5TSWA

High resolution crystal structure of a human tnf-alpha mutant
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
149
structure length
149
Chain Sequence
SDKPVAHVVANPQAEGQLQWSNRRANALLANGVELRDNQLVVPIEGLFLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High resolution crystal structure of a human tumor necrosis factor-alpha mutant with low systemic toxicity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lymphokine
molecule keywords PROTEIN (TUMOR NECROSIS FACTOR-ALPHA)
total genus 23
structure length 149
sequence length 149
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 1999-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5tswA00
3FC0A 4NN0A 4F3JA 2QDNA 4J6GA 4KGQA 4OULA 4QQLA 2ZPXA 1D4VB 4EN0A 2JG9A 1TNRA 3QD6A 1U5ZA 1U5YA 1S55A 5L19A 2Z5WA 3B94A 2Q1MA 1PK6B 4QQPA 4D7YA 1OQDA 1A8MA 3L9JT 2RJKA 1DU3D 2RJLA 1IQAA 1KD7A 4TSVA 1I9RA 2JG8B 1D0GA 4DOUA 4KGGA 3ALQA 2WNVC 3TWIA 2WNVB 1JTZX 1PK6A 3AB0A 1PK6C 2TUNA 3TYJA 3ME2A 3URFA 4GIQA 2KA3A 2JG8C 2R32A 2AZ5A 2R6QA 4MXWB 5L36A 3MI8A 4OUMA 4QQ2A 2R30A 1TNFA 1KXGA 3K48A 1XU1A 3K51A 4TWTA 4OUSA 3B9IA 3V56A 4E4SA 4G3YC 2HEVF 4QQHA 3WD5A 3LKJA 3IT8A 1DG6A 2TNFA 4MXVA 4RSUA 3B93A 2ZJCA 1GR3A 2HEWF 5KC6A 1OSGA 1C28A 2HEYF 4G4FA 4QPYA 2O0OA 4HT1T 1C3HA 5KC5A 4QQOA 1D2QA 2JG9B 1RJ8A 2JG9C 1O91A 5BNQA 4MXWA 1WCKA 2Q8OA 1RJ7A 4DB5A 5HBAA 1JH5A 1ALYA 2QE3A 5KWRA 2WNUA 2OIIA 2JG8A 5CIRA 2X29A 2E7AA 5TSWA 2WNVA 3QBQA 4N90A 2RE9A 4MSVA 1XU2A 2WNUB 1OQEA 2WNUC 4KG8A 1U5XA 4E4DX
chains in the Genus database with same CATH superfamily
2PELA 1OBNA 2YFUA 4XDOA 1QOSA 4RS5A 4QB1A 2XVKA 5CKQA 1ZBE1 1C5IA 2GNBA 2XOMA 2ZPXA 3VUOA 2VZPA 4RR3A 2Y8KA 1NOVA 4ONUA 4QGNA 4ZY9A 1ONAA 2VQTA 3NVCA 2GMMA 3EJKA 1RINA 2W1QA 2GC3A 4Y5Z0 4RFRB 4CDXB 2P3IA 5D21A 4OHWA 1W0PA 1UPSA 5C8WA 4MUVA 3E5QA 5FYHA 1NY72 1VIWB 3KVBA 1DYPA 5E88A 2W91A 5JXGA 4FP3A 2WA3A 1K5MC 1R083 2BFUS 2GALA 3I3BA 5DUUA 5FBZA 2XUEA 1NT0A 4LKEA 4H3WA 1ASJ1 3OGRA 4FXGB 3I3MA 3TYJA 4XAEA 3J8F2 3NV1A 2VY0A 4C1XA 1L3JA 1E5SA 3AP5A 3IIIA 1PM4A 2C24A 4JGZA 4NHYA 2EF6A 3ZXDA 1MEC2 4LIVA 1W6PB 3SITA 4BK5A 2AZ5A 1KDKA 4NAMA 5E16A 2BFUL 1WLDA 1RB8G 2VZRA 4QU2A 2QCSB 4XJZA 3ZYFA 2B39A 2JIJA 1F8VA 1O3TA 4HSLA 2XBO3 4QHOA 1MR5A 5DDJ3 3BGAA 1LHWA 4Q4W2 4XFHA 2JDHA 4CDWC 4GB33 2CGOA 4CUBA 3P6BA 4LORA 4WVMA 3N3HA 2VTXA 1KS4A 4JZRA 4E2GA 1KQRA 3M7AA 1VBB1 4MHUA 2JE7A 2RS53 3H1MA 3KD4A 2GH2A 2RMU2 3MIGA 3H7JA 4YGEA 2ZAAA 3O0WA 3B93A 2ZJCA 2HEWF 3M3EA 4M3CB 1MS4A 3HJRA 2HEYF 3MV01 1D4M1 4IXLA 3FL7A 3H1YA 3WF0A 1G9DA 3CIHA 1DHKB 1H4GA 1AYN1 5LK7B 4AG4A 4UI9L 3K75B 3UKVA 2Z2SB 2RR13 2VM9A 4ZONA 1BXHA 2GU9A 3Q8FA 2TEPA 2WQZC 5A7WA 1VBD2 4XBQA 2MPFA 1OXCA 1XYOA 4AVSA 1PM7A 3ZSEA 4OI4A 4FPFA 4CDXC 5I91A 1WA4A 2LW8A 1COV1 4XQ4A 1RUOA 1GP5A 5LRSA 4HVRA 4Q1PA 3FLTA 2ZMNA 2LRPA 2YC2A 4AGRA 1LGBA 1LOFC 1UU4A 3W5MA 4Q0PA 3MFCA 4ASKA 5GLUA 3UK9A 1REFA 2E7AA 3VBFB 5C9AC 1YNAA 1QJZA 2CAVA 2LM3A 4A3XA 1OKQA 4N90A 4KL1A 1HB1A 1T6BX 5AC91 2H0BA 4IEZA 3ZXLA 5FY0A 4UYBA 1U5XA 2Y33A 4DUWA 3AL5A 2FZ1A 2Q1FA 1HRI1 2P5BA 3HIFA 2VZVA 5H9PA 5FP3A 4XUTA 4YARA 1U5ZA 1WD3A 1RMU2 2AACA 1JU4A 1S0FA 1CPMA 2EICA 3FHIB 3JBG1 3C2UA 3KHBA 3POJA 5DAVA 2HWE1 5EXOA 1GZCA 4I09A 4U2AA 1L7LA 3B9CA 4EV0A 2ZHNA 3ZR5A 4ATEA 4Z2WA 3LDBA 2PLV1 2ERFA 1FX5A 1EV11 1I9RA 5K8SA 1UOFA 3ECQA 3CF6E 2YUEA 1MQTC 2AH2A 3ZKYA 1W6PA 4Q27A 5C3QA 5FR3A 1PGL1 4FQZA 5FO7B 5HCFA 1UYPA 1NE4A 4S2GA 3WNXA 1W8OA 4UW6A 5FLHA 3RJRA 3SC7X 5IFTA 5JR2A 1AL21 4XXAA 1AJOA 4U36A 4Y1XA 1AR91 2YG0A 1UIKA 2WZEA 1H2NA 2QDRA 5C3PA 3CJIA 3W58A 4LO8A 4O7XA 3D0SA 5L7OC 1H8TB 1A6CA 1VR3A 4RS5B 1OH4A 2PN5A 3RI8A 1UAIA 4YW5A 1DZRA 3P3NA 4Y26A 3OBZA 2GN3A 3T1MA 3FBMA 1FYUA 2ZMKA 1G6NA 2BWCA 4NIAA 1AR92 4W50A 1TNFA 5IVJA 4OHZA 3WQ1A 5K0UB 5JPMB 4DNYA 4XIOA 1VE0A 1W9TA 4YYOA 2WWSA 2QZ2A 4D0QA 2FQPA 3FHQA 1ULEA 2ZGLA 1QH6A 4K20A 4OHVA 1YXWA 3AKPA 1IS4A 1ZZ8A 2ZX3A 2GMEA 1W28A 1CN1A 1TVGA 2C5DA 3LA7A 3N9LA 3O12A 2YB7A 1AYM3 4A44A 1W8ZA 1SLTA 4HSJA 2RDRA 2W0XA 3ACHA 3KGZA 4YPJA 1LTEA 2JDUA 3LOIA 3QH6A 5DDJ2 5HXMA 2XB6C 2XPJA 1ULPA 5ANQA 4QQOA 3THTA 4MHRA 4YW2A 4QPGA 3S7EA 1D2QA 3WNOA 4CDWA 4A6SA 1MQTA 1UU6A 3ON7A 3TOJA 1BMV1 1AUYA 2SLIA 3LAGA 2LTNA 1DGWA 2D5FA 2VAUA 2Q30A 4CCNA 3TB0A 3B00A 4IW3A 1QJU2 1VMHA 1DGRA 1LR5A 1GZ9A 1KJLA 2GZWA 2ZEWA 5HCHA 1KGYA 2JG8A 3M3CA 4JGZC 1XBFA 3AP6A 3OCPA 2A1XA 2OZJA 2ZGTA 4RHV3 3O1OA 2TBVA 3PVNA 1UMIA 1YJKA 4N43C 2ZGSA 1JOPA 1QJFA 3AZZA 4Q8LA 4XYXA 5FLJA 3SH4A 1V6IA 3ZFGA 3NMBA 3I59A 1CWPA 4QB6A 2DVBA 1OT5A 3PURA 3DYOA 2P3KA 2VULA 2WNUC 1MS8A 3WDXA 3PUHA 4M00A 4UOJA 3FZ3A 1NZIA 4LPLA 1AR73 4XFFA 4Y24A 4CDUA 4QWNA 1W0OA 2WAAA 4LULA 1WLWA 2KR2A 2NMNA 2XKOA 4F3JA 2ZAHA 4J6GA 5FZIA 1CONA 1H8TC 4FAGA 2UWAA 4E8CA 1HQLA 2GC1A 4KH9A 1HJFA 2HWF3 3KLSA 3R4SA 4QPGB 2Y6JA 2JDZA 2UY9A 4XHXA 3RYPA 1DQ5A 4P00B 4QM8A 4IGPA 2BU9A 1X9PA 3VLBB 4ES8A 3ZN6B 4XF1A 1D0HA 1PGSA 4P9XA 4PF1A 5ABJC 5FZGA 4HFSA 4AAXA 3S5AA 5A33A 3SH5A 2GAUA 1AYN3 1HKDA 1R1ZA 2A6YA 2AEZA 2K9ZA 3I4IA 3HNYM 1MS0A 4J25A 1IQAA 5F5AA 1W8WA 5F39A 2O14A 1G8WA 1RHI2 1WMFA 3SH3A 3PLQA 2ZA9A 3ASIA 5GZEA 3GHMA 5LEKA 1UYXA 1LESA 1COV3 5EPAA 5L9VA 4D7SA 3ZFFC 4C91A 3SLIA 1RUH2 1SLCA 1WGPA 1GU3A 4OUEA 4BLJA 1S0IA 2PTMA 1VBA1 4BDVB 4C8DA 4XJAA 1G86A 5AC93 5LY1A 1R081 5BUVA 3H3LA 4IV3B 1HRV2 5CAZA 1EUTA 2VR4A 1H8VA 1XNCA 4YM1A 4BQ1A 3KHCA 1CAVB 1VBE2 3GNEA 2XLGA 3WNKA 4F8AA 2QQKA 4LJHA 4FOQA 4NJ4A 1HB2A 4IV1C 1RL3A 4GJYA 1KXGA 1V70A 3IIAA 4ZXKA 3AP9A 4TWTA 2E7TA 3I8TA 4L99A 4GULA 5KHGA 2PXJA 4QMAA 3BCWA 4AI1A 2D6MA 1DCSA 3TN91 2B9UA 4HKWA 4JKKA 4N8MA 1K12A 1K5MB 3WD5A 2CY6A 1ZZCA 2ET7A 2VBDA 3HPNA 2XDVA 3THPA 5JXIA 1DZQA 3VZOA 4AFDA 4KWLA 2VD7A 4DFSA 3M1HA 2BGPA 3POGA 3PIJA 4FFIA 4G4FA 2DTWA 4P08A 4XE9A 1X50A 1P8JA 3IM0A 5FZ9A 1SACA 4TLFA 1PMHX 1SLAA 3VBHC 1Y9GA 1LJ7A 2LALA 5ERLA 4RQPA 2JWPA 2YYOA 2R0HA 3H0OA 3AP4A 2OZ6A 4LBOA 4GAZA 4AVVA 3O1MA 5SV5A 3T2TA 1V6OA 3MFAA 1QH7A 1ZRIA 5A6YA 3N7LA 5F1RA 1IKPA 3ZKUA 1GWKA 1ZM1A 1STMA 1WA6X 4DB5A 5BNPA 2QZ3A 1CAUA 4P02B 1OVPA 2W87A 3FBYA 1QJX2 1SLLA 4IETA 4IE5A 3RVHA 3WF4A 1QQP1 3NKTA 4LNVA 1Y9MA 1QQP3 3KCXA 5FOBB 2DUQA 4YVSC 2VTXJ 5FTTC 4AHXA 2RR11 1OLME 1JYNA 4CP9B 1ULFA 1IS3A 1XXNA 3DECA 3OD4A 3ZR6A 2UWCA 4JV4A 3ROUA 2W95A 4AI2A 2EAAA 3JB8A 2DVFA 2A5ZA 1PO23 2VQ0A 2VUJA 2ZMLA 4H2AA 1CQ9A 3B69A 4Q29A 5BPXA 4W65A 3J7NA 1W8UA 4NAOA 2OPKA 3POIA 4Y5SA 4Y22A 1OLRA 1A34A 2YY1A 2WL1A 1V6NA 1X33A 2RJ2A 3BB6A 3JZVA 4GB31 3CO2A 1UD1A 1POV3 3VL9A 3KZ4C 5FP8A 2RM21 4META 4CE8A 4S2DA 2WA4A 2WC2A 2RM23 4XIKA 5I0SA 1TME1 5A70A 3P5BA 3HAGA 3VKOA 2RS51 5ACA1 1W9WA 1ST8A 4IUGA 1CPNA 1ND2B 5DABA 4RD7A 3WVJA 1OFSA 1ZX5A 4R4ZA 1NCRA 1TG7A 2KD7A 4YVWC 1LU2A 1LOGA 1UQXA 4IEUA 4KWUA 2ZGRA 4XUPA 5A6ZA 1XNKA 3NW4A 4TSVA 1KD7A 5F2SA 3VZLA 5F5QA 2JG8B 3DXUA 1X82A 3K4DA 3PJYA 4A6OA 1LENA 1I1EA 2D3RA 3R4DB 1TMF1 2HH9A 2Y6KA 1H9WA 3VBHB 3FLRA 2JKBA 4MX3A 5FZDA 5A7NA 3WUCA 4D69A 4MG2A 4XUQA 3D5OA 1GOHA 1HRI2 2ZX2A 3H9AA 3MUY1 4BISA 1REEA 4E2SA 4PI0A 1EY2A 3OF1A 4RGAA 3AYAA 4QPWA 1B35B 5FDBA 1YC61 4BQWA 1EV13 3P3PA 2Y0OA 2VVDA 3BOPA 4XVHA 1H1AA 3HD8B 1DLCA 3JD72 1S0EA 4CP0A 1W3XA 4N7IA 1J3PA 4R9DA 1G9CA 3O5SA 1POV0 1BVP1 2PLV2 1W6MB 3BVCA 5GZDA 5JOZA 1AF9A 4MADA 2WZR1 1DFQA 1IOAA 1DZTA 2ADEA 2Z69A 4K1ZA 4IV3C 5A3NA 4AFCA 1S0BA 3C7HA 2HWB3 1PGL2 3A22A 3I54A 1QJU3 2HEVF 5KHIA 1J1TA 3WSOA 3KT1A 4Z92B 4MGTA 2VCCA 3J26N 5F3CA 3T0DA 2DU1A 4WM8C 1KDMA 1ZZ9A 3WF1A 1PIV2 1N1YA 1WMDA 1XRUA 2Y60A 1HXS3 1ZNPA 3LD8A 5KC6A 5C8CA 4I3GA 1O6UA 2ZOEB 1DQ2A 2P4EA 4YZ1A 4D8MA 3GJBA 4GWNA 3U11A 4BH9A 4DUVA 2WFF3 2Z4FA 1Y3TA 2PHWA 4FFGA 1H1IA 2WFF1 3VBSA 4ES9A 1FMD2 4HN1A 4IE0A 2Q8DA 3AFGA 2WO7A 1J83A 5KHJA 3LA2A 3N7JA 5T5LA 1PVC2 1SPPB 4XFAA 5FY5A 5LEJA 5FPAA 1BBT1 4Q4X1 2A6XA 4P5HA 5K9YA 2ZXQA 3OGJA 1RUD1 2D6LX 1ND3A 1URXA 1S2EA 4GJZA 5D1IA 1OMIA 3L2YA 5IJRA 3WDUA 4C1WA 5C8CC 4N43A 1K5MA 1MACA 2W39A 5IK5A 2JDKA 5B4XA 4AGGA 3INAA 4ASLA 4QKFA 3LFMA 4UAPA 2DYCA 1W2TA 4E4DX 5FO9B 5CNAA 5BNPC 1O3RA 2JICA 2UYBA 1Q8OA 1NUKA 3MHZA 3W9AA 5JOWA 2ID4A 1X36A 3RGBA 1UW8A 5FOJB 1JZ3A 3AVRA 3KMHA 5JAXA 5K0UC 2KM2A 3VBRB 4C0HA 4BQXA 3ZVXA 4BQ2A 5A3TA 5F3EA 5EQUA 3ZYBA 3KT7A 4IE7A 4FI9A 4JCKA 4BM8A 2DDUA 2BVVA 2AGSA 1SCSA 2JD9A 2W9XA 4QQPA 4A7KA 2Y0IA 4BHPA 3VD9A 3WCSA 4HN0A 3D8CA 4IQPA 1XYNA 4XQDA 2X09A 3PL0A 3NJYA 3RZJA 2W5FA 4CA9A 3POWA 3PVEA 1W9YA 5FQ0A 1PMIA 3D6EA 2W52A 4N7UA 3AKSA 1WW5A 4I0WB 4JDOA 4NMIA 3VZNA 2W46A 3MW4A 1UY3A 2G4IA 4FTBA 2XG3A 5JZGB 1C8M2 3JUUA 2WNVB 1PK6A 1R64A 4P9LA 3ZFGB 5J96B 2ARBA 1JYXA 1OPOA 2HWC3 2R071 2VNGA 4QXBA 4UFIA 1OOPA 1CZSA 1S2KA 2WNEA 1BVVA 5DQ0A 1LOEA 4YFWA 4AXOA 2HWC1 2R073 4LBMA 4UFHA 1GNHA 2ZBJA 1QMJA 4XC9A 5F9TA 2VUAA 5F5CA 4LUKA 4XFCA 4Q4V1 2HLEA 4C90A 2Q4SA 1ZRDA 5GJ6A 5FY4A 3I97A 1SG3A 4WZCA 4Z07A 4V2VA 4CEYC 5ABJB 1CIYA 4JKLA 4O9EA 4DS0A 4CVUA 4Q8KA 4E8DA 2HJIA 3PNAA 4J1WA 4EE2A 4AFBA 1XJAA 1ULGA 1XU1A 5DDJ1 5EYXA 5GLVA 3NJZA 3ZFFB 3CJXA 3B9IA 3CQOA 4W6XA 2P2KA 3V56A 3HNBM 4XETA 4AVBA 4QHZA 1V6MA 1WW7A 2IXKA 3RRDA 3POSA 1Y9QA 3M3OA 1O4ZA 3H7YA 2WT1A 5DZEA 5CFCB 1C5HA 3OUIA 3UKNA 5J09A 1RUNA 1SBEA 3HT1A 4I02A 3VBUB 3UV9A 1PHMA 1MZ5A 4OI2A 3B02A 2RHPA 4QKNA 4AQ2A 5IVYA 5IW0A 4DRRA 1U12A 4WV8A 2FDHA 4Q5OA 4KQ7A 3IBMA 3MF9A 4BJ0A 5E1RA 5FYCA 1XC6A 1YYNA 1C8NA 1EPZA 3LPFA 4GWIA 1PNFA 4P9JA 4PIYA 2ET1A 5C33A 4AOCA 5SV8A 4JTOA 2XQRA 4Q1RA 5DXDA 3T2QA 3E6CC 4AEDB 3LDKA 4NR1A 1ZZ6A 4OCTA 3I3QA 4CDUC 2WT2A 1NZCA 4YZ3A 1O4TA 2L9LA 1QJY2 1FAYA 2HWD1 4Z8BA 1QHDA 2XLAA 1YFUA 2Q1ZB 3GALA 5FXVA 4KU7A 1NA1C 2BWAA 4X6RB 3SISA 4QX3A 3NJVA 2OW4A 1DYKA 2XBO2 4EYUA 3WQ7A 2OUJA 4EN6B 4BMBA 4IV1B 4MSVA 4GMP3 1CAWA 1LODA 3ZIWA 1GQHA 3AMPA 3O1UA 1FOD2 3NNJA 3R0RA 5ANNA 5LA9A 3UGHA 4L11A 3M3QA 1UNBA 2N7GA 1FT9A 4IEYA 5FXZA 1Z0HA 2VGDA 3DV8A 3KF3A 1D4VB 2PHDA 4LKFA 2VZ3A 2VQUA 3DPRC 4QX7A 4XXPA 4XTPA 1BZWA 3ENRA 1JYVA 2R042 1XNDA 2YXSA 1Q56A 3FHAA 1HIXA 3I7DA 4PCRA 3WINE 3ACLA 3QH7A 1XNAA 4FFFA 4UW4A 5FIXA 5IVCA 5FK7A 3PDQA 4BQ3A 2I07B 3POFA 1ODMA 1UXZA 4D7YA 1GANA 4K8FA 2VG9A 3T1LA 2E63A 2XONA 3I49A 3ZFEC 4QX5A 2VOXA 1LB2A 5LCWL 1DQ4A 1PNGA 2QVSB 4MGZE 3VD4A 3NO8A 5D8AB 4HKOA 3RYKA 3EXUA 5KXEA 3IDCB 4NHXA 4UWDA 3TEXA 1Y7BA 1BBT3 4XF4A 5A7SA 4WM7B 3MF6A 4NIHA 5DAPA 2WYFA 4GD4A 3I2IA 3GM8A 1ZBE2 4PF5A 1JZ5A 1UCXA 4XMIA 4WM8A 5A7WB 5CKNA 2R6QA 4QPIA 5AVPA 1IS6A 1RYYA 1SLIA 2D7FA 2XHKA 1NLSA 5J3UA 3O1SA 3QOPA 4YRDA 1SQ4A 1UX7A 1M06G 4MO3M 5FPVA 2RDNA 4CPBA 5BV6A 2R30A 4V1PA 2DBNA 4BPZA 1BQPA 5K7PA 4TZDA 1O8PA 2BV4A 3TEZA 2XWBB 5FXWA 1BLZA 1E57A 2WZ8A 2ZGNA 3J7HA 2NLRA 1QNWA 1LGNA 3S5QA 5KHHA 5C70A 4NOTA 5F32A 4XJUA 1SBFA 4XF9A 1DDLA 2Q8EA 1JZ8A 3ZSJA 3VDCA 4YW3A 4Y4YA 3WP6A 4Q4Y2 3N9OA 1OSGA 4L9BA 1OC1A 2VMDA 3AMQA 4XF0A 4YVWA 5LBBA 2JDMA 3OYWA 1SDWA 3VKFC 3ACIA 3ZSLA 2W1WA 3JD71 3ZPOA 1KFUL 1XSRA 5FZBA 3KGLA 3KSCA 2JDPA 2GC2A 1W2OA 1XE7A 1VBD3 1YQ2A 3ZFEA 1W6NB 3BTZA 3E6BA 3ZLIA 4AE2A 3E6DA 4B4RA 2FDJA 3SQOA 1JI6A 5JDBA 1O5UA 3ZMOA 1N3QA 3GBGA 1JYWA 1CAXB 2C6SA 3HVDA 2VMEA 4RYDA 3ACGA 3OPZA 4XACA 1Z7S3 3A0KA 3EHKA 2Z42A 3LF7A 4Y5TA 5LA1A 1H2MA 1MS9A 1RUJ1 3QCWA 1UZ0A 4MGIE 3NRUA 4LR4A 3GBWA 4WVWA 2PAEA 3I2KA 1D4M2 1W2AX 1PX3A 2A3XA 2QQVA 2WINB 3QBQA 4WM7A 3VKMA 4AAPA 4FTSA 3IMNA 3SCHA 4YZ2A 1G9FA 2WWUA 2ZZJA 4LOSA 3WR0A 4MLOA 1WWYA 3MIHA 3WP4A 3PU3A 4DEVA 2JDYA 2DFCA 5IATA 2HBTA 4FTEA 3JB4C 3TN92 4GKYA 4QPIB 1SDDB 3OBRA 1VBA3 3VDDB 4LHSA 5J48A 1HJGA 3V65A 1W2UA 5BNNA 3RZGA 4EN0A 4RQPB 4SBVA 3JQXA 5E89A 1S55A 4LBNA 5FZMA 1RUC3 1OOPC 1Q8QA 2VH9A 2J1AA 3ACFA 4PBOA 3VBSB 1ENQA 3JXSA 3KV9A 2LS6A 2ILMA 3HQXA 1QY4A 4YZ5A 3O14A 1RC6A 1UOJA 2GNDA 4L8QA 4LO5B 2PHRA 2RJLA 3WHUA 2G9GA 2OXBA 1DLLA 5CVRA 2CYFA 4EROA 1I5ZA 2CWSA 3CHXA 3IWZA 3RMXA 1NCQA 3WP5A 2FBEA 4OLLA 5LBCA 3DEMA 3LDRA 5A1LA 5T52A 4UBGA 5GLZA 2CNAA 1UIJA 2BZDA 4IEVA 3WDTA 2WO3A 4K21A 5A3OA 1H30A 1NXD1 1WZXA 2RDQA 2XQXA 3ILNA 2QQIA 2I2SA 5FYUA 5GLTA 5E6HA 3DKQA 3TNPB 1JYIA 1JUHA 5JSOA 1RUG1 1WW4A 4TN7A 2X5IA 1UY0A 3WW4A 2YPDA 2D5HA 1AX2A 3DGTA 4BMEA 3DUIA 1WMEA 1CR7A 2CDOA 1W06A 4O65A 3Q8BA 3R05A 5FY8A 5AFEA 3EBRA 4OMCA 4RR3B 3VZMA 3N4MA 4LK6A 3VBOC 5GZGA 3S6PA 5CFCC 4UFMA 1E5HA 4FQ4A 2B8MA 5FP4A 3RMYA 4FBFA 5J7MA 4ARYA 5LRRA 5FYTA 2OVUA 3LZZA 5FZ4A 1MZFA 2G19A 2R1DA 3SKVA 4Q4V3 3O0VA 1NQDA 1I5PA 2RDSA 3AKTA 1JOJA 1GQGA 1OA4A 2WT0A 2ZHMA 3IT8A 3LFIA 1AYN2 4PHZA 5EJ3A 4MXVA 1EAH2 3LE0A 4RSUA 3W59A 1JODA 1H1MA 4ZZ8A 3IDAA 1WCUA 2VW1A 3K4ZA 4GZ9A 3U4SA 4BIOA 2IXJA 2VOVA 4A7ZA 3WLUA 5KR7A 1H4HA 3HBZA 3I2JA 1PGW2 4Q4X2 5JOXA 3KS7A 1C3HA 1ULDA 2XL9A 2ETEA 3CZJA 1FV3A 4YVSB 5LBFA 5DAQA 4KG0A 2BJSA 1COV2 2PMWB 3AC0A 1ULOA 1AR82 2MNGA 3IN9A 3BI3A 2E31A 3OUHA 2DBIA 2X8KA 3LGRA 3TBDA 2PHFA 1H2KA 3OY8A 2QE3A 2G9FA 4NHLA 4D6RA 3CNAA 3ILRA 5FO8B 1IGOA 4RL7A 4UF0A 4AK3A 1AX0A 1O4YA 4WVMB 3M70A 4JHZA 2V5YA 3H42B 1GOGA 1MS5A 1RUH3 4HBNA 3N7KA 1MPXA 4PJYA 1PVXA 1UO9A 4N53B 1AR81 3CLPA 4NPLA 4NRMA 1R091 2P1BA 4YG0A 4CUGA 4D6SA 5JOYA 3Q8AA 3WG3A 5ISLA 1PO21 4D94A 3ZN6A 4MVTA 2HWD3 4KG8A 3FUQA 3BIEA 1ULCA 2WNOA 2YMZA 4Z1VA 2QDNA 1UF2C 3KWVA 3WT3A 3TEWA 4OULA 4FFHA 3UNPA 1POV1 3HT2A 4AVCA 4DUXA 5LW9A 4AR2A 3AVSA 4A7YA 2VE1A 2V4AA 5JSRA 2IXLA 4CXWA 1QU0A 1WBLA 2VVFA 2VOKA 3BIWE 3LEMA 3RYRA 4CDQB 3RZKA 3RZMA 5JZGA 2Q8CA 2BNMA 2WZR3 2ZX4A 3NSTA 1RMU3 5FJHA 4FOYA 1POQA 3OOXA 4OQ9A 4P9IA 5BXXA 4LK7A 2WUHA 3H8UA 1WW6A 2BQPA 3VBUC 1RUI3 5I8YA 1VBD1 2XL7A 3RWKX 2VMIA 4AQSA 1Y43B 1FNZA 3WW2A 2A71A 1N1TA 1Q43A 3I3EA 1SFPA 2VU9A 2OYZA 5CZKA 1W6OB 2A3YA 2GP3A 3AB0A 3I2FA 4YLZA 4GXLA 1W3VA 4ZHNA 3A0NA 1Z7S1 3NQHA 4NHMA 5LASA 3WXPA 4XPVA 4YGCA 5EFUA 1MEC3 3GCWA 1UY4A 4IDZA 1DBNA 3THDA 3J8F1 2DV9A 5D2AA 2VW0A 3SNMA 3UKTA 1Q3EA 3QLQA 3WG2A 3WF3A 4N9HA 3ZSKA 5E8AA 2WSUA 2VZTA 2IVJA 2X5IC 3T0BA 4XUOA 4JQTA 2D6PA 5CU1A 4QPGC 4IL7A 1CVNA 5DPNA 3FUOA 1FMD3 4OHYA 1IG0A 1VPHA 3KCCA 4XHBA 2ATFA 2XXZA 3MW3A 1NAEA 4XCAA 4M01A 1AXYA 4DZGA 4CU7A 4CEWC 5HV0A 1SEFA 4AI0A 3MIBA 4B3NA 5FMBA 1DG6A 1K45A 2P6HA 3BODA 3KV4A 4E4HA 1T2XA 5FY1A 5HCAA 3QACA 3ZYGA 4ISRA 4C0BA 5CA6A 2B7YA 4XJ8A 2OA2A 5FZOB 3AJZA 4QPYA 3VDDA 2O0OA 2H6BA 3Q8EA 2J1SA 3FJSA 2OKXA 5J98B 3MV11 5FMCA 4BZ4A 4UXAA 2JG9C 1LHOA 1O91A 1LHNA 2EAKA 3LIHA 1VBE1 2J1RA 2QQOA 2QQMA 1RUF2 3PTYA 1G7YA 1MZEA 4HKLA 4Z2AA 5IVEA 4FPYA 5JVVA 1BHGA 2PAKA 4F7ZA 4AF9A 3APBA 1BYHA 2QBXA 1CAVA 2XJQA 1TQ5A 1QXJA 1YJLA 1H2LA 2OIIA 3V64A 4NIGA 1ENSA 1REDA 4JAAA 2PAMA 4QT6A 4RHV2 5CIRA 3TRSB 4E2QA 3NV3A 3GXUA 1AR63 3AK0A 4Y4RA 1UZWA 4M4PA 4YW1A 1ZBA2 3GDBA 1AR61 1XU2A 3AMHA 3UYJA 3L2HA 3GZEA 4CCCA 4RHV1 2XKPA 3OBTA 4XFBA 2IXIA 1OD3A 5JCTA 1K42A 4QQLA 5JSPA 1RUJ3 3NAPB 2B42B 4NIIA 1QJX1 1S0GA 3ILFA 4CPBD 1AR62 1U5YA 2ENRA 2QUOA 1F35A 2VO5A 3ZFEB 5FV3A 4BXFA 2R061 2RMU3 5EJZB 3V0AA 5IVVA 2ZGPA 5L7OB 2XMLA 2Z79A 4XMAA 1D2SA 2ZCWA 5FUNA 1W90A 2WIIB 2D44A 2HWF1 3AMNA 4CCJA 1GICA 1D0GA 4DOUA 4M0NA 3F95A 2PYTA 4ET7A 2RS11 3N36A 5GLWA 3KQRA 4LOTA 4B4QA 2Y38A 4UW5A 4BQ4A 1QJY1 3KB5A 2VL4A 1LKNA 3LOBA 3UL2A 3U78A 4JRAA 4LO6B 1L7QA 4COUA 1KRIA 1QJY3 3IDEA 3VD5A 2XR4A 2F6BA 3T2PA 4JGYB 1YRZA 4HONA 4MGYE 2V09A 5FP9A 2RM22 4JQRA 4GIQA 1OLQA 4K6BA 4DRVA 5FAXA 5JI9A 3PMSA 4LBJA 5K0UA 5CYYA 3BU0A 4Q0UA 1Z78A 4XDQA 1AL22 4NIDA 2BUKA 4RGGA 4LA2A 2UYAA 3KM5A 3PIGA 3D3AA 4MXWB 1O7FA 2RS12 1YLLA 2VUDA 3AJYA 4P9YA 4HOOA 1YCIA 3MI8A 4Q0SA 4AQTA 3HOBA 2EIBA 4XOGA 5C6CA 1PO13 1S0DA 4Q4Y1 4P9GA 2Q5TA 3WUDA 3SXWA 2E33A 1CX4A 4HZFA 1PO11 1XYPA 4URAA 3AZWA 1GNYA 4BB3A 2P37A 1JYTA 4MGKE 3TNQA 4CCDA 4URTA 3HQRA 1W03A 1YFWA 3O1VA 4HLTA 2GMPA 1FXZA 2O1QA 3K2OA 3USSA 3RS6A 3N9NA 4CP9A 4L0PA 3IDBB 3VHRA 1CAWB 4GH4C 4AI9A 2O8OA 5DZGA 1GR3A 1AYM2 5IUQA 3HEIA 4EZ4A 1C28A 1DQ0A 3LCPA 3IPVB 4W6YA 3T09A 4HT1T 4A45A 2P6CA 4EJRA 1QDCA 1SHWB 5BNNB 5G04L 4FOWA 4X8PA 4B29A 4A42A 3TN93 1JBCA 2BBAA 3VBRA 2DCZA 2WZPP 4RA0A 2F4PA 2GNMA 4Y20A 1F2NA 1PX4A 2ZX1A 3J4UH 1GWMA 5EWSA 3H8RA 4IEQA 1JZ7A 1FPN2 5A32A 2W47A 3H1WA 2EIGA 1OHFA 3JU9A 2WYSA 5FYIA 5C3RA 2XLFA 4I01A 1C8M3 3T0AA 1VBA2 1BMV2 2XHNA 4PI2A 2J1EA 2X29A 2H0VA 4NROA 4TLGA 4Y33A 4CEYB 4BU2A 1EAH1 2ZHLA 4ZS3A 2ZGOA 4A4AA 1YHFA 4LMFA 4B7KA 3KV6A 3BU7A 2PQSA 2ZGQA 3ZXFA 2G9ZA 3OSDA 2GH8A 3OGGA 1C1LA 1LU1A 3BTAA 4GMP1 5FK8A 3HQUA 4X6QB 4PT6A 4AEJA 1RUF3 2IWGB 3FC0A 5ACA2 1S1AA 1VLNA 1FI2A 2MEV3 5H9SA 5L7OA 5FZEA 3VBFA 4YG6A 4CP2A 3CJIC 1PVC3 3T08A 3BTXA 2JG9A 4PIZA 3SEEA 3U07A 5FPZA 1V00A 3ZOIA 1NY71 1PVC1 3KCYA 5GZFA 1W6MA 1GZWB 2JECA 4B7EA 3HR9A 4BQ5A 2Q1MA 3M3IA 4AGVA 5CFDC 2WJSA 3AL6A 3NV2A 5FBJA 1K3IA 5JXJA 4CXYA 4JGYA 5F3GA 2GN7A 3C7OA 1MS3A 2W1UA 1VBE3 5H9QA 4B4PA 5A7OA 1WMXA 3MUZ1 5FYVA 3J9SA 3ZDSA 1TME3 4PLOA 1ZZBA 2E26A 2C1FA 4LE3A 5ACA3 3E5XA 2BGCA 4AHYA 4EN7B 4UFJA 5LBEA 4CU8A 3MPPG 4OI1A 3VKLA 1OI6A 2ZZQA 4W4ZA 1WCQA 4QB2A 5HI0A 3AZVA 4INDA 3I2GA 4KBZA 1HRI3 4LLFA 4FOVA 3VBOA 3X29B 3DYPA 1E5RA 4ZU7A 1VP6A 1LEDA 1IPSA 4CEWB 1YQ5A 4GALA 1W6NA 2D98A 4UFLA 3BUCA 1GLHA 1SMVA 3WCRA 4FPHA 2JB8A 5EIYB 2LUWA 3UGFA 2E7QA 1OF3A 2E53A 4ZPIA 3KVAA 3ZXGA 1R093 1F15A 2R16A 1GZWA 3OD0A 4GB32 1R082 5FPLA 4KU8A 4ZKTB 3B3QE 3K48A 5CG9A 1XE8A 4IEOA 1PGW1 4OUSA 5FFOC 3ZYRA 4CU6A 5C9AA 1OKOA 3ES1A 3PVOA 3NNMA 3VB9A 1DQ6A 3PVBB 1TE1B 1NYWA 2P3YA 2RS52 2W68A 1G9AA 2DFBA 3VN4A 4EWEA 5CBLA 3LKJA 2HWB2 1G9BA 1VALA 5JMOA 1NLRA 1RVF3 2YBKA 3K46A 4WVVA 5L73A 1ZRRA 4I3PA 1QKQA 2QJVA 2B5HA 5FYZA 4FVVA 4JVAA 4WM7C 1AL23 3ELNA 4B1LA 2WFF2 1UMHA 1FMD1 1AR71 4LTAA 2WQ8A 1SFNA 4X8NA 2YFZA 5KC5A 5IWFA 1QEXA 3LWCA 3B01A 2VNRA 3UT0A 1OURA 4PLMA 2RS31 2YBSA 5F6LB 2RS13 2VZOA 1AL0G 3ITQA 4IERA 4QU1A 1BBT2 3WW1A 4JTNA 2ZEYA 4QXCA 3RWNA 5B2GB 5FCCA 5FKCA 5A3PA 1HX6A 1R092 4NE9A 5FZHA 2AENA 4QXKA 3N9QA 5CFDB 4NHKA 3HBKA 1RVF2 4R8HA 2FDKA 2XVGA 1VAVA 4LLOA 1W05A 2VMHA 4CDWB 3MO4A 1YQ8A 1BEV1 2V5DA 2ZACA 3J7MA 2DTYA 4ZU4A 1NXMA 3C3VA 1HV1A 2NPIA 1U5IA 3MLKA 2F17A 1ND3C 2GNTA 5DN2A 1CAUB 1LNSA 2VZ1A 2A3WA 2WBKA 3VDBA 4DEQA 4AVTA 2AYHA 3UETA 4NVPA 2R7EB 3EO6A 4GWJA 2JD4A 1GOFA 4TYSA 1OQ1A 2ZABA 5FYBA 1UKGA 2Y6FA 3GZAA 1GUIA 1JZ6A 3CU7A 1LOFA 2K46A 2NYYA 3H8XA 4OQ8A 5I0TA 5FZLA 4PDWB 1YFYA 1C1FA 1JZ2A 3VBFC 5C9AB 1Z7S2 3HN3A 4QX1A 5CB7A 1SPPA 1SZBA 5F3IA 2BP6A 5LY2A 1H0BA 2DU0A 5EP9A 5F37A 1LAJA 3LPGA 3VBRC 3O1TA 2VMGA 4CUCA 1CD3G 1A3KA 4KGGA 4W6WA 3ALQA 1DP0A 1RTVA 4R9BA 5T5OA 1O5LA 1FOD1 3RJ2X 3TWIA 5A1FA 4JRLA 5A33B 2CGPA 1PK6C 1SCRA 2TUNA 4PDWC 4XILA 5ABJA 1O3SA 1NG0A 1YO8A 2I45A 5FZFA 4LHKA 1ZRCA 3WF2A 3FFQA 4HANA 2UU8A 2VJXA 2W94A 2JE9A 2QQNA 2EIDA 2PFWA 3GZUC 2EVXA 4LE4A 3DN7A 3ZFFA 3KV5A 5C71A 5JXHA 5A3WA 2VCMA 5A1AA 3DF0A 1UMZA 4AEDA 1JXNA 1ODNA 1Q5OA 1PO22 3NAPA 4D6QA 1NCRC 2A70A 2XJSA 2R062 5FUPA 3IKWA 5DUVA 1CJPA 3LB9A 3OTFA 5FMDA 2A75A 5BYNA 3C7FA 4XZUG 2XJUA 4XAAA 4R52A 1L7RA 3OPWA 5IVFA 4AEKA 2B4KA 2FD8A 1APNA 4LBLA 4QD2A 4XZPA 3I3DA 4Y1YA 2JIGA 5FY7A 4UT5A 4M0HA 1GQPA 3WQ0A 2ARXA 2YROA 2VNVA 2TNFA 4DIQA 1KFXL 1T6GC 4CRQA 2YC0A 3RG0A 2ZKNA 4Q4Y3 2ZGUA 2OUHA 3ZYIB 1X9TA 3CZUA 2P3JA 5FWJA 1FATA 2R063 2HBUA 1XQNA 2DCYA 2RMU1 3OY8B 4AEMA 2ZTNA 4BXSV 3GGLA 5JPNB 1VBC1 3OGSA 3NNFA 4K8RB 1W0NA 1VBC3 4LQRA 1ZA7A 3DPRB 4FPKA 3PHMA 3K4AA 2EXIA 4AZZA 5JIAA 4BQYA 4WVZA 2D40A 3E97A 2W08A 3ZO0B 2UURA 1W99A 2C9KA 4XURA 4E27A 2AC1A 5T55A 4OFGA 4FO9A 2PHUA 2D6NA 3DL3A 1O3QA 1RUI1 3O0XA 3GJAA 5FUIA 1XE0A 1X8EA 1I3HA 5K4LA 4RR3C 5D8AA 5B4NA 4QXHA 4LA3A 1UU5A 2I74A 2DUOA 4QKDA 5BNPB 5FZ6A 2UWBA 1YI9A 3FWEA 1N3PA 4L2NA 4R9CA 2CU5A 4F83A 1VRBA 1AR83 3MIEA 4KMQA 4PQQA 4YM2A 5L9BA 1UOBA 1PZ8A 1YFXA 1ASJ2 2VOWA 2JDNA 2Y34A 5F2WA 2X05A 1DGWX 4NN0A 1GZTA 3VL8A 5KXBA 2PLV3 4J1XA 1Y4WA 3BALA 1MZ6A 1PIV3 2B9VA 2O8QA 1BKZA 1NE6A 3J8F3 2HWF2 4KGQA 4QDRA 2W2IA 4YGBA 2ZEZA 4IV1A 1FPN1 3ZYPA 4DINB 3R6SA 2Z5WA 3WEZA 1AXZA 5JMCA 5A3LA 1OQDA 1KJRA 1OPMA 3MLLA 2P34A 1DU3D 5EHDA 1US3A 4BYYA 2MEV1 1RMU1 3MGUA 4MV2A 2BYVE 3PU8A 2H6CA 3GF6A 3WNPA 1JHJA 1J3RA 1HB3A 1WLTA 3EB7A 3G7DA 3WNNA 3K3OA 4OMDA 5IFPA 2OPWA 2IFWA 3NV4A 4GA9A 3PUSA 3I2HA 1YI7A 2VZUA 2YGLA 1ZA4A 3ZXAC 4LXLA 3IB3A 4CYDA 4IE4A 4IV3A 3ZSMA 2HWD2 1HN1A 2E9QA 2AUYA 1HN0A 2DVAA 2Y26A 4HPKA 5FZ1A 1CESA 1W9SA 1EUUA 2X53S 1OA2A 1QOTA 1PMJX 2UY8A 3VHPA 5IAXA 2R32A 3ST7A 1Q8PA 3ZIXA 3O1PA 5F6KA 2VUCA 2R072 1OA3A 5FKBA 3WP3A 1GP4A 2FMDA 4CTEA 3S57A 1J3QA 4XABA 4DO0A 1DIWA 2BRTA 4CDQC 3ZN5A 5FJKA 5IK8A 3KF5A 5FLIA 3I2DA 2WLPA 3RFRA 1AYM1 5FPUA 1W8FA 3K51A 3ATGA 3AKQA 3WG4A 1RUE2 1LCLA 3OYWB 1RUD3 2QTWB 3MICA 3RZHA 1QJEA 2K0GA 3IAPA 4K3UA 4N53A 2WR9A 2W92A 3SEPA 1IG3A 4UW3A 3SCFA 1FV2A 4IGQA 1R1A3 4CCKA 4KI5M 5IK4A 3VZJA 3MZHA 2PA7A 2BOIA 4K40A 3MYXA 5AVAA 3UJOA 1SFYA 2JENA 3JQWA 1CAXA 4IE6A 1RUE1 1ND2C 2J1VA 1B35A 1F5FA 3URFA 3M4FA 4BLIA 3PMEA 5C7GA 4YFZA 2IZWA 4UF0B 5BNOC 2VQAA 2BDRA 3Q8CA 1FOD3 1NKGA 2YZ4A 2IC1A 4MXWA 4M3CA 5KBFA 4YVWB 3C7EA 4CCOA 3E1F1 3WNLA 4IEXA 4H7MA 1KEXA 4GH4B 2WNUA 1WD4A 4RN5A 2VZSA 2FDFA 3MW2A 3POBA 1TEIA 3WNMA 4BWOA 2RS33 1W9FA 3DPRA 1VAMA 4MYEA 2A6WA 1QJU1 3H50A 3ETPA 1AXKA 2CDPA 2VNOA 3S0MA 3U0ZA 4PIXA 1K5JA 1HRV3 4XCBA 3EMRA 1BJQA 1RIRA 4XBLA 2PHLA 1H9PA 2WKKA 2YC4A 4ASMB 2WNUB 4CP1A 5APAA 4LBQD 5EJ1B 3VBOB 5IHRA 1UY2A 3SCGA 3WHTA 4N53C 3T4VA 1IQDC 2RV9A 3CL1A 4FPGA 3V0AB 3PJQA 3THCA 5DZFA 5GZCA 1GV9A 2Y6GA 4OHXA 3D0JA 5LATA 3WOGA 3LEIA 1UN1A 2XGXA 1O8SA 4D7TA 3VD3A 1B35C 2VECA 3ZXEA 2CHHA 3WY6A 3AYEA 1HXS2 2E51A 2QKDA 4BIFA 5J36A 2R1BA 3U37A 1BEV2 2DURA 1V9U1 1PK6B 1TMF2 2R043 2R0FA 1RUC2 3MEPA 1A8MA 2C4XA 4Q4W3 3USUB 4GWMA 3RSJA 4AEDC 3R4UA 3GHNA 5I0UA 2BBVA 1UXXX 5FMOS 1NCQC 4EN8B 4NO4A 2FCTA 4ZZ5A 3D4KA 4WM8B 4FPJA 4K9SA 5FRAA 4YGDA 1RUG2 1QWRA 4K1YA 1VMFA 3GZTB 1GFF2 1V0AA 4WZFA 1OFNA 1FNYA 1JTZX 5FZOA 4QHBA 2ZS6B 1QGLA 1QDOA 5BNOB 4AI3A 2YHJA 3T2OA 2KA3A 2NZ9A 2ARAA 5FMOL 5DMYA 3NAPC 1EYBA 2XVLA 1VAKA 4GKXA 4P9WA 1BCXA 4DY5A 3VHOA 1OVSA 2RR12 3TEYA 4YZ4A 3OGVA 3B7MA 5CFDA 2YBPA 5A32B 4DXRA 1W39A 4HL0A 4MH0E 5DG1A 1UKRA 1GMMA 3EYPA 3N9MA 4JGZB 4AHWA 3I2OA 5JLVA 3BOWA 2WO2A 1WKYA 1AR72 1EPWA 2DCJA 4FPLA 2VBBA 2ADDA 1PIV1 2BTVC 3EQEA 4JHTA 4TXWA 5C8CB 1MVEA 2EALA 1VBB3 3AP7A 1ND3B 4E4SA 5LK5A 1N1SA 4XUNA 3CBNA 3U75A 2DVGA 4JX0A 1FPN3 4QQHA 5GKAC 4P5YA 3CMGA 3NNGA 4DMIA 1GBGA 1JN2P 1LHVA 1OLMA 3JCIA 4NPRA 2XJVA 1JYCA 2NM1A 3RDIA 1S4CA 2GP5A 4CXXA 3MDPA 3NNLA 4JGYC 5JIUA 1JU3A 4ITCA 4LHLA 5DUXA 5FY9A 4MZUA 2Y64A 3UESA 2JXAA 2CWMA 3HMYA 5D8AC 3KT4A 5LB6A 4Y3OA 5I0RA 3V0BB 1UYZA 2E6VA 4FP2A 4R9AA 4LUMA 3ZMNA 3IZOA 3ZN4A 5CFCA 1C57A 1W8TA 2VCAA 5EZWA 1US2A 1UZYA 4COVA 3BYWA 3AYDA 3N7MA 2FCUA 2LROA 1RJ7A 2A6ZA 5I8SA 1EP0A 4AI8A 3LEKA 4QPIC 4HXCA 1KITA 4QX0A 2D93A 2VOTA 1KS5A 3I59B 5J37A 3ZXKA 1AHSA 1GSLA 4COZA 3AXDA 3NL1A 5GM0A 1DGLA 2VZQA 3A4UA 3FMGA 3POEA 4QX2A 4RQPC 1IPJA 1RGSA 1LOAA 1Q8SA 4M3CF 3ES4A 4NPMA 2ZX0A 3VBHA 1QQP2 4MOAA 3SKJE 5C3OA 1UPIA 1R1A2 2J7MA 2V4VA 2WS91 5T54A 4CCLA 4UFKA 5A3MA 1GKBA 2WNVA 3ZYJB 3AXEA 3RQ0A 5CEHA 1RHI1 4GH4A 2A73B 2QQWA 4B8EA 2DVDA 3IMMA 4CZSA 1DGRN 1ENXA 3VBUA 1VBC2 5C4WB 2SBAA 4CSWA 1NCRB 3WDWA 4CCMA 4CEWA 2VBPA 2YPJA 4MGSA 1RUF1 4A3ZA 1DQ1A 5JZGC 3DKWA 1UOGA 3K77A 1A8DA 1PZ9A 1RUH1 1R1A1 3CKHA 3WG1A 1S0JA 5IYYA 3JBG3 3OEBA 5DG2A 3ZDVA 5LWBA 1QXRA 3FFZA 2FHRA 3B94A 3FLPA 4L92A 4O9GA 5T3NA 2J1TA 4ZU5A 4JC1A 3WV6A 1RUI2 5L19A 1J1LA 1CIWA 4HMZA 2RS32 2WWJA 3Q9OA 3W20A 5FZAA 1SBDA 4DXTA 2VC9A 3WQBA 4V2WA 4ARXA 1ACCA 3ABZA 3MIDA 5JR7B 5FYSA 1GWLA 3D82A 3DYMA 1LHUA 3H3ZA 3M8LA 1RVF1 1YWKA 4PDWA 4EWAA 4QAWA 3BN6A 4NWVA 5A80A 4ORFA 3PUIA 3ZYHA 3W5NA 4S2FA 3LIGA 3V0BA 2D43A 4PLNA 1YQ6A 3JD73 4ISQA 4OZXA 5H9RA 4YSFA 2ZGKA 5FZ8A 5A3UA 5C4WA 2XWJB 1N47A 4KWJA 5A6XA 1BK1A 4Y1ZA 1D7PM 2CSGA 3T3YA 2C26A 2E32A 1XSQA 2BEOA 4I0BA 4CCEA 5EV7A 1CZVA 2DCKA 2MEV2 3SMHA 2WDBA 4NRPA 4JDMA 2F4LA 3RZZA 3VGIA 3CJIB 2AREA 4PQ9A 1UYYA 2VVEA 4FPOB 2G1MA 4XTMA 1VRH3 2XUMA 2BPA2 1MEC1 2DUPA 3S30A 4RS5C 4AFMA 5JWPA 2BNOA 1QXPA 2D6OX 1JW6A 1WCDJ 2FDIA 4N43B 1WUVA 3ORJA 4HG6B 2RG4A 3POYA 4FXKB 2QQUA 1RXGA 3FE5A 5G05L 2XJPA 5CISA 4ATFA 3E5UA 4MGQA 4Q4W1 4AWDA 3ZFGC 4H14A 4AFAA 1F5JA 1W6OA 4XW3A 3ZX7A 3T4HB 1YQCA 2HWE2 4A2UA 4EZHA 3BPZA 4Q4X3 1ENRA 1S0CA 1IPKA 2J42A 3OJBA 2WN2A 3AZXA 1RJ8A 3AZYA 4AW7A 1VBB2 1E5IA 2PHTA 3LSDA 3A23A 3VHNA 4BE3A 3U14A 4B1MA 1UWWA 1ASJ3 2B46X 3HN1A 3ZXJA 4CEYA 4XDPA 4W8JA 4RGKA 5FZ7A 1DYOA 1IZ3A 4PBPA 4HVOA 1VJ2A 5HBAA 1TME2 4WBBA 2QQLA 3USUA 4BOWA 3H3UA 1IHMA 5HCBA 4N9IA 2WO1A 4FPEA 4XEZA 1XNTA 2BNNA 4LBKA 2B45X 2IXHA 1QNYA 1B09A 1BEV3 3GYDA 2A7AA 1W2NA 4AHZA 1XB9A 4P14A 1ZBE3 5I0DA 4TTGA 4LO4B 2FZ2A 2ZHKA 4XQWA 2WRAA 3OG2A 4KNCA 5FZ3A 1VMJA 2IUWA 5GALA 2WAOA 2EIEA 2JX9A 2WSVA 4Q0VA 4YWAA 5LA2A 4YM3A 4FSJA 2XJRA 4QX8A 2VXJA 2YDEA 5F5IA 5JUVA 4S2HA 4AYUA 3AMMA 1UZZA 4Q2FA 1RUG3 4CUAA 1MVQA 4EQVA 1LGCA 2W3JA 1JS9A 1LEMA 2QQJA 3O1RA 3WX5A 1GNZA 1TNRA 2EXJA 2Y6HA 2EA7A 3MPBA 3PTRB 4YW4A 2X10A 1LECA 3FX3A 5F7UA 3ZPYA 4OI0A 3PUAA 2ES3A 3PUQA 5J1XA 2VTFA 1CGPA 1UZVA 3AM2A 2YU1A 1OUSA 3M2MA 4CDUB 1QOOA 1YUDA 2DF7A 2NN8A 1U0AA 4IGOA 1SLBA 5IVBA 1NQJA 4BCUA 3U10A 2MHFA 3RI9A 1M4WA 4FAHA 2WZR2 2HKXA 1CX1A 5C5TA 1QJX3 2QQPA 1J58A 1H6XA 4XFIA 5DUWA 4I30A 2WNVC 3JBG2 3FN9A 2VPVA 3WZ1A 4XJ9A 2JKXA 2OS2A 3N9PA 4GMP0 2IFRA 3OUJA 3LA3A 1XNBA 2QFEA 4YVSA 4Y1UA 1TZOA 5BNNC 2PHXA 1OD5A 5FZ0A 4HK8A 1N1VA 2GSYA 1XPWA 5AFBA 3ZM8A 4FCAA 4K7JA 1JHNA 1PO12 2WABA 4OYUA 2NMOA 1DF0A 2YU2A 4XJWA 5T5JA 1V9U2 1RUC1 4ZXEA 5A7PA 4QQ2A 4HVQA 4LT5A 1F4HA 2VMFA 3NKGA 2YV8A 5FWEA 1ND2A 3A7QA 4JKMA 3WDYA 4M4RA 3RNSA 2D97A 1S2BA 1CZTA 1N3OA 1Q8VA 2CV6A 5FPXA 1GP6A 3U4XA 5KXDA 3DCQA 4Q0QA 4XFGA 2OX0A 1VB2A 4LITA 1RUD2 2RVAA 1MQTB 4JDNA 4LKDA 4Q26A 4IEPA 2WN3A 4ZS2A 3U1XA 5AC92 3GBFA 4R4XA 3VKNA 4OVEA 2BGOA 2JB4A 4DPNA 2K2SA 4IESA 3S7IA 3VZKA 1V9U3 1HLCA 5BNOA 3J7LA 2J1UA 3O7OA 1UX6A 5FPBA 1NX9A 5HXVA 3WDVA 2J22A 5CG8A 2VW2A 3OBAA 5KXCA 3BTYA 4BK4A 1H8TA 2D3SA 1V6LA 4I0AA 1ZZ7A 1I6XA 2Q8OA 1WCKA 3W21A 5LA0A 4AL9A 1AR93 2A6VA 2VCBA 4FPCA 2BW8A 4AVAA 1ZVFA 4DY3A 1HDKA 3MIFA 2XH6A 1RUJ2 2PQQA 4EWDA 1VRH2 5C4WC 5KHKA 2V73A 4HETA 4YG3A 1QF3A 3N35A 1NCQB 2C0ZA 4QKBA 4FT8A 4KWKA 5DAWA 1AZDA 3VV1A 4COWA 3CDZB 4Z82A 1HV0A 5JI7A 1W8HA 5A7QA 2ZKLA 4YW7A 1EV12 1OUXA 4LKSA 3IAQA 2WFPA 1XOYA 5FP7A 1BK0A 1YIFA 1WCSA 1ZBA3 2P17A 2BOJA 2HWE3 2HYXA 3OB8A 3UGGA 2XBO1 2IVIB 1UL9A 1C8M1 1VRH1 1ZBA1 2ORXA 2X5IB 5FYMA 3OEAA 4CDQA 5BY5A 4CDXA 5IK7A 1W8NA 1YIPA 3IPVA 4H55A 1UY1A 4XF3A 1J84A 4YM0A 1EAH3 2HWC2 2Y6LA 3MBWA 1YEWA 4IEWA 4QGLA 4UBHA 1CJDA 4M3CE 3QD6A 1O59A 2JEMA 2CGNA 5FXXA 3T30A 4Q4V2 2OQ7A 1ZYBA 2QNKA 1V6JA 4QM9A 2VXRA 1F31A 1H6YA 1HB4A 2WQ4A 5DAXA 2WLQA 2C9AA 2HYKA 2RJKA 3L9JT 3DXTA 1D4M3 2JDAA 3VDAA 1NA1B 2WS92 4LBQB 1WLCA 2ORZA 1TMF3 4Y1VA 4NWWA 2BVBA 2Q0AA 3CEWA 3RZLA 2W1SA 1VB4A 1V6KA 5CKMA 4QGMA 1X8MA 5HPOA 1W6QB 3HWJA 5IAVA 1IS5A 4G9SB 4YNIA 4YW6A 3BKZA 3TAYA 4E9KA 2KXLA 3ME2A 3AFKA 1RXFA 1JZ4A 3OPTA 3ETQA 1JMUB 1LOCA 1LRHA 2JG8C 1LULA 2EXHA 3G6JB 2DWRA 3C7GA 5IT6A 2AR6A 4EN9B 4NRQA 3K3NA 3VD7A 3H8OA 4RFT0 3LEGA 5L36A 1F4AA 4NUBA 2OT7A 1RITA 1JUIA 5I93A 2WS93 3B5LB 2CAUA 1OOPB 3VBSC 5FYYA 4OUMA 1AJKA 4QDSA 1C4RA 2ZGMA 3GCXA 2JE8A 1RHI3 1W04A 1HW5A 4DXSA 2HWB1 2CL2A 1JOBA 2XJTA 3LSEA 4QDQA 5C3SA 5L9RA 3SHRA 5M0TA 1HQWA 1ZREA 4GQ7A 4G3YC 1NA1A 4LBQA 4LIUA 1OH3A 5FZCA 1HXS1 2FCVA 1HRV1 2D6KA 4OZOA 2ZEXA 4H7LA 2OQ6A 2D3PA 1A78A 3P1IA 4D3WA 4DXZA 2BERA 2DCTA 4Y22B 5C5UA 4A41A 1LOBA 3C8XA 4E4ZA 2NQYA 3NJXA 1X7NA 3AX4A 2CTVA 4DQAA 3AKRA 4LHNA 4KBBA 4HK9A 3WW3A 1F9KA 5HV4A 1AX1A 2JG9B 4AQ6A 2VMCA 1RUE3 5FZKA 5BNQA 3BPSA 4CU9A 1PZ7A 1NLQA 4XBNA 4LO7A 2FMYA 5A6QA 4O61A 5EYYA 3F2ZA 3HNMA 2YGMA 3MLJA 2FDGA 1JH5A 4COYA 5LZ6A 1OF4A 2ARCA 2R041 1ALYA 2V72A 2IXCA 3RPQA 5I8TA 5KWRA 3AYCA 1WBFA 1J59A 4BA6A 5CADA 1HQNA 3KQ4B 4L97A 5FQ0B 3A21A 2JJ6A 3NWKA 1AVBA 5F8PA 3UJQA 1W6QA 2EXKA 4Y20B 3VDDC 5T50A 5TSWA 1GYKA 2NP0A 4HPKB 2GC0A 2RE9A 4LEJA 1IKQA 1QIQA 5FREA 1ZRFA 5T5PA 1MS1A 2R49A 1OQEA 3LQCA 4SLIA 4I2OA 2AEYA 2GDFA
chains in the Genus database with same CATH topology
2PELA 1QOSA 4RS5A 2XVKA 1ZBE1 1C5IA 2GNBA 2ZPXA 3VUOA 4RR3A 4ONUA 1NOVA 4QGNA 1ONAA 3NVCA 2GMMA 3EJKA 1RINA 2GC3A 4Y5Z0 4CDXB 2P3IA 4OHWA 1W0PA 1UPSA 5C8WA 4MUVA 3E5QA 1NY72 1VIWB 1DYPA 5E88A 4FP3A 2WA3A 1K5MC 1R083 2BFUS 2GALA 5DUUA 5FBZA 4H3WA 1ASJ1 4FXGB 3TYJA 3J8F2 3NV1A 2VY0A 4C1XA 1L3JA 3AP5A 4JGZA 2EF6A 3ZXDA 1MEC2 1W6PB 3SITA 2AZ5A 1KDKA 5E16A 2BFUL 1WLDA 1RB8G 4QU2A 2QCSB 4XJZA 2B39A 1F8VA 1O3TA 4HSLA 2XBO3 1MR5A 5DDJ3 4Q4W2 1LHWA 4XFHA 4CDWC 4GB33 2CGOA 4WVMA 3N3HA 1KS4A 4E2GA 1KQRA 3M7AA 1VBB1 2JE7A 2RS53 3H1MA 3KD4A 2GH2A 2RMU2 3MIGA 3H7JA 4YGEA 2ZAAA 3O0WA 3B93A 2ZJCA 2HEWF 3M3EA 4M3CB 1MS4A 2HEYF 4IXLA 1D4M1 3H1YA 1G9DA 1DHKB 1H4GA 1AYN1 5LK7B 4AG4A 3UKVA 2Z2SB 2RR13 1BXHA 2GU9A 2TEPA 2WQZC 1VBD2 4XBQA 2MPFA 4AVSA 1XYOA 1PM7A 3ZSEA 4OI4A 4FPFA 4CDXC 5I91A 1WA4A 1COV1 4XQ4A 1RUOA 5LRSA 4HVRA 4Q1PA 3FLTA 2ZMNA 4AGRA 1LGBA 1LOFC 1UU4A 4Q0PA 3MFCA 5GLUA 3UK9A 1REFA 2E7AA 3VBFB 5C9AC 1YNAA 1QJZA 2CAVA 2LM3A 4A3XA 1OKQA 4N90A 4KL1A 5AC91 2H0BA 4IEZA 3ZXLA 1U5XA 2FZ1A 1HRI1 3HIFA 5H9PA 4YARA 1U5ZA 1WD3A 1RMU2 1S0FA 1CPMA 3FHIB 3JBG1 3C2UA 2HWE1 5EXOA 1GZCA 4I09A 4U2AA 3B9CA 4EV0A 2ZHNA 4ATEA 4Z2WA 2PLV1 2ERFA 1FX5A 1EV11 1I9RA 5K8SA 3ECQA 3CF6E 2YUEA 1MQTC 2AH2A 1W6PA 4Q27A 1PGL1 4FQZA 5FO7B 5HCFA 1NE4A 4S2GA 3WNXA 5FLHA 4UW6A 3RJRA 1AL21 4XXAA 1AJOA 4U36A 4Y1XA 1AR91 1UIKA 1H2NA 2QDRA 3CJIA 3W58A 4LO8A 3D0SA 5L7OC 1H8TB 1A6CA 1VR3A 4RS5B 2PN5A 3RI8A 1UAIA 4YW5A 1DZRA 3P3NA 4Y26A 2GN3A 3T1MA 3FBMA 1FYUA 2ZMKA 1G6NA 2BWCA 1AR92 1TNFA 4OHZA 3WQ1A 5K0UB 5JPMB 4DNYA 4XIOA 4YYOA 2WWSA 2QZ2A 2FQPA 1ULEA 2ZGLA 1QH6A 4K20A 4OHVA 1YXWA 3AKPA 1IS4A 1ZZ8A 2ZX3A 2GMEA 1CN1A 2C5DA 3O12A 3LA7A 1AYM3 1SLTA 4HSJA 2W0XA 3KGZA 1LTEA 3LOIA 3QH6A 5DDJ2 2XPJA 2XB6C 4QQOA 3THTA 4CDWA 4YW2A 4QPGA 3S7EA 1D2QA 1MQTA 1UU6A 3TOJA 1BMV1 1AUYA 2SLIA 3LAGA 2LTNA 1DGWA 2D5FA 2Q30A 3TB0A 3B00A 1QJU2 1DGRA 1LR5A 1GZ9A 1KJLA 2GZWA 2JG8A 3M3CA 4JGZC 3OCPA 3AP6A 2OZJA 2ZGTA 4RHV3 2TBVA 3PVNA 4N43C 1YJKA 2ZGSA 3AZZA 4Q8LA 4XYXA 5FLJA 3SH4A 1V6IA 3ZFGA 3I59A 2DVBA 2P3KA 2VULA 2WNUC 1MS8A 3WDXA 4M00A 3FZ3A 4XFFA 4CDUA 1AR73 4Y24A 1W0OA 4LULA 4F3JA 1WLWA 2NMNA 2XKOA 2ZAHA 4J6GA 1CONA 1H8TC 4FAGA 2UWAA 1HQLA 2GC1A 4KH9A 3KLSA 2HWF3 4XHXA 3R4SA 4QPGB 3RYPA 2JDZA 2UY9A 3ZFFC 1DQ5A 4QM8A 3VLBB 4ES8A 3ZN6B 4XF1A 1D0HA 1PGSA 4P9XA 5ABJC 4HFSA 5A33A 3SH5A 2GAUA 1AYN3 1HKDA 1R1ZA 2A6YA 2K9ZA 3I4IA 1MS0A 1IQAA 1G8WA 1RHI2 1WMFA 3SH3A 3PLQA 2ZA9A 3ASIA 5GZEA 3GHMA 5LEKA 1LESA 1COV3 4D7SA 4C91A 3SLIA 1RUH2 1SLCA 1WGPA 4BLJA 1S0IA 2PTMA 1VBA1 4XJAA 1G86A 5AC93 1R081 5BUVA 4IV3B 1HRV2 5CAZA 4YM1A 1H8VA 1XNCA 1CAVB 1VBE2 3GNEA 2XLGA 4F8AA 4FOQA 4IV1C 1RL3A 1KXGA 1V70A 3IIAA 4ZXKA 3AP9A 4TWTA 2E7TA 3I8TA 4L99A 4GULA 5KHGA 4QMAA 3BCWA 4AI1A 2D6MA 3TN91 2B9UA 4HKWA 3WD5A 1K5MB 2CY6A 1ZZCA 2ET7A 3THPA 1DZQA 3VZOA 4AFDA 4KWLA 4DFSA 3M1HA 4XE9A 4G4FA 2DTWA 1X50A 3IM0A 1SACA 4TLFA 1SLAA 3VBHC 2LALA 1LJ7A 4RQPA 2YYOA 2R0HA 3H0OA 3AP4A 2OZ6A 4LBOA 4AVVA 5SV5A 3T2TA 1V6OA 3MFAA 1QH7A 5F1RA 3N7LA 1IKPA 1ZM1A 4DB5A 5BNPA 2QZ3A 1CAUA 4IETA 3FBYA 1QJX2 1SLLA 1QQP1 3NKTA 4LNVA 1QQP3 3KCXA 5FOBB 2DUQA 4YVSC 5FTTC 4AHXA 2RR11 1ULFA 1IS3A 1XXNA 3OD4A 2UWCA 4JV4A 3ROUA 4AI2A 2EAAA 3JB8A 2DVFA 2A5ZA 1PO23 2VQ0A 2VUJA 2ZMLA 5BPXA 1CQ9A 3B69A 4Q29A 4W65A 2OPKA 4Y22A 1OLRA 2YY1A 2WL1A 1V6NA 1X33A 3BB6A 3JZVA 4GB31 3CO2A 1UD1A 1POV3 3VL9A 3KZ4C 2RM21 4META 4S2DA 2WA4A 2WC2A 2RM23 4XIKA 5I0SA 1TME1 3HAGA 3VKOA 2RS51 5ACA1 3WVJA 1CPNA 1ND2B 4RD7A 1OFSA 1ZX5A 4R4ZA 1NCRA 4YVWC 1LU2A 1LOGA 4IEUA 2ZGRA 1XNKA 3NW4A 4TSVA 1KD7A 3VZLA 5F5QA 2JG8B 1X82A 3PJYA 1LENA 1I1EA 2D3RA 3R4DB 1TMF1 1H9WA 3VBHB 3FLRA 2JKBA 4MX3A 3WUCA 4D69A 3D5OA 1HRI2 2ZX2A 3H9AA 1REEA 4E2SA 1EY2A 3OF1A 4RGAA 3AYAA 1B35B 5FDBA 1EV13 3P3PA 2Y0OA 2VVDA 3BOPA 1H1AA 3HD8B 3JD72 1S0EA 4CP0A 4N7IA 1J3PA 4R9DA 1G9CA 3O5SA 1POV0 1BVP1 2PLV2 1W6MB 5GZDA 5JOZA 1AF9A 2WZR1 1DFQA 1IOAA 1DZTA 2Z69A 4K1ZA 4IV3C 4AFCA 1S0BA 2HWB3 1PGL2 3I54A 1QJU3 2HEVF 5KHIA 1J1TA 3KT1A 4Z92B 3J26N 2DU1A 4WM8C 1KDMA 1ZZ9A 1PIV2 1N1YA 1WMDA 1XRUA 1HXS3 1ZNPA 5KC6A 5C8CA 4I3GA 2ZOEB 1DQ2A 4YZ1A 4GWNA 3U11A 4BH9A 2WFF3 1Y3TA 2PHWA 1H1IA 2WFF1 3VBSA 4ES9A 1FMD2 4HN1A 3AFGA 5KHJA 3LA2A 3N7JA 5T5LA 1PVC2 5LEJA 4XFAA 1BBT1 4Q4X1 2A6XA 4P5HA 5K9YA 3OGJA 1RUD1 2D6LX 1ND3A 1URXA 5D1IA 1OMIA 3L2YA 3WDUA 4C1WA 5C8CC 4N43A 1K5MA 1MACA 2W39A 5IK5A 4AGGA 3INAA 4ASLA 2DYCA 4E4DX 5FO9B 5CNAA 5BNPC 1O3RA 2JICA 2UYBA 1Q8OA 3W9AA 5JOWA 1X36A 5FOJB 1UW8A 3KMHA 5JAXA 5K0UC 2KM2A 3VBRB 4C0HA 3ZVXA 3KT7A 4JCKA 4BM8A 2BVVA 2AGSA 1SCSA 4A7KA 4QQPA 2Y0IA 4BHPA 3WCSA 4HN0A 3D8CA 4IQPA 1XYNA 4XQDA 3POWA 3PVEA 5FQ0A 1PMIA 3D6EA 2W52A 4N7UA 3AKSA 1WW5A 4I0WB 4JDOA 3VZNA 3MW4A 2G4IA 4FTBA 2XG3A 5JZGB 1C8M2 3JUUA 2WNVB 1PK6A 5J96B 4P9LA 3ZFGB 2BPA2 2ARBA 1OPOA 2HWC3 2R071 2VNGA 1OOPA 1S2KA 2WNEA 1BVVA 1LOEA 4YFWA 4AXOA 2HWC1 2R073 4LBMA 1GNHA 2ZBJA 1QMJA 5F9TA 2VUAA 4LUKA 4XFCA 4Q4V1 4C90A 2Q4SA 1ZRDA 5GJ6A 4WZCA 4Z07A 4CEYC 5ABJB 4Q8KA 4O9EA 4DS0A 2HJIA 3PNAA 4J1WA 4AFBA 1ULGA 1XU1A 5DDJ1 5EYXA 5GLVA 3NJZA 3ZFFB 3CJXA 3B9IA 4W6XA 2P2KA 3V56A 4AVBA 4XETA 1V6MA 1WW7A 2IXKA 3RRDA 3POSA 1Y9QA 3M3OA 1O4ZA 3H7YA 2WT1A 5DZEA 5CFCB 1C5HA 3UKNA 5J09A 1RUNA 1SBEA 3HT1A 4I02A 3VBUB 3UV9A 1PHMA 1MZ5A 4OI2A 3B02A 2RHPA 4AQ2A 4DRRA 1U12A 4WV8A 4KQ7A 3IBMA 3MF9A 5E1RA 1YYNA 1C8NA 1EPZA 4P9JA 1PNFA 4PIYA 5C33A 2ET1A 5SV8A 4JTOA 4Q1RA 5DXDA 3E6CC 4AEDB 4NR1A 1ZZ6A 4CDUC 2WT2A 1NZCA 4YZ3A 1O4TA 1QJY2 1FAYA 2HWD1 1QHDA 2XLAA 1YFUA 2Q1ZB 3GALA 4KU7A 1NA1C 2BWAA 4X6RB 3SISA 2OW4A 1DYKA 2XBO2 3WQ7A 2OUJA 4EN6B 4BMBA 4IV1B 4MSVA 4GMP3 1CAWA 1LODA 3ZIWA 1GQHA 3AMPA 1FOD2 3R0RA 4L11A 3M3QA 2N7GA 1FT9A 4IEYA 1Z0HA 2VGDA 3DV8A 1D4VB 2PHDA 3DPRC 4XXPA 4XTPA 1BZWA 3ENRA 2R042 1XNDA 2YXSA 1Q56A 3I7DA 1HIXA 4PCRA 3WINE 5L19A 3ACLA 3QH7A 4UW4A 2I07B 4D7YA 1GANA 4K8FA 2VG9A 3T1LA 2E63A 3ZFEC 4QX5A 2VOXA 1LB2A 1DQ4A 1PNGA 2QVSB 4MGZE 3NO8A 5D8AB 4HKOA 3RYKA 3EXUA 5KXEA 3IDCB 1Y7BA 1BBT3 4XF4A 4WM7B 3MF6A 1ZBE2 4PF5A 1UCXA 4XMIA 4WM8A 2R6QA 4QPIA 5AVPA 1IS6A 1SLIA 2D7FA 2XHKA 1NLSA 5J3UA 3QOPA 4YRDA 1SQ4A 1M06G 5BV6A 2R30A 4V1PA 4BPZA 1BQPA 5K7PA 4TZDA 2XWBB 1E57A 2ZGNA 2NLRA 1QNWA 1LGNA 5KHHA 4NOTA 4XJUA 1SBFA 4XF9A 1DDLA 3ZSJA 4YW3A 4Y4YA 3WP6A 4Q4Y2 1OSGA 4L9BA 4YVWA 4XF0A 3AMQA 3OYWA 1SDWA 3VKFC 3ZSLA 3JD71 1KFUL 3KGLA 3KSCA 2GC2A 1XE7A 1VBD3 3ZFEA 1W6NB 3E6BA 4AE2A 3E6DA 4B4RA 5JDBA 1O5UA 3ZMOA 1N3QA 3GBGA 1CAXB 3OPZA 1Z7S3 3A0KA 3EHKA 2Z42A 1H2MA 1MS9A 1RUJ1 3QCWA 4MGIE 4LR4A 3GBWA 4WVWA 2PAEA 3QBQA 1D4M2 2A3XA 2WINB 4WM7A 4FTSA 3VKMA 3IMNA 3SCHA 4YZ2A 1G9FA 3WR0A 2ZZJA 4MLOA 3MIHA 3WP4A 2DFCA 4FTEA 3JB4C 3TN92 4GKYA 4QPIB 3VDDB 3OBRA 1VBA3 5J48A 3V65A 1W2UA 5BNNA 4EN0A 4RQPB 4SBVA 3JQXA 5E89A 1S55A 4LBNA 1RUC3 1OOPC 1Q8QA 2VH9A 4PBOA 3VBSB 1ENQA 2ILMA 3HQXA 1QY4A 4YZ5A 3O14A 1RC6A 2GNDA 4L8QA 4LO5B 2PHRA 2RJLA 3WHUA 2G9GA 5CVRA 1DLLA 4EROA 2CYFA 1I5ZA 2CWSA 3RMXA 3IWZA 1NCQA 3WP5A 2FBEA 4OLLA 5T52A 4UBGA 5GLZA 2CNAA 1UIJA 4IEVA 3WDTA 4K21A 1H30A 1NXD1 3URFA 3ILNA 5GLTA 1JYIA 2I2SA 3TNPB 1JUHA 5JSOA 1RUG1 1WW4A 2X5IA 3WW4A 2D5HA 1AX2A 3DGTA 4BMEA 3DUIA 1WMEA 1CR7A 3R05A 5AFEA 3EBRA 4RR3B 3VZMA 3N4MA 3VBOC 5GZGA 3S6PA 5CFCC 4FQ4A 5J7MA 2B8MA 3RMYA 4FBFA 5LRRA 2OVUA 3LZZA 1MZFA 2R1DA 4Q4V3 3O0VA 1NQDA 3AKTA 1JOJA 1GQGA 1OA4A 2ZHMA 2WT0A 3IT8A 1AYN2 5EJ3A 4MXVA 1EAH2 4RSUA 3W59A 1H1MA 2VW1A 4BIOA 2IXJA 2VOVA 4A7ZA 3WLUA 1H4HA 3HBZA 4Q4X2 1PGW2 5JOXA 3KS7A 1C3HA 1ULDA 2XL9A 2ETEA 1FV3A 4YVSB 4KG0A 1COV2 1AR82 2MNGA 3IN9A 2X8KA 3LGRA 3TBDA 2PHFA 1H2KA 3OY8A 2QE3A 2G9FA 4NHLA 3CNAA 3ILRA 5FO8B 1IGOA 4RL7A 4AK3A 1AX0A 1O4YA 4WVMB 3M70A 2V5YA 1MS5A 1RUH3 4HBNA 3N7KA 4PJYA 1PVXA 4N53B 3CLPA 1AR81 1R091 4YG0A 5JOYA 3WG3A 1PO21 4D94A 3ZN6A 4MVTA 2HWD3 4KG8A 3FUQA 1ULCA 2YMZA 4Z1VA 2QDNA 1UF2C 3WT3A 4OULA 1POV1 3HT2A 4A7YA 5JSRA 2IXLA 1QU0A 2VVFA 3BIWE 1WBLA 2VOKA 4CDQB 3RYRA 5JZGA 4BQ1A 2BNMA 2WZR3 2ZX4A 3NSTA 1RMU3 4FOYA 4P9IA 5BXXA 3H8UA 1WW6A 2BQPA 3VBUC 1RUI3 5I8YA 1VBD1 2XL7A 4AQSA 2VMIA 1Y43B 1FNZA 3WW2A 2A71A 1N1TA 1Q43A 2VU9A 2OYZA 1W6OB 2A3YA 3AB0A 4YLZA 4GXLA 3A0NA 1Z7S1 4NHMA 3WXPA 4XPVA 4YGCA 5EFUA 1MEC3 1DBNA 3J8F1 2DV9A 3UKTA 2VW0A 3SNMA 3WG2A 1Q3EA 3QLQA 3ZSKA 4N9HA 5E8AA 2WSUA 2X5IC 2D6PA 5CU1A 4QPGC 4IL7A 1CVNA 4OHYA 3FUOA 1FMD3 3KCCA 4XHBA 2ATFA 3MW3A 4M01A 1AXYA 4DZGA 4CEWC 1SEFA 4AI0A 3MIBA 4B3NA 1DG6A 3BODA 5HCAA 3QACA 3ZYGA 4ISRA 4C0BA 5CA6A 2B7YA 4XJ8A 2OA2A 3AJZA 4QPYA 3VDDA 2O0OA 2H6BA 3FJSA 5J98B 4BZ4A 4UXAA 2JG9C 1LHOA 1O91A 1LHNA 2EAKA 3PTYA 1VBE1 4Z8BA 1RUF2 1G7YA 1MZEA 4HKLA 4FPYA 5JVVA 2PAKA 4F7ZA 4AF9A 3APBA 1BYHA 1CAVA 2XJQA 1TQ5A 1QXJA 1YJLA 1H2LA 2OIIA 3V64A 1ENSA 1REDA 4JAAA 2PAMA 4QT6A 4RHV2 5CIRA 3TRSB 4E2QA 3NV3A 1AR63 3AK0A 4YW1A 1ZBA2 1AR61 1XU2A 3AMHA 3L2HA 4RHV1 2XKPA 3OBTA 4XFBA 2IXIA 5JCTA 4QQLA 5JSPA 1RUJ3 3NAPB 2B42B 1AR62 1QJX1 1S0GA 3ILFA 1U5YA 2ENRA 2QUOA 3ZFEB 2R061 2RMU3 3V0AA 2ZGPA 5L7OB 2Z79A 4XMAA 1D2SA 2ZCWA 2WIIB 2D44A 2HWF1 3AMNA 1GICA 1D0GA 4DOUA 4M0NA 2PYTA 2RS11 3N36A 5GLWA 3KQRA 4B4QA 2Y38A 4UW5A 1QJY1 3KB5A 3LOBA 1LKNA 3UL2A 4JRAA 4LO6B 4COUA 1KRIA 1QJY3 3IDEA 2F6BA 4JGYB 1YRZA 4MGYE 2V09A 2RM22 4JQRA 4GIQA 1OLQA 4K6BA 4DRVA 5FAXA 5JI9A 3PMSA 4LBJA 5K0UA 4Q0UA 1Z78A 4XDQA 1AL22 2BUKA 4RGGA 4LA2A 2UYAA 3KM5A 4MXWB 1O7FA 2RS12 1YLLA 3AJYA 4P9YA 1YCIA 3MI8A 4Q0SA 4AQTA 4XOGA 5C6CA 1PO13 1S0DA 4Q4Y1 4P9GA 2Q5TA 3WUDA 3SXWA 4HZFA 1CX4A 1PO11 1XYPA 3AZWA 2P37A 4MGKE 3TNQA 4URTA 1YFWA 4HLTA 2GMPA 1FXZA 2O1QA 3USSA 3RS6A 3VHRA 3IDBB 1CAWB 4GH4C 2O8OA 5DZGA 1GR3A 1AYM2 5IUQA 1C28A 1DQ0A 3LCPA 3IPVB 4W6YA 4HT1T 4EJRA 1QDCA 5BNNB 4FOWA 4X8PA 4B29A 3TN93 1JBCA 3VBRA 2DCZA 2WZPP 4RA0A 2F4PA 2GNMA 4Y20A 1F2NA 2ZX1A 3J4UH 5EWSA 4IEQA 1FPN2 5A32A 3H1WA 2EIGA 1OHFA 3JU9A 2XLFA 4I01A 1C8M3 1VBA2 1BMV2 2X29A 2H0VA 4CEYB 1EAH1 2ZHLA 2ZGOA 1YHFA 4B7KA 3BU7A 3ZXFA 2ZGQA 2GH8A 3OGGA 1C1LA 1LU1A 3BTAA 4GMP1 4X6QB 4AEJA 1RUF3 2IWGB 3FC0A 5ACA2 1S1AA 1VLNA 1FI2A 2MEV3 5H9SA 5L7OA 3VBFA 4YG6A 4CP2A 3CJIC 1PVC3 2JG9A 4PIZA 3U07A 5FPZA 1V00A 1NY71 1PVC1 3KCYA 5GZFA 1W6MA 1GZWB 2JECA 4B7EA 3HR9A 2Q1MA 3M3IA 4AGVA 5CFDC 2WJSA 3NV2A 4JGYA 2GN7A 1MS3A 1VBE3 5H9QA 4B4PA 3J9SA 3ZDSA 1TME3 4PLOA 1ZZBA 2C1FA 4LE3A 5ACA3 3E5XA 2BGCA 4AHYA 4EN7B 3MPPG 4OI1A 3VKLA 1OI6A 2ZZQA 5HI0A 3AZVA 4INDA 1HRI3 4LLFA 4FOVA 3VBOA 3X29B 4ZU7A 1VP6A 1LEDA 4CEWB 4GALA 1W6NA 2D98A 1GLHA 1SMVA 3WCRA 4FPHA 2LUWA 2E7QA 2E53A 3ZXGA 1R093 2R16A 1GZWA 3OD0A 4GB32 1R082 4ZKTB 4KU8A 5CG9A 3B3QE 3K48A 1XE8A 4IEOA 1PGW1 4OUSA 5FFOC 3ZYRA 5C9AA 3ES1A 3PVOA 1DQ6A 3PVBB 1TE1B 1NYWA 2RS52 2W68A 1G9AA 2DFBA 3VN4A 4EWEA 5CBLA 3LKJA 2HWB2 1G9BA 1VALA 1NLRA 1RVF3 5L73A 4WVVA 1ZRRA 4I3PA 1QKQA 2QJVA 2B5HA 4FVVA 4JVAA 4WM7C 1AL23 3ELNA 2WFF2 1FMD1 1AR71 4LTAA 1SFNA 4X8NA 5KC5A 3LWCA 3B01A 2VNRA 4PLMA 2RS31 5F6LB 2RS13 1AL0G 4IERA 1BBT2 3WW1A 4JTNA 3RWNA 5B2GB 5FCCA 1HX6A 1R092 2AENA 4QXKA 5CFDB 4NHKA 1RVF2 4R8HA 2XVGA 1VAVA 4LLOA 2VMHA 4CDWB 1BEV1 2ZACA 2DTYA 4ZU4A 1NXMA 3C3VA 1HV1A 1U5IA 2NPIA 3MLKA 2GNTA 1ND3C 1CAUB 2A3WA 4AVTA 2AYHA 4NVPA 3EO6A 2JD4A 4TYSA 1OQ1A 2ZABA 1UKGA 3GZAA 3CU7A 1LOFA 2NYYA 5I0TA 4PDWB 1YFYA 1C1FA 3VBFC 5C9AB 1Z7S2 5CB7A 1H0BA 2DU0A 3VBRC 2VMGA 1CD3G 1A3KA 4KGGA 4W6WA 3ALQA 1RTVA 4R9BA 5T5OA 1O5LA 1FOD1 3RJ2X 3TWIA 5A33B 4JRLA 2CGPA 1PK6C 1SCRA 2TUNA 4PDWC 4XILA 5ABJA 1O3SA 1NG0A 1YO8A 2I45A 1ZRCA 4LHKA 3FFQA 4HANA 2UU8A 2JE9A 3GZUC 4AVCA 2PFWA 4LE4A 2EVXA 3ZFFA 3DN7A 3DF0A 1UMZA 4AEDA 1JXNA 1Q5OA 1PO22 3NAPA 1NCRC 2A70A 2XJSA 2R062 3IKWA 5DUVA 1CJPA 3LB9A 3OTFA 2A75A 5BYNA 2XJUA 4R52A 4AEKA 1APNA 4LBLA 4QD2A 4XZPA 4Y1YA 4M0HA 3WQ0A 2ARXA 2YROA 2TNFA 1KFXL 1T6GC 4CRQA 2YC0A 3RG0A 2ZKNA 4Q4Y3 2ZGUA 2OUHA 3ZYIB 2P3JA 1FATA 2RMU1 2R063 1XQNA 2DCYA 3OY8B 4AEMA 5JPNB 2ZTNA 1VBC1 1VBC3 3DPRB 4FPKA 3PHMA 2EXIA 5JIAA 4WVZA 2D40A 3E97A 2W08A 3ZO0B 2UURA 4E27A 5T55A 4OFGA 4FO9A 2PHUA 2D6NA 3DL3A 1O3QA 1RUI1 3O0XA 1X8EA 1I3HA 4RR3C 5D8AA 4LA3A 1UU5A 2I74A 2DUOA 5BNPB 2UWBA 1YI9A 3FWEA 1N3PA 4L2NA 4R9CA 4F83A 1AR83 3MIEA 4YM2A 1YFXA 1PZ8A 1ASJ2 2VOWA 1DGWX 4NN0A 3VL8A 5KXBA 2PLV3 4J1XA 3BALA 1MZ6A 1PIV3 2O8QA 4KGQA 1BKZA 1NE6A 3J8F3 2HWF2 4YGBA 4IV1A 1FPN1 3ZYPA 4DINB 3R6SA 2Z5WA 1AXZA 5JMCA 5A3LA 1OQDA 1KJRA 1OPMA 3MLLA 2P34A 1DU3D 4BYYA 2MEV1 1RMU1 3MGUA 4MV2A 2BYVE 2H6CA 3GF6A 1J3RA 3G7DA 1WLTA 2IFWA 3NV4A 4GA9A 1YI7A 2YGLA 1ZA4A 3ZXAC 4CYDA 4IV3A 3ZSMA 2HWD2 2E9QA 2AUYA 2DVAA 2Y26A 4HPKA 1CESA 2X53S 1OA2A 1QOTA 2UY8A 3VHPA 2R32A 3ST7A 1Q8PA 3ZIXA 5F6KA 2R072 1OA3A 3WP3A 2FMDA 4CTEA 1J3QA 1DIWA 4CDQC 3ZN5A 5IK8A 5FLIA 3I2DA 2WLPA 1AYM1 3K51A 3ATGA 3AKQA 3WG4A 1RUE2 1LCLA 3OYWB 1RUD3 3MICA 2K0GA 4K3UA 4N53A 4UW3A 3SCFA 1FV2A 1R1A3 5IK4A 3VZJA 3MZHA 2PA7A 4K40A 3MYXA 5AVAA 3UJOA 1SFYA 2JENA 3JQWA 1CAXA 1RUE1 1ND2C 1B35A 1F5FA 4BLIA 3M4FA 3PMEA 4YFZA 2IZWA 5BNOC 2VQAA 1FOD3 2YZ4A 2IC1A 4MXWA 4M3CA 5KBFA 4YVWB 4IEXA 4H7MA 4GH4B 2WNUA 1WD4A 3MW2A 1TEIA 4BWOA 2RS33 3DPRA 1VAMA 4MYEA 2A6WA 1QJU1 3H50A 1AXKA </