2YY1A

Crystal sturcture of n-terminal domain of human galectin-9 containing l-acetyllactosamine
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
141
structure length
141
Chain Sequence
QAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galectin-9
publication title Crystal sturcture of N-terminal domain of human galectin-9 containing L-acetyllactosamine
rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 35
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2yy1A00
1QF3A 1UX6A 1N3QA 1JOJA 2PHUA 4BQ1A 3VKNA 3ILRA 1G8WA 2ZABA 3OY8B 4R9CA 4Y1UA 4C1WA 2R1DA 4GWMA 2D6KA 4DPNA 5KXCA 5E89A 3QCWA 1JYIA 3ZVXA 3KM5A 4BLJA 5JVVA 1LULA 1W6QA 3B3QE 3TAYA 4MYEA 3NV2A 3VKFC 5DZFA 3B69A 3BIWE 5DXDA 4M3CF 4Y22A 4YGCA 1UZZA 2D44A 1G9CA 4FOVA 4RL7A 5E88A 5BYNA 3POYA 2GALA 5DZGA 1ONAA 1AZDA 2A7AA 5DG2A 2A6WA 3TB0A 5F5QA 3PJQA 2C9AA 3MPPG 1MS8A 2AENA 3IN9A 2LALA 3PMEA 2A3WA 2R16A 2ZGRA 1MS0A 1V6JA 1ENQA 4Y20B 1FV3A 4Q26A 2W08A 4XJZA 1QU0A 5GLWA 3SH4A 4M3CB 1DGLA 3ZXLA 5JDBA 3WLUA 2ZMKA 1SLIA 2ZHLA 3A0NA 5FRAA 1G7YA 4FPYA 2WT0A 3SITA 2ZMLA 2P3JA 1DQ1A 2NMOA 5DUUA 4UW5A 5JMCA 2UWCA 1W6NA 4Y24A 1RINA 3KQRA 3BODA 1YIFA 5IK8A 2ZA9A 2VU9A 1CESA 2VY0A 3O0XA 1UL9A 4BM8A 1V00A 5DUXA 3AYEA 4Z8BA 1VALA 4XJWA 4AYUA 1QDCA 2OUJA 3B9CA 3WHTA 2WSUA 4YFZA 3MW2A 2A71A 1SLCA 2D6MA 2DUOA 5IK5A 1QMJA 3V0AA 5HCBA 2VUAA 3O12A 3IPVA 5GZDA 2A6ZA 2AH2A 3RMXA 1G9AA 5EYXA 2R1BA 2ZAAA 4OZXA 1MACA 4Q8KA 1GV9A 4AVSA 1GLHA 4UW6A 2YROA 4WVWA 1UAIA 3ZSKA 4YM2A 1BZWA 2VH9A 2XB6C 2LTNA 5IK7A 5F9TA 5L73A 5JOWA 4LBKA 5GZCA 2VW0A 1DYKA 1LOCA 5GLUA 1GSLA 4U2AA 2D3PA 2P34A 3WV6A 1Z0HA 2D6OX 1W6MB 3NV3A 3OJBA 1IKQA 1WW5A 1W6PA 5T54A 2FMDA 2WQZC 4K1YA 1Y7BA 1N1SA 2PELA 1UPSA 5SV8A 1GNHA 1Q8VA 1DYPA 3ZYRA 4ZKTB 5DUWA 1WBFA 1DQ0A 1R1ZA 3IM0A 3N35A 1EPWA 2B7YA 2AR6A 3USUB 1OKQA 1DZQA 1S0BA 4GKXA 2D6LX 2ZGQA 3ILNA 4H55A 4FPHA 4LBOA 1VAVA 2E7QA 1FNZA 2D6PA 3AFKA 1F5FA 4FOYA 4Y1VA 1GZWA 2DU0A 1WLDA 4XZPA 1O4YA 4TYSA 2P2KA 2DTYA 3V0BB 3AZWA 3M2MA 1LOFC 4CRQA 1WLCA 4YGEA 5EXOA 4YM1A 4YGDA 1AVBA 2R49A 3AJYA 3RS6A 2C5DA 5IK4A 3ENRA 1DHKB 1LJ7A 1UKGA 4P14A 2GNMA 4XIOA 4LBQB 2P37A 3WUCA 5AVAA 4ITCA 4YW1A 1W6OB 2A3YA 1S0FA 2CYFA 3AX4A 3H0OA 3MW3A 1S0JA 4Q1RA 3WUDA 4YFWA 4LBQD 2JECA 1CN1A 1H30A 3M1HA 1LECA 1MS9A 3VKOA 4ATEA 4C1XA 3JU9A 1A8DA 1DBNA 2EIGA 3M3QA 5GALA 5DG1A 4P9XA 4BLIA 4YM3A 4RA0A 1GZCA 2DUPA 1ZA4A 1MVQA 1KDMA 1CPNA 2GNDA 1N3OA 4UW4A 4Y22B 1JN2P 3B01A 5HCFA 3SH5A 2A6XA 3AP4A 3CNAA 4XXAA 5EYYA 2RHPA 5E8AA 2YV8A 3AP9A 2DVAA 2WJSA 3RMYA 3T2TA 2D6NA 3OBTA 2KM2A 2A75A 4Q8LA 2A6YA 3ZSMA 2ZGTA 1LHWA 5FREA 3B00A 3M3EA 3N7JA 3WDTA 4BOWA 1KJLA 3PVEA 4CZSA 1ENSA 2DVBA 1KJRA 5H9QA 2A3XA 3WOGA 1ZM1A 1WD3A 1CIWA 4XE9A 1SCSA 1GYKA 2ZHKA 1CJPA 3V65A 4XBNA 2GMPA 2OUHA 4GKYA 1H9WA 1MZ5A 4YZ5A 4WVVA 4XHBA 2VW2A 4HL0A 1RITA 2PHWA 4P9WA 2YY1A 1UN1A 1W6NB 1JXNA 2PHXA 1AXKA 2OVUA 2YXSA 1AXYA 1NLSA 1ULDA 3OYWB 4PBPA 4U36A 3WDYA 3ZXEA 4BMEA 1Q8QA 4JCKA 3INAA 1GICA 1LOAA 2WNEA 1S0DA 1SBFA 3OGGA 2R0HA 1WCSA 2FHRA 5T52A 1GKBA 2SLIA 2ZGLA 1QDOA 5T5JA 2EXJA 3RQ0A 1Z78A 3V64A 1OQ1A 2DTWA 4DFSA 1LTEA 2UWBA 3LCPA 3I8TA 5T5PA 1KRIA 1LODA 1AXZA 3AXEA 4KBBA 3UJQA 4F83A 2ARBA 3GNEA 2GMEA 1YO8A 2JKBA 2R0FA 4FPGA 2E51A 4FPOB 4R9DA 1IS3A 1AJKA 1JUIA 3RG0A 2OW4A 1OFSA 3C2UA 4UW3A 4Y20A 3SISA 3D4KA 3FLPA 1IS4A 4JRAA 4M3CA 1QNWA 1MS1A 4XOGA 1VIWB 2ERFA 2I2SA 3LSDA 2JDZA 3O5SA 4R9AA 1SLAA 2PHTA 1B09A 3AJZA 1RIRA 4YLZA 3M3CA 1S0EA 3AXDA 3Q9OA 1MR5A 5KXEA 3DUIA 3VKLA 4FPLA 3AZYA 3I4IA 3HN1A 1SLBA 1LGCA 4AGGA 4AGVA 1FATA 3WG2A 5CBLA 1YXWA 3IKWA 3N7MA 4PF5A 3D5OA 3AZZA 1WLWA 4Q27A 2DVGA 2G4IA 1AJOA 3A4UA 5T50A 2E7TA 3T1LA 1LOGA 1LEMA 3HR9A 1C1FA 3AYDA 3WCRA 2CTVA 4JC1A 4K21A 3PVOA 5CNAA 4YZ3A 1V6KA 2GNBA 4XDQA 4ZXKA 5IUQA 1V6OA 1Q56A 4ASMB 3N7KA 3N36A 5CB7A 2AUYA 3HMYA 2A70A 1SCRA 2DU1A 4FPCA 3WZ1A 2ES3A 1GZ9A 1AX2A 1V6MA 1MS5A 4ISQA 2NM1A 4FQZA 2PHFA 2VW1A 1SBEA 1DIWA 4XJ8A 4YW5A 2ARXA 1V6NA 3LSEA 3POWA 1PZ8A 1S0IA 1WW6A 4AVVA 3ASIA 2H0BA 2JJ6A 3WG4A 1G9DA 2DUQA 2EAKA 2A6VA 1GBGA 2D3RA 1HQWA 2ZGUA 2ZMNA 1X50A 4LBMA 2ZGSA 1AF9A 4XYXA 5GZEA 2P3KA 2NYYA 4YZ4A 1IS6A 3DGTA 2ZGOA 2VXRA 3ZXKA 4XMAA 4Y1XA 4PCRA 1Q8OA 4GA9A 3W59A 3USUA 1ULGA 3ZSJA 1IS5A 2W68A 4YG3A 5GJ6A 4DS0A 3NV4A 1LHOA 5JLVA 2DV9A 3UL2A 1KITA 1YI7A 3N7LA 1CONA 1W6QB 4SLIA 1AX0A 4R9BA 1QOTA 4XHXA 4YG0A 2ZZJA 1Q8PA 1TEIA 2ZGKA 3AK0A 2WT1A 4I30A 2EXKA 2WKKA 3FLTA 3FUOA 1DFQA 3BTAA 3VKMA 3W58A 3APBA 1JBCA 3O0WA 5KXBA 3R05A 3MEPA 1FAYA 3WCSA 4LBJA 1W0PA 3AP7A 1LU1A 2CWMA 1MVEA 4L8QA 4ATFA 5T5LA 1LOFA 2DVDA 4LBQA 4XIKA 3L2YA 3ILFA 4XJ9A 3AZVA 1W6OA 1BXHA 2WT2A 1C57A 4FP3A 2AGSA 2E53A 5JOXA 3NV1A 2W39A 1C4RA 1D2SA 5KXDA 1BYHA 2NP0A 1G9FA 1IOAA 1QOSA 1S0GA 1YYNA 5H9RA 1MS3A 2GN3A 2GN7A 1DLLA 4P9YA 1LU2A 3NWKA 5JOZA 3VUOA 1LOBA 1ULFA 1N1TA 1UMZA 2JE9A 2YZ4A 3A0KA 1WW7A 3UK9A 5GZGA 3OY8A 3OBRA 1DQ6A 4Q2FA 4W65A 4YW2A 4BPZA 2NN8A 1ULCA 4PBOA 1LEDA 2JE7A 2NZ9A 2ZGPA 3ATGA 3AZXA 3WHUA 1KQRA 2P3IA 4YZ1A 2ZKNA 1PZ9A 3U4XA 3FLRA 1HQLA 5IT6A 4AVTA 3V0AB 1F9KA 5DZEA 3T1MA 1LOEA 3GALA 1CVNA 3IPVB 4YM0A 5CA6A 2TEPA 1JYCA 4GXLA 1FNYA 3R4SA 3JUUA 1N1VA 2ZBJA 1WD4A 4FPFA 1V6IA 4YG6A 3ZPYA 1UZYA 1S1AA 2JD4A 1SBDA 1GANA 2EXIA 1MS4A 4FPJA 5H9PA 1QGLA 1LCLA 3IMNA 3BOPA 2GDFA 4TZDA 1KDKA 2ENRA 3N3HA 3R4UA 2W52A 2CNAA 1HDKA 2NMNA 4M00A 1Q8SA 5LK5A 1BJQA 3AYAA 3OYWA 2CY6A 4FQ4A 4PQ9A 3M3OA 3RRDA 1CQ9A 3WVJA 3WDWA 3PVNA 1GNZA 1HKDA 3AP5A 1HLCA 5GM0A 4FP2A 1LESA 3WG3A 1ENRA 1N47A 2AYHA 1DQ4A 4AWDA 1W6PB 1IKPA 4Y26A 4XILA 1FX5A 2ZGNA 4M3CE 2AREA 4Y1ZA 1APNA 3SLIA 4BMBA 2DWRA 2DYCA 2GNTA 4FOQA 1F31A 4DRVA 4XJUA 1SFYA 3AP6A 3OPZA 1FYUA 1S0CA 3SNMA 1PZ7A 1CR7A 4IQPA 4FVVA 1V6LA 1O4ZA 2Z42A 3D6EA 3VV1A 4WZFA 2GMMA 1N1YA 2BQPA 5T55A 4ISRA 3WDUA 1MZ6A 1CPMA 1FV2A 1LENA 1URXA 2DURA 2UU8A 2UURA 4LBNA 4YZ2A 1H9PA 1BQPA 1GZWB 1NXD1 1BKZA 1QKQA 1SLLA 1VAMA 1LGNA 4NO4A 1LGBA 1LHVA 1AX1A 3FBYA 4FPEA 5GLVA 5CAZA 4XMIA 2XG3A 5JOYA 1I1EA 4XTPA 1U0AA 2SBAA 1SACA 1DQ2A 3ZSLA 1A78A 1A3KA 2EF6A 1C1LA 2CWSA 2ZHNA 4WV8A 5GLTA 5H9SA 1N3PA 3ZXJA 3QLQA 4K1ZA 2ZACA 1D0HA 1W6MA 2CL2A 2D43A 5DUVA 4DQAA 2D7FA 2A5ZA 1ULEA 5GLZA 3MW4A 2HYKA 2EALA 3WNXA 1SLTA 3RSJA 4DRRA 2EXHA 2PHRA 4CTEA 1WBLA 2ZHMA 5T5OA 4HANA 5GZFA 4YW4A 3WG1A 1VLNA 2DVFA 4AGRA 2Q5TA 1I3HA 2UWAA 1WUVA 4XXPA 3ZYPA 3UJOA 2YMZA 3FFZA 4Y1YA 1QOOA 1G9BA 4D69A 3O0VA 1W0OA 4Q1PA 4K20A 4GALA 5EWSA 1LHUA 2WSVA 4XBLA 2ZGMA 3POSA 4M01A 3AYCA 3V0BA 4LBLA 1DQ5A 4FOWA 1XQNA 4XBQA 5HCAA 1QNYA 4GWNA 1J1TA 4YGBA 3WDVA 3ZXFA 1WW4A 4XTMA 4XJAA 1JW6A 2D3SA 1JHNA 2WLQA 4FPKA 3SH3A 4NOTA 2V73A 1G86A 2E6VA 4YW3A 1YRZA 1LHNA 3WDXA 2V5YA 3FUQA
chains in the Genus database with same CATH superfamily
5IYYA 5EQUA 3VBHB 1RTVA 5AFEA 5LBCA 3OY8B 1UYXA 5BNQA 2R1DA 4GWMA 4DPNA 3ZR6A 4OFGA 5E89A 2IC1A 3ZVXA 3CO2A 3FC0A 1UOJA 3LEKA 5JVVA 5C5TA 1LULA 1W6QA 3BPZA 5CFCA 2VJXA 3P6BA 5DXDA 4M3CF 4YGCA 3WW4A 3ITQA 1UWWA 2P6HA 2D44A 3BGAA 1G9CA 4FOVA 5BYNA 5E88A 4UI9L 3J7NA 2GALA 4KQ7A 1OUSA 2WYSA 1PVC2 1PVC1 4N8MA 2BP6A 2W3JA 3TB0A 4EN9B 5CU1A 1UU4A 5FKCA 5F3EA 2A3WA 5LBEA 1WCDJ 2HEWF 2JG8A 1ENQA 2QNKA 5LB6A 2CGPA 4BZ4A 4A6SA 4Q26A 3ACLA 4XJZA 5GLWA 2XH6A 3SH4A 1NY71 1NY72 3WLUA 5CZKA 3A0NA 1QJU3 2WN2A 1G7YA 2KA3A 3NO8A 4FPYA 5FMCA 3NAPA 3O1RA 1UY0A 3USSA 4B1LA 5F1RA 1DQ1A 1LAJA 1WMDA 4CDQC 2OQ6A 4Y24A 1D4VB 1UXZA 1YCIA 5D8AC 3KQRA 1XNKA 2VZRA 1LNSA 1COV3 2ZA9A 5A3LA 1PMIA 1XJAA 2VY0A 1UL9A 3NJZA 3O0XA 1V00A 4IV1B 4OZOA 3AVSA 5DUXA 5FK7A 2OXBA 3AYEA 1SG3A 3VHPA 4XJWA 3B9CA 3J8F2 1DZRA 2LROA 2WSUA 3T3YA 4S2GA 3IB3A 3LDKA 4QQHA 4XFHA 5JMOA 1QMJA 4H3WA 4CP9A 5HCBA 3V0AA 3VBRB 1RJ8A 3MIFA 3RZKA 5LEKA 2AH2A 2R1BA 2NQYA 4V1PA 4URAA 1JYWA 1ZRFA 4E2QA 4Q8KA 1GV9A 3TNQA 4UW6A 2Y6JA 1YEWA 3FHIB 3H9AA 3ZSKA 3C3VA 3W5NA 2Y6KA 1FOD3 4J25A 2LTNA 2WS93 4CDWA 4OHYA 2CGNA 5L73A 4QQOA 5IHRA 3JQXA 4Z82A 2BW8A 2VW0A 4Q4Y3 4ZS2A 1JYXA 5GLUA 3AC0A 4CU8A 2JDNA 1VR3A 1OOPA 1BLZA 1PNGA 2WINB 3RJ2X 2WWSA 5C4WC 3WV6A 1Z0HA 2D6OX 3B93A 3PUIA 3OBAA 5C5UA 3ZSEA 5A1FA 4LUMA 4ARYA 2WC2A 2RR11 2RR12 1IKQA 2ORZA 3LEMA 3DEMA 2CAUA 3O1TA 4C90A 2WQZC 5FZMA 3P1IA 2UYBA 3P3PA 3O1OA 2B42B 1OPMA 5A3WA 3ZYRA 3N9PA 1WBFA 4QGNA 1GOGA 5J37A 2B7YA 4N90A 4A41A 1S0BA 1A34A 4GKXA 4DNYA 2D6LX 3HNBM 3IIIA 2W87A 5F3IA 2W1QA 3UGFA 4QB2A 3ZPOA 1AR71 1AR72 1F5FA 2EVXA 4FOYA 3ROUA 2IUWA 2C6SA 1CAUA 2BJSA 2WZEA 1WLDA 3E5UA 4RR3C 3KV9A 4XFBA 5CKNA 1O4YA 5FYVA 2WNUA 1UF2C 2DTYA 2YFUA 3OD4A 2Y0IA 1WLCA 3VDDC 4JGZC 1AVBA 1GP6A 1RVF3 4YGDA 1YFYA 1PGSA 1LJ7A 1POQA 3WX5A 5LBBA 1HRV3 5DAPA 5FZDA 3LDBA 3AL6A 4YW1A 2BYVE 5EFUA 4E4DX 4DUWA 1HRI1 1HRI2 1OFNA 1GQPA 1S0JA 4X6QB 5A70A 1QJU1 1QJU2 1XSRA 4LBQD 4YFWA 2JECA 4E4SA 1GWKA 4B29A 1I9RA 2VGDA 1GWMA 1MQTA 4B8EA 1A8MA 4CEYC 4CXYA 1YQ8A 5FYZA 4ZU5A 4EN8B 4YM3A 5AC93 1OLMA 4LULA 5LATA 1K42A 2HH9A 3SKJE 1N3OA 1W9YA 4B3NA 3C7HA 4FAGA 1CAWA 3ZIWA 5KHIA 1UCXA 3ELNA 2A6XA 2WLPA 4IGQA 4WVMB 4QDQA 5EYYA 5BNNB 3CBNA 4GMP1 4Z2WA 3T2TA 2KM2A 3BALA 2BNNA 2A6YA 4ASKA 1ZZBA 1LHWA 3M3EA 1VBA1 1VBA2 4NAMA 1R093 3N9MA 4NIGA 2ZOEB 1KJRA 1OSGA 5H9QA 2A3XA 3T2OA 4XFCA 3LF7A 4XE9A 1W28A 1P8JA 3CDZB 3V65A 2JDMA 4XBNA 2Y34A 3O1MA 2J1EA 4LUKA 4MSVA 2LUWA 4W6XA 4WVVA 1F15A 1XNDA 2VOVA 3B7MA 1UU6A 2RS32 2RS31 1H8TA 3NJYA 1XE7A 2YY1A 4IEZA 4Q0QA 4GWJA 4QQ2A 4D6SA 3BU7A 5FO9B 5JXHA 1UN1A 4EZ4A 1C28A 1JXNA 1AXKA 2YXSA 4PIXA 3ZXEA 4KWLA 3T30A 2HWF3 1OHFA 4GH4A 3INAA 5L9VA 1GICA 2RV9A 2WNEA 1V70A 2G9ZA 5JSRA 1QHDA 1WCSA 2E31A 2XJSA 3C8XA 4MXWB 3VBOC 1QDOA 3FX3A 5FV3A 1ND3B 2EXJA 4EZHA 1Z78A 3MFCA 4AEDB 3V64A 4DFSA 4X6RB 5FY4A 1LTEA 1WMXA 3I8TA 1LODA 1XBFA 4LKSA 4RS5C 4GIQA 4F83A 2YUEA 2ZJCA 2JKBA 3UYJA 4R9DA 2E51A 4FPOB 3MO4A 4CP2A 4CUGA 4D6QA 1AJKA 4CEWC 1D4M3 2OW4A 5A6QA 4UW3A 3GXUA 2Y64A 3CZUA 4I0BA 1IS4A 2KXLA 3ECQA 2B9VA 4LLOA 4M3CA 3CKHA 1MZEA 1QNWA 3O14A 5F3GA 3VLBB 1VIWB 3O5SA 1QWRA 2JDZA 3EJKA 3LSDA 4CDUC 5FP7A 2MPFA 2YB7A 5IVCA 3ETQA 3TEYA 3CJXA 3DV8A 5B4XA 5C9AB 2OYZA 4B7KA 5C8WA 1S0EA 3R4DB 1REDA 3Q9OA 2AC1A 3HT1A 2L9LA 3KCCA 4NIDA 3AZYA 3KGZA 4N53B 2FDIA 3WG2A 1ZZ8A 5CFDC 2Q1ZB 3N7MA 4GWIA 1NZIA 1RMU3 2G4IA 4PLNA 4BQ5A 2E7TA 1EUTA 4MV2A 4EWAA 5FUIA 1LEMA 3HR9A 4QXCA 1C1FA 2Q8CA 4JC1A 5AC91 4DMIA 5D21A 2GNBA 1EV11 1EV12 2PHLA 5FPZA 5ISLA 4N43C 2UY8A 3PMSA 3Q8BA 1L7RA 4IEXA 1SCRA 3WZ1A 3ZKYA 5LW9A 4P5YA 4R4ZA 2YG0A 1V6MA 4WM7C 1H4GA 2KD7A 2IWGB 1UNBA 2PHFA 2VW1A 1OXCA 1DIWA 1SBEA 3MIEA 1O5LA 4FQZA 1VBD3 5J09A 2EIDA 1ULPA 3AMQA 2OT7A 4XFGA 1OQDA 2Y33A 4NMIA 4AAPA 3QH6A 1DLCA 5FP9A 2FCUA 1GBGA 1K5MC 1R1A2 1R1A1 1XXNA 2GC1A 2P5BA 4QPGB 1XNBA 4XURA 4EWDA 2W94A 4IE7A 4YZ4A 4ET7A 1IQDC 1KGYA 4FTBA 2VXRA 5KWRA 1VB2A 2WDBA 1OMIA 3ZYFA 2J1SA 4OULA 3W21A 1TMF2 1TMF1 2VPVA 3USUA 3ZSJA 1IS5A 3URFA 4L0PA 1DZTA 2E33A 5GJ6A 3WINE 4DS0A 5FO7B 1IPSA 2DV9A 4LO6B 2F4LA 1YI7A 1DGWA 1PNFA 1VP6A 2C0ZA 5JZGA 4SLIA 1HB1A 4TLFA 1AX0A 1YFXA 4HKOA 1W3VA 2P1BA 3L9JT 3NMBA 2OS2A 3RZHA 3J7MA 1GP5A 1FT9A 2HWB3 3O0WA 4NVPA 5FCCA 4NRMA 4BA6A 2JG8C 4AG4A 2XQXA 3GHNA 1W0PA 4KH9A 3IMMA 4F3JA 1LOFA 3IWZA 2DVDA 2XKPA 1QJX2 1NA1A 1QJX1 5C8CA 4MX3A 4IGOA 1C5IA 1W6OA 1BXHA 3PHMA 1UIKA 4FP3A 3NAPC 3BB6A 3ZYIB 2NP0A 2TUNA 5FQ0A 2VMFA 1X8EA 1RB8G 4OI0A 1UZWA 1MS3A 2GN3A 4LQRA 1DLLA 4MGKE 5DAXA 1LU2A 3LD8A 4QPIB 3CQOA 1LOBA 2JE9A 3A0KA 1A6CA 5EJ3A 1C3HA 5C3QA 1AL23 1S2BA 3RDIA 3OBRA 1UOBA 4Q2FA 4W65A 3LB9A 4Y5Z0 5FTTC 3C7EA 5FPUA 3OGRA 3RZJA 2JE7A 4CCJA 4CU9A 3WHUA 2IXJA 2P3IA 4UF0A 3CJIA 3U4XA 3FLRA 2JDYA 3VZLA 2OKXA 4AVTA 2K46A 3THCA 5E16A 1UKRA 2WIIB 3GALA 3IPVB 4YM0A 3UNPA 4QX0A 1JYCA 3WNNA 4GXLA 5IJRA 4CDWC 4JGYB 4NHKA 4IEVA 3MF6A 5A80A 3LFIA 5FZ7A 4JKLA 5FOJB 4PIYA 1WD4A 4FPFA 4YG6A 2JD4A 1SBDA 4DUXA 2EXIA 5H9PA 5DQ0A 5A7QA 2VULA 3IMNA 1GWLA 1XOYA 4PI2A 3N3HA 4NRQA 5FYIA 5IVYA 3ZFGA 2PLV3 1HDKA 4M00A 3AKQA 4PQ9A 4FQ4A 2Y60A 1T6BX 2MEV1 2MEV2 2EIBA 2RVAA 2GC2A 3Q8FA 4JHTA 1OD5A 4JQTA 5ANQA 5GM0A 1HKDA 2ZX3A 3WG3A 1HLCA 1X7NA 2JE8A 5K7PA 5A32B 4MGTA 1QIQA 4JKKA 1J3RA 5A7WB 5J3UA 5FYUA 1IKPA 1R083 2RMU3 1FX5A 2W95A 2ZGNA 4XILA 3VHOA 4Y1ZA 3SLIA 2JB8A 3AVRA 2E26A 4QKBA 5FYTA 4BIOA 4BMBA 4DRVA 3IT8A 3AP6A 3O1PA 3GJAA 2WL1A 3NKTA 2FQPA 4RGGA 5IVBA 5A3TA 4WM8A 1V6LA 3D6EA 4XAEA 4WZFA 2JICA 1RUD3 4BH9A 1CPMA 1W2UA 2WNUC 3RYRA 4TSVA 1URXA 1V9U3 5JXIA 1F8VA 5F5AA 4I09A 2XDVA 1BKZA 4DUVA 5FZBA 3U0ZA 1LGBA 5GLVA 5F7UA 5I93A 2JDKA 4Q0PA 4KWKA 2QQJA 3UGHA 1HV0A 2GAUA 3PVBB 5JOYA 1U0AA 3HBKA 3F95A 5BUVA 4HZFA 2EF6A 4PDWA 3WEZA 2ZHNA 5GLTA 3ZXJA 4BXFA 1N3PA 2MNGA 3TOJA 1W6MA 4N7IA 5FJHA 4UBGA 1MQTC 3KSCA 3MW4A 2VG9A 2PAMA 2B39A 1GU3A 1SLTA 3RSJA 1T6GC 3THDA 2ZHMA 2DF7A 2OIIA 3HQRA 2ZEWA 2PQQA 4YW4A 2RM23 1K12A 5FREA 3ZYPA 3JBG1 3JBG2 1LR5A 2NPIA 4MOAA 3ZYJB 4K7JA 5C3RA 5FJKA 4HVRA 3AKRA 2XLGA 4HG6B 2Z69A 3H3ZA 1YUDA 3OB8A 3KF5A 5EWSA 1ZBE2 1ZBE1 1VMHA 3H8OA 5C3SA 3JZVA 4BXSV 2WQ8A 4FAHA 5A7NA 3GBWA 3AYCA 3KQ4B 3V0BA 2R6QA 5JXGA 3E97A 4LA2A 5EPAA 4W50A 3IDEA 4L2NA 4JGZB 4GWNA 3I2DA 5EHDA 4YGBA 4YVWA 1O5UA 3ACIA 3U78A 3AKPA 5EV7A 2V73A 2PQSA 2E6VA 2BWAA 1G86A 1U12A 5BNOB 1XE8A 4YWAA 2PLV1 4D94A 1J3PA 2RDQA 3J7HA 4DXRA 3B02A 1CZSA 4JHZA 3VBSB 2PHUA 3E5XA 4ZHNA 4C1WA 4CEYB 1PO12 1PO11 4QPWA 1Y9QA 4C0HA 5A3UA 4BLJA 3GCWA 2QCSB 3TAYA 1GOHA 3U07A 1AR83 3I59B 1H0BA 3W5MA 2Z4FA 2QDNA 4Y33A 2BBVA 4P00B 4Q5OA 5FZ4A 1JZ6A 2H6CA 4ES8A 2PHDA 5LY1A 4CP0A 1AZDA 5DG2A 2O0OA 1RUOA 1FPN3 1AR61 4AF9A 1AR62 2CDPA 1H2KA 3KHBA 3HQUA 2AENA 2NLRA 3IN9A 2LALA 5CIRA 3J4UH 1V6JA 4LO5B 4HK8A 2ARAA 3CZJA 5IVJA 5JDBA 5A3NA 2Y38A 1SLIA 2ZHLA 2IVIB 2ZMKA 3H8RA 2EICA 3NW4A 4TWTA 5J36A 1W9WA 5FP8A 4Q4X3 3ZLIA 3SITA 2ARCA 2P3JA 3WNPA 4IV3A 4UW5A 2UYAA 2VVEA 1W6NA 5FLJA 1SFPA 2XHNA 2OQ7A 3MLKA 2V5DA 2VU9A 1CESA 3T4VA 1ASJ1 1ASJ2 1NCRB 2VCCA 3AB0A 3K51A 4YFZA 3WHTA 4NIAA 4F7ZA 2QFEA 1SLCA 2DUOA 3MPBA 1W2OA 3OG2A 5A33B 5IK5A 1Y9GA 1VRBA 3O12A 3RPQA 1CAXA 4UAPA 5GZDA 5IVVA 1G9AA 5LEJA 1RXGA 3U11A 4P08A 2RM21 1AL0G 1VBE3 2FZ1A 2R063 3O7OA 2IXKA 4OZXA 1RUJ3 3KMHA 4RS5B 4RHV3 3X29B 4AVSA 1IG3A 5A6XA 3ORJA 2YROA 4WVWA 4HBNA 4A7KA 1HXS3 2C1FA 1SZBA 4FT8A 1RYYA 4CEWB 1IPKA 2Z5WA 1C5HA 2D40A 4GB33 4KG0A 5F9TA 5IK7A 1YFWA 4LBKA 1SPPB 4RSUA 3FFQA 3OUHA 4K9SA 1H2MA 4IE4A 1LOCA 1S4CA 3MDPA 5K0UA 4E2GA 2QQWA 3A7QA 1PO22 1PO21 2Q30A 4FFHA 1ULOA 1PX4A 2H0VA 3NQHA 2ZZQA 5LASA 4AFAA 1WCKA 3LEIA 5L19A 3DXUA 5J1XA 2DCTA 4EN0A 3OJBA 2WNVA 1WW5A 4BJ0A 3ACHA 1RUH2 1RUH1 3OGSA 4XCBA 4CCEA 2X09A 3GJBA 1LRHA 2FMDA 3NL1A 1RL3A 4RFRB 5FZKA 1OH4A 1GNHA 2WQ4A 2PA7A 3RGBA 1DYPA 2Y6GA 3PIJA 3BU0A 4P9JA 5DUWA 4BISA 1DQ0A 3LFMA 1EUUA 1EPWA 2AR6A 1HN0A 1W8NA 2R073 4BQ3A 1DZQA 3VN4A 5JZGC 2QE3A 1RC6A 5FY1A 1BBT3 4FPHA 4H55A 4BK4A 4Q4V2 2E7QA 1FNZA 4Q4V1 4DXSA 4QXBA 4N43B 3T09A 2XJQA 4Y1VA 1GZWA 2HWC1 2HWC2 4IEUA 5EZWA 4DEVA 3D82A 2Y6LA 4TYSA 3VBFB 1ZVFA 2P2KA 4JDMA 5BXXA 1OLRA 1LOFC 4CRQA 5C8CC 5FZ9A 1NA1C 1YC61 2X5IA 4YM1A 5JIUA 4XUQA 1O59A 1HB2A 1OVSA 3ENRA 1DHKB 1TNRA 1ZBA1 1XC6A 1ZBA2 2VMDA 1GQGA 2XGXA 4P14A 5I0UA 4XIOA 5TSWA 2DCZA 3RI9A 1QJY2 1QJY1 4JDOA 4XQWA 2H6BA 5I8TA 1LKNA 2ZXQA 2A3YA 1H8VA 2JENA 3I3EA 3AX4A 1D0GA 1HX6A 5EP9A 4YVSA 5EJZB 2BERA 3GZEA 1MEC3 4AEKA 3ALQA 4LK6A 4FTEA 5KC6A 3ZXAC 4XACA 2ZX0A 3M1HA 5F8PA 1MS9A 3RWKX 4C1XA 1A8DA 3ZN6A 5DG1A 1RUC3 1VAKA 4RA0A 4CDXB 1KDMA 4AFCA 1DGRA 1PVXA 3VDAA 3CJIC 5E1RA 3DN7A 4E4ZA 3H50A 3DPRA 3CNAA 4NN0A 4OMCA 4XXAA 5FZOA 2RHPA 2JX9A 3PJYA 3AP9A 2WJSA 3AMMA 3RMYA 4L92A 1XU2A 3IDCB 4AFDA 2ZGTA 1RUF3 3LA3A 2CU5A 1TE1B 3B00A 3EMRA 3N7JA 1KJLA 1NZCA 1ST8A 4LA3A 3WDTA 1ENSA 4CZSA 2DVBA 3C7OA 5L7OB 2YC4A 5ABJB 5FPVA 5ACA3 3WOGA 1WD3A 1SCSA 2ZHKA 3WSOA 4AVCA 1CJPA 3S57A 5I91A 3GYDA 5F2SA 5FBZA 3TEZA 1L3JA 5HCHA 1DG6A 1H9WA 3NSTA 1X9PA 2VW2A 4AR2A 4ZPIA 4D7SA 3MBWA 3U4SA 1OLQA 2W1UA 3VBHA 4XUOA 4DEQA 2WWUA 4XETA 2RS13 1XNCA 4URTA 1NLSA 2B45X 3K4DA 1Q8QA 4MH0E 3HIFA 3WW3A 2FHRA 2RS52 2RS51 1AYN1 1AYN2 1NCQA 2ZGLA 4LIUA 4OVEA 2F17A 5T5JA 3RQ0A 3UT0A 4DOUA 4WM8C 4MGSA 3T2PA 4BWOA 5FZHA 4HSJA 5FLHA 3IAQA 1NLRA 4LE3A 5FZGA 3WW1A 5AVPA 1CWPA 3UJQA 1AR91 1AR92 5FBJA 2HWE3 4XQ4A 1H2NA 2GMEA 1BBT1 1BBT2 1W04A 1WMFA 4FPGA 4QX8A 1CD3G 5HPOA 4XDPA 1IS3A 3O1VA 3Q8EA 1RHI1 1RHI2 2OX0A 4YPJA 3PTRB 1WA6X 3MIBA 2YBSA 3GZUC 3POBA 3E1F1 5FY7A 3RNSA 2VTXA 4IEYA 2PXJA 4XUNA 1UW8A 2V09A 4PDWC 3VHRA 3WQ7A 4A3ZA 2PHTA 5CYYA 3JQWA 3UKNA 2PTMA 2VUCA 2IXLA 2VNGA 3OTFA 3WF2A 4FPLA 1H6XA 1SLBA 4XQDA 1FATA 3OUJA 5BV6A 5LCWL 1YJKA 1PIV3 3IKWA 4PF5A 1OF4A 3D5OA 5KR7A 2DVGA 2BU9A 1AJOA 4UYBA 5T50A 3VBRA 1RUG1 1RUG2 4N9IA 1H1AA 4UOJA 1VBB2 1VBB1 5EJ1B 1JZ4A 4XZUG 4YZ3A 1JI6A 4A44A 4DIQA 1V6KA 1QXJA 4XDQA 4QPYA 4ZXKA 4NE9A 5IUQA 3UV9A 5FDBA 1RUE3 1V6OA 1UYPA 3D8CA 3N36A 2AUYA 2A70A 2ZAHA 1AX2A 2G9GA 2JKXA 1QJZA 1L7QA 3N9NA 4QM9A 3LGRA 4CCLA 4RN5A 5FLIA 5FYCA 2ARXA 1V6NA 1UO9A 4XW3A 4B4PA 4YVWC 4AVVA 3PLQA 2JJ6A 3QD6A 1JU4A 2JG9B 1X8MA 3K3OA 3M8LA 3VZMA 2DUQA 3WG4A 5LRSA 2EAKA 2RJLA 1DP0A 2ZPXA 3M7AA 4NWVA 4LBMA 2TBVA 1HQWA 4MUVA 1UZ0A 3HBZA 5LA9A 2F6BA 2RDRA 2DBIA 3MHZA 4NJ4A 5GZEA 5BNPB 1IS6A 2DDUA 3MIDA 4ZZ8A 3O1UA 2QQKA 3ZXKA 4FXKB 3LPFA 1JU3A 3ZFEB 2YBPA 3BCWA 3W59A 1ULGA 2W68A 2HKXA 2VUDA 4CPBD 2YC2A 4Z1VA 3NV4A 1PHMA 3UL2A 3NNGA 1KITA 1WCQA 4KWJA 4LXLA 2VMIA 3PUQA 1OKOA 3U37A 3I2OA 1CONA 4OUSA 4NIHA 1COV1 1COV2 4R9BA 3A21A 4ASLA 4EV0A 5J98B 2ZZJA 1Q8PA 1TEIA 1DF0A 3IDAA 4I30A 3N9QA 2EXKA 2WKKA 3FLTA 3BTAA 5DAQA 3LE0A 1FAYA 2J1TA 3TYJA 3MGUA 1OLME 2JIGA 4JRLA 4YW7A 5LZ6A 4FO9A 4OHXA 3J9SA 3FWEA 1LU1A 3H1YA 5FOBB 2X10A 1W2TA 4HFSA 4R8HA 5FZAA 3MFAA 4NUBA 2WT2A 2BV4A 3HNYM 3GHMA 2VNVA 4W4ZA 3SHRA 2AGSA 2PAEA 2VE1A 1C4RA 4IV3C 1FOD1 1FOD2 1BYHA 2WS92 2WS91 3S5AA 1YYNA 2XJTA 2I45A 1JUHA 3LIGA 1GP4A 4J1WA 1F4AA 1I5ZA 1NX9A 4Q4Y1 2B8MA 4Q4Y2 4TN7A 4BQWA 5A3MA 2YZ4A 3B5LB 4OCTA 1AHSA 1S2KA 3BI3A 4UFIA 2DCJA 1XNTA 4XPVA 5C6CA 1T2XA 4YW2A 3WF0A 5BNNA 4PBOA 2QQLA 3ATGA 1PX3A 2AEZA 1PK6B 3S30A 3THPA 4CCDA 3J26N 2W5FA 3WY6A 4MGZE 1OURA 1F9KA 5DZEA 1E57A 4P9IA 3JB8A 5BPXA 5FZ0A 1FNYA 3R4SA 1RUE1 1VBC3 1JZ5A 1W06A 1PM4A 1ODMA 3H3UA 2ZBJA 5K0UC 2X05A 2ZCWA 3HT2A 1OI6A 3TEXA 2W91A 4FPJA 4IEPA 1QGLA 1LCLA 4CVUA 4TZDA 2BRTA 2ENRA 2W52A 4OQ8A 2CNAA 2XJPA 2WNVC 3WNKA 1Q8SA 1BJQA 1XPWA 5T3NA 3M3OA 1CQ9A 1WCUA 3WVJA 3WDWA 4IERA 3PIGA 1GNZA 3AP5A 5FMOS 4NHLA 1RVF2 1RVF1 5DMYA 3E6BA 3ZFFB 1W8UA 2Y0OA 2AYHA 2WFPA 1W6PB 4MXWA 1JS9A 4Y26A 3V56A 5B4NA 1ND3A 4M3CE 4K8FA 1NAEA 1C8M3 1HRV1 1HRV2 4AQ6A 1APNA 4FFFA 1F31A 4P5HA 1SFYA 4KWUA 1FYUA 1S0CA 4I0AA 3R6SA 2JDUA 1CR7A 2ZX4A 1KD7A 3FHQA 4FVVA 3NRUA 3VV1A 3BUCA 4Q0SA 1N1YA 4X8NA 2W1WA 5T55A 1EAH3 4ISRA 3KT7A 4PQQA 3U75A 4PT6A 5AC92 1W05A 2UURA 3TBDA 2FD8A 1DU3D 4LBNA 2VMHA 4ZS3A 5BNOA 1H9PA 2X5IC 4NWWA 4IEQA 2D97A 1QKQA 2XWJB 3UKTA 4MZUA 3ES1A 1HV1A 4FPEA 4OI4A 3K4ZA 1UMHA 1SQ4A 5C9AA 1I1EA 4P9GA 2VQ0A 1ZZ9A 1W0NA 4H2AA 1A3KA 3VBUB 5IT6A 4YVSC 1OQEA 3MLJA 1R091 1R092 3THTA 1KS5A 3HQXA 2ZACA 4H7MA 2D43A 3DF0A 4AI1A 4NHXA 3VZNA 4CCKA 2VBPA 2A5ZA 4M4RA 3ZN4A 5GLZA 2XVGA 3WP5A 4HK9A 3IAPA 3RFRA 4CTEA 2FDJA 3RYPA 5EIYB 2GC0A 5GZFA 1QEXA 3K4AA 2V4VA 4NPRA 4AGRA 2Q5TA 1CIYA 3NJXA 2UWAA 3OEAA 2IZWA 5FZ8A 3DPRC 4AVBA 1WUVA 4XXPA 5IFTA 4JAAA 5FY0A 3UJOA 5CFCC 1BEV3 2WA3A 2ILMA 5JZGB 2HWF1 2HWF2 4O61A 2VCMA 5I0DA 2YMZA 1G9BA 2WWJA 4XF9A 2JXAA 2XVLA 3A22A 4AAXA 3FJSA 1BK1A 4GALA 4K20A 3GBGA 3VDCA 4AFMA 1LHUA 3S7EA 4EN6B 3T4HB 2J7MA 2K0GA 3POSA 4M01A 4CA9A 2ZS6B 4FOWA 1XQNA 4XBQA 5HBAA 5HCAA 3E6CC 3TN93 1JYTA 4KU7A 3LA7A 4XFAA 4QPGA 5GKAC 3NNFA 3RVHA 3VBHC 3SH3A 3K75B 3MV01 4NOTA 1B35A 1TQ5A 1US3A 1W8TA 1D4M1 1D4M2 4JKMA 2Y6HA 1NXMA 1YRZA 4YW3A 3WR0A 1LHNA 3LZZA 3WDXA 4DB5A 3FUQA 1N3QA 3N4MA 2GC3A 4BQ1A 5DDJ3 3LWCA 3ILRA 1G8WA 1NCQC 1X82A 2ZABA 4PHZA 4RQPA 4Y1UA 5SV5A 2D6KA 5KXCA 1JYIA 3TRSB 2VCAA 3VKFC 2VZUA 1CZVA 2DFCA 3NV2A 3B69A 3BIWE 2XKOA 4HPKB 4Y22A 5DZFA 5IWFA 4CUBA 3KHCA 1HJGA 4C0BA 1AYM3 3KVAA 4MGQA 4LHKA 3POYA 1OD3A 1RMU2 1RMU1 5LY2A 3PUHA 1ONAA 4LR4A 3MZHA 5IFPA 4FXGB 5DN2A 3M3IA 2VUJA 5FYSA 3GDBA 2G9FA 2QQOA 4MXVA 2R16A 4S2FA 3I3MA 4CUCA 2IXHA 4YARA 4Y20B 1FV3A 4W8JA 2W08A 1QU0A 2D5HA 2Y8KA 1DGLA 3ZXLA 4EN7B 4XC9A 1OOPC 1SFNA 1NOVA 5FRAA 2WFF3 4E27A 5IVEA 2WT0A 2ZMLA 4QPIA 1VBD2 1VBD1 4L97A 4TLGA 5JUVA 1VRH3 3SCGA 3ZOIA 2JD9A 3K3NA 3PTYA 4W6WA 2RDSA 4AEMA 1ZZ7A 1REEA 3BODA 4D0QA 5D1IA 1LB2A 2FMYA 3N9OA 3RWNA 4BM8A 2R043 3VBRC 1IHMA 2WN3A 2O8OA 4CDQB 4Z8BA 4AYUA 4FTSA 1R64A 1Y9MA 4TXWA 4XF1A 3WQ1A 5D8AB 3I2JA 1DGWX 3IDBB 2D6MA 1E5RA 5FR3A 5JR7B 2Q4SA 2BGPA 4YYOA 3LIHA 2WNOA 3FL7A 3IPVA 4AK3A 4BK5A 1Y3TA 3J7LA 3ZIXA 3I54A 3I2HA 2ZAAA 4IETA 1MACA 2XOMA 4JGYA 4IE0A 3VZJA 5KBFA 4JTOA 4RFT0 4BIFA 1GLHA 2E63A 5FMDA 3KCXA 4YM2A 1VJ2A 2WR9A 2XB6C 2Z79A 5DABA 5A3PA 3K77A 5JI7A 1X36A 1POV3 4R4XA 3D0JA 2FCTA 2ZKLA 1DYKA 4HONA 4QXKA 1W39A 3ABZA 4HMZA 3JD73 2D3PA 4PDWB 3UETA 4DO0A 3WF3A 3DECA 2HWB2 2HWB1 1W6MB 4LTAA 1V0AA 3TN91 2CGOA 4ES9A 5A32A 3H42B 5A7WA 2VOWA 3JB4C 5JSOA 2BDRA 2P3YA 5T54A 1WA4A 5C4WB 5KHKA 2Q1MA 4K1YA 4HKLA 1Z7S3 4CCNA 4K3UA 4KBZA 2XQRA 5F32A 5SV8A 1ND2A 3LKJA 3IM0A 3N35A 3I3DA 4IGPA 3JXSA 1JZ7A 1QJFA 4XABA 3KVBA 4QAWA 4A6OA 2ZGQA 3ILNA 4DINB 1I5PA 3HNMA 1VAVA 1XRUA 1VMFA 1Y4WA 1RUI3 4COVA 3LOIA 1AL21 1AL22 5C70A 1ZZ6A 5FFOC 3FZ3A 1RJ7A 4QU1A 3UGGA 3ZDSA 2DU0A 3B9IA 1UQXA 2VZ3A 1NQJA 5JIAA 2JB4A 1WWYA 4QDSA 1Y43B 5CVRA 3WQBA 3M2MA 4JTNA 3V0BB 4I0WB 3ON7A 5EXOA 4RR3B 4AEJA 1CAVB 2WZR3 4LMFA 3L2HA 2C5DA 5IK4A 5J7MA 2VMGA 4D6RA 2GNMA 3UESA 3O1SA 4LBQB 3VDDB 4D8MA 2P37A 2Q8OA 5AVAA 1U5ZA 1PMJX 1UY1A 1Q3EA 4ITCA 5FKBA 3ZR5A 1S0FA 2CYFA 1VB4A 1H8TC 2ZEYA 4IXLA 2QUOA 4B4RA 3MW3A 2WRAA 4Q1RA 4CCMA 4GJZA 3HD8B 4A7YA 2XXZA 3RZGA 4CPBA 4A42A 1H30A 4OHWA 4H14A 3GCXA 3VKOA 4QD2A 4ATEA 2PLV2 4GH4C 3M3QA 2WZPP 1NUKA 3IBMA 5BNNC 1YQ5A 1GZCA 4NROA 2DBNA 1ZRDA 4KGQA 5LRRA 2R30A 1MVQA 1FI2A 1CPNA 4ONUA 4UW4A 4LHSA 1XB9A 4ZY9A 2XBO3 5HCFA 3MIHA 1QQP3 3ES4A 1GR3A 3ZN5A 5E8AA 1R081 1R082 2RMU2 2RMU1 2O1QA 2DVAA 2WAOA 3H7JA 5FPAA 3S7IA 1JOPA 4E4HA 5C3PA 2A75A 4OHVA 4I01A 4Q4W3 4B4QA 4BOWA 2WO7A 4AXOA 3PVEA 3CL1A 4EYUA 3ZDVA 1JODA 1ZM1A 4RD7A 1CZTA 3KWVA 2BPA2 3PL0A 1ENXA 4UFHA 4AHZA 1RUD1 1RUD2 2GMPA 2OUHA 2W47A 4GKYA 1MZ5A 2W1SA 3I2FA 4XHBA 3RI8A 4DY5A 4YZ5A 4HL0A 1RITA 2PHWA 1V9U1 1V9U2 3KV6A 4Q0VA 4UFLA 1J3QA 2GH2A 4XUTA 5FMOL 4IV3B 3VBSA 1TME3 1W6NB 2FCVA 1UYYA 2PHXA 2OVUA 2TNFA 1AXYA 3OYWB 1ULDA 1YQCA 4U36A 4OUEA 4I3PA 4UXAA 5DPNA 1FMD3 1ND3C 2E7AA 3A23A 3WDYA 2HBTA 4PLMA 4AOCA 1BVVA 1GKBA 4AI9A 1U5XA 3BN6A 4NR1A 3SEEA 4C91A 5DAWA 3I59A 5FK8A 3FBMA 1RUNA 3ME2A 3FE5A 1OPOA 1OQ1A 5BY5A 1JYVA 1DCSA 2OA2A 5FPXA 2UWBA 4GJYA 3LOBA 2CHHA 4Q29A 3CEWA 5FYYA 3VBOB 3AXEA 4E8CA 4KBBA 1OH3A 4QT6A 5HXMA 4G3YC 3NKGA 2ARBA 3H8XA 2P17A 3GNEA 1OA2A 1WMEA 2R0FA 3VGIA 5FO8B 1HN1A 1OBNA 2RJKA 2JDAA 1K45A 2RM22 4YNIA 3RG0A 2BVVA 3C2UA 2P6CA 5DAVA 3SISA 1XYOA 3W20A 3D4KA 3SC7X 1W90A 4JRAA 4LKFA 4LOTA 1MS1A 3WP4A 2I2SA 2ET7A 1SLAA 3H1MA 1BHGA 1Q5OA 1B09A 1UD1A 3MLLA 3OPWA 2ZEZA 2AZ5A 1RIRA 2B4KA 3D3AA 4Y4RA 3LDRA 3D0SA 1MR5A 5IW0A 3DUIA 1JYNA 4CDUB 1NG0A 2D93A 1NCRA 2ET1A 2WO1A 4META 5B2GB 2JDHA 4AGGA 1LGCA 2Y26A 3MIGA 5CBLA 2BWCA 1YXWA 5FYHA 5FUNA 5F39A 5A33A 2LS6A 3CLPA 3AZZA 3OSDA 5FZ3A 3ZMNA 3T1LA 1PVC3 3A4UA 3M4FA 4LNVA 1LOGA 1XSQA 2QDRA 1M06G 1IPJA 2CTVA 4QB6A 4K21A 5CFDB 4RS5A 3K48A 2O8QA 3HAGA 2QQIA 5FUPA 3MYXA 1W3XA 3HMYA 2AEYA 2DU1A 5HV4A 4CEWA 4ISQA 1SPPA 4UWDA 5J48A 3MF9A 4YW5A 4QX1A 4JV4A 1AR81 1AR82 1C8NA 4MLOA 2XJUA 3LEGA 1UPIA 5FZFA 1WW6A 4COZA 3AM2A 4WM7B 4QPGC 1G9DA 2VTFA 3ZX7A 1S55A 1B35C 1WZXA 3MI8A 4KGGA 4A3XA 4HN0A 1OUXA 3P5BA 2D3RA 2ZGUA 2ZMNA 1X50A 3J8F3 2B46X 2BGOA 1FPN2 1FPN1 2ZGSA 3BPSA 4IE5A 1AF9A 4LHNA 4C8DA 2P3KA 2NYYA 4I3GA 2ADDA 4FCAA 4HKWA 4HXCA 4RQPC 4XMAA 1EP0A 4Y1XA 4HOOA 3EYPA 1K5MB 5FP3A 4XAAA 4GA9A 2V5YA 2VTXJ 3C7GA 4ZXEA 2XMLA 1FMD2 1FMD1 4O7XA 4Q4X2 4LKDA 4Q4X1 1JZ3A 2BOIA 5JLVA 1J1LA 1OC1A 1SEFA 5L9RA 4N43A 5FZOB 2VZOA 5CFCB 1W6QB 3B94A 4XHXA 1QOTA 3VBFA 4AI0A 2ZGKA 2WT1A 2HWD3 4J6GA 2IXCA 1JBCA 5HXVA 5A7OA 1M4WA 3MEPA 1E5SA 2RR13 4LPLA 3GM8A 4OI1A 4JDNA 5JCTA 2G1MA 2CWMA 2VAUA 1MVEA 2ZEXA 5T5LA 4D7YA 1ACCA 3C7FA 5FXXA 3S0MA 1VBE1 1VBE2 2R061 2R062 2BFUS 3ILFA 1RUJ2 1RUJ1 3AZVA 4RHV2 4RHV1 4XJ9A 1C57A 3SEPA 2JG8B 3MUY1 3VD4A 2E53A 4QPIC 1HXS2 1HXS1 2CDOA 2W39A 1H1IA 3ZFGC 2IXIA 3U10A 4E2SA 5CEHA 1QOSA 1PGW1 1PGW2 2VCBA 4GB32 4GB31 4LO7A 5H9RA 1NKGA 4I02A 2JIJA 5JPMB 2GN7A 4P9YA 3NAPB 1UOGA 4XEZA 4MGIE 3VUOA 5JOZA 2YU2A 4CDXA 3OBZA 1JZ8A 5HV0A 1WW7A 1AR73 2KR2A 5GZGA 1NCQB 1Q43A 3OY8A 2A73B 4XF0A 1DQ6A 3TWIA 4Y3OA 2OZJA 4BQYA 3GZTB 4Z07A 4YW6A 1ULCA 4YRDA 5LA2A 4QHZA 5I0TA 3EQEA 3GF6A 3QACA 2ZGPA 2CV6A 3PURA 3AZXA 4PLOA 4XDOA 2A1XA 2ZKNA 4JGYC 1PZ9A 1U5IA 1HQLA 5L36A 1OF3A 2C24A 2VZPA 4CP9B 3AMHA 3I2IA 1RXFA 3V0AB 3T1MA 5CA6A 1CVNA 5L7OA 2TEPA 5ABJA 3DXTA 1XYNA 2QQNA 4E8DA 1CJDA 2UY9A 3JUUA 2R072 2R071 2PFWA 5LA1A 1HRI3 2QJVA 2GZWA 2C9KA 1V6IA 3MUZ1 1GANA 3PDQA 4CDWB 2HEVF 3ZKUA 2GDFA 5LA0A 1KDKA 2YPDA 3KV4A 2BOJA 2NMNA 3HPNA 3CMGA 3T0DA 1OOPB 5LK5A 3AYAA 2CY6A 3RRDA 1GOFA 4L99A 5JSPA 4FSJA 3PVNA 4WVZA 3P3NA 3OGJA 2XHKA 1LESA 4FP2A 1ENRA 1N47A 3J8F1 3BKZA 1DQ4A 2Y6FA 1ND2C 2C26A 4GMP3 4NHYA 4IV1A 3FHAA 1O8PA 2YFZA 3HJRA 4LKEA 4FOQA 2DYCA 4QKFA 2VOXA 2VR4A 3LA2A 1VBA3 4L9BA 2VOKA 3BTZA 3OPZA 1MEC2 1MEC1 1PZ7A 3F2ZA 4DZGA 4IQPA 1UY4A 1QJEA 1O4ZA 3DL3A 2VZVA 5F3CA 1QXRA 1RUC1 1RUC2 2UU8A 2XVKA 2RS33 4HETA 4O65A 4YZ2A 1BQPA 1CAUB 4BDVB 1SLLA 2PMWB 4HSLA 3UKVA 1VAMA 2ID4A 1LGNA 3HN3A 5FY9A 4COWA 2HWD1 2HWD2 3FBYA 4BYYA 2WNUB 5CAZA 2WA4A 4XMIA 2XG3A 5C33A 4X8PA 4COYA 2I74A 4FFIA 4XTPA 3HOBA 5FYBA 2SBAA 3DYOA 3I97A 3KD4A 1RUF2 1RUF1 3AMPA 4PIZA 3WF1A 2VZTA 2CWSA 3KV5A 5H9SA 3DYMA 5LWBA 1U5YA 2CL2A 1NYWA 3DCQA 3H7YA 4N7UA 5FZ6A 5ACA1 2D7FA 5ACA2 3KCYA 2ZX2A 2HYKA 5FPLA 1RGSA 4DRRA 2YPJA 1WBLA 1QXPA 5KC5A 3IIAA 5T5OA 3I7DA 3CU7A 1HB3A 1MQTB 3WP6A 2RS11 2RS12 2G19A 3LAGA 4L11A 4A4AA 4P9LA 3PU3A 4Q0UA 4BU2A 1F2NA 3ZMOA 1W8WA 1QOOA 4NRPA 4BE3A 1O3SA 3O0VA 1CAWB 1CGPA 4CCCA 3RJRA 1O3RA 2EAAA 4JX0A 1YQ6A 3KS7A 4XBLA 2ZGMA 2QBXA 2JG9A 3WNLA 4LBLA 1J84A 4CU6A 3E5QA 3VL8A 1QNYA 3POFA 5BNOC 1J1TA 3WDVA 2GP5A 2HWE2 2HWE1 2RG4A 4P02B 1NT0A 4XTMA 5BNPA 2D3SA 1KFUL 3VBSC 4N9HA 4IDZA 2HYXA 3K46A 2XONA 2QVSB 4UBHA 3VDBA 2MHFA 5CADA 2W2IA 1H8TB 3ZFEA 2VO5A 1ZREA 2XL7A 1KS4A 1EV13 1QF3A 1UX6A 4AHXA 1JOJA 2VMEA 1JTZX 1DDLA 4OUMA 3SKVA 4R9CA 5JAXA 3QOPA 2DCYA 3QCWA 1W9SA 4GH4B 4KMQA 5A7SA 3OGVA 4AQSA 5K9YA 1S2EA 3KM5A 5CKQA 2VM9A 4ARXA 3B3QE 4LOSA 2VZQA 4MYEA 4SBVA 4CSWA 4CYDA 5FY8A 1UZZA 1UZVA 2J42A 3E6DA 2VL4A 4WVMA 3ACGA 1K3IA 3EBRA 3SQOA 4RL7A 2X29A 1PIV1 1PIV2 2ADEA 1IG0A 5KHJA 5DZGA 2A7AA 4MG2A 2A6WA 3OEBA 1R1A3 5F6LB 5F5QA 1H6YA 2FBEA 1MPXA 3R0RA 5C7GA 5FMBA 2WUHA 1ZYBA 2C9AA 3PJQA 2WYFA 3MPPG 1GQHA 1MS8A 1UU5A 3TEWA 3PMEA 2ZGRA 4GAZA 1MS0A 1RUE2 2BGCA 2EIEA 1W03A 1ZZCA 4KI5M 5IAVA 3SCFA 4A45A 4AHYA 1TMF3 4M3CB 2HEYF 3ZYHA 2BVBA 3PUSA 1IGOA 2W92A 5CG8A 5JWPA 2WAAA 2NMOA 1NCRC 2RDNA 5A6YA 4LHLA 5DUUA 5JMCA 2UWCA 3FMGA 2LW8A 3ZYBA 1RINA 4HVOA 5IK8A 1YIFA 4ZZ5A 3I49A 1QH7A 3AKTA 5FP4A 4OHZA 1VALA 1QDCA 2OUJA 3MW2A 4XF3A 2A71A 4W6YA 3HWJA 1PK6A 2YHJA 4GQ7A 4IUGA 5I0SA 4QX2A 1ZA7A 4AEDA 3CF6E 3BVCA 4FFGA 2VUAA 4QXHA 4AFBA 5JPNB 2A6ZA 4UFJA 3RMXA 5EYXA 1QJX3 2C4XA 2YGMA 2VQAA 2R32A 1JHJA 1HQNA 2QQUA 2VXJA 4HVQA 3BTXA 3DKWA 1UAIA 2VQTA 1BZWA 2VH9A 1WKYA 1VMJA 2BTVC 4WBBA 5JOWA 1UY2A 5GZCA 4QB1A 3H8UA 4QKDA 4MADA 2VMCA 4CCOA 4WZCA 2B5HA 1GSLA 4U2AA 4QKNA 4CXXA 4TTGA 2VVFA 2P34A 4BCUA 3EB7A 1HB4A 5E6HA 1OA4A 4FI9A 3M70A 1PGL2 1PGL1 1HIXA 4M0NA 1YI9A 5FAXA 2W0XA 3NV3A 3ZFFA 1W2NA 1OVPA 1O4TA 1O6UA 1W6PA 2JWPA 3AL5A 2VNRA 2QZ3A 1Y7BA 1O3TA 1N1SA 2PELA 1UPSA 1Q8VA 4N53A 4PI0A 4ZKTB 5FWEA 5K4LA 1I6XA 1US2A 1R1ZA 3USUB 1OKQA 2WBKA 4OLLA 3VKNA 5APAA 3VD3A 3NNJA 4ZONA 5FZEA 2BNMA 4K6BA 1W8HA 4QGMA 4LBOA 3VBFC 5A1LA 1GMMA 5D2AA 2D6PA 2VVDA 2IFRA 3AFKA 3U1XA 3ZYGA 2XPJA 4UT5A 4UFMA 4KL1A 3NNMA 5FY5A 1NE6A 1YHFA 2VQUA 4XZPA 1KFXL 4AL9A 4O9GA 3WD5A 2MEV3 5FZLA 2Q0AA 3AZWA 3FN9A 4QM8A 4QWNA 4YGEA 5CISA 1VPHA 2J22A 2XR4A 2BFUL 4QDRA 4XUPA 2R49A 3AJYA 4OQ9A 4LJHA 1UKGA 3VBUA 2HJIA 2RJ2A 1QY4A 4GULA 5C8CB 1B35B 1NA1B 4V2WA 2XJRA 5G04L 3SMHA 3SXWA 1VBC2 1VBC1 3WUCA 4QX3A 1W6OB 1BCXA 2VOTA 4Z92B 3VD5A 4S2HA 2ATFA 5CG9A 4QX7A 3H0OA 2W9XA 3POGA 4CDXC 3NNLA 4CP1A 1CX4A 5F5CA 5FQ0B 3WUDA 2X8KA 1CN1A 1W8FA 4RQPB 4QU2A 1D2QA 1LECA 4EE2A 1YWKA 2K2SA 1OT5A 2V72A 3H3LA 1DBNA 1O8SA 2EIGA 3JU9A 4KU8A 4P9XA 2PAKA 4XFIA 5GALA 4AZZA 4BLIA 1GFF2 2DUPA 1ZA4A 2GNDA 4MGYE 4Y22B 1JN2P 1POV0 1MZFA 3B01A 4LO4B 5J96B 3SH5A 3AP4A 2ZTNA 3BOWA 1DYOA 4FBFA 4D7TA 5L7OC 2YV8A 5ABJC 4NAOA 4UF0B 1C8M2 1C8M1 2D6NA 3CJIB 3OBTA 4NHMA 3RZMA 1NE4A 4Q8LA 3I2GA 3ZSMA 5I8YA 4OI2A 1ODNA 4LITA 4RYDA 4ZU4A 3KF3A 1BVP1 2GSYA 1TNFA 1ZNPA 2PN5A 4INDA 4XF4A 1W8OA 2WO2A 3WNMA 2Q8EA 1CIWA 2BZDA 1GYKA 2D5FA 2W46A 5LK7B 1E5IA 1EAH1 1EAH2 2XUEA 2OZ6A 4P9WA 5JR2A 3WP3A 4CXWA 1W9FA 3ZFGB 4NIIA 4ZU7A 2BUKA 1F4HA 3JBG3 4PBPA 3EXUA 4GZ9A 4IV1C 2O14A 4JCKA 2YYOA 1LOAA 2HBUA 3OGGA 1S0DA 1SBFA 2R0HA 5T52A 2DCKA 2SLIA 4HPKA 1TVGA 1ZBE3 3POIA 5LBFA 3U14A 1BK0A 3T0AA 3PU8A 2J1AA 4UFKA 2VD7A 2VC9A 2DTWA 5A1AA 1K5JA 1VE0A 3LCPA 5A3OA 3BYWA 4NPLA 1SHWB 1AXZA 5T5PA 5KHGA 1O3QA 1KRIA 2WO3A 3AFGA 3G6JB 2I07B 4WM8B 3T2QA 1YO8A 4BQXA 2Q8DA 2CAVA 2XL9A 4F8AA 1JUIA 2YGLA 1OFSA 4Y20A 1BEV1 1BEV2 2P4EA 3FLPA 4HN1A 2J1UA 1W9TA 2XWBB 3VHNA 3AMNA 4XOGA 3QH7A 3POJA 2ERFA 3QBQA 4Y5TA 4R9AA 1J59A 1X9TA 1PO13 3AJZA 3OF1A 4LE4A 5FXZA 4IL7A 4YLZA 2AACA 4MHRA 5ERLA 3M3CA 3VD7A 3AXDA 3KT1A 4Y5SA 5KXEA 3VKLA 4PF1A 4AQ2A 2FZ2A 4CDQA 3EHKA 3HN1A 3I4IA 4CU7A 3TN92 4AGVA 5FPBA 5D8AA 1ND2B 1NQDA 1WLTA 1UXXX 2GH8A 3OCPA 4DXTA 4QHOA 4AW7A 4LK7A 1WLWA 2VZSA 4Q27A 3WNOA 1KXGA 4JQRA 1OA3A 1AR63 3T0BA 3AYDA 3WCRA 5CNAA 3PVOA 1JH5A 4AI2A 5DDJ1 1Q56A 2IVJA 5DDJ2 4ASMB 4KG8A 3N7KA 5CB7A 3KT4A 1W8ZA 4G4FA 4FPCA 5HI0A 3WQ0A 2ES3A 1GUIA 1GZ9A 1O7FA 3NJVA 4CUAA 1MS5A 2JG9C 2NM1A 5F2WA 4ORFA 5FZIA 4XJ8A 4A2UA 2QQVA 3LSEA 3POWA 1PZ8A 3ZXGA 1S0IA 2JDPA 4RGAA 1AYM1 1AYM2 2H0BA 3ASIA 3DYPA 3JCIA 4G9SB 4S2DA 3VZOA 4BQ2A 4M4PA 5BNPC 2B9UA 1H2LA 2V4AA 1ASJ3 1IZ3A 1TZOA 4BMEA 5IATA 3W9AA 4A7ZA 3WT3A 3RZLA 5A6ZA 4D3WA 2A6VA 3VL9A 2N7GA 2HLEA 4YVWB 1ZX5A 1XYPA 3ZFEC 5C4WA 4AQTA 4XYXA 1YFUA 2E32A 3ACFA 4LLFA 3DGTA 5FZ1A 1AUYA 2ZGOA 2J1RA 3SCHA 4Z2AA 1YLLA 1F5JA 2OPKA 4QMAA 2XUMA 4O9EA 4PCRA 1Q8OA 1UOFA 4J1XA 4DY3A 4YG3A 4R52A 2WABA 5F5IA 2WFF2 2WFF1 5KHHA 4MO3M 3ETPA 1LHOA 4CE8A 1GNYA 1VRH1 1VRH2 1XU1A 1DGRN 3N7LA 1UY3A 5IVFA 1YNAA 4YG0A 4QGLA 4EROA 4I2OA 1PO23 2R042 2R041 2DFBA 3AK0A 3OOXA 1JOBA 3FUOA 1DFQA 2VECA 1GZTA 2Z2SB 3APBA 4RGKA 3VKMA 3HVDA 4OMDA 3W58A 5KXBA 3R05A 4RR3A 1CAVA 4IESA 3WCSA 1STMA 4LBJA 1FXZA 3Q8AA 3AP7A 4AE2A 1RUH3 3G7DA 4L8QA 4ATFA 4EWEA 4JVAA 4LBQA 4XIKA 3VDDA 4B7EA 2QQMA 3L2YA 1YQ2A 3GZAA 1L7LA 4JGZA 3WF4A 4AI8A 1WGPA 3OUIA 2QZ2A 4K8RB 5K8SA 2ZX1A 1TG7A 2WZ8A 3OPTA 5JOXA 3NV1A 4LORA 1D2SA 5KXDA 1G9FA 1SDDB 1IOAA 3BTYA 2QQPA 1S0GA 2YU1A 1POV1 5AFBA 2BNOA 3PNAA 3ZO0B 2FDHA 4Y4YA 5C3OA 3NWKA 1ULFA 1UMZA 1N1TA 4Q4V3 4PJYA 1EPZA 1D7PM 3UK9A 3JD72 3JD71 2HWC3 1PK6C 1H4HA 3GBFA 4BPZA 4CEYA 4AEDC 2NN8A 2J1VA 2ORXA 1ZRIA 1YIPA 4IEWA 4NPMA 4EQVA 5ANNA 1LEDA 2NZ9A 2XLFA 1HW5A 3KZ4C 1G6NA 1KQRA 4YZ1A 4LT5A 1BMV1 1BMV2 3KB5A 1IQAA 4COUA 4DXZA 1Z7S2 1Z7S1 3CIHA 3ZM8A 4BQ4A 1ZBA3 1LOEA 1CAXB 2CSGA 4OYUA 2OPWA 4IEOA 1QJY3 1EYBA 3WXPA 1O91A 1N1VA 4AVAA 5CKMA 1ZRRA 2R7EB 3ZPYA 2VBDA 1UZYA 3RYKA 1S1AA 3LPGA 1MS4A 1RUI2 1RUI1 3RS6A 3VZKA 4QHBA 3VB9A 3BOPA 3MV11 3R4UA 3POEA 5K0UB 2LRPA 3I2KA 4LEJA 3ZFFC 2FDFA 1CX1A 5C9AC 3OYWA 2GP3A 3K2OA 3BIEA 1JZ2A 1J58A 3T08A 4AHWA 4EJRA 2VBBA 1F35A 2WZR1 1H1MA 2WZR2 1EY2A 2IFWA 2WNVB 3CHXA 4KNCA 4AWDA 2EA7A 2BBAA 2BEOA 3Q8CA 2ETEA 4N53C 5FZCA 1SMVA 4LO8A 3KGLA 1KEXA 2AREA 3S5QA 3I3QA 5FXVA 2DWRA 2GNTA 1PMHX 5FXWA 2FDKA 3S6PA 1QH6A 1PM7A 1YJLA 4XJUA 4XVHA 2YDEA 5G05L 3VBOA 3SNMA 3VD9A 4IE6A 3H1WA 2LM3A 4JZRA 2PYTA 2Z42A 1SDWA 2GMMA 1REFA 2BQPA 4B1MA 3ST7A 1UMIA 3WDUA 1MZ6A 3HEIA 3N9LA 1FV2A 1LENA 2DURA 3WW2A 3IZOA 1HJFA 1NXD1 1GZWB 2E9QA 3I3BA 5JI9A 2XBO2 2XBO1 2D98A 4NO4A 3KLSA 3VBUC 1LHVA 1AX1A 1QQP2 1QQP1 5M0TA 2X5IB 4XCAA 3GGLA 3PUAA 4MHUA 5C71A 4GD4A 1SACA 1DQ2A 2RS53 1A78A 1AYN3 4Q4W1 4Q4W2 1C1LA 4WV8A 3ZSLA 4BB3A 4CDUA 5JXJA 3QLQA 4K1ZA 3AKSA 5F6KA 1D0HA 5DUVA 4DQAA 5I0RA 5L9BA 2FDGA 1ULEA 4QQPA 2EALA 4YVSB 3WNXA 1ZRCA 2X53S 2YBKA 5F37A 1AR93 2EXHA 2PHRA 2QTWB 2YC0A 4QQLA 3RZZA 4HANA 4K40A 4V2VA 5FIXA 1XNAA 3WG1A 1VLNA 2DVFA 5CFDA 2JEMA 1I3HA 3ZN6B 1RHI3 1TME1 1TME2 1ALYA 2VNOA 1W2AX 4IW3A 4MVTA 1X33A 1W99A 2RE9A 4XFFA 2Q1FA 3DKQA 3FFZA 4Y1YA 3TNPB 4E9KA 4D69A 4HT1T 4BHPA 1W0OA 4Q1PA 4M0HA 3EO6A 3DPRB 2XLAA 4LIVA 4AI3A 5IAXA 2XJVA 2K9ZA 5FYMA 2WSVA 5FWJA 3MICA 4WM7A 3NVCA 1UX7A 3OD0A 1J83A 1DQ5A 3ZXDA 1UIJA 1UYZA 4HLTA 5I8SA 5A7PA 1XE0A 4GMP0 3ZXFA 1WW4A 4QX5A 2GU9A 4XJAA 1JW6A 2WLQA 1JHNA 4FPKA 1JMUB 1RUG3 1NLQA 4H7LA 3LQCA 1E5HA 1VBB3 1K5MA 4YSFA 2F4PA 2QKDA 2VZ1A
chains in the Genus database with same CATH topology
3VBHB 1RTVA 5AFEA 3OY8B 5BNQA 2R1DA 4GWMA 4DPNA 4OFGA 5E89A 2IC1A 3ZVXA 3CO2A 3FC0A 5JVVA 5CFCA 1LULA 1W6QA 3BPZA 5DXDA 4M3CF 4YGCA 3WW4A 2D44A 1G9CA 4FOVA 5BYNA 5E88A 2GALA 4KQ7A 1PVC2 1PVC1 3TB0A 4EN9B 5CU1A 1UU4A 2A3WA 1WCDJ 2HEWF 2JG8A 1ENQA 2QNKA 2CGPA 4BZ4A 4Q26A 3ACLA 4XJZA 5GLWA 2XH6A 3SH4A 1NY71 1NY72 3WLUA 3A0NA 1QJU3 1G7YA 2KA3A 3NO8A 4FPYA 3NAPA 3USSA 5F1RA 1DQ1A 1WMDA 4CDQC 4Y24A 1D4VB 1YCIA 5D8AC 3KQRA 1XNKA 1COV3 2ZA9A 5A3LA 1PMIA 2VY0A 3NJZA 1UL9A 3O0XA 4IV1B 1V00A 5DUXA 3VHPA 3AYEA 4XJWA 3B9CA 3J8F2 1DZRA 2WSUA 4S2GA 4XFHA 4QQHA 1QMJA 4H3WA 3V0AA 5HCBA 3VBRB 1RJ8A 3MIFA 5LEKA 2AH2A 2R1BA 2NQYA 4V1PA 1ZRFA 4E2QA 4Q8KA 1GV9A 3TNQA 4UW6A 3FHIB 3H9AA 3ZSKA 3C3VA 1FOD3 2LTNA 2WS93 4CDWA 4OHYA 2CGNA 5L73A 4QQOA 3JQXA 4Z82A 2BW8A 2VW0A 4Q4Y3 5GLUA 1VR3A 1OOPA 1PNGA 2WINB 3RJ2X 2WWSA 5C4WC 3WV6A 1Z0HA 2D6OX 3B93A 3ZSEA 4LUMA 2WC2A 2RR11 2RR12 1IKQA 2CAUA 4C90A 2WQZC 2UYBA 3P3PA 2B42B 1OPMA 3ZYRA 1WBFA 4QGNA 5J37A 2B7YA 4N90A 1S0BA 4GKXA 4DNYA 2D6LX 1AR71 1AR72 1F5FA 2EVXA 4FOYA 3ROUA 3E5UA 1CAUA 4RR3C 4XFBA 1WLDA 1O4YA 2WNUA 1UF2C 2DTYA 3OD4A 2Y0IA 1WLCA 3VDDC 4JGZC 1AVBA 1RVF3 4YGDA 1YFYA 1PGSA 1LJ7A 3WX5A 1HRV3 4YW1A 2BYVE 5EFUA 4E4DX 1HRI1 1HRI2 1OFNA 1S0JA 4X6QB 1QJU1 1QJU2 4LBQD 4YFWA 4E4SA 2JECA 4B29A 1I9RA 2VGDA 1MQTA 4B8EA 1A8MA 4CEYC 4ZU5A 4EN8B 4YM3A 5AC93 4LULA 1N3OA 4B3NA 4FAGA 1CAWA 3ZIWA 5KHIA 1UCXA 3ELNA 2A6XA 2WLPA 4WVMB 5EYYA 5BNNB 4GMP1 4Z2WA 3T2TA 2KM2A 3BALA 2BNNA 2A6YA 1ZZBA 1LHWA 3M3EA 1VBA1 1VBA2 1R093 2ZOEB 1KJRA 1OSGA 5H9QA 2A3XA 4XFCA 4XE9A 3V65A 4XBNA 4LUKA 4MSVA 2LUWA 4W6XA 4WVVA 1XNDA 2VOVA 3B7MA 1UU6A 2RS32 2RS31 1H8TA 4QQ2A 1XE7A 2YY1A 4IEZA 4Q0QA 3BU7A 5FO9B 1UN1A 1C28A 1JXNA 1AXKA 2YXSA 4PIXA 3ZXEA 4KWLA 2HWF3 1OHFA 4GH4A 3INAA 1GICA 2WNEA 1V70A 5JSRA 1QHDA 1WCSA 2XJSA 4MXWB 3VBOC 1QDOA 3FX3A 1ND3B 2EXJA 1Z78A 3MFCA 4AEDB 3V64A 4DFSA 4X6RB 1LTEA 3I8TA 1LODA 4RS5C 4GIQA 4F83A 2YUEA 2ZJCA 2JKBA 4R9DA 2E51A 4FPOB 4CP2A 1AJKA 4CEWC 1D4M3 2OW4A 4UW3A 4I0BA 1IS4A 2KXLA 3ECQA 4M3CA 4LLOA 1MZEA 1QNWA 3O14A 3VLBB 1VIWB 3O5SA 1QWRA 2JDZA 3EJKA 3LSDA 4CDUC 2MPFA 3ETQA 3CJXA 3DV8A 5C9AB 2OYZA 4B7KA 5C8WA 1S0EA 3R4DB 1REDA 3Q9OA 3HT1A 3KCCA 3AZYA 3KGZA 4N53B 3WG2A 1ZZ8A 5CFDC 2Q1ZB 3N7MA 1RMU3 2G4IA 4PLNA 2E7TA 4MV2A 4EWAA 1LEMA 3HR9A 1C1FA 4JC1A 5AC91 4DMIA 2GNBA 1EV11 1EV12 2PHLA 5FPZA 4N43C 2UY8A 3PMSA 4IEXA 3WZ1A 1SCRA 4R4ZA 1V6MA 4WM7C 1H4GA 2IWGB 4FQZA 2PHFA 2VW1A 1SBEA 1DIWA 3MIEA 5J09A 1O5LA 1VBD3 3AMQA 4XFGA 1OQDA 3QH6A 1GBGA 1K5MC 1R1A2 1R1A1 1XXNA 2GC1A 4QPGB 1XNBA 4EWDA 4YZ4A 4FTBA 2VXRA 5KWRA 1VB2A 1OMIA 4OULA 1TMF2 1TMF1 2VPVA 3USUA 3ZSJA 1IS5A 3URFA 1DZTA 5GJ6A 3WINE 4DS0A 5FO7B 2DV9A 4LO6B 1YI7A 1DGWA 1PNFA 1VP6A 2C0ZA 5JZGA 4SLIA 4TLFA 1AX0A 1YFXA 4HKOA 3L9JT 3O0WA 1FT9A 2HWB3 4NVPA 5FCCA 4BA6A 2JG8C 4AG4A 3GHNA 1W0PA 4KH9A 4F3JA 1LOFA 3IWZA 2DVDA 2XKPA 1QJX2 1NA1A 1QJX1 5C8CA 4MX3A 1C5IA 1W6OA 1BXHA 3PHMA 1UIKA 4FP3A 3NAPC 3BB6A 3ZYIB 2NP0A 2TUNA 5FQ0A 1X8EA 1RB8G 4OI0A 1MS3A 2GN3A 1DLLA 4MGKE 1LU2A 4QPIB 1LOBA 2JE9A 3A0KA 1A6CA 5EJ3A 1C3HA 1AL23 1S2BA 3RDIA 3OBRA 4Q2FA 4W65A 3LB9A 4Y5Z0 5FTTC 2JE7A 3WHUA 2IXJA 2P3IA 3CJIA 3U4XA 3FLRA 3VZLA 4AVTA 5E16A 1UKRA 2WIIB 3GALA 3IPVB 4YM0A 1JYCA 4GXLA 4CDWC 4JGYB 4NHKA 4IEVA 3MF6A 5FOJB 4PIYA 1WD4A 4FPFA 4YG6A 2JD4A 1SBDA 2EXIA 5H9PA 2VULA 3IMNA 3N3HA 3ZFGA 2PLV3 1HDKA 4M00A 3AKQA 4PQ9A 4FQ4A 2MEV1 2MEV2 2GC2A 1OD5A 5GM0A 1HKDA 2ZX3A 3WG3A 1HLCA 1X7NA 5K7PA 5A32B 1J3RA 5J3UA 1IKPA 1R083 2RMU3 1FX5A 4XILA 2ZGNA 3VHOA 4Y1ZA 3SLIA 4BMBA 4BIOA 4DRVA 3IT8A 3AP6A 2WL1A 3NKTA 2FQPA 4RGGA 4WM8A 1V6LA 3D6EA 4WZFA 2JICA 1RUD3 4BH9A 1CPMA 2WNUC 1W2UA 3RYRA 4TSVA 1URXA 1V9U3 1F8VA 4I09A 1BKZA 3U0ZA 1LGBA 5GLVA 5I93A 4Q0PA 4KWKA 5JOYA 1HV0A 2GAUA 3PVBB 1U0AA 5BUVA 4HZFA 2EF6A 4PDWA 2ZHNA 5GLTA 3ZXJA 1N3PA 2MNGA 3TOJA 1W6MA 4N7IA 4UBGA 1MQTC 3KSCA 3MW4A 2VG9A 2PAMA 2B39A 1SLTA 3RSJA 1T6GC 2ZHMA 2DF7A 2OIIA 4YW4A 2PQQA 2RM23 3ZYPA 3JBG1 3JBG2 1LR5A 2NPIA 3ZYJB 4K7JA 4HVRA 3AKRA 2XLGA 2Z69A 3H3ZA 1YUDA 5EWSA 1ZBE2 1ZBE1 3JZVA 4FAHA 3GBWA 3AYCA 3V0BA 2R6QA 3E97A 4LA2A 3IDEA 4L2NA 4JGZB 4GWNA 3I2DA 4YGBA 4YVWA 1O5UA 3AKPA 5EV7A 2V73A 1G86A 2BWAA 2E6VA 1U12A 5BNOB 1XE8A 2PLV1 4D94A 1J3PA 3B02A 3VBSB 2PHUA 3E5XA 4C1WA 4CEYB 1PO12 1PO11 1Y9QA 4C0HA 4BLJA 2QCSB 3TAYA 3U07A 1AR83 3I59B 1H0BA 2QDNA 2BBVA 2H6CA 4ES8A 2PHDA 4CP0A 1AZDA 5DG2A 2O0OA 1RUOA 1FPN3 1AR61 4AF9A 1AR62 1H2KA 2AENA 2NLRA 3IN9A 2LALA 5CIRA 3J4UH 1V6JA 4LO5B 4HK8A 5JDBA 2Y38A 1SLIA 2ZHLA 2ZMKA 3NW4A 5J36A 4TWTA 4Q4X3 3SITA 2P3JA 4IV3A 4UW5A 2UYAA 2VVEA 1W6NA 5FLJA 3MLKA 2VU9A 1CESA 1ASJ1 1ASJ2 1NCRB 3AB0A 3K51A 4YFZA 3WHTA 4F7ZA 2QFEA 1SLCA 2DUOA 3MPBA 5A33B 5IK5A 3O12A 3RPQA 1CAXA 5GZDA 1G9AA 5LEJA 3U11A 2RM21 1AL0G 1VBE3 2FZ1A 2R063 3O7OA 2IXKA 4OZXA 1RUJ3 3KMHA 4RS5B 4RHV3 3X29B 4AVSA 2YROA 4WVWA 4HBNA 4A7KA 1HXS3 2C1FA 4FT8A 4CEWB 1IPKA 2Z5WA 1C5HA 2D40A 4GB33 4KG0A 5F9TA 5IK7A 1YFWA 4LBKA 4RSUA 3FFQA 4K9SA 5K0UA 1H2MA 1LOCA 3MDPA 4E2GA 1PO22 1PO21 2Q30A 2H0VA 2ZZQA 4AFAA 1WCKA 5L19A 2DCTA 4EN0A 3OJBA 2WNVA 1WW5A 1RUH2 1RUH1 1LRHA 2FMDA 3NL1A 1RL3A 2WQ4A 1GNHA 2PA7A 1DYPA 4P9JA 5DUWA 1DQ0A 1EPWA 2AR6A 2R073 1DZQA 3VN4A 5JZGC 2QE3A 1RC6A 1BBT3 4FPHA 4H55A 4Q4V2 2E7QA 1FNZA 4Q4V1 4N43B 2XJQA 4Y1VA 1GZWA 2HWC1 2HWC2 4IEUA 5EZWA 3D82A 3VBFB 4TYSA 1ZVFA 2P2KA 4JDMA 5BXXA 1OLRA 1LOFC 4CRQA 5C8CC 1NA1C 2X5IA 4YM1A 3RS6A 3ENRA 1DHKB 1TNRA 1ZBA1 1ZBA2 1GQGA 2XGXA 4P14A 5I0UA 4XIOA 5TSWA 2DCZA 3RI9A 1QJY2 1QJY1 4JDOA 4XQWA 2H6BA 5I8TA 1LKNA 2A3YA 1H8VA 2JENA 3AX4A 1D0GA 1HX6A 4YVSA 4AEKA 1MEC3 3ALQA 4FTEA 5KC6A 3ZXAC 2ZX0A 3M1HA 1MS9A 4C1XA 1A8DA 3ZN6A 5DG1A 1RUC3 1VAKA 4RA0A 4CDXB 1KDMA 4AFCA 1DGRA 1PVXA 3CJIC 5E1RA 3DN7A 4E4ZA 3H50A 3DPRA 3CNAA 4NN0A 4XXAA 2RHPA 2JX9A 3PJYA 3AP9A 2WJSA 3AMMA 3RMYA 4L92A 1XU2A 3IDCB 4AFDA 2ZGTA 1RUF3 3LA3A 3B00A 1TE1B 3N7JA 4LA3A 5FREA 1KJLA 1NZCA 3WDTA 4CZSA 1ENSA 2DVBA 5L7OB 5ABJB 5ACA3 3WOGA 1WD3A 1SCSA 2ZHKA 4AVCA 1CJPA 5I91A 3GYDA 5FBZA 1L3JA 1DG6A 1H9WA 3NSTA 2VW2A 4D7SA 1OLQA 3VBHA 4XETA 2RS13 1XNCA 4URTA 1NLSA 2B45X 1Q8QA 4MH0E 3HIFA 3WW3A 2FHRA 2RS52 2RS51 1AYN1 1AYN2 1NCQA 2ZGLA 4OVEA 5T5JA 3RQ0A 4DOUA 4WM8C 4BWOA 4HSJA 5FLHA 1NLRA 4LE3A 3WW1A 5AVPA 3UJQA 1AR91 1AR92 2HWE3 4XQ4A 1H2NA 2GMEA 1BBT1 1BBT2 1WMFA 4FPGA 1CD3G 1IS3A 1RHI1 1RHI2 3MIBA 3GZUC 3RNSA 4IEYA 1UW8A 2V09A 4PDWC 3VHRA 3WQ7A 2PHTA 3JQWA 3UKNA 2PTMA 2IXLA 2VNGA 3OTFA 4FPLA 1SLBA 4XQDA 1FATA 5BV6A 1YJKA 1PIV3 3IKWA 4PF5A 3D5OA 2DVGA 1AJOA 5T50A 3VBRA 1RUG1 1RUG2 4N9IA 1H1AA 1VBB2 1VBB1 4YZ3A 1V6KA 1QXJA 4XDQA 4QPYA 4ZXKA 5FDBA 5IUQA 3UV9A 1RUE3 1V6OA 3D8CA 3N36A 2AUYA 2A70A 2ZAHA 1AX2A 2G9GA 1QJZA 4QM9A 3LGRA 5FLIA 2ARXA 1V6NA 4XW3A 4B4PA 4YVWC 4AVVA 3PLQA 2JJ6A 3QD6A 2JG9B 3WG4A 1X8MA 5LRSA 3M8LA 3VZMA 2DUQA 2EAKA 2RJLA 2ZPXA 3M7AA 4NWVA 4LBMA 2TBVA 1HQWA 4MUVA 3HBZA 2F6BA 5GZEA 5BNPB 1IS6A 3MIDA 3ZXKA 4FXKB 3ZFEB 3BCWA 3W59A 1ULGA 2W68A 2HKXA 4Z1VA 3NV4A 1PHMA 3UL2A 1KITA 4KWJA 2VMIA 1CONA 4OUSA 1COV1 1COV2 4R9BA 4ASLA 4EV0A 5J98B 2ZZJA 1Q8PA 1TEIA 1DF0A 4I30A 2EXKA 2WKKA 3FLTA 3BTAA 1FAYA 3TYJA 3MGUA 4JRLA 4FO9A 4OHXA 3J9SA 3FWEA 1LU1A 3H1YA 5FOBB 4HFSA 4R8HA 3MFAA 2WT2A 3SHRA 3GHMA 2AGSA 2PAEA 1C4RA 4IV3C 1FOD1 1FOD2 1BYHA 2WS92 2WS91 1YYNA 2XJTA 2I45A 1JUHA 4J1WA 1I5ZA 4Q4Y1 2B8MA 4Q4Y2 5A3MA 2YZ4A 3B5LB 1AHSA 1S2KA 2DCJA 4XPVA 5C6CA 4YW2A 5BNNA 4PBOA 3ATGA 1PK6B 3S30A 3THPA 3J26N 3WY6A 4MGZE 1F9KA 5DZEA 1E57A 4P9IA 3JB8A 5BPXA 1FNYA 3R4SA 1RUE1 1VBC3 3H3UA 2ZBJA 5K0UC 2ZCWA 3HT2A 1OI6A 4FPJA 4IEPA 1QGLA 1LCLA 4TZDA 2ENRA 2W52A 2CNAA 2XJPA 2WNVC 1Q8SA 1BJQA 5T3NA 3M3OA 1CQ9A 3WVJA 3WDWA 4IERA 5FMOS 1GNZA 3AP5A 4NHLA 1RVF2 1RVF1 3E6BA 3ZFFB 2Y0OA 2AYHA 2WFPA