4WM8C

Crystal structure of human enterovirus d68
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
247
structure length
247
Chain Sequence
b'GVPTYLLPGSGQFLTTDDHSSAPVLPCFNPTPEMHIPGQIRNMLEMIQVESMMEINNTDGANGMERLRVDISVQADLDQLLFNIPLDIQLDGPLRNTLVGNISRYYTHWSGSLEMTFMFCGSFMATGKLILCYTPPGGSCPTTRETAMLGTHIVWDFGLQSSITLIIPWISGSHYRMFNSDAKSTNANVGYVTCFMQTNLIVPSESSDTCSLIGFIAAKDDFSLRLMRDSPDIGQSNHLHGAEAAYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP1
publication title Virus structure. Structure and inhibition of EV-D68, a virus that causes respiratory illness in children.
pubmed doi rcsb
molecule tags Virus
total genus 40
structure length 247
sequence length 247
ec nomenclature
pdb deposition date 2014-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4wm8C00
4CDQC 4FSJA 1HRI3 1TME2 1AR72 1K5MB 2XBO2 1HRI1 4JGYA 4CEWC 1FPN2 3VBFB 4CDUA 5CFDA 3VBSB 1ND3A 5C9AA 1RUG1 1BEV2 2RM22 1B35C 4QPGA 4N43C 1PO22 1ZBA3 4IV1C 5ABJC 1ZBA1 4IV3A 1V9U3 4WM7A 1M06G 5AC92 3VBOA 1FOD3 5J98B 5CFCB 4QPIA 1V9U1 4WM8A 1ASJ2 1FOD1 1PVC3 3DPRA 2ZTNA 1PVC1 1SMVA 2HWB2 2PLV3 1R092 2PLV1 2BPA2 4CDWC 5C4WB 1NCQB 1QJX3 3VBUB 4RHV3 1QJX1 4GMP0 1DDLA 1RUI2 1FMD2 4RHV1 4WM7C 2MEV3 3NAPB 1TMF2 4Q4V3 1ND2B 1RVF2 4Y4YA 2MEV1 1BBT3 4Q4V1 1TME3 1AR73 1QQP2 1BBT1 1RUD2 1OOPA 2XBO3 1AR93 4Q4Y3 1TME1 1AR71 5JZGC 4YVSA 2XBO1 4Q4Y1 1AR91 1AL23 3VBRB 4GB32 4CDQB 1AL21 2HWF2 1K5MA 5ACA3 4RS5C 5L7OA 5ACA1 2R042 3VBFA 5BNPC 5C8CA 2Y26A 1NY72 3ZFEA 1OPOA 4IV1B 1AYN2 1E57A 1X33A 5ABJB 5BNNA 3ZFFB 1AL0G 3LOBA 1BMV2 3TN92 1NG0A 1FMD3 3VBSC 1VBC2 1AYM2 1RVF3 4CDWB 1NCQA 2BFUL 5A32A 1NCRB 2HWC2 2RMU2 1POV3 3VDDB 4Z92B 3VBUA 3ZFGB 1POV1 2RS33 1GFF2 1RUH3 5CFCC 2RS31 3NAPA 1RUH1 2HWF3 1VBD2 1HXS2 2HWF1 3VBRA 5C4WC 1EV12 4CDQA 1NOVA 2BFUS 1VBE2 4RQPB 1PO13 1ZBE2 1PO11 1RUF2 4RS5B 4Q4X3 1D4M2 4CEWA 5BNOB 5BNPB 1ND2C 4Q4X1 4Q4W2 1EAH3 1RUJ3 2R072 4CDXB 1EAH1 1RUJ1 1COV2 1HX6A 1B35A 1VB2A 1PGL1 2IZWA 4N43A 3TN93 4IV1A 1VBC3 5ABJA 1RUC2 3TN91 4RR3B 2BUKA 1QJY2 1VBC1 1VBA2 2HWC3 1Z7S2 3ZFFA 1AR82 2HWC1 1R082 3JB8A 1MQTB 3JBG2 4CDWA 1RUE3 1VBD3 4EJRA 1VRH3 1RUE1 1VBD1 3M8LA 1VRH1 5J96B 1IHMA 2WS93 5DDJ2 3ZFFC 2WS91 4N53B 2QQPA 1ZBE3 5JZGA 1D4M3 1ZBE1 2HWD3 1D4M1 3CJIB 4GH4C 2WWSA 2HWD1 1NCRC 1R1A3 2R073 3VDDC 4JGZB 3ZFGC 1R1A1 4RS5A 1C8M2 5BNPA 3VBHC 1RUC3 4CDXA 3IDEA 1FPN3 1Z7S3 1FPN1 1AUYA 4RQPC 4AEDB 1QJU2 1BEV3 2RM23 5D8AB 2WFF2 3JBG3 1BEV1 2RM21 5BNOC 3JBG1 3HAGA 1PO23 1NA1C 1PO21 3VBSA 4CDXC 4RFT0 5FOJB 5AC93 2X5IB 1ASJ3 5FMOL 1X36A 5AC91 1ASJ1 5K0UB 2HWB3 4RR3C 1R093 1CJDA 2HWB1 4Y5Z0 5CFCA 2HWE2 1R091 1HRV2 1MEC2 1RUI3 1RUI1 1MQTC 1FMD1 1C8M3 1TMF3 4GH4B 3CJIA 4PDWB 5C4WA 1C8M1 1TMF1 1RVF1 1QQP3 1RUD3 1QQP1 1RUD1 2WLPA 4GB33 1ND2A 4JGYB 4CEYB 1F8VA 4GB31 3VBHB 4N53C 1ND3B 2R043 5C9AB 2ZAHA 3CJIC 2R041 1PGW2 4QPGB 4JGZC 4FTSA 5A33B 4FTEA 1RUG2 3ZXAC 4IV3B 1WCDJ 1NY71 1AYN3 2RR12 4WM8B 1NA1B 1AYN1 5LK7B 2X5IA 1RB8G 1HRV3 1V9U2 1FOD2 5K0UA 1BMV1 1HRV1 2WZR2 1AYM3 4AEDC 1PVC2 4NWVA 5D8AC 1AYM1 4YVWC 2PLV2 2RMU3 2RMU1 1RHI2 4GMP3 1POV0 2X5IC 4GMP1 1H8TB 3JB4C 4GH4A 4PDWA 2R062 1NCRA 3VDDA 1HXS3 5K0UC 2MEV2 3ZFGA 4Q4V2 1HXS1 1BBT2 1EV13 4Q4Y2 1AR92 4CEYA 5L7OB 1VBE3 1EV11 3VBHA 1PGW1 1AL22 1VBE1 1RUF3 2VQ0A 1RUG3 5C8CB 1RUF1 4Q4W3 1OHFA 4PDWC 2RR13 5ACA2 4Q4W1 2RR11 4RQPA 3ZFEB 1COV3 2R071 5A33A 1COV1 4BCUA 5BNOA 4JGYC 4CEYC 5BNNB 2WZR3 1NA1A 4FTBA 1QJY3 2WZR1 4CDUC 1RUC1 5CFDC 1C8NA 1ND3C 1QJY1 2GSYA 1VBA3 5C9AC 3S6PA 1AR83 4SBVA 1VBA1 1RHI3 1R083 1A6CA 1Z7S1 4QPGC 1AR81 1RMU2 5A32B 1RHI1 1R081 4RR3A 4IV3C 4YVWB 2GH8A 2R063 3VBOC 4QPIC 4WM8C 2R061 3DPRC 2RS52 1MQTA 2TBVA 1H8TA 5DDJ3 2RS32 2RS12 1RUH2 5DDJ1 2FZ1A 1PIV2 5GKAC 2XPJA 4CEWB 1AR62 3JD72 4N53A 1QJZA 1H8TC 1PO12 1OOPC 1CD3G 5FMOS 1B35B 4YVSC 4Q4X2 4JGZA 4N43B 1EAH2 1RUJ2 1VBB2 1K5MC 1PGL2 5L7OC 1RMU3 3J8F2 3VBFC 1QJU3 1VB4A 1RMU1 2WFF3 4CDUB 1QJU1 1W39A 5CFDB 5C8CC 2WFF1 1HRI2 2BBVA 3ZFEC 4AEDA 2RS53 5D8AA 2RS51 2RS13 4WM7B 4YVWA 3VBOB 1VAKA 2RS11 4QPIB 5BNNC 1RUE2 3DPRB 1VRH2 4LLFA 1PIV3 1ZBA2 2HWE3 1PIV1 5JZGB 2HWE1 1AR63 2FZ2A 1MEC3 3JD73 1NCQC 1AR61 2WS92 1MEC1 3JD71 2DF7A 3VBUC 3FBMA 2ZZQA 3NAPC 2HWD2 1VBB3 1QJX2 1R1A2 1F2NA 4RHV2 1VBB1 1OOPB 4NWWA 1HQNA 4YVSB 3J8F3 3VBRC 3J8F1
chains in the Genus database with same CATH superfamily
2VC9A 4FSJA 2GMEA 3ACIA 2F4LA 2QTWB 5CAZA 2MPFA 2NQYA 1DQ0A 1DQ1A 3JZVA 2XL9A 3F2ZA 4M3CE 4QX7A 4CEWC 1O8PA 5FYYA 4LBMA 1Q8QA 1STMA 1LAJA 3W9AA 5FFOC 5CFDA 1ND3A 3CZUA 4XJAA 2WQ8A 4UFIA 1RUG1 4UW5A 3MI8A 2XL7A 3DUIA 1U5ZA 3T0DA 3ACLA 5FV3A 4M01A 2YU1A 1D2QA 5JXHA 3NV2A 3P3PA 1H2LA 5LATA 3FBYA 4K1YA 4XUPA 4FBFA 1M06G 2XG3A 5CFCB 5J98B 4WM8A 4Q0VA 3ES4A 2QQUA 2F6BA 4DB5A 3BU0A 3QH6A 5DZFA 5FZHA 5H9RA 4QGLA 2KXLA 1DP0A 1SMVA 2PLV3 1LEMA 3LIHA 4YG6A 2CGOA 1R092 4LO4B 4Y33A 4DY5A 2PLV1 1JZ7A 2QCSB 4UWDA 2EIGA 1QJX3 5F9TA 3VBUB 1QJX1 1FMD2 1CJPA 4AI1A 3THDA 4WZFA 4HMZA 4INDA 2B4KA 5BYNA 5JAXA 2W1QA 3QACA 1BBT3 3WVJA 3ZYGA 1J3QA 2A6YA 4JTNA 5E16A 4YRDA 1BBT1 4A41A 5A3LA 3T0BA 3R6SA 4QM9A 3DECA 3WD5A 1QY4A 2WBKA 3AZWA 4W6YA 4YVSA 5JPMB 1SCRA 3VBRB 1LODA 1T6BX 4ZU5A 5A7SA 2P17A 4XAEA 4R4ZA 1X50A 4D7SA 3CLPA 2HWF2 4JQTA 5KHJA 2ZX4A 1NT0A 3NV1A 5A3WA 1K5MA 1XC6A 4GXLA 4KWKA 3WP6A 3WW4A 1W03A 3T2PA 4D6RA 2J1VA 3WF4A 4XBNA 1MS3A 3PJQA 4UF0B 5FCCA 3LAGA 2OUHA 2Y26A 4LBQD 3VKMA 2FDHA 3PVNA 5GZGA 2G19A 1NXMA 2FCTA 5FZFA 1OPOA 1K12A 4AGGA 4IV1B 3DF0A 1AYN2 1CAWB 4CP9A 5ABJB 3IDBB 4XJUA 5GZFA 2E51A 2ZEXA 3QLQA 5T5LA 3C7OA 3RWKX 3NO8A 5BNNA 2ENRA 4K40A 4ORFA 4YG0A 4JX0A 5A3OA 3WG2A 1W3XA 3ON7A 5LASA 1FMD3 2OPKA 3PIJA 4NO4A 4XJ8A 1VBC2 3BOPA 1AYM2 1QEXA 1G7YA 2X29A 4MGSA 1UY3A 1ZRIA 1NCQA 2WT1A 4DFSA 4CXYA 2OVUA 1NCRB 3THPA 3VDDB 3NQHA 5CKQA 3HNYM 3WX5A 3ZFGB 2ZEZA 1BQPA 1KFUL 4V2VA 1E5IA 2ZX0A 4Q26A 1GFF2 3I2IA 3RZKA 5JOWA 4QQPA 3ALQA 3Q8AA 2HWF3 2DVAA 5CZKA 5FYZA 5KHHA 1D0GA 1H0BA 2WYFA 1JZ8A 1NE4A 2HWF1 3ZKYA 3WNMA 3ATGA 1I9RA 1TVGA 1KS5A 1UX6A 2D40A 3MF9A 1B09A 3BIEA 1V6IA 3AX4A 4RQPB 5IAVA 3Q8FA 3VUOA 3RZJA 2XWBB 1ZBE2 3WHTA 3MBWA 3ZXLA 4HANA 4CEWA 3OF1A 2P34A 3MUY1 3WQ1A 3RYKA 4LULA 2WT2A 3POIA 1H2NA 2QKDA 3AVSA 4MH0E 4PIZA 4QX2A 2R072 2XVKA 3WNXA 2YZ4A 4ASKA 4CDXB 5K8SA 5FXVA 4AQ6A 4AXOA 4I09A 2QQNA 3OEAA 5A3NA 1XNTA 4ATEA 1CAUA 3D8CA 4UBHA 4UYBA 5EZWA 1CVNA 1Y9QA 1SFYA 3M4FA 5FYBA 1VBC3 3GZAA 2ZGTA 4RR3B 1W8NA 2BUKA 1QJY2 3OB8A 1VBC1 2QQVA 2YC2A 1AX1A 3OUHA 4YZ4A 4CP1A 1GP5A 2RDRA 3NNJA 3INAA 5HV0A 4CTEA 2GMPA 4XYXA 4ZU4A 4HVOA 4P9WA 3WNKA 2XJQA 1RYYA 1HB4A 2XMLA 5K9YA 4BQWA 2QZ3A 3LPGA 3JBG2 3N9MA 4FOWA 5I0TA 1RUE3 2DYCA 3VKLA 1W6NB 1RUE1 1BK0A 3M8LA 4OHYA 1XYNA 3N9LA 3I54A 1JYIA 3WP5A 5F5CA 4COUA 3PIGA 5FQ0B 3AB0A 5FBZA 5CIRA 3ZFFC 3LDKA 5F5QA 2ZX2A 1OVPA 2QQPA 3SLIA 4BXSV 3OUJA 1ZBE3 2E31A 4QGNA 5BNQA 2IXLA 1LHVA 4PI0A 5LY2A 1X9PA 3AMMA 1ZBE1 3ZIXA 4XUNA 4YZ1A 2VOXA 3RMYA 4A45A 1SLAA 5C5UA 1VMHA 4NHXA 2R073 4NHYA 1SLCA 4R52A 3KCYA 5H9SA 2D3RA 1JI6A 4XXAA 2W91A 1O4YA 2YFZA 3I3QA 3JUUA 2PHXA 2V5DA 4HXCA 3VLBB 3JCIA 4CCEA 3WUCA 3WEZA 2ETEA 5JIUA 2ZHKA 2JIGA 2BGCA 3VBHC 2VBBA 4E4DX 3B5LB 4LBQB 4QXKA 5LA1A 3VZOA 1Q3EA 2W94A 4PIXA 1NQJA 2V4VA 2GP3A 3E97A 5IATA 5A6ZA 3BTAA 4EN8B 1Y9GA 3JXSA 3OD4A 2RM23 4YPJA 3ILNA 3JBG3 5CKMA 1L7QA 1JYCA 2RM21 4M00A 3JBG1 3OYWA 2VZSA 1PO23 3U07A 1GP6A 5F6KA 1NA1C 2JXAA 5GJ6A 1PO21 2A75A 2GNBA 4QPWA 1CWPA 1YQ2A 4KL1A 4RFT0 5AC93 1RUNA 5A7PA 3ELNA 1JZ6A 1X36A 3ECQA 5AC91 2CL2A 1HW5A 1YFXA 5A6YA 1W05A 1JOPA 1H2MA 3PU8A 3WSOA 2UY9A 4OVEA 5B4NA 2VR4A 1W0OA 2E9QA 3W5MA 3CO2A 3LPFA 4LBKA 4Y5Z0 2W1UA 1N1TA 2XVGA 3USUB 4UFLA 4FPJA 5FZCA 1BVP1 2Z2SB 3I59B 1XQNA 5FZ7A 5EJ1B 5FZAA 2D98A 1OMIA 2VZUA 4HZFA 1DZTA 3B7MA 1CONA 1ODNA 2VZVA 1TMF3 1YIFA 5KXBA 1C57A 1WMFA 4XPVA 3W58A 3ZYIB 3CJIA 5DXDA 5IFPA 1TMF1 2QQWA 3UV9A 4ATFA 1QQP3 1YQ8A 3KF5A 2YYOA 2WIIB 1QXRA 3UYJA 1QQP1 5IHRA 1K45A 5EP9A 4M3CF 2ADDA 4I01A 1NKGA 2ARBA 3AKPA 3RDIA 5FZ1A 5FWEA 2K9ZA 1F8VA 1UIKA 1WUVA 5FUPA 2C4XA 1OLMA 2OIIA 1UXZA 1LOFC 4Y5SA 3LGRA 3U14A 2R043 4LO7A 3ZN6A 5C9AB 2ZAHA 4FT8A 4CCCA 1HDKA 2R041 2J42A 3RNSA 2QJVA 2BZDA 1LGCA 1QDOA 2VMDA 3RZHA 2VTXA 2QQKA 3WXPA 1JUIA 3KCXA 5GLUA 1YLLA 2YPDA 3ZXAC 4IV3B 1KRIA 1WCDJ 4X6RB 3CMGA 5FZ8A 3WV6A 1NY71 1SFNA 5EWSA 1O5LA 5E88A 1J3PA 1T6GC 2XGXA 1RTVA 1S0JA 2BQPA 4DPNA 2WNUB 1V9U2 1HN1A 2B8MA 4IDZA 5IW0A 2NMNA 3GHMA 3MICA 2VCAA 1S0IA 3NL1A 4M3CA 4AEDC 1UAIA 3PUAA 4CU6A 5I93A 1MPXA 3VKFC 1UPSA 2PQSA 4FVVA 1XNDA 4O7XA 1G6NA 1UY1A 3V0BB 3GM8A 1KDMA 2K2SA 2RMU3 4UFJA 4IE5A 5C71A 3AZXA 4XCBA 3ZSMA 5KHGA 2RMU1 3SEPA 4GMP3 2O0OA 2ZGRA 4JDOA 2A70A 4QXHA 1ZZ6A 2X5IC 4GMP1 5FZOB 3ZVXA 2D97A 4RYDA 5I0DA 3LSEA 2NN8A 3JB4C 3Q8CA 2Z4FA 3OBTA 3V0AA 5GZDA 1CR7A 1HXS3 2BNOA 2WJSA 2MEV2 5K0UC 4XDPA 3CL1A 1V0AA 1W04A 1HXS1 3O1VA 2ILMA 5FPUA 4QD2A 1C3HA 2C0ZA 4QHBA 4DUXA 1C1LA 2DUOA 2XJTA 4QB2A 2WT0A 4AEMA 4Q4Y2 1AR92 3TYJA 5L7OB 3WQBA 5A6XA 4GD4A 3VBHA 2W1SA 1DG6A 1Y7BA 5I8TA 1RUF3 5DQ0A 1GV9A 1QGLA 2FDIA 4UI9L 1RUF1 2BRTA 4Q4W3 4ASMB 4PDWC 4IEQA 5LY1A 4IQPA 3AZVA 4Q4W1 3H3UA 3U10A 1H1IA 1HKDA 1COV3 3PVEA 5A33A 3NMBA 1COV1 3RQ0A 2CTVA 2VMGA 4FXGB 4BCUA 5FPLA 4BQYA 1HN0A 3WCSA 4C0HA 4JGYC 1Q8OA 4CEYC 1ZRCA 1NA1A 4YSFA 4FTBA 4PJYA 4WVWA 2V4AA 3I3BA 1T2XA 2WSUA 4IEWA 1GANA 1ZX5A 3FHAA 2JG9C 2BWAA 4BLJA 2IXJA 5FO9B 3S6PA 3K4ZA 4QXBA 3MLJA 3IDAA 1A6CA 1ZZ7A 3C7EA 3DV8A 1RMU2 4QPGC 4RA0A 1ZNPA 3PHMA 4S2GA 3TAYA 1CZSA 1O7FA 4XF9A 3AC0A 3N7KA 3MUZ1 4UW6A 3OGRA 3R4UA 4MVTA 3RG0A 5HBAA 4AI0A 3E5UA 1JU4A 4QPIC 1OD5A 4IL7A 5D1IA 4IE7A 3AMPA 4OQ8A 3DPRC 3Q8BA 3V56A 1H8TA 2ZGPA 3GF6A 3PTRB 1DLLA 4XF4A 1OD3A 4FAHA 3CJXA 1ULGA 1RGSA 3O1PA 1UU5A 3I3DA 4XJ9A 1F15A 2DUQA 3SMHA 5HV4A 2ORZA 1XU2A 1XXNA 3LEGA 1ZRRA 3N9QA 3D82A 4BISA 2ARAA 2ZGLA 4OLLA 4XILA 2CAUA 2QDRA 2XJRA 3TNPB 3P6BA 2DURA 4IUGA 1I5PA 1YFUA 3VZKA 4TLGA 3JD72 3ZM8A 2P2KA 4D0QA 4CXWA 5FZIA 5FIXA 1LOFA 2R16A 2QUOA 2BGOA 4OFGA 1CAXB 1YYNA 1A78A 3M2MA 1NLSA 2GH2A 3N35A 3UJOA 1W6PA 1YRZA 2PHLA 1QJEA 3OGJA 4HKLA 2UYBA 4N43B 1RUJ2 1YJKA 3CU7A 3VD5A 5LRSA 3WCRA 2VY0A 1UYZA 4JHZA 2PELA 1RMU3 2XB6C 3J8F2 5F37A 5LA2A 1UYPA 4Q0SA 1RMU1 3EB7A 1D0HA 3NSTA 1DQ2A 4CDUB 2FDKA 2ES3A 3J4UH 5AFEA 1FATA 5FLJA 2CWMA 5G04L 1OQEA 2IC1A 1VLNA 5FYCA 3T4HB 3PMEA 3ZFEC 4J1XA 4AEDA 1S1AA 2VVFA 2DBIA 2AEYA 3FN9A 3PURA 3WG4A 2ZKNA 5FP4A 4JCKA 2WR9A 2VTFA 3VBOB 1MS1A 3I2FA 4R9CA 3PLQA 4H55A 3NKGA 4NRPA 3C2UA 5IYYA 2B46X 1VRH2 3WQ0A 1ZBA2 2WA3A 4FPGA 4QQOA 4I0WB 3SC7X 1FNZA 2G4IA 3FFQA 5JZGB 2D3SA 1W8HA 4XFCA 5ANQA 3R4SA 1XNKA 1PZ8A 3JD73 2JE9A 1DU3D 4W4ZA 1IS3A 3AJYA 1KQRA 3JD71 2JDAA 1OUSA 1XPWA 3VBUC 4HL0A 4NROA 3WDXA 4DS0A 3J7NA 2JDYA 2PA7A 2ZEWA 1KJLA 2ZMNA 2Z79A 4L8QA 3UKVA 3H8XA 4B4PA 1XU1A 5FP9A 2J1RA 3ABZA 2ZGQA 3LF7A 2ORXA 4L99A 2D6PA 4OHVA 1LOEA 2QZ2A 4XDQA 4EWEA 1R1A2 1F2NA 4M0NA 4RHV2 2RJ2A 2V09A 5FTTC 3AP7A 4DINB 5FO8B 3HQRA 1WA6X 2FHRA 3H8UA 1ZA4A 3KMHA 5IFTA 3J8F3 5FUIA 1YIPA 4XFBA 3VBRC 1WW7A 2WAOA 3J8F1 1WD4A 4ZZ5A 5L9BA 3BPSA 2WO1A 1YI9A 4BQ1A 3ZXJA 1TME2 4A3XA 2XBO2 4EE2A 1JZ3A 4JGYA 1FV3A 5CADA 4BYYA 3I7DA 3VBFB 1XYOA 5F6LB 4W8JA 4NVPA 1CAVB 2J1TA 3MIHA 1C5HA 1LOAA 2E7AA 2JG9A 1O91A 4HONA 4JHTA 3WUDA 4PF1A 4D3WA 1B35C 4WVMB 3MDPA 1URXA 3FX3A 3IPVA 4COVA 1RITA 4LA2A 4QPGA 3S30A 5D2AA 4E8CA 4FP2A 1ZBA3 4IV1C 3PMSA 1REDA 1YHFA 1CZVA 3MV01 4GZ9A 2GNMA 4W50A 1ZBA1 3NNFA 4WM7A 1GR3A 2AZ5A 1NLQA 4XFGA 3D6EA 3ACHA 4GJYA 4E8DA 3T2QA 4QPIA 4XUTA 1ASJ2 3DYOA 1MS8A 1GNZA 3DEMA 4YW2A 5TSWA 3DPRA 5FXZA 1YNAA 3BI3A 1DF0A 4CA9A 3JQXA 3ZPOA 3RZZA 4AE2A 2YBKA 3HT1A 1WW5A 3B01A 3HIFA 2XJSA 4AQ2A 5EQUA 2OUJA 5DUUA 3KVAA 1JTZX 4D6QA 4GKYA 2AH2A 1VP6A 4RHV3 1N3PA 2JICA 4IESA 4S2DA 1GOHA 5EJ3A 5FZGA 4RHV1 2Y60A 2UY8A 4XFAA 2ZX1A 3GZEA 4TTGA 1TG7A 4AR2A 4C1WA 5IVVA 1SEFA 1WLWA 3WDVA 1X9TA 2W52A 3ES1A 5C3OA 4TN7A 1YFWA 1XYPA 1TME3 5A7WB 5FJKA 3WNLA 1NYWA 4ASLA 4I02A 2XBO3 1TME1 1BVVA 4Y1ZA 2ZACA 4Y1UA 4ET7A 1G9AA 2XBO1 5EPAA 4GB32 2RDNA 1W2UA 3KM5A 4V1PA 5T54A 2ZEYA 1SG3A 2JB4A 2VOTA 5DAVA 2OT7A 3A0KA 4E27A 5ACA3 2ID4A 3D0JA 3ILFA 1GZTA 5ERLA 5ACA1 3J7LA 4Y22B 5AVAA 2R0HA 4XAAA 4BU2A 3K75B 4NIDA 4E4ZA 2D6MA 2VOVA 1WBLA 3S7IA 1F5FA 1LEDA 1OVSA 3T08A 3ZXGA 3ZYRA 3B02A 1PHMA 2JEMA 1H1AA 2GC1A 1OPMA 1SBEA 4P9YA 4FAGA 2VTXJ 5JLVA 3T3YA 2WQZC 3KGLA 3ZFEA 1S0GA 4XXPA 3WNPA 1KDKA 3RJRA 2YUEA 1R1ZA 4FOYA 1ODMA 1BCXA 2EICA 3R4DB 1WCSA 1Y4WA 1WW4A 1PMIA 1GBGA 1UZVA 3LWCA 4P9GA 3ORJA 1AL0G 3W20A 1BMV2 2AYHA 4CUCA 4Z2WA 3TN92 1NG0A 1LGNA 3VBSC 4Y5TA 5J7MA 3BTXA 2GU9A 2X10A 3LFMA 1JMUB 4LORA 4Q0QA 5EHDA 3BTYA 2JDZA 1ZZ9A 1O4TA 1PVXA 1BYHA 1QNYA 2QQJA 1R64A 2XLAA 2HWC2 2EXIA 1POV3 4MGIE 3AP4A 5FRAA 3VBUA 1LNSA 4B3NA 4CUBA 5LEJA 2JDNA 1POV1 1ULOA 2RS33 4K21A 2VULA 1RUH3 1PNGA 2RS31 2EIBA 3LKJA 4LUKA 2CGPA 1V70A 1GSLA 1RUH1 4P02B 2WDBA 2PHTA 1J84A 1VBD2 2UWBA 4YW7A 4HK8A 4L0PA 4XACA 1YCIA 2DCZA 3N7JA 4Q8KA 3GJBA 1WBFA 3NWKA 4R4XA 2AACA 5JSRA 1Q8PA 4HPKB 2ZMKA 5F3IA 3VBRA 5C4WC 3ZIWA 1A3KA 1EV12 1O59A 2NM1A 1IS5A 4IEUA 1ZYBA 2BFUS 2PAEA 4G9SB 4LE3A 1AXZA 1H6XA 1H4GA 4S2HA 3KHCA 1C1FA 3J7MA 1MZFA 4XHXA 3I2GA 1D4M2 4JKMA 2V5YA 2VZ1A 5BNOB 4FPOB 1W28A 2VZRA 1ND2C 3OTFA 5APAA 1EAH3 4UF0A 4D94A 1O5UA 4QT6A 1EAH1 5LBEA 2WZ8A 5C3RA 4WBBA 4F7ZA 1ENQA 4YARA 4LKEA 2A7AA 1NQDA 1YQ5A 3AKQA 1B35A 4PLOA 1UW8A 4V2WA 3H3LA 2IVJA 2HJIA 3RZLA 3TN93 1LRHA 1UL9A 4I0AA 4IV1A 2A6WA 3S5AA 4HVQA 4HK9A 5ABJA 2Y8KA 4UXAA 3TN91 5KC6A 1FXZA 4ZHNA 4G4FA 3VKNA 1CPNA 1WLTA 4P9JA 1VBA2 1G9FA 2HWC3 3QCWA 1LCLA 3LQCA 4DOUA 1DQ5A 1AR82 4RD7A 4A3ZA 4AVTA 4JAAA 2HWC1 3ZSLA 1R082 3KS7A 3ZN4A 3MO4A 3FMGA 3JB8A 3KT7A 3OUIA 2BU9A 1BHGA 1UU6A 1NAEA 1F5JA 5FP8A 4DRRA 3MYXA 1VBD3 1SCSA 2WSVA 2GALA 3R0RA 4B4RA 5A70A 5IT6A 2Y6KA 3N36A 1VBD1 1QU0A 4AK3A 2WO3A 5J96B 3OG2A 4Z07A 1VJ2A 3ITQA 3BGAA 3IAPA 2WS93 4HSJA 5DDJ2 3E6DA 1V6KA 4UFKA 5I0RA 2WS91 3IIAA 4N53B 4PBOA 1CQ9A 2VQTA 3WF3A 2J7MA 4XQ4A 4FPEA 4YZ2A 4XMAA 5FMBA 1D4M3 1UO9A 5FO7B 5I8YA 5FJHA 1D4M1 1KXGA 5IVYA 2WWSA 2VBPA 1H6YA 3KGZA 1RINA 1Y9MA 2OS2A 1WLCA 2XLGA 3G6JB 4ISRA 3ZN5A 5FZKA 3ZX7A 1APNA 5DABA 2WABA 4IETA 4ISQA 1Q43A 2RJKA 2O8OA 3CQOA 3N3HA 1C8M2 3QD6A 4Z82A 3THTA 3ZSJA 5FY7A 3HD8B 4WVZA 1J58A 2DFCA 1YJLA 2J1EA 4A4AA 5HCBA 2YHJA 4K1ZA 4MGQA 4R9AA 5FZDA 4CDXA 1JYTA 1QOTA 3NJYA 3KV9A 4UT5A 4YW4A 1BK1A 2Z42A 4Q1RA 3MW4A 5FR3A 4AI2A 4NIGA 2GDFA 4QAWA 2A3WA 1IZ3A 4PIYA 2OPWA 4AI9A 1ULDA 1U5IA 1QJU2 5FY5A 2QE3A 2JWPA 3I2DA 5D8AB 3AYDA 2W87A 4RGAA 5FYUA 4QPYA 4CSWA 5C70A 5JMOA 1LB2A 2P3YA 3HAGA 2X53S 1BKZA 1DQ4A 4NRMA 1OFNA 3VBSA 3DGTA 3T30A 1GNHA 1QIQA 1OXCA 4K7JA 5CKNA 1W6OB 3LSDA 5I91A 2ZHMA 4QHOA 2CY6A 2DCTA 4JKKA 4QQLA 1MS4A 5GLZA 4TSVA 1GQHA 4EN0A 5A6QA 1UZZA 3KB5A 4MSVA 1N1SA 2D6OX 4FP3A 4Y20B 5KC5A 2EALA 1IQDC 1R093 1CJDA 1A8DA 1F9KA 1W8FA 2HH9A 2RG4A 4IEVA 3RS6A 4E4SA 3RSJA 1R091 5FQ0A 1UWWA 4JZRA 3RVHA 4PI2A 3S5QA 1MEC2 1UZYA 3LD8A 4MXWA 4KH9A 2Q8OA 1DZQA 1GOFA 3LEKA 2YPJA 5FMDA 1MQTC 1FMD1 5ANNA 1C8M3 5KWRA 4GH4B 4K8RB 1ALYA 5C4WA 1C8M1 4LHNA 1HB3A 2X09A 2ZCWA 2O8QA 3GGLA 2B42B 1UPIA 4EN6B 2V72A 1H2KA 3LCPA 5FZLA 3T1MA 4A6SA 3JQWA 1ND2A 2ET7A 4KG0A 4AI3A 3CF6E 4Y4RA 1KJRA 1JYNA 3VDAA 2Q0AA 2VXJA 2AUYA 4EZ4A 4LBLA 4LBQA 3H3ZA 2ZKLA 3IZOA 1ND3B 5H9PA 4CCDA 4QU2A 3CJIC 1QH7A 3M3CA 1PGW2 3POYA 2OXBA 2MHFA 4JGZC 3RI9A 4AWDA 1OH4A 2D93A 5T3NA 1C28A 1Y43B 4RFRB 4GALA 2BP6A 4IEZA 4FTEA 3AMQA 2VNOA 4XZUG 2BNNA 2JECA 4YGDA 2W08A 5F3EA 1AYN3 4WM8B 4OHZA 1OI6A 3T4VA 4CCJA 1AYN1 4UAPA 5JSPA 3SITA 1YEWA 4CU7A 5IK4A 1F31A 4PLMA 1UMIA 3CBNA 3LB9A 2XUEA 1FYUA 1RB8G 3KZ4C 2Q1ZB 3PU3A 1FOD2 1W9TA 3FL7A 3MIEA 1UOFA 4N9HA 1YO8A 2WZR2 1AYM3 2VQAA 1PVC2 4MLOA 4NPLA 4DXZA 4NWVA 4NUBA 1AYM1 3GCXA 5FPZA 5A3PA 3T0AA 1ZZBA 3BN6A 2DTYA 5KHKA 1HQLA 2OX0A 2PHDA 2RHPA 3DL3A 4BMBA 4JDMA 5KHIA 1QDCA 1JHJA 5IK7A 5DUWA 3USSA 5FY1A 5FOBB 4CPBD 1WW6A 2WFPA 1AXKA 2XXZA 3O1OA 4Q4V2 2UURA 3IAQA 2VMHA 1ONAA 3OY8B 4CXXA 2A3YA 4XF0A 5DUVA 4F83A 4Y1XA 1PGW1 4KWJA 3PNAA 1AL22 3J26N 4XOGA 4WVVA 3PTYA 3CIHA 4I30A 3NJZA 1LESA 2VQ0A 1W8WA 5JOZA 3HN3A 4L9BA 3UKTA 1H4HA 1OHFA 4L2NA 2HBUA 2D5HA 4Y26A 1J3RA 4LTAA 2C9KA 4KGQA 4KNCA 2XOMA 1E5RA 2R071 4W65A 2OA2A 3VN4A 2VU9A 4M0HA 4LOTA 5BNNB 1MZ6A 2WN2A 2YB7A 2YBSA 3P3NA 3PUIA 2WZR3 4DQAA 4J1WA 4QKDA 4BQ5A 4YM2A 1QJY3 2ZBJA 2WZR1 1DYOA 2C6SA 4CDUC 5M0TA 1C8NA 1Q5OA 1QJY1 2VVEA 5FYTA 2I07B 1LHOA 4CCMA 4XETA 3H7JA 1GICA 2BVBA 4XFFA 1U12A 4NHKA 3WNOA 4Q27A 4GIQA 1IGOA 4URTA 4YVWB 2JIJA 4X6QB 5A7NA 1W8OA 3VBOC 2ZABA 2DWRA 4AQTA 4BDVB 5GZCA 4DEQA 1XNCA 1ZVFA 3UETA 2RS52 1MQTA 5FZOA 4QDRA 5L9VA 2TBVA 3AYAA 1SZBA 2QVSB 3EYPA 2WAAA 3AFGA 4LIVA 4P5YA 4PQQA 2W47A 1BZWA 2WNVC 4ZS3A 1I1EA 4LK6A 3NW4A 4MOAA 3HNMA 1ULEA 1YWKA 3TNQA 2ZOEB 5HCAA 3U4XA 1PIV2 5GLTA 5BPXA 1MVQA 5C3PA 2XPJA 4CEWB 1TQ5A 4B29A 2H6BA 3BALA 1JZ4A 1LECA 5FXXA 1XJAA 1QJZA 3FJSA 3UGGA 1KGYA 1AX2A 4BQ2A 4EROA 2YDEA 1H8TC 1PO12 3O0XA 3A4UA 5FMOS 1ULCA 2W0XA 3HBKA 4XURA 4Q4X2 2YFUA 4JGZA 1JOJA 1CAUB 1S4CA 2WZPP 3MEPA 4H3WA 3WNNA 4LBOA 5F1RA 4BHPA 3A0NA 2GNDA 1E5HA 5IWFA 5DAXA 4MHRA 3AP5A 1LJ7A 3ZYPA 3I97A 2GC0A 3OEBA 4CP0A 1PGL2 3AL5A 1H30A 4GKXA 3VBFC 2BWCA 4A2UA 4IEYA 4AI8A 1VB4A 5J09A 1W39A 1VMJA 2OQ6A 2NYYA 3PVBB 4AFAA 1SQ4A 5C8CC 2C9AA 1LGBA 3GHNA 2C26A 4LKFA 4E2GA 3L2YA 2DUPA 3DN7A 4DZGA 4WV8A 2QDNA 2RS53 3RYRA 3VZNA 3Q8EA 5IVJA 2RS51 4P9LA 4BQ4A 4DO0A 3O0WA 4IGPA 4XBLA 4BLIA 4KI5M 3BVCA 1ULPA 1PIV3 5GLVA 2YC4A 2VQUA 3B9CA 3ACGA 3V65A 5DZEA 1PIV1 4BH9A 3TOJA 2FZ2A 2XONA 5IVBA 4L11A 2ZGSA 2FQPA 1Q56A 3A7QA 2DF7A 4HKOA 2DU1A 4ZONA 1J1LA 3WR0A 4X8PA 3O1SA 3WG3A 1W8ZA 2X8KA 2I74A 3FHIB 1DGRA 2HWD2 3LFIA 2SLIA 2VMIA 2VJXA 2IXCA 3BIWE 3RPQA 1C4RA 1WMDA 5HI0A 3POJA 2ZMLA 2XLFA 4KQ7A 4LJHA 4BPZA 5JPNB 1OOPB 2ZS6B 4XFIA 1OBNA 4AAXA 2VD7A 4FFFA 2VCBA 3I2HA 3SEEA 4YM0A 1DGWA 1AR72 2P5BA 4MYEA 1G9BA 3AFKA 3MLLA 3KV4A 4HETA 2EXJA 2GMMA 4LBJA 1FPN2 4AFMA 2E7QA 3ZOIA 3IWZA 2G1MA 2G9GA 2PTMA 4CDUA 1N1VA 3NRUA 4AHYA 2B9VA 1BEV2 1FV2A 3LIGA 4DXSA 3H1MA 1IKQA 3LEIA 4Z1VA 4UW3A 2VZOA 1VE0A 5H9QA 3AP6A 2VNVA 4CCNA 2E63A 4J25A 3DKWA 1DQ6A 4NN0A 2Q4SA 2ZHLA 1V9U3 2FBEA 4P5HA 5D21A 2PAMA 3VBOA 4XF1A 1V9U1 1WZXA 4FFGA 1GLHA 3T1LA 3PDQA 3AVRA 1OLRA 5F3GA 4GWMA 4NIAA 2VPVA 4FPCA 3SISA 1PM4A 2HWB2 4MZUA 3B69A 1U0AA 5E89A 5FLHA 4LNVA 2LW8A 2WNVA 4AGVA 2WUHA 2PXJA 4OCTA 3CHXA 4KMQA 4NE9A 3ZYFA 3UNPA 5HCHA 1PM7A 4GMP0 1JS9A 1RUI2 1YI7A 4WM7C 2JD4A 4IE0A 1DGRN 3BTZA 2MEV3 3NAPB 1XSRA 1WGPA 2JJ6A 2P3IA 2VUJA 3HR9A 1RVF2 4Q0UA 4QB6A 4UOJA 1EUTA 1PK6B 2MEV1 3GNEA 5T52A 4CRQA 4AFCA 2GAUA 1AR73 1GOGA 1RUD2 2DTWA 2J1AA 2VVDA 3HNBM 3BUCA 4Q4Y3 1AR93 1AR71 4A7ZA 3ZYBA 4Q4Y1 1AR91 1PMJX 3BODA 2TEPA 5FREA 2CNAA 4CDQB 4LQRA 3UGHA 3H42B 1GYKA 2VZTA 3RRDA 1WKYA 1JYXA 1KITA 2FMDA 2J1UA 3A22A 1GP4A 4JRAA 3ZKUA 3VBFA 4DIQA 4UW4A 4YW6A 4LBNA 2P4EA 3SKJE 2YC0A 4AVCA 1DZRA 3MIDA 1W6MB 3KHBA 4BE3A 2YBPA 5C8CA 4AW7A 4N7UA 4AOCA 3BYWA 3KF3A 3RJ2X 1EPWA 2O1QA 3KQRA 4QWNA 3WP4A 3VL8A 2ZHNA 2YXSA 5DAWA 3N9OA 5C7GA 1SLTA 1L7RA 1UX7A 2CU5A 3WW2A 1HV1A 3NVCA 1GZWA 1E57A 2BGPA 2XR4A 1X33A 2JB8A 2H0BA 5HXVA 1NXD1 1LOGA 3ROUA 4TZDA 1W2TA 2GC3A 1YXWA 3OD0A 4XF3A 4AZZA 3ZFFB 1W8UA 4PF5A 3E5QA 2YROA 5F32A 4FPFA 3W5NA 5EYYA 2VW0A 4OI4A 3WLUA 2IFWA 4B1MA 1REEA 5HPOA 1RVF3 4CDWB 3V0AB 1S2BA 5A32A 3FFZA 1L3JA 2C5DA 3RFRA 5CG8A 5EXOA 4H2AA 2YGMA 1CPMA 1NLRA 3K51A 3KLSA 3C7HA 1HB1A 5CFCC 2YV8A 4CVUA 4XW3A 2PQQA 3WZ1A 4OQ9A 1MS9A 5ISLA 4PT6A 2YY1A 3ETPA 3AKTA 1XE7A 3OBRA 3NNLA 2QFEA 2VUAA 3K3NA 4JTOA 5CYYA 4BMEA 4QU1A 1NOVA 4ZKTB 3FUQA 1VBE2 4A42A 2Y34A 3I4IA 4FPKA 2D44A 4RS5B 2JDHA 1VR3A 4QKBA 4Y22A 1OQ1A 5ABJC 5JR7B 1U5YA 5BNPB 1RUJ3 3O1RA 3K2OA 4LIUA 4XIOA 1RUJ1 3AK0A 1DIWA 2JDKA 3OGGA 3LA2A 1HX6A 4JDNA 4LUMA 4CYDA 2EA7A 2FD8A 2WN3A 4YZ5A 5FK7A 3AXEA 3BB6A 4E4HA 3SNMA 5J3UA 2BERA 1QH6A 5A3TA 1RUOA 1S0CA 3EQEA 1QF3A 2W92A 1VAMA 1RUC2 3HN1A 1QHDA 4ZPIA 1RJ8A 2WA4A 2ZAAA 4FPHA 4LOSA 1IQAA 4L92A 1SBFA 1SPPB 1Z7S2 5DG1A 1A8MA 4XUOA 4RGKA 1H9PA 4H7LA 5K4LA 1G8WA 3VD7A 5FMCA 5FKCA 1MS0A 5LRRA 1E5SA 1DYKA 1VRH3 5FZ0A 4EJRA 3FUOA 1UMHA 4LO8A 4MHUA 5LB6A 1VRH1 5FP3A 1IHMA 1CN1A 3TEXA 2HYKA 2OZ6A 1UCXA 2VGDA 1S0FA 3ZYJB 2R32A 3PJYA 2Y64A 2BNMA 2YMZA 2HEVF 1DGWX 3PL0A 4LO6B 3FLRA 4AVBA 2NPIA 1G9DA 3A21A 4HOOA 1ZM1A 4HPKA 3NJXA 4GH4C 4XTPA 3CDZB 3K4AA 1NCRC 1R1A3 4U2AA 3VDDC 5F3CA 5KXDA 2VNGA 3ZFGC 2HEWF 1R1A1 2R1DA 4YFZA 5C6CA 5G05L 2R7EB 5FYMA 3PUSA 2VMEA 2A6VA 5KXEA 1QMJA 1KD7A 1EY2A 4H14A 1UMZA 2R49A 1S0BA 1IG3A 2YG0A 3SH5A 3MPPG 4FOVA 1RUC3 3VZLA 1IOAA 2CV6A 2P37A 3ZPYA 2BYVE 1W6QA 3AZZA 3OBZA 4E9KA 2CDOA 1LHWA 1MACA 3MW2A 1OFSA 1AJKA 1Z7S3 2BV4A 1OSGA 2Q5TA 2WO2A 3E1F1 1LKNA 3QBQA 3ZXEA 1U5XA 5EJZB 4E2SA 5GZEA 5DZGA 4PCRA 4RQPC 2Q1MA 1MZ5A 4AEDB 5CEHA 1UF2C 5FWJA 1KS4A 4CU8A 2DBNA 2EIDA 2WFF2 1QXJA 1UOBA 5A1FA 1JYVA 2I2SA 5KR7A 1D7PM 3G7DA 1ZRFA 1AHSA 2EAAA 5FBJA 3WG1A 1JW6A 1UN1A 2DDUA 4ZS2A 2JDUA 4CDXC 3AYCA 2AREA 2Q30A 4PLNA 1SLLA 2X5IB 5CVRA 3KCCA 4COYA 1ASJ3 2ZA9A 4META 4Y1VA 2ERFA 5FMOL 3WQ7A 1YFYA 2VO5A 3IMMA 1ASJ1 2DU0A 3QOPA 4PBPA 2WLQA 5K0UB 3B9IA 2AC1A 3O1UA 3KT4A 4RR3C 4KU7A 5CFCA 1SLBA 1CX4A 2ADEA 2CWSA 2HWE2 2OQ7A 3POFA 4RSUA 1HRV2 3HPNA 4BQ3A 2LALA 5I8SA 3FZ3A 1L7LA 2WNEA 2G9FA 4YW3A 3U4SA 4B7KA 3TEZA 3MF6A 3MIBA 4N9IA 2Y0OA 4XBQA 1NZIA 5LEKA 2TUNA 4PDWB 3WDYA 2R30A 1OC1A 4LHLA 4P14A 2RV9A 1WCQA 1N3QA 4MO3M 4XCAA 1I6XA 4YYOA 1REFA 2E33A 3MFCA 4GB33 5I0UA 1LULA 3MGUA 3I3MA 4JGYB 4BK4A 4CEYB 4GB31 4CUGA 1XE8A 1W2NA 2A5ZA 3MFAA 4YM1A 4C0BA 4OMDA 1RC6A 4OUMA 4XIKA 2JG8B 2Y0IA 2IXIA 4QPGB 3OGSA 4X8NA 4FTSA 2PHWA 3MHZA 4LEJA 4KBBA 4A44A 1LENA 5KBFA 1RUG2 1ENXA 4MADA 4AVVA 3EJKA 1QJFA 2W95A 3NV3A 4HN1A 4P9XA 3TB0A 5K7PA 3OBAA 2RR12 1ULFA 3TWIA 4AG4A 3H8RA 3T2OA 4I0BA 3IN9A 2FDGA 2ZJCA 1PX4A 5LK7B 4C1XA 2AGSA 2UU8A 4AFDA 4M4PA 1W6OA 3DCQA 4LMFA 4CCOA 5CNAA 4HT1T 5FDBA 1HRV3 3ACFA 3LEMA 4TLFA 3AM2A 3SKVA 1OLME 4BIFA 1OT5A 3GCWA 4MXVA 4Q29A 1BMV1 1HRV1 4XZPA 4YM3A 1CAWA 4Y20A 3GBFA 2VMFA 2TNFA 2V73A 3CNAA 3DYPA 2QQIA 4YVWC 5FYSA 1JBCA 5JXIA 1W9FA 1TNFA 2PLV2 5F39A 4GWIA 3BCWA 1RHI2 5F2SA 1POV0 1F4AA 5E1RA 1LOBA 2VW2A 1J83A 1V6NA 3KVBA 1GQPA 4Q0PA 5JWPA 4GH4A 3EMRA 1NCRA 3VDDA 4WZCA 1DBNA 2B45X 5EV7A 3ZFGA 5E6HA 3CZJA 4FCAA 1DCSA 2Y6HA 1BBT2 2KD7A 5JIAA 1WMXA 1JH5A 3AZYA 5L9RA 1EV13 1GWMA 3AXDA 1TEIA 2QNKA 4LLOA 1VALA 1EV11 4OI2A 1SFPA 4LA3A 4UBGA 3SXWA 1ZREA 2PFWA 4N90A 4XQDA 3NV4A 5GLWA 4JV4A 1NZCA 4EZHA 1RUG3 2XJVA 3IMNA 1MVEA 3MPBA 2Y6GA 4AHXA 4RGGA 3I3EA 4Q2FA 2RR13 1UZWA 1W0NA 2E6VA 1UKGA 2RR11 4RQPA 3ZFEB 2DCYA 3F95A 1V6MA 1QWRA 4XJWA 4C91A 1V6LA 4B8EA 4QKFA 1YUDA 1TE1B 1ST8A 3KD4A 4ZXKA 1V6OA 2GNTA 3D5OA 4W6XA 3GXUA 3UESA 1M4WA 1VBA3 5C9AC 2RDSA 1JZ2A 2R0FA 2P3JA 2XWJB 4BA6A 1AR83 1VBA1 1RHI3 1R083 1RIRA 2WC2A 4YLZA 1AR81 1RHI1 1R081 2GN7A 4RR3A 2JE8A 3B94A 1JYWA 1JZ5A 1ZA7A 4IV3C 3KT1A 5DAPA 1BJQA 2GH8A 2F4PA 3LOIA 3W59A 1CX1A 3OJBA 4HKWA 4CUAA 1UYYA 3URFA 1F35A 1D4VB 2DVFA 4MGYE 3ZXDA 4XVHA 5DDJ3 2RS12 2WNUC 2HEYF 3WDWA 2P3KA 4MV2A 4QX3A 5DDJ1 1W6NA 4BB3A 4EWDA 1DHKB 1KEXA 4YGBA 2KR2A 2PHUA 2B9UA 2PHFA 3OY8A 3ZMOA 5FZBA 2EF6A 1S0EA 4YFWA 1YC61 3C7FA 4NPMA 4XUQA 4G3YC 3M3QA 3L9JT 2WKKA 3AJZA 3X29B 1OOPC 1V00A 2XKPA 1UU4A 4NIIA 4OI0A 1B35B 3K77A 4XJZA 5LBFA 5T5JA 2FCUA 4IXLA 3MIGA 1NE6A 1I3HA 1RL3A 1LU1A 3BU7A 2P6CA 2W68A 3M1HA 2DV9A 4Q5OA 2Q8CA 4J6GA 1EYBA 1G86A 5LA9A 4DXTA 3MW3A 5L7OC 2JDPA 2H0VA 1QJU3 5CISA 2EIEA 1JU3A 1QJU1 2YGLA 4NOTA 4TWTA 5CFDB 4DEVA 2I45A 2VZ3A 1HRI2 4AHWA 1QKQA 1W0PA 1O8SA 4QHZA 1K3IA 3ZR5A 2WINB 2FCVA 3O7OA 2BOIA 3TEYA 5FZ3A 1IKPA 1Y3TA 2Z69A 4K9SA 3RZMA 1S2KA 2K0GA 2ZGNA 3BOWA 2RS13 3J9SA 2CAVA 2XQXA 4H7MA 4R9DA 4YVWA 3WW3A 4IGOA 1VAKA 1PX3A 2QQMA 2RS11 4QKNA 2XJUA 4HSLA 1RUE2 3ZXFA 3ZMNA 4SLIA 2ARCA 1OA4A 3C3VA 5DAQA 3O1TA 3I2JA 4AGRA 3QH7A 1MEC3 2BDRA 3CEWA 4K20A 1OF3A 1MEC1 3U11A 1V6JA 4EYUA 4EWAA 2VUCA 2J1SA 3T09A 2BW8A 3FC0A 3FBMA 3USUA 3IDCB 5CBLA 4PQ9A 1W06A 2ZZQA 1PZ9A 5DUXA 4XDOA 1F4HA 3NAPC 3I59A 2DCKA 5FUNA 1O3RA 1PK6C 5FLIA 1BXHA 1C5IA 1XRUA 4BWOA 5FXWA 5C8WA 1QXPA 4FQ4A 1OF4A 4GWNA 4ZXEA 4LKSA 4NWWA 5EFUA 4CCKA 1HQNA 4NHLA 3B3QE 4YVSB 4AL9A 5FP7A 2XKOA 1AZDA 3H9AA 1JOBA 3D0SA 2BPA2 4GWJA 5EYXA 4CDQC 4JC1A 3HEIA 4GA9A 4UFHA 1HRI3 3AL6A 1UXXX 1O3SA 1K5MB 1RJ7A 2RVAA 1FT9A 4P9IA 1HRI1 5CB7A 1AXYA 4EQVA 2ZGMA 4RN5A 3M3EA 1X8MA 1I5ZA 4XC9A 1XB9A 1GU3A 4Z2AA 3POGA 4BIOA 2LRPA 1NX9A 2QBXA 3VBSB 4IE6A 2NZ9A 3B00A 5C9AA 3POSA 2RM22 2A1XA 3IBMA 3EO6A 5A80A 3ILRA 4BXFA 1W9WA 3O5SA 5FZ4A 4F8AA 1XE0A 4N43C 1PO22 4IGQA 4ZY9A 4CP9B 4B4QA 1MZEA 4KWLA 2CSGA 4IV3A 2VH9A 2LUWA 3PUQA 1BLZA 4GULA 5AC92 1FOD3 5F7UA 3GJAA 4HLTA 1FOD1 1PVC3 2XUMA 4A7YA 2ZTNA 1PVC1 4MXWB 2DVGA 4CPBA 3ASIA 2WNUA 1US3A 4GQ7A 2W5FA 3WF1A 3HQUA 2ZGKA 1OH3A 1PNFA 1NCQB 4FI9A 3WF2A 4CDWC 5C4WB 1LU2A 2JENA 5JXGA 1PMHX 4HG6B 2DFBA 5JR2A 4LO5B 1DDLA 3POEA 3ENRA 3V0BA 1W9YA 3IKWA 4OUEA 5BUVA 4DUVA 5FY0A 3UK9A 1TMF2 3HVDA 4Q4V3 4UFMA 1ND2B 3HQXA 2OKXA 4Y4YA 3CKHA 5BV6A 4RL7A 4Q4V1 4QQHA 1QQP2 4OZOA 1OOPA 5JZGC 1GQGA 4DRVA 5T5OA 1XOYA 2Q1FA 3D4KA 4COWA 1FAYA 1AL23 1FI2A 2CGNA 4MX3A 2D3PA 3IIIA 2IFRA 4XMIA 1AVBA 5C5TA 4I2OA 1AL21 1ACCA 4CE8A 4IW3A 3BKZA 1O6UA 4OZXA 4GAZA 4KU8A 3VB9A 4RS5C 3HMYA 4DXRA 5L7OA 5FPBA 2R042 5BNPC 4JVAA 5AVPA 3OPWA 1US2A 2XH6A 5L36A 2B7YA 4BOWA 2WYSA 4EN9B 1WCUA 5FAXA 1UNBA 5F5IA 3ETQA 1NY72 4HVRA 1TNRA 5FYVA 4COZA 2A71A 3N7MA 4M4RA 5JVVA 3KV6A 3HWJA 2E32A 5JUVA 1GZCA 3LE0A 4I3PA 4XEZA 2X05A 2Z5WA 2IXKA 4AEKA 2BJSA 1HQWA 2VOWA 4YWAA 3VD9A 1X7NA 1J1TA 5FY9A 4MGZE 3M3OA 3LOBA 1JODA 3K4DA 4QM8A 2D6LX 1JHNA 1FNYA 2Y6LA 4FPYA 4Z8BA 2KM2A 3AKRA 3O1MA 2FDFA 1GUIA 2BFUL 2RMU2 3SHRA 3LDRA 3VKOA 4FFHA 5JI7A 5A1LA 3C7GA 2XQRA 5DN2A 1N47A 1YQ6A 3NAPA 2HKXA 2Y33A 1VPHA 4IEPA 3FE5A 3GBGA 3HJRA 3VHPA 3VGIA 1PK6A 1Q8SA 2A6XA 2GZWA 1HXS2 4JRLA 4ITCA 5FYIA 2VMCA 1JXNA 1CGPA 2VL4A 4QDSA 3HT2A 3VL9A 3ST7A 4A7KA 3WF0A 1DLCA 1W9SA 2NMOA 2F17A 2PYTA 4AF9A 1VRBA 2PN5A 4O65A 3OOXA 3TBDA 4CDQA 2JKBA 1EP0A 2VCMA 4XE9A 4BQXA 1PO13 5JXJA 1XSQA 1W2OA 4YZ3A 5J1XA 2PAKA 3GYDA 1PO11 1RUF2 3K3OA 3SCHA 1YQCA 4Q4X3 4DUWA 2XVLA 2OYZA 5J36A 4D7YA 4Q4X1 4Q4W2 3ZSKA 1PZ7A 1W6MA 1WMEA 3O14A 4ES9A 1CAXA 1H1MA 4K8FA 1COV2 1VIWB 2ZPXA 4OYUA 4JKLA 1VB2A 4FQZA 4QXCA 4YNIA 2LROA 2IZWA 5IAXA 1PGL1 3HOBA 4NAMA 5LK5A 3I2KA 5JCTA 3KWVA 4N43A 3M70A 3EBRA 5FY8A 4YGEA 4LPLA 5B4XA 4PHZA 2RE9A 3UL2A 3OYWB 4QX8A 3ZLIA 3ZFFA 2IUWA 5GALA 2IXHA 5KXCA 5SV8A 1OQDA 3S7EA 2VCCA 3THCA 3DKQA 1MQTB 2LM3A 3J7HA 2WZEA 3N9PA 4KGGA 1SHWB 4N7IA 4Y3OA 1OUXA 3NNMA 4K6BA 4Q1PA 1ZZCA 4CDWA 3DXUA 4FO9A 1HV0A 4QX5A 2Q8EA 4ES8A 5B2GB 5IUQA 2DVDA 4ONUA 4QGMA 3LA7A 3WDUA 1O3QA 4U36A 3NJVA 2EAKA 3DXTA 4IERA 2JX9A 4IEXA 1UZ0A 4HN0A 5A3MA 4FPLA 5JZGA 1LHUA 2HWD3 1DFQA 3AMHA 3CJIB 1OKOA 2HWD1 1UY2A 1LHNA 4JGZB 2CYFA 3IT8A 3P5BA 2AENA 2L9LA 3VHNA 2OZJA 4RS5A 1SBDA 2H6CA 1HJGA 2RJLA 3H1WA 2NP0A 4KBZA 5FZEA 5HCFA 1WCKA 5BNPA 2G9ZA 3OPZA 1HB2A 3H7YA 3Q9OA 4LITA 5DG2A 2EXKA 2OW4A 4W6WA 2VAUA 3IDEA 4S2FA 3KQ4B 1UQXA 1FPN3 5FPVA 3ZN6B 4NJ4A 2UWAA 2JG8C 4CU9A 1FPN1 1AUYA 4HFSA 5EIYB 3U37A 5I0SA 3A23A 1IPKA 1UY0A 2W46A 4NAOA 1BEV3 5AFBA 4O9GA 1BEV1 2WO7A 2Y6JA 3WT3A 5BNOC 3N7LA 5CU1A 5IVEA 2ET1A 1AF9A 4MG2A 1SPPA 5LZ6A 1RXFA 4HBNA 4BM8A 4NIHA 1CAVA 4P08A 1UD1A 5L73A 4A6OA 2VZPA 5C3SA 5FOJB 2ZGUA 4AFBA 5JSOA 1DGLA 4WVMA 2WNOA 2ZZJA 5IK5A 1MR5A 2R6QA 2VUDA 3O0VA 3B93A 1O4ZA 3NNGA 2J22A 4M3CB 2DVBA 2HWB3 2D6KA 2VE1A 4NR1A 3T2TA 4MGTA 1WD3A 2Y38A 2HWB1 2PHRA 4YW5A 4O61A 3RWNA 5LCWL 2HBTA 4Y24A 1CIWA 5LWBA 2UYAA 4CP2A 3MZHA 1RUI3 2A73B 1RUI1 4F3JA 3UT0A 2D6NA 4LT5A 4AQSA 3ZO0B 3RMXA 1GKBA 1RVF1 1CIYA 4Z92B 1RUD3 2BBAA 4FOQA 4Q8LA 2MNGA 3HBZA 1H8VA 1RUD1 3VV1A 1J59A 2WLPA 3S57A 1ZZ8A 4OHXA 2CDPA 2LS6A 5GM0A 3POWA 2Y6FA 5LBBA 3VBHB 4N53C 5C33A 1SDWA 5A7WA 3ZYHA 2GN3A 2LTNA 3H1YA 4AYUA 4C90A 1DYPA 2XJPA 4YGCA 1IPJA 2B39A 2A3XA 4LR4A 3VDCA 3RYPA 3M3IA 4Y1YA 4KG8A 3OSDA 3U0ZA 3LDBA 1CESA 1QNWA 3H0OA 3MIFA 3OPTA 2P1BA 2FMYA 1WWYA 3VZMA 2PMWB 2WL1A 5A33B 1W99A 1S55A 3H50A 3V64A 5HXMA 4YW1A 1X8EA 3WY6A 2Q8DA 4IEOA 2E53A 2D5FA 2R1BA 1NA1B 1G9CA 2HYXA 3U1XA 3EHKA 3K48A 2X5IA 5FY4A 2VM9A 2E7TA 5FK8A 5J48A 1LTEA 2VW1A 2WNVB 3BPZA 1XBFA 5T55A 4QX1A 5K0UA 4AAPA 4LK7A 4N8MA 1ENRA 1XNAA 2ARXA 3JU9A 1HIXA 1SACA 2UWCA 5D8AC 2P6HA 5E8AA 2C24A 5FZ6A 3RI8A 1ZRDA 2VZQA 5L19A 1SDDB 2ATFA 3APBA 2YU2A 3E6BA 4P00B 3TRSB 1OLQA 1EUUA 2JE7A 2ZXQA 1GMMA 3D3AA 2O14A 3VDBA 3AYEA 3GDBA 5A7OA 5CA6A 5LA0A 1W8TA 3SQOA 2BVVA 4XQWA 1H8TB 1N1YA 4B7EA 4LE4A 1D2SA 4LKDA 4PDWA 1O3TA 5FPAA 5FZMA 4JQRA 2IVIB 2R062 3I49A 2EXHA 2BTVC 4L97A 4QDQA 3RZGA 4GJZA 5J37A 2BOJA 4ZZ8A 5IK8A 5BY5A 4XABA 4CEYA 1VBE3 1Z78A 1W2AX 2NLRA 3ZXKA 1S0DA 3I8TA 4DY3A 1VBE1 1NUKA 2DCJA 4MUVA 2W39A 4CCLA 2WRAA 4OULA 5C8CB 1JUHA 3LZZA 3TEWA 3U78A 3OGVA 1QOSA 4DMIA 3WW1A 1N3OA 2JG8A 1UOGA 3UGFA 5JMCA 3S0MA 5FKBA 3SH3A 5ACA2 2B5HA 1RXGA 4BJ0A 1OURA 1W6PB 2WQ4A 5FZ9A 3SCGA 1GZWB 2SBAA 2VECA 4XHBA 4YG3A 5BNOA 3GALA 3OCPA 4TXWA 1HLCA 5F8PA 5T50A 3PVOA 4EN7B 1RUC1 5CFDC 1LR5A 1ND3C 2GSYA 2D43A 2WWUA 1GNYA 4FFIA 4SBVA 3VD4A 4R8HA 1Z7S1 3GZTB 5DPNA 1CZTA 2E26A 5A32B 1IS6A 5A3UA 5IJRA 4QB1A 1W90A 5DMYA 4NHMA 4AHZA 4D6SA 3MLKA 3LA3A 3WDTA 3E5XA 2R063 5A1AA 3I2OA 1EPZA 4QX0A 3R05A 4WM8C 4OI1A 4E2QA 1K5JA 2R061 3FWEA 3IB3A 2VOKA 3H8OA 3C8XA 1ENSA 3U75A 4NMIA 1UY4A 4LHKA 1VAVA 2RS32 2XHNA 4XTMA 3ZDVA 4BK5A 1POQA 2HLEA 1RUH2 1Q8VA 3SH4A 2FZ1A 1SLIA 1TZOA 4D69A 1OA2A 2IWGB 3M7AA 4C8DA 3GBWA 5JOXA 5SV5A 1VMFA 1KFXL 3ZDSA 2VNRA 4ZU7A 3EXUA 5GKAC 1JN2P 4CZSA 3K46A 3KSCA 2ZX3A 5LBCA 3DYMA 1AR62 4N53A 3WINE 3N9NA 1UOJA 4NRQA 5FPXA 1OKQA 3WOGA 3FLTA 3MV11 1H9WA 4QMAA 2W9XA 4XFHA 1GZ9A 1CD3G 3W21A 5LW9A 2N7GA 4OHWA 3L2HA 4QQ2A 1WLDA 4YVSC 3AP9A 4BZ4A 2K46A 3PUHA 3FLPA 5FYHA 2KA3A 3POBA 2AR6A 3ME2A 1FX5A 1EAH2 4KWUA 3WP3A 4OMCA 1VBB2 1MS5A 1AJOA 2BEOA 2JDMA 2RDQA 2XHKA 4B1LA 2WWJA 1K5MC 3UKNA 4EV0A 2JD9A 1WA4A 2W1WA 1UYXA 2AEZA 3P1IA 5JOYA 3E6CC 1GWKA 1A34A 3O12A 5F5AA 3SCFA 2WFF3 1IG0A 2WFF1 2JG9B 4TYSA 3VHOA 2BBVA 5F2WA 3ZSEA 4D7TA 3IPVB 1LOCA 5IVFA 4AVAA 2EVXA 2VXRA 1GWLA 4LXLA 4NPRA 5D8AA 1IPSA 3IM0A 1Z0HA 4MGKE 4WM7B 4AVSA 1IS4A 1UKRA 4QPIB 5BNNC 3VD3A 5JDBA 5JI9A 2D7FA 3FHQA 4LHSA 3DPRB 5C3QA 4AEJA 2JKXA 4LLFA 2ZGOA 3GZUC 2HWE3 5T5PA 5IVCA 1S2EA 2HWE1 1AR63 4DNYA 1NCQC 4ARXA 2GP5A 1AR61 2WS92 3VZJA 4D8MA 4FXKB 2VBDA 1UIJA 2GC2A 3NKTA 1X82A 3AKSA 4O9EA 3WHUA 2XDVA 1AX0A 1OA3A 2VG9A 3KV5A 4IE4A 4I3GA 2W2IA 3UJQA 2W3JA 2CHHA 3RGBA 5A7QA 2C1FA 2FDJA 1VBB3 1QJX2 1XNBA 2QQOA 4K3UA 4R9BA 3VHRA 4ARYA 5BXXA 3N4MA 1K42A 4URAA 2A6ZA 1VBB1 1P8JA 1W6QB 5CG9A 1QOOA 2QQLA 1HJFA 4OUSA 1W3VA 1PGSA 3ZR6A 3AMNA
chains in the Genus database with same CATH topology
4FSJA 2GMEA 5CAZA 2MPFA 2NQYA 1DQ0A 1DQ1A 3JZVA 2XL9A 4M3CE 4CEWC 4LBMA 1Q8QA 3W9AA 5FFOC 5CFDA 1ND3A 4XJAA 1RUG1 4UW5A 3MI8A 2XL7A 3DUIA 1U5ZA 3ACLA 4M01A 1D2QA 3NV2A 3P3PA 1H2LA 3FBYA 4K1YA 4FBFA 1M06G 2XG3A 5CFCB 5J98B 4WM8A 4Q0VA 3ES4A 4DB5A 2F6BA 3QH6A 5DZFA 5H9RA 4QGLA 2KXLA 1SMVA 2PLV3 1LEMA 4YG6A 2CGOA 1R092 4LO4B 4DY5A 2PLV1 2QCSB 2EIGA 1QJX3 5F9TA 3VBUB 1QJX1 1FMD2 1CJPA 4AI1A 4WZFA 4HMZA 4INDA 5BYNA 5JAXA 3WVJA 3QACA 1BBT3 3ZYGA 1J3QA 2A6YA 4JTNA 5E16A 4YRDA 1BBT1 5A3LA 3R6SA 4QM9A 3WD5A 1QY4A 3AZWA 4W6YA 4YVSA 5JPMB 1SCRA 3VBRB 1LODA 4ZU5A 2P17A 4R4ZA 1X50A 4D7SA 3CLPA 2HWF2 5KHJA 2ZX4A 3NV1A 3WW4A 1K5MA 3WP6A 4GXLA 4KWKA 4XBNA 1MS3A 3PJQA 5FCCA 3LAGA 2OUHA 2Y26A 4LBQD 3VKMA 3PVNA 5GZGA 1NXMA 1OPOA 4AGGA 4IV1B 3DF0A 1AYN2 1CAWB 5ABJB 3IDBB 4XJUA 5GZFA 2E51A 3QLQA 5T5LA 3NO8A 5BNNA 2ENRA 4K40A 4ORFA 4YG0A 3WG2A 1FMD3 2OPKA 4NO4A 4XJ8A 1VBC2 3BOPA 1AYM2 1G7YA 2X29A 1NCQA 2WT1A 4DFSA 2OVUA 1NCRB 3THPA 3VDDB 3ZFGB 1BQPA 1KFUL 2ZX0A 4Q26A 1GFF2 5JOWA 4QQPA 3ALQA 2HWF3 2DVAA 5KHHA 1D0GA 1H0BA 1NE4A 2HWF1 3ATGA 1I9RA 1KS5A 1UX6A 2D40A 3MF9A 1B09A 1V6IA 3AX4A 4RQPB 3VUOA 2XWBB 1ZBE2 3ZXLA 4HANA 4CEWA 3OF1A 2P34A 3WQ1A 3RYKA 4LULA 2WT2A 1H2NA 2QKDA 4PIZA 4MH0E 2R072 2XVKA 3WNXA 2YZ4A 4CDXB 5K8SA 4AQ6A 4AXOA 4I09A 4ATEA 1CAUA 3D8CA 4UBHA 5EZWA 1CVNA 1Y9QA 1SFYA 3M4FA 1VBC3 3GZAA 2ZGTA 4RR3B 2BUKA 1QJY2 4YZ4A 1VBC1 4CP1A 1AX1A 3INAA 4CTEA 2GMPA 4XYXA 4ZU4A 4HVOA 4P9WA 2XJQA 5K9YA 2QZ3A 5I0TA 3JBG2 4FOWA 1RUE3 2DYCA 3VKLA 1W6NB 1RUE1 3M8LA 4OHYA 1XYNA 3I54A 1JYIA 3WP5A 4COUA 5FQ0B 3AB0A 5FBZA 5CIRA 3ZFFC 5F5QA 2ZX2A 2QQPA 3SLIA 5BNQA 1ZBE3 4QGNA 2IXLA 1LHVA 4YZ1A 3AMMA 1ZBE1 3ZIXA 2VOXA 3RMYA 1SLAA 2R073 1SLCA 4R52A 3KCYA 5H9SA 2D3RA 4XXAA 1O4YA 3JUUA 2PHXA 3VLBB 3JCIA 3WUCA 2ETEA 5JIUA 2ZHKA 2BGCA 3VBHC 4E4DX 3B5LB 4LBQB 4QXKA 3VZOA 1Q3EA 4PIXA 1NQJA 3E97A 3BTAA 4EN8B 3OD4A 2RM23 3ILNA 3JBG3 1JYCA 2RM21 4M00A 3JBG1 3OYWA 1PO23 3U07A 5F6KA 1NA1C 2JXAA 5GJ6A 1PO21 2A75A 2GNBA 4KL1A 4RFT0 5AC93 1RUNA 3ELNA 1X36A 3ECQA 5AC91 2CL2A 1HW5A 1YFXA 1H2MA 2UY9A 4OVEA 1W0OA 2E9QA 3CO2A 4LBKA 4Y5Z0 1N1TA 2XVGA 3USUB 4FPJA 1BVP1 2Z2SB 3I59B 1XQNA 2D98A 1OMIA 4HZFA 1DZTA 3B7MA 1CONA 1TMF3 1YIFA 5KXBA 1C57A 1WMFA 4XPVA 3W58A 3ZYIB 3CJIA 5DXDA 1TMF1 3UV9A 4ATFA 1QQP3 2YYOA 2WIIB 1QXRA 1QQP1 4M3CF 4I01A 2ARBA 3AKPA 3RDIA 2K9ZA 1F8VA 1UIKA 1WUVA 2OIIA 1LOFC 3LGRA 3ZN6A 2R043 4LO7A 5C9AB 2ZAHA 4FT8A 1HDKA 2R041 3RNSA 2QJVA 1LGCA 1QDOA 3WXPA 1JUIA 3KCXA 5GLUA 1YLLA 3ZXAC 1KRIA 4IV3B 1WCDJ 4X6RB 3WV6A 1NY71 1SFNA 5EWSA 1O5LA 5E88A 1J3PA 1T6GC 2XGXA 1RTVA 1S0JA 2BQPA 4DPNA 2WNUB 1V9U2 2B8MA 2NMNA 3GHMA 3MICA 1S0IA 3NL1A 4M3CA 4AEDC 1UAIA 5I93A 3VKFC 1UPSA 4FVVA 1XNDA 1G6NA 3V0BB 1KDMA 2K2SA 2RMU3 3AZXA 3ZSMA 5KHGA 2RMU1 4GMP3 2O0OA 2ZGRA 4JDOA 2A70A 3ZVXA 1ZZ6A 2X5IC 4GMP1 2D97A 3LSEA 2NN8A 3JB4C 3OBTA 3V0AA 5GZDA 1CR7A 1HXS3 2BNOA 2WJSA 2MEV2 5K0UC 3CL1A 1HXS1 2ILMA 4QD2A 1C3HA 2C0ZA 4QHBA 1C1LA 2DUOA 2XJTA 2WT0A 4AEMA 4Q4Y2 1AR92 3TYJA 5L7OB 3VBHA 1DG6A 1Y7BA 5I8TA 1RUF3 1GV9A 1QGLA 1RUF1 4Q4W3 4ASMB 4PDWC 4IEQA 4IQPA 3AZVA 4Q4W1 3H3UA 3U10A 1H1IA 1HKDA 1COV3 3PVEA 5A33A 1COV1 3RQ0A 2CTVA 2VMGA 4FXGB 4BCUA 3WCSA 4C0HA 4JGYC 1Q8OA 4CEYC 1ZRCA 1NA1A 4YSFA 4FTBA 4PJYA 4WVWA 2WSUA 4IEWA 1GANA 1ZX5A 5FO9B 2JG9C 2BWAA 4BLJA 2IXJA 3S6PA 3MLJA 1A6CA 1ZZ7A 3DV8A 4QPGC 1RMU2 4RA0A 1ZNPA 3PHMA 4S2GA 3TAYA 1O7FA 4XF9A 3N7KA 4UW6A 3R4UA 3RG0A 4MVTA 5HBAA 4AI0A 3E5UA 4QPIC 1OD5A 4IL7A 5D1IA 3AMPA 3DPRC 3V56A 1H8TA 2ZGPA 3GF6A 1DLLA 4XF4A 4FAHA 3CJXA 1ULGA 1RGSA 1UU5A 4XJ9A 3SMHA 2DUQA 1XU2A 1XXNA 1ZRRA 3D82A 2ZGLA 4OLLA 4XILA 2CAUA 2QDRA 2XJRA 3TNPB 2DURA 1YFUA 3VZKA 3JD72 2P2KA 1LOFA 2R16A 2QUOA 4OFGA 1CAXB 1YYNA 1A78A 3M2MA 1NLSA 2GH2A 3N35A 3UJOA 1W6PA 1YRZA 2PHLA 3OGJA 4HKLA 4N43B 2UYBA 1RUJ2 1YJKA 3CU7A 5LRSA 3WCRA 2VY0A 2PELA 1RMU3 2XB6C 3J8F2 4Q0SA 1RMU1 3NSTA 1D0HA 4CDUB 1DQ2A 2ES3A 3J4UH 5AFEA 1FATA 5FLJA 2CWMA 1OQEA 2IC1A 1VLNA 3PMEA 3ZFEC 4J1XA 4AEDA 1S1AA 2VVFA 3WG4A 2ZKNA 4JCKA 3VBOB 1MS1A 4R9CA 3PLQA 4H55A 3NKGA 3C2UA 2B46X 1VRH2 3WQ0A 1ZBA2 2WA3A 4FPGA 4QQOA 4I0WB 1FNZA 2G4IA 3FFQA 5JZGB 2D3SA 4XFCA 3R4SA 1XNKA 1PZ8A 3JD73 2JE9A 1DU3D 1IS3A 3AJYA 1KQRA 3JD71 3VBUC 4HL0A 3WDXA 4DS0A 2PA7A 1KJLA 2ZMNA 2Z79A 4L8QA 3UKVA 4B4PA 1XU1A 2ZGQA 4L99A 2D6PA 4OHVA 2QZ2A 1LOEA 4XDQA 4EWEA 1R1A2 1F2NA 4M0NA 4RHV2 2V09A 5FTTC 4DINB 3AP7A 2FHRA 3H8UA 1ZA4A 3KMHA 3J8F3 1YIPA 4XFBA 3VBRC 1WW7A 3J8F1 1WD4A 1YI9A 4BQ1A 3ZXJA 1TME2 4A3XA 2XBO2 4JGYA 1FV3A 5CADA 4BYYA 3I7DA 3VBFB 1XYOA 5F6LB 4NVPA 1CAVB 3MIHA 1C5HA 1LOAA 2E7AA 2JG9A 1O91A 3WUDA 4D3WA 1B35C 4WVMB 3MDPA 1URXA 3FX3A 3IPVA 4COVA 1RITA 4LA2A 4QPGA 3S30A 4FP2A 1ZBA3 4IV1C 3PMSA 1REDA 1YHFA 5ABJC 2GNMA 1ZBA1 4XFGA 4WM7A 1GR3A 2AZ5A 3D6EA 4QPIA 1ASJ2 1MS8A 1GNZA 4YW2A 5TSWA 3DPRA 1YNAA 1DF0A 3JQXA 3RZZA 4AE2A 3HT1A 1WW5A 3B01A 3HIFA 2XJSA 4AQ2A 2OUJA 5DUUA 1JTZX 4GKYA 2AH2A 1VP6A 4RHV3 1N3PA 2JICA 4IESA 4S2DA 5EJ3A 4RHV1 2UY8A 4XFAA 2ZX1A 4C1WA 1SEFA 1WLWA 3WDVA 3ES1A 2W52A 1YFWA 1XYPA 1TME3 1NYWA 4ASLA 4I02A 2XBO3 1TME1 1BVVA 4Y1ZA 2ZACA 4Y1UA 1G9AA 2XBO1 4GB32 1W2UA 3KM5A 4V1PA 5T54A 3A0KA 4E27A 5ACA3 3D0JA 3ILFA 5ACA1 4Y22B 5AVAA 2R0HA 4E4ZA 2D6MA 2VOVA 1WBLA 3S7IA 1F5FA 1LEDA 3ZXGA 3ZYRA 3B02A 1PHMA 2JEMA 1H1AA 2GC1A 1OPMA 1SBEA 4P9YA 4FAGA 5JLVA 2WQZC 3KGLA 3ZFEA 1S0GA 4XXPA 1KDKA 3RJRA 2YUEA 1R1ZA 4FOYA 1BCXA 3R4DB 1WCSA 1WW4A 1PMIA 1GBGA 3LWCA 4P9GA 1BMV2 1AL0G 2AYHA 4Z2WA 3TN92 1NG0A 1LGNA 3VBSC 5J7MA 2GU9A 4Q0QA 2JDZA 1ZZ9A 1O4TA 1PVXA 1BYHA 1QNYA 2XLAA 4MGIE 3WHTA 2HWC2 2EXIA 1POV3 5FRAA 3AP4A 3VBUA 4AHYA 4B3NA 5LEJA 4Z92B 1POV1 2RS33 4K21A 2VULA 1RUH3 1PNGA 2RS31 3LKJA 4LUKA 2CGPA 1V70A 1GSLA 1RUH1 2PHTA 1VBD2 2UWBA 4HK8A 1YCIA 2DCZA 3N7JA 4Q8KA 1WBFA 3NWKA 4R4XA 5JSRA 1Q8PA 4HPKB 2ZMKA 3VBRA 5C4WC 3ZIWA 1A3KA 1EV12 2NM1A 1IS5A 4IEUA 1ZYBA 2BFUS 2PAEA 4G9SB 4LE3A 1AXZA 1H4GA 4S2HA 1C1FA 1MZFA 4XHXA 1D4M2 2V5YA 5BNOB 4FPOB 1ND2C 3OTFA 1EAH3 4D94A 1O5UA 4QT6A 1EAH1 4WBBA 4F7ZA 1ENQA 4YARA 2A7AA 1NQDA 3AKQA 1B35A 1UW8A 2HJIA 3TN93 1LRHA 1UL9A 4I0AA 4IV1A 2A6WA 4HVQA 4HK9A 5ABJA 4UXAA 3TN91 5KC6A 1FXZA 4G4FA 3VKNA 1CPNA 1WLTA 4P9JA 1VBA2 1G9FA 2HWC3 3QCWA 1LCLA 4DOUA 1DQ5A 1AR82 4RD7A 4AVTA 4JAAA 2HWC1 3ZSLA 1R082 3KS7A 3ZN4A 3FMGA 3JB8A 3KT7A 1UU6A 1F5JA 4DRRA 3MYXA 1VBD3 1SCSA 2WSVA 2GALA 3R0RA 4B4RA 5IT6A 3N36A 1VBD1 1QU0A 4AK3A 5J96B 4Z07A 1VJ2A 2WS93 4HSJA 5DDJ2 3E6DA 1V6KA 5I0RA 2WS91 3IIAA 4N53B 4PBOA 1CQ9A 4XQ4A 4FPEA 4YZ2A 4XMAA 1D4M3 5I8YA 5FO7B 1D4M1 1KXGA 2WWSA 3KGZA 1RINA 1WLCA 2XLGA 3G6JB 4ISRA 3ZN5A 3ZX7A 1APNA 4IETA 4ISQA 1Q43A 2RJKA 2O8OA 3N3HA 3QD6A 1C8M2 4Z82A 3THTA 3ZSJA 3HD8B 4WVZA 1J58A 2DFCA 1YJLA 5HCBA 2YHJA 4K1ZA 4R9AA 4CDXA 1QOTA 4YW4A 1BK1A 2Z42A 4Q1RA 3MW4A 4AI2A 2GDFA 2A3WA 1IZ3A 4PIYA 1ULDA 1U5IA 1QJU2 2QE3A 3I2DA 5D8AB 3AYDA 4RGAA 4QPYA 1LB2A 3HAGA 2X53S 1BKZA 1DQ4A 1OFNA 3VBSA 3DGTA 1GNHA 4K7JA 1W6OB 3LSDA 5I91A 2ZHMA 2CY6A 2DCTA 5GLZA 4QQLA 1MS4A 4TSVA 1GQHA 4EN0A 1UZZA 3KB5A 4MSVA 1N1SA 2D6OX 4FP3A 4Y20B 5KC5A 2EALA 1R093 1CJDA 1A8DA 1F9KA 4IEVA 3RS6A 4E4SA 3RSJA 1R091 5FQ0A 1MEC2 1UZYA 4MXWA 4KH9A 2Q8OA 1DZQA 2YPJA 1MQTC 1FMD1 1C8M3 5KWRA 4GH4B 5C4WA 1ALYA 1C8M1 4LHNA 2ZCWA 2O8QA 2B42B 1UPIA 4EN6B 1H2KA 3LCPA 3T1MA 3JQWA 1ND2A 2ET7A 4KG0A 4AI3A 3CF6E 1KJRA 2Q0AA 2AUYA 4LBLA 4LBQA 3H3ZA 2ZKLA 1ND3B 5H9PA 4QU2A 3CJIC 1QH7A 3M3CA 1PGW2 3POYA 2MHFA 4JGZC 3RI9A 4AWDA 2D93A 5T3NA 1C28A 1Y43B 4GALA 4IEZA 4FTEA 3AMQA 2VNOA 2BNNA 2JECA 4YGDA 2W08A 1AYN3 4WM8B 4OHZA 1OI6A 1AYN1 5JSPA 3SITA 5IK4A 1F31A 4PLMA 3LB9A 1FYUA 1RB8G 3KZ4C 2Q1ZB 1FOD2 3MIEA 4N9HA 1YO8A 2WZR2 1AYM3 2VQAA 1PVC2 4MLOA 4DXZA 4NWVA 1AYM1 5FPZA 1ZZBA 2DTYA 1HQLA 2PHDA 2RHPA 3DL3A 4BMBA 4JDMA 5KHIA 1QDCA 5IK7A 5DUWA 3USSA 5FOBB 1WW6A 2WFPA 1AXKA 4Q4V2 2UURA 2VMHA 1ONAA 3OY8B 2A3YA 4XF0A 5DUVA 4F83A 4Y1XA 1PGW1 4KWJA 3PNAA 1AL22 3J26N 4XOGA 4WVVA 3PTYA 4I30A 3NJZA 1LESA 2VQ0A 5JOZA 4L9BA 3UKTA 1H4HA 1OHFA 4L2NA 2D5HA 4Y26A 1J3RA 4LTAA 4KGQA 4KNCA 4W65A 2R071 2OA2A 3VN4A 2VU9A 4M0HA 5BNNB 1MZ6A 5KHKA 3P3NA 4DQAA 2WZR3 4J1WA 4YM2A 1QJY3 2ZBJA 2WZR1 4CDUC 1C8NA 1Q5OA 1QJY1 2VVEA 2I07B 1LHOA 4XETA 3H7JA 1GICA 2BVBA 4XFFA 1U12A 4NHKA 4Q27A 4GIQA 1IGOA 4URTA 4YVWB 4X6QB 3VBOC 4AQTA 2ZABA 2DWRA 5GZCA 1XNCA 1ZVFA 2RS52 1MQTA 2TBVA 3AYAA 2QVSB 3AFGA 1BZWA 2WNVC 1I1EA 3NW4A 1ULEA 1YWKA 3TNQA 2ZOEB 3U4XA 1PIV2 5GLTA 5BPXA 1MVQA 2XPJA 4CEWB 1TQ5A 4B29A 2H6BA 3BALA 1LECA 1QJZA 3FJSA 1AX2A 4EROA 2YDEA 1H8TC 1PO12 3O0XA 3A4UA 5FMOS 1ULCA 2W0XA 4Q4X2 4JGZA 1JOJA 1CAUB 2WZPP 3MEPA 4H3WA 4LBOA 5F1RA 4BHPA 3A0NA 2GNDA 3AP5A 1LJ7A 3ZYPA 2GC0A 4CP0A 1PGL2 1H30A 4GKXA 3VBFC 2BWCA 4A2UA 4IEYA 4AI8A 1VB4A 5J09A 1W39A 2NYYA 3PVBB 4AFAA 1SQ4A 5C8CC 2C9AA 1LGBA 3GHNA 4E2GA 3L2YA 2DUPA 3DN7A 4DZGA 4WV8A 2QDNA 2RS53 3RYRA 3VZNA 2RS51 4P9LA 3O0WA 4XBLA 4BLIA 1PIV3 5GLVA 3B9CA 3V65A 5DZEA 1PIV1 4BH9A 3TOJA 2FZ2A 4L11A 2ZGSA 2FQPA 1Q56A 2DF7A 4HKOA 2DU1A 3WR0A 1J1LA 4X8PA 3WG3A 2X8KA 2I74A 3FHIB 1DGRA 2HWD2 2SLIA 2VMIA 3BIWE 2IXCA 3RPQA 5HI0A 1C4RA 1WMDA 2ZMLA 2XLFA 4KQ7A 4BPZA 5JPNB 1OOPB 2ZS6B 4XFIA 4YM0A 1DGWA 1AR72 4MYEA 1G9BA 3AFKA 3MLLA 4HETA 2EXJA 2GMMA 4LBJA 1FPN2 4AFMA 2E7QA 3IWZA 2G9GA 2PTMA 4CDUA 1N1VA 1BEV2 1FV2A 3H1MA 1IKQA 4Z1VA 4UW3A 5H9QA 3AP6A 2E63A 3DKWA 1DQ6A 4NN0A 2Q4SA 2ZHLA 1V9U3 2FBEA 4P5HA 2PAMA 3VBOA 4XF1A 1V9U1 3T1LA 1GLHA 1OLRA 4GWMA 2VPVA 4FPCA 3SISA 2HWB2 4MZUA 3B69A 1U0AA 5E89A 5FLHA 4LNVA 2WNVA 4AGVA 1PM7A 4GMP0 1RUI2 1YI7A 4WM7C 2JD4A 1DGRN 2MEV3 3NAPB 2P3IA 1WGPA 2JJ6A 2VUJA 3HR9A 5L73A 1RVF2 4Q0UA 5T52A 3WX5A 1PK6B 2MEV1 4BZ4A 3GNEA 4CRQA 4AFCA 2GAUA 1AR73 1RUD2 2DTWA 2VVDA 4Q4Y3 1AR93 1AR71 4A7ZA 4Q4Y1 1AR91 3BODA 2TEPA 5FREA 2CNAA 4CDQB 1GYKA 3RRDA 1KITA 2FMDA 4JRAA 3VBFA 4UW4A 4LBNA 2YC0A 4AVCA 1DZRA 3MIDA 1W6MB 4BE3A 5C8CA 4AW7A 4N7UA 3RJ2X 1EPWA 2O1QA 3KQRA 3WP4A 3VL8A 2ZHNA 2YXSA 1SLTA 3WW2A 1HV1A 3NVCA 1GZWA 1E57A 1X33A 2H0BA 5HXVA 1NXD1 1LOGA 3ROUA 4TZDA 2GC3A 1YXWA 3OD0A 4XF3A 3ZFFB 4PF5A 3E5QA 2YROA 4FPFA 5EYYA 2VW0A 4OI4A 3WLUA 2IFWA 1REEA 1RVF3 4CDWB 3V0AB 1S2BA 5A32A 3FFZA 1L3JA 2C5DA 5CG8A 5EXOA 2YGMA 1CPMA 1NLRA 3K51A 3KLSA 5CFCC 2YV8A 4XW3A 2PQQA 3WZ1A 1MS9A 2YY1A 3AKTA 1XE7A 3OBRA 2QFEA 2VUAA 4JTOA 4BMEA 1NOVA 4ZKTB 3FUQA 1VBE2 3I4IA 4FPKA 2D44A 4RS5B 1VR3A 4Y22A 5BNPB 1OQ1A 5JR7B 1U5YA 1RUJ3 4XIOA 1RUJ1 3AK0A 1DIWA 3OGGA 3LA2A 1HX6A 4JDNA 4LUMA 4CYDA<