1O3TA

Protein-dna recognition and dna deformation revealed in crystal structures of cap-dna complexes
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
199
structure length
199
Chain Sequence
b'PTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*CP*GP*AP*AP*AP*AP*AP*TP*GP*CP*GP*AP*T)-3'
publication title Indirect Readout of DNA Sequence at the Primary-kink Site in the CAP-DNA Complex: DNA Binding Specificity Based on Energetics of DNA Kinking
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
total genus 47
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1o3tA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1o3tA01
4I3PA 3BJ6A 1G3WA 2RC4A 2QBYB 3MZHA 1YFYA 3FE5A 1TNSA 4ZYHA 2PBIA 1KA8A 1RTVA 3ZQ7A 4B09A 2JPCA 1IF1A 4AVBA 3E3VA 2XAGA 3FMRA 4G6DA 1KU9A 1YS6A 4M71A 1Z05A 4YFNF 4HMZA 5CADA 1J3QA 3HYIA 4EMSA 3D5LA 3LA3A 2Q30A 3Q9SA 3H7YA 3USSA 2IXKA 2JRTA 4HVQA 5DV5A 3DXJF 4LULA 3L2CA 2YX7A 1CAXB 1HSTA 2GH2A 4L5JA 1BIBA 5LEJA 4XEZA 1FBUA 1LVAA 1F1ZA 3M1EA 1I5ZA 3TO6A 3HTSB 2BYVE 5I91A 3WTZA 4KMFA 1R23A 4AVPA 4CDGA 1RI7A 2M8EA 4EWAA 3T0YA 3TO9A 2HGCA 1YW8A 4HLXA 3WW4A 2D1VA 1Q3EA 1NE4A 2LDUA 5CVVA 2FU4A 1Y0UA 5L3GA 3LQQA 3L7WA 3TOBA 1QBJA 3EBRA 1R1VA 2STWA 1ULYA 2A5YB 5FLIA 4I7HA 5HLGA 3H92A 1CX4A 2L01A 3SZPA 3IC7A 2OA4A 4ON0A 1SFUA 4XRFA 4GULA 1DZTA 1XDUA 4I98B 3CTAA 4LLLA 1XMAA 4HA8A 1LR5A 5I0TA 2L3DA 2VXZA 3P9CA 1VTNC 2PHLA 3WODF 2W24A 3EDPA 2DTRA 4AIJA 2FEZA 4BQAA 1FC3A 1EPZA 4JVAA 2HR3A 1J58A 3J7AO 3N97A 2PQQA 4MV2A 1XGSA 4BHBA 2UY8A 3KE2A 3FMSA 2A6EF 5HLIA 1PDNC 2XAQA 1OD5A 2OAZA 3RKYA 4BIFA 1IXSB 3M8EA 3KLOA 4XFAA 3GZ5A 3U1DA 5BS6A 1L3JA 1T38A 1B59A 4WCGA 3WTXC 5FQ0B 2IT0A 4RB1A 2K02A 3KEQA 1CAWA 1I27A 3K1NA 2O6GE 1EY2A 3REOA 2BNNA 4XFBA 4MTEA 2XROA 1U5TC 1VJ2A 2YSRA 4QWQA 1TBXA 1USTA 1PP7U 4YFKF 3E5UA 1YO5C 1FLIA 4RAZA 5F64A 1X7NA 5KHIA 4HZFA 4X6QB 2CW0F 3V7RA 4G94A 5DD8A 1HBXG 2HTSA 3GFJA 1LB2A 1FP1D 2IA1A 2WV0A 4L9VA 2LNBA 4PGHA 4ZZLA 3FZ3A 2XIGA 2ATFA 2G7UA 2KIUA 2H27A 3SXYA 3CJXA 2MD5A 2BEOA 1RZ4A 4P9GA 2RDPA 3S7EA 5LGTA 1OR7A 1IXCA 2ZJ2A 5EZWA 1Z7UA 2HKXA 2BV6A 1T6SA 4UXAA 4Q0PA 5HS9A 1CAVB 3LWFA 1FOKA 3W6JB 3H1WA 1O7FA 4KMUX 1FXZA 2UY9A 4LGWA 3GUDA 4QGLA 2XV4S 4U0YA 2VT3A 1JHHA 2F5CA 1R00A 3HRMA 2XUBA 3I54A 2GC1A 3F72A 1O3RA 2QLZA 3GYDA 3V7SA 3TDUC 4ZYEA 2GC0A 4E70A 4XFCA 4QLCU 2NNNA 3K69A 4HF0A 1RNLA 4WXHA 5BV6A 2IXIA 1B9MA 2O1QA 1FSEA 4OIPF 3O14A 3K2ZA 4WF2A 4EM2A 1B6AA 3EYIA 1I6XA 5ILUA 2X0LA 2BNOA 4EVIA 2UXNA 2QVOA 2IXJA 1FYKA 5D4RA 3KEOA 2QZ8A 1SD5A 2GZWA 2HQRA 3T5XA 1ZZBA 4XSZF 1D5VA 1O5UA 3R0JA 1WWXA 4A5MA 4HV5A 5DUKA 2FMLA 4XFGA 3KGLA 5I0UA 2R7FA 3F6OA 4BH9A 3ACLA 2GA1A 3U9GA 5JHUA 1MDMB 3ELNA 1O57A 4AWXB 3IWZA 2O0YA 3K1PA 3GZ6A 1TW3A 4KU7A 3TNQA 1LDJA 4HAMA 2V09A 5CYVA 1XGOA 5BPXA 4F7ZA 3I0TA 3S0MA 4FAHA 2GU9A 5D6FA 5HI0A 4BHCA 1EYBA 3CF6E 2OZUA 4IEPA 4NVPA 4KWJA 3SMHA 1REPC 5FLJA 3VFZA 2EFQA 2K86A 4MTDA 2RN7A 1STZA 5JR7B 1FI2A 1U2WA 3IBMA 2FOKA 4QGMA 1XGMA 2M5WA 2EA4A 4LUKA 1KQ0A 1O7LA 2IJLA 4X6RB 3HRUA 3OOPA 1L3LA 1Z6RA 4EGZA 1Q1HA 2ZO4A 3DPTA 3GFMA 4UVAA 3V8KA 3SFZA 5HS7A 4J1XA 4META 2FNAA 2DU9A 3CUQB 2DQLA 4RGRA 2EJRA 4CHUA 2PAKA 2VT2A 2RVCA 1ZGAA 2ET1A 1BJAA 3IKVA 2UYBA 1D8JA 5K5OA 4RS8A 2HYGD 2HQNA 1RC6A 3Q5FA 4PZJA 2ESNA 1BIAA 2ZNZA 3QP5A 3I53A 4BXUA 1J3RA 5DCMA 1WRJA 1XSDA 1U12A 3AAFA 1XSXA 3HTUA 2Q1ZB 3BCWA 3NKTA 1HQCA 1BM9A 2HDCA 5FDBA 4OINF 2M30A 4MGZE 2EV5A 2GC3A 2LKPA 4K2EA 2XRNA 2RKHA 1YW9A 2L4MA 3GXOA 2ETHA 5FD6A 4ETSA 2E9QA 1GVJA 1W7PA 4O9EA 4O5VA 2PJPA 4MH0E 4RD7A 5FGMA 3ZP5A 1GXPA 5D5VB 1XN7A 1ZARA 1YS7A 2PFWA 1R1TA 1DGRA 2PTMA 1ON2A 1R5HA 4IVNA 1LKNA 5D4SA 3GW2A 3PNAA 4KDPA 4R52A 4KUMA 1J1LA 1TNTA 1KQ8A 2LF8A 1XSVA 5A2QK 3QPHA 3F8CA 1BBYA 5K1YA 4ZYGA 1EH6A 5JSOA 3DF8A 2L02A 1J75A 3DL3A 2GQQA 4S05A 4MHGA 2QVSB 2UWMA 1HKSA 5HDNA 4HLYA 2ZKLA 5IT3A 3G7DA 1OYWA 1UD1A 1HW1A 2XLAA 1X8MA 1SFNA 1BI3A 2H6CA 4XF3A 4U7DA 1ZG3A 1H0MA 4F8AA 3G3ZA 4MEYF 5J48A 2ET7A 2F5DA 2ZKZA 1VP6A 3BPVA 3BOQA 5ILVA 1LRHA 5E1XA 1MZBA 1X3UA 3R61A 4AIHA 4HN1A 2VECA 2HJIA 1OYIA 4LJZF 5HDKA 3WE3A 2PI0A 3COAC 4XFHA 1S29A 1XD7A 3H8UA 3E97A 2CAVA 4TLFA 3ZMVA 4IF4A 1FY7A 4UHTA 2F5EA 3JSPA 3QU3A 3HHGA 1YFXA 3ISPA 3PFIA 3V8JA 3OTFA 3V4GA 4CYDA 1QGPA 1G6NA 5IT9Z 2P8TA 4BYYA 4MX3A 4L9JA 3LA2A 3NEUA 4R1HA 3FM5A 3UKVA 3IWFA 3SCGA 4XFFA 3BALA 2V6CA 3IIAA 2QUFA 2STTA 5J8CA 4AD9A 2B9UA 3VEPA 1CF7A 3FMQA 4LG0B 1CF7B 4DQ2A 3HUGA 2ZBKA 2Y75A 5H20A 4O6JA 4J1WA 3L09A 2GA2A 3I71A 3DEUA 3ERED 3KSCA 4HX4A 3CLPA 4HSLA 4XLPF 4OFGA 2CSOA 1DPUA 5HS8A 3RIRA 5ERIA 3RKXA 1FZPB 4KWLA 5LLQA 3FX3A 3WW3A 4JTNA 5ILSA 1YYVA 1SMYF 4B8XA 2BNMA 2XAHA 4L0YB 2W25A 4OMZA 1WGPA 4XF1A 3KZYA 4ASNA 4N9IA 1S7AA 1QQIA 4IXAA 5DDGA 1Z1DA 5BPIA 2IXCA 2QBYA 1P4WA 3WTWC 1IW7F 4Q48A 2R3SA 1AWCA 2XASA 1P4AA 1DPRA 4L2NA 3DPLC 2XHKA 4KN7X 1F9NA 2DI3A 1QPMA 1R58A 2WTEA 5FPZA 1QXRA 3D0SA 3EJKA 4IEUA 4RB0A 3U0ZA 2DT5A 4RAYA 3RYRA 1PM7A 3C3WA 3HHHA 2Z33A 1E2XA 1R5GA 4XLNF 2BBYA 2Z2SB 3VHRA 2FRHA 1J2XA 1RIOH 2MNGA 2OYZA 3ZMUA 1Z6TA 4UV9A 3CJNA 3MDPA 4QM8A 4WXCA 1CAXA 3EYYA 2IW5A 4A5NA 2NAZA 4L5IA 1UCRA 4H0EA 1QNTA 1FBQA 5KHKA 3WE2A 3CDHA 4HDUA 3JW4A 5ED4A 4L9NA 5AVPA 2EV6A 4KWKA 4UVCA 2E7XA 5E20A 5D5UB 1YQAA 2Q4SA 1SMTA 4HYEA 2FQPA 1FWZA 2XLGA 2P7CB 1A04A 1ZG1A 3BJOA 1K78B 4AVAA 1ZGJA 5FFXA 3B73A 5JSRA 2JZYA 5LHGA 4HOBA 2PAEA 4G7ZF 1XCVA 2O3FA 1D8KA 1BOAA 2IXHA 5CVRA 3GFIA 2FA5A 3E6BA 3CO7C 4UV8A 2C0ZA 4BHPA 3OV8A 3TO7A 3ABUA 1R7JA 1MGTA 5CVUA 2MC3A 4OOIA 1IN5A 4PCQA 4ZH4F 1Z91A 3FXQA 2HZTA 2ZNYA 4FAGA 3WTUC 2N7GA 4A6EA 2O03A 3U10A 3PQJA 2MH9A 2QQBA 5FD5A 4PGGA 3JTGA 4PJYA 5BQTA 1ZHFA 3LQRA 4IEZA 2C6YA 1HXDA 2A69F 4FHTA 2ZCWA 4OLLA 1H1MA 4NB5A 1GXQA 3H1YA 3ZN1A 4KYWA 2KIFA 2LSOA 5L3BA 2EFWA 4A0ZA 3JAMZ 5FQ0A 2VC1A 2K9ZA 3GLXA 3HRTA 3DQVC 4IRGA 4GGGA 5JVTA 3SXWA 1TW2A 1O3TA 3F6VA 2ZMEB 3QACA 4LB5A 3IL2A 4YYOA 1B4AA 3H7JA 2J5PA 5EFUA 1G3SA 2QNKA 4QXKA 2PEXA 3ZN0A 5I8SA 5BOXA 2E1NA 1FX7A 1KU7A 2OQRA 1PUEE 2V1XA 2YR2A 4BAYA 5L3CA 5TRDA 1WI9A 4Q0UA 5BY5A 3HT2A 2JTVA 3FWEA 3BPXA 1I1GA 1TQPA 2P5VA 4YIFA 3MAJA 2FBKA 1FT9A 2FBIA 3I59B 5EEHA 4E2QA 4RGUA 1CAVA 1LEBA 2HOEA 4L9TA 4CGZA 4FX0A 3WTYC 1O3QA 1SD6A 4CICA 2RGVA 2QCSB 4WK8F 4ONUA 3R60A 4U0VA 1UIJA 1QZZA 4LK1F 2QDRA 3E5XA 1WSUA 3RZZA 4I02A 2GIVA 4YFXF 3ZDSA 2DFIA 4QX5A 5L3FA 4GCVA 1YFUA 2NYXA 2DQRA 1YIOA 1XDSA 2K27A 2WWYA 2P4WA 1YFHA 4KFCA 5KK1A 4MGYE 4P9UA 2IVMA 4HBLA 1BC8C 2ELHA 3ST7A 4WVZA 1QXJA 3PVBB 1O3SA 1V3FA 3RYPA 3HRSA 2W84A 4GXOA 1TTYA 2MLKA 1XGNA 4NQWA 4P96A 5HLHA 4EM0B 3BWGA 1MDMA 3E5QA 4ENKA 1BI2A 1NHAA 3BDDA 3T1BA 2P17A 2PA7A 4R8HA 4P9FA 2VPVA 3QPTA 5JFRA 6PAXA 4D0PA 4IRIA 2XAFA 2DAOA 1LDDA 2Q8KA 2TDXA 4PIZA 2VQAA 2GXGA 1BI0A 4MGKE 3KGZA 2P5LC 1YHFA 3ECHA 1SD7A 1DZRA 5JCTA 3E6MA 4DINB 1PMIA 3GWZA 2I45A 4ZU4A 1IPJA 1IPKA 1J7KA 4M6YA 4LLOA 5DD4A 3WW2A 1ZREA 1FSHA 1T0FA 3HSEA 3M9AA 1C0WA 2B8MA 3CUQA 3C7JA 3FJSA 4HDVA 3I64A 3B02A 3K9TA 3EHKA 4WBBA 1F4KA 3MZYA 2XVCA 4WZCA 2Y48A 1W7PD 5C8WA 3WTSC 3H3UA 2DBBA 2EV0A 3DKWA 2MLGA 2VE8A 4BNCA 1Y3TA 2O61A 1UB9A 4MUVA 1J9IA 3D82A 5IT9K 3NSTA 1LEAA 2UZKA 3CUOA 4EJWA 2MBFA 1YWKA 5AIQA 4A12A 4Q0VA 1Q43A 1JUHA 2V1UA 3WU0A 1GQHA 1U8RA 3CL1A 4EROA 1IRGA 1ON1A 1Q5OA 1SFXA 3LAPA 5LHHA 4WWCA 3TQNA 4HF1A 3UKTA 5EEGA 5DUIA 2VBZA 4EV0A 2IXLA 5J8FA 1TQIA 4DNCA 2H09A 4Y17A 2VE9A 5D5XB 3FHIB 3FXRA 3LFKA 2EWNA 4IERA 3J81Z 3VOEA 5F6FA 2EFPA 3KCCA 1FBSA 4ENMA 2PHDA 3QU6A 3HSFA 4Q4ZF 3SHFA 3QAHA 2FNPA 1WA4A 5FCCA 3HIFA 2H6BA 1IN8A 3FM3A 4IEOA 2EFOA 4P55A 1FNNA 3KP3A 3RKWA 1DP7P 2FQ3A 4LLGF 2WC2A 2W57A 4LTAA 4AQ6A 1IXRC 5FLXZ 2K4JA 5DCFA 1J3PA 3BY6A 5D5WB 2XL9A 4KIBA 4IPAA 5E8IA 3VODA 2D40A 3G73A 3C1DA 1S6LA 3LWCA 1L0OC 1MJBA 4G7HF 2CAUA 1OPCA 2EAAA 2RNJA 1Y9QA 5K8SA 2G9WA 4KL1A 3C3VA 1GHCA 2PMUA 1ZRRA 2PFBA 4E2SA 1ZH5A 4UBHA 4MGRA 5JAXA 1FP2A 2CO5A 4LLNA 2V9VA 3I58A 1RL3A 1BN5A 5LGUA 3RPQA 4FBFA 2HKOA 2P6SA 4PIXA 4LK0F 4QM9A 3WU1B 4H7LA 1KYZA 3P9IA 3RYKA 3M8FA 2QQ9A 4YRDA 3KFWX 2MH2A 5D6EA 1UIKA 1XB4A 4HQMA 3LA7A 4IJAA 5H6RA 4OIOF 2X4HA 1J5YA 2Y0MA 5F1RA 1U5TB 4UXNA 4ZYDA 1YUDA 2KJCA 4XF0A 4AQ2A 4IHTA 2DO7A 2A68F 4U7BA 5E16A 4MNUA 1G3TA 1S3JA 4GYGA 4B29A 5D8LB 1NYWA 2DK5A 2J5OA 1H9TA 1B9NA 2JPBA 3OF1A 3M7GA 2YX4A 2Q0OA 4LG0A 1O4TA 3RPUA 2KXLA 3HOSA 3NJZA 1E17A 2Z9OA 2IC1A 2XAJA 4IHSA 4KNYA 3KMHA 2GXBA 5I93A 1G3YA 5ICFA 3WG9A 3N4MA 4PDKA 2QENA 2D5FA 4IEXA 1H9GA 2GWRA 5AIPA 5D8KB 4MZUA 4EQQA 2FXAA 4CO8A 3ML6A 3R4KA 4FT8A 3MQ0A 2P5KA 3JZVA 3LZZA 1G4DA 3LSTA 2DPUA 1BC7C 2D93A 5KHJA 1O5LA 1JHFA 4TV7A 4RB3C 2W85A 1USSA 5J3UA 4RB2C 1UHMA 2QWWA 3IRQA 3KETA 2KJBA 3JAMK 1YLLA 2D2WA 2OZ6A 2DK8A 4EWDA 3OGJA 2GAUA 1IN6A 5ICGA 1QWRA 2OA2A 3VB2A 2VC0A 4GYIA 2KKOA 4Q29A 2UYAA 3M3IA 4XF9A 1KU3A 2CYYA 4U88A 5CVIA 1J59A 4LMYA 2H94A 2XKOA 3ZMTA 1CAUA 4LD5A 3ROUA 4N0BA 1CAUB 4JK1X 2P6TA 4LUMA 1J0RA 3TKYA 1YW7A 1ZRCA 3LOIA 1TLHB 2EFNA 3CUQC 3R0AA 1EH7A 1ZVFA 1W4MA 4Y15A 5FPXA 3NW4A 1UCXA 4IRHA 1R36A 4GO1A 1XE8A 1B1BA 2BE5F 3GVAA 1WLTA 3T8TA 4M72A 2RQPA 5E8GA 5FFZA 2FMYA 4HSJA 2EK5A 3DV8A 3L2HA 5ICCA 3CO2A 1F5TA 4UVBA 1K78A 3ETQA 3F23A 4ORFA 4M9SA 3WGIA 2PLYA 2A3SA 4XETA 2QYOA 2OQGA 3J80Z 1OKRA 3JTHA 2RV8A 1NE6A 4YG2F 4ZU5A 5TJJA 2VONA 2QJVA 1MD0A 1P2FA 2ZXJA 5E1ZB 3MEXA 3QOPA 1RGSA 4QGNA 2ETEA 4IEQA 3CO6C 2KIMA 3RDIA 2Z69A 1UW8A 3UKNA 5I8YA 3GBFA 2E1CA 3HOTA 2IRFG 4A2UA 3BU7A 2L54A 4JBAA 3SCFA 3SHRA 5CVJA 3S2WA 2AS5F 4HLTA 1UFMA 3MCZA 4IEYA 3KP4A 1WQ2A 2K4BA 1KGSA 1ZX5A 4HV6A 1IUYA 3V7CA 1XCBA 1HW2A 4UBGA 5E1RA 1ZLJA 5L3DA 4KN4X 1U6GA 4M6XA 3WGGA 3I4PA 3H9AA 3LAGA 3ZMDA 4L18B 3MPBA 1EP0A 4AIKA 5KHGA 1IN7A 5LGNA 2WFPA 1KU2A 1NZCA 5LHIA 4P5OA 1SFEA 3PQKA 4AXOA 3GFLA 3KP7A 4A0YA 2CWEA 4OMYA 4YSFA 2K0GA 4M9ZA 3BJAA 3E6CC 2ZMEA 3HQXA 3U11A 1U78A 3ELKA 3F8MA 3GX4X 4IETA 2FE3A 3HSRA 4G8XA 2VBWA 5K5RA 3WTVC 1D3YA 4CXFA 1JGSA 3O6BB 3EQLF 2VN2A 4ZZDA 1I1SA 2M1BA 1HKQA 1CAWB 5HOOA 4OIRF 3IDCB 4A0XA 2XGXA 2JSCA 5BMZA 3BP8A 2GC2A 1SAXA 2ACJA 2QM3A 1EV7A 1QO0D 4Y13A 4KIGA 3F21A 4ZU7A 3EQEA 2EA2A 3I59A 2HYFA 1ONVA 1VR3A 1RUOA 2CGPA 4HBNA 2OPKA 4I0AA 4I09A 5L3EA 5LRSA 3MYXA 3CLOA 4WX9A 2F5FA 1P92A 5BPDA 2M45A 2IP2A 4XF4A 3TNPB 2OZJA 2JT1A 5JSPA 4KIFA 4M9XA 5E17F 3IKTA 4EWEA 3U2RA 1Z9CA 1X82A 3H50A 2HS5A 3FXUA 3ABTA 2F2EA 5E1WA 5CU1A 3RTRA 3OD0A 4O3MA 2D1HA 3WW1A 2MHFA 3T8RA 4HX7A 2R7DA 2VOOA 5AONA 4EJUA 1ZN2A 4Q5SF 4LA3A 3ZMSA 2E7WA 3KP6A 3J81K 4IEWA 4Q0QA 4XBFA 1T2KA 2Z3YA 1ODDA 4ESBA 2F4PA 4E2GA 1KQ9A 4ENJA 2VBXA 1YTYA 5ICEA 2Q2EA 1QY4A 5K5QA 2BGCA 5T3NA 3DN7A 2K7LA 5KBFA 3CEWA 2ESHA 5LEKA 3TGNA 1ZG5A 4I2OA 1LDKB 4UUVA 2V1DA 5FLXK 3IDBB 2PMHA 4RGXA 4Z82A 5D1IA 3GF2A 3C18A 1JXSA 4L0ZB 4MQVA 4FX4A 4LFUA 1OYYA 1MJ9A 5LRRA 2DW4A 5E18F 2B5HA 2HWVA 4N9HA 4U0WA 3P7NA 1PP8F 3NQOA 3ULQB 1R1UA 1V70A 1JE8A 5I8TA 1RUNA 3EUHA 2P7VB 3IRRA 3QRFF 3V8LA 5FO5A 1HKTA 1K7AA 4JV4A 1FPQA 2OBPA 3PLQA 5FLHA 4D7TA 1XMKA 1UHWA 3OCPA 4KA4A 3M70A 3ES4A 1HSJA 3RI4A 2A07F 4O9GA 4HVRA 2VBYA 4OU0A 4I0BA 3GO5A 1NXMA 3S7IA 1R22A 2M87A 1ZRFA 4KICA 3WGHA 3L00A 4I01A 1ZZCA 1SQ4A 1DDNA 5CLSA 1ZLKA 1FYLA 4ESFA 3SZTA 4IESA 4WXDA 1S7OA 4Z2YA 4XFIA 3F22A 4JQFA 4S04A 1U3EM 1LJ9A 3F3XA 3JSOA 3L9FA 3W6KB 4NHJA 2EB7A 4XSXF 3DP7A 3RNSA 3RJPA 2DPDA 4A6DA 2XKPA 1K79A 3K0LA 4G9YA 3K1MA 2DLLA 3FF5A 1OI6A 3MWMA 4M74A 1T98A 2G7HA 1ZNPA 1W5SA 3TOAA 3IHUA 4RGSA 4HQEA 4JTOA 5I0RA 3NVCA 3BB6A 2IPQX 3EO6A 1CGPA 5DCMB 1HW5A 2PAMA 1YFWA 2DCTA 2OU2A 2HEOA 3H3ZA 3BZ6A 2D5HA 2Q0AA 4Q0SA 5JR3A 1AOYA 3P9KA 1TQMA 2NNYA 1XE7A 3F8NA 1OMIA 5FB2A 1GQGA 4YIIA 3ZPLA 1W7PB 3D0JA 3BROA 2YPRA 1IAWA 3I7DA 3NL1A 2CQKA 3ES1A 4PIYA 3H1MA 2O8XA 4LB6B 4K8FA 4EJOA 5KHHA 3ZMZA 1W5TA 2ISYA 1XRUA 1LQ1A 1T39A 1ZZ6A 1SD4A 2L4AA 1S8NA 5DYMA 1ZAOA 3FZVA 3FHZA 4LA2A 4KU8A 2AXLA 2O8QA 1V4RA 2UXXA 4LEJA 4AVCA 4ESJA 3EETA 4EM1A 4MEXF 2CG4A 5BUVA 2Z99A 3HT1A 2CFXA 1QZYA 1BI1A 4R79A 2PQ8A 3DFGA 3BPZA 1UPIA 1U5TA 3MFKA 2PG4A 4EJTA 4EGYA 3LAJA 2COMA 1YG2A 1FYMA 4HN0A 2LF7A 4YARA 2A6HF 5KVRA 3KP5A 1SEFA 3J80K 4HX8A 3GYHX 1ZZ7A 1WKMA 2Z5UA 1ZYRF 4QMAA 4IEVA 2D45A 2YU3A 3KP2A 3R6SA 2IA0A 2PN6A 2CV6A 3ECOA 4M73A 4HVOA 2XL7A 2Y0OA 2FBHA 5CJ9A 5H6QA 4Q47A 2MPFA 2NRAC 2IA2A 3SQNA 2MA3A 3F8FA 2VODA 2KRFA 3SCHA 3E6DA 1YLFA 1MJAA 3QP6A 1ZRDA 5DEQA 2OD5A 5JI6A 1IZ1A 4D7SA 4HF2A 1KYWA 4YNIA 2FF4A 2FSWA 5BXXA 2A61A 4HW0A 3NRVA 4UNOA 2H0VA 1P4XA 2QQAA 2V79A 1IRFA 4CZZA 1X8EA 4Z07A 2EA7A 1P6RA 1K6OA 4G6QA 3WTTC 3Q9VA 3TDZC 4KT5C 3GEZA 1ZZ8A 5HVQC 3O2PE 4MQ9F 3FFQA 4EJVA 2HTJA 2EVXA 5I0SA 1TQ5A 1IN4A 1H1IA 5HDGA 2XLFA 5J6XA 1LNWA 2ZFWA 2VOPA 4ENNA 1DGWA 4L11A 2NS0A 4OIQF 1MKMA 4MGIE 5C6CA 5J7MA 2ADUA 2B0LA 3KZZA 1EH8A 5LBQA 1ZZ9A 3I5UA 3KLNA 3O3KA 1DUXC 2PYTA 2ISZA 5A2QZ 3F8BA 1OFNA 2HFHA 4G7OF
chains in the Genus database with same CATH superfamily
1HB4A 3AZYA 1IQDC 2M0MA 1KA8A 1UOJA 2LY9A 2P3IA 1IF1A 4AVBA 3E3VA 2IEKA 1DYPA 1SBFA 2AGSA 1Z05A 1UY3A 4HMZA 1GKBA 4HK8A 3D5LA 1RKWA 3Q9SA 1W36C 4PHZA 1G9AA 3W5NA 2IXKA 2A6TA 4CTEA 3S1QJ 3AG2H 4ZJZA 2DVBA 2NXNB 1XNAA 4LULA 2XOMA 3J7LA 1OQEA 3VGIA 2JG9A 2GH2A 2GP3A 3K46A 2I07B 2OPTA 3A0KA 1VBD1 4XHXA 2HYKA 1LVAA 3RS6A 3M1EA 3N36A 2ZA9A 3HTSB 5FPLA 1K6YA 1PO23 4EN0A 1JJ8C 4NIIA 1JZ2A 3BG5A 2XXZA 4CDGA 1RI7A 4XONA 2XWBB 4RAGA 5IVVA 3WW4A 1M4WA 1LAJA 5CIRA 1PZ9A 5GZCA 2FU4A 4AEKA 5K7FA 4FFHA 2ZB9A 1S0IA 2XGCA 1ULYA 2A5YB 3MHZA 1X33A 3U4SA 3H92A 5DM7F 1S0BA 2XHNA 3IC7A 2OA4A 3DBLB 1SFUA 4XRFA 2IS6A 5DABA 4GULA 2OCEA 5JIUA 3W6VA 1XDUA 5A32B 1REEA 1R082 2Z16A 2PHRA 3CTAA 4LLLA 4P9YA 2B39A 5FKCA 4B1RA 4BQNA 1LR5A 3WODF 3EDPA 2R0FA 3WNPA 4KITB 4AIJA 2WO7A 2A3WA 5AC91 3HQUA 4MOAA 2VCAA 3N97A 1MMDA 4DS0A 3KE2A 3THCA 1PDNC 1XPWA 1GR3A 5DXDA 1E3OC 3I2JA 1AR91 1Z3XA 2JWTA 3PSIA 1U5IA 1UMIA 1QJY1 5BS6A 3CJQB 3WTXC 2IT0A 5FPVA 3T1MA 2K02A 3KEQA 5FXWA 5FRNA 2O6GE 1EY2A 2BNNA 1RUG2 5FYVA 4A93J 3M2MA 3I3QA 1PP7U 4O7XA 3IPVB 4NIDA 4YFKF 5E6HA 1I9RA 1JYXA 2X48A 1CPMA 4C30A 1X7NA 2EXIA 1UX7A 4NIGA 2CW0F 5IW0A 5FLMJ 1HBXG 3CZJA 1CZVA 5CB7A 4QX8A 2WV0A 3OBZA 1XPXA 4PK4A 3LEKA 1HIXA 3NJYA 2G7UA 3NV2A 4X8PA 1ND3B 4CCKA 2BEOA 4A3CJ 1W03A 2L9RA 1RZ4A 2TBVA 3RJRA 2OX0A 2CTVA 3S7EA 3ZRGA 3BPSA 3LCPA 4WM7C 5EZWA 5A70A 2BVBA 3VBSB 1T6SA 1W99A 1CAVB 3LWFA 2V72A 4LHLA 3AC0A 3J7AY 1K83J 2HI3A 3LSRA 1KXGA 3OL4A 3GUDA 1AX0A 3OIPA 2VT3A 2F5CA 1R00A 2XUBA 5A1LA 1O3RA 3OEBA 4XAEA 2EIEA 4XCBA 1T33A 2BOJA 2GC0A 3UESA 4C0HA 2E71A 2J1AA 5KC5A 4PJ0C 2R7TA 1LOFA 1B9MA 2O1QA 3PUAA 2R072 5EJZB 1AHDP 3EYIA 1WZXA 1I6XA 2CL2A 5FO7B 1TWCJ 2IXJA 2WV1A 1FYKA 2JE9A 1D2SA 2L9NA 3B00A 2OC6A 2HQRA 3WNXA 1O5UA 1O8PA 3R0JA 2TUNA 1WWXA 2FMLA 3LNQA 1Q8OA 5FAXA 4YG6A 3DEEA 4RQPA 1NCRC 5JHUA 2HDDA 2WKKA 4K21A 1AR71 3K1PA 1ZTRA 1F35A 3TNQA 1DP3A 5JVGF 5BPXA 2DCZA 3A22A 5TSWA 1D1BA 4F7ZA 3S0MA 2GU9A 1EYBA 1XTAA 3ZMOA 1UY0A 2VNRA 2OZUA 1QJU3 1XNCA 5FLJA 2LVSA 3AKQA 2VBBA 3VFZA 4D6SA 1EF4A 5M5WJ 4UY8I 1OFSA 2P3JA 2C9AA 3U78A 2HU9A 4QGMA 2DMPA 4IV3C 2M5WA 1KQ0A 2JG8B 4UFKA 5F37A 1Q1HA 1PO12 3POEA 4J1XA 2FNAA 4BBRJ 4CEYA 4ZYAA 1GNZA 3OD4A 2DQLA 4IQJA 4FI9A 1ZGAA 5FJHA 2K3PA 1IRZA 1D8JA 1VRBA 3KHCA 4XIOA 2AHQA 3MPPG 4K3UA 5L9VA 3SH5A 2Y34A 4PZJA 2ESNA 1OLTA 3ZXSA 3VBRA 2EIBA 1POGA 4BXUA 1VQ7I 2PMWB 4P9IA 4MXWB 3EUKL 1I3AA 2EZKA 3FHNA 3TBDA 1WBFA 1IJWC 2ZX4A 1U12A 3AAFA 2ZKNA 3HTUA 3NKTA 4QPGA 2GC3A 5KR7A 1AL23 2RKHA 1Z78A 2Y30A 2W0XA 3DCQA 3K75B 2QSHX 5FD6A 1GDTA 3LQCA 5TGTA 5ISLA 3K4NA 4O5VA 1H8TA 1LVKA 4QHOA 4RA2A 4CPBD 5D5VB 1XN7A 1PVXA 2PFWA 1R1TA 2PTMA 2JWPA 3BG9A 1P8JA 3OS1A 4FCYA 1XYOA 4RAFA 4QPIC 1F15A 3U75A 2LF8A 3FXJA 1I5PA 2DA4A 2E31A 5M3FJ 1BW6A 1EH6A 3DL3A 2NVYJ 3NWTA 2W1QA 3GZUC 3OBTA 1E5IA 4XE9A 3M3YJ 3G7DA 3W2VA 3INAA 1HW1A 2XLAA 4CDXA 3LSKA 2BGOA 1BI3A 4M0HA 3L1PA 3NNJA 1DQ6A 4F8AA 4MEYF 2YU1A 2F5DA 2ZKZA 1KGYA 2XDVA 1W2NA 2OIIA 3BOQA 2VY0A 1LRHA 2OQ6A 2HWB1 3E7LA 1V5GA 4AIHA 2CDPA 2HJIA 5FKMA 2ME6A 4YZ4A 1Y7BA 4XFHA 1S29A 1XD7A 5HCAA 2WFF3 1BR2A 3HXLA 4JGZC 1FY7A 4UHTA 3CCSI 3ISPA 5JVVA 3M8JA 4OCTA 2R063 3IDAA 5FKLA 1G6NA 4CCNA 4HL0A 4HPQA 4N4OB 3MV01 4FTBA 3PMSA 3KZ4C 2V6CA 2C9KA 1NA1B 4LBNA 5J8CA 2R49A 3I3BA 3FMQA 3A01A 3BQZA 2HWD3 3I2HA 4GWJA 4M6VA 3T4VA 5H20A 2VCMA 2AEZA 3HUGB 3RZDJ 5EIYB 3KSCA 2OJED 2C1FA 4HSLA 4XLPF 2ZTNA 5FMBA 3POFA 4OFGA 5ERLA 5J1UA 2ZHMA 2C4XA 1WW6A 4RS5A 1FZPB 3G1OA 3FX3A 3O7OA 2D7FA 3WW3A 4C3JJ 3WHUA 5IP9J 2EXHA 1SMYF 2XAHA 3KZYA 1JYVA 4DXSA 3ZFFC 5DDGA 2WZR1 3H35A 2B7YA 5GZGA 1Z1DA 2VOKA 4ZC3A 1WMEA 4W97A 1KFUL 5CA6A 1JT6A 3MLKA 5M3MJ 5FP3A 4L2NA 4KN7X 3MIEA 4RSUA 5B66C 4IEUA 3U0ZA 3USUB 3G1LA 3M1CA 1VAKA 1W0OA 3HHHA 2Z33A 1PIV3 4XLNF 1QU3A 2WS92 3JXSA 1Z6TA 3CJIB 3CJNA 2WBMA 5T55A 3MKYB 4XMAA 4QM8A 5FYHA 1R4MB 4A5NA 1EV13 4LMFA 1IV8A 3IMNA 1UKRA 3JW4A 4L9NA 1V6KA 4CXXA 2E7XA 5E20A 2ADDA 4E27A 2GALA 1SMTA 2FQPA 1XG1A 5L7OC 1ZG1A 1VRH3 3C2GA 1ND2A 3U14A 2X6WA 2BOLA 2YZ4A 1VIWB 2RAEA 4AVAA 1MZ6A 1ZGJA 4GRIA 1T08B 5JSRA 1LEDA 4PLMA 2PAEA 2DJIA 2O3FA 4L5EA 5BNOB 2LOOA 2IXHA 5CVRA 3SEPA 2FA5A 5FP7A 4ARXA 3T0BA 4E4HA 3GTPJ 3PIJA 5FKBA 3V56A 4IHYA 2K9QA 2HXOA 4M3BA 1RVF1 4D6QA 2HZDA 2MC3A 2YROA 4CE8A 1J83A 1ZBA3 1DFQA 2P2KA 2RS33 2XPVA 4NWVA 3I4MJ 2O03A 5FXXA 4OAYA 3U10A 2E7AA 3JTGA 1WMXA 4P9JA 5BQTA 3MLLA 5AFEA 2Q5TA 4OLLA 1HRV1 1CR7A 3ZYJB 5A3TA 1GXQA 1JKRC 2KIFA 2P0WA 2CWSA 4YZ5A 2KD7A 1VBE1 4A0ZA 4OQ8A 2ZEXA 2DA5A 2NS8A 3VLBB 3SXWA 3H0GJ 5LW9A 1O3TA 2VOVA 3WNNA 2YGLA 2ZMEB 3O8HA 4PFPA 1FAYA 4CP2A 3QACA 3L2WA 1GZTA 1VQPI 1B4AA 3R4UA 3H7JA 1H0BA 3H5RA 2VMDA 1OA2A 3WOGA 1UMQA 2ID4A 4HPKB 5JHFA 3KWVA 2WNVC 4V1PA 3VWBA 1G9BA 2RJLA 5TRDA 3DKQA 2V7FA 1B35A 3OJBA 2FMDA 2JTVA 3FWEA 1TQPA 2P5VA 4YIFA 3MAJA 2FBIA 3I59B 5EEHA 3VBHC 5F3EA 1O3QA 1D1CA 3ASIA 1Q8QA 2QCSB 4B4RA 2VUCA 4IE0A 4QT6A 3N35A 3HOXJ 1QZZA 5K0UB 1H88C 4M3CE 1D0ZA 1PO21 2QDRA 2QZ2A 5GM0A 3ZSMA 1DHKB 4I02A 3RZZA 4YFXF 4H55A 4PJNA 3ZDSA 2CJJA 4M3CA 2GH8A 1XDSA 2P4WA 3KX2A 4KFCA 2WB1A 2VBDA 3A02A 4P9UA 1RUH3 2UV1A 4HBLA 4CP9A 4WVZA 3VBUC 3ZKYA 1KQRA 1NCQB 3TRSB 4Y52J 3HRSA 4XJWA 3Q0WA 2JA7J 3PNVA 3OWTA 1A36A 5BNPA 2YDEA 5HLHA 4NQWA 1W36D 3BWGA 4Y20A 4ZS3A 4Z1VA 1MDMA 3V65A 1YJNI 2JB4A 4A7YA 3BDDA 4P9FA 6PAXA 2ZOEB 3B6CA 2D6LX 2DAOA 3I3EA 2VQTA 2YC2A 1OJLA 1Z0HA 4MGKE 3ZQIA 1AF9A 3MO4A 3WP6A 2P5LC 4BWOA 1YHFA 3O8GA 5KAIC 3ZQFA 2P6CA 3T1LA 5JCTA 1STMA 3ZN6A 3GBGA 1T2XA 1JOJA 2W7NA 1EA3A 4M6YA 4FFFA 2VW1A 3WW2A 3UT0A 4W6WA 1FSHA 5LB6A 1T0FA 1V54H 2XF6A 3HSEA 4JOMA 1UYYA 2VZUA 3A03A 3V0AB 2B8MA 3CUQA 3TW6A 2ZZJA 5FOJB 2NP0A 2PLV3 4GH4A 2Y48A 3E1F1 1W7PD 1VZ0A 2CQQA 2VOTA 3L2RA 3OS0A 2IS4A 5C8WA 4DZJA 3GHNA 2ZGTA 4WV8A 1Y3TA 1IDZA 1UB9A 4MUVA 2BXZA 1LEAA 2UZKA 1W8UA 2A3XA 4KGQA 4DGWB 4A3EJ 3CUOA 5EYYA 4EJWA 3JREA 5AIQA 4A12A 5C4WA 1Q43A 2DVDA 5DDJ3 2CY6A 1AR63 2V1UA 2X1DA 4IE4A 1GSLA 1H2LA 4W4ZA 4EROA 2YBPA 1ON1A 3LAPA 5LHHA 4D3WA 4HF1A 5DUIA 2R7QA 3O1OA 2VBZA 4EV0A 3ABLH 2D6OX 4IHVA 2H09A 3ZOIA 1Z77A 4XLCA 3A2KA 2WWUA 3NMBA 1VMFA 2YS9A 4BQOA 5F6FA 4IGOA 2X29A 4XMIA 1FTZA 1OF3A 2PHTA 3SHFA 2RR12 1HCRA 1WA4A 5FCCA 3VHNA 3ESWB 3IP4B 2FUG2 2DFBA 4ET7A 4EJRA 1QIQA 3ZLIA 4B3NA 2VAUA 3IZOA 3VD5A 3RKWA 3BIEA 2FQ3A 1AX1A 2WC2A 2W57A 4LTAA 4AQ6A 3OR2C 5FLXZ 1VQOI 4TYSA 4NAOA 5BNGA 2PHFA 3ZYHA 2ZBJA 3K2OA 4IPAA 5E8IA 5H2FC 4PJJA 2YB7A 1RMU3 2XPJA 4EN7B 1QEXA 2EAAA 2EPFA 2JSPA 3VYSB 1OUXA 4E9KA 1JW6A 3JD73 1GHCA 2PFBA 5M5YJ 1UZVA 4UBHA 1Z0XA 2HPMA 2JVHA 2CSGA 1Z21A 4WVMB 2VR4A 1WCUA 2HKOA 1ND3C 4PIXA 3SEEA 4LK0F 1QJU1 2GN3A 3ZQHA 3WU1B 1KYZA 1BA5A 3M8FA 1CPNA 3VBSC 2VVDA 5KC6A 4IJAA 2D6KA 4UXNA 4YM3A 4AGVA 1SVOA 4A3MJ 1FPN3 3A0HC 4IHTA 2DO7A 1KJLA 1S3JA 4BE1A 2V6EA 3RWKX 4KG8A 2ZGKA 1MMAA 4B29A 5D8LB 2J5OA 3WCRA 2R7VA 3I97A 4LG0A 2HEVF 1YITI 2Q8CA 3M4OJ 2Z9OA 3CCYA 1U5ZA 3BIWE 1IQAA 1YJWI 3WG9A 1I3QJ 2RS53 2QENA 3QPLA 2KL4A 4QU2A 4IEXA 2FHRA 2VGDA 5D8KB 4EQQA 4CO8A 1HLVA 2B42B 4Y5Z0 3ML6A 4FT8A 1RHI3 1AL21 3PVOA 1G4DA 4C1XA 4KJZA 2DPUA 1O5LA 3QCWA 5FZBA 3A21A 2HPIA 4LJHA 2KJBA 3I2DA 2DOAA 2GAUA 1IN6A 1QWRA 1S4CA 3GTOJ 3ILNA 4LKEA 4YVSA 4MGTA 1SFYA 4JCKA 4XF9A 2V9KA 2CYYA 2HQAA 2XKOA 3MFCA 1VNDA 4V19K 2JG8C 1NCRA 3FXKA 1CAUB 2HNHA 1U5XA 2P6TA 3TKYA 4OI1A 4XQWA 3ZXAC 1YJKA 4ISRA 3R0AA 5FLVA 2OTLI 4Y15A 3ZXEA 2E35A 1LFBA 3WU2C 3NWKA 1SLLA 5A3NA 3HOBA 3PU3A 4LORA 2CH0A 1TMF1 3GVAA 1VQNI 2FDGA 4XOTA 2RQPA 5E8GA 5FFOC 1RKTA 2V5YA 2FMYA 2JUGA 5LA9A 1SMVA 2B9VA 3RQ0A 4XQDA 3QH7A 3AYEA 3FBMA 3ETQA 4AI8A 2GMEA 4XETA 4LKDA 4IQPA 3J80Z 4AVTA 3KQRA 5J40A 4XHBA 4YG2F 4QB1A 4W65A 5TJJA 2JG9B 2WFF1 2QJVA 1BK0A 1LUJB 1FNYA 1MD0A 2KT0A 3S8PA 4QGNA 1X1DA 3CO6C 4ASLA 1UZYA 3AG3H 3BOWA 1AXYA 3GBFA 2E1CA 1NH3A 2AREA 2BERA 5IK5A 4K9SA 1ZGWA 2IRFG 4A2UA 5J1XA 2F17A 4FPYA 4GAZA 4JBAA 3A0BC 3SDBA 3CP8A 1CJDA 3OSDA 4XQ4A 5FO9B 5CNAA 2WA4A 3GCWA 5FR3A 1YX3A 1WQ2A 1IRXA 1ZX5A 5F0CA 4XC9A 3JB8A 3VBFA 3VPRA 1XCBA 2HWD1 4KN4X 3ZQGA 1Y56A 4QPQA 3ZMDA 4L18B 3WP4A 4AIKA 1JZ5A 3B9IA 3KCYA 5LGNA 2JDPA 1MSEC 3A23A 2V4JC 5LHIA 4R9CA 5C3SA 2ZGUA 3GFLA 1QQP3 4A0YA 1H89C 3POGA 3NNMA 1VI0A 3E6CC 3HQXA 3GDBA 2AACA 3F8MA 4AVZA 1GOFA 3HSRA 5A1FA 3J8F2 1OISA 4AHWA 4QPIA 1VBC3 2VBWA 3GTGJ 2A73B 4CZSA 3NRUA 3WTVC 1RIRA 1ULCA 4IDZA 3AFGA 4P14A 3ILFA 2A6VA 2M1BA 1HKQA 4A0XA 5BMZA 1K5JA 5EV7A 2JVGA 5C7GA 4AUXA 3OPZA 2ACJA 2QM3A 1EV7A 2M4KA 5DAWA 4Y13A 1ZBE2 1PIV1 4KIGA 4ATEA 3EQEA 4ZU7A 2EA2A 2CFOA 4F3QA 3SFIA 1VR3A 1OQ1A 1SACA 4HBNA 4I0AA 4TTGA 5LRSA 2PHWA 4AL9A 1EV11 3MYXA 1UZWA 4WX9A 5FZDA 3K4ZA 5FYCA 4Q4V2 3KT4A 4XCAA 1NA1C 4AGRA 2VZSA 5FY4A 2M45A 1ZM1A 3VKMA 4CDUA 2FDKA 3TNPB 2OZJA 1SLIA 2PHXA 4QKDA 2VKDA 1MVQA 4M9XA 5E17F 3PUIA 4L92A 1VRH1 5JMOA 2HS5A 4GJZA 4CDWA 4BDYA 3RTRA 1OT5A 3HNMA 5JUVA 2MHFA 4EJUA 4HOOA 3BG3A 1ZN2A 2JA8J 2E7WA 3KP6A 4IEWA 1RUI2 2VPLA 4E2GA 1ZR2A 1S0CA 5ICEA 2Q2EA 3W3CA 2KDOA 4HNTA 1SCRA 4RYDA 2F48A 4IEJA 4XYXA 1ZBA1 4Y5TA 2ESHA 5LEKA 2IBDA 4I2OA 3QH6A 4DZGA 3CJTB 1JYIA 4DOZA 3D6EA 1NKGA 3OYHA 4RGXA 4Z82A 1QJX3 4LKFA 2Y6KA 4V2GA 1JXSA 3GALA 2A6XA 2IAIA 4LFUA 3CP2A 4KISA 2ZGQA 1LODA 2V5DA 5LRRA 2L2OA 3BG7A 2KQRA 1F31A 4RQPB 2F6BA 4R4XA 2D3PA 3URFA 4XKVA 3ULQB 1R1UA 1JE8A 5EGOA 2ECBA 1PUFA 1X9PA 3IRRA 4BQQA 5CG8A 2E7TA 3N9QA 2CUZA 5JXGA 1K7AA 2B45X 3EPZA 3B94A 1OCCH 4NRQA 1G9DA 1LFUP 1F5JA 4EZHA 1V5FA 3LFMA 4D7TA 1W6PA 3KVBA 4DPNA 3OCPA 2ZACA 4O9GA 1L7RA 2IWGB 4HVRA 3AZZA 1GWLA 3BTYA 2VBYA 1CVNA 1AJKA 5M5XJ 2M87A 1K5MA 2LALA 1Y1WJ 3L00A 1B8IA 4HKOA 2GXAA 1K61A 1TME2 3AKPA 1S7OA 5BNOC 1LPQA 4Q2FA 2ZS6B 4XFIA 1U3EM 1BCXA 2VOXA 3KZIC 4CEYB 3F3XA 3JSOA 3M3QA 3O12A 1PK6B 4NHYA 4NHJA 4M3DA 4YG0A 1XYNA 3MIBA 2XKPA 4G9YA 1UOBA 2ZGLA 2G19A 3CLQA 3IAPA 1HX6A 4AYUA 3WQ7A 4OI4A 1OI6A 4F92B 1E3PA 5L7OA 1W2AX 2Y0IA 3DXUA 1JGGA 1BK1A 1ZNPA 3Q8EA 3VBRB 5L73A 3IHUA 1S0GA 1X9TA 4RGSA 4OHWA 4YGCA 1Z7LA 5I0RA 2VKHA 1CGPA 2LG4A 3WX5A 3CCJI 1JMUB 3W58A 2D5HA 2Q0AA 3HOYJ 2NNYA 1RUH1 1JUSA 1OMIA 4ZTFA 3GNEA 1ULGA 5HCFA 1BMV1 1OPMA 5E3NA 2DCYA 5IY5H 1XC5A 1H8TB 4FTHA 5KNLA 1LOBA 3I7DA 2ZMEC 5A7WA 2CQKA 2IZWA 3KT7A 3H1MA 2O8XA 5KHHA 1W5TA 1LQ1A 2WAFA 3HWJA 1LENA 2XJRA 4XICA 1GQPA 2L4AA 1S8NA 2KMUA 1HB2A 4YW3A 1ETVA 4LO7A 5FZ8A 2DA7A 2FDJA 2E7QA 1RUF2 2WBKA 2CS3A 4HANA 1R083 4IE5A 2ZFUA 2WSVA 3GTMJ 1JHJA 4CDXB 3OYWA 5FY9A 1PNGA 3I2GA 4MEXF 1BI1A 3X29B 4CUAA 3MFKA 5G04L 4YELA 4JYKA 1SEUA 4M3FA 2XUEA 1AYN2 1W8HA 3W9AA 1FOD2 1XC6A 2G1MA 3C7OA 3ZPOA 2AO9A 3LMMA 3ZYPA 2ELKA 5KVRA 3KP5A 4HX8A 2JRMA 1WKMA 2Z5UA 5K0UC 4IEVA 5K7ZA 3H9GA 3R6SA 2IA0A 4UF0A 2PLV1 5GTIC 2ZEYA 4E8CA 1D4VB 4HVOA 2WNVA 1S2KA 2NRAC 2OQ7A 4FPEA 2MA3A 2XJSA 3AKZA 1CQ9A 4RHV2 3JBG2 3HGGA 1URXA 3VBHA 5DDJ1 5IYCJ 1AR61 1NCQC 1G86A 1NY71 4PCRA 1KYWA 1Q8SA 2FSWA 2E60A 3VL8A 1GZWA 1LHOA 1VMJA 4P02B 3K3OA 1UHSA 2R042 2EA7A 1P6RA 3Q9VA 4FFIA 3A01B 2P6HA 3S3OA 2Y8KA 4FE7A 2DV9A 5HV0A 3OYMA 3AP7A 2EVXA 5I0SA 2VD7A 4JX5A 1IN4A 4QIWN 2FJ1A 4RS5B 2WRAA 2XLFA 5CKTA 1LNWA 4FPGA 1BEV2 2NS0A 1MKMA 2B0LA 3KZZA 5FIXA 2ISZA 5A2QZ 3F8BA 4BS9A 2DTZA 3RZLA 2HFHA 1JXNA 4UB6C 3TBIA 4AIDA 1RMU1 1X58A 3VB9A 2SBAA 3D5RC 2NM1A 4ZYHA 2R073 4JGYA 4B09A 2JPCA 3JD71 1HQLA 4KWUA 4E7ZA 1YS6A 3DKXA 2H8WA 1MBHA 1J3QA 5K9YA 3HYIA 4EMSA 3NV4A 2Q30A 3MEPA 3H1CA 1DLLA 5FK8A 3N9MA 3DXJF 5J4VA 3IV5A 2YX7A 2JECA 4E8DA 3CESA 2DFCA 4DXTA 3CIHA 4XEZA 5GAGJ 1F1ZA 1FPN1 5CAZA 1TEIA 2X6YA 4MGSA 1OUSA 3WTZA 1ND2B 4AVPA 1SLAA 2Y38A 2M8EA 1ENSA 1OFCX 3Q3SA 2CU5A 2D1VA 4F93B 2LDUA 3MKWB 2UWAA 1VAVA 4DEVA 5LA1A 3LQQA 3L7WA 1PO13 2WN2A 2VJ5A 3O1VA 1Y4WA 5HLGA 1CX4A 2ARBA 2L01A 3SZPA 1W9FA 4ON0A 3MF6A 1ULPA 4KMQA 2ZJCA 3HKZA 1O6UA 3KV6A 3JRFA 2RS51 1Z3YA 2ZX2A 4IL7A 4A3DJ 4HA8A 1QH7A 4P5HA 5I0TA 3KYDB 2VXZA 4E4DX 4BQAA 4QWNA 2FEZA 1EPZA 1RHI1 4G6TB 2XJTA 2ZC2A 3J7AO 5T5PA 3CCVI 2PQQA 5LWBA 4BHBA 2FOWA 1E5SA 2Z5WA 4IUGA 3Q0UA 1GFF2 2XAQA 5FZFA 4B47A 2OAZA 3RKYA 3T3YA 1C3HA 3GZ5A 3U1DA 1GV9A 1T38A 2YFUA 4WCGA 4QU1A 4RB1A 3MICA 2BY0A 2BWCA 1I27A 1GP5A 3MIFA 4BKXA 3WDYA 4BXFA 3U21A 4XFBA 2RMU2 1QNWA 1VJ2A 3IPVA 4QWQA 1USTA 1UU4A 4DZPA 1FLIA 5F64A 5DQ0A 2VC9A 1UOFA 4HZFA 1IGOA 2YY1A 5GPCA 2JDMA 2E6VA 4C2UA 1C1LA 2M9HA 2IA1A 3VZKA 4L9VA 4ZZLA 1AVBA 2FD5A 1DQUA 2ATFA 3RZOJ 2H27A 4Q26A 4OUMA 4DBQA 3CJXA 5AC92 4P9GA 4RM2A 4LBKA 4BY7J 1B35B 1QJFA 3VBSA 1OR7A 2WO1A 3VZNA 4GB31 2BV6A 4QKNA 2XJPA 1IKQA 4XAAA 2YXSA 5FMOL 1FOKA 4KMUX 4E7HA 2VU9A 1ZK8A 5CBLA 5IVBA 2ZEWA 9ANTA 5IVEA 4LGWA 3K70C 3OEAA 1JHHA 3PU8A 1KZHA 3I54A 4WVVA 3F72A 1WLDA 2P1BA 4OI0A 3JRDA 3V7SA 4LBQD 2K3FA 4W1UA 4BE3A 2ICWG 4ZYEA 4XUOA 4XFCA 4QLCU 3K69A 5BV6A 3VYTB 4Z6YA 1FSEA 1W2OA 3K2ZA 3M3CA 1KS4A 2O9LA 1A31A 5J47A 2XBO1 2DA3A 2UXNA 4CP9B 3HD8B 4P5YA 5A7NA 3LOBA 5JXHA 2QZ8A 1PYVA 2RDQA 1RETA 2XWJB 4X0GA 4CCDA 5BNPB 5DUKA 2D5VA 1BBT3 4LO5B 4NQWB 2R7FA 3F6OA 4BH9A 1OLRA 3ACLA 3THDA 2GA1A 3U9GA 1MDMB 3ELNA 1O57A 2RM23 2LRPA 4A7KA 3ZSJA 2XRLA 4HAMA 1XGOA 2DT7B 4LT5A 3I0TA 3T4HB 4FAHA 5D21A 4YW6A 3AFKA 5EQUA 3CF6E 2WAAA 3MLJA 1NG7A 4IEPA 4NVPA 3SMHA 1REPC 2QTWB 1VBC1 1JODA 4MTDA 2JA6J 3WP5A 1STZA 2OVUA 1DZQA 2BY3A 3IBMA 2DUPA 2FOKA 3V0BA 2JG8A 1OCTC 1XGMA 4LUKA 1XS9A 1RUJ3 2JG9C 2WDBA 1WD4A 1F43A 1L3LA 3W2AA 3RSJA 3S57A 2QF7A 4EGZA 3J9SA 3PTRB 3DPTA 5FYUA 1SVMA 4P00B 1N78A 5HS7A 1IDYA 1YYNA 3CUQB 1CIYA 3TAYA 4CHUA 2EJRA 2VT2A 2CU7A 2DCJA 2RVCA 1AU7A 2ET1A 4GH4B 1BJAA 4RGAA 2UYBA 3D3AA 1WD3A 1GWMA 2LC2A 2HYGD 2KA3A 4N43A 1U0JA 1V00A 1SVLA 1BIAA 2ZNZA 3QP5A 4MXWA 4AEMA 1IUFA 2KISA 5C4WB 1FOWA 1J3RA 1K3IA 1LHNA 3FHQA 4C91A 3VHOA 5DCMA 5EG0B 1WRJA 1XSDA 3ZR5A 2VTFA 2Q1ZB 3OYJA 3J7ZI 1I1EA 3WG7H 1F5FA 5APAA 5FDBA 1OHFA 4MO7A 4MGZE 2XRNA 1I50J 4LO6B 2L4MA 2NVXJ 2ETHA 1JU3A 2LKXA 4ETSA 1V6LA 1W7PA 3WF3A 3DUIA 1BOBA 3ZP5A 5A1AA 4HSRA 3LSIA 1ZARA 1YS7A 1LKXA 1A6CA 3J26N 5D8AA 4IVNA 3GW2A 4COZA 2I10A 1J1LA 1TNTA 5K1YA 4CA9A 1QJX1 1IS5A 4HNVA 4JP0A 1XU2A 1FMD2 4O61A 4C0BA 3OMYA 1SFNA 1PVC3 3IH3A 4XF3A 2JEMA 4YM0A 3GF6A 1ZG3A 4EATA 3S16J 1QJEA 3G3ZA 1MR5A 1R1ZA 3AVRA 1HQWA 2IS2A 3UJOA 1QH6A 1VP6A 1YQCA 3BPVA 4DRVA 1N1VA 3KF3A 1X3UA 3R61A 4HN1A 1GNHA 5CPRB 2VECA 3JU9A 4LJZF 3NNLA 1BHGA 3F0CA 3HAGA 2L9VA 1UJ8A 4TLFA 4A3BJ 2WWSA 1PGSA 1ULOA 1YFXA 3HHGA 3FL7A 1CZSA 3PFIA 3OPWA 4CYDA 1QGPA 4QKBA 3WHCA 5IT9Z 1BVP1 2LR8A 4BDVB 4R1HA 3FM5A 1MVEA 3MF9A 4XM3A 3WR0A 1NA1A 4GMP3 4ASKA 3K4LA 1MEC2 5IHRA 5FKOA 5T5OA 3WEZA 3PIOF 1F36A 1LOFC 3KVAA 5DMYA 4NUBA 4LG0B 1CF7B 4DQ2A 3HUGA 4UW4A 4O6JA 3L09A 3I71A 3ERED 3Q8FA 3O0VA 1EUTA 5JZGB 1GANA 1DPUA 3CBNA 3RIRA 4NHXA 4JDNA 4KWLA 1WVRA 2D6MA 4RQPC 4AI3A 3AYCA 3DYOA 1BXHA 3AL0B 5ILSA 2BNMA 1AXZA 4L0YB 1BYHA 1WGPA 2Q8DA 2BXYA 2QKMB 3TB0A 1QQIA 5C5UA 2BFUS 3BTAA 1AR93 4U2AA 3UNPA 3ZYBA 2QBYA 2CHHA 3WTWC 5FUPA 1AWCA 2WYFA 5F5AA 2Q1FA 1WCKA 2WB1N 1P4AA 1TP4A 2ZAHA 4YVSB 4CP1A 2DI3A 1QPMA 1R58A 3D0SA 3BVCA 4RB0A 2VZQA 1TE1B 3U07A 1PM7A 3TEXA 1R081 3J7MA 2BBYA 2Z2SB 3ERMA 2FRHA 1RIOH 2OYZA 1Y9GA 4CEYC 4UV9A 3GCMA 1PK6C 1CAXA 2VZPA 4L5IA 2G9FA 5GALA 3WE2A 4HDUA 1C8M2 4KWKA 4UVCA 5C8CA 5D5UB 1ZR4A 1A3KA 4HYEA 4RR3C 1E57A 3BGAA 2XLGA 2P7CB 1A04A 2CV0A 1YJ9I 3VBRC 5FY8A 4QKFA 4HEA2 2JZYA 5FKNA 3TYJA 5BNOA 5LHGA 2MSYA 4G7ZF 3I2OA 1D8KA 1JYTA 1AUYA 3PNYA 4I0WB 3ZDVA 3RQIA 3UETA 5DZEA 4LHNA 4BEHA 4FSJA 4BIOA 2VZVA 1HC8A 3TO7A 2Y31A 4PSXA 3IB3A 4LE3A 4ZXKA 1H8TC 3ECQA 4UB8C 2ARCA 3VBOA 3WF0A 1QA6A 1MGTA 1V6NA 3WDXA 4PCQA 3UGFA 1Z91A 2A75A 2P3YA 1T8IA 1XNDA 4CCJA 2LM3A 4FAGA 4A6EA 2DFFA 3VBFB 3PQJA 4PJYA 5FD5A 2YC0A 3U1KA 2XMLA 5J4YA 3FUQA 1JI8A 5J98B 2C6YA 2LRDA 2ZCWA 3IH2A 2Q8OA 1H1MA 3KT1A 2YGMA 4UUTA 2M4GA 5IYYA 5FZLA 4B44A 1QU0A 3JAMZ 5FQ0A 4CDXC 3MZ8A 3ZYIB 4IRGA 2UURA 5JXIA 4YFZA 4DY5A 1TW2A 3QPSA 2H1KA 2NLRA 2WNEA 5EF6A 5HLTA 2E36A 4LB5A 1DU3D 1ULEA 3CDLA 4BK4A 2RR13 1RXFA 5EFUA 2J5PA 3HMYA 3S2HJ 3QYBA 1BJQA 2R071 5J36A 3RZGA 1N25A 1W6MA 2E1NA 3EB7A 1FX7A 4QDRA 5FYSA 3K4AA 1FMWA 5HXMA 2FCTA 2YR2A 5CFCA 2A05A 1IPSA 3S1MJ 3TWIA 1WI9A 1D4M2 5BY5A 1ULFA 3NJXA 4F3JA 1S72I 1I1GA 1PGL2 2LW8A 3Q0VA 1YNAA 1JZ6A 4RGUA 4AM3A 1WCQA 2RQQA 4CGZA 3WTYC 3WD5A 4UOJA 4CICA 5E89A 1X2NA 4WK8F 4ONUA 3I2FA 4CDUB 3AL5A 5K0UA 1F9KA 3HDDA 1ZQ3P 1GWKA 4YRVA 2QQJA 5IYDJ 4KH9A 3E5XA 3RI8A 4CDWB 1QVTA 2XH6A 2IGKA 1V6OA 3M07A 1W04A 4NR1A 4TXWA 3ZXLA 1JZ3A 2PXJA 1C28A 4CUGA 4GIQA 4A3KJ 2DQRA 1MBKA 2VIXA 4QX0A 4RS5C 4QX2A 4LBMA 5KK1A 4MGYE 1PO11 3ST7A 5ANNA 3PVBB 5GJ6A 1O3SA 3WF1A 2GIZA 3RYPA 3NNFA 4YIRX 3OYLA 2MC4A 1QHDA 1TTYA 2Q2EB 2EXJA 2MLKA 1OVSA 3ZSLA 4QXHA 4EM0B 4L97A 3ZQLA 3E5QA 4ENKA 1BI2A 1NHAA 2R93J 2VPVA 1JN2P 3QPTA 2LK2A 5LK5A 3WHBA 3T0AA 2Q8KA 3HOWJ 2TDXA 4PIZA 5F32A 4I76A 2VQAA 2GXGA 1XSQA 2EIKH 1WW7A 4A3IJ 4BDZA 1OA4A 1BI0A 2QQIA 1RUD2 4G12A 5FZMA 4D7MA 1UXZA 5JOZA 3OYCA 1OXCA 4D6RA 4XUPA 3FXOA 3B5LB 2QQPA 5EGOB 1PUFB 4XDOA 4LLOA 3LDBA 3GXUA 4G9SB 1ZREA 4JRLA 3O1MA 5F6KA 2WL1A 3H36A 2RHPA 3WF4A 4JAAA 4WZFA 1ZRIA 3PJQA 2JKXA 4CYCA 4M01A 2JN6A 1ND2C 2ZGPA 1KDKA 1UL9A 4F83A 2EV0A 1M06G 5DZFA 2MLGA 1WUVA 3J7HA 1K5MB 4Q4X2 1J9IA 1B8IB 2VG9A 2KP6A 4OULA 1IGNA 2ZAAA 3ZFGB 3WG1A 1OVPA 3O1RA 1W0PA 5F5CA 5EEGA 3N05A 2ARAA 2Z4FA 3HB9A 2IXLA 5L7OB 3BR3A 1TQIA 4DNCA 2RG4A 4NPRA 5A6ZA 1UZCA 2VJIA 2VE9A 2HVQA 2M7AA 2F4OB 2EWNA 4IERA 4Q27A 3KCCA 3AVSA 4ENMA 4LQRA 1VQKI 1NK3P 5LCWL 3HSFA 1RJ7A 2VL8A 3HM5A 1WH5A 1IN8A 3BG6A 3FM3A 4IEOA 4P55A 1FNNA 2EZLA 3LSGA 4B8EA 1NZIA 2VZ1A 5DCFA 1XMXA 2NQYA 2EQRA 3BY6A 2XL9A 5FXZA 1Q8VA 4BJ0A 4S2DA 4GQ7A 2D40A 3G73A 3SKVA 1DP0A 3W2WA 1BBT1 1E5HA 3LWCA 1SDWA 1OPCA 1RUE2 5LBBA 2RNJA 2RM21 3C3VA 4OZOA 2Y9ZA 4DUWA 2VQ0A 1LOEA 1E5RA 1MS3A 5JAXA 4MGRA 4GWMA 3I58A 1BN5A 5LGUA 4FBFA 3F95A 1JZ8A 4NHKA 4RLFA 3QOEA 1NK2P 4UI9L 2DOEA 3GJAA 3I4IA 1B35C 5DUXA 4M3EA 4B7KA 3KB5A 2MH2A 4GFBA 1UIKA 4IE6A 5H6RA 4OIOF 2X4HA 4DNYA 1ASJ2 1PGW2 3TEDA 1YUDA 1V6IA 1TZLA 2KJCA 1Q56A 4XF0A 5FYBA 4KBBA 3MBWA 4LBOA 2A68F 3J8F3 4COVA 1ONAA 4GYGA 2BP6A 4BQ2A 1X1CA 4UF0B 1G7YA 2QKDA 4AHXA 4MHUA 2DBIA 2X85A 4Y4RA 5FZGA 3DYPA 5JWPA 2WNVB 2R5YB 2DK5A 1F2NA 5LK7B 2HH9A 4LG3A 3UGHA 2Q0OA 3SDGA 4UYBA 3RPUA 4FQZA 4RDUA 3VKFC 2X51A 1SBDA 1E17A 1C8NA 3K6GA 2OT7A 3PJYA 1N3PA 4BOWA 2JKBA 2WS91 3KMHA 5I93A 1G3YA 3N4MA 1EKEA 1GZWB 1QJU2 3LOCA 2D5FA 5BNPC 1O4YA 1V5EA 1U8BA 1H9GA 1WJAA 2JDHA 2BTVC 4Q4V3 2FXAA 5HNHA 3R4KA 5C3OA 3LZZA 3DTKA 4I99C 5HV4A 1SFOJ 3LSTA 3HPHA 4C90A 1BC7C 4OI2A 5DN2A 1MH4A 1W8OA 2FZ1A 2W85A 3DPRA 3NQHA 1HRV3 4XDQA 4RB2C 5J3UA 2QWWA 1YOVB 3KETA 1ENHA 1ITYA 2XSDC 4U87A 1FMVA 3VB2A 1GUUA 5A6XA 4K7JA 1OH3A 4IW3A 4Q29A 1HLCA 2UYAA 4U88A 5CVIA 1RUI3 4HKLA 4S2FA 2H94A 3DCFA 2EZHA 1IG7A 3SZGA 3ACFA 1CAUA 1DQ2A 2CQNA 2E63A 3ILRA 4NRMA 4W50A 2JJ6A 2YG0A 4H14A 3CUQC 1EH7A 1ZVFA 1W4MA 4XUTA 2QEXI 2AQEA 1UCXA 1PVC1 4GH4C 2DVGA 4JGYB 5FPUA 3OY9A 1XE8A 2BE5F 4II3A 4M72A 1XOYA 2VQLA 2VW0A 4X6AJ 2EK5A 3UL2A 2W52A 1W8WA 1UWWA 3CO2A 4BUPA 5C4WC 1VPHA 3F23A 3WGIA 2FZ2A 5H9SA 4A3ZA 1BKZA 2RV8A 4E7KA 3NAPC 2GNTA 4HXCA 2VONA 3MEXA 5GLTA 1RGSA 4D1QA 2G9GA 1EPWA 2KIMA 3OOXA 3UKNA 3CMGA 3QYEA 3F2ZA 5FY0A 4AVVA 2L54A 3BI3A 3P3PA 3SCFA 3SHRA 5CVJA 3S2WA 2BW8A 5LA0A 1OCRH 1OH4A 4GMP1 1HRI2 3MCZA 1FIPA 2V4AA 3CKHA 2X9DA 1AYM2 1KGSA 1TME3 2GSYA 4HV6A 3U4XA 1IUYA 3FXLA 1HW2A 4XORA 4IZZA 1HN0A 1DQ5A 1U6GA 4LO8A 4M6XA 3WGGA 3I4PA 2ADEA 2JICA 3H9AA 4TSVA 1R5ID 3OSFA 3MPBA 2LROA 5FZ3A 1IN7A 2WUHA 4KG0A 1G8XA 4PUSA 4P5OA 4B1LA 2W91A 3PQKA 4AXOA 2IXSA 5A6QA 2KM2A 2K0GA 2WQZC 2WFF2 1S7EA 2C5DA 4M9ZA 2WA0A 3U11A 2RV9A 1U78A 3ELKA 2WWJA 4OAZA 4W6XA 4G8XA 2R062 4AAXA 1W8FA 4EEFG 2Y6JA 1D3YA 4CXFA 1YI2I 1TL8A 2VXDA 3JR9A 4ZZDA 1G9FA 1I1SA 3RKQA 4K40A 3QQAA 1JH5A 3IDCB 4Y4YA 3HN1A 2JSCA 3BP8A 2KZVA 4W8JA 2Z79A 1SAXA 2QQOA 2ZPXA 4XRSA 3QWLA 4A42A 2HWD2 1FATA 2HYFA 1X19A 5EDNA 2GMMA 3LFUA 3MIHA 1GU3A 5BPDA 3MKLA 2CV1A 2IP2A 1MS9A 3PO2J 3S2DJ 1OURA 1RUF3 5FYYA 3F9KA 5B4XA 4D94A 1Z9CA 1X82A 2WLQA 3ABTA 2F2EA 5E1WA 2RNGA 1VQ5I 1XSRA 1W8ZA 3FXMA 3BCBA 5JZGC 1RC9A 2D1HA 3ACGA 2VOOA 4Q1PA 2QDNA 4LA3A 3T30A 1AYN3 3AL0C 1FOD3 4XBFA 1T2KA 2Z3YA 1ODDA 4Q4W2 2GNMA 4EN9B 4YW4A 4CEWA 1QY4A 5T3NA 3DN7A 3CC4I 1LOCA 4NNJA 4UW5A 3CEWA 3WDTA 5IOZA 4BGDA 1ZG5A 1LDKB 4UUVA 2V1DA 1W6NA 3DF0A 5FLXK 4UFJA 2PMHA 1EV12 4RHV3 2C6SA 4YVSC 5T5LA 3VDDA 5AFBA 1GYKA 3RSNA 3LEMA 3J4UH 1MJ9A 1REDA 3MW2A 3ZSKA 2B5HA 1VRH2 4AG4A 1X2MA 1RB8G 3P7NA 1PP8F 2FX0A 2V73A 2BWAA 5FKKA 5DAQA 1V70A 5I8TA 3HR9A 3EUHA 2R043 1BR4A 3QRFF 2WNUB 2MEV3 1T6BX 3BODA 3LEIA 3P5JA 2DT6A 1R1A2 2VXJA 4LBQA 1HKTA 3DBRB 2IFRA 1VB2A 4K20A 5CYYA 2D6NA 4JV4A 1FTTA 5B5EC 5IVJA 1HF0A 1JKOC 2OBPA 1LE8A 5FLHA 3GCXA 3MFAA 3AKRA 4KA4A 2A07F 3BOPA 5DAXA 2RR11 4OU0A 1OQYA 3S7IA 5J1YA 3DEMA 5F5QA 3BTLA 1YJLA 3V0BB 1ZZCA 2A1XA 1GZ9A 1BEV3 4ITVA 3BUCA 1FYLA 2RS32 3SZTA 4IESA 4QX3A 3IDEA 2DFEA 4AYBA 1PK6A 2WSUA 1LJ9A 1Z7S2 3L9FA 2LLKA 3BR6A 3W6KB 3RNSA 4ES8A 4JQTA 1VFCA 3SEZA 3AXEA 3B01A 3HVDA 4TWTA 2DWRA 2XB6C 2WAQA 4RR3A 4N43B 4IV1B 2BRTA 3DU5A 2W87A 2LMDA 2ZHLA 4ZHNA 1IO2A 3VBFC 4BBSJ 4HQEA 5JDBA 5FZAA 1TWFJ 4QQHA 3NVCA 5BYNA 3EO6A 5DCMB 1YFWA 2QCOA 2DYSH 4JQRA 2LS6A 4MG2A 1VLNA 1TQMA 4Q5OA 3CDIA 5FB2A 1CD3G 2QQKA 4YIIA 2BY2A 2DVFA 1W7PB 3D0JA 2P37A 1X36A 3PUHA 3QBQA 4CDQA 2EIMH 1E3HA 2LP0A 3ACIA 1X1PA 2YPRA 2JDUA 1MPXA 1YIPA 4XXPA 5A3LA 5D8AB 4DW6A 4A69C 4EJOA 1NLRA 4H7MA 3CMMA 5F8PA 1T39A 2DFHA 1ZZ6A 4P1WA 1JJ6C 5DYMA 3WDUA 1ETKA 4CXWA 3A4UA 2AXLA 4LEJA 2M7BA 5B4NA 5IYBJ 4EM1A 5BUVA 1MBFA 2CFXA 2Y33A 1QZYA 5A3MA 1TMF3 2PQ8A 1UPIA 1U5TA 3ZYRA 4ZZ8A 2OCCH 3HBZA 1DDLA 2PG4A 4LR4A 1V6JA 4EGYA 3H0OA 3LAJA 2COMA 1YG2A 4CDUC 2A6HF 3A1YA 1SEFA 3J80K 5F27A 3OOUA 2YU3A 1PMHX 5EEAA 2QUOA 3A7QA 4CDWC 2XL7A 2Y0OA 2K40A 2AR6A 2FBHA 5CJ9A 3POYA 2J1UA 3F8FA 1Y8QB 5CQGA 4BY1J 1W6QB 2ENRA 2RMU3 1YLFA 1MJAA 3KEYA 2A6WA 2PN5A 4PI0A 1ZRDA 1YI9A 3UJQA 4HF2A 3IN9A 4YNIA 3I3DA 2A61A 2JQ7A 3NRVA 3WSOA 2V79A 4BK5A 4YLZA 2M8GX 3GMEA 4Z07A 1Y9MA 5HODA 1TNRA 3ZN5A 3BYWA 1ULDA 1C57A 5M0TA 5FYTA 4ZXEA 4BMBA 1U9OA 1UNBA 3GEZA 3M1HA 4C3IJ 4URTA 4R4ZA 1QMJA 5HVQC 3O2PE 3CCQI 4TN7A 2CQXA 4XQFA 4IE7A 1YI7A 3WDVA 4ZDLA 5HDGA 4XBNA 4HSTA 2PLV2 4CCEA 4C8DA 1CJPA 2YBSA 2VOPA 5FY1A 3MW4A 1DGWA 4L11A 4OIQF 5J7MA 2R7ZJ 1UAIA 2GMPA 3I5UA 1DUXC 2PYTA 3L9JT 1R4NB 2O14A 4YW1A 2WT0A 3H3LA 2JE8A 4I3PA 5C71A 1LGBA 3BJ6A 3TEWA 1G3WA 2QBYB 3C2HA 3MZHA 1YFYA 3FE5A 3OIQA 3QODA 2O8OA 1TNSA 2JDYA 3I9V2 1ENQA 2RS12 1Y43B 4FPOB 2XAGA 1UN1A 3FMRA 4G6DA 1K5MC 1Q8PA 4YFNF 1H2MA 2P5BA 3KD4A 3USSA 1EJ9A 1PZ8A 3OGGA 5DV5A 5GLVA 4AWDA 2ID3A 3OYKA 3ZFGC 1UF2C 3ZFEB 1CAXB 3C7EA 3AJYA 4FPFA 2JX9A 4BMEA 1W90A 4FPHA 5C8CB 2WT1A 3WG3A 4CCLA 2AYHA 2ZZQA 3TO6A 4F52A 2BYVE 1MBEA 4HRIA 4S2GA 3T2OA 2BUKA 3J8F1 3SKJE 4D69A 2VE1A 4NHMA 1R23A 1SC7A 4XL9A 3AKSA 4M4PA 2HWF2 2JDNA 4MGQA 4EWAA 3T0YA 5GZFA 3TO9A 4UFIA 2HGCA 5F1JA 3T0DA 1CN1A 2VNVA 3FK6A 1Q3EA 1NE4A 1NOVA 1Y0UA 4DQAA 1POQA 5LD2C 5EXOA 3EBRA 1R1VA 2STWA 2WZ8A 4I7HA 1ZBE1 4BEHB 2N8GA 4Z2WA 4KT6A 3VL9A 5T54A 1X3ZB 5IP7J 3VBOB 1XMAA 1K4SA 3O0WA 3P9CA 1VTNC 4Q4V1 3IM0A 5GPAA 3I49A 5DZGA 2HR3A 2ZXHA 5F04A 4MFEA 2PELA 1XGSA 2LY1A 1XNTA 2EBIA 3AMMA 3UK9A 3ZXDA 2A6EF 4CCCA 1UELB 1W28A 3OGVA 3O1PA 4BIFA 1IXSB 3M8EA 3SC7X 1ODNA 3I4NJ 2I8DA 1B59A 5FQ0B 1O59A 1REFA 2FCUA 2B9SA 1CAWA 2X09A 1RUI1 3K1NA 4HT1T 4Z8BA 4MTEA 2XROA 4AF9A 2WQ8A 4D7YA 2NOJB 3ZGKA 2YSRA 1GZCA 1TBXA 1YO5C 3VKNA 4X6QB 3THPA 3OY8A 2JXAA 1CIWA 3GFJA 3RZJA 5JOXA 1W6MB 4UUSA 2XIGA 2KIUA 2WYSA 1POV3 2KR2A 2MD5A 3AYDA 4FP3A 5CFCB 5C3PA 2RDPA 1H6YA 1IXCA 3IAS2 2HKXA 3AXDA 3B9CA 1JZ7A 4I30A 4FPJA 1O7FA 1FXZA 2UY9A 4NAMA 3WLUA 5KXEA 3MGUA 5JI7A 4FPCA 3Q9OA 3FC0A 4QGLA 2XV4S 2EICA 1JYCA 1D0XA 1GOHA 4B1MA 4MLOA 1HKDA 2VUDA 2GC1A 4FQGA 3LEGA 3NKGA 2W9XA 3GYDA 2QKLB 3TDUC 1H30A 4M3CF 3N7JA 2QQUA 4HF0A 1RNLA 2JB8A 2IXIA 4XIKA 1X1AA 3O14A 1ALYA 3TW7A 4D5FA 1B6AA 1TME1 2X0LA 5IAXA 3FBYA 1UY2A 5EWSA 3S14J 3KEOA 3JRHA 5JLWA 3W59A 1CWPA 1ZZBA 2GZWA 2FQ4A 3T5XA 5FRMA 1H9PA 4URAA 4W6YA 2ZHKA 4XFGA 2CQ7A 2TEPA 4D7NA 4AWXB 3IWZA 2O0YA 4XOPA 2MG4A 5JLXA 3KM5A 3GZ6A 1TW3A 4KU7A 1LDJA 2GBYA 2V09A 5CYVA 2R32A 4JGYC 2X1EA 5BNNB 1FIAA 5J3LA 5HI0A 4BHCA 3S1NJ 5F3GA 4ISQA 4H3WA 4N53C 3ABMH 4KWJA 4CCOA 2B63J 2EFQA 2K86A 3IKWA 3OPTA 5F7UA 1KITA 1W0NA 4Z2AA 4IX7A 1ACCA 2PQSA 1O7LA 1YX5A 2IJLA 2J42A 3HRUA 3OOPA 5EYRA 2NVQJ 4NWWA 1Z6RA 3D4KA 2ZO4A 3SITA 5KXDA 4BLIA 3GFMA 4UVAA 1T6GC 3DPUA 1GICA 2PMZA 1U0AA 3GZTB 2PAKA 4CYCB 3SJMA 3IKVA 2SLIA 4FOYA 1LTEA 4UFMA 2AZ5A 3AM2A 4RS8A 1UMZA 1L7QA 4X1EA 2HQNA 2VW2A 3ORJA 1RC6A 4II2A 1BL0A 1LCLA 1QQP2 1S0JA 3OL3A 1RUF1 2WA3A 4DFSA 4COWA 2YUEA 3SISA 1TZOA 2VQUA 5EG0A 3NAPA 5B3SH 1XSXA 3FFZA 3BCWA 2IVIB 2RE9A 2M30A 1B09A 2EV5A 5LZ6A 2LKPA 4K2EA 2ZHNA 2A5ZA 1C8M3 3JQWA 1AYN1 1JT0A 1FOD1 3GXOA 4IHWA 2VLAA 2RJ2A 3VKOA 1GVJA 4O9EA 2PJPA 3UKGA 5FGMA 3LPGA 4LKSA 2EIGA 2ILMA 1DGRA 1UYPA 1GOGA 2CMPA 3CU7A 1JYWA 2I2SA 4LXLA 4IKFA 5A2QK 1VALA 4RHV1 3JBG1 3DF8A 2L02A 4NROA 2GQQA 4S05A 2QVSB 4K6BA 2UWMA 2DDUA 1HKSA 5HDNA 5IT3A 3AMNA 3BLYA 1EUUA 1UD1A 1HXS2 2KRHA 1X8MA 4FXKB 3GTQJ 5A33A 3LDRA 1QOOA 2H6CA 2R041 1H0MA 2MEV1 1NAEA 2L7ZA 5FK7A 3JB4C 3K2AA 2EINH 4K8RB 3WP3A 4XTMA 3A0NA 2RJKA 2HWE2 1MZBA 2DN0A 3OYNA 4INDA 1NQDA 4S0HB 3WE3A 1DQ0A 3DBHB 2PI0A 3COAC 1OR7C 5IPAA 3H8UA 4Q4Y2 2CAVA 4XPVA 3ALQA 3ZMVA 1A35A 4PBOA 3I3MA 2F5EA 1BEV1 5J09A 1IZ3A 5IJRA 5F9TA 2KDZA 4B7EA 5EZHA 3V4GA 4GD4A 4BYYA 4MX3A 2VXRA 1GBGA 3OGSA 2ELJA 3NEUA 4GALA 3UKVA 2Y2ZA 3TL4X 3SCGA 4GZ9A 3T09A 1HOMA 3POWA 1Y39A 2QUFA 2STTA 4XKBA 2VZOA 2B9UA 4XJAA 2XJQA 1CF7A 4Y5SA 5GLZA 5LY2A 2Y75A 1D4M3 2J22A 1HDPA 5JZGA 3DEUA 5CFDB 4HX4A 3NWSA 3CLPA 4QAWA 1Y8RB 2D3SA 5HS8A 1D7PM 1IG3A 5LLQA 1WJDA 4NC7A 5HNFA 4LOSA 5CKQA 4B8XA 1N1SA 2K46A 2W25A 4OMZA 3GTJJ 2WNUC 4XF1A 4XJ9A 4ASNA 2FCVA 4N9IA 4QPOA 1RPWA 3DPRB 1H8VA 3CCUI 1HN1A 1AR82 5F3CA 3PUFA 5A3UA 3H8OA 2Y6FA 2EIDA 3W21A 4QQLA 1MZ5A 4HK9A 1VE0A 3J7NA 4YM2A 2R3SA 2XASA 1IS6A 1DPRA 2XHKA 1F9NA 3DGTA 3VDCA 5FUNA 5D2AA 5LY1A 4RAYA 1US2A 3C3WA 3AZWA 2M0CA 5C4XJ 5C3RA 3MW3A 3ZMUA 5A6YA 3FBNB 3MDPA 2CUEA 4WXCA 3O5SA 2ZJPF 2Y6GA 4Y22A 2IW5A 2XAUA 2XPWA 2XF7A 1UCRA 4H0EA 1FBQA 1V0AA 5ED4A 2R0QC 1RUC2 3UNGC 1OC1A 5AVPA 4N43C 4IV1C 1W8TA 1YQAA 1RUD3 1FOXA 1FWZA 1QDCA 4GB33 1QOTA 4QPWA 4XABA 3HOZJ 3B73A 4BJTA 3K4CA 1N3QA 1XCVA 1S0EA 4G3YC 1BOAA 3GFIA 2RMU1 3E6BA 1WJFA 2NOGA 2IGMA 3X2QH 2AC1A 2E19A 2ORXA 3CO7C 5H9QA 4LE4A 2B7EA 3KLSA 3ABUA 1R7JA 5FRAA 2BOIA 4OOIA 1VBA2 4MFDA 1IN5A 1SFKA 4ANJA 4Q4X3 4HG6B 5D8AC 2JE7A 2XBO3 2VJXA 1HB1A 2HZTA 2VZ3A 3PTYA 5FOBB 1Y6IA 5ABJA 2RDNA 1ZHFA 2DJNA 4IEZA 4IO9F 4FPLA 1ENRA 3CCRI 1HXDA 4FHTA 3N9NA 3WCSA 3PFYA 1P7JA 1Y0NA 1J84A 3VD9A 3H1YA 5FZ0A 1SFPA 2LSOA 1P7IA 1IKPA 5L3BA 4YZ2A 1DIWA 5ACA2 3HRTA 1YQ5A 4GGGA 3G4SI 4FTEA 2HQ5A 5CZKA 1YQ8A 3BC8A 3BTCA 3F6VA 4EN8B 3VV1A 3KQ4B 4R9DA 4ZTJA 1WZ2A 3RG0A 4ZS2A 4YYOA 2DU1A 4AFMA 1LEMA 1QNYA 2ZEZA 2BV4A 1G3SA 2BZTA 4AEJA 4DMIA 3TOJA 4QXKA 3CF2A 2XONA 3ZR6A 2J1VA 3PNTA 4RM3A 2ZJQF 3JRAA 4WM8A 4YZ3A 5I8SA 3C7HA 4J01A 1QKQA 2BBAA 1RINA 4A7ZA 3WDWA 1PUEE 1MH3A 4BPZA 2VH9A 1UYXA 5A7SA 5L3CA 4ABZA 1JOPA 4Q0UA 3HT2A 4ARYA 3BPXA 2ZGRA 4E2QA 1RUE3 2HVRA 2HOEA 4L9TA 1SD6A 1SANA 2RGVA 4YVWA 4NPMA 3GZEA 3RZKA 1MS0A 1OKQA 3R60A 3VHPA 4U0VA 1UIJA 2X8KA 5BNQA 4B4CA 3M8LA 4PDWB 2HWC2 2PHUA 2K9NA 4C2TA 2DMQA 2DFIA 4QX5A 2E1OA 1YIOA 2K27A 1ASJ3 1G2HA 1YFHA 1MIJA 3AG4H 4X8NA 4BLJA 2Y26A 5HPOA 5FP4A 2ELHA 1POV0 1OSGA 1QXJA 2WR9A 4PF1A 1QHHD 1V3FA 4CXYA 2MD0A 4LNVA 4CEWB 3Q8BA 3RMXA 1XGNA 4P96A 1VBB2 4JKLA 2R5ZA 5GZEA 2TRTA 2LTPA 1TWAJ 1SLCA 5GAHJ 2P17A 2PA7A 3AFHA 4R8HA 3TN92 1W6NB 5JFRA 4D0PA 4IRIA 4IL6C 1PMJX 1LDDA 2J1TA 3AZXA 2WJSA 3VDDB 2ZXIA 5C3EJ 1AXKA 3E6MA 4DINB 3WZ1A 4XBLA 3GWZA 4ZU4A 1N47A 3UR3C 4BQ4A 1J7KA 1FJLA 5DD4A 3ZFEC 4CUBA 1QJZA 5JXJA 4KNCA 4LBQB 2IS1A 5GKAC 2LFBA 3DU6A 5DUVA 1C0WA 3C7JA 5C8CC 4SBVA 1LE8B 4HDVA 3I64A 3K9TA 4WBBA 2XVCA 4WZCA 2R1DA 3WTSC 5LATA 4BB3A 3H3UA 2YYOA 3DKWA 1COV2 3OGRA 2VE8A 2O61A 1D0YA 4NPLA 2K9MA 2DA2A 5IT9K 5DS9A 3WNLA 3K4MA 5IWFA 4AR2A 2XVKA 1POV1 2IGOA 3ASOH 2KLOA 1JUHA 1GVDA 3WU0A 3ZFGA 1FMD1 2LBFA 3BQYA 4LITA 1IRGA 1OLME 1OOPA 3TQNA 4XLAA 3K4DA 3VBOC 4JKMA 5FP8A 2A6YA 2XQRA