2YY1A

Crystal sturcture of n-terminal domain of human galectin-9 containing l-acetyllactosamine
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
141
structure length
141
Chain Sequence
QAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galectin-9
publication title Crystal sturcture of N-terminal domain of human galectin-9 containing L-acetyllactosamine
rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 35
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2yy1A00
2A3WA 2ES3A 2ARBA 4YW4A 1XQNA 4XHBA 4R9BA 1CIWA 2VU9A 3N7JA 3WVJA 2A6YA 1UAIA 2ZMKA 1CN1A 4BOWA 4BMBA 4JCKA 1Q8VA 1QMJA 1JYIA 1V6KA 2AENA 3SLIA 1H9WA 1MS5A 4DQAA 1KITA 4GALA 4BLJA 2XG3A 5DUVA 5EWSA 1MS9A 3AJYA 3QCWA 3HR9A 3UK9A 1S0GA 3LSDA 1DQ2A 1LTEA 2I2SA 2D3SA 4DRRA 4Y1XA 3WCRA 4FOQA 1GYKA 1GICA 1VLNA 4PF5A 2H0BA 4Q8KA 2ZHMA 1C1LA 1AZDA 5AVAA 4DRVA 4XBLA 1DIWA 3O12A 5BYNA 1ULEA 1O4ZA 3JUUA 2R1DA 5T5JA 1DHKB 2FMDA 1D0HA 5L73A 3FLTA 1FV2A 1DGLA 1GNHA 1PZ8A 2JKBA 2ZGRA 3TB0A 1SBEA 2AGSA 5T54A 2WSUA 4YZ1A 2ZGNA 4DS0A 4SLIA 3MW3A 1MVEA 4AWDA 3WG3A 2WQZC 2A6VA 5GZFA 1WBFA 2HYKA 1H9PA 4C1XA 1SLTA 2ZGKA 4LBQD 4AVVA 1S0IA 1UKGA 1AJOA 1RINA 1CONA 3FLPA 1KJRA 3IMNA 1WW6A 1W6QA 2KM2A 2OVUA 2ZKNA 3IN9A 5GLVA 1V6NA 4UW5A 1LEDA 2WJSA 3WDVA 1B09A 3ENRA 3RG0A 2PHXA 5KXEA 3USUA 4P14A 4Y22A 3ILFA 4XILA 3AYCA 1DFQA 3UJQA 3POWA 3WHUA 3VV1A 1WBLA 4R9AA 3AZWA 4R9DA 3WDWA 4YZ5A 3IPVA 2SLIA 3V0AA 1I3HA 1LOFC 4FPYA 3USUB 1S0FA 4Y22B 1CJPA 1OFSA 1LOGA 1GZWB 2P3JA 3OBTA 3VKFC 1DLLA 3B3QE 2GNTA 4FQZA 2FHRA 1BKZA 3IPVB 4I30A 3V0AB 1Q8SA 4GKYA 2ZGOA 2GNDA 4XZPA 4DFSA 1ULCA 3RMYA 5JLVA 2ZAAA 2EXJA 4FPKA 3IM0A 4YM2A 4FP3A 1EPWA 1G9BA 1QKQA 2GMMA 3POYA 3AYDA 1Z78A 2EIGA 4FP2A 1QOSA 5CA6A 3VKNA 4M01A 4LBKA 2W68A 1LHWA 1MS8A 2G4IA 1W6MB 4FPOB 1TEIA 2UU8A 5T5PA 1H30A 4Y24A 1W6OB 1HKDA 1N3QA 4YG6A 5JVVA 3WV6A 4AVSA 1FV3A 5E89A 4WZFA 1SACA 1GZCA 1X50A 3AP4A 3KM5A 3LCPA 1KDMA 4Y20B 3WHTA 1JXNA 4XYXA 1DYPA 1DZQA 1WW4A 3AP5A 4XJ8A 2EXIA 2NMNA 2VXRA 3ZVXA 3HMYA 2PELA 4ASMB 1LODA 5FREA 1SLAA 3NV1A 4GKXA 1DQ1A 1SBDA 5JOYA 1C4RA 1FNZA 2CNAA 5IK5A 2DWRA 3GNEA 3NV4A 3ILRA 1N1YA 1S0CA 1G9FA 2DTWA 2JDZA 2EXHA 3UJOA 1W0OA 4XJZA 4Q8LA 3ZXLA 2UURA 3O0WA 3AXDA 5JDBA 1QNYA 2P3KA 1DQ0A 5GLZA 3A0NA 3DUIA 4FOVA 1AX0A 2E7QA 1G86A 4FPHA 3PVNA 2A7AA 4UW6A 4YW2A 1J1TA 1N1SA 2DURA 2D7FA 1UN1A 2DVDA 2ZGQA 1GV9A 4D69A 3VUOA 1LEMA 1QU0A 2JE9A 3WG2A 3N7MA 3AXEA 2NYYA 4YGBA 5JMCA 3W59A 1QDOA 4YGDA 5KXBA 5DUWA 3I8TA 1O4YA 1LOBA 3BIWE 3MEPA 3OY8A 1BYHA 2GNMA 1LHVA 3DGTA 1AX1A 3H0OA 3A0KA 2AR6A 3M3EA 1SLBA 1LCLA 4Q2FA 1CESA 4XTMA 4JC1A 3PJQA 1AX2A 2EALA 1SLIA 1MS3A 3ILNA 4UW3A 3SH5A 3V0BA 3OY8B 1W0PA 2E53A 1APNA 3B9CA 2WKKA 1ONAA 2P37A 3INAA 1HQLA 5IK8A 3BODA 4DPNA 2OUJA 2D6PA 3WOGA 5FRAA 2WNEA 1YYNA 3O5SA 4YM1A 1LJ7A 4XOGA 4PCRA 5H9PA 3ZXKA 3MPPG 1WLDA 3V0BB 4XTPA 3HN1A 4FPFA 1CPNA 2EF6A 3T1LA 2UWBA 1BXHA 2A3YA 2DU1A 5SV8A 1IKQA 1SLCA 2ZA9A 4YFWA 2V5YA 2VW2A 3AZXA 2NM1A 4Z8BA 3R4SA 1LECA 4F83A 1GSLA 3FUOA 4KBBA 1LHOA 2GN3A 1IS3A 1UX6A 1MACA 4XIKA 1S0BA 2ZHNA 1MZ5A 5GZGA 3ZSJA 4M3CA 1LOAA 4U2AA 5H9SA 2R1BA 3SNMA 4YM3A 2R16A 5JOZA 5KXCA 5GLWA 2DUOA 3AYAA 3WZ1A 1SLLA 5EYYA 1AXZA 1KQRA 1MS1A 2JD4A 2UWAA 2JECA 1NXD1 2W08A 3AYEA 4YGEA 5GZCA 1CPMA 2WT1A 4M3CB 1Q8QA 1JW6A 4Y26A 3M3OA 4LBJA 3WCSA 3M3QA 3SITA 4LBMA 5DUUA 3OYWA 1S0DA 3WG4A 1F5FA 1GZWA 2D6LX 1GZ9A 1PZ9A 1WD4A 3IKWA 4M00A 1LGNA 3R4UA 3SH3A 3JU9A 1PZ7A 2RHPA 4BLIA 3APBA 2LTNA 4XBNA 2DVGA 3OPZA 2A75A 4ITCA 4K1YA 2E51A 3RMXA 1LGBA 3ZXEA 1LOFA 1KJLA 1JYCA 1MR5A 1VAVA 1MS4A 3BOPA 3FBYA 3QLQA 2DV9A 1FNYA 2NN8A 1V6MA 2GMEA 3OYWB 4FOWA 4HL0A 1G9AA 2ENRA 3WLUA 2GDFA 4LBNA 1ULGA 1G7YA 1LULA 3Q9OA 4YM0A 2A71A 3NV3A 1WLWA 4C1WA 4XMIA 4FOYA 4FQ4A 1AXKA 4GWNA 1LOEA 3WG1A 4AGVA 1I1EA 1AF9A 1W6MA 2PHWA 4Y1ZA 2OUHA 3VKMA 2D6OX 4P9XA 4ATEA 2D43A 4FVVA 1W6OA 2WSVA 4Y1UA 5T50A 1QF3A 2R0FA 1WLCA 2ZGLA 2D3RA 2D44A 2VH9A 5JOXA 1IS6A 1AXYA 2GMPA 4RA0A 1QDCA 3M1HA 4Y20A 4YZ3A 3V64A 5HCAA 2YV8A 4YW3A 5IT6A 3AZZA 1KRIA 5IUQA 2D6NA 3PMEA 3ZYPA 2CWMA 2A6WA 5HCBA 1WCSA 3FFZA 2ZGMA 2ZHLA 2AREA 5DG1A 1WUVA 2DVBA 4WVVA 1GBGA 1BJQA 1HQWA 4YW5A 3AP7A 5EYXA 5H9QA 3OGGA 1N3OA 2VUAA 3WDTA 5CAZA 1S0JA 2ZGPA 5LK5A 3U4XA 1V6LA 4WV8A 1UZZA 2A3XA 4MYEA 1Y7BA 2GNBA 3LSEA 1U0AA 5GZEA 5DZEA 1W6NA 3L2YA 1F9KA 2AUYA 4BM8A 3RQ0A 2VW1A 3R05A 1SCRA 4R9CA 2DUPA 2YY1A 2ZMLA 3N36A 2DUQA 1ENRA 1N3PA 4FPCA 1MZ6A 1QOTA 5HCFA 4YZ2A 4XJAA 2GALA 5T55A 2VY0A 4YFZA 1W6NB 2ZZJA 4LBQA 4YZ4A 4XIOA 1JN2P 3A4UA 4LBOA 5IK7A 1JOJA 1HDKA 3D6EA 4LBLA 1SCSA 4YGCA 5GLTA 2PHFA 2C9AA 3C2UA 3FUQA 2ZGSA 4K20A 3ZYRA 1VIWB 2CYFA 2DTYA 3AX4A 4XJUA 4LBQB 3ZSLA 4GA9A 1OKQA 3W58A 2CL2A 1GKBA 4XE9A 1Q56A 5CNAA 4Q1PA 4XXPA 2P2KA 4XDQA 1YRZA 1FYUA 3ZSMA 5DXDA 2R0HA 1G9DA 1ULDA 4RL7A 2VW0A 1AVBA 1N1VA 2E7TA 1V6IA 1Q8OA 5CBLA 1V6OA 1ZM1A 2DVAA 2V73A 3V65A 4Y1VA 4FPGA 4AVTA 2DVFA 1IS5A 5GM0A 5IK4A 3O0VA 1QGLA 3T2TA 4UW4A 3N35A 2W39A 3ZXJA 2P3IA 2XB6C 4ISRA 1QNWA 1SFYA 2CTVA 1DYKA 3RS6A 3D4KA 1LGCA 1SBFA 2ZHKA 1DQ4A 2UWCA 3CNAA 4L8QA 1AJKA 2GN7A 4H55A 5KXDA 4CRQA 2WLQA 1N47A 2ZGTA 3AK0A 4XJWA 3AP9A 3M2MA 1LU2A 2EXKA 1IS4A 5DZFA 4YG3A 2W52A 2ZGUA 4FPLA 4ISQA 2ARXA 3NWKA 2A5ZA 2NP0A 3UL2A 4CTEA 4YG0A 5GLUA 3WDUA 3ZPYA 2YXSA 4AYUA 2NMOA 4WVWA 1URXA 1HLCA 2ZACA 3ZXFA 3B00A 3N7LA 1MS0A 1D2SA 3ZSKA 2PHRA 4ATFA 2YMZA 3AZVA 4FPJA 2P34A 3BTAA 3B69A 3KQRA 2ZABA 4PBOA 4Q27A 3B01A 1YO8A 2ERFA 2ZMNA 1FATA 1V00A 1V6JA 1A8DA 4IQPA 2CY6A 3WDXA 1C57A 1R1ZA 1WW7A 4GXLA 1RITA 1UZYA 1VAMA 3D5OA 1YI7A 1A78A 2BQPA 3WDYA 1WW5A 3AZYA 3POSA 1YXWA 4XHXA 2WT2A 3MW2A 4FPEA 1MVQA 1LENA 2CWSA 2D6KA 2D3PA 1VALA 3WNXA 2JE7A 1IOAA 1FX5A 5DG2A 3N7KA 4ZKTB 2Q5TA 3GALA 1DBNA 5F9TA 5DUXA 1LU1A 4K1ZA 2SBAA 4W65A 1FAYA 2TEPA 4XXAA 3SH4A 1UL9A 2DU0A 4NOTA 1OQ1A 1GANA 1W6QB 2A6ZA 4PQ9A 1JBCA 2PHTA 1CR7A 3WUCA 1CVNA 4BQ1A 1LOCA 1UPSA 2A70A 2B7YA 3RRDA 3MW4A 2OW4A 1S1AA 2C5DA 5F5QA 4K21A 5DZGA 2LALA 5T5LA 2A6XA 1G9CA 2JJ6A 2D6MA 5GJ6A 1DQ5A 4YW1A 3WUDA 2YROA 1WD3A 2Z42A 1YIFA 3FLRA 4AGGA 3O0XA 2DYCA 1LESA 3N3HA 1W6PA 5T52A 4XMAA 2NZ9A 2WT0A 1GNZA 1ENSA 1NLSA 1ULFA 4AGRA 3TAYA 4XJ9A 4CZSA 3AP6A 1IKPA 4NO4A 4XBQA 2E6VA 4ZXKA 2AYHA 1DQ6A 1BZWA 1ENQA 1W6PB 4BMEA 4Q26A 4YLZA 1KDKA 1GLHA 5E88A 1JHNA 2AH2A 4GWMA 1UMZA 4HANA 5GZDA 3T1MA 5GALA 1QOOA 1F31A 5JOWA 3NV2A 4M3CE 5CB7A 1BQPA 3PVEA 1LHNA 4OZXA 2PHUA 3AJZA 1C1FA 4BPZA 1N1TA 1CQ9A 1RIRA 3M3CA 3VKOA 1S0EA 2EAKA 5E8AA 1JUIA 3VKLA 3ATGA 1G8WA 1ZA4A 3OBRA 4PBPA 4TYSA 4P9YA 3RSJA 3ASIA 3I4IA 4P9WA 4TZDA 4Y1YA 1Z0HA 5T5OA 2R49A 3AFKA 3PVOA 3OJBA 2YZ4A 5H9RA 1A3KA 1Q8PA 4M3CF 3SISA 4JRAA 5EXOA 4Q1RA 1LHUA 2ZBJA 4U36A
chains in the Genus database with same CATH superfamily
4YW4A 3ZFEA 4F8AA 4R9BA 1WZXA 2HWC2 3IIAA 1W2TA 2XHNA 2ZMKA 4NIHA 3LGRA 1VBA2 2VNGA 2ET1A 4Q0VA 5IWFA 4JCKA 3IWZA 1RHI2 3J8F1 4NROA 5FP4A 1DGWA 3ACFA 1JYIA 2AENA 2UY8A 3AMPA 3P3NA 1H9WA 1QH6A 3IB3A 4XFGA 1KITA 2VOTA 1E5IA 2JDYA 1DLCA 3NNJA 5D21A 5DUVA 5G04L 4LK7A 3QCWA 4IEVA 1HV0A 2WO1A 3DV8A 2PFWA 4GIQA 2LRPA 2Y6JA 3ZKYA 3O7OA 1OQEA 1DQ2A 2I2SA 3LSDA 3MUY1 2D3SA 3BTXA 1GICA 2B4KA 3C7HA 3IZOA 1IGOA 3OPTA 4Q8KA 5BNOA 3I7DA 4HG6B 1AL21 1XNKA 4XZUG 1DGRA 1EUUA 4XBLA 4K9SA 1DIWA 4Q4X1 1NZCA 3WINE 4IEUA 1ULEA 1VBB3 2DCKA 4JGZB 4LIUA 2OZ6A 1JOBA 1TMF2 2FMDA 2G1MA 3FLTA 1OA3A 4CUAA 1F15A 1PZ8A 2JKBA 1WMXA 2VBDA 2ZGRA 4LO5B 1UZWA 2PAKA 2XBO1 1I6XA 1WMFA 4DS0A 1XNAA 3IAPA 5ABJA 1WGPA 1A6CA 1YNAA 1W3XA 1RUI2 4DNYA 1E57A 3ZX7A 4S2GA 5K0UA 2HWB3 1J3RA 4P08A 4B1LA 1HRI3 1SFPA 4NHXA 4L97A 1KEXA 1YHFA 5FPBA 5FOJB 1VBD1 1BK0A 1WW6A 2ZKNA 5FPLA 5HV4A 3E6DA 4QT6A 2WJSA 1WCUA 3WQ0A 3ENRA 3PHMA 1XNDA 4QX1A 2VZ1A 3PU8A 4Y22A 4EE2A 2ZX3A 1GWLA 3MIFA 4R9AA 5C70A 2IFWA 4R9DA 2JG9A 4Z07A 4BWOA 3WDWA 3W5MA 3LA7A 4ORFA 3V0AA 2WFF2 4AAPA 3I2GA 1LOFC 3AM2A 3PUSA 2YC2A 3USUB 5BPXA 1S0FA 4BH9A 5C33A 3FBMA 2VNVA 3UKNA 4EN6B 2P3JA 1DLLA 1YJKA 4CEWA 4FQZA 3D3AA 1BKZA 3GJAA 2ZGOA 1X33A 2DFCA 2R30A 2D40A 3HBKA 3JD73 1ULCA 4LR4A 5K7PA 2EXJA 4ASLA 2RS52 1BBT3 1TME1 2I74A 3IM0A 4YM2A 3ZR5A 2DCJA 2IVIB 4BQYA 2IWGB 4ZONA 1QOSA 1OMIA 3B9IA 4PDWB 5C9AC 4FCAA 4NPLA 2G4IA 2HEYF 3ZDVA 1CWPA 1H30A 3SHRA 2HWF3 3H8RA 1W6OB 2ORXA 2YC4A 3KT7A 4LK6A 2HWC1 5JXHA 3S0MA 2JG8A 4QXHA 5E89A 2OIIA 2PLV3 1VBA1 2I45A 3WHTA 3SEEA 1RHI1 1S2KA 2VAUA 1JHJA 3ZPOA 1H8TA 2W1SA 4UBHA 1F2NA 3LFMA 1US2A 4N53B 3ZFGB 3VDBA 4NIAA 2K9ZA 1SLAA 3NV1A 1B35C 1ZZBA 4GKXA 1RUD2 1C4RA 4IV3A 4P5HA 4WM8A 4C91A 4I01A 3W9AA 3GNEA 2VTFA 1UZVA 4MHRA 1PK6C 1G9FA 4G4FA 4AI1A 3U4SA 4Q8LA 2J1EA 5A6ZA 2CAUA 2UURA 3AXDA 4CCDA 5JDBA 5C3PA 1C8M2 2P3KA 2Q4SA 2QQVA 3RNSA 1R082 3C7EA 1G86A 1LR5A 4X6QB 1VBE2 1ZBA3 2A7AA 5JZGA 1JTZX 1JZ7A 2ZGQA 1UKRA 1UN1A 3KWVA 2ETEA 1TMF1 3ZFFA 3ZDSA 1LEMA 2JWPA 2JE9A 1CAVA 4QPIC 2Z4FA 1RYYA 4QPYA 1J3QA 5I8SA 3W59A 5KXBA 5LA1A 2GC2A 2VL4A 5A3NA 4IV1A 3BKZA 3BIEA 1AX1A 1RUI1 4AXOA 3S6PA 1NAEA 4Q2FA 1GOGA 4XTMA 3WX5A 5AC93 4JC1A 4B1MA 1AX2A 4XFFA 4XUPA 5L7OB 2VZUA 4YWAA 3SH5A 4ES8A 2YBKA 5BNNA 4YARA 1JOPA 2E53A 5B4NA 3PNAA 4GMP3 4OHWA 1HQLA 1UWWA 1M4WA 1RUJ3 2OUJA 3BODA 2ZZQA 2VR4A 3WOGA 4PQQA 5LK7B 2QQWA 1YYNA 3O5SA 2VMEA 4YM1A 3LA2A 3MPPG 1S2EA 3Q8CA 5C8CB 1D4VB 5A3MA 3LAGA 3NNGA 2QTWB 1ND3C 4GB33 1UIKA 2HKXA 4D3WA 3S57A 5BNQA 1PO22 1W99A 2WNVA 5SV8A 3VDAA 1YUDA 2FDJA 2WFF1 2ZA9A 4HVOA 4O7XA 1QJX2 4YFWA 2ORZA 3DL3A 5FP9A 3R4SA 1CX1A 1W90A 5FYHA 3UETA 5F6LB 3FUOA 1IG0A 4RR3C 1MACA 4DXTA 4AI8A 2E32A 3KV4A 4XF3A 5FZBA 2YU2A 3NJZA 4M3CA 5GZGA 4U2AA 5FY8A 3BUCA 3MI8A 2R16A 3A21A 5KXCA 4H3WA 2DUOA 2OXBA 4CP9B 1SLLA 2QCSB 5EYYA 2RS51 4E4HA 5A7WA 1Y9GA 1WA6X 1KQRA 2FCTA 2JD4A 3T09A 2UWAA 3VBFB 2W08A 1NXD1 2W47A 3WNLA 2WZR2 3GJBA 1H4HA 1JW6A 4LBMA 2W91A 4R52A 4JHZA 1RMU2 3WNNA 1WD4A 4M00A 3LE0A 4QPGA 3AB0A 4NWVA 5FBZA 3WXPA 4G9SB 3CJIC 4BLIA 5FLHA 3TEYA 2Z69A 2DVGA 3RMXA 4JRLA 3WY6A 3OSDA 5CFCC 2D93A 4XAAA 1MPXA 1ULPA 3GXUA 4MXVA 5GLVA 5LW9A 2GP3A 3OYWB 3T2QA 5IATA 3U78A 2G9ZA 2XJQA 2YB7A 4Y5Z0 1G9AA 3RDIA 4NRQA 5IVFA 2JDPA 1F8VA 1RUG3 4OHVA 4XMIA 4FOYA 4Y5SA 2YBPA 4M0NA 4A3ZA 2PQSA 3FN9A 4AGVA 5FPXA 1I1EA 1RUD1 1Z7S2 2GSYA 1HJFA 2GU9A 2D6OX 3AFGA 5FQ0B 2D43A 1VRBA 4ATEA 3VBUA 3ALQA 3I2HA 1RUC3 2R0FA 3PUHA 2D3RA 3GCXA 4RN5A 1AXYA 3WNMA 2ARCA 3M1HA 1C8M1 3V64A 4JTOA 5IT6A 1R081 3AZZA 4KMQA 4XURA 5IUQA 3ZYPA 1HXS3 1VBC3 1VBE1 2RM23 4XVHA 1QQP3 4GULA 3U07A 2A6WA 3ZKUA 3H3UA 5F8PA 1QXRA 2ZGMA 2AREA 3H8UA 4WVVA 5A7QA 3PTRB 1BJQA 5I93A 3ZLIA 3AP7A 3ETQA 4JQTA 5H9QA 1YI9A 3WDTA 4K7JA 4UFHA 1S0JA 3MFAA 1NCRB 5FXZA 5LK5A 3U4XA 1V6LA 5JPNB 4QKDA 2VOWA 5FZLA 3CO2A 1UW8A 4ARXA 1X8EA 3LSEA 4NHMA 4KG0A 1U0AA 3LZZA 4MO3M 3M70A 5DDJ3 3ZOIA 2FDGA 1W6NA 4KGQA 3B5LB 2AUYA 2E33A 1FMD3 4QB1A 1PVC3 2ZMLA 5F32A 4D7TA 2DUQA 3K4ZA 2PQQA 4BK5A 1MZ6A 1QOTA 4HSJA 5F5AA 4B29A 5T55A 2VY0A 2XGXA 1TNRA 2XMLA 3H8OA 2OZJA 4JGYA 1O3TA 1ZZ6A 4LBQA 4YZ4A 4XIOA 1EAH2 5IK7A 1JOJA 3MIBA 5IFPA 1HIXA 1ND2B 1OOPC 1PO13 1QH7A 4LHKA 1DYOA 5GLTA 2PHFA 2QZ2A 3FUQA 4FI9A 2ZGSA 1PO21 4PT6A 2EIDA 4AF9A 3ZYRA 3WP3A 3AX4A 3GHNA 2CGPA 1QJX1 1XPWA 2QBXA 4MV2A 2VZVA 3DEMA 1GZTA 4QB2A 4YVWB 3VBRB 4XDQA 2Y6HA 1NXMA 5FV3A 3RFRA 3LEGA 5DXDA 5FZHA 2ZPXA 1G9DA 1ULDA 3SCFA 3GZTB 2HLEA 1ZZ7A 3UV9A 5JSOA 1AVBA 1CAWB 3PMSA 5J3UA 2E7TA 1V6IA 1Q8OA 5JIUA 1T6GC 2V73A 3ZMNA 4FPGA 1W8WA 5GM0A 2WZR1 1BEV3 1SPPA 4IESA 1QGLA 1WKYA 4UW4A 3VLBB 3ZFEB 1CIYA 4FTSA 3AMQA 1F4AA 4DXSA 1RMU1 4ISRA 5FZKA 2PAMA 5LWBA 2CTVA 5CYYA 1O8PA 3CF6E 3GF6A 2JX9A 4JGZC 1Y9MA 3SQOA 5KXDA 4CRQA 2WLQA 1N47A 2ZGTA 1RGSA 2RE9A 3T0AA 2BZDA 4FSJA 3M2MA 5FYTA 3ACGA 1RUF2 2J1SA 3O1TA 4YG3A 3LOIA 3K2OA 3NNMA 2DF7A 2J1RA 3KV9A 2A5ZA 3RVHA 1UOJA 2NP0A 3MICA 4CTEA 4K40A 4DMIA 4YG0A 5GLUA 4MXWA 3GZAA 1Z7S1 2RJKA 5LEKA 4WVWA 5CKQA 2ZACA 4IE7A 1GP4A 2VCMA 1MS0A 1D2SA 1TQ5A 3ZSKA 1ZRDA 2IC1A 2PHRA 1HRI2 1PGW2 3QACA 4ATFA 4D7SA 4DO0A 3KQRA 5FYCA 3B69A 4CDXB 4DUVA 4ZS3A 4FAHA 4Q27A 5C3SA 2ZMNA 2UY9A 1V6JA 1A8DA 1Y4WA 3B02A 4AZZA 2BRTA 3VN4A 1RITA 3HJRA 1DZRA 1GNYA 4H7MA 1YI7A 2VQAA 4A2UA 3IDCB 3POSA 1YXWA 3ECQA 2OQ7A 3OGRA 1OLMA 3LDRA 1W2UA 1CAUB 2CWSA 2RR13 3WNXA 4DZGA 1VALA 2JE7A 3B94A 1YJLA 1Q3EA 3GALA 4QKBA 3VBSA 3DPRB 1DBNA 4EWAA 5F9TA 3LA3A 4W65A 1FAYA 2TEPA 4BCUA 4JKKA 2VVFA 2DU0A 3LEMA 5FZDA 3VBOA 1OQ1A 1DZTA 1OF4A 4A44A 1Q43A 4D94A 5C6CA 1CVNA 5FZOA 2A70A 3MW4A 4N8MA 5HI0A 2OKXA 2HWD3 1S1AA 2C5DA 2R043 4KWJA 4D0QA 5DZGA 3KCCA 3U10A 4XCBA 2Y33A 4GH4A 4OMDA 2A6XA 2RDRA 2ZXQA 1QHDA 1EAH1 4RFT0 4CDWA 2HYXA 3C7GA 2JG9B 3WUDA 3ZYFA 4PDWC 3KHBA 1VRH2 4AGGA 3HPNA 1LESA 3N3HA 1W6PA 4E9KA 2NZ9A 2VOXA 2ZAHA 2WYFA 3FHAA 4Y4RA 2CV6A 1NLSA 2BU9A 1EYBA 4XJ9A 5A7OA 4BYYA 1ALYA 2HWF2 4BXFA 4JX0A 4AFDA 1FOD3 1MZFA 3QH6A 4BQXA 1CZSA 4ZXKA 1DQ6A 2XQXA 3U75A 2VZSA 1AHSA 4YLZA 3T3YA 1NY72 5JUVA 2AH2A 3NW4A 1UMZA 4IDZA 4N43B 5GZDA 1UZ0A 3Q8BA 1QOOA 2XOMA 5JOWA 4N53C 3ZFGC 4LKDA 4CEYB 5JXGA 4M3CE 2A1XA 3I49A 4LHNA 2NLRA 1E5SA 2IXCA 3PVEA 1LHNA 3LWCA 4OZXA 4RQPB 4UBGA 2PHUA 1IPKA 3H50A 4Q4V3 4N9IA 1HW5A 4XFHA 2VG9A 3JB8A 3T4HB 3ABZA 4KG8A 3C3VA 2VJXA 2IFRA 3OBRA 1NYWA 3FL7A 4P9YA 4AI2A 5J1XA 3ZMOA 1Z0HA 4PF1A 3FWEA 3H9AA 4XFIA 3X29B 3PVOA 2YZ4A 1JZ3A 3I54A 1A3KA 3MLJA 4M3CF 1RUF1 2VMGA 4Z2WA 4COZA 2Y0IA 5A6YA 3KV5A 4J1XA 3PUQA 1GP5A 2WDBA 4U36A 2ARBA 1XQNA 3E6BA 3LKJA 4XHBA 3ZIXA 3K3NA 3I59A 4K3UA 1CIWA 3N7JA 5FPVA 1ASJ3 2MNGA 5KC6A 4CU8A 1JZ5A 1IZ3A 1OXCA 4FFGA 1CAXA 4RS5B 4BOWA 3KT1A 4BMBA 2WAOA 5AC92 5L7OC 1GQGA 1OVSA 1QMJA 4E4SA 1F35A 1HRI1 1PGW1 4QKNA 3SLIA 2BVVA 4DQAA 3N9NA 4BLJA 5JZGB 2IXHA 3F2ZA 3LF7A 3AJYA 3UGFA 1RUJ2 4LOTA 4LUMA 5C71A 1PX3A 1KS4A 2VNOA 3HR9A 3K51A 1F4HA 3NAPB 5I0DA 4UT5A 5C8CC 5F2SA 4CXYA 4Y1XA 3EBRA 4CU7A 1JI6A 1TE1B 2H0BA 5F39A 2ZHMA 2QE3A 1C1LA 5BY5A 1O3QA 1AZDA 3CMGA 2F4LA 1SMVA 5E1RA 5F5IA 2FBEA 3H7YA 5BYNA 5C4WB 4Z92B 4BA6A 4BQ3A 2IXJA 4ZZ8A 5BNNB 1A34A 1R64A 2ILMA 2R1DA 1JYTA 2Z5WA 1BVVA 3RZHA 4HKOA 4NHYA 5LBFA 2XWJB 1DGLA 2VZTA 1UXXX 3NJYA 3TB0A 4XAEA 4LORA 2ZGNA 3E5XA 2VTXJ 5FLJA 5B4XA 5A3WA 3VZOA 4Q4W2 4D6SA 5EP9A 1AR63 2VCBA 4AWDA 1NA1B 3VBFC 4O61A 5IJRA 3WG3A 3WF4A 5GZFA 2A6VA 5KBFA 1HN1A 1WBFA 2HYKA 2ZGKA 4LBQD 1VRH1 1UF2C 1ZYBA 1S0IA 1RINA 5FZ8A 3TRSB 1CONA 2XLAA 3AMNA 3IN9A 2HWF1 1NCQB 1LEDA 3D0JA 4AHWA 1OD3A 4QWNA 2A73B 1B09A 2QQOA 3TYJA 1PX4A 2ZCWA 2FCVA 2XQRA 1BK1A 1DFQA 5A7WB 1NY71 4HN1A 3VV1A 1X82A 3AZWA 4FFIA 4IXLA 5A3LA 1RUG2 2RG4A 3ZXAC 2SLIA 2JKXA 1I3HA 1UY4A 3KZ4C 1QXPA 3ST7A 4LHSA 1QJY3 2WABA 3HT2A 1CJPA 2XJPA 4KBZA 3OBTA 4KGGA 3ZIWA 2HBTA 3B3QE 4R4XA 1EPZA 2FHRA 1RUC2 3IPVB 2MEV3 2QDNA 4I30A 4NR1A 4Q29A 5IVBA 1FPN3 4AEDA 1NUKA 3NJXA 3MV11 5EJZB 3RMYA 3TNPB 5JLVA 4FPKA 4CCEA 2Y0OA 1W9SA 3ZYGA 1G9BA 1QKQA 1HXS2 1VBC2 2RM22 4MHUA 3RYRA 3ZXEA 1QQP2 1QJU3 2K2SA 2EIGA 2C24A 3AYDA 3FZ3A 3POYA 3WF0A 2BGCA 3F95A 5F3IA 4OQ9A 2PHLA 4Q0SA 2WNUA 4OCTA 1U12A 4UYBA 4K6BA 1RVF3 5L9RA 1J58A 2Y6KA 3OGVA 5A3OA 1HKDA 3SXWA 3URFA 2C1FA 3BOWA 2FDFA 2WR9A 5JVVA 4AVSA 4RFRB 1SACA 1X50A 3AP4A 1O6UA 5CFDA 5AC91 2RDNA 3GDBA 2GH8A 3LFIA 4I0WB 1PVC2 3IAQA 5SV5A 3SCHA 4BE3A 3AP5A 1ZZCA 2JXAA 3ROUA 2E26A 4YVSA 3P5BA 5FYBA 3E5QA 4XJ8A 3TEXA 2NMNA 2VZRA 5A1LA 2PELA 3WR0A 4BHPA 4LNVA 1RUJ1 5A32B 1MQTC 3UNPA 1YFWA 2CNAA 2VNRA 5IK5A 3MV01 1ND2C 1I5PA 2DTWA 3DXTA 3ILRA 3UJOA 3WP4A 2DBNA 4AR2A 1AL0G 1W0OA 2ZX1A 4XJZA 3JXSA 2JIJA 3KB5A 3ZXLA 3O0WA 5JWPA 1YFUA 3O1VA 4XQWA 5FWJA 1XE0A 1AYM3 3DUIA 4FOVA 1OLME 4X6RB 1AX0A 4FPHA 2P6HA 3PVNA 2BOJA 2QQNA 4HSLA 4K8FA 1D4M3 5T3NA 4YW2A 1N1SA 2DURA 2RJLA 4PI2A 4YVWC 1JMUB 3VBRC 2B46X 4LMFA 3VUOA 3WG2A 2RDQA 3H1WA 3OUIA 1RB8G 3BN6A 2BNNA 4H7LA 3ACIA 3I8TA 1OH3A 5DUWA 4AQ6A 1OC1A 4Q4Y3 1LOBA 4RGAA 4D6QA 3BIWE 3OY8A 5A3TA 2OA2A 1UU4A 4Q4W1 4Y4YA 2GNMA 4MUVA 1SDDB 1U5IA 3AMHA 5BV6A 3R4DB 1UYXA 4H2AA 5KWRA 1QXJA 4CU9A 4E4DX 3PJQA 4W50A 1VE0A 2XVKA 4N7IA 5IVEA 1SLIA 1DU3D 1QWRA 1ULOA 5FO8B 1HB3A 1NZIA 4P5YA 1U5XA 3NMBA 4LA3A 3WW4A 3INAA 1U5ZA 2GAUA 5IK8A 3RI9A 1GWKA 4DUXA 3K4DA 3C7OA 2EICA 2WNEA 5H9PA 4F7ZA 4PCRA 1WLDA 3V0BB 2AEYA 1XXNA 1O8SA 3MYXA 4GQ7A 4XTPA 1AYN3 3O1RA 3BALA 2UWBA 3OUHA 5FZ3A 3T1LA 4EZ4A 3MBWA 2A3YA 2ARAA 1RUG1 4BQ5A 1V70A 3G6JB 2V5YA 2VW2A 3IMMA 4Z1VA 1SPPB 2NM1A 3K75B 1YQ8A 4P00B 3H1MA 1A8MA 2VQ0A 2W95A 4CP2A 5BNPB 3OPWA 2JDHA 3ON7A 3VDDB 1P8JA 5IVCA 2RS12 3I2DA 4ES9A 1OUXA 4XIKA 1UD1A 1S0BA 2ZHNA 1RUC1 2QZ3A 1JZ2A 1LOAA 4CDXC 3SNMA 4QX0A 3GCWA 1W28A 2B8MA 3AYAA 3H3LA 4UOJA 4QX7A 5FZCA 2RMU2 3WZ1A 1W03A 3PURA 2R072 4QX5A 3EMRA 4L9BA 4AEMA 4CDQB 1HXS1 1VBC1 2RM21 4OLLA 4UFLA 5A7PA 1KFXL 1QQP1 4B4RA 4CCMA 2WIIB 5GZCA 4FTBA 4UF0B 3POGA 4Y26A 2IXIA 2OQ6A 4FXGB 3WCSA 4YW7A 3SITA 5AFEA 3KT4A 2C0ZA 4G3YC 5DUUA 4LE4A 1S0DA 4CYDA 4I02A 1GZWA 1PZ9A 2Q1FA 2RR12 3SH3A 3E6CC 3JU9A 1GQPA 3DPRC 3APBA 5EJ1B 3AVRA 5FZGA 2O14A 2CU5A 1LOFA 2GP5A 1MR5A 1RL3A 1VAVA 4F83A 4OQ8A 2XLFA 1FNYA 1V6MA 2W46A 1AR93 1PVC1 3VZMA 2J22A 2HWE3 2XWBB 5FZ0A 2GDFA 1COV2 4LBNA 3Q9OA 1BHGA 1OD5A 2XVLA 4IGPA 3ZYJB 2D5HA 4IE6A 1AXKA 2WWSA 3Q8AA 1OPMA 2BTVC 1LOEA 3WG1A 2JB4A 3HQXA 1X9PA 2OUHA 2R042 3VKMA 3ZXDA 4PLNA 5J48A 1TVGA 4WVMA 2JG9C 2WSVA 2EA7A 5T50A 1QF3A 3VBSB 3POFA 4HFSA 2VH9A 2WAAA 3PLQA 1EV13 4Y20A 2QQKA 5C9AA 3RZGA 3ITQA 3ZN6B 5FMBA 5BXXA 4UFMA 4QB6A 3PMEA 2V4AA 2XUEA 4W4ZA 3P1IA 3VBOB 2CWMA 5CG8A 5BUVA 1WCSA 3FFZA 2W1QA 2Q1ZB 1FOD2 2ZHLA 3NVCA 5DG1A 2DVBA 1XU2A 5FZOB 4QQOA 3RPQA 5EYXA 3OGGA 3HQUA 3CKHA 2PA7A 3CBNA 4N43C 4WV8A 1UZZA 3J26N 2VQUA 4HMZA 1Y7BA 3OD0A 4QM9A 1W3VA 5EQUA 4CEYC 5A33B 1RUE2 4IEQA 5GZEA 1GWMA 4BU2A 4RQPC 1F9KA 1ZRFA 5FZFA 5FUNA 1B35A 1R093 3R05A 5ANQA 5FJHA 4R9CA 1K42A 1N3PA 3J7MA 4Q4V2 4FPCA 4YZ2A 3LIHA 1H2MA 4XJAA 1PK6A 2GALA 4D8MA 4YFZA 2Q8EA 1H1MA 2X5IB 1QIQA 3IT8A 3A4UA 4LBOA 2CHHA 4E8CA 5FMOS 4ONUA 4A42A 1WCQA 3KCYA 4LBLA 4QX8A 4BIFA 4HPKA 3C2UA 3DKQA 2F4PA 4K20A 1VIWB 2XONA 4QPIA 1YQ2A 5FXXA 2YU1A 4GA9A 4ET7A 4P9LA 4Q0PA 4Y33A 1GKBA 1OUSA 3OBAA 3ELNA 4XE9A 2RS11 4V1PA 4XXPA 1UPIA 2DCTA 3DN7A 4RS5C 3ETPA 1YQ6A 5J98B 1W06A 3I3BA 4M4PA 1WWYA 1XB9A 3JBG2 3M8LA 3EO6A 3ORJA 2R0HA 3GHMA 1PGSA 4RL7A 5JZGC 2ZEZA 4W6XA 2VW0A 5FMOL 2GC3A 3L9JT 2RMU1 4DINB 3HIFA 5CBLA 1LAJA 1ZM1A 1RUH3 1LKNA 2R071 3FHQA 3OOXA 3V65A 4Y1VA 4AVTA 3NAPC 1JYVA 4QXBA 5IK4A 2Q1MA 3BB6A 3Q8FA 1DGWX 3T2TA 3D82A 4RHV3 3MPBA 3WNPA 3I2IA 4IGQA 2BWCA 1ND3A 2RR11 3OUJA 4AAXA 2K46A 4LHLA 5FXVA 1LGCA 3ACLA 1SBFA 1W8ZA 2ZHKA 4IEPA 1DQ4A 1OA2A 1J3PA 3CNAA 4L8QA 5C4WC 2GN7A 1HRV2 3UT0A 5BNNC 1XSQA 1US3A 4XJWA 1LNSA 1LU2A 2EXKA 5AFBA 1DGRN 1COV1 5ANNA 1VP6A 1LRHA 2ZGUA 1IPJA 3HEIA 2ARXA 1Y43B 5ISLA 3O1SA 3TWIA 4Z82A 1K5JA 3WW3A 2R32A 2R041 2YXSA 1NA1C 2NMOA 2YG0A 4FFHA 2GZWA 4YSFA 1XNTA 4L99A 4WM7B 4HVQA 4QM8A 3ZXFA 1RJ7A 5J7MA 2JD9A 1UOFA 2CAVA 4Q5OA 4R4ZA 5FBJA 2Y8KA 2D98A 1WMEA 2YMZA 3AKTA 3CEWA 4TSVA 4OULA 2ZABA 1QJEA 3WDXA 3LIGA 4IQPA 3J7LA 1NCQC 4C8DA 1C57A 4J6GA 2XR4A 5JMOA 5FXWA 1NQDA 1IG3A 3J8F3 4AG4A 2VVEA 1HB1A 1VAMA 1KS5A 1FOD1 5LB6A 3SKVA 3WDYA 2ZS6B 5CFCA 4QQPA 3FJSA 4KU8A 1MVQA 4L11A 4XF4A 5FDBA 2X53S 3R6SA 2YHJA 1JU3A 2JDAA 3N7KA 3M7AA 4CP0A 3ME2A 3WQBA 1PM4A 1RUE1 1VB4A 4K1ZA 3W20A 2WWJA 3HD8B 3I97A 3SH4A 1ZX5A 4OUMA 4EYUA 5DPNA 4Q4V1 4XF0A 5F7UA 4X8PA 2PHTA 3ZN5A 1ZNPA 5A1FA 3RRDA 4E8DA 4Q4X3 2MEV2 1FPN2 3DCQA 2OW4A 5F5QA 4LKSA 5LEJA 2N7GA 2QQJA 2VULA 4IE4A 5IAVA 3LD8A 2KR2A 4QX2A 2D6MA 5GJ6A 5LA9A 4C0HA 3VD4A 1OBNA 3HQRA 2DCYA 2J1AA 1K5MB 2XBO3 2Y34A 3FLRA 5CKMA 5ERLA 2XJSA 4XFBA 1H6XA 5IVJA 3K3OA 3NL1A 5J36A 3MZHA 1ULFA 1RVF2 3VHOA 5FY7A 4TWTA 3WQ7A 1YCIA 2W1WA 5FUPA 4NO4A 4MLOA 1H2LA 2AYHA 1UYYA 4IERA 1RC6A 5FCCA 4AEDB 1ENQA 4BMEA 5FPAA 1VBD3 3JBG1 2XXZA 2VMHA 1KDKA 4EN7B 1UX7A 5C5TA 5E88A 1JHNA 3N4MA 2FQPA 3E97A 4NRMA 4XUQA 5FY4A 5DABA 5GALA 4CU6A 4EN9B 1BMV2 3NV2A 4JQRA 5APAA 1REFA 1BQPA 2WNUB 5GKAC 4COYA 5A6XA 1C8NA 1EP0A 3M3CA 3O14A 2QQLA 3RZZA 3LB9A 2P3YA 4P9JA 3CU7A 4ZZ5A 1OOPA 3AKSA 4B3NA 2D97A 1G8WA 3ATGA 5ACA2 2XVGA 1J83A 4PBPA 4TYSA 3O1PA 5LBCA 4LOSA 3WSOA 4NHLA 1RXFA 4Y1YA 3WF3A 1UNBA 2R49A 1HRV1 1PIV3 3OJBA 4UFKA 2B45X 2ZKLA 5F3EA 5H9RA 5FK7A 1OURA 3SISA 3CJXA 4CDUB 2WL1A 3POBA 5F3GA 5FYZA 4A4AA 2WLPA 3HN3A 3PU3A 4FO9A 4Q4Y2 5FYUA 4BK4A 5D2AA 4KNCA 1ZVFA 1UAIA 3U14A 4XC9A 5JI9A 3I2KA 4LO7A 3ZSEA 3SEPA 4XUOA 1V6KA 2FCUA 3H8XA 1MS5A 2HWC3 3N9LA 2XG3A 4JAAA 1OT5A 3FE5A 3OD4A 2V4VA 1UU6A 5FKCA 3UK9A 1RHI3 3UGGA 4JDOA 4XF9A 5FYVA 2W94A 4GMP0 5C3QA 2VMIA 1VBB2 4FOQA 2H6BA 2VCAA 1VLNA 5L9VA 1QJZA 2W2IA 1W05A 4AHZA 5JCTA 2FDHA 2O8OA 3CQOA 4QU2A 4IW3A 4QHOA 2AACA 4XF1A 5AVAA 4O9EA 3KVAA 3VB9A 5BNPC 4O9GA 3VDDC 1C3HA 4OI2A 2WQ8A 5A7NA 3O1UA 4QHZA 1DHKB 1G6NA 1H1IA 1Q5OA 5BNOB 5I0RA 2EIBA 3VZLA 2WA4A 3RI8A 4LT5A 2HWB2 5FY9A 4YZ1A 2WSUA 2MEV1 4MGQA 2C9KA 1UU5A 4E2SA 1FPN1 2QKDA 4O65A 2PN5A 2UYAA 3T08A 1TMF3 2Y6GA 3MW3A 4ZXEA 1MVEA 4CDQC 3FC0A 1OH4A 1K3IA 2J1TA 2VE1A 1H9PA 1SLTA 2DCZA 4V2VA 4AVVA 2DFBA 1UKGA 1AJOA 1OA4A 2LUWA 5ABJB 1RUI3 1VB2A 3FLPA 1O3SA 3IMNA 2KM2A 1W6QA 1RVF1 1AR83 1V6NA 2JENA 5K0UB 3O1MA 1ODNA 3CL1A 3IDEA 1XNCA 2Q8CA 1S55A 1C5IA 2E7AA 3RG0A 3RGBA 1O7FA 3USUA 2JDNA 4P14A 4XILA 1L7LA 4LTAA 2LS6A 1AR92 3WHUA 1WBLA 4MOAA 1YFYA 3RZLA 3MO4A 4OUEA 2BV4A 4DY3A 1QJFA 1BMV1 4GJZA 3JD72 1NG0A 4Y22B 3VBHA 1OFSA 1UY0A 1YLLA 1GZWB 1BBT2 3OB8A 3MIEA 3VKFC 4NE9A 1HQNA 2GNTA 5DAXA 3VBSC 1JZ4A 2QQPA 2WFF3 4KQ7A 3V0AB 4GKYA 1OKOA 4PDWA 4BB3A 5ACA1 5FKBA 5A3PA 4XZPA 5CZKA 4DFSA 2JDMA 1EV12 2ZAAA 1AR73 3VBOC 4QQ2A 3BTZA 4CEWB 3T30A 4A7KA 1W2NA 1Z78A 4K8RB 4COWA 1DDLA 3VKNA 4OHZA 4OI4A 1GFF2 2PLV2 3DYOA 1LHWA 2IUWA 2QFEA 1TG7A 4FPOB 1TEIA 5T5PA 5FOBB 5HBAA 2RJ2A 2Q0AA 3PIJA 4Q4Y1 3P6BA 3AMMA 2YBSA 3P3PA 3BU7A 1POV3 3HNYM 4Z2AA 3DYPA 2BPA2 1FV3A 4BJ0A 1JUHA 3ZFGA 3LCPA 5D8AA 4Y20B 1JXNA 2V72A 1R092 2BBAA 1NLRA 4IEXA 1DYPA 1WW4A 3I2FA 4XEZA 3H42B 3THTA 1CJDA 3AKRA 3I3DA 2EXIA 2JG8B 1PMHX 2VXRA 2X5IC 3HMYA 3KF5A 3TOJA 3PUAA 1LODA 2R063 1DQ1A 1L7QA 4XQ4A 5EV7A 5G05L 1FNZA 2BUKA 4NIGA 1OI6A 2WO3A 3NV4A 1XU1A 1W9WA 1ZBA2 1N1YA 1VBB1 4IEOA 1H8TB 2EXHA 4B4PA 4A41A 4HXCA 2TBVA 3NNLA 5FP7A 1T2XA 1QNYA 1RUD3 1DQ0A 2QJVA 5GLZA 4IV3B 4WM8B 3NKTA 1D0GA 2GH2A 2XKOA 2D7FA 2DVDA 3MHZA 3NKGA 1GV9A 2WZEA 4HZFA 4KU7A 2VUJA 3U37A 2P1BA 3TN93 2LROA 1CZVA 2HWB1 4YGBA 2WN2A 4NMIA 5JMCA 5JSPA 1QDOA 2J1VA 3IIIA 5F37A 5HXMA 5JXIA 1I5ZA 2YC0A 3MEPA 1HB2A 5JAXA 3ZFFB 1LHVA 3EQEA 2VVDA 3FFQA 3H0OA 1O91A 3M3EA 1SLBA 2BNMA 2OPKA 4FXKB 1CAVB 1R1A3 3U1XA 3MF9A 4NRPA 1ZRCA 1J84A 5DMYA 4UW3A 3MGUA 2WUHA 2XL7A 5FPZA 1W8OA 1EUTA 4IV1B 1W0PA 4AW7A 4MH0E 2IZWA 2WKKA 4GB32 3KD4A 4DPNA 5JSRA 1V9U3 3LOBA 5FRAA 3S30A 2VM9A 3A7QA 4LE3A 4A6OA 1LJ7A 4XOGA 3WD5A 4AOCA 2BVBA 4FPFA 4YYOA 3SCGA 5FZ9A 2EF6A 5FO7B 4MGTA 1AR91 4CCCA 1BXHA 4XDOA 2DU1A 5F6KA 4HK8A 3DF0A 5LY2A 1OLQA 4LQRA 1WMDA 3AZXA 4Z8BA 4CP9A 3JD71 1QEXA 4P9GA 1GSLA 4KBBA 4WM7C 1BBT1 1LHOA 2GN3A 1IS3A 1PO23 2RV9A 3JCIA 3VBFA 2WNVB 4AFAA 2DBIA 3OTFA 1QJX3 4YM3A 4DOUA 2MHFA 2WFPA 4QDSA 4COUA 4KH9A 1EV11 2OX0A 3RWNA 5LCWL 1AXZA 1PGL2 1MS1A 3GYDA 3UYJA 2JECA 2DDUA 3C7FA 3AYEA 4LULA 3TBDA 1CPMA 1IHMA 2WT1A 3JQWA 4M3CB 1Q8QA 2OS2A 3WW1A 3M3OA 4ZU4A 2PLV1 2H0VA 3OYWA 1F5FA 5IHRA 3T0DA 1W8NA 1GZ9A 5EHDA 2XL9A 3J4UH 1LGNA 2GC1A 4OUSA 1F5JA 4ZPIA 3VZJA 4E2GA 1PZ7A 4E4ZA 2LTNA 1PNGA 5FIXA 4ITCA 2A75A 2ATFA 4NAOA 2E51A 4J1WA 1JYCA 4LO4B 1MS4A 3BTYA 5LA2A 1XJAA 2DV9A 4HL0A 1RMU3 2NN8A 2GMEA 4FOWA 2ZEWA 2EAAA 1NQJA 1R091 2ENRA 2JDUA 3JZVA 4QPGB 5LRRA 3WLUA 1ZRIA 5J96B 1LULA 4YM0A 4C1WA 1W9FA 2VD7A 3T2OA 3IDBB 4GWNA 3LEIA 5CFCB 1BCXA 2MPFA 4GZ9A 3HAGA 1AF9A 1CD3G 4JKLA 1W6MA 3OGSA 3MFCA 1RUOA 5DQ0A 5FFOC 2ID4A 3GZUC 4QXCA 4Y1UA 1ZBA1 3THDA 2K0GA 5FZ7A 4CCLA 1K5MC 1UY3A 2LW8A 2D44A 2VECA 3G7DA 2XBO2 4W8JA 4RA0A 1GUIA 1QDCA 4YZ3A 5HCAA 1NCRC 4Q0UA 5CKNA 1SQ4A 4IEWA 3PDQA 2FMYA 1D7PM 1DCSA 3T2PA 4IGOA 3VBUB 2IXLA 4NHKA 1UYZA 2BERA 4AEDC 1WUVA 5DDJ2 5FK8A 3I2OA 1GBGA 2RS33 1FMD2 3VL8A 1FI2A 1N3OA 4B7EA 1PMJX 5HCHA 1O5LA 4LXLA 3MIHA 2J42A 3AKQA 2A3XA 4XFCA 3FX3A 5A3UA 2GNBA 2RDSA 4GMP1 4AK3A 5DZEA 3H3ZA 1ODMA 2WNUC 1GOFA 1XYNA 2XJUA 3RQ0A 4BM8A 5I0TA 2VW1A 2Q8OA 1MQTA 1PVXA 2YY1A 3N36A 2WRAA 3BCWA 1POV0 2Q8DA 1ND2A 1NE4A 1GQHA 1PO12 4GB31 1IQDC 4A45A 4XFAA 1W6NB 3GM8A 2ZZJA 4CXXA 4HLTA 2G9FA 1YEWA 3NQHA 5JXJA 1UXZA 2E63A 1HDKA 4I0BA 5JPMB 1PIV2 3ZM8A 3GBGA 5FYMA 4YVWA 1MZEA 3VBRA 2VUCA 2C9AA 5DN2A 4AI3A 2CGOA 2KD7A 4CDUC 4DIQA 2JB8A 4JGYB 5FWEA 2DTYA 5HPOA 4XJUA 4LBQB 1EAH3 1OKQA 1KD7A 3W58A 2FZ1A 1OSGA 3RJ2X 1RUNA 1CAWA 1SG3A 1Q56A 5CNAA 2H6CA 2BGOA 1OOPB 2BJSA 2P2KA 4S2FA 5J37A 1ZBE3 1K12A 1K45A 4TLGA 1YRZA 4V2WA 5FLIA 3ZSMA 4AVBA 2VMFA 2YFZA 3ZFEC 1BEV2 4MGYE 4KWLA 4YPJA 3ZYBA 5FMDA 1V6OA 4HKWA 5IVYA 2XJTA 1PGL1 3RZKA 1ZA7A 4AQ2A 4OMCA 4AQSA 3PL0A 3VD3A 2PMWB 2W39A 2VMDA 3ZXJA 4ZU5A 4I09A 3OCPA 2P3IA 2XB6C 1QNWA 1VR3A 1SFYA 2R7EB 4QD2A 5EZWA 2VUDA 1DYKA 3RS6A 5CEHA 4A7ZA 3VZNA 1OHFA 1W9YA 3PIGA 4BZ4A 2UWCA 2Y64A 1AJKA 5I8TA 1ST8A 4N9HA 3AK0A 3AP9A 4XPVA 3OEAA 5BNOC 5DZFA 1UIJA 4A6SA 2W52A 2X09A 4CUGA 5DAWA 5KHIA 4CPBA 5I8YA 1HN0A 2VOVA 3UL2A 1VPHA 4QQLA 4UFJA 4CDXA 5A70A 1NOVA 1AUYA 3QOPA 1CX4A 3ZPYA 2OPWA 4OI0A 4AYUA 1RUF3 1YC61 2ZX4A 1JZ8A 4URTA 1XRUA 3ZO0B 1H2NA 3I3QA 3VHPA 1ZZ9A 3B00A 3LPGA 4CE8A 1XSRA 3AZVA 4FPJA 3S7IA 4XUTA 5ABJC 4MXWB 1XE8A 1CAUA 4XETA 4R8HA 3B01A 3BU0A 1YO8A 3CZJA 1FATA 5IAXA 3LPFA 2CY6A 2E31A 4XW3A 1R1ZA 2GC0A 5K0UC 4AVCA 4GXLA 1AR82 3DPRA 2TNFA 4AHYA 1A78A 1WW5A 3AZYA 5DDJ1 2WS93 4UI9L 4RD7A 1FMD1 2WT2A 3MW2A 4KWKA 1LENA 1W8TA 1WA4A 3AKPA 4ZKTB 2BP6A 3T4VA 2BNOA 5DUXA 2SBAA 2VMCA 4QPWA 4LEJA 4RGGA 2HWD2 5F3CA 4FBFA 3TEWA 4C0BA 1W2OA 1YQCA 4NOTA 5FAXA 4OHYA 1GANA 1W6QB 2VOKA 1TZOA 1HJGA 1PO11 2HJIA 4JDNA 3KCXA 5KHHA 4K21A 4I3PA 4LKFA 4PHZA 3WP6A 1AR72 2P4EA 5T5LA 5F1RA 2BWAA 4CEWC 2QVSB 4AE2A 1JYNA 1PIV1 2YROA 3VD5A 4MX3A 1MEC3 2TUNA 2Z42A 5E6HA 1YIFA 1W0NA 2BDRA 3OG2A 3RYKA 1ZREA 5FJKA 4MADA 4XMAA 5T52A 2ADDA 3N9QA 3VBHB 4N7UA 5EPAA 4CDWB 4GH4B 1ENSA 4QDRA 3TAYA 4N43A 2VGDA 4COVA 1NX9A 1IKPA 3HVDA 1VRH3 4CEYA 4EZHA 5L9BA 4FTEA 3ES4A 1W6PB 4RQPA 4Q26A 3ACHA 1BEV1 2WO2A 3NSTA 4GWMA 2WNOA 4HANA 4OZOA 2QDRA 4PI0A 3T1MA 2JG8C 5I0UA 1F31A 2WQ4A 2XDVA 3WT3A 5FZ6A 1WCKA 4MSVA 3ES1A 3KGLA 1H2KA 2R062 4AVAA 1N1TA 4CCNA 1H8VA 5JR7B 1RXGA 1YWKA 1ZRRA 1H8TC 1S0EA 4Q0QA 5FZEA 3S5QA 1JUIA 2VBPA 4HETA 1KGYA 3SMHA 3FHIB 4IV3C 5D8AB 2OYZA 4WM8C 4PIXA 3ASIA 2Y26A 4TZDA 3EJKA 1XOYA 5T5OA 3KMHA 3KSCA 2CSGA 5IVVA 4MGZE 4QAWA 1NT0A 1ASJ2 5AVPA 1UYPA 5FYIA 1QY4A 4JRAA 1T6BX 3USSA 4RS5A 4DEVA 1LHUA 2Z79A 2ZJCA 3HBZA 4S2DA 3TN92 2A3WA 3MLKA 2ES3A 5E16A 3ZFFC 2VU9A 4CUCA 3H7JA 3WVJA 2A6YA 5CIRA 3THCA 2VC9A 1CN1A 2AZ5A 4P02B 5LY1A 1R1A2 3NAPA 1XNBA 1Q8VA 4S2HA 3HT1A 4IV1C 1SFNA 3M3IA 4HVRA 3I59B 4GALA 5LZ6A 1S4CA 2F6BA 2O8QA 1XE7A 5EWSA 2FD8A 1CAXB 1MS9A 5A1AA 5IYYA 1V9U2 1AR81 2VCCA 3KHCA 4QHBA 3POJA 1S0GA 3NJVA 5C4WA 1LTEA 2YGMA 4HN0A 4DRRA 3WCRA 2ZTNA 1GYKA 4QKFA 5CG9A 4PF5A 3WEZA 2CDPA 2VQTA 4RR3A 2J7MA 1JYWA 3HWJA 1X36A 5A6QA 4DRVA 2RVAA 4L2NA 1W04A 4XACA 4D7YA 4I2OA 3O12A 4H14A 3UESA 4AEKA 2VZOA 4NJ4A 3RYPA 2EIEA 1O4ZA 2HWD1 3JUUA 3VDCA 5T5JA 1IQAA 2W3JA 1NA1A 1D0HA 2HEWF 3DECA 4XQDA 2WNVC 1FV2A 3B7MA 5L73A 4BISA 1WLTA 3KF3A 1AR62 1GNHA 3N9MA 1NKGA 3OF1A 5DAPA 1SBEA 2AGSA 2B5HA 5T54A 4LJHA 4DB5A 4AEJA 1O59A 4BQ4A 3RZMA 2HH9A 2KXLA 4OI1A 4QU1A 1GOHA 4FFFA 2VZQA 4N90A 1AR71 4SLIA 4C90A 5I0SA 3PUIA 1GR3A 1L7RA 1NCQA 1VMJA 2WQZC 3CJIA 3VD7A 1O3RA 5FY5A 4C1XA 2CGNA 5K8SA 4BQ2A 4Y5TA 1X8MA 5C8WA 5CISA 4Q4W3 1M06G 3EYPA 1KJRA 3BVCA 2OVUA 2PYTA 3UGHA 2NPIA 3UKTA 2YDEA 4UW5A 4HK9A 3WDVA 3OBZA 1POV1 4CCKA 2BGPA 2PHXA 5LATA 5KXEA 4TTGA 1WCDJ 3ILFA 3AYCA 1QJY2 5LRSA 3UJQA 4QPGC 3POWA 1AL23 2B39A 2WWUA 1UO9A 3VD9A 1FXZA 2CDOA 4YZ5A 1X9TA 3IPVA 2G9GA 3DYMA 2XUMA 4FPYA 2R061 4PIZA 2BOIA 4URAA 5EIYB 1LOGA 2IVJA 3CIHA 2YUEA 4BDVB 2WZ8A 1QJU2 4J25A 1Q8SA 3THPA 2YPDA 4IETA 2X05A 2GNDA 2Y38A 3B93A 4LKEA 1PHMA 4HOOA 2I07B 3LDBA 1XC6A 3CHXA 2J1UA 2VO5A 4I0AA 4AFMA 2VXJA 2WC2A 1UOBA 4FP3A 3VBUC 1EPWA 5JR2A 4NIIA 2GMMA 1JS9A 1ASJ1 2PAEA 3HOBA 4LO6B 2Y60A 4LPLA 4AL9A 3WF1A 3AC0A 2JDKA 3E5UA 2ADEA 2W68A 2YFUA 1ACCA 1MS8A 4JKMA 4LBKA 3TN91 1W8UA 2RS32 1W6MB 1LB2A 2UU8A 3HNBM 4AFBA 2WINB 5LBBA 4Y24A 1VJ2A 3TEZA 4JDMA 1JODA 1N3QA 2VZ3A 4YG6A 3WV6A 4CPBD 4WZFA 3KM5A 1GZCA 4QGLA 4JV4A 1PMIA 1KDMA 3KV6A 5A32A 5TSWA 3VL9A 1R1A1 1J59A 4XYXA 2Y6FA 5D1IA 4Y3OA 1DZQA 1H1AA 4FT8A 2W92A 4HT1T 3ZVXA 4ASMB 5FREA 3C8XA 2XHKA 5CFDB 1JU4A 1SBDA 1V9U1 2D5FA 3NNFA 4A3XA 5JOYA 1AYM2 2DWRA 3RWKX 1D4M2 1S0CA 2JDZA 5I91A 4QMAA 4YVSB 5HXVA 4XABA 4RSUA 3J9SA 4JGYC 3IDAA 3A0NA 4LIVA 1TME3 2QQIA 2E7QA 3H1YA 1MQTB 1HB4A 4UW6A 1J1TA 2B9UA 4D69A 4GJYA 3PVBB 3JB4C 1AR61 1QU0A 1SEFA 5JIAA 3N7MA 5DAVA 1ZBE2 3AXEA 2NYYA 2C4XA 4AHXA 1D2QA 4YGDA 2AEZA 1O4YA 2ZEXA 2C6SA 1BYHA 3DGTA 3A0KA 2AR6A 1LCLA 1VBA3 3KGZA 1CESA 4UAPA 5IW0A 2FDKA 4MZUA 1H4GA 2EALA 1BVP1 3CLPA 1ENXA 1MS3A 3J7NA 4GAZA 2WBKA 1HX6A 3ILNA 3VZKA 4JGZA 4NVPA 3V0BA 1CGPA 5M0TA 3OY8B 4WZCA 1APNA 3B9CA 4LLFA 4EJRA 1AYN2 1ONAA 5C3RA 2P37A 4D6RA 5L36A 3MUZ1 2D6PA 1UQXA 2PXJA 1JZ6A 2XKPA 5B2GB 4OFGA 1H6YA 4X8NA 2XH6A 3ZXKA 5BNPA 3VDDA 3HN1A 1CPNA 1QJY1 4JZRA 4MGSA 4ZU7A 1L3JA 2HBUA 2P6CA 1OPOA 4I3GA 4EROA 1GU3A 4PLMA 1IKQA 1SLCA 2C26A 3LQCA 4CP1A 4CCJA 1LECA 1W2AX 2W1UA 1UX6A 4CDQA 4LA2A 3UKVA 4XCAA 3MIGA 1C5HA 3D0SA 2XJRA 1MZ5A 3N9PA 3ZSJA 1QJU1 2KA3A 2BFUS 4UF0A 5H9SA 2R1BA 4IEYA 5KHJA 5JOZA 4PIYA 1J1LA 5GLWA 3U0ZA 4META 3I3MA 4DEQA 4QQHA 2RS13 3ZYIB 2Q30A 3GZEA 3AVSA 4YGEA 1UMHA 4W6WA 3EHKA 5EJ3A 4LBJA 1PM7A 1E5RA 3M3QA 2WS92 3WG4A 2RMU3 5LA0A 2RS31 1GP6A 2D6LX 5LBEA 2R073 3GGLA 3IKWA 1SDWA 3R4UA 2HWE2 2RHPA 4XBNA 4EN0A 3OPZA 4K1YA 5FZ4A 1Y9QA 2BFUL 4IE5A 1LGBA 3K77A 5FYYA 4LLOA 1KJLA 3BOPA 3QLQA 4FP2A 4M01A 2LM3A 1PNFA 3FBYA 4XUNA 5FYSA 4DY5A 4E27A 5FZMA 4UFIA 3POIA 1ULGA 1G7YA 2V5DA 4B4QA 4B8EA 2A71A 3NV3A 1WLWA 2WYSA 4FQ4A 4PLOA 4AFCA 3CDZB 1JYXA 2YGLA 3ZN6A 4EV0A 2PHWA 4Y1ZA 3O1OA 1AYM1 4P9XA 4FVVA 5C3OA 1COV3 4ZHNA 1W6OA 3WP5A 2EVXA 3J7HA 1D4M1 2R6QA 2V09A 3KS7A 3CZUA 1WLCA 2ZGLA 2IXKA 4NPRA 2X10A 4PJYA 5FUIA 3V56A 1IS6A 1MEC2 3K4AA 5JOXA 2GMPA 4JTNA 3VBHC 2RS53 3S7EA 4CDWC 1OLRA 2YV8A 4GH4C 4NPMA 1VMFA 4YW3A 1KRIA 1H0BA 2D6NA 4RGKA 4WVMB 4CUBA 1W39A 3KVBA 5K4LA 5HV0A 3JQXA 2QQMA 5HCBA 5A33A 5IFTA 1OVPA 1O4TA 5J09A 4N53A 2YPJA 2ZX0A 1HQWA 4YW5A 1HV1A 1ZBE1 5C9AB 4NIDA 2VUAA 5CAZA 2ZGPA 3GBFA 2ZOEB 3LEKA 4YW6A 4CVUA 4MYEA 2B9VA 3QH7A 3WQ1A 4YRDA 4KI5M 5FZAA 4CCOA 4KL1A 2X5IA 3L2YA 4IL7A 3ZXGA 4HBNA 1SCRA 4L92A 2DUPA 4AI0A 2O1QA 1ENRA 2X29A 2W0XA 5HCFA 4MG2A 3AL6A 3R0RA 1RUE3 1AYN1 3AL5A 4P9IA 2QUOA 5D8AC 1XBFA 2P17A 1B35B 4CXWA 1NE6A 1JN2P 1UOGA 2B42B 4A7YA 4B7KA 3D6EA 3MF6A 4AI9A 4KWUA 1ZZ8A 1PK6B 1SCSA 2JEMA 4YGCA 3EXUA 4ZS2A 4DXZA 5L19A 4TXWA 1C8M3 5FO9B 1DF0A 1YIPA 2G19A 3WNOA 2CYFA 1R083 3Q8EA 5L7OA 1BLZA 3ZSLA 1TNFA 1VBE3 2L9LA 3KQ4B 2CL2A 5DAQA 4EN8B 4BQWA 5C7GA 2O0OA 1EY2A 3A23A 3FMGA 4GWJA 4IEZA 4Q1PA 4RYDA 5FTTC 4HPKB 1RUH2 1OFNA 4OVEA 2NQYA 2ZEYA 1FYUA 1REEA 4QGNA 2W9XA 4QPIB 4YNIA 3BYWA 1OQDA 5C8CA 2ET7A 4LO8A 5F5CA 5FPUA 1N1VA 4RHV2 5FMCA 3TNQA 2DVAA 3W5NA 1NLQA 2FZ2A 2DVFA 3JBG3 1IS5A 4OHXA 3O0VA 2WN3A 5C5UA 2VTXA 4M0HA 3N35A 3HNMA 3K48A 2WO7A 1JH5A 1U5YA 2WS91 4GWIA 2XLGA 3ZYHA 3QBQA 3BPZA 2JE8A 1CZTA 2HWE1 3PJYA 3SKJE 3D4KA 3A22A 3D8CA 4IUGA 3IBMA 4ARYA 1VAKA 4H55A 5CADA 1S2BA 2JIGA 3KLSA 4ASKA 4L0PA 1IS4A 3MDPA 5EFUA 4QX3A 1ND3B 4NN0A 4WM7A 4FPLA 4ISQA 3NWKA 1KXGA 2F17A 3E1F1 1HRV3 2VBBA 1KFUL 4E2QA 4FAGA 3WDUA 4WVZA 4CSWA 3OGJA 3RZJA 2VPVA 1Y3TA 2PHDA 1UY1A 2ZX2A 3S5AA 1URXA 1HLCA 4RR3B 2XPJA 4LUKA 1UMIA 2WZPP 3N7LA 1YQ5A 3J8F2 4MGIE 1MEC1 5FZ1A 2P34A 3BTAA 5K9YA 2W5FA 4PBOA 4CA9A 4OYUA 1IPSA 2ERFA 3VGIA 5CA6A 1V00A 1SHWB 4W6YA 4IE0A 3WW2A 4F3JA 1WW7A 3WNKA 1FT9A 2WZR3 1UZYA 4QDQA 3D5OA 4UXAA 3RJRA 2BQPA 3POEA 4DUWA 4BIOA 4XHXA 2W87A 4FPEA 3VHNA 4HONA 5FQ0A 2D3PA 2D6KA 3NO8A 1AL22 1IOAA 1FX5A 4MGKE 5DG2A 3U11A 3N9OA 3QD6A 2Q5TA 3CJIB 4QXKA 1RTVA 4NAMA 4HKLA 2WA3A 1LU1A 4Q4X2 2BW8A 3DXUA 4XXAA 4TLFA 2BEOA 4MVTA 1UL9A 4NWWA 3ZR6A 1XYOA 2A6ZA 4JVAA 4PQ9A 1JBCA 4BQ1A 1CR7A 4WBBA 4GD4A 1GMMA 3WUCA 1LOCA 1UPSA 1K5MA 2B7YA 4QGMA 5CU1A 5FY0A 4EWDA 3BPSA 5KC5A 3ZN4A 2FDIA 4JHTA 1Z7S3 4EWEA 2JICA 2LALA 1NCRA 2QQUA 3PTYA 1G9CA 3SC7X 2JJ6A 1YFXA 3LDKA 1POQA 5FZIA 1DQ5A 4YW1A 4NUBA 4AQTA 1WD3A 3K46A 2QNKA 4BXSV 3O0XA 2DYCA 2BBVA 2AC1A 3WF2A 5FP3A 2WT0A 1DP0A 1VBD2 5A7SA 2PTMA 1GNZA 3NRUA 4AGRA 1STMA 2E9QA 4LITA 2XJVA 2BYVE 4CZSA 1UCXA 1REDA 3AP6A 4ZY9A 3M4FA 3MIDA 4XBQA 2E6VA 1BZWA 1RUH1 2Z2SB 3W21A 3GBWA 1OF3A 1W8HA 4UWDA 1GLHA 2VZPA 1X7NA 2YYOA 4RHV1 4XDPA 2X8KA 4M4RA 5CB7A 5CFDC 5KR7A 4SBVA 1DG6A 2P5BA 5JI7A 3T0BA 5KHKA 1UY2A 1C1FA 3AJZA 4BPZA 1CQ9A 1RIRA 2OT7A 3I3EA 2Y6LA 3VKOA 3BGAA 2EAKA 5E8AA 4YVSC 1C28A 5KHGA 4TN7A 3VKLA 2UYBA 1VMHA 5FP8A 3MLLA 1ZA4A 3DKWA 5FY1A 3RSJA 4CDUA 3I4IA 4P9WA 3EB7A 5A80A 1TME2 1E5HA 5FR3A 3L2HA 1SZBA 1RJ8A 1V0AA 2HEVF 3AFKA 3BI3A 1XYPA 1O5UA 4EQVA 1I9RA 5CVRA 1Q8PA 5ACA3 1W8FA 5F2WA 4DXRA 5EXOA 3OEBA 3I2JA 4Q1RA 4INDA 5LASA 1W9TA 2ZBJA 3VHRA
chains in the Genus database with same CATH topology
4YW4A 3ZFEA 4F8AA 4R9BA 2HWC2 3IIAA 2ZMKA 3LGRA 1VBA2 2VNGA 2ET1A 4Q0VA 4JCKA 3IWZA 1RHI2 3J8F1 1JYIA 1DGWA 2AENA 2UY8A 3AMPA 3P3NA 1H9WA 1QH6A 4XFGA 1KITA 5DUVA 3QCWA 4IEVA 1HV0A 3DV8A 2PFWA 4GIQA 3O7OA 1OQEA 1DQ2A 2I2SA 3LSDA 2D3SA 1GICA 1IGOA 4Q8KA 5BNOA 3I7DA 1AL21 1XNKA 1DGRA 4XBLA 4K9SA 1DIWA 4Q4X1 1NZCA 3WINE 4IEUA 1ULEA 1VBB3 2DCKA 4JGZB 2OZ6A 1TMF2 2FMDA 3FLTA 1OA3A 1PZ8A 2JKBA 2ZGRA 4LO5B 2PAKA 2XBO1 1I6XA 1WMFA 4DS0A 5ABJA 1WGPA 1A6CA 1YNAA 4DNYA 1RUI2 1E57A 3ZX7A 4S2GA 5K0UA 2HWB3 1J3RA 1HRI3 4L97A 1YHFA 5FOJB 1VBD1 1WW6A 2ZKNA 3E6DA 4QT6A 2WJSA 3WQ0A 3ENRA 3PHMA 1XNDA 4Y22A 2ZX3A 3MIFA 4R9AA 2IFWA 4R9DA 2JG9A 4Z07A 4BWOA 3WDWA 3LA7A 4ORFA 3V0AA 2WFF2 1LOFC 3AM2A 3USUB 5BPXA 1S0FA 4BH9A 5C33A 3FBMA 3UKNA 4EN6B 2P3JA 1DLLA 1YJKA 4CEWA 4FQZA 1BKZA 2ZGOA 1X33A 2DFCA 2R30A 2D40A 3JD73 4LR4A 1ULCA 5K7PA 2EXJA 4ASLA 2RS52 1BBT3 1TME1 2I74A 3IM0A 4YM2A 2DCJA 2IWGB 1QOSA 1OMIA 3B9IA 4PDWB 5C9AC 4FCAA 2G4IA 2HEYF 1H30A 3SHRA 2HWF3 1W6OB 3KT7A 2HWC1 3S0MA 2JG8A 5E89A 2OIIA 2PLV3 1VBA1 2I45A 3WHTA 1RHI1 1S2KA 1H8TA 4UBHA 1F2NA 4N53B 3ZFGB 2K9ZA 1SLAA 3NV1A 1B35C 1ZZBA 4GKXA 1RUD2 1C4RA 4IV3A 4P5HA 4WM8A 4C91A 4I01A 3W9AA 3GNEA 1PK6C 1G9FA 4G4FA 4AI1A 4Q8LA 2CAUA 2UURA 3AXDA 5JDBA 1C8M2 2P3KA 2Q4SA 3RNSA 1R082 1G86A 1LR5A 4X6QB 1VBE2 1ZBA3 2A7AA 5JZGA 1JTZX 2ZGQA 1UKRA 1UN1A 3ZFFA 2ETEA 1TMF1 3ZDSA 1LEMA 2JE9A 1CAVA 4QPIC 4QPYA 1J3QA 5I8SA 3W59A 5KXBA 2GC2A 4IV1A 1AX1A 1RUI1 4AXOA 3S6PA 4Q2FA 4XTMA 3WX5A 5AC93 4JC1A 1AX2A 4XFFA 5L7OB 3SH5A 4ES8A 5BNNA 4YARA 2E53A 3PNAA 4GMP3 4OHWA 1HQLA 1M4WA 1RUJ3 2OUJA 3BODA 2ZZQA 3WOGA 5LK7B 1YYNA 3O5SA 4YM1A 3LA2A 3MPPG 5C8CB 1D4VB 5A3MA 3LAGA 4GB33 1ND3C 1UIKA 2HKXA 4D3WA 5BNQA 1PO22 2WNVA 5SV8A 1YUDA 2ZA9A 2WFF1 4HVOA 4YFWA 1QJX2 3DL3A 3R4SA 5F6LB 3FUOA 4RR3C 1MACA 4AI8A 5GZGA 4XF3A 3NJZA 4M3CA 4U2AA 3MI8A 2R16A 5KXCA 4H3WA 2DUOA 1SLLA 2QCSB 5EYYA 2RS51 1KQRA 2JD4A 2UWAA 3VBFB 2W08A 1NXD1 2WZR2 1H4HA 1JW6A 4LBMA 4R52A 1RMU2 1WD4A 4M00A 4QPGA 5FBZA 3AB0A 4NWVA 3WXPA 4G9SB 3CJIC 4BLIA 5FLHA 2Z69A 2DVGA 3RMXA 4JRLA 3WY6A 5CFCC 2D93A 4MXVA 5GLVA 1G9AA 3OYWB 2XJQA 1F8VA 4Y5Z0 3RDIA 1RUG3 4OHVA 4XMIA 4FOYA 4M0NA 4AGVA 5FPXA 1I1EA 1RUD1 1Z7S2 2GSYA 2GU9A 2D6OX 3AFGA 5FQ0B 2D43A 4ATEA 3VBUA 3ALQA 1RUC3 2R0FA 2D3RA 1AXYA 3M1HA 1C8M1 3V64A 4JTOA 5IT6A 1R081 3AZZA 5IUQA 3ZYPA 1HXS3 1VBC3 1VBE1 2RM23 1QQP3 4GULA 3U07A 2A6WA 3H3UA 1QXRA 2ZGMA 2AREA 3H8UA 4WVVA 1BJQA 5I93A 3AP7A 3ETQA 5H9QA 1YI9A 3WDTA 4K7JA 1S0JA 3MFAA 1NCRB 5LK5A 3U4XA 1V6LA 5JPNB 2VOWA 3CO2A 1UW8A 1X8EA 3LSEA 4NHMA 4KG0A 1U0AA 3LZZA 3M70A 5DDJ3 1W6NA 4KGQA 3B5LB 2AUYA 1FMD3 1PVC3 2ZMLA 4D7TA 2DUQA 2PQQA 1MZ6A 1QOTA 4HSJA 4B29A 5T55A 2VY0A 2XGXA 1TNRA 2OZJA 4JGYA 1O3TA 1ZZ6A 4LBQA 4YZ4A 4XIOA 1EAH2 5IK7A 1JOJA 3MIBA 1HIXA 1ND2B 1OOPC 1PO13 1QH7A 4LHKA 5GLTA 2PHFA 2QZ2A 3FUQA 2ZGSA 1PO21 4AF9A 3ZYRA 3WP3A 3AX4A 3GHNA 2CGPA 1QJX1 4MV2A 4YVWB 3VBRB 4XDQA 1NXMA 5DXDA 2ZPXA 1G9DA 1ULDA 3SCFA 3GZTB 1ZZ7A 3UV9A 5JSOA 1AVBA 1CAWB 3PMSA 5J3UA 2E7TA 1V6IA 1Q8OA 5JIUA 1T6GC 2V73A 3ZMNA 4FPGA 5GM0A 2WZR1 1BEV3 4IESA 1QGLA 4UW4A 3VLBB 3ZFEB 4FTSA 3AMQA 1RMU1 4ISRA 2PAMA 2CTVA 3CF6E 3GF6A 2JX9A 4JGZC 5KXDA 4CRQA 2WLQA 1N47A 2ZGTA 1RGSA 2RE9A 4FSJA 3M2MA 1RUF2 4YG3A 3LOIA 2DF7A 2A5ZA 2NP0A 3MICA 4CTEA 4K40A 4DMIA 4YG0A 5GLUA 4MXWA 3GZAA 1Z7S1 2RJKA 5LEKA 4WVWA 2ZACA 1MS0A 1D2SA 1TQ5A 3ZSKA 1ZRDA 2IC1A 2PHRA 1HRI2 1PGW2 3QACA 4ATFA 4D7SA 3KQRA 4CDXB 3B69A 4FAHA 4Q27A 2ZMNA 2UY9A 1V6JA 1A8DA 3B02A 3VN4A 1RITA 1DZRA 4H7MA 1YI7A 2VQAA 4A2UA 3IDCB 3POSA 1YXWA 3ECQA 1W2UA 1CAUB 2CWSA 2RR13 3WNXA 4DZGA 1VALA 2JE7A 3B94A 1YJLA 1Q3EA 3GALA 3VBSA 4EWAA 3DPRB 1DBNA 5F9TA 3LA3A 4W65A 1FAYA 2TEPA 4BCUA 2VVFA 2DU0A 3VBOA 1OQ1A 1DZTA 1Q43A 4D94A 5C6CA 1CVNA 2A70A 3MW4A 5HI0A 2HWD3 1S1AA 2C5DA 2R043 4KWJA 5DZGA 3KCCA 3U10A 4RFT0 4GH4A 4CDWA 2A6XA 1QHDA 1EAH1 2JG9B 3WUDA 4PDWC 1VRH2 4AGGA 1LESA 3N3HA 1W6PA 4E9KA 2NZ9A 2VOXA 2ZAHA 2CV6A 1NLSA 1EYBA 4XJ9A 4BYYA 1ALYA 2HWF2 4AFDA 1FOD3 1MZFA 3QH6A 4ZXKA 1DQ6A 1AHSA 4YLZA 1NY72 2AH2A 3NW4A 1UMZA 4N43B 5GZDA 1QOOA 5JOWA 4N53C 3ZFGC 4CEYB 4M3CE 4LHNA 2NLRA 2IXCA 3PVEA 1LHNA 3LWCA 4OZXA 4RQPB 4UBGA 2PHUA 1IPKA 3H50A 4Q4V3 4N9IA 1HW5A 4XFHA 2VG9A 3JB8A 4KG8A 3C3VA 2IFRA 3OBRA 1NYWA 4P9YA 4AI2A 3ZMOA 1Z0HA 3FWEA 3H9AA 4XFIA 3X29B 3PVOA 2YZ4A 3I54A 1A3KA 3MLJA 4M3CF 1RUF1 2VMGA 4Z2WA 4COZA 2Y0IA 4J1XA 4U36A 2ARBA 1XQNA 3E6BA 3LKJA 4XHBA 3ZIXA 4K3UA 3I59A 1CIWA 3N7JA 1ASJ3 2MNGA 5KC6A 1IZ3A 1CAXA 4RS5B 4BOWA 3KT1A 4BMBA 5AC92 5L7OC 1GQGA 1QMJA 4E4SA 1HRI1 1PGW1 3SLIA 2BVVA 4DQAA 4BLJA 5JZGB 2IXHA 3AJYA 1RUJ2 4LUMA 1KS4A 2VNOA 3HR9A 3K51A 3NAPB 5C8CC 4Y1XA 3EBRA 1TE1B 2H0BA 2ZHMA 2QE3A 1C1LA 5BY5A 1O3QA 1AZDA 1SMVA 5E1RA 2FBEA 3H7YA 5BYNA 5C4WB 4Z92B 4BA6A 2IXJA 5BNNB 2R1DA 2ILMA 2Z5WA 1BVVA 4HKOA 2XWJB 1DGLA 3TB0A 2ZGNA 3E5XA 5FLJA 3VZOA 4Q4W2 1AR63 4AWDA 1NA1B 3VBFC 3WG3A 5KBFA 5GZFA 2A6VA 1WBFA 2HYKA 2ZGKA 4LBQD 1VRH1 1UF2C 1ZYBA 1S0IA 1RINA 3TRSB 1CONA 2XLAA 3AMNA 3IN9A 2HWF1 1NCQB 1LEDA 3D0JA 4AHWA 2A73B 1B09A 3TYJA 2ZCWA 1BK1A 1DFQA 1NY71 4HN1A 3VV1A 1X82A 3AZWA 4IXLA 5A3LA 1RUG2 3ZXAC 2SLIA 1I3HA 3KZ4C 1QXPA 3ST7A 1QJY3 3HT2A 1CJPA 2XJPA 3OBTA 4KGGA 3ZIWA 3B3QE 4R4XA 1EPZA 2FHRA 1RUC2 3IPVB 2MEV3 2QDNA 4I30A 4NR1A 4Q29A 1FPN3 4AEDA 3RMYA 3TNPB 5JLVA 4FPKA 2Y0OA 3ZYGA 1G9BA 1QKQA 1HXS2 1VBC2 2RM22 3RYRA 1QQP2 1QJU3 2K2SA 2EIGA 3AYDA 3POYA 3FZ3A 2BGCA 2PHLA 4Q0SA 2WNUA 1U12A 4K6BA 1RVF3 1J58A 1HKDA 3SXWA 3URFA 2C1FA 3BOWA 4AVSA 5JVVA 1SACA 1X50A 3AP4A 5CFDA 5AC91 4I0WB 2GH8A 1PVC2 5SV5A 3SCHA 4BE3A 3AP5A 1ZZCA 2JXAA 3ROUA 4YVSA 3E5QA 4XJ8A 2NMNA 2PELA 3WR0A 4BHPA 4LNVA 1RUJ1 5A32B 1MQTC 1YFWA 2CNAA 2VNRA 5IK5A 1ND2C 3ILRA 2DTWA 3UJOA 3WP4A 1AL0G 1W0OA 2ZX1A 4XJZA 3ZXLA 3KB5A 3O0WA 5JWPA 1YFUA 4XQWA 3DUIA 1AYM3 4FOVA 4X6RB 1AX0A 4FPHA 3PVNA 4K8FA 4HSLA 5T3NA 1D4M3 4YW2A 1N1SA 2DURA 2RJLA 4YVWC 3VBRC 2B46X 3VUOA 3WG2A 3H1WA 1RB8G 2BNNA 4H7LA 5DUWA 3I8TA 4AQ6A 4RGAA 4Q4Y3 1LOBA 3BIWE 3OY8A 2OA2A 1UU4A 4Q4W1 4Y4YA 2GNMA 4MUVA 3AMHA 1U5IA 5BV6A 3R4DB 5KWRA 1QXJA 4E4DX 3PJQA 2XVKA 4N7IA 1SLIA 1DU3D 1QWRA 5FO8B 1U5XA 4LA3A 3WW4A 3INAA 1U5ZA 2GAUA 5IK8A 3RI9A 2WNEA 5H9PA 4F7ZA 4PCRA 1WLDA 3V0BB 4XTPA 1XXNA 3MYXA 4GQ7A 1AYN3 3BALA 2UWBA 3T1LA 2A3YA 1RUG1 1V70A 3G6JB 2V5YA 2VW2A 4Z1VA 2NM1A 3H1MA 1A8MA 2VQ0A 4CP2A 5BNPB 3VDDB 2RS12 3I2DA 4ES9A 4XIKA 1UD1A 1S0BA 2ZHNA 1RUC1 2QZ3A 1LOAA 4CDXC 3SNMA 2B8MA 3AYAA 3WZ1A 2RMU2 2R072 4QX5A 4AEMA 4L9BA 4CDQB 1HXS1 1VBC1 2RM21 4OLLA 4B4RA 1KFXL 1QQP1 5GZCA 2WIIB 4FTBA 4Y26A 2IXIA 4FXGB 3WCSA 5AFEA 3SITA 3KT4A 2C0ZA 4G3YC 5DUUA 4LE4A 1S0DA 4CYDA 4I02A 1GZWA 1PZ9A 2RR12 3SH3A 3E6CC 3JU9A 3DPRC 3APBA 1LOFA 1MR5A 1RL3A 1VAVA 4F83A 2XLFA 1FNYA 1V6MA 1AR93 1PVC1 3VZMA 2XWBB 2HWE3 2GDFA 1COV2 4LBNA 3Q9OA 1OD5A 2XVLA 3ZYJB 2D5HA 1AXKA 2WWSA 1OPMA 2BTVC 1LOEA 3WG1A 3HQXA 2R042 2OUHA 3ZXDA 3VKMA 4PLNA 5J48A 4WVMA 2JG9C 2WSVA 2EA7A 5T50A 1QF3A 3VBSB 4HFSA 2VH9A 3PLQA 1EV13 4Y20A 5C9AA 3ZN6B 3PMEA 3VBOB 2CWMA 5CG8A 5BUVA 1WCSA 3FFZA 2Q1ZB 1FOD2 2ZHLA 3NVCA 5DG1A 2DVBA 1XU2A 4QQOA 3RPQA 5EYXA 3OGGA 2PA7A 4N43C 4WV8A 1UZZA 3J26N 4HMZA 1Y7BA 3OD0A 4QM9A 4CEYC 5A33B 1RUE2 4IEQA 5GZEA 4RQPC 1F9KA 1ZRFA 1B35A 1R093 3R05A 4R9CA 1N3PA 4Q4V2 4FPCA 4YZ2A 1H2MA 4XJAA 1PK6A 2GALA 4YFZA 1H1MA 2X5IB 3IT8A 3A4UA 4LBOA 5FMOS 4ONUA 3KCYA 4LBLA 4BIFA 4HPKA 3C2UA 2F4PA 4K20A 1VIWB 4QPIA 4GA9A 4P9LA 4Q0PA 1GKBA 4XE9A 3ELNA 2RS11 4V1PA 4XXPA 1UPIA 2DCTA 3DN7A 4RS5C 5J98B 3JBG2 3M8LA 3EO6A 2R0HA 3GHMA 1PGSA 4RL7A 5JZGC 4W6XA 5FMOL 2VW0A 2GC3A 3L9JT 2RMU1 4DINB 3HIFA 5CBLA 1ZM1A 1RUH3 1LKNA 2R071 3V65A 4Y1VA 4AVTA 3NAPC 5IK4A 2Q1MA 3BB6A 1DGWX 3T2TA 3D82A 4RHV3 3MPBA 2BWCA 1ND3A 2RR11 4LHLA 1LGCA