2YY1A

Crystal sturcture of n-terminal domain of human galectin-9 containing l-acetyllactosamine
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
141
structure length
141
Chain Sequence
QAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Galectin-9
publication title Crystal sturcture of N-terminal domain of human galectin-9 containing L-acetyllactosamine
rcsb
source organism Homo sapiens
total genus 35
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2yy1A00
1RIRA 2CY6A 4FOVA 5HCBA 1SLAA 2XB6C 3WDUA 4DRVA 3TB0A 3WOGA 1ULGA 2UWBA 5H9SA 3VKNA 3NV4A 1NXD1 1LTEA 2ZMKA 2A7AA 2GNBA 3ZVXA 2AYHA 4Y1XA 4XBNA 3AK0A 4RL7A 2CNAA 3WZ1A 5JOWA 1LOFC 1UL9A 1U0AA 2P2KA 1UKGA 2P37A 4DPNA 4SLIA 2GMMA 5FREA 3V0BB 1SLTA 2WQZC 5T5OA 3POSA 1HKDA 5IK7A 5DUUA 3N7JA 4XXAA 3B9CA 1GICA 1V6KA 2ARBA 5IK8A 3NV3A 3N35A 1Q8QA 2DVGA 4KBBA 4BLJA 5CAZA 4FQ4A 1GZ9A 2VXRA 1WW7A 1AJKA 3MEPA 4XBLA 2DUQA 4YLZA 3WDYA 3PVOA 1YO8A 1Y7BA 3UL2A 4FPJA 4P9XA 3IM0A 3AZYA 4P14A 1JYCA 2CWSA 1S0BA 1CONA 1VIWB 2D6KA 4XYXA 1KDMA 3ENRA 4FPLA 1FATA 4Y26A 1YRZA 3MW3A 4JC1A 4XOGA 4YZ1A 1F9KA 3RG0A 1SBDA 1PZ8A 3IPVA 1LHVA 1VLNA 1DHKB 1DQ6A 1AX2A 4UW5A 1LOGA 2GMPA 2VUAA 4HANA 4YW5A 1ULFA 2JE9A 5E8AA 1QDCA 2EIGA 2R49A 1DBNA 2ZMLA 3AYDA 1XQNA 2AGSA 2VU9A 4YZ5A 1LU2A 4R9CA 3M3EA 2ZGMA 4FOWA 4W65A 4BQ1A 2CYFA 2ZGNA 5JLVA 3WCRA 1MACA 4CRQA 1LGCA 3A0KA 1KDKA 1LULA 1OKQA 2YXSA 4IQPA 5CNAA 2WKKA 3KQRA 2ZA9A 1H9PA 1HLCA 4UW4A 1APNA 4XJUA 1LHNA 5IK4A 1W6QA 3RS6A 1LECA 3B3QE 3LCPA 2KM2A 4M3CF 2D3SA 2EXKA 4PF5A 3A4UA 4K20A 1QKQA 1MS1A 3WG1A 5IUQA 4YFZA 3WDXA 3FUQA 4FPFA 5T5PA 3FLRA 3I4IA 3MPPG 4XHXA 4Y20B 1GBGA 1SLCA 3T1LA 3ZSJA 1N1YA 1MS0A 4AGVA 4XTPA 5IT6A 3ZSLA 4M3CE 5EYYA 1V6IA 3W59A 1V6MA 1IS6A 1SACA 2A3WA 3ZPYA 1W0PA 2A6WA 1D0HA 2WNEA 1I3HA 2DVAA 3L2YA 2RHPA 1ULEA 2ES3A 4BMEA 3ILRA 1YI7A 3ATGA 1LEDA 1SLIA 2D3PA 5T55A 3B00A 3R05A 4PBPA 1A8DA 1O4YA 4AGRA 3N3HA 1Q8OA 4NO4A 4ATEA 3B69A 2OUHA 1V6LA 2ZGTA 1S0DA 1HDKA 1RITA 1V6JA 3OY8B 3QCWA 3WNXA 3N7KA 4FPHA 5GZFA 1CN1A 1CQ9A 1WBFA 2NP0A 4AGGA 1IOAA 2GN7A 4GALA 3SH5A 2ZHKA 4WVWA 2PHUA 1GNZA 3GNEA 3Q9OA 1RINA 1G8WA 3O12A 5DG2A 4XHBA 4WV8A 1QNYA 1X50A 3SH3A 5GLWA 2I2SA 1KJLA 3SNMA 1QOSA 1LENA 4FOQA 1IKQA 3SISA 1AXZA 3ZXEA 1ENQA 3A0NA 1C1FA 4LBQA 3HR9A 4U2AA 1DZQA 2PHFA 4YW1A 2DYCA 2ZGUA 1W6PA 2WSUA 3D6EA 1CESA 4XJ8A 2D6PA 4YW3A 2OUJA 5DZFA 2NMOA 1DQ0A 5FRAA 4PQ9A 5DUWA 3D4KA 5T5JA 3SLIA 5JOZA 1YYNA 1WUVA 1W6MB 4MYEA 5F5QA 3R4SA 3WG3A 4K21A 2EXIA 2CTVA 1WLDA 5CA6A 3KM5A 1DQ5A 1LOEA 4GWNA 1KJRA 3WDTA 3ZXKA 2A5ZA 1QF3A 5H9QA 1G9AA 3ILNA 2EF6A 1GKBA 4YFWA 4BLIA 1S0IA 3PMEA 3V0BA 2ZZJA 1MZ5A 4L8QA 3USUB 1ONAA 1AX0A 2DTYA 3JUUA 1Z0HA 3D5OA 4YM2A 5KXDA 4YGCA 2YZ4A 4DRRA 2PHXA 2ZGPA 1LOCA 1BXHA 1AJOA 1GLHA 2AR6A 3WLUA 3AFKA 5JVVA 1ZA4A 4RA0A 3LSDA 5F9TA 2E6VA 3POWA 5JOYA 1D2SA 1LOBA 4BPZA 1DQ4A 1QMJA 4DS0A 1LESA 5E88A 4OZXA 4XXPA 4YZ2A 4PBOA 5CB7A 1GV9A 5T52A 2P3IA 1LJ7A 1QDOA 3VKLA 3AYCA 4XBQA 1B09A 2W52A 5SV8A 4H55A 4ATFA 1WCSA 3O0VA 3QLQA 3IMNA 2R16A 4Z8BA 2DVDA 1N3OA 5GLVA 1LCLA 3T1MA 5LK5A 1MR5A 2UWCA 3AYEA 4LBKA 1IS4A 1WD4A 2D6OX 1SCRA 3AZVA 1CIWA 1EPWA 1IS3A 4XJAA 1AF9A 2D6MA 1MZ6A 4UW6A 2E7QA 2XG3A 3RMYA 1IKPA 1GSLA 4M3CA 4XIKA 3DUIA 2A71A 1F5FA 4YM3A 1N3QA 2UURA 3VV1A 4ISQA 1VAVA 2JJ6A 1MS3A 4Y1VA 1UZYA 1V6OA 1WW5A 3AJYA 3VKFC 2WLQA 1W0OA 2ZGKA 1JOJA 1G9BA 2ZMNA 4BMBA 4LBOA 4FPGA 2ZABA 5DG1A 1AXYA 2JKBA 3H0OA 2DURA 1DYKA 1W6OA 2GDFA 4WVVA 2YROA 3CNAA 1G9FA 1SCSA 2D3RA 1S0FA 1DGLA 4I30A 1PZ7A 3ZYPA 2GNDA 2AH2A 2ERFA 4UW3A 3U4XA 3AYAA 3FFZA 2H0BA 4Q26A 4ZKTB 3GALA 1KQRA 1W6NB 2EAKA 2R1BA 2WJSA 1BYHA 3AXEA 1O4ZA 1VAMA 2NYYA 5GZEA 4ASMB 4BOWA 1W6QB 1ZM1A 4Y1YA 3O0WA 1Q56A 1A78A 3AP9A 4Y1ZA 3O5SA 4LBMA 1GYKA 4R9AA 2FHRA 4JCKA 1LU1A 4FP2A 1QOTA 4LBJA 1JYIA 3WDWA 1FV2A 3N7LA 4LBLA 3OJBA 3FLPA 1GZWA 3R4UA 2ZAAA 4FQZA 3OYWA 3PVNA 3FLTA 1JXNA 1Z78A 4TYSA 1G9DA 2LTNA 2JD4A 3PJQA 2YV8A 4GWMA 2A6XA 4PCRA 3AP6A 2ZHNA 1AX1A 3AX4A 1NLSA 1H30A 2G4IA 1N3PA 5H9RA 2OVUA 2VH9A 1ULDA 4YZ4A 1AXKA 1KRIA 1S0CA 1N1VA 3AXDA 3NV1A 2ZGRA 3OBTA 5GALA 2DTWA 3TAYA 4Y22B 5JDBA 4XMAA 4YGEA 3V0AA 1MVEA 2V73A 2ZACA 1H9WA 2VW1A 4R9BA 5GZCA 1DYPA 4YG6A 2A75A 1UN1A 3FUOA 2VY0A 4GKYA 2ZGSA 3VKMA 4XE9A 2WT1A 2GNTA 2R1DA 3APBA 5HCFA 1N1SA 1URXA 4NOTA 4ZXKA 4Y1UA 4AVTA 2D43A 2WT0A 2GNMA 1DQ2A 5H9PA 1CVNA 1TEIA 5DXDA 1IS5A 1WW4A 3OBRA 2R0FA 5GM0A 3ZXFA 4FPKA 4Q27A 5GLUA 2PHWA 1LGBA 3VUOA 2DWRA 2P3KA 5T54A 3T2TA 4FPYA 3ZSMA 4XILA 1C4RA 2W39A 1QU0A 5E89A 4LBQB 2ZHLA 1JUIA 1FYUA 1S0GA 2TEPA 3RSJA 1DFQA 4JRAA 5GJ6A 1LHOA 2P34A 4P9YA 4YGDA 1Q8SA 1W6PB 1LHUA 3ILFA 3NV2A 3WHUA 2A3YA 1CPMA 3PVEA 1G9CA 1CJPA 1R1ZA 1CR7A 3NWKA 4K1YA 3USUA 2D7FA 5IK5A 2ZHMA 2PHRA 2W68A 1WLCA 2E51A 2UU8A 3BTAA 2D6LX 1OQ1A 4ITCA 1LEMA 5KXEA 5T5LA 2PELA 3BIWE 3WUCA 3IN9A 2DVBA 5EYXA 1S0JA 1FX5A 4YW4A 2NMNA 1BJQA 2JE7A 2NN8A 2V5YA 5CBLA 1N47A 3O0XA 2W08A 2GN3A 2PHTA 2ARXA 2OW4A 3AZXA 2ENRA 4YM1A 2DU0A 2R0HA 1S0EA 3JU9A 4Q8KA 1SBFA 3N7MA 2A3XA 4AWDA 1YXWA 2EALA 4BM8A 1SLBA 4TZDA 1WLWA 4YW2A 4LBQD 3WG2A 3ZXLA 1LODA 2VW0A 3SITA 3AP5A 1GZCA 1GNHA 4FPCA 4Y24A 3WG4A 5JOXA 2CL2A 1CPNA 1G7YA 3ZYRA 1HQWA 3DGTA 3AP4A 2C9AA 3AZZA 3N36A 4D69A 3BOPA 4YG0A 1SBEA 2EXJA 4XJ9A 3RRDA 1FV3A 4Q8LA 2GMEA 3AJZA 1FNZA 3HN1A 3IPVB 3M3CA 2CWMA 3WHTA 4ISRA 1C1LA 4M00A 1QGLA 1LOFA 1ULCA 3WV6A 3OPZA 4XDQA 1MS9A 4DFSA 1MVQA 3M1HA 2JECA 4FPOB 3V65A 1GANA 5HCAA 1FNYA 4GKXA 1KITA 3C2UA 1WW6A 2A6VA 4DQAA 1VALA 4LBNA 3W58A 4M3CB 3UK9A 4AYUA 5GLZA 3WUDA 1FAYA 3BODA 2YY1A 1I1EA 3OGGA 1AVBA 2WSVA 2E53A 1WD3A 2AUYA 4Y20A 1WBLA 4YM0A 1QOOA 5KXCA 1AZDA 1MS4A 2NM1A 3IKWA 4YZ3A 1MS8A 1W6NA 3M3OA 1C57A 2DV9A 3INAA 2ZGQA 3M3QA 1W6OB 4P9WA 1HQLA 2A6YA 1Q8VA 5GZDA 5GZGA 4YGBA 4CTEA 2VW2A 5DZGA 1QNWA 4FOYA 1UAIA 3WDVA 1UZZA 1SFYA 2DUPA 2E7TA 2EXHA 4M01A 3ZXJA 1N1TA 1PZ9A 1OFSA 2NZ9A 4Q2FA 3V64A 2AREA 1SLLA 1V00A 1F31A 1JN2P 2HYKA 2UWAA 4XJWA 4XTMA 4WZFA 5AVAA 3ZSKA 4HL0A 3WVJA 1A3KA 2Z42A 5DUXA 1BZWA 1LGNA 3B01A 3MW4A 4YG3A 3SH4A 5GLTA 4FVVA 4GA9A 3UJQA 4FPEA 3LSEA 3OY8A 2SBAA 2DU1A 5T50A 5DZEA 2C5DA 4CZSA 1BQPA 4U36A 2A70A 3ASIA 2JDZA 3FBYA 4R9DA 3I8TA 2DUOA 1GZWB 2BQPA 4GXLA 4Y22A 2YMZA 5BYNA 3OYWB 2P3JA 4XIOA 5EWSA 1LOAA 4F83A 1YIFA 1G86A 1UPSA 2Q5TA 4XMIA 2LALA 1J1TA 2WT2A 4XZPA 1UX6A 1DIWA 4C1WA 2ZGLA 3RMXA 3RQ0A 3AZWA 3V0AB 3M2MA 3AP7A 2ZGOA 1JW6A 1MS5A 1DLLA 3VKOA 4C1XA 4AVVA 1LHWA 1ENRA 1DQ1A 4Q1RA 2A6ZA 3UJOA 5L73A 2ZBJA 4Q1PA 1W6MA 2ZKNA 4FP3A 1JHNA 5DUVA 3WCSA 1BKZA 3HMYA 1V6NA 2AENA 4K1ZA 2D44A 3POYA 5EXOA 5JMCA 1Q8PA 2B7YA 5KXBA 1UMZA 1ENSA 3MW2A 4XJZA 1JBCA 2SLIA 1S1AA 2DVFA 4AVSA 2GALA 2FMDA 2D6NA
chains in the Genus database with same CATH superfamily
5FZEA 1MQTA 3ZIXA 4M4RA 4CCDA 5A3MA 5IVVA 3VB9A 5HCBA 2VZ1A 2W2IA 1HRV3 3PVBB 3WOGA 1PGW2 4GZ9A 1QWRA 1OH3A 1AR93 2MEV1 3NV4A 2XBO1 2YC0A 2A7AA 4LA3A 3ZVXA 1H4GA 1IG3A 4I09A 4KGGA 1D7PM 4MUVA 5CVRA 2Q8DA 1LOFC 1UL9A 3ZXAC 4A41A 2QQJA 2WBKA 2RS11 1EPZA 4QDQA 4SLIA 2GMMA 4V2WA 3V0BB 3MICA 4I0AA 1GOHA 1VBB1 1YJKA 2XL9A 2XJPA 3I97A 4OHWA 1HKDA 4CDWA 5IYYA 2IXJA 3U75A 2Y6GA 2RS53 1OHFA 5CU1A 3P5BA 1H4HA 5A7WB 4EN7B 3WNMA 1ULPA 4BLJA 3C3VA 4Q0QA 2BBVA 4XBLA 1NCQB 5JI7A 5BNQA 4NHMA 3PVOA 1IHMA 4CP0A 3UL2A 3VBFB 3WP3A 3TEZA 2HWB2 3HBZA 3LFIA 1R1A3 2CSGA 4P14A 2FQPA 4COVA 3TWIA 1PIV2 4KI5M 4NAOA 1TG7A 2X29A 4L9BA 2JENA 5E6HA 5FP8A 5C8CC 2ZCWA 1KDMA 4DEQA 1QJX1 4CCMA 4B4PA 1F9KA 1H8TA 3W20A 5F2WA 3LEGA 4BQXA 4QGLA 2BV4A 4JKKA 2IWGB 4IEUA 1LHVA 1NOVA 3OUJA 2VCAA 2PAMA 3SCFA 2ETEA 5JR2A 2EIGA 2R49A 2RR11 4RHV3 4L11A 4WM8C 3WT3A 2AZ5A 5FTTC 1XQNA 1WCKA 5K0UA 2FCUA 4COWA 4YZ5A 1LU2A 5CG8A 1NXMA 1W0NA 4OUEA 2ZGNA 5JZGA 5JLVA 1H2KA 1MACA 3CLPA 4PJYA 4XQDA 5L7OC 3A0KA 3TN91 1KDKA 1ZNPA 4GAZA 3UKNA 1OKQA 1IZ3A 2OPKA 5FY1A 3T0BA 4BQYA 2VMCA 2WKKA 2Z4FA 4OCTA 3ZKUA 3I2IA 2LRPA 3VBUC 1PGW1 3KQRA 1HLCA 4XFAA 3BGAA 4QX1A 4XJUA 4G9SB 1W8OA 5IAVA 2HWF3 1ZZ7A 3B3QE 3IMMA 2EA7A 3LCPA 1OD3A 2KM2A 3TEXA 4FBFA 2EXKA 3OD0A 4LMFA 1SZBA 1C8NA 4XZUG 3MPPG 1JMUB 3UETA 3T1LA 3A21A 2XVGA 3ZIWA 1MS0A 2XONA 5L9RA 2GC0A 4CDQB 5FBJA 3NJZA 2WAAA 4UAPA 1SACA 4Q29A 5FZ8A 2HWB1 1D0HA 2G9FA 3AM2A 1ODMA 2DVAA 4RGGA 4XUOA 4YW7A 3VZNA 3GZAA 4JGZB 1PIV1 4BMEA 1YI7A 1RXGA 3E97A 1GWLA 5FZ9A 5IJRA 2D3PA 4CU9A 3BU0A 3B00A 1F8VA 4Q5OA 4I2OA 1Q8OA 1YFWA 3B69A 5LCWL 3ZKYA 2OUHA 1PX4A 5I93A 1HDKA 2Y6LA 5F2SA 1RITA 3QCWA 1PM4A 3WNXA 3KT4A 4FPHA 2F17A 1TMF3 4QQ2A 1W06A 4UYBA 3LQCA 2GN7A 2E26A 3SH5A 2E32A 1NCRB 3GNEA 1RINA 4TSVA 5DG2A 5AC93 2WA3A 4NHKA 4D7YA 1W8TA 2PHDA 4QKDA 3BB6A 3ACHA 3C7EA 1WGPA 3DF0A 3GZEA 3VZOA 1QOSA 1SPPB 2XJUA 2Q8EA 1BLZA 3JBG2 1Q43A 1ZRFA 5F1RA 1OLME 2WO2A 4QPWA 1YQ8A 1YUDA 2PHFA 2ZGUA 4YVSC 2WSUA 5CFDC 1GP5A 4IGPA 2ADEA 3ZM8A 5DZFA 3T2QA 5CG9A 5FRAA 3U07A 1YYNA 1WUVA 4LQRA 4QXKA 5C70A 3O7OA 5F5QA 3WG3A 4AE2A 1GQPA 2CTVA 2WLPA 3MDPA 3ZR5A 1YWKA 2QNKA 1DQ5A 3AVSA 4GWNA 1J3QA 2A5ZA 3MBWA 1FMD2 1JYWA 1W2TA 1D4M3 2EF6A 2TUNA 3WQ7A 3LDBA 1GKBA 1QJFA 4JKMA 4BLIA 3VL8A 3JXSA 3SQOA 1X9PA 3D5OA 5KXDA 3E1F1 3MF9A 1UOBA 3VBHC 4LO6B 5KHHA 1UQXA 4DRRA 1OOPC 2W95A 3QH6A 4GMP1 3PTRB 3T0DA 4BQWA 4QHBA 3WLUA 5JVVA 3VBSC 4RA0A 2QDRA 3CQOA 1RUI2 4MGIE 4MX3A 1YCIA 4AFDA 5IHRA 3POWA 4AQ6A 2RJKA 3VD3A 5C9AC 2C9KA 4AQTA 1DQ4A 1PK6C 3Q8CA 4HPKA 4QDSA 5E88A 4OZXA 4YZ2A 1K5MA 1SFNA 2R30A 4RS5B 1X7NA 2YC4A 4BIOA 2W1QA 1XJAA 2YBPA 1CZSA 4H14A 2W52A 3VBOA 4BXSV 5FZGA 1WCSA 1D2QA 5D8AB 2W5FA 3QLQA 1JU3A 3IMNA 3VDAA 2Q4SA 2DVDA 1N3OA 2RM23 3KF3A 5FP3A 3PNAA 2BEOA 4IEWA 3AYEA 1X36A 4RGAA 4FCAA 5J7MA 3JBG1 2D6OX 5BNOC 1SCRA 3AZVA 1O3QA 1EPWA 1IS3A 2X5IB 1CGPA 2JDPA 2ZJCA 3RMYA 4IE7A 4RR3A 4M3CA 3DUIA 1UZ0A 4IGOA 2A71A 5FZLA 3IDCB 4UFJA 3VV1A 3HWJA 2JJ6A 5CFCC 1UZYA 2P3YA 5KBFA 2WLQA 2ZGKA 5LK7B 3GXUA 2O8QA 3NVCA 5FYHA 2ZMNA 1BK0A 3MIBA 1UW8A 3VHOA 5CKMA 2IXHA 1AXYA 5JIUA 2XKOA 3H0OA 4QU1A 2VE1A 2VZQA 4OI2A 2JWPA 2GDFA 1FMD1 4QQOA 4WVVA 4Y5Z0 5F3EA 1SCSA 1DLCA 2DCTA 2J1AA 2ZS6B 1S0FA 2O8OA 4QQHA 1ND3A 3W21A 5EHDA 3GZTB 3ZYPA 2LW8A 1RHI2 5APAA 3PUAA 2AH2A 2ERFA 2QQLA 2VCBA 1QJY3 2BERA 4A6OA 3U4XA 2K2SA 3GALA 2R1BA 4COYA 1O4ZA 2VR4A 2NYYA 2V4VA 2VUJA 2BYVE 2VECA 3V56A 4INDA 4CDUB 1Q56A 1RUI1 4Z2AA 5FYSA 4CCCA 1A6CA 1GYKA 1D0GA 1XBFA 4JCKA 4Q4Y3 3SHRA 2RG4A 4C0BA 5FZAA 4MGQA 3U10A 3JD73 4FP2A 2IXCA 4XF0A 2IZWA 5FXVA 3OJBA 2B4KA 1O7FA 3LPFA 1GZWA 5L36A 2FDFA 2ZAAA 3ST7A 4FQZA 4CEYB 4JQTA 4NIDA 4TYSA 1G9DA 1ALYA 4IE4A 2JDMA 2YV8A 1CWPA 1SG3A 3KQ4B 2VULA 2XXZA 1EUUA 5H9RA 2JG9B 5FPAA 1ULDA 1AXKA 1PO12 1YQ2A 2BJSA 3AXDA 1N1VA 4MGZE 3NV1A 4X8PA 4CXXA 2DTWA 5FR3A 2X09A 3WQ0A 1CJDA 1WA6X 5FY8A 2XGXA 2HEVF 4YSFA 1VB2A 4GKYA 4LHSA 3VKMA 1PHMA 3BYWA 4IXLA 4NJ4A 3I3EA 4EE2A 2KD7A 2VJXA 1DQ2A 4DXZA 3ZYIB 5J3UA 3HQXA 3HNMA 5KC6A 3OBRA 2R0FA 3POGA 4IEXA 2VZTA 2YFUA 3ABZA 4O61A 3ZYHA 3W5MA 1ZREA 3RWNA 3QH7A 1RHI1 3VUOA 1F4AA 4JX0A 2JDNA 5T54A 4NIHA 4AR2A 4XILA 3O1VA 1QU0A 2R7EB 2ZHLA 1FYUA 2YG0A 4KG0A 2XH6A 2J1VA 4JRAA 2P34A 4P9YA 4S2GA 3HVDA 4XVHA 3NV2A 2A1XA 1CPMA 2B39A 2DBNA 1R1ZA 3KD4A 1YQ6A 3BALA 3WF3A 4I0BA 1CR7A 2K0GA 2ORXA 4K1YA 3O1MA 3H8XA 5DABA 1IG0A 3GJAA 3POJA 2PHRA 4QWNA 4A7YA 2RDNA 1OQ1A 1LEMA 3KCXA 1NCQA 4GQ7A 2BGOA 3K2OA 4JKLA 2PELA 2VNRA 4N7UA 4QQLA 4P9LA 4N90A 4QX7A 4JAAA 3WUCA 4CDXA 3K46A 3OUIA 3IN9A 4OUMA 5FYYA 1FX5A 1QQP2 5KHIA 1UMHA 1V9U3 3O14A 5EFUA 2NN8A 3T4VA 5CBLA 3O0XA 1REEA 4F8AA 1PO11 5KWRA 2ARXA 2ENRA 4Q8KA 2R0HA 5HCHA 3PUQA 2Y60A 3E6BA 4BIFA 4AVCA 5JIAA 4AXOA 2FDJA 4BM8A 1LAJA 1SLBA 1QXJA 1VMJA 3VZJA 1H1AA 1QHDA 5SV5A 3SITA 3VDCA 5FCCA 5C8WA 1GZCA 5FP4A 4R52A 4D0QA 1BEV2 3ZDVA 2CL2A 1CPNA 4NWVA 3VHNA 4PIXA 1DF0A 1OKOA 4LIVA 3AP4A 2C9AA 4D69A 2BVVA 2VOKA 3B5LB 4P5YA 4QXBA 4QXCA 1ND2B 5FK8A 5HPOA 2WZPP 4LHKA 3AJZA 3HN1A 4PLMA 3SMHA 3J7LA 4ISRA 1C1LA 3NJXA 1QGLA 2QCSB 1ULCA 3EBRA 4KBZA 4OMCA 5J1XA 1TNRA 1P8JA 1XNKA 4DFSA 4FPOB 5KR7A 4RSUA 3AVRA 5K0UB 1FNYA 4Y3OA 1XNDA 4CUAA 3VL9A 1WW6A 4BISA 2R072 2PLV2 1UD1A 4ZZ5A 1JUHA 1VALA 1JZ6A 1OQEA 4AQ2A 3GZUC 4CPBD 4AYUA 5ACA2 3JB4C 4AEMA 2YY1A 2A73B 1W8UA 5FV3A 5C6CA 1VBA2 2C24A 3A22A 4H3WA 5FLJA 2V5DA 3I54A 4J6GA 1NCRC 2R042 1QJZA 2HLEA 3M3OA 2VO5A 5AFEA 2DV9A 1PNFA 4CDQA 1RUF3 2PQQA 1W6OB 2ZGQA 3C7HA 4K40A 1PO23 3DYMA 1O6UA 2VVFA 4YGBA 3NAPB 4YARA 5DZGA 4B8EA 3KV6A 3WDVA 3K48A 1CAVB 1W9YA 1SFYA 2DUPA 3K75B 1QQP1 4AFMA 5C4WC 4AW7A 4QT6A 4CXYA 1NLRA 4V1PA 1UX7A 3PU8A 4KU7A 4I3PA 1Z7S2 2R061 4XJWA 4XTMA 2XKPA 4HL0A 3GJBA 2DCJA 1NQJA 2PQSA 3RYPA 2RS33 3WNKA 1BZWA 1EYBA 2VQUA 3MW4A 4YG3A 2V72A 4GIQA 1HXS3 2SBAA 5T50A 3A23A 2XHNA 5DZEA 3VN4A 4R4ZA 2VXJA 1BEV1 4N53C 2YB7A 1JZ7A 2BGCA 3WF1A 1ZRRA 5LA2A 5DDJ2 3POBA 1J1LA 2XLGA 5L19A 3MZHA 3J8F3 1H2MA 1PMHX 2BWAA 5FFOC 1XXNA 2DUOA 5LWBA 3SXWA 1BBT2 1PX3A 2RDSA 3B7MA 3OYWB 4KGQA 1J58A 2J1UA 2X05A 1VP6A 4D7SA 2Q30A 4JVAA 2BGPA 1YIFA 3CO2A 4JTOA 5ABJA 3WX5A 2LALA 4JRLA 1EAH2 1Q5OA 4BH9A 2JDYA 2DFCA 1S4CA 1W9FA 1DIWA 4C90A 1XU1A 1YFUA 2P17A 4DOUA 3RQ0A 2R071 2PLV1 1R64A 1ST8A 5I0DA 4HONA 4YVWA 5FYTA 3AMQA 4CCKA 5ACA1 1MS5A 4JDOA 1M4WA 3V0AB 4AVVA 2PN5A 1DQ1A 2QTWB 2WC2A 2VUCA 2JDUA 5L73A 1VBA1 2ZBJA 2VOTA 3HQRA 1NZIA 2CU5A 1WCQA 2DCZA 4FP3A 1UYPA 2R041 2WN2A 3LEMA 3MIGA 4LHNA 3MUY1 2WZR3 4HK9A 4OMDA 5EPAA 1V6NA 2AENA 2DBIA 4K1ZA 1OMIA 1CAWB 3NSTA 3POYA 2B7YA 1UMZA 3KV5A 4XJZA 2GALA 2FMDA 2D6NA 1HB2A 2ZAHA 2VMGA 2XVKA 3TNPB 3WDUA 4DRVA 3TB0A 1ULGA 2X5IC 3H42B 1NXD1 1Z7S1 2WABA 2ZMKA 4W8JA 3ZYGA 4DUVA 2GNBA 3I2HA 4Y1XA 4XBNA 4RL7A 1MEC2 4BXFA 3BN6A 5F6KA 2OA2A 3H8RA 1OF3A 1Y4WA 1U0AA 5EQUA 1UKGA 1X33A 4DPNA 3NJYA 1VRBA 2WQZC 5T5OA 3ZFEA 5IK7A 3VDDA 3N7JA 1V6KA 1RUE3 4RS5A 2ATFA 5DDJ1 1VBE2 4L97A 3GHMA 3I59A 1BBT1 3MEPA 1UPIA 4S2DA 5FYMA 5D8AA 3WDYA 2GAUA 1Y7BA 4X8NA 4DMIA 3IM0A 1PVC2 4HPKB 3AMNA 2OXBA 1EAH1 1EY2A 3DYOA 4JV4A 1UWWA 4A7KA 4B29A 1VIWB 5LASA 3HNBM 1ASJ2 1RUJ3 4XYXA 3I7DA 2Z5WA 3MW3A 2VZVA 4W6YA 4NIIA 4JC1A 1WA4A 4B7EA 3S0MA 2GH8A 3CJIB 5LBEA 1CX1A 4TLGA 4UFMA 2LM3A 4B4QA 2F6BA 1L7RA 1VLNA 1DHKB 1DQ6A 1ZBA3 2GP3A 1LOGA 2W92A 3FHIB 4HVRA 4YW5A 3QD6A 5E8AA 2BFUS 1QDCA 4K8FA 1DBNA 2RVAA 5FZBA 3AYDA 3HN3A 2VM9A 3RJ2X 1CAXA 1DZTA 4W65A 4AHWA 2Y6KA 2CYFA 4NR1A 3CZJA 1RUG2 2XHKA 4MGTA 3LEIA 4PF1A 4CRQA 2BPA2 5CNAA 4IQPA 5LRRA 2JG9C 5A7PA 2VG9A 2WNUC 4UW4A 1GNYA 2JEMA 2ZZQA 1LHNA 3AKSA 1T6BX 5F5CA 1MEC1 3H7YA 4XQ4A 3T2PA 1GZTA 4YNIA 4CDUA 4AEDB 4XCAA 4PF5A 1H1MA 2QJVA 2QVSB 3W9AA 4GH4B 1MS1A 1DDLA 3WG1A 5IUQA 4HZFA 4FPFA 2QFEA 5FWEA 3VBRA 2CGOA 3N9NA 5BNPC 1GBGA 3Q8AA 1N1YA 1NY72 1SHWB 1VBE1 1W8WA 4AGVA 5FO9B 1OA2A 4XTPA 3RPQA 4LLOA 4NVPA 4CEYA 4M3CE 5A6QA 5IT6A 1W28A 4IV1B 2J1EA 5EYYA 5IATA 2BU9A 1V6IA 1F5JA 1IS6A 1UZWA 2WNOA 1RUNA 2JG8B 1ZBE2 4CP2A 1FPN2 2WNEA 3ELNA 5FPUA 1US2A 1PVC1 3L2YA 1AR73 3ZXDA 4AFBA 1NAEA 5A1FA 1LEDA 4N9IA 1SLIA 1ASJ1 1DGRN 4QPGC 4QU2A 1SFPA 4PBPA 2BP6A 2OT7A 1VPHA 3N3HA 4NO4A 3EO6A 5CIRA 1MQTC 4N43B 1RUD2 4OUSA 3DV8A 1ZZ8A 1RUC2 1U12A 5J37A 3U11A 2WS92 1TE1B 1VMFA 1CN1A 1WBFA 2PMWB 5CFDA 4ONUA 1VRH3 1UU4A 1IOAA 4AGGA 2ZHKA 4WVWA 1GNZA 1UIKA 3Q9OA 4LORA 3BTXA 1HRV2 2BTVC 1XYOA 2AACA 5F37A 3DPRB 4WV8A 2XJTA 4UFHA 1RUG1 4AAXA 2BDRA 5GLWA 4CYDA 2R063 4AOCA 5J36A 3AMMA 1BHGA 1GWKA 1HW5A 4CDWC 1KJLA 4AEJA 5LEKA 3SNMA 3OCPA 1O8PA 4F3JA 3S57A 1LENA 2WZEA 4EWDA 4JHZA 3DCQA 1GUIA 1ENQA 1C1FA 2G19A 3HR9A 4U2AA 4ASLA 2RS52 1DZQA 3FE5A 4LITA 4YW1A 1JZ8A 3D6EA 5IVEA 4A6SA 2XJSA 1H1IA 1CAUA 2OPWA 3I2JA 5BNNA 4WBBA 1ZX5A 2D6PA 4YW3A 1GP4A 2NMOA 2LS6A 3WNPA 1EP0A 3M3IA 1W6MB 4M4PA 2JKXA 4MGYE 5BPXA 3RI8A 5AFBA 1WLDA 1NY71 4XEZA 4RQPA 3KM5A 5CA6A 1D4VB 1H8TC 1KJRA 4Q0VA 3NNLA 4XAAA 4MGKE 1QF3A 1POV1 2VZUA 4LJHA 4XC9A 3OD4A 2P1BA 1G9AA 4AZZA 5BUVA 4GJYA 5JPMB 1WMEA 1ZBE1 1FPN1 1S0IA 3PMEA 2ZZJA 1TZOA 1KS5A 1POQA 1WCUA 2OZ6A 3IBMA 4OHXA 3H7JA 4YM2A 4YGCA 2YZ4A 1HJGA 1LOCA 2ZGPA 1V70A 5JZGC 2WO1A 2L9LA 2Y64A 3ZFGB 3AFKA 2WWSA 3BUCA 1ZA4A 1U5XA 1RUD1 4CDXB 3BVCA 3GCWA 5FY4A 4FT8A 1RUC1 1UU6A 4IETA 2WS91 3BPZA 1D2SA 1UY1A 1S55A 4S2FA 4YPJA 3OG2A 1LESA 1W9TA 2LROA 5LA9A 1GV9A 5T52A 3VKLA 1S2KA 3LWCA 1SDDB 1HRV1 1ND2A 1O5UA 1B09A 5IVBA 4ATFA 1PMJX 2HKXA 1F35A 5FP7A 2HWF2 2R16A 4Z8BA 5GLVA 3AC0A 2QQMA 2B8MA 2UWCA 2PXJA 5EIYB 1IS4A 1WD4A 3LA7A 3RYRA 4Q0PA 1RUH2 5FZOB 4LK7A 4UW6A 3E5XA 3ZO0B 2E7QA 2RS51 1JZ2A 3OB8A 1XOYA 5JSOA 1GSLA 1AHSA 2Y38A 2HWE2 1N3QA 1JHJA 2ZXQA 4L2NA 5C3RA 1C8M3 4K7JA 5F3CA 1MS3A 1V6OA 3VKFC 2E33A 1E5IA 5C3QA 1XB9A 1W0OA 5IVJA 1JOJA 3BOWA 4GB32 5A7QA 1G9BA 4BMBA 1K3IA 3HNYM 1R083 3CZUA 2FZ1A 3WNNA 2C1FA 3ME2A 4EZ4A 1W6OA 2WUHA 4KQ7A 4P9JA 3NAPA 4MVTA 4HLTA 2D3RA 3RGBA 1CAVA 3ZR6A 4ORFA 5C33A 2H0BA 2QQUA 3GDBA 1O3TA 1SEFA 2WJSA 1BYHA 1TMF2 3ZYFA 5I0RA 3D0SA 4BOWA 1XNCA 4HKOA 3CIHA 4HN0A 3H1WA 4XFGA 4Q4V2 3I2OA 5AC92 4Y1ZA 5F5AA 1QJEA 2Y8KA 4AF9A 3O5SA 4E2GA 2FHRA 5F8PA 5FZFA 1YC61 1K42A 3A7QA 1QOTA 4LBJA 3K4ZA 1ZRIA 3WDWA 1IPKA 4NPRA 2XUMA 4B1MA 2ZEWA 2VD7A 4Q4X3 3R4UA 4DXRA 3OYWA 3PVNA 2P6HA 5D2AA 4FSJA 2HWF1 4PCRA 2FD8A 2IXIA 1WCDJ 2OX0A 4I3GA 4IV3B 2WFF2 1N3PA 5CYYA 2VH9A 1RUH1 3LB9A 1B35B 3MUZ1 4YZ4A 3THCA 3UESA 1KRIA 1S0CA 3LKJA 5A6XA 2ZGRA 3KT1A 3OBTA 2XJVA 2EIEA 3CJXA 3DEMA 4YGEA 3V0AA 4EN9B 1KGYA 2V73A 3KGZA 1NZCA 4ZU5A 1H9WA 2HWE1 3FUOA 1UN1A 5ABJB 4MG2A 4NUBA 3RZKA 1D4M2 4HSLA 4GB31 2ZGSA 4MO3M 2GNTA 3FFQA 3ITQA 1N1SA 2XOMA 4ZXKA 3ZMNA 4AVTA 2D43A 4D94A 5H9PA 1CX4A 4YVWB 1CVNA 1CAWA 3WINE 3WF0A 1W8NA 1RC6A 4W6WA 1WW4A 3BTYA 3CF6E 4FPKA 5GLUA 5HXMA 5A33B 2WNVB 1LGBA 4NHYA 4P02B 3U4SA 4E8CA 1C5HA 1K5MC 1YNAA 4OQ8A 5CISA 2HJIA 4FTEA 4X6RB 4FPYA 5F7UA 2W39A 1RTVA 3VBOC 2W46A 1V0AA 3PJYA 3GCXA 4LBQB 4BQ5A 1TMF1 1S0GA 3T09A 1DFQA 5GJ6A 4FAHA 2HWC3 1Q8SA 1W6PB 1YQ5A 2BOJA 2W87A 3ILFA 4Q4V1 2B9UA 4XDPA 2IUWA 5AC91 4ARYA 1UOJA 3ZYJB 5A3LA 1OVPA 4W6XA 2D5HA 4CEWB 4HETA 2QE3A 1OURA 2VVEA 1AR83 3FJSA 2JDHA 4QPIC 4BB3A 4ET7A 2RM22 2VBDA 1QIQA 3TRSB 2W68A 4RR3C 2E7AA 4D8MA 4UFKA 3BTAA 4C91A 2D6LX 3HJRA 1RMU3 4MADA 1F4HA 4XUTA 5A32A 5HV4A 3FBMA 3ZFEB 4TXWA 3HT1A 2YUEA 2TBVA 3VDDB 1S0JA 3ON7A 2WFF1 1NE6A 2NMNA 4WM7A 3L2HA 4ZPIA 2JE7A 4AI2A 4CCOA 4QX5A 1DGWA 3I2GA 2OW4A 3FN9A 2DU0A 3PL0A 1DCSA 1S0EA 3I59B 4MXVA 5I8YA 1J84A 2A3XA 1RB8G 5JPNB 1ND3C 3CJIA 3OBZA 4CCNA 1MZEA 1VBD2 4OZOA 2J7MA 2E31A 2YGMA 3AP5A 1GNHA 3WG4A 3ZN5A 1NA1B 3LOIA 4KG8A 1D4M1 1OC1A 2VAUA 3J26N 3KGLA 1SQ4A 3DGTA 4XF1A 4YG0A 1QJY2 1SBEA 1FV3A 2GC3A 4QKFA 1GFF2 3EXUA 3M3CA 1L7LA 2WO3A 3WV6A 1MPXA 2RDRA 2BUKA 3BPSA 3TYJA 3BIEA 3POFA 3I3BA 2C0ZA 3WXPA 5FO8B 4R8HA 2GZWA 2JECA 3THTA 1GANA 2Y6FA 3V65A 3J7NA 4CSWA 4Q4Y2 1W3VA 1CAXB 1WLTA 2A6VA 2Q1MA 3JD72 4LBNA 4W4ZA 4KWJA 1RUI3 4BDVB 4AEDA 3MPBA 3VBHA 5FDBA 3T2OA 4OFGA 3SKJE 1FAYA 3H9AA 2VTXJ 4GH4A 1I1EA 1GR3A 4CU6A 2RJ2A 2VZPA 4JHTA 2AUYA 2IVJA 5KXCA 1WBLA 4YM0A 2RM21 3IKWA 5K4LA 1MS8A 1W6NA 4NHXA 1C57A 5A80A 3T30A 4HVOA 1PK6A 1X8MA 3LF7A 4L0PA 4UOJA 4IV1A 1Q8VA 5GZDA 5GZGA 2ZX2A 1JODA 3K4DA 2JG8A 2VW2A 3U37A 1QNWA 2VOWA 3AKTA 4FOYA 4CU7A 1UYYA 3DXTA 5FUIA 4LO8A 3VBRB 4UWDA 2OIIA 4LUMA 1N1TA 4PDWB 1OFSA 3V64A 2AREA 2HH9A 1F31A 1JN2P 5LBBA 2UWAA 3ECQA 2XLFA 3UGHA 1OFNA 2Y26A 2Z42A 3ES4A 2V4AA 4N43A 4XF9A 4TWTA 1VBC2 1VBD1 4UBGA 4V2VA 3LE0A 1W8ZA 3VD9A 2DU1A 4LIUA 4XF4A 3S7EA 2C5DA 5HXVA 4CZSA 4U36A 3T4HB 5C71A 1F2NA 1YIPA 3AMPA 1UMIA 1UY4A 1IPJA 2VOVA 3WNOA 4QX8A 2ZX4A 1AYN3 1O3SA 5EJ3A 4R9DA 1QJY1 5FOJB 3DPRA 3LFMA 5DAWA 2RJLA 4IERA 3EQEA 4ASKA 3D3AA 2P3JA 4JGYB 2XL7A 5CFDB 4E4SA 1G86A 2Q5TA 3K3NA 4H7MA 3WQ1A 4IE0A 1C28A 2HEYF 4CP9A 4A2UA 4Q4Y1 1NCQC 2YC2A 1XYNA 3J7MA 3SKVA 3AZWA 2VMHA 3JD71 3FC0A 1W2OA 4OLLA 3VBFC 1JZ5A 5I8SA 3M2MA 3AP7A 3WP6A 4CDXC 4HG6B 2DF7A 2B9VA 2W47A 2B42B 3RZLA 4FO9A 3AKQA 1W2UA 3NNMA 3S5QA 1W6MA 1OF4A 3OOXA 1XE8A 5IWFA 4JQRA 1JU4A 1V9U2 4HK8A 2D93A 2D44A 4HN1A 4DB5A 3TBDA 2VNOA 1CAUB 5LZ6A 5BNNB 5JMCA 4XPVA 5KXBA 1S1AA 3WY6A 1RIRA 2NPIA 2CY6A 3I2KA 5A7NA 4LULA 4O9GA 3DN7A 3C7FA 4R4XA 4PQQA 3VKNA 1RJ8A 4RQPB 1LTEA 2N7GA 3NNFA 2ET1A 2AYHA 2JDKA 3F95A 3ZFGA 5JCTA 3EMRA 5E1RA 5JOWA 1VBC1 2P2KA 2P37A 2EIBA 2VL4A 5FAXA 2RDQA 3MLJA 1SLTA 3M4FA 3POSA 3VGIA 3NO8A 5DUUA 4EJRA 4XXAA 3B9CA 1GICA 3NV3A 2PFWA 5CAZA 2R6QA 3WW2A 1LR5A 5FMOS 4FQ4A 2VXRA 4AHZA 1WW7A 4CU8A 1S2EA 2DUQA 4BQ3A 4YLZA 3THDA 3VD5A 3EYPA 3VDBA 3PU3A 2RMU3 1XPWA 4XFIA 2AC1A 1H8VA 4C8DA 4IDZA 2CWSA 5FZOA 1S0BA 2HWD3 3D82A 1CONA 5IAXA 5LATA 1AYM3 2Y0OA 2D6KA 4CDQC 3KHBA 3ENRA 4Y26A 3O1OA 1FATA 1YRZA 4LT5A 4UBHA 4BK5A 4XOGA 3S6PA 4JGZC 1REDA 1E5RA 2RV9A 3D8CA 2VMDA 1RUF2 2B5HA 4LO7A 1ZRCA 3MFCA 1JH5A 2GMPA 5IW0A 4A3ZA 4KL1A 1ULFA 1AR62 4QX3A 2CV6A 2VMFA 1UF2C 2AGSA 4KWKA 5KC5A 1V9U1 4FOWA 3HT2A 2J1RA 3ES1A 3T0AA 2D40A 1LULA 2RS32 2ZEYA 1QJU3 1VMHA 2BWCA 2VNGA 2YXSA 2YGLA 1HXS2 3VHPA 1ODNA 3BU7A 3DECA 1BVP1 3UT0A 4AVBA 2ARCA 1JZ3A 3ZOIA 2VBBA 5FP9A 3OBAA 1EV13 1APNA 4NROA 4L99A 1HB3A 5IK4A 1FI2A 3R4DB 1LECA 1HQNA 1X9TA 4AEKA 3UYJA 4XDOA 4M3CF 2D3SA 3CL1A 3GF6A 2PA7A 3WDXA 3FUQA 5T5PA 5C3PA 5DQ0A 3I4IA 4DY5A 2O14A 3ZSJA 4ZHNA 3P1IA 1PM7A 2WL1A 3UNPA 4OHVA 2C26A 2Y33A 3ZSLA 4PI0A 3LEKA 1C3HA 1NX9A 4TLFA 3W59A 1V6MA 1O8SA 5A6ZA 2A3WA 4NAMA 4QX0A 1W0PA 4LR4A 4EWEA 4IV3A 2RHPA 1OXCA 1ULEA 1ZZ9A 2ES3A 3ATGA 1B35A 4A45A 2WFPA 4E4DX 4XCBA 5F39A 5JXGA 2R073 2PLV3 4MXWB 4WM8B 1A8DA 5ACA3 4ATEA 2Q1ZB 4HOOA 2WZR2 1NG0A 2ZGTA 4WVMB 3FHAA 1VBA3 1V6JA 1RUF1 3R0RA 3SEEA 5GZFA 2ZPXA 1GWMA 1CQ9A 3BCWA 4A44A 2WN3A 1AR61 2R043 4NN0A 4PT6A 3H8UA 2NP0A 3MIHA 4N7IA 2PHUA 3IAQA 3H1YA 3O12A 4ZU4A 2WWUA 1QNYA 2YPJA 3S7IA 1J3PA 3MGUA 4URTA 1UNBA 3ZFEC 1JI6A 5A33A 2I2SA 2RS31 3AMHA 4FFIA 3VDDC 2WNVA 1HXS1 2G1MA 1W04A 4RS5C 1IKQA 3LIGA 3ZXEA 4E2QA 5KHGA 3R6SA 1QH6A 4LBQA 3RJRA 1O59A 5D8AC 3RI9A 5C4WA 2DYCA 1KS4A 1RUE2 1W3XA 2QZ2A 2VCCA 1W6PA 2O0OA 3GBGA 2BFUL 5B4XA 1REFA 3PIJA 4X6QB 5FOBB 2OUJA 2EAAA 5I0SA 3K3OA 3CBNA 4PQ9A 3D4KA 3I3QA 5FYZA 4CEWA 5JOZA 4OI0A 4NRPA 5DDJ3 1OA3A 4AFAA 2PYTA 3WW4A 2EXIA 5DAXA 3X29B 1AUYA 1BBT3 1LOEA 1Y3TA 3WDTA 3ZXKA 4LNVA 1FOD2 5CEHA 4QB2A 3T08A 4GWJA 3ILNA 4E2SA 3NJVA 4YFWA 2VCMA 4IE6A 1MZ5A 5FZ0A 4L8QA 2W3JA 1ONAA 3JUUA 1QXPA 2QZ3A 1ZBA2 5CZKA 2CAVA 2CDPA 4ZS3A 3KCCA 1GLHA 1AJOA 2WYSA 3NNGA 1DZRA 5A32B 2WZR1 4D6QA 2JB4A 3C8XA 4DY3A 2X53S 1NKGA 2WO7A 5F9TA 2E6VA 3LA3A 1NA1A 1U5YA 1J83A 2JD9A 4IGQA 1NYWA 4WM7B 2WIIB 3NMBA 4BYYA 1QMJA 4Y33A 4DS0A 1XSQA 4D7TA 1NLQA 4PBOA 4UI9L 4Q0UA 1XE0A 4H2AA 3AYCA 4CDUC 5FYIA 2W9XA 4B1LA 4CP1A 3BKZA 3O0VA 4L92A 3VBRC 3B93A 4YVSB 5HI0A 1R093 1OQDA 3ZSEA 3DXUA 2OKXA 1HRI2 4XACA 3MV11 4ZU7A 1CIWA 1COV3 4JTNA 3OPWA 1MEC3 2D6MA 1MZ6A 3JQXA 3U78A 1OT5A 4CEYC 4UXAA 2JIJA 3U0ZA 1RUE1 1O91A 1OVSA 3WP4A 4XIKA 2F4LA 2UURA 1VAVA 2QQOA 4Y1VA 1WW5A 3AJYA 2Q1FA 2WA4A 4GJZA 5EJZB 3WQBA 5EP9A 1G6NA 1VBE3 2C6SA 4LBOA 4FPGA 3G7DA 3QACA 5FMCA 1AR72 5FY5A 4E4HA 5DPNA 5M0TA 2XLAA 4Q4W3 3VBHB 1FOD1 4BE3A 1OOPB 2YROA 1L7QA 1G9FA 1DP0A 2VZOA 4I30A 2ZOEB 4PDWA 3QOPA 2YYOA 1S2BA 3AYAA 3FFZA 5C9AB 1ZBA1 4ZKTB 1JYTA 1W6NB 1RVF3 4EYUA 4DZGA 1PK6B 3AXEA 4HT1T 3FMGA 2WWJA 5GZEA 4ASMB 1W6QB 1ZM1A 4AI3A 3O0WA 3WW1A 1W9WA 1IQAA 4LUKA 3WR0A 4FXGB 2EVXA 3MIDA 1JYIA 1HN0A 1FV2A 1RL3A 3N7LA 2VBPA 2XMLA 1UO9A 1AL23 1ZYBA 3FLPA 3N9OA 5BNOB 1K12A 2LUWA 1YQCA 4Z82A 4IEPA 3FLTA 1JXNA 1Z78A 5DAQA 3TEYA 4ZONA 3HPNA 4JGYA 2JD4A 1US3A 1W39A 4GWMA 2A6XA 2FMYA 3B9IA 3IZOA 1UY0A 3AP6A 1AX1A 1OA4A 1H30A 2G4IA 2EICA 1HRI1 2OVUA 5CFCB 2Y34A 5FJKA 1W2NA 3ROUA 4BU2A 1TME3 4ES9A 2ILMA 3TAYA 1AR92 1UCXA 5JDBA 4GMP0 1OH4A 4XMAA 5J98B 2MPFA 3H50A 1DGWX 1GOGA 3Q8FA 5BXXA 2VW1A 4R9BA 1DYPA 4YG6A 1M06G 1RYYA 1HB1A 4QHZA 4OQ9A 2MEV3 2VY0A 1W99A 2XBO3 3LPGA 4HSJA 4CP9B 5JMOA 2WT1A 1ZA7A 3APBA 5JXJA 5FY7A 4E8DA 1AR71 4Y1UA 4C0HA 4AQSA 2ZX3A 2BRTA 3WF4A 2RS13 1VBB3 3P6BA 3EJKA 3UGFA 3TNQA 1BMV2 1ZBE3 5GM0A 1XU2A 3ZXFA 3H1MA 4Q27A 1H2LA 2PHWA 1ZZBA 1SMVA 4P08A 2VUDA 1NUKA 5FZHA 2P3KA 3W5NA 4MHRA 3I49A 1R1A2 3T2TA 4OULA 3JZVA 3SCGA 1ND2C 3ZFFA 3MIFA 1PVXA 3G6JB 2QQKA 1LKNA 3NKTA 1JUIA 3JQWA 3RSJA 2TEPA 4LE3A 1PGL2 4CVUA 3H8OA 2BNMA 1LHOA 3J7HA 4YGDA 4IEQA 1W05A 1OPOA 4QPGA 1LHUA 3NRUA 1G9CA 3PVEA 4AI1A 2B46X 3URFA 5JWPA 5K0UC 4QB1A 2QQNA 5FMDA 1TQ5A 3USUA 1HV0A 1QJX3 2D7FA 5IK5A 2WQ8A 2ZHMA 3OTFA 2Y6HA 4RHV2 2E51A 4OHZA 3MLKA 4N8MA 4ITCA 5AVPA 4XF3A 5KXEA 5T5LA 4P00B 3IWZA 3MIEA 4P9GA 1HN1A 1X82A 2RR13 5LY1A 3UGGA 2DVBA 5EYXA 3MF6A 5LA1A 2V5YA 1C8M2 1N47A 1JTZX 2W08A 5I0UA 2GN3A 1DU3D 2VGDA 3AZXA 4YM1A 1E5HA 2OZJA 1AR91 3JU9A 1KFXL 3NAPC 3TN93 1SBFA 5E16A 4I0WB 1YXWA 2EALA 1R082 4LHLA 2I74A 4LK6A 5JXHA 1GMMA 3GBFA 1WLWA 4RGKA 4YW2A 3WG2A 3ZXLA 1LODA 2VW0A 5IVFA 4QKBA 4KWLA 5FLHA 1XE7A 2YBKA 2ARAA 2YU1A 4K9SA 4CCLA 2CGPA 2Z69A 3ZYRA 3AL6A 3P3PA 1HQWA 3HIFA 3MLLA 4DIQA 3AZZA 2MHFA 3N36A 2XJQA 2OQ7A 4JZRA 4D3WA 1KFUL 1W8FA 3O1RA 1BMV1 3GHNA 4Q8LA 2GMEA 3WHTA 4QGMA 3LOBA 2XJRA 1LOFA 2VQTA 5D1IA 4FXKB 3OPZA 5FPLA 5FYBA 3ZDSA 5IVCA 5A3TA 1R1A1 1MVQA 5HCAA 4PHZA 2JE8A 3ZN6B 3LD8A 4GKXA 1KITA 2K9ZA 2GC2A 4QQPA 3AKPA 2PTMA 1PGL1 3B94A 3O1SA 4A7ZA 2HWB3 4COZA 3POIA 5TSWA 3T3YA 4Q4X2 1PIV3 4XW3A 2WZ8A 3OGGA 4WVZA 4ZZ8A 1KD7A 2CAUA 5B2GB 3RZZA 4ZY9A 1MZFA 1UU5A 2UY9A 4AI9A 5FUNA 5JAXA 1QOOA 1JZ4A 1JYXA 2FDHA 1AZDA 1MS4A 4O65A 5LW9A 2ZEXA 4YZ3A 4RHV1 1JS9A 4AVAA 4LKSA 4NHLA 4EN6B 5C8CA 2IXLA 3POEA 1X8EA 4QX2A 5K9YA 2WDBA 3OGSA 1UAIA 4AI8A 2VVDA 2EXHA 4M01A 2ZEZA 4XFCA 1RUH3 1PZ9A 4AK3A 1C8M1 1SLLA 1YI9A 2Y0IA 2XVLA 2G9ZA 3ZSKA 2Y6JA 4MXWA 3OGVA 4WM8A 3FHQA 3CMGA 1RJ7A 3PDQA 4HXCA 1NQDA 5DUXA 1HJFA 2HWE3 1LGNA 3SH4A 1R081 4BWOA 3MV01 3LDKA 4RYDA 3UJQA 4WVMA 3LSEA 1F15A 4NIGA 1K45A 1YLLA 4GB33 5G05L 1BQPA 5L7OA 1XNTA 5A70A 3ASIA 4QB6A 5JSRA 4NIAA 1U5ZA 4XUPA 3VBUA 3K51A 4LKFA 2CHHA 3I8TA 1H6YA 2CGNA 1HV1A 2VMIA 4RD7A 4M0HA 2YMZA 4Y22A 4WZCA 3RFRA 5BYNA 4LOTA 3SCHA 1L3JA 5CKQA 3PIGA 2HWC2 4F83A 4UF0A 4URAA 2BOIA 4XMIA 3TOJA 4AG4A 3KSCA 1J1TA 4XZPA 1UX6A 2E63A 2XQRA 4E9KA 1XNAA 4LKDA 2ZGLA 4C1WA 1A34A 1AR82 2V09A 1KXGA 4LLFA 5FK7A 4Q4V3 4XAEA 1DLLA 4Q4X1 3KB5A 4HFSA 2QQVA 3MHZA 4C1XA 3USSA 1RMU2 4Q1RA 4WM7C 3UJOA 5HBAA 3DKWA 5FZCA 4GMP3 5IVYA 2VZRA 4FTBA 1JHNA 5DUVA 3WCSA 5C4WB 3CJIC 2VPVA 4KU8A 1GQGA 3K77A 3OGRA 2FDKA 4MOAA 5I0TA 1ENSA 2ZGOA 2WFF3 3UKVA 5LEJA 4FOVA 3P3NA 1SLAA 1JOPA 2XB6C 5A3WA 3NL1A 2UWBA 1WKYA 2J42A 5H9SA 3KF5A 2ORZA 4N53B 5JSPA 3OPTA 1PNGA 2H0VA 4S2HA 4AAPA 4MGSA 4E27A 3C7GA 3AK0A 2JICA 1UIJA 2CNAA 2VMEA 3WZ1A 5HV0A 4H7LA 2ID4A 4MLOA 5FREA 3JBG3 4OHYA 1Q3EA 3KHCA 3ACIA 4P9IA 3K4AA 3HEIA 1NT0A 4AFCA 4BHPA 2ARBA 5IK8A 3PURA 1CZVA 2YFZA 1Q8QA 2DVGA 3N35A 4KBBA 4AEDC 2OYZA 1WMXA 5FKCA 1GZ9A 5I91A 1AJKA 1BCXA 4GH4C 3C7OA 1UY2A 4E4ZA 2VC9A 2AEZA 1YO8A 2GC1A 4FFHA 1ZZCA 4FPJA 2GH2A 4P9XA 4YVSA 2HWC1 5FYUA 5J48A 3AZYA 4KNCA 5A3OA 1JYCA 1O3RA 3U1XA 2JX9A 3VLBB 2VTFA 4GWIA 2QBXA 1FMD3 4IV1C 1VJ2A 4FPLA 4G4FA 1W8HA 2I07B 2XR4A 1AR81 4Y5TA 5DAVA 5FPXA 2JG8C 4EWAA 4QM8A 4YZ1A 3AB0A 1PMIA 1ACCA 2KXLA 1T2XA 3RG0A 4RFT0 1SBDA 2NQYA 1PZ8A 3IPVA 5FY9A 1RMU1 4CA9A 5C5TA 3LGRA 4UW5A 3I3DA 1AX2A 4KH9A 4XABA 2BZDA 2VUAA 4HANA 3WD5A 2JE9A 5BY5A 3KLSA 2ZMLA 3IDBB 2D97A 1AL0G 2VU9A 3PUHA 4O7XA 3SEPA 2IFWA 4N43C 3EHKA 4LTAA 3M3EA 2ZGMA 3KCYA 4QPIA 1IQDC 4R9CA 1STMA 5FZDA 4BQ1A 5I8TA 1OOPA 5ANQA 3WCRA 4CE8A 1LGCA 2EIDA 2JXAA 3VBSA 3HQUA 4QHOA 3RWKX 3ZLIA 1WMDA 4MHUA 1HIXA 2FZ2A 2HEWF 5C9AA 1JYNA 4LO5B 2ZA9A 5B4NA 1GQHA 1H9PA 3DPRC 3RNSA 5KHKA 5L9VA 4RN5A 5JR7B 3ORJA 4ARXA 4DINB 1FT9A 2F4PA 5C3OA 4G3YC 1W6QA 1VBD3 3RS6A 4Z2WA 1AYN2 1ZZ6A 3PMSA 1OUSA 1YHFA 1XNBA 1XC6A 4CXWA 3A4UA 4K20A 1QKQA 4YFZA 3FL7A 2UYAA 4IL7A 5FQ0A 3FLRA 5A3NA 4Z92B 4XHXA 2YHJA 3VZMA 4Y20B 1SLCA 1ENXA 4IEYA 4JDNA 5IFPA 1XYPA 3MI8A 5FZ7A 1ZRDA 4PLNA 2HBTA 1I5ZA 2W91A 4IUGA 5BNOA 4K3UA 4Q0SA 3F2ZA 4EN0A 5FZ3A 4IESA 3ZPYA 3H3ZA 2A6WA 1CZTA 1I3HA 5FIXA 3VHRA 3ACFA 4BK4A 2QQIA 3ILRA 3RDIA 5CFCA 2D98A 4MV2A 2XDVA 1UXXX 5T55A 4QGNA 4BQ4A 3R05A 1GOFA 2ZKLA 1O4YA 4SBVA 2XWBB 1C5IA 4AGRA 1RHI3 3GBWA 3Q8EA 1V6LA 1S0DA 3GGLA 3OY8B 2AEYA 1UY3A 3RZJA 5F3GA 3N7KA 3AFGA 1H6XA 2PAEA 5FMOL 4IE5A 4TTGA 1E57A 4OVEA 4GALA 3ZFGC 4CUCA 3LIHA 2IVIB 4YYOA 5FZMA 2KA3A 4CUGA 5FZIA 4CCEA 1G8WA 2E9QA 3KV4A 4UFIA 1X50A 2WNUB 4XHBA 4OI1A 3SH3A 3QBQA 5FLIA 2W94A 3SC7X 4BA6A 3E5QA 4KWUA 5C5UA 4XFBA 4FOQA 5JUVA 1I5PA 3SISA 1AXZA 1T6GC 1YFYA 3A0NA 3ETQA 3PTYA 2J1TA 2QKDA 5LY2A 5BNPB 3CU7A 1VBC3 1AYN1 1TNFA 4XUQA 3CKHA 3HBKA 3KV9A 4FI9A 1CESA 4XJ8A 2DCKA 3NQHA 3SLIA 1DQ0A 5GKAC 5DUWA 5T5JA 1PO13 5FPZA 4AHYA 4AL9A 4O9EA 1CD3G 4COUA 4IEZA 1GP6A 1ZVFA 2DDUA 3ZFFB 4MYEA 4QAWA 3R4SA 4XETA 2RMU2 4K21A 4NRMA 3IDAA 2H6BA 2HWD2 3M8LA 2HYXA 4QPGB 1AYM2 3E6DA 5C7GA 4META 5H9QA 5G04L 3WSOA 1MQTB 3V0BA 3ZYBA 3USUB 2DTYA 1AX0A 2D5FA 1Z0HA 2Q8CA 4AI0A 4CPBA 3THPA 5JI9A 3CDZB 2PHXA 5A7WA 4IEVA 3WF2A 1BXHA 5F5IA 1LB2A 2AR6A 3CHXA 3KWVA 3IIIA 3RZHA 1H2NA 2FCVA 2R32A 2ZX0A 3LSDA 5JOYA 3VBFA 2ZX1A 2W1WA 1LOBA 3HOBA 3I2DA 4BPZA 4CDWB 2NLRA 4LO4B 1QJU2 1UZVA 4XXPA 5CB7A 2P3IA 1LJ7A 1QDOA 4JDMA 3I2FA 4MH0E 4UFLA 4EZHA 4XBQA 4DXTA 1EV12 5SV8A 4H55A 1LRHA 4A3XA 2WRAA 1PO22 5T3NA 3VD4A 4J1XA 1LCLA 3PUIA 5LK5A 3T1MA 1MR5A 4LBKA 3I3MA 5J96B 4I02A 3ZN6A 2FCTA 1DG6A 4XJAA 2FDGA 1AF9A 2J1SA 4NE9A 2WQ4A 2XG3A 1RXFA 3E5UA 1IKPA 4QMAA 5CADA 2QDNA 1QY4A 1F5FA 1GU3A 1H8TB 1QQP3 4IV3C 4A4AA 4YM3A 2XQXA 4ISQA 3BI3A 2Z79A 2IFRA 1B35C 5FBZA 3OUHA 3HD8B 4I01A 4B7KA 5EZWA 2RMU1 2ZABA 5DG1A 3E6CC 1A8MA 2JKBA 3IIAA 3O1TA 3N4MA 2HWD1 2DURA 1DYKA 3J8F2 3VZLA 1AYM1 2IC1A 3OEBA 5ABJC 5C3SA 3UKTA 1BEV3 1JOBA 3CNAA 3OGJA 5JZGB 2JDAA 3VD7A 1DGLA 1DYOA 1PZ7A 4EROA 2GNDA 3IAPA 4BJ0A 2OS2A 4UW3A 5J09A 1TVGA 4Q26A 4YVWC 4NMIA 2HBUA 1KQRA 3MYXA 2EAKA 5C8CB 4HKWA 3RVHA 1VAMA 4Y4YA 5FXWA 4PLOA 5A7OA 1UKRA 2WNVC 4Y1YA 5FZ6A 3AP9A 1A78A 2ADDA 5IFTA 1BVVA 4LBMA 2GU9A 3WEZA 1AR63 2K46A 4R9AA 3N9MA 1LU1A 5F3IA 1WMFA 2OQ6A 3FZ3A 3OF1A 1QH7A 2BVBA 4JGZA 2X10A 1FXZA 1QJU1 3RYKA 2X8KA 4PI2A 4LBLA 2WAOA 1OLMA 3JB8A 4HBNA 4YRDA 5A1AA 4HMZA 3RZGA 2YDEA 4QXHA 1EV11 3JCIA 5K8SA 1ULOA 2BNOA 3KMHA 2RE9A 4XURA 5BV6A 4CEWC 1POV0 1IPSA 2LTNA 3KVAA 1PO21 2Q0AA 3PJQA 5A1LA 5L7OB 4GD4A 5FY0A 2ZHNA 3AX4A 1NLSA 4NRQA 5FPBA 5FXZA 1K5JA 3VBUB 4B4RA 5FJHA 2GP5A 2YU2A 1VAKA 1CIYA 4Z07A 5GALA 1Y9GA 4Y22B 1NCRA 4Y4RA 3WP5A 4ES8A 2J22A 4DXSA 1UYZA 1MVEA 2ZACA 3NKGA 2KR2A 5ANNA 4DEVA 2C4XA 1YFXA 5GZCA 5KHJA 4UF0B 2A75A 2W1SA 3TEWA 1Z7S3 4QM9A 3WW3A 4DUXA 4J25A 4K6BA 4LE4A 4XE9A 1SPPA 2I45A 2R1DA 5HCFA 5DAPA 1URXA 2MNGA 4NOTA 3NNJA 2VNVA 1LNSA 2WT0A 2GNMA 1HX6A 3AL5A 1O5LA 3J8F1 3H3UA 2VQ0A 1TEIA 4LXLA 1IS5A 1NA1C 5DXDA 3S5AA 5DN2A 3Q8BA 4QDRA 4K8RB 2QQPA 2DWRA 2H6CA 5A3PA 3AKRA 3M70A 3ZSMA 4N53A 1C4RA 1W9SA 4B3NA 5E89A 3OEAA 1OLQA 1UYXA 1QXRA 1OLRA 1RUJ2 2DFBA 4NPLA 4YW6A 5FKBA 4FAGA 3L9JT 3WHUA 1EAH3 1YJLA 2A3YA 3LAGA 4MSVA 5FPVA 1CJPA 3PLQA 3ZMOA 2P4EA 3NWKA 3GM8A 2Z2SB 3ACLA 4DUWA 1R092 3DKQA 1WLCA 3WNLA 4PIZA 2UU8A 4D6RA 2WYFA 1COV2 4XFHA 5FZKA 3D0JA 4N9HA 1UOGA 3BIWE 5F32A 1NE4A 1W2AX 3OSDA 1SDWA 2ZTNA 1OPMA 3ACGA 4QPYA 4YW4A 1QEXA 1BJQA 3RZMA 5FXXA 4QKNA 4CCJA 2PHTA 3O1UA 2VZSA 3M7AA 2VOXA 4IEOA 1OD5A 3N7MA 4AWDA 4Z1VA 2FBEA 5FYVA 3HAGA 4BQ2A 4LBQD 5EV7A 2CDOA 1J3RA 3KT7A 3N9QA 4PDWC 4Q4W2 3O1PA 3ZX7A 4Y24A 1KEXA 4FPCA 5JOXA 3FX3A 4EQVA 5A3UA 1G7YA 2DCYA 5FZ1A 1DGRA 5ERLA 4ZXEA 3KZ4C 4DNYA 3UV9A 5JXIA 1K5MB 2G9GA 3DL3A 2X5IA 3BOPA 1FOD3 1VE0A 1W03A 2EXJA 4DO0A 1VR3A 1I9RA 2B45X 2BW8A 1RVF2 4IW3A 4XJ9A 5A7SA 3RRDA 1FNZA 3IPVB 5F6LB 2CWMA 1Y43B 4M00A 1WWYA 4PIYA 4XDQA 1MS9A 1RUOA 3NW4A 1BK1A 3M1HA 3ZN4A 4FTSA 5LBFA 5FMBA 4Y5SA 5LA0A 1IGOA 4QPIB 2Q8OA 1RGSA 3C2UA 3KS7A 4FFGA 4FFFA 1RUJ1 4DQAA 3N9LA 4JGYC 3J4UH 1I6XA 3W58A 4RR3B 4M3CB 4D6SA 3UK9A 1PVC3 1H0BA 1AL22 2VZ3A 3MO4A 4LA2A 5GLZA 3U14A 3VBSB 3WUDA 4YWAA 3BODA 4XUNA 1AVBA 4P5HA 2FDIA 2WSVA 5LRSA 1ASJ3 3J9SA 2E53A 2UY8A 1WD3A 4MZUA 2PAKA 4Y20A 5FO7B 1R091 2NM1A 1VRH2 2BNNA 2XUEA 4XFFA 3VZKA 4LKEA 3EB7A 3INAA 1COV1 3M3QA 1VB4A 1HQLA 2A6YA 2WINB 4P9WA 4TN7A 1TME2 3DYPA 1HB4A 2ET7A 4CTEA 2W1UA 3BTZA 2IXKA 4F7ZA 2R062 4M0NA 3B02A 1ND3B 1UZZA 2P6CA 5FQ0B 1HRI3 2E7TA 1OBNA 3ZXJA 1XSRA 5A6YA 1J59A 4Q2FA 2NZ9A 1Y9MA 4EN8B 4RFRB 1V00A 2MEV2 3IDEA 3IT8A 2HYKA 3MFAA 4KMQA 1RUG3 2XBO2 4WZFA 5AVAA 5LB6A 4HVQA 5BNNC 3WVJA 3CEWA 1UXZA 1A3KA 3S30A 3GYDA 1OI6A 3B01A 3ALQA 4LPLA 2BBAA 4FVVA 1E5SA 4GA9A 5GLTA 4FPEA 2RS12 4OI4A 3OY8A 4Q4W1 4LOSA 2YPDA 1VBB2 2W0XA 3PHMA 4RQPC 2XWJB 3N9PA 3ZFFC 2A70A 3ETPA 2JDZA 2XPJA 2JG9A 3LA2A 3FBYA 5ISLA 3PUSA 4NPMA 5FWJA 1JYVA 5K7PA 1OUXA 1GZWB 2BQPA 2WNUA 4GXLA 1RVF1 3KVBA 5L9BA 3H3LA 3LZZA 5LBCA 5FUPA 1W90A 4GULA 2VQAA 1U5IA 4XIOA 5EWSA 5FZ4A 1LOAA 4CUBA 1PGSA 4J1WA 4TZDA 5EJ1B 5DMYA 2QQWA 1UPSA 3ZPOA 2QUOA 1OSGA 2P5BA 4ZS2A 2WT2A 1POV3 3FWEA 4NWWA 1O4TA 5BNPA 3RMXA 2JIGA 2UYBA 1QJX2 1FPN3 4XQWA 5D21A 1JW6A 3IB3A 1AL21 1XRUA 2WR9A 3VKOA 1LHWA 1ENRA 4A42A 4EV0A 2A6ZA 2YBSA 3ZXGA 4LEJA 2JB8A 4OYUA 4BCUA 5CKNA 4Q1PA 2O1QA 2PHLA 1YEWA 2ZKNA 4UT5A 2RR12 4AHXA 1VRH1 4QD2A 2GSYA 4HKLA 1Y9QA 1BKZA 1RUD3 3HMYA 1RUC3 3LDRA 5EXOA 4BZ4A 2VTXA 2TNFA 1Q8PA 1EUTA 1TME1 1WZXA 2WS93 4W50A 3MW2A 5FYCA 3VBOB 1JBCA 2SLIA 3TN92 2DVFA 4AVSA 1UOFA
chains in the Genus database with same CATH topology
1MQTA 3ZIXA 5A3MA 5HCBA 1HRV3 3PVBB 3WOGA 1PGW2 1QWRA 2MEV1 1AR93 3NV4A 2XBO1 2YC0A 2A7AA 4LA3A 3ZVXA 1H4GA 4I09A 4KGGA 4MUVA 5CVRA 1LOFC 1UL9A 3ZXAC 2RS11 1EPZA 4SLIA 2GMMA 3V0BB 3MICA 4I0AA 1VBB1 1YJKA 2XJPA 2XL9A 4OHWA 1HKDA 4CDWA 2IXJA 2RS53 1OHFA 5CU1A 1H4HA 4EN7B 4BLJA 3C3VA 4Q0QA 2BBVA 4XBLA 1NCQB 5JI7A 5BNQA 4NHMA 3PVOA 1IHMA 4CP0A 3UL2A 3VBFB 3WP3A 2HWB2 3HBZA 1R1A3 4P14A 2FQPA 4COVA 3TWIA 1PIV2 2X29A 4L9BA 2JENA 5C8CC 2ZCWA 1KDMA 1QJX1 4B4PA 1F9KA 1H8TA 4QGLA 2IWGB 4IEUA 1LHVA 1NOVA 2PAMA 3SCFA 2ETEA 2EIGA 2R49A 2RR11 4RHV3 4L11A 4WM8C 3WT3A 2AZ5A 5FTTC 1XQNA 1WCKA 5K0UA 4COWA 4YZ5A 1LU2A 5CG8A 1NXMA 2ZGNA 5JZGA 5JLVA 1H2KA 1MACA 3CLPA 4PJYA 4XQDA 5L7OC 3A0KA 3TN91 1KDKA 1ZNPA 3UKNA 1OKQA 1IZ3A 2OPKA 2WKKA 3VBUC 1PGW1 3KQRA 1HLCA 4XFAA 4XJUA 4G9SB 2HWF3 1ZZ7A 3B3QE 2EA7A 3LCPA 2KM2A 4FBFA 2EXKA 3OD0A 1C8NA 3MPPG 3T1LA 2XVGA 3ZIWA 1MS0A 2GC0A 4CDQB 3NJZA 1SACA 4Q29A 2HWB1 1D0HA 2G9FA 3AM2A 4RGGA 2DVAA 3VZNA 3GZAA 4JGZB 1PIV1 4BMEA 1YI7A 3E97A 2D3PA 3B00A 4I2OA 1Q8OA 1YFWA 3B69A 2OUHA 5I93A 1HDKA 1RITA 3QCWA 3WNXA 3KT4A 4FPHA 1TMF3 4QQ2A 2GN7A 3SH5A 1NCRB 3GNEA 1RINA 4TSVA 5DG2A 5AC93 2WA3A 4NHKA 4D7YA 2PHDA 3BB6A 3DF0A 1WGPA 3VZOA 1QOSA 2XJUA 3JBG2 1Q43A 1ZRFA 5F1RA 1YUDA 2PHFA 2ZGUA 4YVSC 2WSUA 5DZFA 5CG9A 5FRAA 3U07A 1YYNA 1WUVA 4QXKA 3O7OA 5F5QA 3WG3A 4AE2A 2CTVA 2WLPA 3MDPA 1YWKA 2QNKA 1DQ5A 4GWNA 1J3QA 2A5ZA 1FMD2 1D4M3 2EF6A 2TUNA 3WQ7A 1GKBA 4BLIA 3VL8A 3D5OA 5KXDA 3MF9A 3VBHC 4LO6B 5KHHA 4DRRA 1OOPC 3QH6A 4GMP1 4QHBA 3WLUA 5JVVA 3VBSC 4RA0A 2QDRA 4MGIE 1RUI2 4MX3A 4AFDA 1YCIA 3POWA 4AQ6A 2RJKA 5C9AC 4AQTA 1DQ4A 1PK6C 4HPKA 5E88A 4OZXA 4YZ2A 1K5MA 1SFNA 2R30A 4RS5B 1X7NA 4BIOA 4H14A 2W52A 3VBOA 1WCSA 1D2QA 5D8AB 3QLQA 3IMNA 2Q4SA 2DVDA 1N3OA 2RM23 3PNAA 2BEOA 4IEWA 3AYEA 1X36A 4RGAA 4FCAA 5J7MA 3JBG1 2D6OX 5BNOC 1SCRA 3AZVA 1O3QA 1EPWA 1IS3A 2X5IB 1CGPA 2ZJCA 3RMYA 4RR3A 4M3CA 3DUIA 2A71A 3IDCB 3VV1A 3HWJA 2JJ6A 5CFCC 1UZYA 5KBFA 2WLQA 2ZGKA 5LK7B 2O8QA 3NVCA 2ZMNA 3MIBA 1UW8A 3VHOA 2IXHA 1AXYA 5JIUA 2XKOA 3H0OA 4QQOA 4OI2A 2GDFA 1FMD1 4Y5Z0 4WVVA 1SCSA 2DCTA 2ZS6B 1S0FA 2O8OA 4QQHA 1ND3A 3GZTB 3ZYPA 1RHI2 2AH2A 2ERFA 1QJY3 3U4XA 2K2SA 3GALA 2R1BA 4COYA 1O4ZA 2NYYA 2VUJA 2BYVE 2VECA 3V56A 4INDA 4CDUB 1Q56A 1RUI1 1A6CA 1GYKA 1D0GA 4JCKA 4Q4Y3 3SHRA 4C0BA 3U10A 3JD73 4FP2A 2IXCA 4XF0A 2IZWA 3OJBA 1O7FA 5L36A 1GZWA 2ZAAA 3ST7A 4FQZA 4CEYB 4TYSA 1G9DA 1ALYA 2YV8A 2VULA 5H9RA 2JG9B 1ULDA 1AXKA 1PO12 4X8PA 3AXDA 1N1VA 4MGZE 3NV1A 2DTWA 3WQ0A 1CJDA 2XGXA 2HEVF 4YSFA 1VB2A 4GKYA 3VKMA 1PHMA 4IXLA 4DXZA 1DQ2A 3ZYIB 5J3UA 3HQXA 5KC6A 3OBRA 2R0FA 4IEXA 1ZREA 3RWNA 3QH7A 1RHI1 3VUOA 5T54A 4XILA 1QU0A 2ZHLA 1FYUA 4KG0A 2XH6A 4JRAA 2P34A 4P9YA 4S2GA 3NV2A 1CPMA 2B39A 1R1ZA 3KD4A 3BALA 4I0BA 1CR7A 2K0GA 4K1YA 2PHRA 4A7YA 1OQ1A 1LEMA 3KCXA 1NCQA 4GQ7A 4N7UA 4QQLA 2PELA 2VNRA 4P9LA 4N90A 3WUCA 4JAAA 4CDXA 3IN9A 4OUMA 5KHIA 1FX5A 1QQP2 1V9U3 3O14A 5EFUA 2NN8A 5CBLA 3O0XA 1REEA 4F8AA 1PO11 5KWRA 2ARXA 2ENRA 4Q8KA 2R0HA 3E6BA 4BIFA 4AVCA 5JIAA 4AXOA 4BM8A 1SLBA 1QXJA 3VZJA 1H1AA 1QHDA 5SV5A 3SITA 5C8WA 5FCCA 1GZCA 4R52A 1BEV2 2CL2A 1CPNA 4NWVA 3VHNA 4PIXA 1DF0A 3AP4A 2C9AA 4D69A 2BVVA 2VOKA 3B5LB 1ND2B 2WZPP 4LHKA 3AJZA 3HN1A 4PLMA 3SMHA 4ISRA 4AEMA 1C1LA 1QGLA 2QCSB 1ULCA 3EBRA 1TNRA 1XNKA 4DFSA 4FPOB 4RSUA 5K0UB 1FNYA 1XNDA 3VL9A 1WW6A 2R072 2PLV2 1UD1A 1JUHA 1VALA 1OQEA 4AQ2A 3GZUC 5ACA2 4AYUA 3JB4C 2YY1A 2A73B 5C6CA 1VBA2 4H3WA 5FLJA 3I54A 4J6GA 1NCRC 2R042 1QJZA 3M3OA 5AFEA 2DV9A 1PNFA 4CDQA 1RUF3 2PQQA 1W6OB 2ZGQA 4K40A 1PO23 2VVFA 4YGBA 3NAPB 4YARA 5DZGA 4B8EA 3WDVA 3K48A 1CAVB 1SFYA 2DUPA 1QQP1 4AFMA 5C4WC 4AW7A 4QT6A 1NLRA 4V1PA 4KU7A 4I3PA 1Z7S2 4XJWA 4XTMA 2XKPA 4HL0A 2DCJA 1NQJA 3RYPA 2RS33 1BZWA 1EYBA 3MW4A 4YG3A 4GIQA 1HXS3 2SBAA 5T50A 5DZEA 3VN4A 4R4ZA 1BEV1 4N53C 2BGCA 1ZRRA 5DDJ2 1J1LA 2XLGA 5L19A 3MZHA 3J8F3 1H2MA 2BWAA 5FFOC 1XXNA 2DUOA 3SXWA 1BBT2 3B7MA 3OYWB 4KGQA 1J58A 1VP6A 4D7SA 2Q30A 4JVAA 3CO2A 1YIFA 4JTOA 5ABJA 3WX5A 2LALA 4JRLA 1EAH2 1Q5OA 4BH9A 2DFCA 4C90A 1DIWA 1XU1A 1YFUA 2P17A 4DOUA 3RQ0A 2R071 2PLV1 4YVWA 3V0AB 3AMQA 5ACA1 1MS5A 4JDOA 1M4WA 4AVVA 2PN5A 1DQ1A 2WC2A 5L73A 1VBA1 2ZBJA 2DCZA 4FP3A 2R041 4LHNA 3MIGA 4HK9A 2WZR3 1V6NA 2AENA 4K1ZA 1OMIA 1CAWB 3NSTA 3POYA 2B7YA 1UMZA 4XJZA 2GALA 2FMDA 2D6NA 2ZAHA 2VMGA 2XVKA 3TNPB 3WDUA 4DRVA 3TB0A 1ULGA 2X5IC 1NXD1 1Z7S1 2ZMKA 3ZYGA 2GNBA 4Y1XA 4XBNA 4RL7A 1MEC2 5F6KA 2OA2A 1U0AA 1UKGA 1X33A 4DPNA 2WQZC 5T5OA 3ZFEA 5IK7A 3VDDA 3N7JA 1V6KA 1RUE3 4RS5A 2ATFA 5DDJ1 1VBE2 4L97A 3GHMA 3I59A 1BBT1 3MEPA 1UPIA 4S2DA 5D8AA 3WDYA 2GAUA 1Y7BA 4X8NA 4DMIA 3IM0A 1PVC2 4HPKB 3AMNA 1EAH1 1EY2A 4JV4A 4A7KA 4B29A 1VIWB 1ASJ2 1RUJ3 4XYXA 3I7DA 2Z5WA 3MW3A 4W6YA 4JC1A 1WA4A 4B7EA 3S0MA 2GH8A 3CJIB 2LM3A 4B4QA 2F6BA 1ZBA3 1VLNA 1DHKB 1DQ6A 3FHIB 4HVRA 1LOGA 4YW5A 3QD6A 5E8AA 2BFUS 1QDCA 4K8FA 1DBNA 3AYDA 3RJ2X 1CAXA 1DZTA 4W65A 4AHWA 2CYFA 4NR1A 1RUG2 2XHKA 4CRQA 2BPA2 5CNAA 4IQPA 5LRRA 2JG9C 2VG9A 2WNUC 4UW4A 2JEMA 2ZZQA 1LHNA 3AKSA 1MEC1 3H7YA 4XQ4A 4YNIA 4CDUA 4AEDB 4PF5A 1H1MA 2QJVA 2QVSB 3W9AA 4GH4B 1MS1A 1DDLA 3WG1A 5IUQA 4HZFA 4FPFA 2QFEA 3VBRA 2CGOA 5BNPC 1GBGA 1N1YA 1NY72 1VBE1 4AGVA 5FO9B 1OA2A 4XTPA 3RPQA 4LLOA 4NVPA 4CEYA 4M3CE 5IT6A 4IV1B 5EYYA 1V6IA 1F5JA 1IS6A 1RUNA 2JG8B 1ZBE2 4CP2A 1FPN2 2WNEA 3ELNA 3L2YA 1PVC1 1AR73 3ZXDA 4AFBA 1LEDA 4N9IA 1SLIA 1ASJ1 1DGRN 4QPGC 4QU2A 4PBPA 3N3HA 4NO4A 3EO6A 5CIRA 1MQTC 4N43B 1RUD2 4OUSA 3DV8A 1ZZ8A 1RUC2 1U12A 5J37A 3U11A 2WS92 1TE1B 1CN1A 1WBFA 5CFDA 4ONUA 1VRH3 1UU4A 1IOAA 4AGGA 2ZHKA 4WVWA 1GNZA 1UIKA 3Q9OA 1HRV2 2BTVC 1XYOA 3DPRB 4WV8A 2XJTA 1RUG1 4CYDA 5GLWA 2R063 5J36A 3AMMA 4CDWC 1HW5A 1KJLA 4AEJA 5LEKA 3SNMA 3OCPA 4F3JA 1LENA 4EWDA 1ENQA 1C1FA 4ASLA 3HR9A 4U2AA 2RS52 1DZQA 3FE5A 4YW1A 3D6EA 2XJSA 1H1IA 1CAUA 5BNNA 4WBBA 1ZX5A 2D6PA 4YW3A 2NMOA 1EP0A 3M3IA 1W6MB 4MGYE 5BPXA 3RI8A 5AFBA 1WLDA 1NY71 4XEZA 4RQPA 3KM5A 5CA6A 1D4VB 1H8TC 1KJRA 4Q0VA 4MGKE 1QF3A 1POV1 3OD4A 1G9AA 5BUVA 5JPMB 1WMEA 1ZBE1 1FPN1 1S0IA 3PMEA 2ZZJA 1KS5A 2OZ6A 3IBMA 4OHXA 3H7JA 4YM2A 4YGCA 2YZ4A 2ZGPA 1LOCA 5JZGC 1V70A 3ZFGB 3AFKA 2WWSA 1ZA4A 1U5XA 1RUD1 4CDXB 4FT8A 1RUC1 1UU6A 4IETA 2WS91 3BPZA 1D2SA 1S55A 4S2FA 1LESA 1GV9A 5T52A 3VKLA 1S2KA 3LWCA 1HRV1 1ND2A 1O5UA 1B09A 4ATFA 2HKXA 2HWF2 2R16A 4Z8BA 5GLVA 2B8MA 2UWCA 1IS4A 1WD4A 3LA7A 3RYRA 4Q0PA 1RUH2 4UW6A 3E5XA 3ZO0B 2E7QA 2RS51 5JSOA 1GSLA 1AHSA 2Y38A 2HWE2 1N3QA 4L2NA 1C8M3 4K7JA 1MS3A 1V6OA 3VKFC 1W0OA 1JOJA 3BOWA 4GB32 1G9BA 4BMBA 1R083 2FZ1A 2C1FA 3ME2A 1W6OA 4KQ7A 4P9JA 3NAPA 4MVTA 4HLTA 2D3RA 1CAVA 4ORFA 5C33A 2H0BA 1O3TA 1SEFA 2WJSA 1BYHA 1TMF2 5I0RA 3D0SA 4BOWA 1XNCA 4HKOA 4XFGA 4HN0A 3H1WA 4Q4V2 5AC92 4Y1ZA 4AF9A 3O5SA 4E2GA 2FHRA 1QOTA 4LBJA 3WDWA 1IPKA 4NPRA 2XUMA 4Q4X3 3R4UA 3OYWA 3PVNA 4FSJA 2HWF1 4PCRA 2IXIA 1WCDJ 4I3GA 4IV3B 2WFF2 1N3PA 2VH9A 1RUH1 3LB9A 1B35B 4YZ4A 1KRIA 1S0CA 3LKJA 2ZGRA 3KT1A 3OBTA 2XJVA 3CJXA 4YGEA 3V0AA 4EN9B 2V73A 3KGZA 1NZCA 4ZU5A 1H9WA 2HWE1 3FUOA 1UN1A 5ABJB 1D4M2 4HSLA 4GB31 2ZGSA 2GNTA 3FFQA 1N1SA 3ZMNA 4ZXKA 4AVTA 2D43A 4D94A 5H9PA 1CX4A 4YVWB 1CVNA 1CAWA 3WINE 1RC6A 4W6WA 1WW4A 3CF6E 4FPKA 5GLUA 5A33B 2WNVB 1LGBA 1C5HA 1K5MC 1YNAA 4FTEA 2HJIA 4X6RB 4FPYA 2W39A 1RTVA 3VBOC 4LBQB 3PJYA 1TMF1 1S0GA 1DFQA 5GJ6A 4FAHA 2HWC3 1Q8SA 1W6PB 3ILFA 4Q4V1 2B9UA 5AC91 3ZYJB 5A3LA 4W6XA 2D5HA 4CEWB 4HETA 2QE3A 2VVEA 3FJSA 1AR83 4QPIC 2RM22 3TRSB 2W68A 4RR3C 2E7AA 4C91A 3BTAA 2D6LX 1RMU3 5A32A 3FBMA 3ZFEB 3HT1A 2YUEA 2TBVA 3VDDB 1S0JA 2WFF1 1NE6A 2NMNA 4WM7A 3L2HA 2JE7A 4AI2A 4QX5A 1DGWA 2OW4A 2DU0A 4MXVA 1S0EA 3I59B 5I8YA 2A3XA 1RB8G 5JPNB 1ND3C 3CJIA 1MZEA 1VBD2 2YGMA 3AP5A 1GNHA 3WG4A 3ZN5A 1NA1B 3LOIA 4KG8A 1D4M1 3J26N 3KGLA