5TSWA

High resolution crystal structure of a human tnf-alpha mutant
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
149
structure length
149
Chain Sequence
SDKPVAHVVANPQAEGQLQWSNRRANALLANGVELRDNQLVVPIEGLFLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (TUMOR NECROSIS FACTOR-ALPHA)
publication title High resolution crystal structure of a human tumor necrosis factor-alpha mutant with low systemic toxicity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lymphokine
total genus 23
structure length 149
sequence length 149
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 1999-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5tswA00
1U5XA 2RE9A 2Z5WA 3MI8A 1TNFA 1OSGA 4TSVA 3TYJA 5BNQA 3QD6A 1DU3D 1RJ7A 3URFA 2JG9B 3L9JT 1JH5A 4GIQA 2WNVB 2WNUB 4EN0A 1A8MA 1GR3A 1WCKA 3K51A 4MXWA 4MXVA 4KGGA 2E7AA 1KXGA 4QQOA 4MSVA 2R32A 3V56A 3IT8A 3TWIA 4OULA 1PK6B 4MXWB 4QQHA 2TNFA 2OIIA 2HEYF 4KG8A 2JG8C 1S55A 4E4SA 1I9RA 4TWTA 4G4FA 4J6GA 4G3YC 2RJLA 5L19A 4QQ2A 2RJKA 2ZPXA 1IQAA 4QQPA 4OUMA 3B94A 4D7YA 3FC0A 3K48A 3AB0A 3B93A 2R30A 1D2QA 1JTZX 3ME2A 1TNRA 3WD5A 4F3JA 1C28A 1C3HA 1ALYA 4NN0A 2QDNA 1OQEA 2JG9C 4HT1T 2Q1MA 2HEWF 2JG8A 2WNVC 2WNUC 5HBAA 2ZJCA 4QQLA 5TSWA 4E4DX 5KC6A 2QE3A 3B9IA 1KD7A 1D4VB 2WNVA 1U5ZA 2WNUA 4RSUA 4OUSA 1RJ8A 2O0OA 2AZ5A 4N90A 2X29A 4DOUA 1D0GA 2JG8B 4QPYA 2TUNA 1PK6C 1O91A 1OQDA 5KWRA 5KC5A 2R6QA 1DG6A 5L36A 2KA3A 1PK6A 2HEVF 2Q8OA 4KGQA 1U5YA 1XU2A 3ALQA 4DB5A 3QBQA 5CIRA 3LKJA 2JG9A 1XU1A
chains in the Genus database with same CATH superfamily
1AR63 5DZFA 1FNYA 4AE2A 2BJSA 4JTOA 3UGHA 1ZRDA 1Y9GA 2FDJA 1QJY1 4ES8A 5FYIA 3H7JA 5IATA 1KITA 5BNQA 4IL7A 3EBRA 3JQXA 1ND3A 3EXUA 3D6EA 3W9AA 5FZ9A 3T2QA 2RMU2 4GMP1 3ACFA 4IEYA 4N8MA 2ZEXA 4XUNA 5ACA3 4OQ9A 1TME1 4XUQA 3HN3A 5FY9A 4MXWA 5K0UC 1OD5A 1HRV2 1RVF1 1XE8A 3VDAA 4XC9A 2VZOA 3HQRA 4QDQA 4YW1A 5FZDA 2WFPA 2BZDA 2QQNA 3N7JA 4Q27A 3LEKA 4YZ3A 4HMZA 1UY1A 1TZOA 5ISLA 1DQ5A 1UYXA 1F2NA 2ZX0A 4H7MA 3A21A 4IV3A 4BQ5A 1NQJA 1VP6A 2RM21 1R1A1 2XJTA 5DAPA 1I3HA 3I3EA 1F4AA 4QPIC 1DGWA 2GC0A 4CDXB 2NN8A 4ASKA 3GNEA 3S6PA 1GUIA 5BNOC 1VBD2 4HBNA 5C6CA 2VBPA 3IDCB 4Q0SA 4NIHA 1I9RA 4RR3C 5FXXA 1QGLA 1MQTB 4RHV1 5CNAA 1BBT2 1WCDJ 2DURA 4MOAA 4NR1A 2JB4A 1OOPC 5L19A 2NPIA 1VBE2 4QQ2A 3SH4A 5C4WC 1H8TA 2ZPXA 2A6YA 3LEGA 4XF1A 2Y34A 1DFQA 2NLRA 3N7LA 5I0DA 1KS4A 1W04A 5JPMB 3ZYFA 1UX7A 1HJFA 2I2SA 3AB0A 4XQDA 4AK3A 2VTXJ 2W1UA 4HPKB 3E6DA 3WW3A 2R042 4FTSA 4AEDC 2IXHA 3ZFGB 1JTZX 4LOSA 4PJYA 2E7QA 5KXDA 4K7JA 1JZ6A 5LBEA 2ZBJA 1OFSA 3OY8B 3J8F3 5DG1A 1PZ8A 3ILNA 1H6XA 2ZGTA 3B02A 3KT4A 4S2DA 2FHRA 3EJKA 3V0BB 4DNYA 2BU9A 5LZ6A 4XQ4A 3ON7A 2HYXA 3A22A 1S0BA 3R4DB 1VRH1 3KF3A 4WVZA 2D43A 3M2MA 2FMYA 2ET1A 2VCMA 4IE0A 4A3XA 3VBHA 3CL1A 1QJU1 1R083 2MEV3 4N53C 4GZ9A 2ZACA 3AP7A 4RA0A 5GKAC 2JG8B 5JWPA 2A6XA 1T6BX 1SACA 3AP9A 5FYHA 2P2KA 3ASIA 4TN7A 4GH4A 3WQBA 1GFF2 4CDWA 3RZHA 5KWRA 1VR3A 2XONA 3H9AA 1PZ9A 2XG3A 1OF4A 1YIFA 3MIBA 2P3KA 4GALA 2WINB 5LA1A 5J37A 2QQVA 1UXXX 2BNNA 4IETA 3V0AA 3AMQA 4QPWA 2W87A 4SBVA 3VHRA 2RHPA 2VQTA 2WFF1 2RDQA 2GNBA 4QMAA 1A78A 4GB33 2PHXA 2W5FA 1ZBE3 2VD7A 5ABJA 2VZSA 5FPUA 3GCWA 2QQUA 3TYJA 4BIOA 3ZXAC 1F15A 4LT5A 3I49A 1OUSA 1R093 4ONUA 3LD8A 1K5JA 4M0NA 2XJRA 1IPKA 4A3ZA 4K8RB 1O8PA 5CFDB 1UL9A 3H8OA 3H3ZA 1GNZA 5D8AB 2WNVB 1NA1C 2LS6A 1SLBA 2FBEA 3VBOA 3K51A 1AR93 4WBBA 5FMDA 4LNVA 3I2GA 5EFUA 2WJSA 1U5IA 1ZZBA 3VDBA 2DFBA 1D2SA 2O14A 2GU9A 1CJDA 2P37A 1LKNA 3P3NA 3AZXA 3I2HA 5HCHA 2CGPA 4BLIA 5F3GA 3AKQA 1PVC1 2DU0A 2E51A 1C8M3 4OUEA 4WVWA 5FO7B 1RUOA 1AYM2 2AREA 3OGJA 5HCBA 1AX2A 4K40A 1L7QA 2A71A 2EF6A 1UQXA 5FZ3A 4NIDA 1RUE2 4HVRA 3AKSA 1UNBA 4X8PA 5DQ0A 3ZSLA 5L9VA 3ACGA 4QDRA 5FUIA 2WAOA 3WNOA 1VBC2 5H9QA 5IT6A 4HK8A 1WMFA 5A7OA 1OURA 4BQWA 4AI9A 5CB7A 3A0KA 3I2FA 3TEYA 4TYSA 4YM2A 3HBZA 2F4LA 4QHOA 3AYCA 5M0TA 4QX1A 4D0QA 4DY5A 5GLZA 4HXCA 3VB9A 2VUCA 4D7YA 3FUQA 5GZGA 3O0WA 4BDVB 3PTYA 2DDUA 4NO4A 1PGW2 2GMPA 4PBOA 3T0AA 2DCYA 3PVBB 2VZRA 4K21A 5LY2A 4BM8A 3RJRA 1W2OA 4CEWB 1UZZA 2WQ4A 5I0SA 1VBA1 1I5ZA 4EWEA 3VZKA 2IZWA 5FQ0A 2VZVA 1C28A 5LA2A 5A7WA 4RQPA 1GP4A 3SXWA 3KSCA 1Z78A 5GZDA 4LHLA 1VAVA 1ASJ2 1VBB1 3O7OA 4MHRA 5FPVA 4DY3A 1C3HA 3VBRA 5D2AA 4NE9A 4QPGA 5LRSA 3ZKYA 1LGCA 3M70A 4GD4A 4YG3A 5GLVA 1FV3A 1NG0A 2X5IC 3GCXA 3IBMA 4JGZB 5A6YA 5J1XA 3B9CA 1YLLA 3NJYA 4M3CE 3ZXJA 4Q4W2 2WO3A 3I2DA 5FZLA 5FZ0A 1N1YA 2Y0OA 2FZ2A 1CPNA 2JDNA 4PIZA 2R0HA 4YM3A 3LPFA 1OA3A 1N3OA 3G7DA 4O65A 4AF9A 2D3RA 2K46A 1RHI2 3N35A 5JZGC 1GICA 1XSRA 2EIBA 1ND2C 2DCZA 2HYKA 3RSJA 3ZYHA 3HT1A 3MV11 5APAA 2WS92 4XETA 2CL2A 2GC2A 1HRI3 2VY0A 2D3PA 3EYPA 4QT6A 5LASA 3RMXA 3H3UA 3BKZA 4UXAA 3UL2A 4M3CB 4CP2A 2J1VA 1JZ5A 4P9WA 2WNEA 1PZ7A 1AYN1 1WA6X 1VB4A 1WW7A 4RFRB 2VAUA 3LA3A 3BCWA 3UT0A 1U5XA 1W3VA 1RUG1 4Q4Y3 4PLNA 3D82A 3E5UA 4HN0A 1PX3A 4FOQA 4L0PA 4MGZE 2QUOA 4XIOA 1XPWA 4YGCA 2OZJA 3WDXA 3WNNA 2LROA 4LO4B 1POV3 5HI0A 1V6LA 1DU3D 2KR2A 3K4AA 4HONA 2W52A 4XUOA 3ZYBA 3IAPA 4MGYE 3VKNA 4IEOA 3E5QA 1C4RA 1H8TC 5FYZA 4HSLA 4NRQA 1VJ2A 4LEJA 4EN0A 4KG0A 4YW6A 5FLIA 5A70A 1JBCA 4EQVA 5EIYB 3ST7A 1WMEA 3WDTA 4MADA 1PO11 1B35A 1DQ4A 3HEIA 4JQRA 4LITA 4Y22B 3AMNA 3THTA 4Z2WA 1UZWA 2VUJA 5AFBA 1E5SA 2YYOA 1FNZA 4Y24A 3S5QA 2KXLA 2AYHA 1SBFA 1SLTA 1ULDA 3B69A 4YLZA 2BOIA 5EPAA 5FY0A 4OI1A 3WF0A 4E4ZA 4URAA 2XQXA 1ZRFA 1BXHA 3ZXKA 1KJRA 4BQ4A 1RUJ2 1MS0A 5JOXA 3WEZA 4D6RA 3ZN5A 5GALA 3OPTA 4P9LA 4S2FA 1JYXA 1X9PA 3RYKA 4YVSA 4CUGA 1RUH2 3BB6A 2R49A 3NRUA 4U2AA 2CY6A 3WHUA 3TBDA 3AC0A 5FZAA 2P6CA 1D7PM 1OVPA 3WDVA 4BOWA 3KV9A 4WM8A 5CZKA 3ZR6A 4CCCA 1RMU3 2HLEA 5JIUA 4L99A 4Z2AA 4CZSA 4B8EA 2R7EB 5C7GA 3LQCA 3PNAA 3KWVA 2ILMA 2CHHA 2WT1A 2DVDA 2RS32 1O59A 3ENRA 3HIFA 1AL22 2QQJA 2ZHNA 1COV3 4QKBA 3BUCA 5FP9A 3KS7A 1DYPA 2Q8CA 1LCLA 3WF3A 1AYM3 3KCYA 4NWWA 4EROA 2YB7A 1CAWA 1HQLA 4RGAA 3T3YA 4UWDA 5K0UB 1OQEA 2AUYA 3I59A 2XUMA 2WFF3 4R52A 4Y20B 2Q1MA 1CVNA 1HN1A 1H4HA 1CONA 1UKRA 2XL7A 1UYZA 4YGDA 1W6NA 5ABJC 1BKZA 2VU9A 4INDA 1UCXA 4HLTA 2VMCA 1ZZ7A 1KEXA 3ELNA 4QKDA 3ZKUA 3NNLA 3KV4A 3V65A 4QPIB 4TZDA 4YG6A 3WP6A 2YC4A 2Z4FA 2GDFA 3UKTA 4I0BA 5BNOB 3H50A 3MGUA 4NHKA 4CE8A 3WF2A 1PK6C 5A32B 3VBOC 4F7ZA 3R05A 3CO2A 3KV6A 4CUBA 1XOYA 3FHIB 4RR3B 5F3EA 5A33A 5L36A 1JZ7A 1KQRA 2J1SA 1UY2A 1OXCA 1YFXA 5A3OA 1OOPB 2PTMA 4COYA 3P5BA 2ID4A 5C4WB 3S57A 1YQCA 1BZWA 4BCUA 1XNCA 3ZLIA 1A6CA 2VNOA 3AX4A 1LECA 1QNWA 1XU1A 5E8AA 2AGSA 2JEMA 1PMHX 2OZ6A 3ECQA 1YHFA 3M3EA 3OD0A 4FPGA 4L92A 4AEDB 5DUXA 4XEZA 2ZTNA 3ZOIA 2D44A 4YZ4A 1BEV2 4CRQA 1GZCA 3LDBA 3LFMA 5DN2A 3NVCA 1RUF1 3AFKA 1CZVA 2ZKNA 3POIA 1D4M3 5FIXA 1DGRA 3OG2A 1W9FA 1LRHA 2BVVA 4Y1ZA 1WW4A 3KF5A 3SCGA 5IFPA 2W3JA 3MW4A 5E88A 1NLQA 3LOIA 4CDXC 4JGYA 1MZ5A 5C3RA 3VHNA 2YC0A 4GKYA 4YZ2A 1FAYA 1UW8A 2C1FA 1NZCA 3BPSA 3M3QA 5LBFA 3TB0A 3MYXA 2XBO1 3DYMA 2WAAA 2G9GA 3IMMA 1LOFA 1OUXA 1TE1B 4XHXA 1WZXA 4N53B 5SV5A 2GMMA 2EAKA 1OD3A 1HQWA 4MSVA 3VGIA 2RG4A 1YC61 2R32A 1OH3A 3JBG3 4RQPC 3RWNA 5C3OA 2RS52 5KHJA 1CX1A 1H30A 5IVBA 2VMEA 3VBRC 1OPMA 3ES4A 1ULGA 3KHBA 2EICA 4M3CF 1C8NA 1S2KA 3CIHA 5LATA 1OF3A 4RD7A 4CDQA 5CBLA 1AX0A 4Y1XA 4JCKA 2NYYA 5FOJB 1DQ0A 1FYUA 3KGZA 1DYKA 1PHMA 2VTFA 3POGA 5F5CA 3TN92 4G4FA 3NL1A 1JUIA 1MZFA 2NZ9A 2WN3A 4PDWB 2VQUA 4CP9A 3MF9A 4QX0A 2OKXA 3M3CA 2HWF1 4XZUG 1SQ4A 4BK5A 1HW5A 5DDJ1 4IEQA 2XJUA 4NOTA 3J4UH 4JRAA 3FC0A 3THPA 2WA3A 3MIFA 1SDWA 3CJIC 1P8JA 3C3VA 5FKBA 1NXD1 2P3IA 5DUUA 1XE7A 4COWA 1W8WA 3B01A 4KWLA 1W03A 3ME2A 3O12A 2ZEZA 2HKXA 1QXPA 5H9RA 1NA1B 4QXKA 4MZUA 5DG2A 5FPAA 3MEPA 4HN1A 3WNMA 3GBGA 4YGEA 1SMVA 5LW9A 4HG6B 2VO5A 4QX7A 1UZ0A 5HCFA 1JOPA 2BVBA 3USUA 2QZ3A 3O1RA 4YZ5A 4FFGA 5KC6A 5FZHA 1RUJ3 1ZREA 3KLSA 2Y6LA 1ZBA3 1FPN1 2PYTA 1LODA 2A3WA 2R072 2VBDA 2WNUA 5L9RA 3W20A 3LEIA 2WWSA 1UX6A 1VE0A 1RUH3 1ZZ8A 2XOMA 1RJ8A 1TQ5A 2O0OA 4Q4X3 5KHGA 3ACIA 3OPWA 1W0PA 4QU1A 1UKGA 3SITA 4QPYA 5C8CA 4X8NA 5A7NA 2VVEA 5HXMA 1LOGA 3KT1A 1O4ZA 5EJ3A 3HMYA 1K3IA 3UJQA 5IVCA 4K6BA 3C2UA 4NRMA 3LCPA 3KV5A 4UT5A 2BBAA 5FJHA 3T2TA 3WR0A 1YRZA 4DQAA 1AR62 1B35C 4O9EA 3FE5A 2OX0A 2ZEWA 4KBBA 4NROA 5BUVA 3CQOA 1OA2A 3ZFEA 3K77A 4HKWA 2DVFA 1UU4A 4XFAA 5ERLA 2R062 4P9XA 4CPBA 3Q8CA 3JD71 3LOBA 1AL0G 2NMOA 1UWWA 1UXZA 5ACA2 2X05A 4W8JA 1UPSA 1RC6A 2HWB1 4A6OA 1GQPA 1PIV3 1O3RA 3RYPA 4K20A 3WVJA 1JYIA 5CFCA 4A6SA 4XE9A 3WHTA 4ASLA 3NAPA 1EYBA 5DUWA 3M4FA 1W9SA 2GC1A 4Y1UA 4AVVA 2X5IB 1GR3A 1W9WA 4E8DA 4P02B 5FV3A 2CSGA 4AFDA 4MXVA 1S0DA 2OUJA 4YW5A 2WC2A 3JU9A 2HWE1 4FFFA 5IVJA 1AR81 4FPEA 4LO6B 1EV13 4F83A 3CDZB 3O14A 2QQKA 2ZX4A 5JZGB 1BYHA 1OKOA 1JHNA 4HKLA 1RYYA 1ND2B 5HXVA 3ES1A 4MXWB 5LY1A 4A7YA 4QXHA 2D6PA 3USSA 1WCQA 4OMCA 4ZS3A 3LFIA 3DECA 3AVRA 3R6SA 3POEA 1NKGA 3U75A 1LHOA 1UAIA 1W6PA 2IUWA 3OB8A 3LWCA 4TWTA 1ACCA 4RS5C 4LUMA 1US3A 1IKPA 1CWPA 1H1IA 3N9QA 2A3YA 2A70A 2BDRA 4KL1A 5IYYA 4IERA 2RJKA 3OEAA 4YFWA 3FBMA 3HR9A 4IE4A 2WN2A 4XAAA 2E63A 2WSVA 2FQPA 2J7MA 3VD3A 1E57A 3J8F2 1RXGA 1QJX3 2JKBA 3TOJA 5AC91 3IDEA 4K1YA 1N1TA 3LSEA 2D6KA 4YVWC 2P5BA 3JQWA 3WD5A 3I97A 3E1F1 2CWSA 4D7SA 1CAUA 1PO23 3VKFC 1Y4WA 1GZWA 5DAQA 4XDOA 1A3KA 1H8TB 4HFSA 4Q0VA 3VBFA 3WP5A 1DBNA 1H9PA 2DVBA 4AWDA 2XUEA 2DCTA 4FOVA 5JXJA 4LK7A 2RS53 4XFIA 4E8CA 1AXZA 2W46A 2W68A 3IDAA 1R082 2J42A 2MEV2 3PIGA 3OGRA 4IV1A 4B29A 5AFEA 1LHWA 5BV6A 5HBAA 1NT0A 3H8XA 5F37A 4KQ7A 1AR71 2CU5A 3WF1A 3GXUA 1S2BA 4XDQA 1KD7A 4RSUA 1QOSA 3WY6A 5FPZA 3RZGA 5J7MA 1JYCA 2LW8A 3HN1A 4UW5A 4FPOB 5FPLA 4Y4RA 2BEOA 3AVSA 3POYA 1D0GA 2RR11 4ZZ8A 2WO7A 5EJ1B 4JGYC 1H0BA 1UZYA 1W9TA 3BOWA 2UU8A 2GNMA 4ZPIA 4BWOA 4I0WB 2JE8A 1UF2C 2A7AA 2XJSA 4Q4V3 3DUIA 1AX1A 1ULCA 4B4QA 3VBHB 1JYNA 4GB32 4BLJA 3AMMA 3VLBB 1ZBE2 5I8SA 1EAH3 3KGLA 2E32A 4FFHA 2C9KA 4RFT0 3NJXA 5GJ6A 2EXIA 5LEJA 3VDDA 2VL4A 4GH4B 1HV1A 4CDWB 1R092 1IQDC 2C24A 3NJZA 3GHMA 3VZMA 1TMF2 3OBZA 1L7RA 3ZSMA 1W8NA 4DXTA 4CDQC 3ZXGA 1Z0HA 4CU8A 5DUVA 3J7LA 2PLV1 3SH5A 1XQNA 1SLLA 3MLKA 5H9SA 4QB1A 4QDSA 1ZZCA 5F5QA 3V0AB 2XLAA 1HB3A 3POSA 3WF4A 4CU7A 2YPDA 4YG0A 5CAZA 1RUNA 3I54A 3RWKX 1C8M2 1WW6A 5HPOA 3D3AA 5L9BA 1W6QB 3JCIA 4LLOA 3ZN4A 4XZPA 1WKYA 1J1LA 5ABJB 1BK1A 3O0VA 4XJUA 3LA7A 2LTNA 3T30A 4QKFA 5JXGA 3ABZA 3W5MA 1DYOA 4QQOA 2N7GA 1W8HA 2RMU1 2P3JA 3ZYGA 4C1XA 2VMIA 1UU5A 3HBKA 2FMDA 3IB3A 3IT8A 3PDQA 5ANQA 5JSPA 3BTYA 2HWD1 2BTVC 3IAQA 1PK6B 3VBOB 4BISA 1Q3EA 2V5DA 1HRV1 2R063 2Y6FA 2PAEA 2RS11 4BE3A 4CXWA 3O1UA 4MGIE 4AVTA 4UW6A 1RTVA 2C26A 2BOJA 4ATFA 5EXOA 2VZPA 3KCXA 3MFCA 4UFJA 5DZGA 4DFSA 2EA7A 2DUQA 5EZWA 1GKBA 2RJLA 4L2NA 1ST8A 5FP7A 2Y38A 2XPJA 4PHZA 3E6BA 3HWJA 2OQ6A 3LA2A 2W94A 1K5MA 3AYAA 1VBD1 3K48A 3NMBA 4HVOA 1WA4A 3B5LB 5C8CC 1ZA7A 4AYUA 5FZKA 1O3QA 2G9ZA 3PUHA 3OBAA 1BBT1 1IZ3A 2JDMA 2YGLA 5FOBB 1UN1A 4XFGA 1V6IA 1VBE1 2IWGB 5FYUA 5T52A 3EHKA 4ZZ5A 3VD4A 3ZX7A 1ALYA 3BN6A 1IS4A 2Q1FA 4D8MA 4FP2A 1W6OA 5FFOC 1VRBA 3GZUC 3THCA 2Z69A 1LAJA 2R041 1MVEA 2DCKA 5FZ7A 1C57A 4OMDA 1YQ5A 4KWUA 5FQ0B 1POV0 2WT0A 1O6UA 2IXCA 3POFA 1MEC3 2VXJA 4RQPB 3PJYA 1NCRC 1HB2A 1V9U3 2ZOEB 4QGMA 4D3WA 2OQ7A 1CESA 1RVF2 2QJVA 4QB6A 1HRI2 3NAPC 2J1TA 5FLJA 1JHJA 4OHZA 4XTMA 3VBRB 3ZYRA 3OPZA 5KBFA 5IJRA 3AYDA 3FN9A 4XJWA 1KS5A 1ZRRA 3INAA 4P00B 3F2ZA 3UV9A 4AHYA 4COUA 2G9FA 3EO6A 4AR2A 2W92A 3K46A 1QH6A 4KWKA 1BQPA 1H1AA 1S1AA 5KC5A 3AJYA 2YU2A 2HWE3 3VZJA 4UF0A 2DCJA 3SKJE 2EXJA 1FMD3 4Q4Y2 3D0SA 4YWAA 2ZGOA 4R9BA 3EMRA 5C9AC 3MIEA 2VMDA 3OUIA 5FP8A 4XF9A 2WNOA 5FZ1A 2PA7A 3KMHA 1AXYA 4AI0A 3CJIB 2RE9A 4BQ2A 4N9HA 3VD5A 5LA0A 3UNPA 2EXHA 5IHRA 3O1PA 3ZPYA 4RHV2 2VW0A 1OSGA 4DINB 3OEBA 2FCUA 4CCEA 2CGNA 4XMAA 3FHQA 2F6BA 1LB2A 4MH0E 2DBIA 1RUD1 2WYSA 4OYUA 1XNKA 1STMA 5DXDA 5HV4A 3KQ4B 4XPVA 4D94A 2V5YA 4K9SA 3K75B 4LKSA 4BJ0A 1JMUB 2W91A 4W6WA 2XVGA 4GIQA 2DV9A 4H55A 1CX4A 1N47A 1SZBA 5FCCA 2K2SA 3RQ0A 1W6MA 4XACA 3KZ4C 1LOAA 4UAPA 3MW3A 5JUVA 1OA4A 3WQ1A 2YG0A 4KGGA 4Y5TA 2PELA 4N7IA 5B2GB 3DGTA 3WDYA 1SEFA 1KXGA 2VZ3A 4PDWC 3VL9A 4ARXA 4ITCA 4LMFA 4MX3A 4E2SA 2Q5TA 1SFNA 1IS3A 4Y26A 3IDBB 3SQOA 1Y9QA 3RG0A 3ZYIB 3O1OA 1QEXA 5CVRA 2H6BA 4XUPA 5JMCA 4TLFA 5F32A 3HVDA 3ZM8A 1S0IA 4AFMA 4BB3A 1QJFA 1QJU2 1J58A 3CU7A 4TXWA 2WZR3 2ETEA 1B35B 4IV1C 1S55A 5F5AA 1TMF3 4I2OA 1AR73 4CCJA 5T50A 1RMU2 1QQP3 1YNAA 1IS6A 4P5YA 2Y33A 4XDPA 1VAMA 3PUSA 1NLRA 1XJAA 4LTAA 1RUE1 2YROA 1IQAA 1COV2 1HXS3 1RUI3 1Z7S3 2AEYA 3PL0A 2PHDA 4B7EA 4XXPA 4A4AA 1VBC1 1LGNA 4EZ4A 4R4XA 4OHXA 4XILA 1EPWA 4IESA 4AL9A 1GSLA 3HQXA 3RZMA 2AENA 2Z42A 4FCAA 2WFF2 4R4ZA 2B5HA 1RL3A 5FK7A 1TNRA 4MG2A 1C5HA 1UD1A 1QU0A 1DGLA 4I02A 4XF3A 2GN3A 4GXLA 1DCSA 1Y9MA 4PLOA 1FXZA 3M3OA 1PGW1 1ZYBA 2WO1A 2FCVA 4P5HA 3VDDC 3WLUA 2XR4A 2WO2A 1Q5OA 2PXJA 2GMEA 3DPRA 4LIUA 3JB4C 2ZJCA 4QQLA 2ADDA 4IEWA 1KJLA 3S7IA 3U10A 3ZIWA 2E53A 3HAGA 5I0RA 5A1AA 2V73A 5DAWA 1J84A 1ASJ1 2BRTA 5L73A 4D69A 1CAWB 1GP5A 4XF4A 3M1HA 3I59B 2X29A 4ZU7A 3BALA 3PURA 3LIHA 4YW3A 1PVC2 4EN7B 4WM7A 1B09A 4ZXEA 1HX6A 3ZR5A 1OQDA 3F95A 4RS5B 3VZOA 1S0EA 4MUVA 4Q4W1 2GH8A 4WZFA 3D0JA 1A34A 4FQZA 2KA3A 3N9NA 2WQZC 2BPA2 2HEVF 5FYVA 4CSWA 2IC1A 1G9DA 2XH6A 3SKVA 1D0HA 3U4SA 4AVCA 3VBSA 3QBQA 4XURA 1RHI1 1PX4A 5DPNA 2YXSA 5A3UA 5FKCA 1D4M2 1QJY3 4QM9A 4EJRA 2XQRA 1JZ8A 2WZEA 1WWYA 1BVVA 2WA4A 2WS91 1MQTA 2WBKA 4BQXA 2J1UA 4NJ4A 1ND3C 4YM0A 4YVWB 3RJ2X 5A33B 1ENRA 4GMP3 2W47A 3ILFA 3UK9A 4IE7A 5C33A 2TEPA 3OOXA 4GWIA 5FZIA 1TME3 4X6RB 3RS6A 4AGVA 3LZZA 1DGRN 4OI2A 4HPKA 3B7MA 1RVF3 4YYOA 4XUTA 4CU6A 5F7UA 1QKQA 4XBLA 4FPHA 1YIPA 2ZHLA 1NOVA 4KBZA 2QQIA 5FAXA 1UIKA 3JBG2 1K5MC 1XYOA 2IXJA 3CJXA 2E33A 2QQLA 4OHVA 5A3PA 2XMLA 1W28A 1RINA 2BYVE 3RNSA 3C7OA 4GA9A 4IV3C 1EUTA 4JVAA 4UBHA 2BW8A 1LU2A 1R1A3 2QCSB 2RM23 4H7LA 4HZFA 5A7QA 3ZXDA 3V0BA 2J1EA 2HWC1 3TWIA 4G9SB 4JGYB 1X7NA 3T4VA 2VCAA 3FLRA 5J36A 5J48A 2VQAA 2ZAHA 2CDOA 1VMHA 4IEZA 1G9CA 4RHV3 1LEMA 3SHRA 3SLIA 1G7YA 4KH9A 1NAEA 1V6NA 2UYAA 3IN9A 2VPVA 5FZOB 1BMV2 1OLME 2UWAA 2W2IA 5F39A 4DMIA 2JDKA 2Q1ZB 4AHWA 3BIEA 2Y26A 2P4EA 3WINE 4Z1VA 1JUHA 4IXLA 2PHRA 4IUGA 4MYEA 4O7XA 5I91A 1CAXA 4ISQA 1LULA 2WT2A 4JTNA 4YFZA 2ZS6B 3EQEA 2EXKA 4CDQB 4FFIA 2XHKA 4Y1VA 2NQYA 4W6XA 4WZCA 2W39A 1JU3A 3WNKA 5KHIA 5A1LA 4N9IA 4F3JA 3VL8A 5BXXA 4XMIA 2A6WA 2PHLA 3BVCA 3LB9A 5FZCA 1ZBA2 5E16A 3ZMOA 2K0GA 5C70A 5CKMA 1VALA 1VRH3 4LE4A 3J7MA 1O7FA 4Q4X2 4BQYA 4Z82A 2RS31 1QJU3 3VBHC 2G4IA 4NHMA 1AL21 2GSYA 3WG3A 5L7OA 5FP3A 2VUAA 2WNVA 1RUD3 2FZ1A 3CKHA 2BV4A 3WXPA 4UW4A 5FZ8A 3VD7A 1WMDA 1GP6A 4N90A 3TRSB 4GH4C 2I07B 4UI9L 5FLHA 4CDWC 2YDEA 5C8WA 5IFTA 3T09A 2XJPA 3USUB 1RUC1 2V4AA 4CCOA 3WQ0A 2TUNA 1N1SA 1NY72 2VW2A 1G9FA 1J1TA 1O91A 2ZABA 5FXWA 3R4UA 3DXUA 1LR5A 3N7MA 4JX0A 5GZCA 4LLFA 2VOTA 1F5FA 4CDUA 1YCIA 3AXEA 4AGRA 5BNPA 1J3RA 4BYYA 4IGPA 4NUBA 4PIXA 2GN7A 3ALQA 5FMBA 5AVPA 1VPHA 2YMZA 1PIV2 2PHFA 3AM2A 3LF7A 4FOYA 1XNDA 5C8CB 1JZ3A 4C91A 2JDHA 4MLOA 1C1LA 5FY4A 4TSVA 3O1MA 2E9QA 3NV3A 3BU7A 4XJ8A 3T1MA 3J7HA 4XXAA 3AL5A 5FY7A 4LA3A 3A0NA 1AJOA 2OS2A 5IK5A 4LBQB 1QWRA 1UOFA 2Y6HA 2K9ZA 1EV12 4HOOA 2FDGA 1H1MA 4CEWA 1SLIA 1NXMA 4CTEA 4EWDA 4CCMA 1PVC3 2X09A 2XLGA 1YYNA 1TVGA 2BFUL 1BEV1 1CAVA 2IXKA 3DEMA 3J7NA 3Q8EA 1HQNA 3H1YA 2WQ8A 2VXRA 4Y3OA 1QOOA 3A7QA 4XFCA 1MS4A 1NCRB 4LBLA 1O5UA 4NAMA 3K2OA 2A3XA 2CAVA 2WLQA 3NAPB 3WDUA 2BNMA 5FDBA 3ZMNA 1H6YA 1US2A 4AFCA 5A6ZA 4JGZA 4NIAA 2QZ2A 4AZZA 1LJ7A 1QF3A 2JJ6A 4AHZA 3M8LA 1CZSA 2FCTA 1AXKA 4DXRA 2FDKA 4P14A 5JXHA 4E4SA 3DPRC 1YJLA 2UWCA 4Y33A 5C9AB 3HD8B 2VGDA 3U11A 1EP0A 4AEJA 5FTTC 1QJX2 3RFRA 4XBNA 3NV1A 1ULPA 3SCFA 2ET7A 2Z2SB 4M3CA 1PO22 4DIQA 5FYTA 1VBA3 1FOD1 2WR9A 4WM7C 5BNNA 4HK9A 2ATFA 2W08A 4QGNA 3TN91 1VBB3 1A8DA 1D2QA 4Y5SA 5FYBA 2D6NA 4QPGC 5LBBA 3S30A 5B4NA 1PM7A 3HNYM 3RPQA 5EV7A 2G19A 2WYFA 2J22A 2OUHA 3SEPA 1CIYA 3ZSEA 3VBSC 5BYNA 3RI8A 4K8FA 3GJBA 1IGOA 2XL9A 2B45X 2XVKA 1LOCA 1BLZA 4ZKTB 4WVMA 2VQ0A 3UKVA 5FMOS 4OFGA 2Y6KA 3RZJA 5JOYA 4FO9A 3KM5A 1CAUB 4KI5M 1GZWB 3U37A 3C7FA 3U14A 3OGGA 4QU2A 4Q4V2 1REEA 5D21A 4Z8BA 2XBO2 1H8VA 2ZAAA 4FOWA 5LK5A 3VBUA 3MFAA 4IV1B 4OZOA 5EHDA 3MIDA 1EAH2 1QH7A 3DXTA 4EE2A 1POQA 2SBAA 1LEDA 1AYN3 1BK0A 4LPLA 2R071 4OQ8A 1VIWB 1UMIA 1X33A 3N9OA 1UO9A 3AKTA 1GYKA 1VB2A 3KD4A 1OLMA 1RUG3 5IUQA 3OYWB 2E26A 2ZMNA 4MGSA 5CIRA 4UFLA 3VHOA 2JG9A 3MUZ1 1H9WA 3B00A 1W2AX 2G1MA 3H8RA 4NIGA 4D7TA 5AVAA 1MPXA 2EALA 3NKTA 2D6MA 4C1WA 1XBFA 4MVTA 3UGGA 1AR61 5LB6A 3CF6E 4JDOA 4CVUA 1JI6A 5CADA 1BJQA 3D5OA 4YM1A 4XFBA 3QLQA 3KQRA 5KXCA 4CCLA 3VDDB 1DIWA 1ULOA 1S0CA 1JN2P 1PGL2 4N7UA 4CEYA 3HPNA 2GC3A 3LSDA 1PO13 3ATGA 5FZEA 4D6SA 1VAKA 4CP1A 2W95A 1MVQA 5ACA1 2CAUA 3POWA 2ZGRA 3CNAA 5EYYA 1S2EA 4AHXA 3LE0A 2RJ2A 5H9PA 2D93A 1LU1A 5I93A 1LESA 1X8MA 3C7HA 4ZS2A 4ZU5A 4OULA 2JICA 1KFUL 2BP6A 3DF0A 2A75A 3GJAA 4IQPA 2UWBA 1FPN2 1ZNPA 1FATA 1SPPB 3LIGA 3LAGA 5E6HA 1QXRA 3NW4A 4YPJA 3OD4A 4YVSC 4LHNA 3ZN6B 2HEYF 4MGQA 5F6LB 4BK4A 1DZQA 1IG0A 3DL3A 4IEXA 2JX9A 3RVHA 2KM2A 3X29B 4WM8C 3CEWA 3NNFA 4AOCA 5A32A 1EY2A 2TBVA 4DO0A 3RDIA 2XXZA 2SLIA 5IVYA 2E6VA 3MICA 5IK7A 3H1MA 1ND3B 4F8AA 5C3QA 1OOPA 2ENRA 3OCPA 4NMIA 2R1DA 5C4WA 1LOEA 3G6JB 1ENSA 1RGSA 2WL1A 2X10A 3CZJA 3U0ZA 1ZX5A 2EIGA 1R64A 3RGBA 2VOWA 4CDUC 3BTAA 3JD72 3L2HA 3T0BA 5BNPC 2ZGNA 3IPVA 3IM0A 4JV4A 3PU3A 4EN6B 1N3PA 2R16A 4NN0A 1SFYA 1K5MB 1MEC2 1WBFA 3J8F1 1FT9A 4QGLA 1V9U2 4GJZA 4BU2A 1SG3A 3GALA 1UIJA 4YNIA 4IV3B 3PVEA 3B9IA 3ZO0B 3VZNA 5T3NA 5LWBA 1IOAA 1WLWA 4ASMB 5C3PA 5T5OA 3VV1A 1W2TA 3ZSKA 4M01A 1S0JA 1W05A 3ILRA 2HWE2 4B7KA 4AVAA 3WZ1A 4HSJA 1TEIA 4FVVA 1FMD2 1F4HA 3KT7A 1WUVA 4AVBA 1R081 1XXNA 2MEV1 4N53A 3DYOA 4LHKA 1XB9A 4XVHA 2ORZA 1J3PA 2Y8KA 2XWJB 2EIDA 2B42B 1DLCA 2B4KA 3ETPA 2WLPA 4LORA 4V2VA 1REFA 3HT2A 4XBQA 4COVA 4QB2A 3RZLA 4DB5A 5C3SA 3UYJA 3WG2A 4HVQA 4A41A 4I01A 1REDA 1RB8G 4JKMA 4WV8A 3IZOA 3KVAA 1RUF3 2JDUA 4QHBA 4URTA 3VKLA 2B9VA 3HJRA 5K4LA 5CISA 1PMJX 3MDPA 1GOHA 4GB31 3ZXFA 1JU4A 1ZBE1 3OTFA 5FUNA 3H7YA 2CGOA 4CP0A 3FX3A 2B9UA 3JZVA 3W21A 5AC92 5FRAA 1O3SA 4IEPA 4AEMA 4LR4A 1YI9A 1QJEA 1R091 1WCKA 2J1RA 4XIKA 4UBGA 2XBO3 4N43A 3T0DA 3N9LA 1DZRA 2DVAA 5F9TA 1BHGA 4JKKA 1LOFC 1ENQA 1O5LA 3MHZA 5JSOA 4YZ1A 1NA1A 1DLLA 3C7GA 2E7AA 1XE0A 1AR91 4DXZA 3NWKA 3VN4A 2D3SA 5F6KA 4GKXA 1IKQA 2O1QA 2WZR2 1APNA 2PHTA 1UY4A 1CZTA 3V56A 1RITA 3PVOA 1W0OA 1C8M1 1AR72 3QH7A 4FAGA 1W6MB 2WWUA 1QQP2 5EQUA 2TNFA 4KU7A 4LKFA 4E2GA 5FWEA 3OGSA 2ZGQA 3ZIXA 1GU3A 4Q2FA 4ES9A 3S5AA 2HWF3 3Q8BA 1HXS2 1Z7S2 1RUI2 3K4ZA 4IW3A 4L11A 4XAEA 4SLIA 5DDJ3 4R9AA 1V00A 5IVEA 1EUUA 2WZ8A 5T54A 4C90A 4LBQD 2GNDA 2C5DA 1GWKA 3O0XA 2ZMLA 4H2AA 4Q1PA 1HDKA 2GP3A 4PQ9A 4XJ9A 1F31A 1J3QA 2QQMA 4XF0A 2ZGUA 3RRDA 5DAVA 2X8KA 1SHWB 3VBUC 4DXSA 5KR7A 4J1XA 4FPFA 5F3IA 1QY4A 4Q0UA 3WW2A 2WRAA 1QDCA 1YI7A 3AMPA 1GOGA 2D5FA 3ACHA 4LBOA 5IW0A 2F17A 5C71A 2B46X 1YQ8A 2XJVA 3WW4A 1CN1A 3AZWA 4DRRA 1UMZA 2JG9C 2PLV2 3ZFFA 2W9XA 2ARAA 2D98A 1FPN3 4JHZA 2VBBA 1NZIA 2WNUC 4ARYA 3MIHA 1X9TA 1Q8SA 2RDNA 3UGFA 3FLPA 2C4XA 4GMP0 4YARA 4A42A 4DUVA 2JDZA 3DKWA 3LDKA 3J9SA 1AJKA 1U5ZA 1WLCA 2X5IA 2WKKA 4EWAA 5J96B 2ZMKA 3I2JA 3AKPA 4LQRA 3NV4A 4XHBA 5JR7B 5FZFA 1W3XA 2D40A 3WUCA 2JD9A 3PMEA 4DOUA 2GP5A 4PLMA 2WZPP 2W1SA 3DPRB 4CEYC 2VNGA 4LO8A 1GV9A 1OQ1A 4YW7A 5JZGA 3PU8A 2OVUA 2CWMA 1ND2A 2HWD2 1QJY2 2WIIB 4U36A 3ZFEC 2XLFA 3QACA 1DF0A 3TNPB 3MPPG 2WSUA 1JZ4A 1XNBA 4XQWA 1HRI1 2RS12 1X50A 3AP4A 1JOJA 3JD73 3N3HA 3VKOA 2ZGKA 4JC1A 3HNMA 2UYBA 3WNXA 4WM7B 5FMCA 4E27A 1TME2 1CPMA 2HWB3 5A7WB 4FXGB 1UOBA 1MZ6A 2VUDA 4XJZA 1YQ6A 3WNLA 1W8OA 3T4HB 4QPGB 4P9JA 4Q4Y1 4XW3A 3HOBA 5A3LA 1W8ZA 4XFHA 3GHNA 2VULA 3DV8A 5GZEA 3VBSB 1RJ7A 1V6MA 4BQ3A 3OF1A 4DUWA 2VZQA 3WG1A 1NLSA 1POV1 2LALA 2VMHA 2XWBB 4AAXA 1K42A 4FPYA 1V6JA 2ZEYA 4UW3A 2RM22 1AR83 1R1A2 1GNYA 3MV01 4W4ZA 2DF7A 2ZCWA 1GWMA 4M4RA 1DQ2A 4BXSV 5K7PA 4CA9A 2HBUA 1C1FA 3T2OA 4PI0A 4FPCA 4FBFA 1KDMA 2O8QA 1HJGA 1XRUA 3HNBM 5KXBA 3A4UA 4XOGA 4Q26A 3CBNA 5C5UA 2DUPA 1W8FA 5ANNA 4S2GA 1UMHA 4EN9B 1QOTA 1YFWA 4P08A 4FPLA 4I0AA 4AQSA 3FHAA 5IAXA 4QQHA 5K8SA 2LUWA 3N4MA 2V09A 1U0AA 3H42B 4DEVA 3VDCA 3LEMA 5JOZA 3WOGA 2GZWA 3P3PA 3BI3A 3WV6A 2YUEA 1MS9A 1CD3G 4FT8A 1W90A 4OI0A 2L9LA 5FJKA 2V4VA 4RL7A 3OJBA 3WX5A 4AW7A 1AVBA 2VOVA 1JW6A 4LJHA 5I8YA 2DBNA 4AI2A 5AC93 1G9BA 1KGYA 3GZAA 2YC2A 5CU1A 4NPLA 4L8QA 3B3QE 3ACLA 2YBPA 3RMYA 3CHXA 1GNHA 3IMNA 3D4KA 1RMU1 3H8UA 2R30A 4LBMA 3I7DA 3VBFC 2VOXA 4META 1VRH2 3RZZA 2VG9A 3RI9A 1NCQA 1Q8QA 3GDBA 4GULA 5J3UA 1MZEA 2NMNA 2JIJA 5FBZA 3BPZA 3AXDA 4J25A 1CAXB 5CFCC 2YFZA 1COV1 2YBKA 2VOKA 2ERFA 1RUD2 3ZYPA 4OHWA 4CXXA 1AYM1 1BVP1 2GALA 3WG4A 2NP0A 4QX2A 3MZHA 5CA6A 2VVFA 2ZZQA 2JXAA 2KD7A 5EWSA 1ODNA 3NNGA 1UY0A 1HB1A 1XC6A 4E2QA 2IXIA 1W6QA 2VVDA 1FI2A 2RR13 2YZ4A 4C0HA 1PMIA 2ZX2A 4AFAA 2VCCA 2AZ5A 5GLWA 4ORFA 3T08A 2OPKA 1I6XA 3L2YA 3KCCA 4YVSB 2Q30A 3K3OA 4RYDA 3ZDSA 1EPZA 1LHUA 2QBXA 4LBNA 4N43C 3O5SA 3P1IA 4OVEA 3U07A 4PBPA 5L7OB 1JODA 5CKQA 5A7SA 5FR3A 2R6QA 5LA9A 1CGPA 2ZHMA 4WM8B 3WUDA 1PK6A 5GLUA 5F1RA 2DTWA 3Q8AA 3AZYA 5LRRA 5JIAA 1YFYA 1H2NA 4AQ6A 4B1LA 3BTZA 3LKJA 2DYCA 2H0BA 4BMBA 2VECA 2Z5WA 5F5IA 4XYXA 3SH3A 1FV2A 2PLV3 3ORJA 4CUAA 3C7EA 3AP6A 5C5TA 4QX5A 4CDUB 3SEEA 2I74A 1CQ9A 5GLTA 3CZUA 5BNPB 1GBGA 2F4PA 1GOFA 3QD6A 4DEQA 1S4CA 5KHHA 5LK7B 1NE4A 4AI1A 2A1XA 1FX5A 4TTGA 4I09A 4AI8A 3FJSA 4LHSA 1W6NB 1YQ2A 2E7TA 2QQWA 1D4M1 4LOTA 3WSOA 4IGOA 5F3CA 2DWRA 1A8MA 2Z79A 1SBEA 3OGVA 4FPKA 3VZLA 2Y6GA 2IFWA 2Q0AA 2RMU3 1JYWA 4JAAA 4CDXA 5LEKA 4MGKE 1OMIA 3I3BA 1NYWA 2HWD3 2YV8A 5JVVA 5CG9A 1HB4A 1HV0A 2Y60A 1HRV3 1MS8A 1UOGA 2XHNA 1LHNA 1W9YA 2RS13 3R0RA 4COZA 4H14A 4LE3A 1NX9A 4PT6A 2EVXA 3THDA 1CAVB 1W39A 1J83A 2ARCA 2PQSA 3JBG1 3ZFFC 2Y64A 1W2NA 2MPFA 2UURA 3BOPA 5T55A 3CMGA 2ZXQA 4IE6A 3ZFGA 4J6GA 5A3TA 1VBA2 2MNGA 4MGTA 5CKNA 2ZX1A 2CYFA 3OY8A 3FFZA 1VBD3 2R1BA 3H3LA 4IGQA 1VBB2 3K4DA 5BY5A 5A1FA 3B94A 5JOWA 5FWJA 1LGBA 4W50A 4D6QA 2P3YA 1LNSA 1YEWA 2XJQA 4FQ4A 4RGKA 3WDWA 2OXBA 1BBT3 2IFRA 3E6CC 4GWNA 3AYEA 2XB6C 1VBE3 3NNMA 4LA2A 1BMV1 3N9PA 2YGMA 2W0XA 2B39A 3CJIA 2B8MA 4OLLA 2EAAA 1AHSA 1GZTA 2BERA 1R1ZA 3MO4A 5K9YA 2FDIA 1WGPA 2GH2A 2W1WA 2CTVA 4QXBA 2RDSA 2R043 4GJYA 5T5LA 2Q4SA 1UYYA 3GZTB 4AQ2A 1QDOA 1X36A 5DAXA 4UFIA 3N9MA 5BNNB 5FXVA 2HEWF 4CYDA 2JG8A 4W6YA 4Y5Z0 5CEHA 5CG8A 3PUIA 4HANA 3Q9OA 3N36A 2JD4A 4Y4YA 4OI4A 5GM0A 1O4YA 1HKDA 1D4VB 1LTEA 2BGOA 1DDLA 1Q56A 3FL7A 1M4WA 1RUJ1 1MR5A 4ZXKA 1ZBA1 4FSJA 1AYN2 1UOJA 4X6QB 4QWNA 1VMFA 4JDMA 3BTXA 3K3NA 1RUH1 2QDRA 4IEUA 1RUG2 4ZU4A 4CP9B 5JAXA 4Q4X1 3I2OA 1WD4A 2O8OA 1W8TA 2ARXA 4LKEA 4WVMB 4P9IA 2HWC2 4ET7A 4FP3A 4A7KA 3FLTA 3UESA 3AZVA 2YHJA 2ZKLA 2BQPA 1HIXA 3MW2A 4QX8A 5A80A 1SFPA 1ULFA 3PUAA 1UZVA 5FREA 4ZHNA 1U5YA 4PIYA 5E1RA 3I8TA 1XU2A 2WWJA 3MLLA 5DABA 3I3QA 5FBJA 2DU1A 3AZZA 3NSTA 1CJPA 3VBUB 5CFDA 3OUHA 2FDFA 1T2XA 2VH9A 1OLRA 3MI8A 1TNFA 5D8AA 1KDKA 1NY71 1UPIA 1YO8A 1OVSA 3WT3A 4AEKA 4CXYA 2D97A 3E97A 4IE5A 3W59A 3SNMA 1G86A 3Q8FA 5GZFA 4EYUA 3U78A 1WMXA 2VMFA 2YPJA 5IK8A 1PO12 1E5RA 1WCSA 1T6GC 4JKLA 1G9AA 2ZGPA 2QKDA 1YFUA 4KNCA 2OT7A 5A6QA 2BWCA 3URFA 2OA2A 3GBFA 2JG9B 1ODMA 5I0TA 4C8DA 1PIV1 4Y1YA 5HCAA 1AUYA 3I2KA 4ZY9A 1H2MA 2WNUB 2NM1A 1U12A 4Q5OA 5FY8A 5FP4A 4KU8A 2IVIB 3IKWA 5JMOA 4HL0A 2RDRA 3FUOA 3JUUA 4CUCA 3M7AA 4MHUA 3W58A 5J09A 3O1SA 5FY1A 2JDPA 5FZ4A 1ZZ6A 1DHKB 5FZGA 1NCQC 1EV11 1G8WA 1SDDB 2WDBA 1ONAA 4XCBA 4CEYB 4Z92B 1Q43A 3PJQA 2ZA9A 2BGPA 1YJKA 2BBVA 1WCUA 2VTXA 2C6SA 3BYWA 2R0FA 2OIIA 2PHUA 4A2UA 3ZFEB 2V72A 2W1QA 1S0FA 5BPXA 1GMMA 1GANA 3WP3A 2RVAA 1RUE3 4Q29A 3KHCA 1RUC2 4G3YC 1W8UA 1V6OA 4MO3M 4QKNA 1VBC3 4RS5A 1IPJA 4KWJA 3AJZA 1S0GA 4OUMA 3N7KA 4Q0QA 1V70A 1N1VA 3R4SA 5I0UA 3SCHA 1QNYA 1SLAA 3MUY1 5FXZA 1WLTA 4PI2A 4CCDA 2VJXA 2IVJA 3P6BA 1OC1A 4JRLA 1QJX1 3LGRA 1UYPA 3MIGA 3FWEA 4V2WA 2P34A 2HJIA 2B7YA 4YVWA 1SCSA 1ENXA 3ZSJA 1IHMA 2QDNA 4JHTA 5FMOL 4GAZA 1GQHA 1PO21 3WQ7A 5A6XA 2A73B 1XNAA 4NWVA 2VMGA 3QCWA 3SMHA 3WCRA 4A45A 3MF6A 2JE9A 1JYVA 3VD9A 4H3WA 2RS51 1ASJ3 2MHFA 2P6HA 5A3MA 5FK8A 4WVVA 4HKOA 1JXNA 1MS3A 3IPVB 4OUSA 4OCTA 4DZGA 5B4XA 4O61A 2CV6A 2PFWA 3AKRA 4J1WA 3GF6A 1OLQA 1W6PB 1DGWX 4R9DA 4Q8KA 2JWPA 2PMWB 1QJZA 2AR6A 3ZYJB 2OW4A 4Q4W3 4YSFA 1IPSA 2OPWA 1ZRIA 3T1LA 1H2LA 4NAOA 4ZONA 5JI9A 1Q8OA 1QMJA 4LO5B 3TEWA 1RHI3 1RUF2 4Z07A 2ADEA 2Y0IA 2BWAA 3AP5A 1OBNA 4DPNA 1CIWA 4Q4V1 3QOPA 5DZEA 2WS93 4MV2A 1UU6A 2AEZA 4QX3A 1MQTC 3ROUA 3U4XA 2YFUA 5LBCA 3C8XA 5FZOA 2BFUS 4AXOA 1EAH1 2E31A 3W5NA 2AACA 5JI7A 3VBFB 2I45A 1W99A 3WP4A 1Y43B 2YU1A 4M4PA 4I3GA 1Q8PA 4BZ4A 3UKNA 4B4PA 1ZVFA 2UY9A 4Y22A 4Q0PA 5CFCB 1OKQA 2ZGSA 4FXKB 2C9AA 3I3DA 3NNJA 5F8PA 1FOD2 3ZFGC 4AG4A 4BMEA 3O1TA 1JH5A 4QM8A 2PN5A 3TEXA 3GM8A 4LBJA 2AC1A 4O9GA 3NO8A 3ZPOA 1PVXA 3H1WA 4GWJA 4QXCA 5A3NA 1SCRA 2ARBA 2X53S 1K12A 2D6LX 4PQQA 5JLVA 2HH9A 1AZDA 1SBDA 3AMHA 2HWC3 2DVGA 1W06A 3I2IA 3U1XA 3WW1A 2VR4A 4E4HA 2JECA 2QVSB 1H2KA 1URXA 2WUHA 1YWKA 1WLDA 3PIJA 4KMQA 3VKMA 2BNOA 2BGCA 3AK0A 5HV0A 1PGL1 2HWF2 2PAMA 3D8CA 3IWZA 2J1AA 2JDAA 3AFGA 4N43B 5DDJ2 4CCKA 3POBA 4B4RA 4RGGA 5JCTA 1LOBA 1WBLA 4UFMA 3WCSA 3FFQA 1DQ6A 2ES3A 1ZA4A 2JG8C 4KG8A 5FZMA 1NUKA 5FO9B 3LPGA 1H4GA 2C0ZA 2LM3A 3HQUA 4I30A 1X8EA 2R061 1MACA 4LBKA 1MS5A 3CLPA 4FTEA 2XVLA 2PHWA 4IEVA 4NPRA 5T5PA 1KRIA 1NE6A 1PNGA 3BIWE 2XKOA 4P9GA 1OPOA 4JZRA 2VM9A 5K0UA 4UFHA 4Y20A 3V64A 2XDVA 1GZ9A 2YY1A 2IXLA 3B93A 4FPJA 1LENA 5IWFA 3KVBA 1VLNA 1I5PA 2VNRA 4AQTA 3APBA 2XGXA 2JE7A 1UY3A 3QH6A 4B3NA 2VZ1A 1QXJA 1V0AA 1O4TA 4M0HA 2ZGLA 2D7FA 4QPIA 3OSDA 2RS33 2YBSA 3VUOA 1AL23 3FZ3A 3I4IA 5CFDC 3GGLA 3EB7A 4NRPA 5FZBA 2Q8EA 5BNOA 1HLCA 5D8AC 5L7OC 5IK4A 2WNVC 1ZM1A 3AL6A 3PUQA 4B1MA 1QHDA 2A6ZA 4LBQA 1Y7BA 2QE3A 4RR3A 4UOJA 5E89A 4NHYA 5DMYA 4ATEA 1F8VA 4L97A 2P1BA 3DYPA 5KXEA 1VMJA 3FMGA 1XYNA 1RUC3 3I3MA 3ITQA 1ZRCA 4YW4A 1JZ2A 1JYTA 1OFNA 3ZFFB 2ZHKA 3ZXEA 1MEC1 1NCRA 1TG7A 4QAWA 4YRDA 1V9U1 5F2WA 2JDYA 3LDRA 5T5JA 1O8SA 2OYZA 3KB5A 2DUOA 2HBTA 2H6CA 3ETQA 3GZEA 2DFCA 3S0MA 4AEDA 2AH2A 4JQTA 4XJAA 5FYCA 4NIIA 1RXFA 2VNVA 4LKDA 3DN7A 2D6OX 5IAVA 3IIAA 1ZZ9A 1WD3A 5IVFA 2HWB2 2VC9A 4FTBA 1XSQA 3SC7X 4KGQA 2QQOA 4QHZA 4BXFA 3NV2A 3M3IA 3T2PA 1G6NA 5JPNB 1IS5A 1FMD1 1JOBA 3TEZA 4BQ1A 3H0OA 5C9AA 4V1PA 3MBWA 4BIFA 1V6KA 4IDZA 3PLQA 4ISRA 4XABA 5EJZB 5LCWL 5A7PA 2ORXA 1BCXA 4JDNA 4R9CA 4NHLA 1E5HA 3NJVA 3TNQA 4FAHA 1PGSA 5IVVA 1W6OB 4XCAA 3ZXLA 1AR82 5A3WA 4K1ZA 5FYYA 5JXIA 3DCQA 3OUJA 1GQGA 4I3PA 4P9YA 4EN8B 4CEWC 2P17A 2RV9A 5FO8B 1N3QA 1K45A 3L9JT 1KFXL 4CU9A 1BEV3 4GQ7A 1RIRA 3NQHA 5KHKA 4UFKA 3SISA 2BUKA 3PHMA 1L7LA 4EZHA 5EP9A 4L9BA 4PF5A 3BODA 5FPXA 3OBRA 4Q8LA 3DKQA 1QIQA 4DS0A 2EIEA 4JGZC 2VZUA 3RZKA 3BGAA 1DP0A 4DRVA 5FY5A 1GLHA 1OI6A 2CNAA 4GWMA 4PDWA 5FPBA 1GWLA 2JENA 4NPMA 4CCNA 4OHYA 4UF0B 3FBYA 3TAYA 4A44A 1DQ1A 4AGGA 1F35A 4EV0A 4FI9A 1J59A 3J26N 1E5IA 4Q1RA 4R8HA 3OBTA 1HN0A 2VE1A 3JXSA 4W65A 1YXWA 5JSRA 3NKGA 1L3JA 2QQPA 1O3TA 3O1VA 1PM4A 1F9KA 3ZDVA 1OH4A 5SV8A 4E9KA 4S2HA 4HETA 4LUKA 2VCBA 3E5XA 2WZR1 5JDBA 2GNTA 2UY8A 5F2SA 2CDPA 1TMF1 4LK6A 2LRPA 5D1IA 4LO7A 3MLJA 4LIVA 1F5JA 1FOD3 4QQPA 4PF1A 5BNNC 1QQP1 4PCRA 2GAUA 3TN93 4LXLA 3UETA 5J98B 2H0VA 2JB8A 4OZXA 1JS9A 4AAPA 2Y6JA 3OYWA 2VZTA 3PVNA 2ZX3A 1I1EA 1HXS1 1Z7S1 1RUI1 1PNFA 2DTYA 5FUPA 4BH9A 1WW5A 1AF9A 4K3UA 2Q8DA 5JR2A 1XYPA 2FDHA 1IG3A 1SLCA 1LHVA 2QFEA 1OHFA 1W2UA 1Y3TA 2PAKA 4TLGA 3ZVXA 4XTPA 1CR7A 4LULA 1Q8VA 5CYYA 3S7EA 4AVSA 4BHPA 2RR12 4HT1T 5G04L 2FD8A 1YUDA 3VHPA 2A5ZA 2QNKA 2D5HA 5FYMA 3GBWA 2PQQA 5TSWA 4E4DX 3IIIA 4DUXA 1ULEA 4CPBD 4RN5A 4A7ZA 5FYSA 4BA6A 1NCQB 3JB8A 4XFFA 4YW2A 5FZ6A 2JIGA 1W0NA 2XKPA 3BU0A 3A23A 4BPZA 1C5IA 3GYDA 3UJOA 2JKXA 1AR92 1XNTA 2R073 1OT5A 3PMSA 1M06G 3MPBA 3POJA 4YGBA 5I8TA 4QD2A 1DG6A 4AI3A 1MS1A 1X82A 5EYXA 3PTRB 4NVPA 4M00A 5G05L 1NQDA 1SPPA 3WNPA 2Q8OA 3RYRA 4UYBA 3ZN6A 2WABA 2QTWB 2ZZJA 4C0BA 4AFBA 2A6VA 1DZTA 2ZGMA 4NHXA 2VW1A
chains in the Genus database with same CATH topology
1AR63 5DZFA 1FNYA 4AE2A 4JTOA 1ZRDA 1QJY1 4ES8A 3H7JA 1KITA 5BNQA 4IL7A 3EBRA 3JQXA 1ND3A 3EXUA 3D6EA 3W9AA 2RMU2 4GMP1 4IEYA 5ACA3 1TME1 4MXWA 5K0UC 1OD5A 1HRV2 1RVF1 1XE8A 4YW1A 2WFPA 3N7JA 4Q27A 4YZ3A 4HMZA 1DQ5A 2ZX0A 1F2NA 4H7MA 4IV3A 1NQJA 1VP6A 2RM21 1R1A1 2XJTA 1I3HA 4QPIC 1DGWA 2GC0A 4CDXB 2NN8A 3GNEA 3S6PA 5BNOC 1VBD2 4HBNA 5C6CA 3IDCB 4Q0SA 1I9RA 4RR3C 1QGLA 1MQTB 4RHV1 1BBT2 1WCDJ 2DURA 4NR1A 5L19A 1OOPC 2NPIA 1VBE2 4QQ2A 3SH4A 5C4WC 1H8TA 2ZPXA 2A6YA 4XF1A 1DFQA 2NLRA 3N7LA 1KS4A 5JPMB 2I2SA 3AB0A 4XQDA 4AK3A 4FTSA 4HPKB 3E6DA 3WW3A 2R042 4AEDC 2IXHA 3ZFGB 1JTZX 4PJYA 2E7QA 5KXDA 4K7JA 2ZBJA 1OFSA 3OY8B 3J8F3 5DG1A 1PZ8A 3ILNA 4S2DA 2ZGTA 3B02A 3KT4A 2FHRA 3EJKA 3V0BB 4DNYA 4XQ4A 1S0BA 3R4DB 1VRH1 4WVZA 2D43A 3M2MA 2FMYA 2ET1A 4A3XA 3VBHA 3CL1A 1QJU1 1R083 2MEV3 4N53C 2ZACA 3AP7A 4RA0A 5GKAC 2JG8B 5JWPA 2A6XA 3AP9A 1SACA 2P2KA 3ASIA 4GH4A 1GFF2 4CDWA 5KWRA 1VR3A 3H9AA 1PZ9A 2XG3A 1YIFA 3MIBA 2P3KA 4GALA 2WINB 5J37A 2BNNA 4IETA 3V0AA 3AMQA 4SBVA 3VHRA 2RHPA 2WFF1 2GNBA 4QMAA 1A78A 4GB33 2PHXA 1ZBE3 5ABJA 3TYJA 4BIOA 3ZXAC 4LT5A 1R093 4ONUA 4M0NA 2XJRA 1IPKA 5CFDB 1UL9A 3H3ZA 1GNZA 5D8AB 2WNVB 1NA1C 1SLBA 2FBEA 3VBOA 3K51A 1AR93 4WBBA 4LNVA 5EFUA 2WJSA 1U5IA 1ZZBA 2DFBA 1D2SA 2GU9A 1CJDA 2P37A 1LKNA 3P3NA 3AZXA 2CGPA 4BLIA 3AKQA 1PVC1 2DU0A 2E51A 1C8M3 4WVWA 5FO7B 1RUOA 1AYM2 2AREA 3OGJA 5HCBA 1AX2A 4K40A 2A71A 2EF6A 1RUE2 4HVRA 3AKSA 4X8PA 3ZSLA 1VBC2 5H9QA 5IT6A 4HK8A 1WMFA 5CB7A 3A0KA 4TYSA 4YM2A 3HBZA 3AYCA 4DY5A 5GLZA 4D7YA 3FUQA 5GZGA 3O0WA 3PTYA 4NO4A 1PGW2 2GMPA 4PBOA 2DCYA 3PVBB 4K21A 4BM8A 3RJRA 4CEWB 1UZZA 2WQ4A 5I0SA 1VBA1 1I5ZA 4EWEA 3VZKA 2IZWA 5FQ0A 1C28A 4RQPA 3SXWA 3KSCA 1Z78A 5GZDA 4LHLA 1VAVA 1ASJ2 1VBB1 3O7OA 4DY3A 1C3HA 3VBRA 4QPGA 5LRSA 1LGCA 3M70A 4YG3A 5GLVA 1FV3A 1NG0A 2X5IC 3IBMA 4JGZB 3B9CA 1YLLA 4M3CE 3ZXJA 4Q4W2 3I2DA 1N1YA 2Y0OA 2FZ2A 1CPNA 4YM3A 4PIZA 2R0HA 1OA3A 1N3OA 3G7DA 4AF9A 2D3RA 3N35A 1RHI2 5JZGC 1GICA 1ND2C 2DCZA 2HYKA 3RSJA 3HT1A 2WS92 4XETA 2CL2A 2GC2A 1HRI3 2VY0A 2D3PA 4QT6A 3RMXA 3H3UA 4UXAA 3UL2A 4M3CB 4CP2A 4P9WA 2WNEA 1PZ7A 1AYN1 1VB4A 1WW7A 3LA3A 3BCWA 1U5XA 1RUG1 4Q4Y3 4PLNA 3D82A 3E5UA 4HN0A 4FOQA 4MGZE 4YGCA 2QUOA 4XIOA 2OZJA 3WDXA 4LO4B 1POV3 5HI0A 1V6LA 1DU3D 2W52A 4MGYE 3VKNA 4IEOA 3E5QA 1C4RA 1H8TC 4EN0A 4HSLA 1VJ2A 4LEJA 4KG0A 5FLIA 1JBCA 3ST7A 1WMEA 3WDTA 1PO11 1B35A 1DQ4A 4JQRA 4Y22B 3THTA 4Z2WA 3AMNA 2VUJA 5AFBA 2YYOA 1FNZA 4Y24A 2KXLA 2AYHA 1SBFA 1SLTA 1ULDA 3B69A 4YLZA 4OI1A 4E4ZA 1ZRFA 1BXHA 3ZXKA 1KJRA 1RUJ2 1MS0A 5JOXA 3ZN5A 5GALA 4P9LA 4S2FA 3RYKA 4YVSA 1RUH2 3BB6A 2R49A 4U2AA 2CY6A 3WHUA 3TBDA 3WDVA 4BOWA 4WM8A 1RMU3 5JIUA 4L99A 4CZSA 4B8EA 3PNAA 2ILMA 3HIFA 2WT1A 2DVDA 2RS32 3ENRA 4O9EA 5CNAA 1AL22 2ZHNA 5JIAA 1COV3 4C90A 3KS7A 1DYPA 1LCLA 1AYM3 3KCYA 4NWWA 4EROA 1CAWA 1HQLA 4RGAA 5K0UB 1OQEA 2AUYA 3I59A 2XUMA 2WFF3 4R52A 4Y20B 2Q1MA 1CVNA 1H4HA 1CONA 1UKRA 2XL7A 4YGDA 1W6NA 5ABJC 1BKZA 2VU9A 4INDA 1UCXA 4HLTA 1ZZ7A 3ELNA 3V65A 4QPIB 4TZDA 4YG6A 3WP6A 2GDFA 3UKTA 4I0BA 5BNOB 3H50A 3MGUA 4NHKA 4F7ZA 1PK6C 5A32B 3VBOC 3R05A 3CO2A 3FHIB 4RR3B 5A33A 5L36A 1KQRA 1YFXA 1OOPB 2PTMA 4COYA 5C4WB 1BZWA 4BCUA 1XNCA 1A6CA 2VNOA 3AX4A 1LECA 1QNWA 1XU1A 5E8AA 2AGSA 2JEMA 3ECQA 2OZ6A 3M3EA 1YHFA 3OD0A 4FPGA 4L92A 4AEDB 5DUXA 4XEZA 2ZTNA 2D44A 4YZ4A 1BEV2 4CRQA 1GZCA 3NVCA 1RUF1 3AFKA 2ZKNA 1D4M3 1DGRA 2BVVA 1LRHA 4Y1ZA 1WW4A 3SCGA 3MW4A 5E88A 3LOIA 4CDXC 4JGYA 1MZ5A 3VHNA 2YC0A 4GKYA 4YZ2A 1FAYA 1UW8A 2C1FA 1NZCA 3M3QA 3TB0A 3MYXA 2XBO1 2G9GA 1LOFA 1TE1B 4XHXA 5SV5A 4N53B 3VGIA 1G9DA 2GMMA 2EAKA 1HQWA 4MSVA 2R32A 3JBG3 4RQPC 3RWNA 2RS52 5KHJA 1H30A 3VBRC 1OPMA 3ES4A 1ULGA 4M3CF 1C8NA 1S2KA 4CDQA 4RD7A 5CBLA 1AX0A 4Y1XA 4JCKA 2NYYA 5FOJB 1DQ0A 1FYUA 3KGZA 1DYKA 1PHMA 3TN92 4G4FA 3NL1A 1JUIA 1MZFA 2NZ9A 4PDWB 3MF9A 3M3CA 2HWF1 1SQ4A 1HW5A 5DDJ1 4IEQA 2XJUA 4NOTA 3J4UH 4JRAA 3FC0A 3THPA 2WA3A 3MIFA 1SDWA 3CJIC 3C3VA 1NXD1 2P3IA 5DUUA 1XE7A 4COWA 3B01A 4KWLA 3ME2A 3O12A 2HKXA 1QXPA 5H9RA 1NA1B 4QXKA 4MZUA 5DG2A 3MEPA 4HN1A 3GBGA 4YGEA 1SMVA 5HCFA 3USUA 2BVBA 2QZ3A 4YZ5A 5KC6A 1ZREA 1RUJ3 3KLSA 1ZBA3 1FPN1 2PYTA 1LODA 2A3WA 2R072 2WNUA 2WWSA 1UX6A 1RUH3 1ZZ8A 1RJ8A 1TQ5A 2O0OA 4Q4X3 5KHGA 1W0PA 1UKGA 3SITA 4QPYA 5C8CA 4X8NA 2VVEA 1LOGA 3KT1A 1O4ZA 5EJ3A 3HMYA 3UJQA 4K6BA 3C2UA 3WR0A 3LCPA 4DQAA 1AR62 3T2TA 1YRZA 1B35C 3FE5A 4KBBA 5BUVA 1OA2A 3ZFEA 4HKWA 2DVFA 1UU4A 4XFAA 2R062 4P9XA 3JD71 3LOBA 1AL0G 2NMOA 5ACA2 1UPSA 1RC6A 2HWB1 1O3RA 1PIV3 3RYPA 4K20A 3WVJA 1JYIA 4XE9A 3WHTA 4ASLA 3NAPA 1EYBA 5DUWA 3M4FA 2GC1A 4Y1UA 4AVVA 2X5IB 1GR3A 4AFDA 4MXVA 1S0DA 2OUJA 4YW5A 2WC2A 3JU9A 2HWE1 1AR81 4FPEA 4LO6B 1EV13 4F83A 3O14A 2ZX4A 5JZGB 1BYHA 4HKLA 1JHNA 1ND2B 5HXVA 3ES1A 4MXWB 4A7YA 2D6PA 3USSA 3R6SA 1LHOA 1UAIA 1W6PA 3LWCA 4TWTA 4RS5C 4LUMA 1IKPA 1H1IA 2A3YA 2A70A 4KL1A 4IERA 2RJKA 4YFWA 3FBMA 3HR9A 2E63A 2WSVA 2FQPA 1E57A 3J8F2 1QJX3 2JKBA 3TOJA 5AC91 3IDEA 4K1YA 1N1TA 3LSEA 2D6KA 4YVWC 3JQWA 3WD5A 2CWSA 4D7SA 1CAUA 1PO23 3VKFC 1GZWA 1A3KA 1H8TB 4HFSA 4Q0VA 3VBFA 3WP5A 1DBNA 1H9PA 2DVBA 4AWDA 4FOVA 2DCTA 4XFIA 2RS53 1AXZA 2W68A 5CFCA 5AFEA 1R082 2MEV2 5BV6A 4IV1A 4B29A 1LHWA 5HBAA 4KQ7A 1AR71 1S2BA 4XDQA 1KD7A 4RSUA 1QOSA 3WY6A 5FPZA 5J7MA 1JYCA 4UW5A 3HN1A 4FPOB 2BEOA 3POYA 1D0GA 2RR11 4JGYC 1H0BA 1UZYA 3BOWA 2UU8A 2GNMA 4BWOA 4I0WB 1UF2C 2A7AA 2XJSA 4Q4V3 3DUIA 1AX1A 1ULCA 4B4QA 3VBHB 4GB32 4BLJA 3AMMA 3VLBB 1ZBE2 5I8SA 1EAH3 3KGLA 4RFT0 5GJ6A 2EXIA 3VDDA 4GH4B 1HV1A 4CDWB 1R092 3NJZA 3GHMA 3VZMA 1TMF2 3ZSMA 4CDQC 3ZXGA 1Z0HA 5DUVA 2PLV1 3SH5A 1XQNA 1SLLA 3MLKA 5H9SA 1ZZCA 5F5QA 3V0AB 2XLAA 3POSA 4YG0A 5CAZA 1RUNA 3I54A 1C8M2 1WW6A 1W6QB 3JCIA 4LLOA 3ZN4A 4XZPA 5ABJB 1J1LA 1BK1A 3O0VA 4XJUA 3LA7A 2LTNA 4QQOA 2N7GA 2RMU1 2P3JA 3ZYGA 4C1XA 2VMIA 1UU5A 2FMDA 3IT8A 5JSPA 2HWD1 2BTVC 1PK6B 3VBOB 1Q3EA 1HRV1 2R063 2PAEA 2RS11 4BE3A 4MGIE 4AVTA 4UW6A 1RTVA 4ATFA 5EXOA 3KCXA 3MFCA 5DZGA 4DFSA 2EA7A 2DUQA 5EZWA 1GKBA 2RJLA 4L2NA 2XPJA 2Y38A 3E6BA 3HWJA 3LA2A 1K5MA 3AYAA 1VBD1 3K48A 4HVOA 1WA4A 3B5LB 5C8CC 4AYUA 1O3QA 1BBT1 1IZ3A 2YGLA 5FOBB 1UN1A 4XFGA 1V6IA 1VBE1 2IWGB 5T52A 3EHKA 3ZX7A 1ALYA 1IS4A 4FP2A 1W6OA 5FFOC 3GZUC 2Z69A 2R041 1MVEA 2DCKA 1C57A 5FQ0B 1POV0 2WT0A 2IXCA 4RQPB 1MEC3 3PJYA 1NCRC 1V9U3 4QGMA 2ZOEB 4D3WA 1CESA 1RVF2 2QJVA 4OHZA 1HRI2 3NAPC 5FLJA 3VBRB 3ZYRA 5KBFA 4XTMA 3OPZA 3AYDA 4XJWA 1KS5A 1ZRRA 3INAA 4AHYA 3UV9A 4COUA 2G9FA 3EO6A 1QH6A 4KWKA 1BQPA 1H1AA 1S1AA 5KC5A 3AJYA 2HWE3 3VZJA 2DCJA 2EXJA 1FMD3 4Q4Y2 3D0SA 2ZGOA 4R9BA 5C9AC 3MIEA 4XF9A 2PA7A 3KMHA 1AXYA 4AI0A 3CJIB 2RE9A 4N9HA 2EXHA 3ZPYA 4RHV2 2VW0A 1OSGA 4DINB 2CGNA 4XMAA 2F6BA 1LB2A 4MH0E 1RUD1 1XNKA 5DXDA 4XPVA 4D94A 2V5YA 4K9SA 4W6WA 2XVGA 4GIQA 2DV9A 4H55A 1CX4A 1N47A 5FCCA 2K2SA 3RQ0A 1W6MA 3KZ4C 1LOAA 3MW3A 1OA4A 3WQ1A 4KGGA 2PELA 4N7IA 5B2GB 3DGTA 3WDYA 1SEFA 1KXGA 4PDWC 3VL9A 4ITCA 4MX3A 4E2SA 2Q5TA 1SFNA 1IS3A 4Y26A 3IDBB 1Y9QA 3RG0A 3ZYIB 5CVRA 2H6BA 5JMCA 4TLFA 1S0IA 4AFMA 1QJU2 1J58A 3CU7A 2WZR3 2ETEA 1B35B 4IV1C 1S55A 1TMF3 4I2OA 1AR73 5T50A 1RMU2 1QQP3 1YNAA 1IS6A 1VAMA 1NLRA 4LTAA 1RUE1 2YROA 1IQAA 1COV2 1HXS3 1RUI3 1Z7S3 4B7EA 2PHDA 4XXPA 1VBC1 1LGNA 4R4XA 4OHXA 4XILA 1EPWA 4IESA 1GSLA 3HQXA 2AENA 2Z42A 4FCAA 2WFF2 4R4ZA 2B5HA 1RL3A 1TNRA 1C5HA 1UD1A 1QU0A 1DGLA 4I02A 4XF3A 2GN3A 4GXLA 4PLOA 1FXZA 3M3OA 1PGW1 1ZYBA 3VDDC 3WLUA 4P5HA 1Q5OA 2GMEA 3DPRA 3JB4C 2ZJCA 4QQLA 4IEWA 1KJLA 3S7IA 3U10A 3ZIWA 2E53A 3HAGA 5I0RA 2V73A 1ASJ1 5L73A 4D69A 1CAWB 4XF4A 3M1HA 3I59B 2X29A 4ZU7A 3BALA 4YW3A 1PVC2 4EN7B 4WM7A 1B09A 1HX6A 1OQDA 4RS5B 3VZOA 1S0EA 4MUVA 4Q4W1 2GH8A 4WZFA 3D0JA 4FQZA 2KA3A 2BPA2 2WQZC 2HEVF 2IC1A 2XH6A 1D0HA 4AVCA 3VBSA 3QBQA 1RHI1 2YXSA 1D4M2 1QJY3 4QM9A 4EJRA 1BVVA 2WA4A 2WS91 1MQTA 4YM0A 4YVWB 1ND3C 3RJ2X 5A33B 1ENRA 4GMP3 3UK9A 3ILFA 5C33A 2TEPA 3RS6A 1TME3 4X6RB 4AGVA 3LZZA 1DGRN 4OI2A 4HPKA 3B7MA 1RVF3 4YYOA 1QKQA 4XBLA 4FPHA 1YIPA 2ZHLA 1NOVA 5FAXA 1UIKA 3JBG2 1K5MC 1XYOA 2IXJA 3CJXA 4OHVA 1RINA 2BYVE 3RNSA 4GA9A 4IV3C 4JVAA 4UBHA 2RM23 2BW8A 1LU2A 1R1A3 2QCSB 4H7LA 4HZFA 3ZXDA 3V0BA 2HWC1 3TWIA 4G9SB 4JGYB 1X7NA 3FLRA 5J36A 5J48A 2VQAA 2ZAHA 4IEZA 1G9CA 4RHV3 1LEMA 3SHRA 3SLIA 1G7YA 4KH9A 1V6NA 2UYAA 3IN9A 2VPVA 1BMV2 2UWAA 4DMIA 2Q1ZB 4AHWA 2Y26A 3WINE 4Z1VA 1JUHA 4IXLA 2PHRA 4MYEA 5I91A 1CAXA 4ISQA 1LULA 2WT2A 4JTNA 4YFZA 2ZS6B 3EQEA 2EXKA 4CDQB 2XHKA 4Y1VA 2NQYA 4W6XA 4WZCA 2W39A 5KHIA 4N9IA 4F3JA 3VL8A 5BXXA 4XMIA 2PHLA 2A6WA 3LB9A 1ZBA2 5E16A 3ZMOA 2K0GA 1VALA 1VRH3 4LE4A 1O7FA 4Q4X2 4Z82A 2RS31 1QJU3 3VBHC 2G4IA 4NHMA 1AL21 2GSYA 3WG3A 5L7OA 2VUAA 2WNVA 1RUD3 2FZ1A 3WXPA 4UW4A 1WMDA 4N90A 3TRSB 4GH4C 2I07B 4CDWC 5FLHA 2YDEA 5C8WA 3USUB 2XJPA 1RUC1 3WQ0A 2VW2A 1N1SA 1NY72 2TUNA 1G9FA 1J1TA 1O91A 2ZABA 3R4UA 5GZCA 1LR5A 3N7MA 4LLFA 1F5FA 4CDUA 1YCIA 3AXEA 4AGRA 5BNPA 1J3RA 4BYYA 4PIXA 2GN7A 3ALQA 5AVPA 2YMZA 1PIV2 2PHFA 3AM2A 4FOYA 1XNDA 5C8CB 4C91A 4MLOA 1C1LA 4TSVA 2E9QA 3NV3A 3BU7A 4XJ8A 3T1MA 4XXAA 4LA3A 3A0NA 1AJOA 5IK5A 4LBQB 1QWRA 2K9ZA 1EV12 1H1MA 4CEWA 1SLIA 1NXMA 4CTEA 4EWDA 1PVC3 2XLGA 1YYNA 2IXKA 2BFUL 1BEV1 1CAVA 1HQNA 3H1YA 2VXRA 1QOOA 4XFCA 1MS4A 1NCRB 4LBLA 1O5UA 3WDUA 2A3XA 2CAVA 2WLQA 3NAPB 2BNMA 5FDBA 3ZMNA 4AFCA 4JGZA 2QZ2A 1LJ7A 1QF3A 2JJ6A 4AHZA 3M8LA 1AXKA 4P14A 4E4SA 3DPRC 1YJLA 2UWCA 5C9AB 3HD8B 2VGDA 3U11A 1EP0A 4AEJA 5FTTC 1QJX2 3NV1A 3SCFA 2ET7A 2Z2SB 4M3CA 1PO22 1VBA3 1FOD1 4WM7C 5BNNA 4HK9A 2ATFA 2W08A 4QGNA 3TN91 1VBB3 1A8DA 1D2QA 2D6NA 4QPGC 3S30A 1PM7A 3RPQA 5EV7A 2OUHA 3ZSEA 3VBSC 5BYNA 3RI8A 4K8FA 1IGOA 2XL9A 2B45X 2XVKA 1LOCA 4ZKTB 4WVMA 2VQ0A 3UKVA 5FMOS 4OFGA 5JOYA 4FO9A 3KM5A 1CAUB 1GZWB 3OGGA 4QU2A 4Q4V2 1REEA 4Z8BA 2XBO2 1H8VA 2ZAAA 4FOWA 5LK5A 3VBUA 3MFAA 4IV1B 3MIDA 1EAH2 1QH7A 2SBAA 1LEDA 1AYN3 2R071 1VIWB 1X33A 3AKTA 1GYKA 1VB2A 3KD4A 1RUG3 5IUQA 3OYWB 2ZMNA 5CIRA 3VHOA 2JG9A 1H9WA 3B00A 4D7TA 5AVAA 2EALA 3NKTA 2D6MA 4C1WA 4MVTA 1AR61 3CF6E 4JDOA 5CADA 1BJQA 3D5OA 4YM1A 4XFBA 3QLQA 3KQRA 5KXCA 3VDDB 1DIWA 1S0CA 1JN2P 1PGL2 4N7UA 4CEYA 3LSDA 2GC3A 1PO13 3ATGA 1VAKA 4CP1A 5ACA1 1MVQA 2CAUA 3POWA 2ZGRA 3CNAA 5EYYA 4AHXA 5H9PA 2D93A 1LU1A 5I93A 1LESA 1X8MA 4ZU5A 4OULA 2JICA 1KFUL 3DF0A 2A75A 4IQPA 2UWBA 1FPN2 1ZNPA 1FATA 3LAGA 1QXRA 3NW4A 3OD4A 4YVSC 4LHNA 3ZN6B 2HEYF 5F6LB 1DZQA 3DL3A 4IEXA 2JX9A 2KM2A 3X29B 4WM8C 3CEWA 5A32A 1EY2A 2TBVA 3RDIA 2SLIA 2E6VA 3MICA 5IK7A 3H1MA 1ND3B 4F8AA 1OOPA 2ENRA 3OCPA 2R1DA 5C4WA 1LOEA 3G6JB 1ENSA 1RGSA 2WL1A 3U0ZA 1ZX5A 2EIGA 2VOWA 4CDUC 3BTAA 3JD72 3L2HA 5BNPC 2ZGNA 3IPVA 3IM0A 4JV4A 4EN6B 1N3PA 2R16A 4NN0A 1SFYA 1K5MB 1MEC2 1WBFA 3J8F1 1FT9A 4QGLA 1V9U2 3GALA 1UIJA 4YNIA 4IV3B 3PVEA 3B9IA 3ZO0B 3VZNA 5T3NA 1IOAA 1WLWA 4ASMB 5T5OA 3VV1A 3ZSKA 4M01A 1S0JA 3ILRA 2HWE2 4B7KA 4AVAA 3WZ1A 4HSJA 1TEIA 4FVVA 1FMD2 3KT7A 4AVBA 1WUVA 1R081 1XXNA 2MEV1 4N53A 4LHKA 1J3PA 2XWJB 2B42B 2WLPA 1REFA 3HT2A 4XBQA 4COVA 4DB5A 3WG2A 4HVQA 4I01A 1REDA 1RB8G 4WV8A 1RUF3 4QHBA 4URTA 3VKLA 3MDPA 3ZXFA 4GB31 1ZBE1 3OTFA 3H7YA 2CGOA 4CP0A 3FX3A 2B9UA 3JZVA 5AC92 5FRAA 1O3SA 4IEPA 4AEMA 4LR4A 1YI9A 1R091 1WCKA 4XIKA 4UBGA 2XBO3 4N43A 1DZRA 2DVAA 5F9TA 1LOFC 1ENQA 1O5LA 5JSOA 4YZ1A 1NA1A 1DLLA 2E7AA 1AR91 4DXZA 3NWKA 3VN4A 2D3SA 5F6KA 4GKXA 1IKQA 2O1QA 2WZR2 1APNA 2PHTA 3V56A 1RITA 3PVOA 1W0OA 1C8M1 1AR72 3QH7A 4FAGA 1W6MB 1QQP2 2TNFA 4KU7A 4E2GA 2ZGQA 3ZIXA 4Q2FA 4ES9A 2HWF3 1HXS2 1Z7S2 1RUI2 4L11A 4SLIA 5DDJ3 4R9AA 1V00A 5T54A 4LBQD 2GNDA 2C5DA 3O0XA 2ZMLA 4Q1PA 1HDKA 4PQ9A 4XJ9A 1F31A 1J3QA 4XF0A 2ZGUA 3RRDA 2X8KA 3VBUC 4J1XA 4FPFA 1QY4A 4Q0UA 3WW2A 1QDCA 1YI7A 3AMPA 2D5FA 4LBOA 2B46X 2XJVA 3WW4A 1CN1A 3AZWA 4DRRA 1UMZA 2JG9C 2PLV2 3ZFFA 2D98A 1FPN3 2WNUC 3MIHA 1Q8SA 4YARA 3FLPA 4GMP0 2JDZA 3DKWA 4EWAA 3J9SA 1AJKA 1U5ZA 1WLCA 2X5IA 2WKKA 5J96B 2ZMKA 3AKPA 3NV4A 4XHBA 5JR7B 3WUCA 2D40A 3PMEA 4DOUA 4PLMA 2WZPP 3DPRB 4CEYC 2VNGA 4LO8A 1GV9A 1OQ1A 5JZGA 2OVUA 2CWMA 1ND2A 2HWD2 1QJY2 2WIIB 4U36A 3ZFEC 2XLFA 3QACA 1DF0A 3TNPB 3MPPG 2WSUA 1XNBA 4XQWA 1HRI1 2RS12 1X50A 3AP4A 1JOJA 3JD73 3N3HA 3VKOA 2ZGKA 4JC1A 2UYBA 3WNXA 4WM7B 4E27A 1TME2 1CPMA 2HWB3 4FXGB 1MZ6A 4XJZA 4QPGB 4P9JA 4Q4Y1 4XW3A 5A3LA 4XFHA 3GHNA 2VULA 3DV8A 5GZEA 3VBSB 1RJ7A 1V6MA 3OF1A 3WG1A 1NLSA 1POV1 2LALA 2VMHA 2XWBB 4FPYA 1V6JA 4UW3A 2RM22 1AR83 1R1A2 2DF7A 2ZCWA 1DQ2A 5K7PA 1C1FA 4FPCA 4FBFA 1KDMA 2O8QA 1XRUA 5KXBA 3A4UA 4XOGA 4Q26A 2DUPA 4S2GA 4EN9B 5LEJA 1QOTA 1YFWA 5K8SA 4FPLA 4I0AA 4AQSA 3N4MA 4QQHA 2LUWA 2V09A 1U0AA 5JOZA 3WOGA 2GZWA 3P3PA 3WV6A 2YUEA 1MS9A 1CD3G 4FT8A 4OI0A 4RL7A 4AW7A 3OJBA 3WX5A 5I8YA 1AVBA 2VOVA 1JW6A 4AI2A 5AC93 1G9BA 3GZAA 5CU1A 4L8QA 3B3QE 3ACLA 3RMYA 1GNHA 3IMNA 3D4KA 1RMU1 3H8UA 2R30A 4LBMA 3I7DA 3VBFC 2VOXA 4META 1VRH2 3RZZA 2VG9A 3RI9A 1NCQA 1Q8QA 4GULA 5J3UA 1MZEA 2NMNA 5FBZA 3BPZA 3AXDA 5CFCC 1CAXB 1COV1 2VOKA 2ERFA 1RUD2 3ZYPA 4OHWA 1AYM1 1BVP1 2GALA 3WG4A 2NP0A 3MZHA 5CA6A 2VVFA 2ZZQA 2JXAA 5EWSA 4E2QA 2IXIA 1W6QA 2VVDA 1FI2A 2RR13 2YZ4A 4C0HA 1PMIA 2ZX2A 4AFAA 5GLWA 2AZ5A 4ORFA 2OPKA