3WUDA

X-ray crystal structure of xenopus laevis galectin-ib
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
132
structure length
132
Chain Sequence
AGMVMNNFSLKQGHCLELKGFIPKDAKSFAINLGKDSSNYVIHFNPRFDHEGDTNKIICNSKEENSWGTEQRENVFPFQQGAETSICFEYQADHLKVKLSDGQEFNFPIRMPLDTITFLSMDGIELKAISLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Galectin
publication title Crystal structure of a Xenopus laevis skin proto-type galectin, close to but distinct from galectin-1
pubmed doi rcsb
source organism Xenopus laevis
total genus 30
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2014-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wudA00
1WW5A 2PELA 5DUUA 1PZ8A 3OBRA 4BPZA 1UZZA 1A3KA 1WCSA 3AXEA 3WZ1A 4P9WA 2ENRA 3A0NA 2A6XA 1ULCA 1W6PB 4Q1PA 1ULFA 4FOWA 1IS3A 3L2YA 1LTEA 1DFQA 1GLHA 1LHUA 1W6OA 2YY1A 3VKFC 1W6MB 4ITCA 5T52A 4C1WA 1W6QB 4Y1YA 5GZDA 2EXIA 2ZKNA 5H9RA 1MS5A 2ZGRA 1BZWA 2CNAA 3BIWE 5EWSA 3PMEA 2WT0A 1CJPA 1F31A 5DZGA 1LOCA 2EXJA 3PVEA 3USUB 4YG0A 2DVAA 2D6PA 1Q8PA 5DZFA 3VKNA 3R4SA 1OKQA 3JUUA 3RS6A 4Y24A 1CQ9A 3WCSA 2ES3A 1LOAA 1GKBA 4Q26A 1DYKA 5IUQA 4BMBA 2D44A 5T5JA 3B3QE 1W6NA 3PVOA 1GZCA 4K21A 5IK4A 1G9BA 5DG2A 1IS4A 1LGCA 1X50A 2A70A 3BODA 2CY6A 3WDXA 1C1FA 1LHVA 1JW6A 2GNBA 2NMNA 3TAYA 1RITA 2R1DA 4XJAA 5E88A 2A6WA 5GLUA 1N1VA 3AJYA 4GWNA 4XMIA 1QGLA 1CVNA 3V65A 3WDWA 4YZ5A 4RA0A 3ILFA 2DU0A 3JU9A 1QOSA 4AWDA 1ENRA 3W58A 5JDBA 2R0HA 5GLTA 1QF3A 2DUQA 5SV8A 5CAZA 3O0VA 4Q8LA 1LGNA 2PHFA 1UPSA 5CB7A 2Q5TA 3ASIA 2RHPA 1BJQA 3IPVB 3LSEA 1AXZA 2ZMKA 3MW4A 3O12A 1S0EA 1FV2A 2A3WA 5H9PA 1UAIA 4Y20A 4AGGA 2CL2A 1SBDA 3FLTA 2VXRA 4Q27A 2GN7A 2P2KA 4Y1UA 4ZKTB 3I4IA 1LEMA 1Q8SA 1URXA 1AZDA 2JECA 2VU9A 3D4KA 4YW4A 3TB0A 1RIRA 2DYCA 4JRAA 4XHXA 2JE9A 1AX2A 2OVUA 3V0BA 1QNYA 2R16A 3VKOA 3SH5A 3ZXFA 4FPCA 5IK8A 2DURA 1DQ4A 3APBA 4SLIA 3N3HA 2AYHA 2YMZA 3D6EA 3NV2A 4GKXA 2OW4A 1A8DA 4FPKA 4PCRA 1FNZA 2DV9A 1WLWA 2DVBA 3OYWA 1N1TA 4LBLA 1V6MA 4Y22B 2P3IA 5DUXA 2ZACA 4ATEA 5GLVA 1CPNA 4BMEA 2G4IA 4FPJA 5T5PA 3V64A 1N47A 3AZWA 1PZ7A 1QOTA 4FOYA 3V0AA 1G9CA 2ZHLA 1AXKA 1QNWA 1V6IA 3UJQA 1IKQA 2ARXA 1J1TA 4P9YA 1FYUA 4M3CB 3AZXA 1VALA 3A0KA 1ZM1A 3WCRA 2XG3A 5CNAA 1S0JA 1YYNA 4YFWA 1G9FA 5H9SA 1WUVA 2W08A 3N7KA 3AP7A 1AJKA 2ZGMA 2OUJA 5L73A 3N36A 4YG3A 2AUYA 4Y1VA 4M3CF 1MZ5A 1FATA 2ZGUA 1APNA 1U0AA 1V6NA 3ZXKA 1C4RA 3WG1A 4WVVA 2P34A 1S0FA 1S0CA 2AH2A 3ZXEA 5IT6A 3AP9A 3BTAA 1WBFA 4Q8KA 1CPMA 1DQ1A 1IS6A 1NLSA 4YLZA 1Y7BA 1BXHA 1G7YA 3B69A 4YM1A 3N35A 1C1LA 1W6OB 4YM2A 2DUOA 5H9QA 2EF6A 2ZA9A 3UK9A 4XIOA 1RINA 1S0BA 3H0OA 4YW3A 3HMYA 5F5QA 2GMEA 1IS5A 3M2MA 1IOAA 2SLIA 3AFKA 2AREA 2W68A 2ZMLA 3ILNA 1N3OA 3POSA 4YGDA 2ZAAA 3RMYA 4DRVA 2ZHKA 2D3RA 4BLJA 2CWMA 2E53A 4R9DA 3RQ0A 4YM3A 2UU8A 4FPYA 4XTMA 1KQRA 1GNHA 1LHWA 2JKBA 5GALA 5GJ6A 3WDUA 2E7TA 1A78A 2KM2A 1HQLA 1YXWA 2D6MA 1NXD1 1G9DA 4ATFA 4I30A 3OJBA 5T5LA 1G9AA 3MW2A 1JUIA 1W6NB 1LENA 2GNDA 2NYYA 2ZGPA 4RL7A 3SH3A 1LESA 4GWMA 5KXEA 1MR5A 1VLNA 4W65A 1MS4A 1SACA 4M00A 3W59A 1LOFC 1MS1A 4PBOA 1W0OA 2A3XA 2R0FA 3AZZA 1YI7A 3ZVXA 1WLCA 1H9PA 1V6JA 1SLBA 1W0PA 1WLDA 4H55A 3MEPA 4BQ1A 3PJQA 5JOXA 4FQ4A 5F9TA 1SBFA 5FRAA 1GZ9A 5T54A 4AGVA 1O4ZA 4DQAA 4Z8BA 2YZ4A 2WLQA 4XE9A 3OGGA 2VW0A 4BOWA 4PF5A 3RMXA 1W6MA 2AGSA 1D2SA 1F9KA 5EYXA 1W6QA 4WZFA 1N3PA 3WUDA 2VH9A 3AYCA 3T1MA 1LECA 4XYXA 1GBGA 2ZGNA 2DWRA 1LJ7A 1OFSA 4LBOA 1R1ZA 3KQRA 1ULEA 3WHUA 4LBQD 3O5SA 1JXNA 1HLCA 4Y20B 1BKZA 4FP3A 4ISRA 3HR9A 1LEDA 3WDYA 1SLTA 2CYFA 3WUCA 2EAKA 5CBLA 1Q8QA 5HCBA 5JOZA 2D6OX 4WV8A 3RG0A 4P9XA 5KXDA 3A4UA 2P3KA 1MS9A 2AENA 4NO4A 4FPGA 4HANA 1UL9A 2NMOA 3OY8A 4ISQA 4NOTA 1SLLA 1N1YA 5GLWA 4CTEA 4C1XA 3NV4A 2ZGSA 3DUIA 1LCLA 2C5DA 4GXLA 2A6VA 1BYHA 1MZ6A 1Z78A 2W52A 1ONAA 3OYWB 3AJZA 4WVWA 2GNTA 4LBQA 4D69A 2D3PA 3T2TA 5BYNA 2AR6A 3FLPA 2D6LX 2ZGLA 3O0XA 5HCAA 2WSUA 1SLCA 2GNMA 1VAMA 5JVVA 1JBCA 2UWCA 4XTPA 1SCRA 3V0AB 4TZDA 2P3JA 1PZ9A 1MVEA 2C9AA 4YW1A 3FUQA 5GZCA 1FAYA 1IKPA 1MS8A 1LHNA 2D3SA 4GKYA 4XJUA 3WNXA 5GZGA 1Z0HA 5GZFA 1DBNA 1GICA 1JOJA 2JE7A 3MPPG 4YG6A 1N3QA 1GZWA 4Y1XA 4AYUA 2FHRA 2VW2A 1B09A 1DLLA 1Q56A 4KBBA 4R9CA 3AZYA 2ZGKA 2GALA 1UX6A 1V6OA 1DQ5A 3ZPYA 1S0GA 1LULA 1JYCA 3IKWA 3OPZA 4Q1RA 1SBEA 4P14A 4XJ8A 1D0HA 2ZZJA 2I2SA 1KDMA 2YXSA 1SLIA 3B9CA 1AVBA 2GN3A 1Q8VA 1LODA 1I1EA 1ZA4A 4FPOB 2CWSA 1C57A 1MVQA 4FPLA 3ZXJA 1QDOA 2JDZA 3ILRA 3SH4A 3VKLA 2WSVA 1DGLA 1JN2P 4HL0A 1WD4A 3I8TA 2FMDA 1UN1A 5T55A 4DFSA 5FREA 1Q8OA 1CESA 4R9BA 3AXDA 4FOVA 1MS0A 1YRZA 4YW2A 5GLZA 2ZGOA 2DVFA 4K1ZA 2HYKA 2DVDA 1CONA 3FLRA 4XBLA 5DG1A 5GM0A 4XJWA 3VV1A 4AGRA 2UWBA 5KXCA 3M3EA 1SLAA 1CR7A 1QOOA 4BLIA 2DVGA 3U4XA 4Y22A 2UURA 3FUOA 3QCWA 4F83A 1KJRA 1HQWA 3R4UA 2EALA 3WOGA 4YZ2A 1S0IA 2VY0A 2XB6C 2WJSA 4LBJA 3VUOA 4DS0A 2D43A 3INAA 3N7JA 1CIWA 1WBLA 1S0DA 2DU1A 1CN1A 2ZMNA 4YGBA 3ZSJA 1G86A 4FVVA 1LOGA 3VKMA 3AP4A 1MS3A 1G8WA 3UL2A 1F5FA 4YGCA 4UW6A 3HN1A 3AK0A 3KM5A 3LSDA 1TEIA 3SITA 1AX0A 4XXAA 4XIKA 1QU0A 4UW3A 3B01A 4LBMA 4XZPA 1WD3A 1UZYA 1KDKA 2P37A 4AVSA 3ZYRA 4AVVA 4K1YA 3FBYA 4ASMB 5JOWA 5LK5A 2EIGA 1JYIA 4XHBA 3WDTA 2E7QA 1UKGA 4UW4A 4JC1A 1GYKA 2V5YA 1LU1A 2NZ9A 1WW4A 2VUAA 5EXOA 2A5ZA 4MYEA 1KITA 3M3OA 4M01A 3RRDA 3ZSLA 2ERFA 2OUHA 1AX1A 1DQ6A 3ZSMA 5T50A 1DZQA 2NN8A 2Z42A 2WT1A 3WG4A 5GZEA 4YZ1A 2DTWA 1BQPA 5DZEA 3RSJA 2DTYA 3GALA 4YFZA 4IQPA 3M1HA 1W6PA 2A71A 2A6ZA 2EXKA 5E89A 1AXYA 1MACA 4GALA 5IK5A 1DHKB 2NM1A 2ZHMA 2H0BA 4XJZA 2PHRA 3IMNA 3WDVA 1VIWB 3AYDA 2D6NA 2WQZC 2PHUA 1FV3A 5DUVA 4AVTA 3OY8B 4TYSA 3ZYPA 3IM0A 4R9AA 3WVJA 4ZXKA 2EXHA 1EPWA 3USUA 1UMZA 2CTVA 3Q9OA 4YM0A 1HDKA 2JD4A 4L8QA 4CRQA 3ZXLA 1GV9A 2R1BA 1AF9A 4LBQB 3BOPA 4FOQA 3V0BB 3POYA 3NV3A 1QKQA 2NP0A 3D5OA 4PBPA 3FFZA 3NV1A 4K20A 3SLIA 3POWA 2JJ6A 4DPNA 5JOYA 2GMPA 3LCPA 1VAVA 3R05A 3NWKA 5T5OA 3AP5A 2A3YA 4XXPA 4UW5A 3B00A 3GNEA 1GANA 1GZWB 1LGBA 3O0WA 5AVAA 3AYEA 2E6VA 5E8AA 3WV6A 2PHXA 1OQ1A 4OZXA 1N1SA 4XMAA 2ZBJA 1LHOA 1ULDA 1QDCA 1SCSA 1FNYA 3OBTA 4XILA 4Y26A 5DUWA 2YROA 5JMCA 1V6KA 1DIWA 4DRRA 2YV8A 1AJOA 2A7AA 3PVNA 5JLVA 1ULGA 1O4YA 4XJ9A 4U2AA 3IPVA 4YGEA 3CNAA 3UJOA 1FX5A 3N7MA 4FP2A 2WNEA 2R49A 2UWAA 2ZHNA 4BM8A 1LOFA 2V73A 4Y1ZA 1DQ2A 1V00A 4M3CE 4XDQA 1YO8A 1S1AA 1LOBA 4YW5A 1H30A 1JHNA 1XQNA 1DQ0A 3AX4A 3ENRA 1HKDA 1QMJA 2ZABA 3M3CA 2D6KA 2DUPA 2GMMA 4GA9A 2A75A 1H9WA 4JCKA 4LBKA 1LOEA 2ARBA 4XOGA 4YZ3A 5DXDA 4FPHA 1GSLA 3ATGA 3WG3A 1V6LA 2TEPA 1ENQA 4LBNA 5KXBA 1SFYA 2PHTA 3T1LA 3MW3A 4CZSA 3N7LA 2D7FA 2B7YA 3QLQA 4XBQA 3WHTA 1WW6A 3AZVA 4FPFA 3WG2A 5EYYA 5CA6A 5IK7A 4PQ9A 4FQZA 2GDFA 1WW7A 4FPEA 2VW1A 2WT2A 4YZ4A 1DYPA 2ZGQA 2WKKA 3WLUA 3AYAA 2E51A 2ZGTA 4Q2FA 2LALA 3C2UA 3DGTA 4M3CA 4XBNA 3ZSKA 1KJLA 1GNZA 2PHWA 3AP6A 2BQPA 3M3QA 1KRIA 4U36A 1ENSA 2W39A 2A6YA 1LU2A 5HCFA 1YIFA 2SBAA 3SISA 3IN9A 2LTNA 1I3HA 3SNMA
chains in the Genus database with same CATH superfamily
5FY5A 4XQDA 1P8JA 4IV1C 5D8AA 3W5NA 2CGOA 5DUUA 4GB33 2R6QA 5LATA 2ZOEB 1WCSA 2VTXA 4NRPA 3KV4A 4R52A 1FMD1 3K51A 4R4ZA 3BN6A 2RMU3 1VBC3 5KHIA 3ZO0B 1W6PB 1ULFA 4BK5A 3WF1A 2QZ3A 4XCBA 3H7JA 4DZGA 1W6OA 1RUC2 3G6JB 4ITCA 4FO9A 1O3TA 3K4DA 3RGBA 1K45A 2BV4A 5GZDA 2VMCA 4ZU4A 5A3WA 3OBAA 3KQ4B 1MS5A 5H9RA 3VDDA 5BNPC 5K0UB 1F8VA 4LUKA 3BIWE 2GH2A 3JXSA 5EWSA 5I8YA 2WT0A 2VZSA 3I3BA 4HVQA 5DZGA 3WF0A 3BKZA 2JG8A 4QGMA 1NY72 1T2XA 4V2WA 1GWKA 4YG0A 5DN2A 2J1TA 5D1IA 3LPFA 4Y24A 4BIFA 1JH5A 2ES3A 3WCSA 1UNBA 1XRUA 1DYKA 2D93A 3IDAA 5FXZA 3ACIA 2BVVA 4B7KA 4JRLA 4BMBA 4CP9B 3BIEA 3PVOA 4OULA 4OYUA 5A7WB 4MZUA 3K46A 3KV6A 3UESA 5DG2A 1LGCA 3B9IA 3PTRB 1DLCA 4AQTA 1J83A 1XNKA 4I0BA 5FZ4A 1NLQA 1BEV2 2R1DA 1X82A 2VQUA 2XHNA 4AVAA 2A6WA 5GLUA 1FMD2 1JI6A 1N1VA 2C0ZA 4GWNA 4MGQA 1QGLA 1U5IA 4XMIA 3V65A 4YZ5A 4FTSA 5AC91 1VBE1 1PM4A 4RA0A 3LDRA 1MZFA 2WQ4A 2JDAA 3TNPB 4XETA 4TLFA 3WEZA 3VBUC 4PHZA 2R0HA 2TNFA 3H7YA 1QF3A 5SV8A 3PUAA 3RZZA 5FMBA 1UPSA 1JOPA 2Q5TA 4E2GA 3HBZA 3B7MA 3CHXA 5J96B 2VOVA 3B93A 3O12A 1E5SA 1UAIA 3WP4A 1NLRA 5FZOB 3T2PA 3OUJA 4UFLA 2RS13 3FLTA 2PHDA 2VXRA 2WO7A 4WZCA 4Q27A 4WBBA 4LXLA 2P2KA 4Y1UA 5IAVA 2VBDA 3AL5A 4YARA 4ZKTB 3NAPC 1LEMA 1UZVA 4QB6A 1RJ7A 3TB0A 4Z92B 2RMU1 1RIRA 2OVUA 4ZXEA 1PVC2 2J1EA 1ENXA 3ZXFA 1K42A 2BNNA 2OZ6A 5IK8A 1DQ4A 2Z79A 1KXGA 2RS33 2VVEA 2YMZA 3POFA 4YYOA 5F3EA 5AFBA 2IXLA 3NJXA 4PCRA 1KEXA 2DV9A 1WLWA 2LS6A 3OYWA 3P3NA 3EJKA 3JBG1 1PK6C 4ATEA 1CPNA 4N43A 4IV3B 4KGGA 4XQWA 4MHRA 2Y64A 4F8AA 3LIHA 4MXWB 1PGL1 5AC92 1VBE2 3UGHA 2GC1A 3I7DA 1S2BA 4EWDA 4CEWC 4XCAA 2G19A 1S2KA 4P9YA 4C0BA 3K3NA 4AAXA 4LQRA 1ZM1A 3LKJA 2XG3A 5CNAA 5FP8A 3PDQA 5IYYA 1CIYA 5H9SA 1EAH1 2W08A 2BWCA 3KT7A 2HWB3 2ZGMA 2MHFA 2OUJA 4B4RA 3N36A 4PIXA 4XF1A 5FZCA 1YFYA 3O1OA 2AUYA 2JDHA 3OD0A 3D0SA 2VZVA 4M3CF 2VGDA 2ZGUA 1V6NA 1BBT1 2AH2A 3ME2A 3R0RA 2RMU2 4GIQA 3BTAA 4HMZA 4N7IA 5DAPA 1WBFA 4Q8KA 5IT6A 1CPMA 4QHOA 5BNQA 1Y7BA 2C9KA 4Y3OA 1G7YA 2CDOA 4OQ9A 3RWKX 4SBVA 4D0QA 2VMDA 4QQ2A 2DF7A 2YGMA 1AR93 4QPGB 2RDRA 5H9QA 4AEDC 2WZEA 5C5TA 3H0OA 1I6XA 3EMRA 4YW3A 1UZWA 2XJQA 4ES9A 2ZMLA 2W68A 5FWEA 2OYZA 3ILNA 3ZIXA 2FDKA 3JBG2 3RMYA 2ZAAA 3C7OA 2ZHKA 1DP0A 1PGL2 3RQ0A 5DPNA 2ADDA 5FCCA 2UU8A 2HLEA 4INDA 2Q30A 1WCKA 1VAKA 2JKBA 2EA7A 3PUIA 5GJ6A 4UBGA 1GFF2 1YI9A 3WDUA 1GOGA 4WVZA 2WWSA 4JQRA 1W8UA 3B02A 3JQXA 2JX9A 1HRI1 2VECA 4XFHA 3SEPA 3NVCA 4GJYA 4LMFA 3ZR5A 1EAH2 1OLME 3TN93 4GWMA 1BVP1 5FDBA 2FDIA 2ADEA 2VTFA 4LIUA 5C3PA 1MS1A 2WNUB 2X5IA 3NNFA 2R0FA 2Y26A 1YI7A 4WM8C 2HWF1 1JYNA 3DXTA 1GP6A 1WLCA 4YVSA 4XFFA 3W9AA 5EJ3A 1WLDA 3MEPA 2WWJA 5A3MA 1BBT2 2ET7A 2PAEA 4YWAA 5KHKA 2VMFA 3LF7A 4QQPA 4W4ZA 1SBFA 3U11A 2Y6LA 3S7IA 3ABZA 4NIGA 2VW0A 2BW8A 4NPRA 3ZKYA 1AYN3 3H3ZA 1VBA1 5CFDB 3ZYFA 3S0MA 4MGTA 3AYCA 5LBBA 4XYXA 4MOAA 5FPZA 1LJ7A 4G9SB 1OFSA 1ZX5A 4LBOA 3WHUA 1UYPA 3IAQA 3WXPA 3O5SA 3CLPA 2W1QA 4Y20B 1HJGA 2HEYF 2I07B 2YB7A 3HR9A 3ZFGA 1ZZBA 1JZ2A 5HCBA 1C5IA 1X36A 4P9XA 1HRI2 1W39A 3A4UA 5DDJ1 2XJRA 4W6YA 4NAMA 4JHTA 2NMOA 3JD71 3OY8A 4ISQA 4UAPA 2JDUA 1NA1C 4C1XA 1XSRA 3NV4A 4COZA 3OUIA 1LCLA 3WW2A 5D8AC 2ZX2A 2A6VA 1BYHA 1Z78A 2W52A 5HV4A 4WVWA 2VCMA 2HWF2 1NZIA 3KD4A 3SQOA 4JAAA 4QXCA 2D3PA 4Q4Y3 4J1WA 4D69A 2BPA2 3A23A 3H1YA 3VZLA 2YC0A 4TSVA 1UYZA 5B4NA 1NKGA 5HCAA 1ZZ8A 2XONA 1VAMA 2YHJA 4XTPA 1SCRA 2VNVA 5C8CC 1O8SA 5L7OC 1HB2A 4XAAA 4E9KA 1XJAA 2BYVE 5GZCA 1W03A 3WNXA 1MS8A 1HV1A 4KI5M 5GZFA 4QXKA 5FPAA 1VBA2 1GICA 3PIJA 4Q4V3 3VDDC 3E6CC 1PO21 1L7LA 5IVCA 2X8KA 2FHRA 1RHI2 1ZRRA 4Y5SA 1PNFA 4R9CA 5FYUA 4TLGA 4I02A 3WINE 1GOHA 1XE8A 1WKYA 3HQXA 5FBZA 4URAA 1LULA 3WP3A 4ZU7A 2YPDA 1PNGA 3EHKA 4QT6A 4XJ8A 2B5HA 3KVAA 1D0HA 1HV0A 2ZZJA 1SLIA 1Q8VA 3T0DA 2YBSA 4KWUA 2W94A 5DDJ2 4HBNA 3ZXJA 2JDZA 4NHMA 4UT5A 3SH4A 3VBOC 1JYVA 1IZ3A 1JN2P 3CBNA 3JD72 3VD5A 3HIFA 5FREA 5G04L 5FY7A 4R9BA 2RVAA 2XL9A 1QH7A 1IPSA 5EPAA 3FWEA 4FOVA 4S2FA 3WR0A 2JICA 3ACFA 2H6BA 2RJLA 4A3XA 2UWBA 5F2SA 4BQWA 1NE4A 4GH4C 3FHIB 3KCCA 1CR7A 1SFPA 2XQRA 3WQ1A 2IVJA 1HQWA 3R4UA 3I3DA 4AQ2A 3FFQA 1UY4A 3HQUA 1KFUL 4BZ4A 5CKNA 4MXWA 2VY0A 1XBFA 2WJSA 4LBJA 4DS0A 2D43A 3V56A 1CIWA 3AFGA 3ZN6A 4X6QB 4CCNA 1V0AA 2AEZA 4YGBA 3KT4A 5FPBA 4B8EA 4QD2A 2WA4A 1PIV3 1G8WA 1PO22 3VZMA 4JV4A 4YRDA 1F2NA 1F5FA 1RXGA 5F39A 1UOJA 3KM5A 1Y9GA 3AK0A 3WP6A 4P9GA 4JGYB 1JZ4A 1UZ0A 1AX0A 1GQHA 3CJIB 3I3QA 3SITA 3U07A 4CUCA 5JSRA 1JU4A 1UZYA 4JGZC 4AVSA 3FE5A 3ZYRA 4FTEA 4CU7A 2Y33A 2VMIA 4GJZA 2JWPA 1HIXA 2EIGA 3HNBM 1HXS1 2QVSB 3CIHA 4XHBA 2E7QA 3LOBA 1QJFA 3LIGA 2VUAA 5EXOA 2UY8A 1RB8G 3QH6A 4M4PA 4YVWA 3LPGA 3ZSLA 1ND3A 1SPPA 2ERFA 3ZLIA 1RC6A 2VUDA 2VOKA 4P9LA 2A73B 1W8OA 1DQ6A 2P1BA 4CEWB 1MEC1 4Z2AA 4Q4V1 1UY1A 2NN8A 2Z42A 4ZU5A 3WG4A 2QFEA 5ABJA 4UI9L 2DTWA 5DZEA 3RSJA 2DTYA 4NE9A 4TXWA 2A71A 4ORFA 5J48A 3TBDA 5IK5A 3E6BA 5BPXA 4UFKA 2H0BA 4QX5A 4PDWA 2PHRA 4W50A 4D8MA 5SV5A 1XPWA 1WLTA 2D5FA 1UY3A 3WDVA 4E4HA 1VIWB 2VCCA 5ACA1 3AYDA 1D4M3 4PF1A 1EPZA 2VJXA 5A3PA 2W9XA 5DUVA 4AVTA 2IXHA 3PUSA 3KHBA 4TYSA 3ZYPA 3WVJA 2Z2SB 2EXHA 3CU7A 2PMWB 4MX3A 1EPWA 4HFSA 1UMZA 1RUNA 3PLQA 5CVRA 5JXIA 3FHAA 4UFJA 2WLPA 3FJSA 2Q1FA 3KS7A 2R1BA 4LULA 3ZOIA 4QHZA 1H4HA 4I0AA 3JZVA 1C8NA 3V0BB 1JMUB 1ND2B 3NV3A 3D5OA 4OMDA 1O3SA 1RUE3 1UXZA 1HXS2 4K20A 5BUVA 4IE5A 1REDA 2JJ6A 3VBSC 2B9UA 4DINB 2ZCWA 4CDQA 3VHNA 3E97A 3IIAA 1JHJA 1GZTA 4AFCA 4LKEA 4N53B 3NJZA 1UYYA 4UW5A 1MEC2 4LO7A 1OD5A 3PUHA 1UYXA 3ZFEA 5AVAA 1ODMA 2WBKA 5FO7B 2B4KA 1OQ1A 4OZXA 1QHDA 1C5HA 3Q8BA 5FP4A 2P17A 3DECA 1FPN1 3M7AA 2WFF3 3OBTA 1B35C 4XILA 4FI9A 5LA2A 1H2MA 2GSYA 1MQTA 5ACA2 4ZS2A 4LIVA 1W90A 3PVNA 3NNGA 1ULGA 2IVIB 3IPVA 4BXSV 1YFUA 3CNAA 5F5IA 3VBFA 3MIBA 2WAOA 2WNEA 1SG3A 2EIEA 2R49A 3M8LA 4B7EA 2X5IC 3GM8A 4K8FA 4CXYA 1LOFA 2WUHA 4P02B 3OGJA 1YQ5A 2XJUA 2VQAA 2WO3A 3J7NA 3KF3A 1HB1A 4M3CE 4YVSC 4CCEA 2CGPA 2Z5WA 4BJ0A 2EAAA 2XHKA 1O6UA 1SZBA 5JMOA 1GWMA 4N9IA 5EIYB 1DQ0A 3AX4A 2JG9A 3T2QA 1NCQA 3M3CA 2GMMA 4LBKA 4YZ3A 2A75A 4XOGA 1LOEA 1FT9A 2VC9A 2UY9A 1GSLA 2O8QA 2WL1A 2WC2A 4DUVA 2Q1ZB 4AE2A 1W05A 4KQ7A 5TSWA 2R063 2RR11 3C7EA 1UY0A 2BVBA 3J26N 4Q0VA 1AR83 3N4MA 1PX3A 2DCZA 5EYYA 2Y6HA 5IK7A 4CDUB 5F2WA 4XF4A 3ZFGC 4B4QA 2WZR3 1NA1B 3SCFA 4HONA 1FPN2 1K5MA 2VW1A 2WT2A 4YZ4A 5D21A 3WNKA 4CCOA 2D98A 2J1AA 2E51A 2GU9A 2LALA 1CAVB 1OA4A 4QM9A 5IFTA 4CYDA 2PHWA 4Y5Z0 4LO4B 3HN3A 3M3QA 1KRIA 2W39A 1NCRA 3PU3A 1YIFA 1OD3A 2SBAA 2WIIB 4IEXA 1CX4A 2PQSA 3I97A 1SHWB 3PUQA 3UGFA 5C8CB 2PELA 4IERA 3RZKA 4BPZA 2ETEA 1TNFA 3WZ1A 4IESA 4P9WA 1UU6A 2ENRA 1ZBA3 3MFCA 1ULCA 4Q1PA 4FOWA 4CDXC 1FI2A 5FTTC 1LTEA 1X7NA 4QGNA 1JODA 3J8F2 3O7OA 3WNLA 3ELNA 2W1UA 3VKFC 2WFF1 3FBMA 2R073 1W6QB 4S2DA 4ARXA 1WCDJ 2Q0AA 4QQLA 4JZRA 4OUSA 1XNCA 1W06A 4BDVB 1UOBA 1WGPA 2RR12 4TTGA 4AFMA 1GUIA 4NVPA 3PVEA 4UF0B 3VBOB 2PTMA 1ZZCA 4WM7B 2DVAA 5EFUA 2D6PA 5I0DA 2JB8A 3VKNA 4J25A 5A33A 3RS6A 1XU1A 3JUUA 4OHYA 4O65A 3LA7A 1Y3TA 1F35A 4CEYC 3QD6A 1LOAA 4XEZA 5AFEA 2P3YA 1HJFA 4AHXA 4RN5A 2G9ZA 3RZGA 3OGSA 1XNTA 3AKTA 4LA3A 5T5JA 2Y6GA 5DMYA 4FFGA 5F37A 1GZCA 2ET1A 1IS4A 1XYOA 2A70A 1VB2A 3OG2A 1JUHA 1RUJ3 1WCUA 4HPKA 4LKFA 1C1FA 1DG6A 1JOBA 2GNBA 2VOWA 3DV8A 4RQPB 2BOIA 4Q4W3 5FUNA 5FYZA 3TAYA 1A6CA 1RITA 1SEFA 3USSA 5E88A 3O1TA 2CAUA 2HBUA 1H6YA 1Z7S1 3U1XA 5LK7B 3NJYA 1Q5OA 4L99A 4LO6B 1A34A 4QX8A 2DU0A 2O1QA 2VAUA 1OA3A 4UFMA 5IHRA 1QOSA 3UGGA 1ZZ6A 3W58A 5JDBA 4CP0A 1OF4A 2YU2A 3E6DA 4QXHA 2X53S 4MGIE 3E5QA 1LGNA 4JGZB 3AM2A 4GAZA 4OHZA 3ASIA 2RHPA 1W8ZA 3NO8A 4C0HA 4QX7A 4CDWB 4XC9A 4AGGA 5H9PA 2JEMA 1H6XA 4XFAA 3WD5A 4IW3A 5FOBB 2CL2A 2ZJCA 1SBDA 3ES1A 2DBIA 2QCSB 3BTYA 3LEIA 3I4IA 1JYXA 4L92A 3UKNA 2VU9A 4O61A 4YW4A 2WZPP 4P00B 1ZRIA 4FCAA 1ZBA1 1RUH3 3N9NA 2DYCA 1IPKA 4IE6A 1VBB2 2ORZA 3I2IA 3V0BA 1ND2A 4YVWC 2R16A 2H0VA 3ETPA 2E63A 5CU1A 5FYBA 2DURA 3LFMA 4SLIA 3N3HA 2R071 4GULA 2ZX1A 3RYPA 5C3SA 2OW4A 1CX1A 3ZDSA 4GWIA 5ABJC 1R083 1JS9A 2VZUA 4LBLA 4Y22B 2PFWA 1WMFA 1EUTA 3MV11 1LNSA 5ISLA 3U4SA 4FPJA 1Z7S2 3GJBA 3AZWA 1PZ7A 1QOTA 3GBGA 4FOYA 3V0AA 4NIDA 2ZHLA 1AXKA 1A8MA 1J58A 4A44A 1D0GA 2ARXA 4FBFA 2QQPA 4B1MA 4QX0A 3LEGA 3AKPA 2VE1A 2ZXQA 1CAWB 5EJZB 4FFIA 4AQSA 1YYNA 1DZRA 2QDRA 4RR3B 4YFWA 1G9FA 4OLLA 3RI9A 3LFIA 3U37A 3N7KA 3AP7A 5L73A 5C9AA 2VQTA 4XVHA 4YG3A 2BUKA 4AI2A 4BA6A 1RUJ1 2BDRA 4MXVA 5FZFA 2R043 4DY5A 3VBSB 1WMEA 2VMGA 5IVYA 3L2HA 4LR4A 1MZ5A 1AR61 5L9RA 4A3ZA 4XDOA 3ZXKA 1ZRFA 2ID4A 3WG1A 2P34A 1S0FA 4PI0A 3KLSA 1ZBA2 1NX9A 1V9U2 2F17A 1F4AA 1BXHA 4RS5A 4PQQA 3N35A 1C1LA 1QY4A 3TEWA 4DO0A 3OSDA 4Q4X3 4PI2A 4DXRA 4OCTA 2WN2A 2ZA9A 3CJXA 4HN0A 2PAMA 1UCXA 5F5QA 2GMEA 4KU7A 3ALQA 3ZFEC 1B35B 4K9SA 4BE3A 2SLIA 5FPVA 2MPFA 2K9ZA 2HWC1 1N3OA 3POSA 4YGDA 4KU8A 4DRVA 3Q8EA 1U5ZA 4NWVA 4BXFA 1H8TC 1OLQA 1R1A3 1KQRA 2JIGA 5BNOB 1YLLA 5IAXA 5GALA 3BPZA 4XUTA 5C3RA 1RUI3 1HQLA 3NNMA 2D6MA 2WNVB 1NXD1 1RUH1 4I30A 3OJBA 3T4VA 3VBRB 3ZR6A 1G9AA 4Q0PA 3MW2A 3A21A 3SCHA 4EWEA 5CFCA 1W6NB 1LENA 5DQ0A 3MUZ1 4MUVA 4BISA 1LESA 2Y0IA 2RS51 5KXEA 2RG4A 1VLNA 4ZPIA 4M00A 1RUJ2 1LOFC 1H2LA 3UKTA 2A3XA 3VB9A 5IVEA 3FHQA 1R081 1AR62 5FZKA 2XQXA 1YIPA 1SLBA 2WFPA 1W0PA 3UKVA 1T6GC 1OOPC 2GC3A 3I59B 1K5JA 3NNJA 1IQDC 1SDWA 3AMPA 5JOXA 2Q8CA 3POGA 4FQ4A 5F9TA 3EO6A 1VRH1 1O4ZA 3ZM8A 4DQAA 4Z8BA 1ZRCA 3GGLA 1ZRDA 4BOWA 4PF5A 3RMXA 2E31A 2WS93 4CE8A 1D2SA 1LR5A 1XNBA 1W6QA 1Y4WA 4WZFA 2W47A 4Y33A 1E5RA 2MEV1 1RJ8A 3MIEA 3CZUA 2DWRA 2VUJA 2W2IA 2BJSA 2OQ6A 2HWC2 1ULEA 2RM23 3PURA 2WYFA 3T2OA 3E5UA 3MIDA 3RJ2X 2BNOA 3WDYA 4UF0A 3WUCA 4CA9A 5CBLA 1Q8QA 2TUNA 3JQWA 1RUD3 3POIA 4QQOA 4F3JA 2WO2A 5JOZA 1POQA 2YC4A 4BIOA 5KXDA 4MGYE 1RUH2 1CAXB 2VVDA 4NO4A 4NRQA 4OHVA 1NCRC 3ZFFB 1UL9A 4D6RA 5LRRA 1CWPA 1WMXA 2QQWA 5FXWA 3HPNA 4CDXB 1DF0A 5FJHA 4GB31 2RS52 3ZYGA 3DUIA 5DAQA 4GXLA 2HBTA 3VDAA 1H1AA 3MLJA 3HAGA 5A7PA 1O7FA 1MZ6A 1VBC1 5JZGB 2JXAA 4LBQA 2XJPA 5BNNB 4A7ZA 2AR6A 3HEIA 2ZGLA 3O0XA 2XWBB 4CCMA 1ZBE3 3KSCA 4CCLA 4QPIA 2XBO3 5FZ8A 1O59A 4G3YC 2P6HA 4TZDA 3IBMA 1MVEA 2DCJA 3J7HA 1VRH2 4XF3A 3WW1A 4CSWA 5C33A 1LHNA 3WQ0A 3LA3A 2BRTA 3IWZA 1DBNA 1HN1A 5LA1A 3ROUA 1N3QA 1AYM3 4CEYB 4Y1XA 5C4WA 2MEV2 2VW2A 1Q56A 4P08A 3OEBA 4BQ5A 3KCYA 1S0GA 4CDWA 2XDVA 4LE3A 3O14A 3IKWA 4Q1RA 2HYXA 1SBEA 3TOJA 3G7DA 1IHMA 1PMIA 3KT1A 1W8TA 4I3GA 2I2SA 2VD7A 4OI1A 1AVBA 4URTA 1LODA 3AB0A 3DYMA 4OI2A 1MVQA 3DL3A 1QDOA 1W0NA 1DGLA 1QXRA 3RVHA 1POV0 4Y4RA 1UN1A 5T55A 4BH9A 4DFSA 5C6CA 3AMNA 1CESA 1J1LA 3OBZA 1YJLA 1H0BA 2FZ1A 4GB32 3AXDA 5JWPA 1CAUA 4YW2A 2J22A 5GLZA 4AGRA 1CONA 3FLRA 5DG1A 3WW3A 1E5HA 1FOD3 1VBC2 3DEMA 5HXVA 3ZN4A 3T09A 1JZ3A 1QOOA 3U4XA 2DVGA 5FPUA 2Q8DA 4V2VA 4Y22A 2RM21 1O3RA 1KJRA 4FAHA 2ZEYA 1W2NA 3DYPA 1DCSA 3WOGA 3TEXA 1RVF3 4J1XA 3ST7A 4C91A 4DNYA 1DGWA 4PJYA 2P6CA 2VXJA 5KWRA 4JDOA 3INAA 2WABA 3S57A 2DU1A 4LE4A 1G86A 3S5AA 3IT8A 2RDSA 5I8SA 1RMU3 2PLV3 4UW6A 3HN1A 4GMP0 2RS11 5FLHA 4MO3M 1ACCA 4P5HA 4RGGA 3BCWA 4IE0A 4UW3A 4OFGA 4XZPA 5JR2A 5FLIA 2P37A 3GXUA 3VDBA 2IZWA 4AVVA 2PN5A 4ASMB 3TWIA 4A4AA 3VZNA 5HCHA 3I2DA 1AUYA 2CU5A 3KB5A 5FYCA 5LB6A 3VD4A 3D3AA 1RUF3 3FZ3A 3QH7A 2A5ZA 3PU8A 1O8PA 2FMYA 2RS31 2VMEA 1XNAA 4MYEA 4K6BA 4XF9A 2OUHA 2PA7A 2VBPA 5A6QA 4MSVA 5A32B 4Q0SA 4DOUA 1IG3A 2D97A 2WT1A 5A3UA 5FJKA 2D5HA 4QWNA 3GALA 5FPXA 1OF3A 1W8NA 1VB4A 1WA6X 3JB8A 3M1HA 1W6PA 2FDHA 2A6ZA 2RM22 3B94A 5C71A 1MACA 5K8SA 3I3EA 4RGAA 3HNYM 1YQ6A 5JSPA 5K9YA 1DHKB 1MPXA 4XJZA 1TG7A 1XSQA 3AC0A 3BI3A 3I54A 1XC6A 2D6NA 2WQZC 5EP9A 5I0TA 2HWB1 2PHUA 5K0UA 4AOCA 5C9AC 1ULOA 2YPJA 2OQ7A 5LBEA 2RS12 4QU2A 4IEWA 4IV1B 4QX1A 3VBHC 4CPBD 4CRQA 1PO13 3GHMA 3ZXLA 5JIUA 1AF9A 3DPRC 1FOD1 2GP3A 3BOPA 3POYA 4LUMA 2W46A 1Y9QA 3AMMA 3NV1A 3WF4A 3LAGA 4BQXA 3SLIA 4RS5C 4CP9A 5A7WA 1AR91 2J1VA 2RS32 4CCJA 5JOYA 1H8TB 2GMPA 3LCPA 1OQDA 2ZEWA 5JPMB 3R05A 4XUQA 2WRAA 3VZKA 2VNGA 2C24A 1GZWB 2GP5A 1GU3A 5BNPB 3AYEA 2E6VA 3C7GA 4CCKA 1RMU1 5E8AA 2PHXA 1N1SA 3AMHA 5DABA 4XMAA 2CGNA 2ZBJA 4HKWA 2DCTA 2WYSA 3GJAA 4GQ7A 3GBWA 1QDCA 4EJRA 4AXOA 5FZ9A 1FNYA 2ZEZA 2V4AA 3AVSA 3KGZA 5JMCA 3I2OA 4NUBA 3HWJA 2BP6A 2YV8A 4GWJA 1AJOA 2HWB2 1RUF1 2JG8C 3TN91 3HT1A 3POJA 5CFCC 1O4YA 4RSUA 2AACA 4OUMA 3T3YA 3R6SA 2KR2A 5FZOA 5FKCA 2ZHNA 4BM8A 4IGPA 4AHWA 2V73A 4BU2A 3P6BA 1OURA 2HEWF 1UWWA 2PAKA 4Y1ZA 3M3IA 5C5UA 3JCIA 4K7JA 1S1AA 1FOD2 5HPOA 2IFWA 3IDCB 5FY0A 1XNDA 3ZDVA 5JIAA 1NAEA 1AYN1 1AR92 4QKFA 4IEUA 1YFXA 2JDPA 3VBUB 4LBNA 1YQ2A 4Q0QA 5JI7A 4AEMA 1GP5A 1UU4A 4KH9A 2D7FA 3QLQA 4XBQA 1WW6A 2VM9A 4FPFA 4IV3A 5KBFA 5CA6A 4CP2A 4I01A 3RJRA 1VBD3 2DDUA 2IFRA 2QDNA 2WKKA 4WVMB 1ZYBA 4HSLA 2ZGTA 1I9RA 4NHXA 4PLNA 4AFBA 5IVVA 3NAPB 4PIYA 5FFOC 3RNSA 4EZ4A 5L9VA 5LY1A 5A1AA 2W1SA 3THPA 1C8M3 2PQQA 3AKSA 4LEJA 1TMF3 3TN92 4COVA 3ZXAC 1R093 1ZREA 5LA0A 3SISA 4A7YA 4COYA 4J6GA 4JX0A 4O9GA 4HG6B 3C3VA 4XFBA 3KMHA 3MICA 1WW5A 3IAPA 1TQ5A 1PZ8A 4L2NA 4Q4Y1 3OBRA 1IGOA 2FCUA 2PYTA 2G9FA 4TN7A 1LRHA 1NZCA 1HW5A 4IEPA 3FC0A 1AL23 1PK6B 1UPIA 2A6XA 3N9MA 4AG4A 1L7RA 2CHHA 4KMQA 3ZXDA 3L2YA 4KWJA 4QPIC 5IJRA 3H3LA 3PTYA 4MGZE 5FZBA 1OUSA 1ASJ3 3H1MA 2YY1A 1AYN2 5T52A 2LM3A 2VZPA 4QPGA 3BALA 4Y1YA 2EXIA 3K2OA 5FY4A 4IEOA 1W9YA 3EBRA 2ZKNA 4N43C 5FYYA 3BYWA 4CP1A 1VRBA 5C4WC 2QUOA 4B29A 1YWKA 4HN1A 5A7SA 2JDMA 3PMEA 4HLTA 5FYMA 1CJPA 3LDBA 2W91A 1Q43A 2EXJA 3IIIA 2NLRA 4MHUA 5FYHA 3H42B 3ACGA 3USUB 3KCXA 3RWNA 4OQ8A 3Q8AA 2KD7A 4OHXA 5F3GA 1OKQA 4CU9A 5FO8B 3ACLA 1CQ9A 4NPLA 5F8PA 5A3OA 4QU1A 1SDDB 1OFNA 1BK1A 3B3QE 1RXFA 3GCWA 3CL1A 2A1XA 4BB3A 1EY2A 5IK4A 5JR7B 1X50A 5FWJA 3BODA 4FXKB 2CY6A 4AEDB 1LHVA 2WQ8A 2WNUA 3SCGA 3U78A 4Q4Y2 1W8HA 4S2GA 4YNIA 3LGRA 4P5YA 4JKLA 4IE7A 2AC1A 3WDWA 3AJYA 4AEJA 1CVNA 2FCVA 3O1UA 1RUOA 4GD4A 5FQ0B 4XF0A 1VBD1 1OLMA 1QJX3 1XYNA 5FY8A 1O3QA 3N9LA 4AWDA 1ENRA 3EB7A 5FZHA 1RTVA 2LW8A 1F15A 3LEMA 4Q4V2 3ZIWA 3O1RA 5CAZA 1PIV1 3O0VA 4Q8LA 5F5CA 5FP3A 2PHFA 1AR73 5CFDA 4XPVA 5CB7A 5LW9A 5FOJB 1BJQA 2LUWA 4QXBA 1R091 4E8DA 3LSEA 1AXZA 1VE0A 4EN6B 2A3WA 4Y20A 3WSOA 4LNVA 2E32A 2OPKA 5F6KA 4LTAA 5FYVA 2RJKA 3WP5A 5C7GA 4WM8B 4IEQA 2C1FA 3D4KA 1URXA 1AZDA 2J42A 2JECA 3FL7A 5EV7A 2Q8EA 1AX2A 4COUA 3S7EA 3ZN5A 1QNYA 4FSJA 3SH5A 2XKOA 1S55A 2VO5A 3B5LB 4FPCA 5AVPA 1PGSA 3APBA 4NIAA 3D6EA 1HN0A 2XUEA 1UIKA 3NL1A 3POEA 4FPKA 3ZPOA 2XPJA 1XB9A 3ZYBA 2DVBA 4JTNA 3I2JA 3F95A 5DUXA 2HJIA 1W9WA 3UNPA 5GLVA 3UV9A 4BMEA 1OH4A 5A1LA 5BNPA 2VULA 5T5PA 2O8OA 3V64A 4E4DX 1QXJA 5CG9A 4XUNA 1VBD2 2R30A 1QNWA 1V6IA 2C4XA 1IKQA 3J9SA 1D4M1 1FYUA 4M3CB 3AZXA 1VALA 3A0KA 3VBHB 5K0UC 1PIV2 5A6XA 4QGLA 3MI8A 2CAVA 3DPRB 1U12A 4ZONA 2QNKA 1W04A 2V5DA 2B9VA 3RZJA 2CDPA 1R092 1OT5A 3I2GA 4AHZA 2VZ3A 2K0GA 5CIRA 4S2HA 5D8AB 2BERA 4Y1VA 3ZX7A 4XFCA 4LOSA 3QBQA 4Z1VA 2JD9A 3IDBB 3BU0A 1U0AA 1RUE1 1SMVA 5FKBA 2KA3A 3ZXEA 1UQXA 3AP9A 4LLFA 2QZ2A 1DQ1A 1J84A 1NLSA 4YLZA 4N7UA 4HK9A 4YM1A 1W6OB 1JZ5A 5L7OB 4RHV3 1HQNA 3L9JT 3UK9A 4XIOA 1W3XA 3HMYA 3VDDB 1SFNA 2NQYA 4NAOA 1NT0A 1K12A 1UKRA 3M2MA 2WNOA 4QPWA 3AFKA 3ZYJB 2AREA 4O9EA 3WY6A 1X9PA 2HWE3 3U10A 4Y5TA 2JG8B 4BLJA 4C90A 4YM3A 4R9DA 1RUG3 3CDZB 4H7MA 4MGSA 1GNHA 1LHWA 4ASLA 5A7OA 1GWLA 2E7TA 4BK4A 4LHNA 1A78A 1D4M2 4AL9A 2Y0OA 2FDFA 1YXWA 1QJU3 1G9DA 5FP7A 3K3OA 4ATFA 1COV3 1ZNPA 5T5LA 2IUWA 1JUIA 2GNDA 2ZGPA 3OPWA 2YFZA 3E1F1 4RL7A 3SH3A 4EN8B 4CXXA 1MR5A 4W65A 4JGYA 4AFAA 3CJIA 3KVBA 4XABA 1SACA 4W6XA 2V09A 4HT1T 4KBZA 1LKNA 1WCQA 5A7NA 1W0OA 5CKQA 4R8HA 3OGVA 1V6JA 1MZEA 1RUE2 3IB3A 3EYPA 4GH4B 4H55A 2MNGA 4JQTA 1QJY3 3PJQA 3PMSA 5F6LB 4MADA 3HOBA 2YGLA 5T54A 3T30A 2F4LA 2HEVF 2OKXA 5LEJA 4A42A 2BBAA 2JDKA 4AI3A 2WLQA 5LCWL 4CCDA 1RUC3 1ZA7A 2R061 1NUKA 2AGSA 4CEWA 1F9KA 5EYXA 2W92A 4M0NA 1N3PA 5FLJA 1AR81 1BVVA 1C28A 2VH9A 3POBA 3OGRA 5A6ZA 1GBGA 1YQCA 2QQJA 1R1ZA 2WZR1 3OCPA 4QDRA 5F32A 1JTZX 1JXNA 4XACA 4GMP3 1GP4A 4XZUG 4HVRA 3ZMNA 3AMQA 1BKZA 4FP3A 4PLMA 2VPVA 2WFF2 1SLTA 2CYFA 3K4ZA 3LB9A 4AF9A 1W9FA 2Y60A 5EJ1B 1BMV1 2HWD3 1UOGA 5A6YA 4DXZA 2D6OX 5LASA 3RG0A 1QQP3 4JDMA 1OA2A 2XJTA 4BHPA 1QIQA 2AENA 2QQVA 3ETQA 4DEQA 2B8MA 3SHRA 1N1YA 5GLWA 1DYOA 3MIHA 5L9BA 2BTVC 3ZXGA 4MV2A 4QDSA 2C5DA 1DU3D 3HD8B 1YFWA 4LOTA 1US3A 4AZZA 2OS2A 1ONAA 3OYWB 1RYYA 4AEDA 3BTZA 5J98B 2GNTA 1W2TA 2QTWB 1BEV3 3T2TA 2I45A 3FLPA 2BGPA 1D2QA 1EP0A 1FMD3 2D6LX 4KG0A 1ND3C 1O5UA 4D6SA 1SLCA 1JBCA 2UWCA 2AZ5A 4UBHA 1PZ9A 2H6CA 4YW1A 2QJVA 4CPBA 4QPGC 4GKYA 1IKPA 3T0AA 4XJUA 4LHKA 1Z0HA 2R062 1H4GA 4N53A 2YUEA 2JE7A 3MPPG 3WNMA 2R32A 2K46A 1AR82 3I3MA 3GF6A 1RL3A 4FAGA 1OBNA 3AZYA 1G6NA 5FY9A 2ZGKA 2GALA 2BFUS 2WZR2 2X10A 2YDEA 1V6OA 5F3CA 4X8NA 4A6SA 4PDWC 2B45X 4JDNA 4QDQA 3RPQA 3ZPYA 5I8TA 1PX4A 4AVBA 1NQDA 1AL0G 4P14A 3MBWA 4EN0A 5IW0A 1K3IA 1KDMA 1W8WA 2YXSA 3B9CA 2IC1A 2VMHA 5FZ0A 1QJY1 4NR1A 3KF5A 1I1EA 2FD8A 1C57A 1ST8A 3LA2A 4FPLA 4IL7A 5IVFA 3ILRA 3VKLA 3NKGA 1IQAA 4XUPA 1PVC3 3I8TA 4Q0UA 2YBKA 2VNRA 5A7QA 1Q8OA 4Q4W1 1CZTA 4AR2A 4DY3A 2WNUC 5A3TA 2YC2A 3URFA 1CJDA 4D7YA 2XR4A 4LHLA 2ARCA 2DVFA 3UL2A 3LWCA 1STMA 4XBLA 4XJWA 1V70A 5ANQA 3GDBA 3ZMOA 3BOWA 1SLAA 3M3EA 5KXCA 4BLIA 2UURA 3FUOA 3QCWA 4CDQC 4JHZA 2EALA 2GZWA 4H2AA 5AC93 1VBE3 2R072 1S0IA 4YZ2A 1TVGA 3DKQA 3VUOA 2HWD1 3SKJE 1WBLA 1S0DA 1QQP1 3Q8CA 3OPTA 4XDPA 2RDQA 4LK6A 1PVXA 2J1SA 4IEVA 3W21A 5A3NA 1HB3A 5JXHA 1LOGA 1LB2A 1MS3A 1CD3G 3MV01 3SEEA 4YGCA 4N8MA 1O91A 4AEKA 5FYTA 1UOFA 2LRPA 3LSDA 3WT3A 1TEIA 2WO1A 5FMDA 2QQOA 2OXBA 4XXAA 4CDUA 4XIKA 3WF2A 2V72A 1Y9MA 2X5IB 1NA1A 5A80A 3B01A 2W95A 3PJYA 4BCUA 1MQTC 4K1YA 4Q5OA 5CYYA 4YVSB 1BEV1 1CAVA 1VMHA 2XXZA 3FBYA 2OPWA 2X05A 1UIJA 3U0ZA 1PGW1 1JYIA 3EXUA 1QJY2 1UKGA 3VBFC 1GYKA 1WZXA 1LU1A 4NMIA 1WW4A 3MHZA 1OXCA 1KITA 3M3OA 3R4DB 4M01A 3RRDA 3UYJA 2XVGA 4D3WA 3X29B 4Q4W2 1AX1A 5C8CA 5L7OA 3ZSMA 5T50A 1DZQA 1OMIA 3ORJA 1DGRA 2VG9A 5GZEA 4AI8A 3J7MA 2E26A 1BQPA 2JG9C 5A70A 1NCQC 4YFZA 2OT7A 1BK0A 2VVFA 4IQPA 2WWUA 3JBG3 5E89A 2BEOA 2EXKA 2Q1MA 3ZFGB 3BGAA 5FMOS 2B42B 3TNQA 3K4AA 5LBCA 1NOVA 2NM1A 2JKXA 4I0WB 4DXSA 4IEZA 4LT5A 3IMNA 2XLAA 2HWD2 4E2SA 1X8EA 4QKBA 5IVJA 1QQP2 3KHCA 3HBKA 1FV3A 1GMMA 2QQIA 3OY8B 2Z4FA 3MO4A 1PVC1 3CQOA 4R9AA 2BFUL 2R041 1K5MC 1EAH3 3VBOA 4WM7A 4W6WA 2CTVA 4E4SA 4DUXA 1VMFA 3NSTA 3P5BA 2JD4A 3Q9OA 2DFCA 4HKOA 3NKTA 1GV9A 3BTXA 5C70A 4K8RB 5FYIA 3MFAA 5A1FA 3RZLA 4MH0E 4PBPA 3J4UH 1NQJA 1PGW2 1W99A 3FFZA 3M4FA 1X8MA 4DEVA 4GH4A 1BBT3 2EVXA 2W87A 5FZ7A 4Q4X1 1QXPA 4N90A 1QWRA 4RFT0 2V4VA 4DPNA 1YCIA 2BBVA 4HOOA 3NWKA 4CU8A 4QM8A 2IXCA 1R082 4RQPA 2F6BA 1I5PA 4I3PA 4YPJA 3B00A 1GANA 4JVAA 2WA3A 1PMJX 3CKHA 1R1A1 3DF0A 2XVKA 2ZPXA 4NRMA 2ZX3A 2B46X 3K75B 1LHOA 1PHMA 1ULDA 1PM7A 4IDZA 1RUI1 2OZJA 4EROA 3WF3A 4EZHA 3DKWA 2YROA 3BUCA 1V6KA 1H2KA 1UU5A 2ZS6B 4JGZA 5FZ3A 4DRRA 5B2GB 5HBAA 3VD9A 5J7MA 1HRI3 1OKOA 3TYJA 4X8PA 5CADA 3H3UA 4YGEA 1FX5A 1SQ4A 3N7MA 2R042 3CJIC 4FP2A 4JGYC 2Y6JA 5IWFA 3WW4A 1H1MA 3IZOA 2DCKA 5FIXA 2WAAA 2ILMA 1DGWX 1DQ2A 1V00A 4P9IA 2Y38A 4FT8A 3D82A 4RD7A 2XOMA 4YW5A 1H30A 2HWF3 3GBFA 1JHNA 1XQNA 3ENRA 1HKDA 1QMJA 1E57A 3CZJA 4LHSA 4GA9A 2DUPA 3OB8A 1H9WA 2W0XA 4Q4X2 2ARBA 1IPJA 4D94A 1TZOA 2WS91 1V6LA 2TEPA 5KXBA 2B39A 2IWGB 3AKQA 5FXXA 1JZ8A 2PHTA 4K3UA 3ZN6B 4M0HA 5I0SA 2ZX4A 3MW3A 3N7LA 4KL1A 2B7YA 3LEKA 2YU1A 5EHDA 1VBA3 3WHTA 3CF6E 3FN9A 3AZVA 2LROA 3HQRA 5E6HA 1R1A2 1RHI3 3WG2A 4G4FA 1W28A 3VHPA 5LZ6A 4B1LA 3WNPA 1RUD1 5FMOL 4D6QA 4FQZA 4FPEA 2QQNA 3WLUA 1J3QA 2ZGQA 1RUI2 2XH6A 4L97A 4Q2FA 4XBNA 3DGTA 3ZKUA 3ZSKA 1S4CA 5FUPA 4QB2A 3AP6A 1CAWA 3VN4A 4RR3A 1ENSA 1J3RA 3NMBA 4QPYA 4U36A 1TME3 4YVWB 5DDJ3 5HCFA 2HH9A 3TEYA 1ND3B 1WMDA 2W1WA 4OVEA 1SPPB 2FQPA 3T4HB 1AHSA 3JD73 5FV3A 1QH6A 3VBSA 4Y4YA 1TNRA 1F4HA 3J7LA 1UZZA 1A3KA 3AXEA 4H7LA 4BYYA 5ABJB 3A0NA 3ZSEA 1ZBE1 1ND2C 3KWVA 2XBO1 5EQUA 5APAA 3I2HA 1IS3A 1REFA 5FZ6A 1DFQA 1GLHA 1LHUA 1W6MB 2WN3A 3TRSB 1XOYA 2WS92 3GHNA 4PDWB 4C1WA 1AYM1 4N53C 3MUY1 3BU7A 4AAPA 4L11A 2ZGRA 1B35A 4ZHNA 2EIDA 1DGRN 4JTOA 4A45A 3WQ7A 1BZWA 2CNAA 4BQYA 1CGPA 1KGYA 1PO23 3TEZA 1F31A 2GAUA 1LOCA 2XVLA 1W2AX 2VZQA 1W9TA 5BNOA 1Q8PA 1RUD2 4XFGA 5DZFA 4KGQA 4C8DA 3R4SA 4HXCA 2XLGA 2WZ8A 1GKBA 2JDYA 3DN7A 2WNVA 4Q26A 4IEYA 5IUQA 1OUXA 3VBRA 2D44A 4QKNA 1W6NA 3AL6A 3PNAA 4NJ4A 4K21A 2IXJA 2RDNA 2BU9A 1XU2A 1G9BA 3S30A 4CDQB 5J09A 4ET7A 5FZDA 3WDXA 2VZTA 3BPSA 2NMNA 1JW6A 2R7EB 3HT2A 4XUOA 2YFUA 1ZVFA 1UD1A 3O1PA 3D8CA 1OHFA 1WA4A 3ZFEB 4XJAA 4LO5B 2FCTA 1ZBE2 1YHFA 4LKSA 3I59A 1RHI1 2HKXA 1RVF1 2XBO2 2BGOA 2P5BA 3ILFA 3ES4A 2DBNA 3ZYIB 2VNOA 4QAWA 3JU9A 3PIGA 3C7FA 4PIZA 4QQHA 4OI0A 3MZHA 4COWA 5FK7A 3K48A 5GLTA 2XJVA 2DUQA 3GZUC 1AYM2 1UMIA 1MQTB 3MF6A 2PLV1 4A2UA 4I09A 1CZVA 1TME1 3IPVB 2XJSA 2ZMKA 3I2FA 2W3JA 3MW4A 3VBFB 1S0EA 1FV2A 4CDUC 4AI9A 4DUWA 2IXIA 2GH8A 3AKRA 3P3PA 5FP9A 4NIIA 2GN7A 2E33A 1L3JA 4A41A 1Q8SA 3CO2A 4E4ZA 3ON7A 3UT0A 2VCAA 5HI0A 4N9HA 1QEXA 1OOPB 2VZ1A 3H9AA 1CAXA 2JE9A 4JRAA 2ZZQA 2JG9B 4XHXA 5FAXA 4O7XA 5HXMA 1NCQB 3ZFFA 3VKOA 3RZHA 1OH3A 1HXS3 2BZDA 2JDNA 2Y6KA 3PL0A 4LKDA 2XWJB 4CDXA 2ARAA 3SKVA 5F1RA 2AYHA 2O14A 2YBPA 1EUUA 3NV2A 4CUGA 4GKXA 1YUDA 4TWTA 1A8DA 3RYKA 4ARYA 1FNZA 3SC7X 3KZ4C 1N1TA 2WINB 1V6MA 3GZTB 1YNAA 2P3IA 1MEC3 4ASKA 4XW3A 2ZACA 1OQEA 5JZGA 5BNNA 2G4IA 5FK8A 5FZLA 3H8UA 5FZEA 1N47A 3VHOA 1RVF2 4HSJA 4QB1A 1G9CA 5IATA 4JKMA 2TBVA 1JZ7A 1K5MB 1M06G 3UJQA 5C3OA 2Y34A 4ONUA 1J1TA 1W2OA 3VL9A 2X29A 4AVCA 4UYBA 1J59A 2P4EA 5LWBA 5I91A 1VJ2A 3OEAA 1RGSA 4QX2A 3RDIA 3WCRA 5K7PA 1QJEA 5LRSA 1S0JA 1RMU2 2VZRA 4CEYA 1KFXL 2PLV2 2RJ2A 5ACA3 4DIQA 3LZZA 1NCRB 1WUVA 4DXTA 1AJKA 1TME2 3OD4A 2XLFA 4D7SA 4EE2A 1H8VA 4P9JA 2BNMA 4WM7C 1PO11 2D40A 3DYOA 1JYWA 4XAEA 2VL4A 2OX0A 5JCTA 1M4WA 5BXXA 1FATA 5FR3A 3UETA 1APNA 3LD8A 1C4RA 3NJVA 4KG8A 1F5JA 4WVVA 1S0CA 2XKPA 1GNYA 1RUF2 4NHYA 3GZEA 1IS6A 4FXGB 4IUGA 1YEWA 2BGCA 3B69A 4YM2A 5ERLA 2DUOA 4OUEA 1ZZ9A 3AVRA 2EF6A 4RQPC 4NHKA 5KHGA 4ZZ5A 1RINA 1S0BA 5E1RA 5G05L 5FZMA 4AI1A 1EYBA 4OI4A 1IS5A 5DAXA 3THCA 3T0BA 1IOAA 3IDEA 3VL8A 4LORA 4YW6A 2GC2A 4EQVA 2D3RA 2CWMA 2E53A 2YG0A 4H3WA 4FPYA 4XTMA 2QQMA 4RYDA 1NXMA 1DZTA 5A33B 1OVSA 1FPN3 2XMLA 3NQHA 2KM2A 4B3NA 2XL7A 5JSOA 4ZS3A 1O4TA 5DAVA 3VZJA 1ODNA 1U5XA 4CUAA 2AEYA 1OC1A 2NYYA 3N9PA 4E2QA 4CDWC 1OLRA 2GC0A 4UXAA 4HPKB 1MS4A 2Y6FA 3BVCA 5IVBA 3W59A 4PBOA 1PO12 4HVOA 4L0PA 5FYSA 1JZ6A 2DCYA 3AZZA 5L19A 4YW7A 3ZVXA 2VUCA 4XURA 1H9PA 4DMIA 4BQ1A 3A7QA 3U75A 1FXZA 1J3PA 2RE9A 5KC6A 2I74A 5FRAA 1GZ9A 4A6OA 1TE1B 3MF9A 1EV13 4AGVA 4XQ4A 2EICA 4AHYA 2YZ4A 4V1PA 4XE9A 3J8F3 3OGGA 5FBJA 5JPNB 5A32A 3U14A 1S2EA 3H8RA 1IG0A 1W6MA 4NWWA 3KV5A 1U5YA 4LPLA 1D4VB 3WUDA 5I0UA 1I5ZA 5F5AA 3T1MA 1LECA 2ZGNA 3PVBB 4LK7A 4NPMA 3KQRA 2RR13 1HB4A 2ZX0A 2WDBA 3HVDA 3ECQA 4LBQD 4QMAA 1HLCA 3M70A 1HRV3 2EIBA 3OF1A 4ISRA 4CUBA 5HV0A 4I2OA 1LEDA 1HX6A 2EAKA 4IE4A 1OVPA 1ULPA 3MGUA 4NIHA 4WV8A 1C8M1 2JIJA 1REEA 1NE6A 1TMF1 2VOXA 2ORXA 2P3KA 1MS9A 3H50A 5FY1A 5BV6A 3LQCA 5CISA 4RR3C 4FPGA 4MLOA 1C3HA 4HANA 4NOTA 1SLLA 4CTEA 2ZGSA 1GQPA 2BOJA 3KV9A 5FZIA 5JAXA 3OOXA 4IV1A 4Z82A 1JYTA 3H8XA 5I0RA 1AL21 3AJZA 4E8CA 1VR3A 5FPLA 2QE3A 1H2NA 3SMHA 5BYNA 5KC5A 2UYBA 5J36A 2WSUA 1GOFA 1ASJ1 3HNMA 3VDCA 2GNMA 5JVVA 3V0AB 3ITQA 2P3JA 5LA9A 2C9AA 3LOIA 3FUQA 3RYRA 2K2SA 1H8TA 2IXKA 1FAYA 1KS5A 2VOTA 4NN0A 2D3SA 4QKDA 5LBFA 3N9OA 5GZGA 5JXGA 1UO9A 2N7GA 1JOJA 4YG6A 1GR3A 4ZZ8A 4X6RB 4B4PA 1GZWA 1W9SA 1XE0A 4AYUA 4CCCA 2QQKA 1B09A 1DLLA 3C7HA 4KBBA 2QKDA 5KHHA 4EWAA 5C9AB 1UY2A 4Q29A 3MLLA 1UX6A 2ZAHA 3F2ZA 1DQ5A 5BNOC 1JYCA 3HJRA 5K4LA 4NROA 5C3QA 3OPZA 2ZEXA 4MVTA 2WNVC 1C8M2 1XE7A 2GN3A 2YYOA 3MDPA 1TMF2 1ZA4A 4FPOB 3VBRC 2CWSA 5C8WA 1UW8A 4KWLA 5ANNA 3MPBA 4QX3A 4OZOA 2WSVA 4RS5B 1OOPA 1VBB3 1EV11 4HL0A 1WD4A 3THTA 2FMDA 4IGQA 4PLOA 5E16A 3MIGA 3J8F1 4BQ3A 4KWKA 3CEWA 4K40A 2JENA 1MS0A 5L36A 1YRZA 2CV6A 3S6PA 3O1VA 1YC61 4CXWA 2Y8KA 2ZGOA 4K1ZA 2HYKA 2DVDA 5GM0A 4OMCA 3VV1A 4AQ6A 1AL22 1XXNA 2QQUA 1E5IA 3MIFA 5JXJA 2J1UA 1QJX1 4F83A 3OUHA 1Z7S3 5M0TA 1ASJ2 1HRV1 3NRUA 4AFDA 4M4RA 1UMHA 4CVUA 2XB6C 5DAWA 3A22A 3VBUA 1AR71 1VMJA 1D7PM 3N7JA 2X09A 4R4XA 1CN1A 2ZMNA 3ZSJA 5I93A 4FVVA 4GZ9A 3VKMA 3AP4A 5CFCB 1GQGA 1T6BX 2E7AA 4FFFA 3WNNA 4HETA 2ATFA 3K77A 5KR7A 3ZYHA 5JI9A 3O1SA 1QU0A 2PXJA 4A7KA 3GZAA 3MYXA 3QOPA 4LBMA 2XUMA 4XFIA 1WD3A 4WVMA 1KDKA 4L9BA 3NAPA 5J1XA 5LK5A 4BWOA 5JOWA 3VGIA 3WDTA 4UW4A 3WX5A 4JC1A 3ZFFC 2V5YA 2NZ9A 1POV3 3RFRA 4AK3A 4IETA 4Z2WA 4JKKA 3ACHA 1Y43B 1V9U3 3O1MA 2DFBA 1EV12 5GKAC 3WNOA 2Z69A 2J1RA 3LDKA 1XYPA 3RI8A 3C8XA 3H1WA 2WR9A 4YZ1A 5JZGC 2OIIA 5BNNC 4HZFA 4LLOA 2NPIA 1PK6A 2OA2A 3VD7A 4EV0A 1QJX2 2Q4SA 2JE8A 1X33A 1AXYA 3QACA 4GALA 4QHBA 1DDLA 1HRV2 2Q8OA 1KS4A 1OI6A 2G1MA 2ZHMA 4Z07A 5CG8A 2CSGA 5FO9B 1AR72 5B4XA 1O5LA 4IV3C 1W3VA 4EN9B 4MGKE 3E5XA 5T3NA 5F3IA 2UYAA 1VBB1 1L7QA 3IM0A 5D2AA 4ZXKA 4FTBA 1QJZA 4UFIA 5LY2A 3USUA 5IFPA 1H1IA 3I2KA 4OHWA 1R64A 2JB4A 3OTFA 4YM0A 1HDKA 4L8QA 1ZZ7A 5J3UA 3RZMA 4LBQB 2C26A 4FOQA 4LA2A 5FUIA 1AR63 3N9QA 5F7UA 1QKQA 3MLKA 4IXLA 5FZ1A 5JUVA 1LAJA 2NP0A 2VZOA 2KXLA 4RHV1 4QPIB 3POWA 1YQ8A 5KHJA 5J37A 1VAVA 1ALYA 4HKLA 3AP5A 5T5OA 4KNCA 3S5QA 3VHRA 2A3YA 4XXPA 1OSGA 2C6SA 4N43B 3GNEA 2VTXJ 1LGBA 2HWE1 3O0WA 1VP6A 4AI0A 5C4WB 4UWDA 4DB5A 4META 3NNLA 3WV6A 5CZKA 2FZ2A 2O0OA 1RUG1 2G9GA 5FQ0A 2HWC3 3VLBB 4RFRB 5FZGA 2W5FA 5CKMA 1W8FA 2VBBA 1SCSA 1NG0A 3FMGA 3GYDA 1QJU1 2ZTNA 1X9TA 4HK8A 4IGOA 1COV1 2QQLA 3EQEA 4Y26A 1BCXA 5DUWA 4LO8A 1UX7A 1DIWA 2A7AA 4UOJA 5JLVA 1POV1 4BQ2A 3CMGA 4XJ9A 4U2AA 2F4PA 1V9U1 1W2UA 4EN7B 4LJHA 3I49A 1Q3EA 1VPHA 2FBEA 4NHLA 5FZAA 3UJOA 3VD3A 3W5MA 2UWAA 3DXUA 2XGXA 4H14A 2E9QA 2L9LA 3KGLA 3IMMA 1YJKA 2RS53 3T08A 1CAUB 2VR4A 4RGKA 5A3LA 1BMV2 1NYWA 4WM8A 3DCQA 3NW4A 4XDQA 2J7MA 4LITA 1YO8A 3SXWA 2FDGA 1LOBA 1PMHX 1WWYA 2QBXA 2RV9A 4W8JA 4E27A 2ZABA 2D6KA 2PHLA 4JCKA 4RHV2 1RUC1 5FMCA 1BLZA 1JU3A 5DXDA 1UF2C 3WG3A 4FPHA 2BWAA 3ATGA 4F7ZA 1OPMA 1ENQA 5LEKA 1VRH3 1OPOA 1SFYA 3PHMA 3T1LA 4CZSA 3Q8FA 1KD7A 5EZWA 2HWE2 4GMP1 4MG2A 1UXXX 1US2A 4UFHA 2MEV3 4ZY9A 1NY71 3W20A 4FFHA 3BB6A 1CZSA 1RUG2 4PQ9A 2GDFA 1WW7A 4BQ4A 1BHGA 2ZKLA 1DYPA 4YSFA 3FX3A 5CFDC 3VZOA 5CEHA 3AYAA 5BY5A 2VQ0A 1QJU2 3C2UA 4M3CA 4AW7A 1KJLA 1COV2 3P1IA 3WQBA 3VBHA 1GNZA 3DPRA 2BQPA 5FXVA 4CU6A 4PT6A 4D7TA 3D0JA 2A6YA 1LU2A 3JB4C 2FDJA 2VCBA 3GCXA 4ES8A 3IN9A 3H8OA 2LTNA 4EYUA 1I3HA 3LE0A 3SNMA 3THDA
chains in the Genus database with same CATH topology
4XQDA 4IV1C 5D8AA 2CGOA 5DUUA 4GB33 2R6QA 2ZOEB 1WCSA 4R52A 1FMD1 3K51A 4R4ZA 2RMU3 1VBC3 5KHIA 3ZO0B 1W6PB 1ULFA 2QZ3A 3H7JA 4DZGA 1W6OA 1RUC2 3G6JB 4ITCA 4FO9A 1O3TA 5GZDA 4ZU4A 3VDDA 5K0UB 5H9RA 1MS5A 5BNPC 4LUKA 3BIWE 2GH2A 5EWSA 5I8YA 2WT0A 4HVQA 5DZGA 2JG8A 4QGMA 1NY72 4YG0A 5D1IA 4Y24A 4BIFA 1JH5A 2ES3A 3WCSA 1XRUA 1DYKA 2D93A 2BVVA 4B7KA 4JRLA 4BMBA 3PVOA 4OULA 4MZUA 5DG2A 1LGCA 3B9IA 4AQTA 1XNKA 4I0BA 2R1DA 1BEV2 1X82A 4AVAA 2A6WA 5GLUA 1FMD2 1N1VA 2C0ZA 4GWNA 4XMIA 1QGLA 1U5IA 3V65A 4YZ5A 4FTSA 5AC91 1VBE1 4RA0A 1MZFA 2WQ4A 3TNPB 4XETA 4TLFA 3VBUC 2R0HA 2TNFA 3H7YA 1QF3A 5SV8A 3RZZA 1UPSA 2Q5TA 4E2GA 3HBZA 3B7MA 5J96B 2VOVA 3B93A 3O12A 1UAIA 3WP4A 1NLRA 2RS13 3FLTA 2PHDA 2VXRA 4WZCA 4Q27A 4WBBA 4YARA 2P2KA 4Y1UA 4ZKTB 3NAPC 1LEMA 3TB0A 1RJ7A 4Z92B 2RMU1 1RIRA 2OVUA 1PVC2 1ENXA 3ZXFA 2BNNA 2OZ6A 5IK8A 1DQ4A 2Z79A 1KXGA 2RS33 2VVEA 2YMZA 4YYOA 5AFBA 2IXLA 4PCRA 2DV9A 1WLWA 3OYWA 3P3NA 3EJKA 3JBG1 1PK6C 4ATEA 1CPNA 4N43A 4IV3B 4KGGA 4XQWA 1PGL1 4F8AA 4MXWB 5AC92 1VBE2 2GC1A 3I7DA 1S2BA 4EWDA 4CEWC 1S2KA 4P9YA 4C0BA 1ZM1A 3LKJA 2XG3A 5CNAA 5H9SA 1EAH1 2W08A 2BWCA 3KT7A 2HWB3 2ZGMA 2MHFA 2OUJA 4B4RA 3N36A 4PIXA 4XF1A 1YFYA 2AUYA 3OD0A 3D0SA 4M3CF 2VGDA 2ZGUA 1V6NA 1BBT1 2AH2A 3ME2A 3R0RA 2RMU2 4GIQA 3BTAA 4HMZA 4N7IA 5IT6A 1WBFA 4Q8KA 1CPMA 5BNQA 1Y7BA 1G7YA 4SBVA 4QQ2A 2DF7A 2YGMA 1AR93 4QPGB 5H9QA 4AEDC 3H0OA 1I6XA 4YW3A 2XJQA 4ES9A 2ZMLA 2W68A 2OYZA 3ZIXA 3ILNA 3JBG2 3RMYA 2ZAAA 2ZHKA 1PGL2 3RQ0A 5FCCA 2UU8A 4INDA 2Q30A 1WCKA 1VAKA 2JKBA 2EA7A 5GJ6A 4UBGA 1GFF2 1YI9A 3WDUA 4WVZA 2WWSA 4JQRA 3B02A 3JQXA 2JX9A 1HRI1 2VECA 4XFHA 3NVCA 1EAH2 3TN93 4GWMA 1BVP1 5FDBA 1MS1A 2WNUB 2X5IA 2R0FA 2Y26A 1YI7A 4WM8C 2HWF1 1WLCA 4YVSA 4XFFA 3W9AA 5EJ3A 1WLDA 3MEPA 5A3MA 1BBT2 2ET7A 2PAEA 5KHKA 4QQPA 1SBFA 3U11A 3S7IA 2VW0A 2BW8A 4NPRA 1AYN3 3H3ZA 1VBA1 5CFDB 3S0MA 3AYCA 4XYXA 5FPZA 1LJ7A 4G9SB 1OFSA 1ZX5A 4LBOA 3WHUA 3WXPA 3O5SA 3CLPA 4Y20B 2HEYF 2I07B 3HR9A 3ZFGA 1ZZBA 5HCBA 1C5IA 1X36A 4P9XA 1HRI2 1W39A 3A4UA 5DDJ1 2XJRA 4W6YA 2NMOA 3JD71 3OY8A 4ISQA 1NA1C 4C1XA 3NV4A 4COZA 1LCLA 3WW2A 5D8AC 2ZX2A 2A6VA 1BYHA 1Z78A 2W52A 4WVWA 2HWF2 3KD4A 4JAAA 4D69A 2D3PA 4Q4Y3 4J1WA 2BPA2 3H1YA 3VZLA 2YC0A 4TSVA 5HCAA 1ZZ8A 1VAMA 2YHJA 4XTPA 1SCRA 5C8CC 5L7OC 4E9KA 2BYVE 5GZCA 3WNXA 1MS8A 1HV1A 5GZFA 4QXKA 3VDDC 1VBA2 1GICA 4Q4V3 3E6CC 1PO21 2X8KA 2FHRA 1RHI2 1ZRRA 1PNFA 4R9CA 4I02A 3WINE 1XE8A 3HQXA 5FBZA 1LULA 3WP3A 4ZU7A 1PNGA 3EHKA 4QT6A 4XJ8A 2B5HA 1D0HA 1HV0A 2ZZJA 1SLIA 1Q8VA 5DDJ2 4HBNA 3ZXJA 2JDZA 4NHMA 3SH4A 3VBOC 1IZ3A 1JN2P 3JD72 3HIFA 5FREA 4R9BA 2XL9A 1QH7A 3FWEA 4FOVA 4S2FA 3WR0A 2JICA 4A3XA 2H6BA 2RJLA 2UWBA 1NE4A 4GH4C 3FHIB 3KCCA 1CR7A 3WQ1A 1HQWA 3R4UA 4AQ2A 3FFQA 1KFUL 4BZ4A 4MXWA 2VY0A 2WJSA 4LBJA 4DS0A 2D43A 3V56A 1CIWA 3AFGA 3ZN6A 4X6QB 4YGBA 3KT4A 4B8EA 4QD2A 2WA4A 1PIV3 1G8WA 1PO22 3VZMA 4JV4A 4YRDA 1F2NA 1F5FA 3KM5A 3AK0A 3WP6A 4P9GA 4JGYB 3CJIB 1AX0A 1GQHA 3SITA 3U07A 5JSRA 1UZYA 4JGZC 4AVSA 3FE5A 3ZYRA 4FTEA 2VMIA 1HIXA 2EIGA 1HXS1 2QVSB 4XHBA 2E7QA 3LOBA 2VUAA 5EXOA 2UY8A 1RB8G 3QH6A 4YVWA 3ZSLA 1ND3A 2ERFA 1RC6A 4P9LA 2VOKA 2A73B 1DQ6A 4CEWB 1MEC1 4Q4V1 2NN8A 2Z42A 4ZU5A 3WG4A 2QFEA 5ABJA 2DTWA 5DZEA 3RSJA 2DTYA 2A71A 4ORFA 5J48A 3TBDA 5IK5A 3E6BA 5BPXA 2H0BA 4QX5A 4PDWA 2PHRA 5SV5A 1WLTA 2D5FA 3WDVA 1VIWB 5ACA1 3AYDA 1D4M3 1EPZA 5DUVA 4AVTA 2IXHA 4TYSA 3ZYPA 3WVJA 2Z2SB 2EXHA 3CU7A 4MX3A 1EPWA 4HFSA 1UMZA 1RUNA 3PLQA 5CVRA 2WLPA 3FJSA 3KS7A 2R1BA 4LULA 1H4HA 4I0AA 3JZVA 1C8NA 3V0BB 1ND2B 3NV3A 3D5OA 1O3SA 1RUE3 1HXS2 4K20A 5BUVA 1REDA 2JJ6A 3VBSC 2B9UA 4DINB 2ZCWA 4CDQA 3VHNA 3E97A 3IIAA 4AFCA 4N53B 3NJZA 4UW5A 1MEC2 4LO7A 1OD5A 3ZFEA 5AVAA 5FO7B 1OQ1A 4OZXA 1QHDA 1C5HA 2P17A 1FPN1 3M7AA 2WFF3 3OBTA 1B35C 4XILA 1H2MA 2GSYA 1MQTA 5ACA2 3PVNA 1ULGA 3IPVA 1YFUA 3CNAA 3VBFA 3MIBA 4B7EA 2WNEA 2R49A 3M8LA 2X5IC 4K8FA 1LOFA 3OGJA 2XJUA 2VQAA 4M3CE 4YVSC 2CGPA 2Z5WA 2EAAA 2XHKA 4N9IA 1DQ0A 3AX4A 2JG9A 1NCQA 3M3CA 2GMMA 4LBKA 4YZ3A 2A75A 4XOGA 1LOEA 1FT9A 2UY9A 1GSLA 2O8QA 2WL1A 2WC2A 2Q1ZB 5TSWA 4KQ7A 2R063 2RR11 2BVBA 3J26N 4Q0VA 1AR83 3N4MA 2DCZA 5EYYA 5IK7A 4CDUB 4XF4A 3ZFGC 4B4QA 2WZR3 1NA1B 3SCFA 1FPN2 1K5MA 2VW1A 2WT2A 4YZ4A 2D98A 2E51A 2GU9A 2LALA 1CAVB 1OA4A 4QM9A 4CYDA 2PHWA 4Y5Z0 4LO4B 3M3QA 1KRIA 2W39A 1NCRA 1YIFA 2SBAA 4IEXA 2WIIB 1CX4A 5C8CB 2PELA 4IERA 4BPZA 2ETEA 1TNFA 3WZ1A 4IESA 4P9WA 1UU6A 2ENRA 1ZBA3 3MFCA 1ULCA 4Q1PA 4FOWA 4CDXC 1FI2A 5FTTC 1LTEA 1X7NA 4QGNA 3J8F2 3O7OA 3ELNA 3VKFC 2WFF1 3FBMA 2R073 1W6QB 4S2DA 1WCDJ 2Q0AA 4QQLA 4OUSA 1XNCA 1WGPA 2RR12 4AFMA 4NVPA 3PVEA 3VBOB 2PTMA 1ZZCA 4WM7B 2DVAA 5EFUA 2D6PA 3VKNA 5A33A 3RS6A 1XU1A 3JUUA 4OHYA 3LA7A 1Y3TA 4CEYC 3QD6A 1LOAA 4XEZA 5AFEA 4AHXA 3AKTA 4LA3A 5T5JA 1GZCA 2ET1A 1IS4A 1XYOA 2A70A 1VB2A 4HPKA 1JUHA 1RUJ3 4AEMA 4AI1A 4AE2A 1C1FA 1DG6A 2GNBA 2VOWA 3DV8A 4RQPB 3TAYA 4Q4W3 1A6CA 1RITA 1SEFA 3USSA 5E88A 2CAUA 5LK7B 1Z7S1 1Q5OA 4L99A 4LO6B 2DU0A 2O1QA 1OA3A 1QOSA 1ZZ6A 3W58A 5JDBA 4CP0A 3E6DA 2X53S 4MGIE 3E5QA 1LGNA 4JGZB 3AM2A 3ASIA 2RHPA 3NO8A 4C0HA 4CDWB 4AGGA 5H9PA 2JEMA 4XFAA 3WD5A 5FOBB 2CL2A 2ZJCA 1SBDA 3ES1A 2QCSB 3I4IA 4L92A 3UKNA 2VU9A 4YW4A 2WZPP 4FCAA 1ZBA1 1RUH3 2DYCA 1IPKA 1VBB2 3V0BA 1ND2A 4YVWC 2R16A 2H0VA 2E63A 5CU1A 2DURA 4SLIA 3N3HA 2R071 4GULA 2ZX1A 3RYPA 2OW4A 3ZDSA 5ABJC 1R083 4LBLA 4Y22B 2PFWA 1WMFA 4FPJA 1Z7S2 3AZWA 1PZ7A 1QOTA 3GBGA 4FOYA 3V0AA 2ZHLA 1AXKA 1A8MA 1J58A 2QQPA 1D0GA 2ARXA 4FBFA 3AKPA 1CAWB 4AQSA 1YYNA 1DZRA 2QDRA 4RR3B 4YFWA 1G9FA 4OLLA 3RI9A 3N7KA 3AP7A 5L73A 5C9AA 4AI2A 4YG3A 2BUKA 4BA6A 1RUJ1 4MXVA 2R043 4DY5A 3VBSB 1WMEA 2VMGA 3L2HA 4LR4A 1MZ5A 1AR61 1ZRFA 3ZXKA 3WG1A 2P34A 1S0FA 3KLSA 1ZBA2 1V9U2 4RS5A 1BXHA 3N35A 1C1LA 1QY4A 4Q4X3 3CJXA 2ZA9A 4HN0A 2PAMA 1UCXA 5F5QA 2GMEA 4KU7A 3ALQA 3ZFEC 1B35B 4K9SA 4BE3A 2SLIA 2MPFA 2K9ZA 2HWC1 1N3OA 3POSA 4YGDA 4KU8A 4DRVA 1U5ZA 4NWVA 1H8TC 1OLQA 1R1A3 1KQRA 5BNOB 1YLLA 5GALA 3BPZA 1RUI3 1HQLA 2D6MA 2WNVB 1NXD1 1RUH1 4I30A 3OJBA 3VBRB 1G9AA 4Q0PA 3MW2A 4EWEA 3SCHA 5CFCA 1W6NB 1LENA 4MUVA 1LESA 2Y0IA 2RS51 5KXEA 1VLNA 4M00A 1RUJ2 1LOFC 1H2LA 3UKTA 2A3XA 1R081 1AR62 1YIPA 1SLBA 2WFPA 1W0PA 3UKVA 1T6GC 1OOPC 2GC3A 3I59B 1SDWA 3AMPA 5JOXA 4FQ4A 5F9TA 3EO6A 1VRH1 1O4ZA 4DQAA 4Z8BA 1ZRCA 1ZRDA 4BOWA 4PF5A 3RMXA 2WS93 1D2SA 1LR5A 1XNBA 1W6QA 4WZFA 2MEV1 1RJ8A 3MIEA 2DWRA 2VUJA 2HWC2 1ULEA 2RM23 3E5UA 3MIDA 3RJ2X 2BNOA 3WDYA 3WUCA 5CBLA 1Q8QA 2TUNA 3JQWA 1RUD3 4F3JA 4QQOA 5JOZA 4BIOA 5KXDA 4MGYE 1RUH2 1CAXB 2VVDA 4NO4A 4OHVA 1NCRC 3ZFFB 1UL9A 5LRRA 4CDXB 1DF0A 4GB31 2RS52 3ZYGA 3DUIA 4GXLA 1H1AA 3MLJA 3HAGA 1O7FA 1MZ6A 1VBC1 5JZGB 2JXAA 4LBQA 2XJPA 5BNNB 4A7ZA 2AR6A 2ZGLA 3O0XA 2XWBB 1ZBE3 3KSCA 4QPIA 2XBO3 4G3YC 4TZDA 3IBMA 1MVEA 2DCJA 4XF3A 1VRH2 3WW1A 5C33A 1LHNA 3WQ0A 3LA3A 3IWZA 1DBNA 3ROUA 1N3QA 1AYM3 4CEYB 4Y1XA 5C4WA 2MEV2 2VW2A 1Q56A 3KCYA 1S0GA 4CDWA 4LE3A 3O14A 3IKWA 4Q1RA 3TOJA 1SBEA 3G7DA 1IHMA 1PMIA 3KT1A 4I3GA 2I2SA 4OI1A 1AVBA 4URTA 1LODA 3AB0A 4OI2A 1MVQA 3DL3A 1QDOA 1DGLA 1QXRA 1POV0 5T55A 1UN1A 4BH9A 4DFSA 5C6CA 3AMNA 1CESA 1J1LA 1YJLA 1H0BA 2FZ1A 4GB32 3AXDA 5JWPA 1CAUA 4YW2A 5GLZA 4AGRA 1CONA 3FLRA 5DG1A 3WW3A 1FOD3 1VBC2 5HXVA 3ZN4A 1QOOA 3U4XA 2DVGA 4Y22A 2RM21 1O3RA 1KJRA 4FAHA 3WOGA 4DNYA 1RVF3 4J1XA 3ST7A 4C91A 1DGWA 4PJYA 5KWRA 4JDOA 3INAA 2DU1A 4LE4A 1G86A 3IT8A 5I8SA 1RMU3 2PLV3 4UW6A 3HN1A 4GMP0 2RS11 5FLHA 4P5HA 4RGGA 3BCWA 4UW3A 4OFGA 4XZPA 5FLIA 2P37A 2IZWA 4AVVA 2PN5A 4ASMB 3TWIA 3VZNA 3I2DA 1AUYA 3KB5A 1RUF3 3FZ3A 3QH7A 2A5ZA 4MYEA 2RS31 2FMYA 4K6BA 4XF9A 2OUHA 2PA7A 4MSVA 5A32B 4Q0SA 4DOUA 2D97A 2WT1A 2D5HA 3GALA 5FPXA 3JB8A 1VB4A 3M1HA 1W6PA 2A6ZA 2RM22 3B94A 5K8SA 1MACA 4RGAA 5JSPA 5K9YA 1DHKB