5TSWA

High resolution crystal structure of a human tnf-alpha mutant
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
149
structure length
149
Chain Sequence
SDKPVAHVVANPQAEGQLQWSNRRANALLANGVELRDNQLVVPIEGLFLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lymphokine
molecule keywords PROTEIN (TUMOR NECROSIS FACTOR-ALPHA)
publication title High resolution crystal structure of a human tumor necrosis factor-alpha mutant with low systemic toxicity.
pubmed doi rcsb
source organism Homo sapiens
total genus 23
structure length 149
sequence length 149
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 1999-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5tswA00
4QQHA 2ZPXA 5KWRA 2AZ5A 4DB5A 1PK6C 4KGQA 2WNVC 2JG8B 4QPYA 2R6QA 1JH5A 3FC0A 4QQOA 5KC6A 4RSUA 3AB0A 2HEWF 3WD5A 2TUNA 3V56A 3B9IA 1O91A 3QBQA 4QQPA 2JG8A 1DG6A 1PK6B 1U5ZA 5BNQA 2E7AA 2HEVF 2Q1MA 5HBAA 2WNVB 2X29A 4QQ2A 4OULA 4OUMA 5KC5A 2QDNA 2Z5WA 1C28A 2HEYF 1RJ8A 1ALYA 3B93A 1OQEA 4G3YC 1IQAA 4J6GA 2WNUC 4OUSA 2RJKA 4E4SA 2JG9C 1S55A 1C3HA 1PK6A 2OIIA 3QD6A 4GIQA 1TNFA 1JTZX 2WNVA 1KD7A 4MXVA 2ZJCA 5CIRA 4QQLA 4TWTA 2QE3A 3TWIA 1OQDA 2R30A 1I9RA 3K51A 2R32A 3MI8A 4NN0A 1XU2A 3B94A 1A8MA 4D7YA 1WCKA 2WNUB 3TYJA 2Q8OA 2JG9B 1D2QA 1GR3A 4HT1T 2TNFA 1D0GA 1KXGA 1OSGA 3URFA 1U5YA 1TNRA 3IT8A 5TSWA 2WNUA 1RJ7A 3ME2A 4F3JA 4MXWB 2JG9A 4E4DX 5L36A 1U5XA 2KA3A 2JG8C 3ALQA 3K48A 4EN0A 1DU3D 4G4FA 1D4VB 5L19A 4TSVA 2O0OA 1XU1A 2RJLA 3L9JT 4N90A 4KGGA 4MXWA 4DOUA 4KG8A 2RE9A 4MSVA 3LKJA
chains in the Genus database with same CATH superfamily
1ZZ8A 3M3QA 1MVEA 2XVLA 4GB33 4QQHA 2R1DA 5H9PA 3WG2A 4QKNA 5IVBA 4ASKA 2RDSA 2P3KA 1LHOA 3AVRA 1VBA3 2A6ZA 2VXJA 4XURA 5FZ6A 4M0HA 4MHRA 3EYPA 4CP9B 1V00A 5C4WB 4IUGA 4CSWA 1HRV3 4QX7A 1LOAA 3BOPA 5A1LA 2PLV2 1KQRA 3PHMA 3VBSA 4UXAA 1MR5A 5ANQA 4L9BA 3WD5A 3ZYHA 5CFCA 5T5OA 3WVJA 5FY4A 3V56A 1AJOA 1WW4A 4BM8A 1RMU2 1UKGA 3FN9A 5T55A 4UBHA 1QJFA 2Q8DA 1DGWX 3FJSA 5AC91 3EHKA 3GDBA 1O8PA 1FT9A 2PA7A 3N9LA 1VB2A 4RS5A 5FTTC 5LA9A 5IVVA 4IXLA 3AMMA 5FWJA 3V0AB 2JDKA 2Y60A 1XE0A 2VZOA 4XXPA 4DXSA 4QKFA 4CUCA 2YGLA 3I2GA 1DYPA 1K45A 1XQNA 1DGRN 2CTVA 1CD3G 5DAXA 4AEDB 2AEZA 4OHYA 2YBSA 2OPWA 4IV1C 4NWVA 2BBVA 5FYMA 1VBC2 1W05A 1GZ9A 2D98A 4PIYA 4AK3A 5BUVA 2Y0IA 3I2DA 3LA2A 4RR3A 4YG6A 3T1MA 3U14A 5FO9B 2X8KA 3BB6A 1EV13 2J1UA 1JYXA 2WRAA 5EHDA 4IEVA 3VKOA 2ZOEB 2PHDA 4LO7A 4MGYE 3LCPA 4LO5B 2Q0AA 4HVOA 1XJAA 3SLIA 2QCSB 4A6OA 3HNBM 2DCZA 1N1TA 1I3HA 2MNGA 4CA9A 4CE8A 5C71A 4L2NA 5FZ8A 1C1LA 1QOOA 3VD5A 3S7IA 1F8VA 1FAYA 4UWDA 4HONA 5JZGA 2E51A 2PLV1 2WNUB 4H55A 3VD3A 1UW8A 2O1QA 3WSOA 3VL9A 5JUVA 3GHNA 4EQVA 1H4HA 2WAOA 2ZGUA 1OA2A 1RMU1 1J1LA 1CX4A 2V09A 5FZ4A 4KWJA 4CZSA 2EAAA 1LEDA 3BU7A 3VBHA 2PTMA 4BOWA 4CDUA 5FRAA 4WM7A 3I2IA 2W46A 2XMLA 1ZZ7A 3LEIA 1RUH3 1W39A 1SLCA 5A32A 1BCXA 4AR2A 5FO7B 4Q1PA 1NCRC 1R093 4CU8A 4Q4W2 5KR7A 1UO9A 1LOEA 1NXMA 1R082 3E6BA 1UMIA 3FFQA 4JDOA 4RA0A 4BQWA 4BQ5A 4CUGA 1V9U1 2Z4FA 2DU0A 3ZYPA 4CP0A 4YW1A 1UPSA 3ETQA 1VBC1 5A3OA 2YZ4A 5C3SA 2WN3A 2BNMA 5E16A 1YYNA 4H3WA 4PIXA 4XFIA 2Y0OA 3BTXA 1Y4WA 3ZO0B 5L19A 3VLBB 1I1EA 1CX1A 2ZGMA 1UY2A 1WW5A 2RS12 3S5AA 1MS9A 2XG3A 4P9LA 4P00B 3IDEA 4O9GA 5A6ZA 1DF0A 3E5QA 2QQKA 4DO0A 4CEYB 5FBZA 3SCHA 4HOOA 1QJX3 4Z07A 3IDCB 3RGBA 1FMD2 3OPZA 4MYEA 4Y26A 5BPXA 5FXZA 4AAXA 1N47A 3ZSJA 5CKMA 3SMHA 1B09A 3KT1A 2CSGA 3OD4A 4NRPA 5DDJ1 4OLLA 5A6YA 4CDWC 2BYVE 4XABA 1PIV3 4EZHA 2VH9A 4K40A 1OLRA 1CR7A 4LLFA 4LKEA 4TXWA 4KG0A 2CGNA 3FL7A 1GICA 2WFF2 4XF1A 4XFFA 4XOGA 1WUVA 3BPSA 2GMMA 5GLTA 1DHKB 3ZXAC 1W9TA 3EXUA 4Q4W1 4E2SA 1G9FA 1DG6A 1PZ7A 1R081 3ZMNA 5EZWA 3OYWA 3FBYA 2X5IC 4K9SA 4XMIA 3KLSA 4XFHA 4FOVA 3MIDA 1ZVFA 2QQNA 3N4MA 3LFMA 2Z5WA 3Q8CA 3NAPA 3MV01 5FZMA 5D8AC 3GXUA 2BV4A 2AENA 1AL22 2R49A 1UZYA 3J7NA 1G9BA 1SCRA 5J37A 1AR83 5FZHA 1GUIA 1O7FA 2RS11 2FQPA 2ZABA 4XAAA 2R0HA 1CZTA 3VHRA 3MV11 1W2AX 4QXHA 1AR92 4DRVA 4FAHA 2PQQA 3GF6A 3PU3A 4MGTA 1MZFA 4OI0A 1WW7A 3UESA 4NMIA 1FMD1 3HD8B 1S0FA 4HETA 4JQTA 4IERA 4CU7A 2VAUA 3WG3A 5LZ6A 1LJ7A 2VXRA 1FV2A 4GH4A 1V70A 2QQLA 1S0IA 1MZEA 2CDOA 2YBPA 3DL3A 4LHSA 2EXIA 2WNEA 2AGSA 4DFSA 1GP4A 4XFBA 4KWUA 4QGLA 4XC9A 1ND2C 4M3CE 2EXJA 3C7FA 1OOPA 3VBOB 3AP5A 3VV1A 5LY1A 2WFF1 4HT1T 3JQXA 3TN91 2ZMKA 1Z78A 2E9QA 2RR12 5B2GB 3HNMA 1WWYA 2P3IA 2WL1A 4Y1YA 1W04A 2WIIB 1LOFC 3MFCA 4R4ZA 2FDFA 2GP5A 5ABJA 1F31A 2VMIA 2VUCA 3WW1A 3AYDA 5FZ9A 5FKBA 1AL21 4E4DX 4WVVA 5JSOA 3KQRA 4AXOA 4YYOA 1EUTA 1QIQA 3JD72 1CAVB 3H1WA 3OY8B 1LHVA 4LOTA 2ZGQA 3BTAA 2XGXA 3HQRA 4B4PA 4LOSA 4LJHA 3S5QA 1AR91 1JS9A 1QOSA 3H0OA 1PX3A 3LSDA 1IPJA 3THDA 4ZZ8A 4YNIA 4N43C 4TSVA 1BLZA 4N7IA 2VOTA 4DEQA 1IKQA 5C3QA 3I2OA 1V6LA 2R062 3A4UA 4KG8A 3WCRA 4A41A 4X6RB 1NCQB 4CDXC 3RZHA 5ACA3 3LKJA 1OPMA 2NN8A 3G6JB 3HN1A 3POSA 4C90A 5FMDA 3ZVXA 1W6QA 4GJYA 1J3PA 1SACA 1AX1A 4OHXA 1VE0A 3M1HA 5FY5A 4KL1A 4MOAA 2PELA 3H8RA 2YBKA 2E31A 4XF3A 2Q30A 1CJPA 4RN5A 3UKVA 3WDYA 1PO13 3VHPA 3SITA 2H0VA 2WLQA 3POIA 5FK8A 4BMBA 2RR11 2WO1A 1J83A 4EWEA 2JDZA 4XUTA 3ES4A 2UY9A 2BW8A 5JSRA 2PHTA 1ENRA 3PUSA 4CPBA 5HCBA 5FZIA 1AXYA 4Q27A 4R9DA 2YFZA 3I97A 1WCUA 4YVSB 3WHUA 1UPIA 5FREA 2XJVA 1HX6A 4Q0SA 1J84A 4U2AA 2OT7A 5I0TA 1URXA 1LTEA 1CONA 4BQ3A 4KQ7A 1UN1A 1W6NB 1UQXA 5FP4A 3JD71 4E2GA 5FY8A 4LHLA 3VZNA 5EJ3A 1OF3A 4XBLA 4XUQA 1S1AA 4TTGA 2XVGA 4HKOA 1TE1B 4O65A 4HANA 1OI6A 3P6BA 1UOJA 5L7OB 1RUF3 5HCAA 2CWSA 2ZMNA 2ZA9A 1O3QA 2VZ1A 3AZWA 3C8XA 2JG9C 2R072 2YG0A 3T2OA 4AG4A 4D3WA 4DXTA 5C9AC 2RDNA 4DUVA 2R061 2NM1A 3B69A 3H3UA 3MIBA 3N9OA 4FPOB 4G9SB 1JTZX 4HSJA 4Q0UA 5A33B 2W1UA 5GLUA 3NJXA 4AI9A 2ZJCA 2CY6A 4S2GA 2GH8A 4QM8A 3ACHA 5ERLA 1JU3A 3DN7A 4YFZA 4QX1A 4FTSA 3D0JA 2JE8A 3POYA 2D3PA 3TNPB 4CXXA 3CMGA 3ZKYA 5H9QA 1WCQA 1RVF3 1LESA 5B4NA 4B1MA 2EVXA 1GWLA 1ZA4A 2AYHA 4GMP0 2C9KA 2ORXA 2KR2A 3WQ0A 5E88A 3VDDA 4CCKA 2ID4A 1AJKA 4OVEA 5AVAA 3AMNA 3PUIA 1RINA 3MUZ1 1QXRA 1VRBA 1LOBA 1M4WA 1N3PA 4GWIA 2ZX2A 4FSJA 5AFBA 2XLFA 1NX9A 3ES1A 3CKHA 3URFA 3GJBA 3WCSA 1FPN3 4CU6A 1S2KA 4IV3B 4Q0PA 3J4UH 2EXKA 4BQ2A 4BIOA 4CRQA 1OVSA 2D6PA 4HN1A 4PLNA 4WM8B 3U37A 3VBHB 3CEWA 4YM0A 4BK4A 5F1RA 1JYTA 4AEKA 1UU4A 2ATFA 3I54A 2VMEA 1OHFA 1OH4A 2HWD2 4HPKA 4NPMA 5FP8A 2XJRA 5CVRA 2GC3A 5KHKA 2R071 2W68A 4Q8KA 4LBKA 4XCBA 4JGZB 3FLTA 3H50A 3O0WA 3H42B 5F3CA 1D4VB 5IVCA 1UY1A 4RGKA 4W6XA 4NE9A 2BNOA 3HR9A 3A23A 5FKCA 3U78A 2XJTA 2B5HA 4MSVA 4YW6A 4BISA 4MLOA 4QB6A 3ZFGA 1UOBA 1X8EA 3N3HA 5BNPB 3PJQA 1ND3C 2TBVA 4AI3A 1NE6A 1LHWA 1SG3A 2QNKA 2QUOA 3DPRB 3HJRA 4H14A 1HN1A 5C8CB 3IIIA 3MYXA 1HN0A 2D40A 3DKWA 1RUJ3 3UETA 3FC0A 2K9ZA 2IXIA 4W6WA 3AYCA 2NP0A 5FMOS 3WR0A 2LUWA 4V2VA 1GKBA 1NYWA 2ZHMA 2PHFA 3NQHA 2DTYA 2GMPA 3AKQA 4BXSV 2FCTA 1OLME 4KBBA 2TUNA 3ZDVA 1UX6A 1XNTA 1Q8SA 2CDPA 5DQ0A 5I8SA 5A3LA 4XFCA 2ZHKA 3PMSA 4Z82A 1IG3A 2DU1A 1HRI2 3VBUC 1VAKA 2X10A 1PK6B 2ZX1A 1RHI2 4OI2A 2WN2A 2WBKA 2ADDA 2CAVA 4LBMA 4PQ9A 1RC6A 5C4WA 3QLQA 3ZFEC 2HWD1 5KHHA 5JOZA 2XUEA 2O8OA 5KC5A 3ZN5A 1DQ2A 1UAIA 4CDQC 1XE7A 3QACA 2C0ZA 3I7DA 2AUYA 3WZ1A 4PF1A 4PDWB 3RWKX 1J3RA 5FP9A 1MQTC 2CWMA 5FMOL 1WBLA 2RHPA 1RUE2 4JGYC 4CP9A 4JDMA 1SBFA 2W1QA 3PDQA 2PQSA 2JB8A 3EBRA 4ZZ5A 3Q8BA 4JKMA 2PHRA 3KVBA 5CA6A 2JDHA 4FPKA 4GWMA 5FJHA 5BY5A 3MUY1 1NLQA 4CCMA 2G1MA 3V0AA 2WO2A 4YW5A 4HSLA 1CQ9A 2ILMA 3PVOA 3M3IA 3OB8A 4U36A 1WD3A 1SZBA 4CCDA 2BRTA 2UURA 4W65A 5T5JA 3U4SA 4OMDA 2D6LX 3O1UA 2QQJA 4AEDA 1ENXA 1I9RA 1LHNA 1BEV3 1Y3TA 1Z7S2 2VD7A 4FOQA 3WOGA 3BU0A 1U5IA 2ZEWA 4DIQA 2D5HA 1TME3 3MI8A 1DQ6A 2D97A 2ZACA 4YFWA 1YCIA 4QPIC 3B94A 3UKNA 1RYYA 4X8PA 1HV0A 4UW4A 3N9PA 5JOXA 3O1RA 1BVP1 5JAXA 2VMDA 1CAWB 2EXHA 2PHXA 4Q4V3 2QQPA 1HRI1 3C7EA 1W6OB 5JOYA 1J59A 1RHI1 5KXCA 2B45X 2C5DA 2XQXA 1O3TA 5F5AA 2BWAA 3AXEA 3JQWA 3O14A 2WLPA 2XBO3 3PL0A 2WNUA 3LZZA 1H2MA 5FMBA 1W90A 3EB7A 2FMDA 3ON7A 2WZEA 5DUVA 4MADA 2ARXA 3D5OA 1RUE1 3DEMA 3WQ7A 5JCTA 1OD3A 1ZBE2 2VTFA 3O0VA 1WMDA 2AH2A 2DV9A 5JI7A 1AYM2 4AVCA 3O12A 3MW4A 4RS5C 5FP3A 1VJ2A 4MUVA 4YW3A 2X05A 1VAMA 1X7NA 3MW2A 3OOXA 4I0BA 4EV0A 3BUCA 4I2OA 4YSFA 2WT0A 4XAEA 3RI8A 4BB3A 4RFRB 4BXFA 4O9EA 5GKAC 4CCEA 1F35A 4YVWC 3JB4C 4QPGC 1ZYBA 1W8NA 2XL7A 5FZ7A 4XQWA 1Z7S1 1GFF2 5KWRA 3IB3A 4L92A 4RR3C 3IKWA 4ASMB 5D2AA 3KZ4C 3UYJA 3NO8A 4LUMA 1BBT3 1DCSA 3I49A 1JODA 4Q29A 4LXLA 2P2KA 3DYMA 3T1LA 4PJYA 3POJA 4IEWA 3GALA 3AZZA 1A6CA 3RDIA 4A7ZA 4XCAA 2ZCWA 5JR2A 4XE9A 4A3ZA 1TMF3 1NA1C 2V5YA 3HNYM 2VW2A 4M3CB 4RSUA 5H9SA 4Q4X3 5FUNA 5FY0A 4CEYA 4RGAA 3KHCA 1W99A 1LGNA 3J8F2 5KXDA 3U4XA 1X82A 1AVBA 3WNKA 4M01A 2BFUS 3LOBA 2A6WA 2JDYA 3R4UA 2QQMA 1QHDA 1PVC3 4PBOA 4QKDA 1G9CA 2HEVF 4AI1A 5CFDB 1GQPA 4R52A 1KDMA 1ZBE1 1D0HA 2BUKA 2N7GA 1PO22 1W8FA 2Z42A 1AYM1 1HQLA 5FPXA 4IV1B 4WM7C 2YHJA 1K3IA 3MIHA 1NKGA 3KSCA 3T0DA 1IQAA 1D2SA 4HFSA 4QX0A 2VZPA 4OUSA 4FO9A 3RVHA 2UWBA 2QBXA 1SEFA 5J09A 1W6MB 2W39A 2VE1A 5IK5A 5LW9A 1TNFA 3O5SA 2WA3A 3DGTA 3ABZA 4ZONA 3ZIXA 5JPMB 1T6BX 3H9AA 4HL0A 4XQDA 2Q8EA 2K2SA 2Y6FA 1L7LA 5GZDA 2JENA 1XRUA 3TWIA 2K0GA 3CJXA 4XJZA 3I2FA 1OUXA 4JTOA 4FT8A 2P6CA 4BHPA 4YRDA 1O4ZA 2MPFA 4DUXA 4P9IA 1SCSA 1KFUL 1HXS2 3WW4A 5F39A 3WDWA 1W28A 1O4YA 2A3XA 2UYBA 5J98B 2W0XA 3J8F1 4ONUA 4P9YA 4EN8B 1GR3A 2DBIA 3RZGA 1QNWA 5GLVA 1TG7A 1GSLA 3KS7A 4LBLA 1XNKA 4W4ZA 2DUQA 5FZ3A 3VDAA 1XSRA 4RL7A 4LIUA 3DXTA 1NCRB 3USUB 4AQTA 1AYN2 4JQRA 4XXAA 4Y1VA 1JBCA 2NZ9A 5L73A 3WDUA 5JWPA 1KDKA 2P3YA 5JXHA 5I8TA 3CDZB 4MGZE 1PO21 2XKOA 5LWBA 2Y6JA 1SDWA 4MXWB 1XBFA 1U5XA 3D82A 2Y6LA 4YPJA 3VBOA 5FZ0A 3GCXA 4KWKA 3OBRA 3RPQA 1ONAA 1QY4A 2W1WA 5CYYA 1GP5A 4XYXA 5HXVA 2H6BA 4HKWA 1OD5A 1JI6A 1IPKA 2DVAA 2VBPA 1V6OA 4Y1XA 4LKDA 2ZGRA 1YQCA 2X53S 4BIFA 3N9MA 1LODA 1HIXA 1YI9A 3WG1A 1JOBA 2JWPA 1CAVA 3OY8A 4HVRA 5DAQA 3U0ZA 1RITA 1QH7A 1W0OA 4D69A 1QJY3 1POV1 4BQXA 4GXLA 2KD7A 2W2IA 3LIGA 4Y4YA 1PHMA 4FP3A 1AL0G 1HXS1 4GQ7A 5LBBA 4P5YA 4CDWB 1C5HA 5C70A 2QQUA 1IQDC 2GDFA 2XB6C 3OSDA 3VKMA 3K3NA 4FCAA 5DXDA 2VPVA 3Q9OA 5K9YA 1NZIA 1VMJA 4FPFA 1NCQA 4GH4C 4QB1A 2PXJA 4R9CA 3WV6A 2HEWF 2VMCA 2ET7A 3NJVA 1AYN1 2RMU3 1YQ6A 2VOXA 3NJZA 2J1SA 3HPNA 3OUIA 1WMFA 3ZSLA 1AR62 5IK7A 1IHMA 2I74A 5FO8B 3UGHA 1PM4A 1L7RA 1OURA 2GNBA 1C8M2 2WAAA 3BYWA 3NNJA 1U0AA 4MH0E 3N9NA 4D6SA 2WNVB 4QDSA 2RS33 5GJ6A 3AL6A 5C5UA 1C4RA 1O3SA 3K4ZA 4PHZA 2CHHA 1LENA 5FPAA 2A75A 2HWC2 3KV4A 4CCJA 2RS53 3PMEA 2HWB2 4YGBA 1TQ5A 5JLVA 4I01A 4ATFA 4NHKA 4YG0A 5FXXA 4MGQA 3ZR5A 5FXVA 4QDRA 5FLJA 5ABJC 4YVSA 2QQIA 2RJKA 2QQOA 3POGA 4LBQD 2HWE2 4NHXA 1GZCA 4N9HA 2Y6HA 2O8QA 1AZDA 5FYCA 1W6NA 3H1YA 1H8TB 4Y1UA 5FZBA 1OUSA 4IE7A 4Q4Y3 1ZM1A 3AP9A 4NO4A 4PI2A 1G9AA 2GALA 1WZXA 1PMHX 5L7OA 3C7OA 1FOD3 1ND2B 1YQ5A 5GZEA 3WUDA 1UU5A 3WP5A 4CXWA 2RM22 2VZVA 3SQOA 1QJZA 1CPNA 5A33A 2IXHA 2P37A 2VQTA 3N9QA 2R0FA 5SV8A 1V9U2 4XHBA 2BU9A 1NQJA 3M2MA 3MLJA 3C7GA 2P6HA 1O6UA 1VBB3 2Q1ZB 3WNLA 1AR61 4DXRA 3LEKA 4XFGA 5GLWA 1RB8G 1OSGA 4K7JA 2VNVA 5T5PA 1C8M1 1H8VA 1POQA 1KITA 4XW3A 1W8UA 1APNA 2B8MA 1S0EA 4IEPA 3N7JA 3L2YA 3I3EA 2HBUA 5DG1A 2DURA 3BVCA 3PJYA 1FNZA 2HWC1 2DFBA 2HWB1 1E5HA 1OKOA 2I45A 1VRH3 3MGUA 5FYTA 1RUC3 2OPKA 5FOBB 5F5QA 3H7JA 5FY1A 1ENSA 4CVUA 3UJQA 4XF9A 1JOPA 1UMHA 5F3IA 2HWE1 2A71A 4AI8A 1UY0A 1R1A3 2BZDA 5T3NA 4KBZA 4IV3A 5DDJ2 2R042 3ILRA 2VUJA 1YXWA 5DG2A 3T4HB 2WINB 3D3AA 4CDXB 2HKXA 4IGPA 2VNOA 2YGMA 4KGGA 4WM8A 5A7SA 2QVSB 4I3GA 1UX7A 2RE9A 1O59A 4YLZA 1IOAA 2ERFA 1ZREA 4LLOA 3CBNA 4HBNA 3ACGA 1QJU3 1VBE3 1HB1A 5FV3A 2V4VA 3APBA 4GWNA 3RNSA 3VB9A 1HQNA 2J1VA 4DB5A 2FDJA 3O1SA 2RM21 2DF7A 4YM2A 2A3WA 2PAKA 3B02A 4D7TA 4JGZA 4LEJA 3H3LA 1WMXA 4DPNA 2JG8B 2WS93 1UNBA 1DQ1A 1VBD3 4IE4A 1V6NA 3CIHA 4LHKA 4ZU5A 1ULFA 2ZZQA 4F7ZA 1RUG3 2OZJA 5LBCA 4P9GA 4FFIA 3S0MA 4FQZA 2VUDA 1ZZBA 1S0CA 2DVGA 4UW5A 2ZEXA 5JIAA 5A3WA 4AHYA 5BNPA 1T2XA 3VDDC 3DPRA 1AR72 1A8DA 1DGWA 3C2UA 3RZJA 5C8CA 1H30A 1X36A 2FDGA 3Q8EA 4FBFA 5D1IA 3ST7A 5CB7A 1RUD2 1D4M2 1UOFA 3GBGA 1W06A 1W9YA 1ENQA 5C5TA 3DKQA 1O4TA 2ZX3A 4JVAA 1KS5A 1JYNA 2OA2A 4J6GA 4XACA 2R041 5C9AB 1QDOA 2E32A 2BERA 1Q8OA 5FLHA 5J48A 1RUI3 3B5LB 1PK6A 3QD6A 1W6PB 2W92A 3FE5A 2ZKLA 1N3OA 2VQAA 4MXVA 1V0AA 1WCDJ 4UYBA 3SKJE 2VCBA 5KXBA 3EQEA 5CIRA 5FYYA 3TN92 3GJAA 3SKVA 1JZ4A 2IUWA 4PDWA 5FJKA 5HPOA 4MGKE 2JE7A 1GLHA 2DVFA 3WUCA 4RHV2 3KF3A 3T4VA 2R32A 4FVVA 3VZOA 2HYXA 3P3NA 3VZMA 1XU2A 1A8MA 1MPXA 2GMEA 1TVGA 3OGVA 4B1LA 5DUXA 2Y6GA 4BCUA 4DQAA 5K0UC 1SLLA 4OZXA 3E5UA 3POWA 1AR71 4AVVA 3KCXA 2O14A 5FZCA 4DS0A 3ZYGA 1XYOA 3B7MA 2WQZC 5FYUA 1OFNA 2BDRA 2XJQA 1RUD1 1VALA 3I59B 4GB32 3WF4A 3KV9A 3KT7A 1D4M1 4UFLA 3SH3A 4I0WB 3KCCA 3FZ3A 4IGQA 4Z8BA 3ME2A 4B4RA 1WLWA 1VBA2 4CEWC 3O1OA 2FDIA 3PNAA 2YDEA 4DZGA 5F37A 5I0DA 2JDPA 2WYFA 4FPCA 1EAH3 1QXJA 1CAWA 1HRV2 5A3MA 2PFWA 2ZGSA 5FLIA 2JKBA 4D7SA 3J7MA 1W6OA 3NRUA 2R7EB 5C4WC 4DINB 5A7NA 1CGPA 3CJIB 3SHRA 5A6XA 1GNHA 2Z2SB 2PN5A 4IEXA 4XTPA 5E6HA 3VBFC 1V6MA 3JBG3 3ZXKA 4N53B 1CAXB 2JIJA 5L9RA 5FPUA 2FZ1A 4OYUA 4XUPA 3VKFC 4YG3A 5T52A 4MO3M 1MS1A 1KEXA 2IFWA 4P08A 2OYZA 1A78A 2VTXA 2B42B 4Q1RA 1XNDA 1N1VA 2XJSA 1GQHA 4RHV1 1JZ7A 1WLDA 2IC1A 4D0QA 2SLIA 4DY3A 3PU8A 3OBZA 4HLTA 4AF9A 2A6XA 1YIFA 4NAOA 2WT2A 3MPPG 5EPAA 3LWCA 2VZQA 1SPPB 5LASA 4RQPB 2F4PA 2NMNA 3BN6A 5L9VA 1AUYA 2NYYA 2VL4A 3ITQA 4GZ9A 1GOFA 4LMFA 5GZFA 2W52A 1H2LA 2PHLA 4AEDC 4JCKA 1SBDA 2XVKA 1EV12 3IIAA 4IQPA 1DYKA 4GALA 2GC1A 4QWNA 3RJRA 2CGPA 4GB31 4P9WA 3G7DA 3O1MA 4OUEA 1H2KA 2VOVA 4BZ4A 1VBA1 2C24A 4QKBA 2OW4A 1U5ZA 1H1MA 1UZ0A 4CDQB 3K77A 2G9GA 2XL9A 4P02B 2FDHA 1HRV1 5F6LB 4GMP3 4X6QB 4A45A 4JGYB 4PLMA 4UF0B 1F5JA 2UWAA 4M3CA 2JDUA 3D0SA 4K8RB 1I6XA 1PX4A 2MHFA 2FBEA 2YB7A 1QKQA 3ETPA 3MF6A 1XNBA 5JOWA 1ZBA3 2WNUC 3DF0A 1WBFA 4P9XA 2WT1A 3N7KA 4I02A 5FBJA 1S55A 3T3YA 5IYYA 1YFYA 3PURA 4ZXKA 2LS6A 1X8MA 3NNFA 1BK0A 3HVDA 5CFDA 1DLLA 2GZWA 4ZKTB 1RUH2 4Y33A 3WP4A 1RXFA 2EA7A 3MPBA 4Y20B 1S0BA 4IV1A 1R092 5I91A 5KHIA 3MDPA 4A2UA 5IK4A 4ISQA 2LROA 2OQ6A 4CP1A 2DYCA 3O0XA 5A7PA 4YARA 4HZFA 5BV6A 5A7OA 2ZS6B 3V64A 1W6MA 2A70A 3JU9A 4OQ8A 1Y9GA 1YO8A 1QQP3 2ZKNA 4E2QA 3ZN6B 4J1XA 1EV11 1MZ5A 4CTEA 1EP0A 3UK9A 4COVA 2WWUA 1H1AA 4FFHA 3T2PA 1W8TA 1PMIA 2VCMA 3LIHA 5AFEA 4GULA 4L8QA 2YC0A 4MGSA 2VVEA 4LHNA 4R9BA 4BA6A 3RYRA 3VZLA 3MIEA 2F4LA 4PBPA 1QJX2 3IAQA 4KU7A 4D6RA 4QDQA 1P8JA 2VC9A 4NIHA 3GBWA 4FOYA 4AFDA 1LGBA 3R6SA 2BTVC 4E8DA 1UYYA 1ASJ3 4Y5Z0 2EICA 3OEAA 4YZ3A 1XC6A 2C6SA 3FUOA 4M4PA 4FTEA 4D8MA 1OVPA 2XJPA 2HWF3 4Q2FA 1RXGA 1C1FA 1RUOA 3UT0A 2MEV3 1PIV2 2PHWA 4QHZA 3VHNA 1DU3D 1NCRA 3LEMA 3USUA 4XF0A 5LATA 1MEC3 5DZEA 3N7MA 2VO5A 2VM9A 3C3VA 1YFUA 1RUH1 2ZEZA 4AEJA 4YVWB 1XU1A 4QPGB 1I5ZA 3WT3A 2ARAA 2NLRA 1R1ZA 4MXWA 1R091 4AHXA 4DOUA 2BQPA 3AP4A 2D6OX 2J1TA 4J1WA 3BGAA 1JN2P 3HBZA 4X8NA 2EIGA 3ZSEA 3NNMA 3POBA 3R4SA 4QX2A 4LUKA 5F8PA 3IMNA 5CKQA 1CPMA 2WWSA 4MZUA 1NXD1 1XXNA 4JDNA 5HCFA 4ZPIA 1COV3 1UYZA 5FPBA 5A7WB 1YJKA 1AR82 4EROA 2R6QA 1QU0A 1NA1B 2JDMA 1XSQA 3ASIA 4ZU7A 4NHLA 5LRSA 3HQXA 4C91A 3U10A 1JHNA 1H6YA 1GZWB 1UD1A 5A1FA 5FPZA 5C3OA 4N7UA 4CCCA 3VZJA 1QJX1 1HJGA 3OBAA 1HJFA 3VD7A 5I93A 4YGDA 1QF3A 1UKRA 3NSTA 4NRMA 4CDWA 4FPHA 2PAMA 5BNQA 4AFBA 4LNVA 5DAWA 3R0RA 3DUIA 3NKGA 2VZRA 1W0PA 2DFCA 3ILNA 2K46A 1B35C 2NMOA 2F6BA 1UIJA 1GU3A 2IVJA 2ZBJA 3B01A 3P1IA 2A7AA 1PIV1 2OUHA 3WNOA 5IVFA 4M0NA 2BEOA 3OGRA 5J36A 5BNOB 2E53A 3IDBB 3ZXDA 2GC2A 3ZR6A 1DBNA 1HB2A 4GKXA 4NWWA 2W08A 2I2SA 3VBOC 1JUIA 2WNVA 4AVSA 1PGW2 2B39A 2VW1A 3KCYA 4NHYA 4NPLA 1WCSA 3AXDA 1K5JA 1OT5A 5FDBA 3LGRA 2D44A 1Z0HA 3LAGA 3Q8AA 3WNXA 2JE9A 4PIZA 2XR4A 3P3PA 1GQGA 2R30A 4YGEA 2VZUA 5G04L 4PCRA 1AR81 3Q8FA 4JX0A 4NJ4A 3IZOA 3ROUA 3ORJA 5FPVA 2PAEA 1NAEA 5I8YA 1WCKA 2A5ZA 1UU6A 4LR4A 5BNNB 3ZKUA 1D2QA 2Q1FA 3A22A 1V6JA 1DP0A 4UOJA 1H8TA 3AK0A 3MIGA 1F9KA 4EYUA 1NE4A 3MICA 3ZX7A 5LEJA 3B3QE 2XONA 1YQ2A 3VBRB 3WLUA 5JPNB 1HW5A 3ZYIB 3HIFA 3KB5A 3FBMA 2GSYA 1XB9A 1QWRA 2WZR3 2XWBB 1ND2A 3ZPOA 3ENRA 3LDRA 4UFKA 1AXKA 4ARXA 1OFSA 3B9CA 4INDA 1NCQC 1GBGA 4GAZA 3UKTA 1RJ7A 4IW3A 1L7QA 4E4HA 4I3PA 3ZN4A 3FLPA 1FYUA 1K5MB 4K20A 3O1TA 3I2KA 2YY1A 1GNZA 3GZUC 4XIOA 3W59A 3CZUA 2Q4SA 3IN9A 3LSEA 1ZZ6A 3C7HA 1PO12 2QDRA 3ALQA 5T54A 4NR1A 1LOFA 5JMOA 1H2NA 3TEWA 2ZZJA 2RDRA 1PGW1 3KGZA 3TAYA 1OLMA 1LU1A 3VKNA 5FZ1A 3ZMOA 2W9XA 1G86A 1NLSA 4CYDA 4DXZA 1XYNA 2BGCA 2DVDA 2Y64A 3THPA 4NAMA 3ZFFB 1SFYA 5LK5A 3ZXGA 1GWKA 4N9IA 2FMYA 5CBLA 1GMMA 4CPBD 1Q5OA 2VVFA 2YC2A 3WDVA 4FFGA 4UT5A 1GP6A 1LGCA 1C57A 1H6XA 3LPFA 3VL8A 5LK7B 1HQWA 4DMIA 3VBSC 4KH9A 1H1IA 5AC93 5CFCC 3LPGA 3NWKA 4TZDA 4XJAA 2OKXA 3M8LA 5LBEA 1POV0 4CDXA 4P9JA 1RUF2 4PT6A 1ZZCA 1PM7A 3I3DA 4FPGA 5FZEA 4AFCA 3J7LA 2XJUA 1WA6X 2PHUA 2WQ4A 4AGVA 5A70A 2CV6A 1NY72 2J7MA 3NVCA 2QKDA 2B9UA 3N36A 1AHSA 5ACA1 1CESA 2LM3A 4S2FA 3NV1A 3F2ZA 5FZOB 2JG8A 3PIGA 4IEOA 4GJZA 2J22A 5CISA 1RVF2 2UYAA 3NW4A 4XZUG 3SH5A 1W8WA 3LA7A 1F5FA 4QMAA 3W5MA 1PO11 1YHFA 1W9FA 3WP6A 3AP7A 4NPRA 2E7TA 4DRRA 5J96B 3RZLA 3AFKA 4B29A 4QM9A 4YWAA 3V65A 3JXSA 4C1XA 3BKZA 5IHRA 5J7MA 2VR4A 4XDOA 2PLV3 3VZKA 3OUJA 3RS6A 3QOPA 3NMBA 4UBGA 1OKQA 1FPN2 4E4ZA 1REDA 1SLIA 5JZGC 1RMU3 4IL7A 2ADEA 5FMCA 4AAPA 5J1XA 1O5LA 2RV9A 4QAWA 4QXCA 4UFMA 1FXZA 1HV1A 3UL2A 4Z92B 4TN7A 4K1YA 1OQDA 5DPNA 3KV6A 5FOJB 4Q5OA 4BE3A 5C9AA 5JDBA 2WR9A 2QZ2A 5J3UA 1RUF1 3VBHC 2VQUA 4CDUC 1N1SA 4KNCA 1PNFA 2D43A 1W6PA 3TYJA 4JC1A 3KWVA 1Q8PA 2GAUA 2Z79A 1NY71 1V9U3 2Y6KA 4E27A 1VBC3 4AHWA 1CN1A 4LE3A 4XILA 5F9TA 5EXOA 3WHTA 2OX0A 2YYOA 3RG0A 2E6VA 4OFGA 1BQPA 4WBBA 1RVF1 1EPZA 2BFUL 3QH6A 3WP3A 1LCLA 3TB0A 1OQ1A 5FY7A 3AJYA 1TNRA 2ZX0A 4ES9A 1GV9A 1MS8A 2VY0A 3AKPA 1YJLA 2BVBA 4FPJA 4C0BA 1BK1A 4Y4RA 5FK7A 3JCIA 1OPOA 3I4IA 5EJ1B 5I0UA 3UGGA 5GZGA 1RUNA 2D5FA 1RUJ2 3DPRC 2I07B 5FYVA 4BQYA 2UU8A 4BWOA 1S0GA 1K12A 4XJ9A 3MW3A 5CNAA 3WY6A 1G9DA 5C33A 3WG4A 3M70A 1V6IA 2GNDA 3ZXLA 2CYFA 3I59A 3S6PA 1FPN1 3HN3A 5FUPA 4AOCA 5DDJ3 1Q8QA 5LY2A 1GOGA 2W5FA 3L9JT 3PIJA 1RIRA 3PUQA 4UAPA 1MS0A 4TLGA 3MLKA 4OHWA 4WVWA 4LQRA 2VUAA 3F95A 3WNPA 3D4KA 1GWMA 1E5SA 1QH6A 4FPLA 5IW0A 3SNMA 4JKLA 5A1AA 4XETA 5JXIA 1SQ4A 3AP6A 2W87A 3LDKA 1PK6C 1UY3A 2IZWA 5ISLA 4Q4W3 3VD4A 5F2SA 1R083 3CJIA 4NROA 4LKSA 1W2UA 5IAXA 3PVEA 1W8HA 1YFWA 4N53A 1CAXA 1JU4A 1LEMA 2HLEA 4LITA 4YZ2A 4PDWC 5EP9A 1BXHA 1PZ8A 4I0AA 5F2WA 5DZFA 4QQOA 2A73B 2P34A 2OZ6A 4OI1A 1YUDA 2UWCA 2QQWA 3U75A 4BYYA 3GZTB 1Q43A 1WD4A 4XBQA 3IDAA 3NAPC 4YW2A 5FYSA 3ZSKA 3HWJA 3DYOA 5F3EA 3B9IA 5LA1A 2RS13 1O91A 5FFOC 1S0DA 3IM0A 1SPPA 2QTWB 4RQPA 1UYXA 1PGSA 2E7AA 1RTVA 3VKLA 1RUJ1 2JXAA 1BEV2 4OULA 4AGGA 4COUA 2JDAA 5CEHA 3HBKA 5A6QA 3L2HA 1FMD3 5DN2A 1TME2 1WLTA 2AC1A 3BPZA 4O7XA 5DABA 3S30A 3BIWE 4KMQA 5IFTA 4K3UA 4P14A 4DNYA 4FPEA 4LBOA 3LB9A 3LEGA 5C7GA 1JYVA 1X50A 1VMHA 4BMEA 3AM2A 1ODMA 4Q4V2 3WEZA 5LEKA 4Y3OA 4CDQA 3BTYA 1SMVA 3K4DA 1NT0A 4PQQA 4AVTA 3QCWA 4YW7A 3UV9A 4COYA 4AI0A 2WFF3 1LR5A 2X5IB 4QQLA 3TN93 1WGPA 2XBO2 2Q5TA 4JGYA 4UF0A 5L36A 1GOHA 4K21A 3OCPA 3MLLA 3NJYA 1OOPC 5D8AB 2OQ7A 2V4AA 1JHJA 3ACIA 1ZRDA 2JD9A 4TYSA 2JEMA 3MF9A 4I30A 4IESA 2D7FA 1Y9MA 4EN7B 4QU2A 5K0UB 1AL23 1E5RA 2Q8OA 1GANA 5GM0A 3U07A 2D6KA 4RFT0 1DGRA 1CZSA 2YROA 4DY5A 1REFA 2LTNA 3E6DA 4Y20A 2VECA 4XJUA 3A21A 4EN6B 3WDXA 1JYCA 3ACLA 2VCCA 3OD0A 1AR93 3AZXA 1ZRIA 3P5BA 2KXLA 5ANNA 1BEV1 1C5IA 3FX3A 4A42A 4CEWB 3WF0A 1SBEA 3OF1A 1TME1 2JJ6A 2R16A 4XBNA 4Y5SA 4EN9B 3ZN6A 1BBT2 3T2TA 4R4XA 5FCCA 2ET1A 1KFXL 2WO7A 4UFJA 3USSA 4BLIA 2CNAA 2W1SA 1ZRRA 3MEPA 3NV3A 4MGIE 2WKKA 3M3EA 3RI9A 5LB6A 3ZIWA 4QX8A 3WQBA 3WF1A 3VBFB 2BP6A 2LRPA 1NLRA 4Q4V1 2FZ2A 1LNSA 1TMF2 4EN0A 1LRHA 4Q4X2 3VN4A 4LA2A 5LA0A 4C1WA 1QJEA 1DQ0A 2GP3A 4LORA 2GH2A 3LA3A 3R05A 3M3CA 4IEZA 2XBO1 5EQUA 4F8AA 1W8ZA 2YMZA 3J9SA 3ZYFA 3W9AA 2RR13 4FP2A 4KU8A 4LK6A 4Y5TA 5G05L 1PVC2 1JZ2A 4IDZA 3LQCA 2DCYA 3THTA 1GYKA 4BQ1A 3DV8A 3M7AA 4F83A 4IE6A 3WF2A 5FQ0B 1REEA 2BJSA 5CFDC 1VAVA 4NOTA 4OMCA 3BI3A 5FXWA 3AL5A 3JD73 1JH5A 3FFZA 4XQ4A 2J1EA 4HK8A 4QPGA 4YVWA 5IATA 3V0BB 1BYHA 3K2OA 1IS5A 2AEYA 3ATGA 5KC6A 4N43B 2WDBA 5D21A 2ZX4A 2XH6A 1VB4A 3OJBA 3TRSB 4FOWA 4BH9A 5F32A 4L11A 3VUOA 4NIGA 1D7PM 3IAPA 5T50A 3RZKA 4WZFA 1BBT1 2R063 1ZRFA 4R9AA 1JMUB 1LOCA 4FFFA 5A7WA 4CUAA 3OPWA 5HBAA 3LDBA 4IE5A 4QQ2A 1NA1A 2ZGKA 4AE2A 4ZXEA 5IUQA 5CG8A 2DUPA 3KQ4B 1GZWA 1RJ8A 1CAUB 2RDQA 1TMF1 4G3YC 5C3RA 3KF5A 3ZSMA 4Q4X1 4URTA 5FY9A 2RJ2A 3SCGA 2C4XA 3KV5A 1OBNA 1WW6A 2ES3A 5CU1A 2A3YA 2WZPP 1FI2A 5E8AA 3AJZA 3LD8A 4RYDA 3AKSA 1PVC1 1UWWA 3CU7A 2CU5A 3GZEA 4LBQB 1WKYA 4I09A 3EMRA 4LK7A 4LO4B 1JYIA 2C9AA 3SH4A 2A1XA 4V2WA 4N8MA 2CL2A 5F6KA 4A7YA 3WDTA 3I3MA 1ODNA 2SBAA 2WABA 1LKNA 1UZZA 2DCTA 3BOWA 2GNMA 2QE3A 1DZRA 2VULA 4FQ4A 2E7QA 3ZXJA 4AGRA 1E5IA 3WQ1A 1XPWA 2D93A 2OVUA 5DUWA 4AZZA 3FHAA 5BNOA 2WUHA 1ULEA 4NN0A 1Q8VA 1STMA 1N1YA 2JG9B 2VBBA 5E1RA 2UY8A 3RZZA 1IG0A 1ZA7A 2HYKA 2XQRA 1GNYA 2B46X 2R073 1KGYA 2TNFA 1D0GA 1KXGA 2WWJA 1OXCA 4OHZA 4COZA 2VGDA 3B00A 5A3NA 5I0RA 5LRRA 2DUOA 1SLTA 4ORFA 2V72A 5APAA 4HXCA 1G8WA 1QJY2 3OTFA 1BMV2 1NZCA 3ZXEA 2JIGA 1SFPA 4F3JA 2EIDA 4XFAA 4XUOA 5BNNA 4Q26A 1DQ5A 1K42A 1OH3A 3PTYA 3RSJA 1GZTA 1DLCA 1Y43B 1ACCA 2W95A 2FCUA 3NKTA 4R8HA 5KBFA 3VBRA 5FZGA 4CUBA 1CIWA 4ATEA 3ZFGC 1BJQA 5FYZA 3MIFA 3FLRA 4G4FA 4LBJA 3H8XA 4LO8A 2RMU2 1X9TA 2J1RA 1AF9A 4UI9L 3H3ZA 3FMGA 2G9ZA 4WVZA 3RRDA 4A6SA 1ZNPA 4HG6B 1K5MA 5GALA 4WVMB 2IXJA 3O1VA 3CHXA 4E9KA 3N7LA 3OEBA 4QGNA 2RS32 2ZEYA 2ZPXA 3BODA 4NUBA 4XDPA 4CP2A 1XYPA 3NNGA 4QB2A 2RS52 4L99A 4Y22B 5FZFA 5BYNA 2WNVC 5FAXA 1O8SA 4BPZA 2DTWA 2JX9A 1W2TA 3RYPA 5FP7A 2HWD3 3CNAA 4Q0VA 3MBWA 3T30A 3FHIB 4COWA 3ZFFA 4AVBA 1IPSA 4NIIA 1LHUA 4JKKA 4A44A 2EALA 4RD7A 1ULDA 3H1MA 4PF5A 2H0BA 2P3JA 3I8TA 3PTRB 2D6NA 1F4AA 2WQ8A 3FHQA 5EFUA 1S4CA 5T5LA 1QJY1 1BMV1 2FHRA 4QGMA 3U11A 1ND3B 4Q4Y2 3HQUA 1H8TC 1VP6A 1B35B 2W91A 5EIYB 1WLCA 3JUUA 3GM8A 3ZXFA 5IK8A 1FOD2 3KMHA 4SLIA 5K8SA 4IETA 4AEMA 1KRIA 1C28A 1ULGA 2DCJA 2WSVA 4QHBA 3ELNA 1SFNA 4TLFA 2YFUA 3B93A 4GKYA 2YU2A 3BTZA 4AHZA 1W3VA 2XHKA 4CXYA 4JV4A 2RMU1 3VGIA 2KM2A 1VBB2 1XOYA 4KWLA 5DAPA 5FZOA 2IXLA 3NV4A 4DUWA 2QFEA 4GIQA 5FWEA 3T09A 1S2EA 1HKDA 1SLAA 3OG2A 3JZVA 1AXZA 4XVHA 3VBUB 2RS31 5A7QA 3CL1A 3OGJA 2BGOA 3SXWA 3A0KA 3ZFEB 2VNRA 2RS51 1IGOA 1HRI3 4TWTA 1VRH2 3TNQA 1LAJA 1JXNA 1RHI3 1RUC2 2DCKA 3M3OA 4L0PA 4NRQA 2XXZA 3SCFA 3KD4A 3HOBA 4BDVB 1MQTB 1OC1A 3RQ0A 2VQ0A 4M3CF 3HT2A 4LULA 1V6KA 5AVPA 4A7KA 5HV0A 3IWZA 4CCLA 4IE0A 1DFQA 2D3RA 1R1A2 4FAGA 5HCHA 1QMJA 2PMWB 1PGL2 1RUE3 2GN3A 1H9PA 2WNOA 2W47A 4PLOA 1FATA 2ZGLA 1CJDA 1E57A 2VJXA 3OGGA 4HK9A 4Q4Y1 3IPVB 1S0JA 1YEWA 2WO3A 2JDNA 2Y34A 4JAAA 4FTBA 4ZY9A 1FOD1 1QJU2 1VBE2 2W3JA 3H8UA 4M4RA 4XZPA 4ZU4A 2P5BA 3GZAA 1RGSA 4EWDA 1U12A 3FUQA 1LU2A 4Q0QA 4XMAA 5JSPA 3ZYRA 1O5UA 2WS92 4AFMA 4C0HA 4QPIB 1VBD2 1Z7S3 2P1BA 2XHNA 5FIXA 5FZKA 3X29B 3BALA 1EUUA 2ZGPA 3O7OA 5IVEA 5F7UA 5CAZA 1VBB1 2BOIA 2FCVA 1RUG2 2JG8C 5DAVA 3TEXA 4AQ2A 1ZRCA 2B4KA 2ZAAA 2G4IA 2WC2A 5FPLA 1F2NA 2WJSA 4LPLA 1JZ3A 4E8CA 1MS5A 2VCAA 3CQOA 4PI0A 2HJIA 5JXJA 4AL9A 2P4EA 4K1ZA 1VRH1 4GWJA 3SC7X 1PZ9A 2VOWA 4AQ6A 1RUC1 4CCNA 1US3A 3VBSB 2CGOA 4QX5A 5CFCB 4L97A 3TEYA 1QGLA 2VTXJ 2D3SA 3NV2A 3OBTA 4KGQA 4ASLA 4CEYC 1ZX5A 1QDCA 2LW8A 2VMHA 3VDCA 4J25A 4EJRA 1PGL1 1R1A1 4QPYA 4XPVA 4RS5B 1ZBE3 4LT5A 5LA2A 3RJ2X 1AYM3 1RUI2 3T0BA 3DCQA 4JZRA 1N3QA 1OLQA 2IWGB 4YGCA 1MS3A 2E26A 2TEPA 4YZ5A 3POFA 3VDBA 3K75B 1W3XA 1KJRA 2XLAA 1QJU1 5KHGA 1VBE1 4XIKA 1W0NA 1UMZA 2IXKA 1BVVA 2LALA 4RR3B 1DZQA 5F5CA 3E97A 3LFIA 2WS91 3DECA 2Q1MA 1VBD1 1PNGA 2X29A 3RMYA 2BNNA 2YC4A 2QDNA 1LB2A 1RUG1 2HEYF 4AQSA 2BPA2 1ALYA 1W9SA 4NIDA 1UOGA 3HMYA 1UCXA 3DXUA 5FZLA 2XDVA 1EYBA 3I3QA 4HKLA 4XJWA 4AWDA 4A4AA 4A3XA 4JRLA 4MHUA 3POEA 5A3UA 2WSUA 5IFPA 5JZGB 4IEYA 2OIIA 4V1PA 4XHXA 2BVVA 2DVBA 1CVNA 3TOJA 3J8F3 1Y9QA 4GD4A 1R64A 4ZHNA 1ULCA 4AYUA 2ARBA 4JRAA 5C6CA 5F3GA 2IXCA 3MHZA 1DGLA 1YIPA 1FNYA 3A7QA 4C8DA 3AMPA 3AYAA 1L3JA 3SEPA 4BLJA 2EIBA 3OPTA 1J58A 4FXGB 3AYEA 4CDUB 5FYBA 3W21A 2A6VA 4WM7B 3W5NA 3AC0A 1EAH2 1X33A 2Y38A 2Q8CA 1PO23 4XDQA 5A32B 1QNYA 1YWKA 1RUI1 5EV7A 1VIWB 4UFIA 2EIEA 4XEZA 1DZTA 1O3RA 3AMQA 2Y8KA 4AFAA 1NQDA 4NVPA 3JBG2 2Y26A 5HXMA 2X5IA 2FD8A 1OA3A 4MVTA 3CJIC 4W8JA 2DWRA 3T0AA 1DIWA 2H6CA 1W03A 2Z69A 1SLBA 5D8AA 5GLZA 4ET7A 3A0NA 3AVSA 3QH7A 4N53C 1IS3A 2J42A 3M4FA 3T08A 1UZWA 1ST8A 4DEVA 5K0UA 3UGFA 5L9BA 4P5HA 5EWSA 1EY2A 1DYOA 3BIEA 2GU9A 2NQYA 3KM5A 4HMZA 2VU9A 2XUMA 3FWEA 4EWAA 5KHJA 4ZS3A 3GGLA 1POV3 4QPWA 3K3OA 3K48A 4RQPC 5DZGA 5H9RA 2Y33A 1HXS3 2B7YA 4Y24A 4CEWA 5C8WA 2D6MA 4YZ4A 5IJRA 2O0OA 5C3PA 4QHOA 2YPJA 5JR7B 5HV4A 1BHGA 3RYKA 5K7PA 2AACA 2OXBA 2FDKA 2ZTNA 1TEIA 4OCTA 1YLLA 1PMJX 5IWFA 5ACA2 5FZDA 5JMCA 1PVXA 5LBFA 1AYN3 1AX0A 1HB4A 3H8OA 1EAH1 2AZ5A 4QX3A 3MZHA 2VMFA 5CG9A 1UL9A 3VBFA 4UW3A 2E63A 3PVBB 3ZOIA 2BWCA 1H4GA 4Y1ZA 2ZGOA 1G7YA 3OUHA 4JHTA 1VPHA 3OYWB 3WINE 5HI0A 3AZYA 3JBG1 4AI2A 1ZBA2 4LIVA 4MX3A 1H9WA 1IZ3A 1JOJA 2XKPA 3E5XA 1MS4A 3NAPB 2WYSA 5K4LA 4B7KA 2ZGNA 4B8EA 4LBNA 4URAA 3S57A 4B4QA 4OI4A 2E33A 3W58A 1FV3A 3EJKA 2GNTA 4FI9A 4QQPA 1G6NA 5CKNA 5FQ0A 3R4DB 4HVQA 4UW6A 4YVSC 1YFXA 3T2QA 3GHMA 3PLQA 2J1AA 4OUMA 3V0BA 4YW4A 3SISA 1ZZ9A 4N43A 5FUIA 1QQP2 3E1F1 4Z2AA 3LE0A 4IGOA 1OQEA 1UYPA 4GH4B 4NIAA 3KGLA 1IS6A 1CIYA 4D94A 2JKXA 3CF6E 1X9PA 2BGPA 4D6QA 2ZGTA 4H7MA 4QT6A 5B4XA 4QXBA 5L7OC 1MVQA 3AX4A 1SDDB 4KI5M 3ZLIA 1KD7A 2JICA 4JTNA 1YRZA 2VZSA 1YNAA 1OOPB 2XOMA 4LTAA 3THCA 1DDLA 3SEEA 1AR63 2GN7A 3UJOA 1CAUA 4GMP1 4BQ4A 2VBDA 3S7EA 4ITCA 1J1TA 5GZCA 1C8M3 3J7HA 3GCWA 4M00A 1ASJ2 1IKPA 3I2HA 4LO6B 3ZPYA 1ZBA1 2ETEA 2V73A 2HWC3 3CO2A 3VHOA 4BU2A 2HWB3 5ABJB 1WMEA 2WFPA 5FZAA 2HWF2 4D7YA 2VZTA 1YC61 2ORZA 3CZJA 4MV2A 4LBQA 2MEV2 5IAVA 2YV8A 4YZ1A 2GC0A 1HLCA 1BZWA 1YQ8A 1MEC2 1W8OA 2HH9A 1DQ4A 2IVIB 2QJVA 1ULPA 5CZKA 5JVVA 5A3TA 2ZXQA 4XJ8A 3INAA 2HWE3 2VW0A 1QOTA 2NPIA 4B3NA 1M06G 4BJ0A 3NNLA 3KHBA 2WA4A 2W94A 2AREA 2VG9A 2VVDA 3K4AA 3KVAA 4WV8A 3HAGA 5SV5A 5BXXA 2JB4A 5TSWA 1QQP1 2JG9A 3MO4A 4IV3C 4WZCA 4QXKA 5A3PA 4OHVA 1COV2 1LOGA 1I5PA 4OQ9A 3RZMA 5JI9A 3IMMA 4WM8C 4W50A 2XLGA 3HT1A 1W6QB 3J26N 2RM23 3EO6A 3WF3A 1NUKA 1YI7A 5EJZB 3AKRA 3IBMA 1H0BA 2P17A 3ECQA 3PUHA 4GA9A 2QZ3A 1MACA 1T6GC 3ZM8A 4CCOA 1W9WA 4JGZC 3WW3A 2RJLA 4ARYA 1HDKA 3ACFA 1W2OA 1QXPA 3ZYBA 2RG4A 1Y7BA 3O1PA 3I2JA 2PYTA 1QEXA 1ASJ1 2AR6A 1XNAA 3OGSA 3JB8A 4IEQA 2JD4A 1A34A 2HWF1 3MFAA 5BNPC 2VZ3A 3TEZA 2V5DA 2MEV1 4RGGA 3H7YA 1CZVA 1KS4A 1XNCA 5FYIA 1MEC1 1ULOA 3CLPA 5C8CC 4B7EA 5IT6A 4FXKB 4W6YA 5JIUA 4WVMA 3I3BA 1XE8A 1UIKA 3PUAA 1JUHA 3AB0A 5BNOC 4NHMA 4Z1VA 2R043 3KT4A 1S2BA 5IVYA 4Y22A 3QBQA 1W2NA 2BOJA 1J3QA 4MG2A 1AX2A 2L9LA 2XPJA 2EAKA 3RWNA 1IS4A 2R1BA 4YM3A 3E6CC 1COV1 2JECA 3PVNA 2RVAA 4AVAA 4LE4A 2VMGA 1CWPA 4AW7A 1Q3EA 1LECA 2G9FA 4EE2A 5LCWL 1VMFA 3D6EA 3ILFA 1JZ8A 5JXGA 2CAUA 3AZVA 3AMHA 4Q8LA 4XTMA 4JHZA 2HBTA 2BBAA 2XWJB 4E4SA 5BNNC 1ND3A 2G19A 4OZOA 3VDDB 2X09A 3BCWA 1C3HA 1RL3A 2IFRA 1B35A 1JW6A 1NOVA 2DBNA 4S2DA 2WZ8A 1JZ5A 2WZR2 2YU1A 4ZS2A 3VBRC 3VD9A 1AR73 2QQVA 4S2HA 3WNMA 3UNPA 3D8CA 4UFHA 4META 1OMIA 4CU9A 4H2AA 5FR3A 2B9VA 2ZMLA 1C8NA 1VR3A 3K51A 4XF4A 1RUD3 5IVJA 5EYXA 1OA4A 2ZHLA 3NL1A 5E89A 3WXPA 4QD2A 1D4M3 3GBFA 2VOKA 5FYHA 1K5MC 4ISRA 1UY4A 3LOIA 2ZHNA 3LF7A 5A80A 1JYWA 4H7LA 1HB3A 1SHWB 3VBUA 3RMXA 4K8FA 2ARCA 4HPKB 3ZFEA 2C1FA 4O61A 2EF6A 3W20A 2DDUA 2ENRA 3HEIA 3ZDSA 5F5IA 5KXEA 2YPDA 1LULA 1MZ6A 4IEUA 4YM1A 1EPWA 4QU1A 3WX5A 5CADA 1MQTA 1U5YA 3U1XA 1UZVA 3N35A 3TBDA 3ZFFC 1UF2C 1US2A 3IT8A 3AFGA 1JZ6A 2ZAHA 1F4HA 4FPYA 1UXXX 3WW2A 1BKZA 5AC92 5EYYA 2KA3A 4Z2WA 3RFRA 1A3KA 2OUJA 4RHV3 4XUNA 3WNNA 1F15A 3ZFGB 4HN0A 3DYPA 3AKTA 2OS2A 4LA3A 1Q56A 3ZYJB 3IPVA 3GYDA 4LKFA 5DUUA 2YXSA 1TZOA 3GNEA 5I0SA 1NG0A 2F17A 2VNGA 2WZR1 4BK5A 1OF4A 5M0TA 1KJLA 1UXZA 4ES8A 3K46A 2A6YA 4N90A 4SBVA 1WA4A 1VLNA 5DMYA 2C26A 1FX5A 2YUEA 4K6BA 4QPIA 4EZ4A
chains in the Genus database with same CATH topology
1ZZ8A 3M3QA 1MVEA 2XVLA 4GB33 4QQHA 2R1DA 5H9PA 3WG2A 2P3KA 1LHOA 1VBA3 2A6ZA 4M0HA 1V00A 5C4WB 1HRV3 1LOAA 3BOPA 2PLV2 1KQRA 3PHMA 3VBSA 4UXAA 1MR5A 4L9BA 3WD5A 5CFCA 5T5OA 3WVJA 3V56A 1AJOA 1WW4A 4BM8A 1RMU2 1UKGA 5T55A 4UBHA 1DGWX 3FJSA 5AC91 3EHKA 1FT9A 2PA7A 4RS5A 1VB2A 5FTTC 4IXLA 3AMMA 3V0AB 4XXPA 2YGLA 1DYPA 1XQNA 1DGRN 2CTVA 1CD3G 4AEDB 4OHYA 4IV1C 4NWVA 2BBVA 1VBC2 4PIYA 1GZ9A 2D98A 4AK3A 5BUVA 2Y0IA 3I2DA 3LA2A 4RR3A 4YG6A 3T1MA 5FO9B 2X8KA 3BB6A 1EV13 4IEVA 3VKOA 2ZOEB 2PHDA 4LO7A 4MGYE 3LCPA 4LO5B 2Q0AA 4HVOA 3SLIA 2QCSB 2DCZA 1N1TA 1I3HA 2MNGA 4L2NA 1C1LA 1QOOA 3S7IA 1F8VA 1FAYA 5JZGA 2E51A 2PLV1 2WNUB 4H55A 1UW8A 2O1QA 3VL9A 3GHNA 1H4HA 2ZGUA 1OA2A 1RMU1 1J1LA 1CX4A 2V09A 4KWJA 4CZSA 2EAAA 1LEDA 3BU7A 3VBHA 2PTMA 4BOWA 4CDUA 5FRAA 4WM7A 1ZZ7A 1RUH3 1W39A 1SLCA 5A32A 1BCXA 5FO7B 4Q1PA 1NCRC 1R093 4Q4W2 1LOEA 1NXMA 1R082 3E6BA 3FFQA 5L36A 4JDOA 4RA0A 1V9U1 2DU0A 3ZYPA 4CP0A 4YW1A 1UPSA 3ETQA 1VBC1 2YZ4A 2BNMA 5E16A 1YYNA 4H3WA 4PIXA 4XFIA 2Y0OA 3ZO0B 5L19A 3VLBB 1I1EA 2ZGMA 1WW5A 2RS12 1MS9A 2XG3A 4P9LA 3IDEA 4O9GA 1DF0A 3E5QA 4CEYB 5FBZA 3SCHA 1QJX3 4Z07A 3IDCB 1FMD2 3OPZA 4MYEA 4Y26A 5BPXA 1N47A 3ZSJA 3SMHA 1B09A 3KT1A 3OD4A 5DDJ1 4OLLA 4CDWC 2BYVE 1PIV3 2VH9A 4K40A 1OLRA 1CR7A 4LLFA 4KG0A 2CGNA 4XF1A 1GICA 2WFF2 4XFFA 4XOGA 1WUVA 4E2SA 2GMMA 5GLTA 1DHKB 3ZXAC 5KHGA 3EXUA 4Q4W1 1G9FA 1DG6A 1PZ7A 1R081 3ZMNA 5EZWA 3OYWA 3FBYA 2X5IC 4K9SA 4XMIA 3KLSA 4XFHA 4FOVA 3MIDA 1ZVFA 3N4MA 2Z5WA 3NAPA 5D8AC 2AENA 1AL22 2R49A 1UZYA 1G9BA 1SCRA 5J37A 1AR83 1O7FA 2RS11 2FQPA 2ZABA 2R0HA 3VHRA 1AR92 4DRVA 4FAHA 2PQQA 3GF6A 1MZFA 4OI0A 1WW7A 1FMD1 3HD8B 1S0FA 4HETA 4IERA 3WG3A 1LJ7A 2VXRA 1FV2A 4GH4A 1V70A 1S0IA 1MZEA 3DL3A 2EXIA 2WNEA 2AGSA 4DFSA 4XFBA 4QGLA 1ND2C 4M3CE 2EXJA 1OOPA 3VBOB 3AP5A 3VV1A 2WFF1 4HT1T 3JQXA 3TN91 2ZMKA 1Z78A 2E9QA 2RR12 5B2GB 2P3IA 2WL1A 4Y1YA 2WIIB 1LOFC 3MFCA 4R4ZA 5ABJA 1F31A 2VMIA 3WW1A 3AYDA 4E4DX 1AL21 4WVVA 5JSOA 3KQRA 4AXOA 4YYOA 3JD72 1CAVB 3H1WA 3OY8B 1LHVA 2ZGQA 3BTAA 2XGXA 4B4PA 1AR91 1QOSA 3H0OA 3LSDA 1IPJA 4YNIA 4N43C 4TSVA 4N7IA 1IKQA 1V6LA 2R062 3A4UA 4KG8A 3WCRA 4X6RB 1NCQB 4CDXC 5ACA3 3LKJA 1OPMA 2NN8A 3G6JB 3HN1A 3POSA 4C90A 3ZVXA 1W6QA 1J3PA 1SACA 1AX1A 4OHXA 3M1HA 4KL1A 2PELA 4XF3A 2Q30A 1CJPA 3UKVA 3WDYA 1PO13 3VHPA 3SITA 2H0VA 2WLQA 4BMBA 2RR11 4EWEA 2JDZA 3ES4A 2UY9A 2BW8A 5JSRA 2PHTA 1ENRA 5HCBA 1AXYA 4Q27A 4R9DA 4YVSB 3WHUA 1UPIA 5FREA 2XJVA 1HX6A 4Q0SA 4U2AA 5I0TA 1URXA 1LTEA 1CONA 4KQ7A 1UN1A 1W6NB 3JD71 4E2GA 4LHLA 3VZNA 5EJ3A 4XBLA 1S1AA 2XVGA 4HKOA 1TE1B 4HANA 1OI6A 5L7OB 1RUF3 5HCAA 2CWSA 2ZMNA 2ZA9A 1O3QA 3AZWA 2JG9C 2R072 4AG4A 4D3WA 5C9AC 2R061 2NM1A 3B69A 3H3UA 3MIBA 4HSJA 4FPOB 4G9SB 1JTZX 4Q0UA 5A33B 5GLUA 2ZJCA 2CY6A 4S2GA 2GH8A 4QM8A 3DN7A 4YFZA 4FTSA 3D0JA 3POYA 2D3PA 3TNPB 5H9QA 1RVF3 1LESA 2EVXA 2AYHA 1ZA4A 4GMP0 3WQ0A 5E88A 3VDDA 1AJKA 4OVEA 5AVAA 3AMNA 1RINA 1QXRA 1LOBA 1M4WA 1N3PA 2ZX2A 4FSJA 5AFBA 2XLFA 3ES1A 3URFA 3WCSA 1FPN3 1S2KA 4IV3B 4Q0PA 3J4UH 2EXKA 4BIOA 4CRQA 2D6PA 4HN1A 4PLNA 4WM8B 3VBHB 5F1RA 3CEWA 4YM0A 4AEKA 1UU4A 2ATFA 3I54A 4HPKA 1OHFA 2HWD2 2XJRA 5CVRA 2GC3A 5KHKA 2R071 2W68A 4Q8KA 4LBKA 4JGZB 3FLTA 3H50A 3O0WA 1D4VB 4W6XA 2BNOA 3HR9A 2XJTA 2B5HA 4MSVA 4MLOA 3ZFGA 1X8EA 3N3HA 5BNPB 3PJQA 1ND3C 2TBVA 4AI3A 1NE6A 1LHWA 2QNKA 2QUOA 3DPRB 4H14A 5C8CB 3MYXA 2D40A 3DKWA 1RUJ3 3FC0A 2K9ZA 2IXIA 4W6WA 3AYCA 2NP0A 5FMOS 3WR0A 2LUWA 1GKBA 1NYWA 2ZHMA 2PHFA 2DTYA 2GMPA 3AKQA 4KBBA 2TUNA 1UX6A 1Q8SA 5A3LA 5I8SA 4XFCA 2ZHKA 3PMSA 4Z82A 2DU1A 1HRI2 3VBUC 1VAKA 1PK6B 2ZX1A 1RHI2 4OI2A 4PQ9A 5C4WA 2CAVA 4LBMA 3ZFEC 1RC6A 3QLQA 2HWD1 5KHHA 5JOZA 2O8OA 5KC5A 3ZN5A 1DQ2A 1UAIA 4CDQC 1XE7A 3QACA 2C0ZA 3I7DA 2AUYA 3WZ1A 4PDWB 1J3RA 1MQTC 2CWMA 5FMOL 1WBLA 2RHPA 1RUE2 4JGYC 4JDMA 1SBFA 3EBRA 2PHRA 5CA6A 4FPKA 4GWMA 5BY5A 3V0AA 4YW5A 4HSLA 1CQ9A 2ILMA 3PVOA 3M3IA 4U36A 1WD3A 2UURA 4W65A 5T5JA 2D6LX 4AEDA 1ENXA 1I9RA 1LHNA 1BEV3 1Y3TA 1Z7S2 3WOGA 4FOQA 1U5IA 2D5HA 1TME3 3MI8A 1DQ6A 2D97A 2ZACA 4YFWA 1YCIA 4QPIC 3B94A 3UKNA 4X8PA 1HV0A 4UW4A 5JOXA 1BVP1 5JAXA 1CAWB 2EXHA 2PHXA 4Q4V3 2QQPA 1HRI1 1W6OB 5JOYA 1J59A 1RHI1 5KXCA 2B45X 2C5DA 1O3TA 2BWAA 3AXEA 3JQWA 3O14A 2WLPA 2XBO3 2WNUA 3LZZA 1H2MA 2FMDA 5DUVA 2ARXA 3D5OA 1RUE1 3WQ7A 5JCTA 1ZBE2 3O0VA 1WMDA 2AH2A 2DV9A 5JI7A 1AYM2 4AVCA 3O12A 3MW4A 4RS5C 1VJ2A 4MUVA 4YW3A 1VAMA 1X7NA 3MW2A 4I0BA 4EV0A 4I2OA 4YSFA 2WT0A 3RI8A 4O9EA 5GKAC 4YVWC 3JB4C 4QPGC 1ZYBA 2XL7A 4XQWA 1Z7S1 1GFF2 5KWRA 4L92A 4RR3C 3IKWA 4ASMB 3KZ4C 3NO8A 4LUMA 1BBT3 4Q29A 2P2KA 3T1LA 4PJYA 4IEWA 3GALA 3AZZA 1A6CA 3RDIA 4A7ZA 2ZCWA 4XE9A 1TMF3 1NA1C 2V5YA 2VW2A 4M3CB 4RSUA 5H9SA 4Q4X3 4CEYA 4RGAA 1LGNA 3J8F2 5KXDA 3U4XA 1X82A 1AVBA 4M01A 2BFUS 3LOBA 2A6WA 3R4UA 4PBOA 1QHDA 1PVC3 1G9CA 2HEVF 4AI1A 5CFDB 4R52A 1KDMA 1ZBE1 1D0HA 2BUKA 2N7GA 1PO22 2Z42A 1AYM1 1HQLA 5FPXA 4IV1B 4WM7C 2YHJA 3MIHA 3KSCA 1IQAA 1D2SA 4HFSA 4OUSA 4FO9A 2UWBA 5J09A 1SEFA 1W6MB 2W39A 5IK5A 1TNFA 3O5SA 2WA3A 3DGTA 5JPMB 3ZIXA 3H9AA 4HL0A 4XQDA 2K2SA 5GZDA 2JENA 1XRUA 3TWIA 2K0GA 3CJXA 4XJZA 4JTOA 4FT8A 4BHPA 4YRDA 1O4ZA 2MPFA 4P9IA 1SCSA 1KFUL 1HXS2 3WW4A 3WDWA 1O4YA 2A3XA 2UYBA 5J98B 2W0XA 3J8F1 4ONUA 4P9YA 4EN8B 1GR3A 1QNWA 5GLVA 1GSLA 3KS7A 4LBLA 1XNKA 2DUQA 4RL7A 1NCRB 3USUB 4AQTA 1AYN2 4JQRA 4XXAA 4Y1VA 1JBCA 2NZ9A 5L73A 3WDUA 5JWPA 1KDKA 5I8TA 4MGZE 1PO21 2XKOA 1SDWA 4MXWB 1U5XA 3D82A 3VBOA 3RPQA 4KWKA 3OBRA 1ONAA 1QY4A 4XYXA 5HXVA 2H6BA 4HKWA 1OD5A 1IPKA 2DVAA 4Y1XA 1V6OA 2ZGRA 2X53S 4BIFA 1LODA 1HIXA 1YI9A 3WG1A 4HVRA 1CAVA 3OY8A 3U0ZA 1RITA 1QH7A 1W0OA 4D69A 1QJY3 1POV1 4GXLA 4Y4YA 1PHMA 4FP3A 1AL0G 1HXS1 4GQ7A 4CDWB 1C5HA 2GDFA 2XB6C 3VKMA 4FCAA 5DXDA 2VPVA 3Q9OA 5K9YA 4FPFA 1NCQA 4GH4C 4R9CA 3WV6A 2HEWF 2ET7A 1AYN1 2RMU3 2VOXA 3NJZA 1WMFA 3ZSLA 1AR62 5IK7A 1IHMA 2I74A 5FO8B 2GNBA 1C8M2 4MH0E 1U0AA 2WNVB 5GJ6A 2RS33 1C4RA 1O3SA 1LENA 2A75A 2HWC2 5JLVA 2RS53 3PMEA 2HWB2 4YGBA 1TQ5A 4I01A 4ATFA 4NHKA 4YG0A 5FLJA 5ABJC 4YVSA 2RJKA 4LBQD 2HWE2 1GZCA 4N9HA 2O8QA 1AZDA 1W6NA 3H1YA 1H8TB 4Y1UA 4Q4Y3 1ZM1A 3AP9A 4NO4A 1G9AA 2GALA 5L7OA 1FOD3 1ND2B 5GZEA 3WUDA 1UU5A 3WP5A 2RM22 1QJZA 1CPNA 5A33A 2IXHA 2P37A 2R0FA 5SV8A 1V9U2 4XHBA 1NQJA 3M2MA 3MLJA 1VBB3 2Q1ZB 1AR61 5GLWA 4XFGA 1RB8G 1OSGA 4K7JA 5T5PA 1C8M1 1H8VA 1KITA 4XW3A 1APNA 2B8MA 1S0EA 4IEPA 3N7JA 3L2YA 5DG1A 2DURA 3PJYA 1FNZA 2HWC1 2DFBA 2HWB1 2I45A 1VRH3 3MGUA 1RUC3 2OPKA 5FOBB 5F5QA 3H7JA 1ENSA 3UJQA 4XF9A 2HWE1 2A71A 4AI8A 1R1A3 5T3NA 4IV3A 5DDJ2 2R042 3ILRA 2VUJA 1YXWA 5DG2A 2WINB 4CDXB 2HKXA 2VNOA 2YGMA 4KGGA 4WM8A 2QVSB 4I3GA 2RE9A 4YLZA 1IOAA 2ERFA 1ZREA 4LLOA 4HBNA 1QJU3 1VBE3 3RNSA 3APBA 4GWNA 1HQNA 4DB5A 2RM21 2DF7A 4YM2A 2A3WA 2PAKA 3B02A 4D7TA 4JGZA 4LEJA 4DPNA 2JG8B 2WS93 1DQ1A 1VBD3 4LHKA 1V6NA 4ZU5A 1ULFA 2ZZQA 4F7ZA 1RUG3 2OZJA 4P9GA 3S0MA 4FQZA 1ZZBA 1S0CA 2DVGA 4UW5A 5JIAA 4AHYA 5BNPA 3VDDC 3DPRA 1AR72 1A8DA 1DGWA 3C2UA 5C8CA 1H30A 1X36A 4FBFA 5D1IA 3ST7A 5CB7A 1RUD2 1D4M2 3GBGA 1ENQA 1O4TA 2ZX3A 4JVAA 1KS5A 2OA2A 4J6GA 5C9AB 2R041 1QDOA 1Q8OA 5FLHA 5J48A 1RUI3 3B5LB 1PK6A 3QD6A 1W6PB 3FE5A 2ZKLA 1N3OA 2VQAA 4MXVA 1WCDJ 5KXBA 3EQEA 5CIRA 3TN92 4PDWA 4MGKE 2JE7A 1GLHA 2DVFA 3WUCA 4RHV2 2R32A 4FVVA 3VZOA 3P3NA 3VZMA 1XU2A 1A8MA 2GMEA 5DUXA 4BCUA 4DQAA 5K0UC 1SLLA 4OZXA 3E5UA 3POWA 1AR71 4AVVA 3KCXA 4DS0A 3ZYGA 1XYOA 3B7MA 2WQZC 1OFNA 2XJQA 1RUD1 1VALA 3I59B 4GB32 3KT7A 1D4M1 3SH3A 4I0WB 3KCCA 3FZ3A 4Z8BA 3ME2A 4B4RA 1WLWA 1VBA2 4CEWC 3PNAA 2YDEA 4DZGA 4FPCA 1EAH3 1QXJA 1CAWA 1HRV2 5A3MA 2PFWA 2ZGSA 5FLIA 2JKBA 4D7SA 1CGPA 1W6OA 5C4WC 4DINB 3CJIB 3SHRA 1GNHA 2Z2SB 2PN5A 4IEXA 4XTPA 3VBFC 1V6MA 3JBG3 3ZXKA 4N53B 1CAXB 2FZ1A 3VKFC 4YG3A 5T52A 1MS1A 2IFWA 2OYZA 1A78A 2B42B 4Q1RA 1XNDA 1N1VA 2XJSA 1GQHA 4RHV1 1WLDA 2IC1A 2SLIA 4DY3A 4AF9A 4HLTA 2A6XA 1YIFA 2WT2A 3MPPG 3LWCA 4RQPB 2F4PA 2NMNA 1AUYA 2NYYA 5GZFA 2W52A 1H2LA 2PHLA 4AEDC 4JCKA 1SBDA 2XVKA 1EV12 3IIAA 4IQPA 1DYKA 4GALA 2GC1A 3RJRA 2CGPA 4GB31 4P9WA 3G7DA 2VOVA 1H2KA 4BZ4A 1VBA1 2OW4A 1U5ZA 1H1MA 4CDQB 2G9GA 2XL9A 1HRV1 5F6LB 4GMP3 4X6QB 4JGYB 4PLMA 1F5JA 2UWAA 4M3CA 3D0SA 1I6XA 2MHFA 3MF6A 2FBEA 1QKQA 5JOWA 1XNBA 1ZBA3 2WNUC 3DF0A 1WBFA 4P9XA 2WT1A 3N7KA 4I02A 1S55A 1YFYA 4ZXKA 1X8MA 5CFDA 1DLLA 2GZWA 4ZKTB 1RUH2 3WP4A 2EA7A 3MPBA 4Y20B 1S0BA 4IV1A 1R092 5I91A 5KHIA 3MDPA 4A2UA 5IK4A 4ISQA 4CP1A 2DYCA 3O0XA 4YARA 4HZFA 5BV6A 2ZS6B 3V64A 1W6MA 2A70A 3JU9A 1YO8A 4E2QA 1QQP3 2ZKNA 3ZN6B 4J1XA 1EV11 1MZ5A 4CTEA 1EP0A 3UK9A 4COVA 1H1AA 1PMIA 5AFEA 4GULA 4L8QA 2YC0A 2VVEA 4LHNA 4R9BA 4BA6A 3RYRA 3VZLA 3MIEA 4PBPA 1QJX2 4KU7A 3GBWA 4FOYA 4AFDA 1LGBA 3R6SA 2BTVC 1ASJ3 4Y5Z0 4YZ3A 3FUOA 4FTEA 2XJPA 2HWF3 4Q2FA 1C1FA 1RUOA 2MEV3 1PIV2 2PHWA 3VHNA 1DU3D 1NCRA 3USUA 4XF0A 1MEC3 5DZEA 3N7MA 3C3VA 4AEJA 1YFUA 1RUH1 4YVWB 1XU1A 4QPGB 1I5ZA 3WT3A 2NLRA 1R1ZA 4MXWA 1R091 4AHXA 4DOUA 2BQPA 3AP4A 2D6OX 4J1WA 1JN2P 3HBZA 4X8NA 2EIGA 3ZSEA 3R4SA 4LUKA 3IMNA 1CPMA 2WWSA 4MZUA 1NXD1 1XXNA 4JDNA 5HCFA 1COV3 4EROA 1YJKA 1AR82 2R6QA 1QU0A 1NA1B 3ASIA 4ZU7A 4NHLA 5LRSA 3HQXA 4C91A 3U10A 1JHNA 1GZWB 1UD1A 5FPZA 4N7UA 3VZJA 1QJX1 5I93A 4YGDA 1QF3A 1UKRA 3NSTA 4CDWA 4FPHA 2PAMA 5BNQA 4AFBA 4LNVA 3R0RA 3DUIA 3NKGA 1W0PA 2DFCA 3ILNA 1B35C 2NMOA 2F6BA 1UIJA 2ZBJA 3B01A 2A7AA 1PIV1 2OUHA 4M0NA 2BEOA 5J36A 5BNOB 2E53A 3IDBB 3ZXDA 2GC2A 1DBNA 4NWWA 4GKXA 2W08A 2I2SA 3VBOC 1JUIA 2WNVA 4AVSA 1PGW2 2B39A 2VW1A 3KCYA 1WCSA 3AXDA 5FDBA 3LGRA 2D44A 1Z0HA 3LAGA 3WNXA 2JE9A 4PIZA 3P3PA 1GQGA 2R30A 4YGEA 4PCRA 1AR81 3ROUA 2PAEA 5I8YA 1WCKA 2A5ZA 1UU6A 4LR4A 5BNNB 1D2QA 1V6JA 1H8TA 3AK0A 3MIGA 1F9KA 1NE4A 3MICA 3ZX7A 5LEJA 3B3QE 3VBRB 3WLUA 5JPNB 1HW5A 3ZYIB 3HIFA 3KB5A 3FBMA 2GSYA 1QWRA 2WZR3 2XWBB 1ND2A 3ENRA 1AXKA 1OFSA 3B9CA 4INDA 1NCQC 1GBGA 3UKTA 1RJ7A 4I3PA 3ZN4A 3FLPA 1FYUA 1K5MB 4K20A 2YY1A 1GNZA 3GZUC 4XIOA 3W59A 3IN9A 2Q4SA 3LSEA 1ZZ6A 1PO12 2QDRA 3ALQA 5T54A 4NR1A 1LOFA 1H2NA 2ZZJA 1PGW1 3KGZA 3TAYA 3VKNA 1LU1A 3ZMOA 1G86A 1NLSA 4CYDA 4DXZA 1XYNA 2BGCA 2DVDA 3THPA 3ZFFB 1SFYA 5LK5A 3ZXGA 4N9IA 2FMYA 5CBLA 1Q5OA 2VVFA 3WDVA 1LGCA 1C57A 3VL8A 5LK7B 1HQWA 4DMIA 3VBSC 4KH9A 1H1IA 5AC93 5CFCC 3NWKA 4TZDA 4XJAA 3M8LA 1POV0 4CDXA 4P9JA 1RUF2 1ZZCA 1PM7A 4FPGA 4AFCA 2XJUA 2PHUA 2WQ4A 4AGVA 2CV6A 1NY72 3NVCA 2QKDA 2B9UA 3N36A 1AHSA 5ACA1 1CESA 2LM3A 4S2FA 3NV1A 2JG8A 4IEOA 1RVF2 2UYAA 3NW4A 3SH5A 3LA7A 1F5FA 4QMAA 1PO11 1YHFA 3WP6A 3AP7A 4NPRA 2E7TA 4DRRA 5J96B 3AFKA 4B29A 4QM9A 3V65A 4C1XA 5J7MA 2PLV3 3VZKA 3RS6A 3QOPA 4UBGA 1OKQA 1FPN2 4E4ZA 1REDA 1SLIA 5JZGC 1RMU3 4IL7A 1O5LA 4Z92B 1FXZA 1HV1A 3UL2A 4K1YA 1OQDA 5FOJB 4BE3A 5C9AA 5JDBA 2QZ2A 5J3UA 1RUF1 3VBHC 4CDUC 1N1SA 4KNCA 1PNFA 2D43A 1W6PA 3TYJA 4JC1A 1Q8PA 2GAUA 2Z79A 1NY71 1V9U3 4E27A 1VBC3 4AHWA 1CN1A 4LE3A 4XILA 5F9TA 5EXOA 3WHTA 2YYOA 3RG0A 2E6VA 4OFGA 1BQPA 4WBBA 1RVF1 1EPZA 2BFUL 3QH6A 3WP3A 1LCLA 3TB0A 1OQ1A 3AJYA 1TNRA 2ZX0A 4ES9A 1GV9A 1MS8A 2VY0A 3AKPA 1YJLA 2BVBA 4FPJA 4C0BA 1BK1A 3JCIA 1OPOA 3I4IA 5GZGA 5I0UA 1RUNA 2D5FA 1RUJ2 3DPRC 2I07B 2UU8A 4BWOA 1S0GA 4XJ9A 3MW3A 5CNAA 3WY6A 1G9DA 5C33A 3WG4A 3M70A 1V6IA 2GNDA 3ZXLA 2CYFA 3I59A 3S6PA 1FPN1 5DDJ3 1Q8QA 3L9JT 1RIRA 1MS0A 3MLKA 4OHWA 4WVWA 2VUAA 3D4KA 4FPLA 1QH6A 3SNMA 4XETA 1SQ4A 3AP6A 1PK6C 2IZWA 4Q4W3 1R083 3CJIA 1W2UA 3PVEA 1YFWA 4N53A 1CAXA 1LEMA 4YZ2A 4PDWC 1BXHA 1PZ8A 4I0AA 5DZFA 4QQOA 2A73B 2P34A 2OZ6A 4OI1A 1YUDA 2UWCA 4BYYA 3GZTB 1Q43A 1WD4A 4XBQA 3NAPC 4YW2A 3ZSKA 3HWJA 3B9IA 2RS13 1O91A 5FFOC 1S0DA 3IM0A 4RQPA 1PGSA 2E7AA 1RTVA 3VKLA 1RUJ1 2JXAA 1BEV2 4OULA 4AGGA 4COUA 3L2HA 1FMD3 1TME2 1WLTA 3BPZA 3S30A 3BIWE 4K3UA 4P14A 4DNYA 4FPEA 4LBOA 3LB9A 1X50A 4BMEA 3AM2A 4Q4V2 5LEKA 4CDQA 1SMVA 4AVTA 3QCWA 3UV9A 4COYA 4AI0A 2WFF3 1LR5A 2X5IB 4QQLA 3TN93 1WGPA 2XBO2 2Q5TA 4JGYA 4K21A 3OCPA 3MLLA 1OOPC 5D8AB 1ZRDA 4TYSA 2JEMA 3MF9A 4I30A 4IESA 2D7FA 4EN7B 4QU2A 5K0UB 1AL23 2Q8OA 1GANA 5GM0A 3U07A 2D6KA 4RFT0 1DGRA 2YROA 4DY5A 1REFA 2LTNA 3E6DA 4Y20A 2VECA 4XJUA 4EN6B 3WDXA 1JYCA 3ACLA 3OD0A 1AR93 3AZXA 2KXLA 1BEV1 1C5IA 3FX3A 4CEWB 1SBEA 3OF1A 1TME1 2JJ6A 2R16A 4XBNA 4EN9B 3ZN6A 1BBT2 3T2TA 4R4XA 5FCCA 2ET1A 1KFXL 4BLIA 3USSA 2CNAA 1ZRRA 3MEPA 3NV3A 4MGIE 2WKKA 3M3EA 3RI9A 3ZIWA 3VBFB 4Q4V1 1NLRA 2FZ2A 1TMF2 4EN0A 1LRHA 4Q4X2 3VN4A 4LA2A 4C1WA 1DQ0A 2GH2A 3LA3A 3R05A 3M3CA 4IEZA 2XBO1 4F8AA 2YMZA 3J9SA 3W9AA 2RR13 4FP2A 4KU8A 1PVC2 2DCYA 3THTA 1GYKA 4BQ1A 3DV8A 3M7AA 4F83A 5FQ0B 1REEA 5CFDC 1VAVA 4NOTA 3JD73 1JH5A 3FFZA 4XQ4A 4HK8A 4QPGA 4YVWA 3V0BB 1BYHA 1IS5A 3ATGA 5KC6A 4N43B 2ZX4A 2XH6A 1VB4A 3OJBA 3TRSB 4FOWA 4BH9A 3VUOA 4L11A 5T50A 4WZFA 1BBT1 2R063 1ZRFA 4R9AA 1LOCA 5HBAA 4QQ2A 1NA1A 2ZGKA 4AE2A 5IUQA 5CG8A 2DUPA 1GZWA 1RJ8A 1CAUB 1TMF1 4G3YC 3ZSMA 4Q4X1 4URTA 3SCGA 1WW6A 2ES3A 5CU1A 2A3YA 2WZPP 1FI2A 5E8AA 3AJZA 3AKSA 1PVC1 3CU7A 4LBQB 4I09A 1JYIA 4LO4B 2C9AA 3SH4A 2CL2A 5F6KA 4A7YA 3WDTA 2SBAA 1LKNA 1UZZA 2DCTA 3BOWA 2GNMA 2QE3A 1DZRA 2VULA 4FQ4A 2E7QA 3ZXJA 4AGRA 3WQ1A 2OVUA 2D93A 5DUWA 5BNOA 1ULEA 4NN0A 1Q8VA 1N1YA 2JG9B 5E1RA