1HDKA

Charcot-leyden crystal protein - pcmbs complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
139
structure length
139
Chain Sequence
SLLPVPYTEAASLSTGSTVTIKGRPLVCFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EOSINOPHIL LYSOPHOSPHOLIPASE
publication title Charcot-Leyden Crystal Protein (Galectin-10) is not a Dual Function Galectin with Lysophospholipase Activity But Binds a Lysophospholipase Inhibitor in a Novel Structural Fashion.
pubmed doi rcsb
molecule tags Serine esterase
total genus 31
structure length 139
sequence length 139
ec nomenclature ec 3.1.1.5: Lysophospholipase.
pdb deposition date 2000-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1hdkA00
2Z42A 5DZFA 1LGCA 3APBA 1UKGA 1LOFC 2FHRA 2DWRA 1Q8PA 3ENRA 4AVVA 4GKYA 3U4XA 3AJZA 3QCWA 3WDWA 1W6PB 2D43A 2C5DA 1PZ7A 2NMOA 4Q1PA 1IS3A 1S0FA 1JOJA 1CN1A 2GNMA 4U36A 1JYIA 1AJOA 4UW6A 5T55A 4XJWA 4FOVA 1YRZA 2EALA 2A6VA 4K1ZA 4YFWA 4TYSA 2I2SA 5CB7A 4LBMA 1YO8A 2ZMNA 1AZDA 1DZQA 2EXJA 5L73A 4YZ1A 2ZHLA 4H55A 4YZ5A 1URXA 1WLWA 3FLTA 3R4UA 1WLDA 2D3RA 1DLLA 2WJSA 1BKZA 1XQNA 2A6XA 1MS9A 3NWKA 4TZDA 2ZGPA 3UL2A 4W65A 2AREA 5GLZA 3D6EA 1C57A 4XBNA 4LBQA 1LHNA 1VLNA 5DUWA 2ZGTA 5DUUA 5DUXA 1Q56A 3SH5A 1DBNA 1ENRA 4DS0A 3V0AA 2NZ9A 3B69A 3ZVXA 5AVAA 4GA9A 1GZWA 4LBNA 1BQPA 2P3KA 4XTMA 4Y1YA 4JCKA 5CAZA 2H0BA 2DYCA 4Y1XA 2A70A 4ZKTB 2GNBA 5LK5A 3SNMA 1LOAA 4BMEA 3D5OA 1GZCA 3FLRA 5EWSA 3DUIA 1OQ1A 4KBBA 2R49A 3WDUA 3OJBA 2D6KA 1FV2A 3ZXLA 1W6OA 4XHBA 3RG0A 1CESA 1DYPA 4PBOA 2OUHA 3N7LA 1LEDA 3CNAA 4BLIA 3ATGA 4XZPA 2DVFA 4DPNA 2GDFA 4XXAA 3WDYA 5H9SA 3C2UA 4XDQA 1LTEA 2B7YA 1W0OA 2GN3A 3SH4A 2ZAAA 4RA0A 1IKPA 1AVBA 1MS5A 2ZZJA 5GZGA 4ISRA 2NMNA 4XIOA 1WW6A 2D6MA 2EF6A 4PF5A 2ZHNA 3AP7A 3WDTA 1CIWA 3UJQA 1O4YA 2AUYA 4MYEA 4XOGA 4Y22B 4XJAA 5JDBA 3RSJA 2RHPA 2ZBJA 5T5PA 1IS5A 1LOCA 4M3CA 5CBLA 2ZKNA 2ZMKA 4FPOB 2A6WA 1LOEA 2EXKA 3A0KA 2ZGQA 1ONAA 2DUOA 3M3EA 4FPEA 1N3PA 2EXHA 1R1ZA 4GWNA 4UW3A 2EXIA 2WSVA 5DZGA 4YM2A 1ZA4A 1G8WA 2AYHA 3RS6A 2P3JA 1BJQA 1LGBA 1IKQA 2PHXA 3NV3A 4LBJA 4XJZA 2JD4A 2FMDA 5DG1A 3WNXA 1S0CA 3M3OA 4XJ8A 1JXNA 1MZ6A 1CJPA 1GNZA 3RMXA 2UURA 4BOWA 1LHOA 1S0DA 4XMAA 1GV9A 1QNYA 1VIWB 4Q2FA 4FQ4A 4R9DA 2JE7A 2ZHKA 4Y20B 1WLCA 3POYA 3RRDA 1N1VA 5KXDA 1CPMA 5IK7A 4AGVA 2YV8A 2SLIA 2BQPA 2G4IA 2UWAA 3W58A 2DVAA 3WHUA 1MS4A 4YGCA 3AP5A 1NXD1 1DHKB 1QNWA 5GLUA 1N3OA 1W0PA 2GNDA 1WBFA 3MW3A 4Q8LA 2ZGLA 1AXKA 5IK8A 4XXPA 1WD4A 1I3HA 1PZ9A 4K1YA 3ZSMA 3AYAA 3FBYA 1GICA 4LBOA 4CTEA 2E7TA 1H30A 3ZSKA 2R1BA 2V73A 4UW5A 1Q8OA 2DTYA 1N47A 3OYWB 3WUCA 4BM8A 3WCRA 1H9WA 5F9TA 5IK4A 2HYKA 1RIRA 1V6OA 2VW2A 1FV3A 1SLBA 3M3QA 3TAYA 1N1YA 3WV6A 1HKDA 4ASMB 3DGTA 4YGEA 1JHNA 5SV8A 3AYCA 4YW2A 1S0GA 5JOYA 3AYEA 4YG3A 5T50A 2DVGA 5DZEA 1AXYA 1APNA 3USUB 4GXLA 3ILNA 1G86A 4CRQA 2P37A 1RINA 4K20A 4YW3A 3B01A 3JU9A 4LBKA 3OBRA 1LESA 3NV1A 1SCSA 1F31A 1VALA 2D7FA 1VAVA 2DUQA 2E6VA 3QLQA 3SITA 4P9XA 2V5YA 1OFSA 2A7AA 1DQ2A 3IPVA 3N35A 4AYUA 3AXDA 2WKKA 3FUQA 3R4SA 1LGNA 2ZGSA 3BOPA 5CA6A 4XHXA 1UAIA 4YG0A 3HR9A 3A0NA 1ULDA 3OY8B 4WV8A 2CY6A 1V6LA 4ATEA 4Y20A 3Q9OA 5T5OA 4DRRA 4LBLA 3WZ1A 5H9RA 2ARBA 1WW4A 1MS3A 4C1XA 3KQRA 2ZGOA 1W6MA 1V6IA 1Z78A 5EYYA 3VV1A 2D6NA 4WZFA 3I8TA 2OW4A 2SBAA 1C1LA 1WUVA 3AFKA 3MW4A 2A3YA 2R0HA 3HMYA 3JUUA 1LJ7A 2DURA 3IMNA 4M3CF 3VKNA 1W6QA 2VU9A 1G9DA 4FOYA 1CVNA 2ZGRA 4FPKA 5DUVA 4K21A 3AZWA 1ULEA 1WCSA 1SBEA 3V64A 5EXOA 4IQPA 4BQ1A 4Q8KA 1IS6A 3O12A 4FPGA 1OKQA 1LU1A 3AZVA 1YXWA 4F83A 5GLTA 4Z8BA 3POSA 2ZGMA 3ZSLA 4NOTA 4HL0A 1SLIA 1UZZA 3W59A 1CR7A 2D3SA 4FPHA 5IK5A 3OBTA 2P2KA 4FOQA 5JOXA 1G9FA 1W6PA 1FNYA 3N7JA 1LHVA 2WSUA 1BZWA 3PMEA 5H9QA 1W6NB 4YGBA 1QMJA 4FP3A 5T5LA 5KXEA 2YMZA 2LTNA 2GMMA 5E8AA 3PVNA 1GKBA 2YROA 4FQZA 2YZ4A 2AR6A 2AH2A 2GMEA 1V6JA 1C4RA 5FRAA 3A4UA 1AX0A 1ULGA 4OZXA 1S0JA 3ZXJA 1KJRA 1DQ1A 1SBDA 4PCRA 3O0VA 4R9BA 1MVQA 4M01A 2A6YA 3FLPA 1VAMA 4P9YA 5GZDA 3WG1A 3UJOA 3ZXEA 2CNAA 4YFZA 1MS0A 2R0FA 3O5SA 4DRVA 1ULFA 2YY1A 4SLIA 1S1AA 5T52A 1JUIA 1JW6A 4M00A 1QF3A 5E88A 1CQ9A 2ZA9A 3ZYPA 2A71A 1DQ4A 1WW7A 1U0AA 1GBGA 2GN7A 4Y24A 4PBPA 4YM0A 4P14A 3OGGA 5KXCA 2Q5TA 3O0WA 4UW4A 3AZXA 3ZYRA 5GALA 5DG2A 1QU0A 2WNEA 4XMIA 3MW2A 3IKWA 5DXDA 4FVVA 1B09A 3HN1A 3WVJA 1HDKA 1LODA 3LCPA 5H9PA 2NYYA 4AGGA 4YLZA 1FX5A 5JLVA 3T2TA 2OUJA 4GWMA 1MS8A 4XTPA 4DFSA 2DVDA 5HCBA 2XB6C 4M3CE 3WLUA 4YW1A 1G7YA 2EAKA 1AJKA 1MACA 3M2MA 3KM5A 4LBQB 5GZFA 4JC1A 5JOZA 1A78A 1O4ZA 4AVSA 2KM2A 3BIWE 2CWMA 1S0IA 1JBCA 3V0AB 3UK9A 2D6LX 1V6KA 2DTWA 2PELA 3ILRA 1GLHA 1LEMA 2R16A 1UN1A 1GZWB 2W39A 3AXEA 1A8DA 2VY0A 4GALA 4WVWA 4YGDA 5IT6A 1MS1A 1RITA 1HLCA 3H0OA 1W6NA 4Y22A 1Z0HA 4FPCA 3RQ0A 1BYHA 1LOFA 1GNHA 3N7KA 4DQAA 3B9CA 1HQWA 2JJ6A 2WT2A 1WW5A 2CL2A 2W68A 4PQ9A 1LHWA 1AX1A 4YM3A 2D3PA 3LSEA 3AK0A 2TEPA 5KXBA 1UZYA 3WG4A 3AP9A 4YG6A 4BPZA 1W6OB 2A3XA 1JN2P 1UL9A 1CONA 1AF9A 2DV9A 4Q26A 1DQ5A 4Y1ZA 1D0HA 4RL7A 3FFZA 4YM1A 2E7QA 4L8QA 3WUDA 3L2YA 4NO4A 3PJQA 1SBFA 1LOBA 2GNTA 1KDKA 1SLTA 1QKQA 4XBLA 4CZSA 1GYKA 3ASIA 3MEPA 2UWCA 4FOWA 2CWSA 3SISA 4R9CA 3VKOA 1DGLA 1QGLA 2D6OX 2WT0A 4Y26A 5T54A 3ZXKA 2JDZA 1IS4A 3AX4A 1QDOA 2DUPA 2GMPA 3B3QE 4JRAA 1V00A 4WVVA 4BLJA 1DQ6A 1YYNA 4M3CB 1G9BA 1DYKA 5CNAA 1PZ8A 4XBQA 1AXZA 2WQZC 2DU0A 4U2AA 2DU1A 5E89A 2ZGNA 5GZCA 2A3WA 1GSLA 3VKFC 1S0EA 3AJYA 1MR5A 3WCSA 1BXHA 5GM0A 1G9AA 2JECA 3O0XA 3WHTA 2E51A 4FPFA 1LOGA 2ZGUA 2JKBA 2WLQA 4YW5A 3T1MA 5JMCA 5T5JA 3VKLA 1QOOA 1Q8VA 4XYXA 1LHUA 2PHFA 4YZ4A 1N1TA 2ZGKA 5IUQA 1UX6A 2VW0A 4ATFA 3OYWA 2PHUA 4YZ2A 1ENQA 1SFYA 3INAA 4Y1UA 2AGSA 5GLVA 4FPYA 5GLWA 1KITA 2NP0A 1DFQA 4XJUA 1FNZA 1F5FA 3NV4A 1DIWA 2ENRA 3AZZA 1FAYA 1LULA 3R05A 3USUA 3ILFA 1SLCA 1YIFA 1SLLA 2GALA 5JOWA 1A3KA 3M3CA 4BMBA 5FREA 2W52A 1Q8QA 1SCRA 2VH9A 1UMZA 4YZ3A 1Q8SA 3AYDA 5GZEA 2VW1A 4AVTA 2PHRA 4ISQA 4GKXA 2PHTA 3WG2A 1LENA 2NM1A 5HCAA 2ARXA 2P3IA 1KRIA 1WD3A 3GALA 3BODA 2OVUA 4Q27A 1C1FA 1LU2A 1FATA 3IM0A 3WDVA 3V0BB 2D44A 4FP2A 1KJLA 4AWDA 1QOSA 3I4IA 4FPJA 5BYNA 3AP6A 3MPPG 1QDCA 3OY8A 1N3QA 3N36A 4ZXKA 3LSDA 3T1LA 5EYXA 4D69A 3WG3A 1G9CA 1IOAA 3N7MA 1F9KA 1EPWA 1SACA 2D6PA 4XILA 2ZACA 1YI7A 2CTVA 4C1WA 3V0BA 1JYCA 4XIKA 2A6ZA 3M1HA 4LBQD 1CPNA 3D4KA 2LALA 2ZMLA 2R1DA 3AP4A 4I30A 3OPZA 5F5QA 3VKMA 3WDXA 2ES3A 2CYFA 3PVEA 2JE9A 2XG3A 1HQLA 1V6NA 1GZ9A 3IPVB 1N1SA 2DVBA 5HCFA 1LCLA 1FYUA 3TB0A 3SLIA 2A75A 4P9WA 3PVOA 1Y7BA 3BTAA 3POWA 3ZPYA 3IN9A 1S0BA 2W08A 1H9PA 4AGRA 4ITCA 3B00A 4HANA 2WT1A 3ZSJA 4YW4A 1KQRA 3ZXFA 1WBLA 3N3HA 2EIGA 1W6MB 3GNEA 4R9AA 3V65A 1MZ5A 1ULCA 4XJ9A 3WOGA 1ZM1A 3FUOA 2ERFA 2PHWA 5GJ6A 3SH3A 1DQ0A 2AENA 1X50A 2VUAA 2VXRA 4FPLA 3RMYA 1QOTA 1LECA 1D2SA 2UU8A 1W6QB 1SLAA 1GANA 1I1EA 1UPSA 2ZHMA 1TEIA 2ZABA 5JVVA 2NN8A 1AX2A 3AZYA 4XE9A 1NLSA 2P34A 1ENSA 2UWBA 1MVEA 3VUOA 1V6MA 2YXSA 4Y1VA 2C9AA 3NV2A 1J1TA 2A5ZA 1KDMA 4Q1RA 2E53A
chains in the Genus database with same CATH superfamily
4IEYA 1J58A 1ZRRA 2J1EA 3N9MA 4N43C 3NAPA 4AI9A 1W8TA 3OB8A 3U4XA 2RMU2 3AJZA 3O7OA 3QCWA 4QB6A 1W3VA 3PIJA 2D43A 1JMUB 2BVVA 1NUKA 2C5DA 3NJXA 3ZFGB 2UY9A 1Q3EA 4K8FA 1IS3A 4Q1PA 1CN1A 1J83A 3VZLA 5CG8A 2IXLA 3AFGA 4IV1A 2P6CA 4FOVA 4K40A 4Y5TA 3RZGA 1ASJ2 2R072 1D4M3 2ZX0A 2ZMNA 2OKXA 2EXJA 5L73A 3FLTA 5C3QA 2D3RA 4Q4W3 1PVXA 2WJSA 1JU3A 2DDUA 1MS9A 3LEIA 3J26N 4LR4A 3OSDA 3UL2A 1W9WA 5C8CB 2R061 2JG8C 3D6EA 2RG4A 3P3PA 4XACA 2RDRA 3THDA 5C4WC 4QX3A 5DUXA 4XUNA 3AVSA 4IETA 4JZRA 1OXCA 2WR9A 1OQDA 5FYSA 1C3HA 2NZ9A 3B69A 3ZVXA 3MLJA 5AVAA 2CDOA 2XJQA 3GBWA 2NPIA 4GA9A 1L7RA 4Y1YA 2H0BA 5KR7A 5A80A 3E6DA 4I0AA 1WMDA 3J7NA 5LK5A 4QB2A 2PFWA 3D5OA 2O1QA 4S2GA 2P1BA 2PA7A 5A33B 5J1XA 1F8VA 4KBBA 4D8MA 4I0WB 3OJBA 4UFJA 5FYZA 3ZFFB 1W9SA 3FBMA 3NNJA 1DLCA 4UFIA 2HEVF 5FZ1A 2QCSB 1CESA 4L92A 4QKDA 4CUCA 1LEDA 1REEA 1O6UA 3VD5A 4BLIA 2O8QA 4XFCA 3ALQA 4AQ2A 2GDFA 4DPNA 1SQ4A 1QJY3 1LTEA 1W0OA 1REFA 1GZTA 1PK6C 4QDRA 1S55A 2RS53 1H1IA 2J1SA 5HCHA 3ZFEC 1AVBA 1JODA 3LAGA 5GZGA 1HRI1 2D6MA 2EF6A 1C8M3 1PMIA 2HWC3 4I3PA 4IE7A 4PF5A 3WDTA 4JKLA 1L7QA 3K77A 1AR82 5A7QA 2Y6JA 1VP6A 4XOGA 5J48A 2HH9A 4XJAA 5LCWL 4AEJA 3RSJA 2ZBJA 5ABJB 1RL3A 4M3CA 3H7YA 2ZMKA 4EV0A 3CF6E 3ACHA 4LK7A 1V0AA 2RR13 2VBPA 4OQ9A 1PGSA 3LPGA 3M3EA 2EXKA 1FMD1 3LEMA 1ZZ6A 3KV6A 3VHNA 4CCOA 1R1ZA 5JR2A 1HV0A 4I01A 1ND3A 5DZGA 1VR3A 1ZA4A 3KV4A 4L0PA 2YYOA 1EUUA 2BFUL 3C7OA 3K3OA 3NV3A 5DG1A 3WNXA 1S0CA 1OOPA 3NJYA 4XJ8A 1VMFA 2VBDA 2WINB 4HMZA 1YFYA 3UGHA 4EN7B 3E97A 1RXGA 3SCHA 3T30A 1KEXA 1QJU3 2YPJA 4Z07A 2ZHKA 3GHNA 4NAMA 4LE4A 4UT5A 4N53C 5KXDA 4PJYA 1CPMA 1V9U3 1UXZA 2G4IA 2FBEA 1R082 2DVAA 4COYA 2GAUA 1QNWA 4AHWA 3OGVA 3FFQA 4A3XA 4IV3C 3KGZA 5KC6A 4C0BA 4IEPA 5F6KA 1NCRB 3SMHA 1HXS3 1PZ9A 4QAWA 2Q30A 2Q8CA 3PDQA 3AYAA 1RUC3 4GJYA 4LBOA 5JZGA 3IIAA 1BLZA 1ZBA3 2HWF2 2DBNA 1UY1A 5C7GA 1H4HA 4Q4X3 4Q0SA 4H7LA 5IK4A 1DGWX 1FOD3 2HYKA 5CEHA 4H7MA 1RIRA 1W9YA 2VQTA 3I2FA 2DFCA 4KWJA 1GWMA 2HWB3 1FV3A 2VQAA 3IAQA 1AR91 1PGL2 2VGDA 4LEJA 5A6YA 1S0GA 1OLMA 1HW5A 2ARAA 2DVGA 1RMU3 4S2HA 2P4EA 3USUB 1UOJA 3C3VA 3FZ3A 4QPIA 1PIV2 2EIEA 3ILNA 1PO12 2PLV3 1G86A 3LF7A 5JSOA 2P37A 1RINA 3RVHA 3TNQA 2VQUA 3LDKA 3KF3A 4Y5Z0 4AEDA 4CPBD 2WFF2 4IERA 1VALA 5JPMB 2E6VA 4P9XA 3NAPC 4Q4W1 2W5FA 5B2GB 1O7FA 3AXDA 2WNUA 2WDBA 3FUQA 1OH4A 4UFHA 1JS9A 2ZGSA 4WZCA 4ZU5A 3BOPA 1ZNPA 5BNQA 4P00B 1W3XA 4XHXA 3WW3A 4AI0A 3TEZA 2QE3A 2CY6A 4D3WA 4DUWA 3MIEA 2HYXA 1QXJA 4IV1C 2VCAA 3WZ1A 1GMMA 3CL1A 3OOXA 1FPN3 2YBPA 4ZU7A 2ZGOA 3H8RA 1YCIA 4IW3A 2VQ0A 4XFGA 1W8UA 3C7EA 1GR3A 3AKPA 2A3YA 3JUUA 3VKNA 1W6QA 1ZVFA 4FOYA 2PAEA 4Q4V2 1QJEA 4LMFA 3C7GA 3RZMA 3URFA 1PNFA 5A1AA 5E16A 1ULEA 1WCSA 4HFSA 4Q5OA 4FI9A 4ZU4A 5I0TA 3I2JA 1F4AA 2WUHA 2E26A 3V64A 1COV2 1OKQA 1NE4A 1LU1A 2Y38A 3I3EA 4Z8BA 4FT8A 4GAZA 4XPVA 4C90A 5GKAC 3QH6A 4MGKE 5EHDA 2YB7A 5E1RA 4DXZA 3VDBA 3N9PA 5CFCC 2ZX4A 5DAXA 4FOQA 4BQ3A 3HEIA 2XJTA 3N7JA 1PM7A 1LHVA 3EO6A 4Y5SA 5FOJB 1QMJA 5T5LA 3PVNA 1GKBA 4E27A 2BOJA 3I3DA 1D4M2 3J8F1 1CZVA 4IEZA 4OMDA 4Q0QA 2RVAA 2FQPA 2GMEA 5FRAA 3HQUA 4R4ZA 2HWD3 3KGLA 5FY4A 2TUNA 1AX0A 1JOPA 4OZXA 1S0JA 2K46A 2C1FA 2D98A 2YPDA 4R9BA 4M01A 5JIAA 1WA4A 2A6YA 3FLPA 5LBEA 4B4QA 4P9YA 1E5HA 4HPKB 4COUA 3CU7A 3WG1A 3UJOA 4EN6B 3I3MA 3ZDVA 3VDDB 5FPZA 4DRVA 5BPXA 2N7GA 2W1WA 2YY1A 4CPBA 5A3NA 3AM2A 3PU8A 4WM8A 5D8AB 1JW6A 4A6OA 5E88A 2B9VA 2CU5A 4URAA 3ZYPA 3KZ4C 1O3RA 2ZJCA 1DGRA 1VBE1 4W6YA 2JG9A 4PBPA 3S5AA 1IGOA 2Q5TA 1ND3C 3O0WA 5L9RA 4Z1VA 1JYVA 3AZXA 2RS11 2FCTA 2QQVA 2VNVA 1QU0A 5DG2A 4ZY9A 3MW2A 2IFRA 5F39A 1RXFA 4FVVA 2ZKLA 1HDKA 1OOPC 3LCPA 4AGGA 1RUI2 1Y43B 2OIIA 2NYYA 4ZZ8A 1DU3D 4MH0E 4WVMA 4GWMA 3H1YA 2WZPP 1S2KA 4NHYA 1QJY2 1H2KA 5F8PA 2EAKA 3WSOA 2RS52 3M2MA 3VBHC 3VN4A 5BNPA 1C5HA 1LKNA 1DDLA 1OKOA 1C8M2 1ZBA1 2HWC2 1VJ2A 3DYMA 2Q8OA 3LDBA 1RUJ1 1LEMA 1QY4A 2R16A 1GZWB 4G3YC 4GALA 2VY0A 4YGDA 4HKLA 1REDA 4DZGA 1U5YA 4LA2A 4Y22A 4ONUA 4GH4A 3KB5A 2HWB1 3VBRA 1W8NA 4JGZB 3ZYBA 2XHKA 2D3PA 1NOVA 1IG0A 2RR12 2TEPA 1DCSA 1NCQC 2VZOA 2VZTA 2WYSA 5JZGC 2WWJA 5KXBA 2VVFA 3AKRA 2MEV1 4YG6A 5LRSA 2A3XA 2IFWA 4QWNA 1UL9A 3O1SA 4HK9A 4N9IA 1NE6A 1AF9A 3LGRA 1OQEA 5EQUA 1DQ5A 1KD7A 2R041 1H8TB 2VM9A 4QHBA 4Y1ZA 4NO4A 1YEWA 4JV4A 1ACCA 1LOBA 2JDNA 1KDKA 3IB3A 1QKQA 3SKJE 4XBLA 1VBD1 2MNGA 4YVSB 4AFCA 3RFRA 2QQUA 3MEPA 5FZ3A 2UWCA 3SISA 4R9CA 1QGLA 5EFUA 1RUE2 4RHV3 2JDZA 2ZEXA 5J37A 1QJU2 1IS4A 3AX4A 1CAUB 3OBAA 4QPIC 2GMPA 4WVVA 2WWUA 4MHUA 3RWKX 3O1UA 3QOPA 3P6BA 4LHLA 1YYNA 3LA3A 5C3SA 4XQDA 1V9U2 1G9BA 2BERA 5CNAA 1VB4A 1QQP3 2VOTA 4XBQA 1AXZA 2WQZC 2DU0A 5A7WA 4AEDC 3UETA 2DU1A 3KS7A 2XVLA 4UFKA 2A3WA 1RUF1 4CDXA 3PVBB 1DGWA 1BXHA 3OF1A 5A3OA 3WHTA 4YNIA 5J98B 4UXAA 2Z5WA 1HXS2 5K7PA 2QFEA 2VNRA 2I45A 2VL4A 1RUC2 2J42A 2ZGUA 3GJAA 4YW5A 5T5JA 3VKLA 1DYOA 2AZ5A 4MGQA 1Q8VA 3VZOA 1AHSA 1TVGA 3ZLIA 1NY72 1HB1A 1PVC1 2ZGKA 4KBZA 1UX6A 4AI3A 2GC2A 1FOD2 2PHUA 4KI5M 4LA3A 1ZRFA 4Y1UA 2BBAA 4D94A 5GLVA 5F3GA 4FPYA 3H1MA 4GZ9A 4Z82A 3L9JT 4EN9B 5JXGA 3CDZB 4IGOA 1DFQA 2UYAA 4GWJA 4B4PA 2X10A 3UNPA 4XJUA 1U5IA 1F5FA 2FDKA 1DIWA 2ENRA 1R64A 2J1VA 1YIFA 2Y6LA 2PLV2 5JOWA 1ENXA 1A3KA 1VBC3 3DN7A 4BMBA 2W52A 4IESA 1RUOA 2BGPA 3LEGA 2EIBA 4UYBA 2RV9A 1Q8SA 1JOBA 4YZ3A 1O5LA 2X5IB 1O3QA 2BW8A 4CU8A 5HCAA 2NM1A 3O1MA 2P3IA 2VZQA 4QXBA 5C3PA 3GALA 1H4GA 2HWD1 3BODA 2OVUA 4AE2A 1LU2A 4IDZA 3V0BB 4NJ4A 5FBJA 1SEFA 5BYNA 1TZOA 3AP6A 5ANQA 5FJHA 2JKXA 5DAWA 1LR5A 2WA4A 2YUEA 3OY8A 4LO6B 2ZXQA 3POIA 4QHOA 1FPN2 5FZEA 2WYFA 1UMHA 4XETA 3LSDA 3T1LA 4BIFA 5FP4A 2I74A 3LPFA 3C7FA 3WG3A 4AEMA 5BNNB 3H3ZA 3N7MA 4CCJA 1DZTA 1SACA 2VXJA 4BQ2A 1UW8A 3K3NA 2A6ZA 2K0GA 4NVPA 2R073 3A7QA 4LBQD 3GM8A 4LQRA 1EUTA 3VKMA 4C0HA 3WP5A 3I3BA 2JE9A 2GH8A 1V6NA 3MDPA 3VBOC 1N1SA 2DCZA 3JQWA 4QX5A 1LCLA 2EAAA 4NHLA 4WM8C 3ZXGA 3PVOA 1Y7BA 5DAQA 1RUNA 3OUHA 3VZKA 4AAXA 4J25A 2YBKA 4O65A 1S0BA 3FHIB 4B8EA 3A22A 4AGRA 4ASLA 4ITCA 4X6RB 4ARYA 1E5RA 2JG9C 3B00A 4RS5C 3ZSJA 3TYJA 3VBFA 4A45A 4E8DA 5A3LA 2EIGA 3GNEA 1OF3A 5CADA 1ULCA 4J1XA 4XJ9A 5K4LA 2X05A 1JZ7A 2VZUA 4FFFA 2PN5A 5FZHA 1AR72 2ERFA 2RM22 4GD4A 3FE5A 1GOGA 3GDBA 4HN0A 3SH3A 4Q8KA 1XYOA 4TTGA 1UF2C 1D2SA 3UYJA 1VRH1 1WWYA 2Y8KA 1QH6A 1UPSA 4CUAA 5KWRA 1I1EA 3HBKA 2OZJA 3Q8BA 4CP9B 2FMYA 2QDRA 5DPNA 1H8VA 3DPRB 5BNPC 2BJSA 1MVEA 1OH3A 1I6XA 2Y6KA 2RJKA 2QQLA 2Y60A 2YXSA 3JXSA 4S2FA 5A7PA 1AL21 1VMJA 4QGMA 4CP0A 2CAUA 1J1TA 2GP5A 2Z4FA 1UQXA 4Q1RA 2JIGA 2Z42A 5DZFA 1R092 2B4KA 4OHYA 3JD71 4A3ZA 2FHRA 4SBVA 2KA3A 2DWRA 4RR3B 5HXVA 4AVVA 4V2VA 5CU1A 3VBRC 3J7MA 1W6PB 1I5ZA 3ZN6A 3LOBA 1PZ7A 3KSCA 3CJXA 4GULA 4U36A 5C4WA 3ECQA 3KT4A 1NZIA 1PO23 2CHHA 4IL7A 2LRPA 1F15A 1G6NA 3OD0A 4URTA 3JBG1 5T55A 4XF4A 3HD8B 2A6VA 2DCYA 4BA6A 4TYSA 2I2SA 5BUVA 1GWKA 1YO8A 2IVIB 2VOXA 1Q5OA 1AZDA 1DZQA 1S2EA 1SG3A 1T6GC 4GB33 2ZHLA 4NMIA 3MUY1 3JB4C 4BZ4A 4YZ1A 5CFCA 3H50A 1RUD1 3GZTB 1XQNA 4MX3A 3H3UA 1ZBE3 3RJ2X 4TZDA 2ZGPA 4XZUG 2WO3A 3NKTA 5FZAA 1ND2A 5FMCA 5A1FA 3NKGA 1MEC1 2AREA 4LORA 1VE0A 1AR62 2FCUA 4LBQA 1LHNA 1VLNA 2BWAA 2ZGTA 2BZDA 4LPLA 1ST8A 5FQ0B 3W9AA 5HV4A 5IHRA 3LOIA 4E2GA 4UAPA 4DS0A 2XLGA 2R7EB 5LK7B 1H1AA 4XW3A 3WNKA 4LBNA 1VAKA 2P3KA 3RYRA 2WC2A 1AL0G 2E31A 4CDXC 5CAZA 4XF9A 5F7UA 4Y1XA 1M06G 2A70A 2PTMA 1TME2 4NRMA 2GNBA 3TEYA 2FZ2A 1VRBA 3KWVA 4PDWB 4TWTA 1D0GA 1UO9A 3TWIA 5FZ8A 3WDUA 3I3QA 5D2AA 3OPTA 2VVDA 3M4FA 3BIEA 2OQ7A 3EBRA 1DYPA 5CISA 2OUHA 4QDQA 4AI8A 3OTFA 3ATGA 2DVFA 1OC1A 4XXAA 5H9SA 3C2UA 2B8MA 4XDQA 2B7YA 4F7ZA 2GN3A 1HN0A 2VG9A 4NE9A 3SH4A 2VMEA 4AXOA 5T3NA 1MS5A 2HWF3 2VMDA 4ISRA 3WD5A 4XIOA 5CG9A 2F4LA 1JYTA 1IQAA 2MPFA 1AYN3 2I07B 2Y26A 4L99A 4RHV2 1CIWA 1KFUL 2WA3A 3AMMA 1O4YA 1KGYA 1RVF2 1OD5A 4MYEA 5TSWA 3SCGA 3MIGA 4K7JA 4N43B 4LO5B 4COWA 2V09A 5T5PA 1IS5A 1D2QA 1QQP2 4RFRB 4XAAA 2LS6A 1OF4A 3ACGA 1ZZ9A 1JZ4A 2RMU1 4XDPA 2WNOA 5FP9A 4G9SB 3HQXA 4FPEA 3A0KA 2DUOA 1PIV3 3T2QA 1N3PA 2EXHA 4GWNA 3DYPA 4N53A 3PUSA 4DY3A 4YM2A 2FD8A 1G8WA 5C8CA 2AYHA 3RS6A 1BJQA 2WLPA 1ASJ1 1XE0A 2R071 3ETPA 1CAVA 2JD4A 1XNKA 4CDWA 2FMDA 5C5UA 1UU4A 3HOBA 3DXTA 3M3OA 3P5BA 3WNPA 1TE1B 2PXJA 1RJ8A 3PTRB 4QKBA 1CZSA 3H42B 2JG8B 2V4AA 3EMRA 2DBIA 1GOHA 4Q2FA 2WBKA 4CP2A 1POQA 4R9DA 2JE7A 4ZZ5A 4Y20B 1WLCA 3BB6A 3POYA 2KR2A 1N1VA 5FK7A 5FYTA 3WEZA 4BQYA 4BISA 2QJVA 4AGVA 5CKQA 5IATA 2SLIA 3W58A 2GZWA 1LNSA 3WHUA 5A32A 4YGCA 3AP5A 3E6BA 3PU3A 1NXD1 1J3QA 2WZR3 3I59B 1DHKB 3OPWA 4AK3A 2ETEA 4FFGA 2AEZA 3M8LA 5IK8A 4XXPA 1WD4A 1I3HA 2O8OA 3ZSMA 4Q4V3 3ZM8A 1QHDA 4OHWA 1SMVA 2P17A 2DFBA 1JZ2A 4CTEA 1EAH3 2CDPA 4HK8A 4D6RA 1UOGA 2XXZA 4CEYA 1H30A 4NUBA 4AVCA 3MFAA 1ODNA 2IUWA 4QHZA 4UW5A 3BUCA 2DTYA 2P6HA 3VBFC 4QDSA 5F9TA 1UD1A 2QKDA 4MV2A 4Q0VA 1SPPB 5KHHA 3BTZA 1PK6B 1V6OA 5F2WA 2W87A 1SLBA 4KU7A 1HV1A 1SDDB 3ZFEB 2BNOA 2W1QA 4EWDA 1HKDA 1ZZ8A 2IXJA 1JHNA 3RWNA 1UY0A 2OZ6A 4GMP0 4ZS2A 3VZMA 2B5HA 3GCXA 5T50A 5ABJA 2YFUA 5JOYA 4W6WA 5F37A 5DZEA 5B4NA 5I91A 1YFWA 4N90A 4GXLA 3O1RA 1AR81 1Y4WA 5C71A 4DNYA 3NJVA 1NAEA 2W94A 4YW3A 3B01A 1XJAA 1UY2A 3J9SA 2NLRA 4MXVA 3NV1A 3FL7A 1B35B 4QQLA 3SITA 2V5YA 2A7AA 2OPKA 3IPVA 5I93A 3LFIA 2C24A 4MVTA 4P02B 1K3IA 5FXVA 5C8WA 1LAJA 5I0SA 3DEMA 4IEUA 5I0RA 4YG0A 3HR9A 4AAPA 1ULDA 1BCXA 3NL1A 1V6LA 4CUGA 4PIXA 1VBB3 3K4DA 1UWWA 3Q9OA 4DRRA 4AZZA 5M0TA 4KG0A 3MO4A 5LY2A 3RZHA 5H9RA 2ARBA 2QDNA 5F6LB 4K8RB 4KGQA 3KQRA 1X8EA 5CFDA 1W6MA 1V6IA 1L3JA 1BVP1 1Y9QA 3AL5A 3KD4A 4BWOA 1JH5A 4BQ4A 1IPKA 5LW9A 4DXSA 2ET1A 2OW4A 2SBAA 1C1LA 4AQ6A 3MW4A 3JB8A 5SV5A 1WMFA 2XLAA 2R0HA 3RPQA 5FWEA 1LJ7A 4XFBA 1ND2C 4P9JA 1STMA 5DUVA 1DZRA 1YQ6A 4K21A 1K12A 1R081 5FZIA 4LXLA 4IV3B 1QJX3 4LO8A 1W0NA 1RUI3 1J3RA 1IS6A 1HJGA 3O12A 2JDHA 3CQOA 5GLTA 3CJIA 3ZSLA 1UZVA 2R6QA 5FXWA 3I2DA 4GMP1 4YVWC 4V1PA 1ZRCA 4NIGA 3RGBA 2HWF1 4UF0A 3UV9A 1UZ0A 2WSUA 1X9PA 3PMEA 1PO22 3JZVA 5KXEA 1DP0A 2LTNA 2F4PA 2GMMA 3LIGA 2X09A 1KFXL 2VMHA 2VAUA 1H6XA 2YZ4A 1PGL1 4GB32 2KD7A 1OLQA 3DECA 1C4RA 4OULA 1UYZA 3F95A 1ZBE2 3ZXJA 1KJRA 1W2AX 5A6QA 2V4VA 1PO11 5KHKA 5GZDA 5LA1A 1OBNA 2UYBA 3U1XA 3MI8A 3ZYHA 2CNAA 3ABZA 3RJRA 4QQ2A 4YFZA 5IVJA 2R0FA 4HOOA 3VB9A 2ZX3A 3PJYA 3MZHA 2WFF1 4CDQA 1WZXA 3ETQA 5LRRA 3JCIA 1S1AA 5T52A 3KV5A 3FN9A 4UFMA 1QF3A 1RUE3 3G6JB 5FMOS 3VBSA 1PX3A 3KHBA 4LO4B 3I97A 3VBHA 4XEZA 1GBGA 5FZCA 2GN7A 3I49A 2E33A 2JDAA 4IV1B 2RE9A 4LUKA 2Y6GA 4YM0A 4META 3GHMA 4IGPA 5LWBA 3ZYRA 5C8CC 3V56A 1C8NA 4D7YA 4QU2A 5LA2A 1AUYA 4CDWC 3ES1A 3HAGA 1LODA 4IEXA 1NXMA 1UYXA 1XNCA 2W92A 4LLFA 4YLZA 4MSVA 3ES4A 5FKCA 4COZA 2OUJA 5FYHA 1MS8A 2BPA2 1YQ2A 3WQBA 5EIYB 1NCQA 1E5SA 5DAPA 3MIFA 5JXHA 1PM4A 3KM5A 5GZFA 1TQ5A 4JC1A 1HB2A 1DG6A 2OA2A 2YC0A 1JBCA 3B93A 3UK9A 1AYN2 3N9QA 2D6LX 2DTWA 1U5XA 1UN1A 4WVWA 1BBT3 1COV1 2JX9A 4GWIA 4KWLA 4V2WA 5IT6A 3RZKA 3H0OA 5FZDA 1RUH3 2RS32 2HEYF 1XC6A 4F8AA 1GNHA 2XL9A 3B9CA 2WT2A 2CL2A 4PQ9A 2CAVA 1AX1A 4AQSA 3K75B 1WCKA 2E9QA 5JUVA 1ODMA 4MGTA 1UZYA 3WG4A 1HRI2 3HQRA 1CONA 4XUPA 5J09A 1VMHA 1KS5A 4CEYC 5IVYA 1OFNA 4DEVA 4FTEA 3MUZ1 2E7QA 3MHZA 3THPA 3LEKA 1BVVA 1D4M1 1SBFA 2GNTA 3TRSB 2ZEWA 5JR7B 2WO1A 3AKSA 2DCTA 1YUDA 3VKOA 2CWSA 5ABJC 1DGLA 2D6OX 2WS93 4Y26A 1K5JA 4W8JA 3ORJA 4IEWA 4P5YA 1QDOA 1OT5A 1KS4A 2DUPA 4JRAA 4QXCA 4XQ4A 1US2A 4BLJA 1X8MA 1DQ6A 1ZRIA 3WNMA 5A6ZA 3BPSA 4FXGB 4M3CB 4NPRA 2ZTNA 1OI6A 4KWKA 3GJBA 3CO2A 4HG6B 4E4HA 3WXPA 4U2AA 5FY8A 5FZ4A 2WZR2 5AC93 5FPXA 4MGSA 4XFHA 5HPOA 1S0EA 4G4FA 1MR5A 5G04L 5GM0A 3O0XA 1ND3B 4IGQA 2IXCA 2W47A 4BDVB 1MZEA 5FLIA 4PI2A 2JKBA 1PGW2 1PHMA 1D4VB 3ACLA 4LULA 5JMCA 2F6BA 5JSRA 1EAH2 2HWE3 1OOPB 1OUXA 3DXUA 5L36A 1MQTA 2GC1A 4MGYE 3ACFA 1N1TA 1P8JA 3OYWA 4YZ2A 5CFDC 1ENQA 1SFYA 3INAA 4JQTA 3AKQA 5FUIA 2OYZA 5FO9B 1I5PA 1QJY1 5FFOC 2RS51 4ORFA 5L9BA 2DCKA 3ZYJB 1HB4A 5FTTC 2HWC1 1C8M1 3IBMA 3R05A 4AFBA 4QKFA 1OA3A 1S4CA 3OGRA 4J1WA 4DIQA 1Y9MA 1NT0A 4DOUA 5JI9A 2QZ2A 1AR73 2RM23 3M3CA 3WW4A 1W99A 3WQ0A 4HVRA 5FREA 3GZUC 4UFLA 4DO0A 5BV6A 2IXHA 3MICA 5FZLA 3AYDA 1Z7S3 5GZEA 4AVTA 4ISQA 3U11A 3CJIC 3ZKYA 5JZGB 2RR11 2ARXA 1WD3A 3HPNA 1QWRA 1C1FA 1X33A 1FATA 1WCUA 3W5NA 1EV13 2D44A 4NIHA 1KJLA 2MHFA 1HQNA 2PAKA 1VBB2 1R093 2IXIA 1N3QA 3VBOA 1POV3 2JICA 2XR4A 3B94A 3L2HA 4K9SA 4ZXKA 3WNOA 4B29A 3LA7A 3ZYGA 5EYXA 5FZGA 4C8DA 5LEJA 1VBA2 2VCBA 2VTXA 1IOAA 2XQRA 1F9KA 4LT5A 1RUE1 1U12A 4A6SA 2D6PA 4ZHNA 1QJU1 2VMGA 4XILA 1YI7A 4MXWA 2HKXA 1ZYBA 3PHMA 3R0RA 1JYCA 4I02A 4RS5A 4XIKA 3UKVA 1EY2A 1NG0A 4L97A 5IFTA 3D4KA 1W2TA 1IG3A 2R1DA 1V9U1 3AP4A 3DKWA 4QMAA 4XURA 4AEDB 2ES3A 5FY9A 2CYFA 4KU8A 3PVEA 4PHZA 1QJX2 1GZ9A 2PYTA 2VBBA 4CDQC 1OPOA 2WNUB 4XUTA 1UPIA 3MV11 3TB0A 4D6QA 3SLIA 3ZMOA 2Q8EA 4NRQA 3SKVA 2BP6A 3T08A 3VBSC 4Y3OA 3I2IA 5FBZA 4BU2A 1HXS1 1AR63 1BMV2 3OGJA 4LIUA 1OVSA 1RUC1 3OUJA 4W4ZA 4EYUA 4BYYA 2Y6FA 4CP1A 2WT1A 2BGOA 2YG0A 4RQPA 4YW4A 3ZXFA 3MIBA 3N3HA 1AYM3 1NY71 3Q8AA 4JQRA 4OVEA 4R9AA 2JEMA 4Q4X1 4UOJA 3TN92 1FOD1 3WOGA 5LBBA 2WAAA 4TLFA 3S6PA 4LHNA 1TME3 4PI0A 2UU8A 1W6QB 5FXZA 1GANA 2ZABA 4CCMA 2VD7A 1RMU1 4QXKA 2P34A 3B7MA 2UWBA 1YI9A 3IIIA 4LOTA 4HN1A 3K4ZA 4OLLA 5FYVA 5A3UA 2PLV1 5C9AA 2BTVC 3W21A 2C0ZA 3BU7A 3EXUA 4WM7A 4NPMA 2J1TA 3NV2A 2P5BA 1E5IA 1LGCA 3APBA 5F5CA 2EA7A 2ORXA 1JHJA 1Q8PA 4H3WA 1RTVA 4JGYA 5LASA 2Q8DA 2OT7A 4FAGA 5JXJA 4JHTA 1W8FA 1X36A 3ZYFA 4A41A 2NMOA 4QKNA 1RHI3 2QQJA 2WNVA 2GNMA 1JOJA 1FT9A 3ACIA 1RVF3 3RI8A 5LEKA 1JYIA 3PUHA 1K5MA 1AJOA 2QQIA 5BNOA 5ACA3 2H0VA 2EALA 4AEKA 5J96B 3VBUA 1PMJX 4LBMA 1FPN1 3KCYA 3MIHA 3BU0A 4PT6A 2VUJA 2BNNA 4H55A 3IWZA 4Q4Y3 1URXA 5DDJ3 1H0BA 1WLWA 4HZFA 3ST7A 1WLDA 4CU7A 1UY4A 5FZOA 2A6XA 3U37A 2W3JA 4LTAA 3ZMNA 4AFMA 2VCMA 3AMQA 4W65A 5GLZA 3DCQA 4E9KA 3O14A 4XBNA 5DUUA 1Q56A 2XBO3 3WX5A 5FPUA 4YSFA 5FUPA 4B4RA 2RS12 4YW6A 1ENRA 4WM8B 3V0AA 3VZJA 1CAWA 1BBT2 5LATA 2IWGB 1BQPA 1RUH2 4TN7A 4A44A 2G1MA 4XTMA 3O1VA 5AVPA 2DYCA 2Q1MA 3GZEA 2ID4A 3SNMA 4FFHA 2P3YA 5K0UA 1LOAA 4R4XA 5LB6A 3RDIA 3U0ZA 3FLRA 3O1PA 1TG7A 1OQ1A 3CZJA 3NVCA 1UOFA 1WGPA 2D6KA 1FV2A 2W0XA 1W6OA 1RC6A 3EQEA 1UYYA 4XHBA 1MQTC 3RG0A 4B1MA 2GP3A 1AR71 1CAXA 3D0SA 4NIAA 3CNAA 2XWBB 4XZPA 2WZ8A 5LA9A 1F5JA 3A21A 4JDMA 1IKPA 2CGOA 4RR3A 2WS92 5KHJA 4JGZC 3X29B 1UZWA 1NA1A 3UJQA 1CD3G 4ARXA 4BE3A 2VZPA 4Y22B 1F2NA 3HWJA 4LE3A 4PLNA 4GH4B 5JDBA 2RHPA 2R042 1R091 2J1UA 3VBRB 3RYPA 4FPOB 2O0OA 4NIIA 1QJFA 2A6WA 1XSRA 4AFDA 4OI0A 1U5ZA 5AC92 1LOEA 1KXGA 1ONAA 2ZGQA 3FHQA 4HKOA 1W8OA 2VR4A 2EXIA 3LA2A 3Q8EA 3MLKA 2WSVA 1YLLA 2WO2A 4PIZA 5J36A 2RJ2A 2FDIA 3H3LA 1H1MA 2XLFA 1O3SA 1IKQA 2PHXA 3VZNA 4LBJA 2HWE2 4XJZA 3GZAA 1W8WA 4Y4YA 1RGSA 5FQ0A 1MZ6A 3RMXA 3BYWA 3EYPA 5A6XA 1T6BX 1QNYA 4X8PA 1VIWB 1PMHX 4BQXA 1RUF2 1XU1A 4L2NA 4ZONA 2VUDA 1RYYA 1Y9GA 4KMQA 4CYDA 1AR61 5C3RA 3U75A 5EJZB 5IK7A 4O9GA 2YV8A 4M0HA 2UWAA 4NRPA 5A7WB 1UNBA 3PUQA 4CDXB 2VTXJ 3KHCA 1V70A 4AHZA 3O1OA 5C70A 1C5IA 1N3OA 1OPMA 2V5DA 4Q8LA 5C3OA 1Z7S2 2ZGLA 1TME1 1AXKA 1OSGA 3ROUA 2IZWA 3HT1A 5APAA 5HI0A 2GH2A 5J7MA 1GICA 3GYDA 1HRV3 2E7TA 1IQDC 1EV12 4XCBA 3ZSKA 2R1BA 1O5UA 4QB1A 2V73A 4RQPC 1Q8OA 1O4TA 1RUG2 2WABA 3N9LA 4NWVA 3WUCA 4BK4A 1A34A 5FO7B 4A7KA 3NNLA 3EHKA 4P9IA 2VW2A 3TNPB 4KGGA 3M3QA 4RGGA 4XUOA 2H6BA 3TAYA 3ZO0B 3WV6A 4N8MA 4YGEA 3T3YA 2QZ3A 2VOKA 3AYCA 4MUVA 4YW2A 5FYBA 3AYEA 4YG3A 5CVRA 4JHZA 5FZ9A 2X5IC 3VHPA 1APNA 2IXKA 4RHV1 5A7NA 4QXHA 4BB3A 5L7OA 4QX0A 4NHXA 3NNFA 5C9AC 1R1A3 2BDRA 4K20A 3JU9A 4WM7C 3H8OA 4H14A 3WR0A 2YBSA 1QQP1 3OBRA 1LESA 4LBKA 1XYNA 2D7FA 2DUQA 1VAVA 3QLQA 5FK8A 4LO7A 1OFSA 4AYUA 1DQ2A 2D93A 5FZ7A 2WL1A 1IPJA 3R4SA 1LGNA 4JGYC 2TBVA 4CU6A 2WAOA 4S2DA 4E4DX 5CA6A 1UAIA 5FUNA 3LD8A 2WNVC 3I2HA 3OY8B 4M0NA 2A73B 3ZPOA 4QPGA 4ATEA 1K5MC 4XCAA 4Y20A 5T5OA 4LBLA 5BNOC 2WWSA 4QQPA 1WW4A 5ISLA 1MS3A 3VBUC 5FXXA 1AYM2 4C1XA 2BOIA 4CCNA 4ZPIA 1J84A 2OS2A 1UY3A 4Y4RA 5EYYA 3VV1A 5A3WA 1US3A 1WLTA 3SHRA 3I59A 4YVWA 4XDOA 3ZDSA 4QQHA 4QPWA 5C33A 2R063 2VZ1A 2DURA 3IMNA 4YYOA 2HJIA 2VU9A 2BFUS 3ZKUA 4N7UA 4OYUA 4FPKA 3U10A 4CE8A 4CDUB 2DCJA 3PL0A 4L11A 1GWLA 1VBC1 5EXOA 1CJDA 1HX6A 5BY5A 4IQPA 2XUEA 4FPGA 4LKFA 3KLSA 2YDEA 3AZVA 1YXWA 2WO7A 3K2OA 3WF2A 3ME2A 3OEAA 2ZGMA 5A33A 3VD9A 2ZX1A 4NOTA 1SLIA 1W28A 1EYBA 1YIPA 3OGSA 2JWPA 5IK5A 4OZOA 4QU1A 1ZRDA 2YGMA 3VBFB 5K0UC 2WRAA 5DN2A 3T0BA 4CEWB 1FNYA 2C26A 1RHI2 3M3IA 1BEV2 4MHRA 5H9QA 3ZFGA 1W6NB 3LE0A 3WW2A 1SHWB 4FP3A 4YGBA 3S30A 3ZOIA 2RS33 2YMZA 1SFNA 2W1SA 2G19A 3DPRC 5ACA2 2B9UA 1AL22 2W1UA 4JTNA 3U07A 4AI2A 1W2OA 2YROA 4YW7A 1GP6A 5FYYA 5FLJA 2AH2A 4Q4Y2 1V6JA 1WA6X 5DDJ2 4NWWA 5FYUA 1YQ8A 2JDUA 3A4UA 4JX0A 4BQWA 1MZFA 4EZHA 4LKEA 1B35A 2B45X 1HRI3 4LK6A 1DQ1A 4PCRA 1NQDA 3O0VA 4RR3C 1MVQA 3S57A 1VAMA 2R32A 2W9XA 2IVJA 2VECA 5I8SA 3GBFA 1NA1C 3DL3A 4BJ0A 2YC4A 3THCA 3I2OA 3H9AA 1MS0A 4HLTA 1RJ7A 3O5SA 2XBO2 5G05L 3FWEA 2Q1FA 2PHLA 1ULFA 4H2AA 4JAAA 1ZZCA 2HEWF 3JQXA 1WMEA 5CZKA 5ERLA 5FPBA 1SDWA 4M00A 2OPWA 1FMD3 4WVZA 4Z2AA 1CQ9A 4HSJA 2ZA9A 4J6GA 5C4WB 2A71A 3H8UA 1U0AA 4FFIA 4Y24A 2Z79A 3WT3A 3S7EA 3J7HA 3OGGA 4B3NA 4UW4A 4HBNA 3ZSEA 5JXIA 2OX0A 3CHXA 3R4DB 5CFCB 3LWCA 1W2UA 3OG2A 5FZ0A 5DXDA 3H7JA 1B09A 3ZFFA 1K45A 3WVJA 1YC61 2QQPA 5JI7A 4FSJA 3F2ZA 2WN3A 3LDRA 1ND2B 2W95A 3BKZA 4XTPA 4D0QA 4HSLA 2XJVA 3POEA 2C6SA 5HCBA 2XB6C 4M3CE 3BGAA 3WLUA 3CMGA 4CUBA 1AJKA 1MACA 4LBQB 1OMIA 3MLLA 1W05A 4UBHA 1JYNA 2EIDA 4OMCA 2XJRA 2CWMA 3P1IA 4FPLA 3ILRA 2FDFA 2PELA 3IAPA 1GLHA 3AXEA 5D1IA 1O91A 1A8DA 2ORZA 1QXPA 1GP5A 1MS1A 1HLCA 1RITA 4Q0PA 3AMPA 1Z0HA 1E57A 4FPCA 1QEXA 1LOFA 2LM3A 1CGPA 4I3GA 3FHAA 4O9EA 2W91A 4QX1A 4E2QA 4YM3A 3LSEA 4KNCA 2YU2A 4JVAA 2W46A 4BPZA 2Y64A 1PO21 4A7YA 1W9TA 2DV9A 2Z69A 3BCWA 4A42A 1H6YA 1D0HA 3ON7A 4L8QA 3L2YA 2VVEA 2Y33A 3PJQA 1BK0A 4OHVA 4QT6A 1SLTA 3VLBB 1AR93 2OQ6A 4GB31 4CZSA 5FP3A 1ZZBA 1GYKA 2E7AA 5FY0A 4QQOA 3ZN5A 4MG2A 4FOWA 3D82A 4DMIA 1ZBE1 1JUHA 2WT0A 4D6SA 2XKPA 3PTYA 4HT1T 1UMIA 1Q43A 1TMF2 1XOYA 3HN3A 4P08A 3PMSA 1W2NA 5L7OC 1H2MA 1XE8A 4OUSA 4DUVA 1PX4A 1EPZA 2ZZQA 3E5QA 4CCEA 1XNDA 1PZ8A 1VBA3 1LRHA 4CXXA 2J7MA 4O61A 5GZCA 2ZGNA 1GSLA 3RZLA 4AHXA 3AJYA 5FPVA 3WCSA 4N53B 3ZX7A 5KC5A 1G9AA 1GFF2 2JECA 2E51A 2JXAA 4AI1A 1NCRA 1LOGA 4IXLA 5IW0A 1NLRA 1CAVB 2E32A 3T09A 1O59A 1OLME 4CDWB 1QOOA 2FDGA 4QPGC 4XYXA 3ZIWA 1HRV2 2TNFA 4YZ4A 3ZXDA 4NAOA 1H2LA 4E4ZA 4P5HA 1A8MA 2WZEA 5FPAA 5IUQA 4ATFA 4D7TA 4UI9L 1XRUA 2B39A 3AMHA 3CKHA 3SQOA 5F3CA 3NW4A 4XUQA 4DINB 1TNRA 5I8TA 5JAXA 2Y0OA 5HXMA 2LROA 3UGGA 5FDBA 5GLWA 3AKTA 2PMWB 1QJZA 3UKNA 1KITA 4MZUA 1PNGA 2RJLA 3NV4A 1AYN1 3TN93 5A32B 1FAYA 1W8HA 1UIKA 3T2PA 3ILFA 2VMCA 3USUA 2GALA 2RS31 1Q8QA 1R1A2 3Q8FA 2W2IA 2LW8A 2VW1A 4GKXA 3KVBA 2VOWA 1JZ6A 3IDCB 2A1XA 3WG2A 3O1TA 1KRIA 2QQMA 4CEYB 1PIV1 3MFCA 3IM0A 3OEBA 2CGNA 1NQJA 3K48A 3QD6A 4DY5A 1QOSA 4FPJA 4JTOA 4AG4A 1OHFA 3J7LA 2VULA 3VD3A 3TEXA 3WF0A 3MPPG 3ZFGC 5AFEA 1QDCA 3S5QA 5FO8B 3NAPB 3N36A 2XGXA 3J8F3 1NZCA 2GC0A 4BHPA 1ZREA 2RDQA 4AR2A 1ULOA 3I54A 1G9CA 4MGZE 4YRDA 2VC9A 3E1F1 1CWPA 1XBFA 1B35C 2ZACA 2CTVA 3NO8A 4C1WA 1XNTA 2R062 3H1WA 3R6SA 4L9BA 3M1HA 4GQ7A 1CPNA 5D21A 2ZMLA 4IEOA 5F5QA 3DKQA 3VGIA 4QX8A 1YQCA 3MYXA 4OI4A 3IPVB 2YC2A 2DVBA 2WZR1 3KT7A 5HCFA 3FJSA 4CCDA 1L7LA 2QTWB 3CBNA 3BTAA 4P9WA 3RZJA 3POWA 1W8ZA 4K3UA 2XJSA 1VBE3 2XDVA 2UY8A 1WMXA 3IDEA 3S7IA 4QPYA 1H9PA 3MPBA 4Q4V1 4DB5A 5FJKA 1PGW1 2H6CA 3SEPA 3QH7A 4BXSV 1EAH1 1HJFA 5F32A 2RS13 2YGLA 2BWCA 1WBLA 2JENA 2VOVA 5CFDB 1W6MB 1YFXA 3V65A 4X6QB 5FY1A 1ZM1A 3ZFFC 5EJ3A 2VUAA 1X50A 4ZXEA 1QOTA 1O8SA 2QQKA 3D0JA 4LHSA 5C5TA 2JB4A 2CGPA 3N9NA 3T4HB 2ZHMA 1TEIA 5BXXA 4OCTA 2NN8A 3AZYA 1WCQA 5FR3A 4XE9A 3QACA 4IE0A 1W04A 4LIVA 3POGA 5I8YA 4NHKA 4DUXA 3CZUA 3VUOA 1RUJ3 1UXXX 2IC1A 2BVBA 2AACA 2B42B 4HPKA 3WW1A 2A5ZA 1KDMA 3BVCA 3CJIB 4LLOA 4PLMA 5FY7A 3VDDA 1UKGA 2XMLA 1LOFC 3WF1A 4ES9A 4EN0A 3ENRA 3AB0A 4GKYA 5J3UA 2QUOA 3WDWA 4QX2A 4UF0B 3IT8A 5D8AA 4CU9A 1FMD2 3MIDA 1OLRA 1OUSA 2MEV3 4NN0A 1S0FA 4LOSA 3NMBA 3PUAA 3PUIA 4UW6A 4XJWA 2XHNA 3M7AA 1VBB1 1YRZA 2R043 3PLQA 4K1ZA 4CSWA 2CSGA 4YFWA 5CB7A 1JZ5A 4YPJA 4FTSA 2KXLA 5AFBA 4EJRA 5JPNB 2QQOA 3ZR6A 4YZ5A 1VBD3 1XXNA 2ADDA 1VBA1 3R4UA 5FZMA 1MPXA 3OUIA 5FMBA 1DLLA 2BUKA 1BKZA 4PIYA 2C4XA 4Z92B 3NWKA 3GF6A 4HETA 1GP4A 4EROA 3BPZA 1C57A 2BYVE 1BHGA 1F35A 3SH5A 5DUWA 1RB8G 4XF0A 4CDQB 1DBNA 4B1LA 5IVFA 3UKTA 1QJX1 3E5XA 3BALA 1RUI1 2K9ZA 2WQ8A 1J3PA 3AVRA 3KMHA 3ITQA 1GZWA 3NSTA 3POJA 4INDA 1RUF3 4MO3M 3VBSB 1W9FA 3VBHB 1I9RA 3RYKA 5DABA 1IPSA 4JCKA 3KCCA 2XWJB 4NIDA 1X82A 4QM9A 4ZKTB 5KHIA 1BMV1 3PIGA 4OUEA 4RSUA 5JIUA 2PAMA 1DF0A 4K6BA 4LKDA 4BMEA 5FOBB 2ADEA 2EVXA 1NCRC 4JGZA 3ZN4A 1LB2A 1GZCA 2BBVA 3D8CA 3DUIA 5EWSA 4XFFA 2R49A 5A3MA 5B4XA 3I2KA 3DV8A 3KQ4B 3LB9A 3TN91 3ZXLA 1SZBA 1PVC3 2HBUA 3MF6A 3N9OA 2ZOEB 3UESA 4PBOA 3N7LA 3K51A 5FZ6A 1H8TA 2D97A 1NCQB 3WDYA 4E4SA 3S0MA 1AR92 2JD9A 2ZAAA 4YVSA 4RA0A 4IUGA 5FV3A 2ZZJA 1GQPA 3U78A 1YHFA 4JRLA 3TEWA 2NMNA 2ZEYA 1WW6A 1T2XA 5LY1A 1RUG3 2ZHNA 3AP7A 1UIJA 4XFIA 3OBZA 3LZZA 3K4AA 3BTYA 1CAUA 2AUYA 4D7SA 4NPLA 4TXWA 4NHMA 1LOCA 1OVPA 5CIRA 4B7KA 1CX1A 5CBLA 2Z2SB 2ZKNA 3T4VA 5K8SA 4QPIB 5I0DA 1F4HA 2AC1A 2ZPXA 4Q4W2 5DQ0A 4A7ZA 4UW3A 4QD2A 2G9FA 2D40A 4CVUA 4AF9A 2VPVA 2RDNA 2P3JA 1LGBA 1QIQA 4LNVA 5IJRA 5KBFA 3VL8A 1XSQA 2JDPA 3KT1A 5IVCA 1JXNA 3WP4A 1CJPA 1GNZA 2PHDA 2UURA 4YARA 3RZZA 4BOWA 1LHOA 1S0DA 4XMAA 1GV9A 3IDAA 4HVOA 5I0UA 2FDHA 2VMFA 2Y34A 4FQ4A 4W6XA 1NYWA 4MOAA 5A1LA 3RRDA 2WIIB 4AOCA 2VZRA 4GIQA 2BQPA 4R52A 5FZBA 1MS4A 4XABA 1BBT1 1ZZ7A 4KL1A 4ZS3A 1RUH1 5GLUA 2ZS6B 3WF3A 2XJUA 5FP7A 1HN1A 1YJLA 5FYIA 2GNDA 1W0PA 3WINE 1WBFA 3MW3A 3B02A 2ZEZA 4FO9A 4E2SA 3ELNA 2X5IA 4K1YA 3FBYA 2PQSA 3RI9A 2RDSA 5IAVA 1MQTB 2Q4SA 2QQWA 5EV7A 1UX7A 1X9TA 4KH9A 3V0BA 4ES8A 1N47A 3OYWB 5F5AA 4BM8A 3MBWA 1H9WA 3WCRA 1UU6A 4IE6A 1VPHA 4NR1A 2VZ3A 4N9HA 1Y3TA 1ZX5A 1N1YA 3J8F2 1VRH3 2QNKA 3NNGA 4ASMB 3DGTA 4AL9A 2G9ZA 5SV8A 2FZ1A 3WF4A 5FZFA 5LBFA 3RNSA 2WS91 5BNNA 1AXYA 1BEV3 4P9GA 5FMOL 1UKRA 4OQ8A 2HLEA 3HJRA 4WBBA 4N7IA 5F5IA 1UCXA 2LUWA 4RN5A 1AL23 3AMNA 5F3EA 5FYCA 4CRQA 3K46A 1QH7A 1X7NA 3NJZA 1POV0 4OHZA 3KVAA 2Y6HA 4QGLA 3JD73 3EB7A 3VDDC 4XF1A 1SCSA 1F31A 5FYMA 1HIXA 4BH9A 5AC91 1BK1A 3N35A 3T2OA 1JZ8A 5FLHA 3B9IA 1XB9A 2WKKA 3MF9A 3UT0A 3ZYIB 5KHGA 5D8AC 3SEEA 1NX9A 2YHJA 1VBE2 4FCAA 4HXCA 4CCCA 3A0NA 2JDMA 2D5HA 4WV8A 1XPWA 3AL6A 3ZR5A 1CIYA 3GXUA 3JBG3 2Q0AA 3VBOB 2L9LA 1J59A 2HWE1 1CZTA 3LIHA 4Q29A 2XOMA 3IMMA 2Y0IA 1Z78A 3BN6A 1RUD3 4AVBA 2D6NA 4WZFA 3I8TA 1W90A 2VO5A 2XPJA 1WUVA 2JG9B 4MXWB 3AFKA 4RS5B 2VNOA 1YFUA 4DEQA 4QM8A 3HMYA 2WQ4A 1MEC3 2WNUC 1H2NA 4M3CF 1G9DA 1W39A 1CVNA 2ZGRA 4MADA 4CP9A 1C28A 3AZWA 1ZBA2 3DPRA 1SBEA 1RUJ2 3KCXA 2RM21 2FDJA 4WVMB 4Q4X2 1UOBA 4BQ1A 1FI2A 1XNBA 1J1LA 1JTZX 4F83A 3E6CC 1Z7S1 3POSA 2C9KA 3DYOA 1EP0A 2HWB2 2ILMA 4HL0A 5BNPB 1UZZA 3AC0A 3W59A 4KG8A 1CR7A 2D3SA 5IYYA 4FPHA 5A3PA 3OBTA 5CKNA 2P2KA 4RQPB 5F2SA 5JOXA 1EV11 1G9FA 1W6PA 1RMU2 2VTFA 2XH6A 2MEV2 5IVBA 5F3IA 1RUG1 1BZWA 3CEWA 3VDCA 5DMYA 5L19A 4AW7A 2CV6A 5E8AA 4XC9A 3HNYM 5EP9A 5LZ6A 4FXKB 4BXFA 1YNAA 4FQZA 1POV1 2AR6A 5FAXA 1H8TC 2R30A 4IEQA 1VBD2 4Y33A 5IWFA 4I2OA 2ZCWA 4XAEA 1ULGA 4YVSC 2VCCA 4X8NA 3WQ1A 4PLOA 1SBDA 3W20A 5A3TA 5C9AB 5CKMA 5FY5A 4GJZA 3FC0A 4WM7B 5HV0A 3WY6A 4NROA 4HVQA 4A2UA 2XONA 3QBQA 3ZXEA 4FTBA 4AVAA 1YWKA 4I09A 4AHYA 2GC3A 2BV4A 1DGRN 2X8KA 2ZAHA 4CA9A 4JKMA 1O3TA 5FP8A 3G7DA 1GQGA 4SLIA 3WP6A 4JGYB 2BU9A 2RMU3 1JUIA 1VB2A 2D5FA 4COVA 2VZSA 4I0BA 2WNVB 5FWJA 1DQ4A 1WW7A 5JWPA 1TMF3 1K5MB 5L9VA 1GQHA 4RYDA 5BNOB 1HB3A 3CIHA 4P14A 4DXRA 3VBUB 5LBCA 5JSPA 5KXCA 4CCKA 2J22A 1YQ5A 1A6CA 1ASJ3 4PDWA 3LQCA 5GALA 3BI3A 3LKJA 2WNEA 1AYM1 2V72A 4OFGA 4XMIA 3IKWA 5FZOB 3WNLA 4CDUA 1PVC2 2OXBA 3HN1A 5ANNA 4AFAA 5H9PA 1UU5A 5JLVA 3MGUA 1FX5A 3THTA 3FX3A 3T2TA 1K42A 2DVDA 5CYYA 3UGFA 4OHXA 3HVDA 4FBFA 4YW1A 4XQWA 1G7YA 5JOZA 1A78A 1GOFA 1O4ZA 3B5LB 4AVSA 4BQ5A 2KM2A 4EQVA 2VUCA 3BIWE 1S0IA 1ALYA 1XYPA 2PQQA 3M70A 3V0AB 4CXYA 1V6KA 1CAWB 3D3AA 2W39A 5F1RA 4CEWA 2VZVA 1JYWA 2Q1ZB 1W03A 3KV9A 1W6NA 4RD7A 1OA4A 2QVSB 3RQ0A 1BYHA 4N43A 2VMIA 1WKYA 2HBTA 3N7KA 4DQAA 1HQWA 2JJ6A 4CCLA 5K0UB 4OI2A 1WW5A 2W68A 1LHWA 1NLQA 2XVGA 3OD4A 2XVKA 4Q0UA 3AK0A 5FKBA 4EN8B 2HWD2 4RFT0 2JB8A 1RHI1 3AP9A 1BEV1 1W6OB 4OUMA 1JN2P 2DF7A 3NQHA 4EE2A 1RVF1 2BEOA 1WCDJ 3USSA 2ZX2A 4ASKA 1CAXB 4Q26A 5ACA1 4RL7A 4YM1A 3FFZA 4IE5A 3WUDA 2FCVA 1CX4A 4PQQA 5DDJ1 4Q4Y1 1GNYA 3IZOA 3GBGA 4GH4C 3ASIA 3C7HA 1OA2A 3HNMA 3POFA 5JMOA 3N4MA 4DFSA 5T54A 2JG8A 3ZXKA 1NA1B 3VHOA 4E8CA 3NRUA 5BNNC 4PF1A 4TSVA 3B3QE 1AR83 1V00A 4A4AA 4FAHA 2O14A 2XBO1 4LJHA 2XKOA 4UWDA 1DYKA 4DXTA 4EZ4A 1NKGA 1JYXA 3J4UH 1SFPA 4CEWC 5DAVA 5E89A 4F3JA 5FPLA 3VKFC 1JZ3A 4YWAA 1XNAA 5IVVA 3H8XA 4FPFA 5FMDA 3TBDA 3VD7A 1IZ3A 4UBGA 5IVEA 4LITA 2WLQA 3T1MA 2NQYA 3PNAA 4QX7A 5A70A 1LHUA 2PHFA 5EZWA 4M4PA 4W50A 2BNMA 2VW0A 2YFZA 3PURA 3ZXAC 1OURA 3Q8CA 4KQ7A 1SPPA 3I7DA 1PK6A 2AGSA 1VRH2 5A7OA 3ZFEA 2J1RA 4P9LA 2YU1A 2NP0A 3KF5A 5FIXA 3HIFA 4RGAA 3U14A 2XQXA 5LA0A 1FNZA 3HT2A 3AZZA 1LULA 2X29A 1R083 3POBA 1SLCA 3WQ7A 2XJPA 2EICA 1SLLA 3ZIXA 5EJ1B 2VJXA 4C91A 1SCRA 5E6HA 1JU4A 4O7XA 2VH9A 1TNFA 3C8XA 1UMZA 3E5UA 2X53S 2PHRA 2QQNA 2XL7A 3JD72 2PHTA 4M4RA 3VDAA 5HBAA 4B7EA 1LENA 2WFPA 4GMP3 1GUIA 2ET7A 3OCPA 4MLOA 2JE8A 2AEYA 3SCFA 3WP3A 4Q27A 3BOWA 2XUMA 3WDVA 4TLGA 4FP2A 4IEVA 4AWDA 3I4IA 4XFAA 4QGNA 5FZKA 4EWAA 3HNBM 4OI1A 2WN2A 4EWEA 5EPAA 3JBG2 3SXWA 4LUMA 3LFMA 1YJKA 4BK5A 5IFPA 1O8PA 4D69A 2J1AA 3T0AA 3ZN6B 3P3NA 1RUD2 2JDYA 3I2GA 4KWUA 3WNNA 1JI6A 1EPWA 4JDNA 4HONA 5L7OB 1PO13 1XE7A 3CLPA 1TMF1 1FXZA 1MEC2 3GGLA 3DF0A 4RGKA 1D7PM 2LALA 3WDXA 3T0DA 4I30A 3OPZA 1GU3A 2XG3A 3SC7X 3VHRA 2WFF3 4JKKA 1HQLA 2QBXA 3VD4A 3EJKA 4IV3A 2JIJA 3W5MA 5FCCA 1FYUA 5A7SA 2ATFA 2F17A 1QXRA 2A75A 5IAXA 2GSYA 1W06A 2JDKA 4BIOA 3ZPYA 2GU9A 3U4SA 3IN9A 2VE1A 2W08A 2G9GA 1UYPA 2K2SA 4QPGB 1OD3A 4BCUA 4HANA 2BGCA 3NNMA 4CXWA 1HRV1 3TOJA 1KQRA 4PDWC 4XF3A 4LKSA 1MZ5A 2VNGA 4JDOA 4CDUC 3FUOA 3MV01 1VBC2 2PHWA 4YVWB 5GJ6A 1DQ0A 2AENA 2VXRA 3FMGA 3RMYA 3VL9A 4R8HA 1LECA 2ARCA 4HKWA 1SLAA 1M4WA 5JCTA 3HBZA 5K9YA 5JVVA 4XVHA 1AX2A 1ULPA 2B46X 3IDBB 4IE4A 1NLSA 1XU2A 1ENSA 2E63A 1S2BA 3GCWA 4Z2WA 1V6MA 3BTXA 2BRTA 4Y1VA 4MGIE 1COV3 1IHMA 1ZA7A 1R1A1 2C9AA 3A23A 4LHKA 5C6CA 4AQTA 2E53A 4ET7A
chains in the Genus database with same CATH topology
4IEYA 1J58A 1ZRRA 4N43C 3NAPA 3U4XA 2RMU2 3AJZA 3O7OA 3QCWA 2D43A 2BVVA 2C5DA 3ZFGB 2UY9A 1Q3EA 4K8FA 1IS3A 4Q1PA 1CN1A 3VZLA 5CG8A 2IXLA 3AFGA 4IV1A 4FOVA 4K40A 1ASJ2 2R072 1D4M3 2ZX0A 2ZMNA 2EXJA 5L73A 3FLTA 2D3RA 4Q4W3 1PVXA 2WJSA 1MS9A 3J26N 4LR4A 3UL2A 5C8CB 2R061 2JG8C 3D6EA 3P3PA 5C4WC 5DUXA 4IETA 1OQDA 1C3HA 2NZ9A 3B69A 3ZVXA 3MLJA 5AVAA 2XJQA 3GBWA 2NPIA 4GA9A 4Y1YA 2H0BA 3E6DA 4I0AA 1WMDA 5LK5A 2PFWA 3D5OA 2O1QA 4S2GA 2PA7A 5A33B 1F8VA 4KBBA 4I0WB 3OJBA 3ZFFB 3FBMA 2HEVF 2QCSB 1CESA 4L92A 1LEDA 1REEA 4BLIA 2O8QA 4XFCA 3ALQA 4AQ2A 2GDFA 4DPNA 1SQ4A 1QJY3 1LTEA 1W0OA 1REFA 1PK6C 1S55A 2RS53 1H1IA 3ZFEC 1AVBA 3LAGA 5GZGA 1HRI1 2D6MA 2EF6A 1C8M3 1PMIA 2HWC3 4I3PA 4PF5A 3WDTA 1AR82 5J48A 4XOGA 1VP6A 4XJAA 4AEJA 3RSJA 2ZBJA 5ABJB 1RL3A 4M3CA 3H7YA 2ZMKA 4EV0A 3CF6E 2RR13 1PGSA 3M3EA 2EXKA 1FMD1 3VHNA 1ZZ6A 1R1ZA 1HV0A 4I01A 1ND3A 5DZGA 1VR3A 1ZA4A 2YYOA 2BFUL 3NV3A 5DG1A 3WNXA 1S0CA 1OOPA 4XJ8A 2WINB 4HMZA 1YFYA 4EN7B 3E97A 3SCHA 1QJU3 2YPJA 4Z07A 2ZHKA 3GHNA 4LE4A 4N53C 5KXDA 4PJYA 1CPMA 1V9U3 2G4IA 2FBEA 1R082 2DVAA 4COYA 2GAUA 1QNWA 4AHWA 3FFQA 4A3XA 4IV3C 3KGZA 5KC6A 4C0BA 4IEPA 5F6KA 1NCRB 3SMHA 1HXS3 1PZ9A 2Q30A 3AYAA 1RUC3 4LBOA 5JZGA 3IIAA 1ZBA3 2HWF2 1H4HA 4Q4X3 4Q0SA 4H7LA 5IK4A 1DGWX 1FOD3 2HYKA 4H7MA 1RIRA 4KWJA 2DFCA 2HWB3 1FV3A 2VQAA 1AR91 1PGL2 2VGDA 4LEJA 1S0GA 1HW5A 2DVGA 1RMU3 4S2HA 3USUB 3C3VA 3FZ3A 4QPIA 1PIV2 3ILNA 1PO12 2PLV3 1G86A 5JSOA 2P37A 1RINA 3TNQA 4Y5Z0 4AEDA 2WFF2 4IERA 1VALA 5JPMB 2E6VA 4P9XA 3NAPC 4Q4W1 5B2GB 1O7FA 3AXDA 2WNUA 3FUQA 2ZGSA 4WZCA 4ZU5A 3BOPA 1ZNPA 5BNQA 4XHXA 3WW3A 4AI0A 2QE3A 2CY6A 4D3WA 3MIEA 1QXJA 4IV1C 3WZ1A 3CL1A 1FPN3 4ZU7A 2ZGOA 1YCIA 2VQ0A 4XFGA 1GR3A 3AKPA 2A3YA 3JUUA 3VKNA 1W6QA 1ZVFA 4FOYA 2PAEA 4Q4V2 3URFA 1PNFA 5E16A 1ULEA 1WCSA 4HFSA 4ZU4A 5I0TA 3V64A 1COV2 1OKQA 1NE4A 1LU1A 2Y38A 4Z8BA 4FT8A 4XPVA 4C90A 5GKAC 3QH6A 4MGKE 5E1RA 4DXZA 2ZX4A 4FOQA 2XJTA 3N7JA 1PM7A 1LHVA 3EO6A 5FOJB 1QMJA 5T5LA 3PVNA 1GKBA 4E27A 1D4M2 3J8F1 4IEZA 4Q0QA 2FQPA 2GMEA 5FRAA 4R4ZA 2HWD3 3KGLA 2TUNA 1AX0A 4OZXA 1S0JA 4DZGA 2C1FA 2D98A 4R9BA 5JIAA 4M01A 1WA4A 2A6YA 3FLPA 4P9YA 4HPKB 4COUA 3CU7A 3WG1A 3UJOA 4EN6B 3VDDB 5FPZA 4DRVA 5BPXA 2N7GA 2YY1A 3AM2A 5D8AB 4WM8A 1JW6A 5E88A 1O3RA 3ZYPA 3KZ4C 2ZJCA 1DGRA 1VBE1 4W6YA 2JG9A 4PBPA 1IGOA 2Q5TA 1ND3C 3O0WA 4Z1VA 3AZXA 2RS11 5DG2A 1QU0A 3MW2A 2IFRA 4FVVA 2ZKLA 1HDKA 1OOPC 3LCPA 4AGGA 1RUI2 1Y43B 2OIIA 2NYYA 1DU3D 4MH0E 4WVMA 4GWMA 3H1YA 2WZPP 1S2KA 1QJY2 1H2KA 2EAKA 2RS52 3M2MA 3VBHC 3VN4A 5BNPA 1C5HA 1LKNA 1DDLA 1C8M2 1ZBA1 2HWC2 1VJ2A 2Q8OA 1RUJ1 2R16A 1LEMA 1QY4A 1GZWB 4G3YC 4GALA 2VY0A 4YGDA 4HKLA 1REDA 1U5YA 4LA2A 4Y22A 4ONUA 4GH4A 3KB5A 2HWB1 3VBRA 4JGZB 2XHKA 2D3PA 1NOVA 2RR12 2TEPA 1NCQC 5KXBA 5JZGC 2VVFA 3AKRA 2MEV1 4YG6A 5LRSA 2A3XA 2IFWA 1UL9A 4HK9A 4N9IA 1NE6A 1AF9A 3LGRA 1OQEA 1DQ5A 1KD7A 2R041 1H8TB 4QHBA 4Y1ZA 4NO4A 4JV4A 1LOBA 1KDKA 1QKQA 4XBLA 1VBD1 2MNGA 4YVSB 4AFCA 3MEPA 2UWCA 3SISA 4R9CA 1QGLA 5EFUA 1RUE2 4RHV3 2JDZA 5J37A 1QJU2 1IS4A 3AX4A 1CAUB 4QPIC 2GMPA 4WVVA 3QOPA 4LHLA 1YYNA 3LA3A 4XQDA 1V9U2 1G9BA 5CNAA 1VB4A 1QQP3 4XBQA 1AXZA 2WQZC 2DU0A 4AEDC 2DU1A 3KS7A 2XVLA 4CDXA 2A3WA 1RUF1 3PVBB 1DGWA 1BXHA 3OF1A 3WHTA 4YNIA 5J98B 4UXAA 2Z5WA 1HXS2 5K7PA 2QFEA 2VNRA 2I45A 2ZGUA 1RUC2 4YW5A 5T5JA 3VKLA 2AZ5A 3VZOA 1Q8VA 1AHSA 1NY72 1PVC1 2ZGKA 1UX6A 4AI3A 2GC2A 1FOD2 2PHUA 4LA3A 1ZRFA 4Y1UA 4D94A 5GLVA 4FPYA 3H1MA 4Z82A 3L9JT 4EN9B 1DFQA 2UYAA 4B4PA 4XJUA 1U5IA 1F5FA 1DIWA 2ENRA 1YIFA 2PLV2 5JOWA 1ENXA 1A3KA 1VBC3 3DN7A 4BMBA 2W52A 4IESA 1RUOA 4YZ3A 1Q8SA 1O5LA 2X5IB 1O3QA 2BW8A 5HCAA 2NM1A 2P3IA 3GALA 1H4GA 2HWD1 3BODA 2OVUA 4AE2A 1LU2A 3V0BB 1SEFA 5BYNA 3AP6A 1LR5A 2WA4A 2YUEA 3OY8A 4LO6B 1FPN2 4XETA 3LSDA 3T1LA 4BIFA 2I74A 4AEMA 3WG3A 5BNNB 3H3ZA 3N7MA 1DZTA 1SACA 1UW8A 2A6ZA 2K0GA 4NVPA 2R073 4LBQD 3VKMA 4C0HA 3WP5A 2JE9A 2GH8A 1V6NA 3MDPA 3VBOC 1N1SA 2DCZA 3JQWA 4QX5A 1LCLA 2EAAA 4NHLA 4WM8C 3ZXGA 3PVOA 1Y7BA 1RUNA 3VZKA 4B8EA 1S0BA 3FHIB 4AGRA 4ASLA 4ITCA 4X6RB 2JG9C 3B00A 4RS5C 3ZSJA 3TYJA 3VBFA 5A3LA 2EIGA 3GNEA 5CADA 1ULCA 4J1XA 4XJ9A 2PN5A 1AR72 2ERFA 2RM22 4HN0A 3FE5A 3SH3A 4Q8KA 1XYOA 1UF2C 1D2SA 1VRH1 1QH6A 1UPSA 5KWRA 1I1EA 2OZJA 2FMYA 2QDRA 1H8VA 3DPRB 5BNPC 1MVEA 1I6XA 2RJKA 2YXSA 4S2FA 1AL21 4QGMA 4CP0A 2CAUA 1J1TA 4Q1RA 2Z42A 5DZFA 1R092 4OHYA 3JD71 2FHRA 4SBVA 2KA3A 2DWRA 4RR3B 5HXVA 4AVVA 5CU1A 3VBRC 1W6PB 1I5ZA 3ZN6A 3LOBA 1PZ7A 3KSCA 3CJXA 4GULA 4U36A 5C4WA 3ECQA 3KT4A 1PO23 4IL7A 3OD0A 1G6NA 4URTA 5T55A 3JBG1 4XF4A 3HD8B 2A6VA 2DCYA 4BA6A 4TYSA 2I2SA 5BUVA 1YO8A 2VOXA 1Q5OA 1AZDA 1DZQA 1T6GC 4YZ1A 4GB33 5CFCA 2ZHLA 4BZ4A 3JB4C 3H50A 1RUD1 3GZTB 1XQNA 4MX3A 3H3UA 1ZBE3 3RJ2X 4TZDA 2ZGPA 3NKTA 1ND2A 3NKGA 1MEC1 2AREA 1AR62 4LBQA 1LHNA 1VLNA 2BWAA 2ZGTA 5FQ0B 3W9AA 3LOIA 4E2GA 4DS0A 2XLGA 5LK7B 1H1AA 4XW3A 4LBNA 1VAKA 2P3KA 3RYRA 2WC2A 1AL0G 4CDXC 5CAZA 4XF9A 4Y1XA 1M06G 2A70A 2PTMA 1TME2 2GNBA 2FZ2A 4PDWB 4TWTA 1D0GA 3TWIA 3WDUA 2VVDA 3M4FA 3EBRA 1DYPA 2OUHA 4AI8A 3OTFA 3ATGA 2DVFA 4XXAA 5H9SA 3C2UA 2B8MA 4XDQA 2B7YA 4F7ZA 2GN3A 3SH4A 2VG9A 4AXOA 5T3NA 1MS5A 2HWF3 4ISRA 5CG9A 3WD5A 4XIOA 2MPFA 1IQAA 1AYN3 2I07B 2Y26A 4L99A 4RHV2 1CIWA 1KFUL 2WA3A 3AMMA 1O4YA 1RVF2 4MYEA 1OD5A 3SCGA 5TSWA 4COWA 3MIGA 4K7JA 4N43B 4LO5B 2V09A 5T5PA 1IS5A 1D2QA 1QQP2 1ZZ9A 2RMU1 4G9SB 3HQXA 4FPEA 3A0KA 2DUOA 1PIV3 1N3PA 2EXHA 4GWNA 4N53A 4DY3A 4YM2A 1G8WA 5C8CA 2AYHA 3RS6A 1BJQA 2WLPA 1ASJ1 2R071 1CAVA 2JD4A 1XNKA 4CDWA 2FMDA 1UU4A 3M3OA 1TE1B 1RJ8A 2JG8B 4Q2FA 4CP2A 4R9DA 2JE7A 4Y20B 1WLCA 3BB6A 3POYA 1N1VA 2QJVA 4AGVA 2SLIA 3W58A 2GZWA 3WHUA 5A32A 4YGCA 3AP5A 3E6BA 1NXD1 1J3QA 2WZR3 3I59B 1DHKB 4AK3A 2ETEA 3M8LA 5IK8A 4XXPA 1WD4A 1I3HA 2O8OA 3ZSMA 4Q4V3 1QHDA 4OHWA 1SMVA 2P17A 2DFBA 4CTEA 1EAH3 4HK8A 4CEYA 1H30A 4AVCA 3MFAA 4UW5A 2DTYA 3VBFC 5F9TA 1UD1A 2QKDA 4MV2A 4Q0VA 5KHHA 1PK6B 1V6OA 1SLBA 4KU7A 1HV1A 3ZFEB 2BNOA 4EWDA 1HKDA 1ZZ8A 2IXJA 1JHNA 3RWNA 2OZ6A 4GMP0 5ABJA 3VZMA 2B5HA 5JOYA 5T50A 4W6WA 5DZEA 5I91A 1YFWA 4N90A 4GXLA 1AR81 4DNYA 4YW3A 3B01A 3J9SA 2NLRA 4MXVA 3NV1A 4QQLA 1B35B 3SITA 2V5YA 2A7AA 2OPKA 3IPVA 5I93A 4MVTA 5C8WA 5I0SA 5I0RA 4IEUA 4YG0A 3HR9A 1ULDA 1BCXA 3NL1A 1V6LA 4PIXA 1VBB3 3Q9OA 4DRRA 4KG0A 5H9RA 2ARBA 2QDNA 5F6LB 4KGQA 3KQRA 1X8EA 5CFDA 1W6MA 1V6IA 1L3JA 1BVP1 1Y9QA 3KD4A 4BWOA 5CFCC 1JH5A 1IPKA 2ET1A 2OW4A 2SBAA 1C1LA 4AQ6A 3MW4A 3JB8A 5SV5A 1WMFA 2XLAA 2R0HA 3RPQA 1LJ7A 4XFBA 1ND2C 4P9JA 5DUVA 1DZRA 4K21A 1R081 4IV3B 1QJX3 4LO8A 1RUI3 1J3RA 1IS6A 3O12A 5GLTA 3CJIA 3ZSLA 2R6QA 3I2DA 4GMP1 4YVWC 4V1PA 1ZRCA 2HWF1 3UV9A 2WSUA 3PMEA 1PO22 3JZVA 5KXEA 2LTNA 2F4PA 2GMMA 1KFXL 2VMHA 2YZ4A 1PGL1 4GB32 1OLQA 1C4RA 4OULA 1ZBE2 3ZXJA 1KJRA 1PO11 5KHKA 5GZDA 2UYBA 3MI8A 2CNAA 3RJRA 4YFZA 4QQ2A 2R0FA 2ZX3A 3PJYA 3MZHA 2WFF1 4CDQA 3ETQA 5LRRA 3JCIA 1S1AA 5T52A 1QF3A 1RUE3 3G6JB 5FMOS 3VBSA 4LO4B 3VBHA 4XEZA 1GBGA 2GN7A 4IV1B 2RE9A 4LUKA 4YM0A 4META 3GHMA 3ZYRA 5C8CC 3V56A 1C8NA 4D7YA 4QU2A 1AUYA 4CDWC 3ES1A 3HAGA 1LODA 4IEXA 1NXMA 1XNCA 4LLFA 4YLZA 4MSVA 3ES4A 4COZA 2OUJA 1MS8A 2BPA2 1NCQA 3MIFA 3KM5A 5GZFA 1TQ5A 4JC1A 1DG6A 2OA2A 2YC0A 1JBCA 3B93A 3UK9A 1AYN2 2D6LX 2DTWA 1U5XA 1UN1A 4WVWA 1BBT3 1COV1 2JX9A 4KWLA 5IT6A 3H0OA 1RUH3 2RS32 2HEYF 4F8AA 1GNHA 2XL9A 3B9CA 2WT2A 2CL2A 4PQ9A 2CAVA 1AX1A 4AQSA 1WCKA 2E9QA 1UZYA 3WG4A 1HRI2 1CONA 5J09A 1KS5A 4CEYC 1OFNA 4FTEA 2E7QA 3THPA 1BVVA 1D4M1 1SBFA 2GNTA 3TRSB 5JR7B 3AKSA 2DCTA 1YUDA 3VKOA 2CWSA 5ABJC 1DGLA 2D6OX 2WS93 4Y26A 4IEWA 1QDOA 2DUPA 1KS4A 4JRAA 4BLJA 4XQ4A 1X8MA 1DQ6A 4FXGB 4M3CB 4NPRA 2ZTNA 1OI6A 4KWKA 3CO2A 3WXPA 4U2AA 2WZR2 5AC93 5FPXA 4XFHA 1S0EA 4G4FA 1MR5A 5GM0A 3O0XA 1ND3B 2IXCA 1MZEA 5FLIA 2JKBA 1PGW