4FTEA

Crystal structure of the d75n mutant capsid of flock house virus
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
328
structure length
328
Chain Sequence
TRLSQPGLAFLKCAFAPPNFNTDPGKGIPDRFEGKVVSRKDVLNQSISFTAGQDTFILIAPTPGVAYWSASVPAGTFPTSATTFNPVNYPGFTSMFGTTSTSRSDQVSSFRYASMNVGIYPTSNLMQFAGSITVWKCPVKLSTVQFPVATDPATSSLVHTLVGLDGVLAVGPDNFSESFIKGVFSQSACNEPDFEFNDILEGIQTLPPANVSLGSTGQPFTMDSGAEATSGVVGWGNMDTIVIRVSAPEGAVNSAILKAWSCIEYRPNPNAMLYQFGHDSPPLDEVALQEYRTVARSLPVAVIAAQNASMWERVKSIIKSSLAAASNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords Capsid protein alpha
publication title Structural study of virus assembly intermediates reveals maturation event sequence and a staging position for externalized lytic peptides
rcsb
source organism Flock house virus
total genus 80
structure length 328
sequence length 328
chains with identical sequence B, C
ec nomenclature ec 3.4.23.44: Nodavirus endopeptidase.
pdb deposition date 2012-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01829 Peptidase_A6 Peptidase A6 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4fteA00
1NOVA 1VBB3 2BFUL 4GH4C 1ZBA2 2PLV2 4SBVA 5ACA1 3CJIC 2HWD2 1RHI2 1MQTB 3DPRB 1IHMA 4RHV2 3JBG2 1BEV2 1VBC1 2FZ1A 1K5MC 4GMP1 2HWE2 1VBB1 4LLFA 2WS92 1AR93 5K0UC 1AR72 4YVSA 4IV3A 1QQP3 1PGW1 2WWSA 1OPOA 5D8AB 3JB4C 2BPA2 1AR91 5BNPB 1VBE3 1FOD3 4RS5B 2WFF3 1QQP1 1R1A3 1FPN3 4Q4Y2 1QJY2 4N43B 1VBE1 1NCRC 4RQPA 1RUG3 3ZXAC 1FOD1 1SMVA 3VBUB 2WFF1 3VBOC 3J8F2 1R1A1 1FPN1 5BNOC 1RUG1 4FTBA 1V9U2 4Q4W2 1RUI3 4GMP0 1ZBE2 1PGL2 1BMV2 1OOPA 4YVSB 1RUI1 1NCQA 4IV3B 5C4WC 1AYM2 1PO23 1EAH2 4RR3B 2HWF2 4Q4V2 3VBFA 1AR62 1MEC3 1R093 4CDWA 1HXS3 5AC92 1PO21 1H8TA 1HRI2 2XBO2 4N53C 3VBSC 1AR82 1RVF3 4RQPB 4CEWA 2R072 5ABJA 1R091 1HXS1 2RS52 3VDDA 1AYN2 1RUD3 1RVF1 2HWB3 1WCDJ 5C9AA 1BBT2 3NAPC 2R043 1RUD1 4JGYA 3ZFFA 5ACA2 4CDQC 2VQ0A 1RUE3 5C8CC 1X36A 1VBC2 1F8VA 5BNNB 1VBB2 1OOPB 2R041 1RUE1 1R083 1PO11 4QPGA 3VBFB 1ND2C 2RS33 4CDWB 1HX6A 1AR92 2HWC3 1H8TB 1R081 1QQP2 3CJIA 5CFCA 4GB33 4CEWB 1VRH3 2MEV3 5ABJB 1K5MA 4WM7C 2HWC1 1VBE2 2WZR1 1FOD2 3VDDB 2WFF2 4IV1A 4YVWA 1R1A2 1FPN2 4GB31 1C8M3 1VRH1 2MEV1 3JB8A 2GSYA 1RUG2 1VBD3 5C9AB 4CDUA 3ZFEA 4JGYB 1MQTC 3DPRC 4RFT0 3ZFFB 4FTSA 1RB8G 1TME3 1C8M1 1AL23 5DDJ3 3VBHA 5FMOS 2ZZQA 1VBD1 1QJU3 4AEDA 2FZ2A 1TME1 3ZFGC 1RUI2 1AL21 1ASJ1 5DDJ1 4QPGB 1NY71 1X33A 4RR3A 1RUC3 1QJU1 4RS5C 5BNOA 2X5IA 5LK7B 5FMOL 1TMF3 3M8LA 1M06G 3CJIB 5CFCB 1PO22 1RUF3 1K5MB 1RUC1 1POV3 3VBUC 1MEC2 1R092 5CFDC 1TMF1 1HXS2 4IV1B 4YVWB 1GFF2 1E57A 1RUF1 4Q4X3 5L7OC 1POV1 3VBRA 3TN93 4CDUB 3ZFEB 5J96B 1HQNA 1RUJ1 4JGZA 4WM8A 4NWWA 4Q4X1 1RUD2 3VBHB 2HWB2 3TN91 1NCRB 4YVSC 5BNNA 4IV3C 1RUH3 4AEDB 3LOBA 2R042 2RR13 1D4M3 1RUE2 5BNOB 2X5IB 1RUH1 1NA1A 3JBG1 1BEV1 2RR11 1COV3 1ND3A 1D4M1 4RQPC 4NWVA 2RS32 2HWC2 1COV1 1PVC3 3JD73 1POV0 5JZGA 1EV13 4GB32 3VBRB 1VRH2 2MEV2 1A6CA 2ZAHA 2RMU3 1Z7S3 1CJDA 1PVC1 3JD71 4JGZB 4WM8B 4BCUA 1PO13 1EV11 1C8M2 4CEYC 1OOPC 1NCQC 2RMU1 1Z7S1 1VBD2 1W39A 4WM7A 1DDLA 1TME2 4PDWA 1PGW2 1AL22 5DDJ2 4CDWC 1V9U1 3FBMA 1NA1B 4GH4A 2WZR3 1QJU2 1ND3B 4QPIC 1VBA3 4CEWC 2BBVA 1B35C 5ABJC 1RMU3 4CDXC 1RUC2 3VDDC 3HAGA 5K0UA 1VBA1 1TMF2 5JZGB 1AR61 1RMU1 3ZFGA 1RUF2 1OHFA 5C9AC 1VB4A 4JGYC 3ZFFC 4Y5Z0 2R063 1FMD3 1ASJ3 4Q4X2 1HRV3 3TN92 1NCRA 4WM7B 2R061 2RM23 1PIV3 1QJX3 1FMD1 4Y4YA 5CFDA 3IDEA 3VBOA 4QPGC 5D8AC 4PDWB 1HRV1 5BNPC 5L7OA 5GKAC 1BBT1 4GH4B 2RM21 1PIV1 1QJX1 1RUH2 5CFCC 2QQPA 2RR12 2RS13 4N43C 1D4M2 2GH8A 1CD3G 4IV1C 4YVWC 5K0UB 1C8NA 1RUJ3 2RS11 2Y26A 5C4WA 1COV2 3ZFGB 1RVF2 4CDUC 1AUYA 3ZFEC 3VBHC 1PVC2 3JD72 3VBSA 2TBVA 4N53A 1EV12 1ZBA3 4AEDC 2PLV3 2HWD3 3VBOB 2RMU2 1RHI3 4RHV3 5CFDB 1Z7S2 3JBG3 4RR3C 1BEV3 2HWE3 2ZTNA 4FTEA 1PO12 5L7OB 2WS93 1ZBA1 2X5IC 1AR73 2PLV1 2HWD1 1RHI1 4RHV1 5A33A 3NAPA 2HWE1 1R082 2WS91 5A32A 4CDQA 1AR71 5C8CA 4CEYA 1AL0G 5J98B 1VAKA 2XPJA 2WLPA 2WZR2 2IZWA 5C4WB 4Q4Y3 1QJY3 4Z92B 1VBA2 3VBRC 1RMU2 2DF7A 3J8F3 1ND2A 1QJZA 4JGZC 4WM8C 4Q4Y1 4EJRA 1QJY1 3VBSB 4N53B 4QPIA 1NG0A 1MEC1 1B35A 5BNNC 3J8F1 1V9U3 4CDXA 4Q4W3 2R062 3VBFC 1FMD2 1ZBE3 1ASJ2 1NY72 1HRV2 1NA1C 4Q4W1 1H8TC 1VB2A 5A33B 1AYM3 1ND3C 5FOJB 1EAH3 3NAPB 2RM22 1PIV2 1QJX2 2HWF3 1MQTA 2HWB1 3DPRA 1ZBE1 4Q4V3 5A32B 4CDQB 4FSJA 1PGL1 1BMV1 1AR63 5C8CB 4CEYB 5AC93 1AYM1 1NCQB 1EAH1 1HRI3 2XBO3 5JZGC 1AR83 2HWF1 4Q4V1 1F2NA 2R073 5D8AA 2RS12 5AC91 5BNPA 1ND2B 1HRI1 2XBO1 4RS5A 2RS53 1AYN3 1AR81 2BFUS 1RUJ2 2R071 4QPIB 1B35B 2RS31 4N43A 4CDXB 1BBT3 3VBUA 2RS51 1AYN1 5ACA3 4PDWC 2BUKA 3S6PA 1VBC3 4GMP3
chains in the Genus database with same CATH superfamily
1IPJA 2XQXA 4FVVA 4A7YA 1VBB3 2XJVA 4GH4C 1HQLA 1ZBA2 4Q0VA 5JMCA 4Z8BA 1ULDA 4SBVA 3CJIC 1DGLA 3AP9A 2HWD2 2W47A 2WNVB 4QAWA 5DAPA 1O59A 2BGPA 3V0AA 4LUMA 4BDVB 4XJ9A 5H9SA 4AL9A 1V6LA 2H6BA 4GMP1 2HWE2 1VBB1 3VD7A 3U0ZA 1GV9A 4Q0SA 1ZYBA 4MSVA 4OLLA 3V0BB 3POYA 3QACA 1IPKA 2QCSB 3H9AA 1RC6A 2NN8A 3GYDA 1MS9A 1QQP3 2ZMLA 4S2HA 4TWTA 1PGW1 5FZ6A 1ZRDA 3VD3A 4YM2A 3RZHA 2EIDA 1W2TA 2WN2A 2GP3A 3EQEA 5KC6A 2WQ4A 1DZTA 1CAVA 1QQP1 1OURA 4WVMB 4M01A 3EXUA 1IS6A 2PAEA 3OGVA 2A6ZA 2EAAA 3J7HA 2LW8A 2VBBA 4Q4Y2 2WDBA 3I3DA 2HKXA 5FZ9A 2QQVA 1W8ZA 4RQPA 1GZWA 3U78A 4EQVA 2XHKA 5DAVA 4MXVA 1LU2A 4XW3A 3S30A 5JPMB 1S0IA 3J8F2 4IE7A 3WDYA 3E6DA 4J1WA 1LJ7A 4IQPA 2R1DA 1DZQA 1HJFA 5F5QA 3CF6E 4XF4A 4FPKA 4MX3A 4AVSA 1XJAA 4AFMA 1G86A 2BTVC 4UXAA 4E27A 2A5ZA 4HN1A 5LASA 1V9U2 2VOXA 2VUCA 2W87A 1PVXA 3EMRA 3OBTA 1DGWX 1X9PA 3U10A 2VZSA 2D5FA 5KHGA 5FO8B 2ZKNA 1LHWA 2W39A 2ZGQA 4LBMA 2EXJA 1WGPA 2VM9A 3ZKUA 2GAUA 3J7NA 1BMV2 1YUDA 3GZEA 4JHTA 4XUNA 4Y5TA 1OOPA 3HQXA 1XNKA 4YVSB 1NCQA 1UMIA 4K3UA 3NJVA 1YQ2A 3L2HA 3WP3A 1AYM2 5DQ0A 5C4WC 1PO23 1EAH2 4IE4A 5JAXA 4RR3B 2J1TA 4HKWA 2WRAA 1MS8A 3H7JA 2VECA 4L2NA 1O7FA 4P9LA 4NPMA 3VZOA 2V72A 3ZN5A 1GUIA 2J1VA 1O6UA 1PO21 1H8TA 2XKPA 3EBRA 5LA2A 4GALA 1NE6A 5GJ6A 4NPRA 1P8JA 1LB2A 3S5QA 1XXNA 4EN0A 1OQDA 3AYAA 4Q5OA 5FZHA 4CP9A 1XNTA 2OW4A 2UY8A 1OSGA 1I5PA 4AAPA 4IEWA 1YFXA 1CVNA 4I0AA 5FYSA 2VUAA 5DUWA 1ULFA 2CV6A 3NAPC 3OD0A 4MZUA 4C91A 3IKWA 5C9AA 2JX9A 2ILMA 5JUVA 3RMYA 5FXVA 3TYJA 2VQ0A 2A6VA 2GC2A 5H9QA 4CCNA 4V2VA 3BN6A 1J59A 4BQ1A 4CCCA 4XFIA 4NRPA 3UYJA 1F8VA 2CAUA 1QNWA 3ZDVA 3WNMA 2CSGA 2HYXA 5CISA 1FNZA 2ZPXA 5FV3A 3KV9A 4BQXA 5A3LA 5FXWA 3RZGA 5FYZA 3VBFB 3W59A 2G1MA 3MIFA 1V6MA 1NYWA 4GQ7A 3WG2A 2ERFA 1GNHA 2EICA 2R1BA 2XJSA 5KXBA 2GC0A 1YIFA 1AZDA 3I4IA 1W6PA 4FP3A 4CPBD 3SLIA 1VRH3 3N7LA 2L9LA 1RXFA 2WAAA 4H7MA 1QDCA 2BNMA 4OUMA 4UAPA 5F3GA 3VDDB 2WFF2 4YVWA 1OPMA 1R1A2 2GU9A 2W94A 1C8M3 1VRH1 3ZDSA 2B5HA 5EP9A 1OH4A 4AHZA 2GSYA 4MUVA 4QX3A 3HN3A 5BNQA 1VBD3 4MGQA 4B4QA 3RYPA 1G9DA 2WNVC 4JGYB 1H2NA 4Q27A 3I97A 1TME3 3CZJA 5FY1A 1C8M1 1HJGA 1CGPA 1AL23 1JS9A 3CBNA 3VBHA 5M0TA 4KG0A 4XQ4A 2UWAA 3R4SA 2ZZQA 1VBD1 2MHFA 2Z2SB 3AVRA 3ME2A 4QM8A 2Q30A 4FFHA 4AQ6A 1TME1 2AGSA 4PF1A 1SLLA 4IL7A 1AL21 1O91A 5CNAA 1OBNA 1QMJA 4RR3A 3N36A 3H1MA 3F2ZA 1UMHA 2NMOA 3AL6A 5BNOA 2WO1A 2X5IA 5LK7B 3T1LA 4HETA 5FMOL 3M8LA 1W8OA 2MNGA 4XHXA 4R4ZA 5ANNA 2E7TA 4D7SA 2A75A 4MVTA 1G6NA 1R1ZA 1I3HA 1K5MB 4WBBA 3HN1A 4DPNA 1MEC2 3FFQA 4F83A 3AZZA 3C7OA 3E5QA 1HXS2 1RJ7A 1WBLA 3KVAA 4ORFA 1A3KA 1OD3A 2A7AA 4UFIA 4XF9A 4CA9A 5A3UA 3MPPG 4S2FA 1W8NA 2W3JA 2ZA9A 3FHAA 1UPSA 4Q4X3 5FZKA 5L7OC 1TG7A 2JIJA 1H6YA 1LOEA 2RHPA 3LEIA 3PDQA 3MFAA 5FKBA 3TN93 3VBRA 3BPZA 2FDHA 1RJ8A 3RG0A 3ZFEB 3IDAA 4OI0A 1HQNA 1VP6A 3PUQA 2B8MA 4NWWA 4Q4X1 1RUD2 1VRBA 2VBPA 3I2GA 3ZXDA 1HIXA 2FDJA 2IUWA 1W8HA 3M3EA 3OY8B 2VULA 4I0BA 2C9AA 4UW4A 4YWAA 5EFUA 3TN91 4Z2WA 1NCRB 4LLOA 4QPWA 4YVSC 1W03A 5F5IA 2QQMA 2V5YA 2JG8C 4DRRA 1FATA 4LIVA 1YFYA 2VJXA 2Y6GA 2DTWA 1W6OA 5I0DA 4COYA 1C1FA 2OA2A 1D4M3 1RUE2 4NVPA 1Q43A 4E4ZA 1ULOA 5F3EA 3LWCA 1H1IA 5FO7B 2QTWB 2WQ8A 2XJQA 4QQLA 3I2OA 1COV3 4LT5A 1D4M1 3KT1A 3N4MA 2RE9A 4W6WA 4G4FA 1N1YA 4URAA 1PZ8A 2MPFA 4NWVA 1W04A 2PTMA 4UWDA 4FFGA 1J1LA 3FC0A 3LOIA 1GZCA 3M70A 3QD6A 5G05L 1COV1 5I8YA 1PVC3 4CUAA 1DYOA 5DAWA 1WLCA 4LO7A 1F9KA 2OYZA 1OH3A 1EV13 1SLIA 2K2SA 4QQ2A 1ZA4A 1V6OA 5EHDA 3V64A 5LEKA 2RMU3 2Y6FA 1Z7S3 5B4NA 1PVC1 1F5FA 1HDKA 2AENA 2JE8A 4BCUA 1DCSA 3J26N 2RDNA 1PO13 1EV11 4K20A 3RI8A 2P5BA 1IOAA 3TRSB 3BGAA 2BGCA 1Y9GA 4BOWA 4GD4A 4XAAA 2TUNA 2ENRA 2YU2A 2RMU1 3A0KA 2ES3A 2QDNA 1CX1A 1Z7S1 4BQYA 4ASLA 2B7YA 3POSA 4WVVA 2WO2A 1OUSA 4JRLA 3AJYA 2P3JA 4XURA 5LEJA 1VALA 1UQXA 2ARBA 4MOAA 1QKQA 4MGYE 1FT9A 1ZRIA 3B5LB 1ST8A 1AXYA 2B42B 4B3NA 5FLIA 5LCWL 3RS6A 1W9SA 4LBLA 4D6RA 4HKOA 2XOMA 2R0HA 1ND3B 3H50A 3A4UA 3I8TA 4Y22A 1GLHA 3VN4A 5FMDA 1UOFA 2ZX3A 3O1VA 4Y1YA 1KJRA 1N3QA 1R64A 2Q8OA 3VDDC 1SFPA 1CAXA 3ALQA 4HOOA 4M4RA 2B9VA 5GLWA 5FZDA 1EY2A 1TMF2 2LUWA 3ZMOA 2BOIA 2IXCA 3EJKA 3RJRA 1OHFA 2GMMA 1IS3A 5DN2A 4IE0A 3VL8A 2QQIA 1A8DA 1HN1A 4DUVA 1CJPA 3O0VA 4JGYC 5CVRA 4EN9B 2JDUA 4Y26A 3LFMA 3VGIA 5KHHA 3NWKA 5LBFA 5DABA 4A41A 1UKRA 2DBIA 2ZGRA 5FP7A 4XBQA 4DB5A 2WNOA 2AREA 4QQHA 3SITA 3X29B 1NCRA 4BK5A 4WM7B 1O3TA 4CUGA 4QU1A 3RZMA 1BQPA 2GC1A 5CFDA 2W08A 3ACIA 3IDEA 5D8AC 5FP4A 4PDWB 4HMZA 4AHYA 1W3VA 2PXJA 1YIPA 1GZ9A 2QQUA 2Z42A 1W6NB 3OTFA 4LHLA 4XUTA 2WNUB 2JEMA 2CU5A 1BBT1 3PVOA 3WV6A 3O5SA 3BPSA 3P5BA 4XJAA 4OHWA 1WLDA 3GALA 4DS0A 3FWEA 2LRPA 4NIGA 4FPYA 2Q0AA 3NVCA 2DV9A 4K40A 3KQ4B 5K0UB 4Q0PA 2JECA 2DWRA 1U5XA 1RUJ3 2DDUA 3VB9A 5IVFA 1G9FA 2F4PA 2W1SA 4RGKA 3R05A 5FUPA 3ZFGB 4N9IA 2Y0IA 4HBNA 1UPIA 4JKLA 4MO3M 4XBNA 3TNPB 5FMCA 2I07B 5F8PA 4LBKA 3ZFEC 3W9AA 4LORA 1QNYA 3LDBA 1UZVA 5FZ1A 4CU7A 4EROA 3H3LA 2OX0A 3LFIA 4H55A 5G04L 3VBSA 2TBVA 2ZEXA 5FY4A 4YM3A 1SDWA 3D0SA 2ZHMA 4BA6A 5E16A 3VBOB 4NIDA 3N7KA 4RHV3 3ZVXA 1IG3A 1ZZ9A 3CHXA 3FBYA 1V6NA 2VZRA 3JBG3 4TLGA 1PZ9A 1PGSA 1W06A 4EV0A 4P9IA 1J3PA 1LCLA 4P9WA 4Y4RA 3HBKA 1AR73 1J3QA 1JOBA 3VKLA 4AG4A 4S2DA 3OUIA 4AEMA 4RHV1 5FZGA 2CWMA 2GN7A 5A33A 4AVTA 4IE5A 4FCAA 3O1MA 2G9FA 1CIYA 1KS4A 4XCAA 3BU7A 2E6VA 2JJ6A 1GOGA 5EXOA 5A7NA 4BPZA 1AR71 2ZGOA 1XNAA 1Z78A 4AXOA 5LATA 1M4WA 2QVSB 5FK7A 1VAKA 2SBAA 2XPJA 4FBFA 3T2OA 1JW6A 2WR9A 2IZWA 4LBJA 3ZPOA 4CVUA 4RSUA 3BTYA 1QJY3 3JQWA 4YSFA 1VBA2 1J3RA 2R6QA 3KD4A 1QH7A 4N7IA 1RMU2 3T0BA 2YXSA 1GQPA 1IS5A 1SBEA 3ZXFA 4IGPA 1LNSA 1HN0A 2WFPA 5F6LB 4YG6A 3OGRA 1QJY1 4NRQA 4I2OA 1W8FA 2VW2A 1ULCA 1QIQA 3F95A 3H3UA 1GBGA 2E7QA 5FY5A 1WA6X 2E7AA 1UY1A 2AACA 1ULGA 2WZ8A 2ZEZA 5F37A 1LR5A 1QF3A 4GJYA 1JBCA 3FZ3A 5IVVA 1I1EA 1YHFA 2VZ1A 2ARAA 3ILRA 4QXKA 1GMMA 2D6MA 1ZBE3 2ZS6B 3LE0A 4OI4A 1ASJ2 3NNJA 1NY72 2C24A 3RFRA 1HRV2 4Q0QA 4AI0A 5K9YA 1DGWA 3VD5A 4BK4A 4DINB 5FWEA 2VXRA 5BV6A 2PHDA 5FZEA 1ND3C 5FOJB 2YBSA 2RM22 1QJX2 5SV5A 4WZFA 1ZBE1 1GP6A 4AEKA 3BB6A 4AVVA 4CDQB 1PGL1 3B7MA 4HVOA 4FAGA 2VNRA 2R49A 3AKQA 1PMJX 3AMHA 3PL0A 4BISA 1X8MA 4UYBA 1UY2A 4A4AA 4IETA 3H8RA 4HT1T 2ZABA 2WIIB 2XBO3 3B00A 3GJAA 4Y20A 2W92A 1DZRA 2VR4A 4IEVA 2R073 4ONUA 1EUUA 2R30A 5DPNA 4Y1XA 5BNPA 1G9CA 1GOHA 2WYSA 2XBO1 1HLCA 2W0XA 3PTRB 4IERA 3O1TA 2RDSA 1WBFA 2VQTA 4RD7A 4D7YA 1HKDA 4P9XA 5FZ8A 2R071 4QPIB 3UT0A 3WY6A 1G9BA 1B35B 2AZ5A 1W0OA 2RS31 4N43A 1YXWA 3KCYA 1VIWB 4CDXB 2J1AA 4UFHA 4LIUA 1MS3A 3WCSA 4PDWC 4UW3A 5TSWA 5I8SA 4NUBA 4AWDA 1VBC3 3LF7A 1LENA 4UBHA 5EJ1B 2BFUL 1V6JA 3FFZA 3UKNA 3E1F1 3ES4A 1SQ4A 1E5SA 2ARCA 1WW4A 1FYUA 1FI2A 4GJZA 3I3QA 1MQTB 2X10A 4LKDA 1BEV2 5IYYA 1VBC1 5ISLA 3AKTA 1GQGA 3KT4A 3O12A 4YW3A 1JHJA 1W28A 5FOBB 3I59A 1XQNA 2QZ3A 3PJQA 2WS92 4FOQA 4U36A 3T4VA 4A3ZA 5K0UC 1OFSA 3AP6A 4LA2A 3B02A 2DVDA 5T3NA 2D43A 5I0TA 2C4XA 4IV3A 3FHIB 4FFIA 1S0BA 1MZ6A 4META 1JTZX 2J1EA 3G7DA 1A34A 3K4AA 1BHGA 2BPA2 4BIFA 1F5JA 3KV5A 4FOVA 4MXWA 4XJUA 2ZMKA 1FOD3 1PMIA 2PN5A 4RS5B 3H3ZA 4FOYA 3WD5A 1FPN3 5K7PA 4AOCA 1CONA 2Y6KA 1UZYA 1VLNA 3WQ0A 3CMGA 1ENRA 5C70A 4QB6A 3ZXAC 1FOD1 1SMVA 3AP5A 3VBUB 3FHQA 1J1TA 4MADA 4HFSA 4ISRA 4QHOA 3SC7X 3VBOC 5JOYA 2WNEA 2N7GA 1FPN1 1OKQA 3ELNA 4XPVA 1H0BA 1SLTA 2GNBA 3IN9A 4RYDA 1SHWB 4F3JA 1N3OA 4Q4W2 4ZHNA 3V0AB 3GZTB 3HNBM 4GMP0 4XILA 3W20A 3MUY1 2HEVF 3WNOA 4AGVA 2DFCA 2TNFA 4YFZA 3WP5A 2AYHA 3AFGA 3T30A 2DURA 3DV8A 4D6QA 3WHTA 4DMIA 2B9UA 1VPHA 4HSLA 1YQ6A 1LHVA 4G9SB 1OMIA 3AM2A 4Q8KA 4I3PA 2XKOA 2HWF2 3E97A 2YROA 5FLJA 3ZN4A 3WUCA 1AR62 4BM8A 3KMHA 1R093 3ZX7A 3OG2A 3GBFA 1LU1A 1CAVB 4FXKB 3ZPYA 1BJQA 4XJ8A 1JOJA 4JC1A 5FYYA 1HRI2 2OUHA 3WDTA 3NV4A 4XJZA 1AR82 4OI1A 5KHJA 1UX6A 3HR9A 3K3NA 4RQPB 4XE9A 1GZWB 5ABJA 1R091 3MF9A 3ES1A 2XVKA 3OPTA 3GXUA 2WJSA 1JZ7A 3VHRA 3GDBA 3DKQA 5FBZA 1O4TA 2C5DA 2VZOA 2IXJA 2RS52 1AYN2 3EHKA 1O4ZA 4OHXA 2VE1A 3O1RA 2FHRA 2HWB3 2WZEA 1GWKA 5FMBA 4B1LA 2XVGA 4K21A 2VW0A 4HPKA 2CGNA 3NJXA 2VZUA 2SLIA 2DCYA 4N90A 5IHRA 5J48A 5A6XA 4A6OA 2XLFA 1GWMA 1C4RA 4CDQC 1H9PA 4Q2FA 5FQ0A 1NXMA 4I30A 1RGSA 2Q4SA 5APAA 5BNNB 2DU0A 4QX0A 1VBB2 1OOPB 1NAEA 1ZZ6A 4YGDA 1DU3D 5E6HA 3WF3A 3TEXA 4FPEA 2NLRA 2Y34A 3R4UA 3B9IA 1R083 2XL7A 2ZHKA 4CP2A 3I2FA 2YMZA 4M0NA 4UFLA 2CHHA 3DKWA 4LK7A 2P6CA 3PUAA 1S2EA 2XB6C 4TN7A 1HX6A 4PLNA 4ZZ8A 4QMAA 3LDKA 1H8TB 3HNYM 1R081 1O8PA 2E53A 5EPAA 3GCWA 1C1LA 4ES8A 1QQP2 3CJIA 5CFCA 1LOFA 4IEOA 4GB33 5CKNA 1DQ0A 3IPVA 4XOGA 1US2A 5FZCA 2ET1A 4L99A 5IW0A 3RYKA 1D0HA 1LOCA 2WZR1 4YW4A 2W1QA 3KV4A 3CDZB 4RL7A 1KRIA 5FZMA 5FCCA 1CZSA 3NRUA 3VZJA 4CP9B 4GB31 3OEAA 5EJ3A 1HB3A 2DBNA 1Z0HA 4GKXA 2BYVE 2JB4A 2ZEYA 3I2KA 3RWKX 3SH3A 4AVCA 4QGMA 5DUUA 1VR3A 1BK0A 3B3QE 5JMOA 5C9AB 4CDUA 4M00A 3U11A 5LB6A 1MQTC 5FZ0A 1RXGA 2HLEA 2P17A 3FLTA 2VH9A 3OPZA 1HV0A 5DDJ3 2JXAA 1XRUA 2ID4A 2K0GA 2CL2A 1LEDA 4ZY9A 3IDBB 2JIGA 4UFJA 1B09A 1QJU3 4FXGB 4P9YA 5LK5A 3RRDA 3UJOA 3VHPA 4AEDA 4DY3A 3ZSLA 4DO0A 2FZ2A 3MIGA 2WWJA 2AEZA 3WVJA 1LGNA 5IWFA 3LGRA 4M3CF 5DDJ1 5JOZA 1GOFA 3MW2A 1YWKA 4I0WB 4OQ8A 2ZZJA 1AXKA 1LODA 3ACGA 1W9FA 4HK9A 5JSRA 1QJU1 4RS5C 5L9RA 4NAMA 3MLKA 2D98A 4LHSA 2XJTA 4NJ4A 5FP9A 3AP4A 2FMDA 3ZYRA 1W6PB 3BTZA 1ZZ7A 1PO22 1SPPA 1UIJA 5KBFA 3VBUC 1BKZA 5I8TA 4XMIA 1BXHA 2GNTA 4EZHA 1DYPA 3PIGA 4YVWB 1GFF2 2BJSA 4WZCA 4P00B 1YQCA 4LR4A 3DGTA 1N1TA 5A3OA 5CBLA 3SCFA 1PK6A 4JKMA 3ZSJA 1W2AX 1VMFA 1KJLA 2NMNA 4MYEA 4NRMA 4D8MA 1O3SA 5FREA 4JGZA 2ETEA 3VBHB 3VKOA 2X29A 4CP0A 3CQOA 1BVP1 1E5HA 3NNMA 2VCCA 2GN3A 4RFRB 5FPAA 3ZN6A 5BNNA 5HCHA 1RUH3 2EALA 2IXLA 5A7SA 3O7OA 4E2QA 2OPWA 3ZYFA 2BRTA 1V70A 2RR13 5KWRA 1IKQA 4C1WA 1W3XA 3JU9A 4NMIA 5IAXA 1FX5A 5BNOB 3VUOA 1OF4A 2X5IB 1RUH1 3MLJA 3TNQA 4EN7B 5A7WA 5C71A 1NA1A 3WXPA 4W6YA 2Y38A 2RR11 4RQPC 1J84A 3T0DA 2FQPA 1GWLA 4YW5A 1KFUL 1TNFA 2Z79A 3M3CA 1Y43B 4M3CE 3HEIA 3AZWA 5JZGA 3RWNA 4IEZA 4EWEA 4DUXA 1NZCA 5ANQA 3OBRA 1X7NA 4IW3A 4NHYA 1VRH2 3VBRB 2EIGA 4XF3A 1QDOA 4NR1A 4OVEA 5LRRA 3HPNA 2H6CA 2FDFA 3J7LA 1NQJA 1LKNA 3B94A 5H9PA 4Q1PA 4XXAA 3WF4A 1LGBA 1C8M2 3A7QA 4CEYC 3SQOA 1ODNA 4QKFA 4KWJA 1OOPC 3NSTA 4XABA 5EYYA 5A7OA 1NCQC 4NIAA 3THPA 4E8DA 1VBD2 5GLUA 1W39A 2QFEA 5LY2A 3B01A 1KEXA 4HSJA 4I01A 1W6OB 3MV11 1DDLA 3I54A 1TME2 2KXLA 1OUXA 1AL22 2ZHLA 1DQ6A 4EN6B 2J22A 2VVEA 3QBQA 4IDZA 2XHNA 1V9U1 5FZBA 3C7EA 4B1MA 3AL5A 3QH6A 1WW7A 4HL0A 2YPDA 2JDAA 1YNAA 5LA1A 4DEVA 3ETQA 3I2HA 3VD4A 5JXIA 3HT1A 1Q8QA 2YUEA 5D21A 3LEMA 2W5FA 1H8VA 3MICA 4FT8A 4EWDA 4V1PA 4Y5SA 5A3TA 5A6ZA 1ZRFA 4CXXA 4YARA 4AFCA 2WUHA 4LK6A 3ZOIA 4AI1A 5GLVA 3HAGA 3RNSA 1DIWA 2JB8A 2ZGPA 3WG1A 5FUNA 2VOWA 5L73A 1O5UA 5FTTC 4EYUA 5A1LA 4BQ2A 5FZ3A 2YGMA 1I5ZA 2UURA 2C9KA 2OZ6A 1JU3A 5JLVA 1XU2A 3POJA 1OQEA 4JCKA 2VZ3A 4KMQA 5C9AC 1REFA 3JCIA 5KR7A 3WOGA 1CAWA 1ACCA 4KBBA 4LKFA 2QE3A 2VOVA 2P34A 5FY9A 1RITA 1JXNA 4Q4X2 1IQAA 3GM8A 3BODA 4COWA 4YW1A 3LSDA 5LBEA 3TN92 5E88A 4CCOA 5FRAA 4QX5A 2QQKA 4LE3A 3H8OA 1DP0A 4PIZA 1Q8OA 3ZYIB 3GCXA 4IUGA 4WVWA 1SG3A 3N9NA 5DXDA 1H30A 5CKMA 5L7OA 1OFNA 5KC5A 4GZ9A 1WD3A 3TOJA 3WP6A 2PAMA 3LPGA 4YG0A 3CNAA 1J58A 1HB1A 5F39A 3SHRA 4Y22B 1IGOA 1C3HA 4PI2A 2OXBA 3H7YA 1UYZA 1D2SA 4O9EA 1SZBA 5F9TA 2KA3A 4GWIA 1D4M2 1L7QA 2A1XA 1UY3A 4JDOA 4MGIE 2GH8A 3DYMA 5L9BA 3RI9A 4QD2A 3ITQA 3KB5A 1JZ5A 1WLTA 1CAXB 4FP2A 4YVWC 1YRZA 2E63A 3SNMA 3Q8BA 3WSOA 1C8NA 2JG8A 3PU3A 2NP0A 1JZ8A 5KXEA 4Q26A 1COV2 3CU7A 3ZXJA 3ECQA 5FP8A 4OULA 1RVF2 3AYDA 3MPBA 1JUHA 4PIYA 1W9TA 3WP4A 1AUYA 2VUJA 1XE7A 2K9ZA 3NV1A 3PTYA 4DOUA 3VBHC 2VQAA 3BTXA 1PVC2 1QGLA 4N53A 2Z69A 1EV12 3IIAA 4ZONA 3RPQA 4BH9A 3RZJA 3ETPA 3WNNA 2PLV3 3ACHA 4IE6A 2RMU2 1RHI3 1XNCA 3HWJA 2F17A 1Z7S2 5CFDB 1UOJA 4RR3C 4FPGA 1IZ3A 2JG9A 2PQSA 2ZTNA 4FTEA 1DQ4A 2DUQA 2QUOA 1PO12 4JX0A 3LKJA 5CIRA 3S7EA 2WBKA 2X5IC 2WT2A 1MS1A 5KHIA 2PLV1 4JAAA 2JDHA 3ILNA 1RHI1 3VKFC 5I0UA 3ATGA 3HD8B 3TWIA 1KFXL 1AJOA 2G19A 1ZZCA 4KNCA 2O0OA 2RJKA 2YGLA 3UGFA 3S57A 5C8CA 1CZTA 2IXIA 1YI7A 2CAVA 2P4EA 4W4ZA 1W6QA 1ZX5A 3S0MA 1WMFA 1KXGA 5DMYA 2XXZA 4QDSA 4Z92B 1WCKA 3VBRC 4E4SA 4O61A 2JWPA 2BZDA 3VKNA 2ARXA 3W5MA 1ND2A 5CB7A 1WA4A 4GAZA 3T3YA 1AHSA 5AVAA 1H2KA 4EJRA 4ATEA 1YLLA 1MVQA 1YYNA 4L9BA 5FYIA 3VBSB 3NKGA 3ZM8A 5ERLA 3INAA 5I0RA 2WO3A 3RGBA 2VW1A 1MEC1 1UX7A 2FMYA 3AMQA 4LNVA 5GZCA 1PMHX 1C5IA 1X9TA 5JWPA 2YYOA 4R9DA 3VBFC 3VZNA 1W0NA 2WINB 1UWWA 3KHCA 1V6KA 2C26A 1PHMA 5CYYA 4L92A 3EO6A 4R8HA 5LA9A 1ONAA 5A33B 4FO9A 4BU2A 2Y6JA 3EYPA 5J36A 3AXDA 4H7LA 1CX4A 2HJIA 1UMZA 1WLWA 2E31A 3DPRA 3H8UA 4Q4V3 5A32B 1LGCA 5AFEA 2ATFA 3T2QA 1I6XA 2G4IA 1ZNPA 2B39A 1OA2A 5AC93 3JZVA 5FO9B 3GGLA 3USSA 1OQ1A 1PNGA 4XETA 3TAYA 4GWJA 3WQ7A 4DXZA 4Q4V1 1JZ4A 3LSEA 1HQWA 2R16A 3D0JA 3SCGA 1F35A 5D8AA 3GZUC 1SFYA 3SH5A 4F7ZA 1H1AA 1DQ5A 5AC91 1YQ8A 5E8AA 3U4SA 3KS7A 1H6XA 3PU8A 4HG6B 3BUCA 1H4GA 3KQRA 4ITCA 5DZGA 1NT0A 1RUJ2 3P3NA 3VDCA 1E5RA 2FCVA 2CYFA 1GZTA 2QQLA 3WG4A 3VHOA 5B2GB 1JZ3A 1BBT3 3GHNA 3VZLA 2PHRA 2QBXA 4RGGA 5ACA3 4S2GA 2GMEA 3LA2A 4Y3OA 5JCTA 5A70A 3MLLA 4JRAA 3DUIA 1S4CA 1UN1A 3S6PA 2DUOA 1NOVA 2CNAA 1UL9A 4XZUG 4AFBA 1YO8A 2PHXA 5ACA1 2OKXA 4DY5A 2RVAA 2ADDA 3K75B 1RL3A 4J1XA 4AW7A 4D94A 4RHV2 1IHMA 2VMIA 2ZGTA 3JBG2 2EF6A 5C3PA 1XE0A 3R0RA 1K5MC 2VPVA 2R32A 2JENA 2BP6A 1IQDC 3CO2A 1PM4A 2VMFA 1AR93 2RG4A 1LOAA 2WKKA 2BWCA 1AR72 2ZGNA 1W9YA 3OGJA 5H9RA 4HVQA 3KF3A 2B4KA 3UV9A 4Y20B 5A6QA 3DECA 4DZGA 3FE5A 4KGQA 5D1IA 3AK0A 3UNPA 4JTNA 2WWSA 5C3OA 4Y1VA 2GC3A 2X8KA 4RGAA 3GZAA 3WDWA 2P3KA 3JB4C 3LIHA 5DG1A 3BU0A 2A70A 1AR91 5BNPB 1VBE3 1MACA 2A6YA 4KQ7A 3O1OA 1W6MA 2RV9A 3WW4A 4CCEA 3UKVA 4B29A 4R9BA 4UF0A 4OCTA 2V4VA 1QJY2 1SEFA 2CDPA 3ORJA 4N43B 3PVNA 5E89A 1VBE1 1NCRC 1RUG3 4Y1UA 2EIEA 3ZIWA 1UNBA 3MDPA 2VCMA 2XWJB 3N3HA 5CG8A 2CTVA 1OC1A 3ZSEA 4CUCA 1JN2P 4ZU7A 3CEWA 4Y33A 2R7EB 5FPXA 3O0XA 2VVDA 5CZKA 3U07A 4M3CA 1RUG1 3SH4A 3MZHA 4BMBA 3ZO0B 3LIGA 5KHKA 5KXCA 4FTBA 4FOWA 2PHTA 3C3VA 1RUI3 4PBPA 4K8RB 3GNEA 4DQAA 3WZ1A 3I59B 4AGRA 3BOWA 1ZBE2 2E51A 2YPJA 3P1IA 1PGL2 4OI2A 2A3XA 5HI0A 1JYCA 4XACA 1RUI1 4IV3B 1SLCA 5GZEA 2XUMA 2YBKA 5K4LA 4XQWA 3UL2A 4LA3A 5C5UA 3BOPA 4MXWB 3O1PA 3RZLA 4ES9A 4CDWA 1MZFA 1O3QA 1ENSA 3GJBA 1W2OA 1WCQA 1QOSA 1LESA 1OA4A 2XBO2 3VBSC 3K48A 2D93A 2DVFA 2WLQA 2CGOA 2WWUA 2XJUA 5FYTA 2Q8CA 1WKYA 2R072 2GNMA 4YYOA 3SXWA 4CEWA 2XONA 4UW6A 1WMDA 5FXZA 2YBPA 3M2MA 2EXHA 2GNDA 1JMUB 1MZ5A 2V09A 5FJHA 4Y1ZA 4ET7A 5FZOA 1S0GA 3ABZA 5F5CA 3U4XA 1N1SA 1LOBA 1UZ0A 3HBZA 5T5OA 5JPNB 2OQ6A 1GANA 3CZUA 3QOPA 1QY4A 5DUXA 3VZMA 2FDGA 4EWAA 2R043 3USUB 3ZFFA 3DL3A 1NUKA 3LEKA 3KF5A 2FBEA 1JYNA 4ISQA 4OHVA 1F31A 4HN0A 4UBGA 1X36A 2XJPA 1VBC2 4IESA 3BALA 5F3IA 5FZ7A 3SEEA 2VOTA 2A6XA 1QOOA 2Y8KA 4AYUA 2VZVA 3LA7A 2R041 3SEPA 3POIA 2H0VA 4DXRA 2VOKA 1F4AA 2BNNA 5A1FA 4QPGA 2XR4A 5JI9A 1ENXA 1H4HA 1X82A 2G9ZA 1W8UA 2RS33 5C8WA 1XYPA 3KHBA 1UW8A 3AYCA 2JICA 5JIAA 3IAQA 2HWC3 4KWLA 4QDQA 4R9CA 3E6CC 2NYYA 3MBWA 5CG9A 3KSCA 2XVLA 4HXCA 4LHNA 4CXWA 4MG2A 2VUDA 1VE0A 2Z5WA 3S5AA 5EYXA 2OUJA 4IEXA 4QGNA 2MEV3 2AR6A 5ABJB 1XYOA 5J7MA 1U0AA 2VG9A 4WM7C 2HWC1 1AF9A 3DYPA 1FOD2 3L9JT 1OD5A 2JE9A 4LTAA 4IV1A 5T5JA 4GXLA 5FBJA 1J83A 1FPN2 1UXXX 1VMHA 2MEV1 4H14A 3MIHA 1SBDA 2WNUC 4NIHA 3WF0A 4KG8A 2VXJA 5FLHA 2E9QA 1CAUA 4HPKB 3THDA 4ZS3A 1K5JA 1S0CA 4JQRA 5FYHA 2IXHA 4QM9A 4RFT0 3ZYBA 3ZXGA 4FTSA 5FQ0B 5CAZA 2FDIA 4C8DA 1G9AA 4AFAA 1BVVA 1OLME 4JDMA 3OCPA 1HW5A 3AZYA 4QXHA 5FYMA 4CUBA 5A3NA 4CYDA 4K6BA 4QX7A 2WT1A 5FYCA 1YC61 3ZFGC 5T50A 1ASJ1 3TBDA 1LHOA 1NY71 1T6BX 2QNKA 3OF1A 1RUNA 3OBAA 3POWA 2NM1A 1JODA 3LB9A 1RUC3 5FY7A 4RN5A 1FV2A 3MIBA 4D0QA 1G7YA 4C0HA 2PHLA 1M06G 3CJIB 5CFCB 5EWSA 5BYNA 3BVCA 4L0PA 1CZVA 2JDKA 1RUF3 3IPVB 4LQRA 2LALA 4J25A 1RUC1 1POV3 2JD9A 5B4XA 4ZU5A 3HOBA 3ZYHA 1R092 1GQHA 4QXCA 3LAGA 5CEHA 2B45X 4L11A 1E57A 3HMYA 3D6EA 4YZ3A 1RUF1 1EPWA 2DVAA 3PURA 3IZOA 2BNOA 1POV1 4LUKA 2ZEWA 4UFKA 4XEZA 3WNLA 4CDUB 2ZGUA 3FUQA 3MUZ1 1K45A 1S55A 4BLIA 2HBTA 4LJHA 1OLRA 2P3YA 2XJRA 3C7FA 5FZ4A 2D6PA 3USUA 4WM8A 4BWOA 4X6RB 2W1WA 1U12A 1X50A 4O7XA 4LBQA 2VQUA 1H2LA 4NE9A 2HYKA 4P08A 2HWB2 3K51A 1SLAA 4PQQA 1UD1A 3WW3A 2CGPA 4IV3C 4AEDB 3AKRA 2BGOA 5A32A 5L19A 2D6LX 4PI0A 4YZ4A 5FPVA 1K42A 4LXLA 5JR2A 1GYKA 1JUIA 3P6BA 1TZOA 4Z2AA 3WF2A 1PZ7A 1ULEA 1WCSA 1JYVA 3GBWA 4QKNA 4QX2A 1BEV1 4D7TA 4I3GA 4FQZA 3K77A 4AQSA 1CPMA 1SPPB 3POGA 4CE8A 3PLQA 4XFAA 1SFNA 3N9PA 2FD8A 3RSJA 2RJ2A 4NHMA 3R6SA 4LULA 5CADA 1S0DA 3DXUA 2AC1A 2VZPA 3RZZA 3U37A 4R9AA 4PCRA 5EZWA 1V00A 2RDRA 3IBMA 3M7AA 4OFGA 5F2SA 3JD73 1IPSA 1UO9A 2DTYA 4H2AA 4X8PA 3UETA 4TSVA 5GLTA 5J09A 1YJKA 1Y9MA 3MO4A 1PK6B 4GB32 4YGEA 4YPJA 1A6CA 1UZZA 2YG0A 4MHUA 1OVSA 2W1UA 4AQTA 4XTPA 1UIKA 4QDRA 1YQ5A 2O8QA 5FPBA 3JD71 4JGZB 1DYKA 4BIOA 4AR2A 3OOXA 4XF0A 1UU6A 1QU0A 4XMAA 3KCXA 3ZN6B 3OBZA 4ZKTB 2XMLA 1JI6A 5A3MA 5F3CA 5HPOA 4TYSA 2PMWB 1YEWA 1DG6A 2ZAAA 5A1AA 2WL1A 3O1SA 3WNPA 4QQPA 3IWZA 2QDRA 1XOYA 3UESA 5A3PA 4KWUA 4LPLA 4XHBA 2E32A 1PGW2 5DDJ2 1X8EA 2PA7A 4MV2A 1MS5A 4XDQA 3UGHA 5HXVA 3WUDA 3A23A 3FBMA 3URFA 5A7WB 5CU1A 2E33A 1NA1B 2YZ4A 4GH4A 2EA7A 1QJU2 2WZR3 1T2XA 3IM0A 4YZ5A 4QPIC 1DF0A 1Y7BA 5JXJA 4I02A 1B35C 2J1UA 2QKDA 5ABJC 2QQOA 2Y0OA 4A6SA 1POQA 4CDXC 1NLSA 1UY0A 1Q8PA 1S1AA 4UW5A 5T52A 3VL9A 4QKDA 4PLMA 5LRSA 2WT0A 2D3PA 1UZWA 2VNOA 2F6BA 1OKOA 1UOGA 2GMPA 5JZGB 3Q8CA 3A21A 5IFPA 2VZTA 4XC9A 4J6GA 4BXSV 1AR61 4AF9A 3NV2A 5EQUA 1JOPA 1WMEA 2HEWF 3OGSA 1Y3TA 1VB4A 3IMNA 4PBOA 3OB8A 4L8QA 2WO7A 3R4DB 2R063 5IFTA 1BYHA 1FMD3 3KVBA 5FPLA 4XTMA 2GDFA 3MW4A 3PMEA 3PVEA 3DCQA 4TZDA 4ZPIA 5DG2A 1L7LA 2CDOA 3SKJE 2P6HA 3HIFA 1GSLA 2DYCA 4K1ZA 2R061 1PIV3 1GKBA 1FMD1 3WDXA 5FDBA 3FX3A 4LEJA 3C7HA 4UT5A 2AH2A 2Q1ZB 3JQXA 4XUOA 1EP0A 1D4VB 5GKAC 1ZZ8A 4AZZA 3OPWA 3U75A 1L3JA 1HV1A 1DGRA 3WX5A 4QB2A 4DUWA 1PIV1 5FZFA 5BY5A 1NZIA 1RUH2 4XUQA 2DFBA 1U5IA 1LOFC 3NNGA 5CFCC 2A3WA 4LBQD 1LULA 5AVPA 3O1UA 2QQPA 2RR12 2RS13 3Q9OA 3KCCA 4TTGA 4CPBA 4N7UA 5LBCA 5FZAA 3TEZA 4FPLA 1CD3G 2WA3A 1QJEA 2QQJA 3K3OA 4COVA 4PQ9A 2RS11 4NO4A 5C4WA 5C5TA 3AMPA 4AI8A 1W0PA 1O8SA 4YGBA 4CDUC 1KDMA 2QQNA 4M4PA 4LO6B 4URTA 1CAWB 4R4XA 4KL1A 4HLTA 4AFDA 1CIWA 2BOJA 2JD4A 3OYWB 1D2QA 3NMBA 1SLBA 3ZIXA 5BXXA 2OZJA 5A7QA 2W2IA 4XJWA 1ZBA3 4AEDC 5IATA 1C5HA 2HWD3 3H1WA 3RJ2X 3ZYGA 1LEMA 3W5NA 1XE8A 2XDVA 4QPYA 2VY0A 2I45A 3T0AA 2HWE3 1FV3A 1XB9A 1UKGA 3W58A 2ZGSA 3WR0A 4ASMB 5L7OB 1ZBA1 2ZOEB 3LCPA 5I93A 4XFFA 2VGDA 5FIXA 5EJZB 2HWD1 2AEYA 3WW2A 5FWJA 2WAOA 2P3IA 3B69A 1RYYA 4IGOA 5FFOC 2BW8A 3NAPA 4OHZA 2HWE1 1AX1A 1MZEA 1W8WA 2UWBA 4E2SA 2D7FA 5C6CA 1LECA 3M3OA 1GU3A 2VBDA 3NNFA 3N9QA 4CEYA 4LE4A 2JDMA 4LBNA 3AYEA 3MHZA 3ZXLA 5HBAA 4P02B 1TE1B 2JG8B 4B4PA 4HONA 2DUPA 4Q4Y3 1A8MA 3ACFA 4GKYA 1C57A 1PK6C 4AK3A 2XUEA 4INDA 4B4RA 4AEJA 4ZXEA 2A73B 2QQWA 4XZPA 5IUQA 3ZKYA 3J8F3 1UY4A 4JGZC 3W21A 3LZZA 2ADEA 4Q4Y1 3POFA 4XDPA 1GNYA 3DN7A 4JQTA 5HCBA 4QU2A 4N53B 2D44A 3JXSA 1NG0A 1XYNA 2YC0A 3PUIA 5BNNC 4DIQA 4B8EA 3J8F1 5FAXA 1V9U3 1MS0A 3ZR6A 1ZA7A 1AJKA 3DYOA 4XAEA 5GZGA 1XU1A 2PFWA 3AZVA 5F5AA 1BLZA 3B93A 2JG9B 4MLOA 3BYWA 3U1XA 4ARYA 3RDIA 1S2BA 3OD4A 2IXKA 2LROA 1GNZA 5DAQA 1ULPA 5FKCA 1RTVA 1LTEA 4QQOA 2ZX1A 1NA1C 3N7MA 1UU5A 2BQPA 4A44A 1Q8SA 1H8TC 1VB2A 3IMMA 1KS5A 4XVHA 1AYM3 1OT5A 1QXPA 2DU1A 1EAH3 4B7EA 4DXSA 5IVYA 2FDKA 2D6OX 3N35A 2WNVA 2JDYA 2PHWA 4IGQA 1K12A 1VMJA 3NL1A 4AGGA 5F1RA 3IIIA 1NLRA 2VNVA 5C8CB 3BI3A 4FSJA 4B7KA 1BMV1 1W6QB 1WW6A 2X09A 3Q8FA 3O0WA 2C1FA 3V0BA 1AYM1 2OPKA 1EAH1 2C0ZA 5GLZA 2D5HA 5JZGC 4CCDA 3I3BA 1OLMA 1C28A 3WHUA 4CTEA 4QGLA 2YV8A 3MIEA 1NQDA 5CA6A 2OT7A 2VTXJ 3A22A 1ALYA 2UWCA 1JYTA 4DFSA 1DGRN 1ND2B 2LM3A 4CP1A 4ZS2A 4YM0A 5IK8A 5LWBA 1ZVFA 3IT8A 3UJQA 4JDNA 1WZXA 2VMDA 4WVMA 5T55A 1APNA 4BQ5A 3OYWA 1NX9A 5CKQA 1WMXA 3T08A 4YNIA 1JYWA 4KBZA 4NOTA 2EXIA 4XFCA 1ENQA 4SLIA 1F15A 3ZLIA 2BBAA 2NZ9A 4GWNA 3PNAA 3L2YA 1KITA 2X53S 4TXWA 1LAJA 4N8MA 4FPJA 4XCBA 5I0SA 3QCWA 1UF2C 3LDRA 2WSUA 3SMHA 4QB1A 1TEIA 1XSRA 2I2SA 5JXGA 2BV4A 4QKBA 2F4LA 5T54A 2JDPA 2PLV2 1ZZBA 4QWNA 1RHI2 2P37A 3DPRB 3GBGA 2EXKA 4MGZE 2FZ1A 3K4DA 2VMEA 5LBBA 2ZHNA 1Y9QA 5EV7A 2BU9A 4LLFA 5FYUA 2VVFA 1UXZA 2OIIA 3OGGA 5IVCA 5IK5A 1NLQA 1JHNA 1DLCA 2KR2A 1FNYA 3CKHA 3E6BA 4YVSA 3T4HB 3AKPA 3DXTA 5GZFA 1OPOA 5D8AB 2Y60A 4DNYA 3ZYJB 4CCJA 3ACLA 1V0AA 2PHFA 3AKSA 4YW7A 3K46A 3OUHA 4COZA 4ZU4A 1SCRA 5AFBA 2WFF3 4JV4A 1R1A3 1UU4A 4I09A 2UU8A 3K2OA 4TLFA 3S7IA 3SISA 1H2MA 4A42A 4E4HA 4BXFA 3UGGA 1GP4A 3PVBB 4UI9L 4FPOB 1CWPA 3VKMA 1DQ1A 2KD7A 1QWRA 4KU7A 4AHWA 4BLJA 5J3UA 1FAYA 2O8OA 2WFF1 4LMFA 5A7PA 1R1A1 4QHBA 4Z82A 5HCFA 5F7UA 1RUOA 1F4HA 2LS6A 3TB0A 3VHNA 4QX1A 5BNOC 4MHRA 2XLAA 2Y33A 5IT6A 1S2KA 1GICA 3CL1A 1Q56A 2ET7A 4EZ4A 3I3EA 1TNRA 3O14A 1U5ZA 4D3WA 4X6QB 5BPXA 3D5OA 4MGSA 4YW2A 5JVVA 5HXMA 1O3RA 5JIUA 4M0HA 3PUSA 1N47A 3MIDA 5FY8A 3VDBA 2W91A 2FCTA 3ZXEA 2PAKA 3ZR5A 2KM2A 1QXJA 2UYAA 2LTNA 4GULA 2D3RA 3J4UH 4JHZA 2J1SA 3BIEA 1QHDA 5IAVA 3WT3A 4XDOA 3NJYA 4L97A 4Q4V2 3AC0A 1QXRA 3D4KA 3VBFA 4A2UA 1MPXA 1JU4A 3E5XA 1MEC3 2VMGA 3N9MA 2ZGLA 4XFHA 2VTXA 5FZIA 1ZRCA 1W6MB 1HXS3 4YM1A 3LA3A 4NIIA 4OZXA 5AC92 5DAXA 4YG3A 2PHUA 1TVGA 4N53C 3M3QA 3HQUA 4UF0B 4NHXA 2ZX0A 5GZDA 1RVF3 4AAXA 2Q5TA 1KD7A 1T6GC 3ZMNA 1JYXA 3I2JA 3OJBA 1HXS1 4OUEA 3FL7A 3GF6A 1WUVA 3VV1A 4LOTA 4O65A 2ORXA 2JG9C 4XXPA 2NQYA 3VDDA 1RUD3 1STMA 1RVF1 2XGXA 4CXYA 3MEPA 3RVHA 4M3CB 1MVEA 1QJFA 5FYBA 2YC2A 2Q1FA 3HNMA 3IAPA 1BZWA 2WN3A 5SV8A 1WCDJ 2J7MA 2ZX2A 1BBT2 5FP3A 3JUUA 3UK9A 1RUD1 3K4ZA 4JGYA 1NKGA 4XUPA 5ACA2 4E9KA 1RUE3 1LRHA 2W68A 5C8CC 3PMSA 4HKLA 4Y24A 3AVSA 1EYBA 2GALA 3ST7A 5JDBA 3AFKA 1A78A 1RINA 4P5YA 2WYFA 4E8CA 3LPFA 5IVEA 3E5UA 1RUE1 1AX2A 1PO11 1IS4A 1UCXA 2J42A 3D82A 4H3WA 3H0OA 5A6YA 4FPCA 1JZ6A 1ND2C 3QH7A 3WEZA 4CDWB 5JI7A 2R0FA 1AR92 1QOTA 2VCBA 3KV6A 3ZYPA 3WDVA 4DEQA 3M1HA 1CPNA 3HJRA 4PF5A 1I9RA 3J7MA 4XYXA 4CEWB 4CRQA 1W99A 2A6WA 2GP5A 2EVXA 3HT2A 1UYXA 1REEA 1K5MA 2ZACA 2VZQA 2IFWA 1ODMA 1XBFA 1VBE2 4GA9A 4KWKA 4FAHA 1JH5A 1UAIA 3APBA 4KI5M 1W2UA 5FZOB 2XQRA 1AVBA 1SCSA 1CQ9A 4IXLA 3JB8A 4UOJA 4E2GA 1CR7A 2YC4A 3D8CA 5FY0A 3FLPA 1WCUA 1RUG2 1GR3A 2C6SA 4PT6A 4CCLA 3RQ0A 3UKTA 1PM7A 3ZFEA 3ZFFB 3DPRC 5BUVA 3WLUA 4WVZA 1RB8G 1YJLA 2YHJA 3KM5A 2PQQA 2VMCA 5FMOS 5HCAA 1KQRA 3THCA 2AUYA 3DF0A 3H1YA 3IB3A 3OY8A 4LBOA 2G9GA 1N1VA 3N9LA 1DHKB 2YFZA 3H8XA 2D6NA 2IVJA 1CN1A 3MF6A 3U14A 4OUSA 3NO8A 5K8SA 1D7PM 1RUI2 4E4DX 1MR5A 4QPGB 5IVJA 1X33A 5JXHA 4W50A 3CLPA 5F2WA 5GALA 2WA4A 1H9WA 2EIBA 2HBUA 3MGUA 2D3SA 1YFUA 2TEPA 1TMF3 2QJVA 3TEWA 4Z1VA 3OUJA 2CWSA 5FPZA 3KGLA 3TEYA 2P2KA 5F32A 1W9WA 3LQCA 4KGGA 3KWVA 4A7KA 4XFGA 5CFDC 2O1QA 1TMF1 3A0NA 4IV1B 3MFCA 2VNGA 4BQWA 5I91A 3J9SA 3KT7A 2ZGKA 3KLSA 4LO5B 1DFQA 1YCIA 2DCZA 1CAUB 2VC9A 5JSOA 3WDUA 1US3A 2BVVA 4XF1A 5J96B 4A45A 3I49A 1RUJ1 4DXTA 4MGKE 2I74A 2XL9A 2VAUA 4NAOA 3EB7A 1AX0A 2UY9A 5GM0A 3THTA 5JOWA 3I3MA 4FPFA 3LOBA 3Q8AA 4KU8A 4ASKA 1V6IA 2A71A 4XIKA 1XNBA 3C8XA 2R042 3T2PA 3QLQA 1EPZA 3ON7A 1Y4WA 3AXEA 4NROA 4O9GA 2PYTA 2VO5A 2DVBA 3AJZA 4C0BA 4COUA 4Q8LA 5FUIA 3AB0A 4FQ4A 4RA0A 4AE2A 5E1RA 2RDQA 3LEGA 3JBG1 4XBLA 5JR7B 1ND3A 2D97A 2J1RA 5FK8A 1CESA 1OF3A 5IK4A 4BQ4A 3I2DA 5C3SA 2ORZA 5LY1A 4ZXKA 2RS32 2ZX4A 4PJYA 2HWC2 4AVBA 5T5LA 2VMHA 4AQ2A 4A3XA 4CZSA 5FPUA 1POV0 1TQ5A 1FXZA 1SBFA 2Y6LA 4CCMA 2ZCWA 2ZKLA 3C7GA 4OYUA 2GH2A 4AHXA 2ZAHA 1RIRA 2MEV2 3Q8EA 4LHKA 4AI2A 4CU6A 5IVBA 4U2AA 3NV3A 5FXXA 4UFMA 1LHNA 4FPHA 3N7JA 2VU9A 1ZM1A 3NJZA 1BCXA 1N3PA 1CJDA 1DLLA 2E26A 4WM8B 1WWYA 4LBQB 4KH9A 4N9HA 4XFBA 3WG3A 5C7GA 5C33A 4OMCA 4X8NA 5J37A 2QZ2A 3ZXKA 3NQHA 4WM7A 2W52A 1E5IA 4BMEA 4P5HA 3D3AA 2ZXQA 2YY1A 2Z4FA 4PDWA 4NPLA 4BYYA 1W6NA 4CDWC 2JKXA 2WNUA 1SACA 4IEUA 2HH9A 4ATFA 4BE3A 2DCKA 1G8WA 1PNFA 4LKEA 2D6KA 3VLBB 2W46A 1EUTA 4R52A 2Q8DA 4HANA 5J1XA 4P14A 1VBA3 1UOBA 4CEWC 2BDRA 2BBVA 1RMU3 1U5YA 1OVPA 3ZSKA 3WQ1A 1YFWA 2IC1A 3T2TA 1RUC2 3BCWA 4D6SA 5KXDA 1VJ2A 4CU8A 5K0UA 2W9XA 4LO8A 5DZFA 1VBA1 2IFRA 1NXD1 2BERA 2K46A 1RMU1 1KDKA 1Q8VA 2Y64A 1RUF2 3B9CA 3ZFGA 4MH0E 3KZ4C 2XLGA 3ZSMA 2JE7A 3WW1A 4BZ4A 2PELA 5FJKA 2DVGA 2XH6A 5LZ6A 3ZFFC 3WNXA 2VD7A 4Y5Z0 4GIQA 5T5PA 1URXA 1VAMA 1WD4A 4YFWA 3WCRA 1JYIA 4K7JA 1ASJ3 1Q3EA 2WC2A 5HV4A 3LD8A 1HRV3 5HV0A 4AI3A 3VD9A 1H1MA 2RM23 4Y4YA 1QJX3 1UYPA 3VBOA 4F8AA 4K1YA 3DEMA 4QPGC 2DCTA 1DQ2A 3OEBA 3WQBA 3MI8A 3VZKA 1HRV1 5BNPC 3PHMA 5A3WA 3VDAA 3WF1A 1DBNA 4GH4B 1L7RA 2RM21 1QJX1 3M4FA 2O14A 2YDEA 4YW6A 3KGZA 2ZBJA 5FZLA 2YU1A 4N43C 4CCKA 3CJXA 5L9VA 5LW9A 2CY6A 4LITA 4W6XA 5FYVA 4P9GA 4HK8A 4BJ0A 4QT6A 1S0FA 4YZ2A 4IV1C 2ZMNA 4CU9A 1NE4A 2Y26A 3H42B 3IDCB 5D2AA 3FJSA 3V56A 2FCUA 4NN0A 4MGTA 2YFUA 3ENRA 3AP7A 5F6KA 4AVAA 1OA3A 4PHZA 4JVAA 4BQ3A 3BKZA 1ZREA 1S0EA 3ASIA 4G3YC 3JD72 2JKBA 3FUOA 1D0GA 3RYRA 3HVDA 4YGCA 4P9JA 3SCHA 4W8JA 2OS2A 3PIJA 4Q0UA 3WINE 2BVBA 1XC6A 2BWAA 2UYBA 1IG0A 3RZKA 2BEOA 3FLRA 1BEV3 4AI9A 1UYYA 2OVUA 4LKSA 4JTOA 5JSPA 2IWGB 1LHUA 3HQRA 5L36A 2WS93 3BTAA 2B46X 2WQZC 4C1XA 2X05A 4D69A 2WABA 1MS4A 4A7ZA 4HVRA 4K9SA 4ARXA 3POEA 1W05A 2V4AA 1QEXA 1Q5OA 1O4YA 1R082 2ZJCA 3SKVA 1OXCA 2NPIA 2WS91 4IEPA 1KGYA 4IEQA 4LO4B 5DUVA 4CDQA 2YB7A 3FMGA 5IK7A 1AL0G 2HEYF 4FI9A 3I7DA 4NHKA 4WV8A 5J98B 3RMXA 2WLPA 3M3IA 1W8TA 4YRDA 3AX4A 2WZR2 3CIHA 3T1MA 1JZ2A 5C4WB 1YI9A 4QXBA 1OLQA 4CSWA 1O5LA 1W2NA 3I2IA 4XQDA 1REDA 2OQ7A 4JKKA 4YZ1A 4W65A 4K8FA 1XSQA 2DF7A 1LOGA 1WW5A 1QJZA 4BHPA 4WM8C 1GP5A 2P1BA 5EIYB 2RJLA 1SDDB 2VTFA 5JOXA 3OSDA 1OI6A 2WSVA 4QPIA 4OQ9A 4OZOA 4IEYA 1B35A 2H0BA 4Q1RA 2IVIB 3BIWE 4CDXA 4Q4W3 1ZRRA 1HB4A 3NNLA 1QH6A 1BK1A 2R062 1FMD2 3ILFA 4QHZA 2Q8EA 1HB2A 3NW4A 4Z07A 2W95A 4Q29A 4FFFA 4YLZA 2GZWA 3PUHA 4Q4W1 3ROUA 1VAVA 3MV01 5A80A 4HZFA 3WNKA 3NAPB 4BB3A 2D40A 4ZZ5A 1PIV2 5C3RA 2HWF3 1MQTA 2EAKA 2HWB1 4EE2A 2XWBB 3AMNA 1AR63 4GWMA 4NHLA 4XIOA 4CEYB 2V73A 2XG3A 3PJYA 1PX3A 2A3YA 5IJRA 1NCQB 2WZPP 1HRI3 2ZGMA 4LOSA 3N9OA 2JDZA 1AR83 2HWF1 2VCAA 3P3PA 3NKTA 3C2UA 1F2NA 1XPWA 1PX4A 2RS12 3GHMA 3MW3A 3G6JB 2VL4A 1IKPA 1HRI1 5LA0A 1K3IA 4RS5A 2RS53 1AYN3 1AR81 2BFUS 2Y6HA 4EN8B 1AXZA 4PIXA 4PLOA 1XNDA 2DCJA 4V2WA 4OMDA 1W90A 3POBA 3MYXA 4JZRA 3AZXA 4C90A 3VBUA 4DRVA 2RS51 5DZEA 1AYN1 5FR3A 3FN9A 2Q1MA 1S0JA 4QX8A 3V65A 2JDNA 3AMMA 2BUKA 4OHYA 5C3QA 3T09A 2V5DA 4GMP3
chains in the Genus database with same CATH topology
1IPJA 4A7YA 4FVVA 1VBB3 2XJVA 4GH4C 1HQLA 1ZBA2 4Q0VA 5JMCA 4Z8BA 1ULDA 4SBVA 3CJIC 1DGLA 3AP9A 2HWD2 2WNVB 3V0AA 4LUMA 4XJ9A 5H9SA 1V6LA 2H6BA 4GMP1 2HWE2 1VBB1 3U0ZA 1GV9A 4Q0SA 1ZYBA 4MSVA 4OLLA 3V0BB 3POYA 3QACA 1IPKA 2QCSB 3H9AA 1RC6A 2NN8A 3GYDA 1MS9A 1QQP3 2ZMLA 4S2HA 4TWTA 1PGW1 1ZRDA 4YM2A 3EQEA 5KC6A 2WQ4A 1DZTA 1CAVA 1QQP1 4WVMB 4M01A 3EXUA 1IS6A 2PAEA 2A6ZA 2EAAA 4Q4Y2 2HKXA 4RQPA 1GZWA 2XHKA 4MXVA 1LU2A 4XW3A 3S30A 5JPMB 1S0IA 3J8F2 3WDYA 3E6DA 4J1WA 1LJ7A 4IQPA 2R1DA 1DZQA 5F5QA 3CF6E 4XF4A 4FPKA 4MX3A 4AVSA 4AFMA 1G86A 2BTVC 4UXAA 2A5ZA 4HN1A 1V9U2 2VOXA 3OBTA 1PVXA 1DGWX 3U10A 2D5FA 5KHGA 5FO8B 2ZKNA 1LHWA 2W39A 2ZGQA 4LBMA 2EXJA 1WGPA 2GAUA 1BMV2 1YUDA 1OOPA 3HQXA 1XNKA 4YVSB 1NCQA 4K3UA 5C4WC 3L2HA 5FPXA 3WP3A 1AYM2 1PO23 1EAH2 5JAXA 4RR3B 4HKWA 1MS8A 3H7JA 2VECA 4L2NA 1O7FA 4P9LA 3ZN5A 3VZOA 1PO21 1H8TA 2XKPA 3EBRA 4GALA 1NE6A 5GJ6A 4NPRA 1LB2A 1XXNA 4EN0A 1OQDA 3AYAA 2OW4A 2UY8A 1OSGA 4IEWA 1YFXA 1CVNA 4I0AA 2VUAA 5DUWA 1ULFA 2CV6A 3NAPC 3OD0A 4MZUA 4C91A 3IKWA 5C9AA 2JX9A 2ILMA 3RMYA 3TYJA 2VQ0A 2A6VA 2GC2A 5H9QA 1J59A 4BQ1A 4XFIA 1F8VA 2CAUA 1QNWA 1FNZA 2ZPXA 5A3LA 3VBFB 3W59A 3MIFA 1V6MA 1NYWA 4GQ7A 3WG2A 2ERFA 1GNHA 2R1BA 2XJSA 5KXBA 2GC0A 1YIFA 1AZDA 3I4IA 1W6PA 4FP3A 3SLIA 1VRH3 3N7LA 4H7MA 1QDCA 2BNMA 4OUMA 3VDDB 2WFF2 4YVWA 1OPMA 1R1A2 2GU9A 1C8M3 1VRH1 3ZDSA 2B5HA 4AHZA 5BNQA 2GSYA 4MUVA 1VBD3 4B4QA 3RYPA 1G9DA 2WNVC 4JGYB 1H2NA 4Q27A 1TME3 1C8M1 1CGPA 1AL23 3VBHA 4KG0A 4XQ4A 2UWAA 3R4SA 2ZZQA 1VBD1 2MHFA 2Z2SB 3ME2A 4QM8A 2Q30A 4AQ6A 1TME1 2AGSA 1SLLA 4IL7A 1AL21 1O91A 5CNAA 1QMJA 4RR3A 3N36A 3H1MA 2NMOA 5BNOA 2X5IA 5LK7B 3T1LA 4HETA 5FMOL 3M8LA 2MNGA 4XHXA 4R4ZA 2E7TA 4D7SA 2A75A 4MVTA 1G6NA 1R1ZA 1I3HA 1K5MB 4WBBA 3HN1A 4DPNA 1MEC2 3FFQA 4F83A 3AZZA 3E5QA 1HXS2 1RJ7A 1WBLA 4ORFA 4XF9A 1A3KA 2A7AA 1O3QA 3MPPG 4S2FA 2ZA9A 4Q4X3 1UPSA 5L7OC 1LOEA 2RHPA 3VBRA 3TN93 3MFAA 3BPZA 1RJ8A 3RG0A 3ZFEB 4OI0A 1HQNA 1VP6A 2B8MA 4NWWA 4Q4X1 1RUD2 3ZXDA 1HIXA 3M3EA 3OY8B 2VULA 4I0BA 2C9AA 4UW4A 5EFUA 3TN91 4Z2WA 1NCRB 4LLOA 4YVSC 2V5YA 2JG8C 4DRRA 1FATA 1YFYA 2DTWA 1W6OA 4COYA 1C1FA 2OA2A 1D4M3 1RUE2 4NVPA 1Q43A 4E4ZA 3LWCA 1H1IA 5FO7B 2XJQA 4QQLA 1COV3 4LT5A 1D4M1 3KT1A 3N4MA 2RE9A 4W6WA 4G4FA 1N1YA 1PZ8A 2MPFA 4NWVA 2PTMA 1J1LA 3FC0A 3LOIA 1GZCA 3M70A 3QD6A 1COV1 5I8YA 1PVC3 1WLCA 4LO7A 1F9KA 2OYZA 1SLIA 1EV13 2K2SA 4QQ2A 1ZA4A 1V6OA 3V64A 5LEKA 2RMU3 1Z7S3 1PVC1 1F5FA 1HDKA 2AENA 4BCUA 3J26N 1PO13 1EV11 4K20A 3RI8A 1IOAA 3TRSB 4BOWA 2BGCA 2TUNA 2ENRA 2RMU1 3A0KA 2ES3A 2QDNA 1Z7S1 4ASLA 2B7YA 3POSA 4WVVA 4JRLA 3AJYA 2P3JA 5LEJA 1VALA 2ARBA 1QKQA 4MGYE 1FT9A 3B5LB 2B42B 1AXYA 4B3NA 5FLIA 3RS6A 4LBLA 4HKOA 4Y22A 2R0HA 1ND3B 3H50A 3A4UA 3I8TA 3VN4A 1GLHA 2ZX3A 4Y1YA 1KJRA 1N3QA 2Q8OA 3VDDC 1CAXA 3ALQA 5GLWA 1EY2A 1TMF2 2LUWA 3ZMOA 2IXCA 3EJKA 3RJRA 1OHFA 2GMMA 1IS3A 3VL8A 1A8DA 1CJPA 3O0VA 4JGYC 5CVRA 4EN9B 4Y26A 3VGIA 5KHHA 3NWKA 1UKRA 2ZGRA 4DB5A 4XBQA 2AREA 4QQHA 3SITA 3X29B 1NCRA 4WM7B 1O3TA 1BQPA 2GC1A 5CFDA 2W08A 3IDEA 5D8AC 4PDWB 4HMZA 4AHYA 1YIPA 1GZ9A 2Z42A 1W6NB 3OTFA 4LHLA 2WNUB 2JEMA 3PVOA 1BBT1 3WV6A 3O5SA 4XJAA 4OHWA 1WLDA 3GALA 4DS0A 3FWEA 4FPYA 2Q0AA 3NVCA 2DV9A 4K40A 5K0UB 4Q0PA 2JECA 2DWRA 1U5XA 1RUJ3 1G9FA 2F4PA 3R05A 3ZFGB 4N9IA 2Y0IA 4HBNA 1UPIA 3TNPB 4XBNA 2I07B 4LBKA 3ZFEC 3W9AA 1QNYA 4EROA 4H55A 4YM3A 3VBSA 2TBVA 1SDWA 3D0SA 2ZHMA 4BA6A 5E16A 3VBOB 3N7KA 4RHV3 3ZVXA 1ZZ9A 3JBG3 3FBYA 1V6NA 4EV0A 1PZ9A 1PGSA 4P9IA 1J3PA 1LCLA 4P9WA 1AR73 1J3QA 3VKLA 4AG4A 4S2DA 4AEMA 4RHV1 2CWMA 2GN7A 5A33A 4AVTA 4FCAA 2G9FA 1KS4A 5EXOA 3BU7A 2E6VA 2JJ6A 5A32A 4BPZA 1AR71 2ZGOA 1Z78A 4AXOA 1M4WA 2QVSB 2XPJA 1VAKA 2SBAA 4FBFA 1JW6A 2IZWA 4LBJA 4RSUA 1QJY3 3JQWA 4YSFA 1VBA2 1J3RA 2R6QA 3KD4A 1QH7A 4N7IA 1RMU2 2YXSA 1SBEA 1IS5A 3ZXFA 2WFPA 5F6LB 4YG6A 1QJY1 4I2OA 2VW2A 1ULCA 3H3UA 1GBGA 2E7QA 2E7AA 1ULGA 1LR5A 1QF3A 1JBCA 3FZ3A 1I1EA 1YHFA 3ILRA 4QXKA 2D6MA 1ZBE3 2ZS6B 4OI4A 1ASJ2 1NY72 1HRV2 4Q0QA 4AI0A 5K9YA 1DGWA 4DINB 2VXRA 5BV6A 2PHDA 5FOJB 1ND3C 2RM22 1QJX2 5SV5A 4WZFA 1ZBE1 4AEKA 4AVVA 3BB6A 4CDQB 1PGL1 3B7MA 4HVOA 4FAGA 2VNRA 2R49A 3AKQA 3AMHA 1X8MA 4IETA 4HT1T 2ZABA 2WIIB 2XBO3 3B00A 4Y20A 1DZRA 4IEVA 2R073 4ONUA 2R30A 4Y1XA 5BNPA 1G9CA 4IERA 2XBO1 1HLCA 2W0XA 1WBFA 4RD7A 4D7YA 1HKDA 4P9XA 2R071 4QPIB 3WY6A 1G9BA 1B35B 2AZ5A 1W0OA 2RS31 4N43A 1YXWA 3KCYA 1VIWB 4CDXB 1MS3A 3WCSA 4PDWC 4UW3A 5TSWA 5I8SA 4AWDA 1VBC3 1LENA 4UBHA 2BFUL 1V6JA 3FFZA 3UKNA 3ES4A 1SQ4A 1WW4A 1FYUA 1FI2A 1MQTB 1BEV2 1VBC1 3AKTA 1GQGA 3KT4A 3O12A 4YW3A 5FOBB 3I59A 1XQNA 2QZ3A 3PJQA 2WS92 4FOQA 4U36A 5K0UC 1OFSA 3AP6A 4LA2A 3B02A 2DVDA 5T3NA 2D43A 5I0TA 4IV3A 3FHIB 1S0BA 1MZ6A 4META 1JTZX 3G7DA 2BPA2 4BIFA 1F5JA 4MXWA 4FOVA 4XJUA 2ZMKA 1FOD3 1PMIA 2PN5A 4RS5B 3H3ZA 4FOYA 3WD5A 1FPN3 5K7PA 1CONA 1UZYA 1VLNA 3WQ0A 1ENRA 3ZXAC 1FOD1 1SMVA 3AP5A 3VBUB 1J1TA 3VBOC 4HFSA 4ISRA 5JOYA 2WNEA 2N7GA 1FPN1 1OKQA 3ELNA 4XPVA 1H0BA 1SLTA 2GNBA 3IN9A 4F3JA 1N3OA 4Q4W2 3V0AB 3GZTB 4GMP0 4XILA 2HEVF 4AGVA 2DFCA 2TNFA 4YFZA 3WP5A 2AYHA 3AFGA 2DURA 3DV8A 3WHTA 4DMIA 2B9UA 4HSLA 1LHVA 4G9SB 1OMIA 3AM2A 4Q8KA 4I3PA 2XKOA 2HWF2 3E97A 2YROA 5FLJA 3ZN4A 3WUCA 1AR62 4BM8A 3KMHA 1R093 3ZX7A 3GBFA 1LU1A 1CAVB 4FXKB 3ZPYA 1BJQA 4XJ8A 1JOJA 4JC1A 1HRI2 2OUHA 3WDTA 3NV4A 4XJZA 1AR82 4OI1A 5KHJA 1UX6A 3HR9A 4RQPB 4XE9A 1GZWB 5ABJA 1R091 3MF9A 3ES1A 2XVKA 2WJSA 3VHRA 5FBZA 1O4TA 2C5DA 2IXJA 2RS52 1AYN2 3EHKA 1O4ZA 4OHXA 2FHRA 2HWB3 2XVGA 4K21A 2VW0A 4HPKA 2CGNA 2SLIA 2DCYA 4N90A 5J48A 2XLFA 4CDQC 1C4RA 1H9PA 4Q2FA 5FQ0A 1NXMA 4I30A 1RGSA 2Q4SA 5BNNB 2DU0A 1VBB2 1OOPB 4YGDA 1ZZ6A 1DU3D 4FPEA 2NLRA 3R4UA 3B9IA 1R083 2XL7A 2ZHKA 4CP2A 2YMZA 4M0NA 3DKWA 2XB6C 1HX6A 4PLNA 4QMAA 1H8TB 1R081 2E53A 4ES8A 1C1LA 1QQP2 3CJIA 5CFCA 1LOFA 4IEOA 4GB33 1DQ0A 3IPVA 4XOGA 3RYKA 2ET1A 4L99A 1D0HA 1LOCA 2WZR1 4YW4A 4RL7A 1KRIA 3VZJA 5FCCA 4GB31 5EJ3A 1Z0HA 4GKXA 2BYVE 3SH3A 4AVCA 4QGMA 5DUUA 1VR3A 3B3QE 5C9AB 4CDUA 4M00A 3U11A 1MQTC 2P17A 3FLTA 2VH9A 3OPZA 1HV0A 5DDJ3 2JXAA 1XRUA 2K0GA 2CL2A 1LEDA 3IDBB 1B09A 1QJU3 4FXGB 4P9YA 5LK5A 3RRDA 3UJOA 3VHPA 4AEDA 4DY3A 3ZSLA 2FZ2A 3MIGA 3WVJA 1LGNA 3LGRA 4M3CF 5DDJ1 5JOZA 3MW2A 1YWKA 4I0WB 2ZZJA 1AXKA 1LODA 5JSRA 4HK9A 1QJU1 4RS5C 3MLKA 2D98A 2XJTA 3AP4A 2FMDA 3ZYRA 1W6PB 1ZZ7A 1PO22 1UIJA 5KBFA 3VBUC 1BKZA 4XMIA 1BXHA 2GNTA 1DYPA 4YVWB 1GFF2 4WZCA 4LR4A 3DGTA 1N1TA 5CBLA 3SCFA 1PK6A 3ZSJA 1KJLA 2NMNA 4MYEA 1O3SA 5FREA 4JGZA 2ETEA 3VBHB 3VKOA 2X29A 4CP0A 1BVP1 2GN3A 3ZN6A 5BNNA 1RUH3 2EALA 2IXLA 4E2QA 3O7OA 1V70A 2RR13 5KWRA 1IKQA 4C1WA 3JU9A 1FX5A 5BNOB 3VUOA 2X5IB 3MLJA 1RUH1 3TNQA 4EN7B 1NA1A 3WXPA 4W6YA 2Y38A 2RR11 4RQPC 2FQPA 4YW5A 1KFUL 1TNFA 2Z79A 3M3CA 1Y43B 4M3CE 3AZWA 5JZGA 3RWNA 4IEZA 4EWEA 1NZCA 3OBRA 1X7NA 3VBRB 1VRH2 2EIGA 4XF3A 1QDOA 4NR1A 4OVEA 5LRRA 2H6CA 1NQJA 1LKNA 3B94A 5H9PA 4Q1PA 4XXAA 1LGBA 1C8M2 4CEYC 4KWJA 1OOPC 3NSTA 5EYYA 1NCQC 3THPA 1VBD2 5GLUA 1W39A 2QFEA 3B01A 4HSJA 4I01A 1W6OB 1DDLA 3I54A 1TME2 2KXLA 1AL22 2ZHLA 1DQ6A 4EN6B 2VVEA 3QBQA 1V9U1 3QH6A 1WW7A 4HL0A 1YNAA 3ETQA 3HT1A 1Q8QA 2YUEA 4FT8A 1H8VA 3MICA 4EWDA 4V1PA 1ZRFA 4YARA 4AFCA 4AI1A 5GLVA 3HAGA 3RNSA 1DIWA 2ZGPA 3WG1A 2VOWA 5L73A 1O5UA 5FTTC 2YGMA 1I5ZA 2UURA 2OZ6A 5JLVA 1XU2A 1OQEA 4JCKA 5C9AC 1REFA 3JCIA 3WOGA 1CAWA 4KBBA 2QE3A 2VOVA 2P34A 1RITA 1JXNA 4Q4X2 1IQAA 3BODA 4COWA 4YW1A 3LSDA 3TN92 5E88A 5FRAA 4QX5A 4LE3A 4PIZA 1Q8OA 3ZYIB 4WVWA 5DXDA 1H30A 5L7OA 1OFNA 5KC5A 1WD3A 3TOJA 3WP6A 2PAMA 4YG0A 3CNAA 1J58A 3SHRA 4Y22B 1IGOA 1C3HA 3H7YA 1D2SA 4O9EA 5F9TA 2KA3A 1D4M2 4JDOA 4MGIE 3RI9A 4E27A 2GH8A 4QD2A 3KB5A 1WLTA 1CAXB 4FP2A 4YVWC 1YRZA 2E63A 3SNMA 1C8NA 2JG8A 2NP0A 5KXEA 4Q26A 1COV2 3CU7A 3ZXJA 3ECQA 4OULA 1RVF2 3AYDA 3MPBA 1JUHA 4PIYA 3WP4A 1AUYA 2VUJA 1XE7A 2K9ZA 3NV1A 3PTYA 4DOUA 3VBHC 2VQAA 1PVC2 1QGLA 4N53A 2Z69A 1EV12 3IIAA 4BH9A 3RPQA 2PLV3 2RMU2 1RHI3 1XNCA 3HWJA 5CFDB 1Z7S2 4RR3C 4FPGA 1IZ3A 2JG9A 2ZTNA 4FTEA 1DQ4A 2DUQA 2QUOA 1PO12 5CIRA 3LKJA 3S7EA 2X5IC 2WT2A 1MS1A 5KHIA 2PLV1 4JAAA 3ILNA 1RHI1 3VKFC 5I0UA 3ATGA 3HD8B 3TWIA 1KFXL 1AJOA 1ZZCA 4KNCA 2O0OA 2RJKA 2YGLA 5C8CA 2IXIA 1YI7A 2CAVA 1W6QA 1ZX5A 3S0MA 1WMFA 1KXGA 4Z92B 1WCKA 3VBRC 4E4SA 3VKNA 2ARXA 1ND2A 5CB7A 1WA4A 1AHSA 5AVAA 1H2KA 4EJRA 4ATEA 1YLLA 1MVQA 1YYNA 4L9BA 3VBSB 3NKGA 5I0RA 3INAA 2VW1A 1MEC1 2FMYA 3AMQA 4LNVA 5GZCA 1C5IA 5JWPA 2YYOA 4R9DA 3VBFC 3VZNA 2WINB 1V6KA 1PHMA 4L92A 3EO6A 4R8HA 1ONAA 5A33B 4FO9A 5J36A 3AXDA 4H7LA 1CX4A 2HJIA 1UMZA 1WLWA 4Q4V3 3DPRA 3H8UA 5A32B 1LGCA 5AFEA 2ATFA 1I6XA 2G4IA 1ZNPA 2B39A 1OA2A 5AC93 3JZVA 5FO9B 3USSA 1OQ1A 1PNGA 4XETA 3TAYA 3WQ7A 4DXZA 4Q4V1 3LSEA 1HQWA 2R16A 3D0JA 3SCGA 5D8AA 3GZUC 1SFYA 3SH5A 4F7ZA 1H1AA 1DQ5A 5AC91 5E8AA 3KS7A 1H4GA 3KQRA 4ITCA 5DZGA 1RUJ2 3P3NA 2CYFA 3WG4A 3VHOA 5B2GB 1BBT3 3GHNA 3VZLA 2PHRA 4RGGA 5ACA3 4S2GA 2GMEA 3LA2A 5JCTA 3MLLA 4JRAA 3DUIA 3S6PA 1UN1A 2DUOA 1NOVA 2CNAA 1UL9A 4AFBA 1YO8A 2PHXA 5ACA1 4DY5A 1RL3A 4J1XA 4AW7A 4D94A 4RHV2 1IHMA 2VMIA 2ZGTA 3JBG2 2EF6A 3R0RA 1K5MC 2VPVA 2R32A 2JENA 3CO2A 1AR93 1LOAA 2WKKA 2BWCA 1AR72 2ZGNA 3OGJA 5H9RA 4HVQA 3UV9A 4Y20B 4DZGA 3FE5A 4KGQA 5D1IA 3AK0A 4JTNA 2WWSA 4Y1VA 2GC3A 2X8KA 4RGAA 3GZAA 3WDWA 2P3KA 3JB4C 5DG1A 2A70A 1AR91 5BNPB 1VBE3 1MACA 2A6YA 4KQ7A 1W6MA 3WW4A 3UKVA 4B29A 4R9BA 1QJY2 1SEFA 4N43B 5E89A 3PVNA 1VBE1 1NCRC 1RUG3 4Y1UA 3ZIWA 3MDPA 2XWJB 3N3HA 5CG8A 2CTVA 3ZSEA 1JN2P 4ZU7A 3CEWA 3O0XA 2VVDA 3U07A 3MZHA 4M3CA 1RUG1 3SH4A 4BMBA 3ZO0B 5KHKA 5KXCA 4FTBA 4FOWA 2PHTA 3C3VA 1RUI3 4PBPA 3GNEA 4DQAA 3WZ1A 3I59B 4AGRA 3BOWA 1ZBE2 2E51A 2YPJA 1PGL2 4OI2A 2A3XA 5HI0A 1JYCA 1RUI1 4IV3B 1SLCA 5GZEA 2XUMA 4XQWA 3UL2A 4LA3A 3BOPA 4MXWB 4ES9A 4CDWA 1MZFA 1ENSA 1QOSA 1LESA 1OA4A 2XBO2 3VBSC 3K48A 2D93A 2DVFA 2WLQA 2CGOA 2XJUA 4CEWA 2R072 2GNMA 4YYOA 3SXWA 4UW6A 1WMDA 3M2MA 2EXHA 2GNDA 1MZ5A 2V09A 4Y1ZA 1S0GA 3U4XA 1N1SA 1LOBA 5T5OA 3HBZA 5JPNB 1GANA 3QOPA 1QY4A 5DUXA 3VZMA 4EWAA 2R043 3USUB 3ZFFA 3DL3A 2FBEA 4ISQA 4OHVA 1F31A 4HN0A 4UBGA 1X36A 2XJPA 1VBC2 4IESA 3BALA 5JI9A 2A6XA 1QOOA 4AYUA 3LA7A 2R041 2H0VA 2VOKA 2BNNA 4QPGA 1ENXA 1H4HA 1X82A 2RS33 5C8WA 1XYPA 1UW8A 3AYCA 2JICA 5JIAA 2HWC3 4KWLA 3E6CC 4R9CA 5CG9A 2NYYA 3KSCA 2XVLA 4LHNA 2Z5WA 5EYXA 2OUJA 4IEXA 4QGNA 2MEV3 2AR6A 5ABJB 1XYOA 5J7MA 1U0AA 2VG9A 4WM7C 2HWC1 1AF9A 1FOD2 3L9JT 1OD5A 2JE9A 4LTAA 4IV1A 5T5JA 4GXLA 1FPN2