1HDKA

Charcot-leyden crystal protein - pcmbs complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
139
structure length
139
Chain Sequence
SLLPVPYTEAASLSTGSTVTIKGRPLVCFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Serine esterase
molecule keywords EOSINOPHIL LYSOPHOSPHOLIPASE
publication title Charcot-Leyden Crystal Protein (Galectin-10) is not a Dual Function Galectin with Lysophospholipase Activity But Binds a Lysophospholipase Inhibitor in a Novel Structural Fashion.
pubmed doi rcsb
total genus 31
structure length 139
sequence length 139
ec nomenclature ec 3.1.1.5: Lysophospholipase.
pdb deposition date 2000-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1hdkA00
1KQRA 1WBFA 2DUQA 3AZVA 1AXYA 1LEMA 4Y1XA 4YM2A 2DVBA 1SFYA 2C5DA 5GLTA 2PHWA 4Y1ZA 3RRDA 2ZGUA 4XJ9A 1QDCA 5T5LA 1TEIA 1YRZA 4C1WA 1G9BA 2GMMA 2ERFA 1DHKB 2UWAA 2XG3A 2D6OX 4XE9A 2DVAA 5IK8A 4M3CF 2OUJA 3AJYA 2VY0A 3ZVXA 2R1DA 4ATEA 1S0DA 3ZYPA 1QOSA 1QU0A 2A6YA 2D6KA 2NN8A 5KXCA 4IQPA 1S0IA 3AYDA 2GNBA 2GNDA 1MACA 1V6MA 1PZ7A 1MR5A 2A75A 4Y26A 4DPNA 4XILA 1A78A 4YG3A 2R0HA 1V6KA 4FPLA 4ISQA 3B3QE 4P9YA 1C1LA 2G4IA 2JDZA 1DGLA 1G8WA 1SBFA 1AF9A 2EXIA 2GALA 4XBNA 4P14A 1ONAA 4U36A 4YZ3A 5JDBA 4ITCA 1UMZA 2YY1A 4K20A 3ZXKA 2ZGTA 2ZA9A 5GLZA 1MS3A 3L2YA 2YV8A 3AYAA 3R4UA 3AZYA 5E8AA 4YZ1A 2A7AA 2WSUA 2NMNA 2WT0A 1IOAA 1MS5A 1CVNA 1LOGA 4MYEA 4FOVA 1SLLA 2ZGKA 3WHTA 2VW0A 3WDWA 4BPZA 3POWA 1DYPA 2PHUA 3FBYA 3DUIA 2ES3A 4RA0A 1LECA 1LCLA 1Q8SA 1UPSA 2D6LX 3ENRA 2EXHA 3SH3A 5JOWA 4YGBA 3POSA 4Y22B 1WD4A 2ZHKA 2ZGSA 4Y1UA 3N35A 1UN1A 1G86A 1LGCA 3UJQA 3UJOA 2NM1A 4FPEA 4PBPA 1AX2A 4LBQB 1DQ6A 4BLJA 2CTVA 1GYKA 2XB6C 4UW3A 5KXDA 5GM0A 1VAVA 3V65A 2UWBA 1FYUA 3IKWA 4NO4A 4BQ1A 1MVQA 2D7FA 2ZZJA 1KJLA 4YW3A 1AX1A 1ENQA 5JVVA 1SBEA 3I4IA 3ILFA 3U4XA 5JOZA 1FNZA 4FOWA 5DUWA 1CIWA 3ZSJA 4XMIA 5DZGA 1FATA 2UWCA 4WVVA 5CAZA 1ZA4A 4BMBA 2ZMNA 2DYCA 4Q1RA 2P37A 2D6NA 3BOPA 3OBRA 3WHUA 4PQ9A 1HKDA 1JYIA 1AJKA 2DURA 3KM5A 3MW4A 1YO8A 1W0PA 1W6MA 2WJSA 4CRQA 1S1AA 1WBLA 3M3OA 5DG1A 3USUB 3O0XA 4FPGA 3VKLA 4SLIA 2JE7A 3AZWA 4JRAA 4M3CE 2OW4A 4Q26A 1ULCA 3O5SA 1DLLA 4FP3A 4FQZA 2AGSA 3USUA 2AUYA 3UL2A 5HCBA 1R1ZA 2E51A 3WDXA 1VAMA 1SBDA 1YI7A 5CA6A 1LOFC 3RMXA 5GLWA 3JUUA 3AXDA 2DV9A 3NV4A 4AGRA 1A8DA 2AYHA 3ZSKA 2ZMKA 5FREA 1D2SA 2FHRA 2B7YA 4WV8A 2ZHNA 1O4YA 2ZGNA 2GN3A 4W65A 1G7YA 5T55A 1V6JA 2ZGQA 3NV3A 1C57A 1Q56A 2GMPA 3ZXJA 2HYKA 3SISA 3UK9A 1QGLA 1GZ9A 3RMYA 3T1LA 4XXPA 1V6OA 4YGEA 3AP9A 1X50A 5HCAA 1N47A 3APBA 5IK4A 4FPJA 3ZXLA 1JYCA 2WT2A 3IMNA 3VUOA 1LHUA 2OVUA 2DVFA 3Q9OA 1S0CA 3WG3A 1I3HA 3LSDA 1ENSA 4I30A 5FRAA 2WSVA 3TB0A 1OQ1A 4KBBA 4YM0A 5H9RA 5CB7A 2PHTA 2P3KA 3OGGA 1CQ9A 4M3CB 4YM3A 2D43A 5E89A 1ENRA 3V64A 3M1HA 1QNWA 5H9SA 4YFZA 1H9PA 1H9WA 1VLNA 4GXLA 2DTYA 1APNA 4LBJA 5KXBA 2W68A 5KXEA 5GZEA 4Q8KA 3AYEA 2GMEA 1YIFA 1YXWA 1JHNA 1LEDA 3O12A 4M3CA 3WNXA 4R9CA 3FLPA 4PF5A 1O4ZA 4HANA 1W6OB 2OUHA 4LBQD 3R4SA 1DQ5A 1WLDA 2VW1A 2EXJA 4XOGA 3D6EA 4FOYA 3IM0A 4YW4A 2NYYA 3PVEA 1QNYA 3WCSA 1GV9A 2I2SA 1W6OA 5GZFA 4AWDA 4BMEA 4DS0A 1AVBA 4UW5A 3OYWB 1AXZA 1GNZA 2A71A 1LODA 2DWRA 3AZXA 1QOOA 2WQZC 1SLBA 2TEPA 1JBCA 2ZABA 1GANA 2A6XA 3OYWA 3M2MA 4R9DA 1EPWA 2AREA 1LOEA 2YZ4A 1AXKA 4FPYA 4BLIA 4ISRA 1V00A 5IT6A 1FNYA 1Y7BA 1V6IA 3O0WA 5CBLA 3A0KA 3A4UA 3ILNA 1HDKA 5BYNA 4XHXA 2R0FA 1KJRA 2RHPA 1LGBA 4AGGA 1DQ4A 2VH9A 1UX6A 2ZHLA 5AVAA 1JOJA 1J1TA 1URXA 2ENRA 2ZAAA 2A3YA 2AH2A 1WLWA 2R1BA 4GKXA 5CNAA 1PZ9A 3SNMA 5H9QA 2A3WA 4AVVA 4LBKA 2ZGPA 1LU1A 3INAA 3ZYRA 1GZCA 3VKNA 1MVEA 1BYHA 1KDKA 2ZHMA 4XBQA 3W59A 2NZ9A 1Q8OA 4XYXA 1Q8PA 3FLRA 1S0BA 3ATGA 5GALA 1WW4A 2VU9A 3AXEA 5DG2A 5JLVA 4AYUA 1PZ8A 1I1EA 4P9XA 1IKQA 1WW7A 3SH4A 2P3JA 3QLQA 1KDMA 3BTAA 4TZDA 2CNAA 3LCPA 1LOBA 1RINA 2E7TA 4Y20A 5IUQA 2ARBA 1GBGA 5IK5A 2C9AA 1IS5A 4GA9A 1D0HA 4BM8A 3OY8B 1CN1A 5GLUA 4XJWA 2DU0A 2JKBA 1AJOA 1DQ0A 2WT1A 4JC1A 4GWMA 3B00A 1DYKA 2WLQA 2AENA 5T5OA 2AR6A 2UU8A 2D6PA 2FMDA 4L8QA 3RG0A 1FV2A 3AP6A 1BKZA 3OY8A 2D3PA 1DZQA 3MW2A 1FV3A 1QOTA 1W6MB 3WDYA 1QF3A 4ZKTB 1ZM1A 1IS4A 3WVJA 1ULDA 4D69A 2CL2A 1GZWB 2ZGLA 3PMEA 3FUOA 4Q27A 5DUXA 4M01A 4ZXKA 1OFSA 1CR7A 1S0GA 4YG0A 3ZSMA 1N3PA 5F9TA 4F83A 1QKQA 1W6PB 4LBLA 3WG2A 2EIGA 3QCWA 4M00A 1GZWA 3AP4A 4AVTA 4H55A 4RL7A 2E6VA 1LENA 4XBLA 4GKYA 4DRVA 2ZGRA 1DFQA 1MS0A 1W6PA 2D44A 2PHFA 3M3CA 5EWSA 1HLCA 2PHXA 1WLCA 4FPHA 5HCFA 1IKPA 2Z42A 2DTWA 5EYXA 5JOYA 4XTMA 2DVDA 4DQAA 5JMCA 1LESA 5DZEA 4R9AA 1G9AA 2YXSA 3C2UA 4XHBA 2PHRA 2KM2A 3B9CA 4LBMA 2ZGOA 1S0FA 3WDTA 2UURA 3M3EA 2A5ZA 5IK7A 2JE9A 2W52A 3H0OA 1GNHA 1DBNA 1XQNA 4OZXA 5T5JA 4YZ2A 1N3OA 1SCRA 2NP0A 3A0NA 4FPKA 5F5QA 1OKQA 3SLIA 1CPNA 4XXAA 1UZZA 3VV1A 3AK0A 4WVWA 2V5YA 5EXOA 1C1FA 4FPOB 1LU2A 1LULA 2WKKA 2ZGMA 5SV8A 1N1SA 3HMYA 4XJAA 5JOXA 5T54A 1Z78A 1W6NB 4K21A 1WD3A 1A3KA 1ULGA 4AGVA 3V0BA 3VKFC 4CTEA 1G9CA 1WW5A 3R05A 4XJUA 1WUVA 1W6NA 4K1YA 2ARXA 3ZXEA 1LHOA 1ULFA 4DRRA 3AP5A 4BOWA 3VKMA 3ZPYA 1LJ7A 1CESA 3O0VA 4Q1PA 3PVOA 4FPCA 1DQ2A 2JECA 1V6NA 5DZFA 3TAYA 3WCRA 2EALA 2YMZA 4XTPA 3FLTA 2DUPA 4YW5A 5T52A 4ATFA 1FAYA 2ZKNA 5H9PA 3PVNA 3ZSLA 4DFSA 5GZCA 3I8TA 3IN9A 3JU9A 5T50A 1SLTA 4UW4A 1HQWA 2W08A 3NWKA 4FQ4A 1IS3A 2V73A 1W0OA 3WG1A 4TYSA 1AX0A 3AZZA 1BQPA 4AVSA 1BJQA 3AFKA 5GZGA 2R16A 2A6WA 5DUUA 3T2TA 3AJZA 1RIRA 2P3IA 2A70A 2LALA 1FX5A 1G9FA 1W6QB 2BQPA 4U2AA 1N1TA 1LHVA 2VXRA 2ZACA 1QDOA 3WG4A 1BXHA 2E7QA 3B01A 3POYA 1MZ5A 1NLSA 2VUAA 3WUDA 4NOTA 1H30A 2SBAA 1VALA 2GNTA 4Y20B 1SCSA 2DUOA 4YLZA 1W6QA 3FUQA 1GSLA 3WOGA 5DXDA 3RS6A 2ZMLA 4FVVA 1VIWB 3D5OA 2W39A 3AX4A 5DUVA 1LOAA 4XMAA 1UL9A 4Y1VA 1MS9A 2D6MA 3KQRA 1LHWA 1Q8VA 1SLAA 3MPPG 1MZ6A 4Q8LA 4YM1A 3RSJA 1RITA 1GKBA 1ULEA 1KITA 3NV2A 1CONA 2CWSA 1MS1A 4JCKA 2DU1A 2SLIA 2CYFA 1SLIA 3N7KA 5E88A 2D3RA 5L73A 1UKGA 3NV1A 1MS8A 4GWNA 1C4RA 2VW2A 4XIOA 2H0BA 3WV6A 4P9WA 4Q2FA 5LK5A 4C1XA 1NXD1 2JD4A 1YYNA 3SH5A 3BIWE 1SLCA 5GJ6A 3W58A 4XJ8A 4XIKA 4Y22A 3D4KA 3MEPA 3V0AB 4Y1YA 2P34A 2EF6A 1N1YA 2E53A 3WUCA 2LTNA 1LGNA 3HN1A 3N7JA 1Z0HA 4LBOA 4Z8BA 2EXKA 4LBQA 3CNAA 4FP2A 3V0AA 3WZ1A 1Q8QA 3N7MA 2GNMA 1DQ1A 3M3QA 3WDUA 1LHNA 3MW3A 3WLUA 3PJQA 4YG6A 3OJBA 2R49A 4FPFA 4LBNA 1HQLA 1N3QA 3DGTA 3FFZA 3HR9A 4HL0A 3AP7A 5T5PA 2DVGA 1JN2P 3GALA 3OPZA 3B69A 4YZ5A 4YGCA 1GLHA 1JUIA 2YROA 4XJZA 2PELA 1LOFA 5GLVA 2EAKA 1S0JA 2A6ZA 2CWMA 4YW2A 1IS6A 1F9KA 5EYYA 4GALA 2D3SA 2ZBJA 4YW1A 1JXNA 1MS4A 1N1VA 4CZSA 4FOQA 3N7LA 2CY6A 1V6LA 3ASIA 4R9BA 4WZFA 4UW6A 4K1ZA 4PCRA 1UAIA 2GN7A 3T1MA 3RQ0A 3N3HA 3WDVA 4ASMB 3ILRA 2A3XA 3IPVB 4YGDA 3OBTA 1GICA 3VKOA 4YFWA 1DIWA 2JJ6A 2P2KA 1F31A 1BZWA 1AZDA 1B09A 2WNEA 3IPVA 1LOCA 2A6VA 1S0EA 3V0BB 3GNEA 3AYCA 1CPMA 3N36A 1QMJA 4YZ4A 4PBOA 3LSEA 1KRIA 2NMOA 3SITA 1G9DA 5GZDA 2Q5TA 1U0AA 2GDFA 1WW6A 3BODA 1JW6A 1UZYA 3ZXFA 1CJPA 4XDQA 1F5FA 1LTEA 4Y24A 1WCSA 1SACA 4XZPA
chains in the Genus database with same CATH superfamily
5C71A 5JZGB 1KQRA 3ZFEA 1DZRA 1ND3B 2QVSB 2UY8A 5FY5A 5GLTA 1QDCA 1WCKA 1NA1A 3LD8A 3IIIA 5JZGA 1T2XA 1DHKB 5FXVA 2UWAA 3P5BA 2ETEA 1C8M1 2XG3A 3H8XA 4XE9A 3K3NA 2W94A 5A1AA 2RS13 5CKQA 1RUI3 2Q1FA 3ZXAC 1QQP3 1S0DA 3HIFA 3MBWA 4CDQC 1J84A 1QU0A 2W87A 1ODNA 3SHRA 4L9BA 5KXCA 3N4MA 2GNDA 4H7MA 1GOHA 2Y6JA 4W50A 2X5IA 3GF6A 1ZZ6A 2VOKA 2XKPA 2JDZA 1DGLA 2EIEA 2GALA 1AF9A 1PK6C 2ZX3A 4LK7A 4AHZA 2FDFA 5FOBB 4U36A 4YZ3A 2MEV1 5FYCA 4B8EA 4K20A 3UKTA 2VZQA 2ZGTA 2B39A 1WMEA 4HN0A 5J09A 5DQ0A 1PIV3 1DGWX 1SQ4A 2VOTA 3KGLA 1UOGA 2W1WA 2A7AA 2WSUA 4XF1A 3SKJE 1MS5A 5LRSA 1LOGA 5FTTC 1UY4A 3RYKA 2WNVB 1QH6A 4GB33 2VOWA 2W2IA 2VW0A 3WDWA 2K9ZA 4RHV3 2Q0AA 4XZUG 1ZZ7A 4QX8A 3FC0A 3WQ7A 1C8NA 1TME3 3GHNA 3ACHA 1VAKA 4RA0A 4EN7B 1UPSA 4AAXA 2LM3A 3ENRA 2D6LX 3OUIA 3MFCA 4J1XA 4URTA 1K5MC 5FYMA 5JOWA 1YQ2A 5A7NA 2VUCA 5CYYA 4R4XA 5EHDA 4XAAA 2ZHKA 1UY2A 1SFPA 2FQPA 4M0HA 1UU5A 1UN1A 1G86A 1LGCA 4F3JA 2VUDA 4NRQA 1BEV3 4XCBA 3T3YA 1GYKA 4Q4W3 1F8VA 2BJSA 2UWBA 1FYUA 4K8FA 3V65A 1UZ0A 3IKWA 1UYPA 4NO4A 3VBFC 1VR3A 1MVQA 2D7FA 2J1TA 1KJLA 4BQ1A 1O3TA 2WS91 4HPKB 1ZNPA 1X7NA 2B4KA 5J7MA 5B4XA 3OD4A 4AI2A 5JOZA 1CWPA 2Y34A 5F32A 5BNQA 1QY4A 5DUWA 4CE8A 2LW8A 4MGIE 2VNOA 2GC1A 1POV3 1REDA 3ZSJA 4HPKA 3AM2A 1W8ZA 3KGZA 2ZEYA 1DGRN 4Z2AA 1RVF1 3OBAA 4KWLA 4Q5OA 1OUSA 2DYCA 4Q1RA 5J48A 2Y38A 1AR62 4Z92B 2LRPA 1AJKA 2VTXA 2DURA 3FX3A 3ITQA 2BNOA 3KM5A 1YO8A 4HT1T 4QQPA 5IJRA 1W6MA 1O6UA 2RDRA 4DMIA 1U5XA 4FT8A 4CRQA 5DG1A 2Z79A 4LE4A 1STMA 1WA4A 3D0SA 1OA4A 4QX3A 2H6CA 2KR2A 5AVPA 1CAVA 1UY0A 4JHZA 1OPMA 4Q26A 3N9MA 3WQ0A 4CDWB 4MO3M 1A34A 1PM7A 2ZJCA 3VBRB 2HWB2 2AUYA 3UL2A 1RJ7A 4HBNA 4Q4V3 3VBUB 3WDXA 1UYYA 2HWD3 5CA6A 3JUUA 1RUD2 4QPIC 3FZ3A 3RPQA 5BNPB 2PAKA 1ASJ1 4LHSA 3Q8FA 4AGRA 1DGRA 2IUWA 3EHKA 4UWDA 2QDRA 2ZHNA 4ES9A 5FZIA 4W65A 4XUQA 4EWDA 5BNPA 2OIIA 1V6JA 2ZGQA 4ZU4A 4GH4C 1YCIA 1RUF3 1VBE2 2ILMA 2W95A 3KV5A 1V6OA 4QU1A 1F4HA 4LIVA 3BN6A 2RS33 4C0HA 3PURA 3CBNA 1LHUA 3VUOA 3Q9OA 2RV9A 3T2QA 3WG3A 4EZ4A 2VZSA 3M8LA 3J4UH 4YM0A 4KBBA 1C8M2 3CEWA 5T3NA 2YBPA 4PI2A 4B29A 1E5IA 2V5DA 1XB9A 1H2NA 2Y6LA 3B7MA 4S2HA 1H9WA 2WQ8A 3ZDSA 3MDPA 4LKDA 5KXBA 1WCQA 2WO1A 1O5LA 1Q3EA 4RHV1 1LEDA 3O12A 1K12A 2JG8C 1TME1 3WNXA 1XYNA 3AMNA 5CU1A 3GZAA 3THPA 4HSJA 2K2SA 1W6OB 2XLAA 2VZRA 3I2HA 1XNDA 1UNBA 4FOYA 4ZONA 3QH7A 4YW4A 2IWGB 4MSVA 4XURA 2HWC2 4P9IA 3ES1A 2I2SA 1W6OA 2MEV2 4NIGA 2AACA 1AXZA 5J37A 1LODA 4IEXA 2DWRA 1OUXA 1QOOA 1HRI3 3OUHA 5FFOC 2W46A 1SLBA 4Q4W1 4NHMA 1VRH2 2WNUC 2ZXQA 2HWE3 1EPWA 2Y6HA 4JGYB 3VZNA 3VD7A 4FPYA 1AXKA 4AXOA 2YC0A 1OVPA 4ISRA 4EQVA 1NUKA 4H2AA 1YUDA 5TSWA 5A6XA 3U14A 1Y7BA 4AEDA 5C3RA 4Z2WA 3A4UA 3PL0A 3ILNA 4IW3A 3VHOA 3WD5A 2RHPA 1KJRA 3ZYHA 1LGBA 3E6DA 4RR3B 4IGOA 3KLSA 1NX9A 1UX6A 2FDJA 5KBFA 4JKKA 1GP5A 1GZTA 4O9EA 1J1TA 3TNPB 1URXA 2ENRA 3VDDC 2A3YA 2AH2A 4IGQA 2BFUS 2WAAA 3ALQA 4RR3A 2MNGA 3BPSA 4AVVA 2A3WA 3N9OA 2ZGPA 3MF9A 5C3QA 1HV0A 1PVXA 4L97A 3VKNA 1MVEA 2YUEA 3GZEA 2NZ9A 4LE3A 2IXHA 4XYXA 1Q8PA 4MZUA 3FLRA 4D8MA 1VE0A 3WR0A 4QWNA 2E63A 2XVLA 5DG2A 4AYUA 1W05A 1PZ8A 3WNLA 1I1EA 1UWWA 4NWVA 1WW7A 3SH4A 5JSRA 3OGJA 1KDMA 4A6OA 1NLRA 2WBKA 2CNAA 3LCPA 1RINA 5A3LA 5JIAA 1O3SA 4Q4V1 4E8DA 1XYOA 5FZGA 5JI9A 3GBFA 2QKDA 4PIYA 3VBFA 1CN1A 2WZEA 3JQXA 5EQUA 1X9TA 2WT1A 1HW5A 1DYKA 1NE4A 5FZOA 5FYZA 5FZBA 2ID4A 4L8QA 3RG0A 4CXYA 1BKZA 1QJY3 1OD5A 1QOTA 2XJSA 4ZKTB 1RUF1 4N53B 1H8TB 1ULDA 2ZZQA 4RFT0 4CEWB 5ABJB 4UOJA 1EV13 1YQ5A 2J1AA 5DUXA 5KC6A 1QJX3 2P6CA 2QQWA 1RYYA 1S0GA 5CKMA 3GCWA 2MPFA 3FHQA 4N53A 1H8TA 3POFA 3IDEA 2RS31 4OUMA 3DKWA 4XQ4A 4CEWA 2R7EB 5ABJA 3ACLA 4X8NA 1HJFA 1LENA 4O7XA 4XBLA 3O1OA 1UY3A 5D21A 3LOBA 5FY4A 1DFQA 1R093 2PN5A 5D2AA 5HCFA 3EJKA 2DTWA 1E5SA 1VBC3 1Z7S1 2HEVF 2RS12 1COV1 1RUI2 2B46X 2DVDA 2HBUA 2HJIA 1QQP2 1JODA 3AMHA 3KCYA 5FBZA 2RR12 1GMMA 3LA2A 3VDCA 3QD6A 4DNYA 2PLV3 4IV3C 4QMAA 2ZKLA 1HB3A 2JIGA 4QPIA 5FZ7A 2EIDA 4GJYA 4ORFA 4XF9A 4QQ2A 5FP9A 2A5ZA 1SPPB 3HNBM 3JD73 1VP6A 4A42A 1X8MA 1SDWA 4E8CA 3CHXA 3URFA 5FUNA 4I0WB 3WV6A 4B7KA 1EP0A 5L9VA 1GNYA 1OH3A 4UI9L 1IQDC 3A0NA 3NAPB 4P9JA 1LRHA 1NLQA 1M06G 4N43B 2X53S 1JI6A 3MIHA 4PDWC 4LT5A 4XXAA 1PIV2 1UZZA 5E16A 3AK0A 3W21A 3DYMA 2VBBA 2XLFA 3U1XA 2FD8A 4P00B 1LULA 2J7MA 3I2JA 4GJZA 5FKCA 1N1SA 4I3GA 2QQKA 2C0ZA 1RUH3 4Q4X3 4PQQA 3VBOB 4GB32 1TMF3 2WRAA 1NZIA 1OVSA 3MGUA 5T54A 5JOXA 2FZ2A 1DP0A 1W6NB 4K21A 4RHV2 1WD3A 4MADA 2XHKA 1TME2 3MIEA 4KNCA 4CTEA 3VBOA 4F8AA 1G9CA 1JZ3A 4LIUA 1YFXA 1NCRC 1WUVA 1W6NA 4K1YA 1YJLA 1U5YA 5A7OA 4YW7A 5EIYB 3E6BA 3OCPA 3VKMA 4BOWA 4JRLA 4UYBA 2JECA 3T4VA 5CFCB 1BEV2 1G6NA 1WA6X 3VHNA 3ON7A 1DCSA 1ZX5A 2DUPA 3IMMA 5T52A 2ZKNA 4ZS3A 4Q4W2 3JXSA 1S2BA 5H9PA 5CIRA 2XJPA 3I8TA 2GC2A 4IEVA 5CFCA 4LO5B 3JU9A 1Y3TA 2YB7A 1HQWA 4BH9A 3VBSC 4RYDA 4FQ4A 4JQTA 4RQPB 4LTAA 1X8EA 4BU2A 3CO2A 2QBXA 3VL8A 3WNNA 3AZZA 1BQPA 3SEPA 4AVSA 4FO9A 5JXGA 1TG7A 4XUTA 1QJY1 1NCQB 1XE0A 4AEJA 4V1PA 3ZSEA 1KD7A 1RUG3 1PGSA 4OI4A 1UOJA 1J3QA 2BERA 2HWF3 2DDUA 5LW9A 2DBNA 4AFMA 4AQ2A 1N1TA 1LHVA 1XXNA 1UPIA 2RS53 3P3NA 4AQSA 4XVHA 1OA2A 4Y20B 5JMOA 5C4WC 1AR93 3WNPA 2GH8A 3FWEA 3H9AA 4A4AA 3WOGA 1YFWA 1VMFA 4R8HA 1HRV1 1M4WA 2LS6A 1R091 2W39A 3AX4A 4JTNA 4Q4V2 5FLHA 4ZY9A 2HWD2 4WM7C 1ZBA1 1UL9A 3M7AA 1VBC1 4CCKA 4NPLA 2D6MA 2LROA 3U07A 3MPPG 1MZ6A 1W8WA 3RSJA 1YEWA 4OYUA 2WDBA 2ZTNA 5FXXA 4BQYA 3W5NA 1CONA 2CWSA 1AR81 2VL4A 3NO8A 1ZBE1 4JCKA 4FCAA 1FMD3 3VD5A 1B35B 2RJ2A 3TYJA 1RUF2 2O1QA 2VAUA 4OI2A 4XIOA 1EUUA 3NJXA 4NHLA 4OHXA 1PM4A 4P9WA 1C5IA 5LK5A 2XL7A 2JD4A 4DUXA 5J1XA 1UCXA 1AUYA 1E5RA 1YNAA 1JH5A 4EWAA 4XJ8A 4XIKA 1RUE3 4Y22A 4ZU7A 2BV4A 2P34A 3AKRA 1N1YA 4CP1A 2E53A 2RS32 3HN1A 3N7JA 3HOBA 3SKVA 5LWBA 4DXSA 4Z8BA 2DF7A 1OLME 2EXKA 4E27A 1QXPA 3WZ1A 1OSGA 4CP9B 3N7MA 4QHOA 2B9UA 1H8VA 3MW3A 1RUJ3 2DCTA 1BBT3 3PHMA 3D0JA 2WL1A 4IERA 4LKFA 1NE6A 4QX0A 4AI1A 5CFDC 4LBNA 3JB4C 1RUH1 2RM21 5LEJA 1N3QA 3DGTA 3HR9A 1TMF1 4HL0A 3AP7A 4NHKA 3VHPA 3ZN5A 1JN2P 1YWKA 1GLHA 1PGL1 2PELA 3AMMA 1CX4A 1H0BA 1S55A 3OPTA 1S0JA 3E97A 1VBA3 2BDRA 3RZHA 3I2IA 2ZBJA 4H3WA 4CZSA 1MS4A 5C33A 4S2GA 1H4HA 3S6PA 4FOQA 4FXKB 4Y33A 4R9BA 4P9GA 2Q1ZB 4FAHA 3VB9A 4GULA 3KF5A 5B4NA 3T1MA 3POGA 5A6ZA 4P5YA 3WDVA 3K4DA 4UXAA 2KA3A 5E6HA 4A44A 4ASMB 4OCTA 4Q0SA 2XHNA 4YRDA 3ZFFC 5LA0A 5DMYA 1HRI2 3KSCA 5JR2A 4YFWA 2JDUA 4TN7A 2W0XA 2XGXA 2P17A 2HWE2 1DIWA 1PVC3 5BXXA 5FZLA 4E4DX 1F31A 4E9KA 2XDVA 4PDWA 4H7LA 4RS5C 4Z07A 5A7PA 1Y9MA 3K48A 5E1RA 5DDJ1 1VBB2 1CPMA 2IXLA 4ZS2A 1QMJA 1NG0A 2NMOA 5LATA 4UFLA 2RG4A 1UZWA 4OULA 2DCJA 3LEKA 2Y6KA 1EUTA 3B5LB 2IFWA 3NL1A 3I59A 2C5DA 1F5FA 4RD7A 1WCSA 1ZYBA 1SACA 3PIJA 5FY9A 2W91A 4OVEA 1AXYA 1LEMA 4PI0A 4Y1XA 4YM2A 2QQUA 5K7PA 2HWF1 5L19A 1XSRA 3RRDA 2RE9A 2XMLA 4N7UA 1Y43B 4G9SB 2ERFA 2G1MA 2RS51 2Q30A 2BTVC 3CZJA 3WSOA 5C8CB 3J7MA 1AR91 2DVAA 2VMDA 1W8OA 4M3CF 2OUJA 3AJYA 5DAXA 3ZVXA 4ATEA 5HCHA 3POIA 4O65A 5C8CA 4CPBA 2A6YA 1XE7A 2DFCA 2BOJA 1OBNA 4IQPA 3WW4A 5FWJA 5JXIA 3ZOIA 4DPNA 3PMSA 1WMDA 4YG3A 2R0HA 4FPLA 1T6BX 4W8JA 2GSYA 3B3QE 4ISQA 5J96B 1JHJA 3CJXA 1QJY2 5C3SA 3KT7A 5KC5A 5I0SA 4P14A 1TQ5A 5FWEA 5I93A 2XVGA 3MF6A 4ITCA 1XNCA 1UMZA 5A7WB 4ASLA 2Q4SA 3WW2A 1EV12 2YY1A 3N9PA 1REFA 4ARXA 1QJX2 3ZXKA 4CUAA 1CZVA 1AL0G 1W2AX 3A21A 4RGKA 2YV8A 3AYAA 3EYPA 4H14A 5E8AA 2ADDA 4A45A 4PLNA 1DZTA 2E32A 2WT0A 1BK0A 3FL7A 1D7PM 5L7OB 3O7OA 4EROA 1R092 2FMYA 4FOVA 3SCFA 4V2WA 3WHTA 4Z1VA 3ZM8A 5C3PA 5FDBA 3WF1A 1FI2A 3CJIC 2IXCA 3T30A 1VBC2 2WO3A 3HQRA 4BPZA 4MXWB 3O1TA 1YHFA 1DYPA 4D6RA 3FBYA 4IEUA 2FCTA 1UOFA 1JZ6A 1TZOA 3J8F1 1LECA 1LCLA 1Q8SA 2PLV2 1DU3D 2X09A 4WM7A 3SH3A 4MXWA 3IWZA 4AG4A 1POV0 2RDNA 1UY1A 4P9LA 3A22A 4UFHA 4DY5A 2XQRA 5FZ9A 2VE1A 3JD72 4Y1UA 2G19A 3N35A 4HN1A 3HEIA 4AI0A 5SV5A 3BI3A 1OF4A 1DQ6A 4BLJA 2CTVA 4CCNA 2W1SA 2BBVA 2WNVC 3BGAA 4AAPA 5A70A 3WP4A 1W2OA 1UYXA 4DB5A 1AX1A 4IV1B 4P08A 3T2OA 2IXIA 1EYBA 4CSWA 2Q8DA 4CU9A 1OI6A 2VBPA 3P3PA 1PVC1 2OPKA 4AHWA 5ACA3 4Q4X2 1RUH2 1FNZA 2JDMA 4FOWA 4MGZE 5I0TA 1TMF2 4OMDA 4XMIA 3U0ZA 1ZRIA 1FATA 4JHTA 4CDXB 5BNOB 3VZOA 1H1MA 4UT5A 5IVYA 3VGIA 4BMBA 5FZ1A 2P37A 3OBRA 2J42A 3NVCA 5LASA 3T08A 4PQ9A 1WZXA 3ZMOA 4CDXA 3TEWA 1JYIA 5BNOA 3MW4A 1W0PA 2R061 2WJSA 2ZX2A 3WEZA 3RFRA 1S1AA 1WBLA 3KMHA 3P1IA 3USUB 3O0XA 1KS4A 1GUIA 4L2NA 1LKNA 4M3CE 4SLIA 4MUVA 1US3A 5JAXA 1IPKA 1H2KA 2WINB 3H7YA 4FQZA 4QHBA 4NUBA 3USUA 4JTOA 1PX4A 1SBDA 1YI7A 1LOFC 2R071 2WS93 3TEZA 2ZX4A 3L2HA 4UBGA 5JCTA 3NV4A 1GQHA 3JBG1 5K9YA 1UW8A 2OPWA 3ZFFA 2X05A 4QXBA 2ZMKA 1D2SA 3DPRC 1W0NA 2HLEA 2Y64A 3IAPA 4LO7A 4WV8A 5FYSA 1CAUA 1PMIA 1V0AA 2UYBA 1JZ8A 5T55A 4AW7A 3LKJA 1RVF3 1Q56A 1I5ZA 3POEA 2R6QA 1KGYA 5FZKA 4OHVA 3ZFEB 2BEOA 4HK9A 1U5IA 3HN3A 5FXZA 3T1LA 3VD9A 3AP9A 1N47A 1NA1B 5A6YA 1RUG2 4FPJA 3ZXLA 2HWF2 1JYCA 4E2SA 2K46A 1JYTA 2DVFA 1GR3A 4D7SA 5F6LB 2RS52 2VCMA 3PU8A 5CB7A 3C7OA 4YM3A 1AR92 1CQ9A 4OZOA 5A3NA 2JDKA 3ACIA 4IE6A 3M1HA 5H9SA 1H9PA 1VLNA 2VD7A 2DTYA 4YVWB 2ZOEB 4KU8A 2W68A 1ASJ3 3OGVA 2XOMA 4Q8KA 2DBIA 1IG0A 5F2SA 5C9AA 1Q5OA 2X5IB 2Q1MA 4FAGA 5A32B 3FLPA 4PF5A 3DKQA 4HANA 4YVWA 1H4GA 3ECQA 1PO21 1DQ5A 2VW1A 4NAOA 2EXJA 2YC4A 3ZPOA 4AR2A 1FMD2 4WZCA 3IM0A 2QFEA 5KHGA 5A32A 1Y4WA 1QNYA 2H6BA 1GV9A 1YI9A 2YU1A 3BTZA 5FPXA 3RZJA 4UW5A 3LGRA 3OYWB 4CCMA 1F2NA 1RUE2 2A71A 4RFRB 1FXZA 1EAH2 5FZ3A 2AEZA 1RUNA 3PU3A 4WVMB 2WQZC 3KHCA 1PMHX 2JB8A 2VMEA 1HXS3 3OYWA 4LO8A 4O9GA 4R9DA 3VDAA 5FZFA 1HV1A 1RUJ2 1BVVA 4WVMA 1BBT2 3UKVA 4K40A 2E26A 5ACA1 1L7QA 4HK8A 3ZYBA 2IFRA 2YDEA 4I2OA 5BYNA 4AOCA 2P3YA 3FFQA 2R0FA 3S0MA 1SFNA 1DQ4A 2VH9A 4AFAA 3R0RA 1A6CA 4QPGC 4LULA 5AVAA 3CJIA 1BMV1 1AR71 4OQ9A 1WLWA 2R1BA 4JGZB 4BHPA 4K7JA 1VBA2 5FR3A 5H9QA 5FYTA 2W3JA 4QXKA 3H3UA 3INAA 2YHJA 3WNMA 1CGPA 1QIQA 1ULOA 4QKDA 4EE2A 4B1MA 3B93A 3W59A 4M4PA 1Q8OA 3U10A 4JGZA 1S0BA 2BNMA 3ATGA 3HT1A 4BWOA 3BTYA 2VU9A 1XE8A 5FZ8A 2GH2A 4NR1A 4AHXA 4P9XA 3I2FA 1XNBA 3QLQA 5FCCA 4TZDA 5HPOA 4GD4A 5EFUA 2ARBA 1TE1B 5IK5A 2C9AA 1D0HA 2K0GA 4XEZA 1REEA 3C7FA 2B8MA 2JKBA 2CGOA 3HD8B 5K0UC 2FDHA 2PXJA 4MGQA 3S5QA 3LIHA 1F5JA 4MGTA 2JDPA 1UF2C 3UGHA 2VCCA 1R082 2XJVA 4EYUA 1W6MB 1ZM1A 1IS4A 2X10A 4KWJA 1OKOA 4LA2A 4QGMA 4QXCA 3WVJA 2DCZA 2ZGLA 5AC93 5FP4A 1OFSA 1CAVB 4CCLA 3ZSMA 4YG0A 4CPBD 5AFEA 4COYA 3O1PA 1AYM3 1U12A 1NXMA 2EIGA 1XJAA 4G4FA 4IESA 4M00A 1GQGA 3AP4A 1PO13 4HKOA 1K45A 1DLCA 3WP5A 3OOXA 4COVA 4IUGA 4GKYA 3U78A 4N90A 4CDUC 2GZWA 5FPBA 4CXXA 1W9WA 3M3CA 3PNAA 3OD0A 2PHXA 2OQ6A 1PMJX 4S2DA 5A80A 4DQAA 1ZZ9A 5JMCA 4LHLA 3DN7A 4RN5A 3PUIA 4BIOA 2YXSA 3C2UA 4XHBA 4YVSC 4TWTA 2VNGA 1RHI3 2KM2A 4LBMA 3ZFGA 5AFBA 1AL23 2BGOA 2UURA 3BCWA 2ZEWA 3M3EA 2JE9A 3H0OA 5FZMA 1GNHA 1DBNA 1XQNA 4OZXA 4NIDA 3R6SA 3WT3A 1WCDJ 3O1MA 2QNKA 3AL5A 1BLZA 4AE2A 2Z69A 3N9NA 5F5QA 4QDRA 3H1MA 3MIBA 1AHSA 2J22A 4Z82A 4WVWA 3VV1A 1UU4A 2D40A 2V5YA 3S30A 3FMGA 4ZHNA 1C1FA 4FPOB 1HXS1 2AC1A 4KQ7A 2CDPA 5JIUA 1CJDA 1OQDA 1RXGA 2VOVA 5CADA 2B9VA 3THTA 1KFUL 1WWYA 4XJAA 3VBHC 4L99A 4LOSA 4QD2A 4OI1A 3IAQA 2VZOA 2CDOA 4UFIA 4XUPA 1Z7S3 4EWEA 4D7YA 1COV3 4QB1A 1Z78A 1A3KA 4AGVA 2N7GA 4DIQA 3V0BA 4CDQB 5BY5A 2W47A 1VJ2A 1W9FA 1PX3A 1WW5A 2VZPA 3LAGA 4WM8C 3RZZA 3AKPA 3ZX7A 3VZLA 3NAPC 3RWNA 4RGAA 4QGLA 4LK6A 1W99A 4N7IA 4CDQA 2DFBA 4CCCA 4DRRA 3AP5A 2H0VA 3I7DA 4BQ3A 2LUWA 1CESA 1PK6B 2J1RA 2PHLA 3O0VA 4BA6A 3MLJA 4W4ZA 2BPA2 2EALA 3UT0A 4CCEA 4CU7A 1NT0A 4DFSA 3RI8A 3PVNA 1IG3A 1PK6A 5DAQA 1FPN3 3AMQA 4CUBA 2QDNA 3IN9A 4LLOA 5FP8A 1I9RA 2BGPA 3VZMA 4AEDB 1SLTA 2JXAA 2WQ4A 4MV2A 4UW4A 2W08A 5FUIA 3NWKA 3DECA 3NQHA 1W3XA 1W0OA 2YPJA 3WG1A 3H50A 5I0UA 4DEVA 4NN0A 1ST8A 4Q0UA 5LBCA 4D6SA 3AFKA 1X82A 2V09A 2A6WA 1K5MB 1QXJA 5A7QA 3I3BA 1DGWA 3T2TA 3AJZA 2RMU1 4JKLA 3BTXA 3IT8A 5EZWA 2A70A 5AC91 1FX5A 1G9FA 3N9LA 4O61A 4PIZA 1MQTC 3C7GA 1AYM1 1ACCA 1K5MA 3WG4A 4MX3A 1QDOA 1BXHA 1A8MA 1SEFA 2GU9A 1NLSA 1Q43A 1PO11 4JKMA 1VALA 3B02A 5FMBA 4BYYA 5DPNA 1W28A 4YLZA 2OKXA 2OZJA 3WX5A 1UU6A 4W6WA 1ZZBA 3RS6A 3VBFB 1VIWB 3D5OA 3AB0A 2VZ3A 2WS92 5DUVA 5FXWA 5M0TA 3MICA 4Y1VA 5FZOB 4ARYA 2Y6GA 5A33B 1LHWA 1Q8VA 1VPHA 1WMXA 3OUJA 4QXHA 4QPWA 4Q8LA 1RITA 1KITA 1IPJA 4LO6B 2BOIA 4AQ6A 1JYWA 2DU1A 1RHI1 2SLIA 2VM9A 3N7KA 1RVF2 2D3RA 5E88A 1AL21 1D4VB 5FPLA 5A33A 1C4RA 5L73A 5F37A 3WF3A 1J59A 5C70A 4Q2FA 1P8JA 3OB8A 1NXD1 5K0UA 1RGSA 1YYNA 3K75B 1JUHA 2HKXA 4HZFA 1JOPA 5F5AA 4YARA 1HIXA 5GJ6A 3V0AB 4LHKA 3D4KA 4AZZA 2RDSA 3BU7A 2R30A 4L92A 3WUCA 5FZ4A 1Z0HA 2OZ6A 4E2QA 3C8XA 4LBQA 4FP2A 3V0AA 3HNMA 4K6BA 1Q8QA 2R32A 1DQ1A 3M3QA 3WDUA 1J58A 5IVJA 5A3MA 1HRV3 2VMIA 2UY9A 4FPFA 3LOIA 4PIXA 3FFZA 1ZBA3 2A73B 5FO8B 5T5PA 2XKOA 4QPIB 4NIHA 1ASJ2 2DVGA 1QJU1 4JX0A 2W1UA 1H2LA 3VN4A 4YZ5A 2I45A 2YROA 1NQJA 3DXUA 4XJZA 3QOPA 4EN8B 1AR83 2A6ZA 1ZBE3 4YW2A 2QZ3A 2CHHA 4AQTA 1SHWB 3S5AA 4GH4B 3H8UA 3KT4A 3UGGA 4YVSA 4CP0A 1PNFA 1HB4A 1E57A 1V6LA 2WFF3 3ASIA 3UGFA 4WZFA 3DV8A 1ND2C 1OF3A 1OQEA 2Y6FA 5FZHA 3S57A 4LO4B 4UW6A 2WO2A 2GN7A 1GWLA 4GH4A 2YC2A 3N3HA 2JX9A 1VB4A 3H8OA 2A3XA 3IPVB 3NJVA 3VKOA 2XWJB 2PMWB 1O8PA 4XACA 1FPN1 2BYVE 1HXS2 1MZFA 1HJGA 2JJ6A 2P2KA 3HBKA 1BZWA 2JENA 3GBGA 4J1WA 4QQLA 1B09A 2WNEA 3IPVA 2A6VA 5A7SA 3VLBB 5FMCA 4QAWA 2RM23 4HG6B 5DAWA 4LKSA 5IHRA 1EY2A 4M4RA 2QQLA 3N36A 1OLMA 4GIQA 4OI0A 3SITA 3VBHA 3ZDVA 1G9DA 2Q5TA 2XUEA 2GDFA 1WW6A 2JG8B 1JW6A 3BOWA 5FY8A 1CJPA 2O8QA 4XDQA 3S7EA 4Q0VA 4AEMA 4FSJA 4BDVB 3M70A 4Y24A 4TLGA 2WO7A 3LA7A 4XZPA 4XFFA 2WYSA 3AZVA 4NJ4A 2JG8A 3CIHA 2Q8CA 1CZTA 1SFYA 2RJKA 3DYPA 2PHWA 4WM8A 3T09A 2ZGUA 3LWCA 4XJ9A 1O91A 5T5LA 1TEIA 4TXWA 5CG8A 4GMP3 3KCCA 4MGKE 2D6OX 2PHDA 1V9U3 5IK8A 3KS7A 5IW0A 4Y5TA 2UYAA 2R1DA 4LA3A 2YGMA 4ZZ8A 1GWMA 3AYDA 2VTXJ 3POJA 1V6MA 5DDJ3 2A75A 4Q4Y3 2WNUA 4Y26A 4BB3A 4XILA 1A78A 5G04L 4P9YA 3D3AA 5A3OA 3L9JT 4HONA 1SBFA 2I07B 2EXIA 3VDDB 4OUSA 2JKXA 1OA3A 4XUOA 1JS9A 2Z4FA 4HOOA 4XFCA 4NIAA 1O7FA 5AC92 2ZA9A 1H1IA 2B5HA 3RJ2X 1AYM2 1MS3A 2YBSA 3VDDA 4A3XA 3AZYA 1J3RA 1PO12 4YZ1A 1W8FA 2NMNA 3GYDA 4XFAA 1IOAA 5F3GA 1CVNA 1UZVA 4ZXEA 4QU2A 1MQTA 4QX7A 1BK1A 3ABZA 5FMDA 2EIBA 3PUQA 2CSGA 2F4LA 2ZGKA 1OURA 2VQTA 4WBBA 4B7EA 1VRBA 3POWA 3POBA 3TOJA 1S2KA 4BJ0A 1NQDA 2ES3A 5A1FA 1JZ4A 3RZMA 2EXHA 1SDDB 2QQVA 4LLFA 4YGBA 3IDBB 3POSA 1AL22 5LBEA 3EB7A 4Y22B 1WD4A 4DZGA 4C0BA 3HT2A 4J6GA 4LMFA 3UJOA 2WFF1 5D1IA 4FPEA 4PBPA 1QXRA 4A6SA 1AX2A 2XJQA 4X6QB 1QEXA 4MH0E 3ZYJB 5KXDA 3BKZA 5GM0A 1VAVA 3ZN6A 2B45X 1DG6A 3SMHA 3WQBA 1JOBA 4UFKA 1ZRCA 2ZZJA 4YW3A 1ENQA 1SBEA 4QDSA 4QB2A 5FBJA 3U4XA 2BBAA 2ORZA 1XSQA 4BK5A 2JDYA 3UKNA 1Z7S2 3F2ZA 1COV2 1RUOA 3H3ZA 2UWCA 4WVVA 4GZ9A 1F4AA 2P1BA 3DEMA 4N9HA 4AHYA 5D8AC 2WABA 3E1F1 3J8F3 3QBQA 4P02B 5LZ6A 3QH6A 2QCSB 1XU2A 4LITA 2BVVA 2E9QA 2Y8KA 4QX1A 4G3YC 4IV3A 4BQWA 2VO5A 4IEOA 3VKLA 4TTGA 2BUKA 4KGGA 2E7AA 4HXCA 2J1VA 2J1EA 4FXGB 4JRAA 4CU6A 2OW4A 4HSLA 1JZ5A 4CEYC 4PT6A 2PQSA 4GMP1 3WF4A 5IFTA 5BNNC 5HCBA 1ND2A 1OOPC 4PDWB 1FPN2 1ZVFA 2ADEA 3F95A 1V9U1 2BW8A 2DV9A 2WZR1 3RVHA 1A8DA 1YIPA 2AYHA 3D82A 4BZ4A 3U11A 5FREA 3MIFA 4XFGA 2FHRA 3WQ1A 2PYTA 1O4YA 2ZGNA 2GN3A 2Y60A 1G7YA 2QQJA 3NV3A 3WXPA 4Q4Y1 1KXGA 3I59B 3WNKA 3ZXJA 2HYKA 1GWKA 2YPDA 5F3IA 2KD7A 4CUCA 3Q8EA 1QGLA 2PAEA 3RMYA 5I0DA 1D4M1 1NCRB 1W9SA 4I0BA 4MGSA 2JG9C 4YGEA 3X29B 1L3JA 2WC2A 2R063 4FTSA 3APBA 4XFBA 4TSVA 5IK4A 1NZCA 4XDOA 2WT2A 3IMNA 2OVUA 2EAAA 5A3UA 1NCRA 4DY3A 2BGCA 1CZSA 4I30A 2WUHA 5FRAA 2VVEA 3RGBA 3IBMA 1OQ1A 3EQEA 3ZKYA 2PHTA 3LPFA 2P3KA 3OGGA 1NY71 2R043 4M3CB 5CVRA 5L9BA 3V64A 2PAMA 2R073 3GGLA 4YFZA 4GAZA 4JVAA 1W8TA 4GXLA 1APNA 5KXEA 2JE8A 4NWWA 3JBG3 1YXWA 4M3CA 1JHNA 2CGPA 1CAWB 3OEBA 5LRRA 4CUGA 1LAJA 1ALYA 1XOYA 2OUHA 4IEZA 4LBQD 4AVBA 1BHGA 3OSDA 5JZGC 3T4HB 4XOGA 3D6EA 1UMHA 3RDIA 1CAWA 2JD9A 2O0OA 3KV9A 1ND3C 2C9KA 3SC7X 3VBSA 4FI9A 1BCXA 4QX2A 2O14A 4AWDA 4DS0A 5FMOL 3B94A 1AVBA 3ORJA 2G9ZA 3LDRA 1GNZA 2WLPA 4BE3A 2VVFA 3AZXA 4NRMA 3OGSA 1OC1A 2VMCA 5KHHA 4XCAA 4ASKA 2CU5A 1J1LA 5IAXA 1GANA 2A6XA 3B9IA 2XXZA 3GJBA 3M2MA 4NHXA 3EXUA 4IE5A 5C4WB 2IVJA 2AREA 4BLIA 3BVCA 1HRV2 1V00A 1TNRA 3ST7A 1H1AA 4K9SA 3H42B 3O0WA 4IDZA 5IT6A 3A0KA 4WM7B 1ZBA2 3KVAA 2WR9A 1HDKA 2ORXA 5FJKA 5LBBA 5C4WA 4KG8A 1OPOA 1UIKA 1JOJA 4BQ5A 2IC1A 2ZAAA 5F1RA 5LA2A 1PO23 5IAVA 2JDHA 1J83A 4GKXA 1AR82 1PZ9A 5F5IA 1ZBE2 3SNMA 3ZIWA 2FDGA 1GP4A 2PQQA 5FZCA 3PTRB 3H1WA 1GFF2 2VUJA 5FP3A 2J1UA 4P5HA 1KDKA 2XR4A 4QQOA 2WFPA 5ANNA 2QUOA 1W3VA 3TNQA 1WW4A 5CKNA 1X36A 1OFNA 4XPVA 2D97A 5A3TA 2ATFA 2WAOA 5HI0A 2FDIA 2P3JA 5EP9A 5JXHA 3NNGA 3BTAA 3FHAA 4OMCA 3J7LA 1LOBA 2BVBA 2ARCA 2E7TA 1GBGA 4XF3A 3KHBA 1ZA7A 3IB3A 4NAMA 1JYNA 4BM8A 2W9XA 3OY8B 4KL1A 5FZAA 2XH6A 4EN0A 4XF4A 5CFDB 2DU0A 5LEKA 1AJOA 2RM22 4JC1A 3KF3A 4GWMA 4LNVA 2AENA 3MHZA 2AR6A 2UU8A 2D6PA 1T6GC 3AP6A 3OY8A 5CFDA 3MW2A 1FV3A 1PGL2 1QF3A 2BP6A 1RMU3 2AEYA 2JB4A 3CF6E 4D69A 1AR73 2CL2A 4LQRA 3OPWA 3PMEA 3FUOA 2Y0OA 4M01A 5D8AA 1CAXB 3WW3A 1CR7A 5F9TA 1YJKA 4A7YA 1W6PB 4LBLA 5A3WA 1YFUA 2IVIB 2NPIA 3WG2A 3CQOA 2VZVA 4AVTA 3A23A 4FFFA 4H55A 4K3UA 4RL7A 4UFJA 1CAXA 4DINB 2XL9A 4DRVA 1JMUB 2ZGRA 5IVCA 1HN0A 1U5ZA 1W6PA 2PHFA 2YG0A 3I3EA 1HLCA 2E31A 2R041 4FPHA 3ZFFB 3MFAA 4B3NA 2Z42A 1MEC3 4NE9A 4CEYA 1W2UA 5K8SA 3IIAA 3LF7A 1CAUB 5I0RA 2JDAA 3ETPA 4R9AA 1G9AA 3LE0A 4LEJA 5ERLA 1OOPA 5I91A 4RS5B 4JV4A 1AR61 2PHRA 5DDJ2 2ET7A 3WP6A 4IEWA 4Q4Y2 1QJZA 1VBD3 4KBZA 5C3OA 2ZGOA 5CISA 3WDTA 4IL7A 2RDQA 4RSUA 4A41A 1Y9QA 5IK7A 2W52A 4RS5A 2XJTA 4BXSV 4QKBA 4MHUA 2J1SA 1HB1A 1N3OA 1NYWA 3AKTA 5FY0A 4CDWC 1SCRA 2NP0A 1D2QA 3VBRC 2HWB1 4A7ZA 3VBUC 2DCYA 4ZU5A 3WINE 2JG9A 5BNPC 1RUD1 5EXOA 3ZLIA 1LU2A 4KMQA 3K46A 5SV8A 4LHNA 4N9IA 3HMYA 4X8PA 2BNNA 3U4SA 5C9AB 4R4ZA 1WLTA 1SZBA 3O1SA 3K2OA 2WWUA 4N8MA 3GJAA 5A6QA 1R1A3 2Y0IA 4ET7A 1VBE1 2WIIB 5JI7A 5JXJA 4X6RB 2VNRA 4XUNA 3CL1A 3VD3A 4DUWA 4XJUA 2QJVA 3H1YA 1H2MA 2ARXA 4EV0A 1LHOA 2VCBA 3RZGA 2NLRA 3TN93 1I6XA 1LJ7A 1PGW1 3H8RA 3CU7A 5FOJB 1ENXA 1RUC3 4FPCA 1DQ2A 3O1UA 3RI9A 4QKNA 4IE4A 1ND3A 1ODMA 3NRUA 4XTPA 4KG0A 4HLTA 4LPLA 5FLJA 4GWJA 5JPMB 2Q8OA 4IEYA 2VZUA 1VB2A 4AI8A 1ZRDA 5F7UA 1L7LA 2RR13 4JDOA 1XNAA 4MOAA 1W06A 2HH9A 3ACGA 1UIJA 5T50A 1QJEA 1FT9A 4I09A 2XONA 1WMFA 3MV11 3T0DA 4OUEA 3CJIB 4TLFA 2RVAA 4TYSA 1AX0A 3THDA 3JCIA 1BJQA 2HWC1 3J8F2 3OBZA 5GZGA 1R64A 2R16A 1RMU1 5DUUA 5GKAC 3ZYFA 2C24A 1RIRA 3ZXGA 2P5BA 2P3IA 2HEWF 3UESA 2C4XA 2LALA 1W6QB 4OHYA 1YQCA 2BQPA 3VZKA 2VXRA 1VRH1 2ZACA 2HBTA 2YGLA 3LIGA 3POYA 3WUDA 4AEDC 4JDMA 1LR5A 3FBMA 1E5HA 1HX6A 1UYZA 2SBAA 3J26N 5DN2A 2W1QA 1SCSA 2D5HA 4JGYC 1RB8G 1W6QA 3C7HA 3FUQA 5DXDA 5FZEA 2HYXA 4FVVA 4HMZA 3WP3A 3MI8A 1JYXA 2WA4A 1LOAA 1AYN3 4META 1MEC1 3OEAA 3PUSA 3HNYM 4RR3C 5JPNB 2VZTA 1PVC2 2WNVA 3KQRA 4KU7A 5APAA 3WNOA 3I2DA 4R52A 4ONUA 2F4PA 5EJ3A 1GKBA 3K51A 3NV2A 1WKYA 1MS1A 3V56A 1VBD1 4MLOA 4GWNA 2WN2A 2ZCWA 1YQ8A 3AKQA 2H0BA 4B1LA 1JZ7A 3H7JA 4D0QA 2VQUA 3W58A 2RMU3 3MEPA 2VC9A 5FYBA 2R062 2EF6A 3RYPA 3BU0A 4BQ2A 2VECA 1W8NA 5FPZA 5JSOA 3CNAA 1W2NA 5HXVA 1W04A 3U37A 1LHNA 1PHMA 2R042 3OJBA 2WZ8A 2XBO3 4QQHA 5IYYA 2R072 1GOFA 3EBRA 3KVBA 4PLOA 3UYJA 4GQ7A 3ZFGB 3JBG2 3OGRA 1KEXA 5EV7A 1SMVA 1R1A1 3ZO0B 4N53C 1H8TC 3E5QA 3DPRB 4IETA 5C5UA 1LOFA 3A7QA 5GLVA 4CEWC 2EAKA 2XLGA 5ABJC 2CAVA 4GALA 4YW1A 1W9TA 4DOUA 1JXNA 4HETA 4YYOA 3DPRA 2CY6A 2CAUA 1XYPA 3TN91 2OA2A 4AF9A 2WNOA 3J7HA 4K1ZA 2TUNA 4PCRA 1RUC1 4C8DA 2PTMA 3ILRA 3AVSA 4RGGA 3LEGA 2BWCA 3K4AA 2C1FA 3T0BA 5LY1A 2RS11 1OMIA 4CDWA 1RUI1 2XUMA 2G9FA 1QQP1 4KWKA 3VBRA 1OD3A 4AK3A 5FO9B 2RR11 4GMP0 3I54A 1AZDA 3VBUA 1LOCA 2V72A 1S0EA 3V0BB 3GNEA 2TNFA 3UV9A 3BPZA 4OHWA 3ME2A 3JZVA 4BIFA 3KB5A 3G7DA 1K5JA 4AL9A 5IVBA 1QJU3 2BU9A 2YYOA 4E2GA 3I2OA 1RC6A 1KRIA 1U0AA 4HVOA 2FCUA 3QACA 3BODA 5LY2A 1UZYA 3ZXFA 2ZPXA 4QM8A 2VR4A 4KGQA 5IVVA 2F17A 1LTEA 1PO22 5FY1A 1WBFA 1J3PA 2BZDA 2DUQA 1W8UA 3K3OA 4N43C 4FFIA 2DVBA 1PGW2 4Y1ZA 5L9RA 1PIV1 1YRZA 4C1WA 1G9BA 2GMMA 1OLQA 1JU3A 2QQOA 2VXJA 1GP6A 3VBOC 4CP2A 1W39A 4GB31 4V2VA 2VY0A 4FBFA 3ZYPA 2BFUL 1AYN1 1QOSA 3O1RA 2IXJA 2D6KA 2D93A 2NN8A 1YFYA 1UXXX 1S0IA 3CZUA 2GNBA 1MACA 2I74A 1PZ7A 4MXVA 1MR5A 5ACA2 4EN9B 1C5HA 2OYZA 1YQ6A 1XU1A 1V6KA 2IXKA 1VMHA 3EMRA 3I3DA 3ELNA 1C1LA 2MHFA 2G4IA 3GZTB 1G8WA 1RXFA 1RMU2 4QPGB 4XBNA 2ZEXA 1ONAA 5CFCC 1AR72 5FYVA 5JDBA 4CXWA 1BMV2 1BEV1 2ZX0A 1W03A 5C5TA 2L9LA 4XFHA 3GCXA 5BUVA 2IZWA 4B4RA 4QPGA 5GLZA 3L2YA 3R4UA 1UXZA 5DAVA 1YC61 1C3HA 4MVTA 3O14A 3ES4A 4XW3A 4MYEA 4B4QA 3LDBA 4ZPIA 1D0GA 3EO6A 1VBB3 4RQPC 3SEEA 1SLLA 2QZ2A 2JWPA 2NQYA 2XBO1 1MEC2 1POV1 4Y5SA 4JGYA 4DXZA 2DCKA 3GHMA 2PHUA 5LBFA 3MV01 3DUIA 1W2TA 3WW1A 5F3CA 1NCQC 5EPAA 3MPBA 1VBD2 5K0UB 2YFZA 1JZ2A 4LKEA 3J9SA 2ZGSA 2RJLA 3KD4A 2X29A 3UJQA 3Q8BA 2NM1A 4MHRA 3VZJA 4LBQB 2XB6C 3NKTA 4UW3A 4HVQA 1DYOA 3HQUA 1Y9GA 1KS5A 5DAPA 3CKHA 1RL3A 5FO7B 5KHIA 3M4FA 2HWD1 1GQPA 5JVVA 3I4IA 4XF0A 3ILFA 4AVCA 4BXFA 4UF0B 3I3QA 4CDUB 4FTBA 1CIWA 1HQNA 1LB2A 3E5UA 5DZGA 4COWA 2G9GA 1GOGA 5JUVA 4UF0A 5CAZA 1ZA4A 1B35C 2VZ1A 2ZMNA 1R1A2 2ZAHA 4CDUA 2XPJA 4QX5A 2D6NA 3BOPA 3I3MA 4YVSB 3WHUA 2V4VA 3DYOA 4BISA 4DO0A 1HKDA 1UO9A 4I3PA 4QGNA 2VPVA 4COZA 2VQAA 5CG9A 1X9PA 3M3OA 3LZZA 4XETA 2D5FA 3TN92 4FPGA 3KWVA 4URAA 5C7GA 4BCUA 2JE7A 3AZWA 1RUC2 2OT7A 1NKGA 2OX0A 2QQIA 1SG3A 4ZZ5A 1ULCA 2WWSA 3O5SA 1DLLA 4WVZA 3ZXDA 4FP3A 4AI3A 2AGSA 4SBVA 4M0NA 1R1ZA 2E51A 3R4DB 5LK7B 5J36A 1VAMA 3MUY1 5I8SA 3RMXA 2FBEA 5GLWA 2EA7A 4C91A 3AXDA 3E5XA 4JQRA 5FAXA 3MLKA 2XJUA 3DXTA 5F3EA 3ZSKA 3RZKA 3VBHB 2B7YA 2F6BA 2XWBB 4D3WA 3GDBA 3ACFA 3ZKUA 4IGPA 2QQMA 4W6XA 1C57A 2GMPA 2Y33A 3CLPA 3NW4A 3SISA 3UK9A 3MZHA 1GZ9A 4AFDA 3PIGA 3M3IA 2AZ5A 4WM8B 1GU3A 3NJZA 4XXPA 3I2KA 5FKBA 1X50A 1OT5A 1SPPA 5HCAA 3O1VA 1MPXA 1W8HA 1QWRA 3NNJA 5CEHA 5HBAA 1XRUA 1HRI1 4HKWA 4BQXA 1S0CA 5ISLA 1I3HA 3LSDA 1ENSA 1C28A 3NAPA 2HWE1 2WSVA 3TB0A 1L7RA 4HVRA 5H9RA 4AI9A 3PLQA 4N43A 5IATA 5LA1A 4Q0PA 3NNFA 5FYIA 1H6XA 4IXLA 3UNPA 2XQXA 1IZ3A 2D43A 5E89A 1ENRA 1QNWA 3MIDA 5FZDA 1VBB1 1W9YA 2GAUA 4LBJA 1UKRA 5F8PA 2WZR3 1AYN2 3E6CC 2EICA 2WNUB 5GZEA 5FYUA 3AYEA 2GMEA 1YIFA 1OH4A 2QQNA 4KWUA 4CCOA 3VHRA 2WYFA 3NMBA 2CV6A 4R9CA 1O4ZA 3IDAA 4LUMA 2EVXA 4UBHA 3I97A 3R4SA 1WLDA 4GWIA 3I2GA 1FOD3 1YLLA 3AMPA 1ZRRA 5JWPA 5FY7A 3LB9A 4OQ8A 2QQPA 3K4ZA 2NYYA 2VULA 3PVEA 3WCSA 1D4M3 3DF0A 5GZFA 4BMEA 1RJ8A 3MLLA 5FZ0A 4D7TA 4LR4A 2VMFA 1O8SA 2OQ7A 2RMU2 5C8CC 2P4EA 2JIJA 3P6BA 4BK4A 2VMHA 1IGOA 4CA9A 4AFCA 1MQTB 2OXBA 2TEPA 1JBCA 2ZABA 3MO4A 3TRSB 4DXTA 1CIYA 4JZRA 5FPAA 4LOTA 3S7IA 1KFXL 5F6KA 3KCXA 4NIIA 1LOEA 1W90A 2YZ4A 4I01A 4Q29A 4OHZA 2QE3A 3WY6A 2XBO2 1FNYA 5FK7A 3SCHA 1V6IA 5HXMA 5CBLA 4XHXA 3BIEA 1RTVA 3NJYA 4YPJA 4AGGA 4RQPA 2ZHLA 4CCDA 2A1XA 3HQXA 3SXWA 3OF1A 5FLIA 3HVDA 5CNAA 1RHI2 1EV11 4AVAA 4DXRA 4Y4RA 1K42A 1QJX1 4LBKA 4INDA 1LU1A 3ZYRA 1GZCA 1NCQA 4FFGA 1BYHA 2ZHMA 4XBQA 1WGPA 4A7KA 3ZN6B 4JAAA 1ZZ8A 1DDLA 3VDBA 2E33A 2VMGA 5GALA 4MG2A 1HN1A 3AXEA 5L36A 5JLVA 2WN3A 5L7OC 4J25A 3LPGA 4YWAA 4YNIA 1IKQA 4NRPA 3ROUA 2Z2SB 2YBKA 4PHZA 5IUQA 4YSFA 4Y20A 4EZHA 2C6SA 1F35A 5FPUA 5FUPA 1CX1A 3K77A 5IVEA 1IS5A 4GA9A 3RJRA 5G05L 1O3RA 5B2GB 3KV4A 4MGYE 4XAEA 4IE0A 5FJHA 2PLV1 4XJWA 5GLUA 1DQ0A 3PUAA 4XFIA 5JSPA 1CD3G 2C26A 2WLQA 3B00A 5T5OA 3GBWA 5FP7A 4EN6B 2FMDA 1QJU2 1ZREA 1FV2A 2D3PA 1DZQA 2D98A 3WDYA 1UMIA 3JD71 3NNLA 3AKSA 4IV3B 3USSA 2ZS6B 3N9QA 5KHKA 2W5FA 1GZWB 4Q27A 1B35A 1EAH3 3LA3A 3C3VA 4ZXKA 4S2FA 1N3PA 3HWJA 4F83A 1QKQA 4XQDA 2Z5WA 3Q8CA 3QCWA 4IV1C 1GZWA 4YW6A 1ND2B 3AL6A 2E6VA 3T0AA 1O5UA 1XC6A 2VGDA 3HBZA 5LA9A 1MS0A 2D44A 1XNKA 4Q4X1 5EWSA 1WLCA 3SCGA 1IKPA 5EYXA 4I02A 4QDQA 4CP9A 4XTMA 3ZR6A 4CDXC 2VOXA 5JOYA 2WZPP 5BNOC 5LB6A 5F39A 1LESA 5DZEA 2GP3A 1IHMA 3DL3A 2O8OA 1F15A 1PNGA 3T2PA 3B9CA 3I49A 3RWKX 2GC3A 1S0FA 5KWRA 4L11A 1FOD1 3BALA 3JQWA 5T5JA 1OXCA 4YZ2A 4A2UA 2OS2A 3LFIA 1H6YA 3KV6A 2VBDA 4FPKA 4HKLA 3OG2A 5CZKA 4ES8A 1OKQA 1JYVA 3SLIA 1CPNA 2W92A 1ZZCA 3KQ4B 2V4AA 4PF1A 3WF0A 4F7ZA 2P6HA 3OTFA 2WKKA 3HAGA 1X33A 2ZGMA 2VVDA 4XABA 3FJSA 3TWIA 3LEIA 2VJXA 2FCVA 1JTZX 4C90A 1R083 1ULGA 3VKFC 4LXLA 3ZFEC 1UQXA 3ZIXA 2BWAA 1AR63 3VBSB 1QH7A 3R05A 4QT6A 4UAPA 3AVRA 1NA1C 1NAEA 3ZXEA 1NOVA 1RUG1 1S2EA 1ULPA 2GP5A 1ULFA 3HPNA 3WF2A 5EJ1B 4QHZA 3ZPYA 2B42B 3JB8A 4KI5M 3PUHA 4Q1PA 3PVOA 1UX7A 5IFPA 1V6NA 5DZFA 3TAYA 3MIGA 3WCRA 2YMZA 4FTEA 3FLTA 4YW5A 2HWB3 4ATFA 1FAYA 2PFWA 3ZSLA 4CVUA 1TNFA 5C9AC 5GZCA 1OLRA 5F5CA 1RUD3 4YVWC 3THCA 5DABA 4DUVA 5KR7A 2JEMA 3TEYA 5FZ6A 3RYRA 4BQ4A 5KHJA 4D6QA 2X5IC 3IDCB 3W5MA 1XBFA 2TBVA 1IS3A 1HB2A 1V70A 4DEQA 2ARAA 2V73A 4KH9A 4NHYA 3Q8AA 1S4CA 3G6JB 5A1LA 1FMD1 2JDNA 1VBE3 5A3PA 1LNSA 4NPRA 2QTWB 1QJFA 5FV3A 1O59A 1RUE1 4OLLA 3LDKA 5JR7B 1EAH1 3BB6A 2XJRA 3AFGA 3KZ4C 2VQ0A 2VTFA 4XC9A 3CMGA 5BPXA 4A3ZA 4U2AA 5A7WA 5ANQA 3TBDA 3ZR5A 2WFF2 2E7QA 3B01A 4LJHA 1MZ5A 2VUAA 4NOTA 1H30A 2GNTA 1C8M3 3D8CA 4EJRA 2DUOA 4NPMA 1O4TA 1GSLA 2WA3A 1RUJ1 4NVPA 2PA7A 1BBT1 3GM8A 5F2WA 2ZMLA 3AC0A 4CCJA 5FMOS 5I8TA 3TEXA 3RZLA 4XMAA 3W20A 4Y4YA 4E4ZA 5L7OA 1MS9A 2Y26A 4E4HA 4L0PA 3IZOA 5J3UA 1SLAA 2ET1A 4YM1A 1ULEA 2GC0A 3ETQA 4Q0QA 4FFHA 1US2A 5FIXA 4IEQA 4JGZC 2BRTA 2ZEZA 4COUA 4Y3OA 4JDNA 2CYFA 1VBA1 1K3IA 1SLIA 4QKFA 4W6YA 1UKGA 3MYXA 1MS8A 3NV1A 3PTYA 4IE7A 3PDQA 2HWC3 5D8AB 4IEPA 2VW2A 3VD4A 2FDKA 3ZN4A 1MZEA 1IPSA 4C1XA 2MEV3 3SH5A 5EJZB 3BIWE 4AEKA 1SLCA 3MUZ1 4PJYA 4Y1YA 1VMJA 4Y5Z0 4HFSA 1JU4A 4OFGA 2LTNA 1LGNA 4AFBA 4LBOA 4QB6A 4LUKA 1VRH3 3CDZB 4XQWA 3BUCA 5BV6A 3UETA 1QHDA 2GNMA 1UOBA 3J7NA 4CEYB 3DCQA 3WLUA 2CGNA 1DF0A 3PJQA 4YG6A 2XVKA 4XDPA 5BNNB 3ZYGA 3PJYA 3NNMA 4IV1A 5FQ0B 2R49A 1POQA 1HQLA 5K4LA 1OOPB 3ZMNA 3GZUC 1V9U2 2JICA 3BYWA 1EPZA 3C7EA 2ZX1A 3LQCA 2WZR2 4E4SA 1ZRFA 3GALA 4K8RB 5HV4A 3PVBB 3OPZA 1R081 4NMIA 5BNNA 3B69A 5FQ0A 4YGCA 1JUIA 2VNVA 3U75A 4CU8A 1OHFA 2CWMA 5C8WA 2YU2A 3W9AA 5FPVA 3VL9A 1IS6A 1F9KA 1UD1A 1FOD2 3H3LA 2D3SA 4QM9A 2KXLA 1N1VA 5EYYA 2YFUA 3GXUA 3N7LA 5FYYA 3ZYIB 3FHIB 4NROA 1D4M2 1TVGA 3FN9A 2JG9B 1UAIA 2VCAA 2X8KA 3RNSA 3RQ0A 3SQOA 5IVFA 5IWFA 4YGDA 3HJRA 2HEYF 1GICA 3OBTA 1I5PA 1XPWA 4UFMA 4QPYA 3ZFGC 1XNTA 1NY72 1WCUA 5J98B 4D94A 5LCWL 5FK8A 1BVP1 5I8YA 3AYCA 4LORA 2FZ1A 3NKGA 5C6CA 1IQAA 4I0AA 2WWJA 3LFMA 4YZ4A 4PBOA 3LSEA 4PLMA 5GZDA 5FYHA 1O3QA 3LEMA 2VG9A 3KT1A 4CYDA 3FE5A 4B4PA 5HV0A 2Q8EA 3NSTA
chains in the Genus database with same CATH topology
5JZGB 1KQRA 3ZFEA 1DZRA 1ND3B 2QVSB 2UY8A 5GLTA 1QDCA 1WCKA 1NA1A 5JZGA 1DHKB 2UWAA 2ETEA 1C8M1 2XG3A 4XE9A 2RS13 1RUI3 1QQP3 1S0DA 3HIFA 4CDQC 1QU0A 3SHRA 4L9BA 5KXCA 3N4MA 2GNDA 4H7MA 2X5IA 3GF6A 1ZZ6A 2VOKA 2XKPA 2JDZA 1DGLA 2GALA 1AF9A 1PK6C 2ZX3A 4AHZA 5FOBB 4U36A 4YZ3A 2MEV1 4B8EA 4K20A 3UKTA 2ZGTA 2B39A 1WMEA 4HN0A 5J09A 1PIV3 1DGWX 1SQ4A 3KGLA 2A7AA 2WSUA 4XF1A 1MS5A 5LRSA 1LOGA 5FTTC 3RYKA 2WNVB 1QH6A 4GB33 2VOWA 2VW0A 3WDWA 2K9ZA 4RHV3 2Q0AA 1ZZ7A 3WQ7A 3FC0A 1C8NA 1TME3 3GHNA 1VAKA 4RA0A 4EN7B 1UPSA 2LM3A 3ENRA 2D6LX 3MFCA 4J1XA 4URTA 1K5MC 5JOWA 4R4XA 2ZHKA 2FQPA 4M0HA 1UU5A 1UN1A 1G86A 1LGCA 4F3JA 1BEV3 1GYKA 4Q4W3 1F8VA 3V65A 2UWBA 1FYUA 4K8FA 3VBFC 4AG4A 3IKWA 4NO4A 4C91A 4BQ1A 1VR3A 1MVQA 2D7FA 1O3TA 1KJLA 2WS91 4HPKB 1ZNPA 1X7NA 5J7MA 3OD4A 4AI2A 5JOZA 5BNQA 1QY4A 5DUWA 4MGIE 2VNOA 2GC1A 1POV3 1REDA 3ZSJA 4HPKA 3AM2A 3KGZA 1DGRN 1RVF1 4KWLA 2DYCA 4Q1RA 5J48A 2Y38A 1AR62 4Z92B 1AJKA 3FX3A 2DURA 3KM5A 4HT1T 2BNOA 4QQPA 1YO8A 4BZ4A 4DMIA 1W6MA 1U5XA 4FT8A 4CRQA 5DG1A 2Z79A 4LE4A 1WA4A 3D0SA 1OA4A 2H6CA 5AVPA 1CAVA 4Q26A 1OPMA 3WQ0A 4CDWB 1PM7A 2ZJCA 3VBRB 2HWB2 2AUYA 3UL2A 1RJ7A 4HBNA 4Q4V3 3VBUB 3WDXA 2HWD3 5CA6A 3JUUA 1RUD2 4QPIC 3FZ3A 3RPQA 5BNPB 2PAKA 1ASJ1 4AGRA 1DGRA 3EHKA 2QDRA 2ZHNA 4ES9A 4W65A 4EWDA 5BNPA 2OIIA 1V6JA 2ZGQA 4ZU4A 4GH4C 1YCIA 1RUF3 1VBE2 2ILMA 1V6OA 2RS33 4C0HA 3VUOA 1LHUA 3Q9OA 3WG3A 3M8LA 3J4UH 4YM0A 4KBBA 1C8M2 3CEWA 5T3NA 4B29A 1H2NA 3B7MA 4S2HA 1H9WA 3ZDSA 3MDPA 5KXBA 1O5LA 1Q3EA 4RHV1 1LEDA 3O12A 2JG8C 1TME1 3WNXA 1XYNA 3AMNA 5CU1A 3GZAA 3THPA 4HSJA 2K2SA 1W6OB 2XLAA 1XNDA 4FOYA 3QH7A 4YW4A 2IWGB 4MSVA 2HWC2 4P9IA 3ES1A 2I2SA 1W6OA 2MEV2 1AXZA 5J37A 1LODA 4IEXA 2DWRA 1QOOA 1HRI3 5FFOC 1SLBA 4Q4W1 4NHMA 1VRH2 2WNUC 2HWE3 1EPWA 4JGYB 3VZNA 4AXOA 4FPYA 1AXKA 2YC0A 4ISRA 5TSWA 1YUDA 1Y7BA 4AEDA 4Z2WA 3A4UA 3ILNA 3VHOA 3WD5A 2RHPA 1KJRA 1LGBA 3E6DA 4RR3B 3KLSA 1UX6A 5KBFA 4O9EA 1J1TA 3TNPB 1URXA 2ENRA 3VDDC 2A3YA 2AH2A 2BFUS 3ALQA 4RR3A 2MNGA 4AVVA 2A3WA 2ZGPA 3MF9A 1HV0A 1PVXA 4L97A 3VKNA 1MVEA 2YUEA 4LE3A 2NZ9A 4XYXA 2IXHA 1Q8PA 4MZUA 3FLRA 3WR0A 2E63A 2XVLA 5DG2A 4AYUA 1PZ8A 1I1EA 4NWVA 1WW7A 3SH4A 5JSRA 3OGJA 1KDMA 1NLRA 2CNAA 3LCPA 1RINA 5A3LA 5JIAA 1O3SA 4Q4V1 1XYOA 5JI9A 3GBFA 2QKDA 4PIYA 3VBFA 1CN1A 3JQXA 2WT1A 1HW5A 1DYKA 1NE4A 4L8QA 3RG0A 1BKZA 1QJY3 1OD5A 1QOTA 2XJSA 4ZKTB 1RUF1 4N53B 1H8TB 1ULDA 2ZZQA 4RFT0 4CEWB 5ABJB 5KC6A 1EV13 5DUXA 1QJX3 1S0GA 2MPFA 4N53A 1H8TA 3IDEA 2RS31 4OUMA 3DKWA 4XQ4A 4CEWA 5ABJA 3ACLA 4X8NA 1LENA 4XBLA 3LOBA 1DFQA 1R093 2PN5A 5HCFA 3EJKA 2DTWA 1VBC3 1Z7S1 2HEVF 2RS12 1COV1 1RUI2 2B46X 2DVDA 2HJIA 3AMHA 1QQP2 3KCYA 4Q29A 5FBZA 2RR12 3LA2A 3QD6A 4DNYA 2PLV3 4IV3C 4QMAA 2ZKLA 4QPIA 4ORFA 4XF9A 4QQ2A 2A5ZA 3JD73 1VP6A 1X8MA 1SDWA 3URFA 4I0WB 4B7KA 1EP0A 3A0NA 3NAPB 4P9JA 1LRHA 1M06G 4N43B 2X53S 3MIHA 4PDWC 4LT5A 4XXAA 1PIV2 1UZZA 5E16A 3AK0A 2XLFA 1LULA 1N1SA 4I3GA 2C0ZA 1RUH3 4Q4X3 3VBOB 4GB32 1TMF3 5JOXA 3MGUA 5T54A 2FZ2A 1W6NB 4K21A 4RHV2 1WD3A 2XHKA 1TME2 3MIEA 4KNCA 4CTEA 3VBOA 4F8AA 1G9CA 1YFXA 1NCRC 1WUVA 1W6NA 4K1YA 1YJLA 1U5YA 3E6BA 3OCPA 3VKMA 4BOWA 4JRLA 2JECA 5CFCB 1BEV2 1G6NA 3VHNA 1ZX5A 2DUPA 5T52A 2ZKNA 5H9PA 4Q4W2 1S2BA 5CIRA 2XJPA 3I8TA 2GC2A 4IEVA 5CFCA 4LO5B 3JU9A 1Y3TA 1HQWA 4BH9A 3VBSC 4FQ4A 4RQPB 4LTAA 1X8EA 3CO2A 3VL8A 3AZZA 1BQPA 4AVSA 4FO9A 1QJY1 1NCQB 4AEJA 4V1PA 3ZSEA 1KD7A 1RUG3 1PGSA 4OI4A 1J3QA 2HWF3 4AFMA 4AQ2A 1N1TA 1LHVA 1XXNA 1UPIA 2RS53 3P3NA 4AQSA 1OA2A 4Y20B 5C4WC 1AR93 2GH8A 3FWEA 3H9AA 3WOGA 1YFWA 4R8HA 1HRV1 1M4WA 4JTNA 1R091 2W39A 3AX4A 4Q4V2 5FLHA 2HWD2 4WM7C 1ZBA1 1UL9A 3M7AA 1VBC1 2D6MA 3U07A 3MPPG 1MZ6A 3RSJA 2ZTNA 1CONA 2CWSA 1AR81 3NO8A 4JCKA 1ZBE1 4FCAA 1FMD3 1B35B 3TYJA 1RUF2 2O1QA 4XIOA 4OI2A 3WV6A 4NHLA 4P9WA 4OHXA 5LK5A 1C5IA 2XL7A 2JD4A 1UCXA 1AUYA 1YNAA 4EWAA 1JH5A 4XJ8A 4XIKA 1RUE3 4Y22A 4ZU7A 2P34A 3AKRA 1N1YA 4CP1A 2E53A 2RS32 3HN1A 3N7JA 4Z8BA 2DF7A 2EXKA 4E27A 1QXPA 3WZ1A 1OSGA 3N7MA 2B9UA 1H8VA 3MW3A 1RUJ3 2DCTA 1BBT3 3PHMA 3D0JA 2WL1A 4IERA 5CFDC 1NE6A 4AI1A 5LEJA 4LBNA 3JB4C 1RUH1 2RM21 1N3QA 3DGTA 3HR9A 1TMF1 4HL0A 3AP7A 4NHKA 3VHPA 3ZN5A 1JN2P 1YWKA 1GLHA 1PGL1 2PELA 3AMMA 1CX4A 1H0BA 1S55A 1S0JA 3E97A 1VBA3 2ZBJA 4H3WA 4CZSA 1MS4A 5C33A 4S2GA 1H4HA 3S6PA 4FOQA 4FXKB 4R9BA 4P9GA 2Q1ZB 4FAHA 4GULA 3T1MA 3WDVA 4UXAA 2KA3A 4ASMB 4Q0SA 4YRDA 3ZFFC 1HRI2 3KSCA 4YFWA 2W0XA 2XGXA 2P17A 2HWE2 1DIWA 1PVC3 5BXXA 4E4DX 1F31A 4E9KA 4PDWA 4H7LA 4RS5C 4Z07A 3K48A 5E1RA 5DDJ1 1VBB2 1CPMA 2IXLA 1QMJA 1NG0A 2NMOA 4OULA 2DCJA 3B5LB 2IFWA 3NL1A 3I59A 2C5DA 1F5FA 4RD7A 1WCSA 1ZYBA 1SACA 4OVEA 1AXYA 1LEMA 4Y1XA 4YM2A 5K7PA 2HWF1 5L19A 3RRDA 2RE9A 4N7UA 1Y43B 4G9SB 2ERFA 2RS51 2Q30A 2BTVC 5C8CB 1AR91 2DVAA 4M3CF 2OUJA 3AJYA 3ZVXA 4ATEA 5C8CA 2A6YA 1XE7A 2DFCA 4IQPA 3WW4A 4DPNA 3PMSA 1WMDA 4YG3A 2R0HA 4FPLA 2GSYA 3B3QE 4ISQA 5J96B 3CJXA 1QJY2 3KT7A 5KC5A 5I0SA 4P14A 1TQ5A 5I93A 2XVGA 3MF6A 4ITCA 1XNCA 1UMZA 4ASLA 2Q4SA 3WW2A 1EV12 2YY1A 1REFA 1QJX2 3ZXKA 1AL0G 2YV8A 3AYAA 4H14A 5E8AA 4PLNA 1DZTA 2WT0A 5L7OB 3O7OA 4EROA 1R092 2FMYA 4FOVA 3SCFA 4Z1VA 3WHTA 5FDBA 1FI2A 3CJIC 2IXCA 1VBC2 4BPZA 4MXWB 1YHFA 1DYPA 3FBYA 4IEUA 3J8F1 1LECA 1LCLA 1Q8SA 2PLV2 1DU3D 4WM7A 3SH3A 4MXWA 3IWZA 1POV0 4P9LA 4DY5A 3JD72 4Y1UA 3N35A 4HN1A 4AI0A 5SV5A 2BBVA 1DQ6A 4BLJA 2CTVA 2WNVC 3WP4A 4DB5A 1AX1A 4IV1B 2IXIA 1EYBA 1OI6A 3P3PA 1PVC1 2OPKA 4AHWA 5ACA3 4Q4X2 1RUH2 1FNZA 4FOWA 5I0TA 4MGZE 1TMF2 4XMIA 3U0ZA 4CDXB 1FATA 5BNOB 3VZOA 1H1MA 3VGIA 4BMBA 2P37A 3OBRA 3NVCA 4PQ9A 3ZMOA 4CDXA 1JYIA 5BNOA 3MW4A 1W0PA 2R061 2WJSA 2ZX2A 1S1AA 1WBLA 3KMHA 3USUB 3O0XA 1KS4A 4L2NA 4SLIA 1LKNA 4M3CE 4MUVA 5JAXA 1IPKA 1H2KA 2WINB 3H7YA 4FQZA 4QHBA 3USUA 4JTOA 1SBDA 1YI7A 2R071 1LOFC 2WS93 2ZX4A 3L2HA 4UBGA 5JCTA 3NV4A 1GQHA 3JBG1 5K9YA 1UW8A 3ZFFA 2ZMKA 1D2SA 3DPRC 4LO7A 4WV8A 1CAUA 1PMIA 2UYBA 5T55A 4AW7A 3LKJA 1RVF3 1Q56A 1I5ZA 2R6QA 3ZFEB 4OHVA 2BEOA 4HK9A 1U5IA 3T1LA 3AP9A 1N47A 1NA1B 1RUG2 4FPJA 3ZXLA 2HWF2 1JYCA 4E2SA 2DVFA 1GR3A 4D7SA 5F6LB 2RS52 5CB7A 4YM3A 1AR92 1CQ9A 3M1HA 5H9SA 1H9PA 1VLNA 2DTYA 4YVWB 2ZOEB 4KU8A 2W68A 1ASJ3 4Q8KA 5C9AA 1Q5OA 2X5IB 2Q1MA 4FAGA 5A32B 3FLPA 4PF5A 4HANA 4YVWA 1H4GA 3ECQA 1PO21 1DQ5A 2VW1A 2EXJA 1FMD2 4WZCA 3IM0A 2QFEA 5KHGA 5A32A 1QNYA 2H6BA 1GV9A 1YI9A 5FPXA 4UW5A 3LGRA 3OYWB 1F2NA 1RUE2 2A71A 1FXZA 1EAH2 1RUNA 4WVMB 2WQZC 1HXS3 3OYWA 4LO8A 4O9GA 4R9DA 1HV1A 1RUJ2 1BVVA 4WVMA 1BBT2 3UKVA 4K40A 5ACA1 4HK8A 2IFRA 2YDEA 4I2OA 5BYNA 3S0MA 3FFQA 2R0FA 1SFNA 1DQ4A 2VH9A 4AFAA 3R0RA 1A6CA 4QPGC 4LULA 5AVAA 3CJIA 1BMV1 1AR71 1WLWA 2R1BA 4JGZB 4BHPA 4K7JA 1VBA2 5H9QA 4QXKA 3H3UA 3INAA 2YHJA 1CGPA 3B93A 3W59A 1Q8OA 3U10A 4JGZA 1S0BA 2BNMA 3ATGA 3HT1A 4BWOA 2VU9A 1XE8A 2GH2A 4NR1A 4AHXA 4P9XA 1XNBA 3QLQA 5FCCA 4TZDA 5EFUA 2ARBA 1TE1B 5IK5A 2C9AA 1D0HA 2K0GA 4XEZA 1REEA 2B8MA 2JKBA 2CGOA 3HD8B 5K0UC 1F5JA 1UF2C 1R082 2XJVA 1W6MB 1ZM1A 1IS4A 4QGMA 4KWJA 3WVJA 4LA2A 2DCZA 2ZGLA 5AC93 1OFSA 1CAVB 5AFEA 3ZSMA 4YG0A 4COYA 1AYM3 1U12A 1NXMA 2EIGA 4G4FA 4IESA 4M00A 1GQGA 3AP4A 1PO13 4HKOA 3WP5A 4COVA 4GKYA 4N90A 4CDUC 2GZWA 3M3CA 3PNAA 3OD0A 2PHXA 4S2DA 4DQAA 1ZZ9A 5JMCA 4LHLA 3DN7A 4BIOA 2YXSA 3C2UA 4XHBA 4YVSC 4TWTA 2VNGA 1RHI3 2KM2A 4LBMA 3ZFGA 5AFBA 1AL23 2UURA 3M3EA 3BCWA 2JE9A 3H0OA 1GNHA 1DBNA 1XQNA 4OZXA 3R6SA 3WT3A 1WCDJ 2QNKA 4AE2A 2Z69A 5F5QA 3H1MA 3MIBA 1AHSA 4Z82A 3VV1A 4WVWA 1UU4A 2D40A 2V5YA 3S30A 3FMGA 1C1FA 4FPOB 1HXS1 4KQ7A 5JIUA 1CJDA 1OQDA 2VOVA 5CADA 3VBHC 3THTA 1KFUL 4XJAA 4L99A 4QD2A 4OI1A 1Z7S3 4EWEA 4D7YA 1COV3 1Z78A 1A3KA 4AGVA 2N7GA 3V0BA 4CDQB 5BY5A 1VJ2A 1WW5A 3LAGA 4WM8C 3RZZA 3AKPA 3ZX7A 3VZLA 3NAPC 3RWNA 4RGAA 4QGLA 4N7IA 4CDQA 2DFBA 4DRRA 3AP5A 2H0VA