2PAMA

Structure of a h49n, h51n double mutant dtdp-4-keto-6-deoxy-d-glucose-3,4-ketoisomerase from aneurinibacillus thermoaerophilus complexed with tdp
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
135
structure length
135
Chain Sequence
ENKVINFKKIIDSRGSLVAIEENKNIPFSIKRVYYIFDTKGEEPRGFNANKKLEQVLVCLNGSCRVILDDGNIIQEITLDSPAVGLYVGPAVWHEMHDFSSDCVMMVLASDYYDETDYIRQYDNFKKYIAKINLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords DTDP-6-deoxy-3,4-keto-hexulose isomerase
publication title The X-ray Structure of dTDP-4-Keto-6-deoxy-D-glucose-3,4-ketoisomerase.
pubmed doi rcsb
source organism Aneurinibacillus thermoaerophilus
total genus 26
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature ec 5.3.2.3: TDP-4-oxo-6-deoxy-alpha-D-glucose-3,4-oxoisomerase (dTDP-3-dehydro-6-
pdb deposition date 2007-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05523 FdtA WxcM-like, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2pamA00
5FQ0A 3WW2A 1J3PA 3CEWA 3CJXA 3EO6A 4O9GA 4BIFA 1WGPA 3E6DA 3O14A 2XL9A 4XEZA 3C3VA 4PIXA 1LB2A 3RYPA 3KMHA 2GU9A 4AVAA 5FQ0B 1NXMA 3FZ3A 1UW8A 5BXXA 3HQXA 1SEFA 4KWJA 4I0AA 4E2GA 3BPZA 1FXZA 5FDBA 3OGJA 4AVBA 1J59A 2V09A 5LRSA 3RNSA 3ES1A 3E5XA 4KU7A 4HN1A 4HVRA 4IEZA 3SXWA 4XFCA 4HSLA 1YLLA 4KWLA 3WW4A 3SMHA 1QXJA 4TLFA 3DL3A 4UBGA 4JTNA 1XRUA 3ELNA 4QGMA 1X7NA 4IEVA 4LLOA 4LULA 1U12A 1O3SA 4Q0PA 1CAVA 4Z82A 1YFWA 3ZDSA 3MPBA 2HKXA 3CO2A 3KGLA 4XF1A 4LA3A 5FLJA 2B8MA 4Q0SA 4XFIA 2ET1A 1VR3A 4XETA 4EWEA 3I59A 4H7LA 2GC1A 3DKWA 5CVRA 2P17A 2GH2A 3H50A 3LA7A 2ET7A 4E2QA 5FPZA 1UPIA 2ETEA 4F7ZA 1ZZ8A 2VPVA 4IEQA 4OLLA 2XHKA 3SHRA 5KHKA 4XFAA 1Y9QA 2MHFA 3I59B 5J3UA 2HJIA 3RYRA 3H3UA 1ZVFA 2UYAA 4ZU4A 2OA2A 4IEXA 3U11A 3LWCA 1CX4A 5I0SA 3OD0A 4XFBA 1TQ5A 3I54A 4O9EA 2Q0AA 1JUHA 4NVPA 2PTMA 4X6RB 1J3QA 1ZZ6A 1QWRA 2UY9A 4MGYE 3NSTA 1ZRRA 4N9HA 1DGRA 1G6NA 3UKTA 4FAGA 2I45A 4YSFA 4D7TA 3FE5A 5I0TA 5D1IA 1OD5A 4KU8A 2EVXA 1V70A 2H6BA 1RC6A 2XKPA 3L2HA 3H8UA 5I91A 4J1XA 1UIKA 5T3NA 4E2SA 5LRRA 4HSJA 5FPXA 2PHLA 2Q30A 5BV6A 1Y3TA 2D40A 2CAVA 1QXRA 4YRDA 1ZREA 5KHGA 5EFUA 3S0MA 2K0GA 5I8SA 3BU7A 4IEYA 3FWEA 1RUOA 1Q5OA 4F8AA 1ZRCA 2DCTA 1OFNA 2XL7A 3JZVA 4R52A 1X8EA 4P9GA 3R6SA 3TNQA 4QMAA 4YYOA 5KHJA 1J3RA 3FFQA 1X82A 4L11A 3IIAA 5F1RA 5LEKA 4K8FA 3E6CC 1H1IA 2GZWA 5JSOA 4Q0QA 4XF0A 3ROUA 4JV4A 1YFYA 4META 3D0SA 4QGNA 5C8WA 3H1YA 4MV2A 4XFHA 5JCTA 1YUDA 1LKNA 1QY4A 2XGXA 3HT2A 1DGWA 1Q43A 4I09A 3EJKA 3N4MA 4EWAA 1CAUA 3QACA 3LA2A 1HW5A 5JSRA 1O3RA 3OCPA 3E5QA 4LUKA 4EV0A 5I93A 3ETQA 1CAUB 4QXKA 1CAVB 1ZNPA 1O5UA 2CV6A 4PJYA 5I0RA 3LAGA 4RD7A 3U0ZA 5J48A 1DZRA 3IBMA 2BNNA 4KWKA 2C0ZA 2H6CA 3S7EA 3OF1A 3D82A 4WVZA 3SCFA 4CYDA 3WW3A 1IPKA 2IC1A 2PHDA 3OTFA 4IETA 3BCWA 3IWZA 1GQHA 4BYYA 2OPKA 5KHHA 3KGZA 2QJVA 2OZJA 3HT1A 1O7FA 4J1WA 5JAXA 5C6CA 3FHIB 4XF3A 5I8TA 4AXOA 2F4PA 4I0BA 4GULA 5BY5A 2UYBA 1XE7A 4Q0UA 4A2UA 5K8SA 3H7YA 2ZCWA 3E6BA 3CL1A 2D5HA 3H3ZA 3PLQA 2PA7A 5I0UA 2GC2A 5BUVA 4LA2A 2GC3A 1SQ4A 2XKOA 4IEUA 3CLPA 4IESA 3BALA 2UY8A 4YARA 2PAEA 1UCXA 3LOIA 1O3QA 1WLTA 1ZRDA 1IPJA 2OZ6A 1Q3EA 2O8QA 3LZZA 4ZU5A 5JR7B 4B29A 4AVCA 1RGSA 2BNOA 5BPXA 4FT8A 1O3TA 4LUMA 5E16A 3E97A 1UD1A 2D93A 2PYTA 2PAKA 3SCGA 4WBBA 2PFWA 4D7SA 4LEJA 5FCCA 1SFNA 3RYKA 2H0VA 1O5LA 1ZX5A 5HI0A 5CU1A 4FAHA 2FMYA 2IXCA 2CAUA 1DZTA 4XF4A 1I6XA 1RUNA 2MNGA 2Z69A 4HVOA 3MYXA 4XFGA 2Z2SB 3USSA 3IDCB 3BB6A 3H1WA 3PNAA 1H1MA 1OI6A 3NVCA 3DN7A 4MGKE 4N9IA 5KBFA 1UIJA 3FJSA 2WC2A 2QDRA 3H1MA 4XFFA 2VECA 4MH0E 1CAWA 2QNKA 3EBRA 3B02A 1NZCA 4QM9A 3UKNA 3RZZA 4I02A 1CAXA 4Q0VA 1YHFA 5FLIA 3E5UA 2IXJA 3NL1A 3EHKA 3VHRA 2O1QA 2ATFA 4QM8A 1CAWB 4L2NA 3UKVA 2VQAA 1CAXB 5FLHA 4EWDA 1YWKA 4HVQA 2Y0OA 2FQPA 2QCSB 3WW1A 5AVPA 2XLGA 1VJ2A 4IEWA 1VP6A 3TNPB 2KXLA 1XE8A 3M3IA 3LA3A 1EPZA 3NJZA 1CGPA 4ONUA 3HIFA 3U10A 1EYBA 4HN0A 2BGCA 3H7JA 2N7GA 4OFGA 5I8YA 3RPQA 1EP0A 3SCHA 3GBFA 4AQ2A 4HBNA 2IXKA 1X8MA 1PM7A 5E1RA 3NW4A 1ZZ7A 2IXLA 4Z07A 4BH9A 4WZCA 1YFXA 4FBFA 2IXHA 1J58A 3M70A 1ZRFA 4MX3A 3H9AA 1J1LA 1PMIA 1LRHA 1ZZCA 2XLFA 1ZZ9A 2GAUA 4QX5A 1NYWA 4I01A 4I3PA 1FI2A 3FX3A 4MUVA 4EROA 4DINB 4HMZA 4UXAA 3MZHA 3RDIA 4AQ6A 2D5FA 4XF9A 5EZWA 2MPFA 3IDBB 4R8HA 2EAAA 3G7DA 3NKTA 4KL1A 2CGPA 3KCCA 2WFPA 5CADA 2ZKLA 2Q4SA 1ZZBA 3MDPA 4PIYA 4JTOA 5J7MA 4MZUA 2XLAA 2Q1ZB 3D0JA 1RL3A 1NE6A 1RTVA 3QOPA 1EY2A 1FT9A 2IXIA 1GQGA 2GC0A 2BNMA 2OYZA 2B5HA 4ORFA 1WA4A 1YFUA 2QVSB 4X6QB 2PAMA 3ES4A 4HZFA 3GYDA 4YNIA 4HLTA 4LTAA 1NE4A 2K9ZA 4MGZE 3DV8A 2E9QA 3CF6E 3EQEA 3ACLA 3KSCA 5KHIA 2BYVE 5LEJA 4ZU7A 4QGLA 1L3JA 2B9UA 4PIZA 3S7IA 1OMIA 3PVBB 4IEOA 1LR5A 2PQQA 4JVAA 1O4TA 4MGIE 4BHPA 4I2OA 4UBHA 4IERA 3ST7A 1I5ZA 4IEPA 4Q29A 2EA7A 5JSPA 3I7DA 2BEOA
chains in the Genus database with same CATH superfamily
5FQ0A 4MADA 4Z8BA 5J36A 3ZKYA 2VOVA 3DYOA 1DFQA 4RS5A 3ZFFC 4GKYA 4MG2A 5HPOA 2P3KA 1PK6A 4HKWA 3KMHA 4CCKA 3T1MA 1RUI2 1HRV3 4P9LA 3V65A 1NCQB 3Q8CA 2R072 2R043 4XIKA 1AYN2 4IV3B 3O1MA 1UW8A 2JE8A 3HQXA 1G9BA 3RMYA 4AFDA 4E2GA 1HRV1 3Q8FA 5F7UA 1J59A 1EAH2 5D8AB 4AVBA 3U4SA 2R041 3AMQA 4HT1T 2QQPA 5GZEA 1TNRA 1F2NA 4IEZA 1N3OA 5EJ1B 1JW6A 4YW5A 5GM0A 4KWLA 4OHZA 2ORXA 1DQ4A 3RJ2X 1CPMA 2F17A 2IVJA 2WZ8A 3U37A 4BK4A 1AR92 4UBGA 4YVWC 5BNOB 2WQZC 2RS13 4JGZC 2DBIA 2JG8A 3MIHA 3AMPA 1GOFA 4LHSA 5IW0A 3NNJA 4LLOA 1W6QB 3WF0A 2WO1A 1VBA1 4FQ4A 1W9TA 2RS11 1DP0A 2W5FA 1UY1A 1W8WA 2ZA9A 5GLZA 1G9AA 2JWPA 3T2PA 5GLTA 3PU8A 3LCPA 2QDNA 3KWVA 2VL4A 2VZ1A 1R1ZA 4COVA 5C3QA 4QPWA 4B3NA 4XQ4A 4B4PA 4YVSA 2JG9A 5HV0A 1WUVA 4AK3A 5H9PA 2XHNA 3PUHA 3I59A 5JOZA 3NAPC 2EXKA 2CWSA 1V6IA 2GC1A 1EV12 3AKSA 5FZCA 1S55A 3NNFA 2P17A 1BZWA 2P37A 4CP9B 5FYUA 2VNOA 4UT5A 3AXEA 4MYEA 1LHOA 1MZ5A 1SFPA 5EHDA 3BOWA 4YZ5A 3I2OA 1APNA 4QU1A 2ETEA 4F7ZA 1ZZ8A 4IE5A 3RGBA 5CFCC 4S2DA 4CDWC 3CU7A 3ZXGA 2BTVC 1Y9QA 3ZFEB 5J3UA 1QMJA 1DGWX 4CA9A 5IVYA 1MPXA 4AW7A 3I3QA 1LOCA 3ABZA 1AJKA 1PO12 2BU9A 2EALA 4E27A 1YQ6A 4PQQA 5T50A 2WYSA 3TEWA 1LNSA 4WM7B 5FZ4A 2CGOA 5IVEA 4QPIA 3OD0A 1RUH3 3FLTA 1URXA 4C8DA 2C9KA 4JKKA 2NM1A 4XFBA 4AWDA 1DGRN 1F35A 1IQAA 1XNBA 4O9EA 4Y5Z0 2J1TA 4B4RA 2FDHA 5DZFA 3APBA 2RDNA 2VXJA 3AVSA 3MO4A 1HLCA 1RUH1 4XJAA 4X6RB 1Q8QA 1J3QA 2W1SA 5E89A 3ZN6B 4CDWA 4EZHA 5CFCA 1JZ3A 2UY9A 1HQLA 3CJIB 3WG4A 2VTXJ 4AEJA 4D6QA 1ZRRA 3LSDA 2JDNA 4K7JA 2A75A 2QQIA 4PCRA 1BHGA 4AEDC 2J1EA 1GANA 4QQHA 2I45A 1HJFA 2R1DA 4D7TA 3AK0A 3OUIA 4CRQA 2XMLA 2VXRA 2W52A 3ZYHA 5FYZA 4M3CA 3VKNA 1OA4A 2CDOA 3USUB 3JQWA 5EP9A 2ZEWA 3PU3A 1RC6A 2DUQA 4Y26A 5IVVA 4W65A 5A1AA 5FZGA 4CXWA 1A78A 1BYHA 5I91A 2ZMLA 3OB8A 5FY9A 4E2SA 1OQEA 5FAXA 5FPXA 2PHLA 3I97A 2ZEZA 4PBPA 5B4XA 2PHXA 1Y3TA 2VQTA 1NG0A 1UYZA 1QXRA 3GM8A 4LJHA 4WM8A 4XJZA 4FPOB 5DAQA 1PMJX 5FYIA 4P5YA 2Q1FA 2FZ1A 1IG3A 1U5ZA 1FNYA 4YW1A 3T08A 1YI9A 3OYWA 3BU7A 3OEBA 4W8JA 1FAYA 4LHKA 1RUOA 1H9WA 1W9SA 1F9KA 1P8JA 4QD2A 5J98B 1RUD2 3W5NA 1V9U3 3R6SA 4YW3A 5JXHA 2XQXA 4BQWA 3VZJA 1HRI2 1YI7A 4BE3A 2VMFA 3M2MA 5FMDA 4K6BA 3VBSA 2XDVA 2R063 2JECA 5FZEA 5FY0A 3O1VA 1JMUB 1WCUA 2HWD3 3A0NA 1MVEA 2RMU3 2WSUA 1NY71 3D0SA 4META 4NUBA 5C4WC 1AF9A 4FVVA 4IE4A 1LHNA 1AR72 1NUKA 4OUEA 4AI2A 4MV2A 4XFHA 4A3ZA 5JCTA 2R061 3I49A 2D6PA 1QY4A 3FFZA 4QPGB 4MSVA 1YQ2A 2HWD1 1HV0A 4P02B 2B45X 2RMU1 2XWJB 4FFHA 3AFGA 4KBBA 4ARXA 5K9YA 4HKLA 3C7OA 2YC0A 1HW5A 5IJRA 4W4ZA 2JKXA 3ILFA 4CCJA 1KXGA 4UFJA 4XMAA 1W0OA 5FZFA 1F8VA 2VUAA 3E5QA 3M1HA 1YQCA 3TBDA 1D0GA 3OOXA 4CXYA 1PVC2 3I4IA 3I2JA 4ZS2A 1CAUB 5HCHA 1UY3A 3M3OA 3HEIA 1B35B 4BZ4A 1XYNA 3VHNA 2DVAA 3KM5A 3ZYPA 4H55A 5IVJA 4AZZA 4DXZA 1O5UA 1RVF3 4AQTA 5I0RA 3VZOA 4RD7A 1JZ7A 3GDBA 2BNNA 4KWKA 3WLUA 3JBG3 4AG4A 1FPN2 2OQ6A 4Z92B 1UZ0A 4N53C 1PO23 1XNCA 5FXWA 3WW3A 1VRH2 3VKLA 4ISQA 1OUSA 1RVF1 2IC1A 1UXXX 2PHDA 3MW4A 3OTFA 2AEZA 4IETA 3ZFGC 5C3SA 3BCWA 3IWZA 2VNGA 2OX0A 4GALA 4MXWA 3ACIA 4BYYA 3POFA 2XJVA 2BJSA 2OZJA 1PO21 5ANQA 5FUIA 3MFCA 2RS51 5LWBA 1W6NB 2E51A 5AC93 4XF3A 4XAAA 5FWEA 2PLV2 1DCSA 4CDQB 1KFUL 4FOYA 1UYXA 5F3IA 2ZGLA 1R092 3UJOA 1OC1A 1XE7A 4Q0UA 2NN8A 1KGYA 4Y4RA 3E6BA 3GNEA 5AC91 3CL1A 2EIBA 4AL9A 3WNLA 1J1TA 1W2TA 3TEZA 2ZHNA 4BLJA 2XKOA 4QQOA 4CDUC 1NCRC 1RUI3 1TG7A 4TN7A 2A73B 4IEUA 4YGBA 3GZEA 3ZFGA 4IESA 3BALA 2R073 1JS9A 3DYPA 4NHKA 3TEXA 3ZOIA 1AYN3 3AP6A 4M4RA 1OQ1A 4N90A 4QPIB 2AR6A 2C24A 5E6HA 3AFKA 3FBMA 1RUI1 1VAMA 3R4DB 2D6KA 1CJDA 1TMF2 1EAH3 1F15A 1UOFA 3MLKA 3AYDA 1W9FA 3HVDA 1AYN1 4Y20A 4COYA 3N9NA 2UWAA 5BNQA 1UMHA 4EN0A 3R05A 4CEWC 3GJBA 1EAH1 1KDMA 2AZ5A 1DGLA 2DV9A 3DXUA 3IPVB 5M0TA 5GZCA 2PAKA 1AR93 1HX6A 1VALA 3MIGA 4WBBA 3WNOA 3GZTB 1NCRA 2VZRA 2BP6A 1WCDJ 3HNBM 3IB3A 5FO7B 4DIQA 1O5LA 4LBNA 2BQPA 1GP5A 3ZN4A 1UU6A 3WG3A 5AFEA 3OD4A 1R64A 4XAEA 4YPJA 2J42A 4A45A 2VZOA 1XYPA 2RDQA 1AR91 4GMP0 2JE7A 4YM0A 4WM8C 3OPWA 4JDNA 4XUNA 2ZBJA 3VBRC 1DZTA 5FWJA 5GKAC 1SACA 1XOYA 2H0BA 3AZZA 2Q8DA 3IT8A 2MNGA 1ZA7A 3PIGA 2B7YA 3PUAA 1IKPA 1SHWB 3TRSB 2WN2A 2Z2SB 2WNVB 3VHOA 3B9IA 1ZYBA 3USSA 3IDCB 3WNMA 3BB6A 3OPZA 4CEWA 2ZEYA 4MGTA 5LBFA 1SCRA 4QX8A 1H1MA 1XNKA 3PUIA 4DY5A 2X09A 1OI6A 3NVCA 3T0BA 5A3MA 3DN7A 5KBFA 1EV13 1JOBA 2AGSA 4D0QA 2E32A 2XJUA 5KXDA 2QBXA 2WC2A 3GALA 1RMU3 5EXOA 5BNNA 1LENA 2JDKA 2VECA 3MF9A 3GF6A 1CAWA 3EBRA 4G4FA 4JX0A 1LCLA 3ILRA 3B02A 1NZCA 1T6BX 4IDZA 4M01A 3UKNA 3VBUC 1EV11 3ZXAC 4CTEA 5GALA 1CAXA 1AJOA 1MS4A 2ZGMA 3OSDA 4Q0VA 2G9ZA 3LPGA 3E5UA 4XABA 2WNOA 1PO13 5F5QA 2QZ2A 3VKOA 4A4AA 4KMQA 3VDDB 3P6BA 4GZ9A 1GNHA 3VHRA 1W6PB 2HBUA 2O1QA 5CFDC 3LDRA 1N1TA 1VIWB 4P00B 1JTZX 4L2NA 5LASA 1PO11 4NHYA 4LR4A 1R1A2 4EWDA 1YWKA 2VW0A 1XE0A 5L36A 5A1FA 4NWWA 4PI2A 5IT6A 1BMV2 1REFA 2PHRA 3OUHA 4OUMA 3VBHB 1DBNA 4ES8A 4QPYA 1AHSA 1OXCA 3M3IA 1D2QA 5H9SA 3UL2A 4DUXA 5IHRA 3K51A 4Q4W2 2RJKA 3MV01 3TWIA 3HIFA 2Z5WA 3U10A 1LEDA 1ODNA 1EYBA 1VMJA 3R0RA 2VBPA 3WF1A 2N7GA 2W47A 2Y6FA 1WLWA 2ZOEB 5I8YA 5CFDA 4EN7B 1ND2A 5FZIA 5C8CA 1VE0A 4QXHA 3F95A 2ZZJA 5L9BA 3R4SA 4EQVA 3LFMA 1OF3A 3SQOA 5E1RA 3NW4A 1ZZ7A 2IXLA 2DCYA 3JB8A 1E5IA 1SLAA 4WZCA 3PMEA 1UY2A 1KITA 2DUOA 4MX3A 4CCCA 4UFMA 5FOJB 1LRHA 1LOFA 1PMIA 2WQ8A 3KT4A 5L9VA 1SLLA 2GN7A 2BVVA 4DRRA 1MR5A 2VZVA 1XSRA 1ZZ9A 2XLFA 4FP2A 4LT5A 1F4AA 5DN2A 2YY1A 1DYOA 4UFKA 4UW5A 4PI0A 1BJQA 2RR12 1W8HA 1NA1C 4EROA 3OGVA 4LIUA 3MZHA 4F83A 4LOSA 3M3CA 4IE7A 5C3OA 1UY0A 4XF9A 3MIDA 5EZWA 3UESA 1YCIA 1YIFA 2MPFA 2WA4A 4R8HA 4BJ0A 3HJRA 4RHV3 2ZGRA 3UT0A 4CPBD 4A7ZA 4D69A 1RUD3 4FPFA 2WFPA 3THCA 4CEYC 5CADA 1ZM1A 3PTYA 4EN8B 4QX7A 1SLCA 4Q4V2 4UF0B 4ASMB 1HRI3 4LKFA 2V5DA 4JGYC 4P9XA 1C1FA 1PM4A 4QDRA 4K20A 2YFZA 4W50A 1RUD1 2BFUL 2BFUS 1BBT2 3POSA 2EAKA 2LUWA 2G1MA 2QQOA 1HRI1 2J1VA 3P5BA 1EY2A 1FT9A 1AR73 1MZFA 1N3PA 4OCTA 4QKFA 2RM22 4NAOA 3ZMNA 5IVBA 3ETPA 4GKXA 5HBAA 2QQJA 1YQ5A 2FCUA 1GKBA 2BNMA 2OYZA 1S0IA 1UOBA 2GNMA 2PAMA 1AR71 4NO4A 3GYDA 4Y20B 1H4HA 4CEYA 2VE1A 2PN5A 2A7AA 2W94A 4E8CA 1NCQC 5B2GB 4JGYA 3ZR6A 1H30A 4M3CF 4MGZE 4IV3C 1OHFA 1PVC3 3O12A 1Z0HA 2P6HA 5A33B 2EF6A 5JDBA 5KHIA 4DPNA 3C2UA 3POWA 2QFEA 3WZ1A 5L19A 2D6OX 1ZBA2 4QGLA 4QB2A 5LA2A 1XU1A 2UURA 3S7IA 1OMIA 2PHFA 1PVC1 4PBOA 4JVAA 4COZA 5FBJA 1LAJA 1BLZA 2BGPA 4K1ZA 4L97A 5FP9A 4IV1B 4UBHA 1VRH3 2ZAAA 2R30A 2EA7A 3I7DA 2E6VA 4FOVA 1NCQA 4TSVA 2D3RA 2DDUA 1CVNA 3VBOB 1WKYA 1E5RA 1ASJ2 4KGGA 1SDWA 2I74A 2WLPA 3EO6A 4IV3A 1FPN1 3RZLA 4OHWA 1H9PA 5A32B 1MS8A 2VQUA 1VRH1 3O14A 2QUOA 4XEZA 1OA2A 4PIXA 1LB2A 2PLV3 3PVEA 5D8AA 1N1SA 3ECQA 1R093 1BK0A 5BNNB 1OPMA 3HR9A 4AVAA 1UOJA 1NXMA 5FXZA 4GJYA 2EIDA 3KQ4B 2FCTA 4PHZA 2PLV1 1LU1A 1RIRA 1HV1A 4QQPA 3TOJA 1K12A 4B4QA 1VBE2 1R091 1LOAA 3ZPYA 1WCQA 5BNOA 5FDBA 3OGJA 3ZO0B 2LS6A 1MS9A 4W6WA 5LRSA 4NIDA 1H1AA 2DU1A 5FJHA 4UYBA 1RUJ2 1REEA 1UX7A 1W6QA 1X33A 1YQ8A 1WMEA 1DYPA 2E33A 2J1SA 4XTPA 1TMF3 3IMNA 4JTNA 1K3IA 1XRUA 2RE9A 3ZFEC 3ILNA 1AZDA 1U5XA 4PLOA 4JCKA 1FOD2 4LULA 1TVGA 4QT6A 2BZDA 2VZSA 4Q0PA 4A6OA 4Z82A 4WM7C 1TMF1 2QQLA 3GGLA 3I2FA 2BVBA 4KGQA 1F5FA 4BOWA 2V4AA 4UAPA 3ZXFA 3AB0A 2QE3A 2DWRA 3O0XA 2OPWA 5LCWL 4XHXA 4XF1A 2RS32 5F6LB 1OVPA 2P3IA 4AI9A 1WCKA 1ND2B 1CZTA 2HWF2 2YZ4A 4JAAA 5FLJA 4XFIA 3WQBA 3WD5A 5CG9A 2D7FA 1UAIA 2DURA 4AI8A 1ULCA 1VR3A 2WNUB 5FFOC 5CEHA 2OIIA 2VVFA 5FZ1A 4GD4A 1K5JA 1JYWA 3CJIC 1XYOA 1OH4A 4UFLA 1PZ7A 1V9U2 1YJKA 3DKWA 2D6LX 2LALA 4FTBA 1SG3A 4CP2A 3VBFC 1LODA 2GH2A 2R0FA 4P9JA 3H50A 1RHI2 4WM7A 4E2QA 5CIRA 2ZS6B 2ILMA 1ULFA 2ZGPA 5CNAA 4OLLA 4JZRA 3SHRA 5DAVA 4NPMA 5KHKA 2JENA 1O8SA 4CUBA 2HJIA 1Y7BA 2XJTA 3H3UA 4TXWA 1S1AA 3WNPA 2G9GA 3OY8B 4MVTA 3MGUA 4XURA 4ZU4A 2OA2A 2QQWA 4YG6A 1DF0A 2VD7A 2Y6LA 1MQTA 4S2FA 4Y1XA 1IPSA 3RFRA 3U11A 3LWCA 3AYCA 1QJU2 1CX4A 2Y60A 4DS0A 3WHTA 4NIGA 2Q8EA 3AP9A 5FO8B 3ZXLA 3I54A 1YC61 2Q0AA 1JBCA 3IN9A 3C7FA 1AXKA 2W39A 5FR3A 4XMIA 5IUQA 4IW3A 5FZKA 2JEMA 2YU1A 3I2GA 4PF5A 4XPVA 1UMZA 1R1A3 1AX2A 3ME2A 4RQPA 4Y1ZA 4JDOA 1OPOA 1CQ9A 2W95A 4LMFA 4FFGA 3SH3A 3UKTA 1OQDA 4YM2A 1PVXA 1SPPB 2VCMA 5A7WB 5FV3A 1GQPA 3AJYA 4RSUA 4WVWA 1R1A1 4Q4W3 1A6CA 2JIJA 4XZUG 2KA3A 2EVXA 1V70A 4M00A 1BMV1 1KRIA 1MS1A 2H6BA 1X9TA 4D6RA 3N9OA 2JIGA 1C4RA 3N9PA 4FPJA 3L2HA 4BA6A 1CESA 5AVAA 4Q4W1 4LE3A 2X5IB 3IZOA 2J1RA 4AFBA 5T3NA 2OS2A 3VDAA 4QPGC 5LRRA 3WNNA 4HSJA 5IFPA 3VUOA 3LDKA 2Q30A 4N43B 3FLRA 1RJ8A 3O0VA 5GZGA 2C9AA 3CQOA 2CDPA 4K40A 4Q1RA 1QH6A 4YRDA 2BUKA 1Z7S2 2VCBA 2XJPA 5KHGA 3GZAA 4BDVB 2RDSA 2D97A 1UY4A 3FUQA 4RGKA 3LKJA 4YFZA 1QOSA 4GWJA 4IEYA 3ZSEA 1WLDA 1Q5OA 3WG1A 2BRTA 2JG8C 2RR13 1ZRCA 2DCTA 1OVSA 3JZVA 1B35C 2UWBA 3T0DA 1X8EA 4P9GA 3ZSMA 1W99A 2DVBA 4BQYA 4NRMA 4DXTA 2HEWF 4YYOA 5BNPB 1W28A 4LKEA 1FMD3 1SLIA 3MI8A 3FFQA 1SMVA 4FP3A 1X82A 1H8TB 2RR11 2VM9A 4QPGA 5IFTA 4COWA 3GJAA 1OSGA 4AI1A 3E6CC 1YXWA 3LOBA 4Q1PA 1V6MA 2P4EA 1YFYA 1HQWA 2FCVA 4Q4V3 3ZLIA 4BQ5A 2UU8A 2W68A 1ULOA 4QGNA 4YVSC 1VAVA 2JG9C 2FDJA 1W9YA 1PIV2 3EYPA 3ZN5A 1ULGA 1X9PA 4AEKA 1DGWA 4DB5A 4I09A 4A3XA 4CSWA 4DEVA 2JDMA 5CYYA 1SZBA 5IYYA 1BBT3 1CAUA 1GZWB 3QACA 4FXKB 1NLQA 4NRQA 4Q4V1 5FYTA 2ES3A 4P14A 1B35A 4XQDA 2DCJA 3UK9A 1UZWA 3OUJA 4CUAA 5HCAA 4HETA 3H8OA 2VOTA 2Y33A 2RM23 3OCPA 5HXVA 1PNFA 3NQHA 5FRAA 1BBT1 1S2BA 2YFUA 4LUKA 5I93A 1G9CA 2B39A 1K5MB 4C0BA 2VCAA 4OHYA 3LIHA 4Q5OA 3J7NA 1VRBA 4Y1UA 3CIHA 4Y1VA 2RM21 4QXKA 5FPBA 4CP0A 1POV3 2B42B 1TEIA 3FBYA 1Z78A 5IATA 1SFYA 1ZNPA 4LO5B 3F2ZA 2Y38A 3HN3A 4PJYA 1IZ3A 1A8DA 4U36A 1W0PA 4QPIC 2YC2A 4QHZA 5C71A 4QKDA 5J48A 5KC5A 1RB8G 3BUCA 2C0ZA 2H6CA 1POV1 1W6NA 3JB4C 4RA0A 4WVZA 5FZ8A 4CYDA 5KWRA 4OI4A 3OGSA 1ZBA3 4CDQA 3I2HA 3WHUA 4O65A 2ERFA 1KJRA 3HQRA 4L99A 1RMU2 5DMYA 5J37A 3B69A 2CHHA 5B4NA 2W1UA 3K75B 5FZLA 1YO8A 1NX9A 2AUYA 3HT1A 1O7FA 3WOGA 1ZBA1 3AZVA 5JAXA 4EE2A 5ABJB 2B9VA 3JU9A 1JYCA 1JU3A 4I30A 4S2GA 3K46A 2ZEXA 4GULA 3KZ4C 1RUC2 3ENRA 3VL9A 5BY5A 1IQDC 2YG0A 5FPAA 2UYBA 1ASJ3 1QNYA 4C0HA 1VBB2 2VBBA 3SLIA 4BMBA 1PMHX 1UF2C 1WD3A 2ZCWA 2D5HA 3AKPA 3H3ZA 3PLQA 4HL0A 1NZIA 3ZSLA 2PA7A 1GOHA 2RJ2A 1U0AA 2BBAA 2Y0IA 3B93A 3EB7A 3HNMA 2GC2A 1W2OA 4O7XA 5JZGA 1ASJ1 1XU2A 4Y24A 2WR9A 4XC9A 1TZOA 4YZ3A 2C4XA 3CLPA 5FP8A 1MQTB 4Y33A 5EYXA 1O91A 2DF7A 2PELA 1W6MB 2ZABA 5DPNA 2PAEA 1UCXA 3LOIA 1TNFA 3IPVA 1WLTA 2Y6HA 2YYOA 4DNYA 1VBE3 3BI3A 1Q3EA 2O8QA 3KV9A 3LZZA 5JR7B 4M4PA 3VGIA 4B29A 1N1YA 4AVCA 1RGSA 2MEV2 4LBKA 2ZGUA 1RUJ3 2KM2A 4RFT0 1IGOA 5BPXA 2F4LA 1VBE1 4LO4B 4NRPA 5E16A 1OKOA 2VZTA 4IE0A 2VNRA 3ALQA 4RQPB 1UD1A 2D93A 2WS92 3SCGA 1D4M2 2PFWA 1RUJ1 1LOBA 5GLWA 1W04A 4L8QA 3ACGA 1A34A 3GHMA 4G9SB 3RYKA 1KDKA 1FOD3 2QTWB 4CUGA 1TME2 2TUNA 2WNVA 3VBSC 3WEZA 4DRVA 4SBVA 4RYDA 1ND3A 3WP3A 4B7EA 4LBQD 2FMYA 5IVCA 2IXCA 2CAUA 2ZX4A 4CU8A 1FOD1 4XF4A 1I6XA 3Q8EA 1JI6A 2RS33 1AUYA 2P5BA 3ZYRA 3O1PA 4H7MA 2VUJA 2IWGB 3J4UH 3QCWA 4HVOA 4RFRB 2HWF3 3AZXA 4A7KA 1MS5A 4Y5TA 3VBHC 1NLRA 2VTFA 3PTRB 4JRLA 4YZ4A 3VL8A 3H1WA 1ENXA 4KG8A 4AGGA 4RHV2 1WMFA 3PNAA 2A71A 2RS31 1EUTA 1G7YA 2A6XA 4NN0A 4XDQA 3RS6A 3ZKUA 5JXGA 2HWF1 3NO8A 3CZUA 4XYXA 3LEMA 2SLIA 2XXZA 4RR3A 3ORJA 2BOJA 2B4KA 1RHI3 2QDRA 3AZWA 1V6JA 3H1MA 1DZQA 1W6PA 1G9FA 3VDDA 2PQSA 3ZXKA 5C3PA 1Y4WA 2LRPA 1V9U1 3L9JT 1RJ7A 4OULA 4K3UA 1UYPA 4UWDA 3RZKA 1YHFA 4XUTA 2FZ2A 3I2KA 1DYKA 1RHI1 3RI8A 2IXJA 5JOWA 4XTMA 3VBHA 1E57A 4NAMA 3EHKA 4L9BA 2QKDA 5JMOA 4QM8A 3IAQA 2Y26A 1W8OA 1QJU3 4XIOA 1R083 3ON7A 3UKVA 1HIXA 2VQAA 4AF9A 2IFWA 1M06G 3FL7A 3POEA 1LULA 3HAGA 1GWKA 2FQPA 4H14A 4M3CE 5A3LA 4PT6A 1UU5A 1DQ0A 1UNBA 1Y9GA 1VJ2A 2XLGA 1QJU1 1JZ5A 3PMSA 4LIVA 3AZYA 4LQRA 5FJKA 2WINB 3NJZA 4WVVA 4WV8A 3AYEA 1KJLA 3WF4A 1QNWA 3T2QA 3ZPOA 2XQRA 1AR62 2ORZA 2WQ4A 3CNAA 5GJ6A 2BGCA 4UW4A 5CKMA 3ZR5A 1ULPA 1PHMA 1O59A 4UFIA 5JVVA 1QJX3 4OFGA 4BQ3A 1H2NA 2XWBB 4CZSA 1E5HA 1Q56A 5H9RA 3RPQA 3WINE 1QOOA 1YEWA 1ACCA 4H2AA 5A7SA 4AQ2A 1W0NA 5ACA2 2IXKA 3I3DA 3POJA 3UGGA 3WDTA 3AYAA 1PM7A 4LBJA 4JHTA 5FZMA 3ZFFB 2FMDA 4RL7A 5JI7A 5LBCA 5F3CA 3M70A 2RDRA 3JBG1 4LK7A 1ZRFA 4DO0A 1J1LA 5K4LA 3V0AB 1ZRIA 3PL0A 1RYYA 3WXPA 4W6XA 1ZZCA 2J7MA 3I2DA 1XC6A 4YM1A 4E4SA 1G9DA 3E1F1 4QX5A 2GH8A 3GZUC 4I01A 3HOBA 4FPYA 5T5LA 1DG6A 1OA3A 1Z7S3 2YROA 3IM0A 4P9WA 1C8M2 3K77A 4UXAA 3FMGA 4UF0A 3RDIA 1V6LA 4AQ6A 3N7KA 2D5FA 1K42A 1HXS2 2UWCA 5DAPA 2OT7A 3O5SA 3LIGA 1Q8OA 3VDBA 2D3PA 4COUA 3LPFA 5H9QA 1YJLA 2A3WA 4PDWB 3IDBB 3ZM8A 5T5PA 1Z7S1 1T2XA 3O1OA 1UXZA 1V6NA 2JDPA 1VBD2 3MPPG 4YFWA 5A3TA 1WW4A 3OPTA 2VZ3A 3HD8B 4JGZB 1H2KA 1ZZBA 1V0AA 4LKDA 4X8PA 3HMYA 3MDPA 4OZXA 1JZ4A 5J7MA 4MZUA 5K0UA 5L7OA 2ZHLA 4Q4X3 1QGLA 5CBLA 5EIYB 1WCSA 3FLPA 2R071 3BYWA 5JZGB 3BU0A 4LO6B 3D0JA 3NV1A 3OBAA 3I8TA 2RVAA 3QOPA 1QDCA 3AJZA 5HV4A 2Z79A 5JUVA 2ZJCA 1PIV3 3VBOC 3WR0A 2W3JA 1GU3A 3LEKA 3POGA 2GC0A 5T52A 3LB9A 3I3BA 3ZYGA 5A33A 5KXEA 1J84A 2B5HA 3FC0A 3AM2A 2QVSB 5FKBA 4DZGA 1GSLA 3SISA 3IKWA 5LK7B 1PIV1 4HLTA 4LTAA 4NIHA 2FDFA 4X8NA 1NE4A 3NAPB 1GOGA 4LKSA 4UFHA 5BNNC 4N7IA 5FXXA 3N35A 1HQNA 1ZA4A 5IWFA 3EQEA 2NPIA 3KF5A 2YDEA 5CB7A 4BQ1A 3ACLA 4Y3OA 2O8OA 1FATA 1H2LA 1UKGA 2BYVE 4IV1A 3WDVA 4CU6A 4V2WA 4K1YA 4GIQA 4RGAA 3JUUA 5A6ZA 5HCBA 4FCAA 3NV3A 3VBOA 4B7KA 1XNDA 2ZZQA 4IQPA 4NOTA 1ND3B 3PVBB 2NP0A 4IEOA 1I9RA 4AVTA 4AVVA 1LR5A 5A32A 3S5AA 2QQNA 1D7PM 4MGIE 4I2OA 2WO2A 2TNFA 2JD9A 1I5ZA 2EXHA 4IEPA 1QH7A 4NHXA 3POYA 2NLRA 3EXUA 5DDJ2 2X29A 1VPHA 2DFCA 1JN2P 1JXNA 2QQUA 4B1LA 3WW2A 1CZSA 3CJXA 3H42B 4BIFA 4HK9A 3E6DA 3JD73 3DCQA 5DUWA 1AYM2 3RG0A 2LTNA 2XL9A 3K2OA 4I0WB 5JPNB 1RMU1 3C3VA 3NRUA 2WRAA 3RYPA 1H0BA 4RR3B 1RUC3 5DUUA 4AEDB 3B7MA 1ND2C 5C8CC 1VBB3 4NWVA 3FZ3A 2AREA 4KG0A 2G9FA 5BXXA 1K45A 3RJRA 2WO7A 2WUHA 2Q8OA 4I0AA 4AI0A 1RUC1 2ARAA 3JQXA 3KT7A 1AL0G 1KEXA 1FXZA 2A5ZA 1YRZA 3OEAA 2V09A 1VBB1 4ZXKA 2W92A 2DFBA 2ADDA 3E5XA 3ES1A 1LOFC 4XXPA 4YLZA 3RNSA 1Q8PA 1XQNA 1X36A 3SXWA 1O4ZA 1W2NA 1ODMA 4MXVA 3WW4A 3MIFA 3SMHA 4C1XA 3TB0A 4TLFA 1DQ5A 2OXBA 3POBA 1SCSA 3O0WA 5C7GA 5LA9A 4GAZA 1OT5A 3RWKX 3ELNA 3W9AA 2MEV3 4QGMA 4NE9A 4IEVA 3MEPA 4YW4A 3X29B 1SBDA 1U12A 4CU9A 4DY3A 3KLSA 1O3SA 1CAVA 1QJEA 1YFWA 5EWSA 4KBZA 3ZDSA 4ATEA 2WNUA 3B00A 5CKNA 2WS93 4IL7A 4LORA 5IVFA 2MEV1 1D4M3 5FK7A 1CX1A 3WQ1A 2HKXA 4LITA 1MS3A 5FY8A 3WQ0A 1IHMA 1LGBA 3KGLA 4ZZ5A 1ZBE2 1TME3 2YUEA 4P5HA 4LA3A 3HBZA 4Q0SA 2WS91 5DZEA 2ET1A 1D4M1 3RSJA 3QH6A 4BMEA 1V6KA 4A41A 4XE9A 1TME1 3AKQA 3AMNA 1PGW2 4H7LA 4PLNA 3UETA 4BWOA 4OUSA 2OKXA 3OY8A 5CVRA 2GP3A 3LA7A 2ET7A 5C5UA 1FMD2 2BW8A 3NV2A 1B09A 4PLMA 1BXHA 1UPIA 2ZX3A 4YGCA 4FTEA 1I5PA 4XHBA 2VPVA 4IEQA 1GLHA 2XHKA 1JH5A 3IIIA 1DLLA 3URFA 4QWNA 1JOJA 2VY0A 4XFAA 4HPKB 5A70A 3RYRA 2VOKA 1CR7A 1ZVFA 1A8MA 4RHV1 5TSWA 2UYAA 4A44A 1LHWA 1FYUA 2X5IC 3DUIA 4IEXA 3WNXA 5A6YA 2W9XA 2ZKNA 3VKFC 1FV3A 3NMBA 3QLQA 2CNAA 2CWMA 3RQ0A 3ZXDA 1UZYA 3C8XA 3UV9A 1ST8A 1TQ5A 2GMPA 1RUF2 1SPPA 3ZIWA 3NNLA 4QX1A 5A7WA 5K0UB 1OBNA 5L7OB 1QOTA 5FZHA 4E9KA 3DEMA 2W87A 2PTMA 3OGGA 2XPJA 2ZPXA 3GHNA 1Q8VA 4R4ZA 2R32A 4D8MA 3BIEA 4QXCA 2E7TA 1JU4A 1NT0A 2VO5A 3IDEA 5F5CA 4MGYE 3VD7A 2VZPA 4DFSA 2XH6A 4SLIA 1YIPA 1UO9A 4N53B 1G6NA 4U2AA 4FAGA 1IS4A 4GQ7A 5LATA 4YSFA 2VW1A 3T0AA 1OLQA 2YMZA 2X5IA 4C1WA 2P6CA 2XJRA 4D94A 5FTTC 2E7AA 5BNPC 5I0TA 5D1IA 1OD5A 4ZXEA 4NIIA 1WLCA 4KU8A 1RUG2 2AACA 4N43A 3ZSKA 2AEYA 5D8AC 3THDA 1AR63 4M0HA 1OLMA 3OBRA 2YXSA 3MUZ1 4QU2A 3AP4A 3H8UA 4R9BA 1JHJA 3B94A 5C33A 3V56A 3WVJA 1QXPA 3VB9A 4J1XA 1H4GA 1UIKA 4BQ2A 1H6YA 2R6QA 3A4UA 3O7OA 5ACA3 1AR61 2I2SA 1BKZA 3DPRA 5F2SA 5BNOC 2DYCA 1W03A 1EPWA 1G8WA 1WMDA 4HG6B 2D40A 1WA6X 1JZ8A 2CAVA 2ARCA 5APAA 4P9IA 3VZLA 4XCBA 5ACA1 1GV9A 4CDUB 2VH9A 5EFUA 1HJGA 3M3EA 1WW5A 3LQCA 3KT1A 5BNPA 5J96B 3H8RA 2XVLA 1U5IA 4AOCA 1H8TA 5I8SA 3V64A 3N7MA 1K5MC 4XQWA 1HB3A 3C7HA 1O4YA 4F8AA 4MOAA 3HPNA 2XL7A 1LECA 1C8M3 2ZGQA 4R52A 4XILA 3TNQA 2TBVA 4BU2A 1HXS3 1XB9A 5E8AA 5KHJA 1J3RA 2CYFA 4R9AA 1CJPA 5L73A 1NAEA 5FIXA 3AKTA 3RWNA 1GZWA 4K8FA 1H1IA 2GZWA 5JSOA 1HXS1 4Q0QA 1VBD3 5LK5A 3VD9A 1N1VA 5C9AB 3SNMA 5C8WA 2GNTA 3H1YA 5A6QA 1QU0A 1VB2A 2WNEA 1YUDA 1LKNA 1LOEA 2OUHA 3HT2A 1Q43A 1LESA 1K5MA 1U5YA 1VBD1 2F6BA 1D0HA 2VNVA 3RMXA 3MIBA 3VBRB 5ABJC 1NQDA 3VD3A 3BTXA 2Y6JA 5FPUA 1GBGA 1KQRA 4DOUA 5DXDA 1PZ9A 3BGAA 1VB4A 4QDSA 3WF2A 2AENA 4EV0A 2GNDA 1GWLA 1OOPA 2VQ0A 3C7GA 3ZIXA 5IK5A 3BTZA 1JYIA 2XVKA 1CAVB 1JOPA 4WVMA 4BB3A 2W2IA 1MQTC 2Q8CA 2ARXA 2CV6A 1AL22 5F39A 3LAGA 2OUJA 1WD4A 5ERLA 3LDBA 3U0ZA 1UX6A 4XCAA 3WP4A 2ZTNA 1GFF2 5ABJA 3D82A 1AR82 3SCFA 3VBUB 4YZ1A 5GLUA 5CISA 2WZR3 4IGOA 1GP4A 1VBC3 2C26A 2GMMA 3N9QA 2NMNA 1HB4A 2WT1A 3OGRA 3WY6A 2BDRA 5A80A 3ZYJB 4CVUA 1STMA 2DVGA 5AFBA 4KH9A 1A3KA 2OPKA 5KHHA 2QJVA 2AYHA 2YPDA 3PUQA 1GP6A 4JRAA 4RQPC 1G86A 5EJZB 2FD8A 2ZX0A 4ZKTB 3FHIB 5I8TA 3MW3A 3WP5A 1DIWA 1AXZA 4I0BA 5DDJ3 3WQ7A 5EPAA 3KD4A 5FYCA 1DDLA 4Q27A 4LK6A 5FZAA 1QQP2 4GWIA 5K8SA 1W6MA 1BVVA 2RG4A 3H7YA 4MO3M 1UZVA 1R082 2VUCA 1AYM3 4JHZA 5FO9B 4GXLA 4GWNA 4JDMA 5DDJ1 4DQAA 3WX5A 5FYMA 5I0UA 3UGHA 2VUDA 3DYMA 5T55A 3U75A 5BUVA 1SQ4A 4XJUA 5A3OA 4BIOA 2Y6GA 1FV2A 1L7RA 4FOQA 1L7QA 4ET7A 1AYM1 2HWE2 4FFFA 1US2A 2WLQA 4EZ4A 4YARA 3BTAA 1V00A 4A6SA 2HH9A 4NMIA 2C1FA 4BISA 1BQPA 3A23A 1ZRDA 5JWPA 4ZU5A 4A42A 2Y64A 5FMOL 5FMOS 2AH2A 1QJX2 2ZGTA 1H8VA 4Y4YA 3J8F2 3QH7A 5F3GA 2OVUA 2P34A 5FMCA 5GLVA 1D2SA 4LUMA 3SITA 2HWB2 4OI1A 3GXUA 1PGL2 3S6PA 4URAA 4NIAA 1OD3A 3J7MA 5FCCA 5FXVA 2JE9A 1SFNA 1X50A 3SC7X 1CIYA 3AKRA 1NA1B 4M0NA 4AI3A 2HWC2 2DU0A 2ZGKA 3UYJA 3VLBB 1NOVA 3WNKA 3OJBA 1JYTA 5CU1A 1GZCA 4BQ4A 4DUWA 4FAHA 3ASIA 3I3EA 5JMCA 4QHOA 4GH4B 1RUNA 1C3HA 5A6XA 1ZBE3 2Z69A 5A7PA 2WYFA 3WV6A 3W59A 2G4IA 3DPRB 4OZOA 2VZQA 4TYSA 1FNZA 1ZBE1 3T3YA 1QJFA 3N3HA 3N7LA 2JD4A 4N9IA 2NYYA 1UIJA 5D2AA 3FJSA 1W9WA 3NNGA 4LHLA 4QAWA 3ZX7A 3ZYIB 5F32A 4AHXA 4XFFA 1PZ8A 1S2KA 4UI9L 1COV2 4Q4X2 5LB6A 3PVNA 4HFSA 2ZAHA 2VBDA 1PGW1 4CCOA 2QQKA 1MZ6A 3FN9A 4I02A 4BXSV 1W6OB 5CAZA 1FMD1 3NV4A 5F2WA 5FLIA 2L9LA 4LOTA 2ZHKA 5F3EA 3MICA 3WF3A 2A6YA 3NL1A 5FP7A 4MLOA 1RXGA 3V0BB 2ATFA 4C90A 2R7EB 5FYBA 1O6UA 1DLCA 3RZMA 1S0JA 1W3XA 3INAA 3UNPA 2A6VA 5FLHA 4CDQC 4Z2AA 3A0KA 1VAKA 3L2YA 1RUF3 1GZ9A 4D7YA 4ASLA 2QCSB 4IUGA 5AVPA 2VOXA 1XPWA 4IEWA 1H2MA 3THTA 4G3YC 1VP6A 2VMGA 3TNPB 4FPGA 1YNAA 3RZHA 1XE8A 5DG1A 3VHPA 3LA3A 3PVOA 4PDWC 3H3LA 4ONUA 1RUF1 2XONA 1W8ZA 4F3JA 3ZFFA 3ZYBA 3QBQA 1LGCA 3S30A 1VBA3 1SDDB 4HN0A 1JHNA 3DGTA 1DQ6A 1US3A 3KV6A 3HWJA 3D5OA 3IMMA 1SBEA 3AMHA 5DABA 3V0AA 1EP0A 1OOPB 3D3AA 1KFXL 4HK8A 1RUG3 4XXAA 4Q26A 5JXIA 1X8MA 1VMFA 5JZGC 4BH9A 1WW7A 2XVGA 4Y1YA 2R0HA 4Z07A 3B9CA 1YFXA 2NQYA 4WVMB 3NKGA 2WT0A 1J58A 2ZGOA 3H9AA 1RUG1 3ZXJA 1UZZA 5A7OA 4Y5SA 3CHXA 3JD72 5KXBA 3KHBA 2JJ6A 4PDWA 5FZBA 5C5TA 1I3HA 2VMDA 2Q1MA 4I3PA 5A7QA 2XBO2 1SLBA 3FX3A 2JDYA 3T2TA 4YVWA 3K48A 3K3OA 4JGZA 3B5LB 3HN1A 1OLRA 2O14A 2XB6C 2VVEA 4JKMA 5FYHA 5FYSA 2ADEA 3WDUA 4AFCA 2ZHMA 3PDQA 3KHCA 5FUNA 3O1SA 4FFIA 3MW2A 3WDYA 1CD3G 2OW4A 1BK1A 2CTVA 1PGSA 4FPHA 4IE6A 1CN1A 2EAAA 1S2EA 2VMHA 2JXAA 5FY5A 1AX1A 3SEEA 1C1LA 4KL1A 4LO8A 4Z1VA 2CGPA 5LW9A 4JC1A 4OVEA 4LPLA 5CG8A 2FDGA 1O8PA 4CCLA 2WNVC 3K4DA 3LEIA 5J1XA 2WN3A 1MZEA 2K46A 5LBEA 2VMCA 1ND3C 3HNYM 1PX4A 3D8CA 3J7HA 4PIYA 4XDOA 2YBSA 3JCIA 2QQMA 1POQA 1IS5A 2DTWA 2Q1ZB 1IOAA 4S2HA 4BK5A 3NWKA 1IS6A 1HN1A 4LBQB 2WABA 1RL3A 4CDXB 5FZOB 3NAPA 5K7PA 1CIWA 4INDA 2IXIA 4JKLA 4HANA 1C5IA 4CCDA 1M4WA 2D6NA 2JDAA 4XOGA 3SH4A 2BBVA 3BIWE 4FO9A 4JQRA 1WA4A 4CUCA 3ES4A 4DXSA 4YNIA 3DKQA 4RR3C 5C3RA 3VDDC 2DBNA 2KR2A 4UW3A 3VBFB 3DV8A 2D3SA 3RZJA 4QXBA 1S0GA 2DVFA 4E4ZA 5IK7A 1UOGA 3CF6E 3JXSA 3M4FA 3RZGA 3KSCA 3CMGA 5FUPA 5LEJA 4YGEA 3W21A 3U1XA 4BPZA 4FQZA 2ID4A 1L3JA 4OYUA 2B9UA 2LROA 4DEQA 1BEV2 3B3QE 1AL23 4QB1A 4XUPA 2PQQA 2O0OA 4BHPA 4AE2A 2WZPP 1AR83 3FUOA 1H6XA 2Y6KA 4AR2A 4Q29A 1POV0 1DQ1A 1AL21 3WP6A 4ASKA 3MF6A 4AEDA 2XUEA 3ZYFA 4I3GA 5FMBA 5A3PA 5FK8A 3GCWA 1J3PA 3CEWA 1PNGA 2PXJA 1AR81 2HYKA 1NLSA 3ACHA 4O9GA 1WGPA 4XUQA 2KD7A 5JR2A 1ENRA 5G05L 5BYNA 4NHLA 3J26N 4BCUA 3DECA 4AHZA 5T5OA 3OBTA 4QX3A 1F31A 1TE1B 4Y22B 2BGOA 4OQ9A 4KWUA 1QQP3 2GU9A 3FHAA 1CWPA 5FQ0B 3VD4A 3KV4A 2JKBA 3WUDA 3NJXA 3B01A 2VJXA 1XNAA 4RS5B 1JYNA 1SEFA 4FPLA 2X8KA 4KWJA 1HN0A 2VMEA 4LBOA 3RRDA 3BPZA 1QQP1 5DAWA 1PK6B 2EICA 1DQ2A 1R081 4XJ9A 4KU7A 4HN1A 2SBAA 4QX2A 1BVP1 5FKCA 2HWE3 4HVRA 1I1EA 1QJY2 4XFCA 3SEPA 3N36A 4GMP3 2V4VA 4HSLA 1YLLA 3POIA 3J9SA 1QXJA 4Q8LA 1WW6A 3K4ZA 3ZSJA 3DL3A 3N9MA 4YW2A 2RV9A 4CPBA 1WBLA 2HWE1 4FI9A 5FPVA 5CKQA 3J8F3 1X7NA 2WAOA 4GMP1 1UPSA 3T09A 3S5QA 4ZONA 2R49A 4HOOA 3U78A 3VN4A 2VZUA 4FTSA 3VZKA 3MPBA 2A1XA 2G19A 3PIJA 4BQXA 2HWB3 1OKQA 3H0OA 1QJX1 4XDPA 1LU2A 1MEC2 3J8F1 4FXGB 5A7NA 5LY1A 4LBLA 3CO2A 4BM8A 2GALA 2R1BA 2JG8B 4TWTA 5F9TA 1RXFA 3P3NA 2HWB1 2HWC3 5C4WA 2B8MA 1PGL1 4ZZ8A 5K0UC 5JXJA 1QIQA 5L7OC 5DZGA 1QHDA 4RN5A 4XETA 1ENQA 3HQUA 4ZHNA 4EWEA 3TEYA 4HPKA 2HWC1 4Q2FA 4KQ7A 4XUOA 1UN1A 5JIUA 2A3XA 3M3QA 2X05A 3I2IA 2RS53 4HKOA 5JOYA 4LNVA 3WCRA 4YVSB 2JG9B 2TEPA 2WWSA 5FPZA 2IFRA 1HKDA 1WBFA 2JB4A 3RVHA 3CBNA 1C5HA 4FPKA 2WAAA 4JQTA 4XJ8A 4MHRA 3U4XA 4YVWB 4URTA 2MHFA 3I59B 4NROA 4B8EA 1JUIA 2WIIB 3PUSA 3SKJE 2J1UA 5FP3A 3K4AA 1COV3 3CDZB 2ZX2A 5DAXA 4EYUA 4IV1C 1KS4A 5I0SA 2W1WA 3LSEA 2V72A 4GB32 5IAVA 2HEYF 1RUE2 3VZNA 4N53A 5SV5A 1COV1 4Q4X1 3R4UA 2FHRA 3ITQA 2JB8A 1JUHA 3AP5A 4NVPA 3KCXA 4IGPA 4MHUA 1ZZ6A 5DQ0A 5GZFA 4CCNA 1QWRA 4Z2WA 1JZ6A 3WT3A 3WUCA 3LE0A 3NJVA 3NSTA 3FHQA 3Q9OA 1DGRA 4N9HA 4O61A 5LA0A 1HDKA 4XW3A 2JX9A 3FE5A 4NJ4A 4DUVA 3ZMOA 3KVAA 3LEGA 3ATGA 4R9DA 2D98A 4W6YA 5JPMB 1SLTA 1MACA 5EV7A 2Y8KA 2EXIA 5CFCB 4ZS3A 2XUMA 5F6KA 4CDWB 2VW2A 1QDOA 2WZR2 4TLGA 2VAUA 4OI0A 1VBC2 2A70A 2CU5A 2XKPA 4YG3A 4LO7A 4CXXA 5C9AC 3OG2A 2R16A 4CDUA 5F5IA 3K3NA 2CY6A 1XNTA 4CP1A 3HBKA 1N3QA 3KCYA 4XBQA 4Q4Y2 5GZDA 2WSVA 1GUIA 3GBGA 5LBBA 4AEMA 2CGNA 1W06A 3AXDA 2J1AA 4M3CB 1OH3A 3ZVXA 3WDXA 5BV6A 2Z42A 2BOIA 1W05A 1ULEA 3Q8AA 2WT2A 1ZREA 4OQ8A 2B46X 2YGLA 2Z4FA 3O1TA 4NHMA 2VG9A 3KV5A 3N7JA 5HXMA 3S0MA 1UWWA 2K0GA 2CL2A 2ZXQA 5EQUA 4OMCA 1C28A 3ZXEA 2ZMKA 2V5YA 4OI2A 5FZDA 5HCFA 3FWEA 1XBFA 5LZ6A 2XBO3 3T4HB 4A7YA 1HB1A 3W58A 3P3PA 3ZDVA 1OFNA 3O1RA 5F5AA 5IK4A 1W8TA 1HB2A 2LW8A 3JD71 5FPLA 1LHUA 5C9AA 2BPA2 2NMOA 4NR1A 1F5JA 1KS5A 4QMAA 5FREA 1WMXA 3MLLA 2WNUC 3PJYA 1XJAA 2FBEA 2XBO1 2IZWA 2YV8A 3OYWB 3IIAA 4IGQA 4L11A 5G04L 5F1RA 5LEKA 1GR3A 3VBRA 5D21A 2D6MA 3U14A 4XF0A 3ROUA 1S0DA 4JV4A 4AAXA 1LEMA 3U07A 1Q8SA 2GDFA 1W8FA 5T54A 5A1LA 1UYYA 2VCCA 2X53S 2ZMNA 2XGXA 1N47A 3VBSB 2HLEA 3EJKA 3W20A 2WFF2 3N4MA 4EWAA 4YZ2A 1OURA 5FY4A 3EMRA 1C8NA 3LA2A 4AHWA 2K2SA 5JSRA 2XG3A 3DXTA 2VTXA 4XJWA 1MVQA 1O3RA 4TZDA 2E63A 2FDIA 4AFAA 5A3UA 2YU2A 2W08A 3TN92 1JZ2A 4ES9A 4K9SA 4QKNA 3IAPA 4K21A 5FZ3A 5F8PA 1WWYA 4OHVA 4BLIA 4QKBA 4LE4A 4DXRA 1LTEA 3ETQA 2WZEA 3VBUA 4ISRA 4V2VA 2WBKA 4AAPA 5JOXA 2WKKA 3UGFA 1W2AX 1VMHA 2VC9A 4P9YA 4CE8A 2JDHA 3VZMA 2YBPA 1DZRA 2BWCA 3IBMA 5FYYA 3NJYA 3S7EA 3OF1A 4ARYA 4R4XA 2WL1A 1DU3D 4QHBA 1IPKA 1BCXA 5C4WB 1T6GC 3KVBA 2ENRA 1BEV3 3A22A 2ZACA 1S0FA 2NZ9A 1GQHA 3KGZA 4RGGA 4J1WA 3O1UA 3SKVA 2DTYA 5C6CA 1BEV1 2WA3A 4AXOA 2F4PA 1REDA 4D6SA 4AQSA 5LA1A 1SBFA 1HRV2 4CCEA 5I0DA 4A2UA 3GCXA 4MXWB 1MS0A 2R042 2PMWB 4N43C 3M8LA 5JLVA 2VU9A 1GICA 1V6OA 3THPA 4L92A 3AMMA 4Q8KA 1C57A 2DVDA 2GC3A 4GH4C 4LA2A 1CPNA 3MUY1 4XBNA 4L0PA 4UW6A 5T5JA 4E8DA 2UY8A 4K8RB 3T4VA 1NXD1 1GYKA 3MFAA 3LD8A 4YW6A 3WSOA 1JYVA 5FOBB 3DPRC 2Y34A 1O3QA 3ACFA 1IPJA 1UMIA 2OZ6A 4CU7A 1VBA2 3BVCA 2DUPA 2A6WA 1LHVA 3AX4A 2RS12 3ZFGB 4LLFA 1DHKB 1KD7A 1NA1A 2BNOA 3T2OA 3VV1A 4D3WA 1QJY3 4FT8A 1H8TC 4MGSA 3SH5A 3VDCA 1O3TA 4NPRA 1QEXA 1E5SA 1AX0A 2BV4A 1J83A 1W2UA 3E97A 5A3WA 2D43A 3KB5A 3VD5A 2PYTA 2YHJA 5CZKA 1UQXA 4D7SA 1QKQA 4LEJA 4GH4A 3TYJA 3AVRA 3KS7A 2XR4A 2GSYA 3M7AA 1QJY1 1XSQA 4KNCA 2H0VA 5FY7A 1OUXA 1W39A 3LGRA 1S4CA 1ZX5A 2VR4A 1D4VB 1NQJA 5HI0A 2BWAA 2VOWA 5L9RA 5ANNA 5KR7A 4CCMA 1MEC3 5FY1A 3BPSA 5KC6A 3BTYA 3WDWA 2W0XA 2HEVF 3G6JB 1NCRB 5IK8A 1S0BA 3MYXA 2RJLA 2E26A 2I07B 4XFGA 1MEC1 4XZPA 5SV8A 1S0CA 5DUVA 4E4DX 4HONA 4XACA 3BKZA 1JODA 2Q5TA 3NNMA 3P1IA 1NKGA 1W6OA 5JIAA 3PURA 4MGKE 2P1BA 1FPN3 2WWUA 1Y43B 4H3WA 3CKHA 2ARBA 5KXCA 1W8UA 3GBWA 3VKMA 2GN3A 4MH0E 3V0BA 4CEWB 1OOPC 2QNKA 4UOJA 1C8M1 2YGMA 4QM9A 1LOGA 2P2KA 3BN6A 3MIEA 5E88A 3RZZA 4FPCA 2IUWA 5DUXA 1S0EA 1RUH2 2C5DA 3WCSA 3DF0A 2HYXA 2WDBA 5A3NA 1YYNA 4J25A 4OHXA 4QQ2A 3KF3A 3W5MA 3Q8BA 2DCZA 4OMDA 2WWJA 4AFMA 2E53A 1CAWB 1WZXA 2LM3A 2XJQA 4WM8B 3A21A 4LXLA 4N8MA 4YGDA 2WJSA 1W8NA 3I3MA 1CAXB 5EJ3A 4GB33 3CZJA 4HVQA 2GMEA 1RUE3 2Y0OA 3WG2A 5DG2A 2PHUA 3WW1A 2QZ3A 4PF1A 1OLME 2XJSA 2YB7A 4FOWA 2JDUA 2KXLA 4AYUA 4GB31 1ONAA 2D44A 4MGQA 1RUE1 4P08A 1EPZA 2YBKA 1CGPA 1PX3A 3MBWA 4AGVA 2ZX1A 3TAYA 1UL9A 2YPJA 2ZGNA 1GNZA 1L7LA 2IVIB 3H7JA 1VLNA 2VGDA 3AL5A 4GA9A 4J6GA 4EN9B 4B1MA 3J7LA 3SCHA 3GBFA 5JI9A 4HBNA 1OFSA 2ZGSA 1QF3A 1QJZA 2A6ZA 1IKQA 4ZPIA 3KQRA 4HXCA 4CDXC 4TTGA 1IG0A 1AVBA 5ISLA 4FBFA 2IXHA 2PHWA 3QD6A 2EIEA 1RITA 2E31A 4ATFA 5CFDB 2QQVA 4CP9A 4Q4Y3 1ULDA 5C8CB 5CA6A 2WZR1 3AL6A 3MV11 2GAUA 1VBC1 1NYWA 1GZTA 3AC0A 1LGNA 3OBZA 2BERA 4AGRA 1FI2A 2GP5A 1FX5A 4MUVA 5F37A 3S57A 1CZVA 2OQ7A 1W3VA 3ZFEA 2P3JA 4LBMA 4DINB 4HMZA 4Q4Y1 4NPLA 4YM3A 1OF4A 2A3YA 4KI5M 2HBTA 3PHMA 1NY72 4QDQA 4WZFA 3N9LA 2W46A 5FP4A 1LJ7A 3A7QA 1CONA 2CSGA 3G7DA 3NKTA 2R062 4LBQA 1XXNA 5FBZA 4CDXA 3KCCA 1GNYA 1AXYA 3AP7A 2E7QA 2HWD2 2ZKLA 3D6EA 4LHNA 4YG0A 1GMMA 2Q4SA 2RMU2 3PJQA 5FZOA 5LY2A 3D4KA 4N7UA 4R9CA 5FZ9A 1GWMA 2J22A 4E4HA 4JTOA 2JICA 4QQLA 3H8XA 4ZY9A 2XLAA 4EN6B 3C7EA 5J09A 2PHTA 2WO3A 1JYXA 1IS3A 1F4HA 3ZN6A 2DCKA 4XBLA 3LFIA 4AVSA 3MLJA 4FPEA 2C6SA 1NE6A 1RTVA 3CJIA 5FZ7A 1Y9MA 2EXJA 4YW7A 1W90A 3VBFA 2GNBA 1UKRA 1GQGA 4C91A 2VMIA 2YC4A 4GWMA 2WFF3 4DMIA 4QB6A 1ENSA 2XOMA 4ORFA 1YFUA 4X6QB 2AC1A 4QX0A 4HZFA 4YWAA 3USUA 1UU4A 2P3YA 4EJRA 4V1PA 2V73A 2K9ZA 2W91A 2VVDA 2JDZA 2WFF1 3TN93 4BXFA 2E9QA 3BOPA 1RVF2 3T30A 2W1QA 2VULA 3RI9A 4RS5C 3UJQA 4AHYA 3JBG2 2EIGA 3IDAA 5C70A 4ZU7A 1PO22 1PK6C 4CEYB 3TN91 2RS52 4PIZA 2FDKA 1RINA 4FSJA 5EYYA 4JGYB 2RHPA 4PQ9A 1ALYA 4GJZA 5FZ6A 1O4TA 5FYVA 3MHZA 4IXLA 5FZ0A 3BODA 4IERA 5AC92 4XVHA 3ST7A 5JSPA 3T1LA 5IAXA 4ITCA 3LF7A 2BEOA 1EUUA 4Y22A 2X10A
chains in the Genus database with same CATH topology
5FQ0A 4Z8BA 5J36A 2VOVA 1DFQA 4RS5A 3ZFFC 4GKYA 2P3KA 1PK6A 4HKWA 3KMHA 3T1MA 1RUI2 1HRV3 4P9LA 3V65A 1NCQB 2R072 2R043 4XIKA 1AYN2 4IV3B 1UW8A 3HQXA 1G9BA 3RMYA 4AFDA 4E2GA 1HRV1 1J59A 1EAH2 5D8AB 4AVBA 2R041 3AMQA 4HT1T 2QQPA 5GZEA 1TNRA 1F2NA 4IEZA 1N3OA 1JW6A 4YW5A 5GM0A 4KWLA 4OHZA 1DQ4A 3RJ2X 1CPMA 1AR92 4UBGA 4YVWC 5BNOB 2WQZC 2RS13 4JGZC 2JG8A 3MIHA 3AMPA 4LLOA 1W6QB 1VBA1 4FQ4A 2RS11 2ZA9A 5GLZA 1G9AA 5GLTA 3LCPA 2QDNA 1R1ZA 4COVA 4B3NA 4XQ4A 4B4PA 4YVSA 2JG9A 1WUVA 4AK3A 5H9PA 3I59A 5JOZA 3NAPC 2EXKA 2CWSA 1V6IA 2GC1A 1EV12 3AKSA 1S55A 2P17A 1BZWA 2P37A 2VNOA 3AXEA 4MYEA 1LHOA 1MZ5A 4YZ5A 3BOWA 1APNA 2ETEA 4F7ZA 1ZZ8A 5CFCC 4S2DA 4CDWC 3CU7A 3ZXGA 2BTVC 1Y9QA 3ZFEB 5J3UA 1QMJA 1DGWX 4AW7A 1LOCA 1AJKA 1PO12 2EALA 4E27A 5T50A 4WM7B 2CGOA 4QPIA 3OD0A 1RUH3 3FLTA 1URXA 2NM1A 4XFBA 4AWDA 1DGRN 1IQAA 1XNBA 4O9EA 4Y5Z0 4B4RA 5DZFA 3APBA 1HLCA 1RUH1 4XJAA 4X6RB 1Q8QA 1J3QA 5E89A 3ZN6B 5CFCA 4CDWA 1I1EA 2UY9A 1HQLA 3CJIB 3WG4A 4AEJA 1ZRRA 3LSDA 4K7JA 2A75A 4AEDC 4PCRA 1GANA 4QQHA 2I45A 2R1DA 4D7TA 3AK0A 4CRQA 2VXRA 2W52A 4M3CA 3VKNA 1OA4A 3USUB 3JQWA 1RC6A 2DUQA 4Y26A 4W65A 1A78A 1BYHA 5I91A 2ZMLA 4E2SA 1OQEA 5FAXA 5FPXA 2PHLA 4PBPA 2PHXA 1Y3TA 1NG0A 1QXRA 4XJZA 4FPOB 2FZ1A 1U5ZA 1FNYA 4YW1A 1YI9A 3OYWA 3BU7A 1FAYA 4LHKA 1RUOA 1H9WA 1F9KA 4QD2A 5J98B 1RUD2 1V9U3 3R6SA 4YW3A 3VZJA 1HRI2 1YI7A 4BE3A 3VBSA 3M2MA 4K6BA 2R063 2JECA 2HWD3 3A0NA 1MVEA 2RMU3 2WSUA 1NY71 3D0SA 4META 5C4WC 1AF9A 4FVVA 4AI2A 1LHNA 1AR72 4MV2A 4XFHA 5JCTA 2R061 2D6PA 1QY4A 3FFZA 4QPGB 4MSVA 2HWD1 1HV0A 2B45X 2RMU1 2XWJB 4KBBA 3AFGA 5K9YA 4HKLA 2YC0A 1HW5A 3ILFA 1KXGA 1F8VA 4XMAA 1W0OA 2VUAA 3E5QA 3M1HA 3TBDA 1D0GA 1PVC2 3I4IA 1CAUB 3M3OA 1B35B 4BZ4A 1XYNA 3VHNA 2DVAA 3KM5A 3ZYPA 4H55A 4DXZA 1O5UA 1RVF3 4AQTA 5I0RA 3VZOA 4RD7A 2BNNA 4KWKA 3WLUA 3JBG3 4AG4A 1FPN2 4Z92B 4N53C 1PO23 1XNCA 3WW3A 1VRH2 3VKLA 4ISQA 1RVF1 2IC1A 2PHDA 3ZFGC 3OTFA 3MW4A 4IETA 3BCWA 3IWZA 2VNGA 4GALA 4MXWA 4BYYA 2XJVA 2OZJA 1PO21 3MFCA 2RS51 1W6NB 2E51A 5AC93 4XF3A 2PLV2 4CDQB 1KFUL 4FOYA 2ZGLA 1R092 3UJOA 1XE7A 4Q0UA 2NN8A 3E6BA 3GNEA 5AC91 3CL1A 1J1TA 2ZHNA 4BLJA 2XKOA 4QQOA 4CDUC 1NCRC 1RUI3 3ZFGA 2A73B 4IEUA 4YGBA 4IESA 3BALA 2R073 4NHKA 1AYN3 3AP6A 1OQ1A 4N90A 4QPIB 2AR6A 3AFKA 3FBMA 1RUI1 1VAMA 3R4DB 2D6KA 1CJDA 1TMF2 1EAH3 3MLKA 3AYDA 4Y20A 1AYN1 4COYA 2UWAA 5BNQA 4EN0A 4CEWC 3R05A 1EAH1 1KDMA 2AZ5A 1DGLA 2DV9A 3IPVB 5GZCA 2PAKA 1AR93 1HX6A 1VALA 3MIGA 4WBBA 3GZTB 1NCRA 1WCDJ 5FO7B 1O5LA 4LBNA 2BQPA 3ZN4A 5AFEA 1UU6A 3WG3A 3OD4A 1XYPA 4GMP0 1AR91 2JE7A 4YM0A 4WM8C 4JDNA 2ZBJA 3VBRC 1DZTA 5GKAC 1SACA 3AZZA 2H0BA 3IT8A 2MNGA 2B7YA 3TRSB 1IKPA 2Z2SB 2WNVB 3VHOA 3B9IA 1ZYBA 3USSA 3IDCB 4CEWA 3BB6A 3OPZA 1SCRA 1H1MA 1XNKA 4DY5A 1OI6A 3NVCA 5A3MA 3DN7A 5KBFA 1EV13 2AGSA 2XJUA 5KXDA 2WC2A 3GALA 1RMU3 5EXOA 5BNNA 1LENA 2VECA 3MF9A 3GF6A 1CAWA 3EBRA 4G4FA 4M01A 1LCLA 3ILRA 3B02A 1NZCA 4WM8A 3UKNA 3VBUC 1EV11 3ZXAC 4CTEA 5GALA 1CAXA 1AJOA 1MS4A 2ZGMA 4Q0VA 3E5UA 1PO13 5F5QA 2QZ2A 3VKOA 3VDDB 1GNHA 3VHRA 1W6PB 2O1QA 5CFDC 1N1TA 1VIWB 1JTZX 4L2NA 1PO11 4LR4A 1R1A2 4EWDA 1YWKA 2VW0A 5L36A 4NWWA 5IT6A 1BMV2 1REFA 2PHRA 4OUMA 3VBHB 1DBNA 4ES8A 4QPYA 1AHSA 3M3IA 5H9SA 1D2QA 3UL2A 3K51A 4Q4W2 2RJKA 3TWIA 3HIFA 2Z5WA 3U10A 1LEDA 1EYBA 3R0RA 2N7GA 5I8YA 1WLWA 2ZOEB 5CFDA 4EN7B 1ND2A 5C8CA 2ZZJA 3R4SA 5E1RA 3NW4A 1ZZ7A 2IXLA 2DCYA 3JB8A 1SLAA 4WZCA 3PMEA 1KITA 2DUOA 4MX3A 5FOJB 1LRHA 1LOFA 1PMIA 3KT4A 1SLLA 2GN7A 2BVVA 4DRRA 1MR5A 2XLFA 4FP2A 1ZZ9A 4LT5A 2YY1A 4UW5A 1BJQA 2RR12 1NA1C 4EROA 3MZHA 4F83A 3M3CA 4XF9A 3MIDA 5EZWA 1YCIA 2MPFA 1YIFA 2WA4A 4R8HA 4RHV3 2ZGRA 4A7ZA 4D69A 1RUD3 4FPFA 2WFPA 5CADA 4CEYC 1ZM1A 3PTYA 4EN8B 1SLCA 4Q4V2 4ASMB 1HRI3 4JGYC 4P9XA 1C1FA 4K20A 1RUD1 2BFUL 2BFUS 1BBT2 3POSA 2EAKA 2LUWA 1HRI1 1EY2A 1FT9A 1AR73 1MZFA 1N3PA 2RM22 3ZMNA 4GKXA 5HBAA 1GKBA 2BNMA 2OYZA 1S0IA 2GNMA 2PAMA 1AR71 4NO4A 3GYDA 4Y20B 1H4HA 4CEYA 2PN5A 2A7AA 1NCQC 5B2GB 4JGYA 1H30A 4M3CF 4MGZE 4IV3C 1OHFA 1PVC3 3O12A 1Z0HA 5A33B 2EF6A 5JDBA 5KHIA 4DPNA 3C2UA 3POWA 2QFEA 3WZ1A 5L19A 2D6OX 1ZBA2 4QGLA 1XU1A 2UURA 3S7IA 1OMIA 2PHFA 1PVC1 4PBOA 4JVAA 4COZA 4L97A 4K1ZA 4IV1B 4UBHA 1VRH3 2ZAAA 2R30A 2EA7A 3I7DA 2E6VA 4FOVA 1NCQA 4TSVA 2D3RA 3VBOB 1CVNA 1ASJ2 4KGGA 1SDWA 2I74A 2WLPA 3EO6A 4IV3A 1FPN1 4OHWA 1H9PA 5A32B 1MS8A 1VRH1 3O14A 2QUOA 4XEZA 1OA2A 4PIXA 1LB2A 2PLV3 3PVEA 5D8AA 1N1SA 3ECQA 1R093 5BNNB 1OPMA 3HR9A 4AVAA 1NXMA 2PLV1 1LU1A 1RIRA 1HV1A 4QQPA 3TOJA 4B4QA 1VBE2 1R091 1LOAA 3ZPYA 5BNOA 5FDBA 3OGJA 3ZO0B 1MS9A 4W6WA 5LRSA 1H1AA 2DU1A 1RUJ2 1REEA 1W6QA 1X33A 1WMEA 1DYPA 4XTPA 1TMF3 3IMNA 4JTNA 1XRUA 2RE9A 3ZFEC 3ILNA 1AZDA 1U5XA 4PLOA 4JCKA 1FOD2 4LULA 4QT6A 4Q0PA 4Z82A 4WM7C 1TMF1 2BVBA 4KGQA 1F5FA 4BOWA 3ZXFA 3AB0A 2QE3A 2DWRA 3O0XA 4XHXA 4XF1A 2RS32 5F6LB 2P3IA 1WCKA 1ND2B 2HWF2 2YZ4A 4JAAA 5FLJA 4XFIA 3WD5A 5CG9A 2D7FA 1UAIA 2DURA 4AI8A 1ULCA 1VR3A 2WNUB 5FFOC 2OIIA 2VVFA 3CJIC 1XYOA 1PZ7A 1V9U2 1YJKA 3DKWA 2D6LX 2LALA 4FTBA 4CP2A 3VBFC 1LODA 2GH2A 2R0FA 4P9JA 3H50A 1RHI2 4WM7A 4E2QA 5CIRA 2ZS6B 2ILMA 1ULFA 2ZGPA 5CNAA 4OLLA 3SHRA 5KHKA 2JENA 2XJTA 2HJIA 1Y7BA 3H3UA 1S1AA 2G9GA 3OY8B 4MVTA 3MGUA 4ZU4A 2OA2A 4YG6A 1DF0A 1MQTA 4S2FA 4Y1XA 3U11A 3LWCA 3AYCA 1QJU2 1CX4A 4DS0A 3WHTA 3AP9A 5FO8B 3ZXLA 3I54A 3IN9A 2Q0AA 1JBCA 1AXKA 2W39A 4XMIA 5IUQA 2JEMA 4PF5A 4XPVA 1UMZA 1R1A3 1AX2A 3ME2A 4RQPA 4Y1ZA 4JDOA 1OPOA 1CQ9A 3SH3A 3UKTA 1OQDA 4YM2A 1PVXA 3AJYA 4RSUA 4WVWA 1R1A1 4Q4W3 1A6CA 2KA3A 2EVXA 1V70A 4M00A 1BMV1 1KRIA 1MS1A 2H6BA 4BA6A 4FPJA 1C4RA 3L2HA 1CESA 5AVAA 4Q4W1 4LE3A 2X5IB 4AFBA 5T3NA 3VUOA 4QPGC 5LRRA 4HSJA 2Q30A 4N43B 3FLRA 1RJ8A 3O0VA 5GZGA 2C9AA 4K40A 4Q1RA 1QH6A 4YRDA 2BUKA 1Z7S2 2XJPA 5KHGA 3GZAA 2D97A 3FUQA 3LKJA 4YFZA 1QOSA 4IEYA 3ZSEA 1WLDA 1Q5OA 3WG1A 2JG8C 2RR13 1ZRCA 2DCTA 3JZVA 1B35C 2UWBA 1X8EA 4P9GA 3ZSMA 2DVBA 2HEWF 4YYOA 5BNPB 1FMD3 1SLIA 3MI8A 3FFQA 1SMVA 4FP3A 1X82A 1H8TB 2RR11 4QPGA 4COWA 3LOBA 1OSGA 4AI1A 3E6CC 1YXWA 4Q1PA 1V6MA 1YFYA 1HQWA 4Q4V3 2UU8A 2W68A 4QGNA 4YVSC 1VAVA 2JG9C 1PIV2 3ZN5A 1ULGA 4AEKA 1DGWA 4DB5A 4I09A 4A3XA 1BBT3 1CAUA 1GZWB 3QACA 4FXKB 4Q4V1 3UK9A 2ES3A 4P14A 1B35A 4XQDA 2DCJA 5HCAA 4HETA 2RM23 3OCPA 5HXVA 1PNFA 5FRAA 1BBT1 1S2BA 4LUKA 5I93A 1G9CA 2B39A 1K5MB 4C0BA 4OHYA 4Y1UA 4Y1VA 2RM21 4QXKA 4CP0A 1POV3 2B42B 1TEIA 3FBYA 1Z78A 1SFYA 1ZNPA 4LO5B 2Y38A 4PJYA 4U36A 1IZ3A 1A8DA 1W0PA 4QPIC 5KC5A 5J48A 1RB8G 2C0ZA 2H6CA 1POV1 1W6NA 3JB4C 4RA0A 4WVZA 4CYDA 5KWRA 4OI4A 1ZBA3 4CDQA 3WHUA 2ERFA 1KJRA 4L99A 5J37A 1RMU2 3B69A 1YO8A 2AUYA 3HT1A 1O7FA 3WOGA 1ZBA1 3AZVA 5JAXA 5ABJB 3JU9A 1JYCA 4I30A 4S2GA 4GULA 3KZ4C 1RUC2 3ENRA 3VL9A 5BY5A 2UYBA 1ASJ3 1QNYA 4C0HA 1VBB2 3SLIA 4BMBA 1WD3A 1UF2C 2ZCWA 2D5HA 3AKPA 3H3ZA 3PLQA 4HL0A 3ZSLA 2PA7A 3B93A 2Y0IA 1U0AA 2GC2A 5JZGA 1ASJ1 1XU2A 4Y24A 4YZ3A 3CLPA 1MQTB 5EYXA 1O91A 2DF7A 2PELA 1W6MB 2ZABA 2PAEA 1UCXA 3LOIA 1TNFA 3IPVA 1WLTA 2YYOA 4DNYA 1VBE3 1Q3EA 2O8QA 3LZZA 5JR7B 3VGIA 4B29A 1N1YA 4AVCA 1RGSA 2MEV2 4LBKA 2ZGUA 1RUJ3 2KM2A 4RFT0 1IGOA 5BPXA 1VBE1 4LO4B 5E16A 2VNRA 3ALQA 4RQPB 1UD1A 2WS92 2D93A 3SCGA 1D4M2 2PFWA 1RUJ1 1LOBA 5GLWA 4L8QA 3GHMA 4G9SB 3RYKA 1KDKA 1FOD3 1TME2 2TUNA 2WNVA 3VBSC 4DRVA 4SBVA 1ND3A 3WP3A 4B7EA 4LBQD 2FMYA 2IXCA 2CAUA 2ZX4A 1FOD1 4XF4A 1I6XA 2RS33 1AUYA 3ZYRA 4H7MA 2VUJA 2IWGB 3J4UH 3QCWA 4HVOA 4A7KA 2HWF3 3AZXA 1MS5A 3VBHC 1NLRA 4JRLA 4YZ4A 3VL8A 3H1WA 1ENXA 4KG8A 4AGGA 4RHV2 1WMFA 3PNAA 2A71A 2RS31 1G7YA 2A6XA 4NN0A 4XDQA 3RS6A 2HWF1 3NO8A 4XYXA 2SLIA 4RR3A 3VDDA 1RHI3 2QDRA 3AZWA 1V6JA 3H1MA 1DZQA 1W6PA 1G9FA 3ZXKA 1V9U1 3L9JT 1RJ7A 4OULA 4K3UA 1YHFA 2FZ2A 1DYKA 1RHI1 3RI8A 2IXJA 5JOWA 4XTMA 3VBHA 1E57A 3EHKA 4L9BA 2QKDA 4QM8A 2Y26A 1QJU3 4XIOA 1R083 4AF9A 3UKVA 1HIXA 2VQAA 2IFWA 1M06G 1LULA 3HAGA 2FQPA 4H14A 4M3CE 5A3LA 1UU5A 1DQ0A 2XLGA 1VJ2A 1QJU1 3PMSA 3AZYA 2WINB 3NJZA 4WVVA 4WV8A 3AYEA 1KJLA 1QNWA 1AR62 2WQ4A 3CNAA 5GJ6A 2BGCA 4UW4A 1PHMA 5JVVA 1QJX3 4OFGA 1H2NA 2XWBB 4CZSA 1Q56A 5H9RA 3RPQA 3WINE 1QOOA 4AQ2A 5ACA2 2IXKA 3WDTA 3AYAA 1PM7A 4LBJA 3ZFFB 2FMDA 4RL7A 5JI7A 3M70A 3JBG1 1ZRFA 1J1LA 3V0AB 3WXPA 4W6XA 1ZZCA 4YM1A 3I2DA 4E4SA 1G9DA 4QX5A 2GH8A 3GZUC 4I01A 4FPYA 5T5LA 1DG6A 1OA3A 1Z7S3 2YROA 3IM0A 4P9WA 1C8M2 4UXAA 3FMGA 3RDIA 1V6LA 4AQ6A 3N7KA 2D5FA 1HXS2 2UWCA 3O5SA 1Q8OA 2D3PA 4COUA 5H9QA 1YJLA 2A3WA 4PDWB 3IDBB 5T5PA 1Z7S1 1V6NA 4YFWA 1VBD2 3MPPG 1WW4A 4JGZB 3HD8B 4X8PA 1H2KA 1ZZBA 3HMYA 3MDPA 4OZXA 5J7MA 4MZUA 5K0UA 5L7OA 2ZHLA 4Q4X3 1QGLA 5CBLA 1WCSA 3FLPA 2R071 5JZGB 4LO6B 3D0JA 3NV1A 3I8TA 3QOPA 1QDCA 3AJZA 2Z79A 2ZJCA 1PIV3 3VBOC 3WR0A 2GC0A 5T52A 3LB9A 3ZYGA 5KXEA 5A33A 2B5HA 3FC0A 3AM2A 2QVSB 4DZGA 1GSLA 3SISA 3IKWA 5LK7B 1PIV1 4HLTA 4LTAA 4X8NA 1NE4A 3NAPB 5BNNC 4N7IA 3N35A 1HQNA 1ZA4A 3EQEA 2NPIA 2YDEA 5CB7A 4BQ1A 3ACLA 2O8OA 1FATA 1H2LA 1UKGA 2BYVE 4IV1A 3WDVA 4K1YA 4GIQA 4RGAA 3JUUA 5HCBA 4FCAA 3NV3A 3VBOA 4B7KA 1XNDA 2ZZQA 4IQPA 4NOTA 1ND3B 3PVBB 2NP0A 4IEOA 1I9RA 4AVTA 4AVVA 1LR5A 5A32A 4MGIE 4I2OA 2TNFA 1I5ZA 2EXHA 4IEPA 1QH7A 3POYA 2NLRA 3EXUA 5DDJ2 2X29A 2DFCA 1JN2P 1JXNA 3WW2A 3CJXA 4BIFA 4HK9A 3E6DA 3JD73 5DUWA 1AYM2 3RG0A 2LTNA 2XL9A 4I0WB 5JPNB 1RMU1 3C3VA 3RYPA 1H0BA 4RR3B 1RUC3 5DUUA 4AEDB 3B7MA 1ND2C 5C8CC 1VBB3 4NWVA 3FZ3A 2AREA 4KG0A 2G9FA 5BXXA 3RJRA 2Q8OA 4I0AA 4AI0A 1RUC1 3JQXA 3KT7A 1AL0G 1FXZA 2A5ZA 1YRZA 2V09A 1VBB1 4ZXKA 3ES1A 2DFBA 3E5XA 3RNSA 1LOFC 4XXPA 4YLZA 1Q8PA 1XQNA 1X36A 3SXWA 1O4ZA 4MXVA 3WW4A 3MIFA 3SMHA 4C1XA 3TB0A 4TLFA 1DQ5A 1SCSA 3O0WA 3ELNA 3W9AA 2MEV3 4QGMA 4IEVA 3MEPA 4YW4A 3X29B 1SBDA 1U12A 4DY3A 3KLSA 1O3SA 1CAVA 5EWSA 1YFWA 3ZDSA 4ATEA 2WNUA 3B00A 2WS93 4IL7A 2MEV1 1D4M3 3WQ1A 2HKXA 1MS3A 3WQ0A 1IHMA 1LGBA 3KGLA 1ZBE2 1TME3 2YUEA 4P5HA 4LA3A 3HBZA 4Q0SA 2WS91 5DZEA 2ET1A 1D4M1 3RSJA 3QH6A 4BMEA 1V6KA 4XE9A 1TME1 3AKQA 3AMNA 1PGW2 4H7LA 4PLNA 4BWOA 4OUSA 3OY8A 5CVRA 3LA7A 2ET7A 1FMD2 2BW8A 3NV2A 1B09A 4PLMA 1BXHA 1UPIA 2ZX3A 4YGCA 4FTEA 4XHBA 2VPVA 4IEQA 1GLHA 2XHKA 1JH5A 1DLLA 1JOJA 2VY0A 4XFAA 4HPKB 3RYRA 2VOKA 1CR7A 1ZVFA 1A8MA 4RHV1 5TSWA 2UYAA 1LHWA 1FYUA 2X5IC