2YY1A

Crystal sturcture of n-terminal domain of human galectin-9 containing l-acetyllactosamine
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
141
structure length
141
Chain Sequence
b'QAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galectin-9
publication title Crystal sturcture of N-terminal domain of human galectin-9 containing L-acetyllactosamine
rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 35
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2yy1A00
2EXKA 2A6WA 4WZFA 1Q8PA 1W0OA 1I3HA 4XILA 3SISA 1HQWA 2ZHMA 3WHUA 1OFSA 3AJZA 1LESA 1LEMA 2DU0A 1WD4A 4CRQA 3WG4A 4WV8A 2ENRA 2GN7A 1SBEA 2ZA9A 1YRZA 1IS5A 2WSUA 3O0XA 3HR9A 1GZWA 4XJ9A 3PMEA 4M01A 3WG2A 2PHFA 2PELA 1EPWA 5EYYA 1LENA 1ULCA 4P9XA 1JYIA 4Y1UA 1DYPA 2GNBA 3O12A 3VKMA 3DGTA 5EYXA 2ZGPA 1A78A 1YIFA 4XJZA 3ZYRA 3M2MA 1IS3A 1GBGA 2A70A 4YZ1A 3R05A 1CONA 1MVEA 2BQPA 1LEDA 3OY8A 1AJOA 4FPFA 1KJLA 5BYNA 1S0FA 4Y26A 3I4IA 1ZM1A 3WDWA 1DGLA 4UW3A 5HCAA 1SLTA 4Y1XA 4L8QA 1C57A 2P3JA 1N3QA 2OUHA 4FPHA 4FOYA 1Y7BA 2ZGTA 4YW2A 5FREA 3AP4A 3WG3A 3UL2A 3V65A 1SACA 3M3CA 2H0BA 1QOSA 2DURA 2P37A 1ZA4A 3AXDA 3SH5A 1IKQA 5GLZA 3ASIA 5JOZA 1RITA 4XJUA 3WDYA 4YW3A 2WT0A 1DQ0A 1APNA 4JC1A 4YLZA 4GXLA 2SLIA 1LHVA 1AJKA 5IK7A 1NLSA 4Q27A 2JKBA 1SFYA 5IK5A 2OVUA 2NZ9A 1AX1A 2DTYA 1W6QB 2ZGSA 1PZ7A 2E51A 3RQ0A 2Z42A 5IT6A 4LBOA 4AGVA 4YGEA 1LJ7A 5T5LA 2E7QA 1AXZA 4YW5A 1G9FA 4TYSA 2NMOA 5DUWA 5E89A 1S0GA 1MR5A 2DUOA 3FLRA 4FPEA 3LSDA 4F83A 1DFQA 5JDBA 1QKQA 4RL7A 3RSJA 2CY6A 4CZSA 2DVBA 3QLQA 4Q1PA 3RMXA 3U4XA 1W6OA 3MW2A 5HCFA 4AVTA 2D6KA 1WW4A 2PHUA 3AP9A 2JJ6A 3AZXA 2KM2A 3UJOA 1LU2A 4AVSA 2LALA 4FOVA 1V6MA 5CB7A 3HN1A 5DZFA 1CR7A 1GZCA 4Q1RA 2C9AA 2AYHA 4AWDA 1ULDA 4D69A 3AP6A 3PJQA 1AX0A 4XOGA 3B69A 4Q26A 1H30A 2W08A 2DV9A 1A8DA 2EXIA 3ZSLA 5KXDA 1LOFC 4YZ4A 2A5ZA 1WD3A 4DPNA 3QCWA 1WBLA 1WW7A 2I2SA 2JDZA 2ARBA 2VU9A 2XB6C 1LGNA 4XBQA 4XHXA 3VKOA 2ZGMA 4U2AA 3OY8B 1MVQA 3B00A 1BXHA 4Y1VA 4Y20A 2AUYA 2UWCA 2ZGOA 2B7YA 3ZSJA 1S1AA 3B3QE 4M3CE 1ULGA 2D6OX 2XG3A 1AVBA 3OBRA 3PVEA 4XJ8A 1LTEA 1ENSA 2WLQA 2GNTA 1QOTA 3B9CA 4R9DA 4XIKA 5SV8A 1F31A 2YROA 3OPZA 1JUIA 3M3EA 4W65A 2PHTA 1GICA 4YG0A 2YMZA 1GANA 1LOGA 1QGLA 3RG0A 1I1EA 2VW0A 4Y1ZA 4AYUA 4IQPA 5HCBA 1GNZA 5H9SA 2DVAA 2W52A 3A0NA 4PQ9A 4HANA 1VLNA 1LGCA 4ISQA 4DRRA 4BQ1A 1ULFA 3A4UA 3WDUA 2P3KA 4YM2A 3POYA 5JOYA 1QNWA 2NM1A 2EXHA 4Q2FA 2ARXA 2A3WA 1CESA 2FHRA 1SLAA 3D4KA 1BKZA 1CIWA 1N1TA 2CYFA 2DUQA 1GLHA 1Q56A 1A3KA 3M3OA 5KXBA 3INAA 4PF5A 1D0HA 4XTMA 2GNDA 1GNHA 2ZGLA 3FLPA 3N7KA 4FPCA 2D6LX 3AZWA 4GKYA 4LBLA 3DUIA 4M3CF 1O4YA 3WCRA 3IM0A 4FVVA 4HL0A 1RINA 4GALA 1JOJA 3T2TA 1W6PA 1BJQA 3ZSKA 1CVNA 4FOWA 4JRAA 4ATFA 3ATGA 5H9QA 5T5PA 4Q8LA 3ZPYA 1F5FA 2ZHLA 1GV9A 4R9AA 4YZ5A 1W6OB 3OJBA 4XJWA 3LCPA 5IK4A 1KQRA 3AJYA 4BPZA 1ONAA 1G86A 4AGGA 3D5OA 3W58A 5CNAA 1LHNA 1MS3A 1LODA 2E6VA 2JD4A 3W59A 3PVNA 3NV1A 1MS1A 4YGDA 4BOWA 3TB0A 5IUQA 4XE9A 1AZDA 2A71A 2PHRA 4YGBA 2JECA 2D6MA 1JW6A 2V5YA 3FUOA 3N7JA 3WV6A 3N7MA 3GALA 1XQNA 3AYDA 4FPOB 2R1BA 2ZMNA 3MW4A 1QNYA 2ZGRA 4FPGA 4DS0A 3FFZA 2E53A 5F9TA 3AFKA 3BTAA 2D3RA 4YW4A 5KXEA 3OGGA 1AXYA 3WZ1A 1D2SA 3KQRA 5T55A 1FV3A 2ZZJA 4YZ2A 5T52A 1ENQA 2DVDA 3R4SA 5DZGA 5DZEA 3OBTA 4M3CA 4Y20B 1DBNA 4P9YA 1IOAA 3UJQA 4Q8KA 5JLVA 2WT1A 1SLBA 2ZMKA 1KDMA 4P9WA 4BMEA 3D6EA 4BM8A 2A3XA 2ES3A 4PCRA 1MACA 4WVVA 3V0AA 4AVVA 1CQ9A 1H9PA 1Q8VA 1WLCA 1V6NA 2EF6A 2VH9A 2ZKNA 3MW3A 3OYWA 1YYNA 2AR6A 3WDTA 3IN9A 3ZXLA 5EXOA 4Z8BA 4FP3A 2VUAA 5GZFA 3IMNA 2UWBA 3AZZA 1V6KA 4XBNA 3LSEA 3AXEA 1W6NA 1DLLA 1UZYA 2D6NA 5EWSA 3SLIA 3AYEA 1ENRA 3ZXFA 1C1FA 2R0FA 5T5OA 1R1ZA 5CBLA 1B09A 1URXA 2A6XA 3POWA 5T5JA 3WG1A 2VXRA 1TEIA 4BLJA 4NO4A 3V64A 2P2KA 2UURA 4ASMB 4JCKA 1Z78A 4NOTA 2PHWA 4BMBA 1LGBA 2YZ4A 3TAYA 1YI7A 3ILNA 1CN1A 1MS5A 2YV8A 4FQ4A 2OW4A 1N1VA 5DUVA 3I8TA 3WUCA 3WOGA 1QMJA 2GMEA 1DHKB 1JN2P 1W6PB 1LOFA 1WUVA 3WHTA 2R0HA 1QF3A 1GYKA 5GM0A 3N36A 1CJPA 2VW2A 3AK0A 1W6MB 4K1ZA 5JOWA 3ZXKA 5L73A 4R9BA 1FATA 5LK5A 4K20A 3AP7A 1C1LA 1SCSA 3ILRA 1KJRA 3Q9OA 1SCRA 4FOQA 2GMMA 1AX2A 1DQ1A 4LBQA 1UN1A 2GN3A 1BQPA 1LOAA 4XHBA 5JOXA 4U36A 5GLWA 1Z0HA 2A6ZA 3UK9A 3BODA 2DU1A 4FPJA 4YG3A 3B01A 2ZBJA 5IK8A 1IKPA 1WW6A 2R16A 4R9CA 1IS6A 5FRAA 1N3PA 3RS6A 3T1LA 3IPVA 2CTVA 5AVAA 2G4IA 1WBFA 2AREA 1PZ9A 2WJSA 5T54A 4XMIA 1SLCA 1VALA 3RRDA 2D3PA 2R1DA 3PVOA 2UWAA 1WLWA 3VKLA 4XJAA 2A3YA 1G7YA 3JUUA 5T50A 4Y22A 3SNMA 2OUJA 1CPMA 3KM5A 4M3CB 4MYEA 2NP0A 2UU8A 1V00A 2NMNA 2ERFA 5DUUA 4TZDA 4ISRA 4ATEA 5GZEA 1G9BA 2D3SA 1G9CA 5DG2A 2LTNA 4XIOA 5GJ6A 3AZYA 4GA9A 3V0AB 1S0JA 3USUA 2W68A 3OYWB 2Q5TA 2CWMA 4UW5A 2WKKA 2CWSA 2A6YA 4UW4A 2GALA 5GZCA 4YM3A 2RHPA 2WSVA 2NN8A 2AH2A 1KRIA 1JBCA 3WNXA 5CA6A 3O5SA 4YM0A 1IS4A 1W6NB 1FNYA 1HKDA 4XXAA 2V73A 2E7TA 4FPYA 2EALA 1W6MA 2ZHNA 3IKWA 2D43A 2DTWA 1JYCA 3ENRA 4GWMA 1FV2A 2WQZC 1N3OA 2ZACA 2YY1A 4ITCA 3CNAA 1AF9A 1PZ8A 1SLIA 2C5DA 4GKXA 5DXDA 1Q8QA 4M00A 3WDXA 1GSLA 2YXSA 4DRVA 2SBAA 2ZABA 1F9KA 2FMDA 3N3HA 2AGSA 1FYUA 2CNAA 4YGCA 5CAZA 1UAIA 3FLTA 1DQ5A 4LBQD 3WUDA 3M1HA 1DQ2A 5JMCA 1LOEA 4XXPA 2D7FA 4XTPA 2P3IA 2DUPA 1X50A 1VIWB 4KBBA 3VKFC 4ZXKA 2DVGA 1FNZA 4YW1A 4XYXA 1U0AA 3NWKA 3RMYA 3V0BB 2ZGQA 4LBMA 1DQ4A 4WVWA 3ZVXA 2ZGNA 4LBQB 1UPSA 1AXKA 1UZZA 2HYKA 2GDFA 2R49A 3MEPA 1V6LA 1C4RA 1CPNA 1N47A 3M3QA 5E88A 1O4ZA 2WT2A 3ILFA 2DYCA 2VW1A 2ZAAA 3SH3A 3FUQA 3IPVB 4K21A 1J1TA 4SLIA 1W0PA 3APBA 2ZMLA 4K1YA 1QDCA 4ZKTB 1GKBA 1LULA 1LHOA 2ZHKA 4FP2A 4I30A 4YFWA 2VY0A 2D6PA 1RIRA 4Y24A 3ZSMA 1UL9A 4Y22B 2EXJA 1WCSA 4DFSA 1G9DA 2PHXA 1V6JA 3H0OA 1FX5A 1S0IA 3T1MA 4P14A 1DZQA 1OKQA 3L2YA 3MPPG 3A0KA 4YM1A 3FBYA 2A7AA 1QOOA 4LBJA 3VUOA 3AZVA 2EAKA 2WNEA 4YFZA 1MZ5A 3USUB 3VV1A 4YZ3A 3WVJA 3SITA 2GMPA 1UX6A 5GZDA 1Q8SA 2DVFA 2CL2A 1FAYA 4FPKA 4LBNA 4XBLA 1LOCA 1H9WA 4AGRA 5GLTA 1JHNA 4C1WA 5GLUA 2EIGA 5GLVA 1VAVA 3BOPA 2ZGKA 1LHWA 4C1XA 2A75A 1SLLA 1G9AA 3V0BA 3ZXJA 5KXCA 1YXWA 1LHUA 3WDVA 2JE9A 4LBKA 3AX4A 1ULEA 1BZWA 1KDKA 2D44A 4XDQA 2A6VA 1DIWA 1SBFA 1S0CA 4FQZA 5H9PA 1N1YA 1SBDA 5H9RA 1GZWB 3HMYA 4UW6A 3O0VA 4CTEA 1VAMA 3C2UA 2JE7A 1S0EA 1JXNA 3N7LA 4H55A 3BIWE 1S0BA 1WLDA 4FPLA 1MS4A 1WW5A 4PBOA 1HQLA 4YG6A 3SH4A 3WCSA 3AYAA 4Y1YA 5DG1A 4DQAA 3NV2A 1HDKA 3ZXEA 1V6IA 1MS8A 3NV4A 4RA0A 2AENA 2TEPA 3GNEA 1MS9A 1GZ9A 1V6OA 1LCLA 2GNMA 1DYKA 3ZYPA 3R4UA 1MZ6A 3AP5A 3O0WA 2DWRA 1OQ1A 1Q8OA 2W39A 3JU9A 1UKGA 1QU0A 1MS0A 4OZXA 1LECA 1W6QA 1KITA 1YO8A 5F5QA 5GALA 1NXD1 4GWNA 4XMAA 3NV3A 1BYHA 1LOBA 2ZGUA 4XZPA 5JVVA 1QDOA 3POSA 5GZGA 4BLIA 1UMZA 3AYCA 3N35A 5DUXA 5E8AA 1G8WA 1DQ6A 1HLCA 3VKNA 3WLUA 1LU1A 2P34A 1S0DA 2NYYA 1N1SA 4PBPA
chains in the Genus database with same CATH superfamily
2EXKA 2A6WA 4PQQA 4QB1A 5L19A 1HQWA 2RM22 2YG0A 2Z69A 1JUHA 1VBC1 3Q8BA 1GZTA 3ZDVA 3JBG3 3KSCA 1ASJ3 3EHKA 2BGCA 3VBOC 2XJUA 4CEWA 4XJ9A 1GZWA 2P4EA 2F6BA 1DP0A 1O3TA 5EYYA 4CUBA 3AMNA 3S5QA 4P9XA 3FBMA 3VB9A 2JDAA 3B9IA 1A34A 1M06G 1XC6A 4YNIA 3VKMA 4AE2A 3O14A 3O7OA 5EHDA 2XPJA 5EJ1B 1YIFA 4S2FA 1BEV3 1UY3A 3TBDA 3UYJA 1IS3A 1IGOA 3MLJA 1OLQA 3OUIA 1UO9A 2BZDA 3OY8A 4FPFA 5LASA 2XVKA 5FZKA 1IQAA 1RL3A 2GP5A 4IEOA 1QJU3 1PK6C 1TME2 2J1VA 3ZXAC 4EN6B 3H9AA 1SLTA 5HCAA 1BK0A 2ZKLA 1N3QA 2OUHA 1UW8A 3FHAA 1Y7BA 4FPHA 4GH4C 4QPGA 3AP4A 4YW2A 3S6PA 3VD7A 1POQA 2R32A 2GC1A 2WNVA 1SACA 4TN7A 1DGWA 2DURA 3AXDA 3LE0A 1X7NA 4DO0A 2ZX0A 4CEYB 4ZHNA 2R061 4ASLA 3OTFA 3SH5A 1NA1C 4COZA 1CIYA 4N53B 3ASIA 1KD7A 1J3QA 1RUF1 2VNRA 2VQAA 4XJUA 4AEDB 2RS32 4PF1A 2VM9A 4B4QA 1UOJA 2ZXQA 4XF1A 5IFPA 3U10A 4NN0A 5A6XA 1NOVA 4I0BA 1VBA3 4JC1A 5HV4A 4YLZA 3WF1A 1LHVA 5IHRA 3LDRA 4QX2A 3LEMA 1GQGA 1NLSA 2P3YA 4H7MA 3RZKA 2JKBA 5IVVA 3S5AA 5IK5A 2QCSB 4RQPA 1W6QB 3IAQA 4CUGA 5FWEA 4YGEA 2HWC3 3TNQA 4MZUA 2YHJA 4YW5A 3TOJA 5JXJA 1KS5A 4IE4A 4LLOA 3L9JT 1MR5A 1OFNA 4AVCA 4A41A 4JQRA 1IG0A 2BNMA 1QKQA 3J7NA 3LIHA 4XUPA 1C8M3 5FZBA 1YQ6A 1W8WA 1MEC1 4CZSA 2DVBA 1ASJ2 1QIQA 3QLQA 4Q1PA 3RMXA 2B5HA 1W3XA 2PA7A 1VBD2 3GBWA 3PUSA 4AVTA 2G9GA 3HIFA 4QGLA 5FZDA 5ABJA 2ET1A 1WW4A 2WZR3 3AP9A 3AZXA 3ACLA 3BPZA 4OI2A 5FYHA 4CP9A 4I3PA 2KM2A 1HW5A 3J7MA 3UJOA 4OUSA 3SMHA 2WS93 2QKDA 4MHUA 3ZFGB 5AFBA 1V6MA 1ZRIA 5AVPA 5CB7A 5A33A 1UY0A 2XJQA 4LR4A 1GZCA 2VMGA 4Q1RA 1BEV2 2AYHA 4MGKE 3CHXA 2B4KA 4PDWB 1ODNA 3WNOA 2OIIA 4BQYA 1EV12 4DEQA 5F1RA 2BVVA 2W08A 1A8DA 3ZSLA 4I3GA 1V9U2 5KXDA 1YC61 3AKSA 2A5ZA 3QACA 1WD3A 4HFSA 4JTNA 4YZ4A 2C1FA 3VHRA 2I2SA 4PBPA 2C6SA 4XBQA 2WABA 2RS53 2XXZA 3ES4A 1MVQA 1TNRA 4Y1VA 5C70A 5CKQA 5DPNA 5FYYA 2B7YA 1OHFA 1S1AA 3AMPA 3DPRB 3AMQA 1AVBA 3K4ZA 4TTGA 1AR93 4OHYA 2ZJCA 2Q1MA 5JPNB 4N9IA 2FQPA 2YROA 4CDUB 3M3EA 1L3JA 4OUEA 4W65A 2IXKA 4FTBA 1GICA 4YG0A 3ZN6A 5A1AA 3MPBA 4AHWA 4E4DX 4Y1ZA 2JDKA 3DEMA 5FZMA 4IEPA 4WM7B 3J8F1 3MICA 1GNZA 5LBCA 1WLTA 5H9SA 3K4DA 3SCFA 4L2NA 4AL9A 2GAUA 3A4UA 4CCLA 1ZZ8A 1MPXA 1VRBA 2VUJA 4L97A 2WUHA 2ARXA 2X53S 3S7EA 4AFCA 4L11A 3HOBA 3M3OA 1GLHA 1Q56A 1A3KA 5FYBA 5JWPA 4QKFA 4PF5A 1GR3A 4XTMA 1UOFA 1RVF3 2VMCA 3FLPA 3RVHA 4BQ5A 3AZWA 4FTSA 1OVSA 3RWKX 1UIJA 1OF3A 2I74A 4URAA 1NCQA 3WCRA 1D0GA 1Z7S2 1ND3B 1RINA 4GALA 4HBNA 4ES9A 5C3PA 3UKNA 2WZR2 3GBFA 4Q8LA 4LE4A 4Y33A 3P3NA 4QPIC 1LB2A 2WS92 5IK4A 1BHGA 4BZ4A 4UYBA 4EQVA 5CISA 5CNAA 2BFUS 2JD4A 3W59A 1PK6A 4LMFA 4XE9A 1AZDA 2XUMA 2VMIA 4ZU5A 1QQP1 3A21A 5FY8A 3ZFGC 5A6YA 4Y4RA 4XDPA 5LY2A 3UKTA 1XQNA 2DBNA 3AYDA 4S2HA 1PO11 4FPOB 3MW4A 2XJSA 4MGZE 3VHNA 4DXZA 1Q5OA 4DS0A 1RUG2 3NNGA 3F95A 2R041 3BTAA 4IETA 4QDQA 4YW4A 5IFTA 2LROA 5FBZA 2VMDA 1SZBA 2Z79A 1FV3A 3LD8A 4YZ2A 2DVDA 5FZOA 1U5IA 2W47A 4QX7A 5DZGA 5FJHA 3J7LA 3OBTA 1PGL2 3B93A 4XUTA 3LFMA 1NCRA 3AMMA 2Q4SA 1XNTA 2ZMKA 3PIGA 3GBGA 3PIJA 1NKGA 3D6EA 4HONA 5LA2A 4BMEA 4LO8A 4MXWB 1OQDA 2ES3A 1AR63 2FCTA 1MACA 4PLMA 4WVVA 4JAAA 4H7LA 4AVVA 5A1FA 3V0AA 1H9PA 2ZKNA 3MW3A 3WDTA 2AR6A 3WNMA 3N9NA 4FP3A 1HRV3 1YHFA 4CDUC 2VVFA 3I2HA 3JXSA 2RMU3 3OOXA 4CCCA 1K45A 2VTXJ 1VB2A 1DLLA 1GWLA 4IV3C 5I0TA 5M0TA 4JTOA 3AYEA 1ENRA 4ZS3A 5ACA2 4HVRA 5A3NA 2P6CA 1RVF2 5CBLA 2XWBB 1B09A 4CP0A 3POBA 4ZONA 5A7QA 2VXRA 2IXJA 3GHNA 4NO4A 5CIRA 4BMBA 1Z78A 2PHWA 3VL8A 1LGBA 4QGMA 3TAYA 1AYN1 4I01A 1CN1A 4L0PA 3U14A 5A7WA 2IZWA 4CCNA 1GOHA 1HB4A 5C4WC 4RGAA 3RI8A 1DHKB 4QHOA 5C8CB 1W6PB 2NQYA 5I0DA 2P1BA 2UYBA 4BA6A 4P9LA 1ND3C 1QF3A 5BNNC 1GYKA 2ZEYA 3N36A 2VW2A 1REEA 4DUVA 4NROA 3H3LA 3HAGA 1IPKA 2GC3A 1K12A 2B39A 5K4LA 2HEWF 3AP7A 5A7OA 1LNSA 4AQTA 4D7TA 1OC1A 1KJRA 3ECQA 3MIHA 3Q8EA 4A3ZA 5FXVA 2GMMA 3AKTA 4P9JA 4Q4V1 3WF3A 2VOVA 5FZHA 1Z0HA 5GLWA 1FOD1 5A6ZA 2DU1A 4FPJA 1D2QA 2BUKA 1F4HA 3H7YA 3I2GA 4O61A 3ZX7A 5JXGA 1KFUL 1WW6A 4AAXA 1IS6A 4B29A 2CTVA 2G4IA 3WP4A 4WZCA 4IDZA 2VZVA 3RI9A 3THTA 3MDPA 4JZRA 1PZ9A 1RXFA 5DDJ3 1RUH3 4QQOA 4XMIA 5D8AB 5T54A 2D3PA 4CCMA 4Q4W3 1WLWA 5FPBA 3VKLA 3VBUB 4XJAA 2A3YA 3TRSB 5CZKA 1G7YA 5BNOC 3SNMA 3MI8A 2OUJA 1CPMA 4EWEA 4P9GA 3WP6A 4HLTA 3GGLA 2K2SA 1T6GC 2VTFA 2ERFA 4RR3B 4TZDA 5FYMA 2VZ3A 5DABA 5FUNA 1JU4A 1ND2B 3ZN5A 1HRV2 4YVWB 1RHI3 2Y0OA 2CU5A 3AZYA 4BISA 2RMU2 2KR2A 2W9XA 2VGDA 2CWMA 2CWSA 4UW4A 1YLLA 4G4FA 2RHPA 2X5IA 1KRIA 2XVLA 1CJDA 3GCWA 3WNXA 4LKDA 5CA6A 3H8XA 4DB5A 2XHNA 2R062 1W6NB 4CCDA 2JG9C 2G19A 5IAVA 1HB2A 3SQOA 4E4SA 1RUI3 3IKWA 1RUF2 2D43A 4GB31 2DTWA 2WWJA 4CXWA 1SMVA 1T2XA 3ZYFA 2JDUA 1CAWA 1WCKA 1X33A 1PZ8A 1SLIA 2C4XA 1QJX3 4LULA 4A7YA 4QQ2A 5EZWA 3VL9A 1Q8QA 1SHWB 2VVDA 3W9AA 1F9KA 3ZDSA 4EN7B 4AEJA 1H8TA 2AGSA 3ZO0B 4YGCA 4BHPA 3ZMNA 1UY2A 1RJ8A 1AL0G 2VD7A 3M1HA 5F5AA 5BPXA 3KCXA 3RYKA 5ANNA 3UESA 4HVQA 1FMD1 3CMGA 3KCYA 1X50A 3EBRA 2QDNA 4ZXKA 3UV9A 1R1A1 4XZUG 2DVGA 5G04L 1W2AX 1FNZA 1UD1A 2YPJA 2C0ZA 3RMYA 3SKVA 4RSUA 2MHFA 2ZGQA 1VBE3 1DQ4A 4WVWA 3ZVXA 3M8LA 1MEC2 5KHKA 1UPSA 4P5YA 3T08A 1DDLA 2R49A 3MEPA 1C4RA 2D40A 5E16A 4YYOA 3VN4A 1R091 3GZEA 2JD9A 4UFKA 5E88A 4BB3A 4X8PA 4E9KA 4IESA 3ILFA 3VD9A 4KL1A 3C7HA 2DYCA 5BV6A 3NKTA 1US3A 2WZEA 1F4AA 2TUNA 3WT3A 4SLIA 1W0PA 3TEZA 5JR2A 1QJY1 3APBA 1QDCA 1OLME 1LULA 1GP4A 2VCCA 4ZKTB 1DLCA 1B35C 1UNBA 4I30A 3NKGA 1UX7A 2WIIB 4DFSA 4Y24A 4Y22B 2EXJA 1IHMA 3LPGA 4IV3A 2PHXA 4LIVA 2PAKA 2XDVA 4OFGA 3VBUC 3GYDA 1RHI2 3VHOA 4IEWA 1WWYA 3DF0A 4Z82A 4LK7A 3T1MA 4J25A 1OKQA 1L7QA 2BFUL 5A3OA 4YM1A 2QQLA 2A7AA 5LZ6A 4RR3C 1D4M3 5FKBA 1TME1 1YEWA 3AZVA 2RE9A 1W2TA 4HT1T 5F2SA 1V0AA 1I5ZA 2DCJA 1MZ5A 4YFZA 1ND2C 2VUCA 3SHRA 2CDOA 3USUB 4FSJA 3Q8AA 4UFLA 4YVWC 3ZFEC 4XFGA 5C4WA 3WVJA 3NQHA 2GMPA 1WGPA 5GZDA 2DVFA 2CL2A 4Z92B 3ZKUA 1RB8G 5JXIA 1ZRCA 1FAYA 4OLLA 4LA2A 1F35A 1XNDA 4NHXA 3FX3A 3WINE 1REFA 1H9WA 4E8DA 1UCXA 4TLGA 1KFXL 2WNUB 2JIJA 2WQ8A 3I3QA 1W8OA 3CZUA 5GLUA 1VMJA 5FZ7A 2ZX4A 1VAVA 4HVOA 5EIYB 4OQ8A 4IEYA 5ERLA 4Q29A 3ZN4A 4QU1A 5L7OA 4PLNA 2JXAA 2JE9A 1ULEA 1BZWA 2ETEA 1KDKA 4XDQA 4EN8B 4CEWB 1GZWB 3D8CA 3HMYA 4UW6A 2X05A 3TEXA 2VMFA 2IVIB 4CTEA 2JE7A 4A44A 3F2ZA 4D7YA 2JX9A 3BIWE 3VZNA 4UFMA 1S0BA 1VBE2 1J83A 1HQLA 5I91A 1BMV1 2HBTA 5FPUA 2ORZA 4QT6A 2XVGA 4DQAA 5BNOA 3JBG1 3ZLIA 3MLKA 2VZQA 1NZCA 1ASJ1 2B9VA 1GZ9A 2XJTA 1D4VB 1V6OA 2GNMA 2VNGA 1QXPA 4LUMA 3PTRB 3T0AA 5BUVA 2BPA2 2HWF3 1OQEA 4AHYA 3POGA 4IW3A 4FFIA 1OQ1A 2W39A 1JZ3A 2WO3A 4QU2A 3H8OA 1UKGA 3CIHA 4D3WA 2WN3A 3VBRA 2VXJA 1BEV1 1YO8A 3MIFA 4XACA 2Q8OA 1UY1A 1Q3EA 3HNYM 5F6KA 1BBT3 5C5UA 3U4SA 1LOBA 2Y6HA 3JQWA 1FI2A 2XOMA 4NMIA 1QDOA 4GAZA 4COYA 3RZLA 3VKNA 3WF0A 4RHV3 1D4M2 1QJU1 3EJKA 1ZBE3 2R042 1W9SA 3OEBA 2DCZA 3I49A 1X9PA 2DCKA 4WZFA 1Q8PA 5JI7A 3SISA 1O4TA 3ZYGA 3MIGA 2YPDA 3AJZA 4JGZA 2Q8DA 2F17A 1YJKA 4LHKA 4RQPB 4CCKA 3H1WA 3WG4A 2E31A 3X29B 1SBEA 5KC5A 3M4FA 2ZA9A 4DZGA 1YJLA 4AFDA 3HR9A 2QUOA 4AI2A 4XPVA 1CAVA 2B42B 2X10A 3WG2A 4AEMA 2PYTA 1EPWA 4SBVA 1ULCA 5FMOS 5FZ9A 3WNNA 1VBA1 5LATA 4NIHA 2Y0IA 2VZRA 3HD8B 2XL7A 3O12A 4KNCA 1DZTA 5EYXA 5FPXA 2ZGPA 4XJZA 3ZKYA 4MH0E 1GBGA 2A70A 1O3RA 5ABJB 2BQPA 1LEDA 4Y3OA 2HWC1 1MQTC 5LEJA 3OD0A 3WQ1A 4JX0A 1HRI3 4EWAA 4EJRA 3N9OA 4QMAA 3B7MA 3I4IA 2MEV3 3WDWA 4D94A 4AVBA 4O7XA 2XLAA 3LZZA 5A33B 1H1IA 4L8QA 2ARAA 3I2FA 1C8M1 4HSLA 5BNPB 5IVFA 4NIGA 3M3CA 4OMCA 3VD3A 4HPKA 1B35A 2FDJA 2P37A 4CSWA 4B7EA 2EA7A 2WZR1 2WZ8A 4G9SB 1NXMA 2EIEA 2VPVA 4AI9A 3THCA 1RUJ3 4NHMA 3BTZA 2VCBA 1GOGA 2VC9A 3R0RA 1GQPA 2W95A 4YW3A 2I07B 4PIZA 1GOFA 4MLOA 4YVSC 4QXBA 1DQ0A 4IUGA 5IK7A 1OBNA 4RN5A 5A3LA 2BVBA 4W6YA 1SFYA 1XNKA 4RFT0 5EPAA 2OVUA 2NZ9A 5SV5A 2QNKA 3ZYIB 1R1A3 4P08A 4Q4V2 3VZLA 3ZFEA 4D7SA 5IT6A 1FOD2 3KHCA 4LBOA 4FT8A 2XLFA 4AGVA 5A7SA 2RS51 1AXZA 4X8NA 3WQBA 4QQPA 2VAUA 2UY8A 3CZJA 4RS5A 1S0GA 2DUOA 3OUHA 5E89A 4CA9A 5BY5A 5LY1A 1DFQA 5JDBA 1Y9QA 4PJYA 5EJZB 4LITA 3IT8A 2CY6A 2WFF3 1AR91 2ZEZA 3VBHA 5KBFA 3MW2A 1CX4A 4UFJA 2PHLA 3MIEA 3E5XA 4XFAA 3U78A 3I2IA 3NSTA 5FYIA 3WY6A 4BIOA 5FLIA 3GZAA 1RUOA 5CFCC 1UU6A 2LALA 3ZOIA 4LT5A 3ROUA 5A3WA 2C9KA 4AWDA 2C9AA 5LRRA 1ULDA 3WEZA 5FYVA 1VE0A 4BJ0A 5FO9B 2EXIA 4NRPA 1LOFC 3E6DA 3GXUA 5FXXA 3OCPA 1UIKA 2ARBA 3DKQA 4FFGA 1W8UA 4XHXA 3VKOA 2ZX3A 4GZ9A 3KHBA 3VDDB 4JDOA 2KD7A 4Y20A 2WRAA 2YBKA 1W39A 3MV01 2QQKA 4IV1B 1U5XA 2AUYA 2ZGOA 4B8EA 1XSQA 2CGOA 1IPSA 3B3QE 2RVAA 2E26A 4MGSA 3S7IA 2GNTA 2IVJA 1ZX5A 4XIKA 4BQ2A 5F2WA 1W0NA 2WC2A 4I2OA 3OPTA 2ZOEB 2YMZA 1NE6A 3IMMA 1QGLA 2BOIA 2RG4A 1O6UA 2VW0A 1Y4WA 2E9QA 3OGSA 2PXJA 4GIQA 5FZOB 1PVXA 4L92A 2XQXA 2W52A 3A0NA 1VLNA 1GU3A 1R1A2 3AKQA 5FZ3A 4CDXC 4M4RA 1Y9MA 1EPZA 3POYA 1I6XA 1QNWA 2NM1A 3JZVA 4LIUA 4Q2FA 1VMFA 2FHRA 1PMIA 1SDDB 5EV7A 4OI4A 5CU1A 4H14A 1CIWA 1N1TA 2CYFA 2DUQA 2QQMA 5KXBA 5K0UA 1R092 3ME2A 4KMQA 3BOWA 4H2AA 4XFIA 4V1PA 2GNDA 1YFYA 1PVC3 2ZGLA 3B94A 3H7JA 3IWZA 4FPCA 2KA3A 3GHMA 4GKYA 3DUIA 3WF2A 4F7ZA 2JDMA 3IM0A 4OYUA 5FP3A 4HL0A 3ZM8A 1JOJA 1PO23 1QJY2 1BJQA 3KF3A 5FUPA 1K5MC 3ZSKA 1CAUB 1CVNA 4FOWA 4RFRB 4QB2A 4HN1A 5T5PA 3T4HB 2ZHLA 3QH7A 1PMHX 2G9ZA 5CVRA 1W6OB 5C6CA 2YBSA 4N43B 1AR61 3BALA 1MQTA 3OJBA 4AGGA 1G86A 3O1UA 2VOWA 1LHNA 1ZA7A 1J1LA 4AG4A 3PVNA 4YGDA 1MS1A 2VBPA 3NJXA 4GULA 1HRV1 5F8PA 3CJIA 2JECA 3WV6A 3W20A 2RMU1 4QKDA 1ZZCA 2XR4A 3GZTB 4PIYA 2OS2A 2V4AA 4MX3A 1GFF2 3LGRA 2ZMNA 3PUQA 1QNYA 2ZGRA 3BPSA 3VZJA 4OCTA 3T0BA 2E53A 4MVTA 3AFKA 3ZFFC 5KXEA 2D3RA 2W1WA 2BOJA 3OGGA 4LORA 2WQ4A 5FK8A 3LOBA 1CAXB 3C7FA 4NIAA 3VGIA 4YVSA 3SEEA 3AKRA 3K3NA 3OUJA 3PMSA 5FZEA 4M3CA 3T09A 2OZJA 1WMFA 2PLV3 2RDNA 2VBDA 3VDDC 3WXPA 5FIXA 1GNYA 4AXOA 1YWKA 2XBO3 4BDVB 4DXTA 4P9WA 4BM8A 1NUKA 2BW8A 4IEXA 2A3XA 3NL1A 2WN2A 4PLOA 2DBIA 4PCRA 2W91A 1Q8VA 3OYWA 5FMOL 1V6NA 2EVXA 3E1F1 1HB1A 3D3AA 1YYNA 2J1SA 5DAWA 4Z8BA 1XE8A 5EXOA 5J36A 1XNCA 4W6WA 3UGGA 4XURA 1H6XA 2UWBA 3AZZA 5AFEA 1PNGA 1V6KA 2V72A 4XBNA 1BMV2 3MIDA 3LSEA 4CDQB 3LF7A 2XKOA 1UZYA 4MG2A 5EWSA 3JBG2 4QGNA 5I8YA 1C1FA 3AC0A 2R0FA 1ZZ7A 5JIAA 4MGYE 3DYMA 4O9EA 1URXA 2VJXA 3POWA 5DN2A 3OBAA 4AVAA 4YPJA 1COV3 5DDJ1 1RUH1 3V64A 4AW7A 3J7HA 2VNOA 1YQ8A 4Q4W1 1QWRA 3ILNA 1MS5A 2YV8A 5DUVA 2W1SA 3GJBA 2RJLA 1UF2C 4S2GA 4MV2A 3U75A 2HKXA 1OOPB 5E1RA 2PHDA 1LOFA 3AVSA 1WUVA 3QOPA 3U37A 3ZPOA 2R0HA 3IB3A 3MUZ1 5F39A 3AK0A 4NVPA 4K1ZA 2YFUA 2WAOA 1RHI1 3SCHA 1QJU2 5LK5A 4J1XA 3IZOA 2OZ6A 3KQ4B 4HN0A 4TWTA 3KB5A 4N43C 1XBFA 2WNOA 1HV1A 3LA7A 2XHKA 1O59A 1AX2A 4DINB 1UN1A 2GN3A 4XHBA 5JOXA 2HEVF 3S57A 2A6ZA 3UK9A 4AI3A 2WR9A 5ANQA 4OVEA 3WX5A 5J3UA 3T1LA 4R9CA 1RUI1 5CKNA 3C8XA 3IPVA 4A2UA 1ALYA 4COUA 1REDA 5A3TA 2W1UA 5LA1A 5FXZA 1VBA2 4WVMB 4UOJA 1QJX1 4K40A 2WDBA 5AC93 4UBHA 4CEYC 5FZ6A 4N53C 5CYYA 4CDXA 4CCEA 4AEDC 4MYEA 2UU8A 3RZGA 4QQHA 5DUUA 3LDBA 4ISRA 4ONUA 3NRUA 3RWNA 2HH9A 2FMYA 1KS4A 2HWC2 4JGYB 5GZEA 4CCJA 1G9BA 3I2OA 1G9CA 5DG2A 5GJ6A 3VBOA 3KVAA 1S4CA 5FV3A 1VAKA 1ZYBA 1O91A 1H2MA 2TBVA 5IATA 5IVCA 1C8M2 1VBE1 4XFFA 4YM3A 5GZCA 2R073 2YGMA 4A3XA 4YM0A 2QZ2A 2BDRA 5A3PA 1IS4A 1FNYA 1VR3A 4XXAA 2E7TA 4FPYA 4OI0A 4IEVA 4CDQC 2EALA 4ES8A 2GZWA 1JYCA 1FV2A 4J6GA 2XJRA 3B02A 2ZACA 2YY1A 3NNJA 3ABZA 4FFHA 4LKFA 2C5DA 4AQSA 4HKWA 4M00A 4WM8B 1GSLA 2W94A 2ZABA 1AUYA 2FMDA 4OHWA 1OD5A 4AOCA 4GH4A 1NT0A 3MFAA 2GU9A 1OLRA 1UAIA 1UZVA 2PAMA 3CLPA 3FLTA 1DQ2A 1W9TA 1IG3A 3HPNA 4PDWC 2RS52 4BK4A 3ZFFA 2D7FA 4XTPA 4AR2A 3DL3A 5FQ0A 4ZY9A 1GQHA 1NA1A 1D4M1 1VIWB 2PQSA 4WVZA 3VKFC 4Q4Y3 4OMDA 4YW1A 3BB6A 5L36A 3G7DA 1VBB3 1YI9A 4LBMA 4LEJA 3T0DA 4LBQB 5FMDA 1AR92 1SFNA 1VMHA 2HYKA 2TNFA 4HKLA 1AR73 1HJGA 5E6HA 1J3PA 4COVA 1AR83 4NRQA 1O4ZA 1C5HA 1KGYA 2O8OA 1TE1B 4K9SA 3NVCA 2AC1A 4HOOA 2VW1A 2IFRA 4UXAA 2ZAAA 4XVHA 4ZS2A 5FMBA 3FUQA 3DPRC 3RZJA 1QH6A 1W8NA 3GJAA 5A1LA 2QQPA 5IWFA 1STMA 1GKBA 3J26N 3KS7A 4FAHA 4LNVA 2ZHKA 4GJYA 4FBFA 2E63A 1EAH3 1POV3 2D6PA 3ZSMA 1UL9A 2DDUA 1W2NA 4UF0B 4WM7C 2RR13 4N90A 5JCTA 4DXRA 3I2KA 2W0XA 1DZQA 5J09A 3L2YA 3HNMA 2D98A 1O3QA 3FBYA 3TEWA 4A6SA 5FJKA 4YWAA 1WMEA 3VBRB 4LLFA 4Q0VA 3NAPB 2R072 3I3EA 3RDIA 4AAPA 1US2A 1VP6A 4YZ3A 1YCIA 1UX6A 1IQDC 3PJYA 4DEVA 5IVBA 1EUUA 5JUVA 1IPJA 5F3IA 1H4GA 1LOCA 2QTWB 2XJPA 4QX8A 1K42A 2HWF1 2ORXA 1DCSA 4AF9A 4OHXA 4XAEA 1NG0A 5IVYA 3T4VA 2ZX1A 4JKMA 2A75A 3I54A 3NW4A 4JGZB 1VJ2A 2HJIA 3ZXJA 1G9AA 1YXWA 3JD73 5LBBA 1AYM3 2F4PA 1BBT1 5C5TA 3R4DB 2JB8A 2YYOA 4FQZA 1Y43B 5FY1A 1WCDJ 4DUWA 5IW0A 3KT1A 3LPFA 4RHV1 2P5BA 3O0VA 3GZUC 1ZBE1 2B45X 2HWB3 4A6OA 4META 3DCQA 4XW3A 5J7MA 1XYPA 2WYFA 3N7LA 5KHHA 4QAWA 3S30A 4FPLA 1SDWA 1MS4A 4OZOA 4Z2WA 1JYNA 3WCSA 3MBWA 1ZBA3 2DF7A 4H3WA 4MXVA 2HBUA 4CEYA 1AR72 2JDNA 4MADA 4QD2A 4N53A 1HDKA 1UQXA 3ZXEA 3NV4A 1W04A 4AEDA 2AENA 2TEPA 4GWIA 2VUDA 2OXBA 2LUWA 1SPPB 2YC2A 2JG8B 3SKJE 3R4UA 4DY3A 3EMRA 4NAOA 1AR62 4Y5TA 4AI0A 4PI0A 3JQXA 2DWRA 5HV0A 3FHIB 2D5HA 1Q8OA 1RUD3 2MNGA 4XCBA 1QU0A 3IDCB 4CE8A 1MS0A 1GP6A 1W6QA 2Y6JA 4M0HA 4OZXA 2FDHA 4EZHA 1H6YA 1W8FA 4HPKB 4Q4X3 3BN6A 3C7EA 3NV3A 5T3NA 5LRSA 5JVVA 3VBFB 1HB3A 1HRI1 1Y3TA 2WWUA 4XUOA 1H1MA 5GZGA 3VD4A 4Z07A 1DQ6A 1HLCA 1VRH3 2MEV1 2MPFA 2VECA 3D0SA 3TYJA 3I2JA 3HN3A 5CADA 2QFEA 4RYDA 4QPIA 1I3HA 4XILA 2L9LA 5FP8A 1OURA 2ZHMA 4JHZA 3WHUA 5GKAC 3O1OA 1OFSA 2OYZA 4UFIA 3KV9A 1R64A 1EUTA 1H2NA 1LRHA 1RUC1 3O1PA 2Y6FA 4WV8A 4AFMA 4L9BA 2ENRA 2GN7A 5G05L 2VZUA 1YRZA 5APAA 1RUJ1 1IS5A 1RC6A 3AVRA 3ZFGA 1LR5A 5JXHA 4LJHA 5CFDB 3M70A 4M01A 4KQ7A 2PHFA 2PELA 4PDWA 1LENA 2W46A 3SXWA 5C33A 1JYIA 2K46A 4Y1UA 1YUDA 3JD72 3W5MA 1D7PM 4W50A 5C8CC 2YDEA 1A78A 2YC0A 3ZYRA 3K48A 3M2MA 1OF4A 1RMU3 1E57A 4CDWB 3KCCA 4NPMA 2CGPA 1L7RA 1MVEA 5FR3A 1AJOA 1NZIA 2HWB2 5FZFA 1KJLA 5BYNA 1S0FA 1OPMA 2OQ7A 5FLHA 5J48A 2VG9A 4P9IA 1J58A 4UW3A 3HEIA 2Q8EA 4W4ZA 5FYUA 5DDJ2 1K5JA 1PIV3 1RUH2 1ZBA2 2P3JA 1DZRA 3DPRA 5FPVA 4IE5A 5C9AB 1UZWA 2ZGTA 4Q4W2 3UL2A 2WFF1 3V65A 2C26A 4D6SA 5CG9A 4LO4B 4KWLA 4CDUA 1ZA4A 4HSJA 3VBSB 1ODMA 3SCGA 5D8AC 3VD5A 4OHZA 2WT0A 3RGBA 1APNA 1SEFA 1POV0 2XQRA 4NAMA 4LUKA 2JG8C 4Q4X2 3ETPA 3DV8A 1I5PA 4V2VA 1AX1A 4NHYA 2VULA 2Z42A 1S2BA 3ACGA 3NJZA 5JZGB 1VRH2 5T5LA 1LJ7A 2E7QA 3POJA 5KWRA 3TN93 1G9FA 2W92A 1NY72 4KBZA 1RUI2 4HETA 3Q8FA 4TYSA 3FLRA 1OKOA 1WCQA 1ND3A 3LSDA 4YSFA 5BNNA 4D0QA 2PQQA 2UY9A 3TEYA 1FT9A 1QJX2 3IAPA 3UGFA 5C3OA 5A70A 4YARA 3RNSA 3NJYA 5CKMA 2WWSA 5HCFA 4KWJA 1CX1A 4OQ9A 5K8SA 2PHUA 2J7MA 3IIIA 3BVCA 4AVSA 1XJAA 1H1AA 2E32A 5F7UA 1AL23 3HN1A 4R4XA 3FE5A 1UMIA 4JDNA 1RMU2 1C28A 3PTYA 1XRUA 2ATFA 5FLJA 1BLZA 3B69A 1H30A 4Q26A 3O1MA 4N7UA 4N8MA 4XFBA 4BQ4A 2QQOA 2JDYA 4DPNA 3I59A 1WW7A 2JDZA 2VTXA 4QXKA 4BH9A 4AEKA 2XB6C 4B4PA 3IIAA 1O3SA 1OSGA 1UPIA 2ZGMA 3OY8B 4TXWA 4IE6A 4XUQA 2CAUA 1RUE3 3B00A 1PVC1 3N9LA 4KU7A 3KZ4C 3NMBA 4UI9L 1X8EA 4YRDA 3DXUA 4MO3M 1PO21 4M3CE 1TMF3 1ULGA 3MUY1 2XG3A 3N9MA 1UMHA 3PVEA 4AI1A 4QPGB 2IXLA 3CKHA 4MXWA 4EWDA 4UWDA 4R9DA 3B9CA 5SV8A 1E5SA 2WNVB 5C7GA 1JHJA 1F31A 3OPZA 3FMGA 1W28A 5FUIA 2VZTA 2BRTA 4QX1A 1WA6X 2QBXA 2VCAA 1GANA 3J9SA 5FY4A 3RG0A 3RZZA 4JHTA 1I1EA 3VBSC 4E8CA 1JZ7A 3VDCA 4IQPA 2JG9A 3KV6A 3LKJA 4W8JA 2DFBA 3TNPB 1X9TA 2ID4A 4DRRA 5JPMB 4HANA 4ISQA 1E5IA 1LGCA 1O5UA 4BQ1A 4A4AA 3WDUA 2P3KA 1M4WA 1DU3D 5C71A 2PMWB 3K4AA 2ZEXA 5D21A 2EXHA 2GC0A 4QPWA 1CESA 5FY0A 5K7PA 1QXJA 1SLAA 3D4KA 1W3VA 2HEYF 3HNBM 3INAA 4E2SA 2XKPA 1D0HA 3LOIA 2QQJA 3CDZB 3GDBA 5JZGC 4LKSA 1CZTA 1E5RA 1JODA 2Y6KA 3H1YA 4M3CF 1O4YA 2FDKA 4KWUA 4FVVA 4FO9A 2PLV1 1Q43A 1UYYA 5A3UA 5C8CA 1W6PA 3IDBB 4K8RB 4ATFA 4JRAA 4BK5A 2XBO1 1TZOA 2WO7A 4EN0A 2WNUC 3AL5A 1GV9A 2LW8A 4R9AA 4QXHA 5L9RA 4YZ5A 2RJ2A 5IYYA 3IDAA 3QBQA 2J42A 3LCPA 3AJYA 1AL22 4XJWA 1U5YA 4K8FA 4KH9A 4BPZA 1DGRA 3D5OA 4CP9B 1MS3A 2E6VA 1LODA 5C3QA 2BNNA 4K7JA 1XXNA 5IUQA 3TB0A 3URFA 2A71A 4YGBA 4HK9A 2V5YA 3N7JA 5C3SA 4EZ4A 4CEWC 3OBZA 3GALA 2C24A 3ZXGA 2O8QA 3ACHA 3H8UA 2VNVA 2VR4A 3NO8A 4AHZA 3FHQA 4E2GA 1R083 2IXIA 2R1BA 4X6RB 3KLSA 5EFUA 1RUE2 4XFHA 1RUC3 5F9TA 3OPWA 5D8AA 3U1XA 4NIDA 1RYYA 1AXYA 1COV1 1O8PA 1D2SA 3KQRA 2HWF2 5T55A 1TMF2 3VBUA 1ENQA 4NRMA 4KWKA 5F32A 4AZZA 3KGZA 2HWE3 5DZEA 5FYCA 1DBNA 1PHMA 3UJQA 4RR3A 4LE3A 3T3YA 4JRLA 2WT1A 1BBT2 2XL9A 1SLBA 1KDMA 2QQUA 2OT7A 2RS13 1ND2A 5C8WA 4YVWA 3VLBB 1SG3A 4HKOA 5LEKA 5B4NA 4QPGC 5HBAA 4RHV2 1ZBE2 4GQ7A 2WNVC 3ZN6B 1OT5A 3RJRA 3CJXA 3ZXLA 5JAXA 3WW4A 1OUSA 3IMNA 1V70A 2VMHA 3OG2A 1DGRN 2J1TA 1K3IA 2Y33A 4C91A 1HXS3 3AXEA 1W6NA 1DYOA 2D6NA 3K2OA 3ZIXA 4BWOA 4YW6A 4BE3A 5JI9A 3KT4A 3SLIA 1BVP1 2YU2A 1ZNPA 4JQTA 5T5OA 2XGXA 1UU5A 2A6XA 2CGNA 5T5JA 1QJZA 1NLQA 3CEWA 3WG1A 1UU4A 3ZYJB 2FDFA 2IFWA 2P2KA 2UURA 4JCKA 4RQPC 2RM23 2YZ4A 1RUNA 4LTAA 5AC91 5J96B 1LKNA 2QQNA 3HBKA 1FPN3 2VOKA 1HV0A 2JIGA 1NCQB 3WOGA 3P5BA 2XJVA 2OA2A 5JMOA 1UZ0A 5FZAA 5KR7A 4IE0A 4XF4A 4NWVA 1OMIA 5GM0A 1CJPA 1HRI2 2P17A 5B2GB 3ZXKA 1YIPA 3BYWA 5L73A 4R9BA 3BGAA 1FATA 2MEV2 1JH5A 4S2DA 5FK7A 2NPIA 3KMHA 2BYVE 3Q9OA 3LEKA 2W2IA 1XYNA 1GMMA 1PK6B 5ABJC 2IXCA 3FC0A 2WFPA 2R071 3ALQA 1JOBA 3BODA 1RUC2 4YG3A 4CVUA 2OKXA 3B01A 4ZZ5A 2ZBJA 1NQDA 2V09A 4XQWA 2WA4A 4XUNA 2R16A 4EROA 1N3PA 1RUJ2 3CBNA 1S2KA 3C3VA 1WBFA 2YU1A 4BQWA 2AREA 3O1TA 2HWE2 2OX0A 2WJSA 5BNPC 1SLCA 1VALA 5FP4A 3RRDA 1W99A 2A73B 2O14A 2FZ2A 4F8AA 1F8VA 2RDQA 4K3UA 5LB6A 2B8MA 5T50A 4Y22A 3KM5A 4AI8A 1PGW1 3H3UA 1J59A 2NP0A 2BNOA 3PVBB 2NMNA 1XU2A 1NCRB 4B1MA 5FZIA 4ATEA 2RS33 1O5LA 2D3SA 5LBEA 4DY5A 5FZ0A 3V0AB 3DYPA 3MGUA 3USUA 4Q4Y1 2Q5TA 3WR0A 2PN5A 2WKKA 1VBB1 4CP2A 3E5QA 4IGOA 2WSVA 1F2NA 2NN8A 3PHMA 2AH2A 2BTVC 2WFF2 3EB7A 1JBCA 1AR71 4I02A 5I93A 4ZZ8A 4GMP3 1AR81 1HKDA 1W6MA 4I0AA 4Y5SA 3I3MA 3A23A 3ENRA 4GWMA 5I0UA 2WQZC 4R52A 4EV0A 1FPN2 1UOBA 1AF9A 3CNAA 4KG8A 3MV11 4GKXA 4IEQA 2J1EA 4URTA 3HT2A 2SBAA 4DRVA 1EAH1 3I3DA 4P02B 2PTMA 4Q0QA 1POV1 5A7WB 3R6SA 4CP1A 1VBD3 1JYXA 2CNAA 1VB4A 1UXXX 1RTVA 2RR11 1DQ5A 3BCWA 1NCQC 3V56A 5JMCA 1PMJX 2P3IA 2DUPA 3JB4C 4AFAA 4MGTA 1PNFA 5J98B 1WKYA 2RDSA 2IUWA 4KBBA 1EV13 1UYPA 2KXLA 1U0AA 3NWKA 1NLRA 1YQ5A 4LOTA 4Q5OA 1HJFA 1V9U3 2ADDA 3GF6A 3KV4A 4A7ZA 3C7GA 3FWEA 3ZYBA 1V6LA 4LHLA 4LO7A 1N47A 3E6BA 3TWIA 4IV1C 5LCWL 4P5HA 3PUAA 3N9QA 4NPRA 4QHZA 2R6QA 2NLRA 3ZYHA 3DKWA 4K21A 5IVEA 2VZ1A 2ZMLA 4K1YA 1RXGA 3JD71 3K51A 3MF6A 1AYM1 3LWCA 2UYAA 2VQTA 5A7NA 1TQ5A 2AEZA 2XONA 2VMEA 1G9DA 1BK1A 1WCSA 1JZ8A 3E97A 1V6JA 5DQ0A 4ASKA 3H0OA 4QM9A 2HWB1 2HWD3 1S0IA 4XEZA 5FY9A 3CF6E 4NHLA 3EXUA 1NCRC 1PVC2 1QOOA 4RGKA 3VHPA 4LBJA 3WNLA 2QDRA 2IC1A 3VUOA 1KEXA 1P8JA 4HXCA 3WSOA 2A1XA 5CFCA 1ZBA1 3H1MA 3GM8A 1YFXA 5F5IA 1OI6A 1PO22 4PT6A 4C0BA 5C3RA 2IWGB 3W21A 1RGSA 3SITA 3SC7X 1Q8SA 2X5IB 1H4HA 4FTEA 4XBLA 4QHBA 4IE7A 1JHNA 5CG8A 2EIGA 4QPIB 5GLVA 4DIQA 1RUD1 2O0OA 3BOPA 3DXTA 3HQRA 5DMYA 2ZZQA 1Z7S3 2E7AA 1SLLA 3V0BA 1CAWB 1LHUA 1OUXA 3WDVA 4BIFA 4Q4X1 5KHIA 3AX4A 4QKBA 4G3YC 2A6VA 1SBFA 5F3EA 1KXGA 1SBDA 2JDHA 5H9RA 1H8TB 1XYOA 4LOSA 4NPLA 2X8KA 2W1QA 1VRH1 4IERA 2BEOA 3LA3A 1VAMA 3C2UA 4DXSA 4LKEA 1J3RA 1NY71 2LRPA 4Y5Z0 5BNPA 5HCHA 4LHSA 4FI9A 1NQJA 1WW5A 5DG1A 2BU9A 2PLV2 5FZ4A 4QKNA 1G6NA 3NV2A 2ARCA 4RA0A 2XBO2 3D82A 3POEA 3GNEA 1RUG3 2VOXA 4FXGB 2QQVA 4D8MA 4KU8A 4D6RA 3FL7A 3ZR5A 5DAQA 4BCUA 3AP5A 2EIDA 2GH2A 5J37A 2Z5WA 2JICA 3BU7A 2RV9A 1PM7A 2WYSA 2JDPA 4C8DA 2H0VA 3KVBA 5GALA 1RMU1 4NHKA 3J4UH 4XMAA 3PU3A 3I2DA 3C7OA 2ZEWA 2RJKA 4XZPA 2HWD2 1K5MA 5E8AA 2AZ5A 3N35A 1QXRA 3P6BA 4IV3B 1LU1A 3QH6A 2P34A 1S0DA 2NYYA 1GUIA 4B1LA 1COV2 2YBPA 2ZAHA 1PIV1 3HJRA 1W0OA 1A6CA 2X29A 4AFBA 4AQ2A 3WW1A 1W2OA 3ORJA 2ADEA 4GMP0 1LESA 1LEMA 2DU0A 4UBGA 1WD4A 4CRQA 5FTTC 4Q0SA 3AFGA 2WAAA 5ACA3 2WSUA 5C4WB 2ILMA 3O0XA 5EP9A 5FO8B 3KT7A 2W87A 3PMEA 1CGPA 1ZRFA 2WINB 5FMCA 2X5IC 5BNNB 1JZ2A 1NAEA 1DYPA 1X8MA 3D0JA 2GNBA 4NR1A 4E27A 4B3NA 1OOPC 3ZIWA 5FPAA 3DGTA 5BXXA 2J1AA 3M3IA 4XAAA 4I0WB 1XOYA 3U11A 4YW7A 3UGHA 4CU8A 1DF0A 3ACIA 4HK8A 4MGQA 3R05A 1CONA 4KGGA 2LM3A 1F5JA 3PUHA 3VZMA 4YZ1A 5L7OB 1JOPA 3H50A 1XNAA 4CUAA 3BI3A 3VDDA 4PI2A 1U5ZA 1E5HA 4ZXEA 3LEIA 3TN91 3UKVA 1OH3A 2BBAA 4Y26A 1ZM1A 4IV1A 3POIA 4E2QA 1DGLA 3ITQA 2Y6GA 2VL4A 2R30A 4Y1XA 5IAXA 1C57A 1H8TC 4P00B 3FFQA 5FREA 4FOYA 1HX6A 4MSVA 5AC92 1VBC3 4GD4A 3WQ0A 1OA4A 1NYWA 2H0BA 1QOSA 5FP7A 1ENXA 3I59B 5JR7B 4I09A 1IKQA 5GLZA 1ZZ9A 5BNOB 3WNKA 5KHJA 5JOZA 3WF4A 1RITA 4AQ6A 1W2UA 4B7KA 4QB6A 3WDYA 1XPWA 4E4ZA 3USSA 1SQ4A 2J1UA 1AL21 5A32A 3OGJA 3WW2A 3NNFA 1TVGA 2VO5A 2SLIA 4GXLA 2CAVA 1AJKA 2JENA 1W06A 4XETA 4CPBA 4Q27A 4ZPIA 1S2EA 3MF9A 2DTYA 4JGYC 2DFCA 1PZ7A 2E51A 2ZGSA 2VQ0A 3RQ0A 4LHNA 3CQOA 5J1XA 2G9FA 2H6CA 4MGIE 2LS6A 1DGWX 1RUE1 1VPHA 2BERA 4ZU4A 5DUWA 2NMOA 4F83A 4FPEA 2JG9B 1XB9A 3EYPA 1CAUA 1TMF1 4RL7A 4DNYA 1HN0A 3RSJA 2EIBA 4XF9A 4F3JA 3S0MA 3U4XA 5JSRA 1W6OA 4N43A 2FDGA 3WW3A 2Q0AA 5DAPA 1PGW2 1WMDA 2D6KA 2R063 3E6CC 2JJ6A 3K3OA 2K9ZA 1LU2A 1RUF3 5FKCA 2AEYA 1HQNA 4FOVA 5I8TA 4WM8C 4B4RA 1CAVB 3HT1A 4R4ZA 5L9VA 5DZFA 1CR7A 1JZ5A 4IEUA 3HBZA 3NNMA 3W5NA 2B9UA 4D69A 3AP6A 3PJQA 4Q4Y2 1AX0A 4XOGA 4EYUA 2DV9A 1VBB2 2Z2SB 1JYVA 3O1SA 3QCWA 1WBLA 2OPKA 4XABA 2VU9A 1CAXA 1LGNA 1C3HA 1AR82 4U2AA 3RYRA 4IGPA 1OH4A 4XF3A 1RJ7A 2Y8KA 1BXHA 5L7OC 3K46A 1WCUA 2GH8A 1VBC2 3LDKA 3NNLA 2J1RA 2UWCA 4JKKA 3PU8A 3ZSJA 4FFFA 5A6QA 2VOTA 4EN9B 2D6OX 4XJ8A 1MEC3 3DECA 3OBRA 2X09A 4X6QB 1LTEA 3ST7A 1IZ3A 1ENSA 1EAH2 1QOTA 2QE3A 2WLQA 2ZTNA 4NIIA 2I45A 4BXFA 4MOAA 4MHRA 4CPBD 1JUIA 1B35B 4XCAA 4PHZA 2PHTA 2RR12 5FYTA 2VBBA 1LOGA 3ZXDA 3VDAA 3RPQA 4JV4A 4UFHA 4AYUA 1BCXA 5HPOA 5KC6A 5HCBA 2PAEA 2WO2A 5A7PA 2DVAA 3VDBA 2GP3A 4PQ9A 4CDQA 1ULFA 3MFCA 3WP3A 2HYXA 4YM2A 1YQCA 1JZ4A 1QHDA 5JOYA 1R081 2A3WA 2WLPA 3BUCA 4NE9A 3PURA 1BKZA 4Y4YA 3ZFEB 3DN7A 2WA3A 1NE4A 2BGOA 3VBRC 2QQIA 4W6XA 5FZGA 3NAPC 1GNHA 3N7KA 2D6LX 1ACCA 4LBLA 3MO4A 1WZXA 2AACA 2HWE1 4RS5B 3ON7A 3VZOA 4LK6A 1OOPA 1YNAA 3T2TA 1W9WA 3WG3A 2K0GA 4LA3A 1AYM2 3ATGA 3FZ3A 2WBKA 2O1QA 5H9QA 2RS11 3ZPYA 2Y64A 4CXYA 1BVVA 1F5FA 5FWJA 3VBHB 1LAJA 1YFWA 1W9YA 2FZ1A 1JYTA 1Y9GA 1KQRA 2W5FA 4ARYA 1ONAA 4BYYA 3W58A 3THPA 4JGZC 4CU6A 1OA3A 4FXKB 3NV1A 5FZ1A 5LBFA 3WP5A 4AK3A 4BOWA 1JYWA 1ZREA 3J8F3 3ELNA 2PHRA 1H8VA 3PL0A 4QDSA 2D6MA 1JW6A 3FUOA 5D1IA 1HN1A 1QJFA 1JS9A 3N7MA 3CO2A 4LXLA 2GSYA 1HXS1 1WMXA 4Z2AA 4KI5M 3U07A 3ZSEA 5FOJB 2N7GA 3AMHA 3MHZA 3K77A 5BNQA 3JB8A 3RZHA 4FPGA 1TNFA 3FFZA 4Z1VA 4O65A 4OUMA 4QPYA 3OB8A 4WVMA 4XC9A 5FBJA 3WZ1A 2JE8A 4TLFA 2RM21 2ZZJA 2Y26A 4WM7A 5T52A 3R4SA 3RZMA 1RUD2 2PFWA 4DMIA 4Y20B 4EE2A 1FPN1 3PDQA 4HZFA 4P9YA 1IOAA 5FAXA 2QJVA 3PNAA 1EY2A 5I8SA 4Q8KA 4RD7A 5JLVA 2FBEA 3ETQA 4JGYA 4QX3A 4C90A 4XFCA 5F3GA 1O7FA 1OA2A 5FY7A 3O1RA 4XQ4A 1PX3A 3E5UA 3RYPA 4PIXA 1WA4A 4JKLA 4A42A 4QQLA 1CQ9A 1WLCA 2DCYA 2JEMA 2VH9A 2EF6A 3RFRA 2FDIA 3VZKA 5F3CA 3IN9A 4BU2A 2H6BA 4OI1A 1YQ2A 2VUAA 5GZFA 2FCVA 3OF1A 1XE7A 4JVAA 4OHVA 5DAXA 1QQP3 3AM2A 2IXHA 3VBFC 5FZCA 2WZPP 4J1WA 1PX4A 1OD3A 4BQ3A 4ZU7A 3T30A 4GJZA 4IXLA 1PO13 4QDRA 1F15A 1S55A 2CDPA 2BP6A 2XUEA 3A22A 3B5LB 3ZXFA 1ZZ6A 5LWBA 1R1ZA 2FCUA 1EYBA 1UYXA 2CV6A 3FN9A 4MUVA 5FCCA 2R043 3KV5A 3CU7A 1TEIA 3LQCA 4BLJA 2OPWA 4ASMB 4NOTA 4WM8A 5K0UB 4IEZA 1YI7A 4FQ4A 1CZSA 2OW4A 1N1VA 2XH6A 5JSPA 1ULOA 3I8TA 3ZMOA 3WUCA 4XDOA 1QMJA 3SEPA 2GMEA 5CFDC 4ARXA 1JN2P 5F5CA 5K9YA 1H0BA 4RS5C 3WHTA 2F4LA 1YFUA 2GC2A 2VZPA 4HG6B 2RS31 4NUBA 2VVEA 1ULPA 3LA2A 5IJRA 1W6MB 5JOWA 2QQWA 3J8F2 3MYXA 2Q8CA 1JZ6A 2XMLA 1UWWA 4WBBA 3ZR6A 1MQTB 4K20A 1JU3A 1A8MA 2VCMA 3WD5A 1C1LA 1SCSA 3ILRA 1PIV2 4FOQA 1SCRA 3HVDA 4XF0A 3VBHC 4CDWC 3I7DA 3QD6A 4LBQA 1DQ1A 4NJ4A 1BQPA 1LOAA 3BKZA 3CJIB 3G6JB 4U36A 4BXSV 2Y60A 1DG6A 2XWJB 2ZS6B 3AKPA 3CL1A 4AHXA 4GWJA 4UAPA 4GMP1 1NX9A 3OEAA 4M0NA 5IK8A 5LW9A 1IKPA 1PGSA 2FD8A 5FRAA 2DCTA 3RS6A 5HXMA 5AVAA 5C9AC 4XQDA 3MIBA 3OD4A 3PLQA 2R1DA 5DAVA 2CHHA 3PVOA 2UWAA 1AYN3 5I0RA 4HMZA 4YVSB 3JUUA 1ZRRA 2VZSA 1VBD1 1T6BX 4M3CB 1QY4A 4M4PA 4UF0A 5HXVA 1V00A 4LO6B 4V2WA 2D93A 2P6HA 5KHGA 3TN92 1C8NA 2LTNA 4XIOA 3Q8CA 3BU0A 3NAPA 4GA9A 5CEHA 5FOBB 1S0JA 1QQP2 5HI0A 1EV11 2W68A 2BWCA 3IBMA 2J22A 3OYWB 4KGQA 5EJ3A 5TSWA 5JIUA 4UW5A 2A6YA 4JDMA 2GALA 4E4HA 2ZX2A 1V9U1 2VZOA 1PO12 3LB9A 4Q4V3 5IVJA 4COWA 3MZHA 1FOD3 1OPOA 2JB4A 3O5SA 4K6BA 4CU7A 1JTZX 3BTXA 2WO1A 2YFZA 1ZVFA 2V73A 1GP5A 2Q1ZB 3T2QA 5JSOA 2ZHNA 4LPLA 3HWJA 4QX5A 1GWMA 4QX0A 1N3OA 1ZRDA 2BJSA 2Y6LA 4ITCA 1X82A 1J84A 5DXDA 3HQXA 5FZLA 4TSVA 5CFCB 3T2PA 4RGGA 2V4VA 3H3ZA 5ISLA 4QXCA 1QEXA 3JCIA 3WDXA 2YXSA 1CD3G 2YGLA 3N3HA 4Q0PA 4QM8A 5K0UC 1FYUA 2HLEA 4DOUA 5CAZA 5LA0A 1CWPA 1GWKA 3U0ZA 1H2LA 2WL1A 4LBQD 4CUCA 2HWD1 3THDA 3WUDA 1LOEA 4XXPA 2BGPA 3UNPA 4A45A 1ZZBA 1MZEA 2B46X 3EO6A 4D6QA 4FAGA 4XYXA 3V0BB 4QWNA 3UETA 1HIXA 1FXZA 5FXWA 2R7EB 2JKXA 2YB7A 2ZGNA 3FJSA 3P1IA 5FPZA 5FPLA 1AXKA 1SPPA 1UXZA 1UZZA 2JG8A 2OQ6A 2GDFA 4O9GA 5LA9A 1CPNA 2W3JA 1QH7A 2D5FA 3M3QA 5B4XA 3CJIC 2WT2A 4DUXA 3M7AA 1UY4A 4R8HA 2Y34A 5FZ8A 5L9BA 3BIEA 2Q1FA 4GB33 1AYN2 3SH3A 3ACFA 3IPVB 1TG7A 3I97A 2V5DA 1J1TA 1Z7S1 2XLGA 4KG0A 1LHOA 1X36A 4FP2A 3VBFA 4YFWA 1PM4A 3KD4A 2VY0A 1JI6A 1RIRA 3I3BA 3RJ2X 2WS91 4N7IA 4C0HA 3K75B 2D97A 1XNBA 2BV4A 3P3PA 4CDXB 5A3MA 1AHSA 2VE1A 3OGVA 1FX5A 2EAAA 4FCAA 1W8HA 4IL7A 4P14A 3MPPG 3POFA 3A0KA 1FMD3 4N9HA 5FDBA 1EP0A 2EAKA 2WNEA 3EQEA 3DYOA 3VBOB 3VV1A 1SFPA 2G1MA 1XU1A 1MZFA 1C5IA 3OGRA 2Z4FA 1RUG1 3AL6A 5CFDA 1K5MB 2ET7A 4FPKA 4LBNA 1R093 3KGLA 4AGRA 3NJVA 5GLTA 3UT0A 5A32B 4LQRA 4C1WA 3LAGA 4IGQA 2VQUA 3O1VA 1W03A 2ZGKA 5F37A 1LHWA 1PGL1 3LEGA 5A80A 4C1XA 3T2OA 1UKRA 4UT5A 2ZCWA 1QJY3 5D2AA 4CDWA 5KXCA 5FYSA 2QVSB 3PUIA 4ET7A 4LBKA 1W8ZA 2BWAA 2D44A 1UOGA 3BTYA 1DIWA 1S0CA 5H9PA 1N1YA 1R082 1XE0A 3A7QA 2Q30A 2QZ3A 2CSGA 3LFIA 3MLLA 2YC4A 4GH4B 3IDEA 1I9RA 5FYZA 1W8TA 4CCOA 3AB0A 5C9AA 3KWVA 1S0EA 3KF5A 1OVPA 1JXNA 1W05A 2ZPXA 5FY5A 4H55A 3ZFFB 1H2KA 1ST8A 1WLDA 2E33A 5FQ0B 1TME3 4PBOA 1NA1B 4YG6A 3SH4A 3AYAA 4Y1YA 5I0SA 3VBSA 4OULA 1CZVA 4L99A 1V6IA 1MS8A 2Y38A 3OSDA 3HQUA 2YUEA 4A7KA 5ACA1 2RS12 1MS9A 1RVF1 1JMUB 1L7LA 1LCLA 1DYKA 4GB32 3ZYPA 4CYDA 2BBVA 1O8SA 4CU9A 1MZ6A 3GCXA 5LK7B 3O0WA 4CXXA 5EQUA 1U12A 3JU9A 3LIGA 1W9FA 1UYZA 5FP9A 1OLMA 1LECA 5F5QA 1KITA 2EICA 3H8RA 1NXD1 5JZGA 4GWNA 1OXCA 3WNPA 1W90A 3L2HA 4BQXA 1BYHA 1HXS2 1QJEA 3H42B 2ZGUA 3N9PA 4INDA 4NWWA 3WQ7A 3POSA 4ORFA 1XSRA 4BLIA 1UMZA 3AYCA 5DUXA 5F6LB 1FMD2 1G8WA 4LO5B 5FFOC 5FO7B 2RDRA 2JWPA 3WLUA 3N4MA 2WNUA 4Q0UA 1N1SA 3ES1A
chains in the Genus database with same CATH topology
2EXKA 2A6WA 5L19A 1HQWA 2RM22 2Z69A 1JUHA 1VBC1 3JBG3 3KSCA 1ASJ3 3EHKA 2BGCA 3VBOC 2XJUA 4CEWA 4XJ9A 1GZWA 2F6BA 1O3TA 5EYYA 3AMNA 4P9XA 3FBMA 3B9IA 1M06G 4YNIA 3VKMA 4AE2A 3O14A 3O7OA 2XPJA 1YIFA 4S2FA 1BEV3 3TBDA 1IS3A 1IGOA 3MLJA 1OLQA 3OY8A 4FPFA 2XVKA 1IQAA 1RL3A 4IEOA 1QJU3 1PK6C 1TME2 3ZXAC 4EN6B 3H9AA 1SLTA 5HCAA 2ZKLA 1N3QA 2OUHA 1UW8A 4FPHA 1Y7BA 4GH4C 4QPGA 4YW2A 3AP4A 3S6PA 3WG3A 2R32A 2GC1A 2WNVA 1SACA 1DGWA 2DURA 3AXDA 1X7NA 2ZX0A 4CEYB 2R061 4ASLA 3OTFA 3SH5A 1NA1C 4COZA 4N53B 3ASIA 1KD7A 1J3QA 1RUF1 2VNRA 2VQAA 4XJUA 4AEDB 2RS32 4B4QA 4XF1A 3U10A 4NN0A 1NOVA 4I0BA 1VBA3 4JC1A 4YLZA 1LHVA 1GQGA 1NLSA 4H7MA 2JKBA 5IK5A 2QCSB 4RQPA 1W6QB 4YGEA 2HWC3 3TNQA 4MZUA 2YHJA 4YW5A 3TOJA 1KS5A 4LLOA 3L9JT 1MR5A 1OFNA 4AVCA 4JQRA 2BNMA 1QKQA 1C8M3 1MEC1 4CZSA 2DVBA 1ASJ2 3QLQA 4Q1PA 3RMXA 2B5HA 2PA7A 1VBD2 3GBWA 4AVTA 2G9GA 3HIFA 4QGLA 5ABJA 2ET1A 1WW4A 2WZR3 3AP9A 3AZXA 3ACLA 3BPZA 4OI2A 4I3PA 2KM2A 1HW5A 3UJOA 4OUSA 3SMHA 2WS93 2QKDA 3ZFGB 5AFBA 1V6MA 5AVPA 5CB7A 5A33A 2XJQA 4LR4A 1GZCA 2VMGA 4Q1RA 1BEV2 2AYHA 4MGKE 4PDWB 5JI9A 2OIIA 1EV12 5F1RA 2BVVA 2W08A 1A8DA 3ZSLA 4I3GA 1V9U2 5KXDA 3AKSA 4YZ4A 2A5ZA 3QACA 1WD3A 4HFSA 4JTNA 3VHRA 2C1FA 2I2SA 4PBPA 4XBQA 2RS53 3ES4A 1MVQA 1TNRA 4Y1VA 2B7YA 1OHFA 1S1AA 3AMPA 3DPRB 3AMQA 1AVBA 1AR93 4OHYA 2ZJCA 2Q1MA 5JPNB 4N9IA 2FQPA 2YROA 4CDUB 3M3EA 1L3JA 4FTBA 4W65A 2IXKA 1GICA 4YG0A 3ZN6A 3MPBA 4AHWA 4E4DX 4Y1ZA 4IEPA 4WM7B 3J8F1 3MICA 1GNZA 1WLTA 5H9SA 3SCFA 4L2NA 2GAUA 3A4UA 1ZZ8A 2VUJA 4L97A 2ARXA 2X53S 3S7EA 4AFCA 4L11A 3M3OA 1GLHA 1Q56A 1A3KA 5JWPA 4PF5A 1GR3A 4XTMA 1RVF3 3FLPA 3AZWA 4FTSA 1UIJA 2I74A 1NCQA 3WCRA 1D0GA 1Z7S2 1ND3B 1RINA 4GALA 4HBNA 4ES9A 3UKNA 2WZR2 3GBFA 4Q8LA 4LE4A 3P3NA 4QPIC 1LB2A 2WS92 5IK4A 4BZ4A 5CNAA 2BFUS 2JD4A 3W59A 1PK6A 4XE9A 1AZDA 2XUMA 2VMIA 4ZU5A 1QQP1 3ZFGC 3UKTA 1XQNA 3AYDA 4S2HA 1PO11 4FPOB 3MW4A 2XJSA 4MGZE 3VHNA 4DXZA 1Q5OA 4DS0A 1RUG2 2R041 3BTAA 4IETA 4YW4A 5FBZA 2Z79A 1FV3A 4YZ2A 2DVDA 1U5IA 5DZGA 3OBTA 1PGL2 3B93A 1NCRA 3AMMA 2Q4SA 2ZMKA 4BMEA 3GBGA 3D6EA 4LO8A 4MXWB 1OQDA 2ES3A 1AR63 4PLMA 1MACA 4WVVA 3V0AA 4JAAA 4H7LA 4AVVA 1H9PA 2ZKNA 3MW3A 3WDTA 2AR6A 4FP3A 1HRV3 1YHFA 4CDUC 2VVFA 2RMU3 1VB2A 1DLLA 4IV3C 5I0TA 4JTOA 3AYEA 1ENRA 5ACA2 4HVRA 1RVF2 5CBLA 2XWBB 1B09A 4CP0A 2VXRA 2IXJA 3GHNA 4NO4A 5CIRA 4BMBA 1Z78A 2PHWA 3VL8A 1LGBA 4QGMA 3TAYA 1AYN1 4I01A 1CN1A 2IZWA 5C4WC 4RGAA 3RI8A 1DHKB 5C8CB 1W6PB 2NQYA 2UYBA 4BA6A 4P9LA 1ND3C 1QF3A 5BNNC 1GYKA 3N36A 2VW2A 1REEA 3HAGA 1IPKA 2GC3A 2B39A 2HEWF 3AP7A 4AQTA 4D7TA 3MIHA 1KJRA 3ECQA 2GMMA 3AKTA 4P9JA 4Q4V1 2VOVA 5GLWA 1Z0HA 1FOD1 2DU1A 4FPJA 1D2QA 2BUKA 3H7YA 3ZX7A 1KFUL 1WW6A 1IS6A 4B29A 2CTVA 2G4IA 3WP4A 4WZCA 3RI9A 3THTA 3MDPA 1PZ9A 5DDJ3 5T54A 1RUH3 4QQOA 4XMIA 5D8AB 2D3PA 4Q4W3 1WLWA 3VKLA 3VBUB 4XJAA 2A3YA 3TRSB 1G7YA 5BNOC 3SNMA 3MI8A 2OUJA 1CPMA 4EWEA 4P9GA 3WP6A 4HLTA 2K2SA 1T6GC 2ERFA 4RR3B 4TZDA 1ND2B 3ZN5A 1HRV2 4YVWB 1RHI3 2Y0OA 3AZYA 2RMU2 2VGDA 2CWMA 2CWSA 4UW4A 1YLLA 4G4FA 2RHPA 2X5IA 1KRIA 2XVLA 1CJDA 3WNXA 5CA6A 4DB5A 2R062 1W6NB 2JG9C 4E4SA 1RUI3 3IKWA 1RUF2 2D43A 4GB31 2DTWA 1SMVA 1CAWA 1WCKA 1X33A 1PZ8A 1SLIA 4LULA 1QJX3 4A7YA 4QQ2A 5EZWA 3VL9A 1Q8QA 2VVDA 3W9AA 1F9KA 3ZDSA 4EN7B 4AEJA 1H8TA 2AGSA 3ZO0B 4YGCA 4BHPA 3ZMNA 1RJ8A 1AL0G 3M1HA 5BPXA 3KCXA 3RYKA 4HVQA 1FMD1 3KCYA 1X50A 3EBRA 2QDNA 4ZXKA 3UV9A 1R1A1 2DVGA 1FNZA 1UD1A 2YPJA 2C0ZA 3RMYA 4RSUA 2MHFA 2ZGQA 1VBE3 1DQ4A 4WVWA 3ZVXA 3M8LA 1MEC2 5KHKA 1UPSA 1DDLA 2R49A 3MEPA 1C4RA 2D40A 5E16A 4YYOA 3VN4A 1R091 5E88A 4E9KA 4X8PA 4IESA 3ILFA 4KL1A 5BV6A 2DYCA 3NKTA 2TUNA 3WT3A 4SLIA 1W0PA 1QJY1 3APBA 1QDCA 4ZKTB 1LULA 1B35C 4I30A 3NKGA 2WIIB 4DFSA 4Y24A 4Y22B 2EXJA 1IHMA 4IV3A 2PHXA 2PAKA 4OFGA 3VBUC 3GYDA 1RHI2 3VHOA 4IEWA 3DF0A 4Z82A 3T1MA 1OKQA 2BFUL 4YM1A 2A7AA 4RR3C 1D4M3 1TME1 3AZVA 2RE9A 4HT1T 1I5ZA 2DCJA 1MZ5A 4YFZA 1ND2C 3USUB 3SHRA 4FSJA 4YVWC 3ZFEC 4XFGA 5C4WA 3WVJA 2GMPA 1WGPA 5GZDA 2DVFA 2CL2A 4Z92B 1RB8G 1ZRCA 1FAYA 4OLLA 4LA2A 1XNDA 3FX3A 3WINE 1REFA 1H9WA 1UCXA 1KFXL 2WNUB 5GLUA 2ZX4A 1VAVA 4HVOA 4IEYA 4Q29A 3ZN4A 5L7OA 4PLNA 2JXAA 2JE9A 1ULEA 1BZWA 2ETEA 1KDKA 4XDQA 4EN8B 4CEWB 1GZWB 3D8CA 3HMYA 4UW6A 4CTEA 2JE7A 4D7YA 2JX9A 3BIWE 3VZNA 1S0BA 1VBE2 1HQLA 5I91A 1BMV1 4QT6A 2XVGA 4DQAA 5BNOA 3JBG1 3MLKA 1NZCA 1ASJ1 2XJTA 1GZ9A 1D4VB 1V6OA 2GNMA 2VNGA 1QXPA 4LUMA 5BUVA 2BPA2 2HWF3 1OQEA 4AHYA 1OQ1A 2W39A 4QU2A 1UKGA 4D3WA 3VBRA 1BEV1 1YO8A 3MIFA 2Q8OA 1Q3EA 5F6KA 1BBT3 1LOBA 3JQWA 1FI2A 1QDOA 4COYA 3VKNA 4RHV3 1D4M2 1QJU1 3EJKA 2R042 1ZBE3 2DCZA 2DCKA 4WZFA 1Q8PA 5JI7A 3SISA 1O4TA 3ZYGA 3MIGA 3AJZA 4JGZA 1YJKA 4LHKA 4RQPB 3H1WA 3WG4A 3X29B 1SBEA 5KC5A 3M4FA 2ZA9A 4DZGA 1YJLA 4AFDA 3HR9A 2QUOA 4AI2A 4XPVA 1CAVA 2B42B 3WG2A 4AEMA 2PYTA 1EPWA 4SBVA 1ULCA 5FMOS 1VBA1 2Y0IA 3HD8B 2XL7A 3O12A 4KNCA 1DZTA 5EYXA 5FPXA 2ZGPA 4XJZA 4MH0E 1GBGA 2A70A 1O3RA 5ABJB 2BQPA 1LEDA 2HWC1 1MQTC 5LEJA 3OD0A 3WQ1A 1HRI3 4EWAA 4EJRA 4QMAA 3B7MA 3I4IA 2MEV3 3WDWA 4D94A 4AVBA 2XLAA 3LZZA 5A33B 1H1IA 4L8QA 1C8M1 4HSLA 5BNPB 3M3CA 4HPKA 1B35A 2P37A 4B7EA 2EA7A 2WZR1 4G9SB 1NXMA 2VPVA 1RUJ3 4NHMA 3R0RA 4YW3A 2I07B 4PIZA 4MLOA 4YVSC 1DQ0A 5IK7A 5A3LA 2BVBA 4W6YA 1SFYA 1XNKA 4RFT0 5SV5A 2OVUA 2NZ9A 2QNKA 3ZYIB 1R1A3 4Q4V2 3VZLA 3ZFEA 4D7SA 5IT6A 1FOD2 4LBOA 4FT8A 2XLFA 4AGVA 2RS51 1AXZA 4X8NA 4QQPA 2UY8A 4RS5A 1S0GA 2DUOA 5E89A 5BY5A 1DFQA 5JDBA 1Y9QA 4PJYA 3IT8A 2CY6A 2WFF3 1AR91 5KBFA 3VBHA 3MW2A 1CX4A 2PHLA 3MIEA 3E5XA 4XFAA 3NSTA 3WY6A 4BIOA 5FLIA 3GZAA 1RUOA 5CFCC 1UU6A 2LALA 4LT5A 3ROUA 4AWDA 2C9AA 5LRRA 1ULDA 5FO9B 2EXIA 1LOFC 3E6DA 3OCPA 1UIKA 2ARBA 4XHXA 3VKOA 2ZX3A 3VDDB 4JDOA 4Y20A 1W39A 4IV1B 1U5XA 2AUYA 2ZGOA 4B8EA 2CGOA 3B3QE 3S7IA 2GNTA 1ZX5A 4XIKA 2WC2A 4I2OA 2ZOEB 2YMZA 1NE6A 1QGLA 2VW0A 2E9QA 4GIQA 1PVXA 4L92A 2W52A 3A0NA 1VLNA 1R1A2 3AKQA 4CDXC 1EPZA 3POYA 1I6XA 1QNWA 2NM1A 3JZVA 4Q2FA 2FHRA 1PMIA 5EV7A 4OI4A 5CU1A 4H14A 1CIWA 1N1TA 2CYFA 2DUQA 5KXBA 5K0UA 1R092 3ME2A 3BOWA 4XFIA 4V1PA 2GNDA 1YFYA 1PVC3 2ZGLA 3B94A 3H7JA 3IWZA 4FPCA 2KA3A 3GHMA 4GKYA 3DUIA 4F7ZA 3IM0A 4HL0A 1JOJA 1PO23 1QJY2 1BJQA 3ZSKA 1K5MC 1CAUB 1CVNA 4FOWA 4HN1A 5T5PA 2ZHLA 3QH7A 5CVRA 1W6OB 5C6CA 4N43B 1AR61 3BALA 1MQTA 3OJBA 4AGGA 1G86A 2VOWA 1LHNA 1J1LA 4AG4A 3PVNA 4YGDA 1MS1A 4GULA 1HRV1 3CJIA 2JECA 3WV6A 2RMU1 1ZZCA 3GZTB 4PIYA 4MX3A 1GFF2 3LGRA 2ZMNA 1QNYA 2ZGRA 3VZJA 2E53A 4MVTA 3AFKA 3ZFFC 5KXEA 2D3RA 3OGGA 2WQ4A 3LOBA 1CAXB 3VGIA 4YVSA 3AKRA 3PMSA 4M3CA 2OZJA 1WMFA 2PLV3 3VDDC 3WXPA 4AXOA 1YWKA 2XBO3 4P9WA 4BM8A 2BW8A 4IEXA 2A3XA 3NL1A 4PLOA 4PCRA 1Q8VA 3OYWA 5FMOL 1V6NA 2EVXA 4Z8BA 1YYNA 1XE8A 5EXOA 5J36A 1XNCA 4W6WA 2UWBA 3AZZA 5AFEA 1PNGA 1V6KA 4XBNA 1BMV2 3MIDA 3LSEA 4CDQB 2XKOA 1UZYA 5EWSA 3JBG2 4QGNA 5I8YA 1C1FA 2R0FA 1ZZ7A 5JIAA 4MGYE 4O9EA 1URXA 3POWA 4AVAA 1COV3 5DDJ1 1RUH1 3V64A 4AW7A 2VNOA 4Q4W1 1QWRA 3ILNA 1MS5A 2YV8A 5DUVA 2RJLA 1UF2C 4S2GA 4MV2A 2HKXA 1OOPB 5E1RA 2PHDA 1LOFA 3QOPA 1WUVA 2R0HA 3AK0A 4NVPA 4K1ZA 1RHI1 3SCHA 1QJU2 5LK5A 4J1XA 2OZ6A 4HN0A 4TWTA 3KB5A 4N43C 1HV1A 3LA7A 2XHKA 1AX2A 4DINB 1UN1A 2GN3A 4XHBA 5JOXA 2HEVF 2A6ZA 3UK9A 4AI3A 4OVEA 3WX5A 5J3UA 3T1LA 4R9CA 1RUI1 4A2UA 3IPVA 1ALYA 4COUA 1REDA 1VBA2 4WVMB 1QJX1 4K40A 5AC93 4UBHA 4CEYC 4N53C 4CDXA 4AEDC 4MYEA 2UU8A 4QQHA 5DUUA 4ISRA 4ONUA 3RWNA 2HWC2 2FMYA 1KS4A 4JGYB 5GZEA 1G9BA 1G9CA 5DG2A 5GJ6A 3VBOA 1VAKA 1ZYBA 1O91A 1H2MA 2TBVA 1C8M2 1VBE1 4XFFA 4YM3A 5GZCA 2R073 2YGMA 4A3XA 4YM0A 2QZ2A 1IS4A 1FNYA 1VR3A 4XXAA 2E7TA 4FPYA 4OI0A 4IEVA 4CDQC 2EALA 4ES8A 2GZWA 1JYCA 1FV2A 4J6GA 2XJRA 3B02A 2ZACA 2YY1A 2C5DA 4AQSA 4HKWA 4M00A 4WM8B 1GSLA 2ZABA 1AUYA 2FMDA 4OHWA 1OD5A 4GH4A 3MFAA 2GU9A 1OLRA 1UAIA 3CLPA 2PAMA 3FLTA 1DQ2A 4PDWC