4WM8C

Crystal structure of human enterovirus d68
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
247
structure length
247
Chain Sequence
GVPTYLLPGSGQFLTTDDHSSAPVLPCFNPTPEMHIPGQIRNMLEMIQVESMMEINNTDGANGMERLRVDISVQADLDQLLFNIPLDIQLDGPLRNTLVGNISRYYTHWSGSLEMTFMFCGSFMATGKLILCYTPPGGSCPTTRETAMLGTHIVWDFGLQSSITLIIPWISGSHYRMFNSDAKSTNANVGYVTCFMQTNLIVPSESSDTCSLIGFIAAKDDFSLRLMRDSPDIGQSNHLHGAEAAYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Virus structure. Structure and inhibition of EV-D68, a virus that causes respiratory illness in children.
pubmed doi rcsb
molecule tags Virus
molecule keywords VP1
total genus 40
structure length 247
sequence length 247
ec nomenclature
pdb deposition date 2014-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4wm8C00
5K0UA 1NCRC 1MQTC 1NCQA 1PGL2 1RUG3 3VBHB 1ND3B 1RUJ3 1VBD1 4QPIC 4JGZB 4N43C 2WS91 1VRH3 4YVSB 1BMV2 1D4M2 1PVC1 1HRV3 2DF7A 3LOBA 3HAGA 4AEDA 4RR3B 1POV0 5A32A 1RUF1 2R041 2X5IC 1AR71 4QPIB 1ZBA2 3VDDA 3ZXAC 1NCRB 4QPGC 5BNNC 3CJIC 4CDUA 1RUD2 5ABJA 2WFF3 3NAPA 4WM7A 4CEWA 1Z7S3 2HWD3 3JD71 4CDQA 1NOVA 4GMP1 1TMF2 1R092 2RS33 5L7OC 1TME1 5J98B 1B35A 4GB31 1PIV2 1C8M3 3DPRB 1PIV3 1H8TA 1RUJ1 4BCUA 3FBMA 1HXS3 4CDWB 1OPOA 1ASJ3 2WLPA 2XBO1 4Q4X2 5CFDC 1OOPA 1FOD2 5C8CA 3ZFFB 4QPGB 1EAH1 1HRI3 2HWC3 4JGYA 3VBRC 1AUYA 1R082 2HWF1 3VBSB 2HWB1 1COV3 1ZBA1 4GB32 4Z92B 1CJDA 3VBOC 1NY72 5JZGC 1PO23 3J8F3 1BEV2 3VBRA 3CJIB 4YVSC 2R061 1X33A 2XBO2 3TN93 3VBUB 1PVC3 1X36A 1AYM2 1QJU2 4IV3C 4N53B 5CFDA 2WS92 1PGW2 4FTEA 1SMVA 1VRH2 5BNOA 2RR13 5BNPA 1H8TC 1AR62 4RR3C 5L7OA 4WM8C 1ASJ2 2WS93 4N43B 4JGZC 1AYM3 2GH8A 1HRI1 1EAH3 1RUI2 1R1A3 2HWE2 1EAH2 1ND2A 1RUI3 5A33A 1PO12 1ZBA3 1K5MC 2BPA2 5AC92 1NA1B 1M06G 4N53C 4IV3B 1K5MA 1RHI1 3VBHC 1GFF2 2RMU3 1FOD1 4Q4W3 3VBUC 3VDDC 1R1A1 1Z7S2 1FPN1 2HWD2 4GH4A 2X5IA 4RS5A 4WM8A 5C9AB 2PLV2 4AEDC 5JZGB 1AR82 4CDXB 1Z7S1 2HWD1 2RS13 2RS53 5ACA1 4PDWB 5BNOC 1PGW1 1RUC1 2WZR1 5K0UB 5FMOL 3ZFGA 1OHFA 3VBHA 1HRV1 4LLFA 1C8M1 1MQTA 5K0UC 1MEC1 1QQP3 4YVSA 1TME3 1RUD1 4CEYC 1V9U2 3S6PA 2WFF2 5ACA3 1ASJ1 2R062 4GMP0 1AR61 3VBOA 4Q4V3 4AEDB 4RR3A 3JBG3 1RUE3 2MEV3 2WFF1 1VRH1 1MEC3 1QQP1 5D8AA 4FSJA 2FZ2A 5CFCB 3VDDB 4YVWB 1VBB1 1HRV2 2GSYA 1COV2 4CDUB 1BMV1 4RQPB 1OOPC 1ZBE3 5ABJB 3NAPB 5DDJ3 1PO21 3J8F1 2RS11 4WM7B 4CEWB 3IDEA 1QJU1 4NWWA 1RVF1 5LK7B 1PIV1 4CDQB 4Q4Y1 1AL23 1RUC2 2WZR3 2PLV1 5AC93 1V9U3 1TMF1 1ZBE1 1B35C 1B35B 2QQPA 4FTBA 3VBFC 2RMU2 4Q4W2 2BBVA 1H8TB 1FPN2 1EV12 1QJY2 1AR81 1R1A2 3ZFEB 4CDQC 1RHI3 3VBFB 4CDWA 1VB2A 1RMU1 4Q4X3 4IV1A 5C4WA 4JGYC 5AC91 4GMP3 4RFT0 1AR91 1OOPB 1VBA3 1BBT2 4Q4V1 5C8CC 1PO11 5C8CB 1AR63 5BNNA 4QPGA 4JGYB 3ZFGC 5GKAC 2R042 1EV13 1HQNA 3JB8A 4GB33 2R043 4YVWC 1AL22 1RUG1 1QJY1 4RS5C 1RUD3 2RS12 1W39A 1FPN3 4GH4C 4Q4Y3 1AYN3 4Q4Y2 3VBUA 3JD73 3NAPC 3JD72 5CFDB 1VB4A 4N53A 2HWB3 4CDUC 4CEYB 1VBC2 2MEV1 2BUKA 1C8NA 1NCQB 4PDWC 5BNOB 1ND3A 4NWVA 5BNPB 1ND2C 2R063 4JGZA 4RHV1 5L7OB 5FOJB 2XPJA 1VBE3 1RB8G 1FOD3 5BNPC 1RVF3 1A6CA 1MEC2 1C8M2 2HWF2 3M8LA 1FMD2 2BFUL 2HWF3 5A32B 1V9U1 2ZZQA 4QPIA 1NA1C 5J96B 4IV3A 1QJY3 1NCQC 4Q4V2 1POV1 1VBD2 1NCRA 1AYM1 1VBE1 4GH4B 3JBG2 2RR12 1AR73 2X5IB 1RUC3 2WZR2 1RUH1 2HWC2 4CDXC 5C9AA 3JB4C 2HWE1 5JZGA 1HXS1 3TN92 1F2NA 1VBB3 2R073 1NY71 3ZFEC 1RUG2 5DDJ1 1RMU2 2VQ0A 1R091 1RHI2 5DDJ2 1EV11 2HWB2 3ZFGB 1R081 3DPRA 1RVF2 2WWSA 2RM23 1QJX1 1ND3C 2RM22 1MQTB 2RS52 1BBT1 1RUF2 3JBG1 2R072 1RMU3 4Q4X1 1AYN1 3ZFFA 3VBOB 1AR93 1F8VA 1D4M3 1AR72 1VBC3 1FMD1 3VBSA 3VBSC 1WCDJ 2ZAHA 5D8AB 5CFCA 1PVC2 1POV3 4YVWA 1QJU3 3ZFFC 2HWE3 4WM7C 4CEWC 4RQPA 4RHV2 1RUH3 1TMF3 4RHV3 2RS31 1VBC1 2MEV2 2PLV3 5ABJC 1PO22 3J8F2 3VBRB 3CJIA 2RS32 1AR92 2R071 1AR83 1BEV1 1QJZA 1VBB2 2IZWA 3DPRC 4RQPC 5C4WC 1RUF3 4IV1C 1RUJ2 1E57A 4CDWC 5CFCC 1QJX3 1IHMA 3TN91 1PO13 3ZFEA 4FTSA 3VBFA 1NG0A 1BBT3 4IV1B 5C4WB 1VAKA 1D4M1 1AL21 1HXS2 4N43A 5FMOS 1ND2B 4Y5Z0 5BNNB 1AYN2 5A33B 1COV1 1RUE2 1QJX2 1CD3G 1VBE2 2BFUS 1PGL1 1R093 1NA1A 1RUE1 2RS51 1TME2 1K5MB 4SBVA 1QQP2 1HRI2 1RUI1 2RM21 5ACA2 4EJRA 1R083 1VBA1 2Y26A 2TBVA 2ZTNA 5D8AC 2XBO3 4RS5B 1ZBE2 4WM8B 1DDLA 1RUH2 2HWC1 1VBD3 2FZ1A 1BEV3 2RMU1 4Q4W1 2RR11 1AL0G 4CDXA 5C9AC 1VBA2 1HX6A 4PDWA 4Y4YA 4CEYA 1FMD3
chains in the Genus database with same CATH superfamily
4IE0A 1ULEA 4FPLA 4MGYE 3OJBA 5K0UA 1MQTC 3ZXAC 3MV01 1PGL2 4OYUA 2P37A 4NAMA 1XNDA 4O7XA 4EN7B 2GMMA 1E5IA 4CXYA 1A78A 4OQ8A 1KJLA 4MHUA 4XFCA 1YQCA 4YVSB 1OURA 3POIA 4GXLA 2WUHA 1D4M2 1US3A 2LM3A 4ZU4A 3L2YA 5A1LA 3B93A 4B4QA 5HCBA 3WNKA 4WZCA 4B8EA 2DF7A 3IM0A 5FKBA 3LOBA 3RI9A 2RHPA 3LDRA 5FZMA 2RG4A 1QMJA 2ZGPA 5CKMA 1DQ1A 1RUF1 1AR71 1NXD1 1GKBA 2GNTA 3PU8A 1E5RA 1E5SA 5T52A 4LBLA 1LHWA 2XUMA 4ARYA 1T2XA 5DQ0A 5GJ6A 4GIQA 2A6XA 1TNRA 1IG3A 1PK6C 4YM1A 2EXKA 1N1VA 2VCBA 1LECA 3PU3A 4K7JA 4HONA 5FZ9A 1SQ4A 5L9RA 4GWNA 4LKSA 1H1MA 1RTVA 3T2PA 2KM2A 4QGNA 3DYOA 3K3NA 3NAPA 2XL7A 3ZXJA 2HWD3 4Y1UA 5JR2A 5FYZA 4AVAA 4QMAA 4YLZA 4H14A 3INAA 3WUDA 1LOEA 3BPSA 3RQ0A 3ZM8A 4GMP1 1O5UA 4AI3A 3RWNA 1CGPA 5F39A 1AXKA 1TME1 1UAIA 1Y9GA 4GB31 4P9WA 5D2AA 1FX5A 4BQ5A 2BRTA 1DG6A 4CP1A 1C8M3 2DVGA 3AYAA 4S2HA 4U36A 2FDGA 1NLRA 3VL9A 2OZ6A 3K51A 5FPZA 1OPOA 1ASJ3 1LENA 4A41A 4YW4A 1OQ1A 3D4KA 4PQ9A 2O14A 3V0BB 4OULA 3DYMA 3VKOA 1GWKA 3S5QA 2WNVB 5T50A 5CFDC 1OOPA 4QGLA 5F5AA 4LKEA 5FP9A 4HOOA 1CAXA 3ZFFB 4OHWA 1TG7A 4QPGB 3T0BA 4JGYA 3HN3A 3VBRC 3AL5A 4QM8A 1LB2A 1AX0A 1UOBA 3RZMA 4XFAA 2HWF1 5LB6A 5JI9A 4CU6A 3FN9A 4BXFA 1COV3 1ZBA1 2P34A 3LCPA 4NN0A 5E1RA 1W6PA 1F5FA 4O9GA 2AEYA 4NRMA 1Q8PA 3V65A 3VBOC 4Z1VA 4HVOA 2QUOA 2VGDA 4HBNA 1URXA 4JV4A 5AVPA 5FZBA 3J8F3 1YLLA 3LPGA 4A3XA 1D7PM 3H9AA 5I8TA 5FZLA 4IEQA 5JOZA 5IVEA 4F7ZA 3ETPA 2R061 3ZSKA 1UMZA 4XMIA 2Q8DA 3VBUB 1IOAA 2JG9C 1WUVA 3I97A 1YQ8A 3QH7A 3TYJA 5CFDA 1W8NA 4Q0VA 4XYXA 1KITA 2GZWA 1XNCA 3AX4A 2ZGKA 3T4VA 4FTEA 4YGEA 4Y20B 2JB4A 2OT7A 2ZGNA 5AVAA 4Y3OA 1FXZA 1OF3A 1VRH2 4TWTA 3BTAA 1UYZA 1Y4WA 2GU9A 1H2KA 2JX9A 4CCOA 5F5IA 1OUSA 1YYNA 4INDA 1FATA 3MLLA 4ASLA 3MI8A 5HCFA 4E2GA 2D98A 2G9FA 4Y22A 2OS2A 2AR6A 5F8PA 4E8DA 5FLJA 4H2AA 3W21A 1AR62 2BVBA 5L7OA 4IUGA 4OI0A 2GDFA 3PTYA 4LK6A 5KC5A 4XUNA 5M0TA 1H0BA 3AP7A 2GH8A 1RUI2 1WGPA 1S0GA 1R1A3 3BIWE 4QKFA 4P02B 3CKHA 3D6EA 1Q43A 2ZZJA 1JZ6A 1ULPA 2YB7A 2JE8A 1DF0A 1K5MC 3RFRA 1DYKA 2VQAA 1NA1B 1ZRDA 2WINB 4BH9A 3MHZA 2ZX1A 3WOGA 4QPYA 3RGBA 3VBHC 5EJZB 1WW5A 2RMU3 4D7TA 2P6HA 1YJKA 1Z7S2 1FPN1 4XAEA 3GBGA 4GH4A 4KH9A 5DZEA 3AFGA 4J25A 1AJOA 2D93A 2G1MA 3ELNA 1JMUB 1GP6A 2OVUA 3KB5A 4M01A 4AVBA 5FP8A 4MSVA 4ZZ5A 4ZZ8A 1JOBA 3ACIA 4EZHA 3FLPA 1AR82 2LUWA 3C7FA 2ZBJA 1MS9A 2PHDA 2DVAA 2XL9A 3VHNA 4FOYA 5JSOA 2HWD1 2VMEA 4GD4A 5A3NA 2FCUA 2P3JA 2RS53 2VOWA 2Y60A 3LEMA 3NJXA 1LHUA 3QH6A 4H7MA 1NQJA 4PDWB 3VV1A 4AVSA 4C91A 5A6YA 4D6SA 1UU6A 3KT4A 3KWVA 1Y7BA 5K0UB 3LA3A 1QU0A 1WW4A 2VH9A 3ZFGA 1K3IA 3G6JB 1HRV1 3U11A 4DPNA 1OQEA 1GMMA 4A45A 1MQTA 2K2SA 2D5FA 1EYBA 3OGVA 2XLGA 4YVSA 1J83A 2IXIA 4P9XA 3UETA 1ASJ1 1W99A 4P9IA 5FWEA 1BXHA 1ENXA 5GZGA 3K75B 3NW4A 1OFNA 5FTTC 4GMP0 2WWJA 2BP6A 2KA3A 1UZ0A 3J4UH 3KVAA 5IK8A 4KL1A 3J7MA 4X6QB 5DAXA 3MIEA 1Q8QA 2JG8A 2MEV3 2WT1A 3AK0A 4HPKA 4GKXA 1BK1A 4UW3A 2JB8A 4BOWA 4COUA 1MACA 4C8DA 4MX3A 4YVWB 2OX0A 1DYOA 1TNFA 1XU2A 2H0BA 3RJRA 4RQPB 4XUOA 3K3OA 1F35A 1QXJA 4RN5A 4OVEA 3VD5A 1I1EA 2A75A 3I2FA 3OCPA 3NAPB 5IFTA 4YNIA 3BI3A 3RWKX 2IXLA 3WQ0A 2WR9A 3IKWA 5GALA 3CLPA 5FZIA 1QJEA 2GMEA 4IEUA 3USUB 4KWUA 4Z82A 3V64A 2B8MA 4AI0A 1AL23 4F8AA 1XPWA 2WWUA 4QQ2A 1UY0A 3BIEA 1V9U3 2IUWA 2HEVF 1NLQA 5LA1A 2QQPA 3VBFC 3A0NA 5DG2A 4QDQA 4QX7A 1R1A2 3O12A 4QX3A 1NLSA 5FZ6A 1RHI3 2VO5A 3N9OA 4CP9A 2JE9A 4Q4X3 2GAUA 4FPCA 4KGGA 1UO9A 1TZOA 2DVDA 2VL4A 2ARCA 3IAPA 1RJ7A 1CONA 4LE3A 5AC91 1RXGA 2VW0A 2WNVA 2MPFA 3JU9A 2ZGQA 4GULA 1OOPB 3BODA 3MIFA 5FPBA 3WCSA 1Y43B 2D40A 1W6MA 3T3YA 4CU8A 2RDRA 3I3QA 4QPGA 1PK6A 1S0CA 1UYXA 1NT0A 1LGCA 4JGYB 2ZMLA 3ZFGC 5IT6A 1HQNA 4IGOA 4I30A 4CP0A 3O1MA 3N9PA 1WKYA 4PIYA 1PNFA 2RJ2A 2XJPA 4MG2A 3ME2A 2BGCA 3OD4A 4CU7A 1Y3TA 3ATGA 4YW5A 1W6NA 2EALA 4ARXA 1NKGA 1QNWA 3P5BA 5LBFA 3JZVA 5DUWA 5F3IA 4DXTA 1V6MA 1JU3A 2B39A 2RDNA 4CZSA 1WCKA 2UYBA 2RS12 1W39A 4BQXA 5A7SA 1W9YA 3MUZ1 4B3NA 4GH4C 2OQ7A 3F95A 4TYSA 2ZA9A 4F83A 2A6ZA 3HVDA 5T5PA 4FQZA 3VBUA 3JD73 5B4NA 1UOJA 4LXLA 5CFDB 1VB4A 3L2HA 2Q1FA 2YUEA 3FUOA 4Y20A 1MZ5A 1VBC2 3DV8A 4FXGB 4XDQA 2BUKA 1W8HA 3VBSA 4AGRA 1UMHA 3ZN4A 5A6ZA 2NYYA 5F2SA 3HEIA 1JS9A 4QHBA 5B4XA 5FZCA 4COZA 3AKTA 5FPLA 5F5CA 3OG2A 2JIJA 1K42A 1XQNA 2X8KA 2W95A 3POBA 4RHV1 3ACFA 5L7OB 4FQ4A 1JYNA 1QH7A 4KWLA 1S2BA 1GOGA 3ILRA 3KQRA 4BISA 1JOJA 2Q30A 4Q0QA 3WDYA 4OHXA 5HCHA 1MPXA 2JDUA 1RB8G 3PDQA 4OI4A 1A6CA 1GZ9A 3AFKA 4MXVA 3H7YA 1C8M2 4GAZA 4KGQA 1YQ2A 4M4PA 4RD7A 1PM7A 1UY1A 4BPZA 3M8LA 2W1WA 2BFUL 2HWF3 3OOXA 5A32B 2W47A 4L8QA 5FUPA 4O61A 1C1FA 2CGPA 5J3UA 3RZGA 3FUQA 4NROA 5APAA 1QJY3 1TQ5A 3A4UA 4Q29A 4CCMA 4Q4V2 4Q0SA 1AYM1 4GH4B 5CU1A 5FXXA 1L7LA 2XJRA 4PLNA 2VTXJ 3KGLA 5L73A 4QX2A 1RXFA 4L11A 4P9LA 5K8SA 4NR1A 2P3YA 3SH5A 3GJBA 1I3HA 1QH6A 2YZ4A 2XVKA 3T30A 4QKDA 4LA2A 3ZFEC 4CCDA 1H4GA 4EV0A 1UU5A 5GLWA 3R4UA 1CZTA 2FD8A 3K77A 1HKDA 5DDJ2 4UOJA 2ZHKA 4K1YA 4M3CE 3CO2A 2MHFA 3ZFGB 1R081 1LODA 3DPRA 2VZQA 1RVF2 4QX8A 5DAPA 1W05A 5SV8A 3WHTA 1MS5A 2BV4A 1W8TA 2J1AA 1LEDA 2RM22 3AL6A 4FOWA 1SLCA 5I0SA 3BKZA 1MQTB 1IGOA 4PLOA 4AI1A 1BZWA 2W91A 1QIQA 3MEPA 3ZSLA 4Q4X1 1W9WA 2VTXA 4I0AA 5A7QA 2BERA 1OQDA 1WA6X 5BXXA 3T0DA 1JYIA 3D0JA 1W2AX 5LASA 3JQXA 2IXKA 1AX1A 4UW5A 1HV0A 2JG8B 4HPKB 1I5ZA 4RFRB 3W58A 4URAA 2D6OX 3JUUA 1XU1A 2WO2A 2ZPXA 1O91A 2VQUA 5FKCA 1PVC2 3BVCA 4YVWA 3DYPA 4XCAA 4XIOA 5JAXA 4XF1A 5EJ1B 3SQOA 1ZZ7A 2Q5TA 4KU8A 3LEIA 2W39A 4CEWC 3O1UA 1WMEA 4RQPA 2WIIB 2WQ4A 3ZSJA 1J3PA 1RUH3 3ZXEA 1SFNA 4DUWA 2RS31 1VBC1 2PLV3 4L92A 2ADEA 2HLEA 4GJYA 3OSDA 4PLMA 2QQWA 3VBRB 3WDVA 1JZ3A 3N7KA 2JD4A 2WT0A 1DQ2A 4DFSA 3CDZB 4HL0A 2XKPA 3USUA 4HVQA 2Z5WA 5FQ0A 1UKRA 1VBB2 3ZKUA 3CIHA 5JPNB 4Q5OA 5C4WC 4HKOA 4CU9A 4JQTA 1OLRA 2V09A 1RUJ2 5FPVA 2ZGSA 2FDFA 1YXWA 1UPIA 1UXZA 3J7LA 4XILA 1U5YA 5HXVA 5CFCC 1CVNA 1QJX3 1PO13 2W3JA 5FPUA 4CP9B 4KWJA 3RSJA 1PZ7A 2W08A 2XGXA 4XFFA 5FY7A 3WW3A 5J48A 3N7JA 2J22A 3OBZA 4FP3A 3UKTA 2VMFA 3E1F1 3SKJE 1VAKA 4IEVA 4FPYA 3UKNA 3VD7A 3WNNA 4N43A 1AL21 1HXS2 4MLOA 5FMOS 2G9GA 3EB7A 4LJHA 1W2OA 1W6MB 3BALA 3H3LA 1EUTA 1PK6B 4O9EA 1OC1A 4IEOA 1QJX2 2P3IA 3M3EA 5JVVA 1VBE2 2BFUS 5I0DA 1RUE1 2YGLA 3KQ4B 4AFAA 4E4ZA 2P1BA 4JZRA 5GZFA 1W0OA 2E26A 2PAKA 1QOOA 2EXJA 1QQP2 4SBVA 1W6NB 2VBBA 5FY1A 4DEQA 4B7EA 2VPVA 1VBA1 2ZTNA 5HI0A 2YHJA 1KFUL 3TEXA 2NPIA 3IDBB 4RS5B 3T08A 2JG8C 1YIFA 4LHLA 1HJFA 2SBAA 2XQXA 4HMZA 2ZCWA 3ZVXA 1NAEA 3LEKA 3Q9OA 4V2VA 1BEV3 5DZGA 2RMU1 5FY9A 2VMCA 2RR11 1WCSA 3C2UA 4XABA 4C90A 1VBA2 5CKNA 3PMSA 2TUNA 4Y4YA 3RG0A 1W3XA 3AMPA 3THCA 4BXSV 3T1LA 4XE9A 1NCRC 3RMYA 4DINB 4NHKA 3AKQA 4P5HA 3OYWB 4LBJA 4LHNA 5IFPA 4EZ4A 3OUJA 2YC2A 4K3UA 4QPIC 3LFMA 5FZKA 2WS91 2OYZA 2BW8A 3ZYRA 2YV8A 1WMFA 4XFGA 1BMV2 3ASIA 3HT2A 2CDOA 3KCYA 2DCYA 4XFIA 2P3KA 4DUVA 2QJVA 5CG9A 2X10A 1GU3A 3ZDVA 4I0BA 4YPJA 4XUPA 1SEFA 1SBFA 4YGCA 3HAGA 3LF7A 4IGQA 4AEDA 1ULGA 4RR3B 5EZWA 5FUIA 1LHNA 5A32A 2ARAA 2X5IC 1ZYBA 2OUJA 4FPJA 2C24A 2Y34A 3I59B 4IEWA 5FV3A 1W2UA 3U37A 1H30A 1XB9A 2XONA 4BQ2A 1ZA7A 4JRAA 3APBA 3HMYA 4CP2A 2R6QA 1CZVA 2BQPA 5BNQA 2WAAA 5FZ7A 4FPFA 5HV4A 2R0FA 1O8PA 2Y6JA 3UGHA 1DU3D 1GWMA 4WVZA 4WM7A 2W87A 2QZ2A 1J3QA 2DUOA 1GQGA 2ZX0A 1XSRA 2J42A 1U5ZA 2RJLA 1UY2A 5T54A 4AXOA 5LBCA 1NOVA 4XEZA 5CA6A 2AZ5A 1R092 4AGGA 3BGAA 1OPMA 1B35A 2YPJA 3MICA 1NX9A 3JXSA 3IDAA 3DPRB 4DO0A 2CAUA 1H8TA 1CN1A 5DXDA 5CYYA 5E88A 1GQPA 1UL9A 5C70A 2JXAA 4FVVA 5A3PA 5GZDA 4XJZA 3LB9A 1UWWA 2GC1A 1CAVA 5FYSA 3WW2A 1NQDA 1KDMA 4UFHA 4D7SA 1UXXX 2XBO1 4Q4X2 4UT5A 4PI2A 1DQ5A 3NL1A 2OPKA 1FOD2 4LA3A 5C8CA 1CIYA 5I8SA 2WNVC 4Y26A 3SCHA 2HWC3 2W52A 2W68A 4YARA 4ES9A 5CADA 3ZXLA 1VMJA 2R1BA 2VY0A 2F17A 1AUYA 2XQRA 3ECQA 1R082 4UW6A 2VG9A 4XZPA 4C1WA 5ANNA 1EPZA 1L7QA 5F32A 4MO3M 3R4SA 4HKWA 2BOIA 1CJDA 2ZX4A 4GWIA 2JDAA 2E7QA 4DXZA 1J3RA 1O3TA 1WBLA 3CZUA 1MZ6A 5JZGC 2XJVA 5FXWA 4AEKA 2WLQA 4M4RA 1F4AA 2P6CA 4QU2A 4YW6A 1VJ2A 4RSUA 1U5XA 3E5XA 1QY4A 3VBRA 3HQUA 1SDDB 2QQOA 4FFGA 1NE6A 3TN93 2WKKA 4YM3A 1X36A 1V6LA 1AYM2 2Y0IA 4IV3C 4N53B 5FQ0B 1FV2A 4RL7A 3BN6A 2WS92 3NVCA 3UYJA 3ZX7A 1QOSA 2CDPA 3GGLA 5K4LA 2W5FA 5L19A 1S0FA 3O5SA 3ZYFA 1OUXA 5D1IA 3MF6A 1ZZ9A 4Y1ZA 2JKXA 3LA2A 3FLRA 2VVEA 1GP4A 1RC6A 1CQ9A 4MGIE 2NN8A 1O3RA 3WHUA 3GM8A 1W04A 3RZZA 3T0AA 4ATEA 2UURA 2XG3A 3IAQA 3MFCA 1Y9MA 4LPLA 4NJ4A 4OQ9A 4WM8C 3NNFA 2D7FA 2WS93 1WMDA 4JGZC 4LUMA 4N43B 1AYM3 1W6OA 1EAH3 2HWE2 1H9WA 1WCQA 1RUI3 4XHXA 4XBQA 4Z8BA 4Y1VA 2XDVA 1ULCA 1FAYA 2B42B 2V4AA 5H9PA 5IK4A 5KWRA 5F6KA 1I6XA 1ZM1A 2VECA 3MYXA 3R0RA 4PF1A 2PHUA 5LA2A 5AC92 1RUOA 3WP4A 5BY5A 5FMDA 4LIUA 3KGZA 1GOFA 4OHVA 3U1XA 2V72A 2DFCA 4N53C 4N90A 1RHI1 2ZOEB 4CA9A 4BE3A 1DQ4A 1XYOA 4Q4W3 2JG9B 3OY8A 3VBUC 2VC9A 1R1A1 5JMOA 2DCJA 1XXNA 1DGRA 3CF6E 2R49A 5EXOA 3O0VA 1HW5A 5KHKA 2ZEXA 4RS5A 5FBJA 4L99A 2AC1A 1REFA 3ZOIA 2BOJA 4MGTA 4AEDC 5JZGB 3WW4A 4DY3A 2XUEA 2KR2A 2ZGUA 3ZIXA 3N7LA 4P9JA 1UX6A 2JIGA 5DAQA 5BYNA 1ZRCA 1GNHA 2ZEZA 4N9IA 1PGW1 4GWMA 4IXLA 2Q8CA 1WA4A 2DVBA 1U0AA 1OKOA 4ASKA 1WZXA 3OYWA 5FO7B 1OHFA 3MPPG 2ERFA 3LAGA 2SLIA 4PIXA 5LEJA 3RZJA 2A7AA 3LEGA 4ZU7A 1CPNA 2WFPA 1ZRFA 2VZSA 2R30A 2ETEA 1RUD1 2XJSA 5LY2A 1SLLA 2QQUA 2J1SA 4X8PA 4Q1RA 5ACA3 4V2WA 4I02A 3EXUA 2DBIA 1Z0HA 2R0HA 2LALA 2BBAA 1W90A 2VXRA 5FYTA 3ZO0B 4AEDB 3ITQA 2HBTA 2IC1A 4RR3A 1LU1A 1RUE3 1DYPA 5CVRA 1EUUA 2FDJA 3I59A 2BGPA 2G4IA 5IJRA 5I8YA 1HV1A 1MEC3 1OA2A 1NXMA 2NMOA 2PHWA 3GYDA 3IDCB 4JTOA 5CG8A 1WLCA 1SACA 3URFA 3GZTB 1PM4A 4NPLA 1VBB1 5ISLA 1HRV2 1LTEA 4LBQA 4ZS2A 5HXMA 4PF5A 1COV2 1OF4A 3PVOA 5LW9A 1JH5A 1J59A 5JWPA 3LE0A 1QKQA 4WM7B 3CMGA 2VCCA 5CEHA 2XB6C 5FDBA 4LIVA 3H3ZA 2ET1A 1ZZ6A 4NIGA 4DY5A 1PIV1 3VZLA 4CVUA 1U5IA 1RUC2 2WZR3 2VCAA 3M1HA 4AL9A 2BDRA 1VP6A 1HQLA 4QB2A 1ZBE1 1B35B 3WQBA 2ZMNA 3EQEA 3OTFA 4C1XA 2EIEA 4IDZA 3AKPA 2AENA 2BBVA 1H8TB 1FPN2 1QDOA 2W0XA 1H4HA 3VKNA 5JMCA 2V73A 4XW3A 4P00B 3VBFB 3KM5A 3THPA 3AJZA 3THTA 1UX7A 1CAVB 4JAAA 4OUSA 4PBPA 2Z42A 3M4FA 3MV11 3BUCA 4E4DX 4W4ZA 1LOGA 3WD5A 2BYVE 4RFT0 1HB1A 2TNFA 2VOKA 2D5HA 3BYWA 2WDBA 1C5HA 1JBCA 2QQLA 4BIOA 5C8CB 3N4MA 1VRBA 1AR63 1XNBA 5BNNA 1YEWA 3K4AA 4BYYA 2JDPA 2LRPA 4QB1A 2R042 2DUQA 3JB8A 4GB33 3RS6A 3O1VA 2R043 5C3QA 3VDBA 1C1LA 2JKBA 5LA0A 1IPJA 4UFLA 2A3XA 2XJTA 4YW2A 3ZXGA 4AHWA 4CPBA 1RUNA 3Q8BA 5C5TA 2BZDA 4R9DA 5FJHA 1IS4A 3V0AB 3D0SA 2YG0A 4YM0A 4GQ7A 5E89A 1BK0A 1H1IA 3NJVA 5F37A 1NE4A 2DUPA 2QQVA 5CZKA 1YHFA 2Y6GA 5A70A 3QCWA 1LOFA 4M00A 4Q4Y3 4AYUA 4Q4Y2 2I2SA 3NAPC 3JD72 4HG6B 4AI2A 4N53A 1B09A 2HWB3 4D6QA 2XMLA 4CEYB 1XE0A 1MS0A 2IFWA 4PT6A 3PUQA 3R4DB 1CAUB 5A3OA 4LULA 1YO8A 1ND3A 2JJ6A 2BNOA 2ARXA 2XJQA 4YZ5A 3A0KA 1ZREA 5GLZA 2X53S 4BQ3A 2VMIA 4AEJA 4BK5A 4EWDA 5JXGA 5JIUA 1EP0A 2LTNA 5FOJB 3AKRA 4BK4A 4DRVA 1NZIA 1YQ6A 1W6OB 3DXUA 1V6OA 4LR4A 2NP0A 2GNMA 4IERA 1D2SA 1RVF3 3U4XA 1ULOA 4LO4B 5FZ3A 2RVAA 4N9HA 3O14A 5F5QA 1JUIA 2WYFA 2YBSA 4IEXA 1UOGA 5IK5A 4GJZA 4Q0PA 4MH0E 4ASMB 2A6VA 4RA0A 2ZZQA 4BMEA 2AACA 4XXAA 1NA1C 1V0AA 1QWRA 4AAPA 3I3EA 5FMCA 3E6CC 4COVA 3WX5A 3BU0A 2JG9A 3OY8B 5KXBA 1NCRA 2RE9A 4IEZA 4IQPA 5I0RA 1VBE1 1QHDA 3B7MA 1F15A 3F2ZA 2RR12 4FCAA 4Z07A 1AR73 3ZSEA 1RUC3 2WZR2 3J26N 3WP3A 3ZYGA 3R6SA 4ES8A 2Q1MA 1UMIA 3JB4C 2HWE1 4LTAA 4XCBA 5JZGA 2FDIA 1OT5A 1HXS1 2VVFA 3MLJA 4K8RB 5FY8A 2Y6KA 1VBB3 3M3QA 3NKGA 5IVJA 4K8FA 3E5QA 4E8CA 3KT1A 2CHHA 1S0JA 2PXJA 1W2NA 1J84A 3ZN5A 4BLIA 4BU2A 1R1ZA 1RHI2 5J37A 4QXKA 2VMHA 2UY9A 4MADA 4P9YA 4AWDA 1MS1A 2D3PA 3OEAA 1JZ7A 1DLLA 2FDHA 2WSVA 3AMHA 1BJQA 3AVSA 5FYYA 4E4SA 2H6CA 1VMHA 1QJX1 2GP5A 1OKQA 1S2EA 2AREA 3PMEA 4B4RA 4B4PA 4BA6A 1GLHA 2VZTA 2CAVA 1DCSA 3J9SA 2ZX2A 5DAWA 3WUCA 1ENSA 1RUF2 3B9IA 2YU2A 3B94A 4M3CF 4OUEA 1ALYA 1RMU3 1UNBA 4IEPA 3RJ2X 4BJ0A 3ABZA 3ZYIB 2A6YA 3U4SA 1AYN1 4Q0UA 5IWFA 5JSPA 3N9LA 3U0ZA 1X8EA 4FPHA 1S0BA 2HH9A 4ET7A 1VBC3 1VAMA 3EJKA 2JDHA 1RJ8A 1VR3A 2VUDA 2WNUC 1POQA 2YGMA 1W0NA 2ZAHA 3OPTA 3USSA 5LCWL 2P4EA 4HT1T 4JHTA 2W1QA 4YSFA 3T2QA 5CIRA 5FOBB 1VALA 1D0GA 1O7FA 3DKQA 4S2FA 1RITA 4LBQB 1F9KA 4XJAA 2OIIA 1JW6A 1SG3A 2WN2A 4W6WA 2W94A 3HBKA 1TMF3 4Y1YA 3ST7A 2P17A 2VW2A 1V6KA 2EAKA 5DPNA 1GNZA 4I3GA 4Y5TA 2RS32 4ZKTB 3BOWA 3HQXA 3JCIA 1LNSA 2OQ6A 2J1EA 5EWSA 2JENA 2DU1A 3IPVB 4CCLA 4Q26A 4DMIA 2IZWA 2C4XA 4PIZA 4FPGA 4RQPC 2PMWB 2UWBA 1LHOA 4HN0A 4HZFA 3CNAA 3WNMA 4G4FA 4WZFA 3ES1A 4MZUA 4ZXKA 2D97A 1FNZA 5JUVA 4EROA 3TN91 4CUBA 1G9CA 2Y0OA 4ORFA 2V5YA 2WNUA 4MHRA 2XHNA 4NMIA 3FL7A 4Y1XA 3VBFA 3GJAA 4CRQA 1W28A 3O1RA 1NG0A 3H1WA 4E4HA 2ADDA 4W65A 3NV4A 2WZEA 5CKQA 2GC3A 4YFWA 1DIWA 4J6GA 1D4M1 1W0PA 1ZX5A 3E5UA 1JZ4A 4QGMA 1XNKA 4N7IA 3GALA 5BNNB 4I09A 2W1SA 1F4HA 4LMFA 3SKVA 1COV1 4AVVA 3VDAA 5EHDA 1CD3G 1JTZX 1DGWA 1X9PA 3KF3A 4MGZE 2GMPA 1PGL1 4EN9B 1MZEA 4LE4A 1CJPA 2RS51 3ES4A 2Z79A 2BJSA 1K12A 2B9UA 1KDKA 2VBDA 3PUAA 1HRI2 1XNTA 3SLIA 3V0AA 1OH4A 2CGNA 1DZRA 2Y26A 3O1PA 4QT6A 5KR7A 5FPXA 2XBO3 4CCKA 1PMIA 2H6BA 5FO9B 1CAWB 1G7YA 3MW4A 2UU8A 2ZX3A 3WY6A 4ZPIA 4GA9A 3WQ7A 2FZ1A 1K45A 3MIDA 4CDXA 4EN8B 5C9AC 1SLTA 3SC7X 3VD4A 4RGGA 3H8OA 4D94A 1Q3EA 4CEYA 1YI7A 5F6LB 4AVCA 1O6UA 3ALQA 1O5LA 5A3LA 1IPSA 1CAUA 2DCKA 1S55A 1UCXA 2OKXA 1IKQA 3VBHB 3E6BA 1ND3B 5FFOC 3SCFA 3WEZA 5BUVA 4XF0A 5A3UA 1VBD1 5FYUA 3RZLA 1APNA 3NV3A 4W8JA 2BGOA 1SLIA 5T5LA 2J1TA 1MS3A 4OMCA 1ZZ8A 3C7EA 2GALA 5JCTA 2K46A 2YDEA 4CCNA 2BNNA 1VMFA 4YW3A 1CZSA 5I93A 4I0WB 4KNCA 1DZQA 4IE6A 5FYMA 1W8FA 2VOXA 4KQ7A 4MGQA 4UWDA 5KHHA 1D0HA 4JC1A 2A71A 2Y8KA 2DYCA 2P5BA 3I7DA 3EHKA 4XIKA 1QF3A 2PHRA 2XWBB 1KFXL 1FNYA 3M7AA 3RYKA 1G9DA 4DNYA 1EY2A 2PAMA 2VOVA 4TSVA 4SLIA 1CX4A 3NRUA 4XJWA 1ZBA2 3WDTA 3ZN6B 5GLUA 1HN0A 2QE3A 1XNAA 5FY5A 1NCRB 2QQMA 4XC9A 3U10A 3AYEA 2GNBA 5BNNC 2WAOA 3UJOA 3P3PA 4CDUA 3O0XA 1KS4A 1RUD2 1UZVA 5ABJA 2OZJA 2UYAA 4OI2A 4AHZA 1O4TA 4QX0A 1Z7S3 2VUCA 1ZRIA 1HJGA 3PURA 3QOPA 3THDA 4B1MA 4BLJA 5FP3A 4CDQA 3AM2A 4XFBA 1TMF2 1W06A 2E33A 2O8QA 1YI9A 2PAEA 3AZWA 3ZYPA 4CCJA 3IIAA 5JR7B 3AKSA 4EWEA 5L7OC 2VTFA 5J98B 4D0QA 3QLQA 4DOUA 3KZ4C 1H1AA 2XLAA 4LBQD 2BU9A 2TEPA 1HN1A 4MYEA 3UK9A 1IZ3A 1OVSA 3SISA 1RUJ1 4UBGA 3SH4A 4BCUA 4Q27A 3HBZA 1WW6A 4YM2A 3RDIA 4CDWB 2FCTA 4JHZA 4L9BA 2E7AA 4BQ4A 1LESA 3UGGA 3I2DA 3WCRA 1SLAA 5C33A 2WA3A 4LO5B 4IE4A 4ITCA 2Q1ZB 1KXGA 2EA7A 1O3QA 4XACA 1O4YA 2PTMA 2WSUA 4K20A 4D69A 3TEWA 1HRI3 4EN6B 1W9SA 2B46X 4D7YA 5ERLA 2R32A 3I2KA 3WNXA 5KC6A 2Y33A 4RGAA 4OZXA 3KSCA 3VBSB 2HWB1 2J1UA 1YNAA 1QOTA 4AHXA 1EPWA 2GN3A 4GB32 4ZS3A 5T5OA 1XYPA 5JOWA 2P2KA 2Q4SA 4Z2WA 4HN1A 4Y24A 3NKTA 4HSJA 5JOYA 2WQZC 3NV2A 4XQDA 4N7UA 4COYA 4QPWA 1XC6A 2DURA 4XPVA 4BHPA 2VNVA 5GLVA 3UNPA 2CWMA 2E7TA 3H3UA 2XBO2 3O1OA 2WO3A 3IPVA 4QDRA 4YG3A 1WW7A 3HT1A 4HSLA 5C3SA 2L9LA 1QJU2 3HD8B 3B5LB 4QU1A 2YBPA 1NZCA 2NMNA 4EN0A 4L97A 1SMVA 4ZY9A 4AFMA 3BTYA 2D3SA 5BNOA 4NE9A 4AGVA 3PLQA 2D6LX 2PQQA 5BNPA 5CAZA 1A8MA 2XVLA 2WNUB 3FJSA 2FBEA 1MVQA 3O0WA 2VNGA 1E5HA 2DFBA 1WD4A 4S2GA 3OBRA 3U78A 2VR4A 2XWJB 3WDXA 3TNQA 1ASJ2 2B7YA 4YG6A 1CX1A 3CQOA 2FCVA 1HRI1 4R9AA 4OZOA 1EAH2 5LBEA 2PA7A 2QQKA 4AOCA 5J09A 1KS5A 2EIBA 2PQSA 1ULFA 3VHPA 3GZUC 2QQIA 3VZKA 4QQLA 4AQTA 3OGGA 1I5PA 2MNGA 4IETA 4LBMA 1N3OA 2O0OA 4G9SB 5JLVA 3IN9A 3PTRB 3T2OA 1M06G 3VLBB 3LKJA 1J1LA 4AAXA 1GZWA 4A7YA 1GWLA 2IVIB 1FOD1 3VDDC 1A34A 1G8WA 3RRDA 4A4AA 2UY8A 2HWD2 4I01A 1UU4A 5EFUA 4H55A 3N3HA 1YQ5A 4AQSA 3I49A 3CU7A 4H3WA 2X5IA 2C1FA 1UKGA 3GHMA 4XZUG 1X8MA 5DG1A 1CAWA 4AW7A 5IVFA 4LBOA 2CTVA 2X29A 3PHMA 4QX5A 4UBHA 1UIJA 2VZVA 4XDOA 4KG0A 2YROA 5D21A 1Z7S1 3UL2A 4AVTA 2LROA 2EICA 5H9RA 5LK5A 1KGYA 5FREA 4FFFA 4NHYA 1RUC1 3WDWA 3N36A 1BVP1 3DUIA 3B69A 3WR0A 1QXPA 2Z69A 1X9TA 3HNBM 4YGBA 3VBHA 4BZ4A 1WWYA 5DAVA 1XRUA 1WLDA 4E2QA 1IQAA 2ZXQA 4EE2A 5I0UA 5DMYA 3VHOA 5FZ8A 1C8M1 5K0UC 1QQP3 3H0OA 5FZ0A 1TME3 3LPFA 2OXBA 5IK7A 1V9U2 5JI7A 3KV9A 1XBFA 1J58A 4FP2A 5C3OA 2QDNA 1HDKA 2R062 3KV6A 1JZ5A 3S7EA 4DB5A 4TLGA 1YFYA 2WO7A 3PVNA 1AR61 2DTWA 4MOAA 4R52A 3UKVA 3AYCA 4PBOA 3VBOA 1GYKA 1GBGA 1H9PA 2FQPA 3SMHA 5A3MA 1V00A 2CL2A 1DGRN 2WFF1 1IG0A 5FZHA 1VRH1 1QQP1 1SLBA 5D8AA 4R4ZA 4FSJA 2FZ2A 1FV3A 2JDMA 3ZN6A 3FFZA 3CL1A 4PQQA 3ACHA 2ZEYA 1AX2A 3MIGA 1D4VB 2JWPA 2GSYA 2RV9A 5A80A 1DQ0A 2PN5A 4CDUB 1BMV1 3KV5A 1ZBE3 1IPKA 1W8UA 4KG8A 5ABJB 2WNEA 2Y6HA 4FOVA 2VZPA 1HB4A 3WNLA 4IW3A 2D6PA 2XHKA 3FBYA 3J8F1 1N1TA 2RS11 4IE5A 2D43A 1N3QA 1ST8A 3AYDA 1QJU1 3IDEA 3LDBA 3OPZA 2BEOA 2CNAA 1JN2P 3LGRA 5LK7B 3D82A 1UIKA 4CDQB 3AP6A 3RNSA 3IMNA 4BMBA 5FUNA 3B02A 2ZGOA 2ZKNA 5F3CA 2PLV1 4X8NA 5T55A 2I07B 3VN4A 1TMF1 3EMRA 3VKFC 4FTBA 4BB3A 1AJKA 1PGSA 4JX0A 2RMU2 1IQDC 1ODNA 3BTZA 3A23A 1QJY2 3ROUA 4LHKA 3AB0A 3OBTA 3ZFEB 4CDQC 4Y5SA 4CDWA 1VB2A 2YC0A 2GN7A 3ILNA 1SHWB 5E16A 4EYUA 2XR4A 1QNYA 2ZGTA 3ACLA 4JGYC 2JE7A 5I0TA 2F4PA 1BBT2 3ZR6A 1PO11 2PELA 5FR3A 4XTPA 1LEMA 4JKMA 1MVEA 1OI6A 2JEMA 5GKAC 3AXDA 5FZDA 4AR2A 4B1LA 3U14A 3FWEA 2CY6A 2D6NA 3DN7A 5GZEA 3WG3A 2JICA 4IL7A 4JCKA 2B4KA 1O8SA 2C9AA 4YZ2A 1AXYA 2C6SA 3ENRA 4Q8LA 4N8MA 2DCZA 3RYRA 4JKLA 1AL22 4WBBA 1QJY1 4ZHNA 3GF6A 3POYA 5LA9A 1YUDA 1GZCA 1JYTA 2VCMA 2FMYA 4RS5C 2AUYA 4A3ZA 4LO8A 1ONAA 4XTMA 5ANQA 4TN7A 3GBWA 3S0MA 1UD1A 2NLRA 2WO1A 4A7ZA 3U07A 3TEZA 1XSQA 2WYSA 4META 1MS4A 3WVJA 5A6XA 4FPEA 4FFHA 2AGSA 4XBNA 2J1VA 3NNLA 4CCCA 4LOTA 4CDUC 2MEV1 1UYPA 2IXHA 2YFZA 1LR5A 3ZYBA 2IWGB 1NCQB 4PDWC 5BNOB 4CDXB 1ZNPA 3IIIA 4AI9A 5A6QA 2WQ8A 3MO4A 3IMMA 4LO6B 3PNAA 3OUIA 4K6BA 4NWVA 5DUVA 3C8XA 4C0HA 5BNPB 3H1YA 2B9VA 1JU4A 1XE7A 4JGZA 3V56A 3GHNA 1LGNA 3RPQA 3KVBA 1P8JA 4FTSA 1UF2C 2QTWB 4MVTA 4NUBA 1A3KA 1SZBA 4DS0A 4KU7A 5BNPC 4TXWA 3KCCA 2A5ZA 4F3JA 3ZIWA 2ATFA 2WN3A 4XQWA 5LBBA 1H2MA 4QKBA 3VDCA 1V9U1 4WVMA 4QPIA 3LFIA 4UI9L 3DCQA 4L0PA 1D2QA 5A7NA 5IVCA 5KXDA 2ZHLA 1GZWB 5FPAA 3PUIA 3C7GA 1POV1 1VBD2 3B9CA 3WG4A 2XLFA 5L36A 3AZYA 1UPSA 1QEXA 2X5IB 5FXVA 4X6RB 2HWC2 1IS6A 2X05A 3P3NA 2QDRA 5C3PA 3TN92 1YFWA 5J36A 2R073 2VMGA 2ZAAA 3K2OA 1NY71 2K0GA 3VUOA 1RUG2 5DDJ1 1RMU2 3A22A 1BQPA 2VQ0A 1R091 1V6NA 2QQNA 3AMQA 5FZEA 1WLTA 3WT3A 4NIDA 1EV11 4LQRA 1G9BA 2JECA 3WF1A 1SCRA 1W6QA 2EXIA 5FLHA 4CE8A 3FFQA 3QBQA 3W9AA 3K4DA 4UFJA 2YC4A 2CYFA 1QJFA 1US2A 5DZFA 1OXCA 4QD2A 4QAWA 2LW8A 3J7HA 5A1AA 1GP5A 3POJA 4FXKB 2QQJA 2RS52 2WBKA 2BVVA 3NJYA 4LKFA 2A70A 1GSLA 5KBFA 2XOMA 2R072 5FYIA 3B3QE 3IBMA 4XMAA 1GQHA 2E31A 3LIGA 5SV5A 1WCUA 3NMBA 3C7HA 2K9ZA 3VBOB 3LDKA 1D4M3 3H50A 1OH3A 3BB6A 5JSRA 5A3WA 4JDOA 1J1TA 1Q8OA 3PL0A 1GV9A 1WCDJ 3CEWA 2WABA 1OD5A 5A7PA 5D8AB 4XDPA 4E27A 1OLQA 2Y6FA 1QJU3 3K46A 4LLOA 3ZFFC 1PMJX 5H9QA 3KS7A 1FI2A 2HWE3 2EIDA 4WM7C 4AK3A 3FX3A 4MGKE 2CGOA 4LBKA 4RHV2 5A1FA 5EYYA 4BWOA 4HFSA 4RHV3 1PNGA 1YCIA 2MEV2 4UYBA 1PO22 1SFPA 1ZRRA 3CJIA 3A21A 5IAVA 1SDWA 4RGKA 1AR83 4FAHA 1W8ZA 2DU0A 1L7RA 2B5HA 2VJXA 1Y9QA 1UN1A 3DPRC 3PIGA 3MW3A 4QQPA 4IE7A 5B2GB 2GH2A 1UY3A 5FK8A 3G7DA 3VZMA 1REEA 2CU5A 1QGLA 5FMBA 3WG1A 3WSOA 2IXCA 5G05L 1IHMA 1RINA 1YRZA 2VZ1A 3DEMA 3NNGA 4OFGA 3ZFEA 1MZFA 4P14A 4AQ2A 2NQYA 5IUQA 2VW1A 3ZMOA 3J7NA 1BBT3 3I2HA 3MDPA 3I4IA 4IESA 4NPRA 3Q8EA 4OHZA 5JXHA 1SPPA 3NO8A 1YJLA 3L9JT 2YMZA 2A6WA 1ND2B 4Y5Z0 4NHLA 3RYPA 5KXEA 1AYN2 2EF6A 2IXJA 5A33B 1ODMA 4QXBA 4AFDA 1RUE2 3POFA 1GANA 2VULA 2ET7A 2ZEWA 3TOJA 1R093 5C3RA 3PVBB 1X7NA 4WVWA 3M2MA 5FJKA 4P5YA 3NNMA 1TME2 2F4LA 4CCEA 1K5MB 3W5NA 1LULA 5ACA2 3PIJA 4EJRA 3POGA 4NRQA 5FYBA 1UYYA 1UQXA 3LD8A 1H6YA 3FC0A 5FYCA 3AZXA 4ZXEA 4A44A 1BCXA 2QVSB 3D3AA 4WM8B 5F3GA 1DDLA 2LS6A 4W6XA 1GR3A 4Q2FA 1RUH2 1VBD3 3LSDA 1G9FA 4AG4A 5BNOC 2A73B 4QQOA 3GZAA 4LITA 1AL0G 1Z78A 4ZU5A 4PI0A 5JXJA 1HX6A 2GC2A 1W9TA 3GCXA 3QD6A 4HANA 1YIPA 3LSEA 4QQHA 4CUGA 4LT5A 4QWNA 4ATFA 3I3MA 3UGFA 3SHRA 2HBUA 4FAGA 3H8XA 2CSGA 3TAYA 1NCQA 3CHXA 3HOBA 1RUG3 1RYYA 3FHAA 3VHRA 2Q8EA 1LOCA 1RUJ3 4XF9A 3VZJA 4Z2AA 3P6BA 4DUXA 5EIYB 3MF9A 5AFEA 3AP5A 3LIHA 1O59A 4JGZB 4N43C 1VRH3 2YYOA 1LOFC 4HETA 5BV6A 3POSA 1ENRA 4FT8A 1BHGA 4COWA 3KLSA 1LGBA 1CPMA 1PZ8A 3AXEA 3LQCA 1PVC1 3N9QA 1HRV3 1ZZBA 2EVXA 4OLLA 4P08A 4C0BA 1U12A 2ZGLA 4HK9A 4UFIA 5IYYA 1DGWX 2Q0AA 2PYTA 3GZEA 5DUXA 3W59A 1POV0 4HKLA 2R041 4DRRA 3HN1A 3FMGA 4QPIB 1I9RA 2ENRA 4WVMB 4HXCA 3UESA 2KXLA 5A7OA 5FO8B 3AJYA 1X50A 3I3BA 3VDDA 3ZKYA 5K9YA 5LRSA 3PVEA 5EYXA 4Q1PA 4QPGC 5FLIA 1YC61 3CJIC 2ZS6B 4CXWA 5KHIA 2QBXA 3NJZA 2WFF3 3H8UA 3VD3A 1H6XA 2ZABA 3KCXA 5DUUA 4CEWA 4XAAA 4LKDA 3M3IA 3SXWA 3TWIA 1OMIA 3AMNA 3JD71 4QKNA 4AF9A 3E97A 5FP7A 3OEBA 4YYOA 1CIWA 4I3PA 5E6HA 2RS33 3ON7A 1AXZA 1VE0A 5J7MA 1ENQA 2Y38A 3B01A 5IW0A 1JZ8A 1PIV2 1W6QB 3FHQA 1PIV3 4K21A 4XHBA 2FDKA 2W46A 1OLMA 3Q8AA 3FBMA 1PX3A 1HXS3 5J1XA 3NSTA 3T09A 1JXNA 4XXPA 5LATA 1N1YA 4AQ6A 2WLPA 4LO7A 4BM8A 3MFAA 5HV0A 2Z2SB 4LEJA 1KQRA 4QDSA 4L2NA 1JYVA 3WF0A 1GUIA 1O3SA 2DTYA 2A3WA 2WZPP 5FY0A 1SBDA 5FIXA 1EAH1 4QM9A 3VZOA 5FZFA 4Q8KA 4XETA 4XVHA 1JHNA 4BDVB 1RGSA 1AF9A 4WV8A 4AZZA 1FYUA 2YBKA 3DL3A 2O1QA 4ISQA 5FAXA 3W20A 1OA4A 4Z92B 1SBEA 4NVPA 5FYHA 4XF3A 5E8AA 2VUAA 2H0VA 5F1RA 5H9SA 5BPXA 3C3VA 2OUHA 1NY72 3OGJA 1PO23 3SNMA 4CUCA 3HQRA 1BEV2 3WP6A 4E2SA 1WLWA 2BWCA 2RDQA 4KWKA 1DFQA 1FT9A 2IFRA 3QACA 4DXSA 1F5JA 3AMMA 3CJIB 1AHSA 4YVSC 5FZAA 4OHYA 1X33A 4UFMA 1AVBA 3ZDSA 1PVC3 1HB3A 1OLME 4O65A 5EPAA 5FZ1A 4AI8A 1V6IA 3AC0A 2E63A 1PGW2 2E9QA 2WNOA 2KD7A 5EV7A 3ETQA 4BIFA 2GNDA 4DQAA 2VAUA 4GALA 4HVRA 2ZGMA 1HQWA 3EO6A 2UWCA 3I54A 3VGIA 4I2OA 2RR13 4FPKA 4FPOB 3ZSMA 3D8CA 1H8TC 1REDA 2DDUA 1L3JA 4P9GA 3KMHA 4JDNA 3U75A 2WJSA 3RZHA 2XVGA 1DGLA 4MGSA 3DGTA 4RR3C 2ZGRA 1WMXA 5FZGA 4DEVA 2WA4A 2ZJCA 5HPOA 4GZ9A 5F9TA 1LHVA 1SPPB 5FRAA 1JHJA 4V1PA 1JYWA 1SCSA 5CB7A 1S0IA 2QZ3A 1ND2A 1YWKA 3DF0A 5A33A 4K1ZA 1PO12 1K5JA 1C5IA 1ZBA3 2QNKA 1RL3A 2VNRA 4Y33A 2BPA2 1SFYA 5EJ3A 4D6RA 3CBNA 2OW4A 2YFUA 3LWCA 1RIRA 3EBRA 3N7MA 5FK7A 4IV3B 1K5MA 2ORXA 2CV6A 2DWRA 1W8WA 2ILMA 1GFF2 3BCWA 3O1SA 2NM1A 4XUTA 4KI5M 3HIFA 4D3WA 2VD7A 1AZDA 2XKOA 1JYCA 5LZ6A 3BOPA 3CJXA 1S0DA 2R7EB 4PHZA 3HNMA 3VD9A 4WM8A 4JDMA 4EQVA 5C9AB 3DKWA 2PLV2 4TZDA 2PHTA 4M3CA 2JDYA 3ZMNA 4DXRA 4MXWB 4YZ4A 4YW7A 5EQUA 5IVVA 2RS13 3DECA 5ACA1 2V4VA 1S0EA 3PJYA 1W03A 4LNVA 4S2DA 4XJ9A 3FE5A 4H7LA 5C7GA 2JDKA 5FZOB 1V6JA 3K4ZA 1OVPA 1GNYA 3PUSA 4R9BA 2WC2A 2WZR1 3S30A 5C5UA 5FWJA 5C6CA 4QB6A 2R1DA 5FMOL 2E53A 3PUHA 2ARBA 2BTVC 4XF4A 4UXAA 1JOPA 3T2TA 4LLFA 1NUKA 1TE1B 3KT7A 4R8HA 4A2UA 1MEC1 1OD3A 4WVVA 3KV4A 3POEA 4CEYC 4KMQA 1H2NA 1S4CA 2JD9A 3S6PA 2WFF2 4AEMA 1R64A 3Q8CA 2ORZA 4JQRA 1YFXA 2WRAA 4LORA 2OA2A 5DABA 4Q4V3 1QDCA 4AFBA 2CWSA 1S1AA 1C57A 2YY1A 4BQYA 2J7MA 2HYKA 3JBG3 3ACGA 4OI1A 4YFZA 4MUVA 2WZ8A 3RVHA 1IS5A 5T3NA 4NHMA 2VU9A 1H8VA 5A7WB 3TB0A 4XUQA 5L9VA 1M4WA 5CFCB 5F7UA 4NO4A 3VDDB 1JYXA 3HPNA 3C7OA 3MBWA 3TEYA 1WD3A 2RDSA 1LJ7A 2C0ZA 4W6YA 2PHLA 1OOPC 2DBNA 3O1TA 4HLTA 3Q8FA 2VZOA 1A8DA 5DDJ3 3ILFA 1PO21 4CEWB 5LEKA 2N7GA 3WV6A 4NWWA 3PJQA 1RVF1 3GCWA 3OB8A 5CNAA 4Q4Y1 2C26A 3WDUA 5JIAA 4NIAA 1UY4A 5FP4A 3H8RA 1ZVFA 5AC93 1UZYA 3VB9A 2GC0A 3I3DA 2VOTA 1B35C 3T1MA 5C71A 4AHYA 4JTNA 3MIHA 4R4XA 4YWAA 1PZ9A 4XOGA 2W2IA 4Q4W2 1DLCA 2ZMKA 1EV12 3HNYM 1AR81 2VNOA 5JPMB 3WG2A 5F2WA 3MW2A 4UW4A 5FY4A 4DIQA 1RMU1 4UFKA 1KD7A 3S5AA 3S7IA 2VZRA 1LOBA 1VLNA 2Y64A 3KD4A 3POWA 4IV1A 4W50A 5C4WA 3W5MA 4GMP3 1N47A 1OFSA 1T6GC 3OUHA 5EP9A 1AR91 4BQ1A 1VBA3 4Q4V1 5C8CC 1CWPA 3X29B 4KBZA 3HR9A 3A7QA 3GBFA 1W9FA 4MV2A 3IZOA 1DBNA 2FMDA 1G9AA 3N35A 1EV13 2G9ZA 5HCAA 2B45X 2D44A 1KJRA 1LU2A 2YXSA 3E6DA 2X09A 3HJRA 3I2OA 1XE8A 2HYXA 3GXUA 2I45A 3M70A 4URTA 5A3TA 3SCGA 2W92A 1YFUA 4YVWC 1PX4A 1N1SA 2AYHA 4YZ1A 5I91A 1RUG1 4LUKA 5C8WA 3OF1A 1VIWB 1ZZCA 1BYHA 2QCSB 4FOQA 2VXJA 2ZHNA 1RUD3 3I2GA 3M3CA 3ZXFA 1PMHX 3NV1A 1H2LA 3TRSB 3H1MA 3IT8A 1FPN3 2OPWA 4YG0A 3KHBA 3MZHA 1AYN3 4KBBA 5LY1A 3ORJA 1C28A 3T4HB 4UF0A 1DQ6A 4A7KA 4M0NA 1GZTA 1KRIA 5TSWA 2DV9A 1XYNA 1HIXA 1C8NA 3RMXA 4XJUA 3K48A 2Z4FA 4AFCA 2FHRA 2JDNA 2GP3A 1ND2C 2XH6A 1G6NA 3KHCA 2R063 5GM0A 3MIBA 3AVRA 3I2JA 3VKLA 3ZPYA 3LOIA 1DZTA 2PHXA 3D5OA 1MR5A 2YPDA 3OPWA 4FI9A 4G3YC 4A6OA 2EIGA 1GOHA 5IAXA 4U2AA 2XPJA 2QFEA 1VBE3 1W3VA 4NIIA 5JDBA 1FOD3 1ZA4A 1MEC2 2VUJA 4QX1A 3ZYJB 1HB2A 3SH3A 2R16A 4E9KA 2HWF2 3ZYHA 2YU1A 5GLTA 1FMD2 2ZACA 2VMDA 3BPZA 3MPBA 3R05A 2ID4A 1UZZA 4K40A 2W9XA 1JUHA 4OMDA 4GKYA 4TLFA 4YZ3A 5J96B 1CR7A 4IV3A 1F31A 5K7PA 3WINE 1NCQC 4A6SA 4ISRA 1HLCA 4TTGA 3WP5A 2E32A 2O8OA 1JI6A 3JBG2 3N9MA 2QKDA 3AP4A 2ES3A 2VBPA 4NPMA 1RUH1 3LA7A 3DXTA 4CDXC 1X82A 3WLUA 3ZXKA 5C9AA 5DN2A 2HKXA 1ULDA 2D6KA 2J1RA 4JKKA 1F2NA 2V5DA 4M3CB 3O7OA 1UW8A 4XURA 3UJQA 4CSWA 1T6BX 4NAOA 3ZPOA 1O4ZA 4MXWA 4CUAA 3NNJA 3ZXDA 2VM9A 4R9CA 5G04L 2EXHA 3SEEA 1BVVA 1G86A 2AH2A 4LBNA 3OGSA 4K9SA 3ZR5A 5FZOA 2D6MA 3OD0A 2F6BA 2HWB2 2HEYF 2A1XA 1ACCA 3SEPA 4LK7A 2WWSA 2RM23 5FXZA 1ND3C 4YGDA 3MLKA 4NRPA 2WT2A 3OGRA 1BKZA 1Q5OA 2W1UA 3IB3A 4QHOA 3CZJA 3LZZA 1IKPA 1OBNA 3I2IA 1C3HA 1LKNA 5JXIA 1BBT1 3RI8A 1JZ2A 3V0BA 3JBG1 5FBZA 1TEIA 4OCTA 2IVJA 4YW1A 1Q8VA 4EWAA 5L9BA 2PFWA 3SITA 4B29A 2HJIA 1CAXB 3ZFFA 5FYVA 1STMA 4QXHA 4DZGA 3B00A 3TBDA 2VQTA 1AR93 1LRHA 4XFHA 3GDBA 1AR72 4ZONA 1TVGA 1F8VA 1OSGA 1QXRA 2RJKA 1FMD1 3GNEA 2C9KA 4B7KA 2D3RA 4J1XA 1OA3A 4XJ8A 3VBSC 3WXPA 2XXZA 2AEZA 4ONUA 5IVYA 5A7WA 4JRLA 4YRDA 5CFCA 5IVBA 4NOTA 5FZ4A 1W6PB 2VZUA 1Q56A 1POV3 3WF4A 4NIHA 4HK8A 4CTEA 3UT0A 2BWAA 3AZZA 3HWJA 4RYDA 4AE2A 3FHIB 1NYWA 3I8TA 1LOAA 4QXCA 1LAJA 4A42A 5ABJC 2PHFA 3WF3A 4LHSA 2ZKLA 3J8F2 4M0HA 3NQHA 5CBLA 5LWBA 1AR92 3FLTA 3WQ1A 4XBLA 5HBAA 2R071 1UZWA 4D8MA 1BEV1 1QJZA 1WBFA 3AZVA 2XJUA 2VZ3A 2VE1A 4CYDA 1PVXA 2A3YA 1VPHA 2EAAA 3ZLIA 3WNPA 3RZKA 1RUF3 4IV1C 3FZ3A 2C5DA 4Y4RA 1V70A 2JDZA 1E57A 4CDWC 3WZ1A 4IGPA 2E6VA 3NWKA 4FO9A 2Q8OA 1DP0A 3OBAA 1XJAA 1XOYA 2ZHMA 2NZ9A 3N9NA 4Y22B 4FBFA 4OUMA 3IWZA 4FFIA 5AFBA 2UWAA 4IV1B 4JVAA 5C4WB 3AP9A 3JQWA 4GWJA 3BU7A 5KHJA 1Q8SA 1W8OA 5JOXA 1W2TA 5IHRA 5KHGA 2G19A 3MUY1 1BLZA 2I74A 2DCTA 4UAPA 1JODA 2HEWF 3H7JA 3M3OA 3VL8A 5F3EA 2DVFA 3VZNA 5CISA 5IATA 2VVDA 4LOSA 2Y6LA 3TNPB 4CXXA 4IEYA 4NHXA 1NA1A 1LCLA 4PJYA 4XQ4A 3P1IA 3S57A 1PHMA 1KEXA 3H42B 1MS8A 1DHKB 1RUI1 2RM21 3KF5A 5KXCA 1R083 3EYPA 4J1WA 2TBVA 5D8AC 5LRRA 5FCCA 5GZCA 1GICA 1ZBE2 4BQWA 3WF2A 3VKMA 1N3PA 1VAVA 5T5JA 2HWC1 2BNMA 2E51A 3WNOA 1UOFA 1CESA 3MGUA 4Q4W1 4CPBD 4UF0B 3BTXA 1C4RA 3WW1A 1IS3A 4QHZA 4PDWA 4PCRA 1S2KA 2WL1A 3UV9A 1FMD3
chains in the Genus database with same CATH topology
1ULEA 4FPLA 4MGYE 3OJBA 5K0UA 1MQTC 1PGL2 2P37A 1XNDA 4EN7B 2GMMA 1A78A 1KJLA 4XFCA 4YVSB 4GXLA 1D4M2 2LM3A 4ZU4A 3L2YA 3B93A 4B4QA 5HCBA 4WZCA 4B8EA 2DF7A 3IM0A 3LOBA 3RI9A 2RHPA 1QMJA 2ZGPA 1DQ1A 1RUF1 1AR71 1NXD1 1GKBA 2GNTA 5T52A 4LBLA 1LHWA 2XUMA 5GJ6A 3ZXAC 4GIQA 2A6XA 1TNRA 4YM1A 1PK6C 2EXKA 1N1VA 1LECA 4K7JA 1SQ4A 4GWNA 1H1MA 1RTVA 2KM2A 4QGNA 3NAPA 2XL7A 3ZXJA 2HWD3 4Y1UA 4AVAA 4QMAA 4YLZA 4H14A 3INAA 3WUDA 1LOEA 3RQ0A 4GMP1 1O5UA 4AI3A 3RWNA 1CGPA 1AXKA 1TME1 1UAIA 4GB31 4P9WA 4CP1A 1FX5A 1DG6A 1C8M3 2DVGA 3AYAA 4S2HA 4U36A 1NLRA 3VL9A 2OZ6A 3K51A 5FPZA 1OPOA 1ASJ3 1LENA 4YW4A 1OQ1A 3D4KA 4PQ9A 3V0BB 4OULA 3VKOA 2WNVB 5T50A 5CFDC 1OOPA 4QGLA 1CAXA 3ZFFB 4OHWA 4QPGB 4JGYA 3VBRC 4QM8A 1LB2A 1AX0A 4XFAA 2HWF1 5JI9A 1COV3 1ZBA1 2P34A 3LCPA 4NN0A 5E1RA 1W6PA 1F5FA 4O9GA 1Q8PA 3V65A 3VBOC 4Z1VA 4HVOA 2QUOA 2VGDA 4HBNA 1URXA 4JV4A 5AVPA 3J8F3 1YLLA 4A3XA 3H9AA 4IEQA 5JOZA 4F7ZA 2R061 3ZSKA 1UMZA 4XMIA 3VBUB 1IOAA 2JG9C 1WUVA 3QH7A 3TYJA 5CFDA 4Q0VA 4XYXA 1KITA 2GZWA 1XNCA 3AX4A 2ZGKA 4FTEA 4YGEA 4Y20B 5AVAA 2ZGNA 1FXZA 4TWTA 1VRH2 3BTAA 2GU9A 1H2KA 2JX9A 1YYNA 4INDA 1FATA 3MLLA 4ASLA 3MI8A 5HCFA 4E2GA 2D98A 2G9FA 4Y22A 2AR6A 5FLJA 1AR62 2BVBA 5L7OA 4OI0A 2GDFA 3PTYA 5KC5A 1H0BA 3AP7A 1WGPA 1RUI2 2GH8A 1S0GA 1R1A3 3BIWE 3D6EA 1Q43A 2ZZJA 1DF0A 1K5MC 1DYKA 2VQAA 1NA1B 1ZRDA 2WINB 4BH9A 2ZX1A 3WOGA 4QPYA 3VBHC 1WW5A 2RMU3 4D7TA 1YJKA 1Z7S2 1FPN1 3GBGA 4GH4A 4KH9A 5DZEA 3AFGA 1AJOA 2D93A 3ELNA 2OVUA 3KB5A 4M01A 4AVBA 4MSVA 3FLPA 1AR82 2LUWA 2ZBJA 1MS9A 2PHDA 2DVAA 2XL9A 3VHNA 4FOYA 5JSOA 2HWD1 2RS53 2P3JA 5I8TA 2VOWA 3VV1A 4PDWB 1LHUA 3QH6A 4H7MA 1NQJA 4AVSA 5BNOC 4C91A 1UU6A 3KT4A 5K0UB 1Y7BA 3LA3A 1QU0A 1WW4A 2VH9A 3ZFGA 3G6JB 1HRV1 3U11A 4DPNA 1OQEA 1MQTA 2K2SA 2D5FA 1EYBA 2XLGA 4YVSA 2IXIA 4P9XA 1ASJ1 4P9IA 1BXHA 1ENXA 5GZGA 3NW4A 5FTTC 1OFNA 4GMP0 2KA3A 3J4UH 5IK8A 4KL1A 4X6QB 3MIEA 1Q8QA 2JG8A 2MEV3 2WT1A 3AK0A 4HPKA 4GKXA 1BK1A 4UW3A 4BOWA 4COUA 1MACA 4MX3A 4YVWB 1TNFA 1XU2A 2H0BA 3RJRA 4RQPB 1QXJA 4OVEA 1I1EA 2A75A 3OCPA 3NAPB 4YNIA 2IXLA 3WQ0A 3IKWA 5GALA 3CLPA 2GMEA 4IEUA 3USUB 3V64A 4Z82A 4AI0A 2B8MA 1AL23 4F8AA 4QQ2A 1V9U3 2HEVF 2QQPA 3VBFC 3A0NA 5DG2A 1R1A2 3O12A 1NLSA 1RHI3 2JE9A 4Q4X3 2GAUA 4FPCA 4KGGA 2DVDA 5AC91 1RJ7A 1CONA 4LE3A 2VW0A 2WNVA 3JU9A 2MPFA 3WCSA 2ZGQA 4GULA 1OOPB 3BODA 3MIFA 1Y43B 2D40A 1W6MA 4QPGA 1PK6A 1S0CA 4JGYB 3ZFGC 1LGCA 5IT6A 2ZMLA 1HQNA 4CP0A 4I30A 4PIYA 1PNFA 2XJPA 3ME2A 2BGCA 3OD4A 1Y3TA 3ATGA 4YW5A 1W6NA 2EALA 1QNWA 3JZVA 5DUWA 1V6MA 2B39A 4CZSA 1WCKA 2UYBA 2RS12 1W39A 4B3NA 4GH4C 4TYSA 2ZA9A 4F83A 2A6ZA 5T5PA 4FQZA 3VBUA 3JD73 5CFDB 1VB4A 3L2HA 2YUEA 3FUOA 4Y20A 1MZ5A 1VBC2 3DV8A 4FXGB 4XDQA 2BUKA 4AGRA 3ZN4A 2NYYA 4QHBA 4COZA 3AKTA 1XQNA 2X8KA 4RHV1 5L7OB 4FQ4A 1QH7A 4KWLA 1S2BA 3KQRA 3ILRA 1JOJA 2Q30A 4Q0QA 3WDYA 4OHXA 1RB8G 4OI4A 1A6CA 1GZ9A 3AFKA 4MXVA 3H7YA 1C8M2 4KGQA 4RD7A 1PM7A 4BPZA 3M8LA 2BFUL 2HWF3 5A32B 4L8QA 1C1FA 2CGPA 5J3UA 3FUQA 1QJY3 1TQ5A 3A4UA 4Q29A 4Q4V2 4Q0SA 1AYM1 4GH4B 5CU1A 2XJRA 4PLNA 3KGLA 5L73A 5K8SA 4L11A 4P9LA 4NR1A 3SH5A 1I3HA 1QH6A 2YZ4A 2XVKA 3ZFEC 4LA2A 1H4GA 4EV0A 1UU5A 5GLWA 3R4UA 1HKDA 5DDJ2 2ZHKA 4K1YA 4M3CE 3CO2A 2MHFA 3ZFGB 1R081 1LODA 3DPRA 4DRRA 1RVF2 5SV8A 3WHTA 1MS5A 2RM22 4FOWA 1LEDA 5I0SA 1SLCA 1MQTB 1IGOA 4PLOA 4AI1A 1BZWA 3MEPA 3ZSLA 4Q4X1 4I0AA 1OQDA 5BXXA 1JYIA 3D0JA 3JQXA 2IXKA 1AX1A 4UW5A 1HV0A 2JG8B 4HPKB 1I5ZA 3W58A 2D6OX 3JUUA 1XU1A 2ZPXA 1O91A 1PVC2 4YVWA 4XIOA 5JAXA 4XF1A 1ZZ7A 2Q5TA 4KU8A 2W39A 4CEWC 1WMEA 4RQPA 2WIIB 2WQ4A 3ZSJA 1J3PA 1RUH3 3ZXEA 1SFNA 2RS31 1VBC1 2PLV3 4L92A 3WDVA 4PLMA 3VBRB 3N7KA 2JD4A 2WT0A 1DQ2A 4DFSA 4HL0A 2XKPA 3USUA 4HVQA 2Z5WA 5FQ0A 1UKRA 1VBB2 5JPNB 5C4WC 4HKOA 1OLRA 2V09A 1RUJ2 2ZGSA 1YXWA 1UPIA 4XILA 1U5YA 5HXVA 5CFCC 1CVNA 1QJX3 1PO13 4KWJA 3RSJA 1PZ7A 2W08A 2XGXA 4XFFA 3WW3A 5J48A 3N7JA 4FP3A 3UKTA 1VAKA 4IEVA 4FPYA 3UKNA 4N43A 1AL21 1HXS2 4MLOA 5FMOS 2G9GA 1W6MB 3BALA 1PK6B 4O9EA 4IEOA 1QJX2 2P3IA 3M3EA 5JVVA 1VBE2 2BFUS 1RUE1 2YGLA 4AFAA 4E4ZA 5GZFA 1W0OA 1QOOA 2PAKA 1QQP2 2EXJA 4SBVA 1W6NB 4B7EA 2VPVA 1VBA1 2ZTNA 5HI0A 2YHJA 1KFUL 2NPIA 3IDBB 4RS5B 2JG8C 1YIFA 4LHLA 4HMZA 2SBAA 2ZCWA 3ZVXA 3Q9OA 1BEV3 5DZGA 2RMU1 2RR11 1WCSA 3C2UA 4C90A 1VBA2 3PMSA 2TUNA 4Y4YA 3RG0A 3AMPA 3N4MA 3T1LA 4XE9A 1NCRC 3RMYA 4NHKA 3AKQA 4P5HA 3OYWB 4LBJA 4LHNA 4K3UA 4QPIC 2WS91 2OYZA 2BW8A 3ZYRA 2YV8A 1WMFA 4XFGA 1BMV2 3ASIA 3HT2A 3KCYA 2DCYA 4XFIA 2P3KA 2QJVA 5CG9A 4I0BA 1SEFA 1SBFA 4YGCA 3HAGA 4AEDA 1ULGA 4RR3B 5EZWA 1LHNA 5A32A 2X5IC 1ZYBA 2OUJA 4FPJA 3I59B 4IEWA 1W2UA 1H30A 4JRAA 3APBA 3HMYA 4CP2A 2R6QA 2BQPA 5BNQA 4FPFA 2R0FA 1DU3D 4WVZA 4WM7A 2QZ2A 1J3QA 2DUOA 1GQGA 2ZX0A 1U5ZA 2RJLA 5T54A 4AXOA 1NOVA 4XEZA 5CA6A 2AZ5A 1R092 4AGGA 1OPMA 1B35A 2YPJA 3MICA 3DPRB 2CAUA 1H8TA 1CN1A 5DXDA 5E88A 1UL9A 2JXAA 4FVVA 5GZDA 4XJZA 3LB9A 2GC1A 1CAVA 3WW2A 1NQDA 1KDMA 4D7SA 2XBO1 4Q4X2 1DQ5A 3NL1A 2OPKA 1FOD2 4LA3A 5C8CA 5I8SA 2WNVC 4Y26A 3SCHA 2HWC3 2W52A 2W68A 4YARA 4ES9A 5CADA 3ZXLA 2R1BA 2VY0A 1AUYA 3ECQA 1R082 4UW6A 2VG9A 4XZPA 4C1WA 1EPZA 3R4SA 4HKWA 1CJDA 2ZX4A 2E7QA 4DXZA 1J3RA 1O3TA 1WBLA 5JZGC 1MZ6A 2XJVA 4AEKA 2WLQA 4QU2A 1VJ2A 4RSUA 1U5XA 3E5XA 1QY4A 3VBRA 1NE6A 3TN93 2WKKA 4YM3A 1X36A 1V6LA 1AYM2 2Y0IA 4IV3C 4N53B 5FQ0B 1FV2A 4RL7A 3NVCA 2WS92 3ZX7A 1QOSA 5L19A 1S0FA 3O5SA 5D1IA 3MF6A 1ZZ9A 4Y1ZA 3LA2A 3FLRA 2VVEA 1RC6A 1CQ9A 4MGIE 2NN8A 1O3RA 3WHUA 3RZZA 4ATEA 2UURA 2XG3A 3MFCA 4WM8C 2D7FA 2WS93 1WMDA 4JGZC 4LUMA 4N43B 1AYM3 1W6OA 1EAH3 2HWE2 1H9WA 1RUI3 4XHXA 4XBQA 4Z8BA 4Y1VA 1ULCA 1FAYA 2B42B 5H9PA 5IK4A 5KWRA 5F6KA 1I6XA 1ZM1A 2VECA 3MYXA 3R0RA 2PHUA 5AC92 1RUOA 3WP4A 5BY5A 3KGZA 4OHVA 2DFCA 4N53C 4N90A 1RHI1 2ZOEB 4BE3A 1DQ4A 1XYOA 4Q4W3 2JG9B 3OY8A 3VBUC 1R1A1 2DCJA 1XXNA 1DGRA 3CF6E 2R49A 5EXOA 3O0VA 1HW5A 5KHKA 4RS5A 4L99A 1REFA 4AEDC 5JZGB 3WW4A 4DY3A 2ZGUA 3ZIXA 3N7LA 4P9JA 1UX6A 5BYNA 1ZRCA 1GNHA 4N9IA 1PGW1 4GWMA 4IXLA 1WA4A 2DVBA 1U0AA 3OYWA 5FO7B 1OHFA 3MPPG 2ERFA 3LAGA 2SLIA 4PIXA 5LEJA 2A7AA 4ZU7A 1CPNA 2WFPA 1ZRFA 2R30A 2ETEA 1RUD1 2XJSA 1SLLA 4X8PA 4Q1RA 5ACA3 4I02A 3EXUA 1Z0HA 2R0HA 2LALA 2VXRA 3ZO0B 4AEDB 2IC1A 4RR3A 1LU1A 1RUE3 1DYPA 5CVRA 3I59A 2G4IA 5I8YA 1MEC3 1HV1A 1OA2A 1NXMA 2NMOA 2PHWA 3GYDA 3IDCB 4JTOA 5CG8A 1WLCA 1SACA 3URFA 3GZTB 1VBB1 1HRV2 1LTEA 4LBQA 4PF5A 1COV2 3PVOA 1JH5A 1J59A 5JWPA 1QKQA 4WM7B 2XB6C 5FDBA 3H3ZA 2ET1A 1ZZ6A 4DY5A 1PIV1 3VZLA 1U5IA 1RUC2 2WZR3 3M1HA 1VP6A 1HQLA 1ZBE1 1B35B 2ZMNA 3EQEA 3OTFA 4C1XA 3AKPA 2AENA 2BBVA 1H8TB 1FPN2 1QDOA 2W0XA 1H4HA 3VKNA 5JMCA 2V73A 4XW3A 3VBFB 3KM5A 3THPA 3AJZA 3THTA 1CAVB 4JAAA 4OUSA 4PBPA 2Z42A 3M4FA 4E4DX 1LOGA 3WD5A 2BYVE 4RFT0 2TNFA 2VOKA 2D5HA 4BIOA 1C5HA 1JBCA 5C8CB 1AR63 1XNBA 5BNNA 4BYYA 2R042 2DUQA 3JB8A 4GB33 3RS6A 2R043 1C1LA 2JKBA 1IPJA 2A3XA 2XJTA 4YW2A 3ZXGA 4AHWA 1RUNA 4R9DA 1IS4A 3V0AB 3D0SA 4YM0A 4GQ7A 5E89A 1H1IA 1NE4A 2DUPA 1YHFA 3QCWA 1LOFA 4M00A 4Q4Y3 4AYUA 4Q4Y2 2I2SA 3NAPC 3JD72 4AI2A 4N53A 1B09A 2HWB3 4CEYB 1MS0A 2IFWA 3R4DB 1CAUB 4LULA 1YO8A 1ND3A 2JJ6A 2BNOA 2ARXA 2XJQA 4YZ5A 3A0KA 1ZREA 5GLZA 2X53S 2VMIA 4AEJA 4EWDA 5JIUA 1EP0A 2LTNA 5FOJB 3AKRA 4DRVA 1W6OB 1V6OA 4LR4A 2NP0A 2GNMA 4IERA 1D2SA 1RVF3 3U4XA 4LO4B 4N9HA 3O14A 5F5QA 1JUIA 4IEXA 5IK5A 4Q0PA 4MH0E 4ASMB 2A6VA 4RA0A 2ZZQA 4BMEA 4XXAA 1NA1C 1QWRA 3E6CC 4COVA 3WX5A 2JG9A 3OY8B 5KXBA 1NCRA 2RE9A 4IEZA 4IQPA 5I0RA 1VBE1 1QHDA 3B7MA 2RR12 4FCAA 4Z07A 1AR73 3ZSEA 1RUC3 2WZR2 3J26N 3WP3A 3ZYGA 3R6SA 4ES8A 2Q1MA 3JB4C 2HWE1 4LTAA 5JZGA 2VVFA 1HXS1 3MLJA 1VBB3 3M3QA 3NKGA 4K8FA 3E5QA 3KT1A 1S0JA 3ZN5A 4BLIA 1R1ZA 1RHI2 5J37A 4QXKA 2VMHA 2UY9A 4P9YA 4AWDA 1MS1A 2D3PA 1DLLA 2WSVA 3AMHA 1BJQA 4E4SA 2H6CA 1QJX1 2AREA 1OKQA 3PMEA 4B4RA 4B4PA 4BA6A 1GLHA 2CAVA 3J9SA 2ZX2A 3WUCA 1ENSA 1RUF2 3B9IA 3B94A 4M3CF 1ALYA 1RMU3 4IEPA 3RJ2X 3ZYIB 2A6YA 1AYN1 4Q0UA 5JSPA 3U0ZA 1X8EA 4FPHA 1S0BA 1VBC3 1VAMA 3EJKA 1RJ8A 1VR3A 2YGMA 2WNUC 3USSA 2ZAHA 3VBSA 4HT1T 4YSFA 5CIRA 5FOBB 1VALA 1D0GA 1O7FA 4S2FA 1RITA 4LBQB 1F9KA 4XJAA 2OIIA 1JW6A 4W6WA 1TMF3 4Y1YA 3ST7A 2VW2A 2P17A 1V6KA 2EAKA 1GNZA 4I3GA 2RS32 4ZKTB 3BOWA 3HQXA 3JCIA 5EWSA 2JENA 2DU1A 3IPVB 4Q26A 4DMIA 2IZWA 4PIZA 4FPGA 4RQPC 2UWBA 1LHOA 4HN0A 4HZFA 3CNAA 4G4FA 4WZFA 3ES1A 4MZUA 4ZXKA 2D97A 1FNZA 4EROA 3TN91 1G9CA 2Y0OA 4ORFA 2V5YA 2WNUA 4Y1XA 3VBFA 4FTSA 4CRQA 1NG0A 3H1WA 4W65A 3NV4A 2GC3A 4YFWA 1DIWA 4J6GA 1D4M1 1W0PA 1ZX5A 3E5UA 4QGMA 1XNKA 4N7IA 3GALA 5BNNB 4I09A 1COV1 4AVVA 1CD3G 1JTZX 1DGWA 4MGZE 1PGL1 2GMPA 4EN9B 1MZEA 4LE4A 1CJPA 2RS51 3ES4A 2Z79A 1KDKA 2B9UA 1HRI2 3SLIA 3V0AA 2CGNA 1DZRA 2Y26A 4QT6A 5FPXA 2XBO3 1PMIA 2H6BA 5FO9B 1CAWB 1G7YA 3MW4A 2UU8A 2ZX3A 3WY6A 4GA9A 3WQ7A 2FZ1A 3MIDA 4CDXA 4EN8B 5C9AC 1SLTA 4RGGA 4D94A 1Q3EA 4CEYA 1YI7A 5F6LB 3ALQA 1O5LA 5A3LA 1CAUA 2DCKA 1S55A 1UCXA 1IKQA 3VBHB 3E6BA 1ND3B 5FFOC 3SCFA 5BUVA 4XF0A 1VBD1 1APNA 3NV3A 1SLIA 5T5LA 1MS3A 1ZZ8A 2GALA 5JCTA 2YDEA 2BNNA 4YW3A 5I93A 4I0WB 4KNCA 1DZQA 2VOXA 4KQ7A 5KHHA 1D0HA 4JC1A 2A71A 2DYCA 3I7DA 3EHKA 4XIKA 1QF3A 2PHRA 2XWBB 1KFXL 1FNYA 3M7AA 3RYKA 1G9DA 4DNYA 1EY2A 2PAMA 2VOVA 4TSVA 4SLIA 1CX4A 4XJWA 1ZBA2 3WDTA 3ZN6B 5GLUA 2QE3A 1NCRB 3U10A 5BNNC 3AYEA 2GNBA 3UJOA 3P3PA 4CDUA 3O0XA 1KS4A 1RUD2 5ABJA 2OZJA 2UYAA 4OI2A 4AHZA 1O4TA 1Z7S3 3QOPA 4CDQA 3AM2A 4XFBA 1TMF2 2O8QA 1YI9A 2PAEA 3AZWA 3ZYPA 4EWEA 3IIAA 5JR7B 3AKSA 5L7OC 5J98B 3QLQA 4DOUA 3KZ4C 1H1AA 2XLAA 4LBQD 2TEPA 4BLJA 4MYEA 3UK9A 1IZ3A 3SISA 1RUJ1 4UBGA 3SH4A 4BCUA 4Q27A 3HBZA 1WW6A 4YM2A 3RDIA 4CDWB 4L9BA 2E7AA 1LESA 3I2DA 3WCRA 1SLAA 5C33A 2WA3A 4LO5B 4ITCA 2Q1ZB 1KXGA 2EA7A 1O3QA 1O4YA 2PTMA 2WSUA 4K20A 4D69A 1HRI3 4EN6B 2B46X 4D7YA 3WNXA 2R32A 5KC6A 4RGAA 4OZXA 3KSCA 3VBSB 2HWB1 1YNAA 1QOTA 4AHXA 1EPWA 2GN3A 4GB32 5T5OA 1XYPA 5JOWA 2P2KA 2Q4SA 4Z2WA 4HN1A 4Y24A 3NKTA 4HSJA 5JOYA 2WQZC 3NV2A 4XQDA 4N7UA 4COYA 2DURA 4XPVA 4BHPA 5GLVA 2CWMA 2E7TA 3H3UA 2XBO2 3IPVA 4YG3A 1WW7A 3HT1A 4HSLA 1QJU2 3HD8B 3B5LB 1NZCA 2NMNA 4EN0A 4L97A 1SMVA 4AFMA 2D3SA 5BNOA 4AGVA 3PLQA 2D6LX 2PQQA 5BNPA 5CAZA 1A8MA 2XVLA 2WNUB 3FJSA 2FBEA 1MVQA 3O0WA 2VNGA 2DFBA 4S2GA 1WD4A 3OBRA 2XWJB 3WDXA 3TNQA 1ASJ2 2B7YA 4YG6A 1HRI1 4R9AA 1EAH2 2PA7A 5J09A 1KS5A 1ULFA 3VHPA 3GZUC 3VZKA 4QQLA 4AQTA 3OGGA 2MNGA 4LBMA 4IETA 1N3OA 2O0OA 4G9SB 5JLVA 3IN9A 1M06G 3VLBB 3LKJA 1J1LA 1GZWA 4A7YA 1FOD1 3VDDC 1G8WA 3RRDA 2UY8A 2HWD2 4I01A 1UU4A 5EFUA 4H55A 3N3HA 4AQSA