1O3TA

Protein-dna recognition and dna deformation revealed in crystal structures of cap-dna complexes
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
199
structure length
199
Chain Sequence
PTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Indirect Readout of DNA Sequence at the Primary-kink Site in the CAP-DNA Complex: DNA Binding Specificity Based on Energetics of DNA Kinking
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
molecule keywords 5'-D(*GP*CP*GP*AP*AP*AP*AP*AP*TP*GP*CP*GP*AP*T)-3'
total genus 47
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1o3tA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1o3tA01
4EGYA 4L9TA 2G9WA 4ZYHA 4IF4A 3D5LA 5JHUA 4ZZDA 3VODA 2XLFA 3QACA 1R58A 4O6JA 1WWXA 1U6GA 2R7FA 2PTMA 2PG4A 2ZMEB 1Q3EA 4LG0B 1XGOA 1ZZCA 2P5LC 1ZNPA 1FP1D 2CFXA 3KEQA 4PIXA 2ZNYA 1LRHA 4HDUA 4XF0A 2NNYA 4P9GA 4XF1A 4JBAA 5FPXA 2FA5A 3F8BA 4IXAA 5FD5A 4Q5SF 2DBBA 5CVUA 3GYHX 4Q0UA 3L2CA 4L5JA 4JQFA 3BOQA 5E1XA 3MQ0A 1ZVFA 4NHJA 4UUVA 5L3FA 3SHRA 1NZCA 5HDKA 2VODA 3RIRA 4M6YA 1NXMA 2F2EA 4DINB 4BQAA 2GXGA 4AD9A 2FSWA 3ZMSA 2UZKA 1QQIA 2MNGA 4I02A 2OAZA 2MD5A 3MDPA 4RB1A 2F5FA 1LVAA 4ETSA 5E1WA 3GZ5A 2PHLA 4MEYF 2FNAA 4WX9A 3IRRA 4HSLA 2FBHA 4S04A 4MH0E 2OBPA 1EP0A 1XCVA 2IXCA 1TW2A 3EDPA 2V1XA 1RNLA 4HA8A 2BEOA 3O14A 1HSTA 2CGPA 1ZAOA 2HR3A 2V1DA 1FP2A 2KXLA 4MEXF 4CO8A 2IP2A 5LHHA 1GQHA 3BJ6A 1J58A 3BP8A 4J1XA 2HQNA 2FXAA 2P6TA 4P96A 4META 2XKOA 1XCBA 2NAZA 1IAWA 2MC3A 3V7RA 1RUNA 1EYBA 3ZMUA 2A3SA 5L3DA 4EM0B 3HRSA 3P7NA 2GC0A 4IRHA 3WGHA 1HXDA 3K2ZA 1QZZA 1S7AA 4IEWA 2IC1A 2QM3A 2LSOA 1TQIA 4XEZA 2Z69A 1W7PD 4ZH4F 1ZHFA 1O3SA 2L4AA 3RDIA 1XGSA 1YFYA 1XB4A 5KHKA 4Q0VA 2HZTA 4FBFA 2LF8A 4GGGA 3T5XA 1L3LA 1G3WA 2Y0OA 1YFWA 3TQNA 2EJRA 3TOBA 5KHIA 1XSXA 5D5XB 3LZZA 3KZYA 3FHIB 3R60A 4RD7A 3ZMZA 3TOAA 2QZ8A 4Z2YA 2WC2A 4L0YB 4HX4A 4XFAA 3I54A 3L09A 4OINF 3ULQB 1TQPA 1OI6A 3P9IA 2P5KA 5I8SA 1JGSA 3GVAA 2RDPA 2AS5F 4M71A 2A6EF 2DFIA 1Q1HA 2VC0A 3EETA 3MWMA 4PIZA 2B5HA 1FX7A 1CAWA 1CGPA 1ZZ7A 1YQAA 1G3YA 2MPFA 2MBFA 5K5OA 3HT1A 5DDGA 2RC4A 1OMIA 5DUIA 5LEKA 4G9YA 1OYIA 3J80Z 2ZJ2A 1ULYA 1MKMA 2UXNA 1UIKA 1SFNA 1QBJA 2PYTA 3R0JA 4IETA 2M1BA 2KRFA 3WE3A 4LUKA 1YIOA 4LLGF 5I0SA 5KK1A 3D82A 1QXRA 5FCCA 1UCXA 2YX4A 3QPTA 3LWCA 5A2QZ 3S2WA 3WODF 2F5DA 2ACJA 5J7MA 3MFKA 4RGXA 2GZWA 2HTSA 2EVXA 1WLTA 4HSJA 2GA2A 5FQ0B 1DZTA 5LHIA 4UVCA 3BJAA 1CAXA 2KIFA 3QOPA 1XDSA 1UIJA 4MGZE 4CHUA 3O2PE 4H7LA 4BHBA 5TJJA 3T1BA 3F23A 3HIFA 1DGRA 3F21A 3S0MA 2GAUA 3FMRA 1LDKB 2PN6A 2ATFA 2UY8A 3H7YA 2KJBA 4Y17A 5CVIA 3O6BB 2DT5A 5K5QA 1D5VA 3E3VA 4LUMA 3VOEA 4HF2A 2D1HA 3RYPA 4I98B 4P55A 3H1WA 1YUDA 2FQ3A 2L4MA 5AIPA 1B9MA 3V8KA 5F6FA 1IN4A 2AXLA 1LQ1A 3EYYA 3H9AA 2PEXA 1IN6A 2QDRA 3CJNA 2DPDA 1UW8A 3RKXA 2DO7A 1WSUA 5D5VB 1FYMA 4OOIA 1MGTA 3LFKA 3E97A 3FE5A 2HFHA 5IT3A 4G7HF 3RNSA 3DF8A 1R00A 3DPLC 5KVRA 4HX8A 3IHUA 4RB0A 1WKMA 5D5WB 2P5VA 1ON1A 3SFZA 3NL1A 4I7HA 1HW2A 4E2GA 3U10A 2R7DA 5EEGA 5T3NA 3U11A 2P8TA 1U2WA 1ZX5A 4XF3A 1QWRA 3KLOA 2QYOA 1V70A 2OZ6A 1HKSA 4XSZF 4KIFA 3RTRA 1RI7A 4KMFA 1YYVA 4A5NA 1T39A 4ENMA 2EV5A 3ZN1A 1Q5OA 1X8MA 1EY2A 2Y75A 1K6OA 2MLGA 4BNCA 3QPHA 2OA4A 1NE6A 2M8EA 5LGTA 3DP7A 1FY7A 4AIHA 2HYGD 2NYXA 2LNBA 4IJAA 2HWVA 2V1UA 1UHMA 3CTAA 2DTRA 4HLYA 1TW3A 3BJOA 3GYDA 1FBSA 3BWGA 4MUVA 5I0RA 2L54A 5ILSA 5I8YA 1G6NA 2P4WA 1KU3A 2FEZA 4B29A 3ZDSA 2XASA 4R79A 3DFGA 4F8AA 1ZRRA 3TKYA 1ZGJA 3P9KA 2O1QA 1ZREA 1P4XA 4GXOA 5H6QA 5KHHA 3RYKA 1O3TA 4EWDA 3FZ3A 2HS5A 2YPRA 4U0VA 4LEJA 1UFMA 3NSTA 4ORFA 4RS8A 4QM8A 3HHGA 2CV6A 2OZUA 2VC1A 1J3PA 3IC7A 2HOEA 3WW3A 3T8TA 3DXJF 5E1ZB 2H6CA 5TRDA 2DLLA 3ZMDA 4R52A 1XMAA 3KEOA 4Y15A 1IXSB 2QLZA 2GC3A 4WBBA 4ESBA 3CEWA 4KFCA 3ES1A 1FNNA 5DUKA 3WTZA 3JAMZ 3IDBB 5E8IA 5FB2A 2Z3YA 3DEUA 2QVOA 4BHPA 4YFKF 4IEXA 1BI2A 2HEOA 4MQVA 2DPUA 3KP4A 2D93A 3L9FA 3G3ZA 4P5OA 1I5ZA 1G3SA 5LGUA 1IPJA 2QUFA 1YTYA 5HS8A 3GFLA 3CO2A 2VONA 1NYWA 1UB9A 4ON0A 3WGGA 2W25A 3V4GA 2M5WA 1B59A 1PDNC 4R1HA 3GX4X 1EV7A 5FLXZ 3H3ZA 1P92A 4HV6A 2N7GA 1ZRCA 1JE8A 3KE2A 1OD5A 2C0ZA 3HSEA 3GW2A 2IXLA 3EUHA 5BPIA 3T8RA 1TBXA 2KJCA 2V09A 4DQ2A 2PAEA 2CYYA 3CUQC 2GIVA 5ICEA 4PIYA 5FD6A 4I0AA 1QY4A 5FGMA 3G7DA 2EFPA 1I1GA 3N97A 1YW9A 1U78A 4L0ZB 2WTEA 3WG9A 2XAJA 2B9UA 5F64A 3HRUA 3HQXA 2PMHA 1RGSA 4P9FA 3C3WA 1WRJA 2D40A 5CADA 3KP3A 3B73A 2CSOA 3WGIA 2VBZA 3ISPA 4UNOA 1S6LA 3MZHA 4QGLA 3QP6A 4ZU7A 2E7XA 2PQ8A 5LLQA 1J7KA 2GXBA 2YU3A 3FWEA 3M8FA 1VJ2A 1YFXA 4OMZA 2VE9A 3JAMK 1RIOH 3DPTA 1W5SA 2XV4S 3KZZA 4RB2C 3BPVA 3E5UA 3MZYA 3ZN0A 4RB3C 4A0XA 1O5LA 1LR5A 1Z6RA 3KGZA 3HSFA 3NEUA 2GQQA 3WW2A 5LRSA 4LMYA 5HLGA 4X6RB 1LKNA 1U8RA 3TDZC 3R61A 2RVCA 3EQLF 2ZMEA 2Q8KA 3TDUC 4M9SA 1R7JA 2D45A 2ET1A 3ZQ7A 4I3PA 1G3TA 2G7UA 3NRVA 1UHWA 5JSOA 3MCZA 3HTUA 4HAMA 2K27A 3H50A 3R4KA 3I0TA 1B9NA 1USSA 1KU7A 4CXFA 2K4BA 2HYFA 3GF2A 1YWKA 4WXCA 4FAHA 1ZYRF 5BS6A 3F3XA 3SCFA 4YG2F 3QP5A 1WGPA 5HI0A 2FNPA 4EV0A 1Y3TA 1SD7A 4QWQA 4E2QA 2B0LA 3O3KA 3TGNA 3ST7A 1HKQA 1ZZ8A 4UBHA 5JCTA 4LB5A 3COAC 2PAKA 1HW5A 3JSPA 3EQEA 3ABTA 2K4JA 4TV7A 2C6YA 5JSPA 1BI0A 2L3DA 3VB2A 1ZGAA 3IKVA 5HLHA 5FLIA 4Y13A 1B1BA 4LD5A 3QAHA 4MGKE 5EEHA 1BI1A 5D6FA 4XFGA 3IKTA 3KSCA 2VT2A 4MGYE 2BE5F 3I59A 1YS6A 4A5MA 2H94A 4LGWA 2XROA 3HHHA 4D7TA 2O6GE 3SCGA 3R6SA 4YIFA 2W57A 2EV0A 4WF2A 3KMHA 4JTOA 2Z5UA 4LTAA 4XFFA 1ZH5A 4AQ2A 4BH9A 3TO7A 4Q47A 1SMTA 1TTYA 2EFWA 5FFZA 4HLTA 4XRFA 2IXHA 2QNKA 4LJZF 2O61A 1CF7B 2XVCA 5EZWA 2K02A 1Z05A 2LKPA 4UVAA 1MJBA 2VBWA 5E20A 2GU9A 3ZPLA 1O7LA 5J8FA 4KA4A 1ZARA 1J1LA 3F6VA 4F7ZA 4XFHA 1SMYF 3LAJA 1L0OC 2UYAA 1IRFA 4FAGA 1D3YA 1P6RA 1Y0UA 4QM9A 5C8WA 1FXZA 5JFRA 4KU7A 1RC6A 2PI0A 3IIAA 2F4PA 1F9NA 3CO7C 4IEUA 4UV8A 1ON2A 2OZJA 4GULA 5BOXA 1SD6A 3F6OA 1S29A 1TNTA 4Q4ZF 1U5TA 2KIUA 1FBUA 2WV0A 5FFXA 5KBFA 2STTA 4EROA 2GA1A 5BV6A 4XF4A 1IF1A 2NS0A 3PQJA 4I0BA 4PJYA 4L9VA 5FLXK 2DI3A 3OOPA 2Z9OA 1MJ9A 1U12A 4UV9A 4HQMA 1R36A 4I2OA 3GLXA 5D8KB 4N9HA 2EFOA 4Z07A 1XGMA 5IT9Z 2D5HA 1BIBA 4YNIA 3H8UA 4H0EA 5FO5A 3PLQA 2M87A 5LGNA 5ICCA 2UXXA 4JTNA 4IEZA 2EFQA 4QGMA 4OU0A 1YW7A 5AIQA 1I27A 1XGNA 4KMUX 3ACLA 3E5QA 5FLJA 4ONUA 3BCWA 4L9JA 3F22A 1PUEE 5E1RA 4IEOA 1CF7A 4LG0A 1A04A 3ML6A 5I93A 4AXOA 4BIFA 3I53A 1J75A 4GYGA 4EJVA 1O3QA 2Z33A 2IXJA 3GZ6A 1FT9A 2FBIA 4IEQA 3ABUA 2IA2A 5I91A 1B4AA 1Z7UA 3S7EA 2X4HA 1Y9QA 4HN0A 3GFMA 4EM2A 2VECA 2QVSB 2PBIA 4YRDA 2HGCA 3HRMA 4RGRA 5KHJA 2ZFWA 1WA4A 5HS7A 4HVQA 4G94A 2ZKZA 4EQQA 4MV2A 3U0ZA 4J1WA 3V7SA 1X8EA 3GEZA 3SCHA 2E7WA 3TNQA 4EJTA 1J0RA 3SXYA 2VBXA 4BAYA 4ZYDA 4ZYEA 2ZO4A 3L00A 3RKYA 4A2UA 4MGIE 3OGJA 1YS7A 2VBYA 4M72A 3NKTA 3F8CA 2PAMA 3MAJA 1OYWA 1SFUA 2P17A 1JUHA 4YFNF 2MHFA 4RGUA 3WW4A 1WQ2A 3JSOA 2CAVA 3GBFA 3JTHA 1PM7A 1XSDA 2R3SA 3E6MA 2PHDA 2IW5A 2QBYA 3I64A 1UD1A 1QNTA 3LOIA 3QU6A 1S8NA 4O5VA 4JV4A 2W24A 1IXCA 3JZVA 4ESJA 1EH8A 2VPVA 3BZ6A 3LQRA 5JSRA 3K0LA 1YLLA 1L3JA 4KIGA 2QBYB 2PFWA 2B8MA 3I4PA 4EM1A 2NRAC 4XF9A 4EWAA 1ZG1A 4WXDA 4E70A 3MPBA 2Z99A 3C18A 1ZRDA 3HTSB 2EA7A 2EK5A 4Q0QA 2D1VA 2LF7A 5DD8A 1F5TA 1O4TA 3BDDA 1TLHB 4ESFA 1X82A 4AVPA 1SFEA 3BROA 3FHZA 4PGHA 4MTDA 5IT9K 3IDCB 1H9TA 1STZA 2IVMA 4KU8A 5LBQA 4CZZA 4ENNA 3I7DA 1EPZA 3FJSA 4KT5C 4AWXB 3HOTA 4KN7X 3WE2A 4KICA 2Z2SB 2O8QA 4IEYA 4Q48A 5DCFA 3B02A 2FU4A 3D0SA 4L2NA 4LFUA 1Z6TA 4A12A 3KGLA 2L02A 2OQGA 4OIOF 6PAXA 2Y0MA 3L7WA 2FMLA 1FSHA 1Z91A 5BQTA 3FMSA 3GO5A 2OA2A 1X3UA 1YO5C 5DYMA 3CDHA 5CJ9A 5ERIA 2YSRA 3UKNA 4YARA 2MA3A 2IPQX 1NHAA 3F72A 2CG4A 2STWA 4HOBA 2ETHA 3IL2A 3WTSC 4AVCA 2HQRA 4OFGA 2ISZA 3G73A 4ZU4A 4IHTA 4YYOA 3J7AO 2BNMA 1PMIA 2XGXA 4HLXA 3KP6A 4WWCA 2Y48A 2FMYA 4UBGA 5J8CA 2XKPA 4HMZA 3EYIA 3Q9VA 3V8JA 2DQLA 5AVPA 3LAPA 4ZU5A 3HOSA 2V9VA 4GCVA 2UWMA 3KLNA 5L3EA 1P4WA 4EWEA 5FQ0A 4Z82A 4U0WA 1G4DA 4M9XA 4KDPA 4IEVA 4HF0A 4XLNF 2O03A 1BBYA 5K1YA 2W84A 3BALA 1U3EM 3ELNA 1YG2A 1PP7U 4MHGA 2FRHA 3KCCA 5D8LB 4MGRA 2RN7A 3GFJA 1FYKA 5BMZA 3BB6A 5EFUA 4IRIA 2O0YA 4LB6B 4XBFA 2XLGA 2RGVA 2P7CB 1KQ0A 5CVRA 3IWFA 3CLOA 2D2WA 3SHFA 1TQ5A 2VN2A 4UVBA 1KGSA 3E6BA 2L01A 5D6EA 1FBQA 1IUYA 1S7OA 1V4RA 3HYIA 1ONVA 1J59A 2DW4A 4QGNA 4M73A 4M9ZA 3SZPA 4AIKA 3SQNA 5BY5A 4G8XA 4EVIA 3OTFA 1U5TC 1ODDA 1DZRA 2IA1A 1FC3A 3K1NA 4KUMA 4NVPA 3F8FA 3IRQA 3EO6A 4U7DA 2PJPA 3M8EA 1YFHA 5F1RA 1KQ8A 4E2SA 3RI4A 4EGZA 2IJLA 1IRGA 1RL3A 3JW4A 5HS9A 3LA2A 3OV8A 4ZZLA 2CW0F 2ZBKA 3OCPA 1JXSA 2HJIA 5LHGA 1XE7A 5L3CA 3CL1A 1ZN2A 3H7JA 2IA0A 2G7HA 1XMKA 3OF1A 4MX3A 4HZFA 1F4KA 3DQVC 2HTJA 3S7IA 4HVRA 3ZMVA 3ERED 3FM5A 4B8XA 4XFBA 1E2XA 2CO5A 5E18F 1XE8A 1EH7A 2A07F 2DAOA 1LEBA 4Q0PA 4JK1X 3GWZA 2EA4A 4O3MA 4LLNA 2LDUA 2A68F 1QO0D 1WI9A 2PFBA 5BPDA 3AAFA 4KN4X 2KIMA 2OPKA 1BJAA 4XFCA 4A0YA 2EV6A 1T38A 4RAYA 5DCMA 2K7LA 5H6RA 2F5EA 3I58A 1GXPA 2ESNA 4OIRF 3I71A 4DNCA 3ZMTA 3EBRA 4FX4A 3L2HA 2EFNA 1FPQA 2KKOA 1U5TB 2IRFG 3W6KB 3K69A 2HKOA 2FE3A 3D0JA 3KETA 4HBNA 3RKWA 5AONA 2XAGA 4FT8A 1D8JA 1Z1DA 2E9QA 2QJVA 3RPQA 4XLPF 3H3UA 2EWNA 1BI3A 5DV5A 1BN5A 3F8NA 4LK1F 4QLCU 4WZCA 3N4MA 1OR7A 5H20A 2QCSB 1HBXG 3K1PA 2K9ZA 1KU9A 4NQWA 1UPIA 2Q30A 1ZZBA 3J81Z 3PVBB 5L3BA 5I8TA 1IN7A 3WTWC 3WTYC 3HUGA 3OD0A 4L11A 2A69F 4XFIA 4ASNA 1CAVB 2RKHA 1H1IA 2P7VB 3HRTA 3ECOA 1QXJA 4KNYA 5KHGA 3FFQA 2UYBA 1W4MA 3MYXA 3RJPA 2H09A 1R1TA 3WTXC 2EAAA 1AOYA 2ISYA 1USTA 1RZ4A 1LNWA 2DK5A 1MDMB 3CJXA 2PMUA 3GFIA 3CUQB 1GQGA 3REOA 4B09A 1K78A 4WXHA 1ZZ9A 4CGZA 1R1VA 2FOKA 3LSTA 5D4SA 3UKVA 3U9GA 2BNNA 1C0WA 1OFNA 3WTTC 3FZVA 1B6AA 4UHTA 3H1MA 4M74A 4GO1A 1FLIA 1W7PA 3PNAA 1KU2A 1TQMA 3ES4A 4ZYGA 2ZKLA 2IXKA 1J2XA 3Q9SA 1V3FA 2VT3A 1H9GA 1IN8A 2E1NA 1DP7P 2Q2EA 2DU9A 3LWFA 4KYWA 1FOKA 1O5UA 2ZNZA 4OIPF 3EHKA 3I5UA 1JHFA 2OU2A 3H92A 2VXZA 1IPKA 1HW1A 4GYIA 1QZYA 2XIGA 3HT2A 1T0FA 4S05A 3M7GA 5CU1A 3E6CC 4K8FA 2RQPA 1UCRA 2YR2A 1R1UA 3VFZA 2A61A 2DK8A 3BY6A 1AWCA 5CVJA 4A0ZA 3FF5A 3ZP5A 1KQ9A 4RAZA 1GVJA 1REPC 1W5TA 1R5HA 4KL1A 2O3FA 3QU3A 3QRFF 4G7OF 5JVTA 5E16A 2XAHA 2J5PA 4G7ZF 1S3JA 1ZG5A 2YX7A 1X7NA 4XETA 2DCTA 1QPMA 1SFXA 1CAVA 1VR3A 5LEJA 4IPAA 1ZLJA 5J3UA 4G6DA 3K1MA 4P9UA 1VTNC 3WTVC 2A5YB 5J48A 1KYZA 5D1IA 4UXNA 5I0TA 4MZUA 2BNOA 1ZRFA 3J81K 2IXIA 1MD0A 3PQKA 4O9GA 1OPCA 4WCGA 4U0YA 3U2RA 4HN1A 3ELKA 1FZPB 4HDVA 5HVQC 1H0MA 4R8HA 4CDGA 4AQ6A 3J80K 2Q0AA 1BOAA 3V7CA 2WFPA 1I6XA 2JPBA 3NJZA 5JR7B 3GXOA 1IW7F 4MTEA 2CAUA 3LA3A 1IZ1A 5JI6A 3DL3A 4BHCA 2XRNA 1O7FA 5E17F 4D7SA 4CYDA 3ROUA 3EJKA 2GC2A 1LDJA 1CAUB 3BU7A 2J5OA 3BPZA 4AIJA 2COMA 1R5GA 5D4RA 2Q4SA 2HKXA 3C3VA 3M1EA 4A6EA 1SQ4A 1SD5A 2HDCA 3IWZA 3WU1B 3CF6E 2DQRA 3F8MA 2GWRA 1HSJA 5HLIA 1EH6A 3NVCA 2XUBA 1VP6A 2M45A 2O8XA 2Q1ZB 1MZBA 3U1DA 2D5FA 1FSEA 4L9NA 2W85A 3C7JA 4QMAA 1H1MA 1ZG3A 4LLOA 4NB5A 1LB2A 2OYZA 3DN7A 3M9AA 3TNPB 5K5RA 4ENJA 5BXXA 1DPUA 3RPUA 3FXQA 4BYYA 4IERA 5FPZA 1FYLA 4XSXF 2VE8A 5ILVA 4X6QB 4KWLA 1T98A 3LQQA 2FBKA 5CLSA 2XLAA 2IT0A 3E5XA 4PDKA 3RZZA 4Q0SA 1FWZA 1OKRA 2BYVE 2Q0OA 5JR3A 1CAXB 1RUOA 1SAXA 2PQQA 5ICFA 1CAWB 4I01A 3RYRA 4QXKA 1TNSA 4HW0A 4EJUA 1I1SA 1R22A 2FQPA 2JZYA 1DGWA 2ESHA 3GUDA 1J9IA 1ZZ6A 1J3QA 3FXRA 2QENA 2CQKA 2GC1A 4K2EA 1O57A 4G6QA 1IXRC 4HV5A 1W7PB 4IEPA 2VOPA 4MNUA 2ET7A 3BPXA 2P6SA 4OMYA 1ZLKA 4TLFA 1T2KA 2JPCA 1DUXC 2VQAA 2JRTA 3KP2A 1YHFA 4AVAA 2BBYA 4EMSA 3DKWA 3T0YA 4IESA 3FM3A 2QQBA 2JT1A 4U88A 2MLKA 1YLFA 1O3RA 1MDMA 4IHSA 3VEPA 4ENKA 1YFUA 5LRRA 1F1ZA 4WVZA 1LDDA 3JTGA 5BUVA 2UY9A 4EJWA 4KWKA 4YSFA 3TO9A 1DPRA 2XL9A 1HQCA 3W6JB 1QGPA 1J3RA 2A6HF 4EJOA 5J6XA 2JTVA 5DD4A 2H27A 3USSA 4L5IA 3NW4A 1LJ9A 5ED4A 4AVBA 2M30A 3ETQA 2PA7A 3P9CA 4HX7A 1K79A 1E17A 3SXWA 4D0PA 2BGCA 4PCQA 3LA7A 2RNJA 1P4AA 4O9EA 4PGGA 5ICGA 2V6CA 4FX0A 4HF1A 3I59B 4FHTA 5CYVA 1CX4A 3FMQA 3C1DA 4LULA 5C6CA 5JAXA 3FXUA 3VHRA 1XD7A 4MQ9F 4PZJA 2XAFA 3IBMA 2WWYA 2XHKA 1J5YA 1KYWA 5DEQA 2E1CA 4QX5A 1XN7A 3LAGA 2V79A 1Z9CA 3TO6A 1FI2A 2TDXA 1R23A 3K9TA 4Q29A 4KWJA 1YW8A 2K0GA 1RTVA 5L3GA 4I09A 2ADUA 5HOOA 3FX3A 3UKTA 5ILUA 1BM9A 5CVVA 1T6SA 2F5CA 3SZTA 1XRUA 1MJAA 1BIAA 2QQAA 1KA8A 1SD4A 2RV8A 1JHHA 3HSRA 2QWWA 4LK0F 3NQOA 2EA2A 1OYYA 2ZCWA 5K8SA 1HKTA 2H6BA 2JSCA 1K78B 4LA3A 3CUQA 1LEAA 3PFIA 2ETEA 4YIIA 2VOOA 1XDUA 5D5UB 4HQEA 3DV8A 3CUOA 3ECHA 4OLLA 5HDNA 1P2FA 3CO6C 4N9IA 3M3IA 2XAQA 2OQRA 1Q43A 4A6DA 3R0AA 4UXAA 2GH2A 5FDBA 2I45A 2PLYA 3KP7A 4HVOA 4HBLA 5I0UA 5A2QK 2MH2A 2QQ9A 1XSVA 4IVNA 2ELHA 1K7AA 1D8KA 5HDGA 3H1YA 4LA2A 3WW1A 3CLPA 3Q5FA 5E8GA 2MH9A 2K86A 3E6DA 1IN5A 5BPXA 3M70A 4U7BA 2NNNA 4WK8F 1CAUA 3KP5A 4RGSA 3MEXA 2EB7A 3KFWX 1GHCA 4KIBA 2ZXJA 3SMHA 5DCMB 3V8LA 4CICA 1NE4A 4BXUA 1GXQA 3WTUC 1SEFA 2FF4A 4LLLA 4OIQF 2BV6A 4JVAA 4IRGA 1PP8F 1BC7C 4M6XA 4YFXF 2OD5A 2X0LA 2CWEA 4N0BA 1BC8C 4L18B 1DDNA 2H0VA 2XL7A 3WU0A 5FLHA 4HYEA
chains in the Genus database with same CATH superfamily
4EGYA 4D7YA 1J1TA 1SBDA 4ZYHA 1Z67A 4IF4A 4ZZDA 5BNOA 4MG2A 3QACA 4TZDA 3HGYA 4BK4A 5DN2A 3I2JA 3BIEA 3LSRA 3MIEA 3MBWA 3N35A 4ASMB 4HPQA 1I3HA 1XU1A 2X1DA 1NKGA 2CUEA 2A6WA 4JGZA 4QKBA 2DA1A 1ZZCA 2P5LC 3HJEA 5B2GB 4PIXA 3FK7A 4HDUA 4LITA 3S1QJ 5F3CA 1JZ6A 4U2AA 3S3NA 2DV9A 1JGGA 4NHXA 4JX6A 2ARAA 4Y1YA 2C4XA 2MSYA 1AKHA 4FPJA 1OA3A 1AX1A 1UOFA 2IZWA 2K5CA 4C1XA 3SHRA 2LTNA 2JSPA 5HDKA 4LO7A 4BQAA 4QB6A 4AD9A 1HV0A 3AZYA 2UZKA 2MNGA 4I02A 1UKRA 4Q8LA 1U5IA 2MD5A 1WGXA 1LVAA 5E1WA 4P9WA 4XORA 3TRSB 3POBA 1VBA3 4RFT0 3WP6A 4WX9A 2JE8A 3I2FA 1I50J 1VBE2 3AFKA 2RG4A 1RNLA 2V1DA 4MEXF 4CO8A 1W2TA 3BR1A 4PLOA 4J1XA 2FXAA 3HPGA 2Q1MA 4P96A 2DA5A 3PUIA 1IAWA 3ZMUA 1JKOC 2JDHA 2EXIA 4QB1A 1V5FA 4YGCA 4COZA 5LW9A 2GC0A 4IRHA 3MW4A 3K2ZA 1QZZA 2VW2A 5GZEA 1TQIA 2DFFA 2DN0A 4QX0A 1NLRA 2V4VA 4ZH4F 5FXXA 1COV1 4XJWA 5KHKA 2HZTA 1TMF1 3LCPA 2LF8A 4GGGA 4RGGA 1L3LA 2Y6JA 1NCRC 2UU8A 5KHIA 4V2FA 4QXHA 1W36D 1XSXA 2DTYA 3LZZA 2XGEA 2R5YB 3DCFA 2WC2A 4XFAA 2QQUA 5C70A 2B46X 1XNDA 1OI6A 3GVAA 3LE0A 2AS5F 4E7HA 1JUPA 1Z77A 3MWMA 1CAWA 3VB9A 3RZLA 5K5OA 2KPMA 5DZEA 1ZGWA 5L9VA 2RC4A 1JYXA 3GZNB 3JBG1 3WUCA 1ULYA 1DGLA 5A6YA 1SFNA 2FDIA 3VD9A 2C1FA 1WH7A 5FKNA 4IE7A 4LUKA 5E3LA 4MHUA 4CUAA 1YX5A 5KK1A 1QXRA 5FCCA 2RR11 3QPTA 2R92J 3S2WA 2OW4A 4RR3A 1W9FA 2WQ4A 4XILA 3TB0A 2EVXA 4OI2A 3T1LA 2ZJPF 1WLTA 3P5BA 1FTTA 1REFA 2GA2A 2RJKA 4QPGC 3H5NA 2W68A 4UVCA 3OOUA 3RWNA 3VDAA 4F83A 2ZA9A 4OZOA 4P14A 1BW5A 1UAAA 4LIUA 1JBCA 4BHBA 3KV4A 3CBNA 4ES9A 1H8TB 3TYJA 1FMWA 3F23A 3VZNA 4DW6A 1WMDA 5EGOA 1SC7A 2ATFA 4DZJA 2UY8A 1I3AA 2F17A 4JAAA 5CA6A 2WB1N 2VBPA 1DGRN 4CCOA 3O8GA 1IOAA 4YZ2A 4I98B 3H1WA 1B9MA 2R16A 2AXLA 4TN7A 2ZGQA 4F92B 2QDRA 3AMMA 2BVVA 2R0QC 4B4RA 1ERDA 1ULGA 2HZDA 1HJGA 3BTLA 1FYMA 3PJQA 4OOIA 4W6YA 1AYM2 2WINB 5JOZA 2P3JA 4A4AA 1TME1 3MPPG 3DF8A 3CCEI 1IRZA 5KVRA 1WKMA 4XUTA 3RZJA 1TEIA 1UJ8A 3HNYM 2WBKA 5FWJA 2R7SA 2V7FA 3SFZA 2VE1A 4I7HA 2VW1A 4CDXA 5T3NA 4N53B 3QBQA 1HB4A 2W1QA 4PDWC 3KLOA 2R7VA 2RS13 3BODA 3ILRA 2NS7A 5IY5H 5GZFA 4XLAA 2HVRA 2FBEA 3TP0A 4COUA 1MZFA 1YYVA 1O4ZA 1T39A 2EV5A 3KT7A 3BTYA 2YFUA 3VBRC 1R71A 2WS92 2UWAA 5LA0A 1PVC3 2ZHNA 3WQ7A 4D6RA 2WNVC 3GALA 1SFKA 1H2MA 2HYGD 5DDJ1 3EB7A 1W6MA 3BC8A 1VQ8I 2BXYA 3NAPA 2EIBA 3GCXA 3OR2C 2LBFB 5JPNB 4ARXA 5A33B 5F3EA 2YG0A 3BWGA 4RQPA 4AR2A 4MUVA 4A3MJ 3L1PA 5I8YA 3OIOA 5EYXA 2P4WA 4IHYA 1RUC3 2XPJA 1V54H 2EILH 4JP0A 4B29A 1T95A 5DM6F 4KG0A 3GTJJ 3W21A 3RKQA 2KR2A 3LSJA 1UMIA 1JTYA 1AJKA 2HBUA 3P9KA 5FZOB 4GXOA 5H6QA 1S0BA 2VB6A 3VUOA 3RYKA 2R5ZA 1O3TA 3FZ3A 2XJUA 3NSTA 4D3WA 4B43A 1W0OA 3TN91 1VRH1 1V5EA 4F91B 3F2ZA 4QM8A 5C5UA 2R32A 3IC7A 1BR4A 3T8TA 3DXJF 1X1BA 1ACCA 3MUZ1 2DLLA 3ZMDA 4R52A 1XMAA 2GMEA 2WDBA 5A7OA 2GC3A 1AL22 1WLDA 4KFCA 2BGPA 3VDBA 2Y9ZA 1PX4A 3IDBB 3O7OA 3OYHA 3A0BC 4DEQA 5FB2A 3MF6A 2RE9A 1LECA 2LY1A 2XVLA 1W03A 3MVPA 2VUMJ 3ILFA 2HEOA 5FZ4A 4MQVA 2DPUA 3KP4A 3AG3H 1H30A 5IK5A 3WVJA 2DFEA 5FXWA 2KM2A 1HB3A 5C4WB 2JENA 3GFLA 3CO2A 1TWCJ 4G6TB 1O91A 1UY0A 4KJZA 3LSIA 3NNGA 2M5WA 4R1HA 3GX4X 4QB2A 1EV7A 2XVKA 5FLXZ 2CUFA 1G9BA 1P92A 2N7GA 1JE8A 1OD5A 1IS3A 2VZRA 3ZN6A 4AEMA 1GZWA 1WBLA 3EUHA 4IGQA 3WDTA 1M1EB 2KJCA 3E1SA 3KV6A 1FNYA 2CYYA 1O59A 3CUQC 1W3VA 2CL2A 1IZ3A 5ICEA 1UPSA 1PGW1 3RZGA 3WF4A 3G7DA 2EFPA 1I1GA 3HBZA 1YW9A 2JDNA 3OPWA 2YU9J 2W0XA 2GNDA 3WG9A 5LFAA 2B9UA 3HQXA 1RGSA 1JKQC 4FCAA 3WNPA 1WD4A 1WRJA 3VDDA 2ID6A 2Y34A 4BQYA 3WGIA 1SBFA 4PBOA 4ZU7A 4CDWA 3AXDA 4IQ4A 1X1DA 4BXSV 3UYJA 2GXBA 3FWEA 1LOEA 2ECBA 1VJ2A 4XMAA 4A3DJ 5JOYA 1POV3 5EV7A 5FO8B 1RIOH 1V6IA 2IVJA 3CJRB 1W5SA 2XV4S 3CMEI 4Y22B 4RB2C 1Q8PA 2QZ2A 4D94A 2V73A 3CU7A 3E5UA 3USUA 3I2HA 3GTQJ 4Q2FA 1Q56A 4CUCA 3CMGA 5FMBA 3ZN0A 4RB3C 5BNPB 1K83J 3NEUA 2GQQA 3WW2A 2G9FA 4BQQA 4L9BA 5FY7A 1Q8QA 3ABKH 3TDZC 2WFF2 2Q8KA 2VKVA 4MFEA 5TGTA 2Y6HA 2KZGA 4M9SA 1R7JA 2D45A 1NXD1 1FMD3 1UNBA 5DQ0A 3H8XA 1NX9A 1DIWA 2M34A 3VHNA 4OVEA 1DQ4A 2K27A 4RR3C 3I0TA 1USSA 1HDPA 3Q0UA 1VBB3 1AYN1 3ZKUA 3POWA 1PIV1 5FOBB 5IWFA 4DYQA 1VBE3 2WNUC 5BS6A 3F3XA 1RC9A 2YXSA 2IGNA 1WGPA 1IJWC 1UY4A 5HI0A 2J1RA 5GALA 4E2QA 3ZFGC 2B0LA 3POYA 3O3KA 2JDKA 5FR3A 1Z78A 3AMNA 3ST7A 3VBOA 2JDZA 4UBHA 1JYTA 5JCTA 3RG0A 4EZ4A 3JSPA 3EQEA 3ABTA 1W8ZA 4WM7C 3ALQA 1X36A 4TV7A 2C6YA 2WWJA 2BHZA 4Y13A 4LD5A 1A8DA 4A3LJ 3BVCA 3LEKA 1POV0 3JRDA 3NWSA 4MGYE 3I59A 4E4SA 4DYRA 2JECA 3OG2A 5DUXA 4YIFA 1FV2A 5FY8A 3KMHA 4BH9A 5GKAC 1BBT2 4PBPA 4KMQA 2EFWA 4HLTA 4XRFA 4R9CA 1W90A 5IOZA 2XJSA 4LJZF 3HKZA 3OYGA 3GBWA 2XVCA 3WU2C 3AVSA 1RUD1 4URTA 3KHCA 5E20A 3ZPLA 4BL0B 4PJMA 4LIVA 4KA4A 2JEMA 3F6VA 3AVRA 4JKMA 5M0TA 3SEQA 2VCBA 3LAJA 1ZK8A 1IRFA 1UYYA 1COV2 1D3YA 1JI6A 4NWWA 1C8M1 1IKQA 2PI0A 2E2HJ 3AL0B 1ODNA 2OZJA 3DPRC 2MGQA 2ELJA 2NVXJ 1GNZA 3GTGJ 1S29A 1AR73 1ASJ3 5BNOC 4K7JA 1S55A 3ZYPA 4HRIA 3HC7A 1YC61 3PUBA 4CPBD 4K6BA 2DF7A 4FPHA 2X53S 2BZTA 2KL4A 1IF1A 4E7IA 1YQ8A 3L2YA 2WKKA 5FY5A 2KISA 1OJLA 3OOPA 1SFPA 2BY0A 4UV9A 4HQMA 2RS33 5D8KB 4OULA 4XUQA 4AYBA 3DTEA 2CDPA 5IT9Z 4YNIA 1YIPA 4H0EA 3RMXA 3JB8A 5FYSA 1EKEA 2UXXA 2EFQA 2CWMA 1ZBA3 4QGMA 4Y3OA 2JXAA 4OU0A 4WVVA 5AIQA 1I27A 1K61A 1Z7LA 3BTJA 2QSFX 1PUEE 5E1RA 4XPVA 3EYPA 3J7NA 4LG0A 1W2OA 3POEA 4XUOA 3KM5A 1TMF2 1VAVA 2LFBA 3JUUA 1FT9A 3ABUA 1Z7UA 3SKVA 2X4HA 1Y9QA 5T5PA 1ETYA 3TOJA 1UZVA 4CDXC 3CCSI 4RGRA 2ZFWA 5F04A 3VYRB 4GMP0 3S5QA 1F35A 1MR5A 3S15J 4MV2A 1X1PA 4AK3A 2E7WA 3TNQA 2F6CA 4XOGA 4FETA 4ZYDA 3O1PA 4A2UA 1JZ3A 2WABA 1BYHA 2ECCA 3GM8A 1OYWA 1SFUA 2P17A 4MXVA 2QQLA 4C1WA 4YFNF 2MHFA 2YPDA 1JKPC 5L9RA 2E35A 4PT6A 1SDDB 4PJ0C 1RUC2 4AQSA 3AXEA 1PM7A 1P9QC 2PHDA 3QU6A 3ZR5A 4O5VA 2ZJCA 4BQ4A 3JZVA 2G9ZA 3C2GA 2KIQA 3WHBA 1EPWA 3K0LA 2M4KA 2PFWA 4XF9A 2R0HA 1ZG1A 1GFF2 2QGUA 3MPBA 1NY72 1XYPA 3C18A 3CC4I 5LD2C 3OYAA 1VBC3 5FBJA 5ACA2 1F5TA 3BDDA 5FY9A 3H8OA 4Y5Z0 3NV1A 2KDOA 1HRI1 3ZFEA 5GLWA 5T5JA 2WS91 4PGHA 5IK8A 4XAEA 4C9YA 2IVMA 3BIWE 1QH7A 2KZVA 4ENNA 3I7DA 3FJSA 2RQQA 1Z3XA 4KICA 2O8QA 2GSYA 3B02A 2FU4A 4L2NA 5HCHA 3VN4A 3RQ0A 2ILMA 1QVTA 3LMMA 3L7WA 3GO5A 2WJSA 4MFDA 1X3UA 3ZXAC 5T54A 4PHZA 3CDHA 5CJ9A 1RUG1 1DGWX 3UKNA 2VZOA 4XDPA 3TEWA 4FOQA 4Q4W1 2E2JJ 3PUFA 4YYOA 3DF0A 1SHWB 5FZ6A 3WLUA 4HLXA 3MW2A 1U0AA 2Y48A 4INDA 4HMZA 3EYIA 3Q9VA 1V6NA 1ETOA 5FY4A 3OY8A 3V8JA 5AVPA 1LGNA 4ZU5A 2JG8B 1QRYA 3SH3A 3FXJA 5IUQA 4Z82A 4U0WA 3L2WA 4KDPA 4NC6A 4IEVA 1ULFA 4HF0A 1BBYA 1TZOA 1FPN2 3UNGC 3ONQA 3BALA 4BBRJ 3ELNA 2OKXA 4HKOA 5HNFA 4MHGA 3VZJA 1FYKA 2WSVA 1A3KA 1VQ5I 2O0YA 1BKZA 2XLGA 2RGVA 2P7CB 4XLCA 1NCRB 2ZGRA 2ZGMA 2V9KA 4A3IJ 4UVBA 1KGSA 5FZLA 4H55A 1XSRA 1H2NA 4AVZA 4ZC3A 4QGNA 4M73A 4M9ZA 3SQNA 1EV12 5FP9A 3H9GA 1U5TC 5J1YA 4QPYA 1ODDA 2WZPP 1X58A 3F8FA 4W8JA 2PJPA 5F1RA 2OQ6A 2JWPA 1C57A 1LU1A 2P4EA 4EGZA 5F0HA 3JW4A 3LA2A 3OV8A 2R1DA 2XJTA 4KQ7A 2ZBKA 3OCPA 3AB0A 1UU4A 3DPRA 3M1HA 1WD3A 5C9AB 4D7NA 2YC4A 3CL1A 4M3GA 5CFCC 4BS9A 2A75A 1M4WA 3KS7A 3WX5A 2P34A 5FWEA 3BG3A 1F4KA 3DQVC 4HVRA 4KWUA 1ETQA 2WO2A 3FM5A 3ORJA 4FQ4A 4FE4A 5E18F 4B7KA 4AU7A 5E3MA 2DCYA 2DAOA 2VMFA 4Q4V2 5A32B 2HI3A 2YPJA 2A68F 2CSGA 1CVNA 1JZ7A 3AAFA 3OOXA 2OUJA 2GN3A 4Q8KA 2W46A 3MIBA 4AVSA 1BJAA 1U5XA 4A0YA 1DQUA 5CBLA 3FBNB 1UMHA 4RAYA 2WT2A 2Q8DA 4CEWC 4D5FA 5H6RA 3GBGA 2PLV2 1VBE1 1DP0A 4RHV2 2E5ZA 2ZSIB 3A02A 1HCRA 2R7ZJ 1PNGA 3I71A 3WG3A 1LESA 1A31A 4LKSA 3L2HA 2WZR1 1MS3A 4I0WB 2XB0X 2IRFG 1OOPA 2WZR3 4HBNA 2R7OA 3RKWA 4K20A 3BG9A 1OHFA 1Z1DA 2E9QA 3RPQA 4RAFA 4FISA 5DV5A 3F8NA 2LBFA 4LK1F 1N47A 1HJFA 3N4MA 1OR7A 3VBRA 3HEIA 5J09A 4MADA 2B45X 4LJHA 2QKMB 1KU9A 4NQWA 2Q30A 3J81Z 2CNAA 4RS5C 3WTWC 1PZ8A 5GADJ 5D8AC 1UQXA 3ASIA 4JGZB 1VIWB 4L11A 1A6CA 1H8AC 4A7YA 4AI9A 4ASNA 5IYCJ 2RKHA 3IMNA 1D0XA 3HKZN 1QXJA 5C33A 2AQFA 4KNYA 3KV9A 4C0HA 3ZSEA 3CESA 1C5IA 3MYXA 2DFBA 1R1TA 5FKBA 2BBAA 2ISYA 1RZ4A 4C3HJ 2DK5A 1PO22 1KD7A 3DEEA 1NH3A 2X51A 1GVDA 1RUJ3 2DFHA 1MEC1 4GKYA 1ZZ9A 4D8MA 3T0BA 1R082 3UKVA 1PVEA 1PIV2 1C0WA 1BMV2 3ITQA 1B6AA 4M74A 2ZHKA 4XHBA 1KU2A 3FUQA 1TQMA 4RSUA 3ES4A 4ZYGA 2HWB2 2ZKLA 1MQTB 1J2XA 4OI4A 2E1NA 4PFPA 2IGMA 3HPNA 4GB32 2DU9A 1W05A 4TYSA 1WCSA 3JRHA 3K70D 1HB1A 1ULEA 3K4NA 2QTWB 1TG7A 2VULA 1NG6A 3VBUA 1W28A 4V2WA 1W2AX 2XSDC 1LE8A 1T0FA 2HWE1 2MG4A 3N7LA 3M3CA 1IS5A 1WI3A 1WCKA 1R1UA 5FKKA 1BEV1 2FDJA 5A70A 3BY6A 3KX2A 2ZX3A 5CVJA 2RDRA 4A0ZA 1WBFA 3VL9A 2B63J 1QPIA 3ZP5A 5DAPA 3X2QH 3FUOA 1W5TA 1R5HA 1GWMA 2DDUA 1MMGA 3JREA 1RUD3 3OL3A 2CH0A 2DCTA 2HYKA 1EUTA 1H88C 1SFXA 2VR4A 1OCCH 1ITYA 3PM1A 5J3UA 2DYCA 4G6DA 3VD3A 1JUSA 1TMF3 4LLFA 1OF3A 5K7HA 4JDNA 4S2FA 4IQJA 5D1IA 2XRLA 4G4FA 4B47A 4DYCA 3CC7I 3K3NA 4Y20B 4UB8C 3PQKA 5IVCA 4XQ4A 2JA7J 3HJRA 1FZPB 2YS9A 1W6QA 5HVQC 4Q4W3 2ENRA 1C3HA 3V7CA 4DXZA 2R071 1KDMA 4J19A 3NJZA 1IW7F 5JXIA 2XF5A 3BYWA 1IZ1A 2JVGA 4QQPA 3DL3A 4BHCA 4XCAA 4YLZA 2QQWA 2A70A 1SG3A 2W52A 1SLIA 1LDJA 3BU7A 2E5NA 1YJLA 2Y33A 2SBAA 5A7WA 2COMA 1R5GA 3WG7H 5J36A 3SZGA 5A3LA 1OQEA 3M1EA 1E3OC 1SD5A 3IWZA 2DQRA 4Y52J 4XUPA 5E6HA 5HLIA 1EH6A 1MZBA 3KCYA 4M00A 4L9NA 2TBVA 2W85A 3C7JA 4Q4Y2 1ENHA 3HNBM 4QMAA 4IV3C 4URAA 3OS0A 5CG8A 2QQKA 3ZMNA 3VBFC 5CZKA 3G71I 1AA7A 3WF3A 3ZYRA 1PK6C 4ENJA 5BXXA 3RPUA 3FXQA 1VQLI 4IERA 1Y8QB 4XSXF 2VE8A 5ILVA 1QJFA 3ZQLA 2VVDA 1T98A 5DUVA 5FRNA 3J26N 2XLAA 2IT0A 2E6VA 4Q0SA 1TME3 1X2MA 1NG7A 2Q0OA 5JR3A 1CAXB 2LK2A 2VLAA 4QD2A 2GLOA 3CCRI 2PMWB 2JG9B 3UESA 3RYRA 4AHXA 3O1UA 3LSMA 4HSTA 3DPRB 1I1SA 1OFCX 2W95A 4C91A 3GUDA 5FYIA 5DAQA 1W0NA 5IVYA 3NKGA 4K2EA 1N77A 4XYXA 5KAIC 4CE8A 2CS3A 4G6QA 3UV9A 5EPAA 5FZMA 1W7PB 5DG1A 1RUI2 2VOPA 4MNUA 3IDAA 5IOYA 3P1IA 4L97A 2BFUL 2O8KA 3CHXA 1T2KA 3HWJA 1DUXC 4HK8A 4MHRA 2JRTA 1YHFA 2XWBB 2BBYA 4N4OB 4NC7A 4Q4X2 4CZCA 3AZWA 4YW7A 4IESA 3O12A 3UJQA 4Y1ZA 3J8F2 2RM21 4YZ3A 1H2LA 1FJLA 5BUVA 4NBQA 3E0JB 4KWKA 2VIXA 5GM0A 1C28A 3TO9A 1MBGA 2XL9A 1KFUL 2Z1DA 4ZZ8A 1XPXA 1QGPA 4W1UA 2RS12 5DD4A 2GMMA 3IPVB 3S1MJ 5FZ9A 4MLOA 3NW4A 3WHUA 3B6AA 1QZEA 3FXMA 1VQ9I 1RUG3 3MLKA 3PVNA 4HX7A 5IVBA 2BGCA 4PCQA 1LNSA 1P4AA 4ZDPA 2A05A 1I6HJ 2CGNA 4YVSA 2ZX1A 4WM7A 3POSA 1PMJX 1XD7A 3AKPA 3LIHA 3A1YA 2VOVA 5DPNA 2X10A 3ZMOA 1D0HA 1VBA1 5DDJ2 4GH4A 4XDQA 4QX5A 1KZHA 2V79A 2JDPA 2DYSH 5KXEA 1FI2A 5KCMA 1YW8A 2K0GA 1BJQA 1UY1A 2ADUA 3WQ0A 3WSOA 3DKQA 4RGAA 3VZLA 1MH4A 4IOCF 1OKQA 3UKTA 5ILUA 3K4DA 3SZTA 1XRUA 1RYYA 1W6OA 3KB5A 3RZOJ 3W58A 4YZ5A 1OCTC 4M4PA 1PX3A 1VALA 2RV8A 4CEYC 3BR6A 2XPUA 1OKOA 3GZEA 5A1AA 3NQOA 1GWLA 2HWF2 5K8SA 1VAKA 3DBRB 2QKLB 3NRUA 4LA3A 2ETEA 1JJ6C 2VOOA 3CUOA 4OLLA 1AL23 5HDNA 1P2FA 3CO6C 2XAQA 4P9IA 4A6DA 4Z6YA 2HOAA 2PLYA 3CCJI 3KP7A 4HVOA 3GTKJ 2LROA 1YRNA 4IVNA 1D8KA 4LA2A 3B7MA 2K86A 3E6DA 4HETA 5BPXA 2VVEA 1O8PA 4WK8F 2BY2A 2WAEA 5LY1A 2KDZA 3RPUD 2EB7A 4B1RA 2OCCH 1OF4A 4DOUA 1NZIA 4KIBA 1CQ9A 3BR0A 3SMHA 5DCMB 4CICA 4JGYA 3NQHA 4JHTA 2D3PA 4LBLA 4OIQF 2E60A 4NUBA 2BV6A 4JVAA 4LKEA 5ERLA 3OBZA 4MGTA 4YZ1A 1BC7C 4YFXF 1SPPA 3IAPA 4N0BA 1S72I 3O1OA 4IHVA 4JZRA 5FLHA 4XCBA 2VZUA 4XOTA 2ZEYA 2G9WA 1VBD3 5IYDJ 1AR93 2BW3A 4IX7A 1AKHB 4WZFA 5C9AC 5LCWL 2OC6A 4DUXA 2Y60A 1R58A 4O6JA 5FPLA 1GUUA 1U6GA 1LHUA 2R7FA 2HXIA 2DBNA 1PIV3 4RLQA 3HPHA 3AL5A 3L2VA 1GNHA 1XJAA 1R1A3 3L2QA 3KEQA 2ZNYA 5EGOB 1EF4A 3WV6A 3F8BA 4IXAA 1K4TA 2A3YA 2Y38A 5D8AB 5CVUA 4XIOA 4L5JA 4MSVA 4JQFA 2V9PA 3UL2A 4PF5A 4NHJA 2DA3A 5FZHA 4UUVA 4QU2A 1BW6A 1U9OA 1R1A1 4DINB 2WUHA 2CQQA 4PFOA 1N78A 3ZMSA 1QQIA 3KYDB 5A3OA 3G4SI 4HNTA 2AHQA 4XBQA 4ETSA 4IL6C 3ZSKA 1IKPA 3PTYA 3H3VK 2JK3A 3POJA 3A0HC 3NNFA 3H9JA 4QT6A 3IRRA 2FBHA 2OBPA 1GV2A 1XNKA 1AYN2 1SFOJ 1XCVA 2IXCA 5FZBA 1E57A 1TW2A 2VCAA 4HA8A 4OI1A 2Y0SN 1HSTA 2RS53 2IFRA 1ZAOA 1FP2A 3QPLA 2KXLA 1QJX3 3BJ6A 2NAZA 2MC3A 2ARBA 1RUNA 1EYBA 4IEJA 1XSQA 2JG9A 1IQAA 4Y33A 2A3SA 3CF2A 2DA4A 3I56I 3HRSA 4DBRA 4RS5B 1RUD2 1HXDA 5A7QA 4IEWA 1IS6A 2VI6A 2Z69A 3LGRA 4BISA 3I2DA 2WO3A 3T5XA 2H8RA 2Y0OA 2VQTA 1X1AA 1YI9A 1J84A 1W8FA 4NDLA 2XJVA 3FHIB 3R60A 2RS51 4RD7A 3WQBA 2QZ8A 2QSGX 1HQNA 2X29A 2M2EA 3I54A 3L09A 4YRVA 2XWJB 4PQ9A 3I4NJ 5M3FJ 2BW8A 1XE0A 3POIA 2L2OA 3P9IA 2P5KA 2NMOA 4C30A 2A6EF 2DFIA 4W97A 4COVA 2QQIA 2VC0A 3EETA 5IVFA 2CU5A 5APAA 1ZZ7A 4LOCA 2MBFA 5DDGA 3FIWA 1OMIA 5DUIA 5LEKA 5F6KA 1RMU2 3CP8A 2B4KA 3GCWA 2UXNA 4CCJA 3S32A 3R0JA 3K4LA 2KRFA 3WE3A 5ANQA 4LLGF 1RMU1 1JXNA 4YVWB 4Q4Y1 4YWAA 3LWCA 2QDNA 4K21A 4EN8B 3WF2A 1G9AA 2WA3A 1K3IA 1PYVA 2ACJA 1MBKA 1L7QA 1RESA 2NM1A 2QKDA 1V0AA 3POFA 5M5YJ 5FQ0B 4FPCA 1IV6A 3LOCA 3BJAA 3PTRB 2NVQJ 2ZACA 2KIFA 1XDSA 1UIJA 5CQEA 2HEYF 2DA7A 3O2PE 4CP0A 3T1BA 1DGRA 3A4UA 4HPKB 3S0MA 3FMRA 3WCRA 1UAIA 5TISC 3H7YA 2XBO1 2I07B 2ZGSA 1JMUB 1ZRIA 5K5QA 3RS6A 5J40A 4LUMA 4BM8A 3VOEA 4HF2A 2XBO2 3B3QE 4M3CB 3LEGA 5A80A 3IAM2 1GV5A 3EYYA 1LQ1A 5CKNA 2WB1A 4BBSJ 2EIJH 4V2VA 2PEXA 1IN6A 3CJNA 2DPDA 2IS4A 1VQNI 1UW8A 3RKXA 1WSUA 4QXCA 5D5VB 1IUFA 2FZ2A 1RHI1 3MIDA 3LFKA 3HL2A 3E97A 2WT1A 1CX1A 2O5RA 4G7HF 2W1SA 3RNSA 4UWDA 3K70C 3DPLC 2CUJA 2VOTA 4HX8A 3IHUA 4RB0A 2Q8OA 4UW5A 2WBMA 3MKLA 2P5VA 4GXLA 3LNQA 4CDUB 1K42A 5D2AA 2Q1FA 1N3PA 4E2GA 3U10A 2R7DA 5EEGA 3FXOA 4Z1VA 2J1EA 4XF3A 2DT7B 1QWRA 1UX6A 1VFCA 4LBMA 4DOZA 3NV2A 1ODMA 1HKSA 4XSZF 2W1UA 2WAOA 5FMCA 3G1OA 3RTRA 4ABZA 1YJKA 4A5NA 3LSHA 1V6KA 1EY2A 2Y75A 3ZXJA 4P00B 2WAFA 4E7ZA 3QPHA 2OA4A 3TBIA 1GSLA 5IAVA 1Y6IA 4QHZA 3K4AA 2LNBA 1REDA 1V55H 3WZ1A 2WWUA 5GZDA 1W6PB 1UHMA 3CTAA 4HLYA 2DMUA 3BJOA 3GYDA 3PHMA 2DOAA 2WQ8A 3ZSJA 5EJ1B 5AFEA 2V6EA 3K75B 3DYMA 3H36A 2WFF3 1R093 5JXJA 4LG3A 3OYJA 2Z42A 2B42B 3ZDSA 2XASA 4DJAA 2DVBA 5HCBA 4PK4A 3DFGA 4LO5B 3O8HA 1ZR2A 1ZGJA 4UYBA 3I3QA 2X85A 4QPQA 4X8NA 2HS5A 2YPRA 4U0VA 1UFMA 3UKGA 4CCDA 4RS8A 4RM3A 2CV6A 2AC1A 2OZUA 2VC1A 3IH2A 5EYRA 3MKWB 2HOEA 5DTDA 3WW3A 1KONA 3ZXFA 3EUKL 5ABJC 2WNEA 5TRDA 3CCQI 4UI9L 4Y15A 1IXSB 1AXZA 2LW8A 4ESBA 3U14A 1FNNA 4AWDA 3JAMZ 1Y39A 2J7MA 3OJBA 5C8CB 2QVOA 4BHPA 2DODA 2Y8KA 1BI2A 1WA6X 2FDGA 2WNVA 3HMYA 1I5ZA 5LGUA 1OPMA 1IPJA 4OQ8A 4B4CA 2RMU1 3MZ8A 4F52A 3H0OA 2VMHA 2LTPA 2W91A 5K4LA 1B59A 1HRV3 5ANNA 1IQDC 1KJLA 4DNYA 4DFSA 5FYZA 1EA3A 1RKTA 2VQLA 5A3WA 3HSEA 1BCXA 3FKJA 4NO4A 4D1QA 3D3AA 2UWCA 4H7MA 2QSHX 2C9AA 5SV8A 1JTZX 1XU2A 4XOPA 4DQ2A 2PAEA 3A03A 3FLTA 4NPMA 1CPMA 5FD6A 2LC2A 5FGMA 2EQRA 4FE7A 2WSUA 3P6BA 4C90A 2GXAA 3TEXA 2L5QA 4L0ZB 2WTEA 3GMEA 1JYCA 2XAJA 1JYVA 4U36A 3HRUA 2PMHA 4P9FA 3R4DB 3C3WA 4QIWN 2VBZA 2D97A 3A0KA 3S2DJ 4JGYB 2P1BA 1S6LA 1ST8A 3MZHA 3QP6A 2G4IA 3CLQA 4LQRA 2PQ8A 4D7MA 1J7KA 5AVAA 4GDFA 1UG0A 3M8FA 3BTCA 4H3WA 1JYNA 4BDYA 3Q8CA 3PVOA 4MVTA 2VE9A 2VW0A 1EV13 3RWKX 5HLTA 2ZEZA 2K40A 4G12A 5E79C 4ET7A 3WT3A 5GAHJ 3BPVA 4Y1VA 5EJZB 2WY8Q 2JDYA 1DQ2A 1VE0A 2HWF1 2D44A 2L9VA 2ID4A 4LMYA 5HLGA 4MO7A 1ND2A 5CB7A 3R61A 3EQLF 1V6LA 3I3LA 3K2AA 2WNUB 5JXGA 2DA2A 4UFKA 1ENQA 2ET1A 4IE5A 3OPTA 3U4SA 1NA1B 2P6CA 1YQ6A 3NRVA 4XACA 2M7AA 1MNMC 3AMPA 4QKFA 3VZOA 3H50A 5KWRA 1B9NA 2G19A 3PNYA 1JOJA 5F27A 1V6MA 2FDFA 4YG2F 1KXGA 3QP5A 1SD7A 2R072 1VNDA 1OQ1A 3VBSB 3VKNA 4BA6A 1N1SA 5K7PA 2PAKA 3ESWB 1RVF3 1AYN3 4NIAA 2K3PA 1TWFJ 4IGPA 1IHMA 1BI0A 1MBJA 5B1AH 1JI8A 4AGRA 3IKVA 3F0CA 5EEHA 2OS2A 3CJQB 2D43A 4CEYB 5D6FA 2RVAA 2DXIA 3FLPA 3KSCA 4LHKA 1BEV2 4AHWA 1YS6A 4LGWA 4D7TA 4BE3A 3MFCA 3WDUA 2W57A 3ASOH 3WF1A 4WF2A 1G86A 3V0BB 3W2WA 2YGLA 2QQVA 4XLFA 1ZH5A 4RL7A 3HM5A 2ZHLA 4BK5A 3PSFA 2DJIA 2IXHA 1AZDA 1IPSA 1ND2B 2O61A 3AL0C 3VZKA 2JDMA 3NWKA 3WG2A 1ZARA 1XB9A 5CPRB 1A35A 1W6OB 4F7ZA 3VBFA 1SMYF 2ZGKA 2UYAA 3PMEA 2BGOA 1P6RA 5EZGA 2OX0A 5C8WA 4XRSG 1FXZA 4KU7A 1RC6A 2XG3A 2HWC1 3IIAA 2BV4A 3BT9A 1ON2A 3QWLA 2DA6A 3QCWA 1GZTA 4GULA 2JVHA 4UAPA 1BK0A 2HYXA 5FZGA 4YW1A 4HG2A 2YROA 3I49A 4E27A 4DGWB 3IKWA 4KH9A 4RAGA 4D69A 2YC2A 1FBUA 1O4YA 2WV0A 4RBOA 2Q8EA 3AP4A 1R6RA 2EXKA 3DYOA 3VBSA 3CMYA 2E34A 2NS0A 3PQJA 4OQ9A 1DQ1A 3W20A 1AR63 4AFBA 3ZM8A 4L9VA 1WJCA 1PK6A 1G8WA 2JA8J 5FMDA 2PJRA 4NOTA 3OY8B 3PLQA 2HWE3 5LGNA 1NY71 5JPMB 5IP9J 4NE9A 4ZZ5A 1YW7A 5F9TA 4AIDA 1G9CA 2DT6A 2RJ2A 2AYHA 2BJSA 4E7SA 2A3XA 1XXNA 3CQZJ 2BPA2 3F22A 2IXSA 1QHGA 3M8JA 4WM8A 1CF7A 1SPPB 4BIFA 4JKKA 2PHWA 4EATA 3I53A 4YFZA 3LFMA 4EJVA 1O3QA 1L7LA 2K9QA 1WCMJ 2Z33A 2IXJA 5E8AA 1RHI2 3GZTB 2K46A 1MZ5A 1ENXA 3LDRA 1JJ8C 5I91A 4CYCB 1RUI3 1VMFA 1DGWY 4AEDB 3CMMA 3GTLJ 2MFZA 1UX7A 3ZPOA 4LORA 5FZEA 2PBIA 3GHNA 4M0NA 3A21A 3HRMA 5KHJA 4MIMA 4FPYA 1WA4A 3VHOA 4HVQA 1FPN3 1D1AA 2M0MA 4J1WA 3V7SA 1X8EA 3D1NI 1QJY2 1MMDA 2P81A 1AUYA 2CDOA 1Z7S1 2HQAA 4BAYA 2ZO4A 3RKYA 4CXWA 2EZHA 3OGJA 2VBYA 5EDNA 1OISA 3MAJA 1VBC1 3V0AA 3MIFA 4RGUA 4A93J 3HG9A 1M06G 1WW4A 2FUG2 4NRQA 4JC1A 2W39A 3GBFA 3ZGKA 4QPGB 2Y31A 3ZFEB 2JN6A 5F2SA 5DZGA 1FTZA 1QNTA 1S8NA 2HVQA 2H0BA 5E89A 3LQRA 5JSRA 4C3JJ 4UOJA 4EM1A 2NRAC 3SEEA 4EWAA 5K0UB 5A3PA 4E70A 2WS93 2IVIB 4XZUG 1FMD2 1H8VA 3HTSB 2EA7A 4RR3B 4Y24A 2EK5A 1HRI3 3QQAA 5JI9A 1JZ5A 1VQMI 2QBXA 2LF7A 2RDQA 3WF0A 3EMRA 3KCXA 4BKXA 2WLPA 4ESFA 1FMD1 3A22A 3ZFFB 2BWAA 4QQLA 3BROA 1OCPA 1H9TA 2VQCA 3LSGA 4N4NB 2HEWF 4KU8A 3ZXLA 1EPZA 1SBEA 2ZAAA 4AWXB 3HOTA 2FZ1A 5IJRA 3WE2A 5HBAA 2Z2SB 5FKMA 4XAAA 4LFUA 3MN2A 3KGLA 2O8OA 1A6QA 3IP4B 2OQGA 4OIOF 6PAXA 2RAEA 4OHWA 5CISA 5BNOB 5HODA 5BNNB 3UJOA 5KAFC 1YO5C 1HIXA 3OL4A 1CPNA 5DYMA 3LKJA 1QQP1 2XQRA 2IPQX 1NHAA 1GZ9A 2CG4A 2STWA 1U0JA 1US2A 2VTFA 1ETVA 5C3OA 4ZU4A 1PO12 1MSFC 1N75A 1MEC2 2QE3A 1PMIA 2C6SA 5KC5A 4HKLA 4YM0A 4WWCA 1UZZA 3RRDA 3K4KA 5J8CA 4QDQA 3THPA 3NJVA 2P3YA 5FUNA 2NP0A 3LAPA 3AK0A 3BGAA 3M4FA 3HOSA 1O4XA 4GCVA 3E1F1 3IPVA 1LUJB 2JB4A 4EWEA 1YI2I 1KITA 3J8F1 2G9GA 1G4DA 3ZQGA 3AP9A 2O03A 5GLVA 1YG2A 1Y43B 5CKTA 4IV3A 2RMU3 3VLBB 2VTXJ 3K4ZA 5BMZA 3BB6A 5EFUA 1F4AA 2YUSA 4RHV1 4LB6B 5CVRA 5F5IA 3SHFA 5J98B 3E6BA 5F6LB 1AR81 4XTMA 2GNTA 5D6EA 1FBQA 2ZJRF 4V1PA 2UUZA 5C71A 4GWNA 3RSNA 1GNYA 1F31A 3SZPA 1OLQA 1QNYA 5BY5A 2JUGA 4EVIA 3ZYBA 1CN1A 2RHPA 1DZRA 5JWPA 3H1CA 2RNGA 3K1NA 5BNNA 3IRQA 5F0CA 4CCNA 1W6MB 4FQZA 4QDSA 4QQHA 4E2SA 1UOJA 4P1WA 5FZOA 1F43A 2BY1A 2CUZA 2DDAA 5HS9A 2CW0F 5DAWA 1HB2A 3I3BA 1XE7A 2FHRA 3I3DA 4K3UA 1ZN2A 2AACA 4UFIA 4QAWA 1XMKA 4XKVA 2ZZQA 4S2DA 4MX3A 1ASJ2 1AR72 1F5FA 2Y9YA 1W2NA 3S7IA 4Q4V1 3SH5A 3C7GA 3ERED 4B8XA 1SVLA 2CO5A 4E7JA 1QGLA 2VXDA 1EH7A 1KJRA 4QPIC 2A07F 2EXHA 2QQNA 1RXFA 1QHHD 1LOFC 3GWZA 2C26A 4LO8A 4QTRA 5IP6A 3MEPA 5LWBA 4B48A 2PFBA 1S0JA 5BPDA 2BFUS 5EHDA 3Q8EA 2KIMA 1C4RA 4QX1A 3ZR6A 1T38A 2VJXA 4BE2A 1E5RA 2V5DA 1UF2C 5IVEA 2YV8A 3O1SA 4BU2A 4HK9A 3I58A 1W2UA 4HXCA 1ZBE2 2DCKA 4LKDA 4CXYA 4DNCA 1B35A 1MQTA 3ZMTA 1D5YA 1WH5A 2EFNA 1FPQA 3AX4A 3ZFGA 1QJU2 2HKOA 3Q3SA 2VZSA 3VHPA 3DLLF 5AONA 4GWJA 1XX5A 1D1BA 1ULDA 1U5YA 3WOGA 4OUSA 2QJVA 4ANJA 2AZ5A 2E33A 3H3UA 4WM7B 3AYDA 1BN5A 2CQXA 2VASA 2D3SA 4QLCU 2HWD1 4WZCA 1E3PA 4DRVA 3IAS2 1LKXA 2QCSB 3HGGA 4JX0A 2ZGPA 1GYKA 2JKBA 1HLVA 4ZS3A 1FOD1 3WHCA 5I8TA 1IN7A 2AREA 2YZ4A 5K0UA 1GQPA 1CD3G 1WWYA 1BLZA 5FYMA 5I0DA 4XFIA 2VUDA 4KNCA 3ZLIA 1AXYA 3PU8A 4KGQA 1W8WA 2BDRA 4NAMA 5C4XJ 1W4MA 3USUB 1KS4A 2EAAA 4FOVA 1LNWA 4RLFA 2KD7A 3K7AJ 1UOBA 2OUHA 5FZFA 4LPLA 4Z2WA 1R1VA 4AHZA 5IAXA 4LBQD 2VH9A 4M4RA 3WTTC 1JUMA 1W7PA 2R30A 2V5YA 1W99A 5LB6A 5FZ8A 2LUWA 2GALA 1IN8A 2F5VA 1FOKA 1O5UA 3VDDC 3EHKA 5JIUA 1IG7A 1HN1A 2HWE2 3H92A 3ZN4A 3ZXKA 3AKTA 1IPKA 1HW1A 4GYIA 2VJJA 5GJ6A 5CFDB 2XIGA 4PQQA 3HT2A 3VD7A 5CU1A 1UCRA 2YR2A 5FYYA 2YHJA 1AWCA 2FX0A 2LREA 4N8MA 3FF5A 1KQ9A 1GVJA 2WAQN 4KL1A 3QU3A 4BXXJ 4G7OF 1VQ4I 5E16A 4CP9B 2ARCA 1SLTA 4O65A 4A3BJ 3DXTA 2YX7A 1X7NA 4YPJA 1QPMA 2CRGA 1CAVA 4GD4A 4R9DA 1FOXA 1ZLJA 1FYUA 2A5YB 1KYZA 2JMWA 4UXNA 4MZUA 3MI8A 1LOBA 2BNOA 5FO7B 1ZRFA 2IXIA 3OBRA 4Z2AA 4HN1A 5CEHA 3BKZA 1RUI1 1JH5A 2M4GA 4HANA 3T09A 3F95A 4EYUA 1D7PM 4HDVA 3KQ4B 1H0MA 4AQ6A 4N7UA 5DG2A 1BOAA 3MW3A 1W5CC 3BR3A 3W5MA 2WFPA 1I6XA 4XJAA 2QF7A 2CMPA 2VY0A 4MTEA 4XR6A 2YUEA 1W6QB 2CAUA 4B3AA 4NHLA 1UYZA 4AC0A 5DDJ3 5FIXA 4YEJA 3S1NJ 4CYDA 3EJKA 1CAUB 4UW4A 2J5OA 3BPZA 3JCUC 1HOMA 1XMXA 3CCLI 3LPGA 2HKXA 4A6EA 2X6YA 2HDCA 3CF6E 3NVCA 5JI7A 3S16J 3AG1H 5FV3A 5IK4A 3DGTA 3HN1A 3U1DA 4XK4A 2ADDA 1H1MA 4FTEA 3K2OA 4LLOA 4LT5A 4BJTA 1LB2A 4GJYA 2WR9A 1LFBA 3DN7A 3M9AA 2GH8A 4EN7B 2VQHA 1DPUA 2VO5A 1D4M1 2IUWA 5FPZA 1BJZA 1WZXA 3HAGA 4F3QA 2E26A 4KWLA 5DS9A 2FBKA 1ETWA 4AE2A 3E5XA 4PDKA 3ECQA 1FWZA 4Z92B 2BYVE 2DMQA 1LE8B 2MEV3 5EEAA 1KFXL 3RZKA 3U78A 2Q8CA 4N43C 5IFTA 2ZMKA 1WJBA 4HW0A 3OYWB 1KDKA 2PLV3 4CTEA 4RHV3 1J3QA 5FYBA 5C9AA 2QENA 3DTKA 1SLAA 2ERFA 2X9DA 3VKOA 1MVQA 2GC1A 2XMLA 2LP0A 1RUE3 3BN6A 2GNMA 4I30A 4B3XA 5JVVA 4IEPA 3KD4A 2E7QA 2BOJA 2P37A 4JX4A 2GBYA 3T3YA 2NZ9A 1LEDA 2Y6KA 2GOXB 2JPCA 2VQAA 3M3EA 3HD8B 2WZEA 1FEXA 1RUH3 1SZBA 5BNQA 2IS2A 2ZKNA 5LBBA 3D5RC 2MLKA 4BQNA 1O3RA 3MLJA 3T0AA 4IHSA 1QIQA 4XQDA 4ENKA 1OLTA 1UWWA 1S7EA 1DU6A 4D5CA 1HRV2 1LDDA 2DURA 1DCSA 4UUSA 3O1TA 1ORKA 3SFIA 3ZQHA 4FTHA 2YFZA 4YSFA 4YM1A 3W6JB 1VBD2 2YY1A 1J3RA 1XQNA 2LMDA 4WV8A 3GGLA 3ZSLA 3OBAA 4IV1B 1DQ6A 5ED4A 1CJPA 2M30A 4BJ5C 5J4VA 2PA7A 4LHLA 1VBD1 1LHWA 3SXWA 4QPGA 2VMIA 1NA1C 4FPFA 3ZXGA 4O9EA 1D4VB 1YJWI 2V6CA 4XLHA 1WJEA 2Q2EB 2VJIA 1CX4A 3FMQA 1RETA 3KWVA 2ZXHA 4JRAA 5A7NA 1YJNI 3VHRA 1HX6A 2OPWA 3M3YJ 2D6PA 3IBMA 4NPLA 3OYWA 2XHKA 1J5YA 3PVEA 3LAGA 3TO6A 4XRSA 5JOXA 2TDXA 1D1CA 1OFSA 1FMVA 1RTVA 5L3GA 3VDDB 2JA6J 4OHZA 4AFMA 2VUAA 4EZHA 3NJXA 3BG7A 3C7EA 3KYCB 2OQ7A 5A1LA 1T6SA 3RVHA 2GM4A 5B66C 4LMFA 5J4YA 1PUFA 1HF0A 1MBEA 1ASJ1 1AR71 2XGCA 1X33A 2QWWA 5FLMJ 3J7HA 2DMTA 1OYYA 1ZYBA 3WCSA 3ZFEC 1P8JA 2H6BA 2JSCA 3M1CA 2OJED 5K9YA 3CUQA 1R081 1LEAA 2JG8C 1B72A 4E9KA 1R083 4CU9A 2OTLI 3ECHA 3O0VA 3M3IA 3WUDA 5C4WA 4CU6A 3DU5A 1Q43A 5LY2A 3OS2A 3EUAA 5D8AA 2OPTA 4XN0A 3ZOBA 4HBLA 2ZB9A 1XG1A 1YOVB 3AZZA 2M9HA 3WDWA 4C2UA 4WVWA 4Q4V3 3IZOA 4UFMA 1H0BA 4YG6A 1K5MA 4J01A 4RGKA 2Y2ZA 3M70A 4FP3A 3CJIA 4X8PA 2NNNA 3C8XA 3KP5A 1JOPA 3GZUC 2W48A 3MEXA 3KFWX 3C7HA 3VBHB 1AU7A 1GHCA 2I8DA 3NV4A 3I9V2 2ZXQA 1NK3P 3N9QA 1GXQA 3S6PA 4LLLA 3QD6A 4DXSA 4QKNA 2V4AA 4AEDC 2JDAA 4M6XA 1VF9A 1MMSA 4L18B 1QJX1 4CEWA 4HYEA 2PELA 1SLLA 4L9TA 1NCRA 2CW8A 1BR2A 1IO2A 3JRCA 1XC5A 3VODA 4DEVA 1A78A 5EWSA 1JYWA 2A1XA 4PJNA 4JOMA 3KF5A 5BNPA 3U37A 2PG4A 1DLCA 3W59A 2ZMEB 5K7ZA 3I8TA 4LG0B 3R05A 5A3UA 3OPZA 5KR7A 2CFXA 4H4KC 1LRHA 3L9JT 4S2GA 4XF0A 4P9GA 4XF1A 1FX5A 4FFHA 5FPXA 2FA5A 1W3XA 2DBBA 5FPBA 1EAH2 2JDUA 1V5GA 1TT0A 2WO7A 2KA3A 5L3FA 3RJ2X 3RIRA 4M6YA 5FK7A 4A3ZA 3URFA 5EG0A 4ZKTB 1R4MB 2H1LA 1W8HA 4R9BA 2V1NA 4E7LA 4AI3A 3KHBA 3MDPA 4RB1A 2LKSA 2F5FA 2E36A 4IXLA 1Y0NA 2HXOA 3GZ5A 2PHLA 3JBG2 1QKQA 2R6QA 3BR2A 1MW7A 5FZAA 2HQ5A 2KHMA 3J7YJ 3BOWA 2RR13 5JMOA 1EP0A 1N25A 1I1EA 5FKOA 3EDPA 2V1XA 4XNFA 4AW7A 4ZPIA 2H1KA 3O14A 1Q8VA 2CGPA 2HR3A 5LHHA 5AC93 1YQCA 5GLZA 1GQHA 3BP8A 3UT0A 2HQNA 1BVVA 3IAQA 1T8IA 4META 2E51A 1XCBA 4DO0A 4YZ4A 2VNRA 5HNHA 2I74A 2DVAA 5L3DA 1SDWA 3OGSA 4EM0B 1OXCA 4BQWA 2HOSA 1TC3C 4AQTA 2IC1A 2LSOA 3CJIC 4HEA2 3ZYJB 4YM3A 4ES8A 2L4AA 3RDIA 1XGSA 4CCLA 2TRTA 5EYYA 4FBFA 1V9U1 2BBVA 3ZXDA 3JD71 4OZXA 2F4IA 3VKMA 2EJRA 3TOBA 4OHVA 2VUCA 2KP6A 2DTWA 4EE2A 3KT4A 3ZMZA 3VYUB 3TOAA 4RYDA 4Z2YA 4L0YB 5F37A 4YVWA 4OINF 2JRMA 3ULQB 1TQPA 1OLME 2ZX0A 1VB2A 5JLXA 5CG9A 2XPWA 4M71A 1T56A 1Q1HA 3TEDA 1D2QA 3PUQA 5FKLA 4PIZA 5EG0B 4COYA 5L19A 4CRQA 1G3YA 3QLQA 3HT1A 4AHYA 5LK7B 1LVKA 5KXCA 1HC8A 2ZFUA 1AXKA 3VZMA 3VYTB 4NPRA 3WXPA 1GP5A 2V26A 1UZYA 2PYTA 5FP8A 3PIOF 2K9SA 4CA0A 4IETA 3OMYA 1Z7S3 2A71A 2A7AA 5I0SA 1YIOA 5CFDC 2DYRH 4PLMA 1VI0A 3T2OA 3WODF 2DU1A 1BK1A 2VQUA 1GANA 4B1MA 2CQ7A 4OUEA 3VDXA 1X1CA 4RGXA 1RIRA 1U9NA 4ZS2A 4AUXA 4IE6A 2J1SA 5C3PA 3HOBA 3NWTA 5LHIA 3BQZA 1PVXA 1CAXA 3QOPA 4NHKA 4XZPA 4TTGA 4H7LA 1GUIA 2VQGA 1ZQ3P 2LH9A 5EZHA 5A3TA 3GNEA 1G9FA 1W0UA 2VOXA 1UZ0A 3ERMA 4CDQB 3V64A 3HOUJ 2PN6A 1RUH2 3Q8FA 5CVIA 3O6BB 4A41A 4MO3M 2D1HA 1GOHA 4P55A 1YUDA 3VBHA 3V8KA 3RMYA 4YG3A 4AF9A 1IN4A 2XSJC 4GJZA 3J7ZI 1VRH2 3HQRA 2DO7A 4PSWA 4BY1J 1OBNA 3FE5A 3AYEA 2HFHA 5B4NA 1R00A 4YIRX 3B93A 2VOKA 1QOTA 5D5WB 5A7PA 4ASKA 3NL1A 3AZXA 2EH3A 3G2BA 1H1AA 1OVPA 2I5UA 2L9NA 4JQTA 3U11A 2P8TA 1U2WA 1DBNA 1Y9GA 4BWOA 3U21A 3JXSA 3BTXA 2VBBA 1G8XA 2NOGA 1C8M2 2FCTA 2QYOA 2OZ6A 1S0EA 3IIIA 4FPGA 3F9KA 4KIFA 4CUGA 4KMFA 1D0GA 2K9MA 4CUBA 2DVFA 4ENMA 3T1MA 3ZN1A 3FFZA 1Q5OA 5FK8A 1HQWA 3MKZA 3GJBA 1K6OA 1AF9A 3SYTA 3LSPA 3RSJA 2VU9A 1SVMA 1FY7A 2NYXA 1BQPA 1CZTA 2MW8A 3T0DA 4IJAA 5FYHA 2V1UA 3AFHA 1TWAJ 3TEYA 2DTRA 4HPKA 1G9DA 1AL0G 3BG5A 1SFYA 4BB3A 1FBSA 3LPFA 2VMGA 5I0RA 2NPIA 5ILSA 4W50A 1MPXA 1KU3A 1AR82 1CWPA 1OOPB 4R79A 2BERA 3W6VA 4XUNA 1WPKA 3FDYA 1ZRRA 3TKYA 3JRFA 3RI8A 2O1QA 3RZMA 3AJZA 1TP4A 5JR2A 1OPOA 4EWDA 2ZEWA 2R061 1OQDA 1MS0A 2R043 4NMIA 4XMIA 3BOPA 3BU0A 3HHGA 3RQ4A 2VMEA 3DKYA 1NQJA 4RN5A 2DDBA 2JE9A 4RA0A 3PUAA 3KEOA 2QLZA 4NRPA 2DOFA 1GR3A 4KGGA 1OCZH 1MS9A 1ZBA2 4WBBA 3ES1A 1RR7A 4IV1A 1MZEA 2RJLA 5E8IA 2WL1A 1IDYA 4QQ2A 4YFKF 1ZBA1 4IEXA 1RITA 3QODA 4C2TA 2XQXA 2PX9A 3AP7A 5BNPC 1UY3A 3G3ZA 4P5OA 5F1JA 3K48A 4D6QA 1G3SA 3OIQA 3ZIWA 3ENRA 2QUFA 1YTYA 2J1VA 5HS8A 3U1KA 1PO11 1B09A 1UU6A 3WP4A 2PN5A 2W25A 2W82A 3ZN5A 4YW2A 2E32A 3H3ZA 3M07A 5GTHC 4HV6A 1ZRCA 3KE2A 1WCDJ 1GU3A 1F4HA 4BLJA 1AX2A 2QZ3A 4M0HA 2WWSA 1Y7BA 5BPIA 3T8RA 1TBXA 2V09A 4CCMA 1JT6A 4JGYC 5LA9A 4XHXA 4K40A 3FHQA 2A6TA 2K9NA 4I0AA 1QY4A 3LEIA 1U78A 4Y26A 3HBLA 2OXBA 4JDMA 4WVMB 2ME0A 3RQIA 1UELB 4XIDA 2D40A 5CADA 3KP3A 3B73A 2CSOA 5ACA3 4UNOA 4L92A 4QGLA 5ACA1 3ZXSA 3VL8A 5LLQA 4BXFA 5GAGJ 5C7GA 1C1LA 1SLCA 1LODA 1OSGA 3OIPA 4P08A 1N1YA 1JZ4A 4W4ZA 1F36A 4N53C 2XPVA 1DDLA 3JAMK 5DUWA 1RB8G 3SKJE 3K4MA 5J96B 4M3CF 1X19A 1U8BA 4YW4A 3OSGA 2WN2A 2ME6A 3MZYA 2AO9A 4HNVA 3U07A 1VQ6I 4A0XA 1CIYA 1Z6RA 3KGZA 4EN0A 3W2AA 1AR62 2WNOA 1AYM1 1APLC 2RVCA 4UFHA 2VVFA 4Q1RA 2WAQA 2ZMEA 4K1YA 1ND2C 4QWNA 2ZGOA 4LE4A 3FHAA 3ZQ7A 4I3PA 3PSIA 4CSWA 1G3TA 2G7UA 1Q8OA 4ATFA 1UHWA 2R7EB 1DF0A 5JSOA 2GNBA 4HAMA 2ZBJA 2HNHA 1W04A 4UY8I 4N53A 1KU7A 2HWB3 5EJCA 4CDXB 4CXFA 2K4BA 2HYFA 3GF2A 1YWKA 5F0FA 1ZYRF 4R9AA 4F3JA 1VRBA 1Y3TA 3LSDA 5JUVA 3OYLA 4X0GA 4L8QA 3SLIA 3WDXA 3H5AA 4NRMA 2CV0A 1DG6A 4AI8A 1HKQA 4NIIA 2D6MA 1ZZ8A 2A5ZA 3QH6A 1I3QJ 1HW5A 2VGDA 4PUSA 4UF0B 1US3A 3WQ1A 4XBLA 3APBA 5JSPA 3VB2A 1ZGAA 5HLHA 1QH6A 3QAHA 4MGKE 1W9YA 1IG3A 3DECA 2R1BA 1BI1A 3FK6A 2V4JC 4XFGA 2VT2A 3SISA 2IWGB 2BE5F 3BUCA 1EJ9A 1K12A 4RQPB 2W94A 2KRCA 1E3HA 3OGRA 2O6GE 3R6SA 2PMZN 2WIIB 3J9SA 2IBDA 1QJU1 3DEMA 4LTAA 4BQ1A 3IH3A 4P02B 3WNLA 3TO7A 1X3ZB 4Q47A 2VXJA 3RI9A 1WLCA 5FFZA 2Y6GA 5C3EJ 3MKYB 3H9QA 3GTMJ 1WFXA 1CF7B 5EZWA 5CFCA 3GLLA 4KI5M 4GMP3 1MJBA 2GU9A 1O7LA 5J8FA 1XNBA 1J1LA 4PI2A 4Q4W2 1L0OC 2X1EA 2WA4A 1PVC2 4FAGA 4GWMA 1AHDP 2Y30A 3ZDVA 4A3CJ 4QM9A 1LHOA 5JFRA 2F4PA 1F9NA 2R93J 4IEUA 4UV8A 1LHNA 3IMMA 5FJ8J 5BOXA 4AGVA 3TMOA 3AJYA 3F6OA 3NNJA 1QA6A 1YCIA 3AMHA 4Q4ZF 1D0YA 3PIPF 1U5TA 1HDDC 4FVVA 5T5LA 1HV1A 4BQOA 3CC2I 3FC0A 4FFGA 5F5AA 5KBFA 2KLOA 2STTA 1YX3A 4EROA 2XJRA 3B9CA 3ZXEA 3NAUA 2XR4A 2GA1A 2IS1A 1D0ZA 3ASNH 4AYUA 2YGMA 4NHMA 4RDUA 1TT5B 4WM8C 4I0BA 5C4JJ 2DI3A 2NYYA 3I97A 4XABA 2Z9OA 2OIIA 3LQCA 1GZWB 3S93A 1R36A 4I2OA 3MUY1 2EFOA 5B4XA 1R092 4Z07A 1XGMA 2B9SA 4CPBA 2D5HA 3THCA 3ACGA 1RUF2 4DMIA 2M87A 2PLV1 1ZELA 4BJ0A 5ICCA 4JTNA 4OAZA 2QQPA 4FPKA 1XGNA 1WZ2A 4CP9A 2LLKA 4KMUX 3ACLA 3E5QA 5FLJA 4ONUA 3BCWA 5H9SA 2D6OX 4IEOA 2W1OA 5I93A 4AXOA 2A6YA 1J75A 2YU2A 3H5RA 4DPNA 3O0XA 3GZ6A 2IA2A 2CV1A 4IGOA 2XOMA 2VECA 4MOAA 1RR8C 1X50A 4BY7J 4YRDA 2HGCA 2Z5WA 2L7FP 2C24A 3LDBA 5HS7A 3PNTA 4AEDA 5BNGA 4G94A 2DJNA 3C2HA 3U0ZA 2KFDA 3BTZA 1S4CA 1AHSA 3GEZA 1YRZA 4OMDA 4JDOA 4OI0A 3OYBA 4EJTA 1J0RA 4BQ3A 2VBXA 2ADEA 3L00A 1JZ2A 3NNLA 4ZTJA 1YS7A 3NKTA 4M72A 3OGVA 2PAMA 1S9HA 3VBHC 2D5VA 2WYFA 2R0FA 1WQ2A 5IVJA 1H89C 2OF7A 2CAVA 2XGDA 5FXVA 3O1MA 3JTHA 4V2GA 4XTPA 3E6MA 2QBYA 1UD1A 2EXJA 1RRJA 4ZXKA 2W24A 1IXCA 1JHNA 4ESJA 1AVBA 2VPVA 4BJ6C 1PNFA 3D5SC 3MIGA 3BZ6A 3ZFFC 1YLLA 4JRLA 1L3JA 4KIGA 5A3MA 1UMQA 2B8MA 3I4PA 4CP2A 5T52A 2K9LA 3DPUA 1FIAA 4KITB 4WXDA 2Z99A 1K5MB 4XXAA 1XNCA 1WJDA 4Q0QA 1NA1A 2D1VA 1WCUA 2DUPA 1PM4A 1X82A 3SQOA 3VBUB 1UY2A 5KHDA 3FHZA 3S5AA 2R7UA 1NUKA 3IDCB 3DBLB 1STZA 1CESA 4CZZA 2CHHA 2FDHA 4QPWA 1D4M2 4KT5C 5FBZA 4CDWC