3LZZA

Crystal structures of cupin superfamily bbduf985 from branchiostoma belcheri tsingtauense in apo and gdp-bound forms
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
161
structure length
161
Chain Sequence
EEVKRLIALYELTPHPASGGWFRETYRSDVQVEAEGFDGKRSVLTMIYYLMQAGQPDPFHRVKSDETFVHNLGGSMKIHMIHPDGSYSCSILGNPLEHPEARHQVVVPRRVWFAQEVDGYCLASVLVAPGFDFKDFSLGKREELIKEYPQHRDVIMRCTSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Putative uncharacterized protein
publication title Crystal structures of the apo and GDP-bound forms of a cupin-like protein BbDUF985 from Branchiostoma belcheri tsingtauense
rcsb
source organism Branchiostoma belcheri tsingtauense
total genus 39
structure length 161
sequence length 161
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06172 Cupin_5 Cupin superfamily (DUF985)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3lzzA01
2UY8A 4HZFA 4YSFA 3RYPA 5I8TA 1L3JA 2BNMA 3ELNA 3DV8A 2WC2A 4FBFA 4LEJA 1UIKA 4KWLA 4WZCA 4AVCA 4JTOA 3KGLA 3S7IA 1ZNPA 1ZZ9A 3CJXA 3D82A 1XRUA 2HJIA 1ZVFA 2Q0AA 3BALA 3BPZA 4L11A 3UKNA 3CO2A 1ZZBA 4ZU5A 5LEKA 1QWRA 1RUOA 2GH2A 1J59A 5J48A 4RD7A 2UYAA 1LKNA 1WGPA 2XLFA 2QNKA 3FFQA 2IXJA 2C0ZA 5BY5A 3SXWA 3IBMA 3CLPA 4XF1A 4YARA 2I45A 3U11A 3E97A 3LAGA 5JR7B 2O1QA 3U0ZA 2K0GA 4Q0VA 2UYBA 2H6BA 1UPIA 2XKPA 2BNOA 4IETA 1DZTA 1O3RA 3RPQA 4E2SA 3FZ3A 4BHPA 3CEWA 1J3RA 3H50A 4MV2A 5J3UA 4QMAA 4XFGA 4KU8A 4KU7A 4KL1A 5BV6A 1UIJA 3NSTA 4PIYA 2BNNA 2ET7A 4X6RB 2B5HA 4XFFA 3USSA 5KBFA 3H1YA 3G7DA 2EAAA 1O5UA 3H8UA 2CAUA 3FJSA 4LULA 4XF0A 1ZZ6A 5I91A 1J3PA 3FX3A 1YFWA 4J1XA 5FLIA 3C3VA 3SCFA 2XL7A 4HSJA 1LRHA 5JCTA 1TQ5A 4FAHA 2PAEA 2IXIA 4N9HA 4WVZA 2D40A 5F1RA 2D5HA 3RNSA 2CGPA 2VECA 3LA7A 2XLGA 1HW5A 3PVBB 4IEYA 1ZRCA 4K8FA 1OI6A 3NVCA 4JVAA 5I8YA 3RYKA 4XF9A 1VR3A 4IEUA 4YRDA 4I01A 4B29A 1DGWA 1X8MA 1O3TA 5EZWA 5KHJA 3IDBB 3CL1A 4QM8A 2OA2A 2XGXA 5I0SA 2PQQA 4HN1A 4P9GA 4EROA 5FQ0B 2QCSB 5AVPA 5FLHA 1CAWB 3LA3A 4XFHA 1IPKA 1OD5A 1WLTA 1RC6A 3KMHA 4IEZA 3KGZA 1X7NA 1X8EA 1Q43A 4BH9A 2PAMA 4QXKA 3DKWA 3H1MA 1FT9A 1EY2A 5I93A 2OPKA 3IWZA 4X6QB 2B9UA 3FE5A 4JV4A 4HVQA 1I6XA 4Z07A 5I8SA 3DN7A 1Q3EA 1YUDA 4ONUA 3E5QA 5BUVA 4MGZE 5CU1A 3SCGA 1CAUA 3GBFA 1ZRDA 5BXXA 2HKXA 4I09A 1SQ4A 3SCHA 3HQXA 2QVSB 2ZKLA 4LLOA 4MH0E 3M3IA 5J7MA 3LA2A 3MDPA 1O3QA 1NE4A 4ORFA 2P17A 1RUNA 4N9IA 2Q1ZB 3EJKA 2PTMA 1SFNA 3VHRA 3BCWA 4LUKA 1O4TA 3EO6A 4L2NA 4HBNA 4IEWA 3I59A 3TNPB 4JTNA 1DGRA 4J1WA 3WW2A 4AVBA 3PLQA 3H9AA 4MGKE 4Z82A 5C6CA 3MYXA 3ZDSA 5JSRA 4O9EA 4I0BA 5LRRA 4HVRA 2IXCA 4HSLA 4IEPA 4OLLA 1YWKA 1G6NA 3WW1A 4XEZA 3LOIA 5KHHA 3OCPA 1ZREA 4HMZA 5BPXA 1CX4A 2EA7A 4PIXA 2Q4SA 1PM7A 1X82A 3R6SA 4QM9A 2IXHA 1RGSA 1IPJA 3DL3A 1UW8A 4LA3A 3E5XA 1QY4A 3OD0A 4IEXA 4CYDA 1Q5OA 3D0JA 1LR5A 2FMYA 3IIAA 2GAUA 2V09A 4Q0QA 3UKTA 5D1IA 1EYBA 4AVAA 4O9GA 3NKTA 2OZJA 3EBRA 1XE7A 5EFUA 2XKOA 2Z69A 1RTVA 2Z2SB 4QGNA 4I0AA 4E2GA 2KXLA 3OGJA 1NXMA 3HT1A 4GULA 4BYYA 5JSPA 3N4MA 2IC1A 3BB6A 4WBBA 4KWJA 4ZU7A 1YLLA 1VP6A 2CAVA 2QJVA 4IESA 4D7SA 4R8HA 2GU9A 4LUMA 2UY9A 5KHGA 1NYWA 2MHFA 4I02A 3RYRA 4META 1V70A 3NJZA 5K8SA 4QGLA 4D7TA 2PHLA 4IEQA 5E16A 1XE8A 4TLFA 4FT8A 4I3PA 1GQHA 3H7YA 4PIZA 4OFGA 5I0TA 4UXAA 5JAXA 4XETA 4MUVA 5C8WA 3RDIA 4BIFA 5FLJA 2OZ6A 3ACLA 1CAUB 3H3UA 4YYOA 3ES4A 1Y3TA 2IXLA 1WA4A 3NW4A 3TNQA 2O8QA 2D5FA 4F7ZA 3EQEA 1J1LA 4EWAA 3E6DA 3M70A 4MGIE 2ETEA 4AXOA 1JUHA 2VQAA 1YFUA 1ZRRA 2D93A 3JZVA 3B02A 4HN0A 4XFIA 3I7DA 3FWEA 3E6CC 3OTFA 4AQ6A 1OMIA 3D0SA 4H7LA 3MPBA 1UCXA 3U10A 3S0MA 2PFWA 1YFYA 2XL9A 4Q29A 4LTAA 5LEJA 4MGYE 2N7GA 3H1WA 5HI0A 1DZRA 5FDBA 5I0RA 3I59B 2H6CA 4PJYA 2ZCWA 2F4PA 3L2HA 5FCCA 1J3QA 1ZZ7A 4UBHA 2PYTA 4QGMA 1CAVB 4UBGA 1CAVA 5FPXA 2VPVA 2MNGA 1NZCA 3ETQA 4EWDA 3KSCA 2K9ZA 4EV0A 4HLTA 1O7FA 2IXKA 3UKVA 2DCTA 1J58A 4I2OA 3E6BA 5CVRA 4XFBA 1H1MA 1EP0A 4QX5A 3I54A 2OYZA 3O14A 5KHKA 4HVOA 3ROUA 4Q0SA 5E1RA 2PA7A 3GYDA 4MX3A 3FHIB 2GC3A 4IEVA 1EPZA 1CGPA 4LA2A 3HIFA 3IDCB 1GQGA 3QACA 3WW4A 1I5ZA 3BU7A 2ET1A 1RL3A 2B8MA 4YNIA 3PNAA 2EVXA 4R52A 5T3NA 3ES1A 4XFCA 1O5LA 1OFNA 4AQ2A 2GC2A 4MZUA 3EHKA 2QDRA 2ATFA 5I0UA 2XHKA 2GC0A 1SEFA 4IEOA 3HT2A 2GZWA 2PAKA 4XFAA 2E9QA 4A2UA 3QOPA 2Q30A 4XF4A 4F8AA 5LRSA 4Q0UA 3MZHA 1NE6A 4Q0PA 4FAGA 3LWCA 3NL1A 1Y9QA 3CF6E 1ZX5A 3WW3A 1YHFA 1LB2A 4XF3A 4ZU4A 1QXRA 2XLAA 2H0VA 1U12A 3H7JA 4KWKA 1VJ2A 1ZZ8A 2MPFA 3OF1A 3H3ZA 1YFXA 1ZRFA 1PMIA 2Y0OA 3KCCA 1FI2A 2GC1A 4NVPA 3E5UA 3SHRA 5KHIA 3SMHA 3S7EA 1CAXB 1UD1A 1CAXA 1H1IA 1ZZCA 1FXZA 4IERA 2FQPA 4EWEA 5CADA 5FQ0A 3RZZA 2BGCA 4E2QA 2BYVE 4DINB 1CAWA 1QXJA 2PHDA 5FPZA 2WFPA 1O3SA 3ST7A 2CV6A 3LZZA 5JSOA 2BEOA
chains in the Genus database with same CATH superfamily
1UMHA 2UY8A 4HZFA 1ACCA 3DKQA 4NPMA 4YSFA 5AC92 4AEJA 2CGNA 3NAPB 3WUDA 1SCSA 2X05A 1L3JA 1Y4WA 2X8KA 1C3HA 4FTSA 5C8CC 1FOD1 1GOHA 2FZ1A 3G6JB 3DGTA 4KWLA 2F6BA 5FKCA 4XURA 4JDMA 2LUWA 1WCKA 5C5TA 3S7IA 1ZZ9A 3TYJA 3AFKA 4E4SA 3D82A 3BIWE 2VTXJ 2VVDA 5A3WA 1RUC2 4Q8LA 1ZVFA 1DDLA 1HB3A 4KNCA 2NP0A 3UKNA 3AYDA 3T2QA 3URFA 2X5IC 2Q8EA 1S0CA 2WZ8A 2VOWA 5LW9A 4QQ2A 4NN0A 4QKDA 1OQEA 1BEV1 3NV2A 1PO22 3AYAA 4QPIA 5J48A 4K3UA 5FYYA 5FXVA 1PGSA 1W04A 4QHOA 3WV6A 1LKNA 1WGPA 3ZN6A 4GWIA 3NNJA 4IXLA 4FPCA 1XNDA 1QJEA 5C70A 2ZZJA 1BMV2 4NE9A 1LOGA 1PO12 3APBA 1AL21 4LBQB 3VBUC 5A6XA 1LGNA 1BXHA 1HJGA 4YARA 5FZ8A 3RJ2X 2WNUB 3WNOA 3ZYBA 4ZZ5A 3C7GA 3LAGA 1RUF3 4CXYA 1PGL2 5JUVA 3BTAA 2O1QA 3VZOA 2JKBA 1HRI3 4E9KA 2DVFA 1XYOA 2ZAHA 1AX2A 4Q4V3 1UPIA 1F2NA 3VBRA 4D6SA 4N53B 1I5PA 1OUSA 2BVBA 3AL5A 4I0WB 1D0HA 4FO9A 4E2SA 3FZ3A 5F5AA 4L9BA 4BM8A 4DRVA 2CNAA 4P9JA 3CEWA 3UESA 1UOBA 4MV2A 1RUE2 3CQOA 5BNPC 2V5DA 1NG0A 3T4VA 4CDUA 2JEMA 2ZOEB 4NWVA 1HN0A 2WSVA 3VD4A 3AMHA 2A6ZA 4XC9A 2VMFA 3NSTA 5F37A 2WNVB 4EZ4A 4YLZA 1W0OA 3SISA 3BGAA 1VBB2 1O5UA 3H8UA 4IL7A 2VMGA 4QPYA 2J22A 1QJU3 3L9JT 4QDRA 5EPAA 3FJSA 5T5JA 2JJ6A 2FZ2A 3K4DA 4LULA 5FK7A 3HJRA 2VU9A 1WMFA 3QH6A 3KM5A 1RINA 3MF6A 2ARCA 5FMOL 5I91A 5T55A 1NA1B 4K6BA 4JQTA 4TSVA 3FX3A 4YM2A 3BKZA 1L7LA 1S0BA 2PHWA 3AZWA 5IK4A 5FLIA 4HSJA 4LJHA 1JYXA 3WR0A 4K40A 5L73A 4V1PA 2VTXA 1QJY1 3AKSA 3ZVXA 4N9HA 2FDHA 4WVZA 1N1TA 5TSWA 3TB0A 2JDMA 2QDNA 1Z7S1 1W6QB 2D5HA 1VRH2 3K46A 2V5YA 2VNRA 5KXEA 3M3CA 3J8F3 4C0HA 1H8TA 2ZX2A 4JGZC 1H4GA 1OVSA 2AEYA 2W87A 4Y4YA 3ZFFA 1AR73 4IEYA 1QIQA 1D4M3 3WNMA 3OUHA 1RUH1 2FBEA 3NVCA 4JVAA 4A6SA 1TMF2 5CZKA 3WNPA 3MIEA 3V0AA 4XF9A 3GCWA 5FWEA 1YEWA 1X8MA 1OF3A 4AEDA 5F5IA 5KHJA 1KFUL 1GZTA 5LY2A 3CL1A 1JYIA 2YC0A 2WS92 4TTGA 2YV8A 2BJSA 4AQSA 4M4RA 4HN1A 2E63A 3RQ0A 2LRPA 2P6CA 2QCSB 1ZRIA 4BJ0A 3ZSKA 4AHWA 4XDOA 1TG7A 5AVPA 2PMWB 5FLHA 3LA3A 4XFHA 2P3JA 2YMZA 2VZUA 1OD5A 4LK6A 4DO0A 1LECA 3VZJA 1WLTA 4IV3C 1K12A 5F8PA 3KGZA 3D8CA 5A32A 1X8EA 2DVDA 2D97A 2XJSA 4HK8A 1OH4A 1UOJA 5A7SA 3LEGA 1W6MA 3DKWA 1GMMA 3A21A 3VBOC 2JD9A 2RR11 1H2NA 3H1MA 3ATGA 1EY2A 3VL9A 1AYM2 3NMBA 5FREA 5L9RA 4ES9A 5A6QA 4PBPA 1GWMA 4GB32 1G7YA 4GH4A 4IGQA 3VZKA 4NIDA 4Z07A 3N7KA 5I8SA 2ZTNA 1H2LA 1FPN2 2CWMA 4OHZA 4CDXC 1YUDA 1W8WA 1POV3 2ZX3A 5BUVA 4P02B 3SCGA 2WAAA 3IMNA 4DUVA 1CAUA 4BLIA 3GBFA 2VOVA 4ASKA 5BNOA 3UJQA 3ZKUA 3OSDA 1W05A 5A3PA 3SEEA 3WY6A 1UMZA 1PVC2 5FZCA 3WF1A 3NNFA 5FUNA 2B4KA 3LFMA 2VZSA 3HQXA 4XAEA 3P3PA 1YXWA 3KT4A 5GZDA 4RS5C 5SV5A 2PQSA 2VOKA 2XHNA 3OBTA 4DIQA 1RUNA 1LOFC 4S2HA 4DFSA 1V6KA 3AJZA 3UJOA 2E7AA 1ONAA 1HV0A 1AR93 2Y6JA 3OGSA 5DN2A 2ZS6B 4TN7A 3L2YA 5LA0A 5C8CA 1G9CA 4CCKA 4YZ2A 1S2KA 4FQZA 4QB1A 3MGUA 1OD3A 4ARYA 1RUJ1 1BBT1 2VZ1A 2A73B 4XJ8A 1H0BA 4AVBA 3VBHC 2CTVA 2X5IA 1OT5A 2ARXA 4CU9A 1DQ1A 5EQUA 1DQ6A 1VBD2 4Q4X2 3PUSA 3PU8A 1R092 2FD8A 3WSOA 2B45X 2J1TA 3A22A 3BYWA 5JDBA 2GH8A 1SZBA 4JRLA 4O9EA 4I0BA 3W21A 1W6OA 1OOPC 5CB7A 2IXCA 4IEPA 5DQ0A 4BISA 1YWKA 4GWJA 3ACHA 5CBLA 3WW1A 4XEZA 3LOIA 1O59A 2RMU1 5KHHA 1PIV1 4COUA 5ANNA 5CG8A 1CX4A 1IQDC 3AB0A 5SV8A 2DCZA 4LQRA 1EV13 3N3HA 1PM7A 2ZA9A 5A7WA 2R32A 1AR62 3MI8A 5A3OA 1IS5A 2RJ2A 3QCWA 1IPJA 1ASJ3 2HWF1 5IATA 3SH4A 1UW8A 4CXWA 2KD7A 1QF3A 2C9AA 1LEDA 3DYMA 3MHZA 1XPWA 2IVIB 3AP4A 3ENRA 3KZ4C 4FFFA 2ZGLA 4AVTA 2FDGA 3UGHA 2Y6LA 1HRV2 4PDWC 1E5RA 1UX7A 3ECQA 3ILNA 1QOOA 4IW3A 5BNPA 2YUEA 1BHGA 2FMYA 4LHSA 1RYYA 5F9TA 2VBBA 1JZ3A 2OW4A 1DLCA 2W1WA 1GQPA 1GWKA 1WWYA 3UKTA 1VPHA 4CP9B 5FR3A 4AHXA 4AVAA 4YGEA 1S0DA 1WW6A 2UU8A 4E4HA 1AJOA 1QJX1 1ODMA 1XE7A 2WSUA 3C7EA 4FPGA 2AACA 1O8PA 5K0UC 1RTVA 5DUWA 3PMEA 4I0AA 1SBEA 2PLV3 3I3QA 2ZJCA 4CUAA 3HT1A 1N3QA 3FMGA 2VUDA 1RUD1 2XH6A 2IC1A 2R0HA 1E5HA 4DPNA 1V6LA 4XMAA 1MEC3 1R082 4GWNA 2XDVA 1VAMA 4JHTA 4OMDA 3WDYA 4KI5M 4PF5A 4FCAA 4EYUA 2D44A 4G4FA 2P2KA 5B4XA 4UW4A 5DAVA 3AKRA 5DAXA 2RM21 4R9CA 1HX6A 2RJKA 4LNVA 1R1A3 2EIGA 3LEIA 4R8HA 2UY9A 4UFIA 3N35A 5KHGA 4AFCA 4OI0A 1V70A 2CYFA 4CDWC 1RHI1 5FZ7A 4JGZA 1PZ7A 3BOWA 4D7TA 2RS51 4PT6A 3D6EA 1B35C 3J7MA 4FOYA 2KR2A 4N43C 3WDUA 5HXMA 1CX1A 1REEA 3HNBM 1NCRB 3TEWA 2X53S 1DLLA 2XR4A 2R49A 1QQP1 2D3RA 5FP3A 2AC1A 1UU4A 3ZMOA 2QQVA 5C8WA 4DY3A 4U36A 5FLJA 1IKQA 5DG1A 4BK5A 3TEYA 1ZBA2 3ACLA 3Q8CA 1SLCA 3ES4A 2HWE1 1IS3A 4K1ZA 4YFWA 2O8QA 4F7ZA 2R062 3EQEA 1ND3B 1VBC2 1S55A 4MSVA 3M70A 5F3GA 4CVUA 4EWAA 4IV3A 5JXJA 3POIA 3VDDC 2ZGKA 4Q4W3 4KGQA 5FZGA 3PURA 2WZEA 1Y43B 1ZRRA 2D93A 5IUQA 5I0DA 4P5HA 4QPGB 3USUB 3VBOA 3I7DA 1YO8A 1POV0 2HLEA 1RMU3 3BU0A 1AYN2 1AF9A 2SLIA 4LE3A 3E6CC 4AQ6A 1FNZA 5FYMA 5AC91 1SPPA 4GMP1 4ZS2A 4H7LA 1SLIA 4FPYA 2XXZA 3M3EA 3ZO0B 1PNFA 4RQPA 2WFF3 4LO4B 4Q4Y3 2W1UA 4KBBA 5LBCA 2PFWA 3ZLIA 3S0MA 2WWJA 5IW0A 4CDXA 4RGAA 2JIGA 4LTAA 4BQ3A 2E32A 3CKHA 4HG6B 5M0TA 1WA6X 4L0PA 2VW0A 3KF3A 1C8M2 5I0RA 3RZHA 4PLNA 1X33A 1KJLA 2P3IA 2A6XA 2YXSA 1LULA 1CONA 3VBSC 3ZKYA 1RUC1 2D3SA 1COV3 2ZCWA 5FXXA 2LM3A 3RG0A 5FZOB 3ZFEB 2F4PA 3WCSA 5FCCA 3O7OA 4RR3A 4UBHA 2EXKA 1ENRA 1XNCA 5JXIA 1CAVB 2RVAA 4WM8C 1PO21 2SBAA 3B94A 2MNGA 4XJZA 3WDTA 5KWRA 4XUNA 4RS5A 4ZONA 5FY8A 5F3CA 2G9GA 3MIDA 2R1BA 4MGQA 2DCTA 5GLZA 1LOFA 5CVRA 2W52A 2VZQA 4XFBA 4LXLA 3OEBA 5FUPA 2Y6GA 1BMV1 3T08A 4XBNA 1PO11 4QX5A 1XNAA 3B9IA 5JR2A 5JXHA 3HVDA 4NHKA 2DCJA 5GZCA 1P8JA 3I2IA 3ZXLA 3N7MA 3Q9OA 2R30A 3SKJE 4AQTA 4BDVB 1OLMA 4C1XA 1JU3A 1PGL1 3FHIB 3ZSEA 4RFT0 1QKQA 1FV2A 2XG3A 1HJFA 2VMDA 1JZ8A 1CGPA 2Y6KA 5IK8A 3VBHA 5J96B 1X9PA 5FKBA 1D4VB 1I5ZA 1VBE3 3ALQA 3AYCA 1VB2A 3B7MA 3OUJA 1Q8QA 1GNZA 3O1OA 1DBNA 5CNAA 1RUE1 4CUCA 3SQOA 2ADEA 1UKGA 1TME3 2ADDA 3ZXJA 4WM7C 1NX9A 4GWMA 1OOPA 5LCWL 1VBB1 3MIHA 2EAKA 4OUSA 2V4VA 5I0UA 2NZ9A 5E8AA 5J36A 3IZOA 4IEOA 1N47A 2C9KA 1DHKB 2WLPA 4GMP0 5A3UA 5HV0A 2GZWA 3UNPA 1C1LA 2VZTA 4A2UA 4HKOA 2Q30A 5LRSA 4F8AA 3LCPA 5HXVA 1Y9GA 5T52A 1NE6A 2G4IA 1FX5A 3WEZA 4ITCA 4XPVA 4ASMB 1OSGA 4B4RA 3LWCA 1AXZA 2TEPA 4NHLA 5ABJB 1YHFA 1RUF2 4PDWA 4CE8A 5CAZA 3N9LA 3GBWA 3R4DB 5HCAA 1HRI2 3MUZ1 2WYFA 5A7OA 4KWKA 5JWPA 2VAUA 1VRH1 1HKDA 2B9VA 3OB8A 4Q4V2 2JDYA 4DXZA 2JE8A 3OF1A 4LPLA 1KXGA 4Y5Z0 2GNDA 2A3XA 1QMJA 2QTWB 3KCCA 4CDQC 3VZNA 5GM0A 1W6PB 4IE5A 2VVEA 3M2MA 5KHIA 1TMF1 5K0UA 2C6SA 3SMHA 3S7EA 1ULEA 2RV9A 4IV1C 1W9TA 4AAPA 5CISA 4QX7A 4MADA 1DYOA 1DCSA 4IERA 5IVYA 2C26A 4OZXA 4A45A 1S0JA 1G86A 4FOQA 3Q8EA 5FFOC 2WS91 1QJU2 4JAAA 2PHDA 5GLUA 5ACA3 2WFPA 4NO4A 3ZIWA 5F7UA 4JX0A 5FYZA 5T5LA 1QNYA 4CUGA 2ZEYA 4ATEA 4CPBA 3M3OA 1WCDJ 2D98A 2BEOA 1V6OA 4CDWA 1AR63 2O8OA 3K4ZA 1S4CA 3IPVB 5D8AB 1GICA 4UFKA 3PUAA 4XUTA 4HK9A 1F8VA 5EV7A 3JD73 1A3KA 2P6HA 2BNMA 3HWJA 3ELNA 3DV8A 2WC2A 4FBFA 3VKOA 4BQ1A 1AYM1 3O1MA 4FPOB 4AK3A 5CEHA 1ZA4A 4XQDA 4UW6A 3PVNA 5DXDA 5ANQA 3HN1A 4GB31 3RGBA 3J8F2 2GP3A 2WDBA 3HNMA 4OI4A 5E6HA 2HJIA 1FPN1 2Q0AA 3SH3A 3EXUA 3BPZA 4L11A 1AR72 1JOJA 1U5ZA 1UNBA 2D6MA 1WW7A 1D4M2 2VNVA 3C7FA 3ITQA 3JCIA 3JU9A 4OHXA 5C71A 3CO2A 4LHKA 1BKZA 4Z2AA 4YW6A 4COWA 2RS13 2VCBA 4ZU5A 4ZY9A 4XILA 3ZYJB 5J1XA 2JG9B 1RUOA 2BWCA 4MXVA 2CGOA 4RD7A 1YCIA 3MF9A 1YRZA 1PVC1 2JXAA 2Q5TA 3CJIC 2P37A 1H6XA 3I97A 4XBQA 5FO7B 3WX5A 3ZN6B 1IZ3A 3VDDA 1U5YA 2C0ZA 2IXJA 2ZHMA 3UGFA 5JXGA 2A5ZA 3CNAA 3ZYRA 3SXWA 5BY5A 3RJRA 3BTYA 3O1VA 3VV1A 4JKLA 1ND2A 4FP3A 1F5JA 3MW2A 5A33B 1URXA 3E97A 3O0WA 4JGYC 5LBFA 5IVBA 3KD4A 2R043 4A7ZA 2A3WA 1KEXA 1W03A 1LTEA 2K0GA 2YC4A 5BNQA 2UYBA 4DEQA 2JENA 2EXHA 2H6BA 2BNOA 2BP6A 4IETA 1ENQA 1IS4A 5IJRA 1SBDA 1N1YA 1JYWA 2DV9A 3THTA 4N8MA 1CPNA 2HYXA 4AE2A 2W39A 3AKTA 3H50A 3LE0A 4QMAA 5CIRA 1RIRA 4KU7A 5KC5A 3TAYA 1VBD1 2AEZA 1LJ7A 4BXFA 4X8PA 3JB8A 4Q4X1 2PHXA 4WM8A 1DFQA 3Q8BA 1AL0G 4LO8A 2ET7A 1D0GA 3BOPA 1K3IA 1R091 2WL1A 3GXUA 1PNGA 2VMCA 3O0XA 4DS0A 2DCYA 2WLQA 4XJUA 3RSJA 3DPRC 2FHRA 4DNYA 1DQ4A 5FP7A 3V65A 4BQ2A 4QQLA 1YJKA 3KLSA 2VG9A 1WZXA 3OYWA 3KV6A 3J7LA 3NV3A 1XNTA 2CU5A 1PK6B 3OGRA 4LE4A 3POGA 4MXWA 2ARAA 1S2BA 2J1UA 2JE7A 1UYPA 1LRHA 2TUNA 3AMQA 1XNKA 3GBGA 4HKWA 1FMD3 3OGGA 1AR83 4GXLA 2PAEA 4NAMA 2IXIA 4NRPA 4N90A 3O5SA 5L19A 1AR92 2BGPA 3OOXA 3U14A 2XMLA 5IFTA 5DAPA 2AR6A 4NOTA 2CGPA 4EN0A 2VECA 3ZXEA 4XMIA 1HRV1 3KHCA 2BDRA 4Y1VA 3PVBB 4K20A 1WW4A 4XHXA 5F3EA 4LORA 5HCHA 3M8LA 1ZRCA 1OI6A 4BB3A 4WM7A 4ZKTB 5I8YA 2PHUA 1W9SA 2C24A 3H0OA 3SKVA 2EICA 5LK5A 4YRDA 2ERFA 3E1F1 2JKXA 4B29A 3I3BA 4AEDB 1OBNA 1QNWA 1NCQC 2J1SA 3WDVA 5AFEA 2LALA 5JIUA 3IDEA 4QM8A 5DZFA 4AGVA 1ZBE3 3PU3A 2VUJA 1US2A 5CA6A 3HR9A 4P9WA 3N36A 1N1VA 3W5MA 4LR4A 1R081 1DP0A 2ZHNA 4OI2A 5DAQA 4B1MA 1GP6A 2KA3A 2IFRA 4UWDA 1ST8A 2RHPA 1Q8SA 3AZVA 4PLMA 4D3WA 4LBJA 4EQVA 1X7NA 5FY4A 1HB4A 1EV12 1XB9A 3NAPC 1RVF3 3A7QA 1Q43A 1WKYA 4NPRA 2PAMA 3AP5A 3I3DA 5H9QA 2BFUS 1ASJ2 2WKKA 4AWDA 3KWVA 1VALA 1NLQA 3KV5A 5DAWA 2OPKA 5FBZA 2HWC3 4CDQA 5FRAA 5CKQA 2K46A 3FE5A 1I6XA 3AXEA 2ENRA 4YZ3A 1OHFA 1LNSA 1LAJA 3E5QA 1PX3A 5FPVA 4IV1A 1I9RA 3SNMA 5CU1A 3P6BA 4HXCA 3HBKA 2Y8KA 4QQPA 4DXTA 4MO3M 1K5JA 2VW2A 3VBFB 1GR3A 3VZMA 1ZRDA 2VOXA 1JYTA 1UMIA 5BXXA 2BERA 2HKXA 2WIIB 4I09A 5IVEA 1GZ9A 3WG3A 4AZZA 1ZBA1 2QQLA 1K5MB 4R4XA 3OPTA 3FL7A 2NPIA 1ALYA 1CIWA 2PLV2 4UFLA 4D6QA 4DEVA 1HQLA 2B42B 1JOPA 2FDJA 2R061 3M3IA 4MH0E 2YU1A 1VBC1 5GLTA 4LIUA 1MZFA 2BTVC 3LA2A 1MEC2 1ULCA 4ORFA 3ZSJA 5FZ3A 5LASA 4QKBA 1O3QA 1W2UA 2JE9A 4N9IA 5E88A 3KHBA 1WW5A 2NMOA 2PTMA 2WNUC 4XCAA 1SFNA 1DYPA 1EPWA 3FHQA 5T54A 1X9TA 5C8CB 3BCWA 1W39A 1AYN1 2XBO3 5LZ6A 1O4TA 4FPKA 1R1A2 3N7LA 4N53C 4L2NA 4P08A 2YG0A 4CU7A 4AW7A 5FY7A 3PHMA 5EHDA 4JTNA 5CFCB 4J1WA 4XOGA 3ZDVA 2BQPA 4G3YC 4WZFA 2JDUA 3J26N 4H3WA 2DDUA 1SDDB 4LKSA 1C8M1 1UY3A 3PLQA 3H9AA 4GALA 1LENA 4Z82A 2WNVC 4YVWA 5JMOA 4O7XA 5DDJ3 4FP2A 3CJIA 1J1TA 1SCRA 3ILFA 2P34A 2G1MA 1GZWA 1H9WA 4JCKA 2P3KA 4LBNA 2A6VA 1DQ0A 1NA1C 2R7EB 1FV3A 3OY8B 2WINB 5BPXA 2CHHA 2ZGMA 4JGYA 4S2GA 5FBJA 4CEWB 4UOJA 3O1TA 2EA7A 3VKFC 4FFGA 3R6SA 4ISRA 4QM9A 4Q4W2 3SH5A 5DZEA 1RGSA 4AAXA 1CWPA 4CCJA 3ILRA 5G05L 3DL3A 4LA3A 1JHNA 3E5XA 1RMU2 3S5AA 1QY4A 3ME2A 1SFYA 3WLUA 1Q5OA 3NQHA 4LBMA 3INAA 3IIAA 1MS3A 2WFF2 2OUHA 4Q4Y2 2V09A 5A1LA 1R1ZA 1XBFA 1EYBA 1POQA 1UQXA 3LD8A 5FPBA 2XJVA 2Z42A 4O9GA 4W6WA 1UZVA 2OZJA 4PBOA 3ABZA 1CN1A 1OVPA 5EFUA 1Z78A 1COV2 3NNMA 5FWJA 2DUPA 3M7AA 4CEYA 4EN7B 2Z2SB 1AX0A 1BCXA 1HQNA 3OGJA 4Y5SA 3IAQA 3MW3A 4DY5A 1NXMA 2O0OA 4GULA 2JDZA 3PL0A 4UW3A 4BYYA 5IFPA 5JSPA 3LOBA 4WBBA 4KWUA 5BNNA 4AI0A 2V73A 3H8XA 4ZU7A 2JDAA 4EJRA 1CR7A 5FTTC 1WBFA 5L7OC 4IESA 4COVA 4D69A 1KITA 3F2ZA 1IPSA 3TOJA 2GALA 2A3YA 3RYRA 2V4AA 4META 5F39A 5DUXA 2A70A 2OT7A 4PF1A 2ZEWA 1RUF1 1UZWA 5JVVA 1RXGA 1HRI1 4FPLA 4OQ8A 2PHLA 4IEQA 4Q4V1 5E16A 3OJBA 2YPDA 2YDEA 4LBKA 5FMOS 5IVFA 4I3PA 4AL9A 1GQHA 1VBE2 5FMBA 2J1EA 2ARBA 4NJ4A 3H7YA 1JZ7A 4OFGA 2WQ8A 2E7QA 1WLDA 4UXAA 3POFA 4CCLA 3RZJA 4XETA 2ORZA 3JXSA 4MG2A 4YPJA 2VZPA 1DU3D 3T09A 2Q8OA 5FPUA 1TME2 3DUIA 1JYNA 4BIFA 5L36A 3W59A 3AMPA 4QX3A 1MS5A 1EUTA 4YYOA 3ZYFA 2QFEA 2DF7A 3POWA 2IXLA 3TNQA 2OKXA 1W2AX 3I4IA 1QJU1 3QD6A 4A3ZA 4MGIE 2ETEA 3KT7A 4AXOA 4BLJA 1UWWA 3NAPA 1OPMA 1M4WA 3AZZA 4HN0A 3JZVA 2VZVA 4A41A 2VQ0A 4Y20B 4A7YA 3LIGA 3UL2A 1GP4A 2CY6A 3OTFA 4HOOA 2WWUA 4MLOA 5C3RA 4GKYA 5LA2A 3VL8A 4RQPB 4YW1A 1JOBA 4P9LA 4QT6A 2W1SA 4OI1A 2AH2A 4XUPA 3VZLA 1V9U3 1YIFA 4Q29A 4LO6B 2Z79A 3T1LA 3H1WA 3QLQA 5C3PA 5FDBA 1GZCA 4XXAA 5IWFA 3I59B 1V6IA 1UF2C 3AVSA 3J8F1 2A7AA 3PJYA 1M06G 1AR71 5DZGA 1RUI2 1D4M1 2UWCA 4P00B 5FUIA 3L2HA 5IVJA 2DYCA 3HPNA 4RR3B 3VHNA 1G9FA 1ZZ7A 2W47A 1GV9A 2WO1A 1UXXX 4D0QA 4UBGA 3D3AA 3THCA 1CZSA 3TN93 2AZ5A 1NZCA 1UN1A 3ETQA 3KSCA 2K9ZA 3GZTB 4LBQA 4HLTA 4EV0A 4BQYA 3AJYA 2YB7A 1MS0A 2XONA 1WLCA 5C4WB 2A6YA 5CKMA 2WNUA 4LKDA 1GOGA 3HQRA 1EP0A 3ZXFA 5ACA2 3I54A 1JS9A 1XC6A 3AZYA 1LHVA 3VBUA 5LBBA 3S30A 3ZSMA 4YM0A 2QQIA 4NPLA 3O14A 4OUEA 4B7EA 1O91A 3I2GA 4N53A 2G9FA 3AFGA 3AXDA 4C8DA 2DVBA 2VMHA 4LK7A 3ZYIB 1EPZA 3OBZA 4FPJA 2F4LA 1J83A 4LA2A 1C5HA 4AI1A 4CUBA 5A3NA 3FLTA 2K2SA 5FZFA 1GQGA 5AVAA 3JD72 3GZUC 4A44A 4DUWA 5CFDB 1S1AA 3BU7A 4YW4A 3I3MA 2ET1A 3B93A 3C7HA 4GA9A 1AZDA 2OS2A 1CVNA 3PNAA 4YNIA 2EVXA 4NIHA 1DZQA 2GNMA 3ES1A 2CWSA 3JQWA 2VD7A 3U4SA 3HBZA 2VZRA 1AXYA 1O5LA 3LFIA 4IUGA 5L9VA 3ZR5A 2EF6A 1TE1B 1LOBA 1POV1 2GC2A 2ZEZA 3WNLA 4AQ2A 2EIBA 2GMEA 2ATFA 2EALA 5BNNC 1WUVA 4YZ4A 1RB8G 1QU0A 2RS12 4BWOA 1NA1A 1DQ5A 4ZXKA 3WP6A 2XHKA 1HQWA 1SEFA 2GC0A 2VCMA 3WNKA 2I07B 4XFAA 4XJWA 1W0PA 2ZPXA 4XF4A 5C3SA 5A6YA 2A1XA 5DG2A 2ES3A 1YI9A 1HXS3 2WNEA 2WO7A 3B69A 1E5SA 1JHJA 1J84A 4Y26A 3V56A 4Q0PA 1W90A 1W6QA 5F32A 4AI9A 5F3IA 1U5IA 3B3QE 3WCRA 2JDPA 2ZMLA 4FXGB 1JZ6A 1MVQA 2VVFA 1AR91 1LB2A 4UAPA 2R042 4AOCA 4P5YA 2ZZQA 3O12A 4ZU4A 4E8CA 2XLAA 1U12A 3H7JA 1QJZA 1UOFA 4M0NA 1VJ2A 3T2TA 5AFBA 2MPFA 4W6YA 4AFDA 1LU1A 1W99A 1W6NA 2E53A 5FMCA 3RZKA 3T0DA 1ZRFA 1NCRC 2W08A 4NVPA 3O1PA 3POYA 2DBIA 3WZ1A 1QH6A 5LY1A 3A0NA 3V0BA 3EYPA 5DUUA 5T50A 4ASLA 3RWNA 1UD1A 1CAXA 1SACA 3U75A 1FXZA 2WZR3 5CYYA 5T5PA 5C5UA 4I3GA 3C2UA 1SBFA 2VZOA 2WYSA 3FBMA 3ZYPA 4AG4A 1QXJA 1HLCA 1ND3C 5FOJB 5FO9B 2VO5A 5FPZA 3WG4A 1MPXA 5L7OA 3ON7A 2VZ3A 4NIAA 4BU2A 2AYHA 3N9MA 3AKQA 3CMGA 4XDPA 3GJBA 4QPGC 2OPWA 4QKNA 1VBA3 4AFAA 1FMD2 2W0XA 1AR82 1EV11 4RHV3 1APNA 1S0FA 4HANA 3RYPA 5JOZA 5JOWA 4L8QA 1TEIA 5FYSA 5JMCA 1ASJ1 3FC0A 4LEJA 1UIKA 1AHSA 5GKAC 4WZCA 4CP1A 4UF0A 4YZ1A 4JTOA 5A1AA 1S0IA 5FZ1A 2VBPA 1UYZA 1SFPA 1V6NA 1XRUA 5F2WA 3JBG3 2PN5A 5FJHA 4CXXA 3NKGA 3KB5A 4HKLA 1W8UA 1D2QA 1OA2A 4FPEA 5JZGB 3ZFEC 3SEPA 4CU6A 2ZX4A 4RGGA 1RUG2 5JOYA 2BPA2 3WQ1A 2WN2A 1ZZBA 1VRBA 4FQ4A 2FCUA 4IE7A 1QWRA 5FXZA 4FPHA 1MR5A 1XSRA 1YQ5A 1K45A 5KR7A 1J59A 5FYVA 1UU6A 1XNBA 3LF7A 3LIHA 3RMYA 5IAVA 3ACFA 2HYKA 1VMJA 4KH9A 2QNKA 3PVEA 1WBLA 4LMFA 4P14A 4WVMA 1ZBE2 1C57A 2PLV1 5JLVA 1H2KA 1T6BX 4WVWA 2DCKA 4UYBA 4NHXA 4X8NA 4B7KA 2BBVA 1PMJX 2HBUA 1MEC1 3WHTA 2XOMA 1ND2B 1VE0A 1H9PA 3CDZB 1VAKA 1ENSA 1CD3G 4K21A 3U11A 2GN7A 5C3QA 1HN1A 4BQ4A 2JECA 4D6RA 5IYYA 3U0ZA 3O1RA 4NWWA 3ZR6A 1UL9A 3WQ0A 2RG4A 1Q56A 1RVF2 2PXJA 1R1A1 3WNNA 5DUVA 4FOVA 1W9YA 1O3RA 3RPQA 1SDWA 2RDQA 1LOCA 3KCYA 4XIKA 4BHPA 4PI2A 5IHRA 4BCUA 4E8DA 4OULA 2HWC2 1JBCA 3RWKX 2ZMNA 4XFGA 4KU8A 3GHNA 1MZ5A 3UGGA 1G8WA 3LPFA 2HWD3 3RVHA 3ACIA 1VMFA 2DUOA 4LBOA 3T2PA 4A4AA 5HBAA 5BV6A 4AVVA 1KRIA 3MFCA 4PIYA 3N9QA 4X6RB 1S0EA 4XFFA 2ZGPA 1GSLA 1PVXA 1IS6A 1GUIA 2EAAA 4HT1T 5D21A 1W8OA 1G9DA 3A0KA 3HN3A 1BVP1 1S0GA 2CAUA 2G9ZA 3P1IA 3CZJA 3K4AA 4AEMA 4CPBD 1XSQA 1KS4A 3SLIA 4ET7A 2XQXA 3CU7A 5FYHA 5C3OA 4YVSB 1IGOA 1ULPA 2QQNA 5FZEA 3VB9A 4XW3A 4J1XA 1NQJA 4JQRA 4ZPIA 3SCFA 1OF4A 1QHDA 5FXWA 2GSYA 1EAH3 3RZMA 3AMNA 4BQWA 4Q4W1 5ABJC 1MQTB 5FP4A 2D40A 2XJRA 1UAIA 2XUMA 1YI7A 2Y0IA 1IKPA 3PUIA 5A80A 3VD7A 1RMU1 2NLRA 2ZBJA 2XBO2 3FFZA 4ISQA 4V2VA 1QXPA 4CP9A 4U2AA 3VHOA 2WFF1 3OEAA 4Q4Y1 5C9AB 1DGRN 5FMDA 2YGMA 4Y4RA 1PVC3 1K42A 3WF0A 4L99A 1JTZX 3KT1A 1VR3A 2JICA 2ZGUA 1ZM1A 1NLSA 2YY1A 4HPKB 5EZWA 3IDBB 1COV1 4HL0A 2DTYA 4N7IA 2YBSA 2OA2A 5DDJ2 4YZ5A 3TEZA 2XUEA 2NQYA 3NO8A 2DVAA 3ZFGB 4BQ5A 2V72A 1UOGA 4P9GA 4Y22A 4YG0A 5FQ0B 5GJ6A 4EROA 1LGBA 4QD2A 1CAWB 4M3CB 4DUXA 3KV9A 3WXPA 5KXBA 3WG1A 1UY0A 3KMHA 3PMSA 2MEV3 3AK0A 4IEZA 1F9KA 2P4EA 2Y6FA 2VR4A 3LB9A 4Q2FA 5D8AC 1SLTA 2OUJA 4XTMA 1XXNA 4QXKA 2R073 3MW4A 5CKNA 2HH9A 4R9AA 4LT5A 1HB1A 3U07A 1NCRA 4CDQB 3IWZA 3VKLA 2GNBA 1D2SA 2B9UA 5DMYA 4JV4A 4CCMA 4HVQA 4ZHNA 3DN7A 4Y1XA 3VLBB 1B35A 4N43A 2W95A 5FY0A 1VBE1 4J25A 4ONUA 4QU2A 5KXCA 4IV1B 2VXJA 4MGZE 4QHZA 2W1QA 4NIGA 3T3YA 2BW8A 1BZWA 4QDSA 4YW2A 2JG9C 4KG0A 4XVHA 4B1LA 4LLFA 4AI3A 1TME1 1XYNA 1SQ4A 4W8JA 2J1AA 1ND3A 5EYYA 5FY1A 3RS6A 4UI9L 1S2EA 3GF6A 4QQHA 3ZXAC 4EE2A 4LLOA 2ZGQA 1QJFA 2ZKLA 4QPIB 2RDSA 5J7MA 1YJLA 3MDPA 4QPGA 1IQAA 3USUA 4XUQA 1HIXA 2P17A 3IAPA 3ZN5A 3EB7A 1KJRA 3EJKA 1W2TA 2VNOA 2QQWA 3AM2A 2J42A 3TBDA 4QAWA 5ISLA 4KQ7A 3RI8A 3MPPG 3POSA 4GJZA 4Y1YA 5FZLA 2E7TA 3ZSLA 3EO6A 2W5FA 5A3LA 1MS9A 1H6YA 1US3A 2RDNA 3RZGA 5EJ1B 3N9NA 2B46X 3VBRB 3U1XA 3JUUA 3BPSA 2VTFA 2JG8C 5FZOA 1W0NA 3ZFEA 4CTEA 2P1BA 5GLWA 4M3CF 2RS33 2VGDA 1W8FA 2ZACA 3VBSA 4YVWB 1JUIA 4Q1RA 1X50A 1RUI1 4AEKA 2J1VA 4CDUB 3MYXA 4XACA 3ZDSA 5JSRA 3OUIA 1MS4A 4GJYA 4IDZA 5A3MA 1HV1A 2ZKNA 4HVRA 4HSLA 4OLLA 3MEPA 2WA3A 1RXFA 3PTRB 2HWB3 3OCPA 1QH7A 1SLAA 1YC61 5FZAA 5LATA 3THPA 2FDKA 1PK6C 1UZZA 5ACA1 1X82A 3UT0A 1OA4A 4ATFA 5IT6A 1FOD3 2W92A 1JXNA 2XWBB 1TNFA 3A23A 3LEMA 2YGLA 3ZXDA 2BV4A 1QGLA 4OHVA 4UFMA 4IEXA 2CDPA 1AR61 3H3LA 4CYDA 3PIGA 2X10A 1UKRA 3D0JA 4R4ZA 5FZHA 1YQCA 4O65A 4AI8A 3JD71 5F5QA 4COYA 1LHNA 3I2JA 4K9SA 4NIIA 2GAUA 4A6OA 1V9U2 1GFF2 4Q0QA 4MGSA 5EWSA 4P9XA 1H8TB 4YGBA 4AFMA 1BEV3 3ZFFB 2BWAA 4AEDC 1PMHX 4JKMA 4CP0A 3RZLA 5K4LA 2KM2A 4CEYB 1PX4A 2XKOA 1YQ6A 3DYPA 1LHWA 2TBVA 2Z5WA 1JH5A 1ODNA 2KXLA 3ZN4A 3V0AB 2XJPA 3DCQA 4BQXA 2RS11 3P3NA 2LTNA 1QDCA 1ZA7A 2VNGA 1AL23 3TN92 1XU1A 4INDA 2J1RA 5FY5A 1UY2A 4Q26A 1YLLA 4AI2A 3NV4A 4EZHA 1VP6A 5ABJA 2QJVA 1PZ8A 2VY0A 3LEKA 3NNLA 2Y6HA 4WVVA 2A75A 3T0AA 1QDOA 1NYWA 2AGSA 2MHFA 4I02A 4C91A 4QXBA 3NJZA 2DU1A 2QUOA 1NQDA 1BK0A 1EUUA 2R041 5A32B 1SLBA 3GZAA 2I2SA 4QGLA 1W28A 4RSUA 4QWNA 1W6MB 1KGYA 3WQ7A 1XE8A 1W06A 4FT8A 4Y5TA 5G04L 3VHPA 5D2AA 3MUY1 5LB6A 5JOXA 1SLLA 2W46A 3ZPOA 4R9BA 2C1FA 3I2DA 3I3EA 4PIZA 1BJQA 2PHRA 2HEVF 4GH4B 3WP3A 4QB6A 4TXWA 3VBFC 4MUVA 1VIWB 1AJKA 3LPGA 2BRTA 1REFA 2WZPP 3RDIA 2OZ6A 3LSEA 4MHUA 3MICA 1CAUB 1LCLA 1K5MC 1W3VA 3H3UA 3POJA 5BNOB 2WRAA 5HV4A 1HDKA 2UWAA 3C8XA 2D5FA 4NUBA 4XXPA 2C5DA 2CDOA 3N7JA 3WP5A 1I3HA 4QPWA 3E6DA 3ZXGA 4MOAA 1VB4A 1JUHA 1QJY3 4JZRA 4LITA 1XOYA 1IG3A 1WLWA 2NM1A 5GZEA 3IPVA 5D8AA 4C1WA 3I2OA 1Z7S3 1HXS2 3VKNA 4Q8KA 3WUCA 3FWEA 1A6CA 5C7GA 1FMD1 2WJSA 1AR81 2A71A 3MPBA 4QKFA 3GM8A 1W8NA 4YM3A 2GP5A 4Q5OA 5CFCC 1E5IA 1RUH3 2X09A 5BYNA 4FVVA 2GMPA 1DGWX 2N7GA 2JX9A 1DZRA 5APAA 5J98B 1OQ1A 1SG3A 3NJYA 2W3JA 2JG9A 2E31A 1LESA 2VE1A 2X5IB 4MVTA 4Y1ZA 1RUG1 2C4XA 2DVGA 2XVGA 1J3QA 4XZUG 1YQ2A 3OBRA 2H0BA 2PELA 3HQUA 1NXD1 4XJ9A 5FZMA 2YYOA 2VPVA 1PZ9A 4EWDA 2DFBA 4YFZA 3B5LB 5H9PA 2WZR2 5FAXA 1O7FA 3CZUA 3UKVA 1W6OB 1B09A 1ZBE1 5IVCA 2R0FA 5EJZB 3AZXA 5A33A 1H1MA 4CEWC 2E33A 3Q8AA 3VBUB 3WINE 2D6PA 4AF9A 1JZ4A 4H55A 5LWBA 1T2XA 3OG2A 1MZEA 2W94A 3ORJA 2RR13 4IE4A 4Q0SA 5E1RA 5A7QA 3T0BA 2PA7A 5KHKA 3DXUA 1LHUA 3WD5A 3VUOA 5IVVA 3CHXA 4XYXA 5A7WB 1VBA2 4GIQA 1IOAA 3OGVA 3T4HB 3ZMNA 2P5BA 1W2OA 3HIFA 1RVF1 4LOTA 3IDCB 4RHV2 2JG8A 2ZABA 3BODA 1JZ5A 1D7PM 3BI3A 2DWRA 4RA0A 3WW4A 1RITA 1RL3A 3M4FA 1U0AA 2WN3A 4ZS3A 4AYUA 3RMXA 3H8RA 2B8MA 1XYPA 2HWC1 2WR9A 2WT0A 3B9CA 4R52A 4Y1UA 5BNPB 2VQUA 3NWKA 4YG6A 1GP5A 4XFCA 4N7UA 3JBG2 2ZEXA 2YC2A 3GCXA 1OFNA 1V6MA 2ZXQA 2D6OX 3LDKA 2XVLA 3ZX7A 4DZGA 2B39A 2DTWA 5FYTA 1OLRA 3NRUA 4XBLA 1GLHA 2WUHA 4QQOA 2ZGNA 3KF5A 1UY4A 2WQZC 1QOSA 5EXOA 1GBGA 4NRQA 4W50A 1PK6A 3BTZA 3DPRA 3HT2A 3J4UH 4I30A 4F3JA 2OX0A 5FY9A 2PAKA 4BMBA 2E9QA 3QOPA 5FYUA 4CCEA 3DXTA 3TEXA 2YROA 2VUCA 4C90A 1JYCA 3HAGA 4FAGA 3NL1A 1Y9QA 1LOAA 3CF6E 4NR1A 3WW3A 2JD4A 4RFRB 3R4UA 1NKGA 1NY72 2JDHA 1RUJ3 2AUYA 4QHBA 1BBT3 5IK7A 4XF3A 3KCXA 1QOTA 1QXRA 2PHTA 2H0VA 4RGKA 2XBO1 1BK1A 3R4SA 4Y33A 5LA9A 1AXKA 1W3XA 2W68A 1W6NB 5JIAA 2Y26A 3ASIA 4URAA 1YFXA 4JGZB 4D8MA 1PMIA 4Z92B 1GNYA 5A70A 2JB8A 5A6ZA 5HCBA 2BUKA 4E27A 3KV4A 3SHRA 3MIBA 4LBQD 4R9DA 4BA6A 1LEMA 3V0BB 5FYCA 2ZHLA 3D5OA 1UXZA 2NMNA 4OMCA 5FV3A 1Z0HA 2HWD2 3IKWA 5FP9A 2QBXA 3EMRA 1CAXB 3M3QA 2YPJA 3WNXA 4AGGA 5EJ3A 1H1IA 1NCQA 1XE0A 5CADA 2FQPA 4EWEA 3RZZA 4UFJA 2RMU3 1CIYA 2BYVE 2WBKA 5DDJ1 1PIV3 2Q8DA 4CRQA 2D7FA 4DINB 4L92A 3AKPA 4YG3A 3WDXA 5L7OB 5FP8A 4KBZA 1OQDA 2HWF3 4IV3B 1OMIA 3ETPA 1ZYBA 2YFZA 1GKBA 1W9WA 3LDRA 3ZPYA 4PLOA 1PGW2 1EAH2 2YBKA 1Y9MA 3VGIA 4M00A 5I8TA 1JODA 4RQPC 2AREA 3VBOB 4HETA 1OUXA 2CL2A 1LGCA 3FHAA 1OLQA 3FBYA 1G9BA 1TZOA 1SPPB 4UF0B 2WNOA 4OQ9A 4AVCA 3AC0A 1JW6A 2FCTA 3KGLA 1ZNPA 3CJXA 4CA9A 2LW8A 1QJX3 3I2KA 5A1FA 4QB2A 2G19A 1OFSA 4FOWA 3BALA 3VBFA 4CDXB 1AUYA 2GMMA 2ZGSA 4LO7A 4PQ9A 4RR3C 4M01A 2VC9A 1K5MA 2YFUA 4UT5A 1FATA 1RUD3 5LEKA 2GH2A 2QQOA 4GAZA 4JDNA 1TVGA 3QBQA 2UYAA 2IUWA 2DBNA 2XLFA 4WVMB 4J6GA 5C4WC 1UU5A 3FFQA 4Z2WA 2D6KA 2VUAA 1CESA 3PUHA 4FFHA 1OKQA 2B7YA 1H30A 4RS5B 4MYEA 2RM23 1VLNA 1WCQA 3IBMA 3WF3A 1CPMA 1NAEA 3CLPA 4XF1A 4EN6B 2I45A 4TLGA 1O8SA 2Y38A 1DQ2A 1RHI3 2HBTA 2R16A 2ZHKA 5JR7B 4NROA 3GNEA 4Q27A 3W20A 3VD9A 2MEV2 4Q0VA 2RS53 5CFCA 2ILMA 3RRDA 2XKPA 3DF0A 2ZX0A 3WQBA 1WMEA 2R072 5CG9A 1DZTA 5CFDC 2GDFA 4IGOA 3TRSB 2OVUA 3WF4A 1GNHA 4B3NA 3VBHB 3VD3A 1QQP3 2RDRA 5LBEA 3B01A 1J3RA 4LO5B 5FO8B 3IDAA 4D94A 2W2IA 5J3UA 1GYKA 5HPOA 4XUOA 3KVBA 4KL1A 1ULOA 1UIJA 5FIXA 4LKEA 1O4ZA 2BNNA 2HWE3 2WNVA 2B5HA 3USSA 5FOBB 5KBFA 3H1YA 1HB2A 3G7DA 4P9IA 2GN3A 3BTXA 3MIGA 3D4KA 3UK9A 3OY8A 5J09A 2QKDA 4YW5A 4UW5A 2IZWA 3WG2A 1OOPB 3PIJA 3HD8B 4CEWA 1OA3A 4XF0A 5GZGA 4KMQA 1ZZ6A 1J3PA 1MVEA 1N3OA 5FZ6A 2VBDA 1H4HA 4BPZA 1YFWA 4MGTA 1UX6A 2YU2A 2XL7A 3C3VA 3J9SA 1V00A 1V0AA 2BBAA 1TQ5A 5F6LB 4GMP3 5AC93 5JCTA 4FAHA 2UURA 3FUOA 4YW7A 2FDFA 3CIHA 4TZDA 5F1RA 2VL4A 1UZYA 3LQCA 1H1AA 2JIJA 3RNSA 5EYXA 4IE6A 5L9BA 3LA7A 2XLGA 4PDWB 5IAXA 1HW5A 1RUC3 4QU1A 4P9YA 2UWBA 3AVRA 2OQ7A 3WDWA 4LHNA 4JKKA 3WF2A 1E57A 1V9U1 3GZEA 4K8FA 5LK7B 1LU2A 4OHYA 1F15A 5FPLA 3RYKA 4FTBA 4NMIA 2IWGB 4IEUA 1NUKA 4DXRA 1PO23 4I01A 1JYVA 1JI6A 1DGWA 2RS32 1O3TA 2HEWF 3K3NA 1LOEA 5K0UB 2F17A 3VDAA 3HEIA 5A3TA 2XGXA 2QQMA 1KFXL 1UYYA 5I0SA 3U37A 2PQQA 4XAAA 4BOWA 4Y22B 4YW3A 1U5XA 4GZ9A 1PO13 1DG6A 2QQUA 3TN91 4NRMA 1JU4A 5F2SA 1N1SA 2E26A 2D43A 1IPKA 4K8RB 4JDOA 2HWB2 4D7YA 1RC6A 3FN9A 2BU9A 3GALA 3N9PA 4OYUA 4Z8BA 4NAOA 2W9XA 4XABA 1GU3A 2WQ4A 4BH9A 4ES8A 3I2HA 1FOD2 2OQ6A 3MO4A 2BVVA 2BZDA 3K75B 4OVEA 1FT9A 2ZGOA 2ZGTA 3LDBA 4CDWB 3VKMA 4DMIA 5A7PA 3NJVA 3NNGA 2VJXA 3ZM8A 1SHWB 5I93A 1YNAA 5DABA 2DFCA 4X6QB 1RUE3 4QX8A 2BOJA 4XQWA 1B35B 2FCVA 4N43B 3WT3A 3DEMA 3I8TA 1Q3EA 5JZGC 1FYUA 2VXRA 3C7OA 1F5FA 4JHZA 3PTYA 3LKJA 1DYKA 1VBB3 2ZGRA 4XCBA 2VQTA 3SC7X 3AMMA 4BIOA 3QH7A 1BEV2 5HCFA 3LSDA 3U78A 4IGPA 3MLJA 5FZ0A 3SCHA 3J7NA 4QX1A 1NLRA 1AX1A 1O6UA 1LODA 2QVSB 2QQJA 1L7RA 4YWAA 3OBAA 2D6NA 1AL22 1I1EA 1NE4A 4Y20A 4A42A 1ND2C 4BZ4A 3HOBA 4FFIA 3VDDB 2Q1ZB 1A34A 3CBNA 1FAYA 5B4NA 1UPSA 1GOFA 2QZ3A 2Y64A 5ERLA 3VHRA 1F4HA 1HXS1 2LROA 3W5NA 2E51A 1VRH3 4LUKA 4Y3OA 4ZXEA 1Q8OA 1WCUA 2QZ2A 1MS8A 4GD4A 1C1FA 4HBNA 4IEWA 5KC6A 3I59A 3TNPB 2AENA 2I74A 5K7PA 2P3YA 1DGRA 3WW2A 2D3PA 2VH9A 1QEXA 5FZBA 3F95A 1TMF3 5E89A 4CCOA 2QQPA 3WP4A 2PHFA 2XJUA 4MGKE 3K2OA 5F5CA 3VBSB 2WO3A 2QE3A 3T1MA 4AR2A 4CCNA 5C6CA 2XWJB 2WT2A 1IG0A 4JC1A 2WS93 1RJ7A 4XJAA 1C4RA 3MIFA 4XHBA 5LRRA 2DURA 1PM4A 1Y7BA 4W4ZA 5C4WA 4PI0A 4WM8B 1V6JA 2XB6C 2YHJA 4EN8B 4S2DA 1ENXA 1FNYA 4YVSC 1G6NA 4A3XA 2WZR1 5FZKA 1CZTA 3K3OA 3S5QA 1W2NA 4OHWA 5A7NA 3BUCA 2ID4A 1ZREA 4HMZA 3POBA 3PVOA 4QX0A 3GDBA 3IB3A 2D6LX 4XDQA 4KGGA 1SMVA 4CZSA 4Z1VA 2Q1FA 3IIIA 4PIXA 2Q4SA 1QJY2 2JDNA 3OYWB 3T30A 3UV9A 2IXHA 1TNRA 1KD7A 4PHZA 1ULDA 4MXWB 4NHYA 1MQTC 4GKXA 3MV01 1AYM3 1Z7S2 2X29A 3OD4A 3ZOIA 3MLLA 5CFDA 1OLME 1VAVA 4CP2A 3OD0A 1C8NA 1VBA1 1WD3A 5KXDA 4GB33 4URTA 3VDBA 1LR5A 1DIWA 4RHV1 2Y60A 3IT8A 1FPN3 2L9LA 2JWPA 4TYSA 4IQPA 5C9AC 2VULA 1RUH2 5FZ4A 2VCAA 4WV8A 5D1IA 1W8ZA 2RE9A 4BE3A 3MFAA 4BXSV 1JN2P 2GNTA 1JZ2A 4C0BA 3NKTA 2DU0A 1GANA 1W8HA 3EBRA 4OZOA 3JBG1 2W91A 4WM7B 4GQ7A 2A6WA 2Z69A 4QGNA 3OPZA 4DRRA 4E2GA 3AYEA 1NT0A 3S6PA 3ZFGC 3N4MA 1W9FA 1WMDA 1O4YA 5JPNB 2Q1MA 3BB6A 3ZXKA 1H2MA 4B4PA 4B8EA 3T2OA 4KWJA 3ZIXA 4V2WA 2BOIA 5FPAA 4Q1PA 4LIVA 2CAVA 1XJAA 4TWTA 2NN8A 3A4UA 4D7SA 2R6QA 2GU9A 2QQKA 5FK8A 1Q8PA 2BGOA 5GALA 3WOGA 4LUMA 4W65A 4CCDA 3K48A 4W6XA 2WAOA 4SLIA 5DPNA 1NY71 2RR12 3N9OA 1IHMA 2NYYA 3S57A 4YM1A 1CJDA 5K8SA 1NOVA 1RUI3 3SITA 2EXIA 3AX4A 1F35A 2VW1A 2O14A 3NV1A 4QX2A 1VBD3 4TLFA 1T6GC 4AGRA 1G9AA 4Q4X3 2IFWA 1C5IA 3KVAA 3DECA 3PDQA 2YZ4A 5LA1A 1R093 3B00A 5T5OA 1OPOA 5I0TA 3MLKA 3PUQA 2Z4FA 5JAXA 3O1UA 3TWIA 1A8MA 2VM9A 2J7MA 4XE9A 2HWD1 3KQ4B 2WA4A 3FUQA 5GZFA 4FTEA 2JB4A 1VMHA 4YGDA 1OURA 2OXBA 1Y3TA 2JDKA 1WA4A 4DXSA 3NW4A 4QPIC 1YQ8A 3ZYHA 1Q8VA 1YIPA 5GLVA 3Q8FA 1J1LA 1JMUB 4RN5A 4YGCA 1KDKA 2E6VA 4ZZ8A 4NHMA 2DUQA 4RL7A 4OUMA 1BLZA 2VQAA 3KS7A 1CQ9A 1GWLA 2VCCA 3BN6A 1YFUA 3B02A 4A7KA 4XFIA 4AHYA 3K77A 2OIIA 2LS6A 5FYBA 1MACA 2ZX1A 4G9SB 1OKOA 2IVJA 3D0SA 1HRV3 1PGW1 1EAH1 1UCXA 5J37A 4BK4A 3U10A 4EN9B 1N3PA 3JQXA 1ULFA 1RUJ2 1BBT2 1LHOA 3KQRA 4K7JA 1YFYA 2XL9A 3VBRC 2HEYF 5JZGA 4MGYE 5LEJA 1A8DA 4IE0A 1CJPA 5FYIA 3W9AA 5HI0A 2FMDA 4AHZA 1F31A 3WHUA 2VOTA 2XJTA 2H6CA 4PJYA 4PCRA 4YVWC 4H7MA 4COZA 4XTPA 1OH3A 4CDUC 4RYDA 4E4DX 3IMMA 3GJAA 5FJKA 4HONA 3UYJA 2EXJA 2PYTA 5JI7A 1KDMA 4QGMA 4XQ4A 5JPMB 1CAVA 5FZ9A 1R083 3HNYM 5FPXA 3HMYA 1UZ0A 4ARXA 1WMXA 3CJIB 2IXKA 1WCSA 2FDIA 2RMU2 3DYOA 1NZIA 1L7QA 1PIV2 1J58A 2EIEA 3E6BA 5H9SA 4I2OA 4CSWA 1GZWB 2WO2A 1C28A 3ACGA 3X29B 5IK5A 4LKFA 2OYZA 2WWSA 4HFSA 3I2FA 4JRAA 1YYNA 4E4ZA 4HVOA 4JGYB 3ROUA 2HWF2 3M1HA 3GYDA 4MX3A 3V64A 2GC3A 4IEVA 4H14A 4S2FA 4AVSA 3W58A 1DF0A 2MEV1 4O61A 5B2GB 3BIEA 5FZDA 2JG8B 3MV11 3QACA 3FLPA 4XZPA 1BQPA 4CU8A 4FSJA 2R071 4FI9A 4KG8A 1F4AA 1KS5A 1WD4A 4M4PA 1UY1A 2VMIA 4L97A 4Y24A 3LGRA 4FXKB 2EIDA 1A78A 3BVCA 4QDQA 1H8TC 5H9RA 3J7HA 5T3NA 2Q8CA 3ZFFC 4F83A 2XVKA 1QJX2 3NJXA 3AP6A 4CCCA 4MHRA 1ZBA3 4CEYC 4K1YA 4MZUA 3EHKA 3JB4C 3IN9A 2QDRA 3ZYGA 3OPWA 4YVSA 2BFUL 2R063 1RUD2 2ZMKA 1VBC3 3POEA 4H2AA 5C33A 1PHMA 3DPRB 3RI9A 4PQQA 4QXHA 1ULGA 1UO9A 1UYXA 5FZIA 2ZAAA 4UFHA 1W8TA 3AP7A 4QXCA 3R05A 4DQAA 1CZVA 4Q0UA 5BNNB 1MQTA 1STMA 3VD5A 1AYN3 1R64A 5K9YA 3MZHA 2Y34A 1XU2A 1AVBA 2CSGA 2RM22 3WVJA 5JI9A 2XPJA 1KQRA 3O1SA 4DB5A 1ZX5A 3H42B 3K51A 3RFRA 1RHI2 1MS1A 3H8OA 1REDA 3AL6A 2RS52 5C9AA 1RUG3 1ZZ8A 1C8M3 2WABA 1DGLA 3FLRA 1BVVA 2ORXA 3H3ZA 2Y0OA 1FI2A 2GC1A 2XJQA 4HPKA 4GH4C 3E5UA 1W6PA 2R1DA 5EP9A 1QQP2 3IM0A 4LBLA 3AP9A 4SBVA 2Y33A 3THDA 3VDCA 4B4QA 1OXCA 2RS31 3UETA 3I49A 3ZFGA 1RJ8A 1NCQB 1OC1A 1ZZCA 3GHMA 3GGLA 2XQRA 1XQNA 5FQ0A 1BYHA 2HWE2 4LOSA 4XIOA 2BGCA 4DOUA 4E2QA 5BNOC 1CAWA 4M3CA 2VMEA 3U4XA 3PJQA 4LHLA 2WT1A 3O0VA 5F6KA 1O3SA 4M0HA 4BMEA 2YBPA 4FPFA 3P5BA 3ST7A 2RJLA 1H8VA 5EIYB 1MZ6A 2CV6A 3R0RA 2TNFA 3VN4A 2HWB1 3LZZA 4AFBA 4M3CE 3MBWA 4OCTA 5JSOA 1X36A
chains in the Genus database with same CATH topology
2UY8A 4HZFA 4YSFA 5AC92 4AEJA 2CGNA 3NAPB 3WUDA 1SCSA 4FTSA 1L3JA 2X8KA 1C3HA 5C8CC 1FOD1 2FZ1A 3G6JB 3DGTA 4KWLA 2F6BA 4JDMA 2LUWA 1WCKA 3S7IA 1ZZ9A 3TYJA 3AFKA 4E4SA 3D82A 3BIWE 2VVDA 1RUC2 4Q8LA 1ZVFA 1DDLA 4KNCA 2NP0A 3UKNA 3AYDA 3URFA 2X5IC 1S0CA 2VOWA 4QQ2A 4NN0A 1OQEA 1BEV1 3NV2A 1PO22 3AYAA 4QPIA 5J48A 4K3UA 1PGSA 3WV6A 1LKNA 1WGPA 3ZN6A 4IXLA 4FPCA 1XNDA 2ZZJA 1BMV2 1LOGA 1PO12 3APBA 1AL21 4LBQB 3VBUC 1LGNA 1BXHA 4YARA 3RJ2X 2WNUB 3LAGA 1RUF3 1PGL2 3BTAA 2O1QA 3VZOA 2JKBA 1HRI3 4E9KA 2DVFA 1XYOA 2ZAHA 1AX2A 4Q4V3 1UPIA 1F2NA 3VBRA 4N53B 4I0WB 2BVBA 1D0HA 4FO9A 4E2SA 3FZ3A 4L9BA 4BM8A 4DRVA 2CNAA 4P9JA 3CEWA 5BNPC 4MV2A 1RUE2 1NG0A 4CDUA 2JEMA 2ZOEB 4NWVA 2WSVA 3AMHA 2A6ZA 3NSTA 2WNVB 4YLZA 1W0OA 3SISA 1VBB2 1O5UA 3H8UA 4IL7A 2VMGA 4QPYA 3L9JT 1QJU3 2FZ2A 3FJSA 5T5JA 2JJ6A 4LULA 2VU9A 1WMFA 3QH6A 3KM5A 1RINA 3MF6A 5FMOL 5I91A 5T55A 1NA1B 4K6BA 4TSVA 3FX3A 4YM2A 1S0BA 3AZWA 2PHWA 5IK4A 5FLIA 4HSJA 3WR0A 4K40A 5L73A 4V1PA 3AKSA 1QJY1 3ZVXA 4N9HA 4WVZA 1N1TA 5TSWA 3TB0A 2QDNA 1Z7S1 1W6QB 2D5HA 1VRH2 2V5YA 2VNRA 5KXEA 3M3CA 3J8F3 4C0HA 1H8TA 2ZX2A 4JGZC 1H4GA 4Y4YA 3ZFFA 1AR73 4IEYA 1D4M3 1RUH1 2FBEA 3NVCA 4JVAA 1TMF2 3MIEA 3V0AA 4XF9A 1X8MA 4AEDA 5KHJA 1KFUL 3CL1A 2YC0A 2WS92 2YV8A 4AQSA 4HN1A 2E63A 3RQ0A 2QCSB 3ZSKA 4AHWA 5AVPA 5FLHA 3LA3A 4XFHA 2P3JA 2YMZA 1OD5A 1LECA 3VZJA 1WLTA 4IV3C 3KGZA 3D8CA 5A32A 1X8EA 2DVDA 2D97A 2XJSA 4HK8A 1W6MA 3DKWA 3VBOC 2RR11 1H2NA 3H1MA 3ATGA 1EY2A 3VL9A 1AYM2 5FREA 4ES9A 4PBPA 4GB32 1G7YA 4GH4A 3VZKA 4Z07A 3N7KA 5I8SA 2ZTNA 1H2LA 1FPN2 2CWMA 4OHZA 4CDXC 1YUDA 1POV3 2ZX3A 5BUVA 3SCGA 3IMNA 1CAUA 4BLIA 3GBFA 2VOVA 5BNOA 3UJQA 3WY6A 1UMZA 1PVC2 3HQXA 3P3PA 1YXWA 3KT4A 5GZDA 4RS5C 5SV5A 2VOKA 3OBTA 1RUNA 1LOFC 4S2HA 4DFSA 1V6KA 3AJZA 3UJOA 2E7AA 1ONAA 1HV0A 1AR93 2ZS6B 3L2YA 5C8CA 1G9CA 4YZ2A 1S2KA 4FQZA 3MGUA 1RUJ1 1BBT1 2A73B 4XJ8A 1H0BA 4AVBA 3VBHC 2CTVA 2X5IA 2ARXA 1DQ1A 1DQ6A 1VBD2 4Q4X2 1R092 2B45X 5JDBA 2GH8A 4JRLA 4O9EA 4I0BA 1W6OA 1OOPC 5CB7A 2IXCA 4IEPA 1YWKA 5CBLA 3WW1A 4XEZA 3LOIA 5KHHA 2RMU1 1PIV1 4COUA 5CG8A 1CX4A 3AB0A 5SV8A 2DCZA 1EV13 3N3HA 1PM7A 2ZA9A 2R32A 3MI8A 1IS5A 3QCWA 1IPJA 1ASJ3 2HWF1 3SH4A 1UW8A 3ZXKA 1QF3A 2C9AA 1LEDA 4AVTA 3ENRA 3AP4A 3KZ4C 2ZGLA 1HRV2 4PDWC 3ILNA 3ECQA 1QOOA 5BNPA 2YUEA 2FMYA 5F9TA 2OW4A 3UKTA 4AHXA 4AVAA 4YGEA 1S0DA 1WW6A 2UU8A 1AJOA 1QJX1 1XE7A 2WSUA 4FPGA 5K0UC 1RTVA 5DUWA 3PMEA 4I0AA 1SBEA 2PLV3 2ZJCA 3HT1A 1N3QA 3FMGA 1RUD1 2XH6A 2IC1A 2R0HA 4DPNA 1V6LA 4XMAA 1MEC3 1R082 4GWNA 1VAMA 3WDYA 4PF5A 4FCAA 2D44A 4G4FA 2P2KA 4UW4A 3AKRA 2RM21 4R9CA 1HX6A 2RJKA 4LNVA 1R1A3 2EIGA 4R8HA 2UY9A 5KHGA 3N35A 4AFCA 4OI0A 1V70A 2CYFA 4CDWC 1RHI1 4JGZA 1PZ7A 3BOWA 4D7TA 2RS51 3D6EA 1B35C 4FOYA 4N43C 3WDUA 1REEA 1NCRB 2X53S 1DLLA 2R49A 1QQP1 2D3RA 1UU4A 3ZMOA 5C8WA 4DY3A 4U36A 5FLJA 1IKQA 5DG1A 1ZBA2 3ACLA 1SLCA 3ES4A 2HWE1 1IS3A 4K1ZA 4YFWA 2O8QA 4F7ZA 2R062 3EQEA 1ND3B 1VBC2 1S55A 4MSVA 3M70A 4EWAA 4IV3A 3VDDC 2ZGKA 4Q4W3 4KGQA 1Y43B 1ZRRA 2D93A 5IUQA 4P5HA 4QPGB 3USUB 3VBOA 3I7DA 1YO8A 1POV0 1RMU3 1AYN2 1AF9A 2SLIA 4LE3A 3E6CC 4AQ6A 1FNZA 5AC91 4GMP1 4H7LA 1SLIA 4FPYA 3M3EA 3ZO0B 1PNFA 4RQPA 2WFF3 4LO4B 4Q4Y3 4KBBA 3S0MA 2PFWA 4CDXA 4RGAA 4LTAA 2VW0A 1C8M2 5I0RA 4PLNA 1X33A 1KJLA 2P3IA 2A6XA 2YXSA 1LULA 1CONA 3VBSC 1RUC1 2D3SA 1COV3 2ZCWA 2LM3A 3RG0A 3ZFEB 2F4PA 3WCSA 5FCCA 3O7OA 4RR3A 4UBHA 2EXKA 1ENRA 1XNCA 1CAVB 4WM8C 1PO21 2SBAA 3B94A 2MNGA 4XJZA 3WDTA 5KWRA 4RS5A 2G9GA 3MIDA 2R1BA 2DCTA 5GLZA 1LOFA 5CVRA 2W52A 4XFBA 1BMV1 4XBNA 1PO11 4QX5A 3B9IA 4NHKA 2DCJA 5GZCA 3ZXLA 4AQTA 3N7MA 3Q9OA 2R30A 4C1XA 1PGL1 3FHIB 3ZSEA 4RFT0 1QKQA 1FV2A 2XG3A 1CGPA 5IK8A 3VBHA 5J96B 1D4VB 1I5ZA 1VBE3 3ALQA 3AYCA 1VB2A 3B7MA 1Q8QA 1GNZA 1DBNA 5CNAA 1RUE1 1UKGA 1TME3 3ZXJA 4WM7C 4GWMA 1OOPA 1VBB1 3MIHA 2EAKA 4OUSA 5I0UA 2NZ9A 5E8AA 5J36A 4IEOA 1N47A 2WLPA 1DHKB 4GMP0 2GZWA 1C1LA 4A2UA 4HKOA 2Q30A 5LRSA 4F8AA 3LCPA 5HXVA 5T52A 1NE6A 2G4IA 1FX5A 4ITCA 4XPVA 4ASMB 1OSGA 4B4RA 3LWCA 1AXZA 2TEPA 4NHLA 5ABJB 1YHFA 1RUF2 4PDWA 5CAZA 5HCAA 3GBWA 3R4DB 1HRI2 4KWKA 5JWPA 1VRH1 1HKDA 4Q4V2 4DXZA 3OF1A 1KXGA 4Y5Z0 2GNDA 2A3XA 1QMJA 3KCCA 4CDQC 3VZNA 5GM0A 1W6PB 2VVEA 3M2MA 5KHIA 1TMF1 5K0UA 3SMHA 3S7EA 1ULEA 4IV1C 4IERA 4OZXA 1S0JA 1G86A 4FOQA 5FFOC 2WS91 1QJU2 4JAAA 2PHDA 5GLUA 5ACA3 2WFPA 4NO4A 3ZIWA 5T5LA 1QNYA 4ATEA 3M3OA 1WCDJ 2D98A 2BEOA 1V6OA 4CDWA 1AR63 2O8OA 3IPVB 5D8AB 1F8VA 1GICA 4HK9A 5EV7A 3JD73 1A3KA 2BNMA 3HWJA 3ELNA 3DV8A 2WC2A 4FBFA 3VKOA 4BQ1A 1AYM1 4FPOB 4AK3A 1ZA4A 4XQDA 4UW6A 3PVNA 5DXDA 3HN1A 4GB31 3J8F2 4OI4A 2HJIA 1FPN1 2Q0AA 3SH3A 3EXUA 3BPZA 4L11A 1AR72 1JOJA 1U5ZA 2D6MA 1WW7A 1D4M2 3JCIA 3JU9A 4OHXA 3CO2A 4LHKA 1BKZA 4COWA 2RS13 4ZU5A 4XILA 3ZYJB 2JG9B 1RUOA 2BWCA 4MXVA 2CGOA 4RD7A 1YCIA 3MF9A 1YRZA 1PVC1 2JXAA 2Q5TA 3CJIC 2P37A 4XBQA 3ZN6B 5FO7B 3WX5A 1IZ3A 3VDDA 1U5YA 2C0ZA 2IXJA 2ZHMA 2A5ZA 3CNAA 3ZYRA 3SXWA 5BY5A 3RJRA 3VV1A 1ND2A 4FP3A 1F5JA 3MW2A 5A33B 1URXA 3E97A 3O0WA 4JGYC 3KD4A 2R043 4A7ZA 2A3WA 2K0GA 1LTEA 5BNQA 2UYBA 2JENA 2EXHA 2H6BA 2BNOA 4IETA 1ENQA 1IS4A 1SBDA 1N1YA 2DV9A 3THTA 1CPNA 4AE2A 2W39A 3AKTA 3H50A 4QMAA 5CIRA 1RIRA 4KU7A 5KC5A 3TAYA 1VBD1 1LJ7A 4X8PA 3JB8A 4Q4X1 2PHXA 4WM8A 1DFQA 1AL0G 4LO8A 2ET7A 1D0GA 3BOPA 1R091 2WL1A 1PNGA 3O0XA 4DS0A 2DCYA 2WLQA 4XJUA 3RSJA 3DPRC 2FHRA 4DNYA 1DQ4A 3V65A 4QQLA 1YJKA 3KLSA 2VG9A 3OYWA 3NV3A 4LE4A 1PK6B 4MXWA 3THPA 5BNNC 2JE7A 1S2BA 2TUNA 3AMQA 1LRHA 1XNKA 3GBGA 4HKWA 1FMD3 3OGGA 1AR83 4GXLA 2PAEA 2IXIA 4N90A 3O5SA 5L19A 1AR92 2AR6A 4NOTA 2CGPA 4EN0A 2VECA 3ZXEA 4XMIA 1HRV1 4Y1VA 3PVBB 4K20A 1WW4A 4XHXA 1ZRCA 3M8LA 1OI6A 4WM7A 4ZKTB 5I8YA 2PHUA 3H0OA 5LK5A 4YRDA 2ERFA 4B29A 4AEDB 1QNWA 1NCQC 3WDVA 5AFEA 2LALA 5JIUA 3IDEA 4QM8A 5DZFA 4AGVA 1ZBE3 2VUJA 5CA6A 3HR9A 4P9WA 3N36A 1N1VA 4LR4A 1R081 2ZHNA 4OI2A 2KA3A 2IFRA 2RHPA 1Q8SA 3AZVA 4PLMA 4D3WA 4LBJA 1X7NA 1EV12 3NAPC 1RVF3 1Q43A 4NPRA 2PAMA 3AP5A 5H9QA 2BFUS 1ASJ2 2WKKA 4AWDA 1VALA 5FBZA 2OPKA 2HWC3 4CDQA 5FRAA 3FE5A 1I6XA 3AXEA 2ENRA 4YZ3A 1OHFA 3E5QA 4IV1A 1I9RA 3SNMA 5CU1A 4QQPA 3VZMA 2VW2A 3VBFB 1GR3A 1ZRDA 2VOXA 5BXXA 2HKXA 4I09A 2WIIB 1GZ9A 3WG3A 1ZBA1 1K5MB 4R4XA 2NPIA 1ALYA 1CIWA 2PLV2 1HQLA 2B42B 4MH0E 2R061 3M3IA 5GLTA 1VBC1 1MZFA 2BTVC 3LA2A 1MEC2 1ULCA 4ORFA 3ZSJA 1O3QA 1W2UA 2JE9A 4N9IA 5E88A 1WW5A 2NMOA 2PTMA 2WNUC 1SFNA 1DYPA 1EPWA 5T54A 5C8CB 3BCWA 1W39A 1AYN1 2XBO3 1O4TA 4FPKA 1R1A2 3N7LA 4N53C 4L2NA 4AW7A 3PHMA 4JTNA 5CFCB 4J1WA 4XOGA 2BQPA 4G3YC 4WZFA 3J26N 4H3WA 1C8M1 3PLQA 3H9AA 4GALA 1LENA 4Z82A 2WNVC 4YVWA 5DDJ3 4FP2A 3CJIA 1J1TA 1SCRA 3ILFA 2P34A 1GZWA 1H9WA 4JCKA 2P3KA 4LBNA 2A6VA 1DQ0A 1NA1C 3OY8B 1FV3A 2WINB 5BPXA 2ZGMA 4JGYA 4S2GA 4CEWB 2EA7A 3VKFC 3R6SA 4ISRA 4QM9A 4Q4W2 3SH5A 5DZEA 1RGSA 3ILRA 3DL3A 4LA3A 1JHNA 3E5XA 1RMU2 1QY4A 3ME2A 1SFYA 3WLUA 1Q5OA 4LBMA 3INAA 3IIAA 1MS3A 2WFF2 2OUHA 4Q4Y2 2V09A 1R1ZA 1EYBA 2XJVA 2Z42A 4O9GA 4W6WA 2OZJA 4PBOA 1CN1A 5EFUA 1Z78A 1COV2 2DUPA 3M7AA 4CEYA 4EN7B 2Z2SB 1AX0A 1BCXA 1HQNA 3OGJA 4DY5A 3MW3A 1NXMA 2O0OA 4GULA 2JDZA 4UW3A 4BYYA 5JSPA 3LOBA 4WBBA 5BNNA 4AI0A 2V73A 4ZU7A 4EJRA 1CR7A 5FTTC 1WBFA 5L7OC 4IESA 4COVA 4D69A 1KITA 3TOJA 2GALA 2A3YA 3RYRA 4META 5DUXA 2A70A 1RUF1 5JVVA 1HRI1 4FPLA 2PHLA 4IEQA 4Q4V1 5E16A 3OJBA 4LBKA 2YDEA 5FMOS 4I3PA 1GQHA 1VBE2 2ARBA 3H7YA 4OFGA 2E7QA 1WLDA 4UXAA 4XETA 1DU3D 2Q8OA 1TME2 3DUIA 4BIFA 5L36A 3W59A 3AMPA 1MS5A 4YYOA 2QFEA 2DF7A 3POWA 2IXLA 3TNQA 3I4IA 1QJU1 3QD6A 4MGIE 2ETEA 3KT7A 4AXOA 4BLJA 3NAPA 1OPMA 1M4WA 3AZZA 4HN0A 3JZVA 2VQ0A 4Y20B 4A7YA 3UL2A 2CY6A 3OTFA 4MLOA 4GKYA 3VL8A 4RQPB 4YW1A 4P9LA 4QT6A 4OI1A 2AH2A 3VZLA 1V9U3 1YIFA 4Q29A 4LO6B 2Z79A 3T1LA 3H1WA 3QLQA 5FDBA 1GZCA 4XXAA 3I59B 1V6IA 1UF2C 3J8F1 2A7AA 3PJYA 1M06G 1AR71 5DZGA 1RUI2 1D4M1 2UWCA 3L2HA 2DYCA 4RR3B 3VHNA 1G9FA 1ZZ7A 1GV9A 4UBGA 3TN93 2AZ5A 1NZCA 1UN1A 3ETQA 3KSCA 2K9ZA 3GZTB 4LBQA 4HLTA 4EV0A 3AJYA 1MS0A 1WLCA 5C4WB 2A6YA 2WNUA 1EP0A 3ZXFA 5ACA2 3I54A 3VBUA 3AZYA 1LHVA 3S30A 3ZSMA 4YM0A 3O14A 4B7EA 1O91A 4N53A 2G9FA 3AFGA 3AXDA 2DVBA 2VMHA 3ZYIB 1AR62 1EPZA 4FPJA 4AI1A 1G9AA 4LA2A 1C5HA 3FLTA 2K2SA 1GQGA 5AVAA 3JD72 3GZUC 5CFDB 1S1AA 3BU7A 4YW4A 2ET1A 3B93A 4GA9A 1AZDA 1CVNA 3PNAA 4YNIA 2EVXA 1DZQA 2GNMA 3ES1A 2CWSA 3JQWA 3HBZA 1AXYA 1O5LA 2EF6A 1TE1B 1LOBA 1POV1 2GC2A 4AQ2A 2GMEA 2ATFA 2EALA 1WUVA 4YZ4A 1RB8G 1QU0A 2RS12 4BWOA 1NA1A 1DQ5A 4ZXKA 3WP6A 2XHKA 1HQWA 1SEFA 2GC0A 2I07B 4XFAA 4XJWA 1W0PA 2ZPXA 4XF4A 5DG2A 2ES3A 1YI9A 1HXS3 2WNEA 3B69A 4Y26A 3V56A 4Q0PA 1W6QA 1U5IA 3B3QE 3WCRA 2ZMLA 4FXGB 1MVQA 2VVFA 1AR91 1LB2A 2R042 2ZZQA 3O12A 4ZU4A 2XLAA 1U12A 3H7JA 1QJZA 4M0NA 3T2TA 1VJ2A 5AFBA 2MPFA 4W6YA 4AFDA 1LU1A 1W6NA 2E53A 1ZRFA 1NCRC 2W08A 4NVPA 3POYA 3WZ1A 1QH6A 3A0NA 3V0BA 5DUUA 5T50A 4ASLA 3RWNA 1UD1A 1CAXA 1SACA 1FXZA 2WZR3 5T5PA 4I3GA 3C2UA 1SBFA 3ZYPA 3FBMA 4AG4A 1QXJA 1HLCA 1ND3C 5FOJB 5FO9B 5FPZA 3WG4A 5L7OA 2AYHA 3AKQA 4QPGC 1VBA3 4AFAA 1FMD2 2W0XA 1AR82 1EV11 4RHV3 1APNA 1S0FA 4HANA 3RYPA 5JOZA 5JOWA 4L8QA 1TEIA 5JMCA 1ASJ1 3FC0A 4LEJA 1UIKA 1AHSA 5GKAC 4WZCA 4CP1A 4YZ1A 4JTOA 1S0IA 1V6NA 1XRUA 3JBG3 2PN5A 3NKGA 3KB5A 4HKLA 4FPEA 1D2QA 1OA2A 5JZGB 3ZFEC 5JOYA 2BPA2 2ZX4A 4RGGA 1RUG2 3WQ1A 1ZZBA 4FQ4A 1QWRA 4FPHA 1MR5A 1J59A 1UU6A 1XNBA 3RMYA 2HYKA 4KH9A 4WVMA 2QNKA 3PVEA 1WBLA 4P14A 5JLVA 1ZBE2 1C57A 2PLV1 1H2KA 4WVWA 2DCKA 4B7KA 4X8NA 2BBVA 1MEC1 3WHTA 1ND2B 1H9PA 1VAKA 1ENSA 1CD3G 4K21A 3U11A 2GN7A 2JECA 3U0ZA 4NWWA 1UL9A 3WQ0A 1Q56A 1RVF2 1R1A1 5DUVA 4FOVA 1O3RA 3RPQA 1SDWA 1LOCA 3KCYA 4XIKA 4BHPA 4BCUA 4OULA 2HWC2 1JBCA 2ZMNA 4XFGA 4KU8A 3GHNA 1MZ5A 1G8WA 2HWD3 2DUOA 4LBOA 5HBAA 5BV6A 4AVVA 1KRIA 3MFCA 4PIYA 4X6RB 1S0EA 4XFFA 2ZGPA 1GSLA 1PVXA 1IS6A 2EAAA 4HT1T 1G9DA 3A0KA 1JYIA 1BVP1 1S0GA 2CAUA 4AEMA 3SLIA 1KS4A 3CU7A 4YVSB 1IGOA 4XW3A 4J1XA 1NQJA 4JQRA 3SCFA 1QHDA 2GSYA 1EAH3 3AMNA 4Q4W1 5ABJC 1MQTB 2D40A 2XJRA 1UAIA 2XUMA 1YI7A 2Y0IA 1IKPA 1RMU1 2NLRA 2ZBJA 2XBO2 3FFZA 4ISQA 1QXPA 4U2AA 3VHOA 2WFF1 4Q4Y1 5C9AB 1DGRN 2YGMA 1PVC3 4L99A 1JTZX 3KT1A 1VR3A 2JICA 2ZGUA 1ZM1A 1NLSA 2YY1A 4HPKB 5EZWA 3IDBB 1COV1 4HL0A 2DTYA 4N7IA