4WM8C

Crystal structure of human enterovirus d68
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
247
structure length
247
Chain Sequence
GVPTYLLPGSGQFLTTDDHSSAPVLPCFNPTPEMHIPGQIRNMLEMIQVESMMEINNTDGANGMERLRVDISVQADLDQLLFNIPLDIQLDGPLRNTLVGNISRYYTHWSGSLEMTFMFCGSFMATGKLILCYTPPGGSCPTTRETAMLGTHIVWDFGLQSSITLIIPWISGSHYRMFNSDAKSTNANVGYVTCFMQTNLIVPSESSDTCSLIGFIAAKDDFSLRLMRDSPDIGQSNHLHGAEAAYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords VP1
publication title Virus structure. Structure and inhibition of EV-D68, a virus that causes respiratory illness in children.
pubmed doi rcsb
total genus 40
structure length 247
sequence length 247
ec nomenclature
pdb deposition date 2014-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4wm8C00
1WCDJ 5C4WA 4CDWA 1FPN3 1ND2B 1COV1 2RS13 4Q4Y1 3VBRC 1OOPB 2HWB2 1OOPA 1RUC1 3CJIC 4GB31 1Z7S3 5CFCB 2FZ1A 4CDQB 2R042 1NG0A 2XBO3 1AR83 4CDQA 2WS92 5CFCA 1MEC3 4RHV1 4PDWC 1RUH3 4NWVA 1NA1C 2RMU3 1R093 1VAKA 5C9AC 2WFF1 5ACA2 1TME2 1AYM1 1QJY2 2BFUS 1RVF3 4IV3C 2WZR3 3JD72 1RUG2 5DDJ3 1VBA3 5D8AA 1CD3G 1VBB2 2R072 2RM21 2RS53 3ZFEC 2HWE1 1AYN2 3HAGA 3ZFFC 5CFDC 2GH8A 1HQNA 3VBSB 1BBT2 3VBSA 1NA1B 2RR13 4RQPC 5C9AB 1RUD3 5A32B 3DPRC 1C8M3 1K5MA 4RFT0 1FPN2 2RS12 2R041 4QPIB 1B35C 4QPIA 4YVSC 1Z7S2 3NAPA 2R062 5FMOL 2XBO2 1AR82 3FBMA 3S6PA 1HX6A 1MEC2 1GFF2 3TN91 1M06G 2X5IA 3JB8A 1V9U3 5L7OB 2IZWA 3ZFFB 5L7OA 5ACA1 1TME1 1QJY1 2RMU2 4NWWA 1F8VA 4JGZC 1VBC3 3ZFGC 5ABJA 5BNPC 1RUG1 1NCRB 1BEV3 1VBB1 1NCRA 2RS33 2HWD2 1RVF2 2WZR2 4QPGC 4GMP1 5DDJ2 1VBA2 4IV1A 1AR73 1PO13 2RS52 2WWSA 2ZZQA 5BNOB 1BBT1 5BNOA 1PGW2 1ND3C 4N53C 1VB4A 5AC93 4FSJA 1QJX3 1FPN1 2RS11 1EAH3 1QQP3 1DDLA 2RR12 4JGZB 4JGYC 1RUD2 5BNPB 1C8M2 1QJU3 1Z7S1 2R061 2ZAHA 1POV3 3M8LA 4AEDA 1NCQA 3JBG3 1ZBA3 5J98B 1PGL2 1AR61 4RS5C 5C8CB 3VBOC 4YVWB 5C8CA 2RMU1 1AR93 1V9U2 5JZGA 4YVWA 1PVC2 3VBUA 1POV0 1D4M1 2BFUL 5K0UC 2HWD1 4CDUB 1RVF1 1VBC2 1ND2A 2HWC2 2PLV3 2WZR1 1FOD1 4CDUA 4JGYB 4LLFA 5DDJ1 1HRV3 1VBA1 1BEV2 2RS32 2RS51 1ZBE1 4Q4V3 5FOJB 4CDXC 1AR72 1RUE3 1AL21 4GMP0 3VBOB 4Z92B 1MQTB 4RR3C 3VBHC 1VBE3 3LOBA 5AC92 1RUD1 3VDDC 1C8M1 1ASJ1 2MEV3 1VRH1 1PIV1 2TBVA 1EAH2 1X33A 2GSYA 1QQP2 3VBRB 5K0UB 1OPOA 5LK7B 1HRI3 3VBRA 1W39A 4GH4C 1QJU2 3CJIB 1VBD3 3CJIA 1HXS3 1RMU3 1V9U1 3JBG2 1ZBA2 4CDXB 1FMD3 1TMF3 4PDWB 1PVC1 5BNNC 4PDWA 4FTEA 1AR92 2HWB1 1VBC1 2HWC1 1COV3 4Q4Y3 1NA1A 3VDDB 1RUC3 5C9AA 1BEV1 5A32A 2RS31 1R1A3 2PLV2 2DF7A 2WS91 4IV3B 1EV13 1RUI3 1HRV2 4Q4W3 4IV3A 5GKAC 1AR71 1E57A 3ZFEB 1RUE2 1QJZA 3ZFEA 1RUH2 5AC91 5CFDB 5BNNB 5CFDA 3ZFFA 1EAH1 1QQP1 1VBE2 1AYM3 4CEYC 1R092 4WM7C 3VBFC 1QJU1 2MEV2 3JD71 4RQPB 4WM8C 5A33B 4SBVA 3DPRB 5A33A 3DPRA 2R071 1HRI2 1B35B 1VBD2 3JBG1 1AYN1 1RUF3 1ZBA1 4YVSB 4YVSA 1AUYA 1HXS2 1RMU2 1FMD2 1TMF2 4N43C 2VQ0A 2BPA2 4Y5Z0 1CJDA 4FTSA 1COV2 4Q4Y2 4CEYB 3VBFB 3ZFGB 1HRV1 4CEWC 3JB4C 4JGZA 3ZFGA 5BNPA 1NOVA 1R1A2 1H8TC 1X36A 2XPJA 1VB2A 2XBO1 1AR81 1MEC1 1EV12 1RUI2 4Q4W2 4QPGB 5FMOS 1IHMA 1RHI3 1RUE1 4QPGA 3TN93 1RUH1 2HWF3 5C4WC 4CDWC 1VBE1 1ND2C 1OOPC 1R091 1PO23 1ND3B 4N53B 1ND3A 2QQPA 4N53A 1RUG3 1AYM2 1RUJ3 5CFCC 4CDQC 1NY72 4CEWB 1VBD1 4GMP3 4JGYA 3ZXAC 4Y4YA 2BBVA 3J8F3 1RMU1 1OHFA 1RUF2 1PGW1 1FMD1 1TMF1 1PO12 5C4WB 4RS5B 4Q4X3 4RS5A 3VBOA 1MQTA 2RR11 1F2NA 1QJX2 5D8AC 1R083 1R1A1 2R063 1EV11 1RUI1 4Q4W1 5K0UA 3IDEA 1PGL1 3VBSC 1RHI2 1AR63 3TN92 2HWF2 4BCUA 1K5MC 4CDXA 1D4M3 1PO22 4RR3B 3VBHB 4QPIC 2BUKA 2HWD3 4RR3A 3VBHA 1NY71 1FOD3 3NAPC 5D8AB 3VDDA 4GB33 1AL0G 1RUJ2 5J96B 2X5IC 4GH4B 1RUF1 1ZBE3 4GH4A 3J8F2 5L7OC 1PO11 4RHV3 1A6CA 1AL23 4Q4V2 5ABJC 2WLPA 1QJX1 1K5MB 2WFF3 4Q4X2 1NCRC 1ASJ3 1VRH3 1PIV3 5BNNA 1BMV2 4IV1C 1R082 3NAPB 4RQPA 2FZ2A 4EJRA 1SMVA 5BNOC 1RHI1 2X5IB 2RM23 1POV1 2HWF1 1B35A 2HWE3 1PVC3 1AR62 2ZTNA 1AR91 1PO21 5ABJB 2HWB3 2HWC3 1RUJ1 4FTBA 1D4M2 2PLV1 1C8NA 4WM7B 2R043 4CEYA 1FOD2 1RUC2 2WS93 1NCQC 4WM8B 4WM7A 4IV1B 4GB32 3VBFA 4AEDC 3J8F1 4WM8A 1RB8G 5C8CC 4Q4V1 5JZGC 1ZBE2 4YVWC 4RHV2 3VBUC 1AL22 4Q4X1 5ACA3 1TME3 4CDUC 1QJY3 1BMV1 4N43B 2MEV1 2WFF2 4N43A 1R081 3JD73 1ASJ2 1VRH2 1PIV2 1HRI1 1VBB3 2R073 4AEDB 1NCQB 4CEWA 1H8TB 1AYN3 1H8TA 2RM22 1HXS1 1MQTC 5JZGB 1BBT3 2HWE2 2Y26A 3VBUB 4CDWB
chains in the Genus database with same CATH superfamily
4OQ9A 2V5YA 3NW4A 2GNDA 4UFMA 1W2TA 4YZ1A 2D3RA 3ENRA 1OOPB 2VPVA 4F8AA 1HB2A 3D8CA 1CPMA 4DXTA 5JSRA 2DFCA 4GA9A 2W47A 2ZEXA 4XQ4A 4D94A 4EN6B 3PMEA 5LY2A 3RNSA 1GWKA 5FZIA 2B5HA 3WCSA 1DIWA 4DEQA 1YO8A 2R042 5B2GB 2VU9A 5KHJA 2XBO3 3U0ZA 3O1RA 3T2QA 3WG2A 1BKZA 4XAAA 1LR5A 1H1AA 3AMMA 1V6KA 2GMPA 3B69A 4O9EA 1QY4A 5GLUA 2YYOA 1OFSA 4TWTA 1YQ2A 4Q0UA 4CUAA 4XDPA 3TEYA 4KQ7A 3AM2A 1UY3A 1VAKA 3MYXA 1H0BA 4LITA 4META 3THCA 4NE9A 4XF9A 4RYDA 3B01A 3FX3A 2O0OA 2ZGSA 3N9QA 2GMEA 3GALA 1IPJA 3VLBB 3DYPA 2VZVA 4IV3C 4UBHA 1DLCA 5FAXA 1RUG2 1VAMA 4BM8A 3M70A 4MLOA 4JHTA 2R0HA 1CD3G 2CGPA 4BQ3A 2OQ6A 1CESA 3E6DA 4PT6A 3ZLIA 5KR7A 3IAPA 4QQPA 4QKDA 1XBFA 2WT2A 3J26N 3ZFFC 3OY8A 3BGAA 2BVVA 3WP3A 2CDOA 5CISA 3I3MA 3AFKA 3FZ3A 1BBT2 1PVXA 4N9HA 1F31A 5EWSA 2WQ8A 2EAAA 3WP6A 3HQRA 5F3IA 1W3VA 1W6MB 2FCTA 4NIGA 1BJQA 1RUD3 1T2XA 4RFT0 2QE3A 2VZTA 3QH6A 1IPKA 5DABA 4XTMA 1XE7A 1OVPA 3K4AA 2EAKA 4QPIB 4WV8A 4A41A 1UZ0A 1CX1A 2QNKA 5BPXA 4QKFA 4MOAA 3TYJA 5JIAA 3F95A 3ACIA 2H6BA 1Z7S2 4YW7A 4YVSC 3NAPA 3UK9A 5FMOL 1IOAA 3K2OA 4B1LA 3FBMA 1FYUA 5HCHA 4RN5A 1HX6A 5LEJA 4ATEA 1N1YA 1UOJA 1V9U3 2EVXA 2PYTA 3OPTA 4GD4A 3UT0A 3ALQA 4P9XA 2R32A 4RFRB 1H30A 5JVVA 5FO9B 2OYZA 4Z07A 4N8MA 2YPJA 5CKMA 4D3WA 3M4FA 3FFZA 1VBC3 4DXSA 3HVDA 4Q2FA 2NMOA 1UU6A 4AFDA 1NCRB 4CUGA 3PL0A 4IE0A 2VUJA 4LBKA 5FWEA 2ZX2A 2CV6A 2HWD2 2XR4A 1MACA 2XVGA 4YNIA 3IMNA 3UESA 4BB3A 4IGOA 5E1RA 4F3JA 1AX0A 1OLRA 5F5AA 4ARXA 2JD9A 1NYWA 2BJSA 1LODA 4XUOA 2VNOA 2V4AA 1W6NA 1ODNA 1GANA 2JEMA 3N3HA 2Q8DA 4DFSA 4QKNA 1GZCA 1QJX3 4AEKA 1UY2A 1DYKA 4OZOA 3SH4A 3ZMNA 1FPN1 4CXYA 1EAH3 4XDOA 3IIAA 1DDLA 4CPBD 5JSPA 2D3SA 2WYSA 1UYXA 2RR12 4QX3A 5FY4A 4WVVA 2LALA 2FD8A 1FV2A 1WBLA 4FPYA 5BNPB 3TEXA 3VZJA 3M3OA 1XNTA 1HN0A 2ZGQA 4KNCA 4QX1A 2VZSA 4J1WA 2GNTA 2MHFA 2XH6A 3AVRA 1CZVA 4LUKA 5J37A 3M8LA 3OG2A 1XC6A 1MZ5A 1BLZA 2ZGTA 5KXDA 1MVEA 3AYEA 5C8CB 1JI6A 4BE3A 4LQRA 1S0JA 4YVWB 4AI9A 5FKBA 4DMIA 1AR93 5A3WA 5FO8B 4S2DA 4NAMA 3VD4A 3NNJA 1Q43A 1IG0A 1OBNA 4OQ8A 3WLUA 3RRDA 4AXOA 1GLHA 2ZMNA 2P3JA 3WHUA 4UW4A 4DOUA 2PHRA 2JJ6A 3KVBA 1DGRN 2HWC2 5FUNA 1ZZ8A 2WZR1 4UI9L 4CDUA 4ISRA 1US3A 1SEFA 5DDJ1 3ZPYA 1HRV3 4GALA 4QGLA 3T2OA 1KITA 5JXHA 1BEV2 4KI5M 3NV1A 4N7IA 5A7WB 3PUAA 5JR2A 3HJRA 1GQHA 2RS51 2AEYA 2YBSA 1ZBE1 1YIFA 4I0AA 4Q4V3 3VKFC 5FOJB 1AR72 3ES4A 4AVSA 4M0NA 3OGSA 5JPNB 3TNPB 3VBOB 1A8MA 1GKBA 1A3KA 2J1VA 2JWPA 3PDQA 3T2PA 4Z92B 2W92A 4LKDA 5AC92 5F3GA 2ZHKA 5GLVA 2VTFA 4W50A 1W28A 4KGQA 4M3CF 2GSYA 5CVRA 2AREA 2BNNA 1JZ5A 4Q0PA 3D3AA 3C7OA 1QJU2 2B9VA 2CAUA 2OQ7A 4JDMA 2OT7A 4IUGA 5IVJA 4BOWA 1E5HA 2VNVA 2BGPA 4BMBA 1OA4A 4KGGA 5A7QA 5FZEA 4HONA 4XJ9A 3SEEA 2D6MA 2J1RA 1O4TA 1JYXA 2VECA 1HIXA 1HXS3 2UWCA 3JBG2 4HMZA 3FHIB 3JQWA 5JIUA 2NP0A 1R1ZA 2XL7A 3ACHA 2PHXA 4IEPA 3ZOIA 4FTEA 1NAEA 1UU5A 1GQPA 2J22A 1NLSA 2HWB1 1H2KA 5KXEA 1COV3 4Q4Y3 3MFAA 4NRMA 1UXZA 1G7YA 3WCRA 1NA1A 5LB6A 2RS31 4YM1A 2PLV2 1WW7A 1JYCA 3HNYM 3SH5A 2WS91 3Q9OA 4A4AA 4IV3B 4Q4W3 1DZTA 2CWSA 3KV4A 4ZKTB 5CYYA 3BOPA 1WCSA 3N7LA 2J1AA 3ZN5A 4CCCA 1E57A 5C3QA 3O1SA 5I91A 2EA7A 4MGIE 3ZM8A 4AHZA 4AVBA 1RUE2 1QJZA 1JU4A 4OHXA 3LEMA 2PELA 4LBJA 3G7DA 3K51A 1SHWB 2YGMA 4P14A 5JOWA 4DS0A 1QQP1 1CVNA 1MS1A 1PK6C 1AYM3 3H42B 3KHBA 3SHRA 3GJAA 3SQOA 3WQ1A 4CEYC 1G9CA 3M3QA 3S57A 1LU2A 2XQRA 3JD71 2MEV2 2QFEA 4WM8C 3FHQA 4YW5A 3T3YA 3MFCA 4SBVA 4CZSA 3WF3A 4EZHA 1DFQA 5IYYA 2Y38A 2R071 2Z79A 4UFKA 2OS2A 3EQEA 3I2IA 4QU1A 1IZ3A 3BTXA 2A70A 4FFHA 5LASA 3AZVA 1ZBA1 4YVSB 3GJBA 3I2FA 3OSDA 4RD7A 1K42A 3QBQA 2FDHA 3BTZA 5JMCA 2W68A 1AXZA 3WOGA 1GOFA 5FPUA 2TEPA 3OD4A 5T5OA 4AFMA 3I2OA 4DEVA 2VMDA 2JENA 4OFGA 3H1MA 2YHJA 1CJDA 4FTSA 1HV0A 2XLGA 5C3SA 2GZWA 4X8NA 4IEYA 1Y9GA 2Z4FA 3WW4A 4YZ2A 4JGZA 1NOVA 3VB9A 2FMDA 2XBO1 1ULGA 1HQLA 4XQDA 1O3QA 2DUOA 2DVFA 1NZIA 4KG8A 1RUI2 4QGNA 5FMOS 4DUWA 2FDGA 2XJQA 4EROA 3INAA 4LBNA 1WCUA 4HANA 2ZOEB 3J7NA 4QPGA 5GZCA 2XWJB 4V2VA 3BU0A 3I59B 4L2NA 2PMWB 4CDWC 4MG2A 4HSLA 3OF1A 4O9GA 2WT1A 4NHXA 1VBE1 4Q8LA 2QZ3A 3ES1A 3BKZA 4YGBA 3ZR5A 3RZLA 2JG8B 5A7PA 3WV6A 2QQPA 1GYKA 3MGUA 1SCSA 4CDQC 4FPOB 3AP6A 2QJVA 4N90A 3RI9A 1BK0A 4CEWB 4GMP3 4MXWB 2E63A 2P37A 2BBVA 4H3WA 5E89A 1D0HA 2W39A 3N7KA 3LSEA 3SCGA 3GBWA 1SG3A 3SC7X 1T6GC 1RUF2 1ENQA 2JD4A 3E97A 4CCOA 5JUVA 1FMD1 1I6XA 2XOMA 1XU1A 1DLLA 4UAPA 4HKOA 4D0QA 3ZYIB 1OUXA 3WW3A 4DUVA 5C4WB 5JPMB 3MV11 4RS5A 3POJA 4ZPIA 2CU5A 1MQTA 4P08A 1F2NA 4XPVA 2ID4A 4KWJA 3ZPOA 1DZRA 1C1LA 3RJ2X 1R1A1 1CAUB 1X9TA 4LMFA 3MLKA 3ILFA 3RWKX 1O3TA 1J3PA 4BQ1A 4GKYA 2R063 2WWJA 2ZX4A 3LEGA 5K0UA 1JZ2A 5FKCA 5FYYA 5APAA 3B9IA 3LF7A 1N3QA 2EF6A 1HB4A 4K20A 4P9LA 3CMGA 2C9AA 3AL5A 1PGL1 4YGEA 1QDCA 3VBSC 4A6OA 2ZHNA 5F6KA 3RZJA 1RHI2 2WNOA 4Y33A 2WQ4A 4SLIA 1QXRA 1S2EA 1V0AA 2PTMA 4CDXA 3ZDVA 3POFA 3IN9A 1HB1A 4UF0A 4IXLA 1D4M3 1PO22 5KHIA 3NJXA 1D0GA 4RR3A 3VBHA 2WNUC 2RG4A 3USSA 2YUEA 3NNGA 1FOD3 4RGGA 2C24A 5D8AB 2B46X 1H6XA 4Y1XA 3DXUA 4HLTA 2BBAA 4BISA 2LUWA 1OVSA 2X5IC 3CZUA 3ZYHA 5EXOA 2KR2A 3K77A 4YG0A 2VM9A 3O14A 2RE9A 3J8F2 1DGWA 5CZKA 3RZGA 4C8DA 4OUSA 2AEZA 2QTWB 3V0AA 2FCVA 1QH7A 5LATA 5CKNA 2W94A 4UWDA 1GQGA 4LE4A 1YQ6A 1STMA 2BYVE 2ZXQA 5ABJC 2VBBA 4GWIA 5F32A 1H9PA 1QJX1 2B42B 4BIOA 2JDHA 4Z1VA 1LB2A 1SLAA 3I3QA 2VZPA 3ELNA 4XUQA 4OI2A 3H1WA 5DN2A 1PZ7A 4XFGA 1R082 3PIGA 4EJRA 1FT9A 2VZQA 5C3PA 3KWVA 3H8OA 2GDFA 5BNOC 4FAHA 4BDVB 4EN9B 3ZXDA 5FZ3A 2NMNA 5C33A 1KS5A 5EIYB 4I3GA 1KEXA 2FDKA 4H55A 4NVPA 2A6ZA 2D98A 4YYOA 2FDIA 2ZGKA 5LZ6A 1AR91 1H6YA 2UY9A 3SKVA 1H9WA 3LFIA 2WLQA 4ZS2A 2BOIA 4XQWA 1LOFC 3SKJE 3VDAA 1TZOA 3N36A 1RUJ1 1W9FA 2C0ZA 4FTBA 2E7TA 1PK6B 2YY1A 4UOJA 1KRIA 3ZYBA 1GZWA 2WNEA 1AJKA 2HEVF 2OPWA 3JZVA 1QEXA 3UYJA 3VBFA 1NCQC 4WM8B 2DU1A 3N9PA 4GB32 4IV1B 5A3OA 4WZCA 1I9RA 2BU9A 2IFWA 4WBBA 1LGCA 4Q4V1 3H3LA 1Y9MA 5JZGC 1ZBE2 5D1IA 4V2WA 3VBUC 1WA6X 4QDSA 4COYA 1CAXB 3ZN6A 1NXD1 3THDA 5A3LA 4BXFA 3O0WA 3I54A 1PNGA 5FZOB 2X10A 4NO4A 1AX2A 1I5ZA 4CCJA 4S2HA 2PXJA 4N43A 1XJAA 2GH2A 3MHZA 4LOTA 3U07A 3WF4A 4XFIA 3POEA 4MGZE 1GU3A 3FLTA 4FPKA 3I97A 4NRPA 2VUCA 4UFJA 5JI9A 3ZXEA 1NKGA 2TUNA 4AEDB 4OI4A 1JU3A 3D0SA 3K4DA 5FZCA 4BIFA 2H0BA 1AYN3 1OH3A 3EB7A 2D6PA 2DDUA 5F6LB 5JR7B 1H8TA 2XKOA 4AW7A 4FFIA 2RM22 4U36A 1HXS1 3IKWA 3T0DA 3H0OA 4D6QA 1EUUA 1EPZA 3MUZ1 3USUB 4FAGA 5J36A 1CWPA 2ZGMA 3WDXA 5FPZA 3RZMA 3MICA 4CDWB 5CB7A 1VMHA 1FPN3 1COV1 1DQ0A 4Q4Y1 3ZMOA 4GXLA 2HWB2 1X50A 1OOPA 3CJIC 1XNBA 4K9SA 2WSVA 3K48A 5FUIA 1CZSA 5LBFA 3WQBA 3VHPA 1JW6A 5AVAA 3NJVA 4AL9A 4CDQB 1PM4A 1NG0A 4LBLA 3U11A 3IPVA 2WS92 4WVMB 4QT6A 1V6IA 2YDEA 3PTRB 5FZGA 3J7HA 4PF5A 4QX5A 4R4XA 4PDWC 1REFA 3W5NA 4XJ8A 1RUH3 1RINA 4ZONA 5DG2A 3POYA 1VR3A 4K40A 2P4EA 4BK5A 1JUHA 3AJZA 3MPPG 1TNFA 4LO8A 1QWRA 1N1TA 4GWNA 1JZ3A 4NIDA 2R6QA 1W9SA 1R093 4AK3A 5JSOA 1TME2 2KXLA 1AYM1 3OGRA 4CP9A 2BFUS 2DCYA 2YFZA 3OUHA 5IWFA 2WDBA 5HXVA 3VDBA 2G9ZA 1GICA 3H8UA 1H1MA 3O1MA 2WZR3 2GN3A 3WNMA 2Q30A 3FFQA 3JD72 5D2AA 1H1IA 5DDJ3 3VD3A 3GZEA 1MS8A 3ZSLA 1ULFA 2F4LA 1NLQA 3ZIWA 3WF2A 1BZWA 2R072 5IAVA 3AKSA 4DRRA 4FPGA 1SBFA 2RS53 2WNVB 1DQ1A 1V70A 3ZFEC 5BY5A 3AP4A 5FK8A 1G9DA 2EXIA 2IVIB 2RDQA 5CFDC 2D40A 3VBSB 5IAXA 5FBJA 4JQRA 3ZIXA 4JDNA 3AP7A 3LIGA 3NNMA 5FCCA 3S0MA 4AAPA 3VD9A 3AMQA 2IVJA 3IDBB 4BWOA 2W1UA 1EYBA 1SBEA 4RQPC 4PJYA 5C9AB 2JE8A 1H2MA 1W6MA 2VTXA 3DPRC 1K5MA 2X53S 3ILRA 3URFA 4A3XA 4MYEA 3O0XA 1VLNA 5FYUA 1UIJA 2VOTA 4LHLA 5FY5A 2WNUB 1MS0A 1POQA 1B35C 2ZBJA 3D6EA 3B5LB 4QPIA 3T1LA 2Y60A 4I2OA 1RYYA 4MXVA 3EBRA 2XBO2 3S6PA 4WVWA 4F7ZA 1E5SA 3ECQA 4MGSA 3DN7A 1GWLA 4W6XA 1CR7A 3JB8A 2DTYA 4B7KA 5BNQA 3M7AA 3T09A 2YPDA 2WC2A 5ACA1 4MGTA 1YQCA 1YFXA 2X05A 4HXCA 1MR5A 1U0AA 1QJY1 4NWWA 3LZZA 1AJOA 5BNPC 1XQNA 3AC0A 4CU9A 2DUPA 4YPJA 3MO4A 1UNBA 1VBB1 1NCRA 2RS33 4OVEA 2HH9A 4JRAA 5TSWA 4GMP1 1SFNA 3VL8A 3ZSEA 1UD1A 4QDRA 3AZYA 1U5YA 1GNHA 4DQAA 1PO13 5A6ZA 2XVLA 2ZZQA 5BNOB 3LCPA 1EP0A 2E26A 4KBZA 1IS3A 1VJ2A 5A7NA 2BNMA 2YMZA 5DAXA 4AF9A 4LBQA 1DZQA 1NXMA 3EXUA 1ND3C 4LK6A 5T3NA 3ZXFA 4QM9A 4FSJA 1GR3A 4Q29A 4A45A 4MHUA 3IZOA 2RS11 3SEPA 1QQP3 1OA2A 3CEWA 4IEXA 5I0SA 2WBKA 4Y4RA 2ILMA 1RUD2 1GZTA 4KH9A 5FUPA 1B09A 1GNZA 1JYTA 2AENA 4CU7A 2XDVA 1JBCA 3OYWB 4E4DX 3KT4A 2R061 4FXKB 2P5BA 2DWRA 2ZAAA 3ZO0B 2VQUA 2Q8OA 1FV3A 2L9LA 1K12A 2QQKA 3AL6A 2ZAHA 3W5MA 2XHNA 3POBA 2IXJA 4UFHA 1ZBA3 1IGOA 1PGL2 1L7QA 1OF3A 2ZPXA 4NIAA 1DG6A 4I0BA 1UKRA 3VBOC 4HVQA 2A75A 2BZDA 4CCEA 2RMU1 5C8CA 4XTPA 1V9U2 4JQTA 1CPNA 1OQ1A 4XYXA 4QXHA 4YVWA 3R6SA 1KGYA 5LEKA 1MS3A 1PVC2 4NHLA 1D4M1 1LU1A 3HQXA 4K7JA 1NZCA 1RVF1 1ND2A 1VBC2 5F39A 3S7EA 5HV0A 1FOD1 4JGYB 1VBA1 4PI0A 1W8FA 2EALA 4M3CB 5E88A 4NPRA 4AHXA 1UYPA 1S2KA 5FR3A 1V6MA 4XVHA 5EP9A 5A7WA 1FNYA 1DP0A 2WFPA 3CNAA 4AGVA 2G4IA 4H7MA 4XACA 1R64A 5EJ1B 4L97A 1A8DA 5SV8A 5ERLA 4E4ZA 1QXJA 4FQ4A 4PLMA 3I2GA 5EV7A 3UGHA 5AFBA 2J1UA 5IT6A 1XNAA 4XW3A 5FLIA 1CAVB 1W9YA 3N9NA 1VBE3 3LIHA 3LOBA 4J25A 4Q1PA 3KF3A 5IUQA 3X29B 2QQLA 4BU2A 1C8M1 2YBPA 2X29A 2XONA 4R9CA 3SNMA 2TBVA 1EAH2 1X82A 1QDOA 1WLWA 3IDAA 1MS4A 4URTA 5FZ9A 1HRI3 5CAZA 3GGLA 5FMDA 1W39A 4GH4C 3LA2A 2Q8EA 3CJIB 4W6YA 4J6GA 3PHMA 2EIGA 4LE3A 5KXBA 5CA6A 1ZRDA 1V6NA 2NPIA 2B9UA 1LENA 2DCKA 3OCPA 3OGVA 3LPFA 3OTFA 4E2GA 1ZREA 3RYKA 3PVEA 4M00A 1FMD3 2VD7A 4PDWB 3VHOA 4OUEA 4Q27A 1GP4A 5DUVA 4HETA 2VUDA 4MO3M 3WDWA 1LRHA 1N3PA 1AR92 2WYFA 3R05A 3MF6A 4YRDA 4YFZA 1OQDA 1L3JA 3BI3A 2JDMA 4ZY9A 5IK5A 2ZA9A 4AI8A 1V6JA 4XCBA 3VDDB 3MIFA 1RUC3 1MZEA 4AZZA 2LM3A 3OOXA 5A32A 5JOXA 1C1FA 3ZVXA 4BHPA 1R1A3 5T55A 1DU3D 1DQ2A 1VMFA 1WMFA 2DVBA 2JKXA 3H3UA 1DHKB 1A78A 5FTTC 2VVFA 1HRV2 1NT0A 1GUIA 4AGGA 1NUKA 2WO3A 4IV3A 1XOYA 2ZGLA 4XFAA 1UN1A 2Y0IA 2CDPA 2HKXA 1J59A 4KMQA 5EFUA 3CL1A 4Y3OA 3ZFEB 4GAZA 2YROA 2BERA 5FY1A 4COUA 2B45X 2NQYA 5F5CA 1MS9A 4AQ2A 5CFDB 2JXAA 5FXXA 5LY1A 1WLTA 3MUY1 3WDUA 5JWPA 5BNNB 3ZFFA 4QPWA 2V72A 4JV4A 2VCAA 3GM8A 1S0IA 4XBNA 2BTVC 4QAWA 4WM7C 1UOGA 3AK0A 2YBKA 3RQ0A 4RQPB 4HFSA 5A33B 4EE2A 1Q8QA 3DPRB 4OHWA 2O8QA 1WGPA 3BYWA 3FJSA 4A44A 5FOBB 1YLLA 4A3ZA 3Q8AA 2OX0A 2VMFA 2D97A 1B35B 1QXPA 3MIDA 4JKKA 4AI0A 4E4SA 1AYN1 1KDMA 4YZ5A 3GNEA 2WAAA 1X8EA 2VZUA 4YVSA 5T5LA 2RVAA 4IQPA 1HXS2 4Y5SA 5FPBA 4GQ7A 4BZ4A 1N3OA 5EYYA 2JG8C 5FXWA 5FREA 2A6VA 5A3PA 4QB1A 4NPMA 4DO0A 3BIWE 3OBAA 4G9SB 5L9BA 4Z8BA 2WIIB 2WRAA 4AFBA 1COV2 4Q4Y2 3OGGA 3AKPA 2E9QA 3OPWA 1SDDB 5KHGA 4CEWC 1CGPA 2C6SA 3SCHA 5I0RA 1CIYA 1CQ9A 2PQQA 5LRSA 1DF0A 1UZVA 4UW5A 2ADEA 4XF3A 1VB2A 2F6BA 3NJYA 1W06A 1YI7A 3PVNA 4Q4W2 3AXEA 3NWKA 1XRUA 2E7QA 2ZS6B 2GU9A 3VZKA 1RUH1 1QOOA 3B00A 1XSQA 2VMIA 2WL1A 4AYUA 5C4WC 4Q1RA 4IE5A 5FZKA 3PJYA 2GNMA 3I49A 5LWBA 1XXNA 1R091 2FHRA 2QDRA 1OKOA 1ND3B 3AMPA 4DY3A 4I02A 1LNSA 5E16A 1Y3TA 1RUG3 1O6UA 1AYM2 4X6RB 4Y22B 1RUJ3 5L9RA 5CFCC 2ZX1A 5E6HA 3I2JA 4DXZA 2WN3A 3HNBM 1NY72 1XE8A 1VBD1 4GWJA 4Z2WA 2GP3A 3LWCA 3WNLA 3NSTA 4MXWA 2JB4A 2JG9B 5FP4A 1RMU1 3E5UA 4LUMA 5F2WA 3AKQA 3A4UA 1YEWA 1TMF1 1YFWA 3RMYA 3UKVA 2RJKA 3M1HA 4ZXKA 3S5QA 1W03A 4FPJA 5K9YA 4JTOA 1OPMA 2PHLA 3AMNA 3I3EA 2W46A 3TEWA 5D8AC 5FP7A 1J3QA 5FP3A 1KFUL 4MX3A 5L73A 5CG8A 5ANNA 1CAUA 2WWUA 1EV11 2A71A 1PX3A 3PURA 4FP2A 4NHYA 4PBOA 4XZPA 4LO7A 4AVAA 4COWA 1S4CA 2P1BA 1Q56A 2X09A 3D5OA 3N7JA 4CVUA 4P02B 2BWAA 3IB3A 3VBUB 4BK4A 3VKOA 4JX0A 4EWEA 1W0OA 1AR63 1WMDA 4HN0A 3NNFA 3B3QE 3KGZA 3KV9A 4EN8B 2Z2SB 4EN0A 3B02A 1W0NA 2WN2A 4E8CA 4HPKB 3CHXA 2CGNA 3IBMA 4RGKA 1PZ9A 3LQCA 2R0FA 2BUKA 2HWD3 3KM5A 4TLGA 1JUIA 1SQ4A 2AGSA 2VMGA 4XJAA 5IFPA 2PHDA 5J1XA 2IUWA 3H7YA 4EZ4A 3MZHA 1EUTA 4R4ZA 1UW8A 4PQQA 4QQOA 5A7SA 3A22A 5FRAA 4BQYA 1BVVA 3AJYA 4GH4B 4HVOA 4PI2A 2OXBA 3AKRA 4XC9A 1TG7A 3OY8B 1PO11 2HEWF 4K8FA 1VRBA 5L7OC 1AZDA 1HN1A 3GCWA 1AL23 1CZTA 2WKKA 3ASIA 5CEHA 2J1TA 3HWJA 3IAQA 3KV6A 2AUYA 1YQ5A 5IK8A 1ZZBA 2OVUA 3LB9A 2WLPA 2YXSA 4KU7A 2IXLA 1WUVA 5H9RA 1DQ6A 1GMMA 4FT8A 2D6LX 4FPCA 4UYBA 1ASJ3 1DCSA 1ENXA 1VRH3 1QNYA 1Y7BA 3GXUA 4OMCA 4P00B 5GLTA 2QQOA 4XUNA 3V0BB 4AI2A 1GP5A 4IEWA 4IV1C 3MIHA 3NAPB 5IK7A 5LBBA 2FZ2A 1SMVA 1H2NA 1W2AX 1UQXA 2LW8A 3KF5A 4W8JA 4D7YA 1ENSA 2JDZA 3VKMA 5DXDA 3H8XA 5FZ4A 2DVGA 2HWF1 4QQLA 3QOPA 4AQTA 2ZHMA 3OUIA 3OEAA 2NLRA 1UX6A 2KM2A 4D69A 2E33A 3KB5A 2VCBA 5I93A 1PGSA 1OD3A 1LOCA 2WA3A 2DURA 1UY4A 3VZLA 4FXGB 5I8SA 2HWC3 2DU0A 2FDFA 3O1VA 1WCKA 2VAUA 2ZEWA 1D4M2 1C8NA 2ZX3A 5FPXA 1LHNA 2E6VA 1W8WA 1PK6A 3PTYA 3I3BA 4WM7B 3E1F1 4CEYA 1FOD2 4Y20A 4AEDC 4FVVA 2C4XA 3IT8A 3CF6E 2J7MA 2JE9A 4XILA 1WMXA 2HLEA 4WM8A 3POWA 2XB6C 3I4IA 5FYMA 1RB8G 1H2LA 2D93A 1UMZA 4QM8A 1LGNA 1W6NB 2RHPA 4R9AA 4W65A 2NZ9A 3THPA 1JYWA 3U10A 1ENRA 5FWJA 4IL7A 1HV1A 4HKLA 2MNGA 2R16A 3U4SA 3RS6A 1C5IA 4Q4X1 2Q1FA 5DAPA 5FYBA 2Y6HA 5KHHA 5ACA3 2BNOA 4HBNA 1Y43B 1CAXA 2VW0A 3RJRA 4XFFA 2E53A 1QJY3 1BMV1 2VNRA 1GWMA 2PFWA 1OD5A 3KMHA 5FZOA 3EO6A 1PZ8A 5F1RA 2JICA 5FYCA 5I0DA 3LDRA 2PAEA 1HRI1 2VZOA 1VBB3 4H14A 3ZN4A 2ZHLA 2ZKNA 3ETPA 5I8TA 4CPBA 4NIHA 3MV01 3ME2A 4ZZ8A 5KC5A 1W8OA 4IEZA 1QJFA 1W6PA 1CAWB 1N1VA 1W8HA 4XMIA 3HBKA 5A80A 3BTAA 4AE2A 2YC0A 2DCJA 3FMGA 1TEIA 2LS6A 3K4ZA 1MQTC 1IPSA 2P3IA 2J1SA 1BK1A 3BB6A 3KHCA 3USUA 2C9KA 1WMEA 2A3WA 3OUJA 4K21A 5FQ0A 4CDWA 4LHNA 3VBRC 2Y8KA 2RS13 4QWNA 3MW2A 4B1MA 3V56A 3WP5A 1YFUA 2O14A 3N9OA 1RUC1 1LECA 2JDUA 2VZRA 2ENRA 3FLPA 4HOOA 4PIZA 1KJLA 4PLOA 5T5PA 4M4RA 1D7PM 3OB8A 4L9BA 4XJWA 1SFPA 1DGLA 5CFCB 2FZ1A 2B39A 3ZX7A 5JLVA 5JCTA 2A3XA 2WNVC 1AR83 4CDQA 1UAIA 1J84A 1MEC3 3DL3A 5J3UA 2P2KA 4PCRA 4RHV1 2ZKLA 4M01A 3A23A 2GC1A 3AZWA 3BCWA 1AVBA 1K5JA 1IS6A 2P6HA 3KSCA 5F5QA 5A1FA 5LCWL 2JIJA 2XKPA 3GF6A 4QPYA 4Q0SA 3J7LA 1APNA 2RMU3 2VMHA 3WW2A 3NJZA 3Q8CA 2JDAA 5C9AC 2WFF1 3BODA 3T0BA 2BOJA 2HBUA 2WZEA 4JKMA 3ZYJB 4XURA 1YI9A 2PQSA 2OZ6A 2D43A 1UOBA 1RVF3 2ORXA 5JAXA 2AYHA 1ZA7A 3CJXA 2HEYF 4UW6A 3DECA 3CBNA 1VBA3 3T08A 1O7FA 1E5RA 3AYCA 1GV9A 4QKBA 5JOYA 2VO5A 4XHXA 4AQ6A 2HWE1 2JIGA 5A3TA 3F2ZA 1J1LA 1UWWA 1AYN2 4GKXA 4XF4A 1WZXA 5C6CA 3HAGA 3E5XA 2YG0A 4E9KA 3N4MA 4OHZA 3KZ4C 1O5UA 3VBSA 5JXJA 2R1DA 4J1XA 3FUOA 4PLNA 3I3DA 1NA1B 3I2KA 1H8VA 1YRZA 2VG9A 1C8M3 3A7QA 1FPN2 2QCSB 5F3CA 1UL9A 1ZRIA 3GDBA 2R041 3AX4A 3UGFA 3VL9A 1JH5A 2WNUA 1W6OB 1OSGA 1O5LA 1LESA 1YYNA 3KS7A 4AQSA 2WO7A 4QHOA 4ZU5A 5G04L 1S55A 2PAMA 2ORZA 1EPWA 3AKTA 5L9VA 1GFF2 2R30A 2X5IA 4A7ZA 5L7OB 3ACFA 5E8AA 3AMHA 1JOJA 2ARAA 1S0CA 2LROA 3ST7A 5C70A 2GC3A 5ABJA 1F8VA 4HKWA 1WCQA 3ZFGC 4TSVA 2IXCA 1RUG1 2ETEA 3O7OA 1CX4A 2VQTA 3P1IA 3RYPA 5K4LA 1UY1A 1MZFA 2DBNA 2WZR2 2ZJCA 4L8QA 5DDJ2 5BYNA 4CXWA 5CKQA 5H9PA 4ASMB 5FZFA 3NQHA 2SLIA 2BV4A 2XJTA 3WF1A 3JXSA 2RS52 4L0PA 1JMUB 2WWSA 3LFMA 2WQZC 3QH7A 1BBT1 2H6CA 2WZPP 4EWDA 2WJSA 5BNOA 1LAJA 3T4VA 4GJYA 2QZ2A 4N53C 3SITA 1VB4A 5A3MA 2IXKA 5DZEA 5LW9A 3SCFA 3PIJA 5IW0A 4OI0A 1XNDA 1LHOA 5C3OA 3H8RA 4JGZB 4JGYC 1A34A 4H7LA 2VMCA 4MHRA 1Z7S1 1LOFA 3DF0A 4R8HA 1V6LA 2ARXA 3GHMA 3I2DA 5ANQA 3W21A 4AEJA 2Y6LA 2IXIA 4QX7A 3PVBB 4YWAA 4ES8A 5CG9A 1POV3 5DQ0A 1NCQA 3WY6A 2OPKA 5J98B 3T2TA 1K45A 2BDRA 5FZ1A 1AR61 1TNRA 1KFXL 1QU0A 1UOFA 2MPFA 4QDQA 2P6CA 5FZDA 2ZMKA 1FATA 4UBGA 4XJZA 4IE6A 3W58A 2VCCA 1LKNA 4YW6A 5JZGA 4YARA 3B94A 2E7AA 3VBUA 1POV0 1G9FA 3WR0A 2VY0A 3RFRA 1RC6A 2HWD1 5JXIA 2BWCA 2K2SA 2NM1A 2GAUA 4FBFA 1OXCA 5FZ7A 1QIQA 1DYPA 3NO8A 1JTZX 3VDCA 2RS32 2WINB 4DUXA 4M3CA 1O91A 4B4PA 4AI3A 4C0HA 2XLAA 1QOTA 2QQVA 3VD5A 1OT5A 1AL21 1S0FA 1G6NA 3AP5A 2EIEA 3FUQA 4QMAA 5FO7B 3W20A 4EQVA 1UZWA 4QHBA 3O5SA 3WUDA 1JZ6A 3CZJA 1MQTB 1Z0HA 1CAVA 1NE4A 4CU8A 3AZXA 3RVHA 3VDDC 4AI1A 5GZDA 1JZ7A 1ASJ1 1NX9A 4HT1T 1VRH1 3PMSA 1HDKA 3U78A 1X33A 4LO5B 1XPWA 1QQP2 4TN7A 4XIKA 3VBRB 5K0UB 1GBGA 5LA9A 2BQPA 3RWNA 3C7HA 3ZYPA 5FBZA 2ZZJA 3GBGA 3N9LA 1NQDA 5A3UA 1VBD3 4QX2A 3CJIA 1WD4A 4PF1A 3EJKA 4PIYA 2YFUA 3ZKYA 2GNBA 2VJXA 1JYVA 4JDOA 2OUJA 4ZZ5A 3OBTA 4CA9A 1ZRFA 2W95A 1RMU3 3RYRA 4NROA 1LOBA 1ZBA2 4CDXB 1DYOA 3RPQA 1FAYA 1N47A 1TMF3 3AVSA 2FCUA 2YV8A 4UF0B 5BNNC 2XQXA 4PDWA 5GM0A 2RDRA 5B4XA 4QB6A 5KC6A 2HWC1 2YC4A 2VTXJ 4XDQA 2R7EB 4DINB 3HD8B 1H4GA 1ZZCA 4ISQA 2JDKA 5HV4A 2P17A 4YSFA 1BEV1 1FXZA 3WINE 4YW2A 2DBIA 3DYOA 4LHKA 3WXPA 4LPLA 1EV13 1LOGA 2NYYA 1AR71 1V00A 3BPZA 1IQDC 3WF0A 4LKSA 3TEZA 2D5HA 4O65A 1KQRA 1S0EA 3ZFEA 3K46A 5AC91 1HJFA 3VHNA 3U4XA 3JCIA 4ORFA 1JXNA 4L99A 5CFDA 1US2A 2OUHA 2A6YA 1VBE2 4JZRA 2QQNA 4BYYA 3T0AA 5H9QA 4M3CE 3W59A 2J1EA 2BW8A 4HL0A 3H50A 4BH9A 1WWYA 1QJU1 2HYXA 1CIWA 5A33A 4XFCA 3L9JT 3DPRA 3LD8A 2W2IA 1HRI2 2CHHA 2QKDA 4S2FA 4ATFA 5KHKA 1W0PA 2FQPA 1Q3EA 1Z78A 5FXVA 5FZHA 3JBG1 2FBEA 5GLZA 4E27A 4X6QB 4OCTA 4LK7A 4BQWA 1WW6A 2GC0A 3B9CA 1ULPA 3V65A 4I01A 2ES3A 3GBFA 4LNVA 1OH4A 1FMD2 2P3KA 2PA7A 3RSJA 3WW1A 5AFEA 2VQ0A 4XXPA 5L36A 4XETA 3WQ7A 1VIWB 2Q4SA 4OLLA 4XABA 3WNKA 4Y5Z0 3WNNA 2CWMA 1CN1A 1XU2A 4B8EA 4XJUA 3J7MA 3VBFB 3ZFGB 4BQ2A 4MV2A 1W6QB 4MZUA 5DPNA 4JHZA 5BNPA 1UPSA 3BUCA 1R1A2 4P9YA 3G6JB 4JAAA 4MGYE 4GWMA 4C1XA 2JG9C 1AR81 2QQWA 3HNMA 4P5HA 4CP0A 1MEC1 5B4NA 4XAEA 1IHMA 2Y34A 4A42A 2YC2A 1RUE1 5FYZA 1TQ5A 3TN93 2HWF3 4LBMA 3LA3A 3RZZA 3OEBA 3PVOA 4IW3A 5FYVA 4JCKA 1FX5A 3LEIA 1HJGA 1ND2C 4XF0A 2VH9A 2UU8A 1S0DA 2KA3A 1F35A 5A7OA 4N53B 3U14A 4AR2A 1ND3A 3GZAA 4BPZA 4QQ2A 3LGRA 3EMRA 4AHWA 1BHGA 2UYBA 1YIPA 4Y22A 2GC2A 2WA4A 3OD0A 3AYDA 3D82A 2A1XA 4LULA 3ATGA 3I2HA 1W05A 2CNAA 1IS5A 2LRPA 3HN3A 4CCMA 2Q8CA 3U1XA 1LOAA 2BP6A 2EIDA 5ISLA 1OHFA 1ZZ6A 1PGW1 1XYNA 4IESA 4CE8A 1U5ZA 4K3UA 3HR9A 1VAVA 2XXZA 3I8TA 1SDWA 1BQPA 1IG3A 2XJVA 2CAVA 4Q4X3 4GULA 5K8SA 3VBOA 1O4YA 3AYAA 3BTYA 3NKTA 1C57A 1BVP1 1QJX2 4XMAA 1W04A 3UKTA 4V1PA 2N7GA 2LTNA 2VW1A 5FMCA 1U5XA 2G9GA 1VMJA 3IPVB 1RUI1 5FPVA 1EY2A 1OQEA 5FLHA 4L11A 4Q26A 4AEMA 3M3IA 1LEDA 1OF4A 5DUXA 2VL4A 2Y0OA 2QVSB 3KV5A 3KT1A 3N7MA 4MSVA 5FJHA 1VE0A 2ZGNA 5GZGA 4NIIA 3MBWA 2D5FA 3PU3A 5EZWA 2ADDA 4IEUA 4BCUA 4DIQA 2XJUA 5GJ6A 4CXXA 3WUCA 4COZA 5A6XA 2DCZA 3RI8A 4CP9B 2VNGA 1ULCA 3DEMA 4ZHNA 4HPKA 5HI0A 3M3CA 3W9AA 2W87A 3UV9A 3ZKUA 4QX0A 4YLZA 5FP8A 2VGDA 4KBBA 4D6RA 1BCXA 3NAPC 1J1TA 4CCNA 5FPLA 3TRSB 4B4RA 1AL0G 1Q8SA 1RUJ2 2GALA 2EXKA 1JN2P 3MEPA 3POGA 2BRTA 3OBRA 4AWDA 3IDCB 1SBDA 1PMJX 1YC61 3VZMA 2R1BA 2I07B 2JECA 1RUF1 1REEA 1WD3A 4GH4A 2QUOA 5J09A 3P5BA 4RHV3 4CU6A 5J7MA 3WVJA 1A6CA 2VC9A 2CSGA 4Q4V2 4LORA 2Y6GA 3FHAA 5F9TA 4OZXA 1XB9A 4X8PA 5SV5A 4IGPA 1XNCA 1K5MB 1UCXA 2W91A 2WFF3 2RJ2A 1RIRA 5FZ0A 1PIV3 4Y5TA 1VPHA 1RUNA 1UF2C 2D3PA 2PHFA 5FYHA 3AXDA 1SPPB 4OYUA 2A5ZA 3V0BA 2PHWA 2Q1MA 1QH6A 1N1SA 5T52A 1LHUA 4TYSA 2NN8A 3VZNA 1ZX5A 5A6QA 2QBXA 1RHI1 4URAA 1I3HA 1POV1 2W52A 4DY5A 1U12A 3IWZA 2HWE3 5C3RA 4O7XA 4EYUA 5CBLA 2J42A 1PVC3 1AR62 2ZTNA 2ERFA 2VZ3A 2VCMA 2OZJA 2ZEYA 1Q8OA 3VKLA 1DGWX 1PO21 4ET7A 2BEOA 4YW1A 4OI1A 4ZU7A 5FMBA 4NR1A 1X8MA 2A73B 2Z5WA 3FE5A 4FOYA 3C7GA 3DXTA 3GHNA 4YGDA 3HPNA 2AZ5A 2YGLA 3O1TA 3DCQA 2R043 3QACA 4QXBA 2AH2A 1J3RA 4HG6B 4WM7A 3R0RA 4HSJA 5FY8A 3J8F1 1RXFA 1SLTA 3KQRA 2BGOA 4DZGA 1LULA 4XFBA 3H7JA 2DVAA 2YU1A 3VV1A 2XWBB 1UYYA 4LBQB 3SLIA 4JRLA 4IETA 1CJPA 4XUTA 3Q8EA 1DQ4A 3DYMA 1C4RA 4XBLA 2FMYA 1AL22 1DQ5A 3I59A 4LXLA 5JXGA 3HT1A 3FBYA 1OKQA 1AX1A 4AG4A 4XHBA 2VOKA 2ZCWA 4UW3A 4ZXEA 1HKDA 4R9DA 4CDUC 5C7GA 2ZGPA 4NN0A 2JG8A 1QOSA 1R081 2V73A 1ASJ2 2ZGOA 1W9WA 1VRH2 4LOSA 4M0HA 5IHRA 2XLFA 4K6BA 1UKGA 3D0JA 1HQWA 5C5TA 1SFYA 2RDNA 1RXGA 3KT7A 4DXRA 3PUHA 4B3NA 2CTVA 5G05L 3C7EA 4LR4A 5IVCA 4KWLA 3R4DB 1TVGA 4CEWA 3O1UA 1LEMA 2I74A 4UT5A 4OHVA 3P3PA 3M2MA 1CAWA 4C0BA 2D44A 1IKPA 2VXJA 1SLIA 1W2UA 1BBT3 1LOEA 3S7IA 2Y6JA 4F83A 5KBFA 2Y26A 2VBPA 4A2UA 2XUEA 2CL2A 4RL7A 2VW2A 5KWRA 3MW3A 1WCDJ 1ZA4A 4UXAA 2JKBA 3PUSA 4Y26A 4U2AA 5AVPA 5C4WA 4R9BA 4CP2A 2RV9A 1ND2B 1QNWA 3C7FA 4LKEA 4WZFA 1OLMA 4Z82A 5A70A 1OLQA 4KWKA 4OUMA 4BXSV 2ZX0A 1TE1B 1JZ4A 3WZ1A 4GB31 4YZ4A 1SLLA 4XEZA 5LBEA 4UFIA 3THTA 5F5IA 1Z7S3 3RZKA 3CIHA 1Q5OA 3WSOA 1Q8VA 3BOWA 5CFCA 5IVFA 3NV2A 4JTNA 3ILNA 1JYNA 2ZGUA 2WZ8A 3EHKA 4PHZA 1YNAA 4NWVA 3ZDSA 1S2BA 3SISA 4LJHA 2QQMA 2UYAA 3C8XA 5FY7A 3O1PA 1NA1C 1RGSA 2H0VA 5HCBA 3DKQA 3WDYA 1SCRA 1GP6A 4BMEA 1UMHA 5EJZB 5ACA2 1WW4A 4P9GA 2C26A 4QGMA 1QJY2 3JUUA 4LKFA 2YB7A 2JB8A 4FQZA 5M0TA 1UMIA 4KU8A 3LDBA 5FPAA 1T6BX 2WABA 5D8AA 1VBB2 2XL9A 1YCIA 2VOXA 5KXCA 2RM21 3FN9A 4BLIA 1DBNA 2CYFA 4MH0E 1WLCA 1YWKA 2W1SA 3T30A 3QCWA 1YQ8A 4BQXA 5LA1A 4IERA 5EJ3A 1GSLA 1HQNA 2GH8A 4A6SA 3QD6A 4I30A 3TB0A 2X8KA 4YZ3A 2OKXA 4D8MA 2EIBA 3WG1A 2IWGB 4LA2A 2G1MA 2RR13 4NPLA 5A32B 1UY0A 1F4AA 3ON7A 3DGTA 2RS12 2VVEA 4XF1A 2VOWA 1YJKA 4DPNA 5DAVA 2IC1A 1V6OA 1HLCA 3NVCA 3MPBA 4OULA 3Q8BA 1OA3A 4NOTA 2A3YA 2R062 1W6OA 3LA7A 4PIXA 1AR82 2F17A 3E6BA 2EXJA 5CIRA 1MEC2 3RDIA 1YFYA 3GZTB 2HJIA 3NRUA 4JKLA 3TN91 3ZSJA 3CQOA 4GJZA 5IATA 1OLME 2UWAA 1M06G 2VQAA 4HVRA 3TOJA 2RDSA 4IE4A 4LO4B 2IZWA 3L2YA 3ZFFB 5L19A 5L7OA 1LHWA 1SACA 1TME1 2UY8A 3WP4A 4N7UA 2RMU2 1AF9A 1LTEA 4XUPA 5LA0A 4JGZC 4LIVA 5FZLA 4C90A 4K1ZA 4QXCA 4CTEA 2FDJA 3AB0A 3BPSA 2ET7A 1BEV3 1KD7A 5JOZA 4CSWA 4E2QA 1RVF2 2JDPA 3UETA 4HZFA 4QPGC 2PN5A 4FP3A 4B4QA 4CUCA 2QQJA 5A6YA 1VBA2 4P9JA 3MIEA 4IV1A 3C2UA 1AR73 4R52A 3D4KA 4FOQA 2QQUA 1F15A 1MZ6A 5FIXA 1C28A 4MADA 4FOVA 4Y1UA 1PGW2 1IKQA 1AXKA 1YUDA 1L7RA 1O4ZA 3POIA 5F8PA 5AC93 1JOPA 1RL3A 5F37A 5A1LA 3IMMA 2D6NA 3T4HB 5CNAA 1XSRA 3ZYRA 2RJLA 3WHTA 2W08A 5FJKA 1Q8PA 2GN7A 1C8M2 4XZUG 3SXWA 1QJU3 1RUOA 1ZRCA 3K3NA 3CKHA 4GIQA 3MIBA 3MLLA 5BUVA 1K3IA 2OW4A 1REDA 1RITA 2DVDA 4FPEA 2W3JA 3U37A 1ZZ9A 1KXGA 4XE9A 2WO1A 3POSA 3ZXLA 4AEDA 4EV0A 3JBG3 1F4HA 1JOBA 4CRQA 2R49A 1ONAA 4RS5C 4I3PA 1ST8A 3RGBA 4W6WA 4LO6B 4S2GA 1AXYA 2ZEZA 3L2HA 1XYPA 4A7YA 1O3RA 1IS4A 4LIUA 2XGXA 5DUUA 1G9AA 1O8SA 3ABZA 1S0GA 2KD7A 4PQ9A 4FI9A 3FL7A 3FLRA 3P6BA 1QGLA 4IEQA 1S1AA 2BFUL 4D7SA 5K0UC 4CDUB 2VR4A 2PLV3 4YG6A 3OBZA 1HB3A 5DG1A 4LLFA 1IQAA 2I45A 2JDNA 2JE7A 1SZBA 3LE0A 4WVZA 4KL1A 4AGRA 4NAOA 1P8JA 3ZR6A 4Q8KA 3J9SA 3MI8A 2F4PA 5HCAA 4WVMA 3KQ4B 4LHSA 4CDXC 3S30A 2Y33A 1RUE3 2JX9A 3NV3A 3PU8A 4YFWA 4KWUA 3KGLA 4GMP0 4INDA 4OHYA 5IFTA 1OI6A 2VUAA 1JHNA 2WUHA 3K75B 4RR3C 3VBHC 1QJEA 2C1FA 4D7TA 4Q0VA 1RUD1 2Z69A 5IJRA 3WG3A 4ARYA 4BLJA 3BIEA 3ACLA 2MEV3 5H9SA 3UGGA 5JDBA 1PIV1 3BALA 4MUVA 2OA2A 1UX7A 3CO2A 3KCYA 3KD4A 3LOIA 4B29A 2CGOA 1JODA 1OPOA 3KCXA 5DZFA 4NRQA 5LK7B 3VBRA 1W2NA 3C3VA 2ZMLA 5HBAA 1RJ7A 2K9ZA 3VGIA 5LRRA 2K0GA 2ARBA 5GALA 3E5QA 1VALA 2D6OX 3UL2A 1F9KA 1D2QA 5FYSA 2WNVA 1WKYA 1W99A 1V9U1 4FO9A 1ULDA 2WR9A 3NV4A 1PVC1 2B7YA 1GZ9A 4XIOA 3ZYGA 4DNYA 4HN1A 4CUBA 3A21A 2YU2A 1ZZ7A 2Q1ZB 3MDPA 5FDBA 5IK4A 1VBC1 4E2SA 5I0UA 1J83A 1LCLA 4Y24A 5JMOA 2BVBA 3RMXA 5C9AA 2XJSA 1BXHA 1YJLA 4JVAA 4JC1A 5J48A 2DF7A 4P5YA 4RGAA 5T5JA 4H2AA 3TAYA 4BJ0A 1RUI3 3ZXKA 4BQ4A 4RA0A 3WD5A 2WAOA 5GKAC 3B93A 4AHYA 3WNPA 3ETQA 2A6WA 3OGJA 5DZGA 2HBTA 1RTVA 4FFGA 5EPAA 4XXAA 2DV9A 1I1EA 1O3SA 3UNPA 3O1OA 1RUH2 2WSUA 4IE7A 4P9IA 4FPFA 1JS9A 4TXWA 1W90A 2B4KA 3N9MA 5EQUA 3NL1A 1EAH1 3ACGA 4AVTA 1NQJA 4XBQA 4AVVA 1R092 4G3YC 4LBOA 2ET1A 3VBFC 4ES9A 4UFLA 4ONUA 1WA4A 3WEZA 1SLCA 4M4PA 4OMDA 5FXZA 2D7FA 1PX4A 1JHJA 1BYHA 1M4WA 1E5IA 3MF9A 4NUBA 4QXKA 3H9AA 3LKJA 5DUWA 4LBQD 3GCXA 1VBD2 2P3YA 1UPIA 1RUF3 1ZVFA 3AFGA 4AFAA 3P3NA 3ZYFA 1AUYA 1W3XA 4I0WB 3O12A 3O0VA 1MS5A 3BN6A 4LA3A 4CYDA 1RMU2 1LHVA 4MGKE 1UZYA 4XOGA 5F3EA 4YM0A 3HIFA 1TMF2 4N43C 3UJQA 4KG0A 2C5DA 2E32A 2ATFA 1FNZA 1H4HA 2BPA2 3TWIA 5FZMA 1W2OA 1LJ7A 2W5FA 1URXA 5D21A 3RZHA 1OC1A 3U75A 1UO9A 2JDYA 4Y20B 4CEYB 2G19A 2W0XA 3HOBA 5C71A 1MPXA 1HRV1 3JB4C 2DYCA 4E4HA 3ZFGA 5HCFA 1DGRA 1H8TC 1W6QA 4EN7B 2QQIA 1X36A 2XVKA 2XPJA 3OYWA 3ITQA 4IGQA 1EV12 3WQ0A 3DV8A 4QPGB 1RHI3 1X9PA 5CU1A 2PHUA 4G4FA 1QHDA 2OIIA 3PNAA 4YGCA 1GNYA 3FWEA 4YW4A 2Q5TA 1XE0A 4FPHA 4ZU4A 2P34A 1OOPC 1PO23 5FY0A 2I2SA 1OMIA 4FFFA 2SBAA 2QDNA 3A0NA 5HXMA 4N53A 4C91A 3PLQA 5BV6A 3WDTA 4CCLA 3VUOA 2WT0A 3JQXA 1PHMA 5BXXA 3HBZA 1W8ZA 4MVTA 3ORJA 4QX8A 5FFOC 5FLJA 1W6PB 1OUSA 4JGYA 3HN1A 3ZXAC 4Y4YA 3AP9A 3J8F3 2VMEA 1J58A 2XMLA 4NJ4A 5IVVA 2VULA 3TNQA 2CY6A 2UWBA 4HK9A 2EXHA 3ROUA 2XUMA 3MW4A 3R4SA 3UKNA 5DMYA 4LT5A 5FYIA 4Q0QA 4W4ZA 1D2SA 2HYKA 3MIGA 1O8PA 1ZM1A 3PUQA 1PO12 2Y6FA 4K8RB 4N9IA 4NHMA 4Y1ZA 2E51A 5FQ0B 2O1QA 4DB5A 5I8YA 2GP5A 3MLJA 2AR6A 3JU9A 4RS5B 3VHRA 3LPGA 5DAWA 2VBDA 1KDKA 2YZ4A 5GLWA 2RR11 4RSUA 3J4UH 3RG0A 4LEJA 3GYDA 1R083 3WG4A 1LGBA 1Y4WA 3HEIA 1ZRRA 2A7AA 4ZS3A 5T50A 2W9XA 2VXRA 4Q4W1 3LEKA 4D6SA 5FZ8A 4AOCA 2DCTA 3IDEA 5GZFA 3DKWA 3VKNA 3PUIA 4NHKA 3FC0A 2XHKA 4XCAA 1O59A 1ULOA 2E31A 2V09A 3R4UA 2Z42A 5FV3A 3TN92 4EWAA 1G9BA 2HWF2 3BU7A 3LDKA 1K5MC 3TBDA 4Y1VA 5FZ6A 4NMIA 4DRVA 1CONA 3SH3A 2TNFA 3CLPA 3DUIA 3SMHA 5IVBA 4FCAA 4RR3B 3BVCA 3VBHB 4ASLA 4QPIC 4B7EA 2V5DA 1ACCA 1NY71 1WBFA 2VVDA 4K1YA 3VD7A 4BQ5A 1KJRA 3VDDA 4FPLA 4GB33 5J96B 2Y6KA 4Z2AA 5LK5A 1NLRA 4O61A 2XJRA 4ASKA 1MVQA 1ZBE3 3V0AB 1AHSA 1UIKA 2XG3A 4Y1YA 3KLSA 1L7LA 5CADA 4AAXA 1ZNPA 5EYXA 4C1WA 5A3NA 4BA6A 2VZ1A 2AC1A 5LBCA 4MGQA 5FP9A 1PMIA 2ZGRA 1W9TA 2IXHA 3AZZA 2DFBA 3KVAA 5A1AA 3WDVA 3IIIA 3WT3A 3ZXGA 3OJBA 4Q4X2 1SLBA 1NCRC 1GOHA 4YM3A 1W8TA 1JZ8A 5LA2A 2B8MA 5BNNA 4IEVA 1OFNA 1Y9QA 4AFCA 4QB2A 1BMV2 1PNFA 3LAGA 3HT2A 3ZXJA 1W8NA 4FOWA 2ARCA 4RQPA 4IEOA 3VZOA 4GZ9A 2DUQA 1SPPA 3ZSKA 1YHFA 4CCDA 1XNKA 5C8WA 3CDZB 4YW3A 3UJOA 2ZACA 2AACA 3WNXA 1S0BA 2X5IB 2RM23 1UZZA 4YG3A 5FY9A 4LLOA 5I0TA 1F5JA 1B35A 5T54A 5FZBA 2IFRA 2VOVA 4QU2A 3S5AA 4A7KA 5HPOA 4YM2A 2PAKA 2PHTA 3H3ZA 2WO2A 4PBPA 5FYTA 1PMHX 1QMJA 1XYOA 1PM7A 3Q8FA 3APBA 4IDZA 5ABJB 2HWB3 2GMMA 1UYZA 3OPZA 3T1MA 3NKGA 5FK7A 5F7UA 3CU7A 2Q0AA 3QLQA 4COVA 1NE6A 1GZWB 2PLV1 4I09A 5EHDA 3ZSMA 4E8DA 5FZAA 2ZABA 2A6XA 3N35A 1RUC2 1G8WA 2WS93 3HQUA 3KCCA 1D4VB 1ALYA 1UU4A 1YXWA 1ULEA 4TTGA 4TZDA 4ITCA 1OURA 1U5IA 1WW5A 4XFHA 3K3OA 1JYIA 5C8CC 1C3HA 5IVEA 5IVYA 3V64A 3IM0A 4YVWC 4QHZA 2XJPA 1C5HA 5K7PA 4Q5OA 4TLFA 4RHV2 3E6CC 3ZN6B 1HW5A 1FI2A 4LTAA 1QKQA 3LSDA 4P9WA 3WNOA 1TME3 1F5FA 3NNLA 3M3EA 2G9FA 3PJQA 4CCKA 4N43B 2MEV1 2WFF2 4QD2A 1UXXX 1VP6A 1ODMA 3JD73 3B7MA 1PIV2 5JI7A 1KS4A 2Y64A 3GZUC 2W1QA 2V4VA 3HMYA 2R073 2K46A 2UURA 1WLDA 5C5UA 2O8OA 1X7NA 4QQHA 4CP1A 1NCQB 1G86A 3I7DA 1ZYBA 1H8TB 1I5PA 4L92A 1W8UA 5DAQA 5F2SA 3VN4A 3H1YA 3EYPA 3NMBA 2JG9A 2W1WA 5JZGB 1QF3A 2HWE2 1RJ8A 2EICA 3A0KA 3WX5A 4HK8A 2DTWA 2D6KA 1GOGA 5GZEA 2BGCA 4AVCA 2VE1A
chains in the Genus database with same CATH topology
2V5YA 3NW4A 2GNDA 4YZ1A 2D3RA 3ENRA 1OOPB 2VPVA 4F8AA 3D8CA 1CPMA 5JSRA 2DFCA 4GA9A 4XQ4A 4D94A 4EN6B 3PMEA 3RNSA 2B5HA 3WCSA 1DIWA 5KHJA 1YO8A 2R042 5B2GB 2VU9A 3U0ZA 2XBO3 3WG2A 1BKZA 1LR5A 1H1AA 3AMMA 1V6KA 2GMPA 3B69A 4O9EA 1QY4A 5GLUA 2YYOA 1OFSA 4TWTA 4Q0UA 4KQ7A 3AM2A 1VAKA 3MYXA 4META 1H0BA 4XF9A 3B01A 3FX3A 2O0OA 2ZGSA 2GMEA 3GALA 1IPJA 3VLBB 4IV3C 4UBHA 5FAXA 1RUG2 1VAMA 4BM8A 3M70A 4MLOA 2R0HA 1CD3G 2CGPA 1CESA 3E6DA 4QQPA 2WT2A 3J26N 3ZFFC 3OY8A 3WP3A 2BVVA 3AFKA 3FZ3A 1BBT2 1PVXA 4N9HA 1F31A 5EWSA 2EAAA 3WP6A 1W6MB 1BJQA 1RUD3 4RFT0 2QE3A 3QH6A 1IPKA 4XTMA 1XE7A 4WV8A 4QPIB 2EAKA 2QNKA 5BPXA 3TYJA 5JIAA 2H6BA 1Z7S2 4YVSC 3UK9A 3NAPA 5FMOL 1IOAA 3FBMA 1FYUA 1HX6A 5LEJA 4ATEA 1N1YA 1V9U3 2EVXA 2PYTA 3ALQA 4P9XA 2R32A 1H30A 5JVVA 5FO9B 2OYZA 4Z07A 2YPJA 4D3WA 3M4FA 3FFZA 1VBC3 4Q2FA 2NMOA 1UU6A 4AFDA 1NCRB 2VUJA 4LBKA 2ZX2A 2CV6A 2HWD2 2XVGA 1MACA 4YNIA 3IMNA 5E1RA 4F3JA 1AX0A 1OLRA 1NYWA 1LODA 2VNOA 1W6NA 1GANA 2JEMA 3N3HA 4DFSA 1GZCA 1QJX3 4AEKA 1DYKA 3SH4A 3ZMNA 1FPN1 1EAH3 3IIAA 1DDLA 5JSPA 2D3SA 2RR12 4WVVA 2LALA 1FV2A 1WBLA 4FPYA 5BNPB 3VZJA 3M3OA 2ZGQA 4KNCA 4J1WA 2GNTA 2MHFA 2XH6A 4LUKA 5J37A 3M8LA 1MZ5A 2ZGTA 5KXDA 1MVEA 3AYEA 5C8CB 4BE3A 1S0JA 4YVWB 4DMIA 1AR93 5FO8B 4S2DA 1Q43A 3WLUA 3RRDA 4AXOA 1GLHA 2ZMNA 2P3JA 3WHUA 4UW4A 4DOUA 2PHRA 2JJ6A 1DGRN 2HWC2 1ZZ8A 2WZR1 4CDUA 4ISRA 5DDJ1 1SEFA 3ZPYA 1HRV3 4GALA 4QGLA 1KITA 1BEV2 3NV1A 4N7IA 1GQHA 2RS51 1ZBE1 1YIFA 4I0AA 4Q4V3 3VKFC 5FOJB 1AR72 3ES4A 4AVSA 4M0NA 5JPNB 3TNPB 3VBOB 1A8MA 1GKBA 1A3KA 4Z92B 5AC92 5GLVA 2ZHKA 4KGQA 4M3CF 2GSYA 5CVRA 2AREA 2BNNA 4Q0PA 1QJU2 2CAUA 4JDMA 4BOWA 4BMBA 1OA4A 4KGGA 4XJ9A 2D6MA 1O4TA 2VECA 1HIXA 1HXS3 2UWCA 3JBG2 4HMZA 3FHIB 3JQWA 5JIUA 2NP0A 1R1ZA 2XL7A 4IEPA 2PHXA 4FTEA 1UU5A 1NLSA 2HWB1 1H2KA 5KXEA 1COV3 4Q4Y3 3MFAA 3WCRA 1G7YA 1NA1A 2RS31 4YM1A 2PLV2 1WW7A 1JYCA 3SH5A 2WS91 3Q9OA 4IV3B 4Q4W3 1DZTA 2CWSA 4ZKTB 3BOPA 1WCSA 3N7LA 3ZN5A 1E57A 5I91A 2EA7A 4MGIE 4AHZA 4AVBA 1RUE2 1QJZA 4OHXA 2PELA 4LBJA 3G7DA 3K51A 2YGMA 4P14A 4DS0A 1QQP1 1CVNA 1MS1A 1PK6C 1AYM3 1G9CA 3SHRA 3WQ1A 4CEYC 3M3QA 1LU2A 3JD71 2MEV2 2QFEA 4WM8C 4YW5A 4CZSA 3MFCA 4SBVA 1DFQA 2Y38A 2R071 2Z79A 3EQEA 1IZ3A 2A70A 3AZVA 1ZBA1 4YVSB 4RD7A 3QBQA 5JMCA 2W68A 1AXZA 3WOGA 2TEPA 3OD4A 5T5OA 4AFMA 2JENA 4OFGA 3H1MA 2YHJA 1CJDA 4FTSA 1HV0A 2XLGA 2GZWA 4X8NA 4IEYA 3WW4A 4YZ2A 4JGZA 1NOVA 2FMDA 2XBO1 1ULGA 1HQLA 4XQDA 1O3QA 2DUOA 2DVFA 4QGNA 4KG8A 1RUI2 5FMOS 2XJQA 4EROA 3INAA 4LBNA 4QPGA 4HANA 2ZOEB 5GZCA 2XWJB 3I59B 4L2NA 4CDWC 4HSLA 3OF1A 4O9GA 2WT1A 4Q8LA 1VBE1 2QZ3A 3ES1A 4YGBA 2JG8B 3WV6A 2QQPA 1GYKA 3MGUA 1SCSA 4CDQC 4FPOB 3AP6A 2QJVA 4N90A 3RI9A 4CEWB 4GMP3 4MXWB 2E63A 2P37A 2BBVA 4H3WA 5E89A 1D0HA 2W39A 3N7KA 3LSEA 3SCGA 3GBWA 1T6GC 1RUF2 1ENQA 2JD4A 3E97A 1FMD1 1I6XA 1XU1A 1DLLA 4HKOA 3ZYIB 5C4WB 3WW3A 5JPMB 4RS5A 1MQTA 1F2NA 4XPVA 4KWJA 1DZRA 1C1LA 3RJ2X 1R1A1 1CAUB 1O3TA 3MLKA 3ILFA 1J3PA 4BQ1A 4GKYA 2R063 2ZX4A 5K0UA 3B9IA 1N3QA 2EF6A 4K20A 4P9LA 2C9AA 1PGL1 4YGEA 1QDCA 3VBSC 2ZHNA 5F6KA 1RHI2 2WQ4A 4SLIA 1QXRA 2PTMA 4CDXA 3IN9A 4IXLA 1D4M3 1PO22 5KHIA 1D0GA 4RR3A 3VBHA 2WNUC 3USSA 2YUEA 1FOD3 4RGGA 5D8AB 2B46X 4Y1XA 4HLTA 2LUWA 2X5IC 5EXOA 4YG0A 3O14A 2RE9A 3J8F2 1DGWA 4OUSA 3V0AA 1QH7A 1GQGA 4LE4A 2BYVE 5ABJC 1H9PA 1QJX1 2B42B 4BIOA 4Z1VA 1LB2A 1SLAA 3ELNA 4OI2A 3H1WA 1PZ7A 4XFGA 1R082 4EJRA 1FT9A 2GDFA 5BNOC 4FAHA 4EN9B 3ZXDA 2NMNA 5C33A 1KS5A 4I3GA 4H55A 4NVPA 2A6ZA 2D98A 4YYOA 2ZGKA 1AR91 2UY9A 1H9WA 2WLQA 4XQWA 1LOFC 3N36A 1RUJ1 4FTBA 2C0ZA 2E7TA 1PK6B 2YY1A 1GZWA 2WNEA 1AJKA 2HEVF 3JZVA 3VBFA 1NCQC 4WM8B 2DU1A 4IV1B 4GB32 4WZCA 1I9RA 2IFWA 4WBBA 1LGCA 4Q4V1 5JZGC 1ZBE2 5D1IA 3VBUC 4COYA 1CAXB 3ZN6A 1NXD1 5A3LA 3O0WA 3I54A 1PNGA 4NO4A 1AX2A 1I5ZA 4S2HA 4N43A 2GH2A 3U07A 4XFIA 4MGZE 3FLTA 4FPKA 5JI9A 3ZXEA 2TUNA 4AEDB 4OI4A 3D0SA 4BIFA 1AYN3 2H0BA 2D6PA 5F6LB 5JR7B 1H8TA 2XKOA 4AW7A 4U36A 2RM22 1HXS1 3IKWA 3H0OA 1EPZA 3USUB 4FAGA 5J36A 2ZGMA 3WDXA 5FPZA 3MICA 4CDWB 5CB7A 1FPN3 1COV1 1DQ0A 4Q4Y1 3ZMOA 4GXLA 2HWB2 1X50A 1OOPA 3CJIC 1XNBA 4K9SA 2WSVA 3K48A 3VHPA 1JW6A 5AVAA 4CDQB 1NG0A 4LBLA 3U11A 3IPVA 2WS92 4WVMB 4QT6A 1V6IA 2YDEA 4QX5A 4PF5A 4R4XA 4PDWC 1REFA 4XJ8A 1RUH3 1RINA 5DG2A 3POYA 1VR3A 4K40A 1JUHA 3AJZA 3MPPG 1TNFA 4LO8A 1QWRA 1N1TA 4GWNA 2R6QA 1R093 4AK3A 5JSOA 1TME2 2KXLA 1AYM1 2BFUS 2DCYA 5HXVA 1GICA 3H8UA 1H1MA 2WZR3 2GN3A 2Q30A 3FFQA 3JD72 1H1IA 5DDJ3 3ZSLA 1MS8A 1ULFA 3ZIWA 1BZWA 2R072 3AKSA 4DRRA 4FPGA 1SBFA 2RS53 2WNVB 1DQ1A 1V70A 3ZFEC 5BY5A 3AP4A 1G9DA 2EXIA 5CFDC 2D40A 3VBSB 4JQRA 3ZIXA 4JDNA 3AP7A 3S0MA 5FCCA 3AMQA 3IDBB 4BWOA 1EYBA 1SBEA 4RQPC 4PJYA 5C9AB 1H2MA 1W6MA 3DPRC 3ILRA 1K5MA 2X53S 3URFA 4A3XA 4MYEA 3O0XA 1VLNA 1UIJA 4LHLA 2WNUB 1MS0A 3D6EA 1B35C 2ZBJA 4QPIA 3B5LB 4I2OA 3T1LA 4MXVA 3EBRA 2XBO2 3S6PA 4WVWA 4F7ZA 3ECQA 3DN7A 4W6XA 1CR7A 3JB8A 2DTYA 4B7KA 5BNQA 3M7AA 2WC2A 5ACA1 1YFXA 1MR5A 1U0AA 1QJY1 4NWWA 3LZZA 1AJOA 5BNPC 1XQNA 2DUPA 1VBB1 1NCRA 2RS33 4OVEA 4JRAA 5TSWA 4GMP1 1SFNA 3VL8A 3ZSEA 1UD1A 3AZYA 1U5YA 1GNHA 1PO13 2XVLA 2ZZQA 5BNOB 3LCPA 1EP0A 1IS3A 1VJ2A 2BNMA 2YMZA 4AF9A 4LBQA 1DZQA 1NXMA 3EXUA 1ND3C 5T3NA 3ZXFA 4QM9A 4FSJA 1GR3A 4Q29A 2RS11 1QQP3 1OA2A 3CEWA 4IEXA 5I0SA 2ILMA 1RUD2 4KH9A 1B09A 1GNZA 2AENA 1JBCA 3OYWB 4E4DX 3KT4A 2R061 4FXKB 2DWRA 2ZAAA 3ZO0B 2Q8OA 1FV3A 2ZAHA 2IXJA 1ZBA3 1IGOA 1PGL2 2ZPXA 1DG6A 4I0BA 1UKRA 3VBOC 4HVQA 2A75A 5C8CA 2RMU1 4XTPA 1V9U2 1CPNA 1OQ1A 4XYXA 4YVWA 3R6SA 5LEKA 1MS3A 1PVC2 4NHLA 1D4M1 1LU1A 3HQXA 4K7JA 1NZCA 1RVF1 1ND2A 1VBC2 3S7EA 1FOD1 4JGYB 1VBA1 2EALA 4M3CB 5E88A 4NPRA 4AHXA 1S2KA 1V6MA 1FNYA 2WFPA 3CNAA 4AGVA 2G4IA 4H7MA 4L97A 1A8DA 5SV8A 4E4ZA 1QXJA 4FQ4A 4PLMA 5EV7A 5IT6A 5AFBA 4XW3A 5FLIA 1CAVB 1VBE3 3LOBA 4Q1PA 3X29B 5IUQA 1C8M1 3SNMA 2X29A 4R9CA 2TBVA 1EAH2 1X82A 1QDOA 1WLWA 1MS4A 4URTA 1HRI3 5CAZA 1W39A 4GH4C 3LA2A 3CJIB 4W6YA 4J6GA 3PHMA 2EIGA 4LE3A 5KXBA 5CA6A 1ZRDA 1V6NA 2NPIA 2B9UA 1LENA 2DCKA 3OCPA 3OTFA 4E2GA 1ZREA 3RYKA 3PVEA 4M00A 1FMD3 4PDWB 3VHOA 4Q27A 5DUVA 4HETA 3WDWA 1LRHA 1N3PA 1AR92 3R05A 3MF6A 4YRDA 4YFZA 1OQDA 1L3JA 5IK5A 2ZA9A 4AI8A 1V6JA 3VDDB 3MIFA 1RUC3 1MZEA 2LM3A 5A32A 5JOXA 1C1FA 3ZVXA 4BHPA 1R1A3 5T55A 1DU3D 1DQ2A 2DVBA 1WMFA 3H3UA 1DHKB 1A78A 5FTTC 2VVFA 1HRV2 4AGGA 4IV3A 2ZGLA 4XFAA 1UN1A 2Y0IA 2HKXA 1J59A 5EFUA 3CL1A 3ZFEB 2YROA 4COUA 2B45X 2NQYA 1MS9A 4AQ2A 5CFDB 2JXAA 1WLTA 5JWPA 3WDUA 5BNNB 3ZFFA 4JV4A 1S0IA 4XBNA 2BTVC 4WM7C 3AK0A 3RQ0A 4RQPB 4HFSA 5A33B 1Q8QA 3DPRB 4OHWA 2O8QA 1WGPA 3FJSA 5FOBB 1YLLA 2D97A 1B35B 1QXPA 3MIDA 4AI0A 4E4SA 1AYN1 1KDMA 4YZ5A 3GNEA 1X8EA 4YVSA 5T5LA 4IQPA 1HXS2 4GQ7A 4BZ4A 1N3OA 5EYYA 2JG8C 5FREA 2A6VA 3BIWE 4G9SB 4Z8BA 2WIIB 4AFBA 1COV2 4Q4Y2 3OGGA 3AKPA 2E9QA 5KHGA 1CGPA 4CEWC 3SCHA 5I0RA 2PQQA 1CQ9A 5LRSA 1DF0A 4UW5A 4XF3A 1VB2A 2F6BA 1YI7A 3PVNA 4Q4W2 3AXEA 3NWKA 1XRUA 2E7QA 2ZS6B 2GU9A 3VZKA 1RUH1 1QOOA 3B00A 2VMIA 2WL1A 4AYUA 5C4WC 4Q1RA 3PJYA 2GNMA 1XXNA 1R091 2FHRA 2QDRA 4DY3A 1ND3B 3AMPA 4I02A 5E16A 1Y3TA 1RUG3 4X6RB 1AYM2 4Y22B 1RUJ3 5CFCC 2ZX1A 4DXZA 1NY72 1XE8A 1VBD1 4Z2WA 3LWCA 3NSTA 4MXWA 2JG9B 1RMU1 3E5UA 4LUMA 3AKQA 3A4UA 1TMF1 1YFWA 3RMYA 3UKVA 2RJKA 3M1HA 4ZXKA 4FPJA 5K9YA 4JTOA 1OPMA 2PHLA 3AMNA 5D8AC 1J3QA 1KFUL 4MX3A 5L73A 5CG8A 1CAUA 1EV11 2A71A 4FP2A 4PBOA 4XZPA 4AVAA 4LO7A 4COWA 3N7JA 3D5OA 1Q56A 2BWAA 3VBUB 3VKOA 4EWEA 1W0OA 1AR63 1WMDA 4HN0A 3B3QE 3KGZA 4EN8B 2Z2SB 4EN0A 3B02A 4HPKB 2CGNA 3IBMA 1PZ9A 2R0FA 2BUKA 2HWD3 3KM5A 1JUIA 1SQ4A 2AGSA 2VMGA 4XJAA 2PHDA 3H7YA 3MZHA 4R4ZA 1UW8A 4QQOA 5FRAA 1BVVA 3AJYA 4GH4B 4HVOA 3AKRA 5L7OC 3OY8B 1PO11 2HEWF 4K8FA 1AZDA 1AL23 2WKKA 3ASIA 3HWJA 2AUYA 5IK8A 1ZZBA 2OVUA 3LB9A 2WLPA 2YXSA 4KU7A 2IXLA 1WUVA 5H9RA 1DQ6A 4FT8A 2D6LX 4FPCA 1ASJ3 1ENXA 1Y7BA 1VRH3 1QNYA 5GLTA 3V0BB 4AI2A 4IV1C 4IEWA 3MIHA 3NAPB 5IK7A 2FZ2A 1SMVA 1H2NA 4D7YA 1ENSA 2JDZA 3VKMA 5DXDA 2DVGA 2HWF1 4QQLA 3QOPA 4AQTA 2ZHMA 2NLRA 1UX6A 2KM2A 4D69A 3KB5A 5I93A 1PGSA 2WA3A 1LOCA 2DURA 3VZLA 4FXGB 5I8SA 2HWC3 2DU0A 1WCKA 1D4M2 1C8NA 2ZX3A 5FPXA 1LHNA 2E6VA 3PTYA 1PK6A 4WM7B 4CEYA 1FOD2 4Y20A 4AEDC 4FVVA 3IT8A 3CF6E 2JE9A 4XILA 4WM8A 3POWA 2XB6C 3I4IA 1RB8G 1H2LA 2D93A 1UMZA 4QM8A 1LGNA 1W6NB 2RHPA 4R9AA 4W65A 2NZ9A 3THPA 3U10A 1ENRA 4IL7A 1HV1A 4HKLA 2MNGA 2R16A 3RS6A 1C5IA 4Q4X1 5KHHA 5ACA3 2BNOA 4HBNA 1Y43B 1CAXA 2VW0A 3RJRA 4XFFA 2E53A 1QJY3 1BMV1 2VNRA 2PFWA 1OD5A 3KMHA 3EO6A 1PZ8A 5F1RA 2JICA 2PAEA 1HRI1 4H14A 1VBB3 3ZN4A 5I8TA 2ZHLA 2ZKNA 3ME2A 5KC5A 4IEZA 1W6PA 1CAWB 1N1VA 4XMIA 3BTAA 4AE2A 2YC0A 2DCJA 3FMGA 1TEIA 1MQTC 2P3IA 1BK1A 3BB6A 3USUA 1WMEA 2A3WA 4K21A 5FQ0A 4CDWA 4LHNA 3VBRC 2RS13 3MW2A 3V56A 3WP5A 1YFUA 1RUC1 1LECA 3FLPA 5T5PA 2ENRA 4PIZA 4PLOA 1KJLA 4L9BA 4XJWA 1DGLA 5CFCB 2FZ1A 2B39A 3ZX7A 5JLVA 5JCTA 2A3XA 2WNVC 1AR83 4CDQA 1UAIA 1MEC3 3DL3A 5J3UA 2P2KA 4PCRA 4RHV1 2ZKLA 4M01A 3AZWA 2GC1A 3BCWA 1AVBA 5F5QA 1IS6A 3KSCA 2XKPA 3GF6A 4QPYA 4Q0SA 1APNA 2RMU3 2VMHA 3WW2A 3NJZA 5C9AC 2WFF1 3BODA 3ZYJB 1YI9A 2OZ6A 2D43A 1RVF3 5JAXA 2AYHA 3CJXA 2HEYF 4UW6A 1VBA3 1O7FA 3AYCA 1GV9A 5JOYA 4XHXA 4AQ6A 2HWE1 1J1LA 1AYN2 4GKXA 4XF4A 5C6CA 3HAGA 3E5XA 4E9KA 3N4MA 4OHZA 3KZ4C 1O5UA 3VBSA 2R1DA 4J1XA 3FUOA 4PLNA 1NA1B 1H8VA 1YRZA 2VG9A 1C8M3 1FPN2 2QCSB 1UL9A 2R041 3AX4A 3VL9A 1JH5A 2WNUA 1W6OB 1OSGA 1O5LA 1LESA 1YYNA 3KS7A 4AQSA 4ZU5A 1S55A 2PAMA 1EPWA 3AKTA 1GFF2 2R30A 2X5IA 4A7ZA 5L7OB 5E8AA 3AMHA 1JOJA 1S0CA 3ST7A 2GC3A 5ABJA 1F8VA 4HKWA 3ZFGC 4TSVA 2IXCA 1RUG1 2ETEA 3O7OA 1CX4A 3RYPA 1MZFA 2WZR2 2ZJCA 4L8QA 5DDJ2 5BYNA 5H9PA 4ASMB 2SLIA 2XJTA 2RS52 2WWSA 3QH7A 2WQZC 1BBT1 2H6CA 2WZPP 4EWDA 2WJSA 5BNOA 2QZ2A 4N53C 3SITA 1VB4A 5A3MA 2IXKA 5DZEA 3SCFA 4OI0A 1XNDA 1LHOA 4JGZB 4JGYC 4H7LA 1Z7S1 1LOFA 3DF0A 4R8HA 1V6LA 2ARXA 3GHMA 3I2DA 4AEJA 2IXIA 5CG9A 3PVBB 4ES8A 1POV3 1NCQA 3WY6A 2OPKA 5J98B 3T2TA 1AR61 1TNRA 1KFXL 1QU0A 2MPFA 2ZMKA 1FATA 4UBGA 4XJZA 3W58A 5JZGA 1LKNA 4YARA 3B94A 2E7AA 3VBUA 1POV0 1G9FA 3WR0A 2VY0A 1RC6A 2HWD1 2BWCA 2K2SA 2NM1A 2GAUA 4FBFA 1DYPA 3NO8A 1JTZX 2RS32 2WINB 4M3CA 1O91A 4B4PA 4AI3A 4C0HA 2XLAA 1QOTA 1AL21 1S0FA 1G6NA 3AP5A 3FUQA 1KRIA 4QMAA 5FO7B 3WUDA 4QHBA 3O5SA 1MQTB 1Z0HA 1CAVA 1NE4A 3AZXA 3VDDC 4AI1A 5GZDA 1ASJ1 4HT1T 1VRH1 3PMSA 1HDKA 1X33A 4LO5B 4XIKA 1QQP2 3VBRB 5K0UB 1GBGA 2BQPA 3RWNA 3ZYPA 5FBZA 2ZZJA 3GBGA 1NQDA 1VBD3 3CJIA 1WD4A 3EJKA 4PIYA 2GNBA 4JDOA 2OUJA 3OBTA 1ZRFA 3RYRA 1RMU