1S4CA

Yhch protein (hi0227) copper complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
155
structure length
150
Chain Sequence
MIISSLTNPNFKVGLPKVIAEVCDYLNTLDLNALENGRHDINDQIYMNVMEPETAEPSSKKAELHHEYLDVQVLIRGTENIEVGATYPNLSKYEDYNEADDYQLCADIDDKFTVTMKPKMFAVFYPYEPHKPCCVEKIKKLVVKVPVKLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Protein HI0227
publication title Crystal structure of the bacterial YhcH protein indicates a role in sialic acid catabolism.
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 39
structure length 150
sequence length 155
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04074 DUF386 YhcH/YjgK/YiaL
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.370 Mainly Beta Sandwich Jelly Rolls YhcH/YjgK/YiaL 1s4cA00
1JOPA 1S4CA
chains in the Genus database with same CATH superfamily
1MPXA 4I0WB 5IK4A 1SCSA 1PMIA 1XYPA 2A5ZA 2R072 4CXYA 5FZDA 1K42A 3RG0A 1EAH3 4BPZA 1HXS3 3UGGA 3OG2A 3M3OA 4OZOA 5CG9A 1KDMA 4Z2WA 1ENRA 5KHHA 1YYNA 2O14A 2WRAA 1AXKA 1YCIA 3E97A 5FWEA 4KGQA 1TMF2 1GWLA 1H0BA 1Z7S1 2D97A 3D8CA 3LA3A 4KG0A 1GP5A 3UGFA 3AP6A 3Q8CA 4P00B 5A33B 3POFA 1BMV1 1RUI1 1COV2 2PN5A 2XVKA 4M4RA 3WW1A 3LFMA 1IQDC 4BM8A 2D6KA 3KSCA 1LRHA 1UZYA 4K20A 3CO2A 2X53S 4Q4Y3 3MFAA 1NAEA 5CFCA 3U4XA 3WQ7A 5C8CA 2PAMA 1K12A 2GALA 3AMPA 3MW4A 4XAEA 3WW4A 2DUPA 2ZGLA 2Z79A 3APBA 1NCQC 1KXGA 4FTEA 1SLLA 4Q5OA 3AFKA 2WJSA 4JHTA 4XAAA 1AR83 3QH7A 3NJZA 2ZGQA 1QJY2 3VDCA 1DGRA 3HIFA 4HK8A 1AJOA 4JKKA 4AGRA 4ES8A 1VBE1 4DQAA 2IXKA 2CAVA 4XJUA 1E5SA 1XNCA 3CJIA 5LCWL 1JU4A 2OXBA 1SHWB 5A3MA 5C9AB 2JDMA 2Z42A 1S0JA 1SLCA 1BYHA 5FR3A 2CL2A 2F4PA 5A3NA 2HWB3 3ME2A 2P3JA 2YC4A 4GZ9A 3UV9A 2RMU1 3T4HB 4AHXA 5EYXA 3JQWA 2RM21 2EAAA 4OQ8A 3A0KA 3BTYA 4R9AA 2RR13 3SH5A 4AR2A 2D3SA 3D6EA 1UD1A 5HV4A 2I2SA 3ZFGB 5JXJA 1AL0G 3J8F1 3OBTA 5F3CA 3AMMA 3JD71 3TNQA 3POEA 4HKLA 1D7PM 4QX5A 4HKWA 4KL1A 1CIYA 5CKMA 3U37A 5A80A 4F8AA 4IEQA 4WZFA 3VL9A 1D0GA 1AYN1 2P5BA 3C7OA 1NCQA 1ASJ1 2A71A 4TWTA 4ZKTB 3TRSB 1HB1A 3U0ZA 2RVAA 3FUOA 4RHV3 4NOTA 4RD7A 1JZ7A 1AR72 2W47A 2VVDA 1QNYA 3AKTA 4LLFA 3SHRA 4CE8A 4R9BA 4LORA 3ACLA 1PO21 5FYYA 5CFDA 4B7EA 5C3QA 2Q8DA 2LW8A 3O1RA 3P3PA 2FMDA 1PZ8A 1T2XA 2MEV3 1AR62 2VU9A 5CISA 2E7QA 1RHI2 5CAZA 1PIV3 1ZNPA 2ZHMA 1OQ1A 1A6CA 3MF9A 5FKCA 5FK7A 1YO8A 5J3UA 1BBT1 2DCYA 4JVAA 4LOSA 3VBOB 2B9VA 2ZACA 2PHTA 3LQCA 3O1UA 5LEJA 5C9AC 2B46X 2RS12 4NRQA 4QPIC 5F5AA 5GLTA 3H0OA 3C7FA 4IEWA 5K9YA 3RQ0A 5L9BA 5FZGA 1UPIA 1DZQA 4Y4YA 1RUD2 1W0NA 3WNXA 2D6OX 3ZX7A 1ND3C 2RS33 1H30A 1U5IA 1XSQA 4RSUA 1AX0A 4BLIA 1LOEA 4QD2A 1ZYBA 5F5QA 2ERFA 2HWF2 1BK1A 2QQWA 2V4VA 4GB32 5E6HA 3WG1A 4LE4A 2JDYA 3WQ0A 4TYSA 5CA6A 5CVRA 4FOWA 1VRH2 4XFBA 3M70A 4PQQA 5I91A 2IXLA 4QPGC 3KHCA 4O65A 5DDJ3 1H8TA 4I0AA 4XC9A 4Y1VA 3HNBM 3KV6A 3ROUA 1TE1B 1TMF1 2XJRA 4B8EA 5T5JA 4XDOA 5C4WC 1RUH2 1PM7A 3OBAA 2P4EA 5I93A 3W5NA 3MDPA 4DRVA 1X9PA 2VW0A 5D8AC 4OI1A 5F9TA 1J3RA 3DKWA 2B7YA 1OF3A 2XB6C 1C8M3 4N90A 2AACA 4F7ZA 5LY1A 5JIAA 1VMFA 2R30A 2DF7A 1ZBA2 1US2A 2WNVC 1LULA 4DXRA 4QPIA 3H8OA 3T1MA 1VJ2A 1RVF2 3O0VA 1O4ZA 4MO3M 3VZJA 5FPXA 1KS5A 1AZDA 4K7JA 2BW8A 4K6BA 1O4YA 1VBC3 2DU1A 4EWDA 4COYA 4LK6A 2OQ7A 4XPVA 4HVQA 5JPMB 1W39A 4CCEA 2PMWB 3FLPA 4LBMA 4ZHNA 1UIJA 3OPTA 4BQ1A 3VBSA 3ZVXA 3USUB 1BZWA 4A6OA 3SC7X 1DQ5A 1DQ4A 1HRV3 2V09A 1MZEA 3J7HA 3BTZA 5M0TA 2GMEA 4PDWB 1V6LA 2DVAA 4FPLA 4UXAA 3DPRC 1UPSA 5F3GA 3B7MA 4ISRA 5FZ1A 2R073 4QT6A 3RMYA 3WF4A 1W6PB 5JR2A 5AFBA 2D44A 4YW6A 2DCTA 5C4WA 2DCJA 3LFIA 4FPFA 4Y33A 1JOJA 3OEBA 3O0WA 1PX3A 1I6XA 5D8AA 1WZXA 2EXIA 2WL1A 4CU7A 3UKTA 1V6IA 1TEIA 4QPWA 1ZRIA 4F3JA 5A3UA 5A6YA 5BNNA 3MPPG 3VBRA 1COV3 2EF6A 2WO3A 4A7KA 1OQDA 2WNVA 3DCQA 4MGYE 5JLVA 1Y9GA 2YV8A 5G04L 4IEZA 4W4ZA 4EN6B 5CNAA 3BTXA 3GBGA 1DGRN 1ZZBA 5C3PA 2CV6A 1MZFA 1KD7A 4OHYA 1AR71 3VKOA 4OUEA 1OA2A 2XVGA 4JQRA 4RQPC 5HCAA 3CQOA 2D43A 4JAAA 5F3IA 2WQ8A 3HQUA 2JE9A 1X50A 1ZBE1 5FOBB 4TXWA 4AEDB 2R49A 1Z78A 2VL4A 3Q8BA 4KWLA 2VMEA 1IKPA 1RHI1 3AMNA 4JDOA 2RE9A 4B4PA 2BDRA 3J9SA 1W8TA 3HVDA 1N3PA 3AYDA 2BBVA 4ONUA 1GWMA 3RJ2X 3DPRA 1GKBA 2ZGMA 3WVJA 2B8MA 5E8AA 2XHKA 3ZFFC 2HH9A 4EYUA 4QDSA 1UQXA 2C24A 3IAQA 1LAJA 4PDWC 4LO8A 4JHZA 2GH2A 2XHNA 3I2FA 1VIWB 1JMUB 4UFIA 3DYOA 1RUD1 3J26N 2FBEA 2FDHA 3ZYGA 1CAWA 1R082 2QQLA 1GZTA 4K1ZA 4BZ4A 4E9KA 2PTMA 5I0UA 1QJZA 2HWF1 5C6CA 2D6PA 4GB31 2CY6A 2OUHA 3WNNA 1QGLA 3R4SA 4HLTA 5F2SA 3AVRA 4PHZA 2ZGPA 1BLZA 5DXDA 4I3PA 4QX1A 1KEXA 4GA9A 3PTYA 5K7PA 2YGLA 1ENXA 4Q0SA 5FMCA 5FRAA 4MXWA 1OH3A 2CYFA 3BOWA 1TME2 4QU1A 4XUPA 5EPAA 3W21A 3RZGA 2VCCA 1LTEA 4RQPA 1NUKA 3PUSA 1DGWA 1W6NB 4LNVA 2RG4A 4UFMA 4LHNA 3B93A 3K75B 3H50A 4GWIA 2ZGRA 4W8JA 5JOYA 2RDNA 1VR3A 2G4IA 4HVRA 3OSDA 1XXNA 3DKQA 1DFQA 5C8WA 2DTYA 5FZMA 5FXXA 5FMDA 1NG0A 4N8MA 4AGVA 2WSVA 2OQ6A 3ILNA 5A3WA 4AEDC 3AC0A 1ZBA1 3GXUA 2C9AA 4AVAA 2IZWA 1RVF1 4XIOA 4YM0A 4XETA 4CCLA 5J7MA 4XFFA 3E1F1 5FPAA 1K5MC 4AVSA 5AC92 1OOPB 2KXLA 4RA0A 1VLNA 3SITA 4Y20B 2RS13 3HD8B 1SLAA 2QQVA 4O9EA 1FPN3 3G7DA 1QOTA 4XF9A 5FY0A 5CG8A 2A1XA 2BUKA 5L19A 4SLIA 3N7JA 1FV2A 1ZZ9A 2A3YA 1S1AA 4XZPA 1WBLA 1PK6B 4M0HA 4XMAA 1GZCA 1RJ8A 2Q1ZB 4FBFA 1MS8A 1C28A 4O9GA 1O4TA 4HKOA 2VUCA 1GV9A 5EV7A 4YPJA 3U07A 2WNEA 1I9RA 2CNAA 2NMNA 2OPWA 5AVPA 3VD3A 3ZYHA 4FQZA 3UK9A 4H14A 1VRH3 5BNQA 1VAKA 4EN7B 1UU6A 3ZXFA 2CDOA 2SBAA 4GMP3 1LHNA 4PF5A 1BVVA 5DAXA 4RYDA 1RUOA 4WM7A 3IDCB 2ZHKA 3DL3A 5IJRA 1O3SA 5A1AA 1GOGA 4LHSA 3ZPYA 2LRPA 2XVLA 3D4KA 4CPBD 3SH3A 5FZOA 5BY5A 1AR92 1VRBA 3OY8B 3I59A 2C0ZA 3WW2A 2XQXA 1K5MA 1D0HA 1YQ2A 2ZX3A 1W6QB 2VD7A 1EY2A 2J1UA 1RUG2 5FZKA 1O5UA 2WT1A 3SISA 3I4IA 3NWKA 3U14A 3DYMA 3WY6A 4AEMA 2N7GA 3PVOA 2Y6KA 2ZX4A 3NJYA 4ZS2A 4FAHA 2VBPA 4CDUA 2ZEWA 4LA2A 4CZSA 1GSLA 2XMLA 3SEPA 3AXEA 4QB6A 2MNGA 5LB6A 3O1VA 4CEYA 3AFGA 2ET1A 4COUA 1W05A 1QWRA 4NROA 3W9AA 3R0RA 2OPKA 2UYAA 3DYPA 2W92A 4FP2A 3C7HA 3RVHA 5DAQA 2BP6A 3LAGA 4LOTA 1V9U3 2DFCA 2YXSA 3KWVA 1W6OA 3PIJA 1UF2C 4NPRA 3O1PA 1GZWB 1PGSA 1S2KA 4LBKA 4AI0A 3RZHA 3CF6E 3OPWA 3TN93 2HWD3 3HN1A 3WDYA 5EYYA 4IEYA 3DV8A 5CYYA 5C5TA 2F4LA 2WNUB 4J1WA 2EXHA 2WZR2 1WA6X 4QB2A 3AZYA 4JRLA 5FY8A 1O3RA 4YG6A 3M2MA 5FYBA 4YM3A 4KGGA 5IVBA 1OA4A 1EUTA 5BYNA 3S5AA 3ORJA 1CGPA 4ZZ8A 4W6YA 1VBD3 3AXDA 5F5IA 2P3YA 4MSVA 1NA1C 5I0SA 1NE6A 2LALA 1VB4A 4P9WA 2OS2A 3INAA 2PHFA 4XDPA 2D3RA 3S5QA 2FD8A 2QUOA 1JW6A 1R1A3 1XRUA 4CDXB 1QXRA 5FIXA 5FYCA 4E2GA 5EIYB 1JTZX 1LODA 2IWGB 5FPVA 5FY7A 4CDQB 5C33A 3ETPA 4Y5TA 4I0BA 3I49A 1S55A 1RUC2 1NQJA 2Z4FA 4MLOA 1D4M2 1S2EA 2R1DA 3MUZ1 4UW3A 1ALYA 3H8XA 4Q1PA 1EV13 2DVDA 1JU3A 1ULDA 3EB7A 3QCWA 2WZPP 3POBA 1CZSA 5AC91 2D5HA 1CAXA 3THDA 2AR6A 4FTBA 2VECA 2WR9A 4CVUA 4LULA 1VMJA 3T30A 4XURA 4BB3A 3PL0A 4XQDA 3ZFEB 1NE4A 2GP3A 4AEKA 4MUVA 2YU1A 4BK4A 5L7OC 2BU9A 2V72A 4A42A 4CYDA 1HRI2 4QGNA 5E89A 4UOJA 3PIGA 1L7RA 2OYZA 2DVFA 3TEXA 1OA3A 5JDBA 1GQHA 1WCDJ 1KDKA 1NA1A 1EAH2 3N9NA 4N53A 4AQSA 2SLIA 4QQ2A 5HXMA 1N47A 3POJA 4UF0B 1B35B 3WR0A 1PMJX 2QKDA 4RR3B 3RZKA 2HWC1 2X29A 1GICA 5FPLA 2VZ3A 1FOD3 1PZ7A 3MBWA 1STMA 2G9FA 5ANQA 5FP4A 4MG2A 2VNRA 3OYWB 2VZSA 1YUDA 4LUKA 5FLHA 4NHLA 5TSWA 3EMRA 4DXSA 3C3VA 4YZ1A 5A32B 1TME3 4MHRA 3HBKA 4CDWC 2Z2SB 1WLDA 4ATEA 4CDXC 4QQOA 4IV3C 4Q4Y2 3ELNA 3VBFC 1PX4A 2VVEA 1T6GC 2E31A 4ZU5A 3VZKA 4M01A 4HZFA 3UKNA 1BJQA 3LOBA 2LM3A 1J83A 2VZTA 2QCSB 3FE5A 3WNOA 1L3JA 5JZGC 1YLLA 3AP7A 1AR82 1W6MA 3P1IA 5DN2A 4ZXKA 4P9XA 4A3ZA 1UW8A 1OPMA 3VV1A 4CP9A 5FOJB 5J09A 5L7OA 5A7PA 2W46A 1CX4A 4NPLA 4AI1A 1LU2A 1UY0A 4FPOB 3URFA 5JIUA 4IL7A 2H6BA 1WMDA 1OPOA 3ZSEA 2RHPA 4WBBA 4ZXEA 1EUUA 1H2NA 1U5XA 2DWRA 2XLFA 2JEMA 4S2GA 4XXAA 1PMHX 4GH4A 2HYXA 3ILFA 5L9RA 2BBAA 3GGLA 3QACA 2AEZA 5F39A 1MQTB 4K8FA 1BEV1 3J7LA 4QGMA 4KBZA 5T5LA 4AHZA 2RR12 1C5HA 3KMHA 1B35C 1RUF3 4FFGA 4LLOA 3NNFA 1QOOA 1ZVFA 2R0HA 1IKQA 3GHMA 3EO6A 3MICA 2VQAA 2WZR1 3E6DA 4XYXA 4BU2A 5C3OA 4EN9B 4LKEA 1UOGA 4IV3A 4OULA 3JB4C 3K4ZA 3VBFA 1GMMA 3N7MA 3VGIA 5FZCA 2HKXA 1UZWA 2ADDA 2DDUA 2Y8KA 4XJZA 3VD7A 4DZGA 2DU0A 3O1TA 4J25A 1RUJ3 4AEJA 3VBHB 5IATA 1VE0A 3HEIA 1BHGA 1H6YA 5A1LA 3ILRA 4RHV2 4KBBA 3SQOA 3OGSA 4COVA 4URAA 1MR5A 5DQ0A 4P9IA 5IVVA 2VCBA 3GCWA 3VDDA 3U78A 1IHMA 3TAYA 1RUC1 3NRUA 2VQ0A 2MEV2 3VBUB 1XC6A 2BOIA 3KCYA 3U11A 1PIV2 1ZRRA 2B45X 3MLJA 3JUUA 2AYHA 5IK8A 4TLGA 4CRQA 1HV1A 3CL1A 1SLBA 5DUUA 2GU9A 1O91A 2DCZA 2VBDA 3W20A 5JAXA 2G1MA 4DS0A 1YI9A 4P02B 2JB8A 5IVCA 5EZWA 3H7JA 3LE0A 5JOXA 1R091 2B39A 2P17A 4AFAA 4CU6A 1ZX5A 2GN7A 5KC5A 1F4HA 4YVWB 2BFUL 3MIFA 4Z07A 4XVHA 5J98B 3ZYBA 1QOSA 1JZ8A 1ODNA 2ZABA 2RS32 2E63A 1H9WA 4LR4A 1HRI1 3WP4A 1CAUB 1V0AA 1UOBA 1D4VB 2J22A 1F5FA 4FPGA 1QJU1 2DCKA 3BN6A 3ZM8A 4GJZA 3OBRA 2G19A 5FQ0B 1EAH1 1XOYA 1HXS1 4YWAA 5CFCB 1XJAA 1WD3A 3PTRB 1CPNA 3UT0A 2RS53 1BKZA 1JZ6A 2NYYA 1YHFA 3E5UA 4WM8C 1HIXA 2EICA 4JGZC 5JVVA 3R05A 1X33A 4DO0A 4HPKA 3IDAA 2Y0IA 1Q56A 3B9CA 1ULEA 1AF9A 3VBHC 2J1TA 3MV01 4Y1ZA 4XFCA 2QDRA 2JE8A 1VPHA 4JCKA 1LOAA 1ZREA 1K5JA 3O7OA 3O5SA 4GWMA 4OQ9A 3RMXA 4TTGA 3A21A 3CJIB 5KXBA 2Y38A 2UWAA 4IV1B 3KLSA 4Q4Y1 1HJGA 4FAGA 4LBQD 2HYKA 1C8M2 4KWUA 3LDKA 2QQKA 4IESA 2VAUA 3IMNA 5CEHA 1LB2A 2X5IB 1D4M3 1H2KA 1XBFA 2W87A 5KHGA 2PHUA 2PAKA 4QPYA 4AXOA 4NVPA 5A7WA 3AP5A 1ENQA 1ULCA 3T2TA 4CP1A 3M3CA 4E8CA 3LD8A 2RJ2A 1YI7A 3B5LB 5I0RA 1VBC2 3BVCA 1REFA 3HR9A 1AR81 2IVIB 3LSEA 3WW3A 3FHQA 3HNYM 2GNBA 4DY5A 4D8MA 1G8WA 2TNFA 1CZTA 5T50A 5LWBA 3LPFA 1QJX3 5BNOA 1GUIA 1MEC3 3QBQA 3HBZA 2X10A 4Q0VA 4MGTA 5A7OA 4YVWC 4D7SA 3BPZA 2ZOEB 1HRV2 1N1YA 1REDA 2YGMA 3IIIA 1LOFA 2WS93 2ZJCA 3VHRA 3VHNA 5HXVA 1SACA 2JJ6A 4HMZA 2HWB1 2ID4A 1YJLA 5BNPB 3J7NA 1YC61 2Y34A 4QDQA 1JN2P 2RR11 1RL3A 2VXRA 4B4QA 3H3UA 4PBOA 2B9UA 4UAPA 3I2GA 3AM2A 2WQZC 4LE3A 1G9BA 4Q4V1 4IQPA 5FO9B 2VOVA 4QKBA 2ENRA 2YFZA 3E5XA 4NPMA 1LHVA 5AFEA 4BWOA 4Q26A 2TEPA 2BZDA 3WUCA 1US3A 2VVFA 4LPLA 2YU2A 4P9LA 5FY1A 1H2LA 2BQPA 1VBA3 4PIYA 1ENSA 4LITA 3LSDA 5L73A 1GU3A 1JH5A 2XJUA 4NIGA 1OC1A 2Y6HA 1POV3 3GCXA 4RHV1 4Y5Z0 3KD4A 1A8DA 2VNGA 4CP0A 2LROA 5T5OA 4AF9A 5HPOA 3H3LA 4YW2A 4D6SA 1X9TA 3F2ZA 5SV5A 2C4XA 1VBB3 2HLEA 4QX2A 1ND2B 5CKQA 5APAA 3KF5A 1V6KA 2MEV1 3MW3A 2VW2A 4GMP0 1LESA 5KXEA 2PLV3 4UT5A 5IW0A 1PIV1 3R4DB 4E2SA 2D6NA 1UY4A 5FK8A 5K0UC 3D0SA 4UW4A 4YNIA 2BNMA 2P6HA 1BVP1 4MYEA 2JG9B 3H1YA 3HJRA 4AZZA 4BHPA 2YMZA 1GOHA 1Y9QA 2P3IA 2FCTA 4E4HA 1H8TB 1DCSA 3EQEA 4BQ2A 4ET7A 3ITQA 4WV8A 4DY3A 1LECA 4NWWA 5FMOL 1SLIA 3NJXA 2J1VA 2BEOA 4W6XA 3VN4A 3CU7A 4BQ3A 1BQPA 2FMYA 4FPJA 3H8RA 1AX2A 2RS31 2NMOA 5ACA2 3PVEA 4N7IA 2P2KA 3MEPA 1X8MA 3TEYA 3A4UA 1Q8SA 4CUCA 1UN1A 1YIFA 3ZXEA 2PHDA 5DDJ1 1LKNA 2Y26A 4OHXA 5JXGA 4BIOA 5I8TA 4LO7A 4MV2A 3T4VA 4C0HA 5KXDA 2VZUA 4C1XA 5FY9A 5FP7A 2ZHLA 4LHKA 2RDRA 4Y1XA 1LHWA 4GJYA 3ZN4A 5E88A 3L2YA 1C1LA 2W94A 2V5DA 2GMPA 5JSPA 1W8HA 4XTMA 4RS5B 4QXBA 3RPQA 3ZIWA 4DUVA 1UYPA 2WSUA 4OCTA 4CTEA 4LUMA 3LEGA 1C8M1 5A1FA 1ND2C 3AZXA 1T6BX 3ETQA 5FY4A 2VZPA 1SPPB 3OGRA 3CNAA 2E7AA 2RDQA 4XDQA 3RI9A 2OZ6A 1RUI3 4YLZA 1HKDA 1FX5A 1J1TA 1VBC1 1CN1A 1LHUA 1LCLA 2BYVE 3N36A 4HFSA 5F5CA 3I2HA 1B09A 5F7UA 1PZ9A 4IGPA 4OI4A 3HT1A 1UU5A 1FPN2 3BODA 3BKZA 3CZJA 4I01A 4M3CE 3MHZA 4ISQA 2X09A 1MZ6A 2JENA 2HWE3 2VBBA 2BPA2 4IERA 5EQUA 2ZKNA 1HRV1 3OGJA 5FXZA 3CLPA 4ES9A 5BNNB 1JYTA 2Y60A 3MO4A 1CR7A 3RWNA 4MOAA 5EJ1B 1LEMA 3IN9A 2CWSA 4RL7A 3PUHA 4UWDA 3ZFGC 4XQ4A 2ZX0A 4OUMA 2R071 3NW4A 4WVVA 1SFYA 4BXSV 3NKTA 4XF3A 1XNDA 1ONAA 4AVVA 2JB4A 4IUGA 3LIHA 2FDIA 4YM2A 1W8OA 1ST8A 3I3MA 1F8VA 1H1MA 1KFXL 5BPXA 4JX0A 2HJIA 2GC3A 5LBEA 3GJBA 2XUEA 2RMU3 2PHRA 2EXKA 2NN8A 4GAZA 4A44A 2IXJA 3IPVA 3KCCA 5GZEA 1COV1 2Y6LA 3BIWE 2QQUA 4OI0A 5C5UA 1W03A 4Y22B 2R7EB 3J8F3 4CUBA 4CUGA 2YC2A 3KVBA 5C9AA 3KGZA 2ET7A 4YW7A 3VHOA 3IKWA 1DIWA 1EYBA 2WZEA 4BXFA 3VBOC 2ARCA 1QXJA 3FMGA 2QQOA 1FAYA 1QMJA 5G05L 4Q2FA 5JMCA 1QJY1 4IETA 4HONA 1UY2A 4QM9A 1X8EA 2W3JA 4H3WA 1ND3A 2VMGA 3I2KA 4YM1A 2GAUA 2D93A 3ZFGA 5EHDA 1KQRA 4NIIA 3O1SA 4OYUA 5HCFA 1QIQA 1V9U2 2XKOA 4QPGA 2JWPA 3DEMA 1W8FA 1WBFA 3DXUA 3FHIB 3AB0A 1YJKA 3TN92 3IAPA 4CPBA 3IWZA 2HWD2 1WW5A 1FI2A 2BJSA 2VCMA 4EWAA 1W0PA 4PT6A 4GULA 3S7EA 1XU1A 1IPJA 2AREA 4NHKA 3VKMA 1FMD3 4Q0PA 1J3PA 5LW9A 1OLQA 2F6BA 1WCSA 5JCTA 1DZTA 1HQNA 1SBFA 1UY3A 2EIBA 4GIQA 2A7AA 5DZFA 3OF1A 4IE7A 3N9LA 1VBD2 2BTVC 1R1ZA 2R043 4AWDA 4XILA 4FTSA 1OHFA 4LBNA 2AENA 3WD5A 4R9DA 2VTXA 5LA9A 4ASKA 1UZVA 3DF0A 4FFHA 3KV5A 3WG3A 4CXXA 1A3KA 1R1A2 3VBOA 1QQP3 3LWCA 3UL2A 4BMBA 3AVSA 3H42B 3WXPA 3AX4A 2XUMA 3ON7A 2ZMNA 1W2AX 3IT8A 1SZBA 3RZMA 3FC0A 4UFJA 3KB5A 1AYM3 1WLCA 3MPBA 2WC2A 2DVGA 4J1XA 5JSRA 3N4MA 2D98A 5FV3A 4A41A 1AR61 5FJKA 1EV12 2W08A 1AL23 3NAPB 2V73A 4CUAA 5KWRA 1LGNA 1ULGA 1W8UA 4JRAA 1PHMA 4FVVA 3RJRA 1WKYA 4PLMA 4XHXA 3WDWA 3WQ1A 1J84A 1V6MA 4YGDA 2JD9A 4MGQA 5CBLA 2RS11 4W6WA 4H2AA 4LIUA 1JI6A 2FDJA 4QDRA 5EFUA 1ZRDA 4QB1A 2JKXA 3RZLA 4RGGA 2R16A 2OUJA 4QKNA 2ZEXA 2I45A 2P3KA 3N9QA 1TVGA 2YY1A 4PQ9A 3ZXDA 2VMIA 4YZ3A 1UWWA 4Q4X3 4NMIA 3VZMA 5ACA3 1ULFA 5DAVA 2O8OA 4A4AA 2VW1A 1GP4A 4V2WA 1U5YA 2R063 3NV1A 4YVSB 1VRH1 3L9JT 4DEQA 1FOD2 2DV9A 1WLTA 2Y0OA 3O12A 4GMP1 1JYVA 3OJBA 4V2VA 1G86A 1XYNA 4XXPA 1U5ZA 2BWAA 4NWVA 5FZ8A 4CDUB 3W59A 4XJAA 4PI2A 4XJ8A 3S30A 4EJRA 3TNPB 1ZA4A 3U1XA 3KGLA 1RUH1 1SFPA 3LEIA 4TN7A 4A45A 2WABA 4QQPA 3PLQA 5LATA 3AYAA 4QWNA 1X82A 4YRDA 2D5FA 4NIDA 2JX9A 2CGNA 2DTWA 2IVJA 1XE7A 3WEZA 5A7NA 3ZYIB 1WCKA 1EPZA 3WG2A 2NP0A 3ZFFA 1W6OB 2Q1FA 4XFAA 1GNYA 3K51A 1HV0A 5J96B 4PDWA 3THTA 3NV4A 3M4FA 3ST7A 3SCGA 1X7NA 4BQXA 3A22A 1NQDA 4LT5A 3Q8AA 1ZRFA 4W65A 1W9WA 1M4WA 2FHRA 1W6PA 2VZQA 4DINB 1YQCA 1HB3A 2FQPA 5T3NA 4QX7A 2FDFA 3RS6A 2W68A 4Q27A 1IG0A 1EPWA 1DU3D 2R6QA 1KJLA 3PU8A 4JZRA 5B4XA 5JI7A 1VB2A 5FDBA 2GDFA 4FT8A 4L92A 3ALQA 2ZXQA 3VL8A 4H7MA 1QY4A 3AZZA 4AG4A 1I5ZA 1HB2A 1XYOA 1W3XA 2WKKA 4QXKA 3TN91 4DXZA 2A6VA 2GN3A 2HWD1 4S2HA 1PM4A 1RUF2 2ZGTA 1JYXA 1CWPA 1QJEA 4Q4W3 5FTTC 4NHXA 3C2UA 4YSFA 5D1IA 1ACCA 1OUSA 4IEXA 4L8QA 3ACFA 1WA4A 2A73B 1DGLA 2QFEA 3P6BA 4QX8A 2Z69A 4UFLA 3THPA 5AVAA 5KBFA 3LA2A 2ADEA 1VBD1 3AKPA 4FFIA 4QAWA 2WNOA 3TB0A 4UW6A 3WUDA 1H1IA 1RUJ2 1SG3A 2P6CA 4LKSA 3ZSLA 4AEDA 1UXZA 1DP0A 2VTXJ 3D0JA 3ZN6B 3JZVA 4NRMA 2QZ3A 3IZOA 4KWJA 3D82A 1R1A1 1HN1A 4FO9A 4XTPA 3AYEA 3PMEA 4IE5A 5LK5A 4C1WA 1OVPA 2EXJA 2VOTA 3SMHA 4AQ2A 2FDKA 5GJ6A 4I2OA 1NCRB 5B2GB 2PAEA 1OOPC 1GLHA 3ZKYA 1XQNA 3BB6A 3RYPA 2UWBA 4BCUA 3CBNA 2XLGA 5GZDA 2LUWA 1OLME 2K9ZA 4JGYB 2I07B 3EJKA 3FBMA 4Y3OA 2IFWA 1URXA 3ASIA 1W28A 3WF3A 1LR5A 5J36A 4QU2A 1PK6C 4XF4A 4CEWB 5FCCA 4BH9A 3POSA 1POV0 5K4LA 4NIAA 5CB7A 1Y3TA 3PJYA 4XBNA 4ZS3A 2ZGOA 1JBCA 3LCPA 3WHTA 1A78A 4L9BA 1W2NA 4PIZA 5LASA 4KNCA 1R081 5LBCA 5C71A 3EYPA 5LA1A 5F6KA 3TEZA 1W6NA 2JG8B 4GALA 4XW3A 4Y24A 1SMVA 2KA3A 2LS6A 1N1TA 1VALA 2RS52 4WVWA 5K8SA 3WCRA 4FPHA 1H4GA 3GF6A 3A0NA 1WWYA 1QHDA 3SKVA 2NZ9A 4JDNA 5HV0A 1TME1 1RUE3 2ZZQA 4FPEA 5IK5A 4LEJA 3RDIA 2NM1A 2XBO3 4J6GA 4DNYA 3GJAA 4XCAA 5EJZB 2X05A 1PGL2 2J1AA 2XL7A 1UXXX 2D7FA 3POIA 4Y20A 5IAXA 3I3QA 2HEYF 3K3NA 1RTVA 4GH4B 1DF0A 1NCRC 3FZ3A 4HXCA 4BQYA 5LA0A 2J42A 4AVTA 2OZJA 3ZYRA 4LKFA 2WT2A 4PLOA 5FYHA 4BDVB 2NQYA 1MVEA 3IDBB 5D21A 2JDAA 3POGA 3WP3A 5FZIA 3ZLIA 2Q1MA 1QJX2 3FWEA 4JTNA 4YGCA 1MEC2 1PNGA 3I3EA 3ENRA 4CEWC 4CU8A 3WQBA 3DGTA 2QZ2A 4N43B 1GZ9A 1QXPA 1TZOA 1O8SA 2WS92 5T55A 3V0AA 3KQRA 3H3ZA 2JECA 4LIVA 2ZKLA 2BFUS 2ZGKA 3NNMA 5C3RA 3RYRA 2K46A 3EBRA 1MS9A 1S0GA 3PU3A 5FYUA 2WNUC 2Z5WA 1JYIA 3WDVA 4META 4XF0A 5JWPA 5ABJB 1WCUA 4LBQA 5HCBA 5IYYA 1RUF1 1IS3A 3Q8FA 4K3UA 4LHLA 3RI8A 3OY8A 5LA2A 3POYA 1U0AA 3VDDB 2HBUA 4XMIA 3X29B 5F37A 1V70A 1W6QA 3UETA 4DMIA 5LK7B 3GZTB 4NE9A 4ARYA 3V0BB 4L99A 4R4XA 1W2TA 2XL9A 2DFBA 4P9GA 1QDOA 2C9KA 1RUJ1 1WLWA 4G9SB 1CAVB 1VBA2 2ES3A 4X6QB 1QEXA 4CDQC 3VKLA 3AMHA 1AR91 4QGLA 2FZ1A 4CCMA 4UW5A 1S0BA 4Y1YA 1RUG1 1W8NA 3C7GA 2ETEA 5FUPA 4DIQA 5FZ7A 1VBB2 1NX9A 1W90A 2CHHA 3ACGA 3I3DA 3QLQA 4MGSA 4XBLA 4XFGA 1SFNA 1OBNA 4CCNA 2PLV2 3GNEA 1QJFA 1GZWA 3WHUA 3WDTA 1SLTA 4CP2A 1CVNA 4HVOA 1OFNA 2XJVA 5LY2A 3VZOA 1XB9A 4XJWA 3K48A 4N43C 3ZFEC 1F31A 5I8SA 3UESA 1I3HA 5GZCA 2WA3A 2WFF3 1IPSA 4HOOA 5FXWA 2C1FA 1MVQA 3KZ4C 2PQSA 3NL1A 4C8DA 1HJFA 5KC6A 3OD0A 3H1WA 3W5MA 1IOAA 3WP6A 3WCSA 4P08A 2WUHA 4AFDA 1F15A 3HQXA 4FXGB 1LGCA 5ABJC 2UY8A 1KS4A 5JPNB 5CU1A 4L2NA 4CU9A 4R4ZA 3MYXA 4RR3C 5HI0A 1AX1A 3TOJA 4CDWA 2E9QA 4IEOA 4A7ZA 2VQUA 4LO4B 1PVC3 3GZAA 4CDXA 2ILMA 5E16A 1PO12 1UU4A 2IXIA 2RS51 1QU0A 4BQ5A 3B69A 2YB7A 4AQ6A 2EA7A 2YPJA 3VKFC 3T09A 4D7YA 3ZSJA 4E4SA 2BOJA 1G7YA 4GWJA 1HQWA 2ZZJA 4JC1A 5JSOA 5JZGA 2VMFA 3H7YA 4GWNA 4M00A 5BNOB 3LGRA 3WNLA 1JHJA 3FJSA 2GP5A 1NLQA 3HMYA 1PGL1 3UYJA 5DG1A 1LGBA 2CU5A 2HWC3 5EWSA 5IVJA 4N9IA 3K3OA 4OHZA 1JUHA 2HBTA 3AL6A 1D4M1 3NV3A 1Z7S2 3IIAA 1E5HA 3ZFEA 2C6SA 1A34A 5I8YA 4M4PA 5FJHA 1RUI2 4QHZA 2Q30A 4BISA 4KH9A 1KJRA 3J7MA 1GNHA 3IB3A 1H6XA 3SEEA 4BLJA 3UJQA 1GOFA 4XACA 2QQJA 2A70A 4RGKA 1QJX1 1F5JA 5FFOC 1B35A 1MEC1 1O59A 2HWE2 2WBKA 1LOBA 5LRRA 1MQTC 3OYWA 5FMOS 2J1EA 4HETA 4XQWA 4XBQA 2W0XA 3K4AA 2E32A 4KQ7A 4TLFA 5IFTA 1G9AA 4QM8A 3ZXAC 3VD9A 3MGUA 2UU8A 1DQ1A 3LDBA 1FXZA 2VUDA 4MH0E 4OFGA 1SEFA 3U75A 3OD4A 5T5PA 5C8CB 2ZEZA 2BGPA 4L11A 3ZOIA 1RUNA 3WNPA 1E57A 1CZVA 2Y6GA 4AOCA 1XNAA 2RMU2 1OLRA 1VMHA 2WA4A 5I0TA 3M3EA 1XU2A 1DHKB 1RMU3 1TNRA 3F95A 3KCXA 4XIKA 2W9XA 3PUIA 4PLNA 2R1BA 1R64A 4V1PA 1CQ9A 4P5YA 1VBA1 2DVBA 1JODA 3ZDSA 1BXHA 1RC6A 4C0BA 3NO8A 3T2PA 1POV1 3J8F2 2L9LA 1RYYA 4FFFA 3VBUC 4QX3A 1FNZA 4MHUA 1LOCA 2Q4SA 2AGSA 1VBB1 3K2OA 5ISLA 4Q8KA 5H9RA 1O8PA 5FZ0A 1DQ0A 4BA6A 2PLV1 4I3GA 1H4HA 4EROA 3AZWA 4DFSA 2A6ZA 3RNSA 2ZTNA 1MQTA 1YQ5A 4FOQA 4QHOA 4ZPIA 3E6CC 2IC1A 3OPZA 4HN1A 1K3IA 2NLRA 4YZ4A 2PFWA 4QXCA 3U10A 3GDBA 5CIRA 2QVSB 1OURA 3WDUA 1GNZA 3I97A 3MV11 4WM8A 4M3CA 3O14A 1RXFA 4JGZA 3PMSA 1DBNA 1NCQB 1SCRA 1MACA 2EIEA 1DLLA 5JI9A 2VE1A 2QE3A 3T1LA 1H8VA 5CFCC 2IFRA 5C8CC 3VBHA 3S57A 1X36A 3ZDVA 4H55A 2X8KA 4JTOA 1YRZA 3WSOA 1FMD2 2KR2A 2PHLA 2C26A 2MHFA 4D6QA 5FYTA 2E53A 1OXCA 5CFDB 2AC1A 3MIHA 1C8NA 4XABA 2R042 2XGXA 3FN9A 3SNMA 2FDGA 3CIHA 4QXHA 5FZLA 1YIPA 3RGBA 2P1BA 2FCVA 2GC1A 1AVBA 4OI2A 3VBUA 5FPUA 3JQXA 5JMOA 2PQQA 5LZ6A 3CKHA 4MGIE 1AXZA 1E5IA 2GZWA 3CHXA 3CJIC 4P9YA 4IV1C 1QJU3 4ASMB 1QQP2 1DDLA 2CTVA 4QHBA 1YQ6A 4JKMA 4X6RB 2D6LX 4WVMA 1CJPA 2GNDA 1W0OA 4XFHA 3VB9A 1E5RA 2X5IC 3BCWA 3OEAA 4OUSA 3HN3A 5IUQA 2WAAA 5GLVA 2B42B 3T0AA 1AYM2 5EP9A 4NHMA 4NR1A 4HL0A 3BI3A 2PXJA 4YVWA 1AL22 1Q8VA 4LBJA 2EIGA 1NZIA 4XUNA 5H9QA 4MX3A 1Z0HA 5LBFA 2CGOA 2JE7A 2WO1A 5JUVA 1G9DA 1G9CA 4Z92B 1FATA 1TNFA 2VC9A 3S7IA 1CAUA 4ARXA 2VXJA 5IVYA 2WYFA 5FZFA 5GZFA 2ZAAA 3H8UA 5FQ0A 2O8QA 4JV4A 3GZUC 3JBG3 3KQ4B 4Z1VA 5FKBA 2AUYA 4CCKA 2AZ5A 4PJYA 5BUVA 1JOPA 4XF1A 1W9YA 2XXZA 3UJOA 4BJ0A 3OOXA 2VOWA 2HWE1 5BNPC 1D2QA 4ZONA 2JIJA 3FLRA 3IPVB 4UFKA 3WOGA 1IS4A 4Q4X2 2ARAA 4R52A 4CCOA 5L36A 5KR7A 1M06G 2GC0A 4IW3A 1XSRA 1BK0A 3I2IA 4AGGA 1NOVA 5CFDC 1G9FA 2R062 5FLIA 2VQTA 4ZU7A 1GR3A 1W2OA 4IV1A 2FZ2A 1PO13 2ZGSA 1CONA 4QPIB 5BV6A 1YXWA 2OVUA 5FMBA 2ORZA 5GLWA 2ATFA 2X5IA 4HT1T 5DZEA 5A3OA 3VD5A 5GZGA 1ZZCA 4PF1A 4O61A 1IZ3A 2Y6FA 1UYZA 1SQ4A 1XE0A 2D6MA 4URTA 4AHWA 1ND3B 4FI9A 3RZZA 4S2FA 3H1MA 4PIXA 1RITA 3ACHA 1C1FA 2XJQA 1ZRCA 3NMBA 4LQRA 5JR7B 4HANA 3VBSB 2UY9A 5K0UA 3FUQA 2P37A 2GH8A 4Q4V3 3AKRA 4DUWA 3I3BA 4YW3A 4B1LA 2ZX1A 4U36A 1Z7S3 3POWA 4QPGB 5FXVA 5IVEA 1RB8G 5JXHA 1S0DA 2ORXA 2EVXA 4GQ7A 1W9FA 3RSJA 4QQHA 4AI3A 1W2UA 1S4CA 5EXOA 5A7QA 1L7QA 3NNJA 3E5QA 3GYDA 2WO2A 3I2DA 2JG9C 3P3NA 4UFHA 4LO5B 5BNPA 5C4WB 1SBEA 3CEWA 2VNVA 1N3OA 1SDWA 4XUTA 3KT1A 5FWJA 1UKRA 3FFQA 2YBKA 4MGKE 4AAPA 1H8TC 1KITA 3IDEA 4IE6A 3UGHA 5D8AB 3S0MA 2XONA 2JDHA 1V6OA 4YZ5A 1HDKA 4MADA 4B3NA 1ZBE2 3DECA 3KT4A 3VBRB 4E4ZA 4A6SA 2WNVB 2XLAA 3O1MA 4Q29A 5A33A 1JZ4A 1O5LA 2QQIA 1APNA 1VBE3 5A3TA 2W52A 3NKGA 5JOWA 2K0GA 4AHYA 2JXAA 4S2DA 4Q4W2 3VZLA 1JHNA 1UIKA 4KU8A 4AI9A 4AVCA 4D0QA 1FMD1 1Y43B 2JDZA 2VMDA 1C3HA 3I7DA 5FYIA 4C91A 5BXXA 2R041 4YG0A 1SDDB 1ND2A 2RM23 3QD6A 3VBRC 3H9AA 3OCPA 1NLRA 2PYTA 1YFYA 3ZMNA 3VBSC 4RS5C 3DPRB 1UNBA 1QQP1 1JZ3A 1C5IA 1KGYA 3UKVA 2JG9A 1LOGA 4P14A 2XDVA 3I54A 3JD73 1UCXA 2RJKA 3MW2A 3N7LA 1QDCA 3VLBB 4C90A 1AYM1 3NVCA 1CAWB 2W39A 5LRSA 5DABA 2ZGUA 1JZ2A 3WV6A 1AYN3 2VOKA 1IQAA 3N35A 1AL21 4F83A 2WINB 1ASJ3 5EJ3A 2VJXA 4L0PA 1W3VA 1RINA 5FYMA 2VPVA 3V64A 5IVFA 1LENA 3AJZA 1J1LA 1FV3A 1EP0A 2BNNA 2QDNA 1OD5A 2YBPA 4I02A 5ERLA 2OKXA 3WG4A 3WT3A 3ZIXA 1Q43A 4YFZA 1PO23 4XJ9A 2W95A 4KG8A 4ZU4A 4XEZA 5BNNC 2VCAA 3CJXA 4MXWB 5FPBA 1F4AA 3C8XA 2GMMA 4OZXA 5IWFA 1DGWX 3NSTA 2A6WA 3GZEA 4RQPB 3KF3A 3AYCA 1Y4WA 4IE4A 1UYXA 4Q0UA 1BBT3 4IE0A 5FZEA 4Q4X1 3T3YA 5A6ZA 5ACA1 5T54A 5FYSA 3VD4A 2BVVA 4PI0A 5FUNA 2B4KA 2BNOA 4YARA 1U12A 2GC2A 1UMIA 2R061 3A7QA 1CPMA 4RS5A 2K2SA 3IBMA 5D2AA 3AMQA 2A3XA 4UBGA 3ZFFB 1N3QA 2QBXA 2W1WA 3A23A 2XOMA 3DUIA 3WLUA 4NIHA 1V6JA 1VP6A 1W9TA 3BIEA 1SPPA 1RUE2 4GKXA 2HEWF 5SV8A 5A3PA 2G9ZA 4CCCA 5IHRA 2DBNA 3PVBB 2A6YA 2XBO2 5DG2A 1JYWA 5J48A 1JYNA 2W1UA 1NKGA 4ORFA 3KM5A 5FZ9A 4ATFA 2JDKA 3WINE 1QF3A 3WX5A 2ZPXA 4XUQA 4ASLA 4AYUA 2XJTA 4CCJA 1CIWA 3J4UH 3OGGA 4E4DX 1CJDA 1K45A 2GNTA 1XNBA 2W1QA 1TMF3 1UO9A 3EXUA 4AAXA 4FPYA 3IM0A 4LMFA 2O0OA 3K77A 5F3EA 1J3QA 2DURA 4TSVA 1LNSA 4FSJA 2QTWB 2CWMA 1GP6A 1N1SA 3ATGA 4IEPA 3SH4A 4CCDA 3KT7A 2WT0A 4ITCA 2QJVA 5IT6A 1WUVA 5DAWA 1YFXA 1FPN1 1OLMA 1OKQA 2WN2A 4IXLA 4UI9L 5FZAA 1MS4A 2IUWA 1YWKA 4A7YA 1YFUA 1AJKA 1N1VA 2ARBA 4FCAA 3B94A 5F6LB 4WM7B 3VDBA 4MVTA 5C3SA 1XE8A 3I2JA 2VZVA 4HSLA 3THCA 3T0DA 3TBDA 1MS5A 3CMGA 5FZOB 4COZA 1QJY3 4EN0A 3T2OA 3I59B 5IFPA 1W8ZA 4KU7A 1K5MB 1S0IA 2YYOA 3KV4A 2WN3A 3HAGA 1NXD1 2YDEA 4QKFA 1YFWA 3T0BA 3BGAA 3VUOA 1OUXA 2R0FA 4KI5M 4Q4W1 2JD4A 1DYPA 4Q8LA 4XE9A 3PJQA 4RFRB 4RGAA 1WMXA 3DN7A 4Y22A 3OUJA 4IDZA 4NN0A 3ZXGA 3G6JB 2E26A 3SKJE 3ZR5A 2ARXA 4L97A 4K21A 4MGZE 1HB4A 1ZA7A 1LJ7A 3V56A 2DUQA 3OUIA 5FBJA 1ZZ7A 1Q5OA 3AP4A 4CEYB 1SBDA 3KHBA 3ZN5A 4A2UA 5LBBA 3W58A 4D94A 3NJVA 4YG3A 3OBZA 3ZMOA 4YZ2A 1Q8QA 4QKDA 2LTNA 1MZ5A 2W1SA 2JICA 3M8LA 4LTAA 2A3WA 3BU0A 4HN0A 3MLLA 4XUOA 4MZUA 3USUA 5FY5A 2PELA 2BGOA 3PHMA 5JOZA 4Q1RA 2PHXA 2FCUA 3NAPC 3RRDA 2ZS6B 3KV9A 1IPKA 1WMFA 1Y9MA 3C7EA 2QNKA 5FUIA 3ZPOA 3M1HA 4YGEA 3VZNA 5F32A 2GSYA 4X8PA 2A75A 2V4AA 2XH6A 2MPFA 3L2HA 4HBNA 4WVZA 4G3YC 4D7TA 3SCFA 4DOUA 2WYSA 4BQWA 4AQTA 4NAMA 3HWJA 4IGQA 4EQVA 5FZ3A 3ZR6A 5FZ6A 1OD3A 1S2BA 3VKNA 1XNTA 1AR73 2BWCA 2XJPA 4Y5SA 2WFF2 3WF0A 4WM7C 4D3WA 2RV9A 3ZO0B 3N7KA 1NY72 1IG3A 1ZBE3 2ZA9A 3PUQA 1V9U1 2YZ4A 3LF7A 1AR63 4XZUG 3AP9A 1RHI3 3Q8EA 4DXTA 3JCIA 2AEYA 1MS3A 2ZMLA 3EHKA 3PURA 4PBPA 3BYWA 3NNLA 4COWA 3S6PA 2ZBJA 3D5OA 2W5FA 3LZZA 3N9PA 4YVSC 1DQ6A 3D3AA 3LB9A 2DUOA 1PVC2 4UBHA 1UYYA 4LBOA 5FO8B 1V00A 4AI2A 4E27A 3ES4A 5FYZA 1NZCA 3AJYA 4CDUC 3I2OA 1CX1A 4LKDA 1Y7BA 3LOIA 1RUD3 3LIGA 1UMZA 2VZRA 2ZCWA 4EZ4A 2W2IA 3ZYPA 5L9VA 2VTFA 4CEYC 2PHWA 3NAPA 1RUE1 1CAXB 2RDSA 4ZY9A 3HT2A 4K1YA 2XBO1 2WQ4A 2HWF3 1HW5A 4GB33 4K40A 1NXMA 5C70A 5E1RA 2VH9A 5JXIA 4P9JA 2XPJA 3V65A 1CESA 2HWC2 3JB8A 2OX0A 1MS0A 4OHWA 3WF2A 5FZBA 2WLPA 3V0AB 3RFRA 2TUNA 4KMQA 1IS5A 5A6QA 3U4SA 5A7SA 4AFMA 1GQPA 2P34A 5FYVA 1EV11 4AW7A 1RUH3 1WGPA 1NA1B 3GBFA 3WF1A 4N53B 4FXKB 2Y33A 3CDZB 4BMEA 1HQLA 4LBQB 5F1RA 2UYBA 5A6XA 5FZ4A 2VULA 3FLTA 3LA7A 2Q8CA 1FT9A 1UX6A 1W04A 2QQNA 4GKYA 4QX0A 5F2WA 3ZXKA 3HNMA 4I09A 5FP8A 4LA3A 4NHYA 1UL9A 1YNAA 4YVSA 2TBVA 4DPNA 2H6CA 1ZBA3 4XCBA 2G9GA 2WWUA 3M3QA 2WFPA 4FPKA 4YW4A 1RVF3 2JIGA 2V5YA 4XFIA 3OUHA 2VNOA 5GKAC 5DUWA 4YGBA 1REEA 2Q8EA 3VDAA 3Q9OA 4PCRA 3NV2A 2IXHA 2VUAA 1JUIA 5DUXA 4NO4A 3ZSKA 3HOBA 1FOD1 2H0VA 3SLIA 2VO5A 3JU9A 3NNGA 4ZZ5A 1W6MB 1FNYA 4YYOA 4BK5A 3FX3A 3AKSA 3MZHA 4CP9B 5L7OB 1BEV2 1RMU2 3NQHA 3MLKA 3N9MA 3T08A 1H2MA 1P8JA 1OOPA 2J1RA 3FFZA 1JOBA 1UZ0A 2CDPA 3E6BA 4N9HA 4BIFA 5J37A 1WW4A 2YROA 2XJSA 4E8DA 2BV4A 2E6VA 4D69A 1WW7A 4O7XA 1QH6A 2Q0AA 3BOPA 1Q3EA 2YC0A 2AH2A 2Y6JA 4IEVA 3FBYA 1YQ8A 1PK6A 2WWSA 1H1AA 3M7AA 1GFF2 3AL5A 1ULOA 4B1MA 2CGPA 4JGYC 4N53C 1DZRA 2UURA 4FOVA 4CXWA 1I5PA 3PUAA 4Y26A 4OMDA 3ECQA 2OW4A 3VHPA 3P5BA 3HPNA 4LXLA 4D6RA 2C5DA 4Z82A 4AFBA 5F8PA 4AI8A 4CDWB 1UOJA 4YW5A 3FHAA 3MF6A 4IV3B 4SBVA 4FPCA 3VBFB 5GLZA 2OT7A 2VZ1A 5FP9A 2WFF1 3BUCA 1G6NA 3TYJA 1NYWA 2JDNA 4FOYA 4JQTA 2XWBB 1NY71 1C4RA 2UWCA 2WDBA 4I30A 3HQRA 3ZYJB 1HN0A 1UZZA 1RJ7A 1FYUA 3RWKX 5JZGB 2JG8C 2VZOA 1GQGA 1OFSA 1MS1A 2XR4A 3N3HA 4EV0A 3BPSA 3ZN6A 4KWKA 2BVBA 2I74A 4GXLA 2D3PA 4XOGA 1PVC1 1R092 2Q5TA 1DYKA 1W8WA 3TEWA 4EN8B 3ZXLA 3UNPA 3SCHA 5LEKA 4AVBA 1DQ2A 1HLCA 5KHKA 3O1OA 2YBSA 3LEMA 2Q8OA 1IS6A 2KD7A 2VMHA 3AK0A 3RYKA 2CAUA 2XKPA 1NCRA 1R083 2Y64A 5C7GA 1W06A 1QJU2 3M3IA 4QQLA 5I0DA 1POQA 1UOFA 1PGW2 4JGYA 1HXS2 3WDXA 1LEDA 3B01A 4AFCA 4NRPA 2WLQA 2BRTA 2WAOA 4GH4C 1ZM1A 2XQRA 4Y1UA 2ZMKA 3USSA 4CEWA 1S0FA 1S0CA 3ZKUA 1S0EA 3GALA 5T52A 5GM0A 1JXNA 5FZHA 2ZGNA 2YUEA 4N7UA 5KHJA 4XHBA 1IGOA 2YPDA 4OMCA 2E51A 1WD4A 3T2QA 2VMCA 3IMMA 1W99A 2WNUA 2JG8A 4NJ4A 3QH6A 1A8MA 4R8HA 3JBG2 2WIIB 3LEKA 2NPIA 2YHJA 4IEUA 4BE3A 5J1XA 3SXWA 4HPKB 3ZYFA 1QKQA 4HG6B 1KFUL 2YFUA 4OVEA 1DLCA 3ABZA 4Z2AA 1RIRA 4BYYA 1V6NA 4K9SA 5ANNA 5KHIA 2WWJA 5AC93 1J59A 3B02A 3TWIA 3B3QE 5A3LA 2XG3A 2R32A 4R9CA 3VDDC 4A3XA 3QOPA 2KM2A 3B9IA 5DMYA 4DUXA 2ZHNA 4CDQA 3N9OA 3I8TA 2BERA 2ZEYA 1L7LA 3K46A 3WNKA 1TG7A 5A7WB 1HX6A 1VAVA 2VOXA 1AHSA 2HWB2 2ZAHA 3MIEA 4K8RB 4LK7A 4AE2A 2WO7A 2OA2A 1RMU1 3MIDA 1OI6A 4LBLA 3ACIA 4TZDA 4JKLA 1UMHA 2E33A 3CZUA 4OHVA 4Q0QA 2HEVF 5FO7B 3ZXJA 1O7FA 4Q4V2 4YW1A 1OF4A 3MUY1 4M0NA 2E7TA 2PA7A 4N43A 4IGOA 1VAMA 3MI8A 4M3CB 4U2AA 1Q8PA 4WM8B 4JGZB 1JYCA 1DG6A 1NLSA 2EALA 1BMV2 1Q8OA 1NT0A 1WW6A 2QQMA 1UY1A 2VY0A 4AL9A 2XWJB 5CKNA 2H0BA 2A6XA 5GALA 1I1EA 4H7LA 5FPZA 1AR93 5IAVA 4Z8BA 1OVSA 5ABJA 4UF0A 1GWKA 2JKBA 4W50A 3PDQA 1UX7A 4FP3A 4RR3A 4UYBA 4WZCA 1RUG3 4NUBA 4X8NA 4YFWA 1BCXA 4GD4A 1AUYA 3WP5A 1RXGA 3AKQA 3BTAA 2B5HA 2WS91 2VG9A 3AZVA 3JXSA 4HK9A 2VUJA 5A70A 3V0BA 4AK3A 1QH7A 5A32A 5HBAA 1O3TA 1C57A 3B00A 5DPNA 1VBE2 2ZX2A 3MIBA 3RZJA 5DUVA 3DXTA 1OH4A 2VM9A 1CAVA 4WVMB 1W9SA 2W91A 1WMEA 5H9PA 1LHOA 3MIGA 5FP3A 1ZZ8A 1GYKA 5H9SA 1D2SA 1WCQA 1XNKA 5HCHA 3BU7A 1GBGA 1OMIA 4LO6B 1GANA 4BOWA 4HSJA 3K4DA 4M3CF 4Y4RA 4DB5A 5CZKA 2O1QA 2RM22 3GHNA 4EE2A 2J7MA 4INDA 1AXYA 1BEV3 1UKGA 1DYOA 2DYCA 3ES1A 1OT5A 1TQ5A 4EZHA 5B4NA 5BNOC 1ODMA 1KRIA 2IXCA 1LU1A 5FREA 4B7KA 2WZR3 1PGW1 5CADA 2CSGA 1LOFC 4MXVA 2F17A 5KXCA 3GBWA 3JD72 1O3QA 5DDJ2 3ZSMA 1F2NA 2EAKA 2QQPA 2RJLA 1JS9A 1AYN2 4B29A 3PVNA 1OKOA 4CSWA 3BALA 1ASJ2 3R6SA 4DRRA 2VR4A 5FBZA 5FLJA 5IK7A 4RN5A 1JZ5A 1H9PA 3MFCA 5DAPA 5GLUA 1RGSA 1UAIA 2OIIA 4NAOA 2GNMA 2YG0A 4QMAA 3KVAA 1QNWA 1F35A 1PO22 3JBG1 4B4RA 2WZ8A 4DEVA 1RUC3 2JDUA 3LKJA 1J58A 2EIDA 2JDPA 3PNAA 3LPGA 3FL7A 1PNFA 1ULPA 1BBT2 2J1SA 3KS7A 3R4UA 4FQ4A 4G4FA 4EWEA 4LJHA 3OTFA 4RFT0 4JDMA 3WZ1A 4BQ4A 3O0XA 4OLLA 4CA9A 2DBIA 1OSGA 5K0UB 3GM8A 1CD3G 1YEWA 3WNMA 1R093 1F9KA 1ZZ6A 2D40A 3OB8A 1PO11 3OGVA 1O6UA 4E2QA 2VGDA 3LDRA 1XPWA 4P5HA 5DZGA 2BGCA 1PVXA 1OQEA 1HRI3 5FAXA
chains in the Genus database with same CATH topology
1JOPA 1S4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JOP A;  1S4C A; 
#chains in the Genus database with same CATH topology
 1MPX A;  4I0W B;  5IK4 A;  1SCS A;  1PMI A;  1XYP A;  2A5Z A;  2R07 2;  4CXY A;  5FZD A;  1K42 A;  3RG0 A;  1EAH 3;  4BPZ A;  1HXS 3;  3UGG A;  3OG2 A;  3M3O A;  4OZO A;  5CG9 A;  1KDM A;  4Z2W A;  1ENR A;  5KHH A;  1YYN A;  2O14 A;  2WRA A;  1AXK A;  1YCI A;  3E97 A;  5FWE A;  4KGQ A;  1TMF 2;  1GWL A;  1H0B A;  1Z7S 1;  2D97 A;  3D8C A;  3LA3 A;  4KG0 A;  1GP5 A;  3UGF A;  3AP6 A;  3Q8C A;  4P00 B;  5A33 B;  3POF A;  1BMV 1;  1RUI 1;  1COV 2;  2PN5 A;  2XVK A;  4M4R A;  3WW1 A;  3LFM A;  1IQD C;  4BM8 A;  2D6K A;  3KSC A;  1LRH A;  1UZY A;  4K20 A;  3CO2 A;  2X53 S;  4Q4Y 3;  3MFA A;  1NAE A;  5CFC A;  3U4X A;  3WQ7 A;  5C8C A;  2PAM A;  1K12 A;  2GAL A;  3AMP A;  3MW4 A;  4XAE A;  3WW4 A;  2DUP A;  2ZGL A;  2Z79 A;  3APB A;  1NCQ C;  1KXG A;  4FTE A;  1SLL A;  4Q5O A;  3AFK A;  2WJS A;  4JHT A;  4XAA A;  1AR8 3;  3QH7 A;  3NJZ A;  2ZGQ A;  1QJY 2;  3VDC A;  1DGR A;  3HIF A;  4HK8 A;  1AJO A;  4JKK A;  4AGR A;  4ES8 A;  1VBE 1;  4DQA A;  2IXK A;  2CAV A;  4XJU A;  1E5S A;  1XNC A;  3CJI A;  5LCW L;  1JU4 A;  2OXB A;  1SHW B;  5A3M A;  5C9A B;  2JDM A;  2Z42 A;  1S0J A;  1SLC A;  1BYH A;  5FR3 A;  2CL2 A;  2F4P A;  5A3N A;  2HWB 3;  3ME2 A;  2P3J A;  2YC4 A;  4GZ9 A;  3UV9 A;  2RMU 1;  3T4H B;  4AHX A;  5EYX A;  3JQW A;  2RM2 1;  2EAA A;  4OQ8 A;  3A0K A;  3BTY A;  4R9A A;  2RR1 3;  3SH5 A;  4AR2 A;  2D3S A;  3D6E A;  1UD1 A;  5HV4 A;  2I2S A;  3ZFG B;  5JXJ A;  1AL0 G;  3J8F 1;  3OBT A;  5F3C A;  3AMM A;  3JD7 1;  3TNQ A;  3POE A;  4HKL A;  1D7P M;  4QX5 A;  4HKW A;  4KL1 A;  1CIY A;  5CKM A;  3U37 A;  5A80 A;  4F8A A;  4IEQ A;  4WZF A;  3VL9 A;  1D0G A;  1AYN 1;  2P5B A;  3C7O A;  1NCQ A;  1ASJ 1;  2A71 A;  4TWT A;  4ZKT B;  3TRS B;  1HB1 A;  3U0Z A;  2RVA A;  3FUO A;  4RHV 3;  4NOT A;  4RD7 A;  1JZ7 A;  1AR7 2;  2W47 A;  2VVD A;  1QNY A;  3AKT A;  4LLF A;  3SHR A;  4CE8 A;  4R9B A;  4LOR A;  3ACL A;  1PO2 1;  5FYY A;  5CFD A;  4B7E A;  5C3Q A;  2Q8D A;  2LW8 A;  3O1R A;  3P3P A;  2FMD A;  1PZ8 A;  1T2X A;  2MEV 3;  1AR6 2;  2VU9 A;  5CIS A;  2E7Q A;  1RHI 2;  5CAZ A;  1PIV 3;  1ZNP A;  2ZHM A;  1OQ1 A;  1A6C A;  3MF9 A;  5FKC A;  5FK7 A;  1YO8 A;  5J3U A;  1BBT 1;  2DCY A;  4JVA A;  4LOS A;  3VBO B;  2B9V A;  2ZAC A;  2PHT A;  3LQC A;  3O1U A;  5LEJ A;  5C9A C;  2B46 X;  2RS1 2;  4NRQ A;  4QPI C;  5F5A A;  5GLT A;  3H0O A;  3C7F A;  4IEW A;  5K9Y A;  3RQ0 A;  5L9B A;  5FZG A;  1UPI A;  1DZQ A;  4Y4Y A;  1RUD 2;  1W0N A;  3WNX A;  2D6O X;  3ZX7 A;  1ND3 C;  2RS3 3;  1H30 A;  1U5I A;  1XSQ A;  4RSU A;  1AX0 A;  4BLI A;  1LOE A;  4QD2 A;  1ZYB A;  5F5Q A;  2ERF A;  2HWF 2;  1BK1 A;  2QQW A;  2V4V A;  4GB3 2;  5E6H A;  3WG1 A;  4LE4 A;  2JDY A;  3WQ0 A;  4TYS A;  5CA6 A;  5CVR A;  4FOW A;  1VRH 2;  4XFB A;  3M70 A;  4PQQ A;  5I91 A;  2IXL A;  4QPG C;  3KHC A;  4O65 A;  5DDJ 3;  1H8T A;  4I0A A;  4XC9 A;  4Y1V A;  3HNB M;  3KV6 A;  3ROU A;  1TE1 B;  1TMF 1;  2XJR A;  4B8E A;  5T5J A;  4XDO A;  5C4W C;  1RUH 2;  1PM7 A;  3OBA A;  2P4E A;  5I93 A;  3W5N A;  3MDP A;  4DRV A;  1X9P A;  2VW0 A;  5D8A C;  4OI1 A;  5F9T A;  1J3R A;  3DKW A;  2B7Y A;  1OF3 A;  2XB6 C;  1C8M 3;  4N90 A;  2AAC A;  4F7Z A;  5LY1 A;  5JIA A;  1VMF A;  2R30 A;  2DF7 A;  1ZBA 2;  1US2 A;  2WNV C;  1LUL A;  4DXR A;  4QPI A;  3H8O A;  3T1M A;  1VJ2 A;  1RVF 2;  3O0V A;  1O4Z A;  4MO3 M;  3VZJ A;  5FPX A;  1KS5 A;  1AZD A;  4K7J A;  2BW8 A;  4K6B A;  1O4Y A;  1VBC 3;  2DU1 A;  4EWD A;  4COY A;  4LK6 A;  2OQ7 A;  4XPV A;  4HVQ A;  5JPM B;  1W39 A;  4CCE A;  2PMW B;  3FLP A;  4LBM A;  4ZHN A;  1UIJ A;  3OPT A;  4BQ1 A;  3VBS A;  3ZVX A;  3USU B;  1BZW A;  4A6O A;  3SC7 X;  1DQ5 A;  1DQ4 A;  1HRV 3;  2V09 A;  1MZE A;  3J7H A;  3BTZ A;  5M0T A;  2GME A;  4PDW B;  1V6L A;  2DVA A;  4FPL A;  4UXA A;  3DPR C;  1UPS A;  5F3G A;  3B7M A;  4ISR A;  5FZ1 A;  2R07 3;  4QT6 A;  3RMY A;  3WF4 A;  1W6P B;  5JR2 A;  5AFB A;  2D44 A;  4YW6 A;  2DCT A;  5C4W A;  2DCJ A;  3LFI A;  4FPF A;  4Y33 A;  1JOJ A;  3OEB A;  3O0W A;  1PX3 A;  1I6X A;  5D8A A;  1WZX A;  2EXI A;  2WL1 A;  4CU7 A;  3UKT A;  1V6I A;  1TEI A;  4QPW A;  1ZRI A;  4F3J A;  5A3U A;  5A6Y A;  5BNN A;  3MPP G;  3VBR A;  1COV 3;  2EF6 A;  2WO3 A;  4A7K A;  1OQD A;  2WNV A;  3DCQ A;  4MGY E;  5JLV A;  1Y9G A;  2YV8 A;  5G04 L;  4IEZ A;  4W4Z A;  4EN6 B;  5CNA A;  3BTX A;  3GBG A;  1DGR N;  1ZZB A;  5C3P A;  2CV6 A;  1MZF A;  1KD7 A;  4OHY A;  1AR7 1;  3VKO A;  4OUE A;  1OA2 A;  2XVG A;  4JQR A;  4RQP C;  5HCA A;  3CQO A;  2D43 A;  4JAA A;  5F3I A;  2WQ8 A;  3HQU A;  2JE9 A;  1X50 A;  1ZBE 1;  5FOB B;  4TXW A;  4AED B;  2R49 A;  1Z78 A;  2VL4 A;  3Q8B A;  4KWL A;  2VME A;  1IKP A;  1RHI 1;  3AMN A;  4JDO A;  2RE9 A;  4B4P A;  2BDR A;  3J9S A;  1W8T A;  3HVD A;  1N3P A;  3AYD A;  2BBV A;  4ONU A;  1GWM A;  3RJ2 X;  3DPR A;  1GKB A;  2ZGM A;  3WVJ A;  2B8M A;  5E8A A;  2XHK A;  3ZFF C;  2HH9 A;  4EYU A;  4QDS A;  1UQX A;  2C24 A;  3IAQ A;  1LAJ A;  4PDW C;  4LO8 A;  4JHZ A;  2GH2 A;  2XHN A;  3I2F A;  1VIW B;  1JMU B;  4UFI A;  3DYO A;  1RUD 1;  3J26 N;  2FBE A;  2FDH A;  3ZYG A;  1CAW A;  1R08 2;  2QQL A;  1GZT A;  4K1Z A;  4BZ4 A;  4E9K A;  2PTM A;  5I0U A;  1QJZ A;  2HWF 1;  5C6C A;  2D6P A;  4GB3 1;  2CY6 A;  2OUH A;  3WNN A;  1QGL A;  3R4S A;  4HLT A;  5F2S A;  3AVR A;  4PHZ A;  2ZGP A;  1BLZ A;  5DXD A;  4I3P A;  4QX1 A;  1KEX A;  4GA9 A;  3PTY A;  5K7P A;  2YGL A;  1ENX A;  4Q0S A;  5FMC A;  5FRA A;  4MXW A;  1OH3 A;  2CYF A;  3BOW A;  1TME 2;  4QU1 A;  4XUP A;  5EPA A;  3W21 A;  3RZG A;  2VCC A;  1LTE A;  4RQP A;  1NUK A;  3PUS A;  1DGW A;  1W6N B;  4LNV A;  2RG4 A;  4UFM A;  4LHN A;  3B93 A;  3K75 B;  3H50 A;  4GWI A;  2ZGR A;  4W8J A;  5JOY A;  2RDN A;  1VR3 A;  2G4I A;  4HVR A;  3OSD A;  1XXN A;  3DKQ A;  1DFQ A;  5C8W A;  2DTY A;  5FZM A;  5FXX A;  5FMD A;  1NG0 A;  4N8M A;  4AGV A;  2WSV A;  2OQ6 A;  3ILN A;  5A3W A;  4AED C;  3AC0 A;  1ZBA 1;  3GXU A;  2C9A A;  4AVA A;  2IZW A;  1RVF 1;  4XIO A;  4YM0 A;  4XET A;  4CCL A;  5J7M A;  4XFF A;  3E1F 1;  5FPA A;  1K5M C;  4AVS A;  5AC9 2;  1OOP B;  2KXL A;  4RA0 A;  1VLN A;  3SIT A;  4Y20 B;  2RS1 3;  3HD8 B;  1SLA A;  2QQV A;  4O9E A;  1FPN 3;  3G7D A;  1QOT A;  4XF9 A;  5FY0 A;  5CG8 A;  2A1X A;  2BUK A;  5L19 A;  4SLI A;  3N7J A;  1FV2 A;  1ZZ9 A;  2A3Y A;  1S1A A;  4XZP A;  1WBL A;  1PK6 B;  4M0H A;  4XMA A;  1GZC A;  1RJ8 A;  2Q1Z B;  4FBF A;  1MS8 A;  1C28 A;  4O9G A;  1O4T A;  4HKO A;  2VUC A;  1GV9 A;  5EV7 A;  4YPJ A;  3U07 A;  2WNE A;  1I9R A;  2CNA A;  2NMN A;  2OPW A;  5AVP A;  3VD3 A;  3ZYH A;  4FQZ A;  3UK9 A;  4H14 A;  1VRH 3;  5BNQ A;  1VAK A;  4EN7 B;  1UU6 A;  3ZXF A;  2CDO A;  2SBA A;  4GMP 3;  1LHN A;  4PF5 A;  1BVV A;  5DAX A;  4RYD A;  1RUO A;  4WM7 A;  3IDC B;  2ZHK A;  3DL3 A;  5IJR A;  1O3S A;  5A1A A;  1GOG A;  4LHS A;  3ZPY A;  2LRP A;  2XVL A;  3D4K A;  4CPB D;  3SH3 A;  5FZO A;  5BY5 A;  1AR9 2;  1VRB A;  3OY8 B;  3I59 A;  2C0Z A;  3WW2 A;  2XQX A;  1K5M A;  1D0H A;  1YQ2 A;  2ZX3 A;  1W6Q B;  2VD7 A;  1EY2 A;  2J1U A;  1RUG 2;  5FZK A;  1O5U A;  2WT1 A;  3SIS A;  3I4I A;  3NWK A;  3U14 A;  3DYM A;  3WY6 A;  4AEM A;  2N7G A;  3PVO A;  2Y6K A;  2ZX4 A;  3NJY A;  4ZS2 A;  4FAH A;  2VBP A;  4CDU A;  2ZEW A;  4LA2 A;  4CZS A;  1GSL A;  2XML A;  3SEP A;  3AXE A;  4QB6 A;  2MNG A;  5LB6 A;  3O1V A;  4CEY A;  3AFG A;  2ET1 A;  4COU A;  1W05 A;  1QWR A;  4NRO A;  3W9A A;  3R0R A;  2OPK A;  2UYA A;  3DYP A;  2W92 A;  4FP2 A;  3C7H A;  3RVH A;  5DAQ A;  2BP6 A;  3LAG A;  4LOT A;  1V9U 3;  2DFC A;  2YXS A;  3KWV A;  1W6O A;  3PIJ A;  1UF2 C;  4NPR A;  3O1P A;  1GZW B;  1PGS A;  1S2K A;  4LBK A;  4AI0 A;  3RZH A;  3CF6 E;  3OPW A;  3TN9 3;  2HWD 3;  3HN1 A;  3WDY A;  5EYY A;  4IEY A;  3DV8 A;  5CYY A;  5C5T A;  2F4L A;  2WNU B;  4J1W A;  2EXH A;  2WZR 2;  1WA6 X;  4QB2 A;  3AZY A;  4JRL A;  5FY8 A;  1O3R A;  4YG6 A;  3M2M A;  5FYB A;  4YM3 A;  4KGG A;  5IVB A;  1OA4 A;  1EUT A;  5BYN A;  3S5A A;  3ORJ A;  1CGP A;  4ZZ8 A;  4W6Y A;  1VBD 3;  3AXD A;  5F5I A;  2P3Y A;  4MSV A;  1NA1 C;  5I0S A;  1NE6 A;  2LAL A;  1VB4 A;  4P9W A;  2OS2 A;  3INA A;  2PHF A;  4XDP A;  2D3R A;  3S5Q A;  2FD8 A;  2QUO A;  1JW6 A;  1R1A 3;  1XRU A;  4CDX B;  1QXR A;  5FIX A;  5FYC A;  4E2G A;  5EIY B;  1JTZ X;  1LOD A;  2IWG B;  5FPV A;  5FY7 A;  4CDQ B;  5C33 A;  3ETP A;  4Y5T A;  4I0B A;  3I49 A;  1S55 A;  1RUC 2;  1NQJ A;  2Z4F A;  4MLO A;  1D4M 2;  1S2E A;  2R1D A;  3MUZ 1;  4UW3 A;  1ALY A;  3H8X A;  4Q1P A;  1EV1 3;  2DVD A;  1JU3 A;  1ULD A;  3EB7 A;  3QCW A;  2WZP P;  3POB A;  1CZS A;  5AC9 1;  2D5H A;  1CAX A;  3THD A;  2AR6 A;  4FTB A;  2VEC A;  2WR9 A;  4CVU A;  4LUL A;  1VMJ A;  3T30 A;  4XUR A;  4BB3 A;  3PL0 A;  4XQD A;  3ZFE B;  1NE4 A;  2GP3 A;  4AEK A;  4MUV A;  2YU1 A;  4BK4 A;  5L7O C;  2BU9 A;  2V72 A;  4A42 A;  4CYD A;  1HRI 2;  4QGN A;  5E89 A;  4UOJ A;  3PIG A;  1L7R A;  2OYZ A;  2DVF A;  3TEX A;  1OA3 A;  5JDB A;  1GQH A;  1WCD J;  1KDK A;  1NA1 A;  1EAH 2;  3N9N A;  4N53 A;  4AQS A;  2SLI A;  4QQ2 A;  5HXM A;  1N47 A;  3POJ A;  4UF0 B;  1B35 B;  3WR0 A;  1PMJ X;  2QKD A;  4RR3 B;  3RZK A;  2HWC 1;  2X29 A;  1GIC A;  5FPL A;  2VZ3 A;  1FOD 3;  1PZ7 A;  3MBW A;  1STM A;  2G9F A;  5ANQ A;  5FP4 A;  4MG2 A;  2VNR A;  3OYW B;  2VZS A;  1YUD A;  4LUK A;  5FLH A;  4NHL A;  5TSW A;  3EMR A;  4DXS A;  3C3V A;  4YZ1 A;  5A32 B;  1TME 3;  4MHR A;  3HBK A;  4CDW C;  2Z2S B;  1WLD A;  4ATE A;  4CDX C;  4QQO A;  4IV3 C;  4Q4Y 2;  3ELN A;  3VBF C;  1PX4 A;  2VVE A;  1T6G C;  2E31 A;  4ZU5 A;  3VZK A;  4M01 A;  4HZF A;  3UKN A;  1BJQ A;  3LOB A;  2LM3 A;  1J83 A;  2VZT A;  2QCS B;  3FE5 A;  3WNO A;  1L3J A;  5JZG C;  1YLL A;  3AP7 A;  1AR8 2;  1W6M A;  3P1I A;  5DN2 A;  4ZXK A;  4P9X A;  4A3Z A;  1UW8 A;  1OPM A;  3VV1 A;  4CP9 A;  5FOJ B;  5J09 A;  5L7O A;  5A7P A;  2W46 A;  1CX4 A;  4NPL A;  4AI1 A;  1LU2 A;  1UY0 A;  4FPO B;  3URF A;  5JIU A;  4IL7 A;  2H6B A;  1WMD A;  1OPO A;  3ZSE A;  2RHP A;  4WBB A;  4ZXE A;  1EUU A;  1H2N A;  1U5X A;  2DWR A;  2XLF A;  2JEM A;  4S2G A;  4XXA A;  1PMH X;  4GH4 A;  2HYX A;  3ILF A;  5L9R A;  2BBA A;  3GGL A;  3QAC A;  2AEZ A;  5F39 A;  1MQT B;  4K8F A;  1BEV 1;  3J7L A;  4QGM A;  4KBZ A;  5T5L A;  4AHZ A;  2RR1 2;  1C5H A;  3KMH A;  1B35 C;  1RUF 3;  4FFG A;  4LLO A;  3NNF A;  1QOO A;  1ZVF A;  2R0H A;  1IKQ A;  3GHM A;  3EO6 A;  3MIC A;  2VQA A;  2WZR 1;  3E6D A;  4XYX A;  4BU2 A;  5C3O A;  4EN9 B;  4LKE A;  1UOG A;  4IV3 A;  4OUL A;  3JB4 C;  3K4Z A;  3VBF A;  1GMM A;  3N7M A;  3VGI A;  5FZC A;  2HKX A;  1UZW A;  2ADD A;  2DDU A;  2Y8K A;  4XJZ A;  3VD7 A;  4DZG A;  2DU0 A;  3O1T A;  4J25 A;  1RUJ 3;  4AEJ A;  3VBH B;  5IAT A;  1VE0 A;  3HEI A;  1BHG A;  1H6Y A;  5A1L A;  3ILR A;  4RHV 2;  4KBB A;  3SQO A;  3OGS A;  4COV A;  4URA A;  1MR5 A;  5DQ0 A;  4P9I A;  5IVV A;  2VCB A;  3GCW A;  3VDD A;  3U78 A;  1IHM A;  3TAY A;  1RUC 1;  3NRU A;  2VQ0 A;  2MEV 2;  3VBU B;  1XC6 A;  2BOI A;  3KCY A;  3U11 A;  1PIV 2;  1ZRR A;  2B45 X;  3MLJ A;  3JUU A;  2AYH A;  5IK8 A;  4TLG A;  4CRQ A;  1HV1 A;  3CL1 A;  1SLB A;  5DUU A;  2GU9 A;  1O91 A;  2DCZ A;  2VBD A;  3W20 A;  5JAX A;  2G1M A;  4DS0 A;  1YI9 A;  4P02 B;  2JB8 A;  5IVC A;  5EZW A;  3H7J A;  3LE0 A;  5JOX A;  1R09 1;  2B39 A;  2P17 A;  4AFA A;  4CU6 A;  1ZX5 A;  2GN7 A;  5KC5 A;  1F4H A;  4YVW B;  2BFU L;  3MIF A;  4Z07 A;  4XVH A;  5J98 B;  3ZYB A;  1QOS A;  1JZ8 A;  1ODN A;  2ZAB A;  2RS3 2;  2E63 A;  1H9W A;  4LR4 A;  1HRI 1;  3WP4 A;  1CAU B;  1V0A A;  1UOB A;  1D4V B;  2J22 A;  1F5F A;  4FPG A;  1QJU 1;  2DCK A;  3BN6 A;  3ZM8 A;  4GJZ A;  3OBR A;  2G19 A;  5FQ0 B;  1EAH 1;  1XOY A;  1HXS 1;  4YWA A;  5CFC B;  1XJA A;  1WD3 A;  3PTR B;  1CPN A;  3UT0 A;  2RS5 3;  1BKZ A;  1JZ6 A;  2NYY A;  1YHF A;  3E5U A;  4WM8 C;  1HIX A;  2EIC A;  4JGZ C;  5JVV A;  3R05 A;  1X33 A;  4DO0 A;  4HPK A;  3IDA A;  2Y0I A;  1Q56 A;  3B9C A;  1ULE A;  1AF9 A;  3VBH C;  2J1T A;  3MV0 1;  4Y1Z A;  4XFC A;  2QDR A;  2JE8 A;  1VPH A;  4JCK A;  1LOA A;  1ZRE A;  1K5J A;  3O7O A;  3O5S A;  4GWM A;  4OQ9 A;  3RMX A;  4TTG A;  3A21 A;  3CJI B;  5KXB A;  2Y38 A;  2UWA A;  4IV1 B;  3KLS A;  4Q4Y 1;  1HJG A;  4FAG A;  4LBQ D;  2HYK A;  1C8M 2;  4KWU A;  3LDK A;  2QQK A;  4IES A;  2VAU A;  3IMN A;  5CEH A;  1LB2 A;  2X5I B;  1D4M 3;  1H2K A;  1XBF A;  2W87 A;  5KHG A;  2PHU A;  2PAK A;  4QPY A;  4AXO A;  4NVP A;  5A7W A;  3AP5 A;  1ENQ A;  1ULC A;  3T2T A;  4CP1 A;  3M3C A;  4E8C A;  3LD8 A;  2RJ2 A;  1YI7 A;  3B5L B;  5I0R A;  1VBC 2;  3BVC A;  1REF A;  3HR9 A;  1AR8 1;  2IVI B;  3LSE A;  3WW3 A;  3FHQ A;  3HNY M;  2GNB A;  4DY5 A;  4D8M A;  1G8W A;  2TNF A;  1CZT A;  5T50 A;  5LWB A;  3LPF A;  1QJX 3;  5BNO A;  1GUI A;  1MEC 3;  3QBQ A;  3HBZ A;  2X10 A;  4Q0V A;  4MGT A;  5A7O A;  4YVW C;  4D7S A;  3BPZ A;  2ZOE B;  1HRV 2;  1N1Y A;  1RED A;  2YGM A;  3III A;  1LOF A;  2WS9 3;  2ZJC A;  3VHR A;  3VHN A;  5HXV A;  1SAC A;  2JJ6 A;  4HMZ A;  2HWB 1;  2ID4 A;  1YJL A;  5BNP B;  3J7N A;  1YC6 1;  2Y34 A;  4QDQ A;  1JN2 P;  2RR1 1;  1RL3 A;  2VXR A;  4B4Q A;  3H3U A;  4PBO A;  2B9U A;  4UAP A;  3I2G A;  3AM2 A;  2WQZ C;  4LE3 A;  1G9B A;  4Q4V 1;  4IQP A;  5FO9 B;  2VOV A;  4QKB A;  2ENR A;  2YFZ A;  3E5X A;  4NPM A;  1LHV A;  5AFE A;  4BWO A;  4Q26 A;  2TEP A;  2BZD A;  3WUC A;  1US3 A;  2VVF A;  4LPL A;  2YU2 A;  4P9L A;  5FY1 A;  1H2L A;  2BQP A;  1VBA 3;  4PIY A;  1ENS A;  4LIT A;  3LSD A;  5L73 A;  1GU3 A;  1JH5 A;  2XJU A;  4NIG A;  1OC1 A;  2Y6H A;  1POV 3;  3GCX A;  4RHV 1;  4Y5Z 0;  3KD4 A;  1A8D A;  2VNG A;  4CP0 A;  2LRO A;  5T5O A;  4AF9 A;  5HPO A;  3H3L A;  4YW2 A;  4D6S A;  1X9T A;  3F2Z A;  5SV5 A;  2C4X A;  1VBB 3;  2HLE A;  4QX2 A;  1ND2 B;  5CKQ A;  5APA A;  3KF5 A;  1V6K A;  2MEV 1;  3MW3 A;  2VW2 A;  4GMP 0;  1LES A;  5KXE A;  2PLV 3;  4UT5 A;  5IW0 A;  1PIV 1;  3R4D B;  4E2S A;  2D6N A;  1UY4 A;  5FK8 A;  5K0U C;  3D0S A;  4UW4 A;  4YNI A;  2BNM A;  2P6H A;  1BVP 1;  4MYE A;  2JG9 B;  3H1Y A;  3HJR A;  4AZZ A;  4BHP A;  2YMZ A;  1GOH A;  1Y9Q A;  2P3I A;  2FCT A;  4E4H A;  1H8T B;  1DCS A;  3EQE A;  4BQ2 A;  4ET7 A;  3ITQ A;  4WV8 A;  4DY3 A;  1LEC A;  4NWW A;  5FMO L;  1SLI A;  3NJX A;  2J1V A;  2BEO A;  4W6X A;  3VN4 A;  3CU7 A;  4BQ3 A;  1BQP A;  2FMY A;  4FPJ A;  3H8R A;  1AX2 A;  2RS3 1;  2NMO A;  5ACA 2;  3PVE A;  4N7I A;  2P2K A;  3MEP A;  1X8M A;  3TEY A;  3A4U A;  1Q8S A;  4CUC A;  1UN1 A;  1YIF A;  3ZXE A;  2PHD A;  5DDJ 1;  1LKN A;  2Y26 A;  4OHX A;  5JXG A;  4BIO A;  5I8T A;  4LO7 A;  4MV2 A;  3T4V A;  4C0H A;  5KXD A;  2VZU A;  4C1X A;  5FY9 A;  5FP7 A;  2ZHL A;  4LHK A;  2RDR A;  4Y1X A;  1LHW A;  4GJY A;  3ZN4 A;  5E88 A;  3L2Y A;  1C1L A;  2W94 A;  2V5D A;  2GMP A;  5JSP A;  1W8H A;  4XTM A;  4RS5 B;  4QXB A;  3RPQ A;  3ZIW A;  4DUV A;  1UYP A;  2WSU A;  4OCT A;  4CTE A;  4LUM A;  3LEG A;  1C8M 1;  5A1F A;  1ND2 C;  3AZX A;  1T6B X;  3ETQ A;  5FY4 A;  2VZP A;  1SPP B;  3OGR A;  3CNA A;  2E7A A;  2RDQ A;  4XDQ A;  3RI9 A;  2OZ6 A;  1RUI 3;  4YLZ A;  1HKD A;  1FX5 A;  1J1T A;  1VBC 1;  1CN1 A;  1LHU A;  1LCL A;  2BYV E;  3N36 A;  4HFS A;  5F5C A;  3I2H A;  1B09 A;  5F7U A;  1PZ9 A;  4IGP A;  4OI4 A;  3HT1 A;  1UU5 A;  1FPN 2;  3BOD A;  3BKZ A;  3CZJ A;  4I01 A;  4M3C E;  3MHZ A;  4ISQ A;  2X09 A;  1MZ6 A;  2JEN A;  2HWE 3;  2VBB A;  2BPA 2;  4IER A;  5EQU A;  2ZKN A;  1HRV 1;  3OGJ A;  5FXZ A;  3CLP A;  4ES9 A;  5BNN B;  1JYT A;  2Y60 A;  3MO4 A;  1CR7 A;  3RWN A;  4MOA A;  5EJ1 B;  1LEM A;  3IN9 A;  2CWS A;  4RL7 A;  3PUH A;  4UWD A;  3ZFG C;  4XQ4 A;  2ZX0 A;  4OUM A;  2R07 1;  3NW4 A;  4WVV A;  1SFY A;  4BXS V;  3NKT A;  4XF3 A;  1XND A;  1ONA A;  4AVV A;  2JB4 A;  4IUG A;  3LIH A;  2FDI A;  4YM2 A;  1W8O A;  1ST8 A;  3I3M A;  1F8V A;  1H1M A;  1KFX L;  5BPX A;  4JX0 A;  2HJI A;  2GC3 A;  5LBE A;  3GJB A;  2XUE A;  2RMU 3;  2PHR A;  2EXK A;  2NN8 A;  4GAZ A;  4A44 A;  2IXJ A;  3IPV A;  3KCC A;  5GZE A;  1COV 1;  2Y6L A;  3BIW E;  2QQU A;  4OI0 A;  5C5U A;  1W03 A;  4Y22 B;  2R7E B;  3J8F 3;  4CUB A;  4CUG A;  2YC2 A;  3KVB A;  5C9A A;  3KGZ A;  2ET7 A;  4YW7 A;  3VHO A;  3IKW A;  1DIW A;  1EYB A;  2WZE A;  4BXF A;  3VBO C;  2ARC A;  1QXJ A;  3FMG A;  2QQO A;  1FAY A;  1QMJ A;  5G05 L;  4Q2F A;  5JMC A;  1QJY 1;  4IET A;  4HON A;  1UY2 A;  4QM9 A;  1X8E A;  2W3J A;  4H3W A;  1ND3 A;  2VMG A;  3I2K A;  4YM1 A;  2GAU A;  2D93 A;  3ZFG A;  5EHD A;  1KQR A;  4NII A;  3O1S A;  4OYU A;  5HCF A;  1QIQ A;  1V9U 2;  2XKO A;  4QPG A;  2JWP A;  3DEM A;  1W8F A;  1WBF A;  3DXU A;  3FHI B;  3AB0 A;  1YJK A;  3TN9 2;  3IAP A;  4CPB A;  3IWZ A;  2HWD 2;  1WW5 A;  1FI2 A;  2BJS A;  2VCM A;  4EWA A;  1W0P A;  4PT6 A;  4GUL A;  3S7E A;  1XU1 A;  1IPJ A;  2ARE A;  4NHK A;  3VKM A;  1FMD 3;  4Q0P A;  1J3P A;  5LW9 A;  1OLQ A;  2F6B A;  1WCS A;  5JCT A;  1DZT A;  1HQN A;  1SBF A;  1UY3 A;  2EIB A;  4GIQ A;  2A7A A;  5DZF A;  3OF1 A;  4IE7 A;  3N9L A;  1VBD 2;  2BTV C;  1R1Z A;  2R04 3;  4AWD A;  4XIL A;  4FTS A;  1OHF A;  4LBN A;  2AEN A;  3WD5 A;  4R9D A;  2VTX A;  5LA9 A;  4ASK A;  1UZV A;  3DF0 A;  4FFH A;  3KV5 A;  3WG3 A;  4CXX A;  1A3K A;  1R1A 2;  3VBO A;  1QQP 3;  3LWC A;  3UL2 A;  4BMB A;  3AVS A;  3H42 B;  3WXP A;  3AX4 A;  2XUM A;  3ON7 A;  2ZMN A;  1W2A X;  3IT8 A;  1SZB A;  3RZM A;  3FC0 A;  4UFJ A;  3KB5 A;  1AYM 3;  1WLC A;  3MPB A;  2WC2 A;  2DVG A;  4J1X A;  5JSR A;  3N4M A;  2D98 A;  5FV3 A;  4A41 A;  1AR6 1;  5FJK A;  1EV1 2;  2W08 A;  1AL2 3;  3NAP B;  2V73 A;  4CUA A;  5KWR A;  1LGN A;  1ULG A;  1W8U A;  4JRA A;  1PHM A;  4FVV A;  3RJR A;  1WKY A;  4PLM A;  4XHX A;  3WDW A;  3WQ1 A;  1J84 A;  1V6M A;  4YGD A;  2JD9 A;  4MGQ A;  5CBL A;  2RS1 1;  4W6W A;  4H2A A;  4LIU A;  1JI6 A;  2FDJ A;  4QDR A;  5EFU A;  1ZRD A;  4QB1 A;  2JKX A;  3RZL A;  4RGG A;  2R16 A;  2OUJ A;  4QKN A;  2ZEX A;  2I45 A;  2P3K A;  3N9Q A;  1TVG A;  2YY1 A;  4PQ9 A;  3ZXD A;  2VMI A;  4YZ3 A;  1UWW A;  4Q4X 3;  4NMI A;  3VZM A;  5ACA 3;  1ULF A;  5DAV A;  2O8O A;  4A4A A;  2VW1 A;  1GP4 A;  4V2W A;  1U5Y A;  2R06 3;  3NV1 A;  4YVS B;  1VRH 1;  3L9J T;  4DEQ A;  1FOD 2;  2DV9 A;  1WLT A;  2Y0O A;  3O12 A;  4GMP 1;  1JYV A;  3OJB A;  4V2V A;  1G86 A;  1XYN A;  4XXP A;  1U5Z A;  2BWA A;  4NWV A;  5FZ8 A;  4CDU B;  3W59 A;  4XJA A;  4PI2 A;  4XJ8 A;  3S30 A;  4EJR A;  3TNP B;  1ZA4 A;  3U1X A;  3KGL A;  1RUH 1;  1SFP A;  3LEI A;  4TN7 A;  4A45 A;  2WAB A;  4QQP A;  3PLQ A;  5LAT A;  3AYA A;  4QWN A;  1X82 A;  4YRD A;  2D5F A;  4NID A;  2JX9 A;  2CGN A;  2DTW A;  2IVJ A;  1XE7 A;  3WEZ A;  5A7N A;  3ZYI B;  1WCK A;  1EPZ A;  3WG2 A;  2NP0 A;  3ZFF A;  1W6O B;  2Q1F A;  4XFA A;  1GNY A;  3K51 A;  1HV0 A;  5J96 B;  4PDW A;  3THT A;  3NV4 A;  3M4F A;  3ST7 A;  3SCG A;  1X7N A;  4BQX A;  3A22 A;  1NQD A;  4LT5 A;  3Q8A A;  1ZRF A;  4W65 A;  1W9W A;  1M4W A;  2FHR A;  1W6P A;  2VZQ A;  4DIN B;  1YQC A;  1HB3 A;  2FQP A;  5T3N A;  4QX7 A;  2FDF A;  3RS6 A;  2W68 A;  4Q27 A;  1IG0 A;  1EPW A;  1DU3 D;  2R6Q A;  1KJL A;  3PU8 A;  4JZR A;  5B4X A;  5JI7 A;  1VB2 A;  5FDB A;  2GDF A;  4FT8 A;  4L92 A;  3ALQ A;  2ZXQ A;  3VL8 A;  4H7M A;  1QY4 A;  3AZZ A;  4AG4 A;  1I5Z A;  1HB2 A;  1XYO A;  1W3X A;  2WKK A;  4QXK A;  3TN9 1;  4DXZ A;  2A6V A;  2GN3 A;  2HWD 1;  4S2H A;  1PM4 A;  1RUF 2;  2ZGT A;  1JYX A;  1CWP A;  1QJE A;  4Q4W 3;  5FTT C;  4NHX A;  3C2U A;  4YSF A;  5D1I A;  1ACC A;  1OUS A;  4IEX A;  4L8Q A;  3ACF A;  1WA4 A;  2A73 B;  1DGL A;  2QFE A;  3P6B A;  4QX8 A;  2Z69 A;  4UFL A;  3THP A;  5AVA A;  5KBF A;  3LA2 A;  2ADE A;  1VBD 1;  3AKP A;  4FFI A;  4QAW A;  2WNO A;  3TB0 A;  4UW6 A;  3WUD A;  1H1I A;  1RUJ 2;  1SG3 A;  2P6C A;  4LKS A;  3ZSL A;  4AED A;  1UXZ A;  1DP0 A;  2VTX J;  3D0J A;  3ZN6 B;  3JZV A;  4NRM A;  2QZ3 A;  3IZO A;  4KWJ A;  3D82 A;  1R1A 1;  1HN1 A;  4FO9 A;  4XTP A;  3AYE A;  3PME A;  4IE5 A;  5LK5 A;  4C1W A;  1OVP A;  2EXJ A;  2VOT A;  3SMH A;  4AQ2 A;  2FDK A;  5GJ6 A;  4I2O A;  1NCR B;  5B2G B;  2PAE A;  1OOP C;  1GLH A;  3ZKY A;  1XQN A;  3BB6 A;  3RYP A;  2UWB A;  4BCU A;  3CBN A;  2XLG A;  5GZD A;  2LUW A;  1OLM E;  2K9Z A;  4JGY B;  2I07 B;  3EJK A;  3FBM A;  4Y3O A;  2IFW A;  1URX A;  3ASI A;  1W28 A;  3WF3 A;  1LR5 A;  5J36 A;  4QU2 A;  1PK6 C;  4XF4 A;  4CEW B;  5FCC A;  4BH9 A;  3POS A;  1POV 0;  5K4L A;  4NIA A;  5CB7 A;  1Y3T A;  3PJY A;  4XBN A;  4ZS3 A;  2ZGO A;  1JBC A;  3LCP A;  3WHT A;  1A78 A;  4L9B A;  1W2N A;  4PIZ A;  5LAS A;  4KNC A;  1R08 1;  5LBC A;  5C71 A;  3EYP A;  5LA1 A;  5F6K A;  3TEZ A;  1W6N A;  2JG8 B;  4GAL A;  4XW3 A;  4Y24 A;  1SMV A;  2KA3 A;  2LS6 A;  1N1T A;  1VAL A;  2RS5 2;  4WVW A;  5K8S A;  3WCR A;  4FPH A;  1H4G A;  3GF6 A;  3A0N A;  1WWY A;  1QHD A;  3SKV A;  2NZ9 A;  4JDN A;  5HV0 A;  1TME 1;  1RUE 3;  2ZZQ A;  4FPE A;  5IK5 A;  4LEJ A;  3RDI A;  2NM1 A;  2XBO 3;  4J6G A;  4DNY A;  3GJA A;  4XCA A;  5EJZ B;  2X05 A;  1PGL 2;  2J1A A;  2XL7 A;  1UXX X;  2D7F A;  3POI A;  4Y20 A;  5IAX A;  3I3Q A;  2HEY F;  3K3N A;  1RTV A;  4GH4 B;  1DF0 A;  1NCR C;  3FZ3 A;  4HXC A;  4BQY A;  5LA0 A;  2J42 A;  4AVT A;  2OZJ A;  3ZYR A;  4LKF A;  2WT2 A;  4PLO A;  5FYH A;  4BDV B;  2NQY A;  1MVE A;  3IDB B;  5D21 A;  2JDA A;  3POG A;  3WP3 A;  5FZI A;  3ZLI A;  2Q1M A;  1QJX 2;  3FWE A;  4JTN A;  4YGC A;  1MEC 2;  1PNG A;  3I3E A;  3ENR A;  4CEW C;  4CU8 A;  3WQB A;  3DGT A;  2QZ2 A;  4N43 B;  1GZ9 A;  1QXP A;  1TZO A;  1O8S A;  2WS9 2;  5T55 A;  3V0A A;  3KQR A;  3H3Z A;  2JEC A;  4LIV A;  2ZKL A;  2BFU S;  2ZGK A;  3NNM A;  5C3R A;  3RYR A;  2K46 A;  3EBR A;  1MS9 A;  1S0G A;  3PU3 A;  5FYU A;  2WNU C;  2Z5W A;  1JYI A;  3WDV A;  4MET A;  4XF0 A;  5JWP A;  5ABJ B;  1WCU A;  4LBQ A;  5HCB A;  5IYY A;  1RUF 1;  1IS3 A;  3Q8F A;  4K3U A;  4LHL A;  3RI8 A;  3OY8 A;  5LA2 A;  3POY A;  1U0A A;  3VDD B;  2HBU A;  4XMI A;  3X29 B;  5F37 A;  1V70 A;  1W6Q A;  3UET A;  4DMI A;  5LK7 B;  3GZT B;  4NE9 A;  4ARY A;  3V0B B;  4L99 A;  4R4X A;  1W2T A;  2XL9 A;  2DFB A;  4P9G A;  1QDO A;  2C9K A;  1RUJ 1;  1WLW A;  4G9S B;  1CAV B;  1VBA 2;  2ES3 A;  4X6Q B;  1QEX A;  4CDQ C;  3VKL A;  3AMH A;  1AR9 1;  4QGL A;  2FZ1 A;  4CCM A;  4UW5 A;  1S0B A;  4Y1Y A;  1RUG 1;  1W8N A;  3C7G A;  2ETE A;  5FUP A;  4DIQ A;  5FZ7 A;  1VBB 2;  1NX9 A;  1W90 A;  2CHH A;  3ACG A;  3I3D A;  3QLQ A;  4MGS A;  4XBL A;  4XFG A;  1SFN A;  1OBN A;  4CCN A;  2PLV 2;  3GNE A;  1QJF A;  1GZW A;  3WHU A;  3WDT A;  1SLT A;  4CP2 A;  1CVN A;  4HVO A;  1OFN A;  2XJV A;  5LY2 A;  3VZO A;  1XB9 A;  4XJW A;  3K48 A;  4N43 C;  3ZFE C;  1F31 A;  5I8S A;  3UES A;  1I3H A;  5GZC A;  2WA3 A;  2WFF 3;  1IPS A;  4HOO A;  5FXW A;  2C1F A;  1MVQ A;  3KZ4 C;  2PQS A;  3NL1 A;  4C8D A;  1HJF A;  5KC6 A;  3OD0 A;  3H1W A;  3W5M A;  1IOA A;  3WP6 A;  3WCS A;  4P08 A;  2WUH A;  4AFD A;  1F15 A;  3HQX A;  4FXG B;  1LGC A;  5ABJ C;  2UY8 A;  1KS4 A;  5JPN B;  5CU1 A;  4L2N A;  4CU9 A;  4R4Z A;  3MYX A;  4RR3 C;  5HI0 A;  1AX1 A;  3TOJ A;  4CDW A;  2E9Q A;  4IEO A;  4A7Z A;  2VQU A;  4LO4 B;  1PVC 3;  3GZA A;  4CDX A;  2ILM A;  5E16 A;  1PO1 2;  1UU4 A;  2IXI A;  2RS5 1;  1QU0 A;  4BQ5 A;  3B69 A;  2YB7 A;  4AQ6 A;  2EA7 A;  2YPJ A;  3VKF C;  3T09 A;  4D7Y A;  3ZSJ A;  4E4S A;  2BOJ A;  1G7Y A;  4GWJ A;  1HQW A;  2ZZJ A;  4JC1 A;  5JSO A;  5JZG A;  2VMF A;  3H7Y A;  4GWN A;  4M00 A;  5BNO B;  3LGR A;  3WNL A;  1JHJ A;  3FJS A;  2GP5 A;  1NLQ A;  3HMY A;  1PGL 1;  3UYJ A;  5DG1 A;  1LGB A;  2CU5 A;  2HWC 3;  5EWS A;  5IVJ A;  4N9I A;  3K3O A;  4OHZ A;  1JUH A;  2HBT A;  3AL6 A;  1D4M 1;  3NV3 A;  1Z7S 2;  3IIA A;  1E5H A;  3ZFE A;  2C6S A;  1A34 A;  5I8Y A;  4M4P A;  5FJH A;  1RUI 2;  4QHZ A;  2Q30 A;  4BIS A;  4KH9 A;  1KJR A;  3J7M A;  1GNH A;  3IB3 A;  1H6X A;  3SEE A;  4BLJ A;  3UJQ A;  1GOF A;  4XAC A;  2QQJ A;  2A70 A;  4RGK A;  1QJX 1;  1F5J A;  5FFO C;  1B35 A;  1MEC 1;  1O59 A;  2HWE 2;  2WBK A;  1LOB A;  5LRR A;  1MQT C;  3OYW A;  5FMO S;  2J1E A;  4HET A;  4XQW A;  4XBQ A;  2W0X A;  3K4A A;  2E32 A;  4KQ7 A;  4TLF A;  5IFT A;  1G9A A;  4QM8 A;  3ZXA C;  3VD9 A;  3MGU A;  2UU8 A;  1DQ1 A;  3LDB A;  1FXZ A;  2VUD A;  4MH0 E;  4OFG A;  1SEF A;  3U75 A;  3OD4 A;  5T5P A;  5C8C B;  2ZEZ A;  2BGP A;  4L11 A;  3ZOI A;  1RUN A;  3WNP A;  1E57 A;  1CZV A;  2Y6G A;  4AOC A;  1XNA A;  2RMU 2;  1OLR A;  1VMH A;  2WA4 A;  5I0T A;  3M3E A;  1XU2 A;  1DHK B;  1RMU 3;  1TNR A;  3F95 A;  3KCX A;  4XIK A;  2W9X A;  3PUI A;  4PLN A;  2R1B A;  1R64 A;  4V1P A;  1CQ9 A;  4P5Y A;  1VBA 1;  2DVB A;  1JOD A;  3ZDS A;  1BXH A;  1RC6 A;  4C0B A;  3NO8 A;  3T2P A;  1POV 1;  3J8F 2;  2L9L A;  1RYY A;  4FFF A;  3VBU C;  4QX3 A;  1FNZ A;  4MHU A;  1LOC A;  2Q4S A;  2AGS A;  1VBB 1;  3K2O A;  5ISL A;  4Q8K A;  5H9R A;  1O8P A;  5FZ0 A;  1DQ0 A;  4BA6 A;  2PLV 1;  4I3G A;  1H4H A;  4ERO A;  3AZW A;  4DFS A;  2A6Z A;  3RNS A;  2ZTN A;  1MQT A;  1YQ5 A;  4FOQ A;  4QHO A;  4ZPI A;  3E6C C;  2IC1 A;  3OPZ A;  4HN1 A;  1K3I A;  2NLR A;  4YZ4 A;  2PFW A;  4QXC A;  3U10 A;  3GDB A;  5CIR A;  2QVS B;  1OUR A;  3WDU A;  1GNZ A;  3I97 A;  3MV1 1;  4WM8 A;  4M3C A;  3O14 A;  1RXF A;  4JGZ A;  3PMS A;  1DBN A;  1NCQ B;  1SCR A;  1MAC A;  2EIE A;  1DLL A;  5JI9 A;  2VE1 A;  2QE3 A;  3T1L A;  1H8V A;  5CFC C;  2IFR A;  5C8C C;  3VBH A;  3S57 A;  1X36 A;  3ZDV A;  4H55 A;  2X8K A;  4JTO A;  1YRZ A;  3WSO A;  1FMD 2;  2KR2 A;  2PHL A;  2C26 A;  2MHF A;  4D6Q A;  5FYT A;  2E53 A;  1OXC A;  5CFD B;  2AC1 A;  3MIH A;  1C8N A;  4XAB A;  2R04 2;  2XGX A;  3FN9 A;  3SNM A;  2FDG A;  3CIH A;  4QXH A;  5FZL A;  1YIP A;  3RGB A;  2P1B A;  2FCV A;  2GC1 A;  1AVB A;  4OI2 A;  3VBU A;  5FPU A;  3JQX A;  5JMO A;  2PQQ A;  5LZ6 A;  3CKH A;  4MGI E;  1AXZ A;  1E5I A;  2GZW A;  3CHX A;  3CJI C;  4P9Y A;  4IV1 C;  1QJU 3;  4ASM B;  1QQP 2;  1DDL A;  2CTV A;  4QHB A;  1YQ6 A;  4JKM A;  4X6R B;  2D6L X;  4WVM A;  1CJP A;  2GND A;  1W0O A;  4XFH A;  3VB9 A;  1E5R A;  2X5I C;  3BCW A;  3OEA A;  4OUS A;  3HN3 A;  5IUQ A;  2WAA A;  5GLV A;  2B42 B;  3T0A A;  1AYM 2;  5EP9 A;  4NHM A;  4NR1 A;  4HL0 A;  3BI3 A;  2PXJ A;  4YVW A;  1AL2 2;  1Q8V A;  4LBJ A;  2EIG A;  1NZI A;  4XUN A;  5H9Q A;  4MX3 A;  1Z0H A;  5LBF A;  2CGO A;  2JE7 A;  2WO1 A;  5JUV A;  1G9D A;  1G9C A;  4Z92 B;  1FAT A;  1TNF A;  2VC9 A;  3S7I A;  1CAU A;  4ARX A;  2VXJ A;  5IVY A;  2WYF A;  5FZF A;  5GZF A;  2ZAA A;  3H8U A;  5FQ0 A;  2O8Q A;  4JV4 A;  3GZU C;  3JBG 3;  3KQ4 B;  4Z1V A;  5FKB A;  2AUY A;  4CCK A;  2AZ5 A;  4PJY A;  5BUV A;  1JOP A;  4XF1 A;  1W9Y A;  2XXZ A;  3UJO A;  4BJ0 A;  3OOX A;  2VOW A;  2HWE 1;  5BNP C;  1D2Q A;  4ZON A;  2JIJ A;  3FLR A;  3IPV B;  4UFK A;  3WOG A;  1IS4 A;  4Q4X 2;  2ARA A;  4R52 A;  4CCO A;  5L36 A;  5KR7 A;  1M06 G;  2GC0 A;  4IW3 A;  1XSR A;  1BK0 A;  3I2I A;  4AGG A;  1NOV A;  5CFD C;  1G9F A;  2R06 2;  5FLI A;  2VQT A;  4ZU7 A;  1GR3 A;  1W2O A;  4IV1 A;  2FZ2 A;  1PO1 3;  2ZGS A;  1CON A;  4QPI B;  5BV6 A;  1YXW A;  2OVU A;  5FMB A;  2ORZ A;  5GLW A;  2ATF A;  2X5I A;  4HT1 T;  5DZE A;  5A3O A;  3VD5 A;  5GZG A;  1ZZC A;  4PF1 A;  4O61 A;  1IZ3 A;  2Y6F A;  1UYZ A;  1SQ4 A;  1XE0 A;  2D6M A;  4URT A;  4AHW A;  1ND3 B;  4FI9 A;  3RZZ A;  4S2F A;  3H1M A;  4PIX A;  1RIT A;  3ACH A;  1C1F A;  2XJQ A;  1ZRC A;  3NMB A;  4LQR A;  5JR7 B;  4HAN A;  3VBS B;  2UY9 A;  5K0U A;  3FUQ A;  2P37 A;  2GH8 A;  4Q4V 3;  3AKR A;  4DUW A;  3I3B A;  4YW3 A;  4B1L A;  2ZX1 A;  4U36 A;  1Z7S 3;  3POW A;  4QPG B;  5FXV A;  5IVE A;  1RB8 G;  5JXH A;  1S0D A;  2ORX A;  2EVX A;  4GQ7 A;  1W9F A;  3RSJ A;  4QQH A;  4AI3 A;  1W2U A;  1S4C A;  5EXO A;  5A7Q A;  1L7Q A;  3NNJ A;  3E5Q A;  3GYD A;  2WO2 A;  3I2D A;  2JG9 C;  3P3N A;  4UFH A;  4LO5 B;  5BNP A;  5C4W B;  1SBE A;  3CEW A;  2VNV A;  1N3O A;  1SDW A;  4XUT A;  3KT1 A;  5FWJ A;  1UKR A;  3FFQ A;  2YBK A;  4MGK E;  4AAP A;  1H8T C;  1KIT A;  3IDE A;  4IE6 A;  3UGH A;  5D8A B;  3S0M A;  2XON A;  2JDH A;  1V6O A;  4YZ5 A;  1HDK A;  4MAD A;  4B3N A;  1ZBE 2;  3DEC A;  3KT4 A;  3VBR B;  4E4Z A;  4A6S A;  2WNV B;  2XLA A;  3O1M A;  4Q29 A;  5A33 A;  1JZ4 A;  1O5L A;  2QQI A;  1APN A;  1VBE 3;  5A3T A;  2W52 A;  3NKG A;  5JOW A;  2K0G A;  4AHY A;  2JXA A;  4S2D A;  4Q4W 2;  3VZL A;  1JHN A;  1UIK A;  4KU8 A;  4AI9 A;  4AVC A;  4D0Q A;  1FMD 1;  1Y43 B;  2JDZ A;  2VMD A;  1C3H A;  3I7D A;  5FYI A;  4C91 A;  5BXX A;  2R04 1;  4YG0 A;  1SDD B;  1ND2 A;  2RM2 3;  3QD6 A;  3VBR C;  3H9A A;  3OCP A;  1NLR A;  2PYT A;  1YFY A;  3ZMN A;  3VBS C;  4RS5 C;  3DPR B;  1UNB A;  1QQP 1;  1JZ3 A;  1C5I A;  1KGY A;  3UKV A;  2JG9 A;  1LOG A;  4P14 A;  2XDV A;  3I54 A;  3JD7 3;  1UCX A;  2RJK A;  3MW2 A;  3N7L A;  1QDC A;  3VLB B;  4C90 A;  1AYM 1;  3NVC A;  1CAW B;  2W39 A;  5LRS A;  5DAB A;  2ZGU A;  1JZ2 A;  3WV6 A;  1AYN 3;  2VOK A;  1IQA A;  3N35 A;  1AL2 1;  4F83 A;  2WIN B;  1ASJ 3;  5EJ3 A;  2VJX A;  4L0P A;  1W3V A;  1RIN A;  5FYM A;  2VPV A;  3V64 A;  5IVF A;  1LEN A;  3AJZ A;  1J1L A;  1FV3 A;  1EP0 A;  2BNN A;  2QDN A;  1OD5 A;  2YBP A;  4I02 A;  5ERL A;  2OKX A;  3WG4 A;  3WT3 A;  3ZIX A;  1Q43 A;  4YFZ A;  1PO2 3;  4XJ9 A;  2W95 A;  4KG8 A;  4ZU4 A;  4XEZ A;  5BNN C;  2VCA A;  3CJX A;  4MXW B;  5FPB A;  1F4A A;  3C8X A;  2GMM A;  4OZX A;  5IWF A;  1DGW X;  3NST A;  2A6W A;  3GZE A;  4RQP B;  3KF3 A;  3AYC A;  1Y4W A;  4IE4 A;  1UYX A;  4Q0U A;  1BBT 3;  4IE0 A;  5FZE A;  4Q4X 1;  3T3Y A;  5A6Z A;  5ACA 1;  5T54 A;  5FYS A;  3VD4 A;  2BVV A;  4PI0 A;  5FUN A;  2B4K A;  2BNO A;  4YAR A;  1U12 A;  2GC2 A;  1UMI A;  2R06 1;  3A7Q A;  1CPM A;  4RS5 A;  2K2S A;  3IBM A;  5D2A A;  3AMQ A;  2A3X A;  4UBG A;  3ZFF B;  1N3Q A;  2QBX A;  2W1W A;  3A23 A;  2XOM A;  3DUI A;  3WLU A;  4NIH A;  1V6J A;  1VP6 A;  1W9T A;  3BIE A;  1SPP A;  1RUE 2;  4GKX A;  2HEW F;  5SV8 A;  5A3P A;  2G9Z A;  4CCC A;  5IHR A;  2DBN A;  3PVB B;  2A6Y A;  2XBO 2;  5DG2 A;  1JYW A;  5J48 A;  1JYN A;  2W1U A;  1NKG A;  4ORF A;  3KM5 A;  5FZ9 A;  4ATF A;  2JDK A;  3WIN E;  1QF3 A;  3WX5 A;  2ZPX A;  4XUQ A;  4ASL A;  4AYU A;  2XJT A;  4CCJ A;  1CIW A;  3J4U H;  3OGG A;  4E4D X;  1CJD A;  1K45 A;  2GNT A;  1XNB A;  2W1Q A;  1TMF 3;  1UO9 A;  3EXU A;  4AAX A;  4FPY A;  3IM0 A;  4LMF A;  2O0O A;  3K77 A;  5F3E A;  1J3Q A;  2DUR A;  4TSV A;  1LNS A;  4FSJ A;  2QTW B;  2CWM A;  1GP6 A;  1N1S A;  3ATG A;  4IEP A;  3SH4 A;  4CCD A;  3KT7 A;  2WT0 A;  4ITC A;  2QJV A;  5IT6 A;  1WUV A;  5DAW A;  1YFX A;  1FPN 1;  1OLM A;  1OKQ A;  2WN2 A;  4IXL A;  4UI9 L;  5FZA A;  1MS4 A;  2IUW A;  1YWK A;  4A7Y A;  1YFU A;  1AJK A;  1N1V A;  2ARB A;  4FCA A;  3B94 A;  5F6L B;  4WM7 B;  3VDB A;  4MVT A;  5C3S A;  1XE8 A;  3I2J A;  2VZV A;  4HSL A;  3THC A;  3T0D A;  3TBD A;  1MS5 A;  3CMG A;  5FZO B;  4COZ A;  1QJY 3;  4EN0 A;  3T2O A;  3I59 B;  5IFP A;  1W8Z A;  4KU7 A;  1K5M B;  1S0I A;  2YYO A;  3KV4 A;  2WN3 A;  3HAG A;  1NXD 1;  2YDE A;  4QKF A;  1YFW A;  3T0B A;  3BGA A;  3VUO A;  1OUX A;  2R0F A;  4KI5 M;  4Q4W 1;  2JD4 A;  1DYP A;  4Q8L A;  4XE9 A;  3PJQ A;  4RFR B;  4RGA A;  1WMX A;  3DN7 A;  4Y22 A;  3OUJ A;  4IDZ A;  4NN0 A;  3ZXG A;  3G6J B;  2E26 A;  3SKJ E;  3ZR5 A;  2ARX A;  4L97 A;  4K21 A;  4MGZ E;  1HB4 A;  1ZA7 A;  1LJ7 A;  3V56 A;  2DUQ A;  3OUI A;  5FBJ A;  1ZZ7 A;  1Q5O A;  3AP4 A;  4CEY B;  1SBD A;  3KHB A;  3ZN5 A;  4A2U A;  5LBB A;  3W58 A;  4D94 A;  3NJV A;  4YG3 A;  3OBZ A;  3ZMO A;  4YZ2 A;  1Q8Q A;  4QKD A;  2LTN A;  1MZ5 A;  2W1S A;  2JIC A;  3M8L A;  4LTA A;  2A3W A;  3BU0 A;  4HN0 A;  3MLL A;  4XUO A;  4MZU A;  3USU A;  5FY5 A;  2PEL A;  2BGO A;  3PHM A;  5JOZ A;  4Q1R A;  2PHX A;  2FCU A;  3NAP C;  3RRD A;  2ZS6 B;  3KV9 A;  1IPK A;  1WMF A;  1Y9M A;  3C7E A;  2QNK A;  5FUI A;  3ZPO A;  3M1H A;  4YGE A;  3VZN A;  5F32 A;  2GSY A;  4X8P A;  2A75 A;  2V4A A;  2XH6 A;  2MPF A;  3L2H A;  4HBN A;  4WVZ A;  4G3Y C;  4D7T A;  3SCF A;  4DOU A;  2WYS A;  4BQW A;  4AQT A;  4NAM A;  3HWJ A;  4IGQ A;  4EQV A;  5FZ3 A;  3ZR6 A;  5FZ6 A;  1OD3 A;  1S2B A;  3VKN A;  1XNT A;  1AR7 3;  2BWC A;  2XJP A;  4Y5S A;  2WFF 2;  3WF0 A;  4WM7 C;  4D3W A;  2RV9 A;  3ZO0 B;  3N7K A;  1NY7 2;  1IG3 A;  1ZBE 3;  2ZA9 A;  3PUQ A;  1V9U 1;  2YZ4 A;  3LF7 A;  1AR6 3;  4XZU G;  3AP9 A;  1RHI 3;  3Q8E A;  4DXT A;  3JCI A;  2AEY A;  1MS3 A;  2ZML A;  3EHK A;  3PUR A;  4PBP A;  3BYW A;  3NNL A;  4COW A;  3S6P A;  2ZBJ A;  3D5O A;  2W5F A;  3LZZ A;  3N9P A;  4YVS C;  1DQ6 A;  3D3A A;  3LB9 A;  2DUO A;  1PVC 2;  4UBH A;  1UYY A;  4LBO A;  5FO8 B;  1V00 A;  4AI2 A;  4E27 A;  3ES4 A;  5FYZ A;  1NZC A;  3AJY A;  4CDU C;  3I2O A;  1CX1 A;  4LKD A;  1Y7B A;  3LOI A;  1RUD 3;  3LIG A;  1UMZ A;  2VZR A;  2ZCW A;  4EZ4 A;  2W2I A;  3ZYP A;  5L9V A;  2VTF A;  4CEY C;  2PHW A;  3NAP A;  1RUE 1;  1CAX B;  2RDS A;  4ZY9 A;  3HT2 A;  4K1Y A;  2XBO 1;  2WQ4 A;  2HWF 3;  1HW5 A;  4GB3 3;  4K40 A;  1NXM A;  5C70 A;  5E1R A;  2VH9 A;  5JXI A;  4P9J A;  2XPJ A;  3V65 A;  1CES A;  2HWC 2;  3JB8 A;  2OX0 A;  1MS0 A;  4OHW A;  3WF2 A;  5FZB A;  2WLP A;  3V0A B;  3RFR A;  2TUN A;  4KMQ A;  1IS5 A;  5A6Q A;  3U4S A;  5A7S A;  4AFM A;  1GQP A;  2P34 A;  5FYV A;  1EV1 1;  4AW7 A;  1RUH 3;  1WGP A;  1NA1 B;  3GBF A;  3WF1 A;  4N53 B;  4FXK B;  2Y33 A;  3CDZ B;  4BME A;  1HQL A;  4LBQ B;  5F1R A;  2UYB A;  5A6X A;  5FZ4 A;  2VUL A;  3FLT A;  3LA7 A;  2Q8C A;  1FT9 A;  1UX6 A;  1W04 A;  2QQN A;  4GKY A;  4QX0 A;  5F2W A;  3ZXK A;  3HNM A;  4I09 A;  5FP8 A;  4LA3 A;  4NHY A;  1UL9 A;  1YNA A;  4YVS A;  2TBV A;  4DPN A;  2H6C A;  1ZBA 3;  4XCB A;  2G9G A;  2WWU A;  3M3Q A;  2WFP A;  4FPK A;  4YW4 A;  1RVF 3;  2JIG A;  2V5Y A;  4XFI A;  3OUH A;  2VNO A;  5GKA C;  5DUW A;  4YGB A;  1REE A;  2Q8E A;  3VDA A;  3Q9O A;  4PCR A;  3NV2 A;  2IXH A;  2VUA A;  1JUI A;  5DUX A;  4NO4 A;  3ZSK A;  3HOB A;  1FOD 1;  2H0V A;  3SLI A;  2VO5 A;  3JU9 A;  3NNG A;  4ZZ5 A;  1W6M B;  1FNY A;  4YYO A;  4BK5 A;  3FX3 A;  3AKS A;  3MZH A;  4CP9 B;  5L7O B;  1BEV 2;  1RMU 2;  3NQH A;  3MLK A;  3N9M A;  3T08 A;  1H2M A;  1P8J A;  1OOP A;  2J1R A;  3FFZ A;  1JOB A;  1UZ0 A;  2CDP A;  3E6B A;  4N9H A;  4BIF A;  5J37 A;  1WW4 A;  2YRO A;  2XJS A;  4E8D A;  2BV4 A;  2E6V A;  4D69 A;  1WW7 A;  4O7X A;  1QH6 A;  2Q0A A;  3BOP A;  1Q3E A;  2YC0 A;  2AH2 A;  2Y6J A;  4IEV A;  3FBY A;  1YQ8 A;  1PK6 A;  2WWS A;  1H1A A;  3M7A A;  1GFF 2;  3AL5 A;  1ULO A;  4B1M A;  2CGP A;  4JGY C;  4N53 C;  1DZR A;  2UUR A;  4FOV A;  4CXW A;  1I5P A;  3PUA A;  4Y26 A;  4OMD A;  3ECQ A;  2OW4 A;  3VHP A;  3P5B A;  3HPN A;  4LXL A;  4D6R A;  2C5D A;  4Z82 A;  4AFB A;  5F8P A;  4AI8 A;  4CDW B;  1UOJ A;  4YW5 A;  3FHA A;  3MF6 A;  4IV3 B;  4SBV A;  4FPC A;  3VBF B;  5GLZ A;  2OT7 A;  2VZ1 A;  5FP9 A;  2WFF 1;  3BUC A;  1G6N A;  3TYJ A;  1NYW A;  2JDN A;  4FOY A;  4JQT A;  2XWB B;  1NY7 1;  1C4R A;  2UWC A;  2WDB A;  4I30 A;  3HQR A;  3ZYJ B;  1HN0 A;  1UZZ A;  1RJ7 A;  1FYU A;  3RWK X;  5JZG B;  2JG8 C;  2VZO A;  1GQG A;  1OFS A;  1MS1 A;  2XR4 A;  3N3H A;  4EV0 A;  3BPS A;  3ZN6 A;  4KWK A;  2BVB A;  2I74 A;  4GXL A;  2D3P A;  4XOG A;  1PVC 1;  1R09 2;  2Q5T A;  1DYK A;  1W8W A;  3TEW A;  4EN8 B;  3ZXL A;  3UNP A;  3SCH A;  5LEK A;  4AVB A;  1DQ2 A;  1HLC A;  5KHK A;  3O1O A;  2YBS A;  3LEM A;  2Q8O A;  1IS6 A;  2KD7 A;  2VMH A;  3AK0 A;  3RYK A;  2CAU A;  2XKP A;  1NCR A;  1R08 3;  2Y64 A;  5C7G A;  1W06 A;  1QJU 2;  3M3I A;  4QQL A;  5I0D A;  1POQ A;  1UOF A;  1PGW 2;  4JGY A;  1HXS 2;  3WDX A;  1LED A;  3B01 A;  4AFC A;  4NRP A;  2WLQ A;  2BRT A;  2WAO A;  4GH4 C;  1ZM1 A;  2XQR A;  4Y1U A;  2ZMK A;  3USS A;  4CEW A;  1S0F A;  1S0C A;  3ZKU A;  1S0E A;  3GAL A;  5T52 A;  5GM0 A;  1JXN A;  5FZH A;  2ZGN A;  2YUE A;  4N7U A;  5KHJ A;  4XHB A;  1IGO A;  2YPD A;  4OMC A;  2E51 A;  1WD4 A;  3T2Q A;  2VMC A;  3IMM A;  1W99 A;  2WNU A;  2JG8 A;  4NJ4 A;  3QH6 A;  1A8M A;  4R8H A;  3JBG 2;  2WII B;  3LEK A;  2NPI A;  2YHJ A;  4IEU A;  4BE3 A;  5J1X A;  3SXW A;  4HPK B;  3ZYF A;  1QKQ A;  4HG6 B;  1KFU L;  2YFU A;  4OVE A;  1DLC A;  3ABZ A;  4Z2A A;  1RIR A;  4BYY A;  1V6N A;  4K9S A;  5ANN A;  5KHI A;  2WWJ A;  5AC9 3;  1J59 A;  3B02 A;  3TWI A;  3B3Q E;  5A3L A;  2XG3 A;  2R32 A;  4R9C A;  3VDD C;  4A3X A;  3QOP A;  2KM2 A;  3B9I A;  5DMY A;  4DUX A;  2ZHN A;  4CDQ A;  3N9O A;  3I8T A;  2BER A;  2ZEY A;  1L7L A;  3K46 A;  3WNK A;  1TG7 A;  5A7W B;  1HX6 A;  1VAV A;  2VOX A;  1AHS A;  2HWB 2;  2ZAH A;  3MIE A;  4K8R B;  4LK7 A;  4AE2 A;  2WO7 A;  2OA2 A;  1RMU 1;  3MID A;  1OI6 A;  4LBL A;  3ACI A;  4TZD A;  4JKL A;  1UMH A;  2E33 A;  3CZU A;  4OHV A;  4Q0Q A;  2HEV F;  5FO7 B;  3ZXJ A;  1O7F A;  4Q4V 2;  4YW1 A;  1OF4 A;  3MUY 1;  4M0N A;  2E7T A;  2PA7 A;  4N43 A;  4IGO A;  1VAM A;  3MI8 A;  4M3C B;  4U2A A;  1Q8P A;  4WM8 B;  4JGZ B;  1JYC A;  1DG6 A;  1NLS A;  2EAL A;  1BMV 2;  1Q8O A;  1NT0 A;  1WW6 A;  2QQM A;  1UY1 A;  2VY0 A;  4AL9 A;  2XWJ B;  5CKN A;  2H0B A;  2A6X A;  5GAL A;  1I1E A;  4H7L A;  5FPZ A;  1AR9 3;  5IAV A;  4Z8B A;  1OVS A;  5ABJ A;  4UF0 A;  1GWK A;  2JKB A;  4W50 A;  3PDQ A;  1UX7 A;  4FP3 A;  4RR3 A;  4UYB A;  4WZC A;  1RUG 3;  4NUB A;  4X8N A;  4YFW A;  1BCX A;  4GD4 A;  1AUY A;  3WP5 A;  1RXG A;  3AKQ A;  3BTA A;  2B5H A;  2WS9 1;  2VG9 A;  3AZV A;  3JXS A;  4HK9 A;  2VUJ A;  5A70 A;  3V0B A;  4AK3 A;  1QH7 A;  5A32 A;  5HBA A;  1O3T A;  1C57 A;  3B00 A;  5DPN A;  1VBE 2;  2ZX2 A;  3MIB A;  3RZJ A;  5DUV A;  3DXT A;  1OH4 A;  2VM9 A;  1CAV A;  4WVM B;  1W9S A;  2W91 A;  1WME A;  5H9P A;  1LHO A;  3MIG A;  5FP3 A;  1ZZ8 A;  1GYK A;  5H9S A;  1D2S A;  1WCQ A;  1XNK A;  5HCH A;  3BU7 A;  1GBG A;  1OMI A;  4LO6 B;  1GAN A;  4BOW A;  4HSJ A;  3K4D A;  4M3C F;  4Y4R A;  4DB5 A;  5CZK A;  2O1Q A;  2RM2 2;  3GHN A;  4EE2 A;  2J7M A;  4IND A;  1AXY A;  1BEV 3;  1UKG A;  1DYO A;  2DYC A;  3ES1 A;  1OT5 A;  1TQ5 A;  4EZH A;  5B4N A;  5BNO C;  1ODM A;  1KRI A;  2IXC A;  1LU1 A;  5FRE A;  4B7K A;  2WZR 3;  1PGW 1;  5CAD A;  2CSG A;  1LOF C;  4MXV A;  2F17 A;  5KXC A;  3GBW A;  3JD7 2;  1O3Q A;  5DDJ 2;  3ZSM A;  1F2N A;  2EAK A;  2QQP A;  2RJL A;  1JS9 A;  1AYN 2;  4B29 A;  3PVN A;  1OKO A;  4CSW A;  3BAL A;  1ASJ 2;  3R6S A;  4DRR A;  2VR4 A;  5FBZ A;  5FLJ A;  5IK7 A;  4RN5 A;  1JZ5 A;  1H9P A;  3MFC A;  5DAP A;  5GLU A;  1RGS A;  1UAI A;  2OII A;  4NAO A;  2GNM A;  2YG0 A;  4QMA A;  3KVA A;  1QNW A;  1F35 A;  1PO2 2;  3JBG 1;  4B4R A;  2WZ8 A;  4DEV A;  1RUC 3;  2JDU A;  3LKJ A;  1J58 A;  2EID A;  2JDP A;  3PNA A;  3LPG A;  3FL7 A;  1PNF A;  1ULP A;  1BBT 2;  2J1S A;  3KS7 A;  3R4U A;  4FQ4 A;  4G4F A;  4EWE A;  4LJH A;  3OTF A;  4RFT 0;  4JDM A;  3WZ1 A;  4BQ4 A;  3O0X A;  4OLL A;  4CA9 A;  2DBI A;  1OSG A;  5K0U B;  3GM8 A;  1CD3 G;  1YEW A;  3WNM A;  1R09 3;  1F9K A;  1ZZ6 A;  2D40 A;  3OB8 A;  1PO1 1;  3OGV A;  1O6U A;  4E2Q A;  2VGD A;  3LDR A;  1XPW A;  4P5H A;  5DZG A;  2BGC A;  1PVX A;  1OQE A;  1HRI 3;  5FAX A; 
#chains in the Genus database with same CATH homology
 1JOP A;  1S4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...