4WM8C

Crystal structure of human enterovirus d68
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
247
structure length
247
Chain Sequence
GVPTYLLPGSGQFLTTDDHSSAPVLPCFNPTPEMHIPGQIRNMLEMIQVESMMEINNTDGANGMERLRVDISVQADLDQLLFNIPLDIQLDGPLRNTLVGNISRYYTHWSGSLEMTFMFCGSFMATGKLILCYTPPGGSCPTTRETAMLGTHIVWDFGLQSSITLIIPWISGSHYRMFNSDAKSTNANVGYVTCFMQTNLIVPSESSDTCSLIGFIAAKDDFSLRLMRDSPDIGQSNHLHGAEAAYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP1
publication title Virus structure. Structure and inhibition of EV-D68, a virus that causes respiratory illness in children.
pubmed doi rcsb
molecule tags Virus
total genus 40
structure length 247
sequence length 247
ec nomenclature
pdb deposition date 2014-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4wm8C00
2HWF1 1PIV3 1MQTA 1D4M2 2RS32 1PO21 3ZFFB 2BFUS 4RS5B 5DDJ2 1RUC2 4PDWC 2BPA2 1PGL2 2MEV1 3IDEA 1OOPA 4AEDA 4RFT0 1FOD3 1TME1 4QPGC 1POV0 4Z92B 2PLV3 2HWB3 4IV3B 1RB8G 1TMF3 2HWF2 1QJU1 3ZFEB 4QPIC 1BBT1 1F2NA 4EJRA 1H8TB 1VBA1 4Q4V1 1ND2C 1RUD1 4NWVA 4SBVA 1PO11 3CJIB 1Z7S2 4JGYC 1NCRA 1QJX2 1RUG2 4GH4B 5CFCC 1NA1A 5L7OC 1IHMA 1TME2 1ZBE1 1RUE1 1QJY1 5C4WC 5BNOA 1D4M3 2RS53 4IV1A 4CDUA 1NCQA 1QJU2 1R082 3VDDC 2RM21 1OHFA 1BBT2 1HRI2 4Q4V2 1VBA2 4PDWB 2GSYA 5AC91 1PO12 4FTSA 1MQTB 1FOD1 2PLV1 1VBD3 1C8NA 2HWB1 4N43A 2R063 1WCDJ 3DPRA 1PIV2 4IV1C 4QPIB 4CDUC 1NCQC 1QJZA 4N53A 1F8VA 2TBVA 1QQP1 1ND2B 2HWF3 1A6CA 1RMU3 1AL21 4AEDB 1PO23 4CDXA 3ZFFC 1BMV1 1AYN1 5AC92 4WM7A 1FMD3 1HXS3 1VBC3 5CFCB 1FOD2 3VBUC 5L7OB 2PLV2 2HWB2 5BNPA 5C4WB 1EAH1 2MEV3 3HAGA 1X33A 4CEYA 3TN91 1TME3 1VB4A 1QQP2 3ZFGC 1QJU3 1NCRB 5CFDC 1BBT3 4Q4V3 4FTEA 1AL22 1RUD3 3FBMA 1NA1B 1PO13 1COV3 2HWC1 5BNPC 4RR3A 4CDWA 5BNOB 4IV1B 1R091 3JBG3 4CDUB 1NCQB 5K0UA 4WM8A 4GH4C 2RS52 2XPJA 4JGZA 1RMU1 1M06G 2WZR3 1ZBE3 1RUE3 1QJY3 4N43B 1FMD1 5D8AA 1MEC1 3VBRA 3DPRB 4CDWC 1HXS1 4YVSA 2RM23 1VBC1 4CDQA 1RUI1 1NY72 1HQNA 1VBD2 1VBE3 2R062 4WM8C 3VBUB 4N53B 2R073 3VBOA 5AC93 1VRH1 1MQTC 1K5MA 3J8F1 1R092 1R1A1 1AR81 5ABJA 4NWWA 2WS91 3ZFGB 5D8AC 1PVC1 5CFDB 4YVWA 2BFUL 1RMU2 4Y4YA 1PO22 5A33A 1COV1 3VBSA 1AYM1 1QQP3 3VBOC 5BNPB 1FMD2 1OOPC 3JBG1 1HXS2 4AEDC 1VBC2 1AL23 2WWSA 1AYN3 2MEV2 2XBO1 1VRH2 1RUJ1 4YVWC 2WZR1 2BBVA 3J8F2 3JB4C 1AR82 1EAH3 3NAPA 2WS92 4RR3B 3VBFA 4CDWB 1PVC2 4FSJA 3TN93 1VBE1 5A32A 1VAKA 2Y26A 4GB31 1RVF1 1RUD2 2R071 5C9AA 1NCRC 1COV2 4WM8B 4GMP1 1ZBA3 1B35A 1RHI1 3JBG2 2DF7A 4CEWA 1NA1C 4JGZB 2HWC3 5BNOC 2RMU1 1PGW1 5D8AB 1R093 1RUJ2 3VBRB 3VBFC 5FMOS 2WZR2 5ACA3 1CJDA 1ZBE2 4Q4Y3 1NG0A 1QJY2 1RUE2 3VBOB 1OOPB 2RM22 2GH8A 1VBE2 4N43C 1ND3A 1X36A 4CEWC 2R072 3DPRC 5ABJB 1AR71 1MEC3 4FTBA 4RS5A 1RUI3 1HRV1 4YVWB 4N53C 1C8M1 4Q4X1 5A33B 2R041 1BEV1 1ASJ1 1VRH3 2WFF1 3VBSB 1RUF1 2BUKA 1EV11 2RMU2 1PGW2 1CD3G 3J8F3 4Q4W1 1R1A3 1AR83 4CDXC 4LLFA 1ND3C 1RUH1 1ZBA1 2WS93 4WM7C 1PVC3 2RS13 2HWD1 1AYM3 1AR91 1BMV2 1AYN2 2RS31 4CEYC 5ACA1 3VBFB 4Q4Y1 4RHV1 4Q4X2 5A32B 1EAH2 2R042 1BEV2 2XBO3 5LK7B 1AR61 1RUJ3 3JD73 5FOJB 5DDJ1 3TN92 4CEWB 2ZTNA 4RR3C 1RUH2 1ZBA2 5BNNA 3VBHA 4PDWA 5K0UC 1DDLA 4GB33 1RVF3 2HWC2 1AR92 1VBB1 4GMP3 1RHI3 1SMVA 2FZ1A 4JGZC 4QPGA 5ACA2 4Q4Y2 2X5IA 4RHV2 4CDXB 1ND3B 4QPIA 3VBRC 2RS11 4YVSC 2RMU3 4WM7B 1Z7S1 1AR62 4CDQC 1AL0G 5BNNC 1ND2A 3VBHC 1POV1 1QJX1 1RUG1 3LOBA 1MEC2 1K5MC 1RUI2 2VQ0A 4CEYB 4JGYA 5C8CA 4RQPA 5ABJC 2X5IC 1AR73 3JD71 1R081 1VBB2 3JB8A 5CFCA 1HRI1 5L7OA 1HRV3 1R1A2 1VB2A 5C4WA 1C8M3 4Q4X3 3VBSC 2R043 1BEV3 1ASJ3 4Y5Z0 2WFF3 3VDDA 1RUF3 2RS12 1EV13 1AUYA 4Q4W3 5K0UB 5C8CC 1AYM2 1PIV1 1V9U3 4RQPC 2HWE3 1RUH3 5JZGA 2RR13 2HWD3 1FPN3 3ZXAC 5J98B 1AR93 4GMP0 2RS33 2XBO2 3NAPC 3JD72 4YVSB 4CDQB 4RHV3 5BNNB 3VBHB 5C9AC 1W39A 1GFF2 1AR63 1B35C 5JZGC 1K5MB 5DDJ3 1RUC3 4GB32 3ZFFA 1RVF2 4QPGB 1TMF1 2X5IB 2QQPA 3S6PA 1RHI2 2ZZQA 5FMOL 3VBUA 1VBB3 2FZ2A 4IV3A 3ZFEA 1V9U1 2HWE1 5C8CB 4JGYB 3ZFGA 2RR11 3M8LA 4RQPB 2IZWA 5CFDA 1H8TA 4RS5C 1NOVA 1Z7S3 1FPN1 1POV3 1QJX3 1RUG3 1D4M1 1HX6A 2RS51 1TMF2 3CJIA 1AR72 3NAPB 1E57A 3VDDB 1HRV2 4IV3C 5J96B 4GH4A 1C8M2 3ZFEC 5C9AB 5GKAC 1ASJ2 4BCUA 2WFF2 1R083 1RUF2 1H8TC 1EV12 1HRI3 1B35B 1NY71 1RUC1 5JZGB 4Q4W2 1VBD1 1PGL1 1VBA3 2R061 1V9U2 2HWE2 2WLPA 3CJIC 2RR12 2HWD2 1OPOA 2ZAHA 1FPN2
chains in the Genus database with same CATH superfamily
4XVHA 2OPKA 5A7SA 1JODA 1TG7A 4QM9A 4YG3A 3WDUA 1OD3A 2X53S 3SKVA 1D4M2 3WNNA 3ABZA 4LBOA 1OXCA 1EUTA 2DCJA 3O1SA 4CUBA 1PO21 5E88A 1X7NA 4EZHA 4EN8B 2VPVA 3C7HA 4L99A 3ZIXA 2AGSA 4NPLA 2IXCA 2BFUS 2WFPA 4Q2FA 3VN4A 2WIIB 3JCIA 4Y5SA 3TAYA 5DDJ2 3W58A 1RUC2 1X9PA 2ZGLA 2HEVF 1PGL2 3H8UA 4KH9A 4AHWA 1RUNA 3IDEA 1A3KA 4KI5M 4XTMA 2BVBA 2XUEA 4QGNA 1GR3A 2DFCA 3MBWA 1FOD3 4RSUA 1TME1 4FXGB 1OURA 3RGBA 2YHJA 4IV3B 3PUQA 4ZXKA 5BXXA 2JDZA 3IIAA 5F37A 3K4DA 2A7AA 2HBTA 4ZKTB 4QQOA 3N7KA 4GWIA 1O4ZA 4MX3A 1UN1A 2EIDA 4ITCA 1L7RA 3J7LA 3H0OA 4LO8A 4PF5A 3VUOA 4BQ1A 3KGZA 2P3IA 1V6LA 3WT3A 2D43A 3PURA 3N9LA 4IERA 4C1XA 4H55A 4E4HA 4LPLA 1DQ4A 1H6XA 1VALA 3ZVXA 3AZZA 4GH4B 4BE3A 5I93A 4NIGA 4YFWA 2ZGOA 5B4NA 1XE0A 1LHNA 4QKFA 5FZEA 4ZXEA 1NA1A 4LA3A 4BLJA 4I3PA 1TME2 3AZXA 2H6CA 3C7EA 3AMPA 4I2OA 2CV6A 5BNOA 1D4M3 3AP4A 1X9TA 2D5FA 4IV1A 3W21A 3AP7A 1XNDA 3N9QA 1OHFA 4O7XA 1HRI2 2VBPA 4RGAA 2VO5A 5LBEA 1H6YA 4AK3A 3WP6A 1JHNA 3ON7A 3RRDA 5FMDA 3I8TA 4KQ7A 3D0JA 2PA7A 1XYNA 4QB2A 1N3OA 2YXSA 1WCDJ 3CZJA 4QDQA 4Y3OA 1OQDA 1PIV2 4CZSA 1JYVA 5F5CA 1HQWA 3T08A 4G3YC 1NCQC 3BVCA 2IFRA 3ECQA 1GYKA 4Z8BA 1W6PB 3FUQA 1O3QA 1Y9MA 3RVHA 1CIYA 4YW1A 4FBFA 2VW2A 3MICA 2RV9A 3MF6A 4L97A 4E4ZA 3E6BA 4YSFA 1NE4A 3AKTA 3KQRA 4AEDB 1PO23 5A3MA 3KV4A 3MW2A 5FY5A 2DVFA 3ZFFC 1W6NA 1OI6A 1W2NA 3MV01 2XHKA 1J58A 3FHQA 1HN1A 3ZSMA 1HXS3 3NNFA 5T5OA 4Q1PA 1ULGA 3M3CA 5DAPA 3OPZA 1OA4A 3VBUC 3WVJA 1W9FA 2JJ6A 2E51A 4P9XA 3ZSLA 1BVP1 2ZA9A 3HAGA 4XFGA 4XF3A 2V72A 1X33A 1WW5A 2W5FA 3VLBB 4NHKA 4CEYA 5JR2A 1TME3 4XUPA 4B29A 4NOTA 1NT0A 2V4VA 3IZOA 3W59A 1YQ5A 3GNEA 3POSA 5C71A 1YXWA 2GC2A 3IWZA 3FJSA 4HK8A 3M3QA 3K77A 4BA6A 1BKZA 3T3YA 1JI6A 3FBMA 3AC0A 1V6JA 4NVPA 4YZ5A 1WLWA 2G9GA 5M0TA 5BNPC 4CDWA 2C1FA 4XXPA 2OT7A 4YGBA 2ADEA 2ZZJA 3JBG3 1DQ5A 2WAAA 1NCQB 4R52A 3VB9A 3A4UA 4QMAA 3NQHA 5K0UA 4WM8A 2IVJA 2K0GA 2VZRA 2ZGSA 3VD7A 4MLOA 4NJ4A 5IK8A 3UGGA 4PCRA 5A3NA 1UYZA 2OQ7A 4TLFA 3ZXGA 1YFWA 2W52A 1PVXA 4S2HA 2B42B 2XJUA 1S2KA 3NNJA 1CPNA 5LZ6A 1PZ8A 1WMFA 1XE8A 1AXKA 1N1YA 2B46X 2DVGA 5D8AA 4FPFA 1PK6C 4ATEA 2E6VA 2Q5TA 1RUI1 2E33A 3HT2A 1HQNA 1ULEA 4MGYE 1VBD2 3BOPA 3VBUB 5FPXA 3VBOA 2ZEXA 3OGVA 2P17A 1K12A 2XLFA 3U07A 1K5MA 1SG3A 4DO0A 1YC61 5EJZB 2HYXA 3AKSA 5LBFA 1R1A1 5CKMA 1ZM1A 1W8NA 2I45A 5F3EA 3TYJA 3O1OA 1KXGA 3FFZA 4FPGA 1ZZBA 3AKRA 2QUOA 3W5MA 1Q8OA 3LE0A 3ZO0B 4NAMA 3RS6A 2VZSA 1MVEA 5IVBA 5EQUA 4Y4YA 4IE4A 4QKNA 4QD2A 1X82A 5J09A 2GN3A 4WVMB 3USUB 3QACA 1ULOA 4BJ0A 5H9QA 2PAKA 3CF6E 1F5JA 2IXLA 5FYHA 4AI1A 4ES8A 1UZYA 5BNPB 1B09A 2YBSA 3FUOA 1GUIA 4B4QA 2QQNA 4NIIA 3ZMOA 5LW9A 1H8VA 2Y64A 3KLSA 4XHXA 3EYPA 3BPSA 2AEYA 3V64A 2DWRA 1ZRRA 3B7MA 4LA2A 1IQDC 2MEV2 1C3HA 1DZQA 1F31A 2K46A 2CDPA 3MW3A 1RUJ1 4H7LA 2J1AA 2J22A 4QQHA 3S7IA 4G4FA 1FV2A 2WZR1 4LIUA 2HYKA 2ARAA 3DKWA 4UW3A 4C91A 1FATA 5EV7A 5HI0A 2D3SA 2ZKLA 1GOHA 3NSTA 5GLTA 1SQ4A 3NAPA 3NJXA 3Q8AA 4GWNA 4LULA 2XVKA 3BU7A 3KWVA 1AX0A 1PK6B 4LO5B 1J3QA 4QQPA 5F39A 5FZ7A 3SH3A 3U14A 3VBFA 1VBE1 4DXSA 4Y1YA 5A32A 2ZPXA 3IAQA 2BERA 2ATFA 3PMEA 3AMHA 1WWYA 1ZYBA 3VHPA 2VZ3A 2Z79A 1B35A 4IEWA 3ZKYA 1RHI1 2WR9A 1W3XA 4BH9A 4E4SA 4NR1A 1WCUA 3OBTA 5FYBA 2IXKA 4LLOA 2VGDA 2WABA 3DYOA 2QDNA 4Q0SA 1ACCA 4Z82A 5F8PA 1BVVA 1QEXA 4OHXA 5HV4A 3QBQA 1RUJ2 3M3OA 5BNQA 5L9VA 4FQ4A 2WZR2 5ACA3 4QB6A 3IAPA 2ZHNA 2DVAA 2HEWF 3O14A 1QJY2 3KQ4B 4QX3A 2WKKA 5ERLA 1GQGA 4YM0A 3VZKA 3POYA 1HQLA 5JPMB 1X8EA 2VXJA 4HK9A 1UPIA 3QH7A 2BNMA 4CCEA 5IUQA 1LTEA 1CIWA 3LWCA 2GH8A 5C7GA 1VBE2 1H2LA 4QU1A 2Q8DA 2Q30A 2W1SA 1X50A 4XIKA 4IE7A 5FXVA 3SQOA 1T2XA 4K8RB 4RS5A 2A3YA 4Q26A 1RUI3 3DCQA 1N1VA 2MNGA 2F4LA 3MLKA 4N53C 3QLQA 4WZFA 1UW8A 4XUNA 5A33B 2XDVA 4LKSA 3VBSB 2C24A 1XOYA 2A70A 2DU0A 1W8TA 2VECA 1CD3G 4IEPA 4BQWA 1R1A3 4MZUA 3N4MA 2R0HA 1ZZ9A 4DB5A 2JX9A 1OVPA 4AQTA 4NPRA 2XUMA 1ZBA1 1XQNA 4L9BA 5LBCA 4WM7C 1LHOA 4CP9B 1YI7A 2PHRA 3RNSA 1GZWA 4P9GA 1BK0A 1YFXA 4A3ZA 3VKNA 4NE9A 4C0HA 2IXHA 5A7WA 3KV9A 3PHMA 3RI8A 2A73B 1BJQA 3SLIA 2VVEA 4F7ZA 2JECA 4X8PA 2GNDA 1HV0A 3ES1A 4CDWB 1W6OA 4QGMA 4Z2WA 4AXOA 5JI7A 4AGGA 2BP6A 2XONA 1W05A 1V0AA 3A22A 1RUJ3 1D0HA 1IPJA 2FDGA 2DCYA 5APAA 5FOJB 2OS2A 3D5OA 1NZIA 4C8DA 1DGWA 3V0BB 3KMHA 2XG3A 4FFIA 2RG4A 1QJFA 3NW4A 3FLPA 3V56A 1ZBA2 5EP9A 1UU4A 3D3AA 1YCIA 4Y1ZA 1LB2A 2ILMA 3C7GA 5BNNA 4EV0A 1F5FA 4PDWA 3VBHA 4D0QA 2LALA 5FV3A 1DDLA 2VZQA 4OQ9A 4FOYA 3VD5A 1DZRA 1YEWA 2DURA 3MPPG 4M3CE 5JOXA 2WT2A 5GZEA 4NPMA 1RHI3 1SMVA 4TZDA 4XFAA 4XBNA 3N35A 4LBJA 4OVEA 3I59A 3N7LA 4A44A 1W3VA 1ONAA 3PU3A 2GC1A 2ERFA 3GHMA 3LEGA 4QXBA 4EE2A 1JZ3A 1UU5A 4YVSC 4WM7B 5GLUA 1O4TA 4UF0B 5FZ6A 1I9RA 4CXYA 4JAAA 1POV1 1SLTA 1QJX1 1GNZA 1U5XA 1BK1A 1Y7BA 2WL1A 3PTYA 1H4HA 1RUG1 1ZZCA 2V5DA 4LO7A 3VD3A 3PTRB 1MEC2 2EIEA 3BN6A 2NPIA 2PHLA 2BEOA 1OQ1A 1SPPA 2RDSA 1V6IA 4UOJA 1LEDA 1BLZA 1MS8A 3PVNA 2G1MA 4JGYA 3OBAA 3IN9A 4RQPA 5FXXA 3VZNA 3WF3A 4YNIA 5ABJC 3N36A 4DMIA 4JZRA 3U37A 2PHWA 2V5YA 4ARXA 5FZOB 3JB8A 4F83A 1Y9GA 2WSUA 2Z2SB 5L7OA 3VD9A 2BNNA 4Y22A 3VKMA 2D7FA 2ZGQA 4OHWA 5CISA 1GU3A 1WZXA 1S0GA 3Q8CA 4V2VA 3RYPA 2Q8OA 3KF3A 3WNOA 3I2KA 1TZOA 2AUYA 5F7UA 1W9WA 1AYM2 4XC9A 3P6BA 2HWE3 3WEZA 2XHNA 5JZGA 1MS9A 2BVVA 4N9HA 4EN6B 3KB5A 3VKLA 5J7MA 3C2UA 1GOGA 1YIPA 1T6BX 2YMZA 3B01A 1UNBA 3WDTA 4JTNA 5J98B 3AMNA 4AR2A 2PN5A 1ENRA 2W39A 4EN7B 2XBO2 2ZGMA 5KHKA 1KJLA 1QDCA 1LJ7A 4YVSB 1RITA 5C9AC 1WW6A 2XH6A 3DEMA 3IT8A 2P3YA 1KEXA 1GFF2 3I4IA 2WWJA 5FLIA 4BK5A 5LA9A 3HMYA 1DU3D 2F4PA 3W9AA 4MGTA 1IKQA 5FCCA 5K9YA 2ZABA 4GB32 2H0VA 1RVF2 2JG8C 1O8PA 5FDBA 2VBDA 4KWJA 3A23A 4QGLA 1V6OA 2ZGTA 4FPYA 1YHFA 5A70A 1JN2P 2JG9A 5EHDA 5GLWA 1GZTA 5FMOL 1OMIA 2VNVA 3H3LA 1CGPA 5C33A 1XNTA 2D5HA 3HT1A 2UWCA 5HXVA 2XOMA 3CDZB 3DXTA 2XXZA 4UBHA 3LEMA 3TRSB 2RVAA 4AAXA 2OZJA 1V9U1 1JYIA 2W9XA 4DUXA 4R4ZA 3ZFGA 5CG8A 3HN1A 5JUVA 5JCTA 3MV11 3LKJA 1DP0A 1UY1A 5JIAA 4ZU7A 1YWKA 1ZA4A 1KDKA 3LIHA 2JDNA 4JQTA 1POV3 3WG2A 1QJX3 3IDBB 1UKRA 1WUVA 2GP5A 1RUG3 3CJIA 3NNLA 3WNXA 1AR72 4HANA 3WX5A 5JAXA 2VCBA 4HXCA 2B9VA 2YU2A 3LF7A 4ASLA 4CA9A 1CZSA 1E5HA 1C8M2 3DECA 4D6QA 1MS1A 3ST7A 5C9AB 1S55A 2VMGA 4AVVA 3PVOA 1C5HA 5A7OA 4B4RA 2GMEA 1EV12 4K1ZA 1W8UA 4XBLA 3SXWA 1DYKA 4Q4W2 3UKNA 3WW4A 1VBA3 2AREA 2GALA 2R061 2W3JA 2A3XA 4Y26A 3ZR5A 4YW5A 5HBAA 5AFBA 1V9U2 2JG8B 1ZRCA 4AE2A 4XMAA 3POWA 3PVEA 5J36A 3UJOA 4Q8LA 1OPOA 4AL9A 2QCSB 1WMEA 4QKBA 5IK7A 5LK5A 3EB7A 2VNGA 3CIHA 2Y6JA 3I2DA 1A8MA 4PBPA 1MQTA 3LPFA 2RS32 5IW0A 4ASMB 1XB9A 2RDQA 4XUTA 3BKZA 5IFPA 1XNCA 1HN0A 2EICA 2R0FA 2WT1A 3POIA 4C90A 3WDWA 3T1LA 1H1MA 1J3RA 2DYCA 4NMIA 3D6EA 3PL0A 5T50A 2UWBA 5F3GA 3AL6A 2YPJA 5IHRA 2W91A 3O7OA 1FV3A 4LJHA 2BPA2 5CYYA 4XF0A 2ZBJA 3D4KA 3K4AA 4DEQA 1OOPA 2EXKA 2W46A 1W90A 3AJZA 5KR7A 3ROUA 1SBDA 4RFT0 4QPGC 2B4KA 4JVAA 1XJAA 4PI2A 5CZKA 2FDJA 3AKQA 2XLGA 5FZFA 5A3UA 4CXXA 1BBT1 3T0DA 2E7AA 1HKDA 4LUMA 1VJ2A 4NWVA 4UAPA 4W8JA 3AP6A 4H7MA 3T1MA 1L7QA 2W68A 4YW3A 3ZYIB 5FPUA 2OXBA 1Z7S2 4EZ4A 2ZX3A 2A6WA 3WNKA 1NCRA 2QBXA 1U5IA 4KBZA 1LR5A 3DGTA 5IFTA 2BQPA 2IVIB 3NJYA 4AFAA 4IE5A 2HKXA 2YBPA 2E7QA 4BQ3A 4OMCA 3ZM8A 2VMHA 2AYHA 3FHIB 5C4WC 3RJRA 3O0VA 1SCRA 2WZEA 2AR6A 4CDUA 4KU7A 1GP5A 3D8CA 3NV2A 2RM21 5F5AA 3RZZA 3VDDC 3ENRA 1UU6A 1BBT2 2GNTA 5LA2A 3ZOIA 1RL3A 2EXHA 4WV8A 4XFFA 4I30A 4XW3A 5AC91 5K8SA 3I3BA 2EA7A 1LKNA 3KVBA 3ZDVA 4FTSA 2R6QA 2XJRA 4M00A 2XR4A 5FZGA 2HJIA 2OVUA 1FOD1 4FCAA 2XB6C 4YM1A 3RZJA 1XU1A 4N43A 5LASA 2R063 2E26A 2G19A 3DPRA 3UESA 3UJQA 1UF2C 4FPCA 4P9JA 3VL8A 4IQPA 2ZGNA 1LU2A 4IGQA 4IV1C 1PMJX 1WGPA 2CWMA 3VGIA 3QOPA 1GP6A 5E1RA 1F8VA 1WMXA 2QZ3A 5KC6A 3DXUA 1QQP1 2GMMA 2O0OA 3B00A 1BYHA 2ZHMA 4TWTA 3HEIA 5GM0A 4UXAA 5KXDA 3ZPYA 4JKMA 3HVDA 1WLTA 1RMU3 4K7JA 1AL21 2XL9A 3O5SA 4CDXA 5A6QA 1ULCA 5AC92 1PM7A 1UOFA 1O8SA 2Q4SA 3IBMA 1IS5A 3I97A 1VBC3 1FOD2 5BPXA 3IKWA 4CCNA 4BZ4A 2YZ4A 4RGKA 1W2UA 4GJZA 3T4VA 2YROA 1VAVA 3BTAA 4RGGA 5C4WB 1FNYA 4OI2A 2XJVA 3MO4A 3JU9A 3AP9A 4AHXA 5C8CA 2ZKNA 1DQ1A 1H2KA 4UYBA 5IWFA 1LU1A 4Q1RA 1WW7A 1URXA 4Q27A 2YV8A 1QOTA 1QQP2 5GALA 5I91A 1JYXA 3KV6A 4I0WB 5FZHA 4FP3A 2D93A 1YJKA 4BLIA 3JQWA 1BBT3 4QAWA 1XC6A 1NQDA 4BQ2A 4FTEA 2G9FA 4ZHNA 1AL22 1S1AA 2WRAA 3FLRA 3LOIA 1NA1B 1COV3 4MG2A 4RR3A 2OW4A 2BOJA 3AFGA 2NLRA 4HG6B 5BNOB 3AYEA 3DF0A 2LRPA 1R091 4IV1B 1HDKA 2MHFA 4XDPA 4ZZ5A 5FKCA 5C8WA 1G7YA 2XJQA 3RWKX 4Y1UA 5H9SA 3GZAA 4GH4C 4XXAA 1OSGA 3KGLA 2A71A 3ZPOA 4ZONA 2XPJA 1OFNA 4JGZA 3KSCA 5AVAA 2ARBA 1M06G 1RXGA 4FOQA 5DZGA 2YYOA 2L9LA 4INDA 5EYYA 2QTWB 3WUCA 3O1RA 3MFAA 4LMFA 5KHHA 3LA2A 5DN2A 3VBRA 4CDWC 1HXS1 2QQIA 5C5TA 1UWWA 2RM23 4CDQA 4XQ4A 2VUAA 4HKLA 4P00B 2XGXA 5JI9A 1S0JA 4HN1A 1Q3EA 4WM8C 3BU0A 4FOWA 5AC93 2PHTA 1W0NA 2B45X 2QQJA 1VRH1 5GZCA 4Q29A 1W8WA 4D6RA 5JSPA 1VAMA 3SH4A 4D8MA 1HB1A 1LHVA 1R092 2TNFA 5BYNA 1AR81 2DVBA 4XZUG 2VOKA 4ARYA 2ZGUA 1K42A 1W8FA 4NWWA 1OFSA 1W6NB 5D8AC 3AMQA 4YVWA 4M0NA 2BFUL 4BOWA 3RZHA 1S0CA 4UFLA 2DVDA 1PO22 3C7FA 3UKTA 4WVZA 3T2PA 2ET1A 1QQP3 2B5HA 3ZXLA 2KM2A 1FXZA 3AM2A 3LA3A 5SV5A 2E63A 3VBOC 5JMOA 3JBG1 5K7PA 3G7DA 3KCCA 1HXS2 4AEDC 2JDHA 1QWRA 3F95A 1UZ0A 2ZHKA 1AL23 2DUPA 3SKJE 5JXIA 3VHOA 2WWSA 1O91A 3B5LB 5A7QA 2ZHLA 2R1BA 4IL7A 3RZMA 2BRTA 4B7EA 4XOGA 5EJ1B 1YFYA 2NP0A 1AVBA 1VRH2 3ATGA 1PX3A 3HWJA 3HQUA 1WMDA 2PAEA 3P3PA 4XE9A 4BU2A 3ZYHA 1OA2A 1MZEA 1CAXA 1MACA 3BGAA 2FDHA 3GHNA 4HLTA 4BXFA 3SNMA 1AR82 3H3UA 5F6KA 3AP5A 5A1AA 4Y33A 2FMYA 2QQVA 5FP8A 1N3QA 3OG2A 1UOGA 2VUJA 4M4PA 4PLNA 4YM2A 1LGBA 3M1HA 5T5JA 3B9CA 4QDRA 2YB7A 2GU9A 1VPHA 4AYUA 3FX3A 5FR3A 2JE7A 2P34A 5IK4A 1LOFC 3PUIA 3E6CC 1U0AA 2RHPA 4IETA 4WM8B 2ZACA 3KCYA 4KMQA 5HPOA 3HOBA 1ZRDA 3AVRA 2X05A 1ZA7A 3JBG2 1RTVA 1NUKA 4DUVA 4ZPIA 5KXEA 4TYSA 4LOSA 5FPBA 4CEWA 2AH2A 5FZ1A 2D97A 4IEVA 4JRLA 2ZJCA 3RMYA 3WG1A 2VU9A 3S57A 3BOWA 4XJ9A 3SMHA 1CAUB 2D6OX 4PJYA 5D8AB 1R093 1W0OA 4LBQA 5C5UA 3VBFC 3ZSJA 3MPBA 3LFMA 2VULA 3AZVA 3MW4A 1CJDA 4Q4Y3 3O1MA 3I7DA 2JENA 1ZZ8A 3THPA 1RJ7A 4EQVA 4COZA 3VBOB 1H9PA 3WW3A 5GZDA 2WSVA 2DU1A 3O0XA 3LCPA 5BY5A 4L11A 1ND3A 2GC0A 2QE3A 1W28A 3FWEA 3JUUA 3UYJA 5T54A 4E27A 5IYYA 1JW6A 2VQAA 4K6BA 4AVSA 3WNLA 4LBQD 5FYCA 1GKBA 4CU8A 5FREA 5B4XA 5EFUA 2WA4A 2WNVC 4Q4X1 3WD5A 3OYWA 1DQ0A 2YC2A 4BMBA 4E2QA 1VRH3 3EO6A 3ZSKA 1RUF1 3S5AA 4MGZE 2EXJA 5FJKA 4QHOA 2A1XA 5FIXA 1AR83 4W4ZA 4XJAA 2ARCA 1OH3A 1GANA 1LEMA 2N7GA 1RUH1 4KU8A 3Q9OA 2EIBA 4NROA 4B8EA 2RS13 2HWD1 2D44A 4O9GA 1I5PA 2V73A 4XF4A 4AQ2A 2C26A 2JKBA 2B8MA 1AR91 2ZXQA 3FC0A 3V0AA 2NYYA 1MZ6A 2VC9A 4ZS3A 3DYPA 4Q5OA 1YRZA 1CESA 4WBBA 1O7FA 4KWKA 3LEKA 3HPNA 3K46A 3VL9A 1W2OA 5ACA1 1N1TA 4XDQA 3VBFB 1KQRA 4Q0PA 3ZXFA 5HCBA 1RJ8A 4Q4X2 4NHMA 5A32B 4PIZA 5GJ6A 1MS4A 3D82A 4MGSA 3H7YA 1Q8PA 2X8KA 3ETQA 1PM4A 4TLGA 5FZBA 1IGOA 4AVBA 2WINB 4P9IA 2C0ZA 4Z07A 1RUH2 1L3JA 5TSWA 1JOBA 4AI0A 4LO6B 4YW6A 3KVAA 3L9JT 1DLLA 2B9UA 2Q1ZB 5LA0A 5KC5A 1LESA 1JHJA 2WNVB 2R32A 1UXZA 3LA7A 3TWIA 4N7UA 2WC2A 4YZ2A 1VRBA 1AR92 4IE6A 3J7MA 1VBB1 4UW5A 4UFIA 2XJTA 1DGRA 2JDAA 2VJXA 1O59A 2XKOA 4LHNA 4XFIA 2VOXA 4MADA 5FMCA 5FZ4A 1D0GA 5ACA2 2X5IA 1UYXA 3FFQA 1HJGA 2Z42A 4A7KA 2GDFA 3H1YA 4NN0A 1JUIA 2WN3A 1BQPA 3IPVA 1OUXA 1XNKA 2VVDA 1CAWA 2WUHA 2Y6HA 3LD8A 5FYYA 2KD7A 1JYCA 1AL0G 1U5YA 3THDA 5EJ3A 5BNNC 3VBHC 3LOBA 1A78A 3E5UA 1YQ8A 4BK4A 3HJRA 5CBLA 4I09A 3I54A 2A6VA 2EAKA 1RUI2 4LITA 4DXTA 4FPLA 3TNQA 1T6GC 3OB8A 4GULA 3MFCA 4KG0A 4GD4A 3NJVA 1R081 2ZOEB 3A0NA 5IJRA 1VBB2 1QNYA 2C5DA 4Y1VA 4BPZA 5IVFA 3BUCA 3HN3A 4O65A 5IVEA 1R1A2 1JZ8A 3BTYA 4BQ5A 1Y9QA 1GZWB 1ULFA 1S0DA 3I3QA 2UURA 3O12A 4HSLA 4LE3A 4Q4X3 4QX1A 3VBSC 2VCAA 5LA1A 1IZ3A 1N47A 2E9QA 1CONA 1RGSA 1RUF3 4PIYA 3FE5A 3TB0A 4H3WA 2ZAAA 4ES9A 3WCSA 3NKGA 2AENA 5C8CC 1LCLA 4RQPC 2Y6KA 4HKWA 1RUH3 4YG0A 3DV8A 4F8AA 4W65A 4K1YA 2HWD3 5DAWA 4IEOA 4QX2A 2PMWB 3VDBA 1FPN3 2I2SA 3GM8A 3I2HA 3CEWA 4YRDA 4QHBA 1AR93 4Y4RA 2A5ZA 4GMP0 4BMEA 5EXOA 4P5HA 4AAPA 3H8XA 5A7NA 1GSLA 5SV8A 5BUVA 2WN2A 1UZVA 5F3CA 2PAMA 4LE4A 5BNNB 3VBHB 1WA4A 1W39A 1D7PM 4YYOA 3J4UH 3OGGA 5A80A 3VZLA 2AACA 4LBMA 5JZGC 1OUSA 3LFIA 2VVFA 2J1SA 4ZU5A 5C3SA 1D2SA 1O3RA 1W6MA 3ZFFA 1NKGA 3WQBA 1DQ2A 3Q8BA 5L9RA 3IMMA 3LIGA 3I59B 3OGJA 1NQJA 1ENSA 4P02B 3WG4A 5LRSA 1VMHA 1LOCA 1OLMA 2QQPA 3S6PA 1RHI2 1UL9A 2QVSB 4CU9A 3PDQA 1RINA 3VBUA 4W6XA 2KXLA 4UWDA 2IXIA 4HETA 1HB3A 2X10A 5FMBA 1QNWA 1SFYA 1VBB3 2VQTA 4HL0A 2A75A 2WZ8A 3BTXA 3RYKA 5A6ZA 3CU7A 1SPPB 2ET7A 3ZFEA 2PXJA 3POBA 2HWE1 2W47A 2AC1A 4JGYB 5EZWA 3VV1A 5C8CB 5I8TA 4RQPB 1QGLA 2CNAA 4UFMA 1H8TA 2NM1A 3PMSA 3EJKA 1NOVA 3DN7A 3NV3A 2LUWA 1AX2A 1MS0A 2LM3A 4LTAA 1SCSA 5A6YA 1WCQA 4FP2A 4Y22B 4GZ9A 1OLME 2RS51 4UFJA 1HLCA 3RWNA 4M3CA 3WW2A 4AEJA 1FAYA 2Z69A 3PLQA 1OF4A 1JMUB 5J96B 4AFDA 5KXBA 3CBNA 4XQWA 3F2ZA 4H14A 1JZ2A 4IDZA 1R083 1YFUA 4URAA 3DKQA 2WQ4A 5KBFA 1NY71 5JZGB 4J1XA 3ZN4A 2J1TA 1PHMA 1KD7A 1UX6A 1UAIA 1V00A 3OOXA 2HWE2 3H1WA 3CJIC 3SC7X 3LSEA 4IEYA 4P5YA 4ATFA 3TEWA 2UWAA 1FYUA 1QY4A 4AF9A 2W95A 3WHUA 1WD3A 3KCXA 1S2BA 4JDNA 3WINE 2QQUA 1S0FA 1CVNA 1ZZ6A 2YPDA 3OUHA 4AQ6A 4AVCA 1YI9A 5FQ0A 2JDPA 2QQMA 4DPNA 3N3HA 2Y33A 3PNAA 3WCRA 4AFMA 3SCHA 4Q0VA 3PU8A 3U4XA 4MOAA 5CVRA 1US2A 2PTMA 1SZBA 2O14A 3L2HA 4ZU4A 5FPAA 2PQSA 3OTFA 3WF1A 2A3WA 3WV6A 1QOSA 4I0AA 4NRPA 4AVTA 5G04L 1RXFA 2WA3A 1CQ9A 4N7IA 2P1BA 4J25A 5ANNA 2E7TA 2Y8KA 3TNPB 5J37A 1UMIA 4Z92B 1APNA 1G9FA 2PLV3 4R9CA 1CZTA 2HWB3 4QX0A 1RB8G 1GWKA 1QJU1 1YQ2A 2J1UA 5D2AA 4M01A 5EPAA 4OZOA 4QPIC 5F6LB 1JZ6A 1KDMA 4V2WA 4XACA 4W6YA 4Q4V1 1VBA1 1WA6X 3CNAA 4GIQA 2VQUA 3UETA 1ND2C 1RUD1 3Q8FA 4SBVA 2ID4A 1IG3A 1V6KA 2JE8A 3FL7A 4FVVA 5FYZA 3OUJA 3WF4A 4EN9B 3EXUA 4XFCA 5L7OB 4FPJA 1V70A 2WNUA 3TEXA 2CDOA 3CJIB 3FN9A 2WLQA 4CU6A 4DQAA 4W50A 3NL1A 4AGRA 1QJX2 1IOAA 3PUSA 2OUJA 1RUG2 5IT6A 1JH5A 5GZFA 3UV9A 4BIOA 4YFZA 3NWKA 3GZEA 3RFRA 4OFGA 1XYOA 5CFCC 4BQXA 4GJYA 1Z0HA 3D0SA 1IHMA 1ZBE1 3WDXA 4XF1A 4AI2A 1JS9A 1RUE1 2JWPA 2WYFA 2YGMA 4OI1A 2GZWA 2RS53 3M7AA 2Z4FA 4PF1A 3W5NA 1QJU2 1WCSA 3OEAA 4P08A 2FBEA 3KT4A 3UGHA 2J1EA 4BQ4A 5ISLA 4UFHA 4Q4V2 1VBA2 3HIFA 4C0BA 1GWMA 2CAUA 2VTXJ 4XF9A 2VCMA 1G9DA 3CHXA 1HIXA 4OI0A 1D2QA 3O1PA 1GLHA 3LDRA 1QHDA 5F5IA 1JYNA 1G6NA 1MQTB 1XRUA 4NIHA 4MHUA 5FTTC 2I07B 1IPKA 1H2NA 1NLRA 4CCOA 5I0RA 4FFHA 1YJLA 2WNOA 1DLCA 4YZ4A 2FMDA 2JDMA 5FZKA 4QPIB 4NRQA 4Y5TA 3THTA 4CDUC 2DCZA 1QJZA 1S0IA 4OQ8A 3BALA 3PJYA 1PZ7A 4N53A 4QPWA 3UK9A 5FZLA 2XWBB 1QH6A 2TBVA 1ND2B 4RL7A 3SITA 2XVGA 1JZ5A 4PQQA 3C3VA 4XZPA 1NLSA 4NAOA 2YG0A 3BB6A 5FUIA 4OULA 2FDFA 5LK7B 2JKXA 4K40A 4YARA 1IS4A 1Q5OA 3AMMA 5FBZA 1A34A 4JHTA 3GGLA 1BMV1 4XDOA 1AYN1 4Y1XA 4WM7A 1FMD3 5JWPA 4TN7A 4ASKA 4XMIA 5CFCB 1YQCA 4QKDA 2G4IA 2X29A 4M0HA 3CKHA 3KT1A 5C70A 4YW2A 4MYEA 1WCKA 3MIDA 3WQ0A 3BI3A 1UY3A 1EAH1 1E5RA 3U0ZA 3KHCA 3MZHA 5T3NA 1XPWA 5FXZA 2IWGB 5H9RA 4XQDA 3TN91 1DF0A 4GKYA 2MPFA 5T5LA 1REFA 4D7YA 5FXWA 3ZXEA 5L19A 1L7LA 1AHSA 1EY2A 1W99A 2E53A 4HPKA 1QJU3 1NCRB 5FZOA 2Y0IA 5CFDC 1LNSA 4XIOA 4B4PA 1A8DA 1EUUA 4D7SA 5A3PA 1XNAA 4LUKA 4Q4V3 3A21A 3WG3A 4LXLA 1ALYA 1SACA 1RUD3 2GP3A 4LOTA 4JV4A 4NRMA 3GZUC 4QX5A 4Y20B 2HWC1 2VZTA 1W2AX 1GZ9A 4K8FA 4Y24A 2AZ5A 1FT9A 2QDRA 4ZZ8A 3LSDA 4CDUB 3GCXA 2QQKA 4QB1A 1ODNA 3NNMA 1VP6A 2JEMA 2R1DA 3K75B 1AX1A 3GF6A 1SDDB 3SISA 3V65A 4COVA 4Q0QA 5FZ3A 2E31A 3POJA 4PIXA 1RMU1 1GBGA 4META 1UOJA 2BDRA 2XQRA 1PNFA 1ZBE3 2ZX4A 5GLVA 1RUE3 1EP0A 4S2FA 4N43B 3OSDA 4LBNA 2XQXA 2YU1A 3DPRB 4XCBA 2ORZA 4YVSA 5FO7B 4CCLA 3K51A 1FX5A 5D1IA 1VBC1 2JD9A 5C3PA 3OGRA 5LY1A 4IEQA 2BBAA 3TOJA 1ZREA 2VMFA 2R062 3KZ4C 5HCHA 5FP7A 1CJPA 2EXIA 2R073 3T2QA 4PQ9A 2QKDA 3MDPA 4PHZA 2C9AA 5C6CA 4CP0A 1IPSA 4L2NA 1NXMA 1MZ5A 2I74A 2RE9A 1ZNPA 4XJ8A 5ABJA 4G9SB 1ULDA 2WQ8A 2A6XA 2FQPA 2WNEA 1IS3A 2WS91 1DIWA 5CFDB 1ENQA 3EQEA 1W8OA 3MEPA 4HOOA 1CZVA 4RFRB 5I0TA 5FO8B 1RMU2 3BPZA 5FZ8A 1EPZA 1JYTA 1COV1 2VD7A 2QFEA 2FCVA 2VW0A 1CAVA 4M4RA 3WSOA 1PZ9A 3HBZA 4LO4B 1VBC2 4P9WA 3PIJA 4E8CA 4M3CF 5AVPA 4X6RB 4CCMA 4F3JA 1IKPA 2TUNA 2WDBA 1WLCA 3L2YA 1AYN3 2WWUA 5FPVA 4EWDA 2BW8A 2OKXA 3ZSEA 2DTWA 1SLLA 2RDNA 4QWNA 2EF6A 3N9NA 2OIIA 5LATA 4YVWC 3ACLA 3P3NA 3GYDA 2BTVC 1Z78A 4XUQA 4A3XA 2GAUA 2BZDA 1EAH3 1N3PA 1SBFA 1UZZA 3MYXA 5FZCA 1IS6A 3AYAA 2WS92 3ZLIA 1ZVFA 4RR3B 2X09A 3MUY1 4GQ7A 4I3GA 1GQHA 3TN93 3VDAA 4DXRA 2BWCA 1WBFA 2Y26A 5JLVA 5C9AA 5FJHA 5CKNA 4QT6A 1K5JA 1MVQA 3SCGA 1COV2 2J1VA 3WF2A 4B1LA 2D3RA 3ZXDA 3OGSA 1C28A 2ZX0A 1AZDA 2D6PA 4EWEA 1TE1B 1RYYA 2D6NA 1E5IA 1H1IA 4Q0UA 3ZX7A 4CP1A 4HVQA 2BNOA 2O8QA 3AVSA 1NA1C 3MIBA 4JGZB 4QX8A 2OPWA 4DY5A 1WLDA 4MVTA 4E2GA 1H9WA 5FP4A 1CPMA 4QXHA 2HWC3 4NIDA 5BNOC 5HXMA 2YY1A 3ACFA 5IATA 4LBLA 5FP9A 1SBEA 2RMU1 1W6QA 3VBRB 2ADDA 1OH4A 5FK8A 5A1LA 1MR5A 3RYRA 5F9TA 1NG0A 2R7EB 2QQOA 4L0PA 1QMJA 4K20A 3CQOA 1PGSA 4OMDA 4UI9L 3RG0A 1O3TA 2F6BA 2RM22 2ZX2A 5A3TA 4XYXA 2W1QA 3CL1A 3DUIA 4CEWC 1ZRFA 5DPNA 3GALA 1VMFA 2ZS6B 3IMNA 4GXLA 4K3UA 1UXXX 1Y43B 2VBBA 1HRV1 5DAVA 3A0KA 4MH0E 4LNVA 4YZ1A 4LK6A 4YVWB 2W2IA 2WJSA 3HQRA 3ZYFA 3CO2A 3K2OA 1ASJ1 4XFBA 2WFF1 2LTNA 1JTZX 2PQQA 2RJLA 1UQXA 2RMU2 5EIYB 5JSOA 1US3A 5DMYA 4LLFA 4BIFA 1LOEA 3RZKA 1ND3C 3IDCB 3MUZ1 5BV6A 2WS93 3DYMA 3KHBA 2DCKA 5JDBA 3POGA 2BGPA 1JZ7A 3BCWA 1CAXB 3WW1A 5GLZA 1WW4A 4YW7A 3OEBA 5LB6A 2BOIA 5A3OA 5CB7A 3H1MA 1SDWA 1POQA 1AJOA 4D7TA 3ZYGA 4AHYA 4CEYC 1WBLA 1SLIA 5J3UA 1EPWA 3LAGA 4Q4Y1 1S2EA 4MHRA 5LRRA 1JXNA 4YLZA 5FYIA 2GC3A 4UBGA 5FK7A 5EWSA 3E1F1 1AR61 2JDYA 3JD73 4JKKA 4AI8A 5JOYA 4COWA 3I49A 1UKGA 3RPQA 3T4HB 5DDJ1 1LHUA 1G9CA 3K4ZA 5FYSA 4S2GA 4OUMA 4CCDA 2VL4A 1W0PA 4L8QA 4CEWB 1KJRA 4XBQA 2DV9A 3KD4A 5CU1A 2D98A 2WQZC 5JOWA 5K0UC 5T52A 4LQRA 5FPLA 2ES3A 1EYBA 2VH9A 1I6XA 4FI9A 3R0RA 3GZTB 1GP4A 2WO1A 3U1XA 3MLJA 2FZ1A 1YUDA 4U36A 2JB4A 4QPGA 1W9SA 3S0MA 4Q4Y2 3AB0A 3PUAA 3MLLA 3OY8A 4LEJA 3AX4A 1ND3B 4GWJA 3RDIA 2UU8A 2V09A 2RS11 2RMU3 5CAZA 3K3OA 1AR62 1BHGA 4FFGA 5FFOC 1CN1A 5DUUA 3JQXA 4HMZA 2FCUA 4B3NA 4FT8A 2EALA 1NXD1 3OYWB 1DGRN 1K5MC 2GNMA 2W0XA 1DHKB 3NNGA 3RQ0A 3THCA 2VQ0A 4CEYB 4KL1A 3B9IA 3N7MA 2VCCA 3T2OA 2ARXA 2ZGPA 2X5IC 4CCJA 2HEYF 1YNAA 3RSJA 4CXWA 3IB3A 4N90A 3KM5A 1HRI1 1KFUL 3UGFA 1HRV3 1REEA 1KITA 2VZPA 3PJQA 5FZMA 5C4WA 3ZXJA 2V4AA 3EMRA 2VNRA 1ASJ3 4ORFA 4Y5Z0 2JDKA 2R49A 2WFF3 3VDDA 5GZGA 3ASIA 1UYPA 3V0AB 2RS12 1AUYA 4DIQA 3BYWA 1O6UA 1H0BA 3WP3A 3OBRA 1G8WA 5K0UB 1PIV1 1Q8VA 5H9PA 3MIHA 1PMIA 1CR7A 1GOFA 4GWMA 2WO3A 3T09A 3IM0A 1YIFA 2EVXA 2RR13 3M3EA 1DYOA 4E2SA 4XPVA 4Z2AA 3MIFA 4I01A 4CUGA 1ODMA 2PELA 3I2IA 4LHKA 3P5BA 4XABA 4L92A 1LECA 1UIJA 1NE6A 3ACIA 4AGVA 1QXJA 3NAPC 3N9OA 1LRHA 2W1UA 4MXWA 2KR2A 3I2GA 3WP5A 1BZWA 2DUQA 2LROA 2A6YA 2PHDA 2XL7A 4QHZA 4AWDA 5FPZA 3E6DA 2H6BA 1NZCA 1N1SA 2VY0A 1JZ4A 3JXSA 4ISRA 1AR63 1LOBA 1B35C 2JB8A 2VE1A 4U2AA 1K5MB 1V6NA 2QNKA 3AJYA 5ANQA 5FY1A 5K4LA 4JCKA 3MIGA 1RUC3 5DDJ3 2RDRA 5LEKA 3S7EA 1TMF1 2YBKA 2VTXA 3H7JA 2D3PA 1QJEA 2X5IB 2QJVA 2VZ1A 3MI8A 4MXWB 2VMEA 1QF3A 1UMHA 1YO8A 2OZ6A 1LGCA 3IPVB 1SEFA 1CAWB 2GN7A 4DRVA 1HV1A 3AKPA 5FZ0A 2Q8EA 1NX9A 4QU2A 1YQ6A 3ZXKA 1NLQA 2J7MA 5JMCA 4FAHA 3IDAA 3LEIA 4R9BA 3WY6A 4IV3A 4MUVA 4B7KA 4LKFA 2FDIA 2K2SA 2KA3A 3T2TA 1RUOA 5E8AA 5JXJA 4CVUA 1MZFA 3K48A 3ALQA 3HBKA 3ILNA 4RS5C 4DNYA 4BDVB 1FPN1 4K21A 4HONA 3AK0A 3PIGA 3PUHA 1V6MA 2HH9A 1TMF2 4N9IA 3NMBA 2RJ2A 4JRAA 1XSRA 3BIEA 3GCWA 3GDBA 3NAPB 4WZCA 1C57A 2DBNA 2FHRA 1E57A 3ZMNA 1F4AA 1QXPA 3WLUA 5L36A 1TQ5A 4GH4A 1LOGA 1GWLA 3ZFEC 3VHRA 3I3MA 5I8YA 5GKAC 4BCUA 3ACHA 5FY9A 4XTPA 2W94A 1RUF2 1H8TC 1HRI3 1B35B 2CWSA 3INAA 3LDBA 3N9PA 1UZWA 4NHYA 1VBD1 4QX7A 3BODA 3O1VA 1XE7A 4YWAA 5FYMA 4DZGA 5JXHA 5LCWL 4GA9A 3M2MA 4MO3M 4JQRA 3H50A 5FWEA 3X29B 1RC6A 1U5ZA 1LAJA 2BV4A 2GNBA 2HWD2 2YFZA 1FPN2 2YFUA 3NV4A 3O0WA 4CU7A 4K9SA 2HWF1 1PIV3 2WYSA 4H2AA 1M4WA 1OD5A 4URTA 5I8SA 3LPGA 1H30A 1MS3A 5F5QA 3ES4A 3I3DA 3ZYPA 5KHJA 1W6MB 2BGCA 3U75A 2C9KA 1CAUA 3ZFFB 1W6PA 4JKLA 5FOBB 1IG0A 3OCPA 4RS5B 4S2DA 3ZN6B 4LK7A 4KWLA 4PDWC 1TEIA 1JU3A 4R9DA 3CZUA 1XU2A 1OKQA 3AYCA 2DDUA 3P1IA 2MEV1 3POEA 4GALA 4MXVA 2GH2A 5JXGA 3I2FA 4AEDA 1S0BA 2DBIA 2VUDA 5DAQA 2JD4A 1POV0 4HZFA 4XCAA 4XAEA 2ENRA 4XJWA 4QM8A 5C3QA 1TMF3 4AI3A 5IVCA 2HWF2 3ZFEB 4IEUA 3AXDA 4WVVA 1I5ZA 1F2NA 4EJRA 1H8TB 4LORA 5FUNA 3UKVA 5JPNB 1UPSA 4N8MA 1Q43A 4E4DX 1PO11 1SFPA 4IESA 3E5QA 4CPBA 1UX7A 2JIJA 5A7WB 2ZMLA 3S5QA 1NAEA 2P37A 4A2UA 4M3CB 4TXWA 4XFHA 5C3OA 2XLAA 4JGYC 1LOFA 1H1AA 3K3NA 1W6OB 4JHZA 1OKOA 2VNOA 3AZWA 4J1WA 1HB2A 5FAXA 3WDYA 3M70A 2OX0A 2YUEA 5CKQA 4BQYA 5L7OC 3HR9A 1QJY1 2JICA 2VAUA 3S30A 3ME2A 3VKOA 3WF0A 3TEYA 4CPBD 1NCQA 4HBNA 4P14A 1R082 2Q1FA 1JOJA 2XVLA 2WNUC 3M4FA 1G9AA 1BCXA 3O1UA 1UCXA 1J83A 2CGPA 4COUA 4A45A 2VMDA 3JZVA 2ORXA 1S0EA 3APBA 4PDWB 3OJBA 5DUVA 2GSYA 5I0DA 1PO12 2CGNA 1XYPA 2D6MA 4AEKA 1OLQA 1UY0A 4PBOA 5FQ0B 1OLRA 2PLV1 1VBD3 1C8NA 2HWB1 2PYTA 1X8MA 3PVBB 4IEXA 5F2WA 4V1PA 1C4RA 1XSQA 4EYUA 4ZS2A 1WKYA 2F17A 3GXUA 5JSRA 2W1WA 5JOZA 4NIAA 2WNVA 2WZPP 4ONUA 2HWF3 1FI2A 3ILRA 3MF9A 1GICA 3POFA 4A41A 1HJFA 2ZMNA 1OBNA 4OCTA 1ZRIA 2DCTA 5FZDA 1AJKA 4XURA 1A6CA 1QU0A 2W87A 4AFBA 2WBKA 2IXJA 4OHZA 2B7YA 4O9EA 4XUOA 5CIRA 2Y34A 1SHWB 2ZX1A 3B02A 3ZR6A 4FO9A 2JG9C 2PHFA 3USUA 4WVMA 5FLJA 2VZVA 3I3EA 1J1LA 3OD4A 4NHXA 5CNAA 2PHXA 1OA3A 2HWB2 2PLV2 2Q1MA 2VOWA 3HD8B 3I2JA 5BNPA 2DTYA 5FY4A 5D21A 3E97A 2MEV3 4GKXA 4PI0A 1H2MA 4AVAA 4WVWA 1U12A 5JVVA 2P6CA 1UY4A 3VKFC 2WNUB 3WXPA 4HVRA 1ENXA 1STMA 3LZZA 3RMXA 3FMGA 1KS5A 4IW3A 1VB4A 4UT5A 2WO7A 5JIUA 3ZFGC 4JDOA 3KS7A 2VOTA 3KF5A 5LWBA 5DUXA 1S4CA 2NMOA 4X6QB 4LHSA 3WNPA 5IAVA 1PO13 5IVVA 1PK6A 4QQ2A 3VHNA 5F1RA 4E8DA 4CCKA 4D94A 4OUSA 4RYDA 1LODA 5FY8A 2C4XA 2Q0AA 3H42B 4DY3A 4D3WA 1CX1A 2OQ6A 2RS52 4RA0A 4OUEA 3A7QA 1TNFA 3ZN5A 3J9SA 3C7OA 4A6OA 2D6LX 2WZR3 4PLOA 2H0BA 4LR4A 1JBCA 1QJY3 3B69A 4BWOA 4CCCA 1FMD1 2BJSA 1MEC1 2JIGA 1JYWA 1SLCA 2WAOA 1Q8QA 3AL5A 4FPOB 4TTGA 4R8HA 4LKDA 1NY72 4UW6A 2JG9B 3ORJA 2W08A 1VBE3 2Y60A 3J7HA 1UYYA 4PLMA 4N53B 1K45A 5KXCA 4IUGA 3WP4A 4OHVA 4DRRA 1MQTC 5CG9A 2CSGA 5DUWA 3SHRA 4QDSA 4BYYA 5KHGA 3J8F1 3DL3A 1VLNA 5DG1A 3U11A 2P3JA 3UL2A 3M3IA 2VMCA 2CAVA 4QPYA 1TNRA 3HQXA 1C5IA 2ZEYA 1LENA 5FP3A 1E5SA 2SBAA 3WZ1A 1PMHX 2BYVE 3ZFGB 1PVC1 1ST8A 2AEZA 5KWRA 4KWUA 3BIWE 1CWPA 4LHLA 1GNYA 4ZY9A 5A33A 5HV0A 2UY9A 4BB3A 5A3WA 3VBSA 1AYM1 2QQWA 4DINB 4IE0A 2VZUA 3SCFA 4CUCA 3LQCA 4DEVA 1FMD2 1OOPC 3WOGA 4A7YA 4MGKE 2YC0A 1SFNA 3LDKA 3WDVA 1P8JA 5IVJA 5IK5A 4Z1VA 5E89A 1I3HA 3ETPA 3J7NA 3WQ1A 1O5UA 4MGQA 5IVYA 4CP9A 1R1ZA 2SLIA 3GBWA 4A4AA 2XBO1 1O5LA 4HPKB 5FYVA 5J1XA 1D4VB 2ZGRA 2ZMKA 3HNMA 2BBVA 1IQAA 2YGLA 3J8F2 5FRAA 3JB4C 4AG4A 5G05L 4FPEA 3R4UA 4P9LA 3FBYA 1KFXL 3C8XA 3R05A 4R4XA 4YG6A 1DYPA 1Q8SA 5C3RA 1PVC2 3VD4A 3H8RA 4FSJA 4TSVA 1VAKA 4GB31 1C1FA 1RVF1 1RUD2 2R071 2VTFA 1NCRC 3B93A 5FZAA 2BWAA 5IAXA 5DXDA 3NO8A 3RZLA 4RN5A 4YM3A 5DQ0A 4GMP1 3WHTA 4A42A 1ZBA3 2ZEWA 1G86A 4YGEA 1Y4WA 4A7ZA 3V0BA 2DF7A 2IUWA 4XJZA 4EROA 3OF1A 4HN0A 4JTOA 2RJKA 2O8OA 4AEMA 4HSJA 1PGW1 2O1QA 4HFSA 4UW4A 1YYNA 4FPKA 4XILA 5FMOS 3H3ZA 1JUHA 3H8OA 1AXYA 5F2SA 1ZBE2 2R16A 1DCSA 3E5XA 1RUE2 4YGDA 4ET7A 4XJUA 1W03A 4O61A 2XWJB 3TBDA 3SH5A 1QOOA 5CADA 1GNHA 1OOPB 4IGPA 2CGOA 1AF9A 4DFSA 4QXKA 2K9ZA 2VUCA 4I02A 4JC1A 1JU4A 5A6XA 4N43C 2XJPA 4DXZA 1X36A 2R072 2VM9A 3DPRC 3UNPA 5ABJB 1AR71 4NO4A 1LOAA 1MEC3 3AXEA 4UF0A 4FTBA 5EYXA 3H9AA 4PT6A 3SEPA 3ZN6A 2JDUA 1C8M1 2CYFA 2P4EA 3HNYM 4MV2A 2JXAA 3ZIWA 1FNZA 1BEV1 2R041 4CSWA 5B2GB 2CY6A 5A1FA 2ZGKA 1W8ZA 1DQ6A 2BUKA 3R4DB 1EV11 2OYZA 3ZYBA 1CAVB 1H4GA 1PGW2 3J8F3 4OYUA 4Q4W1 3ZKUA 1R64A 4DS0A 3N9MA 4RD7A 4CDXC 5AFEA 1I1EA 1J1TA 2G9ZA 1QIQA 2Y6LA 3OBZA 4C1WA 1PVC3 3LB9A 1XXNA 5LEJA 2IFWA 3CLPA 4YGCA 2UYBA 3QH6A 5E6HA 1AYM3 3TEZA 1BMV2 1AYN2 1ZZ7A 2RS31 3URFA 1Y3TA 3FLTA 2CHHA 4SLIA 4YPJA 5L9BA 3T30A 1DFQA 4LIVA 2VR4A 4AFCA 1C1LA 4RHV1 1SLAA 2DFBA 5FBJA 3R6SA 2A6ZA 4XETA 2Y38A 1EAH2 5FY0A 2R042 1BEV2 2XBO3 4FFFA 4AHZA 4J6GA 4KBBA 3VZOA 4D69A 5F32A 5FWJA 1W8HA 2B39A 1DGWX 4P9YA 3NV1A 4MSVA 3TN92 2DUOA 4FAGA 1MS5A 2Y6FA 2PHUA 2NMNA 1DGLA 2ZTNA 4UFKA 1J3PA 4IXLA 4RR3C 5I0UA 2WT0A 4HKOA 2XMLA 1NYWA 2BGOA 2D6KA 4OZXA 1OF3A 1W6QB 4GB33 1RVF3 5FYTA 1OC1A 2HWC2 1ULPA 2CU5A 2YC4A 4GMP3 3I2OA 5FUPA 4R9AA 3R4SA 4JGZC 4XHBA 3VDCA 1BXHA 4CUAA 4LKEA 1LULA 4FQZA 2GMPA 1J59A 3G6JB 2IC1A 1UOBA 2Y6GA 2CL2A 4RHV2 4AW7A 4CDXB 1UIKA 2JE9A 3NRUA 3O1TA 3KT7A 4QPIA 4ISQA 3OPTA 5L73A 3VBRC 1Z7S1 2UYAA 3IIIA 1GZCA 5DZEA 4CDQC 5F3IA 1F4HA 1ND2A 4CYDA 5FYUA 3W20A 1Q56A 3T0BA 1VR3A 5I0SA 1UD1A 5JR7B 2P6HA 3VZMA 3GJBA 4BM8A 4IGOA 1DBNA 1SLBA 5HCAA 3B3QE 5J48A 4HVOA 2HLEA 1XNBA 3NVCA 1G9BA 1F15A 1GMMA 4W6WA 3EHKA 3WQ7A 3GBFA 1AR73 4LT5A 4KG8A 3JD71 1DZTA 1QH7A 1HB4A 4KNCA 1VMJA 5CFCA 5FO9B 3NKTA 5LBBA 3USSA 4MGIE 3AFKA 3J26N 4QQLA 4Q8KA 1VB2A 1VE0A 1C8M3 1XBFA 2YDEA 2P2KA 1BEV3 2LS6A 1OVSA 2QQLA 2R043 3ELNA 2QZ2A 1UY2A 1KRIA 1EV13 3N7JA 3EBRA 3VZJA 2UY8A 2OA2A 4Q4W3 1TVGA 4A6SA 2XKPA 2ZEZA 5A7PA 2VG9A 1V9U3 4NHLA 1GQPA 5DAXA 3MHZA 3SEEA 2NN8A 1F35A 3Q8EA 2VOVA 2VW1A 2R30A 3AYDA 4Y20A 5FY7A 4BISA 2JG8A 3QD6A 5T5PA 2XJSA 4B1MA 4CRQA 3ZXAC 1W9TA 4IEZA 3WNMA 4COYA 2RS33 5FKBA 2Q8CA 3HNBM 4FOVA 3JD72 3ACGA 3OUIA 4CDQB 3CJXA 1ZX5A 4RHV3 2FDKA 4JDMA 1VIWB 5E16A 4DOUA 3MIEA 1K3IA 1QXRA 5KHIA 3OD0A 4OI4A 3U78A 1KGYA 5DG2A 4LBKA 1RIRA 3OPWA 3UT0A 3ZYRA 4AQSA 2D40A 4DUWA 2C6SA 4GAZA 4QPGB 1OQEA 1WD4A 3WR0A 2ZCWA 1GV9A 1LHWA 2Z5WA 3LGRA 4BHPA 2FCTA 4EN0A 3OY8B 1PNGA 1MPXA 3ZDSA 1W2TA 1AXZA 2ZZQA 3RZGA 4EWAA 1F9KA 1UO9A 1W9YA 2HBUA 2J42A 2OUHA 2J1RA 2FZ2A 1J84A 4XAAA 4OLLA 2P5BA 4QXCA 5FZIA 1O3SA 4OHYA 3CMGA 1HW5A 5FZ9A 3WUDA 1QDOA 4AI9A 5FLHA 4CE8A 4D6SA 3AZYA 3QCWA 2EIGA 5DZFA 5DABA 2RR11 2BU9A 3M8LA 1QKQA 2IZWA 2NQYA 1UMZA 5CFDA 5CEHA 4I0BA 2NZ9A 3MGUA 3U4SA 2TEPA 1Z7S3 3FHAA 3KV5A 3RJ2X 3T0AA 2EAAA 3U10A 4E9KA 1W06A 2LW8A 3NJZA 1O4YA 4KGGA 4CTEA 1REDA 5A3LA 4JX0A 1D4M1 1HX6A 2Y0OA 4FPHA 4BXSV 1OPMA 1OT5A 4KGQA 2VXRA 1PX4A 3ILFA 1DG6A 1KS4A 3GJAA 5T55A 1HRV2 2E32A 3VDDB 2CTVA 4IV3C 3ITQA 4NUBA 2WO2A 3B94A 2P3KA 2VZOA 1CX4A 2VMIA 4AOCA 2ETEA 4YZ3A 1ASJ2 4HT1T 4AZZA 2WFF2 1RUC1 4XEZA 1JOPA 4X8NA 3RI9A 1LGNA 3ZYJB 4FXKB 2W92A 1PGL1 4YW4A 4CP2A 1W04A 5CA6A 2WLPA 2RR12 3BTZA 1YLLA 3GBGA 2FD8A 5LY2A 2PFWA 2ZAHA 4LBQB 5HCFA 3FZ3A
chains in the Genus database with same CATH topology
2OPKA 3WDUA 4QM9A 4YG3A 2X53S 1D4M2 4LBOA 2DCJA 1PO21 5E88A 1X7NA 4EN8B 2VPVA 4L99A 3ZIXA 2AGSA 2IXCA 2BFUS 2WFPA 4Q2FA 3VN4A 2WIIB 3JCIA 3TAYA 5DDJ2 3W58A 1RUC2 2ZGLA 2HEVF 1PGL2 3H8UA 4KH9A 4AHWA 1RUNA 3IDEA 1A3KA 4XTMA 2BVBA 4QGNA 1GR3A 2DFCA 1FOD3 4RSUA 1TME1 4FXGB 2YHJA 4IV3B 5BXXA 4ZXKA 2JDZA 3IIAA 2A7AA 4ZKTB 4QQOA 3N7KA 1O4ZA 4MX3A 1UN1A 4ITCA 3H0OA 4LO8A 4PF5A 3VUOA 4BQ1A 3KGZA 2P3IA 1V6LA 3WT3A 2D43A 4IERA 4C1XA 4H55A 1DQ4A 1VALA 3ZVXA 3AZZA 4GH4B 4BE3A 5I93A 4YFWA 2ZGOA 1LHNA 1NA1A 4LA3A 4BLJA 4I3PA 1TME2 3AZXA 2H6CA 3AMPA 4I2OA 2CV6A 5BNOA 1D4M3 3AP4A 2D5FA 4IV1A 3AP7A 1XNDA 1OHFA 1HRI2 4RGAA 4AK3A 3WP6A 1JHNA 3RRDA 3I8TA 4KQ7A 3D0JA 2PA7A 1XYNA 1N3OA 2YXSA 1WCDJ 1OQDA 1PIV2 4CZSA 1HQWA 4G3YC 1NCQC 3ECQA 2IFRA 4Z8BA 1GYKA 1O3QA 1W6PB 3FUQA 4YW1A 4FBFA 2VW2A 3MICA 3MF6A 4YSFA 4L97A 4E4ZA 3E6BA 1NE4A 3AKTA 3KQRA 4AEDB 1PO23 5A3MA 3MW2A 2DVFA 3ZFFC 1W6NA 1OI6A 2XHKA 1J58A 3ZSMA 1HXS3 5T5OA 4Q1PA 1ULGA 3M3CA 3VBUC 3OPZA 1OA4A 3WVJA 2JJ6A 2E51A 4P9XA 3ZSLA 1BVP1 2ZA9A 3HAGA 4XFGA 4XF3A 3VLBB 1X33A 1WW5A 4CEYA 4NHKA 1TME3 4B29A 4NOTA 3W59A 3GNEA 3POSA 1YXWA 2GC2A 3IWZA 3FJSA 4HK8A 3M3QA 4BA6A 1BKZA 3FBMA 4NVPA 1V6JA 4YZ5A 1WLWA 2G9GA 5BNPC 4CDWA 2C1FA 4XXPA 4YGBA 2ZZJA 3JBG3 1DQ5A 1NCQB 4R52A 3A4UA 4QMAA 5K0UA 4WM8A 2K0GA 2ZGSA 5IK8A 4MLOA 4PCRA 4TLFA 3ZXGA 1YFWA 2W52A 1PVXA 4S2HA 2B42B 2XJUA 1S2KA 1CPNA 1PZ8A 1WMFA 1XE8A 1AXKA 1N1YA 2B46X 2DVGA 5D8AA 4FPFA 1PK6C 4ATEA 2E6VA 2Q5TA 1RUI1 3HT2A 1HQNA 1ULEA 4MGYE 1VBD2 3BOPA 3VBUB 5FPXA 3VBOA 2P17A 2XLFA 3U07A 1K5MA 3AKSA 1R1A1 1ZM1A 2I45A 3TYJA 1KXGA 3FFZA 4FPGA 1ZZBA 3AKRA 2QUOA 1Q8OA 3ZO0B 3RS6A 1MVEA 4Y4YA 4QD2A 1X82A 5J09A 2GN3A 4WVMB 3USUB 3QACA 4TZDA 5H9QA 2PAKA 3CF6E 1F5JA 2IXLA 4AI1A 4ES8A 1UZYA 5BNPB 1B09A 3FUOA 4B4QA 3ZMOA 1H8VA 3KLSA 4XHXA 3V64A 2DWRA 1ZRRA 3B7MA 4LA2A 2MEV2 1C3HA 1DZQA 1F31A 3MW3A 1RUJ1 4H7LA 4QQHA 3S7IA 4G4FA 1FV2A 2WZR1 4C91A 2HYKA 3DKWA 4UW3A 5HI0A 1FATA 5EV7A 2D3SA 2ZKLA 3NSTA 5GLTA 1SQ4A 3NAPA 4GWNA 4LULA 2XVKA 3BU7A 4LO5B 1AX0A 1PK6B 4QQPA 1J3QA 5T5JA 3SH3A 3VBFA 1VBE1 4Y1YA 5A32A 2ZPXA 2ATFA 3PMEA 3AMHA 1ZYBA 3VHPA 2Z79A 4IEWA 1B35A 1RHI1 4E4SA 4BH9A 4NR1A 3OBTA 2IXKA 4LLOA 2VGDA 2QDNA 4Q0SA 4Z82A 1BVVA 4OHXA 3QBQA 1RUJ2 3M3OA 5BNQA 4FQ4A 2WZR2 5ACA3 2ZHNA 2DVAA 2HEWF 3O14A 1QJY2 2WKKA 1GQGA 4YM0A 3VZKA 3POYA 1HQLA 5JPMB 1X8EA 4HK9A 1UPIA 3QH7A 2BNMA 5IUQA 1LTEA 1CIWA 3LWCA 2GH8A 1VBE2 1H2LA 2Q30A 1X50A 4XIKA 4RS5A 2A3YA 4Q26A 1RUI3 1N1VA 2MNGA 3MLKA 4N53C 3QLQA 4WZFA 1UW8A 5A33B 3VBSB 2A70A 2DU0A 2VECA 1CD3G 4IEPA 1R1A3 4MZUA 3N4MA 2R0HA 1ZZ9A 4DB5A 2JX9A 4AQTA 4NPRA 2XUMA 1ZBA1 1XQNA 4L9BA 4WM7C 1LHOA 1YI7A 2PHRA 3RNSA 1GZWA 4P9GA 1YFXA 3VKNA 4C0HA 2IXHA 3PHMA 3RI8A 2A73B 1BJQA 3SLIA 2VVEA 4F7ZA 2JECA 4X8PA 2GNDA 1HV0A 3ES1A 1W6OA 4QGMA 4Z2WA 4AXOA 5JI7A 4AGGA 1RUJ3 1D0HA 1IPJA 2DCYA 5FOJB 3D5OA 1DGWA 3V0BB 3KMHA 2XG3A 3NW4A 3FLPA 3V56A 1ZBA2 1UU4A 4Y1ZA 1YCIA 1LB2A 2ILMA 5BNNA 4EV0A 1F5FA 4PDWA 3VBHA 2LALA 1DDLA 4FOYA 1DZRA 2DURA 3MPPG 4M3CE 5JOXA 2WT2A 5GZEA 1RHI3 1SMVA 4XFAA 4XBNA 3N35A 4LBJA 4OVEA 3I59A 3N7LA 1ONAA 2GC1A 2ERFA 3GHMA 1UU5A 4YVSC 4WM7B 5GLUA 1O4TA 1I9RA 4JAAA 1POV1 1SLTA 1QJX1 1GNZA 1U5XA 1BK1A 1Y7BA 2WL1A 3PTYA 1H4HA 1RUG1 1ZZCA 3ZN6B 4LO7A 1MEC2 2NPIA 2PHLA 2BEOA 1OQ1A 1V6IA 1LEDA 1MS8A 4JGYA 3PVNA 5C8CA 3IN9A 4RQPA 3VZNA 5ABJC 4YNIA 3N36A 4DMIA 2PHWA 2V5YA 3JB8A 4F83A 2WSUA 2Z2SB 5L7OA 2BNNA 4Y22A 3VKMA 2D7FA 2ZGQA 4OHWA 1S0GA 3RYPA 2Q8OA 2AUYA 1AYM2 2HWE3 5JZGA 1MS9A 2BVVA 4N9HA 4EN6B 3KB5A 3VKLA 5J7MA 3C2UA 2YMZA 1YIPA 3B01A 3WDTA 4JTNA 5J98B 3AMNA 2PN5A 1ENRA 2W39A 4EN7B 2XBO2 2ZGMA 5KHKA 1KJLA 1QDCA 1LJ7A 4YVSB 1RITA 5C9AC 1WW6A 2XH6A 3IT8A 5FLIA 1GFF2 3I4IA 3HMYA 1DU3D 2F4PA 3W9AA 1IKQA 5FCCA 5K9YA 2ZABA 4GB32 2H0VA 1RVF2 2JG8C 5FDBA 4KWJA 4QGLA 1V6OA 2ZGTA 4FPYA 1YHFA 1JN2P 2JG9A 5GLWA 5FMOL 1OMIA 1CGPA 5C33A 2D5HA 3HT1A 2UWCA 5HXVA 4UBHA 3TRSB 2OZJA 1V9U1 1JYIA 4R4ZA 3ZFGA 5CG8A 3HN1A 5JCTA 4ZU7A 3LKJA 5JIAA 1YWKA 1ZA4A 1KDKA 1POV3 3WG2A 1QJX3 3IDBB 1UKRA 1WUVA 1RUG3 3CJIA 3WNXA 1AR72 4HANA 3WX5A 5JAXA 4ASLA 1C8M2 1MS1A 3ST7A 5C9AB 1S55A 2VMGA 4AVVA 3PVOA 1C5HA 4B4RA 2GMEA 1EV12 4K1ZA 3SXWA 4XBLA 3UKNA 1DYKA 4Q4W2 3WW4A 1VBA3 2AREA 2GALA 2R061 4Y26A 2A3XA 5HBAA 4YW5A 5AFBA 1V9U2 2JG8B 1ZRCA 4AE2A 4XMAA 3POWA 3PVEA 5J36A 3UJOA 4Q8LA 1OPOA 2QCSB 1WMEA 5IK7A 5LK5A 2VNGA 3I2DA 1A8MA 4PBPA 1MQTA 2RS32 4ASMB 1XNCA 2R0FA 2WT1A 4C90A 3WDWA 3T1LA 1H1MA 1J3RA 2DYCA 3D6EA 5T50A 2UWBA 2YPJA 3O7OA 1FV3A 2BPA2 4XF0A 2ZBJA 3D4KA 1OOPA 2EXKA 3AJZA 3ROUA 1SBDA 4RFT0 4QPGC 4JVAA 3AKQA 2XLGA 1BBT1 2E7AA 1HKDA 4LUMA 1VJ2A 4NWVA 3AP6A 4H7MA 3T1MA 2W68A 4YW3A 3ZYIB 1Z7S2 2ZX3A 2A6WA 1NCRA 1U5IA 1LR5A 3DGTA 2BQPA 4AFAA 2HKXA 2E7QA 2VMHA 2AYHA 3FHIB 5C4WC 3RJRA 3O0VA 1SCRA 2AR6A 4CDUA 4KU7A 3RZZA 3D8CA 3NV2A 2RM21 3VDDC 3ENRA 1UU6A 1BBT2 2GNTA 1RL3A 2EXHA 4WV8A 4XFFA 4I30A 4XW3A 5AC91 5K8SA 2EA7A 1LKNA 4FTSA 2R6QA 2XJRA 4M00A 2HJIA 2OVUA 1FOD1 4FCAA 2XB6C 4YM1A 1XU1A 4N43A 2R063 3DPRA 3UJQA 1UF2C 4FPCA 4P9JA 3VL8A 4IQPA 2ZGNA 1LU2A 4IV1C 1WGPA 2CWMA 3VGIA 3QOPA 5E1RA 1F8VA 2QZ3A 5KC6A 1QQP1 2GMMA 2O0OA 3B00A 1BYHA 2ZHMA 4TWTA 5GM0A 4UXAA 5KXDA 3ZPYA 1WLTA 1RMU3 4K7JA 1AL21 2XL9A 3O5SA 4CDXA 1ULCA 5AC92 1PM7A 2Q4SA 3IBMA 1IS5A 1VBC3 1FOD2 5BPXA 3IKWA 4BZ4A 2YZ4A 1W2UA 2YROA 1VAVA 3BTAA 4RGGA 5C4WB 1FNYA 4OI2A 2XJVA 3JU9A 3AP9A 4AHXA 2ZKNA 1DQ1A 1H2KA 1LU1A 4Q1RA 1WW7A 1URXA 4Q27A 2YV8A 1QOTA 1QQP2 5GALA 5I91A 4I0WB 4FP3A 2D93A 1YJKA 4BLIA 3JQWA 1BBT3 1NQDA 4FTEA 2G9FA 1AL22 1S1AA 3FLRA 3LOIA 1NA1B 1COV3 4RR3A 2OW4A 3AFGA 2NLRA 5BNOB 3AYEA 3DF0A 4IV1B 1R091 1HDKA 2MHFA 5C8WA 1G7YA 2XJQA 4Y1UA 5H9SA 3GZAA 4GH4C 4XXAA 1OSGA 3KGLA 2A71A 2XPJA 1OFNA 4JGZA 3KSCA 5AVAA 2ARBA 1M06G 4FOQA 5DZGA 2YYOA 4INDA 5EYYA 3WUCA 3MFAA 5KHHA 3LA2A 3VBRA 4CDWC 1HXS1 2RM23 4CDQA 4XQ4A 2VUAA 4HKLA 2XGXA 5JI9A 1S0JA 4HN1A 1Q3EA 4WM8C 4FOWA 5AC93 2PHTA 2B45X 1VRH1 5GZCA 4Q29A 5JSPA 1VAMA 3SH4A 1LHVA 1R092 2TNFA 5BYNA 1AR81 2DVBA 2VOKA 2ZGUA 4NWWA 1OFSA 1W6NB 5D8AC 3AMQA 4YVWA 4M0NA 2BFUL 4BOWA 1S0CA 2DVDA 1PO22 3UKTA 4WVZA 2ET1A 1QQP3 2B5HA 3ZXLA 2KM2A 1FXZA 3AM2A 3LA3A 5SV5A 2E63A 3VBOC 3JBG1 5K7PA 3G7DA 3KCCA 1HXS2 4AEDC 1QWRA 2ZHKA 1AL23 2DUPA 3VHOA 2WWSA 1O91A 3B5LB 2ZHLA 2R1BA 4IL7A 4B7EA 4XOGA 1YFYA 2NP0A 1AVBA 1VRH2 3ATGA 3HWJA 1WMDA 2PAEA 3P3PA 4XE9A 1OA2A 1MZEA 1CAXA 1MACA 3GHNA 4HLTA 3SNMA 1AR82 3H3UA 5F6KA 3AP5A 2FMYA 1N3QA 4CDWB 2VUJA 4YM2A 4PLNA 1LGBA 3M1HA 3B9CA 2GU9A 4AYUA 3FX3A 2JE7A 2P34A 5IK4A 1LOFC 3E6CC 1U0AA 2RHPA 4IETA 4WM8B 2ZACA 3KCYA 1ZRDA 3JBG2 1RTVA 4TYSA 4CEWA 2AH2A 2D97A 4IEVA 4JRLA 2ZJCA 3RMYA 3WG1A 2VU9A 3BOWA 4XJ9A 3SMHA 1CAUB 2D6OX 4PJYA 5D8AB 1R093 1W0OA 4LBQA 3VBFC 3ZSJA 3MPBA 2VULA 3AZVA 3MW4A 1CJDA 4Q4Y3 3I7DA 2JENA 1ZZ8A 3THPA 1RJ7A 4COZA 3VBOB 1H9PA 3WW3A 5GZDA 2WSVA 2DU1A 3O0XA 3LCPA 5BY5A 4L11A 1ND3A 2GC0A 2QE3A 3FWEA 3JUUA 5T54A 4E27A 1JW6A 2VQAA 4K6BA 4AVSA 4LBQD 1GKBA 5FREA 5EFUA 2WA4A 2WNVC 4Q4X1 3WD5A 3OYWA 1DQ0A 4BMBA 4E2QA 1VRH3 3EO6A 3ZSKA 1RUF1 4MGZE 2EXJA 1AR83 4XJAA 1GANA 1LEMA 2N7GA 1RUH1 4KU8A 3Q9OA 4B8EA 2RS13 2HWD1 2D44A 4O9GA 2V73A 4XF4A 4AQ2A 2JKBA 2B8MA 1AR91 3FC0A 3V0AA 2NYYA 1MZ6A 1YRZA 1CESA 4WBBA 1O7FA 4KWKA 3VL9A 5ACA1 1N1TA 4XDQA 3VBFB 1KQRA 4Q0PA 3ZXFA 5HCBA 1RJ8A 4Q4X2 4NHMA 5A32B 4PIZA 5GJ6A 1MS4A 3D82A 3H7YA 1Q8PA 2X8KA 3ETQA 1IGOA 4AVBA 2WINB 4P9IA 2C0ZA 4Z07A 1RUH2 1L3JA 5TSWA 4AI0A 4LO6B 3L9JT 1DLLA 2B9UA 2Q1ZB 5KC5A 1LESA 2WNVB 2R32A 3LA7A 3TWIA 4N7UA 2WC2A 4YZ2A 4UW5A 1AR92 1VBB1 2XJTA 1DGRA 2XKOA 4LHNA 4XFIA 2VOXA 1D0GA 5ACA2 2X5IA 4A7KA 3FFQA 2Z42A 2GDFA 3H1YA 4NN0A 1JUIA 1BQPA 3IPVA 1XNKA 2VVDA 1CAWA 3U4XA 1JYCA 1AL0G 1U5YA 5EJ3A 5BNNC 3VBHC 3LOBA 1A78A 3E5UA 5CBLA 4I09A 3I54A 2A6VA 2EAKA 1RUI2 4FPLA 3TNQA 1T6GC 4GULA 3MFCA 4KG0A 1R081 2ZOEB 3A0NA 1VBB2 1QNYA 2C5DA 4Y1VA 4BPZA 1R1A2 1Y9QA 1GZWB 1ULFA 1S0DA 4Q4X3 2UURA 3O12A 4HSLA 4LE3A 3VBSC 1IZ3A 1N47A 2E9QA 1CONA 1RGSA 1RUF3 4PIYA 3FE5A 3TB0A 4H3WA 2ZAAA 4ES9A 3WCSA 3NKGA 2AENA 5C8CC 1LCLA 4RQPC 4HKWA 1RUH3 4YG0A 3DV8A 4F8AA 4W65A 4K1YA 2HWD3 4IEOA 1FPN3 2I2SA 4YRDA 3CEWA 4QHBA 1AR93 2A5ZA 4GMP0 4BMEA 5EXOA 4P5HA 1GSLA 5SV8A 5BUVA 2PAMA 4LE4A 5BNNB 3VBHB 1WA4A 1W39A 4YYOA 3J4UH 3OGGA 3VZLA 4LBMA 5JZGC 2VVFA 4ZU5A 1D2SA 1O3RA 1W6MA 3ZFFA 1DQ2A 3OGJA 3I59B 1NQJA 1ENSA 3WG4A 5LRSA 1LOCA 2QQPA 3S6PA 1RHI2 1UL9A 2QVSB 1RINA 3VBUA 4W6XA 2KXLA 2IXIA 4HETA 1QNWA 1SFYA 1VBB3 4HL0A 2A75A 3RYKA 3CU7A 2ET7A 3ZFEA 2HWE1 3VV1A 4JGYB 5EZWA 5C8CB 5I8TA 4RQPB 1QGLA 2CNAA 1H8TA 2NM1A 3PMSA 3EJKA 1NOVA 3DN7A 3NV3A 2LUWA 1AX2A 1MS0A 2LM3A 4LTAA 1SCSA 4FP2A 4Y22B 2RS51 1HLCA 3RWNA 4M3CA 3WW2A 4AEJA 1FAYA 2Z69A 3PLQA 5J96B 4AFDA 5KXBA 4XQWA 4H14A 1R083 1YFUA 5KBFA 2WQ4A 1NY71 5JZGB 4J1XA 3ZN4A 1PHMA 1KD7A 1UX6A 1UAIA 1V00A 2HWE2 3H1WA 3CJIC 3LSEA 4IEYA 4ATFA 2UWAA 1FYUA 1QY4A 4AF9A 3WHUA 1WD3A 3KCXA 1S2BA 4JDNA 3WINE 1S0FA 1CVNA 1ZZ6A 4AQ6A 4AVCA 1YI9A 5FQ0A 4DPNA 3N3HA 3PNAA 3WCRA 4AFMA 3SCHA 4Q0VA 5CVRA 2PTMA 3L2HA 4ZU4A 3OTFA 2A3WA 3WV6A 1QOSA 4I0AA 4AVTA 2WA3A 1CQ9A 4N7IA 2E7TA 3TNPB 5J37A 4Z92B 1APNA 1G9FA 2PLV3 4R9CA 2HWB3 1RB8G 1QJU1 4M01A 5F6LB 4QPIC 1KDMA 4W6YA 4Q4V1 1VBA1 3CNAA 4GIQA 1ND2C 1RUD1 4SBVA 4FVVA 1V6KA 4EN9B 3EXUA 4XFCA 4FPJA 1V70A 2WNUA 3CJIB 2WLQA 4DQAA 3NL1A 4AGRA 1QJX2 1IOAA 2OUJA 1RUG2 5IT6A 1JH5A 5GZFA 3UV9A 4BIOA 4YFZA 3NWKA 4OFGA 1XYOA 5CFCC 1Z0HA 3D0SA 1IHMA 1ZBE1 3WDXA 4XF1A 4AI2A 1RUE1 4OI1A 2YGMA 2GZWA 2RS53 3M7AA 1QJU2 1WCSA 2FBEA 3KT4A 4Q4V2 1VBA2 3HIFA 4C0BA 2CAUA 1G9DA 4XF9A 1HIXA 4OI0A 1D2QA 1GLHA 1QHDA 1G6NA 1MQTB 1XRUA 5FTTC 2I07B 1IPKA 1H2NA 1NLRA 5I0RA 1YJLA 4YZ4A 2FMDA 4QPIB 4CDUC 3THTA 2DCZA 1QJZA 1S0IA 3BALA 3PJYA 1PZ7A 4N53A 3UK9A 2XWBB 1QH6A 2TBVA 1ND2B 4RL7A 3SITA 2XVGA 3C3VA 4XZPA 1NLSA 3BB6A 4OULA 4K40A 4YARA 1IS4A 1Q5OA 3AMMA 5FBZA 1BMV1 1AYN1 4Y1XA 4WM7A 1FMD3 5JWPA 4XMIA 5CFCB 2G4IA 2X29A 4M0HA 3KT1A 4YW2A 4MYEA 1WCKA 3MIDA 3WQ0A 1EAH1 3U0ZA 3MZHA 5T3NA 2IWGB 5H9RA 4XQDA 3TN91 1DF0A 4GKYA 2MPFA 5T5LA 1REFA 4D7YA 3ZXEA 5L19A 1AHSA 1EY2A 2E53A 4HPKA 1QJU3 1NCRB 2Y0IA 5CFDC 4XIOA 4B4PA 1A8DA 4D7SA 4LUKA 4Q4V3 3WG3A 1ALYA 1SACA 1RUD3 4QX5A 4JV4A 4Y20B 3GZUC 2HWC1 1GZ9A 4K8FA 4Y24A 2AZ5A 1FT9A 2QDRA 3LSDA 4CDUB 1VP6A 2JEMA 2R1DA 1AX1A 3GF6A 3SISA 3V65A 4COVA 4Q0QA 4PIXA 1RMU1 1GBGA 4META 1PNFA 1ZBE3 2ZX4A 5GLVA 1RUE3 1EP0A 4S2FA 4N43B 4LBNA 3DPRB 4YVSA 5FO7B 3K51A