4HKOA

Crystal structures of mutant endo-beta-1,4-xylanase ii (e177q) in the apo form
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
189
structure length
189
Chain Sequence
TIQPGTGYNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGNFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDYQIVAVQGYFSSGSASITVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-xylanase 2
publication title X-ray crystallographic studies of family 11 xylanase Michaelis and product complexes: implications for the catalytic mechanism.
pubmed doi rcsb
source organism Trichoderma reesei
total genus 53
structure length 189
sequence length 189
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2012-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hkoA00
2BWCA 1XYOA 3AMHA 2NQYA 3VHNA 1W2UA 3AKTA 4NPRA 3VLBB 4XQWA 2DCZA 1H4HA 3WQ1A 3VZLA 1XNBA 1H8VA 1T6GC 2F6BA 4XPVA 1C5IA 3B5LB 2JICA 3LB9A 1OA3A 3RI9A 1KS5A 3VZJA 3WX5A 1QH6A 2B46X 1UU4A 3ZSEA 1BCXA 4HKWA 5HXVA 2QZ3A 2JEMA 1TE1B 2Z79A 2NLRA 3MF9A 1C5HA 4H7MA 2DCKA 3AMMA 1HV1A 3WQ0A 3WR0A 1XNKA 3AMNA 4S2GA 3M4FA 3VZNA 1XNDA 4HKLA 3AKRA 1BVVA 2B42B 3VL8A 3VHPA 1OA4A 1REFA 4IXLA 2C1FA 5K9YA 1NLRA 2VUJA 2QZ2A 1AXKA 2VULA 3VZMA 4HK9A 3VL9A 3VZKA 3AMQA 1OLQA 1QH7A 3O7OA 3WP4A 1UU5A 1XYNA 3AKQA 3AMPA 1M4WA 2DFCA 1HV0A 2D97A 4S2FA 2BW8A 1H1AA 3VZOA 1H0BA 3MFAA 1OLRA 2BVVA 3WQ7A 1XNCA 3VGIA 4XQDA 3WXPA 1ENXA 3HD8B 1REDA 2DCYA 2JENA 5K7PA 1KS4A 3WP3A 4S2DA 2DCJA 3WP5A 1REEA 2B45X 1H4GA 3WT3A 4HKOA 1YNAA 1XXNA 1XYPA 1UKRA 2BWAA 1PVXA 3AKPA 2D98A 1IGOA 3WP6A 1F5JA 3MF6A 3B7MA 5EJ3A 3LGRA 4S2HA 3VHOA 1BK1A 1UU6A 4XQ4A 3RI8A 3AKSA 2VG9A 4HK8A 2VGDA 3EXUA 1OA2A 3WY6A 2DFBA 1HIXA 3MFCA
chains in the Genus database with same CATH superfamily
4QHZA 1QJEA 3T0DA 1ND2A 4IV1B 2TNFA 2E31A 5BV6A 3IDCB 4UFLA 3WF2A 4QPYA 4NPRA 3TN91 5IFTA 4RA0A 1FX5A 4GJYA 1OF3A 1OH3A 3EO6A 1H1IA 3ECQA 2R0HA 3WZ1A 3I2IA 1D0HA 3WHTA 4ET7A 1AYN1 4DIQA 3HN1A 1E5RA 2VC9A 3V65A 4X8PA 4QKNA 4I3GA 1YJLA 4NRQA 4XDOA 1JMUB 1AX1A 1HB2A 1NQDA 3RJ2X 1KS5A 3MO4A 2JIGA 5F6KA 4QQOA 3T2OA 1ULPA 1S2KA 4MYEA 1AHSA 1Q43A 2YGMA 4EN0A 4P08A 1HW5A 4AFDA 1F15A 3O1MA 2ZX1A 3H9AA 2VZRA 3C7GA 2VBPA 4I30A 5A6QA 4NHXA 4HSJA 2FDIA 4LA2A 3I7DA 4QGMA 1ZA7A 1GMMA 1H2KA 4BK4A 1Z7S2 1EAH2 2DUOA 1B35A 3M4FA 1DYPA 1XE8A 4QU1A 1HRI2 2AENA 3MLKA 1AR93 1OQ1A 1US3A 4W6XA 3UJQA 3VBHB 3VD5A 4A2UA 1XU2A 2WC2A 5L9RA 1HQNA 2BFUL 3RDIA 3ZDSA 1N3OA 2VW2A 1W8OA 1GWLA 1YIFA 5FMCA 3VD7A 3H1WA 3ZOIA 3WDXA 1PZ7A 2VULA 1XE0A 4JHTA 1MEC2 1JODA 4RFRB 1IKQA 1CESA 1N3QA 1R082 4AVSA 4JDNA 5ANNA 4CUAA 5JXIA 2WS92 3D6EA 4V1PA 3ZYPA 3E6DA 4CDWB 1AJKA 3DUIA 3ZKUA 3BU0A 1DQ0A 4Z2AA 2VBDA 3ZM8A 4FPLA 2ADDA 3UK9A 2MHFA 2VXRA 1O3QA 1LOFC 2D3SA 3ETPA 1IS6A 2BZDA 3UGGA 3ZLIA 3ZYHA 3ZYJB 3CO2A 3USUA 4CDXB 3ES1A 1L7RA 1ST8A 5E88A 3THPA 2VQUA 1OLRA 1COV3 1FMD2 5BXXA 1Q8VA 4YSFA 4ES9A 4EN8B 3WXPA 1S0GA 1YFUA 4AVTA 2WUHA 3DYMA 2JENA 3CJIA 1FV3A 1HRV2 1UNBA 3HT2A 5DG1A 4QKDA 4B4RA 3SHRA 5EYYA 4A6OA 4KH9A 2WAAA 3POGA 4J1WA 3WP5A 1JH5A 1ZRRA 1UW8A 2KR2A 2VPVA 2XONA 1QU0A 3U37A 1DZTA 4QT6A 2D6LX 2Z69A 1G9BA 5J96B 4CP9B 3Q8BA 3RZLA 4CDQC 2VL4A 2X5IC 3M1HA 4ZXEA 2DURA 3J4UH 4GIQA 5FLIA 5FUNA 4M00A 3WEZA 1RUE2 5JOYA 3VDBA 2XPJA 5HCHA 5I0RA 1ZA4A 1S0IA 5A33B 1HQLA 1YJKA 2QTWB 2XVKA 3L2YA 4M3CA 5C9AC 3AK0A 4LO5B 3W9AA 4QHBA 2EIEA 4LNVA 1ZBE2 3ASIA 5DUVA 4BB3A 4AOCA 1VMFA 5GJ6A 5GM0A 4E2QA 5F1RA 2JDKA 2WNVC 2VOKA 4YVSA 4AI1A 5J36A 4BCUA 5C8WA 1RUH2 5A7NA 3NW4A 5J7MA 1UY1A 2D6MA 2VECA 3OGGA 2FCVA 2R1BA 3B00A 2R061 2VVEA 5FZ9A 5SV8A 3DKQA 4ZY9A 4H2AA 4P9GA 2XKPA 3AMHA 3PUAA 4XMIA 5JIUA 3N35A 4XF9A 1ZVFA 1N1TA 1XNAA 1CGPA 4MXWB 5IK4A 1H8VA 1XSQA 4XAEA 3VDDB 4UF0B 1UIKA 2DBNA 1V9U1 2R6QA 1E5IA 3IPVA 1R64A 1TVGA 2E32A 2IC1A 2SLIA 2RS33 2ARBA 5FCCA 1LKNA 4FXGB 1E57A 4QPGA 4WM7A 5HCAA 2D40A 2ZX3A 1NAEA 2JDNA 3OPTA 3RGBA 5A32A 4COZA 3SCGA 1JYVA 3FHIB 2RJKA 5K0UA 1UX7A 3PL0A 4PF5A 3UV9A 4FTSA 2X53S 4TZDA 4QB1A 1ZRFA 3K4ZA 4Q4W1 2J1SA 1A8DA 1SFYA 2ARAA 3OYWA 4PLNA 5FLHA 2HWC3 3IM0A 4L97A 3OY8A 5KXDA 5KC5A 4H7LA 2FCTA 5D8AC 3J7LA 3NNFA 1UOGA 3JD72 1UWWA 3HEIA 3AMNA 1STMA 4XXAA 1R1ZA 4UW3A 3QLQA 1WW7A 1SMVA 3KF5A 1AUYA 2A6YA 3IT8A 1QJY1 3RZJA 3K3NA 3H3UA 4C1XA 3N9MA 2PN5A 1CJDA 3H8RA 3J8F2 1H2LA 1UYPA 3NV2A 1QMJA 1GZTA 2GDFA 3JQWA 2HEVF 3JUUA 5F3IA 3TNPB 3LIHA 1W9YA 3O0WA 3IAPA 4KQ7A 4N43C 4HETA 2WA4A 1LESA 1VBA3 4AI0A 1RUD1 4DNYA 5FO9B 3FLRA 1FOD2 1AZDA 3JBG1 4XXPA 3V0BB 4ATFA 1S4CA 3T2QA 4C0BA 1DYKA 2G19A 3P3PA 4AVVA 1ASJ1 4NWVA 2OS2A 1UN1A 1FATA 4P9JA 2WJSA 5BUVA 2N7GA 1DBNA 4LPLA 1W99A 4XIOA 5FDBA 3WLUA 4TYSA 1VBD1 1MS9A 5IT6A 1H2MA 3FE5A 1SLTA 2YB7A 1QNWA 4Y26A 2EAKA 2ZGPA 5FZOA 3IB3A 1C8M1 1HDKA 5IAXA 2W94A 4AGVA 2BOIA 2HWE1 5FMDA 1DGLA 1F35A 4AEKA 1NE6A 3SNMA 4FPHA 2WFF1 3EHKA 3NAPB 4HONA 4LHNA 1KXGA 1XYPA 2Y6JA 2GNBA 5ACA1 5ABJA 2FZ2A 2FMYA 2YFUA 1YFWA 2VUCA 3IMMA 1CAWA 2JXAA 3U78A 2EXJA 4Y4YA 4BQ1A 4XHBA 4DS0A 4GD4A 1OT5A 3OB8A 4WZCA 2PXJA 3OOXA 4CP0A 3DPRA 2WIIB 1I5PA 2CV6A 4IGPA 2DFBA 3MV01 4DO0A 4YW5A 1PGW1 2BP6A 2RG4A 4FPGA 3PTRB 4D0QA 1POV1 4XZUG 4XJ9A 3WCSA 4RS5B 1CX1A 3Q8CA 1FYUA 3AYDA 4AGRA 3QCWA 3VZLA 4P9IA 3T1MA 1PVC1 4ISQA 4C1WA 5D21A 1RTVA 4K40A 1VMJA 4EZ4A 2Q4SA 4BQXA 2A3XA 1UXXX 4RR3C 2O8QA 3P3NA 4K20A 4QX0A 5H9QA 2PLV1 5I8SA 2OKXA 3O1TA 1QH6A 2XQRA 4AHYA 1W03A 2XG3A 2VTXJ 1MACA 4AF9A 3H7JA 3FBMA 1BCXA 3IKWA 2JG8C 3D4KA 2QQVA 1U5XA 4JQRA 2HEYF 2JEMA 5EIYB 2VZQA 3ZSKA 1IOAA 1WCQA 1NY72 4LBMA 3ZFGA 1LCLA 3DCQA 2O8OA 3ZXDA 1Y43B 4AXOA 1WLTA 1MS0A 1D4M3 3CL1A 3IMNA 5IVBA 1UY3A 4CEWC 4BK5A 2JG9A 1UZVA 4IGOA 4CCCA 1LENA 4GZ9A 4JGZA 3DYOA 3OBTA 5DMYA 3BN6A 4KI5M 4GJZA 3WNMA 4M4PA 2OUHA 3AP9A 5FV3A 2VXJA 5FFOC 3JCIA 5FPAA 3CNAA 1K5MC 4JKLA 2Y0OA 1AXKA 4CXXA 5FY0A 1HXS2 1VRH3 3N7MA 4Y24A 2PAKA 4XC9A 1NCRA 2HEWF 1RUF1 2EALA 3WP4A 2VZ3A 4RL7A 3GXUA 4MVTA 2E7QA 4URAA 2KD7A 4IE0A 4XJAA 3CIHA 1BBT2 2WO3A 4XURA 5EV7A 4KU7A 3NMBA 3SKVA 1JZ3A 1IG0A 4QX7A 2FBEA 4C91A 1B09A 4ZXKA 1RUOA 5CFDC 5LBEA 3NNLA 4QX2A 5DG2A 2E51A 1UPIA 2JECA 4AEDA 4UW5A 4CCDA 1H0BA 4CCKA 1TQ5A 3O1UA 2CAUA 2PHTA 3VGIA 4LBNA 4NO4A 1US2A 3HD8B 4JTNA 2ORXA 4FOVA 5BNNB 5A3MA 2HWF3 2WZR2 3HT1A 5FBZA 2BBVA 2DVFA 1YFXA 1S2BA 4GAZA 1UZYA 2Q8CA 2HJIA 3VD3A 1RUI2 1YXWA 3CEWA 3WT3A 2FDKA 4YG6A 3BTAA 5IVVA 5JPNB 1GP4A 2QQLA 2DCTA 4LLFA 5GZDA 3VHRA 1OD5A 4CSWA 4NWWA 5ABJC 1V6KA 4JV4A 3DXUA 1O8PA 2RS53 4C0HA 2Z2SB 5FR3A 4QDRA 5FOJB 4LO8A 1UAIA 3MDPA 4BWOA 2X8KA 4BXSV 1AR91 4ONUA 2CHHA 3E1F1 1F4HA 2R073 1QQP3 1ULOA 3HBZA 1GZ9A 3LZZA 3CU7A 1ALYA 1O5LA 1V0AA 5CYYA 1VBC2 2J1TA 5CIRA 1RHI3 4NIAA 5FTTC 2VMHA 5FZHA 4B1LA 2XLGA 3ME2A 5EPAA 4DUWA 1HN0A 4OHWA 4WM8C 4A7KA 2D6PA 2XKOA 2J1EA 2DCZA 5FP3A 4MHRA 4PBPA 2RMU3 4LO4B 1OPOA 4DRRA 3R4UA 3TN92 4IV3B 2OQ7A 1AR63 5FZKA 4XPVA 2LROA 2XUMA 3HJRA 4BJ0A 3J7NA 1H8TC 4LR4A 2O14A 4B7KA 2A70A 1AYN2 4GULA 2XWBB 2JKBA 3LOBA 3V0AA 1QOSA 4F8AA 4Y5TA 1ENRA 2P3YA 1UX6A 2VY0A 2MNGA 3P1IA 1COV1 2B46X 4IETA 4BA6A 3K46A 3GHNA 2W0XA 1W6PA 1ND3C 4JGYC 4GH4A 4KGGA 5T55A 3KQRA 3OBAA 4N7IA 4QX8A 4X6RB 3SISA 3ZN5A 4TWTA 3ZIWA 5CBLA 5KHKA 2C0ZA 1WCSA 2R0FA 5FRAA 3T4HB 2QQMA 3ZXAC 2RR13 2Y0IA 2ZEYA 3J7MA 5JZGC 3ZFEB 1TEIA 1P8JA 2VUDA 3OUHA 5SV5A 3PJQA 2XBO3 1F9KA 1XNDA 2BRTA 3WG2A 4ZHNA 3OD0A 2VR4A 2WLQA 2UWCA 3WD5A 2D43A 3FWEA 4IE6A 3VL8A 5HBAA 3D5OA 3O12A 4BZ4A 4RQPA 5J37A 2YU1A 1NYWA 4XFGA 1QOOA 5L36A 2BNOA 3LEMA 2G9FA 3NV1A 1RL3A 3UNPA 3OUIA 5LY1A 1VIWB 5IVCA 3C7OA 4QHOA 3VBSB 2ZMLA 3ZX7A 1G9CA 3D82A 4GKYA 4YFWA 3ZPOA 1RINA 1W6QB 2ZZJA 2XVGA 2XL7A 3PNAA 4DXTA 3UESA 4B3NA 4CXWA 5FUIA 1UYZA 3WNLA 1Y9MA 2A6VA 4UWDA 4YG3A 2HKXA 3AZVA 2RS31 1L3JA 5LATA 2I45A 4HLTA 2BVBA 2GNDA 3K48A 2HBUA 2K9ZA 2ZX4A 5FYZA 1W9WA 5AC93 2A3YA 3AC0A 3GHMA 4YVWB 3SQOA 2VOWA 4S2DA 1X33A 4ZZ5A 5I0DA 1W6MA 3M3OA 1VRBA 4Q2FA 4YGDA 2NPIA 5CVRA 2B4KA 5A1LA 4GWIA 1Q8OA 4LJHA 2WNUC 2HWC1 3CMGA 4KWUA 1K45A 3BYWA 4KU8A 4YW3A 4CUCA 3RZKA 4UFMA 4LBQA 5HCBA 1DLCA 1LR5A 1GV9A 1VB4A 3U11A 5LK7B 1XOYA 5FYTA 3I3MA 1FNZA 4WZFA 3MF6A 3WP6A 1OUSA 3PVBB 3B7MA 1X9TA 1ZRCA 2WFPA 4P14A 3ELNA 4XZPA 1O3SA 4K8FA 5F2SA 4OI2A 2JIJA 3I2DA 4E4DX 4FTEA 4ARYA 1SLBA 1WA6X 3I2JA 1TME3 2JD4A 2R16A 3MPPG 5FXVA 4P9WA 4BDVB 2QQPA 2G9ZA 4NIHA 4AI8A 2GMPA 2X09A 2YC2A 3FBYA 4ITCA 1YFYA 3ZO0B 4AVBA 1WCDJ 4MGYE 1RUC3 3MI8A 1JZ5A 3FN9A 3WDUA 1CZTA 2EIBA 1ODMA 5A7PA 2R062 1LOAA 5BNPA 1VBA1 3WF1A 4MGQA 5KXEA 1JHJA 4HSLA 1CAVA 4LOTA 5C3QA 2W87A 1T6GC 4XACA 4RYDA 1HN1A 3HPNA 4IQPA 1GQHA 3I54A 1GQPA 1Q8SA 1V9U2 2PQQA 4IEYA 3CLPA 5LZ6A 2WN2A 2AC1A 4AYUA 5JMCA 1RUNA 2B8MA 1H30A 1HKDA 2XMLA 4CCJA 1WW4A 2B9VA 4U2AA 4MGSA 3AJYA 1DP0A 1TG7A 3DYPA 3AYAA 2PYTA 3POIA 2OPWA 3PU8A 2Y6KA 3OGSA 1CR7A 2PHRA 3TB0A 5IWFA 4LA3A 5JR7B 3RQ0A 4Q4W2 3CDZB 1RYYA 2QBXA 4LOSA 3ZSLA 3I49A 2BPA2 5HI0A 5JVVA 5F5IA 1ULFA 1O3RA 3WNOA 3UYJA 4S2GA 2AUYA 1EPWA 3WG3A 3R6SA 4M0NA 3LFMA 4UFIA 2A7AA 5AVPA 2FDHA 4TTGA 4AFBA 3VKNA 5C33A 3INAA 5FLJA 3ILRA 3I2FA 3PVNA 3MIBA 1W8HA 4DY5A 4K1ZA 4QPIB 2A6ZA 4W6YA 4FQZA 1VBE3 5CKQA 3POYA 3VBUC 3B69A 5C6CA 1POV0 1CWPA 1FPN3 3IWZA 2W1WA 5T5JA 1E5HA 5T54A 3ZSJA 5GZCA 3GZEA 4XJZA 5F8PA 1RUD2 2DFCA 5FYYA 1EV13 2HH9A 3N7LA 2VVFA 5EJ1B 4IE4A 3MHZA 4OI0A 1C8NA 4NRMA 2ZGRA 5FYBA 1X82A 5FK8A 2OPKA 2BV4A 2R043 3LFIA 3LSEA 3CZUA 5HPOA 1ASJ2 3JQXA 4LBJA 4Y20A 1VLNA 1WCUA 1I1EA 3MYXA 5F9TA 3C7FA 5CU1A 2F4PA 1H6YA 4XYXA 4WVZA 3LDBA 1YO8A 5C5TA 5FZDA 2YGLA 1JOBA 2OYZA 5I0SA 4XUOA 4PI0A 1POQA 2EF6A 2WWUA 2XL9A 3VBFB 2WR9A 2P6HA 3BALA 3I8TA 3FZ3A 4BPZA 3O5SA 5B4NA 5DAXA 1W6OA 4ZS3A 4IV1C 1C8M2 4I0AA 4MO3M 4HKOA 2VCBA 3TEZA 2HWE2 2RDNA 5A7WA 3ZYIB 4A45A 4XFCA 4NRPA 3TWIA 3UETA 2WFF2 1AL0G 4DUVA 3BU7A 3E5QA 4R9CA 5EJ3A 1D4M1 2YBKA 1BEV3 1W6PB 1QJU3 1W2NA 1LOFA 4GMP3 1JXNA 4TXWA 4Y1UA 5K4LA 1W6NB 1RVF3 4Q1PA 3ES4A 4GH4B 4XJUA 4HN0A 4PDWB 2ET7A 1I3HA 5EP9A 3H3LA 4URTA 3GYDA 1H2NA 4WVVA 4Y1XA 5B4XA 1WBLA 5BNPC 3AP6A 1VRH1 1HIXA 1GNHA 3WCRA 3ZXGA 1SLAA 2TEPA 4CYDA 1PGW2 5FY9A 1V6IA 4COYA 3AKTA 4M01A 4RGKA 1RXFA 3H8XA 1RUJ3 5CAZA 3OGJA 2HWB3 2VO5A 2CNAA 2H6BA 2VMDA 2VMFA 1WCKA 3ACLA 4HPKB 4NHLA 1GWKA 1JYTA 2E7AA 2UY9A 4BMEA 4F3JA 2Q1FA 2F6BA 2ZX0A 1C57A 5FY7A 3TBDA 2Y6HA 4CDQA 5AFEA 4AQTA 2QDNA 1PVC2 2X5IA 2P4EA 1MZ6A 4Z07A 5FYCA 3VBHC 2ZTNA 1DZRA 3RI9A 2ZKLA 1IPJA 3E5XA 2CGNA 5C9AA 3BTXA 4GALA 4YM1A 2YU2A 3CJXA 3FFQA 2PLV2 3WNNA 5LA1A 2VQ0A 1GQGA 4FFHA 1JS9A 4LQRA 5F3CA 2JWPA 4QM9A 5CFCB 2HWF1 2WNVA 3OJBA 2DTWA 1PO13 1S0DA 4CDWC 1KGYA 2VAUA 4OMCA 4XF3A 3OG2A 1BKZA 1KJLA 4QB6A 5FY5A 1OQEA 1QIQA 3LPFA 4YGCA 2R7EB 1YYNA 1PZ9A 1H6XA 2RS51 4UW4A 4PJYA 1LEDA 4CDXC 1ODNA 3PLQA 4IXLA 3ZKYA 1NA1B 3WDVA 4AL9A 2R071 1QQP1 5E16A 1JZ8A 1K42A 3NJZA 4FVVA 4Q0VA 1GOHA 4QWNA 5BNOB 1QY4A 3AMQA 1WGPA 4RGGA 5LA2A 4PIYA 4EWDA 5C5UA 1RHI1 3A23A 2XHNA 1RUF2 4BE3A 2YZ4A 1HRI3 2P6CA 2LTNA 2C9KA 3T2TA 2Q5TA 1YCIA 2A3WA 3ITQA 2ZAAA 5FQ0A 1JBCA 5D8AA 5LB6A 1ZZ6A 3NJYA 5FPZA 2GC2A 5FPLA 2RMU1 3VZOA 4FPEA 1OUXA 1S0BA 4MV2A 1MVQA 4GWJA 1UO9A 1AR61 3AX4A 5HV4A 1H9WA 5LWBA 5G05L 3A4UA 3POEA 4XETA 5DAPA 1AYM3 3DN7A 1YLLA 4N7UA 5L7OB 3FHAA 4MGZE 1SQ4A 5FZFA 1KS4A 4XUPA 5FYMA 2CL2A 2OZJA 1UMZA 1MQTB 1AR83 4YRDA 1OFSA 2B45X 2XJQA 2VD7A 5DAVA 1NOVA 3N9QA 2JE8A 4LBOA 2ZGQA 4N43A 4PBOA 2ID4A 2VE1A 2GALA 3R0RA 4G3YC 1XXNA 3EB7A 4HXCA 2RR11 4M0HA 4CPBA 2W39A 4ISRA 4AQ6A 4K21A 4B8EA 2XBO1 1IZ3A 3ON7A 5LRSA 2GC3A 2XWJB 4AHZA 1N1SA 3UL2A 1UYYA 2OT7A 4H3WA 1AR92 3TNQA 2E26A 5JSOA 1NCQA 2ZHMA 1YQCA 2IFRA 1OA2A 1BQPA 2E33A 2GN7A 2PHWA 3TEXA 4A3XA 4NPMA 5F5AA 4OI4A 5GALA 2UYAA 3MIGA 3HR9A 3NJVA 2ZGKA 3OTFA 4KWLA 2ENRA 2AEYA 3O0VA 3OGVA 2RHPA 2BJSA 1UCXA 1OPMA 4PIXA 3HQXA 1DQ2A 4MGIE 2ZZQA 1KITA 3U1XA 4QGNA 1ZBA3 3ROUA 4YZ1A 1PO23 3NWKA 1SCSA 3W20A 4IEUA 3H3ZA 4L8QA 4AFAA 4UBGA 5A3OA 1QNYA 3RFRA 3U75A 2CDPA 4YM2A 3TOJA 2DU0A 3BKZA 4ASLA 4UT5A 5LASA 3PIGA 4BOWA 5C4WB 2VNOA 1WLWA 1COV2 4BQ3A 5AC91 4HVOA 3VBRC 1A34A 3O0XA 4BIFA 2QZ3A 1CJPA 1NT0A 2Z42A 5E6HA 4N53B 4PLOA 1TNRA 1C5HA 5DXDA 1WUVA 1XNKA 3AYCA 3KT7A 4NROA 1PK6C 3KZ4C 1EPZA 2DVBA 1OHFA 4C90A 1BVVA 2B42B 4RN5A 4MUVA 4NHKA 4ASKA 4CP1A 1DQ5A 1QJFA 1QWRA 2VMEA 4CDUB 2WSUA 2KXLA 1IS4A 3NJXA 2BNNA 5FIXA 4XW3A 4NOTA 4BU2A 3BUCA 5A3PA 1PM7A 1TME1 4MSVA 4J6GA 4RR3A 1NLQA 4XCBA 1C1FA 4QKFA 1QJX3 4CRQA 4FQ4A 4NAMA 2H0BA 3ZFFA 1O4TA 1SBFA 4AEMA 4FFFA 1WD3A 3BOPA 3WNKA 3AKQA 1RUC1 2RDSA 4TLFA 1Y9QA 1ZM1A 2JG8A 3B9CA 4Y33A 3RS6A 3HWJA 2Q8EA 4MXVA 1H1MA 4F83A 1UZZA 2LRPA 2OIIA 3QACA 1TZOA 4OUEA 3NAPC 1WWYA 2BW8A 3GNEA 4QPWA 2EXIA 3U14A 2RS13 4O9EA 2Q8OA 1U5YA 1V6NA 4MZUA 1SEFA 3H8UA 4JHZA 4MADA 2YC4A 3OGRA 3C7EA 5LBFA 3S5QA 3VV1A 5FXXA 3AJZA 2PMWB 2P3KA 4CEWA 4DEQA 3N9LA 4PCRA 2QJVA 4EWAA 1LOBA 3I59A 3OUJA 4N8MA 1ENSA 2RS32 2ZGUA 5IATA 1RB8G 2UURA 2C4XA 2PA7A 3LQCA 1FOD3 1S0JA 1PGL1 1W28A 4XUQA 1GP5A 1K5MA 2XHKA 3LDKA 4P9XA 2VW1A 5FWJA 1RC6A 5CKMA 1LGCA 4ZS2A 5I0UA 1AX0A 4DPNA 4AFMA 1JZ7A 2CWSA 5EQUA 3S6PA 3POFA 4RS5C 1DGRA 4IESA 4INDA 2D98A 5JOZA 4PQ9A 4A4AA 2PHLA 2WBKA 4D7YA 1G9AA 4OHXA 2BYVE 3AL6A 4CEYB 1I5ZA 2IXKA 4GXLA 2FDFA 4ARXA 1NCQC 2CDOA 1S0FA 2WO7A 5CFDA 5L19A 3A0KA 3WW1A 1O3TA 4COUA 1W9FA 1XB9A 1EYBA 2JB4A 1ND2B 2CU5A 4EWEA 2RJLA 5L9BA 3EXUA 4JDOA 2RJ2A 4IGQA 1VBE1 1GSLA 2DBIA 4Q4V3 4HVQA 1F8VA 1FPN1 2RV9A 1RUG3 4O9GA 2NQYA 4EV0A 1S55A 4QU2A 1UY2A 1OLMA 3VLBB 2D6KA 3R4DB 1LTEA 2WA3A 3WQ1A 1VBA2 3MLJA 5GLZA 3AFGA 1GZCA 3OSDA 4IEXA 4K8RB 4YW4A 1EV11 4FP3A 5ACA2 1ZRDA 4AI3A 4I09A 3GM8A 2H6CA 4XUNA 1BLZA 4LK7A 5IFPA 1GP6A 1OA3A 1OSGA 2J1UA 2R041 4XFHA 3ILFA 2GZWA 2W68A 3LPGA 3WX5A 1VBB3 3HVDA 3PHMA 1JYCA 1OVPA 1UYXA 2DVAA 5KHHA 3UGFA 5CISA 3T1LA 4HKWA 3ALQA 3NNJA 3TAYA 1KDKA 2HBTA 4ORFA 1B35B 1Z78A 2ILMA 1PNFA 2O0OA 2NLRA 1D2SA 2P34A 1OBNA 1ZRIA 2XUEA 1JN2P 2ZGSA 3A22A 3RYKA 3WHUA 2V5YA 1GUIA 5T50A 2ERFA 2VOTA 3KCYA 4WM8A 2WYSA 4R52A 5FXZA 5LEJA 1CD3G 4LORA 4LKEA 2FQPA 3LKJA 3IDAA 5A7SA 2RDQA 3ILNA 2J1AA 2D3PA 3UGHA 2IFWA 1W8TA 3C2UA 5HCFA 1BEV1 4YYOA 1QJU1 1W8UA 1J3PA 2DWRA 2GH8A 2IVJA 4GMP1 4HMZA 1RVF1 4XHXA 2QQWA 5K9YA 5APAA 1H8TA 1JW6A 5FMOS 2EICA 3ZFFC 4HK9A 1Y3TA 5EXOA 3VZKA 4ZPIA 1OLQA 1RXGA 3Q9OA 4JTOA 4JRAA 4Q0QA 5FZ6A 4ZU4A 5BNNC 4AQ2A 3LWCA 1W04A 1PIV3 1ND3A 1PGSA 2BDRA 2EIGA 1YIPA 4RSUA 3WOGA 4BM8A 1SDDB 4JGYA 3T09A 3VBOA 4IEVA 4UFHA 3WF4A 3USUB 4G9SB 2VOXA 4S2FA 1DF0A 2WO1A 1QXRA 4EYUA 4ASMB 3SCFA 1RUJ1 5JSPA 5I8YA 2HWB1 2Y60A 2BBAA 5JZGA 5CNAA 5FMOL 3RVHA 3CJIB 1JYXA 4YZ4A 2IXIA 2PELA 4Q8LA 4BHPA 2DDUA 5I91A 5C8CA 1FI2A 1CIYA 3PU3A 4KWKA 2WNEA 4LBLA 4MLOA 3RPQA 4F7ZA 3S5AA 1NXD1 4Q4X3 4DXZA 1BBT3 4WV8A 3U07A 5FPVA 5JXHA 4Y3OA 1L7LA 3MW4A 1CX4A 1ZREA 2Y6GA 4QKBA 4D94A 3ZXKA 3ZYRA 1CIWA 1WMXA 2VMIA 1PO11 3K3OA 5AFBA 2WL1A 2GP5A 5A80A 3SC7X 4M3CB 3MIDA 1UKGA 3SITA 1QDOA 1G86A 5FZEA 4IV3C 1Q8QA 3LE0A 2Y6FA 3OCPA 2WWSA 4N9HA 3VHOA 4YVSB 4RD7A 4B7EA 1D4M2 3KF3A 3RI8A 1OH4A 2E6VA 1O4YA 4IEPA 4P00B 4HK8A 1SPPA 3PIJA 3MICA 2GMEA 3QOPA 2BNMA 1YI9A 2NYYA 2LM3A 4EQVA 4Y4RA 3U0ZA 2BWCA 3H1YA 2ZJCA 4X6QB 1VRH2 1LU1A 2J7MA 3IPVB 4FT8A 4Y22A 4IW3A 3I3DA 4OZOA 5K8SA 4QPGB 1HRI1 3BODA 4WM7B 4YWAA 3KHCA 1GYKA 1ULCA 2VZTA 3AZYA 5A32B 2WNUA 1CAXA 1YEWA 5FYUA 2ES3A 1U12A 3ZFEC 1O91A 5FYIA 3EBRA 5J48A 2ZAHA 3KV9A 4DINB 2RM23 4OI1A 5FPUA 5K0UB 3BGAA 1QDCA 3KCXA 3LB9A 2ZMKA 3OYWB 2QCSB 4CCEA 5A1FA 5C3RA 3I2OA 1G9FA 2CGOA 4MHUA 3OY8B 2K46A 1AYM1 4AGGA 2IUWA 2P3JA 4LLOA 3WNXA 2D6OX 3WF3A 4YZ2A 1MZEA 5FZAA 1UOBA 1J1LA 4FOQA 5JUVA 1SFPA 3GF6A 4JC1A 1AR81 1OOPA 2W1SA 3K4AA 4O65A 3WW2A 2HWF2 3VBSC 5JCTA 4RGAA 3W21A 5A6XA 5JR2A 2OQ6A 4LUMA 5FPBA 2B9UA 2W95A 2J22A 2R30A 3I59B 5E8AA 4XF0A 1I6XA 4LHLA 2QQJA 4HT1T 4LIUA 3M70A 5KHJA 2RS52 1OA4A 3VHPA 4KMQA 3ZN6A 3LEKA 3RJRA 3RZZA 1ONAA 3VZMA 5J1XA 4XFIA 3ACHA 1UZWA 3APBA 4EN7B 5KC6A 2R072 1QQP2 2JJ6A 3NRUA 4YVWC 2JDUA 3VBOC 2DU1A 5FYVA 3BIEA 2HYKA 1GICA 5DQ0A 1RHI2 4RHV3 3LSDA 4R8HA 1ULDA 4LKSA 4P5YA 1C1LA 1O6UA 3T0AA 1XNTA 4LMFA 4D6SA 2C9AA 4DMIA 1BVP1 4FXKB 4L2NA 3FHQA 2W5FA 2WZ8A 5FZBA 1ZBA1 2KM2A 1PO21 4QQ2A 3SH5A 1TMF3 5C8CC 2RMU2 3GZUC 3SEPA 3Q8FA 3PDQA 1C28A 4XDQA 4LE3A 1WLCA 2Q30A 5FZOB 4ZONA 2WZPP 2EXHA 2IWGB 3FFZA 4XQDA 5FZMA 4WVMA 1CONA 1GNZA 4A41A 1ENXA 1YQ8A 4M3CE 2ADEA 4QDQA 1BJQA 4QQHA 5A7QA 1GR3A 1X8EA 5A70A 1AL23 2ORZA 3LAGA 2JDAA 5ANQA 3I2KA 4BIOA 1OURA 1IQDC 3VBUA 3NNMA 5DUWA 3VN4A 3R4SA 5ABJB 1RMU3 1CAUA 3BTZA 1CAWB 4HL0A 2WWJA 4W50A 3ZYGA 2NP0A 5C70A 4LE4A 5H9SA 1JZ6A 1JYIA 1PM4A 4ZU7A 3RWKX 2RR12 3IAQA 5G04L 3BTYA 1WD4A 4AG4A 2MEV3 3N3HA 3DPRB 2VVDA 3WG4A 2XBO2 1BK1A 3GBFA 5T5PA 1JZ2A 1PX3A 1I9RA 1KFXL 3VB9A 4EZHA 3HNYM 3OEBA 4QXHA 1AR73 1GZWA 1W8WA 2BGCA 4WM8B 1LOEA 1LAJA 1MZ5A 1QJX1 4HN1A 4HZFA 1VB2A 3D0SA 1W8FA 1FV2A 1MS1A 1YQ2A 4XVHA 1JUIA 3LF7A 3HBKA 1XNBA 3HIFA 2EXKA 2XJPA 3OBRA 2PHFA 4IV1A 2HYXA 2JE7A 4AFCA 1SZBA 3IN9A 2DTYA 1C5IA 2RS11 3HN3A 2VQTA 4XE9A 1A78A 2Q1ZB 1XC6A 5T5OA 1LECA 1MS8A 1W0OA 3KSCA 3AVRA 3AP5A 5EZWA 2V4VA 3AP7A 1APNA 1LODA 1DG6A 5I0TA 4QPIC 4JQTA 2JDHA 1UU4A 3ZFGB 4OQ8A 1R093 1UZ0A 1UY4A 1OOPC 2WSVA 1FOD1 5C3SA 2OW4A 3POSA 4CCMA 1DU3D 4AR2A 2IXCA 5AC92 1MS4A 2AEZA 3I3EA 2JG9B 1OQDA 2DCKA 4JGZB 4Q4Y3 2LS6A 1F2NA 1OD3A 5JI9A 4JAAA 1CN1A 2OVUA 2J42A 3K77A 3T4VA 1KJRA 2GN3A 5CADA 4BH9A 2VNRA 4HKLA 1GU3A 2HWD3 2DUQA 4GB33 3SEEA 1NCRB 5FKCA 2BTVC 4ZZ8A 2C1FA 1VAMA 1HLCA 1FT9A 1O7FA 1IG3A 4LBKA 4LUKA 3SLIA 2E7TA 3VBHA 5FAXA 1JZ4A 5A3WA 2P5BA 4HBNA 5FZ0A 1SG3A 1W0PA 2I2SA 4IE5A 3O7OA 1TME2 2VZPA 4Q4V1 1SLLA 5JI7A 3VBFC 1UU5A 2XJTA 2B7YA 5DZGA 2QKDA 1RUG1 3MV11 3MGUA 2ZEXA 4AEDB 3HNBM 1DQ1A 1RUC2 1MPXA 1O4ZA 4QXCA 4K6BA 3KD4A 3FC0A 3W59A 4B4PA 1H1AA 4Q0PA 4CUGA 4Q29A 4CDWA 2E63A 2BEOA 3LA7A 3AYEA 5F39A 2OZ6A 4CXYA 2A6XA 2P3IA 5LRRA 4C8DA 5C3OA 3CF6E 3FUQA 4UI9L 4HVRA 4Q0UA 5J09A 4H14A 2YMZA 3LCPA 1IKPA 1EUUA 4PDWC 1QJY2 2GH2A 4KBBA 4JRLA 1DGWX 4CDXA 5A7OA 1VBB1 4JCKA 4W6WA 5ISLA 4GKXA 2W46A 2DCJA 1HX6A 3L2HA 1PGL2 4QX3A 3JU9A 1YWKA 5DPNA 2V5DA 5ERLA 2YXSA 5DDJ3 3UJOA 1NE4A 1GFF2 3UKTA 2VU9A 3H1MA 5FWEA 2GAUA 4AEJA 4OUMA 3NVCA 5A1AA 3JBG2 1NG0A 3H7YA 4CU9A 1F5JA 4NVPA 4CP9A 3SH4A 4GMP0 4YGBA 3GZTB 1XQNA 2YHJA 2CYFA 4JZRA 2G1MA 3WW4A 4ZU5A 5EHDA 2A71A 4YG0A 2YG0A 4CVUA 5KHIA 1TNFA 4WBBA 2YBSA 4NPLA 2LUWA 5A33A 2QFEA 3RMXA 3O1OA 1K5JA 3KLSA 1JU4A 3AXDA 4YZ5A 1FNYA 4XILA 2JE9A 1LHOA 1VBD2 4NE9A 4OZXA 5JSRA 5CFCC 1VBE2 3WUDA 3KQ4B 3J26N 2X29A 1W2UA 5BYNA 1FPN2 1PIV1 3ZXLA 4XFFA 4BQ5A 1V6MA 5BPXA 4P5HA 3LEIA 1OFNA 4Y1ZA 1UD1A 3AM2A 5F3GA 3V0AB 3B9IA 1HB3A 2AH2A 4KWJA 1Y4WA 2ZMNA 1EV12 1OF4A 4XFAA 3I2GA 4UF0A 1EUTA 2UYBA 1R1A3 2EAAA 3M8LA 3ZMNA 2AGSA 2PAMA 2BUKA 1GBGA 1NA1C 2R042 3KV5A 4FFGA 4Q4X1 2WZEA 3S7IA 5BNOC 1W2OA 1BBT1 2VJXA 4Y1YA 1AX2A 2TBVA 4N9IA 1TE1B 1NZCA 4B29A 2DUPA 1W3XA 3EQEA 3M3IA 3M2MA 1KD7A 3M7AA 2ZPXA 4XOGA 3NO8A 3WR0A 2W3JA 3ZMOA 2AACA 4RQPB 3N36A 1W0NA 3AKRA 1EY2A 1Q56A 1LGNA 1URXA 3QD6A 3BOWA 1W39A 2XGXA 1D7PM 3I4IA 1HJFA 5B2GB 3OF1A 1BEV2 5FP9A 1VAVA 1QJU2 4B4QA 4QB2A 4NAOA 3CQOA 1RVF2 2WO2A 5LBBA 5L7OC 4ATEA 3PMSA 2WT0A 1DYOA 5FZCA 5A6YA 3ENRA 4A7YA 2GNMA 1DQ4A 1EP0A 1MQTC 5FYHA 2XR4A 5TSWA 2ZBJA 2DF7A 2WINB 3QH7A 4W65A 3NKGA 3T08A 4AI9A 2DVDA 1V00A 4NUBA 2R32A 3VBRA 4EE2A 3VD4A 2WRAA 5KXCA 2EVXA 2UWAA 1VP6A 2VZ1A 4Q0SA 3T0BA 5A3NA 1QXJA 3F2ZA 4GWNA 1WA4A 2ZGMA 3C7HA 2QQKA 5J98B 3V0BA 1RUJ2 2V09A 2XH6A 4XF1A 1OMIA 1YI7A 3JXSA 5IW0A 2RM21 4FPOB 1PK6A 1KDMA 3E6CC 3MFAA 1XRUA 1ACCA 1W6MB 4PF1A 4XTMA 1OC1A 3ZPYA 1XNCA 5FUPA 1DLLA 1MS5A 1UMHA 2CY6A 2W2IA 3BPZA 1X8MA 3VDCA 2P1BA 4XFBA 3GGLA 4D69A 4LBQB 5JLVA 2GC1A 1XU1A 4YLZA 1Z7S3 1EAH3 2GSYA 1XBFA 2PFWA 1NQJA 1OVSA 2W1QA 2ZHLA 1CZVA 3LOIA 2PHUA 4QM8A 1PVXA 1PO12 2W08A 3W5NA 5IHRA 3GBGA 1F4AA 1RGSA 3BVCA 3NAPA 1A6CA 3ACIA 1X9PA 1MEC3 1YRZA 3A0NA 3KB5A 4K1YA 2J1VA 1WLDA 2VNGA 1R083 2YBPA 3TYJA 1UQXA 4ES8A 2YY1A 1C4RA 2WS93 3THTA 3RG0A 2VGDA 5BNPB 2BFUS 4QXBA 1JOJA 3ZYBA 1LU2A 1S1AA 2ZGOA 4UBHA 5C4WC 3LDRA 2AREA 2XJUA 2XVLA 4DXSA 4E2GA 4Y1VA 5A3TA 1CAVB 4XBQA 1HJGA 2XB6C 2ZGLA 5BY5A 4CCOA 4YW6A 1S2EA 2AR6A 5FY4A 3ZN4A 5T5LA 1BZWA 4N53C 4XQWA 5L9VA 4LO7A 4RHV1 5M0TA 1WZXA 3PUQA 4XUTA 4COWA 4Q5OA 1NX9A 2VTFA 2XDVA 1FMD3 1E5SA 5C71A 3BPSA 2RDRA 3VDDC 1J58A 1IHMA 3B5LB 4KG0A 4RS5A 5CB7A 1LHUA 4L11A 2JICA 4AW7A 1HRV3 3I3BA 1TMF1 4GA9A 2PHDA 4COVA 4CDUC 2IXLA 2W1UA 3KVAA 3KWVA 2LW8A 1JI6A 3KV6A 1F5FA 3HOBA 4P9LA 1CQ9A 1AYM2 3Q8EA 2Y34A 1VJ2A 3IZOA 1AL21 2A1XA 1PZ8A 2WT2A 2Z79A 5JWPA 1LJ7A 3WF0A 1YC61 1IS5A 3VDAA 4EROA 1RUE3 4PHZA 1QXPA 5FKBA 1AR82 4BISA 2ZCWA 1RMU1 1W05A 5J3UA 1O8SA 3GALA 4XABA 3KT1A 4UFJA 5FY8A 4BYYA 4CCNA 5DN2A 1J1TA 3URFA 3J9SA 1NKGA 1ZBE3 4FO9A 4J1XA 1LHVA 1OI6A 2UU8A 2W47A 4AZZA 5FZIA 2BOJA 3V64A 2R1DA 1RUH3 2MEV1 5FZGA 3B3QE 3KS7A 2Q0AA 1WKYA 4XF4A 4DZGA 1RITA 3FL7A 1Y9GA 5E89A 1UIJA 4JX0A 2D6NA 3O1VA 4HFSA 2O1QA 3G6JB 3ZDVA 4XCAA 1AR71 5FPXA 1PMIA 2DV9A 5FO8B 4NHYA 3MUY1 2JB8A 3ETQA 1HV0A 1WBFA 5LW9A 3RSJA 2ARXA 4Y20B 1SLCA 3DV8A 2AZ5A 4YGEA 5GZEA 3O1SA 2VZUA 3MIEA 3QBQA 5DAQA 3ZSMA 3SCHA 3FJSA 4YM0A 5CA6A 4JVAA 3K2OA 2Y38A 4QX5A 4CEYC 4HOOA 1QF3A 1ZBA2 2GC0A 2QVSB 1PO22 5DABA 4Z1VA 2BVVA 5DZEA 2BQPA 3WQ7A 3B94A 1DDLA 4FSJA 5JOXA 2F4LA 3MW2A 1BMV1 1W6OB 1ND2C 4I0BA 3U4XA 1F31A 3JD73 3NKTA 5A7WB 1KQRA 1R091 2JDMA 2RE9A 5AVAA 1WMDA 1JOPA 1DIWA 4XBLA 1GOFA 4X8NA 1XSRA 4AQSA 5BNNA 1ZYBA 2C24A 5IK5A 2QUOA 4QX1A 1UKRA 2FD8A 5GLVA 1UXZA 4Q4Y1 3AKPA 3U4SA 2ZS6B 5F5QA 2QDRA 4EN6B 2Q1MA 3J8F3 4S2HA 4MGKE 2CGPA 5FZ4A 3ACGA 3RYRA 2JDYA 2PHXA 2R49A 3KMHA 1RJ8A 2HWD1 2DVGA 4GB31 2KA3A 3USSA 5FJKA 3TEYA 2V72A 3NNGA 4OFGA 4DFSA 2D5HA 2WQ8A 3AP4A 3E5UA 5FY1A 1AVBA 5FZ8A 5FXWA 5JDBA 4MGTA 3AL5A 3MZHA 1FAYA 1ENQA 4JDMA 3PTYA 1X50A 4W8JA 4IEQA 4TSVA 1B35C 4CDQB 3SXWA 1QJX2 1J59A 2OA2A 2VZOA 2X5IB 1JYNA 1FXZA 2WT1A 1OKQA 1SDWA 2XJVA 2HWC2 3OD4A 3VD9A 3ST7A 2VTXA 2FHRA 1QGLA 3N7JA 4IERA 4BQYA 5C9AB 5I8TA 3S57A 4G4FA 1UL9A 4LBQD 1HB4A 2RS12 4XDPA 4IV3A 3KGZA 1N1VA 2VQAA 2XLFA 2WNVB 4SLIA 2GU9A 1ZZ9A 4NIGA 3THCA 2VOVA 3VBRB 4YZ3A 3ZR6A 4RFT0 2XJSA 3ZSEA 1VR3A 1RJ7A 4PLMA 4FFIA 3VKMA 2Y8KA 5CEHA 1OXCA 4FTBA 5LCWL 3ORJA 5E1RA 4XMAA 3W58A 4BLJA 5IK7A 2JDPA 3MF9A 3TEWA 1W9SA 3GJBA 4Y5Z0 2Q8DA 5DDJ1 5JPMB 3B02A 1PK6B 3JZVA 1GKBA 4HG6B 4IUGA 4QXKA 4JKMA 3T3YA 3U10A 3E97A 3VZNA 3M3QA 2NN8A 3A7QA 3ZFEA 2BGPA 2ZX2A 5FP7A 3CJIC 1REFA 1CPMA 3H8OA 1WMEA 2AYHA 3M3EA 1UPSA 3NV4A 2JDZA 2ET1A 3VL9A 1D2QA 3G7DA 2GMMA 2NMNA 5FQ0B 1H9PA 5LBCA 5D8AB 5LY2A 2D3RA 3AB0A 3SMHA 1ZZBA 2WLPA 4Q4V2 3AMPA 4D6RA 4UXAA 2NZ9A 2P37A 2WQZC 1YQ5A 3UT0A 1IS3A 1RUG2 3HQUA 2UWBA 4BXFA 3VBSA 4P9YA 1W2TA 1J83A 2NMOA 3N9OA 5JIAA 3T30A 3BB6A 4KL1A 1LRHA 1W6QA 3LA3A 2ZOEB 4NN0A 2B39A 4YVSC 4AE2A 1JYWA 3PURA 4A7ZA 1M06G 4ZKTB 4FBFA 4BQ2A 1X7NA 1BHGA 1G7YA 2CTVA 2JD9A 1R1A1 2ZABA 4K9SA 2CWMA 3AFKA 4N43B 1CZSA 3AXEA 1W8ZA 2YUEA 5GLTA 3DKWA 5FOBB 1VBB2 2WN3A 3H42B 4EJRA 3KM5A 1G8WA 4YVWA 4QMAA 4CCLA 1YNAA 4YPJA 2YV8A 4XAAA 4Z2WA 4E8CA 5A3LA 2ZEWA 5JOWA 4QPGC 4WM7C 1S0EA 1YQ6A 4I02A 5F3EA 4IEZA 1IGOA 1U5ZA 1W90A 4SBVA 3FMGA 4YARA 3LGRA 1NCQB 4I3PA 4FPFA 5K0UC 2BGOA 1HXS3 3CKHA 3GDBA 1IPSA 3AKSA 2FDJA 4TLGA 4YM3A 1GWMA 1DGRN 3O1PA 4YNIA 2E53A 4AVCA 4Q27A 5F5CA 4V2WA 4WVWA 4H55A 3WV6A 5LA9A 3O1RA 4U36A 1XYOA 2W52A 4FPCA 4E2SA 4KBZA 4MOAA 2P2KA 4E4SA 1UF2C 2ARCA 1KEXA 1UY0A 2QQOA 3HMYA 4BMBA 4A6SA 1PIV2 2PQSA 1IQAA 2SBAA 4BQ4A 2ZACA 3B93A 4QGLA 5KHGA 4L92A 2Y26A 2W9XA 3P6BA 5FZ3A 2JKXA 4Z92B 2YPJA 4GQ7A 5FYSA 5EWSA 1AJOA 2WZR3 4Q8KA 2VMGA 5A6ZA 1XE7A 3GJAA 1V70A 2ETEA 5F7UA 4OQ9A 3O14A 1RUI3 4XJ8A 1SBDA 4O61A 1ZNPA 1OKOA 2K2SA 4Q4X2 3PVEA 5HXMA 4LHKA 4KNCA 3OPWA 3MPBA 2Y33A 1SACA 3DF0A 2X10A 1Z7S1 1EAH1 2C6SA 2D93A 2DYCA 3AMMA 3WQ0A 4PQQA 3DECA 3WINE 3MEPA 2VNVA 4Y5SA 4IE7A 1JTZX 2IZWA 3LA2A 2VBBA 4R9BA 4DUXA 2WAOA 2XJRA 1VMHA 2F17A 2ZHKA 5IVYA 3V56A 1VBC3 4RR3B 5FZ1A 3FLPA 3OBZA 3Q8AA 1L7QA 3C8XA 1MEC1 4LK6A 4OLLA 4UW6A 3ZFFB 4E9KA 1GNYA 2QZ2A 1R081 1G6NA 1WW6A 2VUJA 2W91A 4D8MA 4E8DA 2JG8B 4L9BA 4V2VA 2WS91 4LHSA 4R9AA 2YFZA 1C3HA 4UFKA 4Q1RA 2XOMA 4QPIA 2ATFA 3RYPA 2WDBA 2H0VA 3CZJA 3GBWA 3WUCA 1U0AA 1JUHA 3TN93 4EN9B 1ZX5A 2V73A 2FCUA 5IK8A 4FPYA 4YFZA 3AVSA 5FJHA 2BERA 5F6LB 2D97A 4E27A 3ZIXA 3FX3A 3POJA 4AVAA 4NJ4A 4CEWB 1AYN3 3J7HA 3HQRA 3DGTA 5HV0A 3I2HA 4AAXA 3VUOA 1JU3A 4JKKA 3MLLA 1FMD1 3NV3A 3ZXFA 5CKNA 2ZEZA 3RZMA 3DPRC 2YC0A 5T52A 3EYPA 5F32A 1HRV1 1K5MB 2EA7A 2RM22 4NIIA 1W06A 5FBJA 2DCYA 4D3WA 1MZFA 4FI9A 5K7PA 1KRIA 2QQNA 4Z8BA 1J3QA 2GNTA 1K12A 1PX4A 4I0WB 3WQBA 1N3PA 2LALA 5D2AA 2VCCA 4AI2A 4IEWA 4IEOA 4NMIA 4Q4Y2 1RUE1 3VBFA 1A8MA 2RVAA 4LKFA 3RZGA 5CFDB 1J84A 3VKOA 2OUJA 4LITA 2G4IA 5IJRA 4I01A 1ZBE1 4LKDA 2NM1A 4UOJA 2WABA 3MW3A 3ATGA 4NR1A 1HQWA 3T2PA 1X36A 1RUH1 4B1MA 1AR62 4A3ZA 2K0GA 2VW0A 4XEZA 1QJZA 1U5IA 1LHNA 3ZVXA 3KCCA 2VCMA 1W6NA 4D7SA 3ZFGC 4PDWA 3EJKA 1S0CA 3MFCA 4QQPA 3ZXJA 1ULEA 1UOFA 4KGQA 2XQXA 5JXGA 1RIRA 4FP2A 3C3VA 4D6QA 1NUKA 4CZSA 3MIFA 2JG9C 1GLHA 1VPHA 3D3AA 1H4HA 4OCTA 1SBEA 4Q26A 1UMIA 4JGZC 5H9PA 1HB1A 4LIVA 3CBNA 4RHV2 4LT5A 4CA9A 5FZLA 5IYYA 3N9PA 3KVBA 3AZWA 2P17A 1ZZCA 4OMDA 4HPKA 4CPBD 4IL7A 1V6OA 4R4ZA 3DL3A 4PIZA 4XJWA 1NCRC 5EYXA 3VZJA 4MX3A 4UYBA 1TMF2 3X29B 3RWNA 1DQ6A 3GCXA 4AK3A 4NHMA 1Q8PA 5GZGA 2WYFA 3PJYA 4XIKA 4MH0E 2YYOA 5GLUA 1PHMA 5HXVA 3JD71 4M3CF 1SLIA 1AL22 4H7MA 4QDSA 1IPKA 1HV1A 5DUXA 5CFCA 4LEJA 5IAVA 4AEDC 1QKQA 4R4XA 3S30A 2PTMA 4P02B 3FUOA 5JMOA 4L99A 2HLEA 1RMU2 2G9GA 2VH9A 1D0GA 1H8TB 4CUBA 1QHDA 3MUZ1 4DB5A 4I2OA 3P5BA 5FZ7A 3N4MA 3J8F1 5EFUA 4J25A 1NZIA 2IVIB 1VE0A 4A44A 4CU7A 3I3QA 2W92A 5IVJA 3NQHA 3N9NA 5L73A 2I07B 2MEV2 4O7XA 2ZXQA 3UKNA 5JXJA 1ND3B 4M4RA 3WSOA 4BLIA 2R063 4JGYB 4OYUA 3VBOB 2OX0A 3JB8A 2A75A 5DZFA 1QH7A 3M3CA 1NA1A 3HAGA 3WG1A 2ZHNA 4FAGA 3B01A 5BNOA 5JZGB 2QQUA 1AR72 2A6WA 2XXZA 5A3UA 1V9U3 1BK0A 3A21A 1LOGA 1A3KA 1LOCA 1MS3A 4IDZA 5C8CB 2CSGA 2OXBA 5IVEA 4XBNA 4N90A 3VKLA 2QNKA 1LHWA 2CAVA 1PNGA 2Y6LA 2Y64A 4QAWA 4Q4W3 2C5DA 2WNOA 2VM9A 1ZZ8A 3E6BA 4OUSA 2YDEA 1QOTA 3WP3A 4CU6A 1DGWA 1LGBA 2IXJA 1BMV2 3RMYA 1W2AX 2UY8A 5FREA 3WW3A 4A42A 1REEA 5L7OA 3RRDA 3S7EA 1R092 3MBWA 1J3RA 2QQIA 4UAPA 4DRVA 1MQTA 4FOWA 5KR7A 1G9DA 4W4ZA 2BWAA 3WNPA 1UOJA 4DOUA 3BIWE 5BNQA 4FAHA 1AF9A 1OLME 2Z5WA 4FPJA 2GP3A 1QJY3 1LNSA 1SPPB 1QEXA 2IXHA 1O59A 1V6JA 1Z0HA 2J1RA 3ACFA 3IDEA 2ZKNA 3IIIA 3LEGA 4CTEA 2YPDA 1VAKA 1UU6A 2PAEA 4K7JA 4BQWA 4LXLA 5KWRA 4OULA 5KBFA 1MVEA 4GH4C 2HWD2 3N7KA 4HANA 5JAXA 5LA0A 3KV4A 3IBMA 3GZAA 2JX9A 2QE3A 2WQ4A 4GB32 1N1YA 4Y22B 4YW1A 5FO7B 5CZKA 1RUD3 3RNSA 2A73B 2WNUB 1CAXB 3EMRA 3JBG3 3RZHA 3VHNA 1T6BX 2D5FA 4FOYA 1DFQA 3K75B 4AAPA 3D0JA 3S0MA 1WW5A 1ULGA 1YUDA 1KFUL 3LIGA 1ASJ3 4QQLA 3R05A 1AXYA 2FZ1A 4RQPC 3BI3A 5FP4A 5CG8A 1NLSA 2C26A 1V6LA 1PMJX 3PUIA 4QD2A 5FP8A 1SHWB 4LULA 2D7FA 3HNMA 4L0PA 1VBD3 2VMCA 4GWMA 4META 1W9TA 3GCWA 4KG8A 4D7TA 1OOPB 4MG2A 3IDBB 5H9RA 2XLAA 1C8M3 4K3UA 4LO6B 3POBA 5FMBA 1XJAA 2HWE3 4OHVA 1NY71 4YW2A 5GKAC 4OVEA 2WFF3 1GOGA 5C4WA 2X05A 4YW7A 3JB4C 5GLWA 5CG9A 1SCRA 2B5HA 2FDGA 1GANA 3L9JT 5C3PA 5F2WA 1DZQA 5KXBA 1DCSA 5ACA3 3OPZA 1DHKB 3THDA 4DXRA 5LEKA 5DDJ2 1W8NA 3MIHA 1ZZ7A 4PT6A 3LD8A 4R9DA 4N53A 5GZFA 3VKFC 3ZN6B 1N47A 2YROA 3SKJE 1Y7BA 3KT4A 4MXWA 4XTPA 4E4HA 1NXMA 3IIAA 4CU8A 1JHNA 1HXS1 3VDDA 1NLRA 3DXTA 1MR5A 5DAWA 1XPWA 5I93A 2Z4FA 1AXZA 3FLTA 3PUHA 4AWDA 4CDUA 2BU9A 1CPNA 4CP2A 4DQAA 3POWA 1POV3 3PVOA 3BCWA 1W3VA 1XYNA 3F95A 4FPKA 3WDWA 1PMHX 2WKKA 1M4WA 3ABZA 3K4DA 3KHBA 1PVC3 3WVJA 1BXHA 1LULA 1Q5OA 4DY3A 2VZSA 4WVMB 3AZZA 3H0OA 1YHFA 1T2XA 5IUQA 2PLV3 4LTAA 4CE8A 4FCAA 1BYHA 1D4VB 5T3NA 3SH3A 2WZR1 5C7GA 3VBUB 3W5MA 1REDA 3H50A 2V4AA 5DUUA 4OHZA 1CAUB 1R1A2 5F37A 4AHXA 1RUI1 3OEAA 2ZA9A 1LEMA 2A5ZA 3CHXA 3KGLA 3ZYFA 3K51A 2VZVA 1H4GA 1K3IA 2ZGNA 3NSTA 4NIDA 3WDYA 2MPFA 2E9QA 3ZXEA 3WDTA 2FMDA 4OHYA 2D44A 4Z82A 3PMEA 4DEVA 2VCAA 1LB2A 1CVNA 4E4ZA 4TN7A 5D1IA 3ZR5A 2EIDA 3D8CA 3DEMA 4PI2A 3NL1A 2HWB2 2ZGTA 4XQ4A 2VUAA 1GZWB 1VBC1 2TUNA 1Q3EA 2VG9A 5EJZB 3QH6A 4CEYA 1RUF3 3PUSA 3AZXA 5FK7A 1WMFA 2I74A 3TRSB 3UKVA 2L9LA 1O5UA 3WY6A 1VALA 4AHWA 5IVFA 1SFNA 5LK5A 3I97A
chains in the Genus database with same CATH topology
1ND2A 4IV1B 2TNFA 5BV6A 3IDCB 4QPYA 4NPRA 3TN91 4RA0A 1FX5A 3EO6A 1H1IA 3ECQA 2R0HA 3WZ1A 1D0HA 3WHTA 1AYN1 3HN1A 3V65A 4X8PA 4I3GA 1YJLA 1AX1A 1NQDA 3RJ2X 1KS5A 5F6KA 4QQOA 1S2KA 4MYEA 1AHSA 1Q43A 2YGMA 4EN0A 1HW5A 4AFDA 2ZX1A 3H9AA 4I30A 4HSJA 4LA2A 3I7DA 4QGMA 1H2KA 1Z7S2 1EAH2 2DUOA 1B35A 3M4FA 1DYPA 1XE8A 1HRI2 2AENA 3MLKA 1AR93 1OQ1A 3UJQA 4W6XA 3VBHB 4A2UA 1XU2A 2WC2A 3RDIA 1HQNA 2BFUL 3ZDSA 1N3OA 2VW2A 1YIFA 3H1WA 3WDXA 1PZ7A 2VULA 1MEC2 1IKQA 1CESA 1N3QA 1R082 4AVSA 4JDNA 2WS92 3D6EA 4V1PA 3ZYPA 3E6DA 4CDWB 1AJKA 3DUIA 1DQ0A 4FPLA 3UK9A 2MHFA 2VXRA 1O3QA 1LOFC 2D3SA 1IS6A 3ZYJB 3CO2A 3USUA 4CDXB 3ES1A 5E88A 3THPA 1OLRA 1COV3 1FMD2 5BXXA 1Q8VA 4YSFA 4ES9A 4EN8B 3WXPA 1S0GA 1YFUA 4AVTA 2JENA 3CJIA 1FV3A 1HRV2 5DG1A 3HT2A 4B4RA 3SHRA 5EYYA 4KH9A 4J1WA 3WP5A 1JH5A 1ZRRA 1UW8A 2VPVA 1QU0A 1DZTA 4QT6A 2D6LX 2Z69A 1G9BA 5J96B 4CDQC 2X5IC 3M1HA 2DURA 3J4UH 4GIQA 5FLIA 4M00A 2XPJA 1RUE2 5JOYA 5I0RA 1ZA4A 1S0IA 5A33B 1HQLA 1YJKA 2XVKA 3L2YA 5C9AC 4M3CA 3AK0A 4LO5B 3W9AA 4QHBA 4LNVA 1ZBE2 3ASIA 5DUVA 5F1RA 5GJ6A 4E2QA 5GM0A 2WNVC 2VOKA 4YVSA 4AI1A 5J36A 4BCUA 5C8WA 1RUH2 5J7MA 3NW4A 2D6MA 2VECA 3OGGA 2R1BA 3B00A 2R061 2VVEA 5SV8A 4P9GA 2XKPA 3AMHA 4XMIA 5JIUA 3N35A 4XF9A 1ZVFA 1N1TA 1CGPA 4MXWB 5IK4A 1H8VA 3VDDB 1UIKA 1V9U1 2R6QA 3IPVA 4YZ1A 2IC1A 2SLIA 2RS33 2ARBA 5FCCA 1LKNA 4FXGB 1E57A 4QPGA 4WM7A 5HCAA 2D40A 2ZX3A 5A32A 4COZA 3SCGA 3FHIB 2RJKA 5K0UA 4PF5A 3UV9A 4FTSA 2X53S 4TZDA 1ZRFA 4Q4W1 5FLHA 1A8DA 1SFYA 4PLNA 3OYWA 2HWC3 3IM0A 4L97A 3OY8A 5KXDA 5KC5A 4H7LA 5D8AC 3JD72 3AMNA 4XXAA 1R1ZA 4UW3A 3QLQA 1WW7A 1SMVA 1AUYA 2A6YA 3IT8A 1QJY1 3H3UA 4C1XA 2PN5A 1CJDA 3J8F2 1H2LA 3NV2A 1QMJA 2GDFA 3JUUA 3JQWA 2HEVF 3TNPB 3O0WA 4KQ7A 4N43C 4HETA 2WA4A 1LESA 1VBA3 4AI0A 1RUD1 4DNYA 5FO9B 3FLRA 1FOD2 1AZDA 3JBG1 4XXPA 3V0BB 4ATFA 4C0BA 1DYKA 3P3PA 4AVVA 1ASJ1 4NWVA 1UN1A 1FATA 4P9JA 2WJSA 5BUVA 2N7GA 1DBNA 4XIOA 5FDBA 3WLUA 4TYSA 1VBD1 1MS9A 5IT6A 1H2MA 3FE5A 1SLTA 1QNWA 4Y26A 2EAKA 2ZGPA 1C8M1 1HDKA 4AGVA 2HWE1 1DGLA 4AEKA 1NE6A 3SNMA 4FPHA 2WFF1 3EHKA 3NAPB 4LHNA 1KXGA 1XYPA 2GNBA 5ACA1 5ABJA 2FZ2A 2FMYA 1YFWA 1CAWA 2JXAA 2EXJA 4Y4YA 4BQ1A 4XHBA 4WZCA 4CP0A 3DPRA 2WIIB 2CV6A 2DFBA 4YW5A 1PGW1 4FPGA 1POV1 4XJ9A 3WCSA 4RS5B 1FYUA 3AYDA 4AGRA 3QCWA 3VZLA 4P9IA 3T1MA 1PVC1 4ISQA 4C1WA 1RTVA 4K40A 2Q4SA 2A3XA 4RR3C 2O8QA 3P3NA 4K20A 5H9QA 5I8SA 2PLV1 1QH6A 4AHYA 2XG3A 1MACA 4AF9A 3H7JA 3FBMA 1BCXA 3IKWA 2JG8C 3D4KA 1U5XA 4JQRA 2HEYF 2JEMA 3ZSKA 1IOAA 1NY72 4LBMA 3ZFGA 1LCLA 2O8OA 3ZXDA 1Y43B 4AXOA 1WLTA 1MS0A 1D4M3 3CL1A 3IMNA 4CEWC 2JG9A 1LENA 4JGZA 3OBTA 2OUHA 3AP9A 5FFOC 3JCIA 3CNAA 1K5MC 2Y0OA 1AXKA 1HXS2 1VRH3 3N7MA 4Y24A 2PAKA 1NCRA 2HEWF 1RUF1 2EALA 3WP4A 4RL7A 4MVTA 2E7QA 4XJAA 1BBT2 5EV7A 4KU7A 2FBEA 4C91A 1B09A 4ZXKA 1RUOA 5CFDC 5DG2A 2E51A 1UPIA 2JECA 4AEDA 4UW5A 1H0BA 1TQ5A 2CAUA 2PHTA 3VGIA 4LBNA 4NO4A 3HD8B 4JTNA 4FOVA 5BNNB 5A3MA 2HWF3 2WZR2 3HT1A 5FBZA 2BBVA 2DVFA 1YFXA 1S2BA 1UZYA 2HJIA 1RUI2 1YXWA 3CEWA 3WT3A 4YG6A 3BTAA 5JPNB 2DCTA 4LLFA 5GZDA 3VHRA 1OD5A 5ABJC 4NWWA 1V6KA 4JV4A 2RS53 4C0HA 2Z2SB 5FOJB 4LO8A 1UAIA 3MDPA 4BWOA 2X8KA 1AR91 4ONUA 2R073 1QQP3 3HBZA 1GZ9A 3LZZA 3CU7A 1ALYA 1O5LA 1VBC2 5CIRA 1RHI3 5FTTC 2VMHA 2XLGA 3ME2A 4OHWA 4WM8C 4A7KA 2D6PA 2XKOA 2DCZA 4PBPA 2RMU3 4LO4B 1OPOA 4DRRA 3R4UA 3TN92 4IV3B 1AR63 4XPVA 2XUMA 4LR4A 1H8TC 4B7KA 2A70A 1AYN2 4GULA 2XWBB 2JKBA 3LOBA 3V0AA 1QOSA 4F8AA 1ENRA 2VY0A 1UX6A 2MNGA 1COV1 2B46X 4IETA 4BA6A 3GHNA 2W0XA 1W6PA 1ND3C 4JGYC 4GH4A 4KGGA 5T55A 3KQRA 4N7IA 5CBLA 4X6RB 3SISA 3ZN5A 4TWTA 3ZIWA 5KHKA 2C0ZA 1WCSA 2R0FA 5FRAA 3ZXAC 2RR13 2Y0IA 5JZGC 3ZFEB 1TEIA 5SV5A 3PJQA 2XBO3 1F9KA 1XNDA 3WG2A 3OD0A 2WLQA 2UWCA 3WD5A 2D43A 3FWEA 3VL8A 5HBAA 3D5OA 3O12A 4BZ4A 4RQPA 5J37A 1NYWA 4XFGA 1QOOA 5L36A 2BNOA 2G9FA 3NV1A 1RL3A 1VIWB 3VBSB 2ZMLA 3ZX7A 1G9CA 3D82A 4GKYA 4YFWA 1RINA 1W6QB 2ZZJA 2XVGA 2XL7A 3PNAA 4B3NA 2A6VA 4YG3A 2HKXA 3AZVA 2RS31 1L3JA 2I45A 4HLTA 2BVBA 2GNDA 3K48A 2K9ZA 2ZX4A 5AC93 2A3YA 3GHMA 4YVWB 2VOWA 4S2DA 1X33A 1W6MA 3M3OA 4Q2FA 4YGDA 2NPIA 5CVRA 1Q8OA 2WNUC 2HWC1 4KU8A 4YW3A 4LBQA 5HCBA 1LR5A 1GV9A 1VB4A 3U11A 5LK7B 1FNZA 4WZFA 3MF6A 3WP6A 3PVBB 3B7MA 1ZRCA 2WFPA 4P14A 3ELNA 4XZPA 1O3SA 4K8FA 4OI2A 4E4DX 3I2DA 4FTEA 1SLBA 3MPPG 1TME3 2JD4A 2R16A 2QQPA 4P9WA 4AI8A 2GMPA 3FBYA 4ITCA 1YFYA 3ZO0B 4AVBA 1WCDJ 4MGYE 1RUC3 3MI8A 3WDUA 5BNPA 2R062 1LOAA 1VBA1 5KXEA 4HSLA 1CAVA 1T6GC 4IQPA 1GQHA 3I54A 1Q8SA 1V9U2 2PQQA 4IEYA 3CLPA 4AYUA 5JMCA 1RUNA 2B8MA 1H30A 1HKDA 1WW4A 4U2AA 3AJYA 3AYAA 2PYTA 3TB0A 1CR7A 2PHRA 4LA3A 5JR7B 3RQ0A 4Q4W2 2BPA2 3ZSLA 5HI0A 5JVVA 1ULFA 1O3RA 4S2GA 2AUYA 1EPWA 3WG3A 3R6SA 4M0NA 5AVPA 2A7AA 4AFBA 3VKNA 5C33A 3INAA 5FLJA 3ILRA 3PVNA 3MIBA 4DY5A 4K1ZA 4QPIB 2A6ZA 4W6YA 4FQZA 1VBE3 3POYA 3VBUC 3B69A 5C6CA 1POV0 1FPN3 3IWZA 5T5JA 5T54A 3ZSJA 5GZCA 4XJZA 1RUD2 2DFCA 1EV13 3N7LA 2VVFA 4OI0A 1C8NA 2ZGRA 1X82A 2OPKA 2R043 3LSEA 1ASJ2 3JQXA 4LBJA 4Y20A 1VLNA 1I1EA 3MYXA 5F9TA 5CU1A 2F4PA 4XYXA 4WVZA 1YO8A 2OYZA 2YGLA 5I0SA 2EF6A 2XL9A 3VBFB 3BALA 3I8TA 3FZ3A 3O5SA 1W6OA 4IV1C 1C8M2 4I0AA 4HKOA 2HWE2 3ZYIB 4XFCA 3TWIA 2WFF2 1AL0G 3BU7A 3E5QA 4R9CA 5EJ3A 1D4M1 1BEV3 1W6PB 1QJU3 3SXWA 1LOFA 4GMP3 1JXNA 5ACA2 4Y1UA 1W6NB 1RVF3 4Q1PA 3ES4A 4GH4B 4XJUA 4HN0A 4PDWB 2ET7A 1I3HA 4URTA 3GYDA 1H2NA 4WVVA 4Y1XA 1WBLA 5BNPC 3AP6A 1VRH1 1HIXA 1GNHA 3WCRA 3ZXGA 1SLAA 2TEPA 4CYDA 1PGW2 1V6IA 4COYA 3AKTA 4M01A 1RUJ3 5CAZA 3OGJA 2HWB3 4NHLA 2CNAA 2H6BA 3ACLA 4HPKB 1WCKA 2E7AA 2UY9A 4BMEA 4F3JA 2F6BA 2ZX0A 1C57A 3TBDA 4CDQA 5AFEA 4AQTA 2QDNA 1PVC2 2X5IA 3VBHC 1MZ6A 4Z07A 2ZTNA 1DZRA 3RI9A 2ZKLA 1IPJA 3E5XA 2CGNA 5C9AA 4GALA 4YM1A 3FFQA 3CJXA 2PLV2 2VQ0A 1GQGA 4QM9A 5CFCB 2HWF1 2WNVA 3OJBA 2DTWA 1PO13 1S0DA 4CDWC 4XF3A 1BKZA 1KJLA 1OQEA 4YGCA 1YYNA 1PZ9A 2RS51 4UW4A 4PJYA 1LEDA 4CDXC 3PLQA 4IXLA 1NA1B 3WDVA 2R071 1QQP1 5E16A 3NJZA 4FVVA 4Q0VA 5BNOB 1QY4A 3AMQA 1WGPA 4RGGA 4PIYA 4EWDA 1RHI1 4BE3A 1RUF2 2YZ4A 1HRI3 2LTNA 3T2TA 2Q5TA 1YCIA 2A3WA 2ZAAA 5FQ0A 1JBCA 5D8AA 1ZZ6A 5FPZA 2GC2A 2RMU1 3VZOA 4FPEA 1S0BA 4MV2A 1MVQA 1AR61 3AX4A 1H9WA 3A4UA 4XETA 1AYM3 3DN7A 1YLLA 4N7UA 5L7OB 4MGZE 1SQ4A 1KS4A 2CL2A 2OZJA 1UMZA 1MQTB 1AR83 4YRDA 1OFSA 2B45X 2XJQA 1NOVA 4LBOA 2ZGQA 4N43A 4PBOA 4G3YC 2GALA 3R0RA 1XXNA 2RR11 4M0HA 2W39A 4ISRA 4AQ6A 4K21A 4B8EA 2XBO1 1IZ3A 5LRSA 2GC3A 2XWJB 4AHZA 1N1SA 3UL2A 4H3WA 1AR92 3TNQA 5JSOA 1NCQA 2ZHMA 2IFRA 1OA2A 1BQPA 2GN7A 2PHWA 4A3XA 4OI4A 5GALA 2UYAA 3MIGA 3HR9A 2ZGKA 3OTFA 4KWLA 2ENRA 3O0VA 2RHPA 1UCXA 1OPMA 4PIXA 3HQXA 1DQ2A 4MGIE 2ZZQA 1KITA 4QGNA 1ZBA3 3ROUA 1PO23 3NWKA 1SCSA 4IEUA 3H3ZA 4L8QA 4AFAA 4UBGA 1QNYA 4YM2A 3TOJA 2DU0A 4ASLA 4BOWA 5C4WB 2VNOA 1WLWA 1COV2 5AC91 4HVOA 3VBRC 3O0XA 4BIFA 2QZ3A 1CJPA 2Z42A 4N53B 4PLOA 1TNRA 1C5HA 5DXDA 1WUVA 1XNKA 3AYCA 3KT7A 1PK6C 3KZ4C 1EPZA 2DVBA 1OHFA 4C90A 1BVVA 2B42B 4MUVA 4NHKA 4CP1A 1DQ5A 1QWRA 4CDUB 2WSUA 2KXLA 1IS4A 2BNNA 4XW3A 4NOTA 1PM7A 1TME1 4MSVA 4J6GA 4RR3A 1C1FA 4CRQA 1QJX3 4FQ4A 2H0BA 3ZFFA 1O4TA 1SBFA 4AEMA 1WD3A 3BOPA 3AKQA 1RUC1 4TLFA 3RS6A 1Y9QA 1ZM1A 2JG8A 3B9CA 4F83A 3HWJA 4MXVA 1H1MA 1UZZA 2OIIA 3QACA 3NAPC 2BW8A 3GNEA 2EXIA 2RS13 4O9EA 2Q8OA 1U5YA 1V6NA 4MZUA 1SEFA 3H8UA 3VV1A 4DS0A 3AJZA 4CEWA 2P3KA 4PCRA 2QJVA 4EWAA 1LOBA 3I59A 1RB8G 1ENSA 2RS32 2ZGUA 2UURA 2PA7A 1FOD3 1S0JA 1PGL1 1K5MA 2XHKA 4P9XA 2VW1A 1RC6A 1LGCA 5I0UA 1AX0A 4DPNA 4AFMA 2CWSA 3S6PA 4RS5C 1DGRA 4IESA 4INDA 2D98A 5JOZA 4PQ9A 2PHLA 4D7YA 1G9AA 4OHXA 2BYVE 4CEYB 1I5ZA 2IXKA 4GXLA 1NCQC 1S0FA 5CFDA 5L19A 3A0KA 3WW1A 1O3TA 4COUA 1EYBA 4EWEA 1ND2B 2RJLA 3EXUA 4JDOA 1VBE1 1GSLA 4Q4V3 4HVQA 1F8VA 1FPN1 1RUG3 4O9GA 2NQYA 4EV0A 1S55A 4QU2A 3VLBB 2D6KA 3R4DB 1LTEA 2WA3A 3WQ1A 1VBA2 3MLJA 5GLZA 3AFGA 1GZCA 4IEXA 4YW4A 1EV11 4FP3A 1ZRDA 4AI3A 4I09A 2H6CA 1OSGA 1OA3A 2R041 4XFHA 3ILFA 2GZWA 2W68A 3WX5A 1VBB3 3PHMA 1JYCA 2DVAA 5KHHA 3T1LA 4HKWA 3ALQA 3TAYA 1KDKA 4ORFA 1B35B 1Z78A 2ILMA 1PNFA 2O0OA 2NLRA 1D2SA 2P34A 2ZGSA 1JN2P 3RYKA 3WHUA 2V5YA 5T50A 2ERFA 3KCYA 5LEJA 4WM8A 4R52A 1CD3G 2FQPA 3LKJA 3ILNA 2D3PA 2IFWA 3C2UA 5HCFA 1BEV1 4YYOA 1QJU1 1J3PA 2DWRA 2GH8A 4GMP1 4HMZA 5K9YA 1RVF1 4XHXA 1H8TA 1JW6A 5FMOS 3ZFFC 4HK9A 1Y3TA 5EXOA 3VZKA 1OLQA 3Q9OA 4JTOA 4Q0QA 4JRAA 5BNNC 4ZU4A 4AQ2A 3LWCA 1PIV3 1ND3A 1PGSA 2EIGA 4RSUA 1YIPA 4BM8A 3WOGA 4JGYA 3VBOA 4IEVA 3USUB 4G9SB 2VOXA 4S2FA 1DF0A 5JSPA 1QXRA 4ASMB 3SCFA 1RUJ1 5I8YA 2HWB1 5JZGA 5CNAA 5FMOL 3CJIB 4YZ4A 2IXIA 2PELA 4Q8LA 4BHPA 5I91A 5C8CA 1FI2A 4KWKA 4MLOA 3RPQA 2WNEA 4LBLA 4F7ZA 1NXD1 4Q4X3 4DXZA 1BBT3 4WV8A 3U07A 3MW4A 1CX4A 1ZREA 4D94A 3ZXKA 3ZYRA 1CIWA 2VMIA 1PO11 5AFBA 2WL1A 4M3CB 3MIDA 1UKGA 3SITA 1QDOA 1G86A 4IV3C 1Q8QA 3OCPA 2WWSA 4N9HA 3VHOA 4YVSB 4RD7A 4B7EA 1D4M2 3RI8A 2E6VA 1O4YA 4IEPA 4HK8A 3MICA 2GMEA 3QOPA 2BNMA 1YI9A 2NYYA 2LM3A 3U0ZA 2BWCA 3H1YA 2ZJCA 4X6QB 1VRH2 1LU1A 3IPVB 4FT8A 4Y22A 5K8SA 4QPGB 1HRI1 3BODA 4WM7B 1GYKA 1ULCA 3AZYA 5A32B 2WNUA 1CAXA 3ZFEC 2ES3A 1U12A 1O91A 5J48A 3EBRA 2ZAHA 5K0UB 4DINB 2RM23 4OI1A 1QDCA 3KCXA 3LB9A 2ZMKA 3OYWB 2QCSB 1G9FA 2CGOA 3OY8B 1AYM1 4AGGA 2P3JA 4LLOA 3WNXA 2D6OX 4YZ2A 1MZEA 1J1LA 4FOQA 3GF6A 4JC1A 1AR81 1OOPA 5JCTA 3WW2A 2HWF2 3VBSC 4RGAA 4LUMA 2B9UA 5E8AA 2R30A 3I59B 4XF0A 1I6XA 4LHLA 4HT1T 3M70A 5KHJA 2RS52 1OA4A 3VHPA 3ZN6A 3RJRA 3RZZA 1ONAA 3VZMA 4XFIA 3APBA 4EN7B 5KC6A 2R072 1QQP2 2JJ6A 4YVWC 3VBOC 2DU1A 2HYKA 1GICA 1RHI2 4RHV3 3LSDA 4R8HA 1ULDA 1C1LA 2C9AA 4DMIA 1BVP1 4FXKB 4L2NA 1ZBA1 2KM2A 1PO21 4QQ2A 3SH5A 1TMF3 5C8CC 2RMU2 3GZUC 4XDQA 1C28A 4LE3A 1WLCA 2Q30A 2WZPP 2EXHA 2IWGB 3FFZA 4XQDA 4WVMA 1CONA 1GNZA 1ENXA 4M3CE 1BJQA 4QQHA 1GR3A 1X8EA 1AL23 3LAGA 4BIOA 3VBUA 5DUWA 3VN4A 3R4SA 5ABJB 1RMU3 1CAUA 1CAWB 4HL0A 3ZYGA 2NP0A 4LE4A 5H9SA 1JYIA 4ZU7A 2RR12 1WD4A 4AG4A 2MEV3 3N3HA 3DPRB 2VVDA 3WG4A 2XBO2 1BK1A 3GBFA 5T5PA 1I9RA 1KFXL 1AR73 1GZWA 2BGCA 4WM8B 1LOEA 1MZ5A 1QJX1 4HN1A 4HZFA 1VB2A 3D0SA 1FV2A 1MS1A 1JUIA 3HIFA 1XNBA 2EXKA 2XJPA 3OBRA 2PHFA 4IV1A 2JE7A 4AFCA 4XE9A 3IN9A 2DTYA 1C5IA 2RS11 1A78A 2Q1ZB 5T5OA 1LECA 1MS8A 1W0OA 3KSCA 3AP5A 5EZWA 3AP7A 1APNA 1LODA 1DG6A 5I0TA 4QPIC 1UU4A 3ZFGB 1R093 1OOPC 2WSVA 1FOD1 2OW4A 3POSA 1DU3D 2IXCA 5AC92 1MS4A 2JG9B 1OQDA 2DCKA 4JGZB 4Q4Y3 1F2NA 5JI9A 4JAAA 1CN1A 2OVUA 1KJRA 2GN3A 5CADA 4BH9A 2VNRA 4HKLA 2HWD3 2DUQA 4GB33 1NCRB 2BTVC 2C1FA 1VAMA 1HLCA 1FT9A 1O7FA 4LBKA 4LUKA 3SLIA 2E7TA 3VBHA 5FAXA 4HBNA 1W0PA 2I2SA 3O7OA 1TME2 4Q4V1 1SLLA 5JI7A 3VBFC 1UU5A 2XJTA 2B7YA 5DZGA 2QKDA 1RUG1 3MGUA 4AEDB 1DQ1A 1RUC2 1O4ZA 3W59A 4K6BA 3KD4A 3FC0A 4B4PA 1H1AA 4Q0PA 4Q29A 4CDWA 2E63A 2BEOA 3LA7A 3AYEA 2OZ6A 2A6XA 2P3IA 5LRRA 3CF6E 3FUQA 4HVRA 4Q0UA 5J09A 4H14A 2YMZA 3LCPA 1IKPA 4PDWC 1QJY2 2GH2A 4KBBA 4JRLA 1DGWX 4CDXA 1VBB1 4JCKA 4W6WA 4GKXA 2DCJA 1HX6A 3L2HA 1PGL2 3JU9A 1YWKA 2YXSA 5DDJ3 3UJOA 1NE4A 1GFF2 3UKTA 2VU9A 3H1MA 2GAUA 4AEJA 4OUMA 3NVCA 3JBG2 1NG0A 3H7YA 1F5JA 4NVPA 3SH4A 4GMP0 4YGBA 3GZTB 1XQNA 2YHJA 2CYFA 3WW4A 4ZU5A 2A71A 4YG0A 5KHIA 1TNFA 4WBBA 2LUWA 5A33A 2QFEA 3RMXA 3KLSA 3AXDA 4YZ5A 1FNYA 4XILA 2JE9A 1LHOA 1VBD2 4OZXA 5JSRA 5CFCC 1VBE2 3WUDA 3J26N 2X29A 1W2UA 5BYNA 1FPN2 1PIV1 3ZXLA 4XFFA 1V6MA 5BPXA 4P5HA 4Y1ZA 1OFNA 1UD1A 3AM2A 3V0AB 3B9IA 2AH2A 4KWJA 2ZMNA 1EV12 4XFAA 2UYBA 1R1A3 2EAAA 3M8LA 3ZMNA 2AGSA 2PAMA 2BUKA 1GBGA 1NA1C 2R042 4Q4X1 3S7IA 5BNOC 1BBT1 4Y1YA 1AX2A 2TBVA 4N9IA 1TE1B 1NZCA 4B29A 2DUPA 3EQEA 3M3IA 3M2MA 1KD7A 3M7AA 2ZPXA 4XOGA 3NO8A 3WR0A 3ZMOA 4RQPB 3N36A 3AKRA 1EY2A 1Q56A 1LGNA 1URXA 3QD6A 3BOWA 1W39A 2XGXA 5B2GB 3I4IA 3OF1A 1BEV2 1VAVA 1QJU2 4B4QA 1RVF2 5L7OC 4ATEA 3PMSA 2WT0A 3ENRA 4A7YA 2GNMA 1DQ4A 1EP0A 1MQTC 5TSWA 2ZBJA 2DF7A 2WINB 3QH7A 4W65A 3NKGA 2DVDA 1V00A 3VBRA 2R32A 5KXCA 2EVXA 2UWAA 1VP6A 4Q0SA 1QXJA 4GWNA 1WA4A 2ZGMA 5J98B 3V0BA 1RUJ2 2V09A 2XH6A 4XF1A 1OMIA 1YI7A 2RM21 4FPOB 1PK6A 1KDMA 3E6CC 3MFAA 1XRUA 1W6MB 4XTMA 3ZPYA 1XNCA 1DLLA 1MS5A 2CY6A 3BPZA 1X8MA 4XFBA 4D69A 4LBQB 5JLVA 2GC1A 1XU1A 4YLZA 1Z7S3 1EAH3 2GSYA 2PFWA 1NQJA 2ZHLA 3LOIA 2PHUA 4QM8A 1PVXA 1PO12 2W08A 3GBGA 1RGSA 3NAPA 1A6CA 1MEC3 1YRZA 3A0NA 3KB5A 4K1YA 1WLDA 2VNGA 1R083 3TYJA 4ES8A 2YY1A 1C4RA 2WS93 3THTA 3RG0A 2VGDA 5BNPB 2BFUS 1JOJA 1LU2A 1S1AA 2ZGOA 4UBHA 5C4WC 2AREA 2XJUA 2XVLA 4E2GA 4Y1VA 1CAVB 4XBQA 2XB6C 2ZGLA 5BY5A 2AR6A 3ZN4A 5T5LA 1BZWA 4N53C 4XQWA 4LO7A 4RHV1 4COWA 1FMD3 3VDDC 1J58A 1IHMA 3B5LB 4KG0A 4RS5A 5CB7A 1LHUA 4L11A 2JICA 4AW7A 1HRV3 1TMF1 4GA9A 2PHDA 4COVA 4CDUC 2IXLA 1F5FA 4P9LA 1CQ9A 1AYM2 1VJ2A 1AL21 1PZ8A 2WT2A 2Z79A 5JWPA 1LJ7A 4EROA 1IS5A 1RUE3 1QXPA 1AR82 2ZCWA 1RMU1 5J3UA 3GALA 3KT1A 4BYYA 1J1TA 3URFA 3J9SA 1ZBE3 4FO9A 4J1XA 1LHVA 1OI6A 2UU8A 3V64A 2R1DA 1RUH3 2MEV1 3B3QE 3KS7A 2Q0AA 4XF4A 4DZGA 1RITA 5E89A 1UIJA 2D6NA 4HFSA 2O1QA 3G6JB 1AR71 5FPXA 1PMIA 2DV9A 5FO8B 3ETQA 1HV0A 1WBFA 3RSJA 2ARXA 4Y20B 1SLCA 3DV8A 2AZ5A 4YGEA 5GZEA 3MIEA 3QBQA 3ZSMA 3SCHA 3FJSA 4YM0A 5CA6A 4JVAA 4QX5A 2Y38A 4CEYC