4WM8C

Crystal structure of human enterovirus d68
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
247
structure length
247
Chain Sequence
GVPTYLLPGSGQFLTTDDHSSAPVLPCFNPTPEMHIPGQIRNMLEMIQVESMMEINNTDGANGMERLRVDISVQADLDQLLFNIPLDIQLDGPLRNTLVGNISRYYTHWSGSLEMTFMFCGSFMATGKLILCYTPPGGSCPTTRETAMLGTHIVWDFGLQSSITLIIPWISGSHYRMFNSDAKSTNANVGYVTCFMQTNLIVPSESSDTCSLIGFIAAKDDFSLRLMRDSPDIGQSNHLHGAEAAYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Virus structure. Structure and inhibition of EV-D68, a virus that causes respiratory illness in children.
pubmed doi rcsb
molecule tags Virus
molecule keywords VP1
total genus 40
structure length 247
sequence length 247
ec nomenclature
pdb deposition date 2014-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4wm8C00
5D8AB 1HRV3 1ZBE1 2X5IB 1RUF3 1VBB2 4Q4V2 4CDXA 1POV3 2WFF2 1CD3G 3DPRC 2WZR2 1RVF2 4N43C 2HWF1 1X36A 1COV1 5BNPC 3JBG3 2R072 2R063 2GH8A 4QPIB 5A33B 1PGL1 5BNNC 4Q4Y3 1BEV1 5L7OA 4Q4X2 4Q4V1 1QJX2 1A6CA 1K5MC 1R092 2MEV2 2XBO2 3VBRA 1VBC2 1NA1C 2HWE2 4Y4YA 1AR63 1ASJ2 1NCRB 5DDJ1 5JZGA 4RS5A 2BFUL 1VB2A 2FZ1A 1ZBA1 1R1A3 1FOD3 1QJU2 1AR71 1RMU3 1VBA2 1R1A1 1D4M1 4CEWB 3VBOA 5ABJC 1C8M2 1AR83 4LLFA 2DF7A 3TN92 4GMP1 2RS51 4YVSB 1EAH1 3NAPB 1BEV2 5K0UC 1RUI3 5C4WA 4RQPB 4RHV3 1C8M1 4WM8C 4NWWA 5CFDC 1RVF3 1PO21 1QQP2 2RMU3 2PLV1 2WS92 1RUC3 1EV11 5CFDB 4QPIA 3J8F1 1B35A 1ZBA3 3NAPC 2RS12 1FPN3 1PGW2 4FTEA 4N53A 1AL22 1PO12 1HRI1 1TME2 4WM7C 2HWC3 1RHI1 3M8LA 2RS31 5BNOB 1HRI3 1RUH2 4JGZB 3VBSC 1RHI3 4WM7B 1PIV1 4Q4X1 5JZGB 4RS5B 2VQ0A 1HX6A 1ASJ3 1MEC1 1PIV3 1CJDA 1VBC1 1PGW1 1RMU2 1AL21 1PO11 2R041 3VBOB 1TMF2 1PVC3 1RUJ1 3ZFGB 1PO13 1NA1B 1AL23 4YVSC 3TN93 1NCQB 2BUKA 2WS91 1AYN1 5K0UB 4GH4C 2WWSA 4RR3B 3IDEA 1OOPC 1V9U1 1VAKA 4CEYB 4JGYC 2WZR3 4NWVA 2R061 1AUYA 4CEYC 1AYM2 2TBVA 4N43B 3VDDA 1GFF2 1TMF1 4GH4B 1RUC2 1NCQC 1RUE2 4N53B 3VBUB 1QJY3 2Y26A 1R093 2MEV3 2XBO3 3ZXAC 2WFF3 1MEC2 3VBOC 2RM23 5BNOA 2HWE3 2ZTNA 1NY71 4JGZA 1K5MB 1OHFA 4QPIC 1RHI2 5JZGC 2XPJA 4Q4Y2 1QJU3 1M06G 3JBG2 4CDUA 2HWF3 3DPRA 1HRV1 1ZBE3 1H8TA 3ZFGA 1QJY2 3ZFFA 1HQNA 1OOPA 1QJX3 2ZZQA 4Y5Z0 4GMP0 1R083 5K0UA 1WCDJ 5D8AC 4RR3A 4AEDA 3VBFB 3ZFFC 1RUI2 5L7OC 1RVF1 1ND2B 1C8NA 4CEYA 2HWD2 2QQPA 4GB31 3VDDC 1VBB1 4YVWC 5AC92 5C8CC 4CDQB 2HWB2 1VBA3 4QPGC 2RS13 4CDXC 5CFCB 2RS32 5ABJB 1VRH2 1D4M2 1NCRA 1MQTC 2RMU1 4IV1B 1K5MA 1RUC1 2RM22 2RMU2 1AR92 4IV3A 4RHV2 1NOVA 1QQP3 5DDJ3 4RFT0 1W39A 4IV1C 3HAGA 2WLPA 4PDWB 4CDUB 1HXS1 1VBD3 5CFCC 1AYN3 3JD72 4Q4W1 1COV2 2BFUS 1HRI2 1RUH3 1TME1 5AC91 4SBVA 5BNNB 2RR11 2RS11 2WZR1 4YVSA 3VBFA 1VBE1 4GB32 1ND2A 1ND3A 1RUF2 1RUG2 1EAH3 2PLV2 1BMV2 5BNPA 3CJIA 2R042 1OPOA 4PDWC 1F2NA 3JD71 4Q4W2 5C9AC 1B35B 2HWB3 1VBC3 3JD73 4AEDC 1PVC2 1RMU1 4RS5C 1MQTA 1AR62 5LK7B 1AR91 1FMD3 3ZFEA 4GMP3 4IV1A 1RUG3 4IV3B 1AL0G 1QJU1 1AR93 2RR13 1PGL2 3J8F2 1VRH1 2R071 4QPGA 1QJZA 2BBVA 3ZFEC 1BBT3 4RHV1 4YVWB 1RUD3 2HWF2 1RUE1 4CDWA 1NG0A 1RUF1 1RUE3 3VBFC 3VBHC 1AR61 1NCQA 1IHMA 2X5IA 1VBD2 5C4WC 5BNNA 4N53C 3VBHA 3TN91 1X33A 1AR73 1Z7S2 3JB8A 1V9U2 3FBMA 1AR81 3JB4C 1RUG1 1RUD2 4JGYB 4WM8A 1F8VA 5A33A 3VBSA 4RR3C 3VBUA 1POV1 4Q4Y1 1ZBE2 3VBRB 1ZBA2 4Q4V3 1FPN2 1HXS2 1R091 2MEV1 2XBO1 3VBUC 1HRV2 1QJX1 2HWC2 1PIV2 3JBG1 4BCUA 2HWD3 1RB8G 5A32B 1FMD2 4EJRA 1POV0 4YVWA 2RS33 1R081 1COV3 1OOPB 5ACA1 1VBE2 5FOJB 1D4M3 1TMF3 4AEDB 1PO22 1QQP1 3NAPA 4GB33 3VBHB 3ZFGC 5C4WB 1QJY1 4RQPA 2WFF1 1EAH2 1SMVA 1FOD2 2PLV3 5C9AB 3LOBA 2RS52 1VBD1 4RQPC 4CDQA 2HWD1 5CFDA 1RUJ2 4JGYA 4WM8B 4IV3C 5GKAC 1R1A2 5J98B 3S6PA 4JGZC 3VBSB 1AYN2 1VBA1 5BNOC 1BEV3 5CFCA 1C8M3 5ABJA 1FMD1 4CEWC 1PO23 5ACA3 1ASJ1 1MEC3 4WM7A 4FTSA 4CDUC 1B35C 3J8F3 2RS53 2HWB1 5A32A 2R043 5C8CA 2BPA2 4FTBA 1NCRC 5J96B 4PDWA 1PVC1 1RUJ3 1DDLA 4Q4W3 4Z92B 2HWC1 5FMOS 1RUH1 1FOD1 1TME3 3VBRC 2WS93 3CJIC 1EV12 1NA1A 1VB4A 1AR82 5D8AA 1VBE3 1ND3C 5FMOL 1BMV1 2GSYA 4CDXB 5ACA2 5AC93 1ND3B 1R082 5C9AA 4CDQC 1RUI1 2RR12 5BNPB 2FZ2A 3CJIB 1E57A 4Q4X3 4N43A 3VDDB 4GH4A 2X5IC 1BBT2 5L7OB 1EV13 2IZWA 1MQTB 1FPN1 4CDWC 1HXS3 1VBB3 1H8TC 4FSJA 1VRH3 2RM21 3ZFEB 2HWE1 1AR72 1NY72 1V9U3 1RUD1 4QPGB 5C8CB 1AYM1 1Z7S3 2ZAHA 2R073 2R062 5DDJ2 4CDWB 3DPRB 4CEWA 1AYM3 1BBT1 1Z7S1 1H8TB 1ND2C 3ZFFB
chains in the Genus database with same CATH superfamily
2CHHA 1PNGA 4J25A 2VW1A 2ID4A 1PZ9A 4RD7A 3T2QA 2QQNA 1JYVA 1VBB2 4WVMB 3P3PA 3KCXA 1KJLA 3I2FA 5F6KA 5A3WA 3JQXA 3C7FA 4W6WA 1Z0HA 2W1UA 4H7MA 2D6KA 1CD3G 2QQVA 4OYUA 4QDQA 3A21A 2SLIA 2HWF1 1CWPA 2W1SA 1CR7A 4LO7A 4XUTA 1X36A 4U36A 2VVFA 1WW4A 4BYYA 1WW6A 2NLRA 2GH8A 2XQXA 3PJYA 3PVEA 2Y33A 3AMHA 2W87A 2P5BA 4MGKE 4OUEA 3FL7A 1F31A 1A6CA 1VIWB 2ZOEB 4DY3A 1K5MC 1R092 2ZACA 1J3QA 2ILMA 3G7DA 1AZDA 3VBRA 3J26N 1NE6A 5H9PA 1NA1C 1FT9A 2PAEA 4HKOA 1POQA 2Z5WA 1AR63 4OHYA 4AEMA 4YW6A 3CF6E 1VB2A 1UF2C 3AMQA 5CB7A 5DUUA 2ZX3A 1W8WA 3AZVA 3S57A 2YGMA 4C1WA 1HN0A 2RDSA 3ZX7A 4GWJA 4QXCA 1Q43A 2WFPA 3U10A 5ABJC 4AGVA 1CAWB 1N1TA 3AKQA 2LALA 1GKBA 2DF7A 4B7KA 3MFCA 1WMDA 5IVCA 2D6OX 1OVSA 3F2ZA 4HVOA 3V0BA 5A7OA 4BE3A 2VW0A 5EJZB 2QVSB 2CL2A 4LA3A 5LASA 3OYWA 4LBOA 1OH3A 2WT0A 4H3WA 5KHKA 2DFBA 3ZR5A 1TVGA 1C8M1 3LGRA 4FP3A 5CFDC 1S0GA 1QQP2 5L19A 5FZGA 4A44A 4CUGA 3H8OA 1LHOA 4AF9A 3I2JA 2BJSA 2PLV1 3ZXLA 4OI2A 4BQWA 3WP4A 4W65A 3I2GA 4E4DX 1JZ2A 5CFDB 2AACA 2K2SA 3T1MA 3J8F1 2PHRA 2EA7A 4QMAA 2HJIA 4HBNA 1FPN3 1V6NA 1XYNA 1W9YA 1AL22 2I07B 3DXTA 1NAEA 1JN2P 1YI9A 4JRLA 1HRI1 1TME2 2H6CA 4WM7C 4AFMA 1UMIA 3H1WA 3IIAA 4A3ZA 5BNOB 4AQ6A 3JCIA 2GDFA 4JGZB 3VBSC 3H8RA 2D43A 2RE9A 3I7DA 1ZM1A 4WM7B 1GNZA 1NLRA 1NXD1 2VQ0A 4RS5B 4XAEA 5EHDA 5CG8A 2R49A 2JE7A 4LO4B 3FUQA 2AUYA 3THCA 2V73A 4OQ8A 3H8UA 2QNKA 3RZGA 3LE0A 1W6OA 3I3QA 4LPLA 4LORA 3RI9A 1ENSA 3PTRB 5JSRA 3TB0A 1I5PA 3CBNA 3N4MA 2GNMA 2W0XA 4LQRA 3WDYA 1FV3A 4NIDA 3LCPA 3THDA 3VZOA 3ZXGA 5C70A 1XC6A 1WLCA 3P1IA 1NCQB 2WS91 4QXKA 5A7SA 2I2SA 4PBOA 3WQBA 3MF6A 2DVGA 4FOWA 4EWEA 2YROA 4GH4C 3BVCA 4YG3A 2WWSA 4RR3B 3BTXA 3IDEA 1H0BA 2ZAAA 4A42A 1KEXA 1W6PB 1VAKA 3IIIA 4FPYA 1H2MA 2VD7A 2GNDA 4XBNA 4CEYB 5F3IA 3RWNA 3URFA 2IFWA 2WWUA 4NWVA 4AI9A 4NPLA 2JB8A 1W8ZA 2A73B 5A6ZA 1H4GA 3KF5A 4I0WB 4CCLA 5CBLA 3VDDA 2R1BA 1GFF2 4GH4B 4A45A 4Z2AA 1RUE2 3ZYFA 1MS9A 1QXJA 4N53B 5FZIA 3VBUB 4BLJA 1R093 4M3CA 2IXKA 3UNPA 3ZXAC 1SCSA 4HPKB 1PX3A 1ULCA 1RUNA 1MEC2 2EIEA 3NW4A 5L9BA 1EUTA 2HWE3 4IDZA 2ZTNA 3SITA 3AK0A 1W8HA 3H1YA 5FPBA 4A3XA 4XFAA 4DOUA 1PX4A 1OHFA 1GZCA 4QPIC 3IMNA 3CIHA 2R16A 1S0FA 1K12A 1OLMA 2AENA 2XPJA 3FN9A 2ENRA 2VQUA 4EYUA 1WBFA 2NYYA 2VQTA 4HKLA 4YFWA 4FPFA 1HRV1 2Y8KA 5J36A 2HKXA 1STMA 4QQPA 3WF2A 3ZFGA 5DAVA 1XE7A 5A1AA 3MBWA 1UPSA 1UU6A 5FZ3A 5JI7A 5GJ6A 4R9AA 3POJA 3MPBA 1FV2A 5FR3A 5GLVA 5D8AC 4CCCA 3ZFFC 4Q1RA 3KGZA 5L7OC 1ND2B 1C8NA 1LRHA 4LT5A 4YGEA 4O9EA 2HWD2 2UWAA 1OBNA 1QEXA 2UY8A 3VDDC 1GMMA 4F3JA 4NUBA 4HXCA 4YVWC 2VZ3A 2QTWB 5C3QA 1A34A 2CWMA 5DAXA 5C8CC 4CDQB 3TEXA 4IQPA 3BODA 4PT6A 3IPVB 5IK8A 4QPGC 2VZVA 3P6BA 4AHWA 3PVNA 3B9IA 2DCZA 3R4SA 4IE4A 3IKWA 5LEJA 5HV4A 1AXKA 4WBBA 3O0XA 4B4PA 4CUCA 3I59A 1GLHA 4QHBA 4F83A 5ABJB 1OLRA 1XU2A 2TUNA 2GH2A 4RGKA 1UY3A 2CGPA 3POEA 2VMDA 5C3PA 4B1LA 3NV1A 2VZPA 4N7UA 4MH0E 1XOYA 4QX2A 1NCRA 2AR6A 1XNBA 4FPJA 4GZ9A 5ANNA 5A3PA 4AFCA 4PHZA 5KHHA 4JVAA 1QQP3 5DDJ3 2PHWA 3T1LA 3ZYJB 1W39A 1Y7BA 2UWCA 1NT0A 4I01A 1N1SA 3H42B 2BV4A 3NNLA 3OUJA 2D3SA 2WLPA 4X6RB 5J48A 1GUIA 1GQGA 2V4AA 3MFAA 3Q8EA 1UZVA 5J7MA 1HXS1 2WLQA 2W39A 1IZ3A 4EN7B 4IXLA 1GWLA 2BFUS 2Y0IA 1HRI2 1TME1 1CJPA 4LKDA 4YGCA 3MIFA 1DLLA 5FZ0A 3WV6A 3VHPA 3NQHA 1D4VB 2H6BA 2CY6A 3FZ3A 1LHVA 3D6EA 4GALA 4MXVA 5FUPA 3WHUA 1UCXA 1UD1A 1WA4A 1RUG2 3Q8FA 1EAH3 1QKQA 4N8MA 3ZSMA 3TNPB 1REFA 2DWRA 4JQRA 1FNYA 1ULFA 2F17A 4FQZA 3U1XA 2R0HA 4CCMA 3KT7A 3ON7A 2ORZA 2HYKA 3I3BA 3V0AB 1YLLA 1KJRA 2FCTA 2VUJA 1WMEA 1VAVA 5E6HA 1GWKA 4NIIA 3JD73 4RFRB 1OT5A 1PVC2 4AEDC 4QXBA 3WW1A 1S0BA 2DBNA 1QU0A 3WLUA 2ES3A 1YQCA 5LA2A 3SC7X 3WP3A 4AI8A 3KVBA 4LJHA 1NLQA 4ZZ8A 2IVIB 1ZREA 1G9BA 2WO1A 1S0DA 4S2GA 5AVPA 3ZFEA 4GMP3 1RUG3 3VHOA 4DZGA 1DIWA 1AL0G 2OQ7A 5FRAA 4ARYA 1JYNA 1PGL2 3NWKA 3J8F2 1GZTA 4L8QA 1VRH1 4MVTA 4P9LA 5HBAA 5IK5A 3WVJA 1YI7A 3R4DB 3USUA 1LGCA 2PMWB 4OULA 4UWDA 1BBT3 4IEPA 2MHFA 3W59A 1W6OB 1CAXA 1RUD3 1RUE1 4CP1A 5TSWA 3POIA 4RN5A 1WCUA 1HKDA 3LIGA 4YM2A 1OQEA 1RUF1 1BXHA 5FPZA 2DYCA 3KF3A 2XWJB 1CVNA 4HETA 4O7XA 5A1LA 1IHMA 4DPNA 5I8TA 1VBD2 2XJTA 4O65A 5C4WC 4FI9A 3BALA 2CGOA 2PHDA 4HVRA 3VBHA 4BK5A 1UYPA 4NO4A 2OX0A 2PA7A 2XHNA 5T50A 5A3NA 2X05A 2PN5A 4XBQA 1AX2A 1W3VA 2HLEA 3NJVA 1LU2A 3JB8A 3WHTA 4GWIA 3IAPA 4NIGA 3EBRA 4JQTA 1ONAA 4HN0A 4JZRA 1AR81 4D7TA 2VR4A 4IEYA 4CXXA 5J09A 4Q0PA 1F8VA 2ZGSA 3RSJA 3B3QE 3WNPA 4LBNA 1O7FA 4UOJA 3VBSA 2BVVA 4BOWA 1IPSA 4AVCA 2VZRA 2FDGA 4PCRA 1C28A 1WW5A 3GBGA 2DFCA 5F3CA 4B4QA 5FLIA 3BGAA 2MEV1 5JMCA 1JOPA 2JIJA 1HRV2 3UKTA 3VN4A 3FX3A 1UY0A 2HWC2 2VUAA 2J42A 3AZXA 5FY1A 1PIV2 5DMYA 3MUZ1 5IWFA 2HWD3 5LATA 3ZKUA 3FE5A 3JUUA 4NR1A 4HG6B 4R9BA 5LRSA 1DZTA 4NHMA 3LDKA 4YW7A 5L36A 5FZEA 3AYEA 3POFA 2ZKNA 5FZ4A 3SEPA 4FP2A 3NKTA 2CGNA 2XVKA 4YZ4A 2KXLA 1BK0A 1XYPA 5T3NA 1PHMA 1X9PA 2GMPA 2E26A 1OSGA 1BHGA 2QQIA 1MZEA 1VBE2 2VNGA 3CZJA 4BH9A 5DAWA 1TMF3 2UURA 2XVGA 3ZN6A 3O1UA 2QUOA 3K46A 3VB9A 3MHZA 2FDFA 2DTYA 4PLMA 2YFZA 4I0AA 1FXZA 1QJY1 4PIYA 4IW3A 2XJUA 1O6UA 1UIKA 2ZX4A 3O0VA 3POSA 1EAH2 1SLBA 2E7QA 4L2NA 2YC2A 3LOBA 5HCBA 3ZIWA 4Z2WA 4FOVA 2BDRA 3O1RA 5EWSA 1LU1A 1VBD1 2BW8A 2GN7A 2QQKA 5A7WB 1KGYA 3VDCA 4F7ZA 3GALA 3TEYA 1YJLA 4JGYA 2A3XA 1Y43B 1GSLA 4WM8B 3WG3A 1R1A2 2DV9A 3PU3A 5HCAA 4GWMA 1KDMA 1Q8PA 4AVTA 1VBA1 2Q1ZB 4Y3OA 1EY2A 1AXYA 2D5HA 5BNOC 3O5SA 1X8EA 5CFCA 1SBEA 4XQWA 1DU3D 4S2DA 4ASLA 3R05A 1QF3A 1YO8A 2WNVC 3ZYBA 2JDZA 1DQ2A 1LJ7A 1FATA 2R6QA 4DY5A 1PK6A 4FTSA 1LHWA 3V64A 1UW8A 1OI6A 4XDQA 1F15A 2HEWF 1FNZA 2GMEA 5C8CA 1W8TA 4PDWA 4HL0A 3UYJA 4YZ5A 1LGBA 3ZDVA 4AGGA 2HWC1 4XJWA 3GHMA 5EYYA 1TME3 1FOD1 2NN8A 5T5JA 2WS93 1JU4A 4YM1A 1XU1A 3CJIC 3VBRC 2G9FA 2JDMA 1EV12 1NA1A 4HKWA 4PLOA 4P9JA 5FV3A 4NN0A 4ZZ5A 4HONA 1BMV1 1T2XA 4LXLA 4EN0A 2GNBA 2XHKA 4CDXB 3A22A 2JDNA 1ODNA 5ACA2 3RRDA 1V00A 5FDBA 1PNFA 1R082 1NZIA 4NMIA 4LKSA 1ULDA 1YYNA 4Q5OA 1TNRA 4V1PA 3T08A 2WIIB 1DGWX 4NROA 2G4IA 1U0AA 2VZ1A 1E57A 3VKFC 4DFSA 1ZZ7A 4FPKA 2Y34A 3BIWE 5JXIA 3DKWA 2YBPA 4XUOA 2VG9A 2ZGUA 2OW4A 4Y4RA 5GZDA 4AHYA 1BBT2 2JECA 2XUMA 4LOSA 4URAA 5B4NA 1JZ7A 3RZMA 1H30A 4L0PA 1PZ8A 2P2KA 3GZUC 4HK8A 4ATEA 5F37A 4QKNA 2JIGA 2Y6HA 1UYZA 2IZWA 1UPIA 1LHUA 1MQTB 2YXSA 1CZTA 4IEOA 4NAMA 2QQLA 4OQ9A 1HXS3 2WL1A 4CDWC 5FKCA 1UAIA 1HW5A 3VKMA 1A8MA 3S7EA 4MXWB 3KT1A 2JG9C 1JOBA 3ZFEB 3ZN5A 2XB6C 1W2OA 3FFQA 3ABZA 3Q8AA 4QGLA 5LBFA 3SEEA 3UESA 4FBFA 1MACA 5HCHA 3AKSA 5KWRA 1QHDA 2GC1A 4MGSA 4JKLA 4CU8A 1A8DA 3HMYA 5M0TA 5H9SA 3ZSLA 2YZ4A 2ZBJA 4FFIA 2QE3A 3KQRA 3AMNA 1HQWA 3VHRA 2W91A 3C7OA 4N9HA 3ZOIA 4AYUA 5DG2A 2ZEWA 3PTYA 1O4TA 1SFYA 5FBJA 1H8TB 3ATGA 5KC6A 4IE7A 1W6QB 3BIEA 4RYDA 5D8AB 2JX9A 1HRV3 1W9WA 2XJSA 3I2KA 3MW3A 3QLQA 5FZCA 4BXSV 2X5IB 2PQQA 4NE9A 2JDPA 3WF4A 3PIGA 3THPA 2WNUA 5F5CA 3PUHA 2W95A 4YWAA 1S0IA 4IERA 3DUIA 1JHNA 3ES1A 1VPHA 2A70A 4AEJA 1G9FA 1FI2A 1OH4A 1RVF2 3BCWA 4P9YA 4M3CF 1UZWA 4P9GA 5FZHA 1QMJA 3HT2A 1G9AA 4MO3M 3UK9A 5FWEA 4QHOA 2FCVA 5FY0A 4YSFA 1DLCA 4QPIB 4OHZA 5A33B 1PGL1 2IXJA 4COZA 4OZXA 1BEV1 4DO0A 5BNNC 2E53A 1AVBA 3AP7A 3H3UA 2BWCA 4NHKA 4Q4V1 1GWMA 3PMSA 1QJX2 3M3QA 2TEPA 3KV6A 3JZVA 5E8AA 1OMIA 5FZ1A 4I2OA 2OXBA 1NE4A 1RJ7A 4CP0A 4OI4A 2XDVA 3JQWA 4JKKA 4XHXA 4COYA 4OUMA 5FZ8A 5FBZA 4EWDA 2LUWA 1NLSA 1KXGA 3UGHA 3K48A 5AFEA 1ZBA1 4ZPIA 1DFQA 1AR71 1RMU3 4QPWA 2XVLA 3JXSA 2R0FA 3LEIA 3BTZA 2DTWA 1R1A1 2E51A 1D4M1 4CEWB 4ZONA 2ORXA 4E2QA 4FAGA 1SDWA 5FKBA 1AR83 5LB6A 3RYRA 3AM2A 2P37A 2ERFA 3DYMA 5APAA 3ACIA 4LBQD 4QB2A 5FPUA 2WQ8A 2D5FA 1H2NA 2H0BA 3ES4A 1H1IA 1WGPA 1YIFA 2AYHA 4AFBA 4UF0B 5FPXA 4DUVA 4CCKA 5K0UC 3DYPA 4H14A 3D0JA 3AL5A 1LOBA 3EHKA 1RVF3 3MV11 3PL0A 4IEVA 5JOYA 3SXWA 3M2MA 1IG3A 1FAYA 2ZA9A 1RUC3 2J22A 2V5YA 4Y20A 5DN2A 3IDAA 1B35A 5EXOA 2DUQA 2Q5TA 2B46X 1IS4A 2IC1A 4YRDA 3RNSA 3NAPC 3WDVA 2JKXA 4LMFA 1O3RA 5FP7A 4K1ZA 3KVAA 3FMGA 3NRUA 3GZEA 1GP5A 2HWC3 2VY0A 1JUHA 1RHI1 2BEOA 3BB6A 3M8LA 2XGXA 2RS31 2IXHA 1ULEA 3NJZA 1DF0A 2VOKA 1HRI3 3WNNA 4KWJA 1RHI3 2ZGMA 5FMDA 4JRAA 1GP4A 3I3MA 1PVXA 2Y6KA 2A1XA 4UW6A 1YQ5A 2X10A 1CJDA 1DGRN 4XABA 4BIOA 1RMU2 4A41A 2A6XA 4PIXA 3WW3A 3ZSKA 3RDIA 1AL23 1X8MA 2Q8EA 2P3KA 2QJVA 2WAAA 4A6OA 3TN93 4CCOA 3J7LA 4XQ4A 4FFGA 3LEGA 5I0TA 5K0UB 1KFXL 2E7TA 4IETA 3VL9A 1V9U1 1YFUA 4GULA 4Z1VA 1UOGA 1QDOA 4A4AA 4BA6A 4JGYC 3GZTB 4JHZA 3BPZA 2C26A 2QBXA 2C1FA 4IEUA 2R061 5EJ3A 3ORJA 4QQHA 2W94A 4Y1ZA 3M70A 3RWKX 1JYWA 3B5LB 1HLCA 2UY9A 4IGPA 3BI3A 1GNYA 1TMF1 1V6OA 2GN3A 4P14A 5EQUA 2G9GA 2A7AA 3N9OA 2C5DA 1XRUA 2OUJA 2PXJA 4KG0A 5FYUA 1MZ5A 3BUCA 1QJY3 2Y26A 2XBO3 3RVHA 5KXEA 1DP0A 4AI1A 2V5DA 4GQ7A 3VBOC 2RM23 2VAUA 3JU9A 4BHPA 3OB8A 5IFTA 4CA9A 3OOXA 1NY71 2VXRA 4YZ3A 5K4LA 4MXWA 5KXBA 3MV01 3EB7A 5FZOA 2LROA 5C5TA 3MLLA 4UXAA 4LK6A 1LOFC 4COUA 1VAMA 4WZCA 2XLAA 1UO9A 2QQOA 2E6VA 3JBG2 1RIRA 3ZM8A 3LEKA 5C6CA 1P8JA 4O9GA 5FZBA 2BGOA 4IGQA 1H8TA 1RINA 1WLWA 2EXHA 2V4VA 1QJY2 2ZZQA 3NNMA 4JKMA 4V2WA 4BQYA 4CU6A 5HI0A 4F8AA 4BISA 4GMP0 3ZYGA 5LK5A 4YGDA 5FXWA 4QXHA 4RR3A 3PURA 5FY8A 3ZVXA 3T0BA 3VKLA 2VGDA 3HNBM 5EPAA 1QXRA 2BBVA 2FDIA 1XNDA 5J3UA 4GB31 2VOXA 1AJKA 5IK7A 2V09A 2GZWA 5AC92 3USSA 2FHRA 3EO6A 2YU1A 4AWDA 3WNXA 2WNEA 4CUAA 2XLGA 4Z8BA 4DXZA 4AG4A 3MIEA 2W46A 1XE0A 4CDXC 1REEA 3KMHA 1S1AA 3S7IA 1ACCA 1PK6C 3E6CC 3M3OA 3AL6A 3LD8A 2ARCA 1RL3A 3AKRA 1XYOA 2WT1A 3N9LA 4XF0A 2FDHA 1XNAA 1W06A 1VJ2A 1D4M2 3M7AA 4LEJA 2KM2A 2VNRA 3EQEA 3AKPA 4LK7A 5F3EA 3CL1A 4IV1B 2E32A 2RMU2 4IV3A 4MHRA 5JCTA 4XFBA 1NOVA 3J4UH 4AI2A 3K75B 1DYKA 4XFFA 5BNQA 2J1TA 2VOWA 1OA2A 3WQ0A 1V6KA 4INDA 3T3YA 3UKVA 1LOCA 4FPHA 4TXWA 1JS9A 2E31A 4E4HA 1IS3A 3I8TA 4UFKA 5IUQA 5CFCC 4R9CA 2B45X 3AP6A 1ZRDA 1H6YA 4C91A 2EAAA 4SBVA 5FZFA 5BNNB 1VMHA 2VC9A 1WKYA 2GP5A 3E5XA 3VBFA 3WUCA 3WD5A 4XCAA 1LCLA 1ND3A 3POBA 1UY2A 1BQPA 2HEVF 2WBKA 4XOGA 2PLV2 1QJFA 5BNPA 5FO8B 2R042 3OY8A 4PDWC 1W8NA 3OSDA 1SLLA 1DGWA 4YW1A 3VV1A 2RDQA 3AC0A 4YM0A 1DCSA 5FQ0B 1Q8OA 3OPZA 1APNA 1F2NA 1UKRA 1WD4A 1VE0A 3JD71 5DZFA 2B9VA 4GD4A 4COVA 1B35B 3H9AA 3IPVA 1IPKA 3MZHA 5F6LB 3ZLIA 1VBC3 4UFIA 1NQJA 2DDUA 1BYHA 3ACLA 1BJQA 1RMU1 1X9TA 1XPWA 4B4RA 3VZMA 3ILNA 1ZRRA 2VBBA 5LY2A 1W2UA 4YZ2A 1OD5A 1N1VA 1WW7A 2UWBA 3AB0A 1SBFA 3B00A 1ZZ9A 3MO4A 4BQ2A 4K1YA 1AR91 4P5HA 1KS4A 3VL8A 3WR0A 2G1MA 4E2GA 3M1HA 2D93A 2OZ6A 3LKJA 4HMZA 4AVAA 2XXZA 3C7HA 3NJXA 4QQLA 1D0HA 1UL9A 3NVCA 5DZEA 2YYOA 1KITA 2IUWA 1YUDA 1HJGA 4G9SB 2JG9B 3KT4A 1QOSA 3ZFEC 5CU1A 4RHV1 3DF0A 1CPMA 3KM5A 3VZJA 4L92A 5FK8A 4YPJA 1D2QA 1RJ8A 5DABA 2PTMA 4ITCA 1NG0A 4LUMA 4YG6A 2ETEA 4MGTA 4SLIA 4CXYA 2VNVA 3KQ4B 5I0UA 3U11A 2VL4A 3VBFC 3BU7A 1AR61 1H4HA 4BB3A 2A6WA 4RL7A 1LAJA 1NCQA 4G3YC 2CV6A 4N53C 2ZHLA 2ZX1A 1BMV2 2AEYA 2J1VA 3MPPG 1W6PA 2PHFA 2VTFA 5A7NA 3OBZA 4DB5A 2NM1A 3N3HA 4IUGA 3GCWA 3RYKA 1LOGA 2Y38A 5F3GA 4KQ7A 2FD8A 3V56A 1W6NA 1UXZA 2A6VA 4ONUA 2E63A 5T5PA 1CQ9A 3B7MA 2CNAA 3FBMA 1CAVB 3V0AA 4I30A 4D8MA 1W9TA 2JDYA 3A4UA 4D6RA 2ZMLA 4XJZA 4LBJA 1W90A 4UAPA 4BQXA 5JPNB 1ZA4A 5EJ1B 1ZRIA 3N7JA 3NNFA 3VBUA 3ZXEA 5FO7B 2PELA 1REDA 4Q0UA 4XIOA 1ZBA2 4RSUA 2WKKA 1GP6A 1HXS2 2XBO1 4ZHNA 1GANA 3A23A 4W50A 3ZYHA 5ISLA 5L9VA 3LAGA 4AGRA 2WWJA 4ISQA 4AR2A 3I2DA 3ZKYA 4D94A 1YRZA 5A70A 1YC61 5A32B 1ZZBA 4Y1YA 3WINE 1UKGA 2J1RA 2ZS6B 2QZ3A 3OD0A 4JC1A 3AMPA 2XMLA 2BWAA 4JTOA 5LBBA 4TWTA 2JG8A 2I74A 3KLSA 1QH6A 1JZ5A 5FJHA 4YW3A 2W5FA 4UFLA 1C3HA 4QT6A 1GQPA 4BWOA 3AFGA 2NMOA 3ACHA 5JOXA 3H8XA 2JKBA 1CAUB 2IWGB 2VZSA 1KQRA 1PO22 3HBZA 3VBHB 3ZXJA 5FO9B 5C4WB 2OPWA 1MPXA 1SPPB 1UU5A 2WFF1 5C9AB 1EUUA 1C1LA 2O0OA 2RS52 3H50A 3RQ0A 3CDZB 3OUIA 5D21A 2W3JA 1S4CA 3GBFA 5FLJA 5JPMB 5FXVA 3WOGA 4CDQA 1RUJ2 2Q8OA 2EVXA 3SMHA 3OEAA 2WABA 1WA6X 4LBQB 3OUHA 5IVFA 4YYOA 4MZUA 1AYN2 1CX4A 2GC2A 2PAMA 2P17A 4OHVA 4Q0VA 5ABJA 2FCUA 3OGSA 4XDPA 4BXFA 4CEWC 2W68A 1URXA 2CU5A 3RZHA 3N9QA 1LEMA 2XR4A 3E1F1 1U5XA 4HSJA 5CA6A 3PVOA 5ACA3 2MNGA 2IVJA 5F32A 2AH2A 5BV6A 1V0AA 2Q30A 1U5IA 4J6GA 2HH9A 4GIQA 2YUEA 4CU9A 4NIHA 3NV4A 3PMEA 1F5FA 5HPOA 1T6BX 3SQOA 5J96B 4LA2A 1CIYA 2WZ8A 4UBGA 5FWJA 4Z92B 1W0OA 2B8MA 2B39A 1RUH1 1Q8VA 4OZOA 1LKNA 3LDBA 1AR82 3OBAA 4Q2FA 4QKDA 1ND3C 2YHJA 1C57A 2Y64A 2BQPA 1EPWA 1RC6A 3B01A 4TSVA 4WVMA 1MS1A 2OS2A 4JCKA 1O91A 2GSYA 1J3PA 1IS6A 4XXPA 3EJKA 3KZ4C 1A78A 3LB9A 1TNFA 4Y5SA 4CDQC 2GMMA 3WCRA 2RR12 4XF4A 4EV0A 1C4RA 1XB9A 2R32A 4KGGA 2ZX0A 5IVEA 4KWUA 5FLHA 3UL2A 4N43A 4ES8A 3BTAA 3O1SA 2A71A 2VO5A 1J3RA 4CU7A 1H1MA 2G19A 5HV0A 2Y60A 1LESA 2VW2A 2X5IC 4QU1A 4XJAA 3RMYA 5L7OB 4ZS2A 2WRAA 3SH4A 3WG4A 2IFRA 1HJFA 2SBAA 2RHPA 1WUVA 3O14A 5I91A 4QX3A 3BPSA 3DGTA 1FPN1 1IPJA 4HN1A 1OKOA 1XBFA 1KS5A 2L9LA 3G6JB 4AL9A 4CYDA 3QACA 2RM21 3K3OA 4URTA 1U5ZA 2EIDA 2OVUA 4BU2A 3WUDA 4HZFA 4TLFA 1OF4A 1W0NA 4DMIA 1KD7A 1V9U3 2I45A 2WO2A 4QQOA 1OLQA 2JG9A 3AZYA 5LBCA 1AYM1 1MVQA 4C8DA 5IHRA 5FAXA 3C7EA 2ZAHA 3EYPA 5DAPA 4QDRA 2R073 4QU2A 5DDJ2 1Y3TA 1AYM3 1BBT1 1Y9MA 2YC0A 4UT5A 4D69A 3IWZA 5DQ0A 4LBLA 4Y22A 1CAWA 3L2HA 1W8UA 4P9WA 4Q8LA 2F4LA 3ZPYA 3V0BB 4Q4V2 3WDXA 3GF6A 4E27A 3OYWB 5LBEA 2EXJA 3KHBA 1MVEA 2BU9A 2OA2A 2PQSA 1JH5A 5A80A 1DZQA 2DURA 2B5HA 3DPRC 2WZR2 3OGVA 4N43C 4AXOA 4JHTA 1CESA 4LBKA 4XURA 2Z42A 4PI2A 2OYZA 5SV5A 2JE8A 3FLPA 1K5JA 2BGCA 3MYXA 1F4HA 2WSUA 2ZHKA 3JBG3 4OI1A 3AYCA 2R063 3POYA 4XETA 5IT6A 1YEWA 4I02A 5E16A 2D98A 5DAQA 4Q4X2 1J59A 3U0ZA 1K3IA 3TRSB 4EN9B 4UI9L 1V6IA 3E6DA 4P5YA 2MEV2 4KL1A 4LR4A 3GJBA 4YG0A 4K8FA 5JWPA 1SFPA 3GHNA 1I5ZA 5FMCA 5BY5A 3U75A 4D3WA 2HWE2 3C7GA 1DG6A 4BJ0A 4Y4YA 4NOTA 1ASJ2 2VZOA 3AYAA 5JZGA 4RS5A 3S5QA 3O0WA 3PJQA 2BFUL 2MPFA 4NIAA 1XSRA 5JIAA 2FZ1A 2X53S 2D7FA 2GP3A 1T6GC 2W52A 2X29A 2Y0OA 4DS0A 4M00A 4JTNA 4XJUA 5BPXA 5JVVA 2EICA 3KHCA 3ENRA 4GKYA 3FLRA 2D3RA 2JG8B 4Y1UA 4AI0A 1L7LA 4O61A 5DUWA 3VBOA 1PM4A 1C8M2 5FZDA 5I8YA 3O1OA 1DQ4A 4IL7A 1ZRCA 2DU1A 3KB5A 1RXFA 4GMP1 4W4ZA 4N9IA 1G9DA 1W6MB 4RGGA 4C0BA 2UYBA 3J7MA 1EAH1 1BEV2 1RUI3 2WUHA 5C4WA 5CKNA 3RFRA 4X8PA 1O8SA 5HXMA 2OPKA 4GJZA 5FP9A 2E33A 1HV0A 2WJSA 2Q1MA 2EF6A 1Y9QA 1J1LA 3EMRA 1YIPA 2XG3A 1OA4A 1S2EA 2P3YA 2ZGQA 2W08A 1EYBA 1ZYBA 4QPIA 4XFHA 3U14A 4LBQA 3ACFA 3AXDA 4M4RA 1TEIA 1OPMA 1WCQA 1ZBA3 1YQ8A 4N53A 2YG0A 4FCAA 2WNVB 1S2BA 4BQ1A 4XACA 1DHKB 2PFWA 1YFYA 5CKQA 2W47A 4X6QB 3H7JA 3PHMA 4EZHA 2Q8DA 4MGZE 4CP9A 4Y5TA 3HBKA 1RUH2 3KWVA 1UZ0A 1MS8A 4OMDA 5SV8A 3BU0A 4XJ9A 2ZGNA 1EPZA 1PIV1 2JG8C 4M0NA 4Q4X1 4UW3A 4EROA 1RTVA 2P1BA 1US3A 5LCWL 5J37A 5HXVA 1LEDA 5F9TA 5JLVA 4AE2A 4XDOA 1PIV3 2A3WA 1GZWA 2EAKA 4KNCA 3N36A 3VZNA 2P6HA 1A3KA 1PGW1 1WD3A 2HYXA 2WYFA 3CMGA 1PO11 1VRBA 1ZA7A 4GXLA 5FZ9A 5JR7B 3RYPA 2OQ6A 1TMF2 3MIGA 5F2WA 3UT0A 5FPAA 1RUJ1 4QDSA 1NKGA 2PHXA 1NA1B 1PO13 2QQMA 3IB3A 1WZXA 3LFIA 1JZ6A 4YVSC 4CCEA 4MX3A 2BUKA 3CNAA 1AYN1 3CKHA 3DEMA 1ALYA 1VLNA 2XWBB 5DXDA 2J7MA 3AP5A 4BK4A 3ZPOA 1S0EA 1BVVA 2VU9A 5T5LA 4Q0SA 4OVEA 3NV3A 5FY5A 1OUXA 4LKEA 4CEYC 1AYM2 1Q8SA 5CAZA 4ZS3A 4N43B 3ST7A 3TOJA 4FOYA 4OHWA 2QCSB 5C7GA 5K7PA 3BTYA 1VALA 5BYNA 1G8WA 2ZEZA 4PF1A 3RG0A 1RUC2 1NCQC 4ASKA 2NP0A 2DCYA 1GOGA 1FYUA 3T4HB 1ZNPA 1DQ5A 2MEV3 4BMEA 2DBIA 3WP6A 5EYXA 3J7NA 5FY9A 2BNMA 4YZ1A 5BNOA 3E97A 4Q8KA 2W1QA 3IT8A 4JGZA 3NJYA 4MSVA 2FMDA 1EP0A 1K5MB 1PMHX 4LBMA 4RGAA 3HQUA 4XVHA 5B4XA 5C8WA 4E8DA 1PMIA 1W2NA 4W6YA 5ERLA 4AHZA 3KS7A 1UY1A 3N7MA 1YQ2A 2WN3A 4IEZA 1ZRFA 2P3IA 2ZGTA 1HB3A 3L2YA 4CDUA 1I9RA 3ILFA 2GAUA 2HWF3 1ZBE3 1UOFA 3AVSA 1J83A 4KBZA 4LO8A 1JW6A 5FJKA 4Y22B 5FTTC 3SKJE 4DXSA 1W6QA 1HQNA 1QJX3 1W0PA 4NAOA 2OZJA 2IXIA 2XKPA 3MIDA 1IKQA 4XEZA 1UZYA 3H0OA 5BUVA 1WCDJ 1I1EA 2BRTA 4H2AA 4AEDA 4D7YA 4PI0A 1RVF1 5CZKA 1ULOA 2QDRA 2XOMA 1E5SA 2VCAA 4CEYA 1JI6A 3TNQA 1MZFA 3ZYPA 2JDUA 3LFMA 5FYIA 4YNIA 3WQ7A 1JYCA 3IMMA 4YLZA 1W8OA 3WDWA 5LA0A 1O3TA 2WR9A 2VMEA 4TN7A 2IXLA 3LA2A 1V70A 1LODA 1VBA3 1LNSA 2Y6GA 1TG7A 2AGSA 4AQSA 4R4ZA 4GWNA 3DXUA 4R4XA 3WNLA 2JD4A 4HPKA 2C0ZA 2RS32 1VRH2 4BDVB 2WA3A 1RXGA 4EQVA 5F2SA 1UQXA 2D97A 2YV8A 2YDEA 4K20A 5C3RA 4WVZA 1GBGA 2GNTA 3LDRA 3CHXA 1MZ6A 1RUC1 1DYOA 3ZIXA 5A3TA 5FYZA 2VULA 3LA7A 4CVUA 4RFT0 1XNKA 3AP9A 3TBDA 3WP5A 4Y26A 2DCKA 2V72A 3HAGA 3M3CA 3D3AA 4LUKA 1O3QA 1CAXB 1RITA 3H3LA 2F6BA 1VMFA 2QQWA 1SLCA 4KWLA 3N7KA 1VBD3 1F35A 1AYN3 3JD72 1J1TA 5FYBA 5LWBA 3WG2A 1O5UA 5JSOA 5AC91 3OJBA 3WSOA 1W6MA 2RR11 4BQ4A 5A3UA 2WZR1 4J1WA 4LHNA 2WZEA 4NPRA 1ND2A 3RI8A 2ZHMA 1UX7A 5GLUA 1V6LA 2D6LX 4ES9A 5F5QA 3SH3A 1OPOA 4IEXA 3ROUA 4LLOA 3W20A 4XMIA 2FMYA 1HB1A 5F5AA 1OC1A 4LHSA 5GLZA 5FOBB 2Q0AA 4Q4W2 5C9AC 4FFHA 4Y20B 5JIUA 2HWB3 3BKZA 3N7LA 5KR7A 1CZSA 4DEVA 2ZMKA 4TYSA 1IQAA 3B94A 4AHXA 4H7LA 2ARBA 1PZ7A 2LTNA 4BIFA 4RS5C 1WMFA 5F8PA 1AR62 1HIXA 3OGRA 5KHJA 2ADDA 2JB4A 5LK7B 4PQ9A 4N90A 4KG8A 4HVQA 2ARXA 4XF9A 4AVBA 4L99A 1X82A 2A3YA 3VD3A 1GU3A 1FMD3 3KGLA 5EIYB 4X8NA 3ME2A 4IV3B 3MEPA 5FMBA 2W1WA 3LZZA 2WDBA 3POGA 2ZZJA 1PM7A 3GYDA 2R071 4MGYE 1QJZA 4P00B 4LNVA 4QPGA 5G04L 3I2HA 1I3HA 5LW9A 2BNNA 5KHIA 4YVWB 2G9ZA 4G4FA 4EE2A 4FPLA 4L97A 4WVWA 4XF3A 1QNYA 4QQ2A 2B42B 5IW0A 4FPEA 2WSVA 3FWEA 2ZX2A 1RUE3 2BZDA 4FOQA 4D6SA 4XMAA 2A75A 4CXWA 3PIJA 2D3PA 2Y6LA 3LPGA 1ZX5A 5BNNA 3AMMA 1Y4WA 1C5HA 2W9XA 2WN2A 3N9MA 2VMIA 3K77A 4IE5A 3RZJA 3TN91 1SHWB 3T2TA 4IE0A 4CTEA 2VJXA 4CZSA 5FYYA 3AJYA 2P6CA 5CADA 3WZ1A 1ZZ8A 4LHLA 4TTGA 4E4ZA 1UY4A 3NNJA 3Q8BA 5IAXA 1H9PA 1V9U2 5DUXA 3OY8B 3AKTA 1G7YA 2WINB 3CQOA 4IEWA 4QD2A 2YMZA 1RUG1 5FYTA 3WXPA 1BVP1 3QD6A 4A2UA 4JGYB 4WM8A 3M3IA 1SZBA 5LA1A 3LPFA 1UX6A 1LB2A 3D0SA 2JWPA 3EXUA 3D4KA 1HQLA 3BOPA 4I3GA 4A7ZA 2YBSA 1SLAA 2XKOA 1LGNA 3KSCA 1POV1 3DL3A 3HEIA 2AREA 4MOAA 4FAHA 1ZBE2 3FHIB 1JYXA 3W58A 4HT1T 1AX1A 4DUXA 3O1MA 1FPN2 1R091 3R4UA 3VBUC 5CKMA 1YFXA 2O1QA 4NHLA 2Y6JA 3H3ZA 3TEWA 3GNEA 3JBG1 4FPOB 4XIKA 4BCUA 5E88A 3ZXKA 3NSTA 5DG1A 1RB8G 1QGLA 3K51A 1FMD2 4EJRA 3USUB 1XJAA 1YNAA 3U07A 2J1SA 4FO9A 1RUOA 1YHFA 2VBDA 3LF7A 3ALQA 2RS33 3GBWA 2VM9A 1R081 2P3JA 3K4AA 1COV3 4ISRA 1LTEA 4FQ4A 4YM3A 3NL1A 5ACA1 1D4M3 5FUIA 5FOJB 2ZMNA 1DQ0A 2R7EB 4NHXA 4DRVA 3H7YA 1GICA 1CIWA 1QQP1 3DECA 2D6PA 3KCYA 3NAPA 1LHNA 4GB33 4BZ4A 1F4AA 1NZCA 2DVAA 3FHAA 4RQPA 1JHJA 1SMVA 2PLV3 2XL9A 3IM0A 5FZAA 5IVBA 3ZYIB 3MLJA 4QWNA 3TWIA 3WDTA 4QKFA 2UYAA 2GC3A 1CAVA 4XF1A 1H1AA 3BN6A 3L9JT 4OHXA 4P9IA 5FPLA 1TQ5A 3HIFA 4KU8A 1W03A 4IV3C 5GKAC 2C9AA 1NXMA 1OQ1A 1NUKA 4JGZC 3UV9A 3VBSB 2ATFA 5A3LA 3T0DA 1BEV3 1I6XA 3NKGA 1W28A 3AX4A 4ZU5A 1AF9A 1UMHA 2VUCA 4NHYA 1PO23 4ZU7A 1OFSA 1YWKA 5LZ6A 3VDBA 5LEKA 5JAXA 4EN6B 4KMQA 1ASJ1 1MEC3 2RDRA 2RJ2A 4NVPA 4CDUC 4HLTA 3WDUA 2ZGLA 3HN3A 5FP3A 3C8XA 4CCNA 3HPNA 3J8F3 4LE4A 2RS53 5IFPA 5A32A 5IVJA 1LOEA 2R043 4FTBA 3MW4A 1RYYA 1PVC1 3U4SA 1ZZCA 3CZUA 2C24A 3E5UA 2VPVA 2X8KA 4HANA 1UOJA 3VUOA 1VB4A 5H9QA 5EZWA 4A7KA 5D8AA 1VBE3 2DVBA 2A6ZA 2FDJA 5FMOL 5GLWA 1DYPA 3UKNA 3ZMOA 4CE8A 1JXNA 5CISA 1F9KA 4LITA 3B93A 2XUEA 2WO3A 2ZGKA 5DPNA 5A7PA 5A3MA 4RA0A 1L7RA 5FP8A 1ND3B 1QY4A 1N1YA 1OA3A 4HK9A 4NRMA 2K9ZA 4ZXKA 4UFJA 4CCJA 5C9AA 1RUI1 5KC5A 5BNPB 1CGPA 4XFIA 4QGNA 3VD9A 1W04A 2FZ2A 3DYOA 3MDPA 3GGLA 3R6SA 1C5IA 3WW4A 5K9YA 2AZ5A 2RJKA 2QFEA 3ELNA 4YARA 2QQUA 2EXIA 3PU8A 2QDNA 2HEYF 4FXKB 4GH4A 1B09A 4TLGA 2VZTA 5EP9A 4AI3A 1EV13 2VXJA 4COWA 1W3XA 4D0QA 2JEMA 4BQ5A 5IAVA 3TAYA 3WG1A 5C71A 3ZSEA 1G86A 1ULPA 1MS0A 1S0JA 2Q1FA 4OLLA 4Y33A 5FZMA 1H8TC 3O1VA 1SDDB 2JXAA 4FSJA 5FYVA 1ENRA 1TE1B 2ZEXA 3AXEA 2ZHNA 1PK6B 1D7PM 5F5IA 1AR72 1UWWA 1AXZA 1SQ4A 4DIQA 3OPTA 1IGOA 5KBFA 5C8CB 1DQ6A 4FVVA 3RMXA 1JYIA 2LS6A 1LOAA 4QX5A 4AOCA 4I09A 4QX1A 4BPZA 2R062 2J1EA 3DPRB 1JU3A 4CRQA 4OCTA 1R64A 3MICA 2YB7A 1UIJA 1ND2C 2ZXQA 3ETPA 3A0NA 3ZFFB 5KXDA 1ZBE1 1H8VA 5JI9A 1GZ9A 4LKFA 2XJPA 1CZVA 1RUF3 4QM8A 2XJRA 3RJ2X 5FYMA 4CDXA 4YW2A 2RG4A 1N3OA 1POV3 3ILRA 2WFF2 3WF0A 3AZZA 2VTXJ 3KV4A 1SBDA 2CTVA 3SCHA 5FYCA 1FX5A 1S0CA 4JDOA 3APBA 3PUAA 4K8RB 1IS5A 1UXXX 2D6NA 1COV1 4M01A 3SISA 2XJVA 5BNPC 4LULA 4KGQA 2R072 3MIBA 2C9KA 2ZGRA 4J1XA 3FLTA 4R52A 4Q4Y3 5GZEA 2ZEYA 3OD4A 5L7OA 2YFUA 5AVAA 3U78A 4HOOA 4EN8B 1SLTA 1W8FA 5GM0A 2XBO2 2CAUA 1XSQA 2CYFA 1OQDA 1SEFA 4AAPA 1VBC2 1BK1A 4XZUG 3TEZA 3IN9A 1ENXA 1KDKA 3O1PA 1E5HA 2VQAA 1UOBA 1H2KA 3QBQA 1IOAA 3P5BA 1NCRB 5A7QA 5DDJ1 3KD4A 1E5RA 2N7GA 3HN1A 3D5OA 3HQRA 3LQCA 4MADA 4A7YA 1JZ3A 1DQ1A 1L3JA 3NV2A 1US2A 1WLDA 1N3QA 2RV9A 1R1A3 3C3VA 3N35A 1UU4A 1FOD3 5BXXA 4AVVA 1QJU2 4B3NA 1VBA2 2WAOA 2Z4FA 3VKNA 3ETQA 3I97A 3N9PA 2PHUA 4E2SA 5A6YA 1K45A 4LLFA 5J1XA 4UBHA 3I54A 2ARAA 3TN92 1L7QA 2XONA 5T54A 1CAUA 2YPDA 1OKQA 2Y6FA 1WCKA 3INAA 2RS51 1GOFA 4YVSB 2DUOA 3NAPB 1QOTA 4UW5A 5L9RA 4JV4A 2D44A 4DUWA 4RQPB 1ST8A 3IZOA 3MF9A 3M3EA 4JAAA 4RHV3 2LRPA 4NWWA 4WM8C 4ASMB 2OT7A 3ZYRA 2B7YA 3ZXFA 2QKDA 5T5OA 1PO21 3VD4A 3I49A 4M0HA 2R1DA 1Z78A 2RMU3 4CP2A 2WS92 1Q3EA 2Z79A 1EV11 4IEQA 4ZY9A 2C4XA 1LOFA 5IATA 4EZ4A 5L73A 4DRRA 2J1AA 3LEMA 2AC1A 4CUBA 3HR9A 3NO8A 2RS12 4K3UA 4MGIE 1PGW2 4L11A 4XE9A 3VDAA 4FTEA 1PO12 3NNGA 4C0HA 1HN1A 4M3CB 1JZ4A 3O1TA 2XJQA 5GLTA 5CEHA 4OFGA 1X7NA 1NQDA 3B02A 5GALA 3DKQA 4NPMA 3PUIA 5FXZA 2WT2A 2BGPA 2VZQA 5DUVA 5JZGB 4MHUA 3W9AA 2JD9A 2OIIA 2D40A 4QB6A 5C3SA 4MG2A 1IKPA 1JOJA 2KR2A 2YBKA 1UYXA 1HX6A 5C3OA 2NMNA 1ASJ3 1MEC1 2NQYA 3PDQA 1VBC1 4W6XA 4JDMA 3AVRA 2BTVC 5FK7A 3VZLA 1D2SA 2VE1A 2VMFA 4ZU4A 1AL21 1IQDC 2R041 2XL7A 4B1MA 3E6BA 3VBOB 3R0RA 1O4YA 4JDNA 3IDBB 1PVC3 3RPQA 3ZFGB 4UW4A 1DGRA 2O8OA 3MLKA 3U37A 1OXCA 1F5JA 1W9FA 4S2HA 2VCMA 2YGLA 4L9BA 1DZRA 1OOPC 2JENA 4LE3A 4LHKA 1U12A 3T2PA 4QX8A 2DVDA 2WZR3 4BM8A 2VVDA 2DU0A 3CLPA 1MS3A 3ZSJA 3O12A 1AUYA 3B9CA 4Y24A 2BVBA 5CNAA 1BLZA 1GR3A 5FY7A 4ATFA 2VTXA 1LR5A 4R9DA 2NZ9A 2TBVA 4Y1XA 1MS4A 5FYSA 4DXRA 5FZ7A 3HQXA 4XCBA 1JODA 5T55A 1O59A 2VMHA 1XQNA 4BQ3A 1JUIA 3ZR6A 3OBRA 3OEBA 3FFZA 3WW2A 1V6MA 1QIQA 2Z69A 4PLNA 4E9KA 1ZZ6A 2K0GA 2CWSA 5ANQA 2OKXA 3RS6A 4B29A 2UU8A 2O14A 2WA4A 2XLFA 3OF1A 1ODMA 5JSPA 4C1XA 3C2UA 3I59B 1H2LA 2WFF3 2WQ4A 2E9QA 3GCXA 3I3DA 4UFMA 1M4WA 3LWCA 1VP6A 4MV2A 5G05L 4CP9B 3GJAA 5JXHA 2F4PA 3W5NA 2ZCWA 5DZGA 4QPYA 5CIRA 1GV9A 4B7EA 1O3SA 2BP6A 1RHI2 1YCIA 2XQRA 1IG0A 5JZGC 4YFZA 3CU7A 2YY1A 2HBTA 4Q4Y2 1QJU3 4U2AA 4EWAA 3PVBB 1M06G 5FPVA 4QGMA 3SH5A 3DPRA 3LSEA 2VBPA 3OCPA 4WVVA 4A6SA 5A6XA 3QH6A 5E89A 5E1RA 1OOPA 3Q9OA 4XAAA 4Y5Z0 3ZFFA 4FFFA 1LULA 1GYKA 1G9CA 2BOJA 4DINB 1NYWA 3DN7A 1R083 5KHGA 5K0UA 3ZN6B 2ZABA 1TZOA 1UYYA 5K8SA 4AFAA 2FBEA 2WO7A 1J58A 1RUI2 3VBFB 1ENQA 5EFUA 2PAKA 4AQTA 2QQPA 3VKOA 2W92A 1VBB1 4XXAA 1XNTA 3FBYA 3SKVA 3SLIA 1WBLA 5FQ0A 2JJ6A 3IDCB 3SHRA 1H9WA 3GDBA 3WEZA 3BYWA 4P02B 5I0DA 2HWB2 4AAXA 1SG3A 1JMUB 4QHZA 4DXTA 5EV7A 2RS13 3RGBA 1CPNA 1OD3A 3WX5A 4B8EA 3OPWA 4XZPA 3RZLA 3WF3A 2E7AA 4YW4A 5T52A 4CPBA 1ZVFA 5CFCB 3QH7A 4Z07A 1R1ZA 2TNFA 2WYSA 2JICA 3GM8A 3FJSA 2WQZC 1QNWA 1MQTC 2RMU1 1S55A 2A6YA 1H6XA 4HSLA 1K5MA 2RM22 4K40A 4XILA 5FY4A 1AR92 4RHV2 4Q27A 3T30A 1Q8QA 3AYDA 4KU7A 2Z2SB 5GZFA 4GAZA 1WWYA 4IV1C 1XNCA 3KV9A 4K6BA 4META 4XYXA 2WZPP 3VZKA 3RZKA 4H55A 4PDWB 4CDUB 1V6JA 2VZUA 1N47A 3PUSA 5AFBA 5FYHA 2QQJA 4XFCA 2IXCA 2VUDA 2VNOA 4MLOA 4BLIA 1QH7A 3GXUA 4Q4W1 5JR2A 2ZGPA 4AZZA 1COV2 3J7HA 1RUH3 5FZKA 2WNOA 3FHQA 3DCQA 4CSWA 2RS11 1YJKA 4YVSA 3THTA 4M3CE 1VBE1 3KV5A 4GB32 4LIVA 2D6MA 3MGUA 3GZAA 1RUF2 2RVAA 1OURA 3K2OA 5JOWA 4IESA 3IBMA 4ORFA 3CJIA 1RGSA 3HT1A 2BBAA 4AVSA 5F1RA 2VECA 3PUQA 1D0GA 3A0KA 3D8CA 1XXNA 4AEKA 3KCCA 2GC0A 1YXWA 4KBBA 4ZKTB 1LECA 2ET7A 2DVFA 2YC4A 3AP4A 5IVVA 2JDKA 2DCJA 1BCXA 2VH9A 4C90A 1KRIA 2VOVA 1JZ8A 3ITQA 1J84A 2PHLA 5D1IA 5A1FA 2WNVA 1UZZA 2BYVE 5I8SA 1KFUL 1BKZA 1MQTA 4XTPA 2VCBA 3ZDSA 5JUVA 1OF3A 1SFNA 3J9SA 1XE8A 2Q4SA 3HNMA 4CPBD 5FCCA 3FUOA 1DGLA 4P08A 2FDKA 4IV1A 4P9XA 5A6QA 4AK3A 3QCWA 5FIXA 4GA9A 1QJU1 1AR93 2YU2A 2RR13 4PQQA 3WNMA 2NPIA 4TZDA 2CDPA 1CN1A 3HOBA 1OFNA 1W9SA 3WY6A 3FC0A 4K9SA 2KA3A 1GZWB 3AFKA 3HD8B 1OLME 2PHTA 2VMGA 3MIHA 3OBTA 4FXGB 4R8HA 5LRRA 3B69A 3RZZA 3X29B 3T2OA 2EXKA 2ZJCA 3Q8CA 2HWF2 4XW3A 1LENA 4CDWA 1SLIA 2GALA 4XJ8A 5IJRA 1S2KA 3P3NA 4QKBA 3VBHC 4CCDA 3WCSA 3WT3A 2BERA 4OUSA 1K42A 2X5IA 3MI8A 2WNUB 4ET7A 1OVPA 4XUQA 1UMZA 1X33A 3VD5A 1OUSA 1AR73 1SPPA 1PMJX 1Z7S2 2H0VA 4S2FA 5JXJA 4AFDA 3TYJA 5LY1A 5F39A 3V65A 2OUHA 2RDNA 3OTFA 5A7WA 3I2OA 4OMCA 2GU9A 3JB4C 1RUD2 1WLTA 4Q26A 3A7QA 5FXXA 1QXPA 1QOOA 4PBPA 1O4ZA 5A33A 5I0RA 2W2IA 5KXCA 5FFOC 5JOZA 2PYTA 1W99A 3WNOA 3I2IA 5GZCA 5JDBA 2BOIA 4RR3C 2HBUA 3F95A 4Q4Y1 5CVRA 1X50A 3VBRB 2X09A 2ET1A 4Q4V3 1N3PA 1WCSA 3LSDA 2C6SA 4WV8A 2J1UA 1QJX1 1W2TA 5IYYA 1CONA 4LIUA 2AEZA 1BZWA 3SCGA 5FREA 4MGQA 2BNOA 4Q0QA 4AQ2A 2EIBA 1YFWA 1ULGA 1POV0 2LW8A 2VOTA 1HB2A 3CO2A 3SNMA 1AHSA 3AJZA 3HJRA 4YVWA 1AX0A 3VGIA 4KH9A 1HB4A 1O8PA 3I4IA 3PNAA 2DUPA 4XC9A 1WMXA 2ADEA 2ZKLA 4YGBA 4PF5A 1Q5OA 1Y9GA 2P34A 5C33A 3BOWA 4W8JA 4D6QA 4IE6A 1QWRA 1OOPB 2FQPA 1HDKA 2WNUC 3OGJA 1E5IA 3POWA 1SCRA 3E5QA 3NMBA 2VMCA 3S5AA 2VCCA 4UF0A 5FP4A 3RJRA 4AEDB 4DEQA 4PIZA 3ZFGC 3T4VA 4I0BA 3LOIA 2EIGA 2YPJA 4N7IA 3WNKA 1FOD2 3ZO0B 2B9UA 1W05A 1W6NB 3S30A 3VLBB 4RQPC 1G6NA 1CX1A 3K4DA 2HWD1 3AZWA 5CFDA 5A3OA 3QOPA 2B4KA 4XPVA 5J98B 4UFHA 4Z82A 1C1FA 1YQ6A 3S6PA 5HCFA 4DQAA 3SCFA 4K21A 2CDOA 3K4ZA 4K7JA 3PLQA 5I0SA 3HNYM 4BMBA 4D7SA 3OG2A 5JXGA 5D2AA 1C8M3 4XUNA 1FMD1 4XUPA 2R30A 4LOTA 5IK4A 3UJQA 3ZN4A 4ZXEA 4WM7A 5C5UA 5CG9A 1VMJA 1B35C 5H9RA 5FZLA 1GQHA 4JX0A 3WQ1A 4GKXA 3K3NA 2HWB1 2ZPXA 4I3PA 4KI5M 4E8CA 2BPA2 3VD7A 1NCRC 3ECQA 3MW2A 1AJOA 1RUJ3 1VR3A 1DDLA 4Q4W3 2EALA 1Q56A 4FPCA 4XQDA 3UGFA 3ZMNA 4E4SA 4OI0A 5FMOS 2CAVA 3UJOA 3LIHA 4V2VA 5B2GB 3ASIA 3U4XA 3M4FA 1MS5A 4FT8A 4LO5B 4NJ4A 4MYEA 5I93A 4XFGA 2WC2A 4WZFA 2JDAA 5LA9A 3UETA 5AC93 4XTMA 3CJXA 4ARXA 5CYYA 1UN1A 3H1MA 4QX0A 1SACA 2K46A 1QJEA 3CJIB 5FZ6A 5F7UA 5FUNA 2LM3A 4QAWA 2Q8CA 3W5MA 4Q4X3 4FPGA 1GNHA 4Q1PA 3VDDB 1U5YA 3W21A 2QZ2A 2VVEA 2A5ZA 4XHBA 3S0MA 2JE9A 4HFSA 1QDCA 4Q29A 4YW5A 3VHNA 3ZXDA 1O5LA 3D82A 3T09A 4UYBA 1NX9A 4M4PA 2ZGOA 1JBCA 4MUVA 5GZGA 2XH6A 1UNBA 3ACGA 3OGGA 3DV8A 4KWKA 1VBB3 3T0AA 4QX7A 3LA3A 3MUY1 1VRH3 4LTAA 3I3EA 1PGSA 4AW7A 5FZOB 2HWE1 5IVYA 4QB1A 1NY72 4Y1VA 3CEWA 3HWJA 3IAQA 3UGGA 1RUD1 4QPGB 3HVDA 2P4EA 1JTZX 4GJYA 2JDHA 4QM9A 1Z7S3 1MR5A 2O8QA 1GOHA 1W2AX 4LO6B 2KD7A 1DBNA 1HV1A 4NRQA 2DCTA 4CDWB 4CEWA 1Z7S1 2RJLA 3O7OA 1JYTA 4XBLA 3WF1A 3N9NA 4IGOA 4PJYA 5JMOA 2CSGA 4NRPA 4DNYA
chains in the Genus database with same CATH topology
1PNGA 2VW1A 1PZ9A 4RD7A 1VBB2 4WVMB 3P3PA 3KCXA 1KJLA 5F6KA 3JQXA 4W6WA 1Z0HA 4H7MA 2D6KA 1CD3G 2SLIA 2HWF1 1CR7A 4LO7A 1X36A 4U36A 2VVFA 1WW4A 4BYYA 1WW6A 2NLRA 2GH8A 3PJYA 3PVEA 3AMHA 4MGKE 1F31A 1A6CA 1VIWB 2ZOEB 4DY3A 1K5MC 1R092 2ZACA 1J3QA 2ILMA 3G7DA 1AZDA 3VBRA 3J26N 1NE6A 5H9PA 1NA1C 1FT9A 2PAEA 4HKOA 2Z5WA 1AR63 4OHYA 4AEMA 3CF6E 1VB2A 1UF2C 3AMQA 5CB7A 5DUUA 2ZX3A 3AZVA 2YGMA 4C1WA 3ZX7A 1Q43A 2WFPA 3U10A 5ABJC 4AGVA 1CAWB 1N1TA 3AKQA 2LALA 1GKBA 2DF7A 4B7KA 3MFCA 1WMDA 2D6OX 4HVOA 3V0BA 4BE3A 2VW0A 2QVSB 2CL2A 4LA3A 3OYWA 4LBOA 4H3WA 2WT0A 5KHKA 2DFBA 1C8M1 3LGRA 4FP3A 5CFDC 1S0GA 1QQP2 5L19A 1LHOA 4AF9A 2PLV1 3ZXLA 4E4DX 4OI2A 3WP4A 4W65A 5CFDB 2K2SA 3T1MA 3J8F1 2PHRA 2EA7A 4QMAA 2HJIA 4HBNA 1FPN3 1V6NA 1XYNA 2I07B 1AL22 1JN2P 1YI9A 4JRLA 1HRI1 1TME2 2H6CA 4WM7C 4AFMA 3H1WA 3IIAA 5BNOB 4AQ6A 3JCIA 2GDFA 4JGZB 3VBSC 2D43A 2RE9A 3I7DA 1ZM1A 4WM7B 1GNZA 1NLRA 1NXD1 2VQ0A 4RS5B 5CG8A 2R49A 2JE7A 4LO4B 3FUQA 2AUYA 2V73A 3H8UA 2QNKA 1W6OA 3RI9A 1ENSA 5JSRA 3TB0A 3N4MA 2GNMA 2W0XA 3WDYA 1FV3A 3LCPA 3VZOA 3ZXGA 4QXKA 1WLCA 1NCQB 2WS91 2I2SA 4PBOA 3MF6A 2DVGA 4FOWA 4EWEA 2YROA 4GH4C 4YG3A 1LB2A 2WWSA 4RR3B 3IDEA 1H0BA 2ZAAA 1W6PB 1VAKA 4FPYA 1H2MA 2GNDA 4XBNA 4CEYB 3RWNA 3URFA 2IFWA 4NWVA 2A73B 1H4GA 4I0WB 3VDDA 2R1BA 1GFF2 4GH4B 1RUE2 1MS9A 1QXJA 4N53B 3VBUB 4BLJA 1R093 4M3CA 2IXKA 3ZXAC 1SCSA 4HPKB 1ULCA 1RUNA 1MEC2 3NW4A 2HWE3 2ZTNA 3SITA 3AK0A 3H1YA 4A3XA 4XFAA 4DOUA 1OHFA 1GZCA 4QPIC 3IMNA 2R16A 1S0FA 2AENA 2XPJA 2ENRA 1WBFA 2NYYA 4HKLA 4YFWA 4FPFA 1HRV1 5J36A 2HKXA 4QQPA 3ZFGA 1XE7A 1UPSA 1UU6A 5JI7A 5GJ6A 4R9AA 3MPBA 1FV2A 5GLVA 5D8AC 3ZFFC 4Q1RA 3KGZA 5L7OC 1ND2B 1C8NA 1LRHA 4LT5A 4YGEA 4O9EA 2HWD2 2UWAA 2UY8A 3VDDC 4YVWC 2CWMA 5C8CC 4CDQB 4IQPA 3BODA 3IPVB 5IK8A 4QPGC 4AHWA 3PVNA 3B9IA 2DCZA 3R4SA 3IKWA 5LEJA 1AXKA 4WBBA 3O0XA 4B4PA 3I59A 1GLHA 4QHBA 5ABJB 1OLRA 1XU2A 2TUNA 2GH2A 2CGPA 3NV1A 4N7UA 4MH0E 1NCRA 1XNBA 2AR6A 4FPJA 4AFCA 5KHHA 4JVAA 1QQP3 5DDJ3 2PHWA 3T1LA 3ZYJB 1W39A 1Y7BA 2UWCA 4I01A 1N1SA 5J48A 2D3SA 2WLPA 4X6RB 1GQGA 3MFAA 5J7MA 1HXS1 2WLQA 2W39A 1IZ3A 4EN7B 4IXLA 2BFUS 2Y0IA 1HRI2 1TME1 1CJPA 4YGCA 3MIFA 1DLLA 3WV6A 3VHPA 1D4VB 2H6BA 2CY6A 3FZ3A 1LHVA 3D6EA 4GALA 4MXVA 3WHUA 1UCXA 1UD1A 1WA4A 1RUG2 1EAH3 1QKQA 3ZSMA 3TNPB 1REFA 2DWRA 4JQRA 1FNYA 1ULFA 4FQZA 2R0HA 3KT7A 2HYKA 3V0AB 1YLLA 1KJRA 2VUJA 1WMEA 1VAVA 3JD73 4AEDC 1PVC2 3WW1A 1S0BA 1QU0A 3WLUA 2ES3A 4AI8A 3WP3A 1ZREA 1G9BA 1S0DA 4S2GA 5AVPA 3ZFEA 4GMP3 1RUG3 3VHOA 4DZGA 1DIWA 1AL0G 5FRAA 1PGL2 3NWKA 3J8F2 4L8QA 1VRH1 4MVTA 4P9LA 5HBAA 5IK5A 3WVJA 1YI7A 3R4DB 3USUA 1LGCA 4OULA 5FDBA 2BBVA 1BBT3 4IEPA 2MHFA 3W59A 1W6OB 1CAXA 1RUD3 1RUE1 4CP1A 5TSWA 1HKDA 4YM2A 1OQEA 1RUF1 1BXHA 5FPZA 2DYCA 2XWJB 1CVNA 4HETA 1IHMA 4DPNA 5I8TA 1VBD2 2XJTA 5C4WC 3BALA 2CGOA 2PHDA 4HVRA 3VBHA 4NO4A 5T50A 2PA7A 2PN5A 4XBQA 1AX2A 1LU2A 3JB8A 3WHTA 3EBRA 1ONAA 4HN0A 1AR81 4D7TA 4IEYA 5J09A 4Q0PA 1F8VA 2ZGSA 3RSJA 3B3QE 4LBNA 1O7FA 3VBSA 2BVVA 4BOWA 4AVCA 4PCRA 1C28A 1WW5A 3GBGA 2DFCA 4B4QA 5FLIA 2MEV1 5JMCA 1HRV2 3UKTA 3VN4A 3FX3A 2HWC2 2VUAA 3AZXA 1PIV2 2HWD3 3FE5A 3JUUA 4NR1A 4R9BA 5LRSA 1DZTA 4NHMA 5L36A 3AYEA 2ZKNA 4FP2A 3NKTA 2CGNA 2XVKA 4YZ4A 2KXLA 1XYPA 5T3NA 1PHMA 2VNGA 2GMPA 1OSGA 1MZEA 1VBE2 4BH9A 1TMF3 2UURA 2XVGA 3ZN6A 2QUOA 2DTYA 4PLMA 4I0AA 1FXZA 1QJY1 4PIYA 2XJUA 1UIKA 3O0VA 2ZX4A 3POSA 4L2NA 1EAH2 1SLBA 2E7QA 3LOBA 5HCBA 3ZIWA 4Z2WA 4FOVA 5EWSA 1LU1A 1VBD1 2BW8A 2GN7A 4F7ZA 3GALA 1YJLA 4JGYA 2A3XA 1Y43B 1GSLA 4WM8B 3WG3A 1R1A2 2DV9A 5HCAA 4GWMA 1KDMA 1Q8PA 4AVTA 1VBA1 2Q1ZB 1EY2A 1AXYA 2D5HA 5BNOC 3O5SA 1X8EA 5CFCA 1SBEA 4XQWA 1DU3D 4S2DA 4ASLA 3R05A 1QF3A 1YO8A 2WNVC 2JDZA 1DQ2A 1LJ7A 1FATA 2R6QA 4DY5A 1PK6A 4FTSA 1LHWA 3V64A 1UW8A 1OI6A 4XDQA 2HEWF 1FNZA 2GMEA 5C8CA 4PDWA 4HL0A 4YZ5A 1LGBA 4AGGA 2HWC1 4XJWA 3GHMA 5EYYA 1TME3 1FOD1 2NN8A 5T5JA 2WS93 4YM1A 3VBRC 1XU1A 3CJIC 2G9FA 1EV12 1NA1A 4HKWA 4PLOA 4P9JA 4NN0A 1BMV1 4EN0A 2GNBA 2XHKA 4CDXB 5ACA2 3RRDA 1V00A 1PNFA 1R082 1ULDA 1YYNA 1TNRA 4V1PA 2WIIB 1DGWX 2G4IA 1U0AA 1E57A 3VKFC 4DFSA 1ZZ7A 4FPKA 3BIWE 3DKWA 2VG9A 2ZGUA 2OW4A 5GZDA 5CBLA 4AHYA 1BBT2 2JECA 2XUMA 1H30A 1PZ8A 2P2KA 3GZUC 4HK8A 4ATEA 2IZWA 1UPIA 1LHUA 1MQTB 2YXSA 4IEOA 4CDWC 1HXS3 2WL1A 1UAIA 1HW5A 3VKMA 1A8MA 3S7EA 4MXWB 3KT1A 2JG9C 3ZFEB 3ZN5A 2XB6C 3FFQA 4QGLA 4FBFA 1MACA 3AKSA 5KWRA 1QHDA 2GC1A 1A8DA 3HMYA 5H9SA 2YZ4A 2ZBJA 2QE3A 3KQRA 3AMNA 1HQWA 3VHRA 4N9HA 4AYUA 5DG2A 3PTYA 1O4TA 1SFYA 1H8TB 3ATGA 5KC6A 1W6QB 5D8AB 2JX9A 1HRV3 3MW3A 2XJSA 3QLQA 2X5IB 2PQQA 3THPA 2WNUA 1S0IA 4IERA 3DUIA 1JHNA 3ES1A 2A70A 4AEJA 1G9FA 1FI2A 1RVF2 3BCWA 4P9YA 4M3CF 4P9GA 1QMJA 3HT2A 1G9AA 3UK9A 4YSFA 4QPIB 4OHZA 5A33B 1PGL1 2IXJA 4COZA 4OZXA 1BEV1 5BNNC 2E53A 1AVBA 3AP7A 3H3UA 2BWCA 4NHKA 4Q4V1 3PMSA 1QJX2 3M3QA 2TEPA 5E8AA 3JZVA 1OMIA 4I2OA 1NE4A 1RJ7A 4CP0A 4OI4A 3JQWA 4XHXA 4COYA 4OUMA 5FBZA 4EWDA 2LUWA 1NLSA 1KXGA 3K48A 5AFEA 1ZBA1 1DFQA 1AR71 1RMU3 2XVLA 2R0FA 2DTWA 1R1A1 2E51A 1D4M1 4CEWB 4E2QA 4FAGA 1SDWA 1AR83 3RYRA 3AM2A 2P37A 2ERFA 4LBQD 4F83A 2D5FA 1H2NA 2H0BA 3ES4A 1H1IA 1WGPA 1YIFA 2AYHA 4AFBA 5FPXA 5K0UC 4H14A 3D0JA 1LOBA 3EHKA 1RVF3 4IEVA 5JOYA 3SXWA 3M2MA 1FAYA 2ZA9A 1RUC3 2V5YA 4Y20A 1B35A 5EXOA 2DUQA 2Q5TA 2B46X 1IS4A 2IC1A 4YRDA 3RNSA 3NAPC 3WDVA 4K1ZA 3FMGA 2VY0A 2HWC3 1JUHA 1RHI1 2BEOA 3BB6A 3M8LA 2XGXA 2RS31 2IXHA 1ULEA 3NJZA 1DF0A 2VOKA 1HRI3 4KWJA 1RHI3 2ZGMA 4JRAA 1PVXA 4UW6A 1CJDA 1DGRN 4BIOA 1RMU2 2A6XA 4PIXA 3WW3A 3ZSKA 3RDIA 1AL23 1X8MA 2P3KA 2QJVA 3TN93 4XQ4A 5I0TA 5K0UB 1KFXL 2E7TA 4IETA 3VL9A 1V9U1 1YFUA 4GULA 4Z1VA 1QDOA 4BA6A 4JGYC 3GZTB 3BPZA 2C1FA 4IEUA 2R061 5EJ3A 4Y1ZA 4QQHA 3M70A 3B5LB 1HLCA 2UY9A 1TMF1 1V6OA 2GN3A 4P14A 2G9GA 2A7AA 2C5DA 1XRUA 2OUJA 4KG0A 1MZ5A 2Y26A 1QJY3 2XBO3 5KXEA 4AI1A 4GQ7A 3VBOC 2RM23 3JU9A 4BHPA 1NY71 2VXRA 4YZ3A 4MXWA 5KXBA 3MLLA 4UXAA 4COUA 1LOFC 1VAMA 4WZCA 2XLAA 2E6VA 3JBG2 1RIRA 5C6CA 4O9GA 1H8TA 1RINA 1WLWA 2EXHA 1QJY2 2ZZQA 5HI0A 4F8AA 4GMP0 3ZYGA 5LK5A 4YGDA 4RR3A 3ZVXA 3VKLA 2VGDA 1QXRA 1XNDA 5J3UA 4GB31 2VOXA 1AJKA 5IK7A 2V09A 2GZWA 5AC92 3USSA 2FHRA 3EO6A 4AWDA 3WNXA 2WNEA 2XLGA 4Z8BA 4DXZA 4AG4A 3MIEA 4CDXC 1REEA 3KMHA 1S1AA 3S7IA 1PK6C 3E6CC 3M3OA 1RL3A 3AKRA 1XYOA 2WT1A 4XF0A 1VJ2A 1D4M2 3M7AA 4LEJA 2VNRA 2KM2A 3EQEA 3AKPA 3CL1A 4IV1B 2RMU2 4IV3A 5JCTA 4XFBA 1NOVA 3J4UH 4AI2A 1DYKA 4XFFA 5BNQA 2VOWA 1OA2A 3WQ0A 1V6KA 4INDA 3UKVA 1LOCA 4FPHA 1IS3A 3I8TA 5IUQA 5CFCC 4R9CA 2B45X 3AP6A 1ZRDA 4C91A 2EAAA 4SBVA 5BNNB 3E5XA 3VBFA 3WUCA 3WD5A 1LCLA 1ND3A 1BQPA 2HEVF 4XOGA 2PLV2 5BNPA 5FO8B 2R042 3OY8A 4PDWC 1SLLA 1DGWA 4YW1A 3VV1A 4YM0A 5FQ0B 1Q8OA 3OPZA 1APNA 1F2NA 1UKRA 1WD4A 3JD71 5DZFA 4COVA 1B35B 3H9AA 3IPVA 1IPKA 3MZHA 5F6LB 1VBC3 1NQJA 1BYHA 3ACLA 1BJQA 1RMU1 4B4RA 3VZMA 3ILNA 1ZRRA 4YZ2A 1W2UA 1OD5A 1N1VA 1WW7A 2UWBA 3AB0A 1SBFA 3B00A 1ZZ9A 4K1YA 1AR91 4P5HA 1KS4A 3VL8A 3WR0A 4E2GA 3M1HA 2D93A 2OZ6A 3LKJA 4HMZA 4AVAA 4QQLA 1D0HA 1UL9A 3NVCA 5DZEA 2YYOA 1KITA 1YUDA 4G9SB 2JG9B 3KT4A 1QOSA 3ZFEC 5CU1A 4RHV1 3DF0A 1CPMA 3KM5A 3VZJA 4L92A 1D2QA 1RJ8A 2PTMA 4ITCA 1NG0A 4LUMA 4YG6A 2ETEA 4SLIA 5I0UA 3U11A 3VBFC 3BU7A 1AR61 1H4HA 2A6WA 4RL7A 1NCQA 4G3YC 2CV6A 4N53C 2ZHLA 2ZX1A 3MPPG 1W6PA 2PHFA 4DB5A 2NM1A 3N3HA 3RYKA 1LOGA 2Y38A 4KQ7A 3V56A 1W6NA 2A6VA 4ONUA 2E63A 5T5PA 1CQ9A 3B7MA 2CNAA 3FBMA 1CAVB 3V0AA 4I30A 3A4UA 2ZMLA 4XJZA 4LBJA 5JPNB 1ZA4A 3VBUA 3N7JA 3ZXEA 5FO7B 2PELA 1REDA 4Q0UA 4XIOA 1ZBA2 4RSUA 2WKKA 1HXS2 2XBO1 1GANA 3LAGA 4AGRA 4ISQA 3I2DA 4D94A 1YRZA 5A32B 1ZZBA 4Y1YA 3WINE 1UKGA 2ZS6B 4JC1A 2QZ3A 3OD0A 3AMPA 2BWAA 4JTOA 4TWTA 2JG8A 2I74A 3KLSA 1QH6A 4YW3A 1C3HA 4QT6A 4BWOA 3AFGA 2NMOA 5JOXA 2JKBA 1CAUB 2IWGB 1KQRA 1PO22 3HBZA 3VBHB 3ZXJA 5FO9B 5C4WB 1UU5A 2WFF1 5C9AB 1C1LA 2O0OA 2RS52 3H50A 3RQ0A 3GBFA 5FLJA 5JPMB 3WOGA 4CDQA 1RUJ2 2Q8OA 2EVXA 3SMHA 4LBQB 4YYOA 4MZUA 1AYN2 1CX4A 2GC2A 2PAMA 2P17A 4OHVA 4Q0VA 5ABJA 4CEWC 2W68A 1URXA 1LEMA 5CA6A 1U5XA 4HSJA 3PVOA 5ACA3 2MNGA 2AH2A 5BV6A 2Q30A 1U5IA 4J6GA 4GIQA 2YUEA 3NV4A 3PMEA 1F5FA 5J96B 4LA2A 4UBGA 4Z92B 1W0OA 2B8MA 2B39A 1RUH1 1Q8VA 1LKNA 1AR82 4Q2FA 1ND3C 2YHJA 1C57A 2BQPA 1EPWA 1RC6A 3B01A 4TSVA 4WVMA 1MS1A 4JCKA 1O91A 2GSYA 1J3PA 1IS6A 4XXPA 3EJKA 3KZ4C 1A78A 3LB9A 1TNFA 4CDQC 2GMMA 3WCRA 2RR12 4XF4A 4EV0A 1C4RA 4KGGA 2R32A 2ZX0A 5FLHA 3UL2A 4N43A 4ES8A 3BTAA 2A71A 1J3RA 1H1MA 1LESA 2VW2A 2X5IC 4XJAA 3RMYA 5L7OB 3SH4A 3WG4A 2IFRA 2SBAA 2RHPA 1WUVA 3O14A 5I91A 3DGTA 1FPN1 1IPJA 4HN1A 1KS5A 3G6JB 4CYDA 3QACA 2RM21 4URTA 1U5ZA 2OVUA 3WUDA 4HZFA 4TLFA 4DMIA 1KD7A 1V9U3 2I45A 4QQOA 1OLQA 2JG9A 3AZYA 1AYM1 1MVQA 5FAXA 2ZAHA 2R073 4QU2A 5DDJ2 1Y3TA 1AYM3 1BBT1 2YC0A 4D69A 3IWZA 4LBLA 4Y22A 1CAWA 3L2HA 4P9WA 4Q8LA 3ZPYA 3V0BB 4Q4V2 3WDXA 3GF6A 4E27A 3OYWB 2EXJA 1MVEA 2OA2A 1JH5A 1DZQA 2DURA 2B5HA 3DPRC 2WZR2 4N43C 4AXOA 1CESA 4LBKA 2Z42A 2OYZA 5SV5A 3FLPA 2BGCA 3MYXA 2WSUA 2ZHKA 3JBG3 4OI1A 3AYCA 2R063 3POYA 4XETA 5IT6A 4I02A 5E16A 2D98A 4Q4X2 1J59A 3U0ZA 3TRSB 4EN9B 1V6IA 3E6DA 2MEV2 4KL1A 4LR4A 4YG0A 5JWPA 4K8FA 3GHNA 1I5ZA 5BY5A 4D3WA 2HWE2 1DG6A 4Y4YA 4NOTA 1ASJ2 3AYAA 5JZGA 4RS5A 3O0WA 3PJQA 2BFUL 2MPFA 5JIAA 2FZ1A 2X53S 2D7FA 2X29A 1T6GC 2W52A 4DS0A 2Y0OA 4M00A 4JTNA 4XJUA 5BPXA 5JVVA 3ENRA 4GKYA 3FLRA 2D3RA 2JG8B 4Y1UA 4AI0A 5DUWA 3VBOA 5I8YA 1C8M2 1DQ4A 4IL7A 1ZRCA 2DU1A 3KB5A 4GMP1 4N9IA 1G9DA 1W6MB 4RGGA 4C0BA 2UYBA 1EAH1 1BEV2 1RUI3 5C4WA 4X8PA 2OPKA 1HV0A 2WJSA 2Q1MA 2EF6A 1Y9QA 1J1LA 1YIPA 2XG3A 1OA4A 2ZGQA 2W08A 1EYBA 1ZYBA 4QPIA 4XFHA 4LBQA 3AXDA 1TEIA 1OPMA 1ZBA3 4N53A 4FCAA 2WNVB 1S2BA 4BQ1A 1DHKB 2PFWA 1YFYA 4X6QB 3H7JA 3PHMA 4MGZE 1RUH2 1MS8A 5SV8A 4XJ9A 2ZGNA 1EPZA 1PIV1 2JG8C 4M0NA 4Q4X1 4UW3A 4EROA 1RTVA 5J37A 5HXVA 1LEDA 5F9TA 5JLVA 4AE2A 1PIV3 2A3WA 1GZWA 2EAKA 4KNCA 3N36A 3VZNA 1A3KA 1PGW1 1WD3A 3ZSLA 1PO11 3RYPA 4GXLA 5JR7B 1TMF2 3MIGA 1RUJ1 2PHXA 1NA1B 1PO13 4YVSC 4MX3A 2BUKA 3CNAA 1AYN1 1ALYA 1VLNA 2XWBB 5DXDA 3AP5A 1S0EA 1BVVA 2VU9A 5T5LA 4Q0SA 4OVEA 3NV3A 4CEYC 1AYM2 1Q8SA 5CAZA 3TOJA 4N43B 3ST7A 4FOYA 4OHWA 2QCSB 5K7PA 1VALA 5BYNA 1G8WA 3RG0A 1RUC2 1NCQC 2NP0A 2DCYA 1FYUA 1ZNPA 1DQ5A 2MEV3 4BMEA 3WP6A 5EYXA 2BNMA 4YZ1A 5BNOA 3E97A 4Q8KA 3IT8A 4JGZA 4MSVA 2FMDA 1EP0A 1K5MB 4LBMA 4RGAA 5C8WA 1PMIA 4W6YA 4AHZA 3KS7A 3N7MA 1ZRFA 4IEZA 2P3IA 2ZGTA 3L2YA 4CDUA 1I9RA 3ILFA 2GAUA 2HWF3 1ZBE3 4LO8A 1JW6A 4Y22B 5FTTC 1W6QA 1HQNA 1QJX3 1W0PA 2OZJA 2IXIA