3LZZA

Crystal structures of cupin superfamily bbduf985 from branchiostoma belcheri tsingtauense in apo and gdp-bound forms
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
161
structure length
161
Chain Sequence
b'EEVKRLIALYELTPHPASGGWFRETYRSDVQVEAEGFDGKRSVLTMIYYLMQAGQPDPFHRVKSDETFVHNLGGSMKIHMIHPDGSYSCSILGNPLEHPEARHQVVVPRRVWFAQEVDGYCLASVLVAPGFDFKDFSLGKREELIKEYPQHRDVIMRCTSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Crystal structures of the apo and GDP-bound forms of a cupin-like protein BbDUF985 from Branchiostoma belcheri tsingtauense
rcsb
source organism Branchiostoma belcheri tsingtauense
molecule tags Unknown function
total genus 39
structure length 161
sequence length 161
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06172 Cupin_5 Cupin superfamily (DUF985)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3lzzA01
1RUOA 4ONUA 1FXZA 3I59A 4JTNA 1ZZBA 2ET7A 4KWLA 4BHPA 4LULA 5FPXA 1LB2A 1QXRA 5KHGA 2FQPA 2XL9A 3LA7A 4ZU5A 4MGIE 3HT2A 3NSTA 3RZZA 2C0ZA 5JSOA 3DN7A 5T3NA 1SQ4A 2B9UA 1CAUA 4PIYA 3DL3A 2Q4SA 5C8WA 3U11A 1ZZ7A 2UY9A 4EWEA 4EWAA 5I8TA 2XL7A 4YARA 2QJVA 3OF1A 4GULA 5BUVA 4E2QA 1YLLA 5K8SA 5I0SA 1YFUA 1PM7A 1XE8A 1DGRA 3FX3A 1LKNA 3NL1A 2WFPA 1OD5A 2D93A 4ZU4A 2VQAA 4H7LA 1Y9QA 2Q30A 3WW3A 4I02A 4L11A 4XEZA 2D40A 2XKPA 5J7MA 3KCCA 1VR3A 3PVBB 4IEPA 2PAMA 2GC0A 2F4PA 3BB6A 3BU7A 4BYYA 4EV0A 4MGYE 1RL3A 4XFGA 3EHKA 1UCXA 1J3PA 4AQ6A 3FWEA 4X6QB 4AQ2A 5KHHA 2OZJA 5EZWA 1SFNA 4HVRA 3N4MA 4I01A 3GBFA 4XF4A 1ZRRA 3RYRA 1WGPA 5KBFA 2ZCWA 1NXMA 2N7GA 1VP6A 1X7NA 4D7SA 2BGCA 1XE7A 4BH9A 1ZRCA 1ZX5A 1TQ5A 4Z07A 3LZZA 4PJYA 5KHIA 3FE5A 4QGMA 1QWRA 4KWJA 1XRUA 1IPJA 1NE4A 1RTVA 3QACA 1J3QA 2BYVE 3CEWA 4R8HA 1EP0A 4IEOA 2B5HA 4LUMA 3BCWA 3LWCA 2H0VA 3GYDA 2Q1ZB 3U10A 3IIAA 5FPZA 1UPIA 2HKXA 4PIXA 1ZVFA 4XFIA 3D82A 2GZWA 3KGZA 1CAWA 3H9AA 1I5ZA 1EY2A 1NZCA 1QY4A 3IDBB 5FLJA 3LA3A 3I54A 4NVPA 5LEKA 5KHJA 5KHKA 3ROUA 3RYPA 2BEOA 3DKWA 2FMYA 3M3IA 4KL1A 5AVPA 4I0AA 4WZCA 3BPZA 1YFXA 1FI2A 4QMAA 4HVQA 2IXLA 1LR5A 2GC1A 1VJ2A 3HT1A 5FCCA 5LRRA 3E6DA 4A2UA 5I93A 3WW4A 1ZNPA 5E16A 4R52A 3LAGA 1ZREA 3UKTA 1RUNA 3R6SA 3NKTA 2BNOA 4IEQA 4QM9A 4QM8A 5D1IA 4YYOA 4IEXA 2PA7A 4META 2PTMA 2V09A 3I59B 3JZVA 4YRDA 4AVCA 3RDIA 1EYBA 1X82A 3H7JA 2IC1A 4J1XA 4ORFA 5JSRA 3ACLA 2GU9A 4L2NA 4K8FA 4QX5A 3CJXA 3HQXA 3OTFA 3E5UA 4CYDA 2MNGA 2IXKA 1U12A 4MGZE 2QDRA 3UKNA 4LTAA 4QGLA 2UYAA 1I6XA 4HSJA 4XF3A 5BXXA 1NYWA 4HLTA 1SEFA 1Q5OA 4XETA 3DV8A 3FFQA 4F7ZA 1ZZCA 1ZRDA 1CAXB 3NJZA 2BNMA 2EAAA 4E2GA 2OPKA 3H3ZA 3LA2A 4KU7A 4WBBA 3SCFA 4HZFA 4KWKA 3TNPB 1DGWA 4JVAA 1CAVB 1JUHA 3O14A 2Q0AA 1O3RA 4RD7A 4O9EA 3IBMA 2D5HA 1J1LA 4AXOA 4IEYA 5JSPA 5J48A 2XHKA 4XFBA 5HI0A 4I0BA 3MPBA 5I0TA 3NVCA 5JR7B 4HSLA 4FAHA 2P17A 3MYXA 5LEJA 1FT9A 2Y0OA 1HW5A 3M70A 2OA2A 4XFCA 2UY8A 1UIKA 2ETEA 4OLLA 2PAEA 3ST7A 2XLFA 4I09A 3VHRA 1DZTA 3D0SA 3OD0A 3CLPA 2K9ZA 3L2HA 2B8MA 4IERA 3FHIB 4Q0VA 3G7DA 5FQ0B 1RC6A 1GQGA 2CAVA 3H50A 4ZU7A 4Z82A 3CL1A 3USSA 1Q3EA 5I0UA 3KMHA 4I3PA 4P9GA 3S0MA 2CAUA 4UBHA 4OFGA 4XF0A 4BIFA 3NW4A 4HMZA 2XKOA 2QCSB 1H1MA 5JAXA 4LEJA 2MPFA 3EJKA 1J3RA 3SCHA 2KXLA 5EFUA 4HBNA 4Q29A 2QVSB 5CU1A 1O5LA 4Q0UA 3SMHA 3OGJA 5BY5A 1YHFA 4J1WA 2DCTA 5JCTA 3KSCA 3RYKA 5J3UA 1UD1A 3MZHA 4UBGA 5C6CA 3FZ3A 4PIZA 1OI6A 2H6CA 4MX3A 4XF9A 4EROA 4IESA 2OYZA 1EPZA 1H1IA 3RPQA 3H1MA 4D7TA 1ZZ8A 3E5QA 1O3SA 2VPVA 4WVZA 4UXAA 4IETA 4FAGA 4HVOA 2D5FA 4LA2A 2PHLA 4XFFA 3LOIA 1CGPA 3PNAA 1Y3TA 3EBRA 4O9GA 3EO6A 2MHFA 4EWDA 4LUKA 2IXCA 2ZKLA 2VECA 4TLFA 3E6CC 4KU8A 1O4TA 1CAUB 1UIJA 3SHRA 3KGLA 1QXJA 2QNKA 4IEZA 2XLAA 3U0ZA 3WW2A 4AVBA 3WW1A 3ZDSA 2ATFA 3E97A 1WLTA 4JTOA 1OMIA 1RGSA 2UYBA 4DINB 3C3VA 3SCGA 3CF6E 5FLIA 3ELNA 2WC2A 1ZZ6A 2HJIA 1WA4A 4XFHA 1J58A 4Q0PA 2IXHA 2PAKA 1CX4A 3PLQA 4QXKA 1CAXA 4FBFA 3EQEA 4JV4A 3BALA 1L3JA 4B29A 4MH0E 2PFWA 5BPXA 1CAVA 4FT8A 1O3TA 4LA3A 1G6NA 3ES1A 1UW8A 5I8YA 2OZ6A 5CVRA 4HN1A 5E1RA 2PQQA 2XLGA 2GAUA 5BV6A 1J59A 1X8EA 4HN0A 3H7YA 5I8SA 1ZZ9A 4I2OA 3HIFA 3B02A 4MZUA 2E9QA 1YFWA 3D0JA 4XFAA 3H1WA 4MUVA 4Q0QA 1YWKA 4IEVA 1GQHA 1PMIA 2XGXA 5LRSA 2IXIA 2GC3A 1NE6A 4LLOA 2CV6A 4MGKE 3E5XA 3S7IA 4Q0SA 3H8UA 2O1QA 4X6RB 5FQ0A 1OFNA 5FLHA 4E2SA 3ES4A 4XF1A 1DZRA 2BNNA 2EA7A 4IEUA 3TNQA 2K0GA 4IEWA 2H6BA 1CAWB 4MV2A 1YUDA 3FJSA 4AVAA 4F8AA 3SXWA 2CGPA 1ZRFA 5FDBA 3CO2A 2I45A 1V70A 4N9HA 1O5UA 1O7FA 1Q43A 2GH2A 3RNSA 2IXJA 3IDCB 4N9IA 3I7DA 1X8MA 4YNIA 2GC2A 3IWZA 4YSFA 3OCPA 5F1RA 3MDPA 3UKVA 1O3QA 4QGNA 3S7EA 1YFYA 3H1YA 2Z69A 2Z2SB 2O8QA 3E6BA 3H3UA 3QOPA 5I0RA 5I91A 1IPKA 5CADA 2PYTA 2ET1A 2EVXA 1LRHA 3ETQA 2PHDA
chains in the Genus database with same CATH superfamily
2RS31 4QU2A 5K4LA 4DEVA 1JZ5A 1GANA 1W2AX 2BOJA 4YG6A 2ZAHA 5FMCA 5BNPB 1ULEA 1UL9A 4JTNA 1GP4A 1ZZBA 4B4QA 4CDUA 5JPNB 4LULA 5FPXA 1BMV2 5JVVA 3JBG2 2D3PA 5FZCA 3H8XA 3LB9A 1N1SA 2VW1A 2FQPA 3PIGA 1F4AA 3M4FA 4GQ7A 3ME2A 5DMYA 1FOD3 1RUF3 4J25A 1SLBA 2W39A 1R1A3 5ERLA 3RZZA 1PK6B 4FPOB 1SQ4A 5T3NA 2B9VA 3TOJA 4PIYA 3S6PA 3U78A 2YFUA 2Q4SA 4P9YA 1CPMA 1I9RA 3CJIB 4AI1A 4GB33 5FYZA 5C7GA 5FZIA 3BODA 2FHRA 5L9BA 4S2HA 4GULA 1GNHA 3WF1A 1GYKA 1G9DA 1JMUB 5GZFA 3MUY1 1CZSA 1UY1A 2JE9A 3ZXEA 2ZEWA 1KXGA 4CU9A 3VKOA 1R092 1YFUA 1NLQA 1PM7A 2ILMA 4Q5OA 5I0SA 1L7QA 3JB8A 1R1ZA 3RSJA 3FX3A 2GN3A 1LKNA 2JG8C 4Y1VA 3NL1A 1OD5A 4FOWA 1GKBA 1XNTA 3B69A 4ZU4A 4L9BA 3T0BA 4BPZA 4BZ4A 4FP3A 4XJAA 5GZEA 3M3OA 3WW3A 1QJU1 4LK7A 4L11A 3M3EA 4ZONA 1GZWB 5G04L 5IJRA 2D40A 2D6MA 1S2KA 3AL5A 4A7KA 2ZAAA 4GA9A 5C3PA 2B46X 2QKDA 2XJVA 2GC0A 3FBMA 5F2SA 3ZFGC 2WLPA 1W6NB 3BB6A 5B2GB 4E8DA 4Y1YA 4MGYE 1RL3A 2Y64A 2WZR1 4A41A 1YJKA 4W65A 5JWPA 1UOJA 2UWAA 4EYUA 2LRPA 2WWJA 4J6GA 4IXLA 3FWEA 3MIFA 2CGOA 1VMFA 4RGGA 1GOHA 3OD4A 4COWA 3KV6A 2ADDA 1IQDC 3N7LA 5C3OA 3VKFC 1C1FA 5HXVA 3VHOA 2HBUA 4JAAA 4I01A 4DO0A 3VL9A 2VZVA 4D3WA 4L8QA 1V00A 1ZRRA 4UFJA 4E8CA 3POGA 4DZGA 5KBFA 1D4M3 3O1OA 1NXMA 2N7GA 1US3A 5F6KA 3I3DA 1SBFA 2KM2A 2QZ2A 3VBOC 4AFBA 4Q4Y2 4BH9A 1GFF2 2FDFA 4JGZB 1ZX5A 3GHNA 3N9PA 2NLRA 3TN92 4A3XA 2IUWA 3Q8FA 5KWRA 2WS93 4KWJA 4IV1C 5CFCC 1PX3A 4H2AA 1AX1A 5JPMB 1ZM1A 3HNMA 5JDBA 1W2TA 2VUDA 1YQ2A 1UYYA 2RVAA 3HBKA 2P5BA 3P6BA 2A6WA 1N47A 1DYOA 1PVC2 5APAA 2VM9A 2FCUA 4GMP3 4CXYA 1GQPA 4AI8A 3VD4A 4MO3M 5FPZA 4DFSA 4QX2A 1UPIA 5JZGB 4PIXA 5A7SA 2KA3A 4CDXA 4QDSA 1RUH1 1VBE2 4YVWB 4U36A 3PTRB 4LHLA 4LITA 1LHNA 2JD9A 1EY2A 3O0XA 5LBCA 1VBD3 2MEV1 1S0GA 3APBA 4XQ4A 1QY4A 1UMIA 2Y8KA 4JGYB 3VKLA 3LA3A 5CEHA 3I49A 4NVPA 2CDOA 4RGAA 4JQRA 1R093 4M4PA 1XNKA 3Q8AA 3DKWA 4Y22B 1OPOA 3AYEA 4QB1A 4CEWB 2ZJCA 1S0FA 3AMQA 1VMJA 3OJBA 4I0AA 4WZCA 1AXZA 2ZGOA 5FAXA 3UK9A 4DB5A 1B35C 1WW7A 1LU1A 4KI5M 1YFXA 1FI2A 4HVQA 2VW2A 1ZA4A 2IXLA 3DPRA 3WG4A 1US2A 1D7PM 2JDAA 3C2UA 5JIUA 1WKYA 2GC1A 3PVNA 4YGDA 3E6DA 4HOOA 5I93A 1DGLA 4I30A 5A1LA 4FOQA 1V6JA 5GKAC 3WW4A 1C8NA 4QHZA 4Y4RA 4R52A 4CCMA 2JX9A 4XABA 5FZHA 1ZREA 4COUA 4XC9A 1LENA 3ZXAC 2BNOA 3BU0A 4IEQA 1JYWA 3IN9A 3ZMNA 4DXRA 3UL2A 4AAPA 1HB4A 1JYXA 3FLPA 5G05L 3MIGA 2W1WA 1FMD1 3OOXA 3ZVXA 1PM4A 4MGQA 3VDDA 1BK1A 2Y38A 4RR3C 3RFRA 2Y33A 3N35A 2V09A 3B94A 2EXKA 3MUZ1 2QQPA 2VVDA 4CDUB 1AYN2 5JOZA 1EYBA 4GH4C 5FUNA 2VVFA 1BXHA 4Q4Y3 3SQOA 3N7KA 5FY4A 4ORFA 4WM8C 5FY7A 4CCNA 4CDQB 1QJX1 2LALA 1ZBE1 2PHTA 1PO23 1MR5A 2B4KA 3WEZA 4LK6A 3B3QE 5K9YA 3C7HA 3WDVA 1WD4A 3CJXA 3HQXA 3OTFA 1AR71 4HPKB 2VJXA 1DF0A 4LBOA 5T52A 5T54A 5A6YA 5IK8A 1U12A 4MGZE 3B00A 1UMHA 5FIXA 3UKNA 1XBFA 3BTYA 3ZSJA 2WFF3 1EV11 4QGLA 3I2OA 2UYAA 5C4WA 4OYUA 2WN3A 4PT6A 4XQDA 2WAAA 4DIQA 2W1UA 4OHYA 3OSDA 1RUE1 3WV6A 3W5MA 2PMWB 2ZGNA 3S5QA 3T1MA 4HLTA 4AFAA 1BZWA 1QIQA 4FQ4A 4AHWA 4KG0A 1VBE3 5T5PA 1S2BA 3IPVB 2GN7A 2O14A 4DXSA 2JDMA 3O0WA 4PI2A 5FZFA 1SACA 1HLCA 2WNVB 4M01A 2AACA 2EAAA 3JD72 3VD3A 3H3ZA 1OLME 2AEYA 1V6LA 4KU7A 2A70A 2VNVA 2XXZA 2XVKA 3MLLA 4RQPC 4HZFA 1RYYA 3TNPB 4JVAA 4HKLA 3A0NA 4CP9B 3PVEA 2W87A 3ZDVA 2Q0AA 3FLRA 2YC2A 3MV11 5F5QA 4O9EA 2D5HA 4AXOA 3DEMA 2D7FA 4F83A 5BNPC 2XUEA 5J48A 2DU0A 5FXVA 1KEXA 5HI0A 1LULA 1AL22 2YG0A 2GH8A 3JXSA 5FYHA 4GXLA 5EJ3A 5F3CA 2RS52 1WCKA 2XDVA 1RUI1 3Q8BA 3ZXDA 1LECA 3RZHA 3K4DA 1RUC2 1PK6C 1ND3B 2P17A 2ZHMA 2EAKA 2HWF1 4EE2A 2E26A 3ORJA 4LO8A 3VBRA 3W9AA 4KG8A 2CY6A 5C71A 1ULOA 1VB2A 1WW5A 3CJIC 3A23A 4PLMA 2UY8A 2RMU1 4ARXA 2ETEA 2FBEA 4AVVA 4OUEA 4QKBA 3THTA 3VHRA 1CR7A 3D0SA 2RE9A 4YVSB 1M4WA 2K9ZA 3AZYA 5J98B 1AR92 2BVVA 2VZRA 2Q5TA 3WUDA 5CKNA 4H7MA 4Q1PA 2VBDA 3ENRA 2JENA 4HL0A 4SLIA 3B93A 3T09A 3WQBA 2RM21 4Q4V1 3ILNA 3SLIA 5F3EA 3J7HA 4AK3A 1V9U3 2ZS6B 4ZU7A 1JYVA 3CL1A 1O6UA 1W99A 2P37A 3PUHA 4CDWA 3GJBA 5IK5A 1ZBA2 4OCTA 3ZPYA 2AUYA 3HEIA 5ANQA 3WP5A 1R083 5HV0A 5FWJA 4DUVA 4CCDA 5HCFA 4OFGA 4CRQA 3RVHA 2VUCA 5JAXA 4LEJA 5FYTA 3WNXA 4CDQA 4DUWA 3GCWA 4FPYA 3I4IA 1O59A 1O8PA 4HBNA 1RUD3 1GUIA 4IV3B 1A3KA 2ZACA 1YHFA 3DGTA 5D8AA 2DCTA 4HETA 4QX3A 5JCTA 3NJVA 3VKNA 1P8JA 1W05A 2I74A 2JDZA 3FZ3A 4NAOA 3N7MA 1DQ6A 2YFZA 4EROA 3I2FA 2OXBA 3J8F2 3DXTA 1W8FA 1ZA7A 4BA6A 5ABJA 4D7TA 3MO4A 1VALA 2ZX4A 3NMBA 1DLLA 5FTTC 1Z7S3 3ZMOA 1E5SA 2OS2A 2P3KA 4BM8A 4LA2A 1TME1 3FL7A 3LPFA 4PF1A 5B4XA 2QQNA 1UY3A 1JOBA 4IUGA 3ZIWA 2PHLA 4XFFA 3LOIA 1W8OA 1U5YA 4JKKA 4NR1A 4I0WB 4DY5A 1AL23 1Y3TA 3W58A 2RR11 2WIIB 3VZKA 4EWDA 4LUKA 4LMFA 5BNQA 5L9VA 3O1MA 2Z42A 3OY8A 5IVJA 4NHKA 5LW9A 1X50A 4YM1A 2VZPA 5CFDA 2TBVA 2BGPA 2FD8A 1MS5A 2HLEA 1NXD1 1QXJA 3DECA 2A6XA 2XJRA 3PMEA 4HT1T 3PU3A 3WNPA 5JZGC 5LA9A 1MVQA 1Z78A 3U0ZA 2VVEA 3WW1A 1GP6A 4JTOA 4UYBA 1PGL1 5LCWL 5EWSA 1OMIA 2SLIA 5TSWA 1HXS2 4RS5A 4ZXEA 3RWKX 3VD7A 1BEV1 4QPIC 4AI0A 5GZGA 1V6MA 1LNSA 3HAGA 4MADA 1DQ2A 4JGYC 1AR93 3BOPA 1RMU1 4JCKA 4COVA 1CESA 2ZZQA 1OH4A 5IK4A 1ZZ6A 5BYNA 1WA4A 4BXSV 1NX9A 4XFHA 1J58A 1C57A 2JXAA 5A80A 3ZFFB 5LA0A 2VCCA 2WQZC 4XXAA 3VDAA 4CEWC 2PAKA 1AR83 5C4WB 2JB4A 1GNYA 1POQA 3VZNA 5FYMA 1SLIA 4DUXA 4JV4A 1VPHA 3LDRA 1ZBA3 4S2DA 3LFMA 3ZYRA 1BJQA 1BBT2 1R1A1 1SG3A 4N43A 1QU0A 1NQDA 2RDNA 1VRH2 3DCQA 3IB3A 2DV9A 1XU1A 1KDMA 3VV1A 5KR7A 1G6NA 5CKQA 4EQVA 1W8HA 1UW8A 2IZWA 5A3TA 3A21A 2OZ6A 4GB31 1TNRA 3B7MA 3W20A 5C3RA 1SDWA 2XLGA 2GAUA 3VBUA 1A8MA 3OB8A 2G9ZA 1KFUL 5FZLA 1WLDA 1W6MA 3ACFA 4QXHA 1PZ7A 1LHUA 3RZMA 3CHXA 3J8F3 5FJHA 1Y43B 4FXGB 3HIFA 4MZUA 5FPBA 5J1XA 1YFWA 5DUVA 4CDUC 1LGCA 1RUJ1 4LO6B 2XUMA 5A3NA 2XWBB 2W2IA 3R4UA 5FFOC 2VZSA 4MSVA 4CDQC 2OUJA 5LK7B 4KGGA 3ECQA 1HRI2 4PQQA 4XE9A 3AB0A 4NRPA 3ABZA 3VZLA 1HQWA 4NWWA 3RI9A 2IFWA 2HYKA 2QTWB 5CKMA 1WMXA 1UZWA 2WO2A 1W8WA 1JOPA 1AZDA 2J1EA 4I3GA 1REFA 5K0UA 4Q0SA 4PDWA 5A7WA 4XUOA 5JOXA 3ZYJB 2WSVA 1VB4A 4P9XA 3MIBA 1GOFA 2JIJA 3D4KA 2AYHA 2D6LX 3H42B 3MI8A 3ES4A 4R9DA 4XTMA 4FPHA 5FZ8A 2J42A 1ULFA 1DQ4A 4S2FA 2EIGA 2NMNA 3KHCA 2K0GA 2A3YA 4AAXA 1WCDJ 4MV2A 2QQIA 2JG8B 1K3IA 4Q4X1 1HXS3 4MGSA 1K42A 3AK0A 1POV1 4GAZA 5FY5A 1IZ3A 5GLWA 1POV0 2LUWA 3OBZA 1Q43A 4A4AA 2LM3A 4PBPA 1TMF2 3IDCB 1FV3A 3AFKA 2HWB2 2C26A 1W6QB 1DQ0A 2WS91 3S5AA 3WD5A 1LJ7A 4XJWA 4MXWA 5A32B 4PLNA 5F1RA 3MDPA 1N1TA 2AGSA 2W68A 3UKVA 5FRAA 2R16A 4D69A 2Z69A 2Z2SB 1BBT3 2XJUA 3E6BA 3H3UA 2YU1A 3QOPA 3BPSA 1PVXA 2CDPA 3HJRA 3ON7A 5D8AB 3BUCA 1QJY3 5FZ3A 1LRHA 2JJ6A 2A5ZA 3GZEA 1GZCA 3ETQA 2PHDA 3RQ0A 2I07B 2ORXA 4P9WA 4CU6A 2E51A 2Q8EA 1LOBA 4BHPA 1VBD1 1WZXA 3WDYA 4XW3A 3BN6A 2P3YA 4FPLA 4BK4A 5DUXA 3K3OA 5DAQA 4DOUA 5JUVA 5KHGA 2YB7A 2XL9A 4OZXA 5FY0A 3MICA 5EJZB 3JB4C 2WA3A 1W2NA 4JRLA 3NSTA 4BQ2A 1LOGA 2PLV2 1C8M1 1H30A 2XONA 3AJYA 4IV1B 3X29B 5AFBA 1AX2A 1CAUA 5CNAA 4XBQA 1S0BA 1KQRA 3DL3A 3MIHA 5BNOA 2NN8A 1ZZ7A 2LW8A 3GZAA 3HVDA 3OY8B 3QH6A 5F8PA 2G1MA 1A34A 1V6OA 3FFZA 2XL7A 2ZZJA 2QJVA 3GBWA 5H9PA 3OF1A 4EZHA 5A70A 5ACA3 2AEZA 4BQ1A 3GBGA 4O65A 1RUG1 3LPGA 5F6LB 4Q4W1 4WZFA 1OOPA 4RGKA 5LBFA 4CDXC 4E2QA 1S2EA 5FXZA 3ZYPA 1GMMA 1XE8A 3HWJA 1DGRA 3LIGA 3ALQA 2CU5A 5FK8A 4FFHA 2WFPA 1W6OB 1HJFA 2AH2A 2D93A 2HWC3 1WCQA 1CVNA 5ISLA 1F4HA 2IWGB 1GWKA 2Q30A 4LIUA 2K2SA 2YV8A 1OC1A 2BGOA 5FO8B 2DYCA 5J7MA 1VR3A 3M7AA 1JHNA 4IGPA 4GJZA 3QLQA 4IEPA 2J1UA 5JLVA 1I3HA 3BTAA 2VW0A 4LT5A 1AVBA 1VBB2 4QPWA 2WYFA 3AXEA 3QH7A 4OUMA 4CTEA 3P5BA 4EV0A 1D0HA 3EHKA 1UCXA 3DPRC 1J3PA 1PO21 3OGRA 5E8AA 5A7OA 2XQRA 2HWB3 4L0PA 4N43B 5F39A 4IE0A 3SH3A 3UJQA 4AQ6A 1WWYA 1J1TA 4V2VA 4X6QB 3TEZA 1IS3A 5EZWA 4OHZA 5EV7A 3PJYA 1SFNA 2XBO1 2ZKNA 1MS1A 1QQP3 3THDA 1VAMA 4LIVA 3K48A 3VB9A 2ZEXA 3N4MA 1OSGA 1WGPA 4IQPA 2ZCWA 5DUWA 2WFF1 4KBZA 1X7NA 3VD9A 5FPLA 1RB8G 4K1YA 1QHDA 1H2LA 4RR3B 3IKWA 4LBQD 4Z07A 1LEDA 3LZZA 1MVEA 3PTYA 4ITCA 2A6ZA 1BQPA 2QZ3A 2QBXA 3FE5A 3M1HA 3CZUA 5CAZA 3U4SA 1K45A 4XURA 1NE4A 1RTVA 4MVTA 2ZABA 3ITQA 1SLAA 3DYMA 2XQXA 3I2HA 2A1XA 4JRAA 4OMCA 1JYNA 1N3PA 1ASJ1 4R8HA 1YQ8A 4LUMA 2EIDA 4RHV3 3Q8CA 5FZ0A 5F3GA 5FPAA 2ORZA 4AR2A 2YY1A 2VZOA 3KT1A 3K46A 1W90A 3KLSA 3HBZA 2VBBA 2W47A 3HPNA 3VBHA 1ZVFA 1SLTA 4H3WA 3NQHA 4XFIA 3LDBA 3D82A 2GZWA 4KBBA 3KGZA 3N36A 5IAXA 3ZFFC 1CAWA 4PDWB 1RITA 3H9AA 1UN1A 4UFLA 2R041 2WA4A 5C4WC 5CA6A 3S30A 4E4HA 4IE6A 4K21A 4YGCA 1NZCA 3BYWA 3IDBB 5FLJA 5JXHA 3AL6A 2VQUA 3I54A 3MW3A 3O1SA 1W06A 4LLFA 4W6XA 3O7OA 2NMOA 3TEXA 4CUAA 3DXUA 5KHKA 3VBFA 2VXJA 3RYPA 3RZJA 3USUA 1KJLA 1OKQA 2JB8A 3R4SA 5A6QA 1VBC2 5GLTA 4RQPB 2VCMA 5FZ1A 1A78A 3HNYM 1LR5A 2ZA9A 3AKTA 3HNBM 4Y33A 3HT1A 4X8PA 3MFCA 5LRRA 3O1TA 4HK8A 5FZMA 5GLVA 4FFIA 1VBB3 2DCZA 5T50A 3VZMA 3J7LA 2VMEA 3J9SA 4XHBA 5SV8A 4JKLA 4W6WA 1W0NA 3T2QA 4XHXA 3NKTA 1GWLA 2X05A 1VAVA 2QQUA 3K75B 4ASLA 2W1QA 2W91A 4XJUA 1V9U1 1YI7A 1COV3 1KS4A 2HEVF 5D1IA 2VMGA 3ZSKA 5L36A 4IEXA 4UF0A 2Y6KA 2ID4A 2ZGSA 2PA7A 4META 2HWD1 2XMLA 2IFRA 4QQPA 1R081 1O8SA 1N3QA 2FZ1A 4BCUA 3AYAA 4EN6B 4AVCA 2Y34A 3NO8A 4FPKA 3H7JA 3LQCA 3KCXA 4CA9A 2YMZA 2FMDA 3ACLA 2WYSA 4C8DA 1RUD1 1LESA 4XDPA 1OLMA 4R9BA 4L2NA 4BB3A 4AVTA 3ZYBA 2JDHA 5DXDA 1S0EA 2YC0A 3CU7A 1FPN3 3C8XA 4LE4A 3HN1A 4NROA 4CYDA 4UW5A 4YG3A 1W0OA 2IXKA 1PIV1 1OUSA 2W95A 4UT5A 4TZDA 4YFWA 4NWVA 4LKEA 4Y5TA 4NRMA 2JEMA 2OW4A 4EJRA 1I6XA 5JIAA 3AJZA 4XF3A 5EIYB 1DG6A 1SPPA 1NYWA 1Z7S1 1SMVA 1AX0A 1JN2P 2C1FA 2Y26A 4ZS2A 5FKBA 1AR62 4CVUA 3ILRA 2ZEZA 3FFQA 4YW1A 3KS7A 1RVF1 5AC92 1EPWA 2YUEA 4OI0A 1DIWA 1CAXB 3S57A 1K5MA 2BNMA 3WDXA 3AX4A 3UGFA 4BXFA 4E2GA 4JDOA 5LK5A 1WW4A 2WO3A 3N9NA 1C28A 3KV5A 3N9QA 4ZY9A 3MEPA 4G9SB 3WP4A 2ZBJA 2V5DA 5D8AC 1CAVB 5DPNA 3IMMA 3MIEA 1S1AA 1AYM2 1O3RA 3FBYA 1VBC3 4ISQA 5JMOA 5GM0A 4UWDA 4LBNA 1W9YA 2CYFA 1BVVA 3B01A 5JSPA 2WKKA 2RDRA 3NWKA 4Q4W2 5FO9B 4M3CF 1PO12 5A1AA 1JYTA 3MPBA 5H9QA 1RHI3 5I0TA 2WZ8A 5JR7B 3LE0A 4M3CB 3ZFEA 3WHTA 4A7ZA 3CQOA 5LEJA 1KFXL 1X9TA 3I2DA 4Y20A 4YZ4A 2Q8DA 2RJ2A 3JBG3 3THCA 1OD3A 2VMDA 2YC4A 2Y0OA 3VKMA 1NZIA 1XSRA 3M70A 1SDDB 1AR81 1MZ5A 4XFCA 1QNYA 4NHLA 2VZUA 1UIKA 1W9SA 5FWEA 1UKRA 2R072 5A3WA 5A7NA 4OLLA 2Q8CA 5KXCA 2XLFA 5CFDC 1DZTA 3SEPA 3VBSA 3OD0A 5K8SA 3VZOA 2V73A 2RJLA 1F15A 2W1SA 3UYJA 3L2HA 1MEC2 4WVVA 3VDCA 4D6RA 3HQUA 3ZX7A 1LHOA 3WDWA 1KITA 3EXUA 3SH4A 5HCBA 5BNNA 4KNCA 4Z2AA 1DP0A 3AZVA 1RC6A 5FQ0B 2GSYA 2VMFA 4NRQA 4QPIB 3ZXLA 4ZHNA 4RS5C 4ZZ5A 2NQYA 3BVCA 1XPWA 4A44A 3WLUA 1GQGA 1VBA2 4Z82A 3USSA 3WQ1A 3UNPA 3LFIA 2EIEA 1JZ2A 3VBHB 1JU3A 3JCIA 3WQ0A 3ZXKA 2Z4FA 5KXBA 4I3PA 3Q8EA 4P9GA 3S0MA 3ZKUA 4TN7A 5LZ6A 3NW4A 4ZXKA 2ZXQA 3RZLA 1H2NA 3LD8A 2ZGKA 2VQ0A 1J3RA 4N53A 5IFTA 1E5RA 2KXLA 1AR63 4CP2A 4COZA 1O5LA 1VAKA 2WR9A 3OGJA 4N43C 4Q0UA 4QX7A 1HQNA 1CJDA 3R0RA 3KSCA 3RYKA 4D6QA 2RS12 5AC93 3MZHA 2B42B 2BU9A 2R062 4UBGA 4BIOA 4PIZA 2ZGQA 3AP9A 5KXDA 3PL0A 1VLNA 3OUJA 3WX5A 1H1IA 5L19A 1XE0A 1RXFA 3H1MA 3VBUC 3E5QA 4AYUA 3IAPA 1S55A 2GNTA 2VQTA 4W4ZA 3PURA 2WDBA 1AYM3 5LA2A 5IVBA 5KXEA 3WQ7A 4QX1A 4UW6A 1YO8A 2HYXA 1LGBA 2ZOEB 5CG9A 2G19A 3PNAA 1EAH2 1OLRA 2WZEA 1KD7A 3LSEA 1OBNA 1PO13 2YBKA 3EBRA 3LEKA 4Y5SA 4KGQA 3TN93 5FMOS 4QQLA 5GLUA 2PHXA 4UF0B 1YC61 4TLFA 5DDJ1 1NKGA 1DGRN 2JE7A 3RS6A 3RJ2X 3SHRA 2ENRA 4R4ZA 1XXNA 1AL0G 2QNKA 4IEZA 4JX0A 5FZDA 2TNFA 2DF7A 2XLAA 2YU2A 4PHZA 1ZRIA 1OT5A 3ZDSA 3E97A 1WLTA 1LU2A 1QKQA 2C5DA 2VNGA 4CP0A 4CU8A 5K0UC 4PDWC 1G9AA 1BK0A 1PVC3 1NG0A 2UYBA 1G9BA 4DINB 2RS32 3OYWA 4DRRA 5DZFA 3SCGA 1C5HA 1MEC3 1QJY1 1XC6A 3ELNA 1K5JA 1NLRA 1OLQA 4Q2FA 2QUOA 2XVGA 1FV2A 4HONA 4Q0PA 4A6SA 1YYNA 2CWMA 3IDAA 5DN2A 2BFUL 1NUKA 1VBA3 3QD6A 3MV01 2Z79A 3ETPA 3C7GA 1SPPB 5FYBA 3SKJE 1VIWB 4E4DX 1UY0A 1HX6A 4FPGA 1ZYBA 3SITA 3DF0A 5BPXA 1W28A 4FT8A 4DRVA 4W8JA 5IATA 1U5ZA 3I97A 2H0BA 4DS0A 3ES1A 2R1DA 3M2MA 1ND2A 3NAPA 3ACGA 3DKQA 2XH6A 4HKWA 1OKOA 3AZWA 2FDGA 3GZUC 1NA1A 5ACA1 2RS13 3GXUA 3KHBA 4HN0A 4AW7A 1YXWA 2BRTA 1M06G 1J59A 3ZOIA 1RJ7A 5F7UA 5FYYA 5J37A 1TE1B 5I8SA 1ZZ9A 1EUUA 1SHWB 2DBIA 3HD8B 1QJU2 4BQYA 1CQ9A 4H14A 4HK9A 1OQEA 4JQTA 1NY71 4CCLA 4EN7B 2HWC1 4MUVA 1YWKA 4NUBA 2YGLA 2VZQA 3CZJA 1S0IA 5IAVA 4YLZA 2X5IA 1MZFA 1GQHA 5LRSA 4R4XA 1Q56A 2IXIA 3ZFEB 5C9AA 2WZR2 3PMSA 1AYN3 4PLOA 3GDBA 3PUAA 4L97A 5FUPA 2ARCA 1F8VA 1EAH3 4R9AA 4YW5A 4LLOA 2Y6JA 5BNOC 4R9CA 3GALA 1ODMA 1OH3A 3E5XA 2FCTA 1HQLA 3E1F1 3PUSA 3ASIA 2WAOA 1OFNA 2QE3A 4QPGA 4RN5A 5IW0A 4C91A 4E2SA 2OT7A 2A71A 2EA7A 3TNQA 4CDXB 4BWOA 4IE7A 4AWDA 4IEWA 1SCRA 1F2NA 1QQP1 4ZS3A 4KQ7A 3FJSA 2OX0A 4LKSA 3RRDA 1OUXA 3J7MA 3SXWA 4P9LA 2CGPA 4EN9B 1SCSA 5EJ1B 2I45A 1E57A 5FYVA 1JTZX 1O5UA 3CNAA 3NV2A 1GLHA 4PBOA 1XYOA 5DAWA 4AEJA 1X9PA 2JDUA 3O1VA 1H4HA 2HWE1 2GC2A 1G86A 2EXHA 3JD73 5C8CA 1UZ0A 3V65A 1DCSA 4K7JA 2JKBA 2A6YA 3ATGA 3V0BA 2EALA 4D94A 3DPRB 2C9KA 4N53B 3OUHA 4WVMA 1NCRA 2DVDA 3NJYA 5I0DA 1RUH2 4RHV1 1AHSA 3T2TA 2CTVA 1F5FA 4E9KA 4XJ8A 5CZKA 1LOAA 2MEV2 5CADA 2ET1A 1YEWA 2JECA 1XYNA 5DAXA 1JZ8A 4AFMA 3OBAA 3LF7A 3NKGA 1LOFA 1ENSA 5EQUA 3U1XA 2YPJA 3K4AA 1WA6X 1RUOA 4LHSA 2WSUA 1FXZA 3OGSA 5FJKA 3SKVA 5DUUA 1LCLA 2ET7A 2VOWA 4KWLA 2RS53 1XNBA 3WT3A 4CUGA 1HB3A 1HV1A 1IPSA 1RUC3 1QXRA 1UY2A 2G9FA 3LA7A 4ZU5A 3VDDB 1QOTA 3ZN6A 2NP0A 2HH9A 2D6OX 3HT2A 5A3UA 2E32A 4HANA 2R7EB 3EMRA 4S2GA 1QJU3 3DN7A 2JDYA 2FZ2A 3ZSEA 2QQLA 4Q8LA 4D7YA 2DTYA 5L73A 4IDZA 2BDRA 2J1RA 5A3OA 5CFCA 4FP2A 2R1BA 4W6YA 2HEWF 4XBNA 3AMHA 1LHWA 4LHNA 2D44A 2DUOA 1OQDA 4EWEA 2D43A 1JS9A 5DQ0A 4YARA 5C33A 2WZR3 4NPLA 4CUBA 5IUQA 3ZO0B 2GNMA 1HRV1 3TYJA 2VUJA 3VBHC 3N9LA 4A45A 1YLLA 2ARBA 1FMD2 3N3HA 5J36A 1GZ9A 2GALA 2P3JA 2NPIA 3RWNA 4AGVA 1COV1 2VQAA 4H7LA 2DUPA 1FOD1 1NQJA 1RUF1 4UFHA 3A7QA 4I02A 2BTVC 1ULDA 2A7AA 4P00B 4XEZA 3VBFC 1QJX2 5IVFA 5CB7A 1ZBE2 5EP9A 3KCCA 1CX1A 3WR0A 2PAMA 2BQPA 4V2WA 1YQ5A 2JG9A 3BU7A 4Z8BA 1AR72 1MZEA 2W92A 4IE4A 2VMCA 4XFGA 2Y0IA 4RFT0 5LBBA 3K77A 1O4YA 4IGQA 1AXKA 1B35A 3N7JA 4XAEA 4C1XA 1OVSA 1EV12 4CCJA 5KHHA 4JDNA 2R6QA 3VD5A 4AEDA 1FPN1 2VH9A 2O8OA 3TEYA 5FY9A 1RUE2 3JQWA 1SFPA 3GBFA 3P3NA 1Y7BA 1ND2B 2XOMA 4K9SA 1PMHX 3RYRA 1RUH3 4A3ZA 4M0NA 4D7SA 2BGCA 2RG4A 1XE7A 3U37A 1XNAA 3A0KA 2D3SA 2MEV3 3NNFA 5EYYA 4ES8A 1ZRCA 1TQ5A 1A8DA 2RV9A 2BP6A 3GHMA 3JQXA 4PJYA 4XMIA 3BI3A 5FYUA 3VBRB 5KHIA 3WHUA 1DQ1A 3KVAA 5FZ6A 1WMEA 1IPJA 3VZJA 3LGRA 3V0AA 4CEYA 4QKFA 1J3QA 4OUSA 3CEWA 4NPRA 3ZYFA 1EP0A 1RIRA 2B5HA 3ZYGA 2DCYA 3LWCA 2H0VA 3KF3A 4K40A 1XNCA 1APNA 2O0OA 2WN2A 2Q1ZB 3GYDA 4PCRA 4QKDA 5H9RA 3SNMA 4BDVB 5C3SA 4QDRA 3FC0A 2HKXA 1G7YA 3K4ZA 1RUI2 1D4M1 3WNOA 1Q8SA 5F2WA 4CPBD 3VLBB 2ZEYA 5FY8A 3O1RA 2HWF2 5IWFA 4QPGB 4CDWB 4BMEA 1DGWX 5FBZA 5A1FA 3I3EA 1WLCA 1UOFA 1DHKB 1RHI1 2FDJA 2RMU2 3OBTA 3MW4A 5KHJA 5LA1A 1FMD3 3ROUA 4NIHA 2L9LA 1HN0A 3UGHA 1OF4A 4Y26A 2BEOA 4YGEA 2FMYA 3BKZA 1BMV1 3JBG1 4OMDA 5L7OA 1K5MC 1OHFA 4KL1A 4PF5A 1FYUA 4XAAA 1MQTA 5FUIA 2RHPA 3KVBA 2DCKA 3GCXA 4BU2A 4QMAA 1VRH3 2WNUA 2JWPA 4GMP1 1MZ6A 4INDA 2PHFA 2RM22 4Q4V2 1VJ2A 4LO7A 5FCCA 3WF4A 4A2UA 4ET7A 1JUIA 3KT7A 3BIWE 3AC0A 4Y5Z0 3J4UH 4NIDA 3KV4A 3AZZA 2ARXA 1AR73 2WJSA 5ABJB 2GMEA 3UKTA 3R4DB 1I1EA 1RUNA 4M4RA 1QOSA 4XACA 3R6SA 1UOGA 4A7YA 2R32A 3BGAA 4TSVA 3OEAA 3T3YA 4AZZA 5DG1A 1URXA 1EV13 4QKNA 5BNPA 3WSOA 1CJPA 5E88A 4QM8A 4UFIA 4YYOA 4TTGA 2OQ6A 2YZ4A 2ZMLA 2ZGLA 3ZXFA 1R091 4BQ4A 1QJZA 1F31A 3ZFEC 2PTMA 4AFCA 4XCBA 3H8RA 4OQ9A 2E53A 4NHXA 4QX0A 4HG6B 5LY1A 4YZ2A 4Z92B 4E4SA 1WMDA 2WT1A 1X82A 5GALA 5DABA 2X09A 5HXMA 5JSRA 1OFSA 2WNOA 5CFDB 1HRI3 4YW7A 1Q8QA 2AZ5A 1C4RA 2YBSA 3O0VA 1K12A 4K3UA 3NNGA 4QX5A 3CKHA 3ZYIB 2ZMNA 3AKRA 4NN0A 4X8NA 4MOAA 4DEQA 3NNLA 2VD7A 5DZEA 5BNNC 3JUUA 4CXWA 4GWMA 2QDRA 4RS5B 5F5CA 1TME2 3IZOA 3I3BA 4LTAA 3VHPA 1H4GA 3THPA 3HN3A 1OA4A 4ZZ8A 4LJHA 4HSJA 2TEPA 5BXXA 4LKFA 1XJAA 2RR12 3GGLA 5C3QA 5C9AB 1SEFA 4IW3A 1CPNA 1Q5OA 3C7FA 1LAJA 4CXXA 5F9TA 3DV8A 4F7ZA 1C3HA 2RDQA 3LEIA 5FZEA 1QDOA 2HWF3 3OG2A 1SBDA 1CONA 3NJZA 4Q4Y1 4TYSA 4Y24A 5C5TA 1QJEA 2Y6LA 3KCYA 3A22A 3TN91 1TMF3 1W0PA 4N53C 4QQ2A 1W6NA 3T0DA 2VY0A 2RMU3 3LA2A 4OZOA 2KD7A 3WOGA 1U0AA 3LEGA 2WQ4A 1PGL2 4KWKA 1RXGA 1H2MA 1DGWA 1RJ8A 1BEV2 3K3NA 3O14A 4OHWA 4BQ5A 5FYIA 3O5SA 2BJSA 2G4IA 1KGYA 1RMU2 3SEEA 1W2UA 4QHBA 5FREA 3IBMA 2DWRA 4LO4B 3UESA 1QOOA 5FP8A 1PVC1 3VBUB 1G9CA 1R64A 1D2QA 1JHJA 3D8CA 2XHKA 4CCCA 5J96B 2BW8A 4K8RB 1W6MB 2GMMA 2WT2A 2R0FA 5IVCA 3VDDC 4AEDB 3BTZA 4Y1XA 1VBE1 4HSLA 2VOKA 2OVUA 3NNMA 4JGZA 4FAHA 5J09A 4C90A 1JOJA 2RJKA 4OQ8A 1XSQA 4JKMA 2GP5A 3LCPA 1R1A2 3GM8A 2ZX0A 2OA2A 3POEA 1BHGA 2ZGPA 4AQSA 3I2KA 2A73B 2PLV3 4UW4A 2PAEA 5EYXA 5F3IA 4GB32 4ATEA 3FHQA 1HIXA 4QD2A 5FK7A 4LOTA 3CLPA 1IGOA 1F35A 1V6IA 2ZHNA 3FHIB 4LQRA 3G7DA 3OPWA 5DZGA 3CIHA 3M3CA 2UWCA 4QXCA 3AXDA 1N3OA 4CEYB 5K0UB 1UZYA 1UXXX 5A7WB 4GJYA 2D6KA 5HPOA 2VZ1A 4YVWA 3AZXA 1WW6A 4JC1A 4CU7A 4GALA 1RUJ2 2J22A 5LASA 5A33A 2OIIA 2B45X 3FLTA 1Q3EA 2ARAA 4JGYA 1IG0A 5I0UA 2GNDA 2ZPXA 4UI9L 3NRUA 1HDKA 2BUKA 2Z5WA 2VTXA 2WO7A 3CMGA 3RI8A 2MPFA 1AJKA 1D0GA 2RR13 3LSDA 5EFUA 2P3IA 2QVSB 4Q29A 1GBGA 5CU1A 4AHZA 5BY5A 3SMHA 1UU5A 4H55A 1AYN1 3WNKA 2R49A 1UD1A 3GZTB 4MXWB 5C6CA 5L7OB 2W94A 5T5JA 5CG8A 4XF9A 5CIRA 4B3NA 1ND2C 2LROA 3NAPC 4P08A 4P9JA 2OYZA 2ES3A 5FPVA 3IAQA 1UOBA 4L92A 3RPQA 4XOGA 4CP1A 1KRIA 2PHWA 4Q4X2 1JH5A 1NA1C 4FFFA 2IVJA 1BEV3 5DAPA 2PELA 4O61A 4UXAA 4C0BA 3PUQA 2JIGA 3ZIXA 4FAGA 3URFA 1RMU3 2QQWA 4HVOA 2FDIA 1UYZA 2D5FA 3VBRC 1BKZA 5CISA 3GNEA 3MLJA 2XHNA 1CGPA 3T4VA 1TEIA 1UU4A 2WS92 1OURA 4HKOA 3EO6A 3VGIA 2MHFA 3PJQA 5IVVA 2XPJA 1ENQA 3POJA 2X5IC 2ZKLA 4LBJA 3E6CC 2XJSA 4KU8A 5C9AC 3GJAA 2DUQA 1CAUB 1UIJA 1W6PA 4NHMA 3MF9A 4WM7A 4XTPA 4RYDA 5FZAA 5LBEA 3RMYA 4O7XA 1JZ7A 5BNOB 3JD71 5F5IA 1VMHA 2ADEA 5T55A 2DBNA 4HPKA 2ATFA 3WP3A 1QEXA 1UAIA 1YIFA 1UKGA 1RGSA 1CZTA 5IYYA 1O4ZA 3WF2A 4QPGC 4CDWC 3CF6E 1TVGA 3MPPG 4TWTA 3WINE 3ILFA 5FLIA 5FBJA 3IIIA 1VBD2 1DQ5A 2BWCA 1LGNA 1OOPB 5LWBA 1C1LA 5FXXA 3WNLA 1GWMA 3AM2A 5T5LA 2PHRA 4MYEA 4CPBA 1H8TA 3T30A 4OVEA 3TEWA 3IPVA 1AL21 3DYPA 2IXHA 1C8M2 2BZDA 5FZBA 5C5UA 4YZ1A 1W9TA 3PLQA 2RS51 1H1AA 1RUJ3 3MFAA 4QXKA 4FBFA 3EQEA 2QQJA 2EIBA 2WNVA 1RUC1 3BALA 4E27A 2YBPA 1W8ZA 2PN5A 4FPEA 2F4LA 3K2OA 1BLZA 3PUIA 4E4ZA 4MH0E 3WG3A 3CBNA 4UFKA 4BOWA 2NM1A 2JD4A 4YM3A 5C8CC 4ASMB 1ULPA 4GWNA 3KM5A 4FTEA 4CP9A 1O3TA 4CCKA 5FMBA 1RUG2 5ABJC 3N9OA 3OUIA 2FDKA 2W9XA 2WUHA 1NCRC 1PZ8A 3B9CA 2PQQA 1UZZA 4LORA 2HBTA 1AR91 2BWAA 1JYIA 1UZVA 3B5LB 2VAUA 2JDNA 4D6SA 1H6YA 1LEMA 4CE8A 1JXNA 2E7AA 4QXBA 5IK7A 2GP3A 4GKYA 4V1PA 3ZM8A 1FAYA 1LOFC 4KH9A 3R05A 4I2OA 3SISA 2ZGMA 4LXLA 5FZOA 3B02A 1W8TA 4FVVA 1ND3A 3KQRA 2NYYA 1TZOA 2GMPA 1MS3A 4Q4X3 2Y6GA 1HKDA 2XJTA 1STMA 3RZKA 1NCQA 2V72A 1POV3 1ZBA1 4IEVA 4NAMA 1OA3A 1Y4WA 3MIDA 1DBNA 1UX7A 4OHXA 1PMIA 2XGXA 4N90A 2BERA 5FXWA 2BBVA 2GC3A 1PO22 1IS5A 2VUAA 3W5NA 4YVSA 5FZ9A 1NE6A 1H2KA 1H9WA 4DNYA 2JDKA 3PHMA 3AVSA 3RGBA 3IMNA 4TXWA 4A6OA 2XBO2 3S7IA 2VBPA 2DDUA 5FLHA 3O1UA 4D0QA 1W39A 1S4CA 2WFF2 3OGVA 4JDMA 4XF1A 1DZRA 2VR4A 2V4VA 4ISRA 5FYSA 1JYCA 4EN8B 1UYXA 2ZGUA 3J8F1 2Q8OA 4M3CE 1CAWB 2BPA2 1GZTA 5F5AA 3AMNA 3UV9A 5GJ6A 4AVAA 4LR4A 4AQTA 2XG3A 2WINB 5JXGA 1ZRFA 1DZQA 1W8UA 4XUQA 1JODA 3CO2A 4B4PA 1V70A 3D6EA 3WVJA 5A33B 5CYYA 3RNSA 2XJQA 3VBFB 1ASJ2 2YDEA 4N9IA 3WXPA 3USUB 4EZ4A 5C70A 1O91A 4OI1A 5T5OA 2QFEA 1X8MA 1NT0A 1FATA 4IV3A 1C8M3 3NV4A 2JG9C 3BIEA 1YQCA 3TB0A 2UURA 2VO5A 4QGNA 3EB7A 4FSJA 2LTNA 3AYCA 3RZGA 4Z2WA 5FR3A 5A6XA 2D6NA 1QH6A 5I0RA 3A4UA 4P9IA 3WDUA 2X8KA 5I91A 1IPKA 2WT0A 2R042 4AEDC 5HCAA 1ULCA 2FCVA 2PYTA 4XJZA 4XIKA 2V5YA 4FTSA 2J1VA 3OPZA 1W04A 1SBEA 2VCAA 4YWAA 1RUG3 2QDNA 4RL7A 1HXS1 3I2IA 1XNDA 4ONUA 4Q4W3 5FOJB 5FOBB 1X36A 3I59A 3KZ4C 3PIJA 4G3YC 4BJ0A 1UMZA 2DFCA 5FP3A 4LBQA 1H8VA 1LB2A 1VRBA 4MG2A 4AF9A 3WP6A 3OGGA 1GNZA 4MGIE 1PGW1 3POWA 3POIA 4ES9A 2TUNA 3BOWA 2C0ZA 5JSOA 4CCOA 3SH5A 2VNRA 4BLJA 2B9UA 2J7MA 2Q1FA 4FFGA 1FX5A 4XCAA 4CEYC 1ACCA 2R073 2A75A 5C8WA 1HV0A 4AG4A 4TLGA 2BV4A 3O1PA 3U11A 1LHVA 3RG0A 1BBT1 1IS6A 1CIWA 2UY9A 4FXKB 1UO9A 1VRH1 2W0XA 4EWAA 5I8TA 1S0CA 1W6PB 1T2XA 4WM7B 2KR2A 3I8TA 4NMIA 1FNZA 2ZMKA 1JZ6A 5A6ZA 1V6KA 1V9U2 5BUVA 3RMXA 2XBO3 2X53S 4YFZA 1REDA 1PX4A 1UNBA 1UY4A 2HWD2 4BLIA 1GR3A 3WCRA 3POFA 4C1WA 1Q8VA 1ST8A 1R082 5JMCA 3ZFFA 2QQMA 4AI2A 1ODNA 3JU9A 1A6CA 4RSUA 1G8WA 4YGBA 1Y9QA 4NJ4A 4NPMA 4B8EA 4XJ9A 2PQSA 2VGDA 4XDQA 2VZTA 1RUD2 2XKPA 1H8TB 1K5MB 1LODA 1QDCA 3PVBB 3AFGA 4FQZA 4Y4YA 5D21A 5L7OC 1SLLA 2J1SA 2DFBA 1MQTC 4ASKA 2F4PA 1YQ6A 4U2AA 4M00A 4BYYA 3U4XA 5FP9A 1PIV2 3TAYA 3WNNA 4AHXA 1ASJ3 4URTA 1HRI1 2WNUC 4IE5A 4CSWA 3HMYA 4N7IA 2R063 3WY6A 2QQVA 1CZVA 1SZBA 4AQ2A 2OZJA 2SBAA 5LY2A 1OF3A 1UU6A 2W52A 4N7UA 2DVGA 1DFQA 2BVBA 4HVRA 3AKQA 2C24A 4XQWA 1JZ4A 1Z0HA 5JOYA 1Z7S2 3ACHA 4XF4A 1WBFA 4GD4A 1VP6A 2IVIB 2YYOA 4Y1UA 3MW2A 1RVF2 2OPWA 1KS5A 2ZX2A 3OBRA 1MS9A 2R043 1W8NA 1UXZA 4CZSA 1MS4A 3KF5A 5IT6A 4Y20B 2OUHA 1BCXA 1UX6A 2CGNA 4UOJA 5FZOB 3UGGA 4QGMA 1QWRA 2J1AA 1XRUA 3D5OA 5JXJA 5SV5A 2P34A 1CD3G 3LEMA 3QACA 1CN1A 2A3XA 1NCQB 1AUYA 1QGLA 2BYVE 2ZX1A 1TMF1 4FPJA 4IEOA 5FZ7A 2VC9A 3VBSB 5E89A 4JHZA 3U07A 2HWB1 3BCWA 1J83A 3C7EA 3I3MA 2C4XA 4EN0A 3U14A 4BK5A 1JZ3A 4P02B 5FZ4A 3U10A 1PGSA 2P1BA 1E5IA 1JBCA 3HOBA 3IIAA 1OOPC 4GKXA 4QPYA 5BNNB 1DU3D 4DMIA 2W3JA 2RS33 4COYA 1GICA 4FO9A 2VE1A 2C6SA 1FNYA 1I5ZA 2JG8A 2JKXA 4QWNA 3T0AA 3T2PA 5DAVA 2JDPA 4PI0A 4BE3A 1PNFA 4LOSA 1AR82 1NLSA 3B9IA 1JI6A 4GIQA 1UPSA 5LEKA 4NIGA 4GZ9A 2WBKA 1F9KA 4GWJA 2Y6FA 2R0HA 2HWD3 2VNOA 5F32A 2WABA 1W9WA 4BQWA 2CWSA 2G9GA 3T2OA 1W6QA 3M3IA 3ZFGA 3RJRA 5AVPA 2E33A 3AP5A 5KC6A 2C9AA 3BPZA 2W5FA 3P3PA 4OHVA 4YPJA 2I2SA 2PLV1 3OEBA 4BISA 5A32A 4KMQA 4BMBA 2CSGA 1DYPA 5A3LA 3CDZB 4UW3A 1HJGA 4B1MA 1ZNPA 1KJRA 3L9JT 5E16A 4Q8KA 5JI9A 2CHHA 1F5JA 3KV9A 3LAGA 1IQAA 1AJOA 2K46A 1PIV3 1IG3A 1W03A 3J7NA 4GWIA 2W08A 1N1VA 3VBOA 4QM9A 4LKDA 5IVYA 1YNAA 4QB6A 4K1ZA 4IGOA 4M0HA 2HEYF 4YG0A 3POYA 5H9SA 3V56A 4JGZC 3MHZA 4B1LA 4F3JA 2VXRA 1UYPA 1E5HA 3NV3A 1ALYA 1IKPA 4QQHA 3I59B 3JZVA 5L9RA 4IV1A 3N9MA 4YRDA 4ZKTB 3RDIA 1RVF3 5FV3A 2VMHA 2IC1A 4J1XA 4LBQB 3F2ZA 3ZSMA 2PHUA 4JHTA 5GLZA 5M0TA 4FCAA 1UQXA 5FKCA 2FDHA 3WF3A 4B7KA 1MS8A 5IVEA 2GU9A 1D4VB 3I2GA 1QF3A 4G4FA 4K8FA 4XZPA 1VBB1 2A3WA 3AMPA 3E5UA 4OI4A 4QHOA 3MF6A 4AI9A 1OA2A 2YGMA 1PMJX 2MNGA 4OULA 4PQ9A 4XIOA 5CBLA 4AE2A 4LO5B 5JOWA 1UF2C 1T6GC 3OYWB 5IFPA 2VOTA 3POBA 4YVWC 2UWBA 3ACIA 4P5HA 2P6HA 4L99A 3J26N 4XUTA 1DDLA 3FMGA 1W6OA 1IKQA 4YW6A 1REEA 1AXYA 4NHYA 4XXPA 4XETA 5DDJ2 3ZYHA 4XUNA 1KDKA 1ZZCA 4AEMA 1ZRDA 1PGW2 5AVAA 1L7LA 3FUQA 3KT4A 2DU1A 1XQNA 2OPKA 3AKSA 3LOBA 1QH7A 4XMAA 4WBBA 3I3QA 3SC7X 3SCFA 2WWSA 1LOEA 1AF9A 2B7YA 1HB1A 4AL9A 4N8MA 1JUHA 1V0AA 4KWUA 2Y6HA 3VN4A 4FOVA 1W9FA 1GV9A 1GOGA 2VCBA 4B7EA 3NAPB 1U5XA 4WVWA 1QJY2 4RD7A 3DYOA 1J1LA 4AHYA 4P5YA 2VULA 1PNGA 4IEYA 1NA1B 3QCWA 4XFBA 3L2YA 4I0BA 3WG1A 3H8OA 2DVAA 3MGUA 5EHDA 1LOCA 2YPDA 3NVCA 1XB9A 5FYCA 4Y1ZA 4RR3A 2WO1A 3LKJA 3MYXA 3W59A 4AVSA 4ATFA 1GSLA 4NOTA 1FT9A 4MHRA 4QT6A 5JR2A 4FTBA 1HW5A 3HQRA 4GH4A 4NIAA 2WNEA 2X5IB 3K51A 3U75A 2DVFA 3O12A 4CUCA 4WM8A 2DTWA 3ST7A 4I09A 5LB6A 3NV1A 2VOVA 4WM7C 3P1IA 2BOIA 4AFDA 2ZGTA 2B8MA 1OQ1A 1YJLA 3KB5A 3Q9OA 4IERA 4NE9A 1IS4A 4Q0VA 4IL7A 4XUPA 1VBC1 3WZ1A 5ACA2 3GF6A 1H9PA 3V64A 1RINA 2Y60A 4YW2A 3NJXA 1OPMA 3ZR5A 5JXIA 1HB2A 2CAVA 2WQ8A 3H50A 5FPUA 4XVHA 2X10A 3NNJA 1NY72 2HWC2 1WD3A 3IDEA 5A7PA 1G9FA 1J84A 4Y3OA 2V4AA 2ZHLA 1S0DA 1EUTA 3KMHA 3ZN5A 1H8TC 1JU4A 3FUOA 4AGRA 2CAUA 5KC5A 4UBHA 4XF0A 4BIFA 3T08A 4HMZA 4CCEA 2XKOA 3LIHA 1GU3A 2QCSB 1H1MA 2WWUA 2WZPP 3WCSA 2YHJA 4AGGA 4LHKA 2WNVC 3EJKA 3SCHA 1JW6A 1QJX3 2ZGRA 1D2SA 1ZBE3 1B09A 3AVRA 2QQOA 3IT8A 4RQPA 2E7QA 1Q8OA 4GMP0 1OXCA 5DDJ3 3ZLIA 4DPNA 5C8CB 1HN1A 4J1WA 3WF0A 2BFUS 2D6PA 5J3UA 2DVBA 1X33A 3V0BB 4HFSA 1OI6A 3ZFGB 2F6BA 3EYPA 2H6CA 4WVMB 4MX3A 3M8LA 3WG2A 1NCRB 1WCSA 4XBLA 2R30A 4LNVA 4IESA 4Q26A 5EXOA 1QQP2 1EPZA 5JI7A 1S0JA 1QXPA 1SFYA 4XILA 3T1LA 1ZZ8A 5FP7A 3ZXGA 1O3SA 4HXCA 4DXTA 1RUE3 2VPVA 4WVZA 3OPTA 3H3LA 1H0BA 4IETA 1YI9A 5LATA 1YCIA 4UFMA 2DURA 3TRSB 1PK6A 4BQXA 2GDFA 1I5PA 2AR6A 3ZSLA 1ND3C 1MACA 2GNBA 2DCJA 4URAA 5FZGA 5FMDA 2BBAA 2HWE2 3ZN6B 4O9GA 3PU8A 3VBOB 1NCQC 3CJIA 2XB6C 4BQ3A 1AR61 3PVOA 1NAEA 1QMJA 1XOYA 2E63A 2IXCA 4WV8A 3VBSC 2LS6A 2VECA 3VHNA 2JICA 1YIPA 1IHMA 3I2JA 3AMMA 3PDQA 3UT0A 1O4TA 5AC91 3KGLA 3MBWA 4LBMA 5IHRA 2D3RA 1W3XA 4YVSC 4RHV2 3WNMA 2ERFA 2ZHKA 4LPLA 3ZXJA 2QQKA 5CFCB 3WW2A 1U5IA 2J1TA 4AVBA 5F37A 5HV4A 5A7QA 5D2AA 4XZUG 1VE0A 3C3VA 4FI9A 3KD4A 2VZ3A 1AYM1 1Y9MA 4LBKA 2WC2A 3W21A 1RUI3 1CIYA 2AENA 2XWJB 1QNWA 1C5IA 2D97A 1Y9GA 2HJIA 5DG2A 1GZWA 4FPCA 2A6VA 2XJPA 3FHAA 5FY1A 3INAA 1GP5A 1PO11 4OI2A 3WDTA 3AP7A 5EPAA 1CX4A 1ENRA 3F95A 1CAXA 4B4RA 4JZRA 3VDBA 3ZPOA 2P2KA 2EICA 4DQAA 2W46A 4YM2A 5HCHA 1UWWA 4YW3A 1LTEA 1L3JA 1ENXA 3FN9A 2AREA 1BYHA 4QQOA 4B29A 2EF6A 3M3QA 4DXZA 2PFWA 4IV3C 3KWVA 3LDKA 2JG9B 2YROA 3BTXA 1CAVA 3UJOA 4XYXA 2R071 1XYPA 2VTFA 1HRV2 4LA3A 5I8YA 4XDOA 2NZ9A 5FP4A 5CVRA 1B35B 2RM23 4HN1A 4Q4V3 5E1RA 5K7PA 4ARYA 5BV6A 1MEC1 4XPVA 4Z1VA 1PZ9A 3ZR6A 4RA0A 3ZKYA 1WMFA 1X8EA 3AYDA 3H7YA 4A42A 3MLKA 2OKXA 1DYKA 2VL4A 2X29A 5B4NA 1WLWA 3D3AA 1COV2 5FMOL 1YRZA 4YW4A 3TBDA 3G6JB 3VL8A 1FOD2 5GZCA 1RUF2 1N1YA 1DLCA 2D98A 2AC1A 4M3CA 2E9QA 4LE3A 3D0JA 4XFAA 2OQ7A 4YM0A 1VBA1 4K20A 3H0OA 4YZ3A 1PHMA 3H1WA 2EXIA 4Q0QA 4DY3A 2JE8A 2P6CA 3WUCA 1XU2A 2WL1A 2VOXA 4Q27A 1MS0A 4QDQA 4MXVA 2UU8A 4C0HA 1WCUA 2EXJA 4MGTA 1Q8PA 1V6NA 4RFRB 5E6HA 4AEKA 3V0AB 4LBLA 1T6BX 2HWE3 2XR4A 5GZDA 4GH4B 5JZGA 1ONAA 2ZTNA 2E7TA 1FPN2 4K6BA 2CV6A 1MPXA 4MGKE 2VTXJ 3AP4A 4WM8B 2P4EA 3H8UA 2O1QA 4D8MA 1W3VA 4X6RB 5FZKA 5FQ0A 1CWPA 4W50A 2RS11 4MHUA 4QPIA 4QB2A 4ZPIA 2R061 1IOAA 4FOYA 2VU9A 1NOVA 2BNNA 2E31A 2WLQA 4IEUA 5HBAA 3VUOA 4NIIA 1TME3 2H6BA 1TNFA 1YUDA 3KQ4B 3QBQA 3AKPA 5A3PA 4Y22A 5A3MA 4F8AA 3DUIA 3TWIA 4UAPA 5ANNA 1OVPA 1H6XA 1SLCA 5FDBA 4QAWA 4CEWA 1TG7A 4YZ5A 2CL2A 4N9HA 4AI3A 4QX8A 1O7FA 2B39A 2GH2A 1WBLA 4FPFA 2PXJA 2IXJA 3I7DA 4AOCA 3UETA 2E6VA 4NO4A 1EAH1 4YNIA 3HR9A 2F17A 1MQTB 3IWZA 5FO7B 4YSFA 1L7RA 3OCPA 1BVP1 3AP6A 5AFEA 2WNUB 3ZN4A 1O3QA 2VMIA 2VG9A 2XVLA 1D4M2 1QJFA 1YFYA 3H1YA 4QU1A 3S7EA 2YXSA 2O8QA 3C7OA 2WRAA 4P14A 4Q1RA 2CNAA 4SBVA 1WUVA 2ZX3A 3POSA 2Q1MA 3IM0A 2EVXA 1ULGA 4MLOA 1HRV3 2RDSA 1W2OA 1RHI2 3T4HB
chains in the Genus database with same CATH topology
2RS31 4QU2A 1GANA 4YG6A 2ZAHA 5BNPB 1ULEA 1UL9A 4JTNA 4B4QA 1ZZBA 4CDUA 5JPNB 4LULA 5FPXA 1BMV2 5JVVA 3JBG2 2D3PA 3LB9A 1N1SA 2VW1A 2FQPA 4GQ7A 3M4FA 3ME2A 1FOD3 1RUF3 1SLBA 2W39A 1R1A3 3RZZA 1PK6B 4FPOB 1SQ4A 5T3NA 3TOJA 4PIYA 3S6PA 2Q4SA 4P9YA 1CPMA 1I9RA 3CJIB 4AI1A 4GB33 3BODA 2FHRA 4S2HA 4GULA 1GNHA 1GYKA 1G9DA 5GZFA 3ZXEA 2JE9A 1KXGA 3VKOA 1R092 1YFUA 2ILMA 1PM7A 5I0SA 3JB8A 1R1ZA 3RSJA 3FX3A 2GN3A 1LKNA 2JG8C 4Y1VA 3NL1A 1OD5A 4FOWA 1GKBA 3B69A 4ZU4A 4L9BA 4BPZA 4BZ4A 4FP3A 4XJAA 5GZEA 3M3OA 3WW3A 1QJU1 4L11A 3M3EA 1GZWB 2D40A 2D6MA 1S2KA 4A7KA 2ZAAA 4GA9A 2B46X 2QKDA 2XJVA 2GC0A 3FBMA 3ZFGC 2WLPA 1W6NB 3BB6A 5B2GB 4Y1YA 4MGYE 1RL3A 2WZR1 5JWPA 1YJKA 4W65A 2UWAA 4J6GA 4IXLA 3FWEA 3MIFA 2CGOA 4RGGA 3OD4A 4COWA 3N7LA 3VKFC 1C1FA 5HXVA 3VHOA 4JAAA 4I01A 3VL9A 4D3WA 4L8QA 1V00A 1ZRRA 4DZGA 5KBFA 1D4M3 1NXMA 2N7GA 5F6KA 1SBFA 2KM2A 2QZ2A 3VBOC 4AFBA 4Q4Y2 4BH9A 1GFF2 4JGZB 1ZX5A 3GHNA 2NLRA 3TN92 4A3XA 5KWRA 2WS93 4KWJA 4IV1C 5CFCC 1AX1A 5JPMB 1ZM1A 5JDBA 2A6WA 1N47A 1PVC2 4GMP3 4AI8A 5FPZA 4DFSA 1UPIA 5JZGB 4PIXA 2KA3A 4CDXA 1RUH1 1VBE2 4YVWB 4U36A 4LHLA 1LHNA 1EY2A 3O0XA 1VBD3 2MEV1 1S0GA 3APBA 4XQ4A 1QY4A 4JGYB 3VKLA 3LA3A 4NVPA 4RGAA 4JQRA 1R093 1XNKA 3DKWA 4Y22B 1OPOA 3AYEA 4CEWB 2ZJCA 1S0FA 3AMQA 3OJBA 4I0AA 4WZCA 1AXZA 2ZGOA 5FAXA 3UK9A 4DB5A 1B35C 1WW7A 1LU1A 1YFXA 1FI2A 4HVQA 2VW2A 1ZA4A 2IXLA 3DPRA 3WG4A 3C2UA 5JIUA 2GC1A 3PVNA 4YGDA 3E6DA 5I93A 1DGLA 4I30A 4FOQA 1V6JA 5GKAC 3WW4A 1C8NA 4R52A 2JX9A 1ZREA 4COUA 1LENA 3ZXAC 2BNOA 4IEQA 3IN9A 3ZMNA 3UL2A 3FLPA 3MIGA 1FMD1 3VDDA 1BK1A 2Y38A 4RR3C 3N35A 2V09A 3B94A 2EXKA 2QQPA 2VVDA 4CDUB 1AYN2 5JOZA 1EYBA 4GH4C 2VVFA 1BXHA 4Q4Y3 3N7KA 4ORFA 4WM8C 4CDQB 1QJX1 2LALA 1ZBE1 2PHTA 1PO23 1MR5A 5K9YA 3B3QE 3WDVA 1WD4A 3CJXA 3HQXA 3OTFA 1AR71 4HPKB 4LBOA 1DF0A 5T54A 5T52A 5IK8A 1U12A 4MGZE 3B00A 3UKNA 3ZSJA 2WFF3 1EV11 4QGLA 2UYAA 5C4WA 4XQDA 4OHYA 3WV6A 1RUE1 2ZGNA 3T1MA 4HLTA 4AFAA 1BZWA 4FQ4A 4AHWA 4KG0A 1VBE3 5T5PA 1S2BA 3IPVB 2GN7A 3O0WA 1SACA 1HLCA 2WNVB 4M01A 3JD72 2EAAA 3H3ZA 1V6LA 4KU7A 2A70A 4RQPC 2XVKA 3MLLA 4HZFA 3TNPB 4JVAA 4HKLA 3A0NA 3PVEA 2Q0AA 3FLRA 5F5QA 4O9EA 2D5HA 4AXOA 4F83A 2D7FA 5BNPC 5J48A 2DU0A 5HI0A 1LULA 1AL22 2GH8A 4GXLA 5EJ3A 2RS52 1WCKA 1RUI1 3ZXDA 1LECA 1RUC2 1PK6C 1ND3B 2P17A 2ZHMA 2EAKA 2HWF1 3VBRA 4LO8A 3W9AA 4KG8A 2CY6A 1VB2A 1WW5A 3CJIC 4PLMA 2UY8A 2RMU1 2ETEA 2FBEA 4AVVA 3THTA 3VHRA 1CR7A 3D0SA 2RE9A 4YVSB 1M4WA 2K9ZA 3AZYA 5J98B 1AR92 2BVVA 2Q5TA 3WUDA 4H7MA 4Q1PA 3ENRA 2JENA 4HL0A 4SLIA 3B93A 2RM21 4Q4V1 3ILNA 3SLIA 4AK3A 1V9U3 2ZS6B 4ZU7A 3CL1A 4CDWA 2P37A 5IK5A 1ZBA2 3ZPYA 2AUYA 3WP5A 1R083 5HCFA 4OFGA 4CRQA 5JAXA 4LEJA 3WNXA 4FPYA 3I4IA 4HBNA 1RUD3 4IV3B 1A3KA 2ZACA 1YHFA 3DGTA 5D8AA 2DCTA 4HETA 5JCTA 3VKNA 2I74A 2JDZA 3FZ3A 3N7MA 1DQ6A 4EROA 3J8F2 5ABJA 4BA6A 4D7TA 1VALA 2ZX4A 1DLLA 5FTTC 1Z7S3 3ZMOA 2P3KA 4BM8A 4LA2A 1TME1 3ZIWA 2PHLA 4XFFA 3LOIA 1U5YA 4NR1A 4I0WB 4DY5A 1AL23 1Y3TA 3W58A 2RR11 2WIIB 3VZKA 4EWDA 4LUKA 5BNQA 2Z42A 3OY8A 4NHKA 1X50A 4YM1A 5CFDA 2TBVA 1MS5A 1NXD1 1QXJA 2A6XA 2XJRA 3PMEA 4HT1T 5JZGC 3U0ZA 1MVQA 1Z78A 2VVEA 3WW1A 4JTOA 1PGL1 5EWSA 1OMIA 2SLIA 5TSWA 1HXS2 4RS5A 1BEV1 4QPIC 4AI0A 5GZGA 1V6MA 3HAGA 1DQ2A 4JGYC 1AR93 3BOPA 1RMU1 4JCKA 4COVA 1CESA 2ZZQA 5IK4A 1ZZ6A 5BYNA 1WA4A 4XFHA 1J58A 1C57A 2JXAA 3ZFFB 2WQZC 4XXAA 4CEWC 2PAKA 1AR83 5C4WB 3VZNA 1SLIA 4JV4A 1ZBA3 4S2DA 3ZYRA 1BJQA 1BBT2 1R1A1 4N43A 1QU0A 1NQDA 1VRH2 2DV9A 1XU1A 1KDMA 3VV1A 1G6NA 1UW8A 2IZWA 2OZ6A 4GB31 1TNRA 3B7MA 1SDWA 2XLGA 2GAUA 3VBUA 1A8MA 1KFUL 1WLDA 1W6MA 1PZ7A 1LHUA 3J8F3 1Y43B 4FXGB 3HIFA 4MZUA 1YFWA 5DUVA 4CDUC 1LGCA 1RUJ1 4LO6B 2XUMA 2XWBB 3R4UA 5FFOC 4MSVA 4CDQC 2OUJA 5LK7B 4KGGA 3ECQA 1HRI2 4XE9A 3AB0A 3VZLA 1HQWA 4NWWA 3RI9A 2IFWA 2HYKA 1AZDA 4I3GA 1REFA 5K0UA 4Q0SA 4PDWA 5JOXA 3ZYJB 2WSVA 1VB4A 4P9XA 3MIBA 3D4KA 2AYHA 2D6LX 3MI8A 3ES4A 4R9DA 4XTMA 4FPHA 1ULFA 1DQ4A 4S2FA 2EIGA 2NMNA 2K0GA 2A3YA 1WCDJ 4MV2A 2JG8B 4Q4X1 1HXS3 3AK0A 1POV1 1IZ3A 5GLWA 1POV0 2LUWA 1Q43A 2LM3A 4PBPA 1TMF2 3IDCB 1FV3A 3AFKA 2HWB2 1W6QB 1DQ0A 2WS91 3WD5A 1LJ7A 4XJWA 4MXWA 5A32B 4PLNA 5F1RA 3MDPA 1N1TA 2AGSA 2W68A 3UKVA 5FRAA 2R16A 4D69A 2Z69A 2Z2SB 1BBT3 2XJUA 3E6BA 3H3UA 3QOPA 1PVXA 5D8AB 1QJY3 1LRHA 2JJ6A 2A5ZA 1GZCA 3ETQA 2PHDA 3RQ0A 2I07B 4P9WA 2E51A 1LOBA 4BHPA 1VBD1 3WDYA 4XW3A 4FPLA 5DUXA 4DOUA 5KHGA 4OZXA 2XL9A 3MICA 3JB4C 2WA3A 4JRLA 3NSTA 1LOGA 2PLV2 1C8M1 1H30A 3AJYA 4IV1B 3X29B 5AFBA 1AX2A 1CAUA 5CNAA 4XBQA 1S0BA 1KQRA 3DL3A 3MIHA 5BNOA 2NN8A 1ZZ7A 3GZAA 3OY8B 3QH6A 1V6OA 3FFZA 2XL7A 2ZZJA 2QJVA 3GBWA 5H9PA 3OF1A 5ACA3 4BQ1A 3GBGA 1RUG1 5F6LB 4Q4W1 4WZFA 1OOPA 4CDXC 4E2QA 5K8SA 3ZYPA 1XE8A 3HWJA 1DGRA 3ALQA 2WFPA 1W6OB 2HWC3 2AH2A 2D93A 1CVNA 2IWGB 2Q30A 2K2SA 2YV8A 5FO8B 2DYCA 5J7MA 1VR3A 3M7AA 1JHNA 3QLQA 4IEPA 5JLVA 1I3HA 3BTAA 2VW0A 1AVBA 1VBB2 3AXEA 3QH7A 4OUMA 4CTEA 4EV0A 1D0HA 3EHKA 1UCXA 3DPRC 1J3PA 1PO21 5E8AA 4AQ6A 2HWB3 4N43B 3SH3A 4LT5A 3UJQA 4X6QB 1J1TA 1IS3A 5EZWA 4OHZA 5EV7A 3PJYA 1SFNA 2XBO1 2ZKNA 1MS1A 1QQP3 1VAMA 3N4MA 3K48A 1OSGA 1WGPA 4IQPA 2ZCWA 5DUWA 2WFF1 1X7NA 1RB8G 4K1YA 1QHDA 1H2LA 4RR3B 3IKWA 4LBQD 4Z07A 1LEDA 3LZZA 1MVEA 3PTYA 4ITCA 2A6ZA 1BQPA 2QZ3A 3FE5A 3M1HA 5CAZA 1NE4A 1RTVA 4MVTA 2ZABA 1SLAA 4JRAA 1N3PA 1ASJ1 4R8HA 4LUMA 4RHV3 2YY1A 3KT1A 3KLSA 3HBZA 3VBHA 1ZVFA 1SLTA 4H3WA 4XFIA 3D82A 2GZWA 4KBBA 3KGZA 3N36A 3ZFFC 1CAWA 4PDWB 1RITA 3H9AA 1UN1A 5CA6A 2R041 2WA4A 5C4WC 3S30A 4K21A 4YGCA 1NZCA 3IDBB 5FLJA 3I54A 3MW3A 4LLFA 4W6XA 3O7OA 2NMOA 5KHKA 3VBFA 3RYPA 3USUA 1KJLA 1OKQA 3R4SA 1VBC2 5GLTA 4RQPB 1A78A 1LR5A 2ZA9A 3AKTA 3HT1A 4X8PA 3MFCA 5LRRA 4HK8A 5GLVA 1VBB3 2DCZA 5T50A 3VZMA 5SV8A 3J9SA 4XHBA 4W6WA 4XHXA 3NKTA 1VAVA 4ASLA 4XJUA 1V9U1 1YI7A 1COV3 1KS4A 2HEVF 5D1IA 2VMGA 3ZSKA 5L36A 4IEXA 2ZGSA 2PA7A 4META 2HWD1 2IFRA 4QQPA 1R081 4BCUA 1N3QA 2FZ1A 3AYAA 4EN6B 4AVCA 3NO8A 4FPKA 3H7JA 3KCXA 2YMZA 2FMDA 3ACLA 1RUD1 1LESA 4R9BA 4L2NA 4AVTA 5DXDA 1S0EA 2YC0A 3CU7A 1FPN3 4LE4A 4CYDA 3HN1A 4UW5A 4YG3A 1W0OA 2IXKA 1PIV1 4TZDA 4YFWA 4NWVA 2JEMA 2OW4A 4EJRA 1I6XA 5JIAA 3AJZA 4XF3A 1DG6A 1NYWA 1Z7S1 1SMVA 1AX0A 1JN2P 2C1FA 2Y26A 1AR62 3ILRA 3FFQA 4YW1A 3KS7A 1RVF1 5AC92 1EPWA 2YUEA 4OI0A 1DIWA 1CAXB 1K5MA 2BNMA 3WDXA 3AX4A 4E2GA 4JDOA 5LK5A 1WW4A 1C28A 3MEPA 4G9SB 3WP4A 2ZBJA 5D8AC 1CAVB 3MIEA 1S1AA 1AYM2 1O3RA 3FBYA 1VBC3 4ISQA 5GM0A 4LBNA 2CYFA 1BVVA 3B01A 5JSPA 2WKKA 3NWKA 4Q4W2 5FO9B 4M3CF 1PO12 3MPBA 5H9QA 1RHI3 5I0TA 5JR7B 4M3CB 3ZFEA 3WHTA 4A7ZA 5LEJA 1KFXL 3I2DA 4Y20A 4YZ4A 3JBG3 3VKMA 3VUOA 2Y0OA 3M70A 1AR81 1MZ5A 4XFCA 1QNYA 4NHLA 1UIKA 1UKRA 2R072 4OLLA 5KXCA 2XLFA 5CFDC 1DZTA 3VBSA 3OD0A 3VZOA 2V73A 2RJLA 3L2HA 1MEC2 4WVVA 3ZX7A 1LHOA 3WDWA 1KITA 3EXUA 3SH4A 5HCBA 5BNNA 4KNCA 3ZXLA 3AZVA 1RC6A 5FQ0B 2GSYA 4QPIB 4RS5C 2NQYA 3WLUA 1GQGA 1VBA2 4Z82A 3USSA 3WQ1A 3VBHB 5KXBA 3JCIA 3WQ0A 3ZXKA 4I3PA 4P9GA 3S0MA 3NW4A 4ZXKA 1H2NA 2ZGKA 2VQ0A 1J3RA 4N53A 2KXLA 1AR63 4CP2A 4COZA 1O5LA 1VAKA 4N43C 3OGJA 4Q0UA 1HQNA 1CJDA 3R0RA 3KSCA 3RYKA 5AC93 2RS12 3MZHA 2B42B 2R062 4UBGA 4BIOA 4PIZA 2ZGQA 3AP9A 5KXDA 1VLNA 3WX5A 1H1IA 5L19A 3H1MA 3VBUC 3E5QA 4AYUA 1S55A 2GNTA 1AYM3 5KXEA 3WQ7A 4UW6A 1YO8A 2ZOEB 1LGBA 5CG9A 3PNAA 1EAH2 1OLRA 3LSEA 1KD7A 1PO13 3EBRA 4KGQA 3TN93 5FMOS 4QQLA 5GLUA 2PHXA 5DDJ1 4TLFA 1DGRN 2JE7A 3RS6A 3RJ2X 3SHRA 2ENRA 4R4ZA 1XXNA 1AL0G 2QNKA 4IEZA 2TNFA 2DF7A 2XLAA 3ZDSA 3E97A 1WLTA 1LU2A 1QKQA 2C5DA 2VNGA 4CP0A 5K0UC 1G9AA 4PDWC 1PVC3 1NG0A 2UYBA 1G9BA 4DINB 2RS32 3OYWA 4DRRA 5DZFA 3SCGA 1C5HA 1MEC3 1QJY1 3ELNA 1NLRA 1OLQA 4Q2FA 2QUOA 2XVGA 1FV2A 4Q0PA 1YYNA 2CWMA 2BFUL 1VBA3 3QD6A 2Z79A 1VIWB 4E4DX 1HX6A 4FPGA 1ZYBA 3SITA 3DF0A 5BPXA 4FT8A 4DRVA 1U5ZA 2H0BA 4DS0A 3ES1A 2R1DA 3M2MA 1ND2A 3NAPA 4HKWA 2XH6A 3AZWA 3GZUC 1NA1A 5ACA1 2RS13 4AW7A 1J59A 4HN0A 1M06G 1YXWA 1RJ7A 5J37A 1TE1B 5I8SA 1ZZ9A 3HD8B 1QJU2 1CQ9A 4H14A 4HK9A 1OQEA 1NY71 4EN7B 2HWC1 4MUVA 1YWKA 2YGLA 1S0IA 4YLZA 2X5IA 1MZFA 1GQHA 5LRSA 4R4XA 1Q56A 2IXIA 3ZFEB 5C9AA 2WZR2 3PMSA 1AYN3 4PLOA 4L97A 1F8VA 1EAH3 4R9AA 4YW5A 4LLOA 5BNOC 4R9CA 3GALA 3E5XA 1HQLA 3ASIA 1OFNA 2QE3A 4QPGA 4C91A 4E2SA 2A71A 2EA7A 3TNQA 4CDXB 4BWOA 4AWDA 4IEWA 1SCRA 1F2NA 1QQP1 4KQ7A 3FJSA 3RRDA 3SXWA 4P9LA 2CGPA 4EN9B 1SCSA 2I45A 1E57A 1JTZX 1O5UA 3CNAA 3NV2A 1GLHA 4PBOA 1XYOA 4AEJA 1H4HA 2HWE1 2GC2A 1G86A 2EXHA 3JD73 5C8CA 3V65A 4K7JA 2JKBA 2A6YA 3ATGA 3V0BA 2EALA 4D94A 3DPRB 4N53B 4WVMA 1NCRA 2DVDA 1RUH2 4RHV1 1AHSA 3T2TA 2CTVA 1F5FA 4E9KA 4XJ8A 5CADA 1LOAA 2MEV2 2ET1A 2JECA 1XYNA 4AFMA 3NKGA 1LOFA 1ENSA 2YPJA 1RUOA 2WSUA 1FXZA 5DUUA 1LCLA 2ET7A 2VOWA 4KWLA 2RS53 1XNBA 3WT3A 1HV1A 1RUC3 1QXRA 3VDDB 2G9FA 3LA7A 4ZU5A 3ZN6A 1QOTA 2NP0A 2D6OX 3HT2A 4HANA 4S2GA 2FZ2A 1QJU3 3DN7A 3ZSEA 4Q8LA 4D7YA 2DTYA 5L73A 5CFCA 4FP2A 2R1BA 4W6YA 2HEWF 4XBNA 3AMHA 1LHWA 4LHNA 2D44A 2DUOA 1OQDA 4EWEA 2D43A 4YARA 5C33A 2WZR3 5IUQA 3ZO0B 2GNMA 1HRV1 3TYJA 2VUJA 3VBHC 1YLLA 2ARBA 1FMD2 3N3HA 5J36A 1GZ9A 2GALA 2P3JA 2NPIA 3RWNA 4AGVA 1COV1 2VQAA 4H7LA 2DUPA 1FOD1 1NQJA 1RUF1 4I02A 2BTVC 1ULDA 2A7AA 4XEZA 3VBFC 1QJX2 5CB7A 1ZBE2 3KCCA 3WR0A 2PAMA 2BQPA 2JG9A 3BU7A 4Z8BA 1AR72 1MZEA 4XFGA 2Y0IA 4RFT0 1O4YA 1AXKA 1B35A 3N7JA 4C1XA 1EV12 5KHHA 4JDNA 2R6QA 4AEDA 1FPN1 2VH9A 2O8OA 1RUE2 3JQWA 3GBFA 3P3NA 1Y7BA 1ND2B 4K9SA 3RYRA 1RUH3 4M0NA 4D7SA 2BGCA 1XE7A 3A0KA 2D3SA 2MEV3 5EYYA 4ES8A 1ZRCA 1TQ5A 1A8DA 3GHMA 4XMIA 3JQXA 4PJYA 3VBRB 5KHIA 3WHUA 1DQ1A 1WMEA 1IPJA 3VZJA 3LGRA 3V0AA 4CEYA 1J3QA 4OUSA 3CEWA 4NPRA 1EP0A 1RIRA 2B5HA 3ZYGA 2DCYA 3LWCA 2H0VA 4K40A 5C9AB 1XNCA 1APNA 2O0OA 4PCRA 2Q1ZB 3GYDA 5H9RA 3SNMA 3FC0A 2HKXA 1G7YA 1RUI2 1D4M1 1Q8SA 3VLBB 2HWF2 4QPGB 4CDWB 4BMEA 1DGWX 5FBZA 1WLCA 1DHKB 1RHI1 2RMU2 3OBTA 3MW4A 5KHJA 1FMD3 3ROUA 4Y26A 2BEOA 4YGEA 2FMYA 1BMV1 3JBG1 5L7OA 1K5MC 1OHFA 4KL1A 4PF5A 1FYUA 1MQTA 2RHPA 2DCKA 4QMAA 1VRH3 2WNUA 4GMP1 1MZ6A 4INDA 2PHFA 2RM22 4Q4V2 1VJ2A 4LO7A 5FCCA 4A2UA 1JUIA 3KT7A 3BIWE 4Y5Z0 3J4UH 3AZZA 2ARXA 1AR73 2WJSA 5ABJB 2GMEA 3UKTA 3R4DB 1I1EA 1RUNA 1QOSA 3R6SA 4A7YA 2R32A 4TSVA 5HCAA 5BNPA 5DG1A 1URXA 1EV13 1CJPA 5E88A 4QM8A 4YYOA