1S4CA

Yhch protein (hi0227) copper complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
155
structure length
150
Chain Sequence
MIISSLTNPNFKVGLPKVIAEVCDYLNTLDLNALENGRHDINDQIYMNVMEPETAEPSSKKAELHHEYLDVQVLIRGTENIEVGATYPNLSKYEDYNEADDYQLCADIDDKFTVTMKPKMFAVFYPYEPHKPCCVEKIKKLVVKVPVKLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein HI0227
publication title Crystal structure of the bacterial YhcH protein indicates a role in sialic acid catabolism.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Structural genomics, unknown function
total genus 39
structure length 150
sequence length 155
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04074 DUF386 YhcH/YjgK/YiaL
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.370 Mainly Beta Sandwich Jelly Rolls YhcH/YjgK/YiaL 1s4cA00
1S4CA 1JOPA
chains in the Genus database with same CATH superfamily
4JDNA 4MGZE 2MEV3 2PHRA 4WV8A 1PIV2 5LA1A 1H4HA 4CPBA 2ARCA 3BTZA 1RUC2 2FHRA 3N9NA 1FMD3 1LHVA 3T09A 3THDA 4NAOA 1YIFA 1E5RA 5IVCA 5E6HA 3B01A 2A6WA 2FZ1A 5F32A 3AKQA 1N1SA 2ZAHA 5FTTC 3GXUA 3G7DA 2JDAA 4KNCA 3O0VA 2GAUA 4AVSA 3MIFA 2WT1A 2YBPA 4YVWB 4OVEA 4IV3C 1PO23 4XXAA 4AEDA 2WABA 2VUCA 3CEWA 5DUVA 5BPXA 1R083 1VLNA 1JU3A 2DV9A 1UCXA 2JDHA 1X50A 4IEZA 2DTYA 3LSDA 5CB7A 1LR5A 5E16A 3OGSA 5KHHA 3W59A 4XOGA 2XHKA 4LA2A 2JG8A 3VKFC 4DOUA 1O91A 5FUNA 4E4ZA 2J22A 4IERA 3H42B 4YZ4A 1GU3A 3K48A 1UMIA 2IXCA 3W5NA 2OQ7A 4WVMA 2VOXA 5FZIA 5I93A 2BEOA 3M3IA 1WA6X 2WJSA 4D6SA 5JZGB 1PVC3 4YZ3A 3WOGA 1Q3EA 1W8ZA 1XBFA 2JG9C 4JGZC 3C7GA 1CAXA 5EQUA 2WN3A 1BK0A 2V73A 3RQ0A 1ENRA 3RYKA 4BIOA 4ZU4A 1VBB2 4DB5A 3BN6A 4XBLA 3VZOA 3OYWA 3VGIA 3ZYFA 5A3UA 4Y20B 2ZPXA 1MS9A 1LEDA 2PFWA 3INAA 3ZFEA 4OQ8A 1S0CA 2DCYA 3ZLIA 3JBG1 4IV3B 4HL0A 5FJKA 1W9SA 4AGVA 4K40A 4Q8KA 5FXWA 5SV8A 3ZDSA 3N9QA 1UY3A 1RUG1 3SLIA 5K0UA 3VKMA 4CTEA 3SQOA 3I2GA 4FVVA 3RS6A 2WFF3 1ACCA 3VLBB 1SLTA 4CRQA 3S5QA 5FZAA 5FPUA 1L7LA 1GP6A 3H1YA 4XUQA 2DTWA 5LA0A 1W6MB 4MGTA 1X7NA 1W6OA 4G3YC 4CUCA 2XQXA 5FO7B 1AR83 5JIAA 2HLEA 3GZEA 5DAPA 2Y0OA 4EN7B 3CHXA 4D94A 1RHI1 2SBAA 4OHVA 4XUTA 3USSA 4A45A 1V6MA 5BNOC 2GH8A 2QDRA 3LIGA 3R4UA 3WCRA 3E5UA 4P9YA 3V0AB 3LA3A 4LKDA 4UFMA 1UXZA 2DUPA 3E5QA 4XUPA 3ZSMA 4JGZB 3I2JA 2FDIA 3CL1A 2WZR3 5TSWA 1IPKA 4V2WA 4XURA 1WW4A 2RR13 5IJRA 3THCA 2PHFA 3C7EA 4M3CF 5FZ7A 2CSGA 2RS11 2VMDA 4NJ4A 3UYJA 4BOWA 3RZHA 2XLFA 4HN1A 2JDYA 2ZGOA 3KHBA 1V6IA 1KS4A 1H2NA 2OT7A 4N90A 2E33A 4AEKA 1PX3A 4AYUA 4XBQA 2ETEA 2EIEA 3AXEA 1MACA 2G4IA 1CZSA 4FPEA 3R6SA 3RFRA 4FAGA 2JE9A 2VJXA 1UF2C 2P4EA 4NHLA 5GLZA 1ZBE3 2VUDA 5J09A 1Q8PA 4UOJA 1OI6A 1W8HA 5A3LA 1PMJX 5I8SA 3F95A 4LKEA 5E89A 3ZFFB 1BXHA 1POQA 2BU9A 2ZA9A 1J3QA 5B2GB 4QHBA 4AFCA 1QJX3 3H3UA 2BWAA 4TYSA 1IZ3A 3EBRA 5BNOB 3A4UA 4LKFA 4XUOA 1W6NA 5JIUA 2TBVA 5KR7A 2VECA 1QJEA 1SLAA 3NV4A 1ULFA 3RJ2X 1PX4A 3Q9OA 1H6XA 2EAKA 4E4SA 1QXPA 2CDPA 4JDOA 2YFUA 4R4ZA 1E5HA 5D8AB 3RRDA 5I0RA 2ZEYA 5FRAA 4XYXA 1W99A 3SCHA 1RVF3 4QQPA 2GDFA 3FL7A 3UJQA 2KM2A 2HBUA 2KD7A 3GCXA 3V0BB 2ZEZA 3OSDA 4IEOA 1QJY2 2UY9A 1DQ0A 2V5YA 4NIGA 3NAPB 5FZOB 3HBZA 4FPFA 5FK8A 1UZ0A 1QJU2 1W9TA 4D3WA 1RXGA 2Z79A 3M3EA 4QT6A 5KWRA 3PUAA 3U78A 3SEEA 1OD5A 4XFGA 1MZ6A 2WYFA 2PXJA 1ZZ9A 3OF1A 4MGQA 4AEDC 3MZHA 4RSUA 3WF0A 3O12A 1H1IA 1H4GA 4CUGA 3U75A 4XFAA 3DPRB 3IDBB 2I74A 3ZXKA 3W21A 1BHGA 3ETPA 1OLRA 3OD0A 4GKXA 4LBLA 2VMIA 4MX3A 4UWDA 2JG8C 4P9JA 5GZCA 2P2KA 4UYBA 4MGSA 4FCAA 1NCRA 5CNAA 3LZZA 2XDVA 1Y4WA 1UYXA 2JDNA 5DZEA 1H8TA 5A7WB 1AZDA 1XNAA 3AFKA 1WCUA 1ZVFA 4NE9A 1HV1A 3ZFGA 2DWRA 3AYCA 2JDUA 1K5MC 3WQBA 3MW3A 1AUYA 4XPVA 5CG9A 4PQ9A 2XG3A 1F8VA 1FYUA 2HWE1 2JIJA 2Q4SA 3I3BA 4RN5A 1OOPB 2C6SA 2EXKA 4YW7A 4CZSA 2AZ5A 1Y9GA 3UT0A 2P3JA 2ORZA 2QQIA 1ULCA 4QGNA 1YJKA 4A7KA 1TQ5A 2A3YA 4MHUA 1LODA 3UKNA 1RINA 2W94A 5FMOL 3M8LA 3WDWA 4XF0A 4J25A 2IVIB 2IXHA 2GC0A 4Q4X3 1OKQA 4Y5TA 2EICA 3SKJE 4UXAA 3W58A 1RUJ1 1ENSA 1X8MA 3POWA 4ZZ5A 2BTVC 3NJXA 5A1FA 4QX0A 2KA3A 3CQOA 1ZRFA 3WW3A 3HIFA 2ZJCA 5FMCA 3POGA 2DCKA 3VZLA 1UOFA 3A7QA 4FI9A 4LA3A 5IVVA 3HVDA 5CBLA 1DLCA 1QEXA 2VCAA 2AEZA 2CTVA 1HDKA 3FBMA 3I3DA 5GZEA 5T5LA 3UV9A 1DYKA 4M0NA 2VAUA 1JZ3A 1OBNA 4FP2A 3P3NA 4XDPA 3Q8EA 3OGVA 1K5MB 4ZXEA 2D40A 1ODMA 2QQVA 3WNPA 3WW4A 4META 4BM8A 2GMMA 2XMLA 4LBQA 4E2QA 4L9BA 2ZOEB 4LO8A 2NQYA 4RGKA 4OI1A 3WD5A 1UU4A 3HAGA 3LB9A 1DYPA 1WW5A 2R16A 1BJQA 1UQXA 5T54A 5K7PA 2WNEA 3VZKA 1AXYA 1CAUB 1B35C 1ENQA 1DBNA 4IUGA 1S4CA 1UKRA 4ES8A 1GP4A 3EQEA 1ASJ2 2GMEA 2XJTA 3CMGA 4TN7A 2BNMA 2D44A 3VN4A 5F3IA 2IWGB 2ZMLA 4W50A 3O1RA 4YLZA 1J58A 2XJUA 3AXDA 1N1TA 1CAVB 1GV9A 5L7OC 5CFDC 4UF0A 3JD71 1AYM2 3M7AA 3KCXA 2P5BA 4PIYA 5IATA 1YI7A 4GMP0 4HVRA 2GALA 3WG2A 5CKNA 3S57A 3T4VA 3ROUA 4B4PA 4TLGA 4FFFA 3WNOA 1WLWA 3ZN6A 5JR2A 5FYMA 3N3HA 5JXJA 1TE1B 4TWTA 3MIGA 3WDUA 1NUKA 2C9AA 1RUF3 2QQPA 4QQOA 1QJFA 1RXFA 4YW4A 2RJ2A 1ULDA 2QVSB 4BK5A 1JOPA 1FI2A 1UZVA 1FXZA 4OUSA 5SV5A 3HR9A 5LBFA 4P9IA 5FOBB 3KF5A 3FJSA 4IE6A 1XQNA 4I0WB 2OZ6A 2W87A 4XC9A 4XFCA 4NVPA 3DCQA 4XQWA 5LWBA 4FPHA 3T4HB 5JSPA 4P14A 2GC2A 5JAXA 1MEC2 4LR4A 2RMU1 5CZKA 3V64A 4BDVB 5B4NA 1B35B 3RZMA 1FT9A 2VTFA 1WD4A 1HRI1 3VV1A 4DO0A 1T2XA 2VW2A 4I3GA 5JOZA 4QPGA 4Y22A 1CD3G 5L7OB 2E53A 2J1SA 2GMPA 3O14A 2Q0AA 5HV4A 1W39A 5JXHA 5CFDB 5IT6A 4NPLA 4IEPA 4F8AA 1SDWA 2VVFA 3D8CA 2XPJA 5IK8A 4CA9A 1NOVA 1QHDA 1NCRC 3RI8A 3N7LA 2CWSA 2DF7A 1C8M3 1K5JA 3ZYPA 2PHTA 4YW6A 4IL7A 2BBVA 4QHZA 2VMCA 1BK1A 2W91A 4FQZA 1H2KA 2MPFA 1VP6A 4YW3A 1S0DA 2JWPA 3VDAA 4OI2A 4HVQA 2VCBA 4B4QA 4HONA 4D69A 1QDOA 3ZYIB 1D4M1 1LOEA 1JN2P 2DUOA 1UY0A 4K7JA 1W3VA 3I2IA 3LPGA 4CUAA 4WVZA 1JYNA 1X82A 4FTBA 1HJFA 1SLIA 4Q4V1 3AMNA 1ZZ7A 3TYJA 4Q8LA 1D2QA 4CEYA 3KD4A 1WW6A 2VBDA 3SC7X 1JYVA 2XJPA 2QNKA 1DQ1A 4EWDA 1U5YA 2XL7A 2WNVB 1NXMA 4LEJA 1MS1A 3N7JA 3VBUC 1RUI3 4W6WA 1VBA2 1LU2A 4N53C 3POBA 5T5JA 5F9TA 1JZ4A 2R042 4DZGA 2P17A 4B7EA 4EJRA 2A73B 4IE7A 4I09A 3VL8A 1POV1 1SZBA 4NIIA 3VHPA 3VBRA 3TEWA 2HWC1 4LITA 1JODA 1NE4A 4LJHA 5A7NA 4BK4A 4D7TA 5IK5A 3LDKA 5IUQA 2PN5A 5M0TA 2VNOA 4Q27A 1UMZA 1O4YA 2HWB3 4S2HA 4GD4A 2RJKA 4QPWA 4HLTA 1EV11 1ZBA1 2F17A 4NRPA 3ETQA 2HWD1 2ZHMA 4FT8A 2PQSA 1GYKA 5LBEA 5AC92 3J7NA 3AVRA 5C3PA 2JIGA 5CADA 4SLIA 5JVVA 4LMFA 1FPN2 3D3AA 2FDHA 4YZ1A 3LOBA 4I2OA 4YZ2A 3RZLA 1PGW1 3CDZB 2R073 4NIHA 4RA0A 3A23A 3FLPA 1W8FA 5H9PA 5A7PA 1JUIA 1SBDA 1W3XA 1CR7A 2HWF1 4U2AA 3ZSJA 2DU1A 3KSCA 4HKOA 5DDJ1 2BBAA 3L2HA 1RIRA 4D0QA 3VBUB 2XONA 3MFCA 5FZDA 5CG8A 1JYTA 1OT5A 5CKQA 4ARYA 5FZ1A 4N53B 5F7UA 3UJOA 4O65A 4CDQA 1O6UA 1RUC3 1RMU1 2R062 1R081 2YPJA 4H14A 4N9IA 1RUE1 1W90A 5DAQA 3B3QE 5IWFA 3WF1A 1SCRA 4OUEA 5JWPA 2MHFA 1SQ4A 2WWJA 3RMYA 5FZMA 2B39A 1T6BX 1UY1A 1YQCA 2B8MA 3BTAA 3ORJA 3KMHA 1V9U1 3POYA 4UI9L 4ZS2A 5JMCA 2NMOA 3BALA 3WCSA 2X8KA 4CXWA 1DCSA 5GZGA 5FXVA 5BNQA 2AACA 1V6LA 5EJZB 3VBHA 1AR92 1L7QA 4JVAA 2W0XA 4O7XA 4COWA 2BQPA 5BNPB 3T2QA 5DMYA 3LF7A 2RJLA 2F6BA 4S2FA 3JXSA 4F3JA 3WHUA 1DDLA 2FQPA 2NN8A 1AYN1 2ZMNA 4GB31 1VBC2 1W6PA 2GNDA 4I30A 3OGJA 4OZXA 1S2EA 3MIBA 3ASIA 3LOIA 3VD7A 1DYOA 2DVFA 2H0VA 2R0HA 2P3KA 3VD4A 1JHJA 2H0BA 1FATA 1VBB3 4E27A 3CJXA 4SBVA 4JTOA 2OZJA 4FBFA 3AKSA 4QPIA 2VZTA 2ZGNA 5APAA 1RUD2 5FAXA 3U4XA 2WFF1 2BRTA 3DL3A 1GUIA 4A6OA 3FUQA 4FPKA 4XQDA 1KJRA 2Q8CA 2P6HA 2FDGA 1SLLA 4LHSA 4AI1A 4WVVA 1AR81 4NIDA 2VU9A 1EAH3 5EFUA 4RR3B 4DEQA 2Y6JA 3ABZA 4LK7A 4RFRB 1XU1A 4RGGA 1NA1A 3VDDA 2VOWA 2V4AA 5KC5A 3P6BA 3Q8BA 2ZHNA 1BEV2 4M4PA 3K4DA 2WZR1 2P37A 2ARAA 1GBGA 2RR11 1AR71 1VBE1 2Q8DA 4XMIA 3WG3A 4CE8A 4Y1VA 2VZRA 2EIDA 3OUIA 3PMEA 4Y4YA 5E1RA 2R32A 3DXUA 4CEWA 5A70A 4JC1A 4XJAA 4DXZA 5A6QA 3I2OA 3LDRA 4JKMA 1Q56A 1K3IA 1EYBA 3B7MA 2O0OA 1F31A 3CU7A 5C3SA 3O1VA 2Y6HA 4M00A 2BPA2 2LROA 4AG4A 4R8HA 3AP5A 3PUQA 3O1MA 5A32A 4KI5M 1TEIA 3VBRC 3N36A 4XE9A 5H9SA 2VE1A 2XBO2 3CNAA 4I01A 2OW4A 2BFUS 2P6CA 4LE3A 3SITA 3ZOIA 5BNNA 1NE6A 3MLJA 3BB6A 1TME2 4GULA 4LBNA 2WN2A 4XCBA 1BBT1 2QKDA 3GJBA 4WM8B 4BE3A 1JZ6A 1O7FA 2ENRA 4HXCA 3LIHA 4LUMA 4HK9A 1E5IA 1HQLA 1VJ2A 5G05L 5A3PA 3JU9A 4A3ZA 1CGPA 5F3EA 3I3QA 1R092 3W9AA 4HKLA 5IHRA 1PK6A 3BIWE 3DYPA 1UIJA 1UZZA 3GYDA 1GNYA 2BUKA 3LA2A 1OHFA 5G04L 5CFCA 4GWMA 1SLCA 2FDFA 2B42B 4JGYB 1JMUB 5B4XA 4RFT0 3IM0A 4B3NA 4CPBD 4FOVA 4FFHA 1RVF1 3OCPA 3WNLA 1NY71 2J42A 4LO5B 4BQ4A 1PNFA 3H8UA 2BOIA 4Q29A 2QQMA 1YFWA 4MG2A 3JB4C 2K46A 3LQCA 2B46X 3HNMA 3IIAA 3J8F1 1UIKA 1ST8A 3RZGA 2XJQA 4GA9A 4AK3A 4CCKA 3WP3A 3LWCA 5BY5A 4LLOA 5JOYA 4E2GA 1UPIA 1HRV1 2WUHA 1HV0A 3AKPA 5BUVA 1HXS1 1QU0A 1QJY3 3JQWA 1SFPA 3HNYM 1K42A 1QJU3 5LK7B 1PZ8A 2L9LA 3BI3A 5GLTA 3HQXA 2I2SA 5HCBA 3I8TA 1DF0A 3K75B 3WP5A 3KHCA 4B1LA 5DG2A 3AL6A 1AL21 2RS51 2D3PA 4WM7B 1AJOA 2CDOA 1XXNA 3HMYA 3M3QA 2GC3A 3NSTA 3O1OA 5FYUA 5HCFA 4Q0QA 4YVSA 4AFDA 2YB7A 4IGQA 3UETA 2VH9A 3WQ0A 3TEYA 1RJ8A 1H6YA 1XB9A 4MLOA 3C8XA 4OZOA 3BYWA 4IEVA 4P9GA 3B02A 4QMAA 2R1BA 1UYYA 3PIGA 1XSQA 5GM0A 2NPIA 1CJDA 3U4SA 2UY8A 3MEPA 1V6OA 2W3JA 3RNSA 3N9PA 3MBWA 2ZMKA 5FZBA 4PI0A 2DUQA 3QLQA 3UGGA 4IW3A 1LOGA 4Q1RA 4Q4Y3 1CX4A 3VUOA 1WBFA 3AP7A 3JBG2 3MIDA 2RM23 4DINB 2GNMA 1ZREA 2JDPA 4Q4X1 2ARXA 4QB6A 4GH4A 1G9DA 1RUG2 2PHDA 2B5HA 2YU1A 1RL3A 4ZZ8A 4OLLA 2YROA 5L19A 3TN91 3W20A 3PVBB 4FFIA 4ORFA 5FY5A 1XOYA 5A1AA 3AB0A 3C7FA 3GF6A 4HPKA 1HB3A 1U5IA 3N7KA 1QOOA 3MV11 5C8CA 1RHI2 4Q4W3 1WCKA 4WZCA 4V2VA 4DRVA 5CKMA 3OGRA 2BVVA 4IEQA 3BPZA 3VDDC 4AI9A 1IGOA 1U5ZA 4NHMA 2FCUA 2PHWA 4GIQA 2XUEA 2R7EB 3FC0A 4PDWB 4O9GA 2VMFA 4N9HA 4S2DA 1JTZX 2AUYA 4KWLA 1WGPA 2RS12 4LO7A 2QUOA 3AZYA 1E57A 5F5IA 4IV1C 3ZM8A 2X5IB 3IAPA 3NNGA 1LOFA 1VR3A 4CEWC 5LRSA 4OCTA 4M0HA 3ES4A 4FXGB 2J1RA 2XGXA 5FY8A 3LEMA 1HB1A 1W9WA 4AHWA 1G9AA 3ZVXA 4HN0A 2IFRA 4LLFA 1US3A 1MVQA 1RUH1 3H50A 5A7QA 5FYIA 4CCEA 4UAPA 4IEYA 1K45A 3VKLA 4DS0A 1CWPA 1M4WA 2ZHKA 4JHZA 5FR3A 1STMA 3FN9A 1NG0A 2EIGA 2TUNA 3U10A 5BNNC 1J1LA 4AL9A 1DGRA 2VVEA 2CV6A 5KHJA 1W6QA 3ZMOA 4JRLA 3LFMA 2GN7A 1ASJ3 4E8DA 4GQ7A 4LOSA 1QQP1 1SPPA 2VZVA 4QM8A 5LBBA 1JZ7A 3WDXA 2NMNA 2Y60A 1XNDA 3IDAA 5FPLA 4OHXA 2OVUA 1PZ7A 3JUUA 3RYPA 5DQ0A 1PK6C 4N7UA 3VBOC 5A6XA 1P8JA 4Q0PA 1O3SA 3MIEA 3U07A 2WT0A 5CFCC 1QY4A 1R1A3 5F37A 3A0KA 1V00A 3JZVA 1YFYA 4ATFA 4RD7A 1XNTA 1RTVA 3GDBA 2NYYA 5FY4A 1NCQC 2W46A 4IV1B 4WBBA 1POV0 2DCJA 4H2AA 2ZTNA 4IEWA 4QU2A 3WX5A 4AQTA 1W9YA 1O3TA 2XVGA 1TZOA 4LE4A 4CDUC 4URTA 4HMZA 2GZWA 3TAYA 5CEHA 3E6CC 1JUHA 5FIXA 2Y64A 5FUPA 3MIHA 1Y9MA 3JB8A 1MR5A 4DFSA 4HSJA 2PAKA 2W1QA 2YC2A 2WAAA 4MXWB 1OUSA 2XQRA 1BVP1 4MGYE 4LPLA 4GWNA 1AXZA 1DP0A 2HKXA 3KB5A 3MUZ1 3VBSA 1MEC3 1ULEA 2YPDA 3IPVA 4A3XA 3URFA 3RDIA 1A78A 1CAWB 4GZ9A 4XW3A 2RDSA 1IG0A 2VR4A 1TMF1 1VALA 2LW8A 4UFJA 4CCLA 2D6OX 4I0BA 4LNVA 5EYXA 1HB2A 3KS7A 1ND3C 4YRDA 4GKYA 5C71A 4YVSC 3VBOB 1QOSA 1G7YA 1W9FA 4L99A 1AR61 1OPMA 3DKQA 4MH0E 2HWE2 4OYUA 4RHV1 2VVDA 3AMMA 3WP4A 1IPJA 4AHXA 1NCQB 4LBOA 5FYVA 4D6QA 4PLNA 3ZYJB 3GHNA 4M3CB 1N1YA 4QDRA 3CO2A 3AKTA 1X33A 4KWJA 1O8PA 1WBLA 4BZ4A 5C3OA 4CDUB 2W1SA 4JKKA 4PBPA 4OULA 4R9AA 3HOBA 3S0MA 3KQ4B 1GZCA 2AH2A 4R4XA 3RJRA 4CP1A 4GH4C 3OY8A 3WUDA 3TEZA 1AL0G 4PBOA 2JG9B 5A7OA 1RUJ2 5JOXA 3ZXFA 3MF9A 3GZTB 1G9FA 2WL1A 1XSRA 1RUI1 2V5DA 4JKLA 1V6NA 2G9FA 3S30A 3X29B 5FLJA 2ADDA 2W39A 3RWNA 1WCDJ 5FCCA 5KHGA 4LBMA 2Z4FA 4OUMA 2G9ZA 2PLV1 3OPZA 3GBGA 4L11A 3MLKA 4QGLA 1QJZA 2WAOA 4XJWA 1VRH2 4A7YA 4DUWA 3NV3A 2RDNA 2ZEWA 5F5CA 3SNMA 3IWZA 1DG6A 2A6YA 4J1XA 2GC1A 1ND3B 5FY7A 3ILRA 2HWB1 4QXKA 4XFIA 5ISLA 1G9BA 4K6BA 2W08A 5FMDA 3FLRA 1C3HA 3DGTA 1NXD1 5DAXA 1YUDA 3PDQA 5F2WA 4DXSA 3PUSA 3VD5A 2ZCWA 4Z2WA 3ZXLA 1I3HA 3MUY1 2DBIA 3LEGA 1GQGA 4W4ZA 1LOFC 3MICA 4LBQD 5FO9B 1YJLA 2W1WA 4X8PA 2AGSA 4LO6B 2ZX0A 5D1IA 2R0FA 4NHYA 1C1LA 5J98B 2B9VA 2R071 3WV6A 4EN8B 2VBPA 2VNRA 5FXZA 4AI2A 1KJLA 1WMFA 4UBHA 5AC93 2VZSA 3SISA 1KQRA 5JOWA 1W2NA 2UYAA 1IS4A 1QNYA 4UFHA 5DPNA 2D93A 1F15A 2PQQA 3PTRB 5FUIA 3RVHA 4DY5A 2BWCA 3B94A 3NV2A 1A8MA 2RS31 2FMDA 3JD72 4F7ZA 1Y7BA 5FQ0A 2ID4A 5AVPA 5GZFA 5LY2A 3T0AA 3EO6A 4UT5A 2ZHLA 5FWEA 2BV4A 1ZRDA 3LDBA 1X8EA 1ALYA 2XL9A 5FYHA 1EP0A 2IUWA 5C4WA 3K3OA 1MVEA 4XHBA 2CNAA 3WDYA 1LHWA 1N3PA 2XJRA 1UOBA 2XR4A 4QKBA 4WZFA 1WWYA 4XUNA 1HX6A 2R063 1LGBA 2KR2A 4XVHA 3MLLA 4AHYA 3O1UA 1O8SA 2EIBA 5H9RA 5FLIA 3WDTA 4RQPA 1F5JA 4ZHNA 3P1IA 4AF9A 1XNCA 2ZX1A 2YUEA 2XKOA 4QX5A 1ZZ6A 2VNVA 2W95A 2XJVA 2XHNA 4JQTA 3U14A 3NJVA 2LALA 2RMU2 2UYBA 5FREA 2WSVA 1UN1A 3KGZA 5C5TA 1UOGA 2D6NA 2RVAA 5ACA1 1X36A 5IVFA 3ELNA 5LZ6A 1O3QA 1HRI2 5IK4A 5IAVA 1JYXA 1OLME 4QB1A 1BKZA 3WUCA 1AR93 2A1XA 4CCOA 2Y6GA 3E6DA 4B29A 2WNUA 5A80A 5C3QA 5I8YA 4AFAA 3VBSC 3SH3A 1Q43A 1VBB1 5FZGA 3IT8A 1W28A 4XF4A 2WO3A 1DFQA 4NRQA 3OOXA 5FO8B 4NO4A 2D3SA 3AP4A 3E5XA 4EYUA 3ZFEC 4HK8A 3USUA 3BOPA 4FQ4A 3APBA 1IS6A 5D21A 1FOD1 4HOOA 4CXYA 3BU0A 4AEDB 2PAMA 2TEPA 5FDBA 2BNOA 4XF1A 4RL7A 1UOJA 4JCKA 1US2A 5K0UC 1EAH1 2BGCA 2QQOA 1RUD3 2GNTA 2QFEA 4K3UA 1D4M2 2E7AA 1GLHA 5HXMA 3PUIA 2JG8B 3WG1A 4ARXA 2RV9A 3MPBA 5KXBA 4GWIA 4FTSA 1SFYA 4Q4V2 2C0ZA 3OBRA 4YNIA 4QKFA 4NIAA 1GICA 1V6KA 3MDPA 3SMHA 4WVMB 4DXRA 5HV0A 5BXXA 3RZKA 4AVTA 3QBQA 3RZZA 3CJIA 4KU8A 3NNMA 2ADEA 1F4AA 2ZACA 1DLLA 4XJZA 5T50A 1CAXB 4UW5A 4GMP3 1BEV3 5T3NA 4JX0A 1QOTA 3RSJA 2B45X 2VXRA 3RPQA 3ZKYA 1QGLA 4NPMA 4CU8A 3OYWB 1WD3A 3DECA 4DXTA 3WDVA 1TG7A 4KH9A 2HWC2 4R9BA 3ACLA 3GJAA 5DXDA 4H7LA 3ZFEB 4CDWA 3V56A 1S55A 1VBD1 4UBGA 1W8NA 1N1VA 2KXLA 2ET1A 2WIIB 4QX2A 2WKKA 3WNXA 2Y26A 4O9EA 3WINE 1LULA 3K51A 3TNPB 1EV12 4BIFA 5ABJA 1ZBA2 2C1FA 1VMJA 4PI2A 5K0UB 1H0BA 2HWD2 2C9KA 1URXA 2V09A 4HFSA 4AHZA 1ZA4A 2XBO3 1WMXA 3FBYA 5DUWA 1SCSA 5LK5A 1MQTA 3VBFA 1Q8VA 1W6OB 3WEZA 5FWJA 1GOFA 1TME3 1AVBA 4CP9A 3VD9A 4TZDA 1ND2A 1PGW2 2VULA 4K21A 1V0AA 4CCMA 4XIOA 4X6RB 3IAQA 4XDQA 5C9AA 1Z7S1 3WG4A 1I9RA 3FUOA 3H3LA 1R093 1KFXL 2FMYA 2HWF2 3NRUA 4COZA 5JMOA 2CGOA 5DDJ2 1LOCA 2K9ZA 2WSUA 4IE0A 2A3XA 3KT1A 3ZMNA 3OEBA 1OLMA 1WLDA 5LB6A 5DZGA 4AAPA 1NYWA 2VCMA 2V4VA 1COV1 4KGGA 2ZGTA 2F4LA 1RMU2 1FNZA 3BVCA 1SBEA 1R082 5JSRA 5FOJB 1RUE2 2QQKA 1UYZA 2W5FA 2WS93 3ZIXA 3FWEA 4C0BA 4COVA 2WR9A 5IVYA 1SMVA 1I6XA 1C1FA 4YPJA 1F35A 2IC1A 5T5PA 3N9LA 5IAXA 4QXHA 3ZDVA 1QJU1 5C4WC 3ZIWA 1LGCA 3VKOA 1J59A 3H9AA 1CPNA 1V9U2 4IQPA 2DVDA 4ASMB 4Z8BA 1W2UA 1J1TA 1S0GA 2YDEA 1JXNA 3R0RA 2DU0A 4MHRA 5EHDA 4F83A 3Q8CA 1WKYA 1YIPA 4RQPC 4DEVA 4QWNA 1DQ2A 4MO3M 5FMBA 4ASKA 3AP6A 2OUHA 2GH2A 4COUA 1MZEA 2OPWA 3I59A 1YC61 2Q8EA 3LPFA 1OF3A 1PO12 4XMAA 1H8TC 1W6NB 2H6CA 2QE3A 4PIZA 4RGAA 4TXWA 3ZFGC 4AQSA 4AXOA 4URAA 1AYN2 1L3JA 2A3WA 1JYIA 4GB32 3ZYHA 1O5LA 1LEMA 1S0JA 4KBZA 2D6KA 4XILA 5GLUA 3JCIA 3KCCA 4Q4Y1 2E31A 3B9IA 3H7JA 3POFA 3SCFA 4RS5A 3TWIA 2RM21 5F6LB 3WW2A 5D2AA 2XH6A 5FZ0A 4AGRA 3FFQA 5LEJA 1R1ZA 1RJ7A 2BYVE 4PIXA 2WFF2 4TTGA 3KCYA 2WRAA 3ZN4A 2Z42A 4RYDA 5K8SA 4FFGA 4EROA 5C33A 2VZPA 1GZWA 4N43A 4W8JA 4J1WA 5KHKA 1R64A 2EALA 3OB8A 1RUG3 1X9TA 5F39A 4Q4W1 3B00A 1IHMA 3M2MA 4QQ2A 1DZTA 3B69A 2D6LX 4NOTA 2P34A 2OA2A 4GXLA 3N9MA 4X6QB 4JHTA 5FLHA 2WZR2 1NCRB 2PELA 4BH9A 3I54A 5HXVA 1D0HA 2E7TA 2RR12 1AR72 1DIWA 1YLLA 2VL4A 1VBE2 3AC0A 2Z69A 4MVTA 1H8TB 1B09A 5FY9A 1XE7A 2XUMA 3ZFGB 4Y24A 1YI9A 3A21A 3J7MA 2Y33A 4YG0A 2Y8KA 3GBFA 1ZZ8A 1OH4A 1BLZA 3M70A 3P5BA 3T1MA 5F2SA 1T6GC 5K4LA 4BXSV 1U0AA 3ENRA 1A34A 2MEV1 1GFF2 2Y6FA 2RS13 3LSEA 5JLVA 1W2AX 4OHWA 1MZFA 1IS3A 3AYDA 3H3ZA 4ITCA 5DAWA 1VE0A 1LGNA 2GU9A 4CDWC 2G19A 2QZ3A 2RDQA 3QOPA 1FMD1 3ZR6A 1EUUA 1OQ1A 1Q8OA 4QHOA 1Q8QA 1I5ZA 1BBT2 1LOAA 3CKHA 3U11A 3ZKUA 4XQ4A 1GWKA 3ILFA 1PIV3 2JECA 3MFAA 3U1XA 2OXBA 4OMCA 2ZGMA 2BZDA 2A70A 4WM7A 1UL9A 3DYOA 1PO21 3FE5A 1MQTC 2A6ZA 3ILNA 3ZXEA 4Q0UA 1RGSA 2UWCA 1R1A1 2ZBJA 4BQ2A 4XFFA 2YZ4A 1IKQA 1RVF2 2VC9A 5C9AC 2Q1FA 5J36A 4OMDA 3UKVA 2A71A 2I45A 1FNYA 1LENA 4R9DA 1UY2A 3PUHA 1ZRRA 1IQAA 1VB4A 5I0TA 2NP0A 1X9PA 3J8F2 2XVKA 4MGIE 4LO4B 1F5FA 3RYRA 4LBQB 1KXGA 2OS2A 1PVC1 3KVAA 2QQWA 5HI0A 2R30A 4AGGA 1TVGA 1HRV2 1UW8A 2QQLA 1UZYA 3F2ZA 4KMQA 1LESA 1HXS2 1E5SA 2BFUL 2TNFA 4BB3A 3NO8A 4XFBA 5GLWA 3UESA 1MEC1 3OD4A 3HD8B 5C5UA 2A6XA 5FPXA 3NVCA 1AL22 3S6PA 2HYXA 2RS52 4QPGC 3VZJA 4MSVA 3NKTA 2CU5A 4Y26A 2X53S 5ERLA 4UF0B 2XLAA 3T30A 3I2DA 4YM3A 5L9RA 3EYPA 1ONAA 4C91A 3ZN6B 1YEWA 4N8MA 1TNRA 2YU2A 2JE8A 3POSA 2FCTA 5E88A 3AJYA 4CDXA 2Y38A 5C3RA 2GP3A 3PMSA 4H7MA 4FAHA 4BYYA 4RS5C 2HWE3 4XTPA 4P00B 5KXDA 5A33A 4Q4X2 4C1WA 3BIEA 2R1DA 1GP5A 4IETA 4IEUA 2YG0A 3H8OA 4EN6B 3HNBM 1CZTA 3I2FA 3TN92 2A5ZA 2LRPA 4IEXA 3TNQA 4CEYC 3PVOA 2WA3A 3OPWA 4FPLA 5DAVA 1OH3A 2X29A 3MGUA 1JBCA 2YC4A 4MUVA 4K20A 2ZGUA 4N43C 4XXPA 5J37A 1HB4A 2VNGA 2RHPA 3AJZA 4QPGB 4Y22B 5DZFA 4CCCA 1LJ7A 1ULOA 2VMGA 4YVWA 2IXIA 4OQ9A 1TNFA 2O8QA 4ZS3A 2JENA 1SDDB 1W0PA 1N3OA 3I3MA 1ZBE1 5L9BA 4HVOA 1BMV1 1UY4A 2JDZA 1VRH3 4P9WA 3ZSLA 1F2NA 2W2IA 3UKTA 2HEYF 3OTFA 4YFZA 3PIJA 3EMRA 2JD9A 4QDQA 3K3NA 1WLTA 5KBFA 5IYYA 2WINB 1QJX1 5FP4A 2O14A 2E7QA 1RUH2 4LHLA 3WF2A 3CZJA 3WQ7A 3L9JT 5JZGA 5IK7A 2VUAA 4DUVA 1UPSA 3PURA 5BV6A 4BQ3A 4YFWA 3T2TA 3ACHA 1A3KA 4CEYB 3QACA 1OSGA 4P5HA 1Q8SA 5KHIA 3DUIA 4K8FA 4BJ0A 2AENA 4Y20A 1QQP2 2D3RA 2AEYA 3U37A 2RE9A 1YCIA 2DURA 4N7IA 4BQXA 3J7HA 1RITA 1V70A 3NKGA 4CCNA 3O1SA 1NAEA 3CF6E 2W68A 4XJUA 4CDQC 2WZPP 4IV3A 4X8NA 3BODA 1IOAA 3JD73 2VUJA 3FFZA 3VBRB 1S0IA 4I0AA 2BW8A 2VQTA 3LEIA 3WF4A 4C1XA 5LCWL 1SEFA 2JB8A 5FV3A 2CGPA 3HBKA 2OPKA 3WLUA 4YW1A 1OVSA 1GMMA 1W6MA 1MS3A 1YYNA 2YYOA 1VAKA 1WZXA 3NMBA 4BLIA 2PHXA 2ZEXA 3LCPA 1WMEA 3WR0A 4GJYA 5HCHA 1PM4A 1VMHA 2Z2SB 5CIRA 4HKWA 4A41A 1YNAA 4U36A 1W8WA 3VBHC 4BU2A 3LGRA 1W03A 3V0AA 3AFGA 1AR91 1Y9QA 5DUUA 4NRMA 4AWDA 4JGZA 3UL2A 1W06A 4EWAA 3WF3A 1S1AA 2QQUA 5FFOC 2RMU3 5FP3A 4AEMA 2JDKA 5JPMB 2VZ1A 4FOQA 3FHQA 3AZVA 3HWJA 1SACA 1TMF2 1HRI3 4ATEA 3W5MA 3SHRA 1UX6A 2UU8A 4LULA 4Y1UA 5DABA 5EZWA 5I0UA 1HN0A 3MF6A 4AFBA 4UW6A 4CDQB 1MS8A 4FO9A 1CIWA 1AR62 5HBAA 4DUXA 4QPIC 5F6KA 5JR7B 3POEA 2UWAA 3ZSEA 4CCJA 4RHV2 4PHZA 1DGWX 1W8OA 2OX0A 3HJRA 3WZ1A 2ZX4A 2GSYA 5KXCA 3PJYA 1QXJA 2I07B 3ZFFA 2ZGKA 2ZZQA 3NNFA 5AVAA 2W92A 1QMJA 4OI4A 4NHKA 1GNHA 3FLTA 4JQRA 1LHOA 4DNYA 3PNAA 1GR3A 2YC0A 1JI6A 1W0NA 4Y5SA 5BNOA 1NA1C 2XOMA 3PJQA 3VBHB 4FPJA 1D4M3 4ONUA 2Y6KA 2WFPA 4E9KA 2FZ2A 2DBNA 2LM3A 1Z78A 5IFTA 3UGFA 4OI0A 2D5FA 3BCWA 2ZGLA 4P08A 1RUI2 4LIVA 4Q4V3 5D8AA 1YXWA 4BA6A 4HANA 2D98A 1O4TA 1RYYA 1XNKA 2CGNA 4EE2A 1DZQA 2PLV2 4NWWA 4JAAA 4BXFA 3C7OA 4NMIA 2YHJA 3PTYA 1W6PB 1J3RA 3KWVA 3KZ4C 3V0BA 5IVJA 1J3PA 3NAPA 5FZOA 3ZPOA 2YBKA 3GGLA 2HWB2 4FOWA 5L9VA 5GLVA 1RUNA 2Y6LA 2QTWB 4QPIB 5IVBA 3L2YA 2D7FA 3WT3A 3D82A 4DPNA 5T55A 2HWC3 5CYYA 3DPRA 4FSJA 1S2KA 2FCVA 3IZOA 2XBO1 2LTNA 4Y33A 2IZWA 5IFPA 1MS0A 4KG8A 5HPOA 2WC2A 2WYSA 3ES1A 2A6VA 4Q5OA 1H9PA 1S2BA 2Q5TA 1UYPA 1BZWA 4WVWA 1G86A 2R072 5T5OA 2HWD3 2VZQA 2X05A 4QX7A 1PGL1 1NA1B 4R52A 3VDDB 5A7WA 2D6MA 4XBNA 4CP0A 5JZGC 1RUF1 2ERFA 3ALQA 2PYTA 3R05A 3RG0A 1AYM3 2VBBA 1OLQA 1JYCA 2PMWB 3SXWA 1PHMA 2UWBA 3OBZA 1HJGA 3UNPA 1IG3A 3I3EA 5CU1A 3THPA 2RS32 4ES9A 1OOPA 1EPZA 3HQUA 3MHZA 5DN2A 5FZEA 5FPZA 2VW1A 2VZ3A 3MW4A 4NROA 2W47A 2WS91 4CEWB 1GOGA 2HWF3 2XB6C 2XWJB 2ZS6B 4FPCA 4GAZA 1N3QA 4IE5A 4PJYA 3KV9A 5DDJ3 1AHSA 3LEKA 2JKBA 4D7YA 2VMHA 1VMFA 1ZRCA 1VB2A 2G1MA 2J1EA 1V6JA 2VOKA 2G9GA 5A32B 1RMU3 3AL5A 4NN0A 4PLMA 1LCLA 3HT1A 3AYAA 1RUE3 1LB2A 5FXXA 4C0HA 5BNNB 1AJKA 4E4HA 2ZX2A 3T1LA 2DFBA 1D7PM 2F4PA 4JRAA 5I0SA 3GCWA 3MPPG 1V9U3 2A7AA 2VQ0A 1C8M1 2E32A 5FYZA 3J4UH 1KITA 3K77A 4TLFA 4LORA 1JOJA 3GM8A 5ACA2 3AYEA 3DN7A 1PK6B 3FZ3A 1S0EA 5J1XA 4MGKE 1K5MA 1WCQA 3DKWA 5CFCB 5FYBA 4LK6A 1HLCA 2PHLA 4BMBA 1U12A 1OXCA 4YGCA 4EZ4A 4QB2A 4AFMA 3CLPA 1WMDA 3BUCA 1PO13 3ATGA 4M4RA 1AYN3 1RUOA 4GB33 3VDCA 3D5OA 4AAXA 4YG3A 4AVCA 1RB8G 5FZFA 4AOCA 1FOD2 2DVGA 3J7LA 1CAUA 1W8TA 1J83A 1HW5A 1DQ6A 1EAH2 5LW9A 1DQ5A 5FK7A 1GSLA 2CAVA 1NLRA 3AMPA 4P02B 3KV4A 4XHXA 1NZCA 2VW0A 1DGWA 4QKDA 2ZGSA 1CAVA 3NNJA 4EZHA 4CU7A 5CA6A 1REFA 1YQ8A 3ZFFC 1OQEA 4FPGA 1O4ZA 4COYA 4XJ9A 2DYCA 2E51A 2VG9A 3SKVA 5C8CC 1C28A 4K1ZA 4L97A 5F5QA 1HQWA 1GKBA 2QBXA 3Q8FA 5KXEA 3O0WA 2OKXA 2ZGRA 3SH5A 4YVSB 1VBA3 2YGMA 1G8WA 4NPRA 1O59A 1KRIA 1QH7A 2R043 5GJ6A 2JB4A 5FYSA 3VL9A 1C4RA 2FD8A 1W8UA 3DF0A 4AI0A 2CHHA 5D8AC 4LHKA 1AR73 1C5IA 1VBE3 1ZX5A 1XJAA 2ORXA 3IMMA 2GP5A 4XZUG 1GWMA 3I97A 4FPOB 4BISA 2RG4A 1VBD2 2FDKA 2YXSA 3NAPC 5F3CA 2CY6A 2QJVA 1NT0A 3ACFA 3JQXA 1B35A 4QX3A 3WXPA 4E2SA 1GWLA 2R6QA 2VTXA 4GH4B 5EV7A 2XVLA 3G6JB 1PIV1 2D6PA 1FPN3 1OKOA 3ACGA 3DPRC 4L8QA 3K2OA 5L7OA 1RUC1 3LKJA 1GNZA 1VAVA 5CFDA 4AVBA 4HPKB 4ZU5A 1BBT3 1AXKA 4JTNA 5C8CB 1PMHX 2VGDA 3E97A 5LY1A 1W2OA 5LASA 1KDKA 3KV5A 1Z7S2 3HEIA 4P5YA 2QDNA 2FBEA 2HH9A 1MS5A 3I7DA 3K46A 4Y1XA 4QX1A 3PL0A 3ST7A 1BCXA 4UFKA 2WQ8A 1QF3A 2YV8A 4NAMA 3IBMA 5FBZA 1COV2 4PCRA 1OOPC 2BGPA 4UFLA 1NZIA 4C8DA 5FY0A 3AMQA 5A3TA 3T08A 3ZYBA 2DVAA 1WUVA 5LEKA 5T52A 3N35A 4CU6A 3J8F3 2HEWF 3OPTA 3GALA 4IESA 3RWKX 2YMZA 2ZX3A 4W6YA 3TOJA 5J48A 3BTYA 4XETA 5CVRA 4XAAA 1LKNA 1HRV3 2HBTA 1H2MA 2WNVA 1U5XA 3KV6A 3OGGA 2R49A 2C5DA 3AKRA 1HXS3 4KWKA 5GKAC 3LD8A 3TBDA 5AFBA 1ODNA 4C90A 2VY0A 5FY1A 1W6QB 2JEMA 2NLRA 1NQDA 1H8VA 4HG6B 3WW1A 3ZSKA 4XF9A 2JDMA 2JD4A 2Q1ZB 2Y34A 3GNEA 1SPPB 1XYPA 2N7GA 3FHAA 2P1BA 1VBC3 3R4DB 1AL23 3KT7A 1LECA 2E6VA 3OEAA 5FZ4A 2RS53 4A42A 4BMEA 4YZ5A 3S5AA 2H6BA 4H55A 2J1UA 2VQAA 4ZU7A 1IKPA 4Q4Y2 5LA9A 2DCTA 3D0JA 2E26A 3J9SA 4XABA 4ZONA 4BQ1A 4ASLA 2RM22 3OG2A 1OA4A 3I2HA 2ES3A 3ZPYA 1H9WA 3WNKA 1XNBA 2E9QA 5HCAA 3J26N 5C70A 1KD7A 1QDCA 3NQHA 2BERA 4QM9A 2J1TA 1YHFA 1ZYBA 2XJSA 5DUXA 4XJ8A 1OUXA 2HJIA 4LIUA 1IQDC 4ZY9A 3EB7A 5L36A 5GZDA 1OPOA 2ZXQA 2GN3A 3B5LB 2O1QA 2Z5WA 4A44A 4Q4W2 5JI7A 1PMIA 2JX9A 3KVBA 3MYXA 5EPAA 3VBUA 3TN93 3IB3A 3VBSB 2SLIA 2WA4A 3IMNA 4QAWA 2VTXJ 3N4MA 3IPVB 4N53A 3M3CA 1ZNPA 4LOTA 4HSLA 3B9CA 3PLQA 4DY3A 1QKQA 2WO2A 2HEVF 3ZXAC 1H2LA 1VRH1 1GOHA 3WHTA 1JOBA 3E1F1 3UGHA 2D97A 4LHNA 1JH5A 1OVPA 1MZ5A 5EWSA 2E63A 4XAEA 4AEJA 1YQ2A 1O5UA 1OQDA 5J3UA 2BP6A 4AVVA 4KBBA 2EVXA 3O7OA 1C8NA 3BGAA 1SBFA 2K0GA 2MEV2 2VOTA 3IIIA 3D0SA 4PLOA 4QD2A 4A2UA 2JICA 3PU3A 4JDMA 4Q2FA 5BNPA 3EJKA 4CP2A 1FMD2 1NQJA 4HZFA 5IVEA 2EXIA 3POJA 1W05A 1WW7A 4QXCA 3NV1A 4IXLA 1DGLA 1OA3A 1OMIA 1RUH3 3OY8B 4TSVA 1UNBA 3TB0A 3QH7A 3C7HA 1APNA 4OFGA 2B9UA 3NJYA 1NLSA 3VHOA 4NHXA 1PO22 2YBSA 2ZZJA 3S7IA 1UXXX 1YQ6A 3O5SA 1OURA 4MXVA 4BQWA 4LKSA 1R1A2 3T3YA 4YWAA 2XLGA 4IGPA 1QQP3 1QJY1 1Y43B 1CONA 4W6XA 1LU1A 4YARA 5J96B 5FMOS 1M06G 4LT5A 5ANQA 4M01A 4GWJA 5JXGA 4OHYA 2C4XA 1FV3A 2LS6A 1JW6A 1UAIA 1OFNA 4RR3A 2VOVA 4QDSA 1HQNA 1L7RA 1PVC2 2MNGA 5FZ8A 3WQ1A 2V72A 4Y5Z0 4E4DX 1LHUA 1A8DA 1QXRA 2PAEA 4Z07A 4JZRA 5FYCA 3ZR5A 1SG3A 3D4KA 1F9KA 4YW2A 2ZABA 3K4ZA 4EWEA 5JSOA 2C24A 1CESA 5FKBA 2PHUA 1I5PA 1JS9A 2BOJA 1SHWB 4PT6A 2QQNA 2X09A 3H7YA 5FYYA 2WO7A 3DEMA 1Q5OA 1ULGA 2FDJA 4B4RA 4B8EA 1ZA7A 3IDCB 5A6YA 3S7EA 1JZ5A 3AK0A 1ZZBA 2WNUC 2WNVC 4AR2A 4L2NA 1DU3D 2WWSA 5FQ0B 1QWRA 5FZCA 1AF9A 3GBWA 3IKWA 3ZO0B 3TEXA 4YGEA 5H9QA 1BVVA 1AX0A 4GJZA 1TMF3 1LOBA 1YQ5A 1GQPA 3H1MA 3H0OA 3NL1A 4ZKTB 5C4WB 1Y3TA 3I4IA 3JBG3 1JZ2A 2DCZA 2P3IA 1W04A 4HT1T 1AR82 3WNNA 3DXTA 4WM8A 2AR6A 4KGQA 3O1PA 1AR63 3C3VA 3CBNA 4G4FA 3PU8A 1LTEA 1N47A 2YGLA 3ACIA 1BYHA 1W0OA 2NZ9A 2WT2A 1G6NA 5LATA 4RHV3 2IXLA 4K1YA 4RQPB 4XF3A 1C5HA 4UW3A 2BGOA 3QD6A 4Z2AA 1XE0A 4FXKB 1DQ4A 4LTAA 4MADA 5IW0A 3ME2A 3ZYRA 5F1RA 2D43A 5JDBA 2NM1A 2Q1MA 4JGYA 4H3WA 1RHI3 4XZPA 1H1AA 3CJIC 3RMXA 2VM9A 3DV8A 2DFCA 2WNOA 2GNBA 3KGLA 1ZRIA 5FP7A 4CU9A 5I91A 2WNUB 3WVJA 4XFHA 4D7SA 4INDA 4A4AA 4EN9B 4J6GA 5C7GA 4AI3A 3CZUA 5EP9A 1IS5A 4FOYA 5EYYA 3OUJA 2A75A 4KL1A 1ZBE2 1BMV2 4XACA 4D8MA 2PLV3 3VZMA 3ZX7A 4XTMA 2YY1A 1UMHA 4PF1A 3MO4A 4AE2A 4B1MA 3USUB 3QCWA 4MV2A 3QH6A 2B7YA 4R9CA 2VMEA 2ZGPA 3OBAA 2P3YA 5ABJC 1I1EA 1ASJ1 5FPAA 1CN1A 2AC1A 3SCGA 1QJX2 3A22A 4NWVA 5AFEA 1PGSA 1ZM1A 4AQ2A 1KFUL 5FZ6A 4LXLA 5EXOA 5GALA 1CX1A 2ATFA 3WNMA 5FZ3A 1VPHA 3P3PA 5LA2A 3VBFC 5A3NA 4Q1PA 5L73A 4YM1A 3I49A 1AYM1 3EXUA 3NWKA 1D0GA 1ND2C 1WLCA 2O8OA 3AMHA 5BNPC 4LBKA 4QGMA 1NY72 1QH6A 1XE8A 3Q8AA 5JXIA 1H30A 3CJIB 2VO5A 4MYEA 2EXHA 3POIA 5K9YA 1DZRA 5A3WA 5FZKA 1JZ8A 2CWMA 3T2PA 3RGBA 3BU7A 2RS33 4Q0VA 3H8RA 3FMGA 1KGYA 1F4HA 1YFUA 5FZLA 1SLBA 2QZ2A 1K12A 3ZYGA 3GZAA 4UW4A 4CDWB 4P9XA 4K8RB 3FX3A 4Y4RA 1OD3A 3ZXDA 2RDRA 3IN9A 4L0PA 3ZXGA 3AP9A 5ABJB 2PTMA 4I3PA 5J7MA 3VHNA 1WA4A 1MPXA 3C2UA 1HN1A 2VPVA 1FAYA 3T0DA 3VHRA 1YRZA 2D5HA 1MS4A 3MV01 2ZAAA 4RR3C 2VXJA 4YM2A 3VBFB 1MQTB 2JXAA 2BJSA 2YFZA 3A0NA 4IE4A 4BPZA 1CZVA 3AZZA 4S2GA 1WCSA 2DDUA 3B93A 4CP9B 1J84A 4YM0A 1G9CA 4PDWA 1REDA 2VZUA 1ND2B 1PZ9A 4DIQA 2VD7A 3OUHA 1UU6A 4AQ6A 5C9AB 3H8XA 4G9SB 2JE7A 1Z0HA 1PO11 4M3CE 2EA7A 4Y1ZA 2X5IA 4PQQA 3PHMA 5ACA3 4NR1A 4BHPA 3KM5A 1EPWA 1UU5A 4B7KA 3ON7A 4YGDA 1KDMA 4W65A 4XCAA 2Y0IA 1BQPA 2J1VA 4HBNA 4Y3OA 1NLQA 4AW7A 4Q26A 4Z82A 2UURA 1D2SA 2WQ4A 1AX2A 4LQRA 1HKDA 4KQ7A 5CAZA 1XRUA 2OYZA 3NJZA 5EJ1B 1FV2A 1JHNA 1FOD3 4YG6A 1XC6A 1FX5A 2WLPA 4QU1A 2CL2A 2OUJA 3KT4A 4WM8C 2W1UA 4UFIA 1RUJ3 1CIYA 2WZ8A 3N7MA 1C57A 1XPWA 1VBA1 1UX7A 2Q8OA 4BCUA 2R041 4KWUA 2WBKA 3LAGA 5I0DA 4FP3A 1XU2A 3I59B 1DHKB 3AVSA 4I02A 4BLJA 4DMIA 1XYNA 1UO9A 1CPMA 2J1AA 2WLQA 1REEA 4JGYC 4PF5A 2BNNA 3BPSA 5F3GA 1NX9A 2JJ6A 4EV0A 3BTXA 4IV1A 1D4VB 2X10A 4E8CA 2ZKNA 4QKNA 3T2OA 5JI9A 3THTA 1UWWA 4FTEA 2C26A 2IXJA 1LRHA 2IVJA 4QQHA 4RS5B 5CISA 3O1TA 3V65A 1GZTA 5LBCA 5FP8A 4ET7A 5AC91 2PA7A 2CAUA 2J7MA 2WQZC 1S0FA 1VIWB 3O0XA 5EJ3A 1FPN1 4MXWA 2W9XA 1IPSA 3LE0A 3N9OA 4D6RA 1EUTA 1VBD3 4LUKA 1KEXA 1GZWB 2ZKLA 4N43B 3VKNA 3FHIB 1LNSA 1CAWA 4IDZA 1W2TA 2EXJA 2ZGQA 3E6BA 1PGL2 4WM7C 4KG0A 1ENXA 1ZZCA 1YWKA 2ILMA 1RUF2 1PNGA 1QNWA 1ULPA 3VBOA 5JPNB 3M3OA 2R061 3RZJA 3MI8A 5FJHA 4JV4A 1H1MA 1DGRN 3M4FA 4OHZA 3BOWA 4CYDA 1CJPA 2IXKA 2VQUA 1PVXA 1OFSA 3AX4A 1Z7S3 4QX8A 1NCQA 1OA2A 2WZEA 2WS92 5A7SA 3BKZA 1GANA 1PM7A 1UZWA 4AVAA 4M3CA 3U0ZA 3K4AA 5FKCA 4CDUA 3ECQA 2HYKA 3OJBA 3SH4A 3MW2A 3NW4A 1COV3 3IDEA 3R4SA 2QQJA 5DG1A 4K9SA 1LAJA 3OBTA 2JG9A 3VDBA 3AM2A 1S0BA 2ARBA 3HT2A 3SEPA 4YYOA 1CQ9A 2XXZA 2CYFA 2LUWA 3KLSA 3PVNA 3HQRA 4FPYA 2WDBA 3AZXA 5C8WA 4EQVA 4A6SA 2OIIA 1VRBA 5ANNA 1QIQA 1C8M2 1VBC1 3HN1A 3LFIA 4AI8A 3H1WA 4P9LA 1ND3A 4V1PA 3GZUC 5BYNA 1UKGA 2OQ6A 3DYMA 3WSOA 2IFWA 4PDWC 3HN3A 1RUD1 2Q30A 1CVNA 4BWOA 4EN0A 2AREA 1JU4A 1RC6A 2QCSB 4YW5A 4YGBA 4HETA 4CDXC 2X5IC 4QXBA 5A3MA 5EIYB 2WWUA 2DVBA 3KQRA 2VZOA 4XEZA 4MZUA 4ZPIA 4MOAA 3AZWA 5JUVA 3GHMA 3VZNA 2B4KA 2AYHA 2XWBB 4BQYA 1EY2A 3I2KA 3ZXJA 4GMP1 5KC6A 1BEV1 1SFNA 2ET7A 3PVEA 4XIKA 4YSFA 4Z92B 5FPBA 4CXXA 1HIXA 5FBJA 5JCTA 1AX1A 4QQLA 5FPVA 3VB9A 4AZZA 5A1LA 2BVBA 3WP6A 4KU7A 2VCCA 4CSWA 4CVUA 3WY6A 5FZ9A 4QPYA 3M1HA 4LBJA 4DRRA 3T0BA 1YO8A 5FP9A 2EAAA 4YVWC 4Y1YA 5FYTA 5A3OA 5E8AA 1JYWA 1NKGA 3ITQA 1XYOA 1A6CA 3TRSB 3ZN5A 4ZXKA 1POV3 4Z1VA 3LA7A 4Q0SA 4GALA 4IGOA 2XKPA 3EHKA 3NNLA 4ISRA 4L92A 4O61A 3RI9A 5C6CA 2W52A 4CCDA 2WO1A 1LHNA 1OC1A 3UK9A 1UD1A 2BDRA 3KF3A 4BQ5A 1TME1 4CDXB 1OF4A 4A7ZA 4DQAA 3CIHA 3HPNA 5FZHA 1KS5A 1EV13 1GQHA 1VAMA 1YFXA 1ZBA3 4ISQA 4NUBA 5LRRA 4XDOA 2EF6A 3VD3A 4CUBA 1O3RA 5F5AA 5A6ZA 3D6EA 1GZ9A 2K2SA 2JKXA 5F8PA 5A33B 5I8TA 1R091
chains in the Genus database with same CATH topology
1S4CA 1JOPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S4C A;  1JOP A; 
#chains in the Genus database with same CATH topology
 4JDN A;  4MGZ E;  2MEV 3;  2PHR A;  4WV8 A;  1PIV 2;  5LA1 A;  1H4H A;  4CPB A;  2ARC A;  3BTZ A;  1RUC 2;  2FHR A;  3N9N A;  1FMD 3;  1LHV A;  3T09 A;  3THD A;  4NAO A;  1YIF A;  1E5R A;  5IVC A;  5E6H A;  3B01 A;  2A6W A;  2FZ1 A;  5F32 A;  3AKQ A;  1N1S A;  2ZAH A;  5FTT C;  3GXU A;  3G7D A;  2JDA A;  4KNC A;  3O0V A;  2GAU A;  4AVS A;  3MIF A;  2WT1 A;  2YBP A;  4YVW B;  4OVE A;  4IV3 C;  1PO2 3;  4XXA A;  4AED A;  2WAB A;  2VUC A;  3CEW A;  5DUV A;  5BPX A;  1R08 3;  1VLN A;  1JU3 A;  2DV9 A;  1UCX A;  2JDH A;  1X50 A;  4IEZ A;  2DTY A;  3LSD A;  5CB7 A;  1LR5 A;  5E16 A;  3OGS A;  5KHH A;  3W59 A;  4XOG A;  2XHK A;  4LA2 A;  2JG8 A;  3VKF C;  4DOU A;  1O91 A;  5FUN A;  4E4Z A;  2J22 A;  4IER A;  3H42 B;  4YZ4 A;  1GU3 A;  3K48 A;  1UMI A;  2IXC A;  3W5N A;  2OQ7 A;  4WVM A;  2VOX A;  5FZI A;  5I93 A;  2BEO A;  3M3I A;  1WA6 X;  2WJS A;  4D6S A;  5JZG B;  1PVC 3;  4YZ3 A;  3WOG A;  1Q3E A;  1W8Z A;  1XBF A;  2JG9 C;  4JGZ C;  3C7G A;  1CAX A;  5EQU A;  2WN3 A;  1BK0 A;  2V73 A;  3RQ0 A;  1ENR A;  3RYK A;  4BIO A;  4ZU4 A;  1VBB 2;  4DB5 A;  3BN6 A;  4XBL A;  3VZO A;  3OYW A;  3VGI A;  3ZYF A;  5A3U A;  4Y20 B;  2ZPX A;  1MS9 A;  1LED A;  2PFW A;  3INA A;  3ZFE A;  4OQ8 A;  1S0C A;  2DCY A;  3ZLI A;  3JBG 1;  4IV3 B;  4HL0 A;  5FJK A;  1W9S A;  4AGV A;  4K40 A;  4Q8K A;  5FXW A;  5SV8 A;  3ZDS A;  3N9Q A;  1UY3 A;  1RUG 1;  3SLI A;  5K0U A;  3VKM A;  4CTE A;  3SQO A;  3I2G A;  4FVV A;  3RS6 A;  2WFF 3;  1ACC A;  3VLB B;  1SLT A;  4CRQ A;  3S5Q A;  5FZA A;  5FPU A;  1L7L A;  1GP6 A;  3H1Y A;  4XUQ A;  2DTW A;  5LA0 A;  1W6M B;  4MGT A;  1X7N A;  1W6O A;  4G3Y C;  4CUC A;  2XQX A;  5FO7 B;  1AR8 3;  5JIA A;  2HLE A;  3GZE A;  5DAP A;  2Y0O A;  4EN7 B;  3CHX A;  4D94 A;  1RHI 1;  2SBA A;  4OHV A;  4XUT A;  3USS A;  4A45 A;  1V6M A;  5BNO C;  2GH8 A;  2QDR A;  3LIG A;  3R4U A;  3WCR A;  3E5U A;  4P9Y A;  3V0A B;  3LA3 A;  4LKD A;  4UFM A;  1UXZ A;  2DUP A;  3E5Q A;  4XUP A;  3ZSM A;  4JGZ B;  3I2J A;  2FDI A;  3CL1 A;  2WZR 3;  5TSW A;  1IPK A;  4V2W A;  4XUR A;  1WW4 A;  2RR1 3;  5IJR A;  3THC A;  2PHF A;  3C7E A;  4M3C F;  5FZ7 A;  2CSG A;  2RS1 1;  2VMD A;  4NJ4 A;  3UYJ A;  4BOW A;  3RZH A;  2XLF A;  4HN1 A;  2JDY A;  2ZGO A;  3KHB A;  1V6I A;  1KS4 A;  1H2N A;  2OT7 A;  4N90 A;  2E33 A;  4AEK A;  1PX3 A;  4AYU A;  4XBQ A;  2ETE A;  2EIE A;  3AXE A;  1MAC A;  2G4I A;  1CZS A;  4FPE A;  3R6S A;  3RFR A;  4FAG A;  2JE9 A;  2VJX A;  1UF2 C;  2P4E A;  4NHL A;  5GLZ A;  1ZBE 3;  2VUD A;  5J09 A;  1Q8P A;  4UOJ A;  1OI6 A;  1W8H A;  5A3L A;  1PMJ X;  5I8S A;  3F95 A;  4LKE A;  5E89 A;  3ZFF B;  1BXH A;  1POQ A;  2BU9 A;  2ZA9 A;  1J3Q A;  5B2G B;  4QHB A;  4AFC A;  1QJX 3;  3H3U A;  2BWA A;  4TYS A;  1IZ3 A;  3EBR A;  5BNO B;  3A4U A;  4LKF A;  4XUO A;  1W6N A;  5JIU A;  2TBV A;  5KR7 A;  2VEC A;  1QJE A;  1SLA A;  3NV4 A;  1ULF A;  3RJ2 X;  1PX4 A;  3Q9O A;  1H6X A;  2EAK A;  4E4S A;  1QXP A;  2CDP A;  4JDO A;  2YFU A;  4R4Z A;  1E5H A;  5D8A B;  3RRD A;  5I0R A;  2ZEY A;  5FRA A;  4XYX A;  1W99 A;  3SCH A;  1RVF 3;  4QQP A;  2GDF A;  3FL7 A;  3UJQ A;  2KM2 A;  2HBU A;  2KD7 A;  3GCX A;  3V0B B;  2ZEZ A;  3OSD A;  4IEO A;  1QJY 2;  2UY9 A;  1DQ0 A;  2V5Y A;  4NIG A;  3NAP B;  5FZO B;  3HBZ A;  4FPF A;  5FK8 A;  1UZ0 A;  1QJU 2;  1W9T A;  4D3W A;  1RXG A;  2Z79 A;  3M3E A;  4QT6 A;  5KWR A;  3PUA A;  3U78 A;  3SEE A;  1OD5 A;  4XFG A;  1MZ6 A;  2WYF A;  2PXJ A;  1ZZ9 A;  3OF1 A;  4MGQ A;  4AED C;  3MZH A;  4RSU A;  3WF0 A;  3O12 A;  1H1I A;  1H4G A;  4CUG A;  3U75 A;  4XFA A;  3DPR B;  3IDB B;  2I74 A;  3ZXK A;  3W21 A;  1BHG A;  3ETP A;  1OLR A;  3OD0 A;  4GKX A;  4LBL A;  2VMI A;  4MX3 A;  4UWD A;  2JG8 C;  4P9J A;  5GZC A;  2P2K A;  4UYB A;  4MGS A;  4FCA A;  1NCR A;  5CNA A;  3LZZ A;  2XDV A;  1Y4W A;  1UYX A;  2JDN A;  5DZE A;  1H8T A;  5A7W B;  1AZD A;  1XNA A;  3AFK A;  1WCU A;  1ZVF A;  4NE9 A;  1HV1 A;  3ZFG A;  2DWR A;  3AYC A;  2JDU A;  1K5M C;  3WQB A;  3MW3 A;  1AUY A;  4XPV A;  5CG9 A;  4PQ9 A;  2XG3 A;  1F8V A;  1FYU A;  2HWE 1;  2JIJ A;  2Q4S A;  3I3B A;  4RN5 A;  1OOP B;  2C6S A;  2EXK A;  4YW7 A;  4CZS A;  2AZ5 A;  1Y9G A;  3UT0 A;  2P3J A;  2ORZ A;  2QQI A;  1ULC A;  4QGN A;  1YJK A;  4A7K A;  1TQ5 A;  2A3Y A;  4MHU A;  1LOD A;  3UKN A;  1RIN A;  2W94 A;  5FMO L;  3M8L A;  3WDW A;  4XF0 A;  4J25 A;  2IVI B;  2IXH A;  2GC0 A;  4Q4X 3;  1OKQ A;  4Y5T A;  2EIC A;  3SKJ E;  4UXA A;  3W58 A;  1RUJ 1;  1ENS A;  1X8M A;  3POW A;  4ZZ5 A;  2BTV C;  3NJX A;  5A1F A;  4QX0 A;  2KA3 A;  3CQO A;  1ZRF A;  3WW3 A;  3HIF A;  2ZJC A;  5FMC A;  3POG A;  2DCK A;  3VZL A;  1UOF A;  3A7Q A;  4FI9 A;  4LA3 A;  5IVV A;  3HVD A;  5CBL A;  1DLC A;  1QEX A;  2VCA A;  2AEZ A;  2CTV A;  1HDK A;  3FBM A;  3I3D A;  5GZE A;  5T5L A;  3UV9 A;  1DYK A;  4M0N A;  2VAU A;  1JZ3 A;  1OBN A;  4FP2 A;  3P3N A;  4XDP A;  3Q8E A;  3OGV A;  1K5M B;  4ZXE A;  2D40 A;  1ODM A;  2QQV A;  3WNP A;  3WW4 A;  4MET A;  4BM8 A;  2GMM A;  2XML A;  4LBQ A;  4E2Q A;  4L9B A;  2ZOE B;  4LO8 A;  2NQY A;  4RGK A;  4OI1 A;  3WD5 A;  1UU4 A;  3HAG A;  3LB9 A;  1DYP A;  1WW5 A;  2R16 A;  1BJQ A;  1UQX A;  5T54 A;  5K7P A;  2WNE A;  3VZK A;  1AXY A;  1CAU B;  1B35 C;  1ENQ A;  1DBN A;  4IUG A;  1S4C A;  1UKR A;  4ES8 A;  1GP4 A;  3EQE A;  1ASJ 2;  2GME A;  2XJT A;  3CMG A;  4TN7 A;  2BNM A;  2D44 A;  3VN4 A;  5F3I A;  2IWG B;  2ZML A;  4W50 A;  3O1R A;  4YLZ A;  1J58 A;  2XJU A;  3AXD A;  1N1T A;  1CAV B;  1GV9 A;  5L7O C;  5CFD C;  4UF0 A;  3JD7 1;  1AYM 2;  3M7A A;  3KCX A;  2P5B A;  4PIY A;  5IAT A;  1YI7 A;  4GMP 0;  4HVR A;  2GAL A;  3WG2 A;  5CKN A;  3S57 A;  3T4V A;  3ROU A;  4B4P A;  4TLG A;  4FFF A;  3WNO A;  1WLW A;  3ZN6 A;  5JR2 A;  5FYM A;  3N3H A;  5JXJ A;  1TE1 B;  4TWT A;  3MIG A;  3WDU A;  1NUK A;  2C9A A;  1RUF 3;  2QQP A;  4QQO A;  1QJF A;  1RXF A;  4YW4 A;  2RJ2 A;  1ULD A;  2QVS B;  4BK5 A;  1JOP A;  1FI2 A;  1UZV A;  1FXZ A;  4OUS A;  5SV5 A;  3HR9 A;  5LBF A;  4P9I A;  5FOB B;  3KF5 A;  3FJS A;  4IE6 A;  1XQN A;  4I0W B;  2OZ6 A;  2W87 A;  4XC9 A;  4XFC A;  4NVP A;  3DCQ A;  4XQW A;  5LWB A;  4FPH A;  3T4H B;  5JSP A;  4P14 A;  2GC2 A;  5JAX A;  1MEC 2;  4LR4 A;  2RMU 1;  5CZK A;  3V64 A;  4BDV B;  5B4N A;  1B35 B;  3RZM A;  1FT9 A;  2VTF A;  1WD4 A;  1HRI 1;  3VV1 A;  4DO0 A;  1T2X A;  2VW2 A;  4I3G A;  5JOZ A;  4QPG A;  4Y22 A;  1CD3 G;  5L7O B;  2E53 A;  2J1S A;  2GMP A;  3O14 A;  2Q0A A;  5HV4 A;  1W39 A;  5JXH A;  5CFD B;  5IT6 A;  4NPL A;  4IEP A;  4F8A A;  1SDW A;  2VVF A;  3D8C A;  2XPJ A;  5IK8 A;  4CA9 A;  1NOV A;  1QHD A;  1NCR C;  3RI8 A;  3N7L A;  2CWS A;  2DF7 A;  1C8M 3;  1K5J A;  3ZYP A;  2PHT A;  4YW6 A;  4IL7 A;  2BBV A;  4QHZ A;  2VMC A;  1BK1 A;  2W91 A;  4FQZ A;  1H2K A;  2MPF A;  1VP6 A;  4YW3 A;  1S0D A;  2JWP A;  3VDA A;  4OI2 A;  4HVQ A;  2VCB A;  4B4Q A;  4HON A;  4D69 A;  1QDO A;  3ZYI B;  1D4M 1;  1LOE A;  1JN2 P;  2DUO A;  1UY0 A;  4K7J A;  1W3V A;  3I2I A;  3LPG A;  4CUA A;  4WVZ A;  1JYN A;  1X82 A;  4FTB A;  1HJF A;  1SLI A;  4Q4V 1;  3AMN A;  1ZZ7 A;  3TYJ A;  4Q8L A;  1D2Q A;  4CEY A;  3KD4 A;  1WW6 A;  2VBD A;  3SC7 X;  1JYV A;  2XJP A;  2QNK A;  1DQ1 A;  4EWD A;  1U5Y A;  2XL7 A;  2WNV B;  1NXM A;  4LEJ A;  1MS1 A;  3N7J A;  3VBU C;  1RUI 3;  4W6W A;  1VBA 2;  1LU2 A;  4N53 C;  3POB A;  5T5J A;  5F9T A;  1JZ4 A;  2R04 2;  4DZG A;  2P17 A;  4B7E A;  4EJR A;  2A73 B;  4IE7 A;  4I09 A;  3VL8 A;  1POV 1;  1SZB A;  4NII A;  3VHP A;  3VBR A;  3TEW A;  2HWC 1;  4LIT A;  1JOD A;  1NE4 A;  4LJH A;  5A7N A;  4BK4 A;  4D7T A;  5IK5 A;  3LDK A;  5IUQ A;  2PN5 A;  5M0T A;  2VNO A;  4Q27 A;  1UMZ A;  1O4Y A;  2HWB 3;  4S2H A;  4GD4 A;  2RJK A;  4QPW A;  4HLT A;  1EV1 1;  1ZBA 1;  2F17 A;  4NRP A;  3ETQ A;  2HWD 1;  2ZHM A;  4FT8 A;  2PQS A;  1GYK A;  5LBE A;  5AC9 2;  3J7N A;  3AVR A;  5C3P A;  2JIG A;  5CAD A;  4SLI A;  5JVV A;  4LMF A;  1FPN 2;  3D3A A;  2FDH A;  4YZ1 A;  3LOB A;  4I2O A;  4YZ2 A;  3RZL A;  1PGW 1;  3CDZ B;  2R07 3;  4NIH A;  4RA0 A;  3A23 A;  3FLP A;  1W8F A;  5H9P A;  5A7P A;  1JUI A;  1SBD A;  1W3X A;  1CR7 A;  2HWF 1;  4U2A A;  3ZSJ A;  2DU1 A;  3KSC A;  4HKO A;  5DDJ 1;  2BBA A;  3L2H A;  1RIR A;  4D0Q A;  3VBU B;  2XON A;  3MFC A;  5FZD A;  5CG8 A;  1JYT A;  1OT5 A;  5CKQ A;  4ARY A;  5FZ1 A;  4N53 B;  5F7U A;  3UJO A;  4O65 A;  4CDQ A;  1O6U A;  1RUC 3;  1RMU 1;  2R06 2;  1R08 1;  2YPJ A;  4H14 A;  4N9I A;  1RUE 1;  1W90 A;  5DAQ A;  3B3Q E;  5IWF A;  3WF1 A;  1SCR A;  4OUE A;  5JWP A;  2MHF A;  1SQ4 A;  2WWJ A;  3RMY A;  5FZM A;  2B39 A;  1T6B X;  1UY1 A;  1YQC A;  2B8M A;  3BTA A;  3ORJ A;  3KMH A;  1V9U 1;  3POY A;  4UI9 L;  4ZS2 A;  5JMC A;  2NMO A;  3BAL A;  3WCS A;  2X8K A;  4CXW A;  1DCS A;  5GZG A;  5FXV A;  5BNQ A;  2AAC A;  1V6L A;  5EJZ B;  3VBH A;  1AR9 2;  1L7Q A;  4JVA A;  2W0X A;  4O7X A;  4COW A;  2BQP A;  5BNP B;  3T2Q A;  5DMY A;  3LF7 A;  2RJL A;  2F6B A;  4S2F A;  3JXS A;  4F3J A;  3WHU A;  1DDL A;  2FQP A;  2NN8 A;  1AYN 1;  2ZMN A;  4GB3 1;  1VBC 2;  1W6P A;  2GND A;  4I30 A;  3OGJ A;  4OZX A;  1S2E A;  3MIB A;  3ASI A;  3LOI A;  3VD7 A;  1DYO A;  2DVF A;  2H0V A;  2R0H A;  2P3K A;  3VD4 A;  1JHJ A;  2H0B A;  1FAT A;  1VBB 3;  4E27 A;  3CJX A;  4SBV A;  4JTO A;  2OZJ A;  4FBF A;  3AKS A;  4QPI A;  2VZT A;  2ZGN A;  5APA A;  1RUD 2;  5FAX A;  3U4X A;  2WFF 1;  2BRT A;  3DL3 A;  1GUI A;  4A6O A;  3FUQ A;  4FPK A;  4XQD A;  1KJR A;  2Q8C A;  2P6H A;  2FDG A;  1SLL A;  4LHS A;  4AI1 A;  4WVV A;  1AR8 1;  4NID A;  2VU9 A;  1EAH 3;  5EFU A;  4RR3 B;  4DEQ A;  2Y6J A;  3ABZ A;  4LK7 A;  4RFR B;  1XU1 A;  4RGG A;  1NA1 A;  3VDD A;  2VOW A;  2V4A A;  5KC5 A;  3P6B A;  3Q8B A;  2ZHN A;  1BEV 2;  4M4P A;  3K4D A;  2WZR 1;  2P37 A;  2ARA A;  1GBG A;  2RR1 1;  1AR7 1;  1VBE 1;  2Q8D A;  4XMI A;  3WG3 A;  4CE8 A;  4Y1V A;  2VZR A;  2EID A;  3OUI A;  3PME A;  4Y4Y A;  5E1R A;  2R32 A;  3DXU A;  4CEW A;  5A70 A;  4JC1 A;  4XJA A;  4DXZ A;  5A6Q A;  3I2O A;  3LDR A;  4JKM A;  1Q56 A;  1K3I A;  1EYB A;  3B7M A;  2O0O A;  1F31 A;  3CU7 A;  5C3S A;  3O1V A;  2Y6H A;  4M00 A;  2BPA 2;  2LRO A;  4AG4 A;  4R8H A;  3AP5 A;  3PUQ A;  3O1M A;  5A32 A;  4KI5 M;  1TEI A;  3VBR C;  3N36 A;  4XE9 A;  5H9S A;  2VE1 A;  2XBO 2;  3CNA A;  4I01 A;  2OW4 A;  2BFU S;  2P6C A;  4LE3 A;  3SIT A;  3ZOI A;  5BNN A;  1NE6 A;  3MLJ A;  3BB6 A;  1TME 2;  4GUL A;  4LBN A;  2WN2 A;  4XCB A;  1BBT 1;  2QKD A;  3GJB A;  4WM8 B;  4BE3 A;  1JZ6 A;  1O7F A;  2ENR A;  4HXC A;  3LIH A;  4LUM A;  4HK9 A;  1E5I A;  1HQL A;  1VJ2 A;  5G05 L;  5A3P A;  3JU9 A;  4A3Z A;  1CGP A;  5F3E A;  3I3Q A;  1R09 2;  3W9A A;  4HKL A;  5IHR A;  1PK6 A;  3BIW E;  3DYP A;  1UIJ A;  1UZZ A;  3GYD A;  1GNY A;  2BUK A;  3LA2 A;  1OHF A;  5G04 L;  5CFC A;  4GWM A;  1SLC A;  2FDF A;  2B42 B;  4JGY B;  1JMU B;  5B4X A;  4RFT 0;  3IM0 A;  4B3N A;  4CPB D;  4FOV A;  4FFH A;  1RVF 1;  3OCP A;  3WNL A;  1NY7 1;  2J42 A;  4LO5 B;  4BQ4 A;  1PNF A;  3H8U A;  2BOI A;  4Q29 A;  2QQM A;  1YFW A;  4MG2 A;  3JB4 C;  2K46 A;  3LQC A;  2B46 X;  3HNM A;  3IIA A;  3J8F 1;  1UIK A;  1ST8 A;  3RZG A;  2XJQ A;  4GA9 A;  4AK3 A;  4CCK A;  3WP3 A;  3LWC A;  5BY5 A;  4LLO A;  5JOY A;  4E2G A;  1UPI A;  1HRV 1;  2WUH A;  1HV0 A;  3AKP A;  5BUV A;  1HXS 1;  1QU0 A;  1QJY 3;  3JQW A;  1SFP A;  3HNY M;  1K42 A;  1QJU 3;  5LK7 B;  1PZ8 A;  2L9L A;  3BI3 A;  5GLT A;  3HQX A;  2I2S A;  5HCB A;  3I8T A;  1DF0 A;  3K75 B;  3WP5 A;  3KHC A;  4B1L A;  5DG2 A;  3AL6 A;  1AL2 1;  2RS5 1;  2D3P A;  4WM7 B;  1AJO A;  2CDO A;  1XXN A;  3HMY A;  3M3Q A;  2GC3 A;  3NST A;  3O1O A;  5FYU A;  5HCF A;  4Q0Q A;  4YVS A;  4AFD A;  2YB7 A;  4IGQ A;  3UET A;  2VH9 A;  3WQ0 A;  3TEY A;  1RJ8 A;  1H6Y A;  1XB9 A;  4MLO A;  3C8X A;  4OZO A;  3BYW A;  4IEV A;  4P9G A;  3B02 A;  4QMA A;  2R1B A;  1UYY A;  3PIG A;  1XSQ A;  5GM0 A;  2NPI A;  1CJD A;  3U4S A;  2UY8 A;  3MEP A;  1V6O A;  2W3J A;  3RNS A;  3N9P A;  3MBW A;  2ZMK A;  5FZB A;  4PI0 A;  2DUQ A;  3QLQ A;  3UGG A;  4IW3 A;  1LOG A;  4Q1R A;  4Q4Y 3;  1CX4 A;  3VUO A;  1WBF A;  3AP7 A;  3JBG 2;  3MID A;  2RM2 3;  4DIN B;  2GNM A;  1ZRE A;  2JDP A;  4Q4X 1;  2ARX A;  4QB6 A;  4GH4 A;  1G9D A;  1RUG 2;  2PHD A;  2B5H A;  2YU1 A;  1RL3 A;  4ZZ8 A;  4OLL A;  2YRO A;  5L19 A;  3TN9 1;  3W20 A;  3PVB B;  4FFI A;  4ORF A;  5FY5 A;  1XOY A;  5A1A A;  3AB0 A;  3C7F A;  3GF6 A;  4HPK A;  1HB3 A;  1U5I A;  3N7K A;  1QOO A;  3MV1 1;  5C8C A;  1RHI 2;  4Q4W 3;  1WCK A;  4WZC A;  4V2V A;  4DRV A;  5CKM A;  3OGR A;  2BVV A;  4IEQ A;  3BPZ A;  3VDD C;  4AI9 A;  1IGO A;  1U5Z A;  4NHM A;  2FCU A;  2PHW A;  4GIQ A;  2XUE A;  2R7E B;  3FC0 A;  4PDW B;  4O9G A;  2VMF A;  4N9H A;  4S2D A;  1JTZ X;  2AUY A;  4KWL A;  1WGP A;  2RS1 2;  4LO7 A;  2QUO A;  3AZY A;  1E57 A;  5F5I A;  4IV1 C;  3ZM8 A;  2X5I B;  3IAP A;  3NNG A;  1LOF A;  1VR3 A;  4CEW C;  5LRS A;  4OCT A;  4M0H A;  3ES4 A;  4FXG B;  2J1R A;  2XGX A;  5FY8 A;  3LEM A;  1HB1 A;  1W9W A;  4AHW A;  1G9A A;  3ZVX A;  4HN0 A;  2IFR A;  4LLF A;  1US3 A;  1MVQ A;  1RUH 1;  3H50 A;  5A7Q A;  5FYI A;  4CCE A;  4UAP A;  4IEY A;  1K45 A;  3VKL A;  4DS0 A;  1CWP A;  1M4W A;  2ZHK A;  4JHZ A;  5FR3 A;  1STM A;  3FN9 A;  1NG0 A;  2EIG A;  2TUN A;  3U10 A;  5BNN C;  1J1L A;  4AL9 A;  1DGR A;  2VVE A;  2CV6 A;  5KHJ A;  1W6Q A;  3ZMO A;  4JRL A;  3LFM A;  2GN7 A;  1ASJ 3;  4E8D A;  4GQ7 A;  4LOS A;  1QQP 1;  1SPP A;  2VZV A;  4QM8 A;  5LBB A;  1JZ7 A;  3WDX A;  2NMN A;  2Y60 A;  1XND A;  3IDA A;  5FPL A;  4OHX A;  2OVU A;  1PZ7 A;  3JUU A;  3RYP A;  5DQ0 A;  1PK6 C;  4N7U A;  3VBO C;  5A6X A;  1P8J A;  4Q0P A;  1O3S A;  3MIE A;  3U07 A;  2WT0 A;  5CFC C;  1QY4 A;  1R1A 3;  5F37 A;  3A0K A;  1V00 A;  3JZV A;  1YFY A;  4ATF A;  4RD7 A;  1XNT A;  1RTV A;  3GDB A;  2NYY A;  5FY4 A;  1NCQ C;  2W46 A;  4IV1 B;  4WBB A;  1POV 0;  2DCJ A;  4H2A A;  2ZTN A;  4IEW A;  4QU2 A;  3WX5 A;  4AQT A;  1W9Y A;  1O3T A;  2XVG A;  1TZO A;  4LE4 A;  4CDU C;  4URT A;  4HMZ A;  2GZW A;  3TAY A;  5CEH A;  3E6C C;  1JUH A;  5FIX A;  2Y64 A;  5FUP A;  3MIH A;  1Y9M A;  3JB8 A;  1MR5 A;  4DFS A;  4HSJ A;  2PAK A;  2W1Q A;  2YC2 A;  2WAA A;  4MXW B;  1OUS A;  2XQR A;  1BVP 1;  4MGY E;  4LPL A;  4GWN A;  1AXZ A;  1DP0 A;  2HKX A;  3KB5 A;  3MUZ 1;  3VBS A;  1MEC 3;  1ULE A;  2YPD A;  3IPV A;  4A3X A;  3URF A;  3RDI A;  1A78 A;  1CAW B;  4GZ9 A;  4XW3 A;  2RDS A;  1IG0 A;  2VR4 A;  1TMF 1;  1VAL A;  2LW8 A;  4UFJ A;  4CCL A;  2D6O X;  4I0B A;  4LNV A;  5EYX A;  1HB2 A;  3KS7 A;  1ND3 C;  4YRD A;  4GKY A;  5C71 A;  4YVS C;  3VBO B;  1QOS A;  1G7Y A;  1W9F A;  4L99 A;  1AR6 1;  1OPM A;  3DKQ A;  4MH0 E;  2HWE 2;  4OYU A;  4RHV 1;  2VVD A;  3AMM A;  3WP4 A;  1IPJ A;  4AHX A;  1NCQ B;  4LBO A;  5FYV A;  4D6Q A;  4PLN A;  3ZYJ B;  3GHN A;  4M3C B;  1N1Y A;  4QDR A;  3CO2 A;  3AKT A;  1X33 A;  4KWJ A;  1O8P A;  1WBL A;  4BZ4 A;  5C3O A;  4CDU B;  2W1S A;  4JKK A;  4PBP A;  4OUL A;  4R9A A;  3HOB A;  3S0M A;  3KQ4 B;  1GZC A;  2AH2 A;  4R4X A;  3RJR A;  4CP1 A;  4GH4 C;  3OY8 A;  3WUD A;  3TEZ A;  1AL0 G;  4PBO A;  2JG9 B;  5A7O A;  1RUJ 2;  5JOX A;  3ZXF A;  3MF9 A;  3GZT B;  1G9F A;  2WL1 A;  1XSR A;  1RUI 1;  2V5D A;  4JKL A;  1V6N A;  2G9F A;  3S30 A;  3X29 B;  5FLJ A;  2ADD A;  2W39 A;  3RWN A;  1WCD J;  5FCC A;  5KHG A;  4LBM A;  2Z4F A;  4OUM A;  2G9Z A;  2PLV 1;  3OPZ A;  3GBG A;  4L11 A;  3MLK A;  4QGL A;  1QJZ A;  2WAO A;  4XJW A;  1VRH 2;  4A7Y A;  4DUW A;  3NV3 A;  2RDN A;  2ZEW A;  5F5C A;  3SNM A;  3IWZ A;  1DG6 A;  2A6Y A;  4J1X A;  2GC1 A;  1ND3 B;  5FY7 A;  3ILR A;  2HWB 1;  4QXK A;  4XFI A;  5ISL A;  1G9B A;  4K6B A;  2W08 A;  5FMD A;  3FLR A;  1C3H A;  3DGT A;  1NXD 1;  5DAX A;  1YUD A;  3PDQ A;  5F2W A;  4DXS A;  3PUS A;  3VD5 A;  2ZCW A;  4Z2W A;  3ZXL A;  1I3H A;  3MUY 1;  2DBI A;  3LEG A;  1GQG A;  4W4Z A;  1LOF C;  3MIC A;  4LBQ D;  5FO9 B;  1YJL A;  2W1W A;  4X8P A;  2AGS A;  4LO6 B;  2ZX0 A;  5D1I A;  2R0F A;  4NHY A;  1C1L A;  5J98 B;  2B9V A;  2R07 1;  3WV6 A;  4EN8 B;  2VBP A;  2VNR A;  5FXZ A;  4AI2 A;  1KJL A;  1WMF A;  4UBH A;  5AC9 3;  2VZS A;  3SIS A;  1KQR A;  5JOW A;  1W2N A;  2UYA A;  1IS4 A;  1QNY A;  4UFH A;  5DPN A;  2D93 A;  1F15 A;  2PQQ A;  3PTR B;  5FUI A;  3RVH A;  4DY5 A;  2BWC A;  3B94 A;  3NV2 A;  1A8M A;  2RS3 1;  2FMD A;  3JD7 2;  4F7Z A;  1Y7B A;  5FQ0 A;  2ID4 A;  5AVP A;  5GZF A;  5LY2 A;  3T0A A;  3EO6 A;  4UT5 A;  2ZHL A;  5FWE A;  2BV4 A;  1ZRD A;  3LDB A;  1X8E A;  1ALY A;  2XL9 A;  5FYH A;  1EP0 A;  2IUW A;  5C4W A;  3K3O A;  1MVE A;  4XHB A;  2CNA A;  3WDY A;  1LHW A;  1N3P A;  2XJR A;  1UOB A;  2XR4 A;  4QKB A;  4WZF A;  1WWY A;  4XUN A;  1HX6 A;  2R06 3;  1LGB A;  2KR2 A;  4XVH A;  3MLL A;  4AHY A;  3O1U A;  1O8S A;  2EIB A;  5H9R A;  5FLI A;  3WDT A;  4RQP A;  1F5J A;  4ZHN A;  3P1I A;  4AF9 A;  1XNC A;  2ZX1 A;  2YUE A;  2XKO A;  4QX5 A;  1ZZ6 A;  2VNV A;  2W95 A;  2XJV A;  2XHN A;  4JQT A;  3U14 A;  3NJV A;  2LAL A;  2RMU 2;  2UYB A;  5FRE A;  2WSV A;  1UN1 A;  3KGZ A;  5C5T A;  1UOG A;  2D6N A;  2RVA A;  5ACA 1;  1X36 A;  5IVF A;  3ELN A;  5LZ6 A;  1O3Q A;  1HRI 2;  5IK4 A;  5IAV A;  1JYX A;  1OLM E;  4QB1 A;  1BKZ A;  3WUC A;  1AR9 3;  2A1X A;  4CCO A;  2Y6G A;  3E6D A;  4B29 A;  2WNU A;  5A80 A;  5C3Q A;  5I8Y A;  4AFA A;  3VBS C;  3SH3 A;  1Q43 A;  1VBB 1;  5FZG A;  3IT8 A;  1W28 A;  4XF4 A;  2WO3 A;  1DFQ A;  4NRQ A;  3OOX A;  5FO8 B;  4NO4 A;  2D3S A;  3AP4 A;  3E5X A;  4EYU A;  3ZFE C;  4HK8 A;  3USU A;  3BOP A;  4FQ4 A;  3APB A;  1IS6 A;  5D21 A;  1FOD 1;  4HOO A;  4CXY A;  3BU0 A;  4AED B;  2PAM A;  2TEP A;  5FDB A;  2BNO A;  4XF1 A;  4RL7 A;  1UOJ A;  4JCK A;  1US2 A;  5K0U C;  1EAH 1;  2BGC A;  2QQO A;  1RUD 3;  2GNT A;  2QFE A;  4K3U A;  1D4M 2;  2E7A A;  1GLH A;  5HXM A;  3PUI A;  2JG8 B;  3WG1 A;  4ARX A;  2RV9 A;  3MPB A;  5KXB A;  4GWI A;  4FTS A;  1SFY A;  4Q4V 2;  2C0Z A;  3OBR A;  4YNI A;  4QKF A;  4NIA A;  1GIC A;  1V6K A;  3MDP A;  3SMH A;  4WVM B;  4DXR A;  5HV0 A;  5BXX A;  3RZK A;  4AVT A;  3QBQ A;  3RZZ A;  3CJI A;  4KU8 A;  3NNM A;  2ADE A;  1F4A A;  2ZAC A;  1DLL A;  4XJZ A;  5T50 A;  1CAX B;  4UW5 A;  4GMP 3;  1BEV 3;  5T3N A;  4JX0 A;  1QOT A;  3RSJ A;  2B45 X;  2VXR A;  3RPQ A;  3ZKY A;  1QGL A;  4NPM A;  4CU8 A;  3OYW B;  1WD3 A;  3DEC A;  4DXT A;  3WDV A;  1TG7 A;  4KH9 A;  2HWC 2;  4R9B A;  3ACL A;  3GJA A;  5DXD A;  4H7L A;  3ZFE B;  4CDW A;  3V56 A;  1S55 A;  1VBD 1;  4UBG A;  1W8N A;  1N1V A;  2KXL A;  2ET1 A;  2WII B;  4QX2 A;  2WKK A;  3WNX A;  2Y26 A;  4O9E A;  3WIN E;  1LUL A;  3K51 A;  3TNP B;  1EV1 2;  4BIF A;  5ABJ A;  1ZBA 2;  2C1F A;  1VMJ A;  4PI2 A;  5K0U B;  1H0B A;  2HWD 2;  2C9K A;  1URX A;  2V09 A;  4HFS A;  4AHZ A;  1ZA4 A;  2XBO 3;  1WMX A;  3FBY A;  5DUW A;  1SCS A;  5LK5 A;  1MQT A;  3VBF A;  1Q8V A;  1W6O B;  3WEZ A;  5FWJ A;  1GOF A;  1TME 3;  1AVB A;  4CP9 A;  3VD9 A;  4TZD A;  1ND2 A;  1PGW 2;  2VUL A;  4K21 A;  1V0A A;  4CCM A;  4XIO A;  4X6R B;  3IAQ A;  4XDQ A;  5C9A A;  1Z7S 1;  3WG4 A;  1I9R A;  3FUO A;  3H3L A;  1R09 3;  1KFX L;  2FMY A;  2HWF 2;  3NRU A;  4COZ A;  5JMO A;  2CGO A;  5DDJ 2;  1LOC A;  2K9Z A;  2WSU A;  4IE0 A;  2A3X A;  3KT1 A;  3ZMN A;  3OEB A;  1OLM A;  1WLD A;  5LB6 A;  5DZG A;  4AAP A;  1NYW A;  2VCM A;  2V4V A;  1COV 1;  4KGG A;  2ZGT A;  2F4L A;  1RMU 2;  1FNZ A;  3BVC A;  1SBE A;  1R08 2;  5JSR A;  5FOJ B;  1RUE 2;  2QQK A;  1UYZ A;  2W5F A;  2WS9 3;  3ZIX A;  3FWE A;  4C0B A;  4COV A;  2WR9 A;  5IVY A;  1SMV A;  1I6X A;  1C1F A;  4YPJ A;  1F35 A;  2IC1 A;  5T5P A;  3N9L A;  5IAX A;  4QXH A;  3ZDV A;  1QJU 1;  5C4W C;  3ZIW A;  1LGC A;  3VKO A;  1J59 A;  3H9A A;  1CPN A;  1V9U 2;  4IQP A;  2DVD A;  4ASM B;  4Z8B A;  1W2U A;  1J1T A;  1S0G A;  2YDE A;  1JXN A;  3R0R A;  2DU0 A;  4MHR A;  5EHD A;  4F83 A;  3Q8C A;  1WKY A;  1YIP A;  4RQP C;  4DEV A;  4QWN A;  1DQ2 A;  4MO3 M;  5FMB A;  4ASK A;  3AP6 A;  2OUH A;  2GH2 A;  4COU A;  1MZE A;  2OPW A;  3I59 A;  1YC6 1;  2Q8E A;  3LPF A;  1OF3 A;  1PO1 2;  4XMA A;  1H8T C;  1W6N B;  2H6C A;  2QE3 A;  4PIZ A;  4RGA A;  4TXW A;  3ZFG C;  4AQS A;  4AXO A;  4URA A;  1AYN 2;  1L3J A;  2A3W A;  1JYI A;  4GB3 2;  3ZYH A;  1O5L A;  1LEM A;  1S0J A;  4KBZ A;  2D6K A;  4XIL A;  5GLU A;  3JCI A;  3KCC A;  4Q4Y 1;  2E31 A;  3B9I A;  3H7J A;  3POF A;  3SCF A;  4RS5 A;  3TWI A;  2RM2 1;  5F6L B;  3WW2 A;  5D2A A;  2XH6 A;  5FZ0 A;  4AGR A;  3FFQ A;  5LEJ A;  1R1Z A;  1RJ7 A;  2BYV E;  4PIX A;  2WFF 2;  4TTG A;  3KCY A;  2WRA A;  3ZN4 A;  2Z42 A;  4RYD A;  5K8S A;  4FFG A;  4ERO A;  5C33 A;  2VZP A;  1GZW A;  4N43 A;  4W8J A;  4J1W A;  5KHK A;  1R64 A;  2EAL A;  3OB8 A;  1RUG 3;  1X9T A;  5F39 A;  4Q4W 1;  3B00 A;  1IHM A;  3M2M A;  4QQ2 A;  1DZT A;  3B69 A;  2D6L X;  4NOT A;  2P34 A;  2OA2 A;  4GXL A;  3N9M A;  4X6Q B;  4JHT A;  5FLH A;  2WZR 2;  1NCR B;  2PEL A;  4BH9 A;  3I54 A;  5HXV A;  1D0H A;  2E7T A;  2RR1 2;  1AR7 2;  1DIW A;  1YLL A;  2VL4 A;  1VBE 2;  3AC0 A;  2Z69 A;  4MVT A;  1H8T B;  1B09 A;  5FY9 A;  1XE7 A;  2XUM A;  3ZFG B;  4Y24 A;  1YI9 A;  3A21 A;  3J7M A;  2Y33 A;  4YG0 A;  2Y8K A;  3GBF A;  1ZZ8 A;  1OH4 A;  1BLZ A;  3M70 A;  3P5B A;  3T1M A;  5F2S A;  1T6G C;  5K4L A;  4BXS V;  1U0A A;  3ENR A;  1A34 A;  2MEV 1;  1GFF 2;  2Y6F A;  2RS1 3;  3LSE A;  5JLV A;  1W2A X;  4OHW A;  1MZF A;  1IS3 A;  3AYD A;  3H3Z A;  4ITC A;  5DAW A;  1VE0 A;  1LGN A;  2GU9 A;  4CDW C;  2G19 A;  2QZ3 A;  2RDQ A;  3QOP A;  1FMD 1;  3ZR6 A;  1EUU A;  1OQ1 A;  1Q8O A;  4QHO A;  1Q8Q A;  1I5Z A;  1BBT 2;  1LOA A;  3CKH A;  3U11 A;  3ZKU A;  4XQ4 A;  1GWK A;  3ILF A;  1PIV 3;  2JEC A;  3MFA A;  3U1X A;  2OXB A;  4OMC A;  2ZGM A;  2BZD A;  2A70 A;  4WM7 A;  1UL9 A;  3DYO A;  1PO2 1;  3FE5 A;  1MQT C;  2A6Z A;  3ILN A;  3ZXE A;  4Q0U A;  1RGS A;  2UWC A;  1R1A 1;  2ZBJ A;  4BQ2 A;  4XFF A;  2YZ4 A;  1IKQ A;  1RVF 2;  2VC9 A;  5C9A C;  2Q1F A;  5J36 A;  4OMD A;  3UKV A;  2A71 A;  2I45 A;  1FNY A;  1LEN A;  4R9D A;  1UY2 A;  3PUH A;  1ZRR A;  1IQA A;  1VB4 A;  5I0T A;  2NP0 A;  1X9P A;  3J8F 2;  2XVK A;  4MGI E;  4LO4 B;  1F5F A;  3RYR A;  4LBQ B;  1KXG A;  2OS2 A;  1PVC 1;  3KVA A;  2QQW A;  5HI0 A;  2R30 A;  4AGG A;  1TVG A;  1HRV 2;  1UW8 A;  2QQL A;  1UZY A;  3F2Z A;  4KMQ A;  1LES A;  1HXS 2;  1E5S A;  2BFU L;  2TNF A;  4BB3 A;  3NO8 A;  4XFB A;  5GLW A;  3UES A;  1MEC 1;  3OD4 A;  3HD8 B;  5C5U A;  2A6X A;  5FPX A;  3NVC A;  1AL2 2;  3S6P A;  2HYX A;  2RS5 2;  4QPG C;  3VZJ A;  4MSV A;  3NKT A;  2CU5 A;  4Y26 A;  2X53 S;  5ERL A;  4UF0 B;  2XLA A;  3T30 A;  3I2D A;  4YM3 A;  5L9R A;  3EYP A;  1ONA A;  4C91 A;  3ZN6 B;  1YEW A;  4N8M A;  1TNR A;  2YU2 A;  2JE8 A;  3POS A;  2FCT A;  5E88 A;  3AJY A;  4CDX A;  2Y38 A;  5C3R A;  2GP3 A;  3PMS A;  4H7M A;  4FAH A;  4BYY A;  4RS5 C;  2HWE 3;  4XTP A;  4P00 B;  5KXD A;  5A33 A;  4Q4X 2;  4C1W A;  3BIE A;  2R1D A;  1GP5 A;  4IET A;  4IEU A;  2YG0 A;  3H8O A;  4EN6 B;  3HNB M;  1CZT A;  3I2F A;  3TN9 2;  2A5Z A;  2LRP A;  4IEX A;  3TNQ A;  4CEY C;  3PVO A;  2WA3 A;  3OPW A;  4FPL A;  5DAV A;  1OH3 A;  2X29 A;  3MGU A;  1JBC A;  2YC4 A;  4MUV A;  4K20 A;  2ZGU A;  4N43 C;  4XXP A;  5J37 A;  1HB4 A;  2VNG A;  2RHP A;  3AJZ A;  4QPG B;  4Y22 B;  5DZF A;  4CCC A;  1LJ7 A;  1ULO A;  2VMG A;  4YVW A;  2IXI A;  4OQ9 A;  1TNF A;  2O8Q A;  4ZS3 A;  2JEN A;  1SDD B;  1W0P A;  1N3O A;  3I3M A;  1ZBE 1;  5L9B A;  4HVO A;  1BMV 1;  1UY4 A;  2JDZ A;  1VRH 3;  4P9W A;  3ZSL A;  1F2N A;  2W2I A;  3UKT A;  2HEY F;  3OTF A;  4YFZ A;  3PIJ A;  3EMR A;  2JD9 A;  4QDQ A;  3K3N A;  1WLT A;  5KBF A;  5IYY A;  2WIN B;  1QJX 1;  5FP4 A;  2O14 A;  2E7Q A;  1RUH 2;  4LHL A;  3WF2 A;  3CZJ A;  3WQ7 A;  3L9J T;  5JZG A;  5IK7 A;  2VUA A;  4DUV A;  1UPS A;  3PUR A;  5BV6 A;  4BQ3 A;  4YFW A;  3T2T A;  3ACH A;  1A3K A;  4CEY B;  3QAC A;  1OSG A;  4P5H A;  1Q8S A;  5KHI A;  3DUI A;  4K8F A;  4BJ0 A;  2AEN A;  4Y20 A;  1QQP 2;  2D3R A;  2AEY A;  3U37 A;  2RE9 A;  1YCI A;  2DUR A;  4N7I A;  4BQX A;  3J7H A;  1RIT A;  1V70 A;  3NKG A;  4CCN A;  3O1S A;  1NAE A;  3CF6 E;  2W68 A;  4XJU A;  4CDQ C;  2WZP P;  4IV3 A;  4X8N A;  3BOD A;  1IOA A;  3JD7 3;  2VUJ A;  3FFZ A;  3VBR B;  1S0I A;  4I0A A;  2BW8 A;  2VQT A;  3LEI A;  3WF4 A;  4C1X A;  5LCW L;  1SEF A;  2JB8 A;  5FV3 A;  2CGP A;  3HBK A;  2OPK A;  3WLU A;  4YW1 A;  1OVS A;  1GMM A;  1W6M A;  1MS3 A;  1YYN A;  2YYO A;  1VAK A;  1WZX A;  3NMB A;  4BLI A;  2PHX A;  2ZEX A;  3LCP A;  1WME A;  3WR0 A;  4GJY A;  5HCH A;  1PM4 A;  1VMH A;  2Z2S B;  5CIR A;  4HKW A;  4A41 A;  1YNA A;  4U36 A;  1W8W A;  3VBH C;  4BU2 A;  3LGR A;  1W03 A;  3V0A A;  3AFG A;  1AR9 1;  1Y9Q A;  5DUU A;  4NRM A;  4AWD A;  4JGZ A;  3UL2 A;  1W06 A;  4EWA A;  3WF3 A;  1S1A A;  2QQU A;  5FFO C;  2RMU 3;  5FP3 A;  4AEM A;  2JDK A;  5JPM B;  2VZ1 A;  4FOQ A;  3FHQ A;  3AZV A;  3HWJ A;  1SAC A;  1TMF 2;  1HRI 3;  4ATE A;  3W5M A;  3SHR A;  1UX6 A;  2UU8 A;  4LUL A;  4Y1U A;  5DAB A;  5EZW A;  5I0U A;  1HN0 A;  3MF6 A;  4AFB A;  4UW6 A;  4CDQ B;  1MS8 A;  4FO9 A;  1CIW A;  1AR6 2;  5HBA A;  4DUX A;  4QPI C;  5F6K A;  5JR7 B;  3POE A;  2UWA A;  3ZSE A;  4CCJ A;  4RHV 2;  4PHZ A;  1DGW X;  1W8O A;  2OX0 A;  3HJR A;  3WZ1 A;  2ZX4 A;  2GSY A;  5KXC A;  3PJY A;  1QXJ A;  2I07 B;  3ZFF A;  2ZGK A;  2ZZQ A;  3NNF A;  5AVA A;  2W92 A;  1QMJ A;  4OI4 A;  4NHK A;  1GNH A;  3FLT A;  4JQR A;  1LHO A;  4DNY A;  3PNA A;  1GR3 A;  2YC0 A;  1JI6 A;  1W0N A;  4Y5S A;  5BNO A;  1NA1 C;  2XOM A;  3PJQ A;  3VBH B;  4FPJ A;  1D4M 3;  4ONU A;  2Y6K A;  2WFP A;  4E9K A;  2FZ2 A;  2DBN A;  2LM3 A;  1Z78 A;  5IFT A;  3UGF A;  4OI0 A;  2D5F A;  3BCW A;  2ZGL A;  4P08 A;  1RUI 2;  4LIV A;  4Q4V 3;  5D8A A;  1YXW A;  4BA6 A;  4HAN A;  2D98 A;  1O4T A;  1RYY A;  1XNK A;  2CGN A;  4EE2 A;  1DZQ A;  2PLV 2;  4NWW A;  4JAA A;  4BXF A;  3C7O A;  4NMI A;  2YHJ A;  3PTY A;  1W6P B;  1J3R A;  3KWV A;  3KZ4 C;  3V0B A;  5IVJ A;  1J3P A;  3NAP A;  5FZO A;  3ZPO A;  2YBK A;  3GGL A;  2HWB 2;  4FOW A;  5L9V A;  5GLV A;  1RUN A;  2Y6L A;  2QTW B;  4QPI B;  5IVB A;  3L2Y A;  2D7F A;  3WT3 A;  3D82 A;  4DPN A;  5T55 A;  2HWC 3;  5CYY A;  3DPR A;  4FSJ A;  1S2K A;  2FCV A;  3IZO A;  2XBO 1;  2LTN A;  4Y33 A;  2IZW A;  5IFP A;  1MS0 A;  4KG8 A;  5HPO A;  2WC2 A;  2WYS A;  3ES1 A;  2A6V A;  4Q5O A;  1H9P A;  1S2B A;  2Q5T A;  1UYP A;  1BZW A;  4WVW A;  1G86 A;  2R07 2;  5T5O A;  2HWD 3;  2VZQ A;  2X05 A;  4QX7 A;  1PGL 1;  1NA1 B;  4R52 A;  3VDD B;  5A7W A;  2D6M A;  4XBN A;  4CP0 A;  5JZG C;  1RUF 1;  2ERF A;  3ALQ A;  2PYT A;  3R05 A;  3RG0 A;  1AYM 3;  2VBB A;  1OLQ A;  1JYC A;  2PMW B;  3SXW A;  1PHM A;  2UWB A;  3OBZ A;  1HJG A;  3UNP A;  1IG3 A;  3I3E A;  5CU1 A;  3THP A;  2RS3 2;  4ES9 A;  1OOP A;  1EPZ A;  3HQU A;  3MHZ A;  5DN2 A;  5FZE A;  5FPZ A;  2VW1 A;  2VZ3 A;  3MW4 A;  4NRO A;  2W47 A;  2WS9 1;  4CEW B;  1GOG A;  2HWF 3;  2XB6 C;  2XWJ B;  2ZS6 B;  4FPC A;  4GAZ A;  1N3Q A;  4IE5 A;  4PJY A;  3KV9 A;  5DDJ 3;  1AHS A;  3LEK A;  2JKB A;  4D7Y A;  2VMH A;  1VMF A;  1ZRC A;  1VB2 A;  2G1M A;  2J1E A;  1V6J A;  2VOK A;  2G9G A;  5A32 B;  1RMU 3;  3AL5 A;  4NN0 A;  4PLM A;  1LCL A;  3HT1 A;  3AYA A;  1RUE 3;  1LB2 A;  5FXX A;  4C0H A;  5BNN B;  1AJK A;  4E4H A;  2ZX2 A;  3T1L A;  2DFB A;  1D7P M;  2F4P A;  4JRA A;  5I0S A;  3GCW A;  3MPP G;  1V9U 3;  2A7A A;  2VQ0 A;  1C8M 1;  2E32 A;  5FYZ A;  3J4U H;  1KIT A;  3K77 A;  4TLF A;  4LOR A;  1JOJ A;  3GM8 A;  5ACA 2;  3AYE A;  3DN7 A;  1PK6 B;  3FZ3 A;  1S0E A;  5J1X A;  4MGK E;  1K5M A;  1WCQ A;  3DKW A;  5CFC B;  5FYB A;  4LK6 A;  1HLC A;  2PHL A;  4BMB A;  1U12 A;  1OXC A;  4YGC A;  4EZ4 A;  4QB2 A;  4AFM A;  3CLP A;  1WMD A;  3BUC A;  1PO1 3;  3ATG A;  4M4R A;  1AYN 3;  1RUO A;  4GB3 3;  3VDC A;  3D5O A;  4AAX A;  4YG3 A;  4AVC A;  1RB8 G;  5FZF A;  4AOC A;  1FOD 2;  2DVG A;  3J7L A;  1CAU A;  1W8T A;  1J83 A;  1HW5 A;  1DQ6 A;  1EAH 2;  5LW9 A;  1DQ5 A;  5FK7 A;  1GSL A;  2CAV A;  1NLR A;  3AMP A;  4P02 B;  3KV4 A;  4XHX A;  1NZC A;  2VW0 A;  1DGW A;  4QKD A;  2ZGS A;  1CAV A;  3NNJ A;  4EZH A;  4CU7 A;  5CA6 A;  1REF A;  1YQ8 A;  3ZFF C;  1OQE A;  4FPG A;  1O4Z A;  4COY A;  4XJ9 A;  2DYC A;  2E51 A;  2VG9 A;  3SKV A;  5C8C C;  1C28 A;  4K1Z A;  4L97 A;  5F5Q A;  1HQW A;  1GKB A;  2QBX A;  3Q8F A;  5KXE A;  3O0W A;  2OKX A;  2ZGR A;  3SH5 A;  4YVS B;  1VBA 3;  2YGM A;  1G8W A;  4NPR A;  1O59 A;  1KRI A;  1QH7 A;  2R04 3;  5GJ6 A;  2JB4 A;  5FYS A;  3VL9 A;  1C4R A;  2FD8 A;  1W8U A;  3DF0 A;  4AI0 A;  2CHH A;  5D8A C;  4LHK A;  1AR7 3;  1C5I A;  1VBE 3;  1ZX5 A;  1XJA A;  2ORX A;  3IMM A;  2GP5 A;  4XZU G;  1GWM A;  3I97 A;  4FPO B;  4BIS A;  2RG4 A;  1VBD 2;  2FDK A;  2YXS A;  3NAP C;  5F3C A;  2CY6 A;  2QJV A;  1NT0 A;  3ACF A;  3JQX A;  1B35 A;  4QX3 A;  3WXP A;  4E2S A;  1GWL A;  2R6Q A;  2VTX A;  4GH4 B;  5EV7 A;  2XVL A;  3G6J B;  1PIV 1;  2D6P A;  1FPN 3;  1OKO A;  3ACG A;  3DPR C;  4L8Q A;  3K2O A;  5L7O A;  1RUC 1;  3LKJ A;  1GNZ A;  1VAV A;  5CFD A;  4AVB A;  4HPK B;  4ZU5 A;  1BBT 3;  1AXK A;  4JTN A;  5C8C B;  1PMH X;  2VGD A;  3E97 A;  5LY1 A;  1W2O A;  5LAS A;  1KDK A;  3KV5 A;  1Z7S 2;  3HEI A;  4P5Y A;  2QDN A;  2FBE A;  2HH9 A;  1MS5 A;  3I7D A;  3K46 A;  4Y1X A;  4QX1 A;  3PL0 A;  3ST7 A;  1BCX A;  4UFK A;  2WQ8 A;  1QF3 A;  2YV8 A;  4NAM A;  3IBM A;  5FBZ A;  1COV 2;  4PCR A;  1OOP C;  2BGP A;  4UFL A;  1NZI A;  4C8D A;  5FY0 A;  3AMQ A;  5A3T A;  3T08 A;  3ZYB A;  2DVA A;  1WUV A;  5LEK A;  5T52 A;  3N35 A;  4CU6 A;  3J8F 3;  2HEW F;  3OPT A;  3GAL A;  4IES A;  3RWK X;  2YMZ A;  2ZX3 A;  4W6Y A;  3TOJ A;  5J48 A;  3BTY A;  4XET A;  5CVR A;  4XAA A;  1LKN A;  1HRV 3;  2HBT A;  1H2M A;  2WNV A;  1U5X A;  3KV6 A;  3OGG A;  2R49 A;  2C5D A;  3AKR A;  1HXS 3;  4KWK A;  5GKA C;  3LD8 A;  3TBD A;  5AFB A;  1ODN A;  4C90 A;  2VY0 A;  5FY1 A;  1W6Q B;  2JEM A;  2NLR A;  1NQD A;  1H8V A;  4HG6 B;  3WW1 A;  3ZSK A;  4XF9 A;  2JDM A;  2JD4 A;  2Q1Z B;  2Y34 A;  3GNE A;  1SPP B;  1XYP A;  2N7G A;  3FHA A;  2P1B A;  1VBC 3;  3R4D B;  1AL2 3;  3KT7 A;  1LEC A;  2E6V A;  3OEA A;  5FZ4 A;  2RS5 3;  4A42 A;  4BME A;  4YZ5 A;  3S5A A;  2H6B A;  4H55 A;  2J1U A;  2VQA A;  4ZU7 A;  1IKP A;  4Q4Y 2;  5LA9 A;  2DCT A;  3D0J A;  2E26 A;  3J9S A;  4XAB A;  4ZON A;  4BQ1 A;  4ASL A;  2RM2 2;  3OG2 A;  1OA4 A;  3I2H A;  2ES3 A;  3ZPY A;  1H9W A;  3WNK A;  1XNB A;  2E9Q A;  5HCA A;  3J26 N;  5C70 A;  1KD7 A;  1QDC A;  3NQH A;  2BER A;  4QM9 A;  2J1T A;  1YHF A;  1ZYB A;  2XJS A;  5DUX A;  4XJ8 A;  1OUX A;  2HJI A;  4LIU A;  1IQD C;  4ZY9 A;  3EB7 A;  5L36 A;  5GZD A;  1OPO A;  2ZXQ A;  2GN3 A;  3B5L B;  2O1Q A;  2Z5W A;  4A44 A;  4Q4W 2;  5JI7 A;  1PMI A;  2JX9 A;  3KVB A;  3MYX A;  5EPA A;  3VBU A;  3TN9 3;  3IB3 A;  3VBS B;  2SLI A;  2WA4 A;  3IMN A;  4QAW A;  2VTX J;  3N4M A;  3IPV B;  4N53 A;  3M3C A;  1ZNP A;  4LOT A;  4HSL A;  3B9C A;  3PLQ A;  4DY3 A;  1QKQ A;  2WO2 A;  2HEV F;  3ZXA C;  1H2L A;  1VRH 1;  1GOH A;  3WHT A;  1JOB A;  3E1F 1;  3UGH A;  2D97 A;  4LHN A;  1JH5 A;  1OVP A;  1MZ5 A;  5EWS A;  2E63 A;  4XAE A;  4AEJ A;  1YQ2 A;  1O5U A;  1OQD A;  5J3U A;  2BP6 A;  4AVV A;  4KBB A;  2EVX A;  3O7O A;  1C8N A;  3BGA A;  1SBF A;  2K0G A;  2MEV 2;  2VOT A;  3III A;  3D0S A;  4PLO A;  4QD2 A;  4A2U A;  2JIC A;  3PU3 A;  4JDM A;  4Q2F A;  5BNP A;  3EJK A;  4CP2 A;  1FMD 2;  1NQJ A;  4HZF A;  5IVE A;  2EXI A;  3POJ A;  1W05 A;  1WW7 A;  4QXC A;  3NV1 A;  4IXL A;  1DGL A;  1OA3 A;  1OMI A;  1RUH 3;  3OY8 B;  4TSV A;  1UNB A;  3TB0 A;  3QH7 A;  3C7H A;  1APN A;  4OFG A;  2B9U A;  3NJY A;  1NLS A;  3VHO A;  4NHX A;  1PO2 2;  2YBS A;  2ZZJ A;  3S7I A;  1UXX X;  1YQ6 A;  3O5S A;  1OUR A;  4MXV A;  4BQW A;  4LKS A;  1R1A 2;  3T3Y A;  4YWA A;  2XLG A;  4IGP A;  1QQP 3;  1QJY 1;  1Y43 B;  1CON A;  4W6X A;  1LU1 A;  4YAR A;  5J96 B;  5FMO S;  1M06 G;  4LT5 A;  5ANQ A;  4M01 A;  4GWJ A;  5JXG A;  4OHY A;  2C4X A;  1FV3 A;  2LS6 A;  1JW6 A;  1UAI A;  1OFN A;  4RR3 A;  2VOV A;  4QDS A;  1HQN A;  1L7R A;  1PVC 2;  2MNG A;  5FZ8 A;  3WQ1 A;  2V72 A;  4Y5Z 0;  4E4D X;  1LHU A;  1A8D A;  1QXR A;  2PAE A;  4Z07 A;  4JZR A;  5FYC A;  3ZR5 A;  1SG3 A;  3D4K A;  1F9K A;  4YW2 A;  2ZAB A;  3K4Z A;  4EWE A;  5JSO A;  2C24 A;  1CES A;  5FKB A;  2PHU A;  1I5P A;  1JS9 A;  2BOJ A;  1SHW B;  4PT6 A;  2QQN A;  2X09 A;  3H7Y A;  5FYY A;  2WO7 A;  3DEM A;  1Q5O A;  1ULG A;  2FDJ A;  4B4R A;  4B8E A;  1ZA7 A;  3IDC B;  5A6Y A;  3S7E A;  1JZ5 A;  3AK0 A;  1ZZB A;  2WNU C;  2WNV C;  4AR2 A;  4L2N A;  1DU3 D;  2WWS A;  5FQ0 B;  1QWR A;  5FZC A;  1AF9 A;  3GBW A;  3IKW A;  3ZO0 B;  3TEX A;  4YGE A;  5H9Q A;  1BVV A;  1AX0 A;  4GJZ A;  1TMF 3;  1LOB A;  1YQ5 A;  1GQP A;  3H1M A;  3H0O A;  3NL1 A;  4ZKT B;  5C4W B;  1Y3T A;  3I4I A;  3JBG 3;  1JZ2 A;  2DCZ A;  2P3I A;  1W04 A;  4HT1 T;  1AR8 2;  3WNN A;  3DXT A;  4WM8 A;  2AR6 A;  4KGQ A;  3O1P A;  1AR6 3;  3C3V A;  3CBN A;  4G4F A;  3PU8 A;  1LTE A;  1N47 A;  2YGL A;  3ACI A;  1BYH A;  1W0O A;  2NZ9 A;  2WT2 A;  1G6N A;  5LAT A;  4RHV 3;  2IXL A;  4K1Y A;  4RQP B;  4XF3 A;  1C5H A;  4UW3 A;  2BGO A;  3QD6 A;  4Z2A A;  1XE0 A;  4FXK B;  1DQ4 A;  4LTA A;  4MAD A;  5IW0 A;  3ME2 A;  3ZYR A;  5F1R A;  2D43 A;  5JDB A;  2NM1 A;  2Q1M A;  4JGY A;  4H3W A;  1RHI 3;  4XZP A;  1H1A A;  3CJI C;  3RMX A;  2VM9 A;  3DV8 A;  2DFC A;  2WNO A;  2GNB A;  3KGL A;  1ZRI A;  5FP7 A;  4CU9 A;  5I91 A;  2WNU B;  3WVJ A;  4XFH A;  4D7S A;  4IND A;  4A4A A;  4EN9 B;  4J6G A;  5C7G A;  4AI3 A;  3CZU A;  5EP9 A;  1IS5 A;  4FOY A;  5EYY A;  3OUJ A;  2A75 A;  4KL1 A;  1ZBE 2;  1BMV 2;  4XAC A;  4D8M A;  2PLV 3;  3VZM A;  3ZX7 A;  4XTM A;  2YY1 A;  1UMH A;  4PF1 A;  3MO4 A;  4AE2 A;  4B1M A;  3USU B;  3QCW A;  4MV2 A;  3QH6 A;  2B7Y A;  4R9C A;  2VME A;  2ZGP A;  3OBA A;  2P3Y A;  5ABJ C;  1I1E A;  1ASJ 1;  5FPA A;  1CN1 A;  2AC1 A;  3SCG A;  1QJX 2;  3A22 A;  4NWV A;  5AFE A;  1PGS A;  1ZM1 A;  4AQ2 A;  1KFU L;  5FZ6 A;  4LXL A;  5EXO A;  5GAL A;  1CX1 A;  2ATF A;  3WNM A;  5FZ3 A;  1VPH A;  3P3P A;  5LA2 A;  3VBF C;  5A3N A;  4Q1P A;  5L73 A;  4YM1 A;  3I49 A;  1AYM 1;  3EXU A;  3NWK A;  1D0G A;  1ND2 C;  1WLC A;  2O8O A;  3AMH A;  5BNP C;  4LBK A;  4QGM A;  1NY7 2;  1QH6 A;  1XE8 A;  3Q8A A;  5JXI A;  1H30 A;  3CJI B;  2VO5 A;  4MYE A;  2EXH A;  3POI A;  5K9Y A;  1DZR A;  5A3W A;  5FZK A;  1JZ8 A;  2CWM A;  3T2P A;  3RGB A;  3BU7 A;  2RS3 3;  4Q0V A;  3H8R A;  3FMG A;  1KGY A;  1F4H A;  1YFU A;  5FZL A;  1SLB A;  2QZ2 A;  1K12 A;  3ZYG A;  3GZA A;  4UW4 A;  4CDW B;  4P9X A;  4K8R B;  3FX3 A;  4Y4R A;  1OD3 A;  3ZXD A;  2RDR A;  3IN9 A;  4L0P A;  3ZXG A;  3AP9 A;  5ABJ B;  2PTM A;  4I3P A;  5J7M A;  3VHN A;  1WA4 A;  1MPX A;  3C2U A;  1HN1 A;  2VPV A;  1FAY A;  3T0D A;  3VHR A;  1YRZ A;  2D5H A;  1MS4 A;  3MV0 1;  2ZAA A;  4RR3 C;  2VXJ A;  4YM2 A;  3VBF B;  1MQT B;  2JXA A;  2BJS A;  2YFZ A;  3A0N A;  4IE4 A;  4BPZ A;  1CZV A;  3AZZ A;  4S2G A;  1WCS A;  2DDU A;  3B93 A;  4CP9 B;  1J84 A;  4YM0 A;  1G9C A;  4PDW A;  1RED A;  2VZU A;  1ND2 B;  1PZ9 A;  4DIQ A;  2VD7 A;  3OUH A;  1UU6 A;  4AQ6 A;  5C9A B;  3H8X A;  4G9S B;  2JE7 A;  1Z0H A;  1PO1 1;  4M3C E;  2EA7 A;  4Y1Z A;  2X5I A;  4PQQ A;  3PHM A;  5ACA 3;  4NR1 A;  4BHP A;  3KM5 A;  1EPW A;  1UU5 A;  4B7K A;  3ON7 A;  4YGD A;  1KDM A;  4W65 A;  4XCA A;  2Y0I A;  1BQP A;  2J1V A;  4HBN A;  4Y3O A;  1NLQ A;  4AW7 A;  4Q26 A;  4Z82 A;  2UUR A;  1D2S A;  2WQ4 A;  1AX2 A;  4LQR A;  1HKD A;  4KQ7 A;  5CAZ A;  1XRU A;  2OYZ A;  3NJZ A;  5EJ1 B;  1FV2 A;  1JHN A;  1FOD 3;  4YG6 A;  1XC6 A;  1FX5 A;  2WLP A;  4QU1 A;  2CL2 A;  2OUJ A;  3KT4 A;  4WM8 C;  2W1U A;  4UFI A;  1RUJ 3;  1CIY A;  2WZ8 A;  3N7M A;  1C57 A;  1XPW A;  1VBA 1;  1UX7 A;  2Q8O A;  4BCU A;  2R04 1;  4KWU A;  2WBK A;  3LAG A;  5I0D A;  4FP3 A;  1XU2 A;  3I59 B;  1DHK B;  3AVS A;  4I02 A;  4BLJ A;  4DMI A;  1XYN A;  1UO9 A;  1CPM A;  2J1A A;  2WLQ A;  1REE A;  4JGY C;  4PF5 A;  2BNN A;  3BPS A;  5F3G A;  1NX9 A;  2JJ6 A;  4EV0 A;  3BTX A;  4IV1 A;  1D4V B;  2X10 A;  4E8C A;  2ZKN A;  4QKN A;  3T2O A;  5JI9 A;  3THT A;  1UWW A;  4FTE A;  2C26 A;  2IXJ A;  1LRH A;  2IVJ A;  4QQH A;  4RS5 B;  5CIS A;  3O1T A;  3V65 A;  1GZT A;  5LBC A;  5FP8 A;  4ET7 A;  5AC9 1;  2PA7 A;  2CAU A;  2J7M A;  2WQZ C;  1S0F A;  1VIW B;  3O0X A;  5EJ3 A;  1FPN 1;  4MXW A;  2W9X A;  1IPS A;  3LE0 A;  3N9O A;  4D6R A;  1EUT A;  1VBD 3;  4LUK A;  1KEX A;  1GZW B;  2ZKL A;  4N43 B;  3VKN A;  3FHI B;  1LNS A;  1CAW A;  4IDZ A;  1W2T A;  2EXJ A;  2ZGQ A;  3E6B A;  1PGL 2;  4WM7 C;  4KG0 A;  1ENX A;  1ZZC A;  1YWK A;  2ILM A;  1RUF 2;  1PNG A;  1QNW A;  1ULP A;  3VBO A;  5JPN B;  3M3O A;  2R06 1;  3RZJ A;  3MI8 A;  5FJH A;  4JV4 A;  1H1M A;  1DGR N;  3M4F A;  4OHZ A;  3BOW A;  4CYD A;  1CJP A;  2IXK A;  2VQU A;  1PVX A;  1OFS A;  3AX4 A;  1Z7S 3;  4QX8 A;  1NCQ A;  1OA2 A;  2WZE A;  2WS9 2;  5A7S A;  3BKZ A;  1GAN A;  1PM7 A;  1UZW A;  4AVA A;  4M3C A;  3U0Z A;  3K4A A;  5FKC A;  4CDU A;  3ECQ A;  2HYK A;  3OJB A;  3SH4 A;  3MW2 A;  3NW4 A;  1COV 3;  3IDE A;  3R4S A;  2QQJ A;  5DG1 A;  4K9S A;  1LAJ A;  3OBT A;  2JG9 A;  3VDB A;  3AM2 A;  1S0B A;  2ARB A;  3HT2 A;  3SEP A;  4YYO A;  1CQ9 A;  2XXZ A;  2CYF A;  2LUW A;  3KLS A;  3PVN A;  3HQR A;  4FPY A;  2WDB A;  3AZX A;  5C8W A;  4EQV A;  4A6S A;  2OII A;  1VRB A;  5ANN A;  1QIQ A;  1C8M 2;  1VBC 1;  3HN1 A;  3LFI A;  4AI8 A;  3H1W A;  4P9L A;  1ND3 A;  4V1P A;  3GZU C;  5BYN A;  1UKG A;  2OQ6 A;  3DYM A;  3WSO A;  2IFW A;  4PDW C;  3HN3 A;  1RUD 1;  2Q30 A;  1CVN A;  4BWO A;  4EN0 A;  2ARE A;  1JU4 A;  1RC6 A;  2QCS B;  4YW5 A;  4YGB A;  4HET A;  4CDX C;  2X5I C;  4QXB A;  5A3M A;  5EIY B;  2WWU A;  2DVB A;  3KQR A;  2VZO A;  4XEZ A;  4MZU A;  4ZPI A;  4MOA A;  3AZW A;  5JUV A;  3GHM A;  3VZN A;  2B4K A;  2AYH A;  2XWB B;  4BQY A;  1EY2 A;  3I2K A;  3ZXJ A;  4GMP 1;  5KC6 A;  1BEV 1;  1SFN A;  2ET7 A;  3PVE A;  4XIK A;  4YSF A;  4Z92 B;  5FPB A;  4CXX A;  1HIX A;  5FBJ A;  5JCT A;  1AX1 A;  4QQL A;  5FPV A;  3VB9 A;  4AZZ A;  5A1L A;  2BVB A;  3WP6 A;  4KU7 A;  2VCC A;  4CSW A;  4CVU A;  3WY6 A;  5FZ9 A;  4QPY A;  3M1H A;  4LBJ A;  4DRR A;  3T0B A;  1YO8 A;  5FP9 A;  2EAA A;  4YVW C;  4Y1Y A;  5FYT A;  5A3O A;  5E8A A;  1JYW A;  1NKG A;  3ITQ A;  1XYO A;  1A6C A;  3TRS B;  3ZN5 A;  4ZXK A;  1POV 3;  4Z1V A;  3LA7 A;  4Q0S A;  4GAL A;  4IGO A;  2XKP A;  3EHK A;  3NNL A;  4ISR A;  4L92 A;  4O61 A;  3RI9 A;  5C6C A;  2W52 A;  4CCD A;  2WO1 A;  1LHN A;  1OC1 A;  3UK9 A;  1UD1 A;  2BDR A;  3KF3 A;  4BQ5 A;  1TME 1;  4CDX B;  1OF4 A;  4A7Z A;  4DQA A;  3CIH A;  3HPN A;  5FZH A;  1KS5 A;  1EV1 3;  1GQH A;  1VAM A;  1YFX A;  1ZBA 3;  4ISQ A;  4NUB A;  5LRR A;  4XDO A;  2EF6 A;  3VD3 A;  4CUB A;  1O3R A;  5F5A A;  5A6Z A;  3D6E A;  1GZ9 A;  2K2S A;  2JKX A;  5F8P A;  5A33 B;  5I8T A;  1R09 1; 
#chains in the Genus database with same CATH homology
 1S4C A;  1JOP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...