1O3TA

Protein-dna recognition and dna deformation revealed in crystal structures of cap-dna complexes
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
199
structure length
199
Chain Sequence
PTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation/dna
molecule keywords 5'-D(*GP*CP*GP*AP*AP*AP*AP*AP*TP*GP*CP*GP*AP*T)-3'
publication title Indirect Readout of DNA Sequence at the Primary-kink Site in the CAP-DNA Complex: DNA Binding Specificity Based on Energetics of DNA Kinking
pubmed doi rcsb
source organism Escherichia coli
total genus 47
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1o3tA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1o3tA01
1GQHA 5I8SA 4YSFA 3K1NA 4M71A 3WW1A 4AVBA 3BPZA 5LGUA 3GFLA 4OMYA 3TQNA 3V8JA 5LGTA 2QENA 4HLTA 3NSTA 5IT9K 2LF7A 3P7NA 3E97A 1R5HA 3H50A 4P9FA 1FLIA 3I71A 3SFZA 4KL1A 2D45A 4Y15A 5E1ZB 3ZMTA 1R00A 4HVQA 2EVXA 3K0LA 2PFBA 2ETEA 1SD7A 5DV5A 3E6DA 1G4DA 1DP7P 2ISYA 1E2XA 2XAQA 3KMHA 3FHIB 4EWEA 2XAHA 2R7FA 5JSOA 1ZGJA 3IC7A 3RYKA 3K1MA 4XF4A 5AIQA 1MDMB 3KP7A 5J48A 3FWEA 2QUFA 3H1MA 1JHHA 4D7TA 1OYWA 2D2WA 4MH0E 5KVRA 3ABUA 4QWQA 3CF6E 5AVPA 5J3UA 1ZNPA 2HYGD 3H3UA 4A6EA 4U7DA 2ZKLA 5CVRA 3ERED 3OOPA 2L4MA 1L3JA 2MA3A 4G94A 2A61A 3RKYA 2K0GA 1Z9CA 2ET1A 3WE2A 1ZG3A 3O14A 4XF3A 2V9VA 4DNCA 3HOSA 2YPRA 2M87A 4PIXA 4MEYF 2XV4S 1QQIA 2OA2A 3ZQ7A 1F1ZA 3QU3A 3WE3A 3IKTA 1WRJA 4BHPA 5K5QA 5HDGA 4HYEA 2ET7A 2MLKA 3P9CA 4HZFA 4ORFA 2W85A 2XIGA 2B8MA 3CLOA 2K9ZA 3FZVA 3I53A 3V8KA 4O5VA 2V1UA 1Q5OA 3WTVC 2Y48A 3L09A 3ISPA 2IA2A 2P6TA 5HDKA 4UVAA 1YFXA 4HVOA 3G7DA 3EQEA 1ON2A 3E3VA 2PI0A 4WBBA 4UV8A 2VC1A 1SFUA 1O3QA 3CO6C 3H7YA 3KZYA 3TDUC 3U11A 5HLHA 4HSJA 3IDBB 3MZYA 3WTWC 3C18A 4K2EA 1D3YA 1R1UA 2VN2A 4DQ2A 5E8GA 1P4WA 4IEPA 4A5NA 3I5UA 3TNQA 1J9IA 3SXWA 2UYAA 5FD5A 2OYZA 3ECHA 3JAMK 2PTMA 2D40A 5ICEA 3F6OA 2EV0A 1J3QA 3T8TA 2D93A 1SD5A 1YQAA 2P7VB 4GULA 1I5ZA 3VODA 5LRSA 2VBWA 3TKYA 4RB2C 5A2QZ 2F4PA 3H9AA 4EGYA 5BPXA 1X3UA 3OTFA 1IF1A 4PGHA 3G73A 4GGGA 4ONUA 2Q0OA 4PZJA 5CVVA 5CADA 3M9AA 4XFCA 1QBJA 4Q29A 4NB5A 4RGXA 4U0YA 3UKVA 3ACLA 2IP2A 3GX4X 2ZMEA 1Z7UA 3GFMA 4CO8A 2BYVE 4HQEA 4A5MA 2E1CA 1FP2A 4ENNA 1O57A 5H6QA 1FYKA 4B8XA 1P2FA 2W24A 1OMIA 2K7LA 2M45A 3FF5A 3NRVA 2XLAA 4EROA 1H9TA 2O03A 5L3CA 5FO5A 5BS6A 3FM3A 3JSOA 1HKQA 2M30A 3P9IA 3NL1A 2IXLA 1DGWA 4XETA 1USSA 2WV0A 2GXGA 1AOYA 3CO2A 4KWJA 2OQRA 5KHIA 3K9TA 3ABTA 2PJPA 4N0BA 5HS8A 4IESA 2P6SA 4HW0A 5FLJA 1Z91A 1EV7A 3KP6A 2CAVA 3GZ5A 2DPDA 4P9GA 1SFNA 2HS5A 2VT3A 2QQBA 1QWRA 2FA5A 5KK1A 3VB2A 2RQPA 1ZRCA 1T38A 2XHKA 2BEOA 3QACA 3TOAA 2EWNA 3WGIA 5IT3A 5JAXA 4CGZA 2ISZA 4ZYHA 4AVPA 5D4RA 3K2ZA 3F23A 2EFQA 3CJNA 3F72A 5FGMA 1O5UA 5H20A 3D0SA 4KYWA 2ZNZA 3SXYA 2FQPA 2MH9A 2GZWA 2A68F 3EUHA 5CVUA 5FLHA 4L2NA 2H6BA 2IW5A 2A6HF 1XGMA 4EJWA 5D5WB 3TOBA 3T0YA 2IC1A 3E6CC 1U2WA 3FHZA 1V3FA 5ICGA 4HDUA 1QXJA 3QPHA 5ILUA 2HKOA 4CICA 1BIAA 1TQMA 3I4PA 2ELHA 2XL7A 3DPTA 3V8LA 3I59B 5ICCA 1FI2A 1CX4A 1T98A 4HA8A 2J5PA 3MEXA 1UB9A 4YG2F 1IUYA 3TGNA 5F1RA 2H94A 3H3ZA 3GLXA 2KKOA 2L01A 3TO7A 2HZTA 4XFBA 4I0AA 3H8UA 5FQ0B 3NKTA 3I59A 1QZZA 1XSVA 4AVAA 1IN8A 2K4BA 3UKTA 2OZUA 1YFWA 2MNGA 2IXCA 3MAJA 3BPVA 1UW8A 3BROA 1TTYA 4PJYA 4Q48A 1KU7A 2IXIA 3ZN0A 4BQAA 1S7AA 2P17A 5LEJA 4OIRF 4MNUA 1ZVFA 5ERIA 1XRUA 4R1HA 2IVMA 4WVZA 2GH2A 1FBSA 3IL2A 2RV8A 1XGSA 4XLPF 3J7AO 2PA7A 4EWDA 1RTVA 4AIHA 3KETA 1U12A 4UBHA 1PUEE 2PMUA 4M6YA 5JFRA 4UHTA 2ACJA 5K5RA 1YIOA 3MQ0A 3GYHX 5D5UB 1Z1DA 2ZO4A 2BNNA 1CF7B 4E2GA 4UBGA 4HMZA 3RNSA 1R22A 1JGSA 2VBXA 3DN7A 4KFCA 4LK1F 2DO7A 2MBFA 1T6SA 5KHKA 2QCSB 2K27A 2EK5A 3H1YA 1CAWB 2QBYB 3KEQA 4IXAA 4HN1A 2FOKA 2PYTA 1Q1HA 4Q0SA 2A07F 1J7KA 3K1PA 1SD4A 4XFIA 4JV4A 4L18B 2N7GA 2YSRA 2PHLA 1STZA 2WWYA 1CAWA 2UZKA 2QBYA 5FFXA 3E5QA 3BP8A 4N9IA 2Q8KA 3JSPA 4L5JA 1RUOA 2KIUA 1PMIA 3EQLF 5CLSA 4Q47A 2GIVA 3VOEA 3GBFA 5CVJA 5DUIA 5FPZA 5D8KB 1DPUA 4OLLA 2PAMA 3SQNA 2QYOA 1UFMA 3HOTA 1D5VA 2UWMA 1Z05A 1KU3A 1J58A 3EDPA 3GW2A 4M9ZA 2A69F 3TO9A 5A2QK 4HV5A 4MQ9F 4AXOA 2QQ9A 3QP5A 1BC8C 3HHHA 2G7UA 3PLQA 5I0SA 4XFFA 1OYIA 4KN4X 3HRSA 1P4XA 3IWZA 4L0ZB 1K7AA 2R7DA 1W7PD 4MHGA 1HSTA 2FMLA 4YARA 1CGPA 4YFNF 1HKSA 1ZRFA 2EFPA 1IZ1A 4ZZDA 3BB6A 2V09A 3J81Z 1YW7A 2EFOA 4EGZA 1R7JA 2FBHA 2HQNA 1RIOH 4KT5C 2ADUA 4IJAA 3CLPA 1R23A 4IRGA 4TLFA 4ZU5A 3C7JA 3O6BB 2D5FA 4IEQA 4MGRA 5CJ9A 3SZTA 2L54A 2IA0A 1F4KA 2IXKA 5L3BA 4LULA 2D1HA 1ZHFA 4AIJA 1YFYA 1MD0A 4IEYA 2E7WA 2XRNA 3N97A 1K6OA 1J1LA 3DKWA 3FMSA 4LEJA 1LJ9A 1KU2A 3J80Z 4U7BA 2DK5A 4E70A 2IPQX 1RL3A 1RZ4A 2D1VA 1J3RA 1B9MA 1LRHA 4BAYA 2UXNA 2FE3A 3HQXA 3WG9A 3G3ZA 2XKPA 1T39A 2Q0AA 2DBBA 5JCTA 1EH8A 1ZG1A 4EQQA 3RJPA 2OU2A 3MCZA 1QPMA 4OINF 5JVTA 3BOQA 5BQTA 3PNAA 3F8NA 2RGVA 1G3TA 1L3LA 3LAGA 5BV6A 4FT8A 1A04A 2PAKA 1PP7U 3S0MA 2HTJA 4X6QB 4IEVA 3HYIA 1YUDA 2CGPA 5FLXZ 4IEWA 3ZMSA 3GFIA 1PP8F 3WTXC 4QM9A 5HDNA 3O2PE 3HHGA 2FU4A 1FSHA 4UVCA 2YR2A 1MJ9A 1MKMA 1HW1A 1DDNA 4ASNA 3IHUA 4Y17A 5DD4A 2CYYA 4RGRA 5FFZA 1ONVA 2ZKZA 4OMZA 4M9XA 5J6XA 3VEPA 2HFHA 5BOXA 4AQ6A 5H6RA 4L9TA 1R5GA 4MGZE 4JK1X 4LLGF 1FC3A 4XBFA 4LUKA 4EM0B 1RNLA 3S7IA 2Z33A 5JI6A 2OPKA 5CYVA 1XDSA 5AIPA 4JVAA 5ILVA 4PGGA 1ZZ7A 4A0XA 4HBLA 4MTEA 1MDMA 4AQ2A 5BUVA 3Q5FA 3ZMDA 3BU7A 2DPUA 1UHMA 4R79A 1O3RA 1ZAOA 5K5OA 5F64A 4QGMA 1H1IA 1JHFA 1NYWA 5D6FA 1WA4A 1OKRA 4RB1A 1PM7A 3OV8A 1FXZA 2UY9A 3HT1A 1XCBA 1I1SA 3LFKA 2FBIA 3KSCA 2FSWA 3FMRA 2PN6A 5K1YA 4HBNA 5KHHA 3U1DA 3D0JA 1YO5C 1TQIA 5EEHA 1I6XA 1SD6A 5ED4A 2EB7A 3CUOA 5D8LB 4WCGA 4XLNF 1BBYA 1EY2A 4YFKF 4O9EA 4LG0B 5DEQA 4BHCA 2ETHA 3E6MA 4XFGA 5EFUA 4A2UA 1TBXA 3ML6A 2IT0A 2VECA 1K78B 2UY8A 4ZZLA 3DV8A 3SHRA 4LG0A 4ZYEA 1RC6A 1G3YA 1KQ8A 3FX3A 2DQLA 4U88A 5C6CA 1FYMA 3HRUA 1P4AA 3P9KA 4QX5A 4ENMA 4Q0QA 1CAVB 2CV6A 1BIBA 4Q0VA 1IPKA 1ZZ8A 2MH2A 3T1BA 3WODF 1NZCA 2EFWA 2ATFA 3W6KB 4RD7A 3MFKA 3ST7A 1REPC 2RNJA 2BE5F 3WTTC 3LWFA 2O61A 3S2WA 3WTYC 1TW2A 2B5HA 4MUVA 3TNPB 2ZJ2A 3T8RA 3RTRA 3VFZA 3DL3A 2OD5A 3SCGA 4UUVA 2C6YA 4I02A 4AIKA 4HOBA 3OGJA 4P9UA 4D7SA 4XSZF 4YIFA 3JTGA 1XE7A 5JSRA 1QGPA 4JBAA 3KGLA 3ZMVA 1H9GA 2W84A 3GXOA 4M9SA 2RN7A 3CUQC 3I58A 1J75A 1LKNA 2ZNYA 2KIFA 1UIKA 2EA2A 3QP6A 1FYLA 3WTUC 4ZU7A 4BXUA 3NW4A 4EJVA 5FLIA 4XSXF 1DUXC 3BY6A 1UCRA 2XLFA 1ZARA 2X4HA 4F7ZA 3M7GA 3LA2A 4I0BA 2PG4A 4OIOF 4HQMA 4EVIA 3WGHA 2XAJA 4A12A 2O0YA 2Z99A 3MZHA 1XB4A 2XAFA 3J81K 4NVPA 3EETA 3QU6A 3PQJA 3K69A 2IXJA 5AONA 1SFXA 3NVCA 2L3DA 4ON0A 1BJAA 5JSPA 3RI4A 2C0ZA 3B02A 4RS8A 1QXRA 3H7JA 5D5VB 4RGSA 2AS5F 5BY5A 1OD5A 1HW5A 2E1NA 3E5XA 5LBQA 4XF0A 2G9WA 2FXAA 1Y9QA 2JZYA 4QMAA 2JPCA 2HKXA 3L00A 3I7DA 1ZG5A 1UIJA 2GXBA 1WGPA 2G7HA 4OFGA 2K86A 3H1WA 3WW4A 2FBKA 3JZVA 2V6CA 3J80K 2RDPA 3D82A 2PMHA 3EJKA 4HVRA 2M5WA 5HI0A 1MJAA 4M74A 2TDXA 4EM2A 4FHTA 4KDPA 3Q9VA 2BNOA 3KP3A 4M6XA 3LQRA 2QJVA 4IRHA 4A6DA 3LOIA 2XASA 2OA4A 2B0LA 3LQQA 1S8NA 5ICFA 5JHUA 1FX7A 3ZP5A 1P92A 5DCMB 1ZZBA 1BI2A 2VQAA 1IAWA 1YTYA 2GQQA 1VP6A 3CEWA 4BH9A 1ZZ6A 2ZBKA 3BJAA 2CW0F 4L9NA 3VHRA 1FBQA 4YYOA 3HSRA 4GYIA 4BNCA 5FLXK 2GAUA 2QLZA 2XVCA 4RB0A 3FMQA 3QPTA 2BNMA 1Z6TA 5HS9A 1D8KA 1HSJA 5L3FA 3QAHA 3WW2A 2DLLA 2BGCA 3F21A 2DT5A 2R3SA 5K8SA 2ZCWA 3F3XA 3PFIA 1EPZA 4CDGA 2JRTA 1B4AA 4IPAA 4IHSA 2KJCA 1H1MA 2KIMA 4KWLA 3R60A 2ESHA 2MLGA 2XGXA 3GO5A 5E18F 1ZRDA 1JE8A 1LDJA 1SFEA 3MPBA 2MC3A 4M73A 3RZZA 2M8EA 5T3NA 5FQ0A 4G7OF 1YLFA 2BBYA 2LNBA 5FB2A 2COMA 5I0RA 4HLYA 2O6GE 3KLOA 2ZXJA 3CDHA 1TQPA 5HLIA 3PQKA 1U78A 4QGNA 1C0WA 5E20A 2A5YB 2F5CA 1OR7A 4Y13A 5LEKA 4LTAA 1XDUA 1IPJA 1TQ5A 4YFXF 1IN6A 4Q4ZF 4UXAA 4XFHA 4AD9A 2H6CA 4L11A 3GF2A 3OF1A 3DEUA 1YFUA 1B59A 1U5TC 1ZRRA 1FWZA 1Y3TA 1E17A 1KQ9A 3M8EA 1Q3EA 3LZZA 5E8IA 3RIRA 3FZ3A 4G8XA 4QLCU 2IXHA 1KU9A 4IHTA 4I7HA 4I3PA 4G6DA 1CF7A 5I0TA 2Z3YA 3R6SA 1YG2A 3M3IA 4JTOA 4LLLA 3EBRA 3IRRA 3KFWX 4WXCA 1USTA 3OD0A 2JPBA 3IRQA 2E7XA 2O8XA 3R0JA 1S6LA 4PIZA 4XF9A 1HW2A 3V4GA 4QGLA 3HSFA 3DQVC 2OZJA 1X8EA 1UPIA 3RKXA 2RC4A 4MEXF 4I2OA 2DQRA 4E2SA 2PHDA 4LMYA 3QOPA 3KCCA 3R61A 1EH7A 4EJOA 3L7WA 3MDPA 2V79A 2QVSB 1MZBA 3ZMUA 5D4SA 4UV9A 4BHBA 4KICA 4EM1A 1OYYA 1YFHA 1GVJA 3U2RA 3CO7C 2XROA 2CSOA 5CVIA 3IWFA 5DCFA 3ETQA 3IKVA 4UXNA 3ZDSA 4IEOA 3HSEA 3BZ6A 3ULQB 5L3DA 2E9QA 1FBUA 4S04A 2WTEA 2XAGA 2Z9OA 3GVAA 3HTUA 4LUMA 1WSUA 4O9GA 1D8JA 5ILSA 3RYPA 1GXPA 1CAUB 4OIQF 3MWMA 1TLHB 1S3JA 1BI3A 4WWCA 4ZH4F 5I0UA 3GWZA 4MZUA 3Q9SA 4X6RB 2WFPA 1HXDA 4G7HF 4LK0F 4GCVA 4JTNA 3CTAA 3B73A 3SCHA 1KGSA 2L4AA 1EP0A 4MTDA 2CFXA 3L2HA 1HQCA 5LGNA 2A3SA 4ZU4A 4KIGA 3BWGA 1B1BA 2DU9A 2FMYA 2NS0A 1F5TA 1TW3A 1IXCA 3C3WA 4MV2A 4KN7X 2NNNA 2QQAA 5FD6A 3FXQA 2YX7A 1O3TA 2VBYA 3ZN1A 1R1TA 1W5SA 1KYWA 2BV6A 1ZX5A 2QNKA 3CJXA 4PIYA 4HV6A 4LFUA 4B09A 2K4JA 3WTSC 3WW3A 3BPXA 3CL1A 4GXOA 1U8RA 1ZN2A 1O4TA 2XLGA 1U3EM 3L2CA 5F6FA 1ZREA 2F2EA 1SMTA 2FRHA 1WI9A 4AVCA 5I93A 2GC0A 1SMYF 3DF8A 2VT2A 4D0PA 3RKWA 1JUHA 4F8AA 4XF1A 1L0OC 3HUGA 2A6EF 1IXRC 1R36A 3KP4A 1FP1D 3REOA 2FNPA 3PVBB 3ZPLA 3HIFA 2VOPA 3FXRA 5J7MA 2YX4A 1YWKA 3KEOA 3F8FA 3GUDA 1LDDA 5EEGA 3I54A 5BXXA 4HSLA 2VE8A 1RGSA 3TO6A 2KRFA 3V7CA 3ELNA 4FBFA 5HOOA 3FM5A 1T2KA 1HBXG 1W5TA 1NHAA 4G7ZF 1I1GA 2ESNA 4XRFA 4FAHA 1FT9A 2XKOA 3FFQA 1BM9A 1G3SA 4WF2A 2GC3A 1ZGAA 2VONA 4IEUA 3IBMA 3F22A 5FDBA 3RPQA 1BOAA 3WTZA 4G9YA 1YS7A 2NNYA 1X82A 3O3KA 1XSDA 4IEZA 2DFIA 1ZZCA 2PQQA 3BJOA 4Q0PA 2PLYA 5D1IA 4HX8A 1RI7A 1XD7A 5LHIA 1SEFA 1Q43A 2QVOA 1UD1A 4IETA 3NQOA 3SHFA 4P55A 2JTVA 4YRDA 3TDZC 4MGIE 5L3EA 5BMZA 2P5VA 5J8FA 1LVAA 5I8YA 4K8FA 1LNWA 3AAFA 2H09A 4Z2YA 1IRGA 4H7LA 4IVNA 5KBFA 1OFNA 2PBIA 4A0YA 1K78A 2GA1A 2YU3A 1UHWA 4WXHA 2P7CB 4IERA 3E6BA 4CZZA 4NQWA 2STWA 2HOEA 3FE5A 1BI1A 1DZRA 1CAVA 4WZCA 3BALA 4BYYA 1UCXA 5DD8A 3HTSB 1OPCA 1WLTA 4Z82A 5JR3A 2STTA 4IF4A 4ENJA 2HEOA 2CQKA 4LGWA 2B9UA 3COAC 2KXLA 4FAGA 4S05A 4JQFA 5DDGA 2Z69A 3V7RA 1I27A 2MD5A 2GA2A 3N4MA 2RKHA 3H92A 2D5HA 5E1RA 4L9JA 4LJZF 2EV5A 2OAZA 4WK8F 3OCPA 4LB6B 2EFNA 1FPQA 4KU7A 2X0LA 5LHGA 2DK8A 2ZFWA 4NHJA 3LA7A 5E16A 4KU8A 4PCQA 4EWAA 3NJZA 2ZMEB 1IRFA 2LF8A 3C1DA 3RPUA 1KQ0A 1WWXA 3MYXA 2M1BA 1NXMA 5LRRA 1YYVA 4J1XA 2UXXA 2PQ8A 3M70A 5JR7B 4CHUA 1J5YA 5D5XB 4R52A 5DYMA 2Q30A 2J5OA 1QNTA 1J59A 4WX9A 4KMFA 1GHCA 4HF0A 4BIFA 2FF4A 3T5XA 1ODDA 3U9GA 1ZH5A 1WQ2A 1LB2A 1FSEA 3BDDA 4Q0UA 3HRTA 3HT2A 1JXSA 1HKTA 1X7NA 2GC2A 3SZPA 4A0ZA 2DW4A 4QXKA 2DI3A 3U0ZA 4FX4A 2IJLA 4LD5A 2L02A 2F5EA 1IN4A 1BN5A 2HWVA 1YHFA 2JSCA 2EJRA 1DGRA 1FZPB 1S7OA 2HYFA 2VC0A 1VTNC 4OU0A 1IW7F 4HN0A 4PDKA 2GU9A 1XGNA 5TJJA 1S29A 5FCCA 3F8CA 2Y75A 2HJIA 4FX0A 2QWWA 4UNOA 2PAEA 4I01A 3CUQB 3ES1A 1OI6A 5EZWA 2KJBA 4AWXB 2PFWA 3JW4A 3R4KA 1RUNA 4ZYDA 2JT1A 3KZZA 4ENKA 2EAAA 3V7SA 1KA8A 2VBZA 1ULYA 1FOKA 1QO0D 1MGTA 1EYBA 2NYXA 2W57A 4OOIA 2OQGA 3CUQA 1ZZ9A 1LR5A 1R1VA 4ETSA 3R0AA 3EO6A 5IT9Z 1XE8A 1J3PA 4LA2A 1T0FA 5DCMA 1MJBA 4IEXA 1BC7C 1O7LA 3E5UA 4DINB 4ESBA 1R58A 4UVBA 1BI0A 4RAYA 4RAZA 3FJSA 1XCVA 3WU1B 1Y0UA 4KIBA 4META 2Y0OA 5BPIA 1SAXA 2GC1A 2IRFG 2P5LC 1B9NA 4GO1A 4R8HA 1NE4A 1LEBA 2MPFA 1AWCA 1FNNA 4LB5A 1YW9A 2EV6A 4U0WA 2EA7A 2O1QA 2Q4SA 2GWRA 1O7FA 2UYBA 4RB3C 3ELKA 4H0EA 3LAJA 2Y0MA 2O3FA 1V70A 4P96A 5LHHA 4EMSA 4QM8A 1X8MA 1ON1A 3IIAA 4EV0A 3IDCB 2IA1A 2H0VA 1DPRA 2CG4A 3I0TA 1WKMA 4WXDA 2CAUA 4HDVA 1YS6A 3LSTA 2P5KA 1ZLKA 3KLNA 4HX4A 3M1EA 4TV7A 3SMHA 4LLOA 1G6NA 2QZ8A 1B6AA 3C3VA 1LEAA 2HR3A 2QDRA 2DCTA 4J1WA 4GYGA 1H0MA 2OBPA 2EA4A 1O3SA 3LAPA 1O5LA 4ESFA 3DFGA 5I91A 1XGOA 2W25A 4KA4A 3M8FA 4HAMA 2I45A 1ZLJA 3ZMZA 4E2QA 5LLQA 4MQVA 4P5OA 1CAXB 2V1XA 1SQ4A 3LWCA 1VJ2A 5C8WA 3KE2A 3GYDA 5L3GA 1LQ1A 4YNIA 3FXUA 2Q2EA 1IN7A 3JTHA 2HTSA 2VE9A 5KHJA 3DXJF 4O6JA 2P4WA 5BPDA 1ZYRF 3USSA 3F8BA 1GXQA 3DP7A 1CAXA 2Q1ZB 4IRIA 4G6QA 2F5DA 4RGUA 4L0YB 3ECOA 2CO5A 1VR3A 3WU0A 2OZ6A 2P8TA 2XUBA 3GZ6A 2H27A 2V1DA 4KWKA 1EH6A 2FEZA 3EYIA 2Z5UA 3ES4A 2QM3A 3KP2A 4U0VA 4I09A 1FY7A 5HS7A 3S7EA 3JAMZ 4XFAA 1KYZA 2AXLA 2Z2SB 3RYRA 3DPLC 1TNTA 1J0RA 2HGCA 6PAXA 3KGZA 5CU1A 5HLGA 4ESJA 2XL9A 1W4MA 2HDCA 2PEXA 4CYDA 3HRMA 1U6GA 2LKPA 1Z6RA 4CXFA 4MGKE 2VODA 5KHGA 4O3MA 4MX3A 3KP5A 2NRAC 4L9VA 1G3WA 1U5TB 3GEZA 4KNYA 4KUMA 5FPXA 1NE6A 1LDKB 3EHKA 3D5LA 2VXZA 1P6RA 1QZYA 2VOOA 2NAZA 1PDNC 5HVQC 2HQRA 3ROUA 3BJ6A 1U5TA 2FQ3A 2VPVA 1CAUA 5E1WA 2LDUA 1K79A 4ZYGA 4HF1A 4HX7A 5DUKA 5D6EA 3F8MA 4M72A 2LSOA 2DTRA 5TRDA 3WGGA 3BCWA 3UKNA 1IN5A 4KIFA 3LA3A 3RDIA 1QY4A 3GFJA 2DAOA 5I8TA 3I64A 3SCFA 4L5IA 4N9HA 1YW8A 4MGYE 5J8CA 2K02A 2CWEA 4HLXA 1XSXA 3U10A 1GQGA 4LA3A 4XEZA 4KMUX 4EJUA 2FNAA 4Z07A 1XMAA 1W7PB 5E1XA 1XMKA 4OIPF 3QRFF 1DZTA 1YLLA 4LLNA 2WC2A 1V4RA 4B29A 3L9FA 2O8QA 4Q5SF 1J2XA 3F6VA 4I98B 3W6JB 1F9NA 5E17F 2MHFA 1IXSB 1TNSA 1W7PA 3EYYA 4HF2A 2RVCA 1XN7A 4EJTA 2F5FA 4YIIA 3NEUA
chains in the Genus database with same CATH superfamily
5FY0A 1VLNA 4D7NA 2LY9A 1G2HA 3K1NA 1W3VA 4DJAA 1NUKA 4OMYA 2BFUS 1BVP1 2VQHA 5LGTA 2QENA 3QODA 3UR3C 3WG3A 3E97A 2YMZA 2GNDA 3SFZA 3GALA 1DF0A 1W8OA 1QJX3 2D45A 4HVQA 2EVXA 3K0LA 2ETEA 3BC8A 1G4DA 1DP7P 2XJRA 4ASKA 1E2XA 1W6OB 3KMHA 2ID6A 1J83A 4EWEA 1VQ7I 5FAXA 3CJIA 2R7FA 1XTAA 1ZGJA 1D1CA 4CEWC 1IS4A 3LSRA 2R32A 3GTGJ 3DKXA 1OYWA 1VQ6I 5KVRA 1WA6X 5J98B 5J3UA 2A6ZA 3RFRA 3I97A 4BXSV 3OOPA 1WBFA 3BQZA 2MA3A 2H1LA 4G94A 2VJIA 2K0GA 2XVGA 3WE2A 5ABJB 3FKJA 1LKXA 2YPRA 3ZN5A 2ZS6B 2NVUB 3IM0A 4NC8A 2EIJH 5BNNA 4BHPA 5K5QA 3NWTA 3ABKH 3HOBA 4Y22B 3AMQA 4HZFA 1W36C 2J1SA 1NXD1 2W85A 3MIGA 2HWE3 1AR62 5FYYA 3QOEA 2K9ZA 2LH9A 5L19A 1BR4A 2V1UA 2Y48A 3QH6A 1B09A 3L09A 5FP7A 3ISPA 5HDKA 1QU3A 4J01A 4DW6A 3S1QJ 1ON2A 3OS1A 4WBBA 1AX0A 4AEKA 2Y9ZA 3NV2A 3DLAA 1X9TA 2GNTA 3LKJA 1SFUA 4FFFA 4LBOA 1V6OA 2E60A 1OKOA 2WFF1 4S2DA 3Q8BA 2J22A 4NHKA 1I3QJ 1N47A 1AF9A 5FPAA 2E1MB 2IS6A 2EXIA 2VMCA 3W2VA 4DQ2A 1ODMA 3HOWJ 3I5UA 3TNQA 1ACCA 2RS11 4HT1T 2VZ1A 3J8F1 5FD5A 1PUFA 4PHZA 3ECHA 1JYIA 3SH5A 2HWF3 4QWNA 4DGWB 3VKLA 2WT2A 5ICEA 3F6OA 2EV0A 2AUYA 1VFCA 1AR92 4FOQA 1TL8A 4CU6A 3VODA 2VBWA 3TKYA 4RB2C 1PNGA 1IF1A 4NPMA 4ZTFA 5EJZB 4BOWA 4ONUA 4D3WA 4DRRA 1UXXX 4BUPA 2G1MA 5CVVA 1BMV1 1GT0C 3JCUC 4UFJA 1TNRA 5G04L 4RGXA 5C3QA 4X1EA 3UKVA 3ACLA 4RDUA 5FKOA 1N1TA 4GH4A 2CQ7A 2DTYA 1JZ7A 2MABA 1VB2A 4CDWC 4A5MA 2E1CA 1QQP2 4ENNA 4BK5A 2FDGA 5A32B 1FYKA 3ZKUA 3Q8CA 2W24A 4PDWC 3B6CA 2P3IA 3POSA 2ZGOA 4CH7A 3ILFA 3KZ4C 2CL2A 4CCLA 5FZAA 4B47A 3SEZA 3IKWA 1JXNA 4PBPA 2Q8DA 3FM3A 1COV2 1D1BA 4KT6A 2Y34A 4KG0A 1OQEA 3NNGA 4LO8A 4P5YA 1WD4A 3P9IA 1XPXA 2HVQA 4RS5A 4B1MA 1AOYA 3GHMA 2L9SA 3MLKA 5KHIA 4GMP3 3ABTA 2PJPA 4N0BA 2P6SA 5FLJA 1Z91A 3FXKA 4GJZA 1EV7A 3KP6A 4D6QA 5C4WC 4BQYA 5FREA 4JX5A 1YJWI 5IY5H 1QRYA 1ZRCA 2G4IA 3VBOB 1T38A 1YE9A 4YW4A 1R092 4PLNA 3QACA 3A4UA 3ONQA 5IT3A 4BACA 2IXSA 1APLC 3BT9A 2EFQA 2A7AA 3MPPG 3O0XA 2FQPA 4AFMA 1E57A 3AVRA 4L99A 4M3EA 5JMCA 1FTZA 4ZY9A 3ZMNA 2JEMA 1UOFA 3Q8EA 2E6VA 2JRMA 5ILUA 2IZWA 4CICA 1BIAA 1TQMA 3I4PA 2EZIA 4A93J 1VQ4I 1FI2A 5ICCA 2OTJI 1JYXA 1JHJA 1S9HA 1W2OA 1IUYA 3TGNA 1GNZA 3H3ZA 4LLFA 1LENA 5BNOC 3I59A 1IN8A 4E6KG 1PO12 2HDDA 3OEBA 2OZUA 1YFWA 2W1WA 1UW8A 3HN1A 2K46A 1KITA 4PJYA 2JWTA 2K85A 1KU7A 2VW0A 3ZN0A 2B7EA 3H9QA 4XMYA 3ZR5A 4M3FA 4MNUA 5GZCA 1RUE2 2W68A 4R1HA 4GIQA 3I3QA 2GH2A 4BQ1A 4CPBD 2RV8A 1XGSA 2LFBA 4XLPF 3J7AO 4EWDA 2OIIA 5CFCA 4YW1A 3VYSB 1W39A 2VVFA 1PUEE 3BKZA 2PMUA 1EUTA 5JFRA 1VQMI 2ACJA 1RUC1 4JKMA 3MQ0A 4K8RB 2ZO4A 2OPWA 1FIAA 3W20A 4FQ4A 3WHCA 3RNSA 3UESA 2VBXA 3DN7A 4UF0B 1T6SA 1LCLA 2D5VA 4UFLA 3W5NA 2C24A 2ILMA 2ZA9A 1JODA 3QBQA 2QBYB 2L5QA 1RXGA 4IXAA 3WF3A 4HN1A 1Q1HA 4Q0SA 2GM4A 2YGLA 1IQDC 4B4PA 4XFIA 4KGGA 4JV4A 2DMTA 5B1AH 4C3JJ 2EAKA 1MMNA 1ZKGA 3E5QA 3PIGA 4N9IA 1TWFJ 3WINE 5DG1A 4Y20B 2Y6LA 3HZJA 1FPN3 3DTIA 3EQLF 2JICA 1A78A 2E32A 5DUIA 2JDZA 4BY7J 5C44J 1H30A 3VYUB 3SQNA 2QYOA 1D5VA 2OQ6A 1O8SA 1WJ5A 3JU9A 3LPFA 4BLIA 1X4PA 5A2QK 3AYEA 1X4OA 4HV5A 1QHGA 4ISRA 2E31A 2EALA 3PLQA 2ZX3A 4WM8B 1OYIA 2JG9A 3IWZA 1P4XA 4L0ZB 1QHHD 1IRXA 1FAYA 1HSTA 4JGZA 5HLTA 4HK9A 2BV4A 1HKSA 1ZRFA 3O1TA 2EFPA 3W21A 5IW0A 5K7HA 2V09A 4FXKB 1YW7A 2EFOA 1HN0A 4EGZA 3M8JA 2FBHA 1LUJB 1PO21 4YVWC 4P9JA 1UOBA 5F04A 2ADUA 2LKSA 1F4HA 3CLPA 3O6BB 4MGRA 4FFHA 1PGW2 2L54A 2WUHA 2WYSA 5L3BA 5EGOA 3J7ZI 1EV13 4LHLA 5FJKA 3VDCA 4IEYA 1J1LA 3DGTA 2ZB9A 3ZYIB 4AHXA 3OPTA 3T0DA 4U7BA 1SLLA 1RZ4A 1OHFA 5D8AB 4BAYA 3L2UA 2EIKH 2NQYA 2DBBA 2QTWB 4BJ5C 2VZVA 4RQPA 2W46A 3IPVB 3AKPA 4H7MA 2WAAA 2OU2A 3NAPA 4NHMA 1IC8A 1GNHA 4GA9A 2QQWA 4M0HA 3AC0A 3F8NA 2RGVA 1L3LA 3LAGA 5BV6A 5C3RA 4XICA 3LSGA 4CDQA 3KD4A 4X6QB 2XBO1 2VG9A 4UW3A 4CU9A 5FLXZ 4IEWA 4YLZA 3ZMSA 4IXLA 3HHGA 3LEMA 1FSHA 4JGYA 3LFMA 1MJ9A 3B3QE 3H8OA 2V7FA 3G6JB 3IHUA 1BEV1 4B3AA 5DD4A 3Q3SA 5FFZA 2CQQA 1ONVA 1IS3A 4OMZA 2VB6A 4BQ2A 5C33A 2R042 2VUJA 4CDUC 1UO9A 4LHNA 2C5DA 1N1SA 4EM0B 1RNLA 3S7IA 1AYN2 4EZ4A 2J1AA 1YHQI 5CYVA 2BY1A 1JYVA 5FK8A 5ILVA 4HBLA 4MTEA 1MDMA 2J1TA 1H88C 4AQ2A 5BUVA 1EKEA 3KF5A 3B01A 1HCRA 3BU7A 2GLOA 4R9CA 5K5OA 2VZRA 4C2TA 2DT7B 5FJHA 5D6FA 4QB6A 2QQKA 1OKRA 4RB1A 1DGRM 3VKNA 1OF3A 3OV8A 1ZBE1 5KXCA 3ZSLA 4AZZA 1R1ZA 2XB6C 5DZEA 1GKBA 3VB9A 2W52A 2ARCA 1BA5A 1YO5C 3OYNA 3TEZA 1TQIA 4XUOA 3E1SA 3LSEA 4WCGA 1CZTA 4LG0B 2ETHA 1FOD1 3E6MA 4Y52J 4OMCA 4XOPA 4Y3OA 4CYCA 5A33A 2QQNA 1K3IA 2VECA 4XLFA 5FZIA 1G3YA 4U88A 2VL4A 1D0ZA 2WNUB 3SZGA 5D2AA 2ARBA 1BIBA 4XXPA 5FZDA 1ZZ8A 1GYKA 1AHSA 1NZCA 2EFWA 1PIV2 4G4FA 3MFKA 4CEWA 5FO8B 3PVOA 1JKQC 5FZOB 2BE5F 3EMRA 1Z3XA 3LWFA 2MW8A 4TTGA 3WTYC 2PQSA 4QPQA 4QQOA 3G6EI 4MUVA 3CC2I 3CQOA 5GPAA 1SBEA 1W0NA 3AKRA 1O4ZA 4GDFA 4PSXA 4LO5B 2EIBA 2FCTA 3WD5A 2C6YA 4QPGB 4NC7A 2UWAA 4HOBA 4LO6B 2W5FA 2ZGMA 3OGJA 4XSZF 4YIFA 3S8PA 1XE7A 3U1KA 3VV1A 4JBAA 3OY8B 4HNTA 2W84A 1KEXA 4DMIA 1UIKA 5H9SA 1RUF2 1T0FC 3POYA 1K45A 3BY6A 3AX4A 3CMYA 2WJSA 2DFFA 1V00A 4YGCA 2RJKA 3K51A 2WZR1 3OPZA 5F08A 5C9AC 2PG4A 1Y39A 1G9DA 4OIOF 1US2A 1YYNA 4HQMA 4EVIA 4A12A 3OGSA 2JA5J 1XX5A 3MZHA 2XAFA 2IGNA 4NVPA 1V6JA 2JDMA 3CCMI 3K69A 2IXJA 5AONA 1SFXA 1ZRIA 3UL2A 3Q0VA 2C0ZA 3B02A 1QXRA 2WYFA 1H8TB 5D5VB 3KT7A 2BPA2 1OD5A 4XF0A 3HDDA 3ZQCA 4FXGB 1T8IA 3I9V2 2RM22 1AR93 1Z21A 5JLXA 1ZG5A 1UIJA 1WGPA 3WW4A 4ATFA 3JZVA 3J80K 3CF5F 3D82A 3EJKA 4AQSA 5M5YJ 4NR1A 2TDXA 4EM2A 3Q9VA 2LROA 5DAVA 1JYTA 1OXCA 3RG0A 1MSFC 4IRHA 2B0LA 1F5FA 2PLV1 4CEYC 4DB5A 1ZZBA 1IAWA 4MOAA 1QQP3 4DOZA 3BJAA 3VHRA 4EZHA 4TLGA 2BTVC 4QB1A 1SPPA 4GYIA 3WP5A 3N3HA 3H0OA 2QLZA 4FETA 4RB0A 4CDWA 4BCUA 4HPKB 4QHBA 5HS9A 1HSJA 5L3FA 3WW2A 3FISA 4PDWA 1HRI3 5DUWA 1ND3C 5F3GA 3UGFA 4AW7A 4NWVA 4OVEA 5AC91 5FY1A 2XF5A 2HNHA 1V9U1 3RZOJ 3VD4A 4EQVA 1YC61 2H0BA 3FBIB 1B35A 3ZVXA 2A05A 2NZ9A 1JE8A 1LDJA 3BIEA 3MPBA 4AOCA 2A6VA 1XQNA 3NWSA 4C3HJ 5T3NA 2RMU1 4KNCA 1FV2A 3N35A 1HQLA 3LPGA 5C4WA 3K7AJ 3KLOA 3OSDA 1RETA 5GLTA 4Y4RA 3K48A 1QJY1 5FKKA 1W2TA 4DS0A 1HV0A 5A3WA 2A5YB 4Y13A 3JBG3 2BP6A 3SH3A 3W5MA 4YFXF 4N53C 2L9VA 4FPLA 2HQ5A 1K6YA 3A22A 1VAVA 2CMPA 3GF2A 4XOTA 1A31A 2IFRA 4JDOA 2GH8A 3C8XA 2BZDA 2P0WA 1Q8PA 5A70A 4QLCU 1KU9A 4EYUA 4F55A 1H2KA 2VXJA 2Z3YA 1ETOA 5GADJ 3AG4H 4LLLA 2CH0A 2ZJCA 5FRAA 2CTVA 2HWD1 2G9GA 1QH6A 3BU0A 1PO13 2E1OA 1HW2A 4QGLA 2ZTNA 2P1BA 4CU8A 4O7XA 3HSFA 2ZACA 3PJQA 1X8EA 4HONA 2DMNA 3HKZA 1UPIA 3RKXA 2Q8EA 4MEXF 1E3OC 1ND2C 4Q1RA 4E2SA 3QOPA 4MXVA 1POQA 4YFWA 3IV5A 3MF9A 2WY7Q 4BQXA 3MO4A 4M6VA 4R4ZA 1ULGA 2PELA 3LGRA 3USUA 1Y8QB 3MHZA 3U2RA 4O65A 2CSOA 5CVIA 2QCOA 3IWFA 1YJKA 2QF7A 3IKVA 3NJXA 1R9TJ 3T1MA 3JXSA 3QCWA 2OT7A 3HSEA 3BZ6A 5A3PA 1NG0A 3I3BA 2WZEA 4XLCA 2WTEA 2TCTA 1WZXA 3HTUA 4LUMA 1WSUA 1GXPA 4N90A 1HLVA 1US3A 1PVEA 2WDBA 4MO3M 3MWMA 3GWZA 1XE0A 3Q9SA 4RN5A 2CSGA 1HXDA 1HB4A 1TVGA 3I4IA 4LK0F 4YW3A 1VMJA 3CTAA 2BGOA 1SFOJ 1KGSA 2L4AA 2E36A 5HCAA 2CFXA 4MADA 5LGNA 3CZ6A 3BG5A 4ZU4A 1W0UA 2IGOA 2LVSA 2DU9A 3VBFB 1QF3A 1F5TA 1JZ3A 3K4JA 2CW8A 1ENHA 2NNNA 2QQAA 4MG2A 3FMGA 5E88A 3FXQA 2AC1A 1WW6A 2YX7A 3T0BA 4BY1J 1O3TA 3ZN1A 1PJRA 1O59A 2JE9A 1XOYA 2MGQA 4YGBA 1IQAA 1U5ZA 1ZX5A 4YZ3A 4LFUA 1RVF3 2F4IA 3N7JA 3WTSC 1ASJ3 1U8RA 2ZXQA 1O4TA 2WNVA 2W08A 1HQNA 1U3EM 2RJ2A 4QX1A 1XC6A 4BJTA 5F6FA 3HUGB 1ZQ3P 4NN0A 3R4SA 1SMTA 2FRHA 1WI9A 1PVC3 1OURA 2VULA 1OCOH 5ABJC 2VT2A 3ZN4A 2BDRA 1OF4A 1IUFA 3PVBB 2ZJRF 1BQPA 3CNAA 2D6MA 1EUUA 2W3JA 4IHWA 2YX4A 1OPOA 2W47A 1W9WA 4NE9A 2WFF2 4AVSA 3RQ0A 4AI2A 4YVWA 3CJIB 3H9GA 5EEGA 1S72I 4MGSA 4A3CJ 1H2MA 3HMYA 3IAPA 1LEMA 3M3CA 4NBQA 4HSLA 4EN9B 4C0HA 1YIJI 3ELNA 4FBFA 2DF7A 2ZEXA 2MD0A 4LPLA 3OYAA 1HBXG 5IHRA 2KA3A 2VKVA 4PF1A 1P9QC 1TE1B 1BM9A 4ZJZA 3ZXDA 3GTLJ 1G3SA 3GHNA 1ZGAA 3AMNA 4XL9A 4C9YA 2XB5A 1OLME 1MBGA 1CJDA 1HRV3 3F22A 3JD72 1BMV2 3L2WA 5JPMB 2E1MC 5B1BH 4R9AA 1K4SA 4Z1VA 4YW5A 4FTBA 4FSJA 1YS7A 5BNNB 2DFIA 4AK3A 3FXOA 4L92A 3BJOA 4JHZA 1VRH3 4FFIA 3I55I 1JU4A 4GWJA 3OYDA 3BTAA 5JOYA 4UYBA 1Q43A 2K9SA 3NQOA 2R0FA 3H1CA 1WJFA 5L3EA 3CZJA 1XS9A 5J8FA 5LA9A 1LNWA 2HI3A 3OOXA 3KX2A 4H4KC 2HPMA 4Z2AA 1YJNI 4XMIA 2PBIA 1YI9A 2GNMA 1E5HA 4QXBA 1IJWC 1YJ9I 1K78A 1MVEA 2R5YA 3PUFA 4WXHA 3D6EA 1O6UA 2P7CB 1CWPA 3LFUA 3RKQA 4CZZA 2STWA 2W95A 4CDUA 3FE5A 1CAVA 4BQ3A 1A6CA 1UCXA 4UI9L 4FE7A 2AR6A 4QX8A 3ZFGB 1R64A 1WLTA 5JR3A 3MW3A 4IF4A 1JT6A 2PX9A 4CCKA 4M3GA 4LORA 4S05A 4RHV1 4JQFA 4QPIA 5FMDA 5FKLA 2LKXA 2ZABA 2MD5A 3EUKL 5IVEA 3RZDJ 5A7OA 1KXGA 4YWAA 2E2HJ 3ZYHA 2XR4A 4LJZF 2EV5A 1FPQA 3JRIA 2DK8A 4P9LA 2W00A 1S5LC 4NHJA 4XK4A 3IMMA 4KU8A 5GLUA 3H5AA 4PCQA 2K5CA 2ES3A 4HNVA 3RPUA 4UOJA 3VBOC 3MYXA 2V5DA 5FP4A 1F15A 5A6YA 4J1XA 4XNFA 3M70A 1LOAA 1CVNA 5JR7B 4R52A 5D5XB 5DYMA 3POGA 4FFGA 2CRGA 4WX9A 2R072 4KMFA 2Y31A 4BIFA 2FF4A 4P9WA 3T5XA 2DFHA 2DU1A 3BQYA 1FSEA 2FBEA 5T5JA 2DOFA 2V4AA 4XHXA 3HT2A 1T95A 2RQQA 4A0ZA 5F27A 5TGTA 1APNA 2Q8OA 4RS5B 1F43A 2LMDA 4BZ4A 4XVHA 1R1A2 2P37A 2BVVA 1GP6A 2VC0A 1HLCA 2JE7A 3V65A 3OS0A 3SH4A 2GU9A 2D6NA 5TJJA 5FCCA 5IP9J 2HPIA 4JRLA 4URTA 4UNOA 2K40A 3ES1A 5EZWA 2MC4A 3R4KA 2WS91 3POFA 2R061 1JN2P 1ZBA3 3RQIA 2WO2A 2M2EA 3MMYB 5IK7A 3P6BA 3MZ8A 5J47A 5EDNA 5IT9Z 1J3PA 4PI0A 1T0FA 1XMXA 1MJBA 1BC7C 1VBE1 1O7LA 3AZYA 1U5YA 4UVBA 5KHDA 3P5JA 2LBFB 1YQCA 2VGDA 1WW7A 4JYKA 4Y4YA 5C9AA 4QKFA 1TP4A 4AI3A 1HX6A 2D3PA 1C8M3 5BPIA 2I07B 2BOJA 5FZEA 2QZ3A 1O91A 3D1NI 3VDDA 3D4KA 4LBNA 5A3MA 1FNNA 2O1QA 4RB3C 5ANQA 3OL3A 1QHDA 2Y0MA 4P96A 5LHHA 4EMSA 3FK6A 1ON1A 5IVBA 3CP2A 4BQ5A 4EV0A 4NRQA 4XBNA 3IDEA 4Y1VA 3WHUA 3AG3H 4U2AA 2ZEYA 2CG4A 2JVGA 4XDPA 3LSTA 4HX4A 2WA4A 4TV7A 1WH7A 3ECQA 4QIWN 3J7HA 1B6AA 1W03A 4F92B 2VI6A 4KG8A 1GP4A 4PI2A 2LTNA 1I1EA 4YG3A 1UZ0A 3UK9A 2F48A 3ACFA 2QDRA 2RDRA 3O0VA 1ZA7A 3DU6A 4DBQA 3VBRC 1TZOA 3OSFA 1RUH2 1GU3A 1PYVA 5FWJA 1PO22 3M8FA 2R4GA 4HAMA 5FZLA 5DQ0A 3ZMZA 5A7SA 1UMQA 1OA3A 1AXZA 1CAXB 4IE5A 3LWCA 1JS9A 3ILRA 3KE2A 5F32A 2CYFA 3FXUA 3SEQA 4U36A 1ZYRF 4LXLA 2JWPA 3NV3A 1ND3A 4RGUA 4DYRA 1X50A 4I99C 3VHNA 3WU0A 3PU3A 2P8TA 2XUBA 3LDKA 4LBQA 1AR81 3BR2A 2XJTA 4YW7A 1CIWA 1TME1 4KWKA 1EH6A 1NQJA 4NO4A 2Z5UA 1RMU1 2VIXA 3ES4A 2QM3A 1W6QA 2JN6A 1QGLA 1UZZA 4I09A 2D6PA 2PN5A 2Z2SB 3CMEI 2JB4A 3DPLC 4Y33A 2ZEZA 1HB2A 1RUG3 3LQCA 2XBO2 1UKRA 1VBD2 1V6KA 4GFBA 2L7KA 1Y43B 1HDPA 3ASOH 4MGKE 1DDLA 4M4RA 5D8AC 4JX0A 4O3MA 5JOXA 3IZOA 2JG9B 4EN7B 3GEZA 1W8TA 3S1MJ 1NE6A 2DOEA 1BEV2 2VBPA 4JGZB 3J7MA 3D5LA 5A7NA 2ZGPA 2VOOA 4BXFA 2NAZA 2EZHA 1DGRN 5HV0A 1CAUA 2W9XA 1LHNA 1GANA 1V6LA 3PUHA 3BCWA 5EGOB 2G9FA 1W99A 3AFKA 5FLVA 3RZHA 1VZ0A 1VIWB 2JX9A 2JB8A 3RDIA 1BK0A 3WCSA 3SCFA 1UZWA 3GZEA 4LBLA 1QJU2 1ZBE2 2K02A 1ND2A 5FMOS 4HLXA 1IG3A 4LA3A 4Z07A 2LY1A 2XGCA 2QKDA 4OIPF 2WC2A 5F5CA 1UY1A 1UZCA 4R9BA 1WBLA 1J2XA 4I98B 1F9NA 1FOD2 5E17F 4B44A 3OGGA 1NA1B 1QIQA 4EJTA 4CDQB 3M4FA 1WW5A 4L0PA 5I8SA 3OYHA 2HWC1 1IG0A 4IO9F 1WCUA 1FEXA 3TQNA 2R7VA 3NSTA 4JGYB 3P7NA 2F17A 3I71A 1DZQA 3OYLA 5LBEA 4KL1A 5FYCA 2I8DA 5TISC 5IVYA 5E1ZB 3ZMTA 1R00A 4Q8LA 1GSLA 3DCFA 2PFBA 5DV5A 1D7PM 1BR1A 4FPKA 3WUCA 5F7UA 2HEVF 2ISYA 3KS7A 2XAQA 1GZTA 4RGAA 5HNFA 1C28A 3PSIA 3FHIB 1LGCA 1REEA 4BISA 2XAHA 4E4ZA 2FZ2A 3ZO0B 4KISA 4XRSG 4HNUA 3I2FA 3IC7A 3NMBA 2DT6A 1QNWA 5DAWA 2WNUC 3RYKA 4IDZA 1MDMB 2CJJA 4NIGA 3KP7A 3WU2C 5J48A 1W6OA 4CCEA 3LSIA 3H1MA 2HVRA 2D2WA 2PMZA 1UY3A 5LASA 2IS4A 1DGWX 2D43A 4A6EA 4U7DA 2ZKLA 5E3LA 4Q4W2 3UYJA 1L3JA 3L2QA 1G59A 2A61A 1Z9CA 3K4ZA 1HDDC 3JR9A 2QQIA 1ZG3A 1HIXA 3O14A 2XAUA 4DNCA 5DAQA 2AO9A 2OA2A 5GZFA 5EQUA 4QPGC 1W9YA 1F1ZA 3WE3A 1W8FA 4S2GA 1JKPC 4AHYA 1WRJA 3OMYA 1DLCA 5HDGA 4HYEA 2WFF3 3AYCA 2MLKA 3P9CA 4N7IA 4CYCB 3NARA 3J4UH 4AC0A 3VL8A 3FZVA 3I53A 4W4ZA 3V8KA 1JOJA 4DXTA 1AX2A 2RS13 1VPHA 3J8F3 2D3RA 5JXIA 2IA2A 2W87A 3PJRA 3VZJA 1SLIA 3FUOA 4HVOA 3G7DA 3T1LA 3DTKA 1DQUA 3E3VA 4CEWB 4BE2A 1VB4A 5KXDA 4YZ4A 4ZYAA 4JRAA 4COVA 4GB31 1QDCA 4ZXKA 2RHPA 1G9AA 3M3EA 3TDUC 3U11A 3PL0A 4NOTA 3IDBB 3J7NA 3WTWC 3C18A 4GALA 1GUIA 2VN2A 1P4WA 4UUSA 4A5NA 3WCRA 1MBEA 1SG3A 2DYCA 2R7UA 2RDNA 2UYAA 3POWA 2OYZA 3JAMK 2VE1A 2PHRA 2P3YA 2CY6A 4D7MA 3T8TA 2D93A 2ZGUA 1YQAA 4GULA 1I5ZA 4H14A 4QPOA 4YVSB 2R7SA 1VBA2 5BPXA 4PGHA 3G73A 5KNLA 1LNSA 2Q0OA 1AXKA 3TEYA 4LKSA 2ZX0A 5CADA 4XKCA 5IP6A 1JJ8C 1XJAA 1SLAA 2W82A 4U0YA 2B4KA 3DPRA 3WX5A 3CESA 3GFMA 2DURA 4Q4Y1 4HQEA 1FP2A 2HLEA 5H6QA 3G2BA 3OUIA 1P2FA 2OVUA 2M45A 2JD9A 1YEWA 1TNFA 2ZXHA 3U75A 1JMUB 2D97A 2XLAA 3ZXGA 5A32A 4MFDA 2HOSA 1H6YA 4KWUA 2O03A 2RMU2 5L3CA 1AR61 4JCKA 3CCJI 5FO5A 1X2NA 3CJQB 1MZ5A 3FHQA 5EJ3A 2M30A 4ES9A 5C7GA 3NL1A 2R7XA 4JDMA 2JDAA 2GXGA 2PHTA 1S2BA 4KWJA 5DDJ1 3SITA 4IESA 1AKHB 1STMA 2VJ4A 3GZ5A 3G1LA 3DYMA 1DQ2A 1MIJA 3O8GA 1IKPA 2QQBA 1CPNA 3LSKA 5KK1A 1W8WA 4A3LJ 3WV6A 2XHKA 1WFXA 3AG1H 3H35A 2EWNA 3BOPA 4O61A 5FZMA 4GKXA 1SPPB 5FWEA 3F23A 3CU7A 3M3YJ 3VBOA 3CJNA 4CDWB 2HWD2 5H20A 2FOWA 3MIDA 2P2KA 2GZWA 2MFZA 2A68F 3EUHA 1UY2A 2BZTA 1OUSA 1ZTRA 2A6HF 3CCLI 1XGMA 4A3GJ 1C57A 3T0YA 2IC1A 3VSKA 3FHZA 2VBDA 4NIAA 1QXJA 3QPHA 2HKOA 3KEYA 3DPTA 1B35B 3WQ1A 3Q0UA 1CX4A 4HA8A 5A3TA 3C7FA 3GLXA 4DO0A 5LA0A 3AP5A 3LEGA 1RUC3 5IFTA 1XSVA 2K4BA 1UELB 1IKQA 1O4XA 2IXCA 3BROA 2XMLA 1ETKA 2VY0A 1UG0A 2ME0A 4XJAA 5GZDA 3SNMA 4Q48A 2A3XA 3KWVA 5LEJA 4OIRF 3ZPYA 5ERIA 3S57A 1ENXA 2PHXA 3PNVA 2M0MA 1COV1 2IVMA 1JKRC 2ZGKA 4K7JA 4WVZA 1WJEA 1UG2A 2D6KA 5GZGA 1RTVA 4AIHA 1U12A 5C3OA 4LNVA 2WAEA 2V26A 4M6YA 1O4YA 4UHTA 1Y4WA 2KQRA 5K5RA 4M0NA 3BTIA 2NN8A 3GYHX 3SLIA 4X0GA 1Z1DA 2BNNA 4DPNA 4E2GA 2OJED 1R22A 4JP0A 3GJAA 1ALYA 5JIUA 4LHSA 3BTYA 4LK1F 4F3JA 4LOCA 1IDZA 5HPOA 2BGPA 1R091 4BBRJ 5GLVA 1T08B 1IG7A 2EK5A 3H1YA 2KR2A 1OCRH 3A01A 3HOYJ 5E6HA 2FOKA 4XM3A 2PYTA 4UF0A 4UW4A 5FY8A 2J1UA 5C3PA 1J7KA 1SD4A 1OSGA 2YSRA 2VCAA 1QEXA 4XACA 4FCYA 3VBFC 4EN8B 2QBYA 3BP8A 1POV0 2Q8KA 2VQGA 2HEYF 4L5JA 2KIUA 2P34A 4PJNA 5CLSA 1OA2A 3WF0A 5CVJA 4CXXA 4OLLA 3LOCA 2XF7A 2QA4I 1VBC3 5H9QA 3SC7X 1PO23 2BUKA 4Y20A 5A7QA 2UWMA 1KU3A 2ZGSA 2CNAA 3GW2A 4QU1A 4XBQA 4XYXA 3VBRA 4XOGA 1U0JA 2WAFA 3AZZA 3QP5A 1M1EB 3I56I 5IK4A 2G7UA 5I0SA 4XFFA 2Y69H 4I30A 3GLLA 1K7AA 4XDQA 1W7PD 3ZYFA 3MKYB 2TNFA 4QXHA 1KRIA 3ZR6A 4LIUA 2ZHKA 3I4NJ 3H8XA 3I2KA 2DCKA 4Y7NJ 1D4M1 2M34A 4A45A 1R7JA 2HQNA 5C70A 3KVAA 3H5RA 2DOAA 4IJAA 4OYUA 2DU0A 4IRGA 5C3EJ 2Y0SN 3KF3A 1TG7A 4IE6A 5FXWA 2Z79A 2VJJA 5A1FA 3CJIC 5F2WA 3UJOA 4Q2FA 2K9MA 4AIJA 4E7LA 4LO4B 1LHUA 3WP3A 2E7WA 4OCTA 1SVOA 5JI9A 5J3LA 4NHLA 4CE8A 5FY9A 1KU2A 2OPTA 2O0OA 3AP9A 2WNVB 1J3RA 4OI2A 1VQ8I 3HQXA 3G3ZA 1T39A 4GZ9A 4OUEA 4M01A 3CZUA 4N8MA 4A3FJ 3V0AA 3I8TA 1BEV3 5EEAA 3I2OA 3ZXFA 4A44A 3FUQA 1K5JA 1MW7A 5HXMA 3MCZA 4OINF 2B7YA 5D8AA 3U37A 4UW5A 3B9CA 4QKNA 2W1SA 2HQAA 3VSLA 3L9JT 3LNQA 1G3TA 2VZTA 1REFA 4M3CB 3K4CA 3IPVA 2X1EA 2B9VA 4IEVA 3HYIA 5BNNC 2CUJA 1YUDA 3LMMA 3AMPA 5F9TA 4QM9A 4E4SA 2FU4A 2ZPXA 4UVCA 4WZFA 2YR2A 1XNCA 5KR7A 2X29A 1QMJA 3SEEA 4RGRA 2JDHA 5FP8A 3WP6A 2QSGX 5J6XA 1H89C 3PUQA 5LK7B 2BFUL 2ZX1A 4RHV2 2YB7A 3U4SA 5IOZA 5FYBA 1DQ0A 2Z33A 4W6YA 2QSFX 3D5OA 5M5XJ 5AIPA 1YOVB 4PGGA 2IGMA 3WEZA 1QJX1 2L7ZA 4DIQA 2DPUA 2VW2A 1UHMA 1C1FA 3Q9OA 1VQPI 5F64A 2AHQA 1RUJ2 1JHFA 3ZFGC 2A5ZA 2KLOA 3PO2J 4RLQA 1PGW1 1PM7A 1FXZA 3KV4A 3V56A 3ZMOA 3HBLA 1XCBA 3ZIWA 1MS1A 2FBIA 4CUBA 3FMRA 3OY9A 3VKFC 1DQ4A 1AR73 4E8CA 3OR2C 5IYBJ 4XLAA 4UFMA 5ED4A 2EB7A 3CUOA 3BTLA 4XLNF 4AAXA 3T2PA 3ABZA 4MXWA 1D5YA 4BHCA 1FV3A 5EFUA 4UAPA 2A5WA 2ID4A 1TBXA 1LHWA 3ML6A 3M1HA 1UX7A 5E89A 3SYTA 1K78B 3LSDA 3CP8A 1QOOA 3QWLA 4LG0A 4ZYEA 3FX3A 2DQLA 4IX7A 4BMBA 3ACIA 5F3CA 4CP9B 4ENMA 2KIQA 3HNBM 2DA1A 1CAVB 2CV6A 2DA2A 5EG0A 2Y33A 2MH2A 2A75A 2Y26A 4GXLA 4C30A 4CZCA 4RD7A 3K70D 2RNGA 3DCQA 2UUZA 1REPC 4AAPA 3OEAA 4QT6A 3WTTC 1F9KA 2JXAA 2WS92 5T55A 2RVAA 3S2WA 4YZ5A 5B3SH 4QPIB 1FNYA 4RS5C 1MH3A 2EZKA 1E0EA 2DYRH 5A3OA 3ON7A 1LOGA 1RYYA 2WZR3 1KS5A 2ZHNA 5FZOA 3RTRA 1SAUA 3OBTA 2M7BA 2OD5A 4UUVA 2R041 4I02A 1UKGA 2ZX2A 4AIKA 1VBE2 2QDNA 1AYN1 4D7SA 3MEPA 4PQ9A 3JTGA 5JSRA 3DXTA 1QGPA 4FPHA 2W7NA 3PNYA 3GXOA 2ECBA 4XRSA 1G9FA 4QPGA 3I58A 1KGYA 3FL7A 1J75A 1LKNA 2ZNYA 5G05L 2EA2A 1FYLA 5L73A 4XURA 1OPMA 1MSEC 4EJVA 2H8WA 4HKOA 2WB1A 4XSXF 2XHNA 1UCRA 5C4XJ 4P5HA 3TN92 5FO9B 1F5JA 4I0BA 4BQOA 2E7TA 2Q5TA 3CC4I 4GWNA 1YQ8A 1JJ6C 2O0YA 1ZR2A 2DMUA 2L3DA 1BJAA 1OOPB 3H7JA 1FMVA 2DVAA 3EYPA 3JRHA 2PLV3 1HW5A 3DTEA 4Z6YA 2ECCA 2JK3A 4F3QA 2IBDA 1QKQA 3POBA 4XAEA 2W91A 2BBVA 4HRIA 4OZOA 3CCSI 1X9PA 2JPCA 3EUAA 3IMNA 4HL0A 5LA1A 2UURA 4INDA 5HBAA 2GXBA 4OFGA 2K86A 2FBKA 2RDPA 2ME6A 2PMHA 4HVRA 5HI0A 1MJAA 4M74A 1NTCA 1S1AA 2CU7A 4FHTA 1VF9A 1PIV1 3PUSA 2ZGTA 3FLTA 4YM3A 1AYM2 3JCIA 2FDFA 3DEMA 5AC93 3LOIA 3PUAA 3MKZA 2OA4A 1V9U3 2D98A 4RGGA 1S8NA 1XPWA 3CJTB 1BI2A 2BRTA 4P9YA 3T2OA 1GUUA 2EIEA 5FY7A 2Y64A 4R9DA 1LJ7A 2R16A 5FLXK 2DCEA 4YGDA 1AR82 1NLRA 3FMQA 3HN3A 3VDDB 3LEKA 1Z6TA 4II2A 1RMU2 1D8KA 3BG7A 2VAUA 2DMQA 3WG7H 5JPNB 2DT5A 2R7ZJ 1QJY3 2ZCWA 1RUF1 4Q4V2 1N3OA 4ET7A 1M06G 2JRTA 2EXHA 4OHXA 3OYWB 3T3YA 2XQRA 1B4AA 4BMEA 4KWLA 3R60A 2MLGA 2XGXA 2EIDA 5E18F 1ZRDA 2L7FP 5GTIC 4P14A 1SFEA 3AJYA 4L5EA 3H3LA 3RZZA 5KXBA 4MIMA 4QB2A 4CCJA 3I2IA 5EXOA 3CD6I 5FQ0A 1YLFA 1W3XA 5I0RA 2O6GE 3N9QA 5LCWL 1AL21 2CUZA 1OT5A 3GM8A 3CDHA 4IUGA 1TQPA 5HLIA 3PQKA 1U78A 4QGNA 1F2NA 1HJGA 3POEA 1XYNA 3ILNA 2HWD3 3LIGA 3RVHA 2F5CA 4LTAA 1MS3A 1IPJA 2RM21 1UOJA 3BTZA 4XIKA 4QQPA 1JZ8A 2CV2A 4HETA 4Q4ZF 3X29B 1LTEA 4UXAA 4XFHA 3IAM2 4AD9A 1D2SA 2OQ7A 5IWFA 2H6CA 2EXJA 1ZELA 3WNLA 1YXWA 1E17A 1ENRA 4JGZC 1GP5A 2WQZC 1WUVA 3VD9A 1MS8A 1DYKA 3FZ3A 4G8XA 4I3PA 1CF7A 5I0TA 3O1VA 1YG2A 1D0XA 1SLBA 4XRMA 4C91A 3IRRA 5J1RA 2HXIA 3VZMA 4B3NA 3JRAA 4A3BJ 1ORKA 2E7XA 3R0JA 3WDYA 4K9SA 2BW8A 3DQVC 1W6QB 3TEDA 3BN6A 3GTMJ 1WKYA 2RS52 1IGNA 2VUMJ 1O8PA 4MLOA 4I2OA 1MBJA 2WAQN 1Q8SA 4TWTA 2PHDA 2X53S 1EH7A 4AIDA 2OUMA 3U21A 2WWSA 2V79A 2QVSB 2HWC2 2DXIA 1GV2A 4XQ4A 3T09A 2PJRA 4UV9A 4KICA 4EM1A 1UZVA 4HG2A 2LTPA 2VH9A 3CO7C 4DZGA 2XROA 3VZKA 1PGL2 3MIHA 1WH5A 2R7EB 3ETQA 3TRSB 4UXNA 1JT0A 2DA7A 5L3DA 2E9QA 3PL8A 1NA1C 3GVAA 1OCTC 4CDQC 1CAUB 5A3LA 2OX0A 1TLHB 1S3JA 3TBDA 2WT0A 4MZUA 4X6RB 3UKGA 3WSOA 3BTXA 2HH9A 2XPUA 5GJ6A 3BZKA 2VZ3A 4MTDA 2AACA 1HQCA 2VUCA 4OZXA 2IS1A 1YX3A 5IVCA 4IQPA 3C3WA 4KN7X 1XG1A 2FX0A 3HNYM 4LE3A 4AQTA 3ZYJB 1F35A 2C26A 5FUNA 3AMHA 3VBFA 2VBYA 2WINB 3ZXAC 1R1TA 4P9XA 3HJEA 5KCMA 3BUCA 4PIYA 4HV6A 3JRFA 5A6ZA 3V0BA 3MUY1 3TBIA 3WW3A 3CL1A 4GXOA 4JX4A 1ZN2A 1OLQA 2XLGA 4YW2A 1SBDA 1Y9MA 1ZREA 2F2EA 5F0CA 4H3WA 4AVCA 2GC0A 1SMYF 3DF8A 3C2GA 4DYQA 1IOAA 3IT8A 4D0PA 1TZLA 3RKWA 3NJYA 1MBKA 1JUHA 3OBZA 3HUGA 4KBZA 1U5XA 2FDKA 1N25A 4OAZA 4C2UA 2FUG2 4GB32 1EAH2 1YWKA 4XIOA 3F0CA 4FPJA 4N43B 1SFPA 2I74A 4A3DJ 3GUDA 2XOMA 1BJZA 3GZTB 1QOTA 2YU9J 3I54A 5BXXA 3AL0C 3BOWA 3NO8A 2E53A 1RGSA 1UWWA 1GOFA 1T2KA 3WLUA 1W5TA 4Z92B 1IPSA 4XZUG 4G7ZF 1I1GA 1NY72 2I10A 3C2HA 2FDHA 4JOMA 2VNVA 4K21A 5JVVA 5FPBA 2M8GX 2KT0A 1ETYA 1LOEA 4IEUA 2DJIA 1A35A 1LHOA 4FPGA 2B63J 3OB8A 5FPLA 4G9YA 3AKQA 2NNYA 1JZ2A 3O3KA 2WN2A 4Q4Y2 4IEZA 1ZZCA 2PQQA 1POV3 4Q0PA 1E5RA 1H9WA 1OFSA 4Q4X2 4I6ZA 1RJ7A 4HX8A 3DYPA 1U8BA 2R49A 4IETA 4Y1UA 4COUA 2CDPA 4CCOA 4W65A 4YVSC 1OCZH 1G8WA 4YRDA 4XONA 1VE0A 2P5VA 4NHXA 3SEPA 1ZGWA 1S0DA 3K6GA 4B43A 2H09A 3OIOA 3QH7A 4RHV3 3UNPA 1LOFC 3D5RC 2HEWF 3GF6A 4A0YA 1W36D 1UXZA 2YU3A 5IK5A 1H1AA 3OD4A 4A3KJ 5DDJ2 1RR7A 2F5VA 1JYWA 4WZCA 1SMVA 3BALA 2EPFA 4HSRA 5DD8A 4UUSB 4LKEA 4EJRA 1W9FA 4PFOA 1JW6A 1S55A 4S2HA 4ENJA 3OGVA 3COAC 3I3DA 1ULPA 5BYNA 1WMFA 3U4XA 2LD5A 3HOUJ 3FLPA 5IYCJ 1SACA 2Z69A 3V7RA 1I27A 3ZFGA 3U14A 4KJZA 1IV6A 5EJ1B 2RKHA 1X36A 2D5HA 5E1RA 4L9JA 1QA6A 4MHUA 2BHYA 3CBNA 3LSPA 1FIPA 1AL0G 2OAZA 4WK8F 1X1AA 1RUD1 4JKLA 2M4GA 4FOVA 3LA7A 4HG6B 1W9TA 3DPRB 2JUCA 4PJ0C 2LF8A 4UY8I 1W6NB 3JD71 4MHRA 5FKCA 2E7QA 5FRMA 3CDLA 2G19A 2OW4A 3RJRA 2WV1A 1GHCA 5CEHA 3DUIA 2JQ7A 5FROA 1ODDA 1I50J 4NJ4A 3U9GA 4AG4A 1H8VA 4LKFA 1RPWA 2WS93 4Q0UA 2W1UA 2R063 1R49A 4M3BA 5FBJA 1S2EA 2HWB2 2X09A 2DI3A 3U0ZA 1QJEA 2L02A 1B35C 1YHFA 2JSCA 2EJRA 1VBE3 1FZPB 4QQ2A 1S7OA 1MACA 2GSYA 4WVMA 4HN0A 4LG3A 4PDKA 1KQRA 1V54H 1XGNA 1BCXA 3N7MA 3THDA 3P3NA 4X8PA 1ZM1A 2J1RA 2E63A 3F8CA 2JENA 4C1WA 2AENA 4AWXB 2PFWA 3ZQIA 2X8KA 4CTEA 4ENKA 3IB3A 4AHWA 4CVUA 1BXHA 1ULYA 2LY2A 2NYXA 3MV01 3PTRB 1ZZ9A 3PDQA 1R1VA 4ETSA 3R0AA 3HVDA 4ABZA 4IEXA 3OR1C 4DINB 1FMD2 2KL4A 4YM1A 1B72A 4RAYA 1UHSA 1M4WA 3FJSA 1XCVA 1P8JA 3OBRA 3WU1B 3LOBA 1BK1A 3LL7A 4KIBA 5LA2A 3DF0A 3IH4A 3CLQA 2WO1A 3CCUI 2GC1A 2LBFA 2MPFA 2VOWA 3U07A 3AB0A 2Q4SA 4COYA 1L7LA 3T4HB 3LAJA 3HXLA 4QM8A 3ZFEC 3KHCA 4AWDA 2R071 2XPVA 4P1WA 3TP0A 4OUSA 4M4PA 3AZXA 3IDCB 2IA1A 5AFEA 3I2HA 3I0TA 4ITVA 5DZFA 2VVDA 5CKQA 4CP1A 5C4JJ 1YS6A 2B46X 4LOTA 2C9KA 4Q27A 5JDBA 4XJ9A 4ZZ5A 3M1EA 3C7HA 4HKWA 3KIOA 2QZ8A 2CHHA 4AFBA 3QYBA 2EF6A 3BIWE 4K20A 1LEAA 2KZGA 2VZSA 2DCTA 4J1WA 1TT0A 4XJUA 5DMYA 5IYDJ 1H0MA 2OBPA 3GTQJ 1H0BA 4ESFA 1D4M2 4PJJA 1R1A1 5JXHA 1AR83 2VMEA 1XGOA 1MQTB 1TME3 2YROA 4C90A 1X3WB 2L9LA 1HXS2 1R71A 4PT6A 3QPSA 2V9KA 3LCPA 3QQAA 1RMU3 1LVKA 3UV9A 1SQ4A 4KH9A 4E7ZA 2E33A 4YNIA 3ENRA 2Q2EA 3DXJF 2P4WA 2FZ1A 1NCQB 1GBGA 1V6MA 3KB5A 3WZ1A 4AL9A 3DP7A 3A01B 1CAXA 2Q1ZB 2OKXA 4IRIA 2VKHA 1EF4A 3ECOA 4DUVA 2YV8A 5FZKA 3SJMA 1VR3A 1F31A 4NWWA 2EXKA 2H27A 2V1DA 4IE4A 4DXSA 2FEZA 3PIOF 2BVBA 4AYBA 1VQ9I 4TSVA 4K6BA 3S6PA 3TYJA 3S7EA 4QDRA 2VC9A 5FKBA 4MFEA 1KYZA 2EINH 4CU7A 2E51A 3RYRA 1TNTA 1J0RA 3K4AA 2LC2A 3HPGA 5CU1A 2CFOA 4XN3A 2PEXA 3VBRB 1U6GA 5LWBA 2LKPA 2WNVC 1Z6RA 2NVQJ 5KHGA 1NCRC 2DODA 1XSQA 4OQ8A 3KP5A 2NRAC 4L9VA 1CQ9A 1CR7A 3PFYA 1GDTA 5BNGA 2WZPP 4KNYA 4EE2A 3ZDVA 1LDKB 3ASNH 4LQRA 2BOLA 2FD5A 2VXZA 1N1YA 1P6RA 1QZYA 2L9RA 1PDNC 5HVQC 3ROUA 4Y1XA 2B45X 4QD2A 4ZYGA 4HF1A 1IS6A 2JDKA 3ZSJA 3NRUA 1CZSA 1HC8A 2VLAA 4UFKA 2LSOA 5FTTC 3L2RA 1QJX2 4DZJA 1RUH1 1JZ4A 1JYCA 1IN5A 5IP7J 5I8TA 2HWC3 2P6HA 2VU9A 3W59A 4MGYE 4E7IA 5J1UA 1XSXA 3U10A 4DXZA 3TEXA 4KMUX 4EJUA 1XMAA 5C5UA 5E1XA 1XMKA 3QRFF 1DZTA 1YLLA 4LLNA 3V0AB 1W6MA 3A0KA 5DAXA 1UU6A 4QKDA 2Y38A 1J09A 3WT3A 3F6VA 1GVDA 2VTXA 3WUDA 1UAIA 2VOVA 3VYRB 4LKDA 1K4TA 1XN7A 1UMZA 3HM5A 4NAMA 4YIIA 3GTPJ 4YSFA 1GR3A 5T5LA 1NA1A 3ZXEA 5LGUA 3ZPOA 1EPWA 4P08A 1CN1A 5DABA 3V8JA 1GOHA 5ISLA 1NLQA 5IT9K 1X3ZB 4CA0A 5CKNA 2DFBA 5K0UB 2P4EA 1FLIA 1JUPA 1VBD1 2ADDA 2BERA 2HWE2 2YDEA 1ETQA 1LE8B 1SD7A 4IGQA 3E6DA 1L7QA 4XKVA 1PVC1 1DQ1A 5GAHJ 5GZEA 4IQJA 3IDAA 1SFYA 3FXJA 5IVJA 4ZS2A 1I9RA 5FXVA 5EF6A 1S0GA 4XF4A 3GBWA 1RR8C 3FWEA 4QDSA 4UFHA 2GMEA 2QUFA 1JHHA 4CZSA 4RAFA 4D7TA 3AZVA 4DY5A 3S3NA 3ABUA 4QWQA 5A80A 1ZNPA 2HYGD 3H3UA 1HDKA 4D8MA 4AI0A 1VAMA 2DUOA 3ERED 2X10A 1SC7A 3EPZA 2NMOA 1CD3G 3SDBA 3RKYA 3LIHA 2ET1A 4QPIC 1OBNA 1EA3A 2V9VA 1JOPA 5FYMA 2O14A 3HOSA 3ZXSA 3TW6A 2BVLA 2M87A 2QGUA 1QJU1 4PIXA 2YC4A 2XV4S 4PLOA 2WL1A 5J09A 2R92J 4MXWB 3MFAA 3QU3A 4GB33 2VXDA 2ET7A 4PLMA 4ORFA 3ESWB 5FZ0A 2CUEA 2XIGA 4V19K 4ANJA 2X5IA 5CQEA 4O5VA 3NV1A 1Q5OA 1JTXA 5KC6A 2JE8A 3ZN6A 2P6TA 1LFUP 4UVAA 1YFXA 2LM3A 4OHWA 3HPHA 5EG0B 5FYIA 4J19A 1W6PA 2PI0A 1QJZA 2ZZQA 3S2DJ 3PMSA 1PM4A 4C2MJ 3GGLA 4AF9A 4YIRX 1YQ2A 3CO6C 5JLWA 2OS2A 2Q1MA 1OOPC 2KFDA 4GWIA 3MZYA 4K2EA 1R1UA 4IEPA 3MVPA 4HFSA 4Q4Y3 4S0HB 1J9IA 3SXWA 1OFCX 1X33A 4AEMA 2XSDC 2PTMA 3OS2A 4XKWA 2D40A 2VMDA 3S5QA 5IATA 4ZKTB 2QQ8A 1HA8A 1MEC1 3GZNB 5LRSA 4D7YA 2F4PA 3H9AA 2GBYA 5CBLA 1AR63 1MZFA 4E7JA 2RR11 4XTPA 3M9AA 1DIWA 1DG6A 4Q29A 4Q4W1 2RJLA 4YVSA 3WXPA 3AP4A 2C1FA 2ZMEA 4YZ1A 1X1PA 1D0YA 4CO8A 2I5UA 2HXOA 3R4DB 5DDJ3 3A03A 5F0FA 4AEDB 1LOFA 4HXCA 1MNDA 3ABLH 5GTHC 1QVTA 4HPQA 5CFDA 3NRVA 3VDDC 4EROA 4J6GA 2EZLA 3SISA 2P81A 1WCSA 3KLSA 1A5JA 3O8HA 2R7TA 3OL4A 2V4VA 4YM2A 1AL22 3ZQLA 2IXLA 2V73A 2TBVA 1BHGA 1DGWA 2ZGNA 1USSA 2LP0A 2WV0A 3C7GA 3CO2A 2X85A 1GWKA 4EN0A 2YZ4A 4L8QA 4HW0A 1OQYA 2DPDA 5E79C 2HS5A 5B4XA 2VT3A 1DU6A 2FA5A 2ZX4A 2F4LA 3VB2A 5EYXA 4D5FA 3G71I 1H2LA 1ETXA 1AKHA 4SBVA 1VQ5I 2BEOA 5I0DA 3TOAA 5FJ8J 4BDYA 5JAXA 2V9PA 2ISZA 4ZYHA 5D4RA 3K2ZA 1WZ2A 3ME2A 5ERLA 2DMPA 3F72A 1RHI1 2D6LX 5FGMA 5J1XA 1O5UA 3BYWA 3D0SA 3BCAA 4LITA 2BW3B 5FY4A 2MH9A 3W9AA 3M4OJ 5CVUA 5B2GB 3J7AY 5FLHA 4L2NA 3WQ0A 1Z7S1 5BNQA 2ZFUA 1RUI1 3CHXA 1VBA1 4EJWA 5D5WB 3TOBA 3E6CC 1Q1VA 1D0GA 1U2WA 2XPWA 2ZJQF 4D94A 4F93B 4RL7A 1V3FA 5ICGA 2XH6A 1COV3 5DUUA 4BQQA 2XL7A 3BGAA 2J5PA 2NMNA 4XHBA 3T08A 3MEXA 1UB9A 1HV1A 5F1RA 2H94A 4B4QA 2HYJA 4FCAA 2L01A 2KP6A 1TT5B 3TO7A 2HZTA 4QX2A 4I0AA 1YRZA 3H8UA 5FQ0B 3NKTA 1QZZA 3D3AA 2WAOA 1Z3YA 4XN0A 4IV1A 4LBQD 3BPVA 1KDKA 5HCHA 3OSGA 3Q8AA 1MMAA 1FPN2 2R7RA 2VQTA 1S7AA 2P17A 1R093 2RS31 1XRUA 4NPLA 2M0CA 3PSFA 3VHPA 3FFZA 1FBSA 2PA7A 1VBB1 4A6OA 1QDOA 4NNJA 4FO9A 2WLPA 2B42B 4OULA 1TWAJ 3POJA 1YIOA 1G9CA 3OG2A 5D5UB 3H42B 4XUQA 1JTYA 1Q8OA 1CF7B 4AR2A 3PUIA 1MS5A 4HMZA 1Z67A 2XJVA 5CB7A 3KCYA 4KFCA 2DO7A 2MBFA 3V42A 1UJ8A 2K27A 1OLTA 1CAWB 4WM7A 5IUQA 5IT6A 3H9JA 2ZXWH 4ZS3A 1DGLA 1PZ9A 2R7OA 4DUWA 1YIFA 2A07F 2ZHMA 5C8CB 4L18B 1MZ6A 4IV3C 2IWGB 1STZA 3ZFEA 2UZKA 1D2QA 1NG7A 1G7YA 1WD3A 1FX5A 4YRVA 3KPHA 1IDYA 1GFF2 2DCYA 2CU5A 1EV12 2PJRB 3JSPA 1PMIA 4Q47A 2GIVA 1UYZA 3GBFA 1YI2I 4XR6A 2JA8J 1RUE3 1FOWA 5T5OA 1JI6A 2KD7A 4NMIA 1D4M3 2PAMA 1UFMA 3GNEA 1Z0HA 3HOTA 4NPRA 2ORXA 1Z05A 1UYYA 3JQXA 2W1QA 1J1TA 3EDPA 2A69F 4RLFA 2HVSA 3PMEA 2W1OA 3K4DA 1QU0A 4MQ9F 5EP9A 4PF5A 1BC8C 3HHHA 1UY0A 4M3DA 2IEKA 3NWKA 2ZZJA 1W0OA 3C7EA 1GWLA 3ZLIA 4MHGA 4YARA 4TZDA 1CGPA 3P3PA 4YFNF 3VUOA 1SLCA 3RS6A 2R93J 3HQRA 4CUGA 1IZ1A 4ZZDA 3J81Z 5F5QA 4W1UA 4COWA 3BCBA 4KT5C 4TLFA 2R0QC 5L9VA 4ZU5A 4N43C 3C7JA 5CJ9A 3SZTA 3T2TA 3PIPF 1LHVA 4LULA 2D1HA 3L2VA 3IUOA 4ZZ8A 1MD0A 5CG9A 3DBHB 2XRNA 3N97A 2ADEA 2K9QA 3DKWA 3V0BB 3N7LA 1I5PA 3WVJA 4OQ9A 2K9NA 2Y8KA 1K5MA 1RL3A 2IPQX 1CONA 1MS4A 2D1VA 1ST8A 2A6TA 1LRHA 1RITA 4C0BA 2UXNA 2FE3A 2JG8A 3WG9A 2XKPA 2DUQA 5ACA1 1XNBA 2XGDA 1AUYA 3HB9A 2WQ4A 3HJRA 4EQQA 1JHNA 1PZ8A 3AJZA 3S2HJ 4W6XA 1X1CA 2JA6J 3NNMA 1NCRA 3BOQA 1NZIA 2FDIA 2ICWG 5BQTA 3PNAA 5FMOL 5CIRA 1X58A 2PAKA 1GZWB 4NUBA 1PP7U 2QQMA 2HTJA 3W2AA 3WTXC 3CCRI 5HDNA 3O2PE 1FATA 3WOGA 4M3CA 3A1YA 1WMXA 4A3MJ 1MKMA 1HW1A 1JGGA 1PK6A 2ZC2A 1DDNA 4ASNA 5J37A 4Y17A 5M5WJ 1Y0NA 2CYYA 2GDFA 5M3FJ 2ZKZA 5A1AA 3KV5A 3VEPA 4AQ6A 5H6RA 1BYHA 3B00A 4L9TA 4CP2A 4MGZE 4LLGF 1ULFA 1FC3A 4XQWA 3KYLA 4LUKA 4NRMA 2QZ2A 1XDSA 1UZYA 1MMDA 4JVAA 1KJRA 1ZZ7A 4A0XA 2YPJA 1RUD2 3WHTA 3IIIA 2JA7J 4X6AJ 3Q5FA 3ZMDA 3N7KA 4BEHA 4R79A 1MR5A 1O3RA 4QGMA 1N3QA 5FZ3A 1NYWA 2HBTA 5E3OA 4XJWA 3K4NA 2K2SA 4NDLA 1XNTA 2UY9A 3QD6A 1MNMC 3LFKA 1SCRA 3IAQA 2HDWA 2E35A 4FPEA 3U1DA 3D0JA 1DU3D 3WG2A 4AYBN 3AP6A 4BE0A 3HEFA 5D8LB 1RESA 1BBYA 4XW3A 3O1MA 5F6KA 4O9EA 2QQOA 5T50A 4XFGA 4JX6A 2WO7A 4A2UA 4QU2A 2DA4A 2IT0A 3DPRC 2ARXA 2UY8A 2X05A 3MICA 4ZZLA 4LT5A 3SHRA 1ACIA 1KQ8A 2R043 1W0PA 4CUAA 1AYN3 2KDOA 3K77A 2AEYA 5IOYA 1NQDA 4TYSA 2VPRA 3JREA 1LGBA 3ST7A 4CP9A 3HBZA 2RREA 3LSHA 3OYJA 1QZEA 2XF6A 2O61A 4AVZA 1N3PA 1ULDA 2YU2A 2K9LA 3S15J 2ZMKA 3B7MA 3VBSA 2ZJ2A 2X6XA 3T8RA 3ZR8X 2WA0A 3B93A 3RZJA 2XUEA 4P9UA 5A6XA 5C5TA 2W0XA 3WF4A 3KGLA 3ZMVA 1W06A 1H9GA 4OHZA 4E7HA 2RN7A 3N36A 1GMMA 3QP6A 3HGYA 3RZLA 4ZU7A 3I49A 1RUJ1 4BXUA 1ETVA 3T2QA 2E2IJ 3JQWA 4YZ2A 1ZARA 4N7UA 2X4HA 3ASIA 5FFOC 1YX5A 3LA2A 2YBKA 3EUHC 1WI3A 5FZBA 2DCJA 1XB4A 1E5IA 5IK8A 2YU1A 4MVTA 3N9PA 3RSJA 4HEA2 3QU6A 1PIV3 3NVCA 4A4AA 5JSPA 4ZXEA 3F9KA 4RS8A 1NKGA 2W4SA 4RGSA 2AS5F 1HRI2 4ISQA 2E1NA 2G9WA 2VW1A 4X8NA 5LY1A 4QQHA 4WVMB 1OOPA 2NOGA 4QMAA 2VMIA 2HKXA 3I7DA 5KAFC 3H1WA 2V6CA 3HC7A 5J96B 2ZSIB 5CZKA 2M5WA 2NVTJ 2E7AA 4KDPA 4AI8A 1OH3A 2BNOA 1VALA 3KP3A 4M6XA 3LQRA 3B6AA 4FP3A 4K40A 4W50A 1RUF3 5ICFA 5JHUA 4KGQA 4E7KA 3H3VK 1ULEA 1P92A 2EIMH 2VQAA 3OPWA 1GLHA 2GQQA 4QSHA 1VP6A 1B72B 3CEWA 3I2JA 5CISA 4BH9A 1FBQA 2DYSH 3JBG2 2WBMA 2YY1A 3VGIA 4PBOA 5KC5A 2GAUA 1MQTC 1N77A 3ABMH 1KONA 3QPTA 4YM0A 3OWTA 3QAHA 2XDVA 4QDQA 1YNAA 2BGCA 1AL23 3F21A 2R3SA 2Y9YA 3A7QA 1ONAA 2XUMA 3N05A 1NCQC 4QX0A 1WJAA 2BQPA 1EPZA 5A1LA 1CX1A 5FR3A 4CDGA 2GXAA 1OQDA 2RM23 4CDXB 3TN91 2KJCA 1H1MA 4XLHA 2KIMA 3PJYA 4H55A 4XAAA 2ESHA 5EYYA 1PGSA 2BY3A 4LK7A 2MC3A 4P00B 2L0KA 4ES8A