2PAMA

Structure of a h49n, h51n double mutant dtdp-4-keto-6-deoxy-d-glucose-3,4-ketoisomerase from aneurinibacillus thermoaerophilus complexed with tdp
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
135
structure length
135
Chain Sequence
ENKVINFKKIIDSRGSLVAIEENKNIPFSIKRVYYIFDTKGEEPRGFNANKKLEQVLVCLNGSCRVILDDGNIIQEITLDSPAVGLYVGPAVWHEMHDFSSDCVMMVLASDYYDETDYIRQYDNFKKYIAKINLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DTDP-6-deoxy-3,4-keto-hexulose isomerase
publication title The X-ray Structure of dTDP-4-Keto-6-deoxy-D-glucose-3,4-ketoisomerase.
pubmed doi rcsb
source organism Aneurinibacillus thermoaerophilus
molecule tags Isomerase
total genus 26
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature ec 5.3.2.3: TDP-4-oxo-6-deoxy-alpha-D-glucose-3,4-oxoisomerase (dTDP-3-dehydro-6-
pdb deposition date 2007-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05523 FdtA WxcM-like, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2pamA00
4KU8A 4QM8A 1ZZBA 1NZCA 5F1RA 3SHRA 3IBMA 2EAAA 2DCTA 2HKXA 2Z2SB 2UYBA 5I8YA 1CAXA 1L3JA 3FWEA 3D82A 1ZRFA 3C3VA 3RYKA 3SCHA 3H3ZA 2V09A 5FLIA 3CF6E 1JUHA 3HT1A 5K8SA 3MZHA 4YYOA 1LR5A 1UD1A 2D5HA 4JTNA 2KXLA 2XLGA 4LULA 4KWLA 1X8EA 3VHRA 2XLFA 4UXAA 2Q30A 5CU1A 3SCFA 4UBHA 1WGPA 4PIZA 2IXHA 4O9EA 2VPVA 4MGYE 5FQ0B 2MPFA 2PHDA 1UIKA 3M3IA 1HW5A 3U11A 4IETA 4XFBA 2QDRA 2BNMA 3PVBB 1O5LA 3ES1A 3CEWA 1O3SA 4Q0QA 5I93A 4DINB 4RD7A 3M70A 2BEOA 3FX3A 2BNOA 1J58A 1QXJA 4META 3OD0A 4EWAA 5KHHA 1J3QA 4JVAA 4OFGA 5FPXA 3IIAA 1Q5OA 3MYXA 3OGJA 3CJXA 1Y9QA 2I45A 3NL1A 2E9QA 1SEFA 2K9ZA 4MV2A 1H1MA 4L11A 1XRUA 1CAVB 4LUKA 2PQQA 5KHKA 2PAKA 4I09A 4Q29A 5JCTA 1YFWA 2IXJA 2CV6A 4KU7A 5C6CA 5JSPA 3WW3A 4N9IA 2Q1ZB 3N4MA 1CAUA 4LA3A 5I8SA 1SFNA 4TLFA 4D7TA 3IDCB 1OFNA 5LEJA 2N7GA 3E5XA 3LA2A 4PJYA 1OI6A 3CLPA 3ETQA 1VJ2A 4XFHA 1RUNA 3BB6A 2UYAA 4WVZA 3RZZA 2H0VA 4R52A 2ATFA 4R8HA 4CYDA 1RTVA 1NXMA 3I54A 4BH9A 5FDBA 4ZU5A 4MGIE 1PM7A 5HI0A 1EP0A 3H7YA 2MNGA 4EV0A 5D1IA 5JAXA 4J1XA 4Q0UA 1ZRCA 2OYZA 2GC3A 3NSTA 5J7MA 1QXRA 1O3TA 4XFGA 2XKOA 3BALA 4AQ2A 2D40A 2IC1A 3ELNA 4IEVA 3EQEA 4Q0PA 2OA2A 3RYRA 2B9UA 3E6BA 1O7FA 3DL3A 1DGRA 4XFFA 3MDPA 4QGNA 5I0SA 1YFYA 2IXKA 3EO6A 4K8FA 1J1LA 4KWJA 2WFPA 3EBRA 4LUMA 2GC2A 3MPBA 1NE4A 5FLHA 3KGZA 3E97A 1CAWB 4HN0A 1O5UA 4LLOA 3WW2A 3FE5A 4XF9A 3R6SA 2Y0OA 4IEYA 4MUVA 1QWRA 1ZRRA 3LWCA 5LRSA 5I0TA 3RYPA 2BNNA 4YSFA 3SXWA 3HQXA 4FAGA 4IEWA 4H7LA 4E2SA 3D0SA 3LAGA 2OZJA 3NKTA 3I7DA 3SMHA 4IESA 1DGWA 3G7DA 4IEPA 4E2QA 3OTFA 2OZ6A 5E16A 4NVPA 1ZZ9A 1VP6A 3I59A 3KMHA 1CGPA 1QY4A 3H1WA 4XEZA 1O4TA 3LA7A 4XF0A 4BYYA 3ROUA 4AVCA 3KSCA 2ET7A 2GC0A 3B02A 5CVRA 1YHFA 2XL7A 5KHIA 1J59A 3H50A 5LEKA 3E6DA 2VECA 1EY2A 4IEQA 1CAXB 1VR3A 2CGPA 3EJKA 1Q43A 2B8MA 1X7NA 1RC6A 5BUVA 1YLLA 3HIFA 2H6BA 2ZKLA 4HMZA 4LTAA 1YUDA 1XE7A 2P17A 4QM9A 5AVPA 3RNSA 5BY5A 4D7SA 3WW1A 1U12A 2CAVA 4MGZE 3ST7A 1YWKA 3U10A 2HJIA 2XKPA 1OMIA 5BPXA 1OD5A 1XE8A 3E6CC 1CX4A 2C0ZA 4HVRA 2H6CA 4I2OA 5E1RA 3GYDA 4J1WA 4I0BA 1I6XA 5JSOA 2B5HA 4I01A 4F7ZA 2BGCA 1J3PA 4XFIA 4YARA 4B29A 4GULA 2PTMA 2QJVA 3H1MA 2PAMA 4MH0E 3DKWA 4AVBA 2ET1A 4XF3A 4JTOA 4A2UA 4Z07A 3CL1A 3LA3A 1EPZA 5LRRA 4L2NA 3H1YA 4Q0VA 3FHIB 2XHKA 3ZDSA 1RGSA 1RL3A 4JV4A 2QNKA 4XFCA 3FZ3A 5JR7B 5I8TA 1Q3EA 3KCCA 3U0ZA 1ZRDA 5FQ0A 4UBGA 2CAUA 2UY9A 1ZZ6A 3CO2A 5KHJA 4I02A 5I0UA 1ZVFA 4XF1A 2Q4SA 2EA7A 4QX5A 1FT9A 4BHPA 3BPZA 2PA7A 4QXKA 1V70A 1DZTA 5T3NA 3IWZA 2BYVE 2FMYA 5FPZA 1CAUB 4IEOA 4WBBA 1LKNA 4E2GA 3RDIA 4FT8A 4QMAA 4XFAA 4FBFA 3H7JA 3QACA 3IDBB 3S0MA 3O14A 3E5QA 3PLQA 1GQGA 3H9AA 4X6RB 4XETA 1UW8A 4BIFA 1NYWA 1LRHA 1O3RA 1G6NA 3H8UA 4QGLA 3HT2A 3OF1A 4AVAA 4P9GA 1CAVA 2IXCA 4HSJA 4IEUA 1ZZ8A 4HVOA 4EWDA 2O1QA 2MHFA 4ZU4A 3EHKA 1O3QA 4O9GA 1IPJA 4KL1A 3FJSA 4HLTA 1YFUA 4ZU7A 1X82A 3QOPA 4Z82A 1RUOA 5EFUA 3NJZA 2PYTA 1X8MA 3JZVA 3BU7A 2Z69A 4AQ6A 4N9HA 2D5FA 4PIYA 1WLTA 2IXLA 2PAEA 2O8QA 3E5UA 5C8WA 1FI2A 3PNAA 5I91A 1NE6A 1WA4A 4X6QB 5KHGA 4ORFA 4HZFA 5JSRA 1IPKA 2WC2A 1FXZA 2ZCWA 4FAHA 2UY8A 4QGMA 3LOIA 5I0RA 5CADA 2GZWA 4IEZA 2D93A 5BXXA 1Y3TA 3SCGA 2GU9A 4AXOA 4EROA 3D0JA 5J3UA 2GC1A 2IXIA 4I3PA 1ZZCA 4IEXA 5EZWA 1LB2A 4MGKE 4YRDA 4MX3A 3S7EA 2QVSB 1ZX5A 5FCCA 3UKNA 4F8AA 1UPIA 4KWKA 1TQ5A 3NW4A 3UKTA 3NVCA 4HBNA 1UIJA 4HSLA 3L2HA 4Q0SA 2ETEA 3I59B 1CAWA 2QCSB 2Q0AA 1DZRA 2XGXA 3DN7A 3GBFA 3H3UA 1J3RA 1SQ4A 4I0AA 3DV8A 2K0GA 4PIXA 3USSA 4HVQA 1EYBA 3TNPB 4LA2A 4LEJA 5BV6A 1UCXA 4MZUA 4WZCA 3WW4A 2XL9A 1I5ZA 1PMIA 2GH2A 5FLJA 3RPQA 1GQHA 1ZREA 3FFQA 2XLAA 3LZZA 4YNIA 2PFWA 3OCPA 1ZNPA 2FQPA 3ACLA 3ES4A 3UKVA 2OPKA 3KGLA 4HN1A 5KBFA 2GAUA 1H1IA 1ZZ7A 2VQAA 3TNQA 3BCWA 2PHLA 3S7IA 2EVXA 4EWEA 4OLLA 4ONUA 5J48A 1YFXA 4IERA 4XF4A 2F4PA
chains in the Genus database with same CATH superfamily
3BVCA 2QQMA 1RHI2 1ZZBA 1NZCA 4FP3A 3SHRA 3IBMA 1ONAA 3P5BA 5HCAA 5LY1A 4XE9A 4XAEA 2DCTA 4L9BA 1V6MA 3VBSA 1FMD3 4ZXEA 4CEWB 3NJYA 1F5FA 4HKLA 5JZGB 5A3LA 1OSGA 1WD4A 1UOJA 2B46X 3VHOA 4Z2WA 4TN7A 3DEMA 1YEWA 3FWEA 3AVSA 2VUDA 5DAWA 5JPNB 1UYXA 5SV8A 3C3VA 5JI7A 1IS6A 3RYKA 5FZAA 1BBT2 2RR13 2V09A 4GJZA 4XHXA 1QIQA 5FOBB 1GUIA 2G4IA 5FREA 5FZCA 2D6LX 2ZGPA 2WFF2 4GWNA 2D5HA 5CBLA 1S4CA 1YXWA 2VQUA 2WNVC 1MACA 4XACA 5EWSA 3AMQA 3N9OA 4KWLA 3N9MA 1A3KA 1W8OA 1S0BA 3WQ1A 1PM4A 3LB9A 2WWJA 4XW3A 4Y1XA 1V6LA 2HWD3 4CCEA 1QU0A 3GHNA 4AQSA 2XXZA 1YQCA 3HNBM 2JG9A 4RFRB 2W47A 1MS1A 1TZOA 2YBSA 3OEAA 4IGQA 2VCBA 2YC0A 1NXD1 3VZOA 3OGSA 1I1EA 4QHZA 1W8UA 1YO8A 2JDAA 1TMF2 1UIKA 2GNMA 3P6BA 5T5LA 1HW5A 3I8TA 2QDRA 5JXGA 3THCA 2I2SA 3I2HA 3PVBB 4QKFA 2FMDA 1LU1A 3BTXA 3ZFEA 2QQIA 1YIFA 1G9FA 1SLTA 3J8F1 1QJY1 1ULCA 4RD7A 3DPRC 2BEOA 2VOXA 1KEXA 4K40A 1YC61 1RUD3 4BQXA 3ACGA 1C8M1 4H3WA 3PUAA 4JX0A 1H8VA 4LO4B 1D2SA 4META 3AB0A 3LEIA 4PLNA 1GYKA 5KHHA 3ZXFA 4CCCA 4C1XA 3B94A 2F4LA 1WUVA 1JMUB 1JBCA 3O1UA 4L99A 1DCSA 3IIAA 3MYXA 5CFCB 4Y1VA 1HB1A 1VBA1 1XBFA 3NL1A 4OYUA 2E9QA 4RFT0 1XE0A 2WAOA 4RA0A 1HQNA 2PLV2 1XRUA 1JZ3A 1PNGA 1GKBA 5A1FA 3O1OA 2WNUC 3K2OA 1W99A 5A7WB 5ANQA 2A73B 2VZOA 2JE7A 2PAKA 3PIGA 1ST8A 4BM8A 1VMJA 1AR71 1C5HA 3BIWE 3ZFGA 4M4RA 3WF0A 2CV6A 5JSPA 2CU5A 3MW3A 3KHCA 2K46A 2Z42A 4RQPC 1WBLA 5LY2A 1BJQA 4PF1A 4TLFA 3VUOA 2JG9B 3ZN5A 5AFBA 1OFNA 1B09A 2R042 2N7GA 2ZHKA 5LEJA 4FFGA 4YVWA 2RS12 1CR7A 3LA2A 5C3OA 1A78A 2CTVA 1UYYA 3PUSA 5EQUA 3W5MA 5C4WA 4LT5A 1W9YA 4AI0A 2WN3A 1RB8G 5A1AA 1HN0A 5LK5A 3TEYA 5AFEA 1GSLA 3DYOA 1R082 3M8LA 3BB6A 3RZZA 3A22A 3RI8A 3K3NA 2H0VA 4LK7A 3T2QA 3CHXA 4CYDA 1AXZA 4FPFA 3J7LA 3SH3A 1DQ2A 1MZ6A 5FDBA 3WNLA 2D6MA 4Y33A 4MGIE 4RR3C 3BOWA 1PM7A 3LD8A 2VAUA 2AZ5A 4DXSA 1EP0A 4CEYC 4EV0A 3ZXKA 4DNYA 5JAXA 2ZKNA 4CVUA 3GJAA 4PQ9A 2OYZA 2Q8DA 1O8PA 2GC3A 2R063 1A34A 2VZPA 2ZHNA 4DO0A 5LA1A 3LSEA 1HDKA 4Q4V1 2IWGB 1TNRA 2YU1A 3D8CA 4YZ1A 2AH2A 3VBUB 3MFCA 1ZBA2 3E6BA 2JWPA 2R0HA 4D6RA 1DGRA 4I3GA 3MDPA 4XFFA 3URFA 2JD4A 1O8SA 4AHXA 4JDMA 4NOTA 3MIBA 2WQ8A 2Y60A 4JC1A 1GNYA 5D8AB 1J1LA 2I07B 5LB6A 2JDZA 2W68A 2WFPA 3VHNA 4FTEA 3ZFGB 2GC2A 5CZKA 1UU4A 1XJAA 1IHMA 3E97A 2RDNA 5FAXA 3M7AA 3P3PA 3WP4A 3ZX7A 2WO1A 3FE5A 4NIGA 1K5MC 1DYKA 3R6SA 3VBFC 4GH4C 2E31A 1SLLA 4CP2A 2EXHA 2ZGKA 1LENA 4MUVA 4QXBA 4D3WA 1JZ7A 1D0GA 1ZRRA 2RS31 4LIVA 4XAAA 2YUEA 2ZEXA 2C4XA 2VBDA 5FZ0A 4BU2A 1RHI3 2Y0IA 3V64A 4UFMA 1S1AA 3HQXA 1ZRIA 2DU0A 1TME2 4UFIA 1CPMA 3FLPA 3T30A 3OPTA 5LATA 5FR3A 1FNZA 1JZ6A 2OUHA 1N3OA 3WCRA 4CCMA 3CJIC 3Q8AA 4E2SA 3VKFC 2NMNA 1EV12 2AEYA 3D0SA 4Q4X1 1SLIA 4LOSA 1V6NA 4HANA 2OKXA 3FFZA 3USUA 3TEZA 5HCFA 2FDKA 3H8RA 2B4KA 3M4FA 4EN8B 5LA0A 1DGWA 2VVFA 4E2QA 1ODMA 3OTFA 1K45A 2OZ6A 4ISQA 4JGZC 4LPLA 4P9WA 4NVPA 2MEV1 4Q4Y1 3ZXLA 3C7HA 1ZZ9A 2BP6A 1VP6A 2A1XA 1N1YA 1GNHA 2DCJA 1RYYA 1OLMA 3WVJA 2DYCA 1JXNA 1DBNA 1QY4A 1UY4A 4FPLA 3H1WA 3PL0A 1SHWB 1U5XA 1C8NA 4XEZA 4BCUA 4M3CB 4XF0A 5ANNA 3ZMNA 5T5OA 2CNAA 3KSCA 3T3YA 2GC0A 2XL7A 5C3QA 1ND2C 2ZGQA 4UFHA 5KHIA 2ZGLA 5LEKA 1TMF3 1W6QA 1BCXA 2VQTA 4NHYA 3BOPA 3TWIA 4QX2A 2AREA 5GLTA 1LHWA 3UGHA 5JOXA 3BTZA 4CUCA 2NYYA 1ZA4A 2XDVA 5GZCA 4J6GA 2VW2A 2WT2A 4IQPA 2R6QA 3ZYIB 2JD9A 2W92A 2RS32 4Y4YA 4QKNA 2B8MA 1LTEA 4COVA 5BNPC 3T0BA 1XYOA 1A8MA 1YLLA 4AI9A 4EN9B 1E5IA 1SCRA 5G05L 2ZKLA 3TOJA 3NO8A 4LTAA 1SMVA 4MO3M 1YUDA 2P17A 1ZBE1 5AVPA 3RNSA 4LBJA 1ASJ1 1C1FA 1U12A 1W9WA 5JWPA 2CAVA 4MGZE 4B7KA 4GD4A 4Q4X2 4DUVA 1YWKA 5EHDA 3U10A 3HN1A 4D6SA 1HV1A 1Q56A 3O7OA 1OD5A 5BPXA 5A6ZA 5LA2A 1IZ3A 4FXKB 4BB3A 3UESA 1CX4A 1NA1B 1AR93 5IYYA 4TTGA 4OMCA 4P02B 4AEJA 3GYDA 1UZ0A 4PI2A 4I0BA 5FZ3A 1VB2A 1BHGA 2MEV2 1DG6A 3HVDA 4KMQA 3BODA 3TEWA 3LDRA 4K6BA 2A75A 3ENRA 4GULA 3ZSKA 2PTMA 2RS51 2VUCA 2QJVA 3VBOA 4D6QA 3PU8A 4FFIA 1MZFA 3HQUA 4NAMA 2A6WA 2V73A 2VL4A 3L9JT 3JU9A 4GJYA 1JYXA 1FOD1 4ZS3A 5GM0A 5CFDA 3P1IA 4D94A 3ZSEA 4JTOA 4YZ2A 1JOPA 2VZUA 1K42A 4PCRA 1JHJA 2VBBA 4M3CF 1S0JA 3R4SA 2D6PA 1HB2A 5LRRA 1AR82 3HMYA 5FZ6A 1BVP1 1QNYA 2DBNA 2HWE2 5ABJB 1C3HA 2D3PA 2LRPA 2YG0A 1S2BA 3ZDSA 1RGSA 4NPMA 2QNKA 5F6KA 1G8WA 1OOPA 3ZXAC 3PJYA 4H14A 1Q3EA 3J8F3 2VMCA 1PZ8A 1QJY3 3B00A 4H55A 5FZIA 5CEHA 5GLVA 5F3CA 5FQ0A 5K0UB 1G9AA 4U2AA 4A3XA 1GFF2 1C8M3 5CISA 5JVVA 3VGIA 4XBNA 1ZBE2 1AJOA 1V9U2 4NROA 4XF1A 1OURA 5C8CA 1ASJ2 4BHPA 5JXHA 2C24A 2DUPA 3AKTA 2E26A 3CNAA 1UKRA 4PDWA 5FYVA 5FYCA 1VPHA 1TE1B 5FZ7A 2BJSA 2HH9A 3O1MA 3OEBA 1VBA3 3QCWA 4YVSA 2GP3A 1Q8PA 3BKZA 2FDFA 1VRBA 2IUWA 3OGVA 4RHV1 4E2GA 3ZIWA 1GP4A 4QMAA 4DRRA 3I3BA 3AZYA 4XDOA 2D6NA 3OD4A 4FBFA 3HR9A 4G3YC 3QACA 3IDBB 4ZPIA 1G9DA 5EJ1B 4DIQA 3UJQA 4AW7A 4YW4A 3H9AA 1AR73 2D44A 3OUIA 2J1TA 2XJUA 1W03A 1UW8A 5DAXA 5GALA 5FY4A 3WCSA 1LRHA 4PBOA 4BIFA 2DF7A 2ZGTA 5FO9B 1O3RA 3DYMA 1UOBA 4RR3A 4XDPA 1XB9A 2DVBA 4QGLA 3ILNA 3R4DB 3T09A 1W8HA 5HBAA 4BE3A 2VOKA 5A33A 1AYM1 3AVRA 3VKNA 1MS5A 1B35A 3I97A 4HPKA 4FCAA 2VOWA 2X29A 3HNMA 4OCTA 4BXFA 4M0HA 4EWDA 2FDJA 2FDIA 3N9LA 1Z7S2 4UF0B 4XBLA 4ISRA 3POSA 3EHKA 4WVMA 5EYXA 3JXSA 4QDSA 1F15A 4JKMA 4DXZA 3FJSA 1E57A 3QOPA 4AHWA 5EFUA 3PVOA 4XC9A 3MIDA 3WD5A 3OBTA 3WY6A 1X8MA 2W46A 2ZX4A 5F32A 2Z69A 2D5FA 4K3UA 1WLTA 2DDUA 1MS8A 2CSGA 2O8QA 2PQSA 1FI2A 3F2ZA 5C8CB 3PNAA 5I91A 1MS9A 1VBD1 3V0AA 1KD7A 1WA4A 2E7QA 2JENA 3ZOIA 5KHGA 1JU4A 2AC1A 4GH4A 1RUC3 1IPKA 2WC2A 5JZGC 4CEWC 5DG2A 4KNCA 2D43A 1IGOA 4RHV2 2R7EB 3GGLA 4AEKA 2Q8CA 2ZCWA 3MV01 1AF9A 3WLUA 4QGMA 4Q4V3 3LIHA 3GM8A 4CCOA 1AYN2 2WZEA 5LZ6A 2D93A 5BXXA 4XURA 1XNCA 2RJKA 2ILMA 4YG0A 4EROA 4RGGA 1PHMA 4HETA 5CKNA 4ZHNA 4B4QA 2NPIA 3ZVXA 4HOOA 1SLBA 4MGKE 4V1PA 4MX3A 1Y9GA 4JGZA 1BYHA 5IVVA 2HWC3 1VAMA 3UKNA 4AAPA 4FQ4A 4F8AA 3GCWA 1GR3A 3ZFFB 2A3YA 1S55A 2AYHA 2RS33 3WDTA 5A32B 1RUJ1 4R9BA 3HAGA 3SISA 1B35B 3UKTA 4IV1A 1UF2C 4JGYA 5JDBA 2DFBA 2P6HA 1KITA 4A4AA 2WAAA 3A7QA 3FMGA 4XDQA 4CSWA 3AL5A 4GKYA 4Q0SA 4LBQD 4OVEA 5DZEA 2X53S 1CAWA 4IL7A 5FP3A 3WDWA 2FZ1A 4LKFA 1DZRA 1KJRA 4GWIA 3DN7A 5GZDA 3WDYA 3H3UA 2RV9A 2X5IB 1SQ4A 2E7TA 4Q4X3 1K5JA 4I0AA 2J1VA 1S2EA 3VD9A 1ND3A 3GJBA 2K0GA 5FPAA 3NNLA 1W2TA 1XOYA 2YMZA 1QDOA 4IGOA 4PQQA 3OGGA 2DURA 1VIWB 2OT7A 4LA2A 4Q4Y3 2CWSA 4HONA 1VBB3 1GZWA 1WA6X 2XB6C 3LFMA 1MS4A 3RPQA 1GQHA 1PK6A 3FFQA 3LZZA 2YY1A 2Y38A 2QE3A 4W6XA 1RUH3 5CFCC 2Y8KA 4BQ4A 3ZYJB 2CHHA 2OPKA 4MSVA 3K4DA 4YFZA 1LGBA 2LUWA 2TBVA 1AX1A 2CY6A 3VBRB 4NUBA 5FZ1A 2J7MA 2Y6KA 2HWB1 5KC5A 2BZDA 4XIKA 4RGKA 5FUNA 2WO3A 2O14A 1GU3A 1ZZ7A 3KVAA 1W6MA 3MHZA 1U5IA 3NNJA 5KR7A 1JYWA 3S7IA 1RMU3 4LJHA 3UT0A 4EYUA 1H6XA 1UAIA 1VBE3 2DTWA 3OY8A 3WNOA 2CL2A 3SEPA 5C70A 2F4PA 1Y4WA 2VZ3A 4YM2A 1PGL1 4GXLA 4CUGA 4CDQC 3VZMA 1MQTB 4CE8A 4CDUA 2QUOA 5A3TA 1GWKA 2VTXA 3VZLA 3ILRA 2CGNA 4D7YA 1ASJ3 2VOVA 1DGLA 5FY8A 4EZ4A 3RFRA 2DVDA 5F2WA 3FBYA 2SBAA 1R092 4QPIA 4XIOA 5EIYB 1JN2P 3NNFA 5FLIA 3QD6A 2WBKA 3HT1A 4ATFA 5F5CA 2WNEA 3UETA 3MZHA 4BMEA 1W6PA 1COV2 1QXPA 4QX8A 1UZWA 3WQ0A 1DFQA 1NKGA 3RVHA 1PO23 2XLGA 4WM8B 4DFSA 1PMHX 5IVBA 5FMDA 3KV4A 3QH7A 5C5UA 5L7OB 1AR61 2ZABA 4XUNA 2WWSA 3WT3A 5IFPA 4BLIA 3N35A 2OQ6A 2JDMA 2RS53 4ES8A 2XH6A 5CU1A 1LU2A 4QT6A 2C5DA 1IPSA 2A5ZA 4IE5A 4ZS2A 3VDAA 2IXHA 4QPYA 4JQTA 2C9AA 1FOD3 5CIRA 3R05A 2QQKA 1BMV1 1PO11 2V5YA 2WLQA 3PHMA 4NJ4A 4L92A 1TEIA 4GZ9A 4LORA 1QMJA 4XFBA 1UL9A 5E88A 3H42B 2BNMA 3VBUC 4FFFA 1W2UA 1GV9A 1OH3A 4IV3A 5ERLA 2ARAA 3TEXA 4PT6A 5IATA 2OX0A 4KG8A 4A42A 1O3SA 3CEWA 4QQHA 2W1QA 4DINB 2J42A 4XJZA 1RIRA 3WHTA 4JHTA 5D8AC 1JU3A 3U1XA 5F5QA 2P37A 2B39A 3SITA 4YW6A 1PGL2 4FPCA 2BNOA 2QQOA 1HIXA 2GMPA 3OY8B 1J58A 1OQ1A 2W9XA 1FX5A 1LEDA 2ZZJA 4AFCA 1CZTA 1HXS1 3AP6A 4EWAA 1J3QA 2DFCA 2JDUA 3KM5A 3HN3A 5CB7A 4N43A 1DU3D 3O1PA 5F6LB 5C9AB 1EAH1 1QQP3 1Q5OA 3GZUC 1VAVA 2TUNA 5A7NA 5FY1A 3T2OA 3CJXA 3P3NA 5FYBA 1Y9QA 2I45A 2ZX0A 3NAPA 2GN7A 5K7PA 1JW6A 2UWCA 1VB4A 3MIFA 4P08A 1SEFA 4MV2A 1H1MA 2YGLA 2EIEA 3I3MA 2ZMKA 4DQAA 2VMFA 3RSJA 2TNFA 3ZYRA 1AXYA 4A41A 5IVCA 2WR9A 1DQ1A 1XSQA 2RM21 2ZAHA 4LXLA 1AR62 4IGPA 4K20A 3O1SA 2WA3A 4I09A 3ITQA 3PTYA 4Q29A 5HPOA 4XABA 1MEC2 4N53B 1ENXA 3WW3A 1VLNA 2HEVF 2IVIB 2LM3A 2Q1ZB 3C2UA 4AR2A 3N4MA 1CAUA 1SFNA 4YM1A 2UURA 3DCQA 3AC0A 3NRUA 1W2OA 4OHXA 4OUEA 4OZXA 2JKXA 3IDCB 4XVHA 2JXAA 1YNAA 3AXEA 1AYM3 3AYEA 5GJ6A 4QHOA 3ECQA 2YB7A 3X29B 4FVVA 2WFF1 3CLPA 1H0BA 2NLRA 1W8ZA 4NE9A 1GP5A 1RUNA 3WF3A 1WBFA 2DUOA 1X50A 4CP9A 2JDPA 2FCTA 4WVZA 1CQ9A 4URTA 1FPN2 2VUJA 1AUYA 2ATFA 4ASMB 1AXKA 2GP5A 4DUWA 4YM3A 3TN91 4YGDA 1NXMA 3NV3A 4ZU5A 4CA9A 4WM7B 3I49A 2W3JA 3RG0A 2NM1A 2VW1A 4TLGA 1W6NA 1EAH2 5J37A 1QOTA 1R64A 5T54A 4XQWA 4Y22A 4JCKA 4C0HA 3JBG2 1NQDA 1VBD3 4XXPA 1DGWX 1O59A 4J1XA 2RDRA 1H2KA 4OQ9A 4C91A 1QF3A 1YQ8A 3AKQA 4Y5SA 3NJXA 4DRVA 1LGCA 1H4GA 2XG3A 2ZS6B 1NZIA 2PN5A 4K7JA 4XFGA 1CJDA 3BALA 4MHRA 2IC1A 1DYOA 1LCLA 1HJGA 2RM22 2A3XA 4AEDB 3TRSB 2W52A 4NHMA 3AKSA 1F35A 3DL3A 4MXWA 3VZJA 4CPBD 5JXIA 1NA1C 4COWA 2D6OX 5F39A 2IXKA 2G9FA 3POGA 3EO6A 5C3RA 4DXRA 4CDWA 3RZMA 2BRTA 2DCZA 4ZY9A 5FLHA 2XMLA 4CDXA 5J96B 1FNYA 4LLOA 4XF9A 3ZXGA 1K12A 2Z79A 4P9JA 2Y0OA 3LOBA 1RUI2 2OQ7A 3KB5A 5JOZA 5LWBA 1QWRA 4UW4A 3LWCA 2PLV1 5FMOL 3RYPA 1LODA 2BNNA 2XQXA 3RWKX 3T1MA 1RUJ3 2DVFA 3ZDVA 4FAGA 4B8EA 1XQNA 1OBNA 2XPJA 4XXAA 2JG8A 5J98B 5ABJC 3N9PA 2KM2A 3FC0A 3TN92 4CP9B 2XJTA 2OZJA 3ZMOA 1DDLA 2A3WA 3ZIXA 3NKTA 4K1YA 5LBFA 1YI9A 4HL0A 1NCQB 1OHFA 3PMEA 4IESA 3AYDA 4DXTA 2BOJA 2R041 5K0UC 1SPPB 5LBEA 2RS11 2OVUA 1H8TA 5DMYA 3KMHA 3IMNA 3AP5A 3OPZA 3POJA 3PVEA 1OLME 4K9SA 2GH8A 5F8PA 4QB1A 4QXHA 1PVC2 5FBZA 4TXWA 5FZEA 3T4VA 1NLSA 1R081 3T2PA 5L19A 3LA7A 5D21A 5FYHA 4CCJA 2FD8A 3LEMA 4AYUA 5FK8A 4XJ9A 1AL22 3T2TA 4OZOA 1LHUA 4AI1A 1QNWA 1UY3A 4YG3A 2HWB3 1YHFA 3FHQA 4QPGA 3RMYA 1J59A 3H50A 3N9QA 1VBC1 3N7MA 1LOFA 1GWMA 2RJ2A 3VBSB 2LALA 4KBZA 4AZZA 3PTRB 5JMCA 2R32A 2XUEA 5FYMA 4DEQA 1VR3A 2WUHA 1C57A 3OBAA 4PLOA 2XJRA 3MLLA 1Q43A 1X7NA 2Q5TA 1I9RA 2J1AA 3PURA 5BUVA 4NWWA 5A3UA 1OPOA 4CP0A 3WUDA 4BK4A 2A71A 4BZ4A 2VZSA 1ZBA1 4CTEA 5BY5A 2GSYA 2VXJA 2VOTA 1NX9A 1DQ6A 4Q8LA 3WW1A 3ZYPA 2JDHA 3NWKA 3NV1A 3U75A 1LHNA 3OUJA 1J84A 2HEWF 2XKPA 4Q27A 1OMIA 2P3KA 2VMEA 3WXPA 4BQ2A 2KA3A 4MADA 4UFJA 5HCBA 2A6YA 2QQVA 3CZJA 2VE1A 4Q5OA 3RZJA 1U5YA 4NIIA 5E1RA 2VW0A 4XZUG 1AJKA 1OKOA 4J1WA 4RS5A 5A6XA 2B5HA 3M1HA 5IWFA 3H0OA 5IVEA 3HNYM 2WT0A 3VDDA 3A4UA 2BGCA 3CKHA 1AR63 4HKWA 3KLSA 3DUIA 1OH4A 3H1MA 2PAMA 1TME1 1UX7A 3ILFA 3O0WA 2EXJA 4MH0E 3WP6A 3BTYA 3B69A 5DDJ3 3ZFEB 3ZYFA 2ES3A 3S6PA 3SQOA 3DKWA 4W4ZA 1EV11 5E89A 3NKGA 4JHZA 1W6OA 1JYNA 3I2IA 4Z07A 1YQ2A 1PO13 4UYBA 3LA3A 1VBC2 2WWUA 1ULOA 2XWBB 5H9QA 4QXCA 3WEZA 1IG3A 4XUTA 1TVGA 3IT8A 1OLQA 4Q0VA 5B2GB 4QHBA 2XHKA 1W9TA 3IDEA 3BU0A 2G19A 3ZKYA 1QJFA 2J1UA 5JR7B 2ZTNA 4XYXA 4COYA 2JDYA 3U0ZA 3W20A 5LCWL 3CO2A 2JDKA 2Q4SA 1VE0A 1XNAA 1YQ6A 4IXLA 4MGQA 4XUQA 1HXS3 1MZEA 1RJ7A 4BISA 2CYFA 4N8MA 3WG3A 4DS0A 2D7FA 4BPZA 4LMFA 5KXEA 2XJVA 1GQPA 2PA7A 4QXKA 4GQ7A 3BTAA 4HKOA 1DZTA 3ZFFC 1EAH3 3U07A 5FYSA 4LO8A 2P3IA 1OA3A 4CZSA 4B1MA 3IWZA 3LCPA 5FPZA 5IW0A 4AE2A 1C5IA 1SLCA 4WBBA 1SCSA 1LKNA 3VD7A 3ZLIA 4HXCA 4CCLA 4BDVB 2HYXA 5JUVA 4LITA 2VUAA 5JIAA 2X5IC 4FO9A 4Y1YA 4YVWB 1NCRA 5H9SA 2RM23 2W1SA 3S0MA 1FYUA 1WW6A 1O4YA 1UOFA 1QGLA 1Y43B 2WIIB 3B9CA 5C4WB 3ACIA 4QQPA 1W8NA 4X6RB 4U36A 3S57A 4GWJA 4IW3A 3EMRA 4C8DA 4CXXA 3LEGA 1G6NA 3POWA 3ORJA 5FJHA 5G04L 2VXRA 3W59A 1W3VA 2HYKA 2FDGA 4O65A 2R0FA 1QDCA 4KWUA 1CAVA 4HSJA 5IVJA 3HBZA 2J1SA 4JQRA 3QBQA 1N47A 1BBT3 2ORXA 1REFA 1W6OB 1WCUA 2G1MA 2WZ8A 1JODA 3ACFA 4OI4A 2ZMLA 2HLEA 1QJZA 3K4AA 1ZZ8A 4UI9L 2WFF3 3POFA 3LIGA 4AG4A 2O1QA 2MHFA 1BEV2 3VBRC 5K9YA 1HRV2 3AYAA 1E5SA 1CD3G 1O3QA 3W58A 4JKKA 4KL1A 4M01A 3DKQA 3SKJE 4ZU7A 3OBRA 4Z82A 4BJ0A 4YGCA 4S2GA 2PHWA 2R1BA 2YU2A 3NQHA 1ENQA 4QQ2A 1GWLA 1QHDA 5JR2A 1HX6A 3WR0A 2PYTA 4QU1A 5KXBA 2GNDA 2R071 4NIDA 3NNMA 1VRH1 1AHSA 3LE0A 1UMIA 2A6ZA 4GAZA 3T1LA 3VV1A 2VM9A 4XQDA 5HV0A 1AR81 2HWE1 3O0VA 3PU3A 4ORFA 1MZ5A 1MQTC 2RVAA 2ADDA 2XUMA 3MBWA 1PX3A 5BNNC 1UZYA 2L9LA 5LBCA 3U14A 1DF0A 4JAAA 4WVVA 5DN2A 2WNVA 1OT5A 1CN1A 1UX6A 4Q4W1 3I3EA 4W50A 3WSOA 4FAHA 3ABZA 5I0RA 5EJZB 2YZ4A 1V9U1 2PHRA 4E4HA 2ZOEB 2NP0A 4QDRA 1NCRB 3V0BA 2ID4A 2DVGA 4WM8C 2IXIA 4DY3A 1LB2A 4INDA 3QH6A 1ALYA 1RJ8A 5IHRA 5L7OC 1LEMA 1KDKA 3HJRA 3S7EA 3ZYGA 4ZZ8A 2QVSB 3TBDA 2ZMNA 5FXXA 2DUQA 5IT6A 4OHZA 4YZ4A 3TYJA 3USUB 3WQBA 2IFWA 3A21A 3LDBA 2PLV3 1TQ5A 4QAWA 4X8NA 3DPRA 1V0AA 3JCIA 1UIJA 4HSLA 2XONA 1PMJX 4P9YA 3WQ7A 4OUMA 3OGRA 1WLDA 1Q8QA 2QCSB 2V72A 2C6SA 3GBFA 4YGEA 1BQPA 1J3RA 5DUXA 3AZZA 2R072 4KI5M 1UPSA 4LBMA 1VRH2 2EIDA 1NLRA 4AWDA 2ZEWA 1PX4A 4RSUA 3IAQA 3KVBA 3VHPA 3MIGA 1SBFA 3USSA 4AI3A 3AZWA 4HVQA 3JQXA 3KCYA 1IQDC 3AMNA 2R043 4LOTA 3TNPB 2RS13 1YIPA 1F4AA 1W0PA 3KWVA 1NUKA 3RS6A 3WW4A 1W6QB 2XL9A 1PMIA 2GH2A 3PUIA 3PIJA 1ZREA 5E6HA 2WNUA 4Q4W2 1Z7S1 5FZDA 1QJEA 1UXZA 1G9BA 5C9AC 1R083 2PMWB 4XOGA 3ES4A 2QZ2A 5A6QA 2WNVB 1OD3A 1WCQA 5A1LA 4Q1PA 3H8XA 3KGLA 3MW2A 4HN1A 5KBFA 1W28A 2CWMA 2GAUA 1UWWA 4RQPA 1OXCA 1VBC3 2GNTA 4WV8A 5GZFA 1ULFA 3TNQA 2VCAA 3BCWA 3NNGA 2EVXA 2VR4A 2K2SA 5FYYA 4OHYA 4E8CA 4ONUA 4YGBA 2W95A 5DAPA 5J48A 4XBQA 4XF4A 2YFUA 2B42B 4KU8A 5DUVA 2VCCA 4AHZA 3RZHA 3ATGA 3ON7A 4XMIA 1NT0A 5IUQA 1QOOA 5FYTA 4OHWA 1AYN1 5BNOC 5CKMA 1ZBA3 1OVSA 2HKXA 1R1A2 2ZZQA 1CZSA 5I8YA 3DPRB 2ZA9A 2EIBA 2DU1A 1CAXA 1L3JA 4LBQA 2GMEA 3U78A 3VBOB 5FZBA 2W87A 1NOVA 2QQUA 2WT1A 2XJPA 1S0FA 3AMHA 3VD4A 1V6OA 2ZGNA 3H3ZA 3R0RA 4GWMA 2I74A 4CEYA 2VMIA 4EE2A 4YYOA 5CFDB 4NHKA 1N1SA 4AVTA 1UD1A 1IS4A 4DZGA 5FKBA 4JTNA 3LQCA 4FPYA 2ARXA 3I2GA 4LULA 2HBTA 4Y26A 4LBKA 1ZA7A 1TG7A 3TAYA 2RJLA 4S2FA 4XTMA 3VHRA 1QJU2 2XLFA 1DHKB 1RXGA 4WM7C 2JIJA 4FOWA 1IS5A 1R1ZA 1U0AA 4YW2A 1OOPB 4P9LA 3SCFA 1TME3 2Y34A 1JZ5A 3DYPA 4UBHA 1WGPA 4PIZA 2W91A 5LBBA 3U4SA 2QQLA 3C7OA 2WS92 1DLLA 2VPVA 4IDZA 4MGYE 5FQ0B 3WG4A 4BQWA 1F9KA 2PHDA 2QFEA 1EV13 5JOYA 3N7LA 3VBHC 5FMBA 3M3IA 4JKLA 4LKDA 4CU8A 3VZKA 2ARCA 1OQDA 2NZ9A 4BMBA 5T55A 4A7YA 1LOBA 3C8XA 5B4XA 4AEDC 1QJX2 4QB6A 1K5MA 2YC2A 4PDWB 3VBFA 1RUF2 1WMDA 3W5NA 3ES1A 3MFAA 4XCBA 1APNA 2C1FA 1KS5A 1KDMA 1UOGA 3IKWA 3HBKA 4YVSB 3FX3A 1JYIA 1KGYA 4OI0A 1TNFA 3GF6A 3IB3A 4K8RB 1QXJA 3UJOA 3OD0A 1NG0A 4W6YA 4YWAA 1CONA 2JE9A 4UW5A 3CJIA 4JVAA 5A3MA 2LTNA 4OFGA 3A23A 1CWPA 1T6BX 4XCAA 4FOYA 2BPA2 1QEXA 3RWNA 4XJ8A 2ZGOA 3NV2A 3KV6A 1UO9A 3RZKA 4S2DA 5FPUA 5TSWA 1KRIA 4RR3B 5L36A 1IOAA 3AFGA 1LULA 4N90A 3APBA 1D2QA 4FPJA 4A3ZA 1NY72 5FY9A 3MPPG 4XMAA 5A3WA 5A33B 4FTSA 3WF2A 2PQQA 5KHKA 1UMHA 2BOIA 4MYEA 4HPKB 3UGGA 1W3XA 2J22A 3WDXA 1RITA 4Y5TA 1NCQC 4HG6B 1SFPA 2IXJA 3LSDA 4KU7A 5C6CA 3KQ4B 4R4XA 4Y1ZA 5AC91 3MICA 1MPXA 1YJKA 1D4M2 3MUY1 2YXSA 1N3QA 4WVMB 4LA3A 2XVGA 2Z4FA 5I8SA 1JYTA 4Y20A 3ZN6A 1ND2A 2W94A 3IPVA 3WNMA 2IFRA 1YQ5A 5FK7A 4D7TA 1R091 2DV9A 1AVBA 4AGGA 3E5XA 2ORZA 3POIA 1COV1 2JICA 5BNNA 1YCIA 3W9AA 4CU6A 5KC6A 2MEV3 2UWAA 2QZ3A 1XNKA 4A7KA 5BNPA 2FBEA 3V0AB 2J1RA 4MOAA 5DAQA 4QX3A 2UYAA 3LFIA 4GH4B 5KXCA 3UV9A 1JZ2A 1FAYA 3VBSC 4SLIA 4R52A 3FN9A 5FP7A 4K21A 3WHUA 1RTVA 2YFZA 3CQOA 4LR4A 2VMHA 2ZAAA 1H30A 4R9DA 2RG4A 4B4RA 4RL7A 2R073 3WUCA 3T08A 5HI0A 1KJLA 1XNTA 2C9KA 3KQRA 2BV4A 4YW7A 4E9KA 2MNGA 3OPWA 5D1IA 5FMCA 1AR83 1YJLA 2HWE3 4E4SA 3VL9A 2P3JA 2FCUA 5F3IA 2WNOA 1J83A 3NSTA 1JUIA 1QXRA 5J7MA 1O3TA 1AZDA 3I4IA 2XKOA 4FPHA 3NMBA 2D40A 3RYRA 4IEVA 3EQEA 1CIWA 2LW8A 4JGZB 5H9PA 3VB9A 3VDCA 3O1RA 1F5JA 1UZZA 2DTYA 3UNPA 1FMD2 4XJWA 4XQ4A 5A70A 4PBPA 1MVEA 2UU8A 3WOGA 5I0SA 1XPWA 2JG9C 1ZBE3 1V9U3 4P14A 3WNNA 1GZ9A 3Q8FA 5AC92 1A6CA 3D5OA 5F3GA 2AR6A 2VGDA 2A6VA 4IV1B 4JGYB 3CZUA 4QQLA 2BFUS 1JYCA 3AXDA 5FXWA 4QPWA 3ZYHA 2RR12 2JKBA 1NE4A 2DWRA 5CG9A 3KGZA 1CAWB 4HN0A 3OOXA 2P3YA 1BXHA 2QQNA 1FV2A 3LPFA 4NRQA 5FZFA 2WZPP 3RZGA 5F5IA 3ZKUA 1F31A 2JEMA 2A70A 5T5JA 3J4UH 1ND3B 2LROA 2DCYA 3AP7A 5I0TA 3LEKA 3ZFEC 5LRSA 1G7YA 1DQ5A 2ZGRA 3ZPYA 4ARXA 5A3PA 1NLQA 4YSFA 5T50A 4AK3A 4QQOA 2HWD2 3RJ2X 4IEWA 3OYWA 3AMPA 1BLZA 1GZWB 1MEC1 3IMMA 2WRAA 4H7LA 1PK6B 1X33A 1X9TA 1O6UA 3OJBA 1ZYBA 5FZOA 4P5HA 3RQ0A 4WVWA 3WF4A 3G6JB 1LOCA 3I7DA 2DVAA 1UY2A 2YHJA 4IEPA 1ZRCA 5A7PA 4DOUA 2RDQA 1KQRA 1W06A 4UFLA 3WDUA 3J7MA 4MG2A 1U5ZA 3I59A 5FZ4A 1CGPA 3PMSA 1W6MB 1RUD2 2WQZC 2ZXQA 1Z7S3 5DUUA 4J25A 4W65A 5A7QA 3AYCA 1O4TA 4Q2FA 3ZFGC 4BYYA 1W90A 1FPN1 3PDQA 2XVKA 4KGQA 3WG2A 5L9VA 4FP2A 3ROUA 2Y6LA 1F8VA 3V56A 4CP1A 4AVCA 2ET7A 4N7IA 4CPBA 3B02A 2YC4A 4KBBA 4YLZA 1GANA 5CVRA 1PVXA 3EYPA 5D2AA 5GLUA 4CDUB 2KR2A 4ET7A 3E6DA 2JECA 4YVWC 3JBG1 3B9IA 5F37A 1H2NA 5CG8A 2X10A 5C4WC 3B5LB 1DLCA 1RINA 4FXGB 2CGPA 1HV0A 1SBDA 2P1BA 4QPIB 2C26A 3EJKA 2VZRA 4RHV3 1RC6A 1AX2A 4EJRA 1W6PB 1OPMA 1QKQA 2WZR1 4HMZA 1XE7A 1XXNA 1AYN3 4D7SA 1LECA 1WD3A 5IVYA 4P9XA 2G9GA 3BN6A 1S0EA 3ST7A 4Y1UA 5LK7B 2HJIA 3VBHA 1LAJA 3D4KA 3K48A 5JLVA 1SBEA 1WW7A 2FCVA 1XE8A 1ULPA 5LA9A 3VKLA 2C0ZA 1W0NA 1DYPA 3KV9A 4I2OA 1ULEA 5CAZA 5L9RA 5J09A 2YV8A 1I6XA 3O1VA 3IIIA 1RUI1 4RN5A 4Y24A 4CEWA 2W08A 4ZXKA 4F7ZA 5JSOA 5JZGA 3BI3A 2BW8A 3N36A 1JTZX 1J3PA 4GALA 5GLWA 2JJ6A 4A44A 4AI8A 4NIAA 4IV3B 2WYFA 1ENSA 4BQ1A 1Z0HA 2E51A 5DQ0A 4XF3A 1GICA 4HK9A 1REEA 4JRAA 4A2UA 4AFAA 4UOJA 3CL1A 1CPNA 2Y6HA 4TSVA 4BIOA 1HN1A 4L2NA 3N9NA 2E53A 4N43B 4UW3A 2O0OA 4Z2AA 1W39A 2R062 4JV4A 1H9WA 3FZ3A 2W1WA 1EPWA 2AENA 2D3RA 3KCCA 1A8DA 4KH9A 4WZFA 1ZRDA 5DABA 3NAPB 2UY9A 1PVC1 1JHNA 2WLPA 4V2WA 5DZGA 5FJKA 5KHJA 2WZR2 3NV4A 5E8AA 4AFMA 4XJUA 2ZGMA 3W21A 3LPGA 1ZVFA 4UW6A 4KGGA 4QX5A 1AL21 3BPZA 3K51A 3MF6A 4NPLA 3I2FA 4XJAA 5EXOA 4FPEA 1V70A 3S5QA 4B3NA 3LKJA 1WCDJ 3AX4A 1S0IA 4OMDA 3AL6A 4PHZA 2W2IA 4LHKA 3VDBA 2BYVE 3KF3A 4FI9A 3MO4A 1E5RA 2PHFA 1CAUB 4IEOA 2D98A 3RDIA 4CXYA 4FT8A 2CGOA 4XFAA 2ZHLA 4AF9A 2VZTA 4TYSA 4GKXA 3AZVA 1W9FA 3H7JA 4Z1VA 4NWVA 4DUXA 3FUOA 1OF3A 5FP8A 4V2VA 4GB31 3PLQA 3E5QA 5CA6A 5CFCA 1GQGA 1JZ8A 4B4PA 1HQWA 4LE4A 4XETA 2VMDA 3IZOA 5FKCA 2QBXA 4COUA 5AC93 3L2YA 1UXXX 2R16A 1T6GC 3POYA 1AR91 1JYVA 4P9GA 3J26N 1R093 5A7WA 2TEPA 3KCXA 4CUBA 2HWF1 1L7LA 4FSJA 4M4PA 1H2MA 3WX5A 1COV3 1W6NB 3HPNA 3GDBA 4HVOA 1C4RA 4OI1A 4A6SA 4EN6B 3IAPA 3S5AA 4Y22B 4DMIA 3T0DA 5HXMA 5LW9A 4O9GA 1IPJA 2ZJCA 4L97A 4ITCA 3RZLA 1X82A 4CDQA 1IKQA 1WW4A 3AMMA 3GALA 5CYYA 1ZM1A 2ZGUA 4RYDA 5CNAA 1V00A 3EB7A 3JZVA 3BU7A 4AQ6A 5IK8A 5T5PA 2ZBJA 4MXWB 2PAEA 3E5UA 1H6YA 3ZM8A 4NIHA 2ZX2A 3FHAA 1NE6A 1ENRA 2PXJA 3GZEA 4HZFA 3THPA 2ADEA 2DCKA 3UGFA 4Y4RA 1FXZA 4CDWB 3B93A 3M3QA 4XZPA 4NPRA 4RGAA 4LHLA 2BDRA 4CDXB 2EXKA 3FL7A 1CX1A 2UY8A 4BOWA 3OB8A 4O7XA 4W6WA 1GNZA 3LOIA 3VBOC 2GZWA 4GB32 1C1LA 3POBA 1Y3TA 3IM0A 2QQJA 1OVPA 3SCGA 1QH6A 5CFDC 4CCKA 1YRZA 1OLRA 3LF7A 3WNKA 5JOWA 3THDA 2Y6FA 3I3DA 1UQXA 2GC1A 4I3PA 1MS0A 1AR92 1ZZCA 3DXTA 4IEXA 3M2MA 5EZWA 5C3PA 1AL0G 4QD2A 5CKQA 2BUKA 2JG8B 4R9AA 2Z5WA 4AAXA 2HWF2 3VBUA 4MHUA 5FCCA 1OOPC 4MLOA 5IK5A 4O61A 5F5AA 4KWKA 5A7OA 4FPOB 5D8AA 3NVCA 3C7GA 3JD71 5C33A 1XNDA 1H8TB 3L2HA 3MIEA 1OC1A 1XU2A 2ETEA 1W2NA 5C8CC 1LOAA 1MEC3 2Q0AA 2XGXA 1DQ0A 5JIUA 4PDWC 2XOMA 2BWCA 4H7MA 2WQ4A 5FTTC 4CDQB 4H2AA 1UMZA 3GBGA 2VD7A 2YDEA 3JQWA 4YVSC 4IE6A 1LOEA 4E8DA 2ZX3A 3AP4A 4YW1A 2V4AA 3RI9A 5HV4A 1T2XA 4QPGB 3ZSJA 2QQPA 3IDAA 2P5BA 1UCXA 2J1EA 3KD4A 3J8F2 4WZCA 1I5ZA 1QJY2 5FXZA 1ACCA 2JX9A 5FLJA 4AI2A 1BEV1 1HB3A 2YYOA 1HRV1 1G9CA 1C8M2 3OCPA 4GMP0 1ZNPA 4AFBA 2FQPA 3UKVA 1FPN3 2VU9A 4XILA 4IE0A 2RDSA 4OQ8A 2WDBA 3U37A 3VKMA 3AFKA 1OFSA 1H1IA 2RHPA 2JB8A 3H8OA 1VBA2 1ODNA 2VNRA 1RUC1 2PHLA 3R4UA 1ULGA 2SLIA 3MIHA 1B35C 4NN0A 3JBG3 4QKBA 4EWEA 2BBVA 4M3CA 5T52A 1W04A 1YFXA 4SBVA 3KT1A 3CDZB 2D97A 2D3SA 1YYNA 3KHBA 4QM8A 2B45X 2W39A 4AGRA 3BPSA 3KV5A 1S0DA 3OG2A 3SEEA 3UL2A 5F1RA 4CU7A 3JD72 2EAAA 1AR72 5EYYA 2WZR3 5FZMA 3ZPOA 2BQPA 1XYPA 4RS5B 3MF9A 4C1WA 1DQ4A 2F6BA 2YPDA 2WL1A 2Z2SB 2PELA 2UYBA 3VDDB 5FO7B 4CU9A 3ZN4A 2AEZA 5FY7A 3D82A 2ENRA 2XQRA 3INAA 3WINE 1ZRFA 1LJ7A 3AKRA 3SCHA 2B7YA 4D69A 1US2A 3AK0A 1JUHA 2EALA 2E63A 2HWC1 3CF6E 5K8SA 1V6IA 3QLQA 4LE3A 1LR5A 1SG3A 4ASKA 1UNBA 1H2LA 4G4FA 3MI8A 2JDNA 5IK4A 2KXLA 4I0WB 1RUI3 1PNFA 3ACHA 1NQJA 3WV6A 3KF5A 1WMXA 4M0NA 1X8EA 3MLJA 5IFTA 1YI7A 2BGPA 3WDVA 3ZXJA 3A0NA 4UXAA 2Q30A 1H1AA 5FBJA 2ZGSA 4XUPA 1S0CA 1NA1A 2V4VA 4BXSV 2NMOA 1Y7BA 1AX0A 2XVLA 4FPKA 4O9EA 5ACA1 4B7EA 2MPFA 3TN93 1POV0 2R1DA 3AP9A 2QTWB 2GNBA 3I2JA 5FYUA 3U11A 4IETA 3OUHA 1WCSA 2EICA 1RUC2 4NO4A 1CESA 3N3HA 2P4EA 1VBB1 3KT4A 5FWJA 2VBPA 2W0XA 1O5LA 2VVDA 4Q0QA 5I93A 4NHXA 1OUXA 4Q4V2 1KFUL 1RUH1 1DGRN 1HRI1 1UKGA 3M70A 5FYIA 3T4HB 4IV1C 4JGYC 4XTPA 1HJFA 2ZEYA 4NAOA 2O8OA 1PVC3 2WINB 3TB0A 1HLCA 4LKSA 3VZNA 1W0OA 4LLFA 3SH4A 2YBPA 2R30A 1W8WA 5FPVA 1S0GA 3WF1A 4DEVA 4LNVA 1AL23 5H9RA 4YW3A 2XWJB 4EQVA 5ABJA 5FPXA 4DB5A 2X8KA 2OUJA 2OIIA 1ND3C 3OGJA 2E32A 2HBUA 1RMU1 4W8JA 2HWC2 1W8FA 4PI0A 1VBE1 4KQ7A 5F2SA 1CZVA 5K0UA 1V6JA 1BZWA 2K9ZA 3MGUA 1HB4A 5FYZA 4L11A 2HEYF 2VNGA 1JOBA 1CAVB 1PK6C 1BK0A 1GOFA 2W5FA 2WKKA 4QWNA 4LUKA 4C90A 3FBMA 3MUZ1 5JCTA 1YFWA 1SDDB 1WZXA 2QQWA 2BU9A 3B01A 4GB33 5L9BA 3VLBB 4QDQA 1D7PM 1R1A1 1NAEA 1MVQA 4N9IA 3MLKA 5FZGA 5FRAA 4DY5A 5ACA2 4QX1A 5F9TA 2P34A 3GNEA 4E4ZA 1P8JA 3VKOA 1CJPA 5EP9A 2XBO1 4QKDA 5A6YA 2E33A 4R4ZA 1K3IA 2P6CA 3VL8A 4Q4Y2 1PO21 2HWF3 1VBB2 4PJYA 5FZ9A 1OI6A 4C0BA 3N7JA 3ETQA 4AL9A 1VJ2A 1PGW1 5K4LA 4XFHA 3O1TA 1RUH2 1HRI2 5JMOA 1SDWA 2F17A 1D4VB 2Y64A 1QJU1 3DGTA 2PHUA 4CDUC 4Q8KA 3A0KA 1HKDA 3LDKA 2VTFA 4R8HA 5FIXA 5GLZA 3RGBA 3THTA 1QOSA 1F2NA 4R9CA 2WS91 4LBLA 2BVBA 3I54A 2VZQA 4QX7A 4BH9A 1RUE1 3K75B 4GMP1 2A7AA 5JI9A 1PIV1 4QPIC 2Q8EA 2CDOA 1URXA 1W2AX 1OA2A 3H7YA 5FFOC 1RMU2 1HQLA 3DF0A 1Y9MA 3CIHA 4UF0A 4AVSA 1H4HA 3V0BB 1VBE2 1SFYA 4Q0UA 1QJX1 2QKDA 4GA9A 3ZSMA 1EUUA 1RUF1 4CUAA 4N53C 3Q8EA 2BGOA 3IN9A 1DIWA 4Q0PA 2VQ0A 3ELNA 4AQ2A 2OA2A 1J1TA 2WYSA 2B9UA 5KWRA 1US3A 1O7FA 2WN2A 3HEIA 1GOHA 2FDHA 3AM2A 4JZRA 3CBNA 4QGNA 1UY0A 1UYZA 1YFYA 1X36A 3GHMA 2BVVA 4YG6A 3CMGA 5FUPA 4K8FA 5A3OA 1W05A 1QQP1 1L7RA 2VZ1A 1WCKA 4KWJA 3EBRA 4XHBA 4LUMA 3SKVA 3ZYBA 3HQRA 3ZR6A 5FY0A 3MPBA 4UFKA 3SLIA 2XBO2 1O5UA 1S2KA 5FZHA 3WW2A 3Q9OA 4IV3C 3ME2A 4Q26A 1PO22 4IEYA 4JDNA 2VNVA 5FPLA 1G86A 2WSVA 1NY71 1PGW2 2GMMA 3J7NA 2GALA 1POQA 3SXWA 2RS52 4QB2A 5FO8B 2PHXA 4AQTA 3U4XA 3JD73 1UN1A 4TZDA 5F7UA 2UWBA 1V6KA 1OF4A 1GBGA 1FOD2 4N43C 2Q8OA 4Z92B 4P9IA 2WNUB 4AFDA 3LAGA 1D4M1 4BA6A 5FZKA 3B3QE 4Y3OA 1RUE2 4M00A 3GZAA 2EIGA 2WO2A 4D0QA 4X8PA 1PIV2 2OS2A 3ZFFA 4YZ3A 3SMHA 5A32A 3ETPA 1UU6A 3NAPC 4BQ5A 3G7DA 4LO6B 3UYJA 4URAA 5E16A 1VALA 1KXGA 1WWYA 1RVF1 4RQPB 2RMU1 1POV1 4Y5Z0 1O4ZA 1RUG1 3SH5A 3I2DA 4YW5A 2NQYA 1BEV3 3D6EA 4LHNA 2X5IA 1HRV3 4IE7A 1LHOA 5HXVA 4UAPA 2YBKA 4BQ3A 2ERFA 3WZ1A 3WG1A 1XU1A 3LGRA 4DPNA 1IS3A 5DZFA 1QQP2 4CCDA 2IVJA 2YROA 5AVAA 5FZ8A 4HFSA 4AOCA 5BNQA 3O0XA 3GZTB 5IK7A 1XNBA 2VECA 3V65A 1EY2A 3D3AA 4S2HA 4GIQA 1GLHA 2EF6A 4IEQA 3AJZA 3CU7A 4I30A 4OUSA 3RMXA 1CAXB 2Y6GA 3VD3A 2E7AA 4LBQB 4Q1RA 4Z8BA 5B4NA 3GCXA 5EV7A 2VC9A 2NN8A 4OULA 4MGSA 5FY5A 2RE9A 3VBRA 1WMEA 3HIFA 2H6BA 3ZR5A 4CEYB 2VO5A 1WW5A 2BTVC 2WABA 4FFHA 4IE4A 1GOGA 4QM9A 2VVEA 1FMD1 1XYNA 3Q8BA 4HT1T 3FUQA 4AVVA 1F4HA 2XHNA 4P5YA 5GZGA 4MVTA 1FV3A 4L0PA 4AGVA 2RR11 3E6CC 1AYM2 4HVRA 2H6CA 3GXUA 5APAA 2VCMA 3OSDA 3C7FA 5FWEA 2ZEZA 2H0BA 1RVF2 1MQTA 1O91A 3NJVA 2RMU2 4I01A 2VTXJ 1RUG2 1DZQA 3J9SA 4BWOA 4XFIA 4YARA 4B29A 3K77A 3DXUA 5FPBA 1K5MB 4NR1A 3VBFB 4A45A 4ASLA 2HWD1 4UWDA 3FLRA 1LGNA 4AVBA 2ET1A 1CIYA 1VMHA 2Y33A 1XC6A 4FOQA 4CDWC 5ACA3 5C7GA 1MR5A 4WM8A 1PZ9A 3HOBA 4LO5B 2BERA 2GDFA 4IERA 1VRH3 1EPZA 3PJQA 1VBD2 4LKEA 3RRDA 4CDXC 5L7OA 3H1YA 3CJIB 3MEPA 1JS9A 3FHIB 3JB8A 4F3JA 5F3EA 5ISLA 2GN3A 3E1F1 1RL3A 4XFCA 5J36A 3MW4A 3ZO0B 1M4WA 5I8TA 3M3EA 1RUD1 1WKYA 5FP9A 1HRI3 1UU5A 1UY1A 2CAUA 4UBGA 1ZZ6A 4YPJA 4Q4W3 2JB4A 4I02A 3GBWA 5I0UA 5GKAC 3H3LA 2JG8C 2EA7A 1FT9A 2XJQA 2ZACA 1Z78A 5FP4A 4COZA 4ZKTB 2VJXA 3M3CA 3PUQA 4G9SB 4PLMA 1LNSA 3BGAA 2R49A 4LBNA 5M0TA 4LO7A 5GZEA 2VNOA 4N7UA 2JIGA 4YM0A 4XPVA 2X09A 5DPNA 5T3NA 3WNXA 3HWJA 2FMYA 3JUUA 1H8TC 4LQRA 4Y20B 4QU2A 1ND2B 2G9ZA 3IPVB 3ZN6B 2FHRA 3O5SA 1RUJ2 2WA4A 4YFWA 2PHTA 4BK5A 1KFXL 1C28A 3F95A 5C9AA 2KD7A 3O14A 1IQAA 5DG1A 2DBIA 5BNNB 1N1VA 1OUSA 1QH7A 4CRQA 1NYWA 4D8MA 1R1A3 2A6XA 5BNPB 3C7EA 2Y6JA 3H8UA 4E4DX 5I0DA 4QPGC 2OPWA 1LOFC 2AACA 3HT2A 3I2KA 3BIEA 3OF1A 4AVAA 3M3OA 2IXCA 5C71A 4FTBA 2B9VA 1Q8VA 3AJYA 2XBO3 2OXBA 3MV11 4OI2A 1MS3A 3ASIA 5EJ3A 4IEUA 3K3OA 3I3QA 1OA4A 3ZXEA 1WMFA 3KT7A 3O12A 2VZVA 4N53A 4MXVA 5FV3A 3KS7A 3AKPA 5J1XA 1IKPA 2XJSA 4LHSA 5FZLA 4ZU4A 2ZHMA 1L7QA 3OBZA 2BWAA 5BYNA 1QJU3 5DDJ1 4B1LA 4HLTA 5FXVA 1YFUA 2Q1FA 5BNOA 2WO7A 4JDOA 1RUOA 4ZZ5A 3NJZA 4CXWA 1IG0A 3WP5A 4K1ZA 2HWB2 4OHVA 2WS93 3WP3A 1H9PA 3POEA 3KZ4C 4ES9A 4L8QA 3SC7X 1RUE3 4LK6A 1SLAA 4N9HA 4GMP3 2V5DA 4PIYA 2IXLA 5C8WA 1PIV3 4EN7B 1GMMA 3AZXA 1UYPA 1PGSA 4X6QB 2XR4A 1CVNA 3S30A 5JSRA 4LIUA 3EXUA 4RS5C 1QJX3 2P2KA 2R061 3PVNA 5C3SA 4NRMA 1RUF3 3VDDC 1FATA 1SZBA 3VD5A 2X05A 2OW4A 4JRLA 4XUOA 5IAXA 1LHVA 2VH9A 1I5PA 1Q8SA 4WM7A 1KS4A 1Q8OA 4IEZA 5CADA 1E5HA 3Q8CA 1GZTA 3N7KA 2GU9A 1GZCA 4EN0A 1W8TA 5L73A 4AXOA 2BFUL 3ALQA 5HCHA 3WNPA 3D0JA 1X9PA 2VY0A 5J3UA 2ARBA 3J7HA 3RJRA 3OYWB 1JH5A 4ATEA 4CCNA 2FZ2A 4NMIA 4YRDA 3BYWA 5EPAA 2IZWA 4AEDA 1ZX5A 2D6KA 4P00B 1RXFA 5FZOB 5IAVA 1D0HA 1STMA 4PF5A 2BBAA 4QX0A 1EUTA 1I3HA 1UPIA 2ZX1A 1WLCA 3FLTA 2EXIA 1RHI1 5FMOS 2JE8A 3NW4A 1OQEA 1JI6A 4HBNA 4E27A 5SV5A 1BVVA 5DDJ2 1SACA 4YZ5A 3I59B 2LS6A 5KXDA 1JZ4A 3UK9A 1XSRA 2E6VA 1OKQA 4BLJA 2QDNA 5A3NA 1DP0A 1LESA 1PO12 1VMFA 1D4M3 5LASA 5A80A 5BNOB 2WJSA 3DV8A 3K4ZA 1PZ7A 4PIXA 3ZSLA 1BBT1 2AUYA 2Y26A 5FUIA 4FPGA 3T0AA 2ZPXA 3HD8B 1VAKA 2YGMA 1UZVA 3B7MA 4AHYA 1EYBA 2AGSA 4LEJA 1RVF3 5IJRA 3SNMA 5BV6A 5C5TA 4MZUA 2Q1MA 1POV3 2RMU3 5A7SA 1JOJA 1BK1A 5JXJA 1RUG3 2XLAA 4ARYA 1NCRC 2YPJA 2VULA 3JB4C 4YNIA 2PFWA 5DUWA 5IVFA 4FQZA 4NRPA 3ACLA 4A6OA 4A7ZA 4KG0A 3ZXDA 1HXS2 1NCQA 2WSUA 5FOJB 4ZONA 1WLWA 1LOGA 4MGTA 2CDPA 1M06G 1W9SA 1SPPA 5DAVA 1GP6A 3DECA 4HK8A 3VN4A 4LBOA 1BKZA 2EAKA 3I2OA 1TMF1 1ULDA 4AEMA 4UT5A 3BUCA 2VQAA 1BMV2 2VMGA 4IUGA 1REDA 4NHLA 1N3PA 4F83A 3PUHA 5DXDA 4FOVA 3K46A 4OLLA 4BQYA 4M3CE 3VBHB 5JPMB 2VG9A 4TWTA 1N1TA 2W1UA 4EZHA
chains in the Genus database with same CATH topology
1RHI2 1ZZBA 1NZCA 4FP3A 3SHRA 3IBMA 1ONAA 5HCAA 4XE9A 2DCTA 4L9BA 1V6MA 3VBSA 1FMD3 4CEWB 5JZGB 1F5FA 4HKLA 5A3LA 1OSGA 1WD4A 2B46X 3VHOA 4Z2WA 3FWEA 5JPNB 5SV8A 3C3VA 5JI7A 1IS6A 3RYKA 1BBT2 2RR13 2V09A 4XHXA 5FOBB 5FREA 2G4IA 2D6LX 2ZGPA 2WFF2 4GWNA 2D5HA 5CBLA 1YXWA 2WNVC 1MACA 5EWSA 3AMQA 4KWLA 1A3KA 1S0BA 3WQ1A 3LB9A 4XW3A 4Y1XA 1V6LA 2HWD3 1QU0A 3GHNA 4AQSA 2JG9A 1MS1A 2YC0A 1NXD1 3VZOA 1I1EA 1YO8A 1TMF2 1UIKA 2GNMA 5T5LA 1HW5A 3I8TA 2QDRA 2I2SA 3PVBB 2FMDA 1LU1A 3ZFEA 1YIFA 1G9FA 1SLTA 3J8F1 1QJY1 1ULCA 4RD7A 3DPRC 2BEOA 2VOXA 4K40A 1RUD3 1C8M1 4H3WA 1H8VA 4LO4B 1D2SA 4META 3AB0A 4PLNA 5KHHA 1GYKA 3ZXFA 4C1XA 3B94A 1WUVA 1JBCA 4L99A 3IIAA 3MYXA 5CFCB 4Y1VA 1VBA1 3NL1A 2E9QA 4RFT0 4RA0A 1HQNA 2PLV2 1XRUA 1PNGA 1GKBA 2WNUC 2A73B 2JE7A 2PAKA 4BM8A 1AR71 1C5HA 3BIWE 3ZFGA 2CV6A 5JSPA 3MW3A 2Z42A 4RQPC 1WBLA 1BJQA 4TLFA 3VUOA 2JG9B 3ZN5A 5AFBA 1OFNA 1B09A 2R042 2N7GA 2ZHKA 5LEJA 4YVWA 2RS12 1CR7A 3LA2A 1A78A 2CTVA 5C4WA 4LT5A 4AI0A 1RB8G 5LK5A 5AFEA 1GSLA 3M8LA 1R082 3BB6A 3RZZA 3RI8A 2H0VA 4CYDA 1AXZA 4FPFA 3SH3A 1DQ2A 1MZ6A 5FDBA 2D6MA 4MGIE 4RR3C 3BOWA 1PM7A 2AZ5A 1EP0A 4CEYC 4EV0A 3ZXKA 4DNYA 5JAXA 2ZKNA 4PQ9A 2OYZA 2GC3A 2R063 2ZHNA 3LSEA 1HDKA 4Q4V1 2IWGB 1TNRA 3D8CA 4YZ1A 2AH2A 3VBUB 3MFCA 1ZBA2 3E6BA 2R0HA 1DGRA 4I3GA 3MDPA 4XFFA 3URFA 2JD4A 4AHXA 4JDMA 4NOTA 3MIBA 4JC1A 5D8AB 1J1LA 2I07B 3VHNA 2JDZA 2W68A 2WFPA 4FTEA 3ZFGB 2GC2A 1UU4A 1IHMA 3E97A 5FAXA 3WP4A 3M7AA 3P3PA 3ZX7A 3FE5A 1K5MC 1DYKA 3R6SA 3VBFC 4GH4C 1SLLA 4CP2A 2EXHA 2ZGKA 1LENA 4MUVA 4D3WA 1D0GA 1ZRRA 2RS31 2YUEA 1RHI3 2Y0IA 3V64A 1S1AA 3HQXA 2DU0A 1TME2 1CPMA 3FLPA 1FNZA 2OUHA 1N3OA 3WCRA 3CJIC 4E2SA 3VKFC 2NMNA 1EV12 3D0SA 4Q4X1 1SLIA 1V6NA 4HANA 3FFZA 3USUA 5HCFA 3M4FA 4EN8B 1DGWA 2VVFA 4E2QA 3OTFA 4JGZC 2OZ6A 4ISQA 4P9WA 4Q4Y1 4NVPA 2MEV1 3ZXLA 1ZZ9A 1VP6A 1N1YA 1GNHA 2DCJA 3WVJA 2DYCA 1JXNA 1DBNA 1QY4A 4FPLA 3H1WA 4BCUA 1U5XA 1C8NA 4XEZA 4M3CB 4XF0A 3ZMNA 5T5OA 2CNAA 3KSCA 2GC0A 2XL7A 5KHIA 1ND2C 2ZGQA 2ZGLA 5LEKA 1TMF3 1W6QA 1BCXA 3TWIA 3BOPA 2AREA 5GLTA 1LHWA 5JOXA 2NYYA 1ZA4A 5GZCA 4J6GA 2VW2A 2WT2A 4IQPA 2R6QA 3ZYIB 4Y4YA 2RS32 4COVA 2B8MA 1LTEA 5BNPC 1XYOA 1A8MA 1YLLA 4EN9B 1SCRA 2ZKLA 3TOJA 3NO8A 4LTAA 1SMVA 1YUDA 2P17A 1ZBE1 5AVPA 3RNSA 4LBJA 1ASJ1 1C1FA 1U12A 5JWPA 2CAVA 4MGZE 4B7KA 4Q4X2 1YWKA 3U10A 3HN1A 1HV1A 1Q56A 3O7OA 1OD5A 5BPXA 1IZ3A 4FXKB 1CX4A 1NA1B 1AR93 4AEJA 3GYDA 4I0BA 1VB2A 2MEV2 1DG6A 3BODA 4K6BA 2A75A 3ENRA 4GULA 3ZSKA 2PTMA 2RS51 3VBOA 2QJVA 1MZFA 2A6WA 2V73A 3L9JT 3JU9A 1FOD1 5GM0A 5CFDA 4D94A 4YZ2A 3ZSEA 4JTOA 4PCRA 4M3CF 1S0JA 3R4SA 2D6PA 5LRRA 1AR82 3HMYA 1BVP1 1QNYA 2HWE2 5ABJB 1C3HA 2D3PA 1S2BA 3ZDSA 1RGSA 2QNKA 5F6KA 1G8WA 1OOPA 3ZXAC 3PJYA 4H14A 1Q3EA 3J8F3 1PZ8A 1QJY3 3B00A 4H55A 5FQ0A 5GLVA 5K0UB 1G9AA 4U2AA 4A3XA 1GFF2 1C8M3 5JVVA 3VGIA 4XBNA 1ZBE2 1AJOA 1V9U2 4XF1A 5C8CA 1ASJ2 4BHPA 2DUPA 3AKTA 3CNAA 1UKRA 4PDWA 1TE1B 1VBA3 3QCWA 4YVSA 1Q8PA 4RHV1 4E2GA 3ZIWA 4QMAA 4DRRA 3AZYA 2D6NA 3OD4A 4FBFA 3HR9A 4G3YC 3QACA 3IDBB 1G9DA 3UJQA 4AW7A 4YW4A 3H9AA 1AR73 2D44A 2XJUA 5GALA 1UW8A 5FO9B 3WCSA 4BIFA 1O3RA 1LRHA 4PBOA 2DF7A 2ZGTA 4RR3A 2DVBA 4QGLA 3ILNA 3R4DB 5HBAA 4BE3A 2VOKA 5A33A 1AYM1 3VKNA 1MS5A 1B35A 4HPKA 4FCAA 2VOWA 2X29A 4M0HA 4EWDA 1Z7S2 4XBLA 4ISRA 3POSA 3EHKA 4WVMA 5EYXA 4DXZA 3FJSA 1E57A 3QOPA 4AHWA 5EFUA 3PVOA 3MIDA 3WD5A 3OBTA 3WY6A 1X8MA 2ZX4A 2Z69A 2D5FA 4K3UA 1WLTA 1MS8A 2O8QA 5C8CB 1FI2A 3PNAA 5I91A 1MS9A 1VBD1 3V0AA 1KD7A 1WA4A 2E7QA 2JENA 5KHGA 4GH4A 1RUC3 1IPKA 2WC2A 5JZGC 4CEWC 5DG2A 4KNCA 2D43A 1IGOA 4RHV2 4AEKA 2ZCWA 1AF9A 3WLUA 4QGMA 4Q4V3 1AYN2 2D93A 5BXXA 1XNCA 2RJKA 2ILMA 4YG0A 4EROA 4RGGA 1PHMA 4HETA 4B4QA 2NPIA 3ZVXA 1SLBA 4MGKE 4V1PA 4MX3A 4JGZA 1BYHA 2HWC3 1VAMA 3UKNA 4FQ4A 4F8AA 1GR3A 3ZFFB 2RS33 1S55A 2A3YA 2AYHA 3WDTA 5A32B 1RUJ1 4R9BA 3HAGA 3SISA 1B35B 3UKTA 4IV1A 1UF2C 4JGYA 5JDBA 2DFBA 1KITA 1BMV1 3FMGA 4XDQA 4GKYA 4Q0SA 4LBQD 4OVEA 5DZEA 2X53S 1CAWA 4IL7A 3WDWA 2FZ1A 1DZRA 1KJRA 3DN7A 5GZDA 3WDYA 3H3UA 2X5IB 1SQ4A 2E7TA 4Q4X3 4I0AA 1ND3A 2K0GA 2YMZA 1QDOA 3OGGA 2DURA 1VIWB 4LA2A 4Q4Y3 2CWSA 1VBB3 1GZWA 2XB6C 1MS4A 3RPQA 1GQHA 1PK6A 3FFQA 3LZZA 2YY1A 2Y38A 2QE3A 4W6XA 1RUH3 5CFCC 3ZYJB 2OPKA 4MSVA 4YFZA 1LGBA 2LUWA 2TBVA 1AX1A 2CY6A 3VBRB 2HWB1 5KC5A 4XIKA 1ZZ7A 1W6MA 1U5IA 3S7IA 1RMU3 1UAIA 1VBE3 2DTWA 3OY8A 2CL2A 2F4PA 4YM2A 1PGL1 4GXLA 1BMV2 4CDQC 3VZMA 1MQTB 4CDUA 2QUOA 3VZLA 3ILRA 2CGNA 4D7YA 1ASJ3 2VOVA 1DGLA 2DVDA 3FBYA 2SBAA 1R092 4QPIA 4XIOA 1JN2P 5FLIA 3QD6A 3HT1A 4ATFA 3MZHA 2WNEA 4BMEA 1W6PA 1COV2 1QXPA 3WQ0A 1DFQA 1PO23 2XLGA 4WM8B 4DFSA 3QH7A 5L7OB 1AR61 2ZABA 2WWSA 3WT3A 4BLIA 3N35A 2RS53 4ES8A 2XH6A 5CU1A 1LU2A 4QT6A 2C5DA 2A5ZA 2IXHA 4QPYA 2C9AA 1FOD3 5CIRA 3R05A 1PO11 2V5YA 2WLQA 3PHMA 4L92A 1TEIA 1QMJA 4XFBA 1UL9A 5E88A 3VBUC 2BNMA 4IV3A 1W2UA 1GV9A 4KG8A 1O3SA 3CEWA 4QQHA 4DINB 4XJZA 1RIRA 3WHTA 5D8AC 5F5QA 2P37A 2B39A 3SITA 1PGL2 4FPCA 2BNOA 3OY8B 1HIXA 2GMPA 1J58A 1OQ1A 1FX5A 1LEDA 2ZZJA 4AFCA 1HXS1 4EWAA 3AP6A 1J3QA 2DFCA 3KM5A 5CB7A 4N43A 1DU3D 5F6LB 5C9AB 1EAH1 1QQP3 1Q5OA 3GZUC 1VAVA 2TUNA 3CJXA 3P3NA 1Y9QA 2I45A 2ZX0A 3NAPA 2GN7A 5K7PA 1JW6A 2UWCA 1VB4A 3MIFA 1SEFA 4MV2A 1H1MA 2YGLA 2ZMKA 4DQAA 3RSJA 2TNFA 3ZYRA 1AXYA 1DQ1A 2RM21 2ZAHA 1AR62 4K20A 2WA3A 4I09A 4Q29A 3PTYA 1MEC2 4N53B 1ENXA 3WW3A 1VLNA 2HEVF 2LM3A 2Q1ZB 3C2UA 3N4MA 1CAUA 1SFNA 4YM1A 2UURA 4OZXA 4OHXA 3IDCB 2JXAA 1YNAA 3AXEA 1AYM3 3AYEA 5GJ6A 3ECQA 3X29B 4FVVA 2WFF1 3CLPA 1H0BA 2NLRA 1RUNA 1WBFA 2DUOA 1X50A 4WVZA 1CQ9A 4URTA 1FPN2 2VUJA 1AUYA 2ATFA 4ASMB 1AXKA 4YM3A 3TN91 4YGDA 1NXMA 3NV3A 4ZU5A 4WM7B 3RG0A 2NM1A 2VW1A 1W6NA 1EAH2 5J37A 1QOTA 5T54A 4XQWA 4Y22A 4JCKA 4C0HA 3JBG2 1NQDA 1VBD3 4XXPA 1DGWX 4J1XA 4C91A 1ZRCA 1H2KA 4DRVA 1QF3A 3AKQA 1LGCA 1H4GA 2XG3A 2ZS6B 4XFGA 2PN5A 4K7JA 1CJDA 3BALA 2IC1A 1LCLA 2RM22 2A3XA 4AEDB 3TRSB 2W52A 4NHMA 3AKSA 3DL3A 4MXWA 3VZJA 1NA1C 4COWA 2D6OX 2IXKA 2G9FA 3EO6A 4CDWA 2DCZA 5FLHA 4CDXA 5J96B 1FNYA 4LLOA 4XF9A 3ZXGA 2Z79A 4P9JA 2Y0OA 3LOBA 1RUI2 3KB5A 5JOZA 1QWRA 4UW4A 3LWCA 2PLV1 5FMOL 3RYPA 1LODA 2BNNA 3T1MA 1RUJ3 2DVFA 4FAGA 4B8EA 1XQNA 2XPJA 4XXAA 2JG8A 5J98B 5ABJC 2KM2A 3FC0A 3TN92 2XJTA 2OZJA 3ZMOA 1DDLA 2A3WA 3ZIXA 3NKTA 4K1YA 1YI9A 4HL0A 1NCQB 1OHFA 3PMEA 4IESA 3AYDA 2R041 5K0UC 2RS11 2OVUA 1H8TA 3KMHA 3IMNA 3AP5A 3OPZA 3PVEA 4K9SA 2GH8A 1PVC2 5FBZA 5L19A 1NLSA 1R081 3LA7A 4AYUA 4XJ9A 1AL22 3T2TA 1LHUA 4AI1A 1QNWA 4YG3A 2HWB3 1YHFA 3RMYA 4QPGA 1J59A 3H50A 1VBC1 3N7MA 1LOFA 3VBSB 2LALA 5JMCA 2R32A 1VR3A 1C57A 4PLOA 2XJRA 3MLLA 1Q43A 1X7NA 2Q5TA 1I9RA 5BUVA 4NWWA 1OPOA 4CP0A 3WUDA 2A71A 4BZ4A 1ZBA1 4CTEA 5BY5A 2GSYA 3ZYPA 3WW1A 1DQ6A 4Q8LA 3NWKA 3NV1A 1LHNA 2HEWF 2XKPA 4Q27A 1OMIA 2P3KA 3WXPA 2KA3A 5HCBA 2A6YA 1U5YA 5E1RA 2VW0A 1AJKA 4J1WA 4RS5A 2B5HA 3M1HA 3H0OA 3VDDA 2WT0A 3A4UA 2BGCA 1AR63 4HKWA 3KLSA 3DUIA 3H1MA 2PAMA 1TME1 3ILFA 3O0WA 2EXJA 4MH0E 3WP6A 3B69A 5DDJ3 3ZFEB 2ES3A 3S6PA 3DKWA 1EV11 5E89A 3NKGA 1W6OA 4Z07A 1PO13 3LA3A 1VBC2 2XWBB 5H9QA 3IT8A 1OLQA 4Q0VA 5B2GB 4QHBA 2XHKA 3IDEA 5JR7B 2ZTNA 4XYXA 4COYA 3U0ZA 3CO2A 2Q4SA 4IXLA 1HXS3 1MZEA 1RJ7A 2CYFA 3WG3A 4DS0A 2D7FA 4BPZA 5KXEA 2XJVA 2PA7A 4QXKA 4GQ7A 3BTAA 4HKOA 1DZTA 3ZFFC 1EAH3 3U07A 4LO8A 2P3IA 1OA3A 4CZSA 3IWZA 3LCPA 5FPZA 4AE2A 1C5IA 1SLCA 4WBBA 1SCSA 1LKNA 5JIAA 2VUAA 2X5IC 4FO9A 4Y1YA 4YVWB 1NCRA 5H9SA 2RM23 3S0MA 1FYUA 1WW6A 1O4YA 1QGLA 1Y43B 2WIIB 3B9CA 5C4WB 4X6RB 4QQPA 4U36A 1G6NA 3POWA 3W59A 2VXRA 2HYKA 2R0FA 1QDCA 1CAVA 4HSJA 3HBZA 4JQRA 3QBQA 1N47A 1BBT3 1REFA 1W6OB 4OI4A 2ZMLA 1QJZA 1ZZ8A 2WFF3 4AG4A 2O1QA 2MHFA 1BEV2 3VBRC 5K9YA 1HRV2 3AYAA 1CD3G 1O3QA 3W58A 4KL1A 4M01A 4ZU7A 3OBRA 4Z82A 4YGCA 4S2GA 2PHWA 2R1BA 1ENQA 4QQ2A 1QHDA 1HX6A 3WR0A 2PYTA 5KXBA 2GNDA 2R071 1VRH1 1AHSA 2A6ZA 3T1LA 3VV1A 4XQDA 1AR81 2HWE1 3O0VA 4ORFA 1MZ5A 1MQTC 2XUMA 5BNNC 1UZYA 1DF0A 4JAAA 4WVVA 2WNVA 1CN1A 1UX6A 4Q4W1 4FAHA 5I0RA 2YZ4A 1V9U1 2PHRA 2ZOEB 2NP0A 1NCRB 3V0BA 2DVGA 4WM8C 2IXIA 4DY3A 1LB2A 4INDA 3QH6A 1ALYA 1RJ8A 5L7OC 1LEMA 1KDKA 3S7EA 3ZYGA 2QVSB 3TBDA 2ZMNA 5IT6A 2DUQA 4OHZA 4YZ4A 3TYJA 3USUB 2IFWA 2PLV3 1TQ5A 4X8NA 3DPRA 3JCIA 1UIJA 4HSLA 4P9YA 3WQ7A 4OUMA 1WLDA 1Q8QA 2QCSB 3GBFA 4YGEA 1BQPA 1J3RA 5DUXA 3AZZA 2R072 1UPSA 4LBMA 1VRH2 4AWDA 1NLRA 4RSUA 3VHPA 3MIGA 1SBFA 3USSA 4AI3A 3AZWA 4HVQA 3JQXA 3KCYA 3AMNA 2R043 3TNPB 2RS13 1YIPA 1W0PA 3RS6A 3WW4A 2XL9A 1W6QB 1PMIA 2GH2A 1ZREA 2WNUA 4Q4W2 1Z7S1 1G9BA 5C9AC 1R083 4XOGA 3ES4A 2QZ2A 2WNVB 4Q1PA 3KGLA 3MW2A 4HN1A 5KBFA 2CWMA 2GAUA 4RQPA 1VBC3 2GNTA 4WV8A 5GZFA 1ULFA 3TNQA 3BCWA 2EVXA 2K2SA 4ONUA 4YGBA 5J48A 4XBQA 4XF4A 2B42B 4KU8A 5DUVA 4AHZA 3ATGA 4XMIA 5IUQA 1QOOA 4OHWA 1AYN1 5BNOC 1ZBA3 2HKXA 1R1A2 2ZZQA 5I8YA 3DPRB 2ZA9A 2DU1A 1CAXA 1L3JA 4LBQA 2GMEA 3VBOB 1NOVA 2WT1A 2XJPA 1S0FA 3AMHA 1V6OA 2ZGNA 3H3ZA 3R0RA 4GWMA 2I74A 4CEYA 2VMIA 4YYOA 5CFDB 4NHKA 1N1SA 4AVTA 1UD1A 1IS4A 4DZGA 4JTNA 4FPYA 2ARXA 4LULA 4Y26A 4LBKA 3TAYA 2RJLA 4S2FA 4XTMA 3VHRA 1QJU2 2XLFA 1DHKB 4WM7C 4FOWA 1IS5A 1R1ZA 1U0AA 4YW2A 1OOPB 4P9LA 3SCFA 1TME3 4UBHA 1WGPA 4PIZA 2WS92 1DLLA 2VPVA 4MGYE 5FQ0B 3WG4A 1F9KA 2PHDA 2QFEA 1EV13 5JOYA 3N7LA 3VBHC 3M3IA 3VZKA 1OQDA 2NZ9A 4BMBA 5T55A 4A7YA 1LOBA 4AEDC 1QJX2 1K5MA 4PDWB 3VBFA 1RUF2 1WMDA 3ES1A 3MFAA 1APNA 2C1FA 1KS5A 1KDMA 3IKWA 4YVSB 3FX3A 1JYIA 4OI0A 1TNFA 3GF6A 3UJOA 1QXJA 3OD0A 1NG0A 4W6YA 1CONA 2JE9A 4UW5A 3CJIA 4JVAA 5A3MA 2LTNA 4OFGA 4FOYA 2BPA2 3RWNA 4XJ8A 2ZGOA 3NV2A 4S2DA 5TSWA 1KRIA 4RR3B 5L36A 1IOAA 3AFGA 1LULA 4N90A 3APBA 1D2QA 4FPJA 1NY72 3MPPG 4XMAA 5A33B 4FTSA 2PQQA 5KHKA 4MYEA 4HPKB 3WDXA 1RITA 1NCQC 2IXJA 3LSDA 4KU7A 5C6CA 4R4XA 4Y1ZA 5AC91 3MICA 1YJKA 1D4M2 2YXSA 1N3QA 4WVMB 4LA3A 2XVGA 5I8SA 4Y20A 3ZN6A 1ND2A 3IPVA 2IFRA 4D7TA 1R091 2DV9A 1AVBA 4AGGA 3E5XA 1COV1 2JICA 5BNNA 1YCIA 3W9AA 5KC6A 2MEV3 2UWAA 2QZ3A 1XNKA 4A7KA 5BNPA 2FBEA 3V0AB 2UYAA 4GH4B 5KXCA 3UV9A 1FAYA 3VBSC 4SLIA 4R52A 4K21A 3WHUA 1RTVA 4LR4A 2VMHA 2ZAAA 1H30A 4R9DA 4B4RA 4RL7A 2R073 3WUCA 5HI0A 1KJLA 3KQRA 4E9KA 2MNGA 5D1IA 1AR83 1YJLA 2HWE3 4E4SA 3VL9A 2P3JA 3NSTA 5J7MA 1JUIA