1S4CA

Yhch protein (hi0227) copper complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
155
structure length
150
Chain Sequence
MIISSLTNPNFKVGLPKVIAEVCDYLNTLDLNALENGRHDINDQIYMNVMEPETAEPSSKKAELHHEYLDVQVLIRGTENIEVGATYPNLSKYEDYNEADDYQLCADIDDKFTVTMKPKMFAVFYPYEPHKPCCVEKIKKLVVKVPVKLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the bacterial YhcH protein indicates a role in sialic acid catabolism.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Structural genomics, unknown function
molecule keywords Protein HI0227
total genus 39
structure length 150
sequence length 155
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04074 DUF386 YhcH/YjgK/YiaL
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.370 Mainly Beta Sandwich Jelly Rolls YhcH/YjgK/YiaL 1s4cA00
1JOPA 1S4CA
chains in the Genus database with same CATH superfamily
3T1MA 3POFA 4AEDA 1ZBA2 3POBA 4ZZ5A 2XJTA 2PMWB 4UW5A 4NHKA 5D8AA 2EVXA 2B4KA 4LO4B 4GB32 2KD7A 1I5PA 1YWKA 1GZTA 4B1LA 5A3TA 4YLZA 2LUWA 2O14A 4Y22A 3WEZA 4CDQC 1POQA 1W8OA 4WVMA 1O7FA 3I2DA 4URTA 4FI9A 1AXZA 1N47A 2WWUA 3MF6A 4NWWA 3HJRA 4JKKA 1ZBE3 5F3GA 4AWDA 4CPBD 4QDQA 5FJKA 1NLSA 5LK7B 2RS53 3PVEA 2LTNA 5JSOA 3ZYJB 3N4MA 3GZUC 2X10A 5LY2A 3R4UA 5BPXA 5L19A 2FDGA 1LHOA 1V9U3 4WV8A 4DQAA 4DMIA 3PU8A 3K77A 2ZKLA 4GALA 2JWPA 5BXXA 4YW5A 2VCAA 2ARXA 1V6KA 1ZZ6A 3UK9A 1AR73 1VJ2A 2WWSA 2VNOA 1H9PA 3D8CA 4Y4RA 2OXBA 3HNBM 2V5DA 2YPJA 3IM0A 3PURA 2XGXA 2GC3A 5LY1A 4FAHA 4W6XA 3UKTA 1MS3A 4Y20B 5C3OA 1NKGA 4N53A 3RZMA 2DTWA 4TYSA 2VCMA 2CYFA 3AP9A 4FXGB 4BZ4A 3BTXA 2W94A 3ZXKA 2JENA 2UY8A 1C3HA 4EN7B 4LKFA 1RUF1 1CX1A 5HXVA 2DFBA 3N9OA 4OHWA 2IUWA 3MICA 1LENA 2DFCA 2VUCA 2W1UA 3J7NA 3O1RA 3PVOA 1WMXA 4YW6A 4LBJA 2AYHA 3AXEA 4UFKA 4EJRA 2MEV1 1QOTA 4DRVA 1GWKA 3O7OA 5BNPB 2E6VA 5FXXA 4HK9A 3ZPOA 1OC1A 3WZ1A 1W2TA 4AW7A 1PO22 3KCXA 4M3CF 3BYWA 2OUJA 3L9JT 2FZ2A 3WP4A 3WQBA 3POJA 5FMCA 4AYUA 2CTVA 3GF6A 4MGIE 4O9EA 5FZKA 3UJQA 4Y1XA 2YDEA 5EZWA 3BKZA 1C5HA 3S6PA 3USUA 4NROA 2VO5A 1ZZ8A 1ZX5A 4O65A 4GA9A 4ARXA 1JYIA 2RG4A 1W9SA 3T0DA 2ZACA 1KDMA 1U5XA 1CJDA 1Q43A 1POV3 3ACIA 4GIQA 3ZFEA 1ZREA 4OI4A 3GNEA 1Z7S2 3WOGA 4QD2A 4S2HA 1LOFA 5JZGA 3THCA 2FCTA 4YGBA 2J1EA 2XUMA 5FYSA 4WM8B 4N53C 1TE1B 1QMJA 2QZ2A 1VAMA 2VZRA 4GB33 2VMFA 5DAQA 4Y3OA 1GOGA 2XBO1 2ORZA 2QTWB 2P2KA 1BQPA 3FHIB 4RFRB 1GV9A 2B9VA 3RWKX 3BTZA 5F6LB 1J3QA 1VBB2 1AR93 2HWB1 2W1QA 1XYOA 4QPYA 5A7SA 4SBVA 1YO8A 5KHJA 1PX3A 4J1WA 1MS9A 3ZKUA 4EROA 3OJBA 1V6LA 4XZPA 4GD4A 2VQUA 2N7GA 1ND3C 3NAPC 2GNTA 1AR91 5C3RA 4CDWB 1FV2A 2NMOA 4K8FA 5I91A 1VAKA 1RUF2 2P1BA 2WT2A 3BGAA 1AYM3 3J7HA 4QX7A 3KV4A 4UI9L 1XXNA 2D6MA 5ANNA 4GMP1 5FPLA 1UY3A 2IXLA 4AZZA 2QNKA 1ZZCA 4IEVA 4YM0A 4I02A 2BVBA 1COV3 1SLTA 2A70A 4PDWC 5GM0A 3ZDSA 3ZX7A 2YBKA 3ZO0B 2GN7A 4QHOA 2VZVA 4Q1PA 4BHPA 4CP0A 1H8TA 3GJBA 2Q0AA 2VGDA 1OF4A 4RR3A 4UXAA 5DAVA 5CYYA 5GLVA 4LJHA 1JYTA 2Y6KA 1OLME 1QGLA 1ZNPA 3O14A 1VALA 4XF4A 2A6XA 2J1SA 4IEYA 2WDBA 3ME2A 2W68A 5LBBA 3MV11 4QQPA 2X09A 2ARCA 5F3EA 3JCIA 4K8RB 1J1TA 3ACFA 5GKAC 4LUKA 2VMEA 1ULGA 4Q4W1 4OHZA 5SV5A 2ZAAA 1OH4A 1HB4A 1SDDB 4JDOA 3IWZA 3I3EA 5GJ6A 5FJHA 4B29A 1TVGA 1R091 4BYYA 5BNOB 3NWKA 4JHTA 3MF9A 3VDCA 1JUIA 2BW8A 4QPIA 3AZXA 5JIAA 3RMYA 4DRRA 4E9KA 2PELA 3CF6E 5FZLA 4YSFA 4AFDA 3GM8A 1VRBA 5CFCC 1CAUA 3AMHA 1A34A 4AQSA 4DS0A 3T2QA 1VRH1 3WDVA 1BZWA 3FZ3A 4DNYA 2WZ8A 1KXGA 4FPGA 3B9IA 1TNFA 2QBXA 3CNAA 1E57A 1NE4A 4EYUA 1O4TA 3UT0A 4D6RA 4IETA 2MNGA 2PHTA 3IPVB 5F5IA 1MPXA 1MS1A 4E2GA 4XUOA 1DQ2A 3J4UH 5FPXA 1JZ8A 1HDKA 3AM2A 3FC0A 3AJYA 2A6VA 2VZSA 1X8EA 4DZGA 2LALA 2G19A 5IVFA 3D0JA 2VOKA 4WM8C 3CU7A 2A6WA 1X7NA 3H42B 3TNPB 2VNVA 1X33A 3EO6A 3G6JB 3RZKA 2ZMKA 5JXHA 4JHZA 1QJX3 1ST8A 1JZ2A 1NXD1 1U12A 2ETEA 1RUC1 2A6YA 4PDWA 2ZX3A 3VN4A 3AL6A 4HN0A 4QXHA 3HQXA 2D98A 4R8HA 4WM7C 3UNPA 5DDJ1 4CUCA 1MVQA 5EYYA 3M3CA 4IGPA 3BTAA 3JBG1 2ZGRA 3POWA 3VZLA 5K0UB 2WQ4A 3ACLA 3GJAA 2E7AA 3AB0A 5T5JA 3GZEA 4OHYA 5JLVA 1RINA 4FOVA 1JOJA 4AI2A 1W3XA 2PXJA 3TEYA 3GGLA 4Q26A 3HNYM 5EP9A 3U10A 4N90A 4FCAA 1PGW1 2LRPA 4EWEA 2RS33 1KEXA 3M8LA 4EWAA 1W03A 4ZZ8A 2ILMA 5FYCA 2HWF1 1G7YA 1QU0A 2YG0A 4RGKA 1LNSA 3MLLA 3ZFGB 1R1A3 4IEXA 1CZVA 4CU8A 3MHZA 4LITA 4MXWB 4ISQA 1LHUA 2RDRA 4WM7A 1UMHA 4L92A 1X50A 1OH3A 1Y43B 3LIHA 1WD4A 1HRV2 4ORFA 4XQWA 3DECA 4QPGC 1NY72 1YFUA 1YQ6A 3AX4A 1BVVA 2VZPA 3LA2A 1YFXA 2RDNA 5G04L 3N3HA 4UFHA 4AOCA 4AEDC 4F83A 1DFQA 2JX9A 5BNNB 4CEYC 1A8DA 3HNMA 1ODMA 3NNJA 5A6ZA 2CU5A 1RHI3 5J98B 4LHLA 3AMNA 3ZSKA 5FBJA 1DZTA 4TZDA 2WNVC 3E6DA 1XB9A 1U0AA 5FCCA 4IV1C 4RA0A 4XFAA 2BGCA 4YVWB 4QQOA 1ULEA 2D93A 3PUAA 1RHI1 3ZXGA 2GMMA 1UPIA 1EYBA 1DLLA 4F3JA 3ROUA 1RIRA 3FL7A 2J22A 1W6MA 5F7UA 5FYTA 3VBFA 5D21A 4LBOA 1ZM1A 4DINB 4FP2A 2R043 1SPPA 4S2GA 2AENA 4Y5SA 3PMEA 5DUVA 5J1XA 1F35A 1UIKA 2JDPA 3F2ZA 1SLBA 4HBNA 4X6RB 1C28A 5IAVA 4OUEA 1O3SA 1VBD2 1UZZA 2XQRA 4ZU5A 2GN3A 3U14A 3A0KA 1K12A 4JGYA 4OI0A 1LOCA 2EIBA 1XSRA 4MXWA 5J3UA 4QXKA 2GC1A 4XUNA 5H9SA 4MXVA 1FOD2 3U07A 1GLHA 3ZFGA 1XE0A 4UW4A 1XPWA 1VB4A 5DAWA 1X9PA 3LGRA 4Q1RA 1MZFA 3HQUA 4MV2A 3VZMA 4AGGA 1WD3A 4CEWB 2H0VA 5FOJB 1V0AA 4NOTA 1BJQA 1YRZA 3CKHA 3WUDA 4UFJA 5B2GB 2F4LA 3TNQA 1NXMA 2Y6GA 1SG3A 1UZVA 1SLLA 4RSUA 1Q8PA 4OMCA 4HOOA 5K0UA 2BGOA 3LPGA 4NAOA 3Q8FA 1UZ0A 2GSYA 3WQ1A 5C70A 1UYXA 2X29A 1D4M3 3DYOA 3OCPA 3P6BA 5FMDA 4BB3A 3BPSA 4N43C 1RXFA 3SHRA 3V56A 4YM2A 4A44A 3LDKA 3W58A 2BTVC 4O9GA 3OGSA 2RS52 4OVEA 3MI8A 4PLOA 4ATEA 1IS5A 2B45X 2ZGPA 4CA9A 5D1IA 4Y1VA 2YROA 4W65A 1XNTA 4LXLA 4FPHA 2JD9A 2YU2A 1OFNA 2Q1ZB 1VBC3 3J9SA 1H8TC 2RR13 3OG2A 5FZ7A 3VDAA 1RUE2 4CCKA 5IHRA 3H8OA 4AGVA 4IW3A 4JTOA 3POGA 2Z2SB 4XPVA 1Q56A 2GH8A 2B7YA 5FYYA 3PUQA 2AEZA 2MHFA 4NN0A 4Q2FA 5A7NA 3SH5A 1D2QA 4JGZA 1RUC3 1OUXA 4JQRA 4XFIA 2OW4A 1O4ZA 2QCSB 4LO8A 5I0RA 2Q8EA 1QQP3 4AFAA 2TNFA 1EP0A 1WLDA 1R093 4FFHA 1VMJA 3OF1A 3OGGA 1W99A 2WO1A 2WC2A 1QJU1 2WINB 3WX5A 5CFDC 4OQ8A 1HV0A 5J37A 4MUVA 3A0NA 3M3IA 1WW6A 1PGL1 1UN1A 2J7MA 1KDKA 4YFZA 4NIHA 3ACGA 1AR71 1JI6A 1I9RA 1Z7S1 1Y4WA 5CG8A 1OKOA 2BVVA 3KHBA 5F37A 4LLFA 1H1AA 2R1BA 1ZRCA 3SH4A 5CIRA 2VVFA 2JG8A 2Y6LA 4Q0QA 1F9KA 3VBHC 3EHKA 4PF5A 3RFRA 2R0HA 5E89A 4R52A 4MHRA 2WAOA 2D6LX 5LATA 5H9RA 3KQ4B 2CGPA 2RVAA 2Y0IA 5J48A 4ZS2A 3ENRA 3VBFC 1LHWA 2IFRA 1K5MC 4J1XA 5C4WC 2RS12 4TTGA 3KVBA 5IK7A 2OYZA 3LFMA 2VMHA 1O4YA 3HT2A 3QACA 3O0WA 5GLWA 4AAXA 3VDDB 1F2NA 4LK6A 2RDQA 4UWDA 5IVJA 4DEQA 3VZOA 3NJXA 1PZ9A 1V9U1 2BNOA 2CWMA 1ASJ2 2Q4SA 4UF0A 1S2EA 1QJY3 1SBDA 1HKDA 1XJAA 3URFA 3RZGA 2K0GA 4CDWC 5FZ9A 5JSPA 1JZ3A 4RS5B 1HW5A 1QJU2 2JB8A 1GYKA 3LEIA 4QDRA 5GZEA 4DXTA 1H6YA 4YM3A 1UYPA 4Q8LA 1ND3B 2A1XA 1TME2 4DY5A 2MEV3 4HPKA 1UIJA 4A7KA 1CQ9A 2C6SA 3AZYA 1W2UA 2VZ1A 4COYA 2GH2A 1V6MA 3OEAA 1UOFA 4RS5A 4D94A 2NMNA 2D40A 2D97A 3NV3A 1S1AA 1OLRA 1HN1A 1UKRA 1KRIA 4FPYA 3LWCA 2YGMA 5JI9A 4HKLA 3ZDVA 2F17A 1I3HA 2QUOA 1VBA3 4HANA 4YW2A 3VDDA 4XF1A 1RUH1 1WKYA 1TMF1 3RQ0A 5A3WA 4BQYA 3LOIA 2WNUC 5FP7A 1KFXL 3WNOA 5L7OC 1OF3A 4OI1A 4LHSA 1SDWA 1Q3EA 4RS5C 2BERA 4R9AA 4UAPA 3ZN6A 4BQ3A 1L3JA 2YMZA 4LKDA 3W20A 1FYUA 1S55A 2Y34A 3FHAA 4HFSA 2R1DA 4YRDA 5F9TA 4CU9A 5CVRA 3LFIA 1HXS3 1AUYA 2BNMA 1PIV3 2OA2A 3BIWE 3KZ4C 4H3WA 4RYDA 2W47A 4Q4X1 4QX3A 5F39A 3WF3A 5KBFA 3AK0A 3CJIA 5ACA3 1NUKA 3HR9A 1X82A 4X6QB 3GCWA 4MGQA 3NNMA 1ACCA 1BEV3 5FZ4A 3DYPA 3JB4C 4XUTA 2AUYA 2QKDA 4XHBA 4MO3M 3QBQA 5I0TA 3DKQA 2AACA 5CG9A 3TRSB 4AFCA 1RUG2 3H7YA 2VU9A 3TAYA 2WNEA 1SQ4A 1XRUA 4HPKB 3OGRA 4Q4Y3 4WVZA 4D7YA 2QQPA 3H8RA 1ND3A 2AREA 5CU1A 1YNAA 1SFNA 4Q27A 5T5OA 3VB9A 1LHVA 1VRH2 4KBBA 4KU8A 4JGZB 1AYM1 4FQZA 2ZKNA 5FR3A 4N7UA 2K2SA 4GMP3 4HXCA 1SFYA 1XQNA 2PHLA 2RS13 3B93A 1WW7A 1EUUA 2FD8A 2WN2A 1BBT2 1ZRDA 1OD5A 4D6QA 1UKGA 4YVSC 2P5BA 4DY3A 3GHMA 2Q1FA 4Y24A 5CZKA 5FZCA 4LO6B 2ZGNA 5A3MA 4KH9A 5K9YA 1Y9QA 4I0WB 5FPZA 5IT6A 3RMXA 2VMGA 1ZVFA 2VH9A 3S30A 4CCMA 2ZX0A 3WG2A 2PYTA 4FFFA 4AXOA 3SEEA 1XSQA 4MHUA 2LROA 3VKOA 4ARYA 1R1ZA 1W9WA 3MIGA 1X36A 2J1UA 3MYXA 1QOSA 4UBGA 3RVHA 2VUDA 4PCRA 4BLJA 4BK4A 3K4ZA 1PZ8A 3HD8B 2WS92 5E1RA 5APAA 3NV4A 1RL3A 1DQ4A 1WLCA 4QX5A 4QPWA 5FK7A 2P4EA 1J59A 2A3XA 1HRI3 3CQOA 5HI0A 1WBFA 4JVAA 1OPMA 4A6OA 1C57A 1PO13 1WCKA 4P02B 2R0FA 3FLTA 2XVKA 3E5UA 1FOD1 2JKXA 5JR2A 1LULA 2RHPA 2VXRA 3HQRA 4G3YC 3AZVA 1LHNA 2GU9A 2R062 1QY4A 1VBE1 3WVJA 4AVAA 4FBFA 1H2NA 5T3NA 2ET7A 4WVMB 4XXPA 3W21A 4LT5A 1RUOA 5HCFA 4BMEA 2BEOA 2V4VA 1O3QA 2D6KA 3N9LA 3UGGA 4AI1A 1JHJA 4MX3A 3B7MA 4UFIA 4BQ2A 4NJ4A 5JXJA 3C7OA 3T0AA 3GALA 1PK6C 1M4WA 3WF1A 3VBOB 2VQ0A 5BNNC 1WCDJ 2WBKA 1KS5A 4CP9B 3M3OA 5DDJ3 1QNYA 1XYPA 4YZ5A 2VUJA 3ELNA 4H2AA 1XC6A 5GZFA 2RJ2A 5CADA 4JTNA 3ON7A 4FPEA 4CZSA 2H6CA 2ZEWA 4QKDA 4NHMA 1R1A2 1HX6A 1GQHA 1MACA 3P3PA 3NL1A 4V1PA 5A70A 3H8XA 2VBPA 5DPNA 1DDLA 1PMIA 3HBKA 4LLOA 4FOYA 4YVWA 1LOGA 1BEV2 3IDCB 2JKBA 2CGNA 4BCUA 3ECQA 1QXRA 4GAZA 1Q8OA 1CAXB 3AMMA 3V0BA 5ABJC 1O3TA 5KXBA 3O1PA 2PLV1 1O5LA 3EJKA 4C91A 1AR83 2BNNA 4FSJA 2WZR3 2DVDA 1PK6B 1KJLA 2WJSA 3PL0A 1DGWX 4QX8A 3ATGA 1DZQA 5DZFA 1I5ZA 4Z8BA 3IPVA 4CDUB 4QKBA 2XDVA 2V5YA 4M0HA 1LGCA 4FXKB 4CDXC 1W6NA 2GC2A 3ZXFA 4WM7B 2E7QA 4J6GA 4WBBA 3JXSA 4L8QA 3NV1A 3TBDA 4AHWA 5KXEA 4P9YA 1XNDA 2IXHA 3LA3A 3VKNA 4AG4A 1HQWA 4LOTA 4NIIA 4A4AA 3SMHA 5C8CA 5F3CA 5I0UA 1Z78A 1COV2 5FQ0B 1W05A 5FV3A 1JUHA 2WNVA 3VBFB 4YFWA 1CIYA 4XJAA 3VKLA 3M7AA 2YXSA 3RZLA 4F8AA 1MEC1 2KXLA 4Z82A 5C6CA 4FTSA 2O8QA 5ERLA 3AJZA 4NE9A 1FATA 5CBLA 3AYEA 3OOXA 5T54A 2NN8A 4LKEA 4GJYA 1OURA 3CIHA 4PIYA 1DCSA 4XAEA 3I8TA 3PJYA 2J1RA 5L73A 1C4RA 2ZAHA 5JI7A 2JEMA 1DLCA 4Y33A 3N9NA 5FYHA 2VTXA 1FPN2 3ZR6A 4CTEA 4ET7A 3VD4A 4S2DA 1XE8A 4BIFA 2IVJA 5FP3A 4JDNA 3LF7A 2O8OA 3K4DA 1LEDA 4QX2A 1Y9GA 4HONA 2FCVA 4LBNA 1QJZA 5C71A 4QGLA 3H0OA 5JXGA 1ULOA 2OUHA 3MLKA 1XNKA 1REDA 1NA1C 5FREA 1D0GA 1B35A 1NCRA 2E9QA 1NLQA 3ASIA 3F95A 4YPJA 3S7EA 4AEJA 1U5ZA 3NJYA 2YHJA 1YFWA 3ABZA 1CD3G 3KB5A 4L9BA 1UY0A 2V73A 1XOYA 3D6EA 4Y5TA 3WDYA 4FPKA 3A21A 3ACHA 4CUBA 4LMFA 3IN9A 2RMU1 1IQAA 4LBKA 4QDSA 1DQ0A 5F5AA 3VL9A 2IXJA 4MSVA 3ZLIA 5A1AA 4M0NA 3C2UA 5FO7B 4CE8A 3RNSA 1OXCA 2YYOA 3VBRC 3JQXA 1SCRA 3R05A 4QGMA 3FLPA 2JIGA 1PHMA 2BWCA 2DCKA 2RM23 3AYCA 3JBG2 4I3GA 5A6YA 3WG3A 2ZA9A 3IAPA 5BNOC 3C7GA 2DBIA 1J1LA 2HWD1 3KT1A 4Q4V2 1HB3A 4MGYE 1GOFA 3GHNA 4A7YA 1ND2A 1VPHA 1XE7A 4QPIC 3ES1A 3CMGA 3VD3A 2NYYA 3N7LA 1MS8A 4D3WA 3T08A 1ZRIA 1RUI3 4I09A 4CEYB 5LBEA 2XQXA 3HWJA 3WQ7A 1EAH3 5A1LA 2W39A 4K7JA 1DIWA 3POSA 1ENRA 1FMD1 2VR4A 5EXOA 1ZBE1 4YZ3A 1WLWA 5H9PA 2KR2A 3M3EA 1W6OA 3HN1A 1ENQA 4L97A 3RI9A 3ZYBA 1EAH1 3AKRA 3MW2A 1DGRN 1Z7S3 3B02A 1S0FA 2DUOA 2QDRA 3NO8A 4P9WA 3NKTA 3A22A 4MVTA 2DF7A 3WHUA 3ZFFA 4B7KA 5LEKA 1C5IA 5K0UC 1PO21 3THPA 1W9YA 1ASJ1 4ZY9A 1W06A 2OKXA 2PA7A 3ZYGA 1OLQA 2JDHA 2V4AA 1H30A 3USSA 2FDIA 4P9GA 3UKNA 4V2VA 4XUQA 3W9AA 2A73B 1UOBA 2R072 3CL1A 4XBQA 4XUPA 3I3MA 4KBZA 1TZOA 2ERFA 1HB2A 1W0PA 1S2BA 3Q8EA 4QB1A 3UETA 3WG4A 4PT6A 3EMRA 4XFFA 3W5MA 1KFUL 3WD5A 3JD72 1ASJ3 4V2WA 2PAMA 1QIQA 2AH2A 1Y3TA 4HVOA 3BU0A 3ZXJA 4H14A 4E4SA 2FDHA 5BV6A 4Y20A 1G9CA 1RHI2 2ZHNA 3VKMA 2WQZC 4YGDA 5BNOA 4NWVA 5FY9A 2RS11 3T3YA 2DCJA 3BALA 2DVGA 5KXCA 1O91A 1SLCA 2YBSA 4A3XA 5JPNB 3KQRA 1DYKA 5BNPC 2RMU2 3ITQA 4NUBA 2OX0A 3MEPA 4Y26A 4OI2A 1PGSA 3TEXA 3ZFFC 2YFUA 1HQNA 3KSCA 4E4ZA 2DDUA 4IGQA 2UWBA 2A7AA 4Y4YA 2W0XA 1NT0A 2ORXA 4M3CB 1S4CA 4W4ZA 1H2KA 2ZGSA 2D3PA 3IDEA 4P9JA 5F6KA 2F4PA 2Y0OA 5IVCA 5G05L 5EJZB 2VZUA 4XW3A 3ZYPA 2XVGA 1AF9A 4EV0A 4PQQA 3AKTA 5C9AC 4B4QA 1UOGA 4Y22B 4XF3A 2A5ZA 4BQ5A 1W0OA 3UYJA 4BXFA 3I3QA 4HSLA 4ES8A 4CDWA 1W8WA 1GOHA 1PO12 4NR1A 4CCNA 5FLIA 3M2MA 3T2PA 1ND2C 1W8UA 1SBEA 1MVEA 4P9XA 1O6UA 1MQTA 3VGIA 5C9AB 3OYWB 2WWJA 3JD71 5A3UA 4BQ1A 1NE6A 4R4XA 3T2OA 4O7XA 3V0AB 3CLPA 2WZR1 3KF5A 1GP6A 3OEBA 1IOAA 1ULDA 4XTMA 3K4AA 2Q8CA 3ZSJA 4ZU4A 1L7QA 5ACA2 4UT5A 1RJ7A 2JDNA 1C1LA 1EPZA 5CKNA 4K9SA 1WWYA 2RV9A 3PVNA 4HZFA 4BISA 1QH6A 2W2IA 4HN1A 5KHGA 4IV1A 1WA6X 2BPA2 4N9HA 5IATA 2WFPA 4FOQA 4IV3C 3I2OA 2QJVA 2R16A 3HN3A 4YW1A 4QT6A 1MQTC 1MS0A 3IB3A 3JU9A 4QX1A 5DDJ2 1QF3A 1O5UA 4N7IA 4Z07A 4H55A 4OHXA 3IDAA 5JZGB 1ALYA 1C8M3 2CDOA 4XIOA 4EWDA 3QOPA 5DG1A 2WL1A 3RS6A 3VZNA 2W52A 1BCXA 2W3JA 5A80A 4LKSA 2BUKA 2Z42A 3M4FA 3H3UA 3RJ2X 4FT8A 4Q0SA 2DUQA 1UXXX 1UAIA 2NPIA 2XLFA 4D7TA 2EIGA 3CJXA 4XFBA 2FDKA 3AC0A 1EV13 2UYBA 4XJ9A 4FP3A 4Q4X3 1LODA 1WBLA 1RUH3 1IPKA 3EBRA 3LEMA 4FFIA 4HL0A 3ZSEA 1R081 1W0NA 4NIAA 3LE0A 3T30A 4AQTA 3FE5A 1CZTA 2OPWA 3ILNA 2WQ8A 4JX0A 5A6QA 1LB2A 2FMDA 4PF1A 1B09A 3N7KA 4Q0UA 2DU0A 2YB7A 4CEWC 5A7WB 2GNMA 3GBGA 3KS7A 4MOAA 3NRUA 5A32A 1H1IA 3OYWA 3TN91 1SLIA 4AK3A 4XAAA 4XYXA 5C9AA 3D0SA 1L7RA 3SLIA 3POYA 1JYNA 4YZ4A 1G9FA 4CDXA 4NVPA 2EXIA 1OT5A 4KL1A 2PHXA 3VBUA 1FAYA 2DU1A 5JVVA 4A3ZA 5A32B 5LA2A 1F5JA 3AZZA 1AL22 1T6BX 3SCHA 4C0HA 2Y38A 1ULCA 3C7FA 1H9WA 3T4VA 2QQWA 3LDBA 1H2MA 2ADDA 2DVAA 2QQNA 3UL2A 2WT1A 3RG0A 1OPOA 5GLZA 2GC0A 2JJ6A 4N53B 5FXVA 1LU2A 2HWE2 4OHVA 4W6WA 4XCAA 5A7QA 4R9BA 3ZYRA 1UO9A 2OS2A 4Q29A 1P8JA 1UL9A 4RHV3 1FPN1 1W3VA 4OULA 4ASLA 5LA1A 1XNAA 2FQPA 3WNXA 4IQPA 1NQDA 4Y5Z0 5FFOC 2DCYA 1H0BA 1LKNA 1KD7A 2EF6A 5FZHA 3RJRA 4C1XA 3CO2A 3N9PA 4MZUA 5AFEA 3WDUA 1I6XA 2ZMLA 2CGOA 3DGTA 4PJYA 4IXLA 4CCOA 2CAUA 4PLNA 3E6BA 3WDWA 3BODA 2ZGLA 5KHIA 1QJEA 1GZWB 2BFUS 2VBDA 4HETA 5KC5A 2OQ6A 1S0IA 4DEVA 3ZMNA 1RITA 5FAXA 1IKQA 1IS3A 4BQ4A 3IT8A 4BM8A 3NJVA 3H8UA 4CP2A 5FPAA 1UX6A 1DG6A 4ZU7A 1UX7A 5HXMA 5E8AA 4CPBA 2C26A 5IAXA 1PVC2 3FX3A 3IIIA 4QXCA 1FX5A 5FWEA 2E33A 2Y33A 4M3CE 4RR3C 1YIFA 5EWSA 5GLUA 4DO0A 5AC93 3P1IA 4K3UA 2BWAA 3V0AA 3KCYA 3VBRA 4I2OA 2IXIA 2JG9B 1NQJA 1YCIA 1TEIA 1C8M2 2BV4A 3LIGA 3OUHA 5LEJA 2VZQA 2HWE1 4YWAA 2XJRA 3ZXDA 3TWIA 4TLFA 4ZS3A 1NG0A 2Q5TA 5CFDA 3WDTA 4D6SA 5AC91 1RB8G 5DAXA 1VBE3 2E7TA 1VBD3 3KGZA 1RUJ1 5HBAA 4QHZA 2RS31 2A3WA 4HK8A 2XJQA 3T1LA 5K4LA 1AR81 2ZGMA 3WLUA 4LUMA 4BIOA 3LKJA 5F32A 3U4XA 3D82A 4CEYA 2GDFA 3RGBA 1G9AA 4QKFA 2WFF3 2EICA 1GICA 1LEMA 2VY0A 3CBNA 5D8AC 1KGYA 4IDZA 1SEFA 5EFUA 3L2YA 3QH6A 3ZMOA 4ZXKA 1QOOA 4M3CA 3MIHA 1OQDA 1QJX1 4AVBA 5FYIA 5DN2A 1JZ6A 3DPRA 1W9FA 3PIGA 1JU4A 2WABA 3EQEA 3UGHA 5L9VA 2X5IA 4OMDA 4N43A 1JOPA 3VLBB 5EYXA 2ZPXA 5F2WA 5FDBA 2ZX1A 3VHPA 2UWCA 4IGOA 3NAPA 4CXWA 4L11A 2RDSA 2JDKA 2XVLA 4GXLA 3UESA 1VR3A 4H7MA 4Q4Y2 4TN7A 3VZKA 2WNVB 4XCBA 1ZA7A 4K40A 4X8PA 4LO5B 1QQP1 1D4M2 2JB4A 3KVAA 2E53A 4CXXA 5FPVA 1VRH3 1H4GA 1IQDC 5C8CB 1CX4A 3PMSA 1DBNA 2AC1A 1EY2A 2XKPA 2XJPA 4X8NA 4LR4A 1HB1A 1ZBA3 1C8NA 2A75A 4EN9B 3TYJA 1UMZA 3R0RA 3K51A 3LEKA 1IG0A 1NLRA 3QLQA 5L7OB 2C0ZA 2C1FA 4P5YA 3E6CC 5DZEA 5FZOB 5FZMA 4QKNA 2CSGA 4CU7A 3K2OA 3DPRB 4XMAA 3VBOC 1MZ6A 2NQYA 4D7SA 5JOWA 4L0PA 3RPQA 5DXDA 4XFGA 3ZIXA 3VDBA 2IXCA 4P9IA 3WW2A 1ENSA 5C33A 3MGUA 1LGBA 4KQ7A 3U11A 2G4IA 1UY4A 3KM5A 1VB2A 4I0AA 3E5XA 4AQ2A 2DYCA 1I1EA 5JMOA 3AXDA 3N7JA 5JAXA 1HRI2 3D3AA 1YHFA 1SCSA 3EB7A 1GBGA 1KQRA 3H3ZA 1K5MA 2JDMA 4UOJA 3AVSA 3K3OA 5IVBA 4FTBA 3I49A 3B9CA 2VNGA 1BLZA 4LA2A 3AP7A 4QM9A 4A42A 4E4DX 2XBO3 1DQ1A 4FAGA 4IEZA 1W2OA 1AR92 3N35A 1POV1 5F3IA 3TB0A 4BJ0A 3T09A 5FRAA 3AKQA 1JZ4A 4AHZA 2XLGA 2J1TA 1DZRA 3O5SA 4Q0VA 4A45A 5ACA1 1Q8VA 3WY6A 3FBYA 2ZGTA 4FFGA 3POEA 5BY5A 3B5LB 4PLMA 5HPOA 1JXNA 1AHSA 1QH7A 3FLRA 4K1YA 2CAVA 4Q4Y1 4ATFA 3V64A 2GNBA 5C4WB 1RUD2 1W6QB 1XBFA 4TXWA 2JE9A 4LBLA 4UFLA 4CCJA 3AP4A 2X5IC 2JG9C 4Z92B 1PK6A 4B4RA 1DYPA 2WN3A 2JXAA 3ZYIB 3ZXAC 4NRMA 3NSTA 2PLV2 4KWJA 4GWNA 4Q4W2 4MGSA 2EIDA 5LBCA 2MEV2 4AEKA 5IYYA 4C1WA 3DYMA 3M3QA 4HLTA 3MIFA 2WSVA 1U5IA 2VZTA 2JECA 3AYDA 4GB31 3WCRA 5C8WA 5T52A 2VCCA 3H7JA 2B9UA 3B00A 4E8DA 2Q8DA 1FT9A 4K21A 1GWMA 3THDA 3VBHA 1CZSA 3VBSA 1SHWB 2Z5WA 5JSRA 4ZHNA 4EZHA 2VD7A 4QX0A 2YC2A 3WW1A 1W8TA 1QKQA 3S5AA 1H4HA 3MIEA 1VBA2 1RUG1 2DCZA 5FUNA 1A8MA 5GZDA 1JBCA 3I2HA 1V6JA 4FVVA 5M0TA 4B1MA 3HPNA 3OB8A 4NPMA 4CP9A 3WXPA 4TWTA 4AFMA 4NHXA 4KMQA 3NW4A 3KLSA 3VBUB 3T0BA 3HT1A 3BTYA 1PGL2 5F1RA 3FMGA 3FWEA 4RQPC 4XQ4A 1AR72 3WNLA 4U36A 2RR11 2X8KA 1JYWA 2IVIB 3QH7A 1LOBA 1COV1 1O59A 1RJ8A 2P34A 4UW3A 3U78A 1K5JA 4IE6A 2PHWA 1JOBA 5HCHA 1CAWA 3ZFGC 5A6XA 2QQUA 1NA1B 4D8MA 2BYVE 3JZVA 3G7DA 5BYNA 4AQ6A 1VMHA 1RUG3 3ZXLA 4PI2A 1FNYA 3JB8A 5ISLA 1W28A 1E5SA 1AL23 1D4VB 2DV9A 5A3PA 3OBRA 5T5PA 1J84A 1TQ5A 4HVQA 3IIAA 2D5FA 2GALA 4YYOA 4FQ4A 1IG3A 3WF4A 1KJRA 4QQLA 3ZN6B 1RGSA 4WZCA 5KHHA 3RSJA 4DFSA 1DYOA 2HWE3 1FPN3 2R32A 2XWJB 1CAXA 3V0BB 2W95A 4LA3A 2I74A 4RHV2 2TUNA 4ZPIA 2LW8A 4IE4A 5CISA 2RJKA 4G9SB 4D0QA 2W5FA 5ANQA 3WP5A 3PTYA 4I30A 1OOPA 1FOD3 2VVDA 4QWNA 4AR2A 4LEJA 3LAGA 4PHZA 4NHYA 5JPMB 4Q5OA 3PU3A 1AJKA 4IEWA 5C3QA 3MZHA 1YYNA 4BK5A 1K45A 2D6OX 4YARA 2VMDA 3INAA 2I07B 2KM2A 3PUIA 1AR61 3AYAA 2HWC2 3DEMA 1MQTB 5FUPA 4COZA 1ENXA 1OA2A 1REEA 3I3DA 1D7PM 2P3IA 3LCPA 4KG8A 3V65A 4GKYA 1HJGA 2WZPP 1DGWA 1H6XA 3S0MA 1NOVA 1PIV1 3AKSA 3K48A 3EYPA 5KC6A 4BPZA 5KWRA 3KHCA 5C7GA 3DN7A 2ID4A 5I93A 2OVUA 1OMIA 3H9AA 4COVA 4CRQA 1RVF3 3CJIB 1H2LA 4LHNA 1VBB3 4UF0B 3BB6A 2PFWA 3SCGA 4ASKA 4CDQA 3AP5A 5B4NA 4F7ZA 3ILRA 4Q0PA 3ZR5A 2W91A 2DVBA 2OIIA 1G8WA 2YBPA 4B3NA 4XILA 5J7MA 3DKWA 3KT7A 3O1OA 1RUE3 2ZMNA 1UD1A 3FUOA 4LBQA 5IVYA 4AHYA 3K46A 4JRLA 3IAQA 3PVBB 4L99A 1R082 3B01A 4XACA 1W90A 2VE1A 4LK7A 4YG6A 4B7EA 1Q5OA 3I2IA 2B5HA 3BN6A 2XOMA 4IV3A 3MFAA 3SEPA 3APBA 1BVP1 1YXWA 1LTEA 2P3KA 2C24A 1RMU1 2QQKA 4RD7A 5FY8A 3VHRA 4AE2A 5CEHA 5FO9B 2QFEA 1NYWA 4Q8KA 1OLMA 1R1A1 2GAUA 2R071 2XB6C 3RZHA 2JG8B 4CUGA 3O1TA 4CYDA 4Z2AA 1GNHA 1AX2A 2HWC1 3I59A 5FYBA 4XE9A 1LESA 1JN2P 1UZYA 4RN5A 1HXS1 2VAUA 2VOXA 1W9TA 2EAKA 3T2TA 2ARAA 3VD9A 1UCXA 3MDPA 3LSEA 1LJ7A 1WUVA 4NAMA 5FPBA 5CA6A 2C4XA 3E5QA 3OD0A 2PHUA 2Y6FA 2HWF3 4K20A 1AYN2 4UW6A 2RS32 1LCLA 2VECA 2AZ5A 2ZEXA 1CIWA 2R063 2XL7A 2YPDA 1J58A 1NAEA 3IMMA 4DB5A 5A33B 1AXKA 2WLPA 1CJPA 3L2HA 4P5HA 3HMYA 1GNYA 4KU7A 3WF2A 1US2A 4QPGA 2EXHA 1AR62 3SNMA 2Z79A 2RMU3 4NPRA 1UOJA 4GKXA 4IEOA 4RGGA 4XC9A 4AL9A 3I7DA 4NHLA 1ZZ7A 4MYEA 1YC61 3OPWA 3ETPA 3TN93 4LNVA 1N1SA 1AX1A 4BOWA 2QQVA 1D0HA 1UMIA 1OOPC 1REFA 3ZKYA 3BU7A 1RMU2 1JU3A 1WMDA 5FYUA 5EIYB 4IV3B 4KGGA 3ZN5A 2YUEA 2FZ1A 3BVCA 5IVVA 2VZOA 2D3RA 1ONAA 2B8MA 2D6NA 2OZJA 3SC7X 5K7PA 2B39A 3SH3A 1JZ7A 2R061 2R49A 1BYHA 1OFSA 1YJLA 1T6GC 2C5DA 1OA3A 1S0DA 2EXKA 2VG9A 2VC9A 1TME3 3NNGA 3PHMA 2QVSB 4FPJA 4JCKA 2VTXJ 4D69A 3W5NA 3RWNA 1VAVA 2P6HA 2ZGKA 4H7LA 2HJIA 3O1MA 3CHXA 5IVEA 1JYCA 5SV8A 4OZOA 1RUC2 2P37A 2WLQA 5JCTA 4YW3A 3M1HA 1IPSA 1SACA 2O1QA 2WIIB 2YC0A 5LA9A 4B4PA 4ITCA 5C8CC 3A7QA 2JIJA 1BK1A 3OGJA 4W8JA 1W6PB 5ABJB 2WZR2 3GBWA 1MZEA 1MS4A 1J83A 3T4HB 4XF9A 3MUY1 1HRV1 2PN5A 5GZCA 1GP4A 1B35B 1NCRB 1QHDA 5E6HA 1X9TA 5FMBA 3Q8BA 4ZONA 1IS6A 2BOJA 5L36A 4INDA 1VBC1 1BKZA 4JGYB 5F5QA 5AVAA 1Y9MA 5FZ0A 3VBSC 4K6BA 2HLEA 1CPMA 1OSGA 5DUWA 1JS9A 4RGAA 1B35C 1NCRC 1RYYA 1UY2A 4P00B 3AL5A 1SPPB 5FMOS 1UNBA 1YFYA 5TSWA 4BXSV 1W39A 4SLIA 4PI0A 4BA6A 4BDVB 1VBD1 3CZUA 1J3PA 3KGLA 2IFWA 3PIJA 2JE7A 2D7FA 1GQGA 2BFUL 1GWLA 2EAAA 2QE3A 3GZTB 3GZAA 5EJ1B 5FXWA 3QD6A 2DURA 1WW5A 4LULA 3VHOA 1BHGA 2WFF1 4O61A 2FBEA 1GZCA 3LD8A 1GUIA 5IFTA 2ZEZA 1SFPA 4KGQA 1ZRFA 3DXTA 4XDOA 4BQXA 5JIUA 3WUCA 2WNUB 4COWA 1RUH2 1ULFA 1TMF2 1G9BA 5K8SA 1GQPA 5FYZA 4CP1A 2JDUA 4GH4B 1ODNA 5KXDA 1AYN3 2FMYA 1CESA 4LIVA 2G9FA 1GSLA 4IUGA 5FZ3A 2VOTA 1MEC3 3ZFEC 1HRI1 4ASMB 2ZGOA 3KV6A 1WCSA 2ET1A 2GP3A 5FP9A 1DHKB 4DOUA 3OSDA 5LRRA 1CAVA 4UFMA 1OI6A 4URAA 5D2AA 4YGEA 3FHQA 3KT4A 4QB6A 1VBC2 4M01A 5HCAA 3N7MA 3U0ZA 3ZVXA 3B94A 2VJXA 1OKQA 4XTPA 1NA1A 1RUF3 3I4IA 4JDMA 1AJOA 1CAWB 3CZJA 2ZTNA 1E5RA 4IE7A 4LE3A 3S5QA 1BMV1 1CAVB 5FZGA 3UGFA 1RMU3 2X05A 2VMCA 4HVRA 3VZJA 4N9IA 3O1UA 2BGPA 4AHXA 4AI8A 4TLGA 4OLLA 4KWLA 4R9DA 5LB6A 1UZWA 3BIEA 4FPOB 4YM1A 2PQSA 3OBZA 2AR6A 5FIXA 2ZZJA 2HBUA 2Y6JA 3MFCA 3VDDC 2VW2A 3RZJA 1N1YA 2IZWA 4HSJA 4IESA 2K46A 4XZUG 1A3KA 5LBFA 3SKVA 3N9MA 1JYXA 3PTRB 3IBMA 1CONA 2BBAA 1Q8SA 1YQ8A 1U5YA 4XJWA 2NP0A 3VBSB 4M4RA 5T5LA 1X8MA 2VQAA 5FZBA 4PIZA 4DXSA 1CWPA 1J3RA 5CFCB 2D43A 2QQJA 1G86A 1VLNA 2OPKA 1JHNA 4BQWA 1Y7BA 4MG2A 5B4XA 4HG6B 4MGZE 2PLV3 5DABA 4DUXA 4S2FA 1PMJX 5FZIA 5FZEA 3I3BA 2XUEA 4OUMA 4EQVA 3GDBA 4DXZA 4EN0A 3WP6A 1IKPA 4E2QA 2VNRA 5JWPA 2F6BA 4CCEA 1AYM2 3VBOA 3RDIA 1F4AA 1RTVA 2BJSA 2D5HA 2HWD3 4FPLA 5FP4A 2Q30A 4CEWA 4GWMA 3NMBA 3RYPA 1STMA 1TNRA 1WGPA 1RUJ2 1UW8A 2Y60A 3WNKA 1WMFA 1F4HA 3HOBA 1QJY2 4Y1UA 5LWBA 4OYUA 3GCXA 1RUI1 4LTAA 1N3OA 3LZZA 4PBPA 5CNAA 1W6PA 5EQUA 5ABJA 5J96B 5JOZA 1XYNA 1G6NA 2WA4A 1D2SA 5I0DA 1VBE2 1FMD3 4PBOA 3RYRA 3KWVA 2RR12 3UJOA 3CDZB 1KITA 3H50A 1ZA4A 5DMYA 5FZ8A 2DTYA 5CAZA 4YGCA 1EPWA 2AGSA 4XABA 4C90A 2WKKA 1RVF1 2WS91 4XJ8A 2UYAA 1US3A 5FP8A 2SBAA 1CPNA 2XMLA 2OT7A 3B3QE 5FY1A 4FTEA 4JKLA 1R092 3RRDA 2ADEA 1VBA1 3Q8AA 2WO2A 2I2SA 4GH4A 3PNAA 5CFCA 1HIXA 1RXGA 4CCLA 2WRAA 5IUQA 2RM21 2WNUA 2WS93 1XU2A 2YZ4A 3ALQA 1M06G 4AVCA 2P3JA 2VQTA 3J8F1 1EV11 3KMHA 3LPFA 1MZ5A 4WVVA 2W46A 1YQ5A 1R083 3OPTA 5F5CA 5FKBA 3QCWA 3C8XA 1LRHA 2EALA 2OQ7A 4JKMA 5BNNA 3GYDA 3WR0A 4OFGA 1DGRA 1PIV2 3NNFA 1OVSA 4JGZC 5CB7A 4LQRA 3ES4A 3VUOA 5LZ6A 1IPJA 1ULPA 3TEWA 1AL21 2VULA 1VP6A 3I2KA 3Q8CA 2XL9A 2CDPA 4JQTA 2BRTA 2OZ6A 2EA7A 1L7LA 3O0XA 3OUJA 3R4SA 4Q4X2 4AI0A 1W8ZA 4QU2A 5KR7A 2O0OA 3R6SA 3ZSMA 3J8F3 4GULA 2HWF2 4M4PA 2W1WA 5FMOL 5I8SA 4Z2WA 4MGKE 2VMIA 5FK8A 1FXZA 1OVPA 2DUPA 1SZBA 5FKCA 3O1SA 3FBMA 3K75B 3MO4A 2HKXA 3A23A 4L2NA 3S57A 1GNZA 4TSVA 2FDJA 5JMCA 2CV6A 2W08A 4C8DA 2XJSA 1GZ9A 2W92A 4QAWA 1OUSA 1F15A 1YEWA 1YLLA 2NLRA 4LBQB 3FFZA 3IMNA 3FFQA 4ES9A 1PNFA 4W6YA 4EN8B 2HEYF 3ZYHA 4QXBA 1XNCA 3KF3A 2D44A 5HCBA 1RVF2 5DQ0A 2HEVF 2WYSA 3PUSA 5IJRA 3KD4A 4PDWB 2FCUA 1MR5A 4OZXA 5AVPA 5A7PA 4AVVA 5L9RA 2P3YA 4QMAA 2YY1A 3MW3A 1PVC1 1W8NA 3TOJA 2R7EB 1QWRA 3DXUA 2B42B 1LOFC 1S0JA 3MIDA 5JZGC 2XPJA 3LOBA 1QJY1 4XBNA 4QPGB 2XONA 5C5UA 2R6QA 1NX9A 3JUUA 3MW4A 3ST7A 4YG3A 3HEIA 1GFF2 5IWFA 3OBTA 2G1MA 3I54A 2PTMA 5GZGA 4GH4C 1PVXA 3IZOA 5FZAA 5A33A 1JODA 1JTZX 1YUDA 4YW4A 1ZZBA 1HXS2 3H1YA 4B8EA 5JDBA 3NVCA 2JDYA 1RUE1 3THTA 2J42A 3X29B 3D4KA 3UKVA 4CDUC 1YQCA 1HN0A 1S0GA 2VCBA 3PJQA 5FYVA 3LB9A 3WINE 1VMFA 1PM4A 2PAEA 4IL7A 3WQ0A 2XXZA 5F2SA 1CAUB 1ZBA1 2VW0A 4NRQA 4G4FA 3U37A 2H0BA 4JGYC 1VBB1 2FHRA 1HV1A 1PVC3 4JAAA 2CY6A 5EHDA 3DF0A 1AXYA 1SBFA 1QXPA 3BPZA 4META 3BOWA 4QPIB 5KHKA 3I2FA 2YFZA 2ZX2A 4HMZA 4N8MA 1GZWA 2XLAA 4XDQA 2ATFA 2E63A 2QZ3A 1FV3A 3OD4A 3MBWA 2IC1A 2LS6A 4AI3A 2R042 5H9QA 1WW4A 1DGLA 5FZ6A 1FI2A 4QB2A 3H1WA 2WNOA 5DUXA 1AX0A 1LU1A 2K9ZA 2TBVA 1H1MA 2Y8KA 2ZHLA 3CJIC 3KV9A 2XHKA 3LDRA 3SITA 4XBLA 2HYXA 1NZCA 3USUB 4E2SA 2ZCWA 4J25A 3TEZA 3AP6A 4KNCA 4RR3B 5FYMA 2R073 4HKWA 2W9XA 4XF0A 1JYVA 4XDPA 1GP5A 2ZHKA 4CDQB 2JDAA 1BEV1 4OUSA 1H8VA 2V09A 4XIKA 4A6SA 3OTFA 2ZZQA 1VE0A 4KG0A 1PMHX 1POV0 2R30A 5EJ3A 1QXJA 5JUVA 5FY7A 2DVFA 1ZBE2 2L9LA 2JDZA 2UY9A 2VM9A 4EE2A 3OGVA 4KWKA 2JICA 1PNGA 3WCSA 4BLIA 2G9GA 2ZS6B 4XOGA 5D8AB 3S7IA 3FUQA 4NRPA 1V9U2 3UV9A 3WDXA 3WSOA 4AGRA 4CDXB 1UY1A 4MH0E 2XKOA 1LOAA 5FWJA 2BBVA 4ONUA 1SLAA 4LE4A 4LBMA 1OQ1A 2XJVA 2WSUA 5GLTA 5A7WA 2XWBB 4ZKTB 4WZFA 5I8TA 3I59B 2A71A 4AF9A 2CL2A 2X53S 3E97A 2RE9A 4YG0A 2GNDA 5A3NA 3MV01 4NPLA 5F8PA 1N1VA 2R041 3NNLA 4CCDA 2DBNA 4OCTA 4P14A 2A3YA 1ZZ9A 4YZ1A 2BQPA 2ZGUA 3IDBB 4BWOA 4NO4A 4JRAA 3I97A 1AL0G 4WM8A 5FY4A 1EAH2 1F5FA 4DIQA 4DPNA 1HLCA 2H6BA 1SMVA 1O8SA 3K3NA 3NV2A 4GJZA 1UPSA 1JW6A 4RQPB 4C0BA 3ZPYA 2WYFA 2WFF2 1IHMA 5J09A 5J36A 4COUA 1JMUB 1S0CA 2PAKA 4Z1VA 3ZFEB 1E5HA 3DPRC 4YVSB 3WHTA 1QQP2 2XH6A 1AZDA 1VIWB 3ORJA 5A7OA 4IE0A 1W6QA 2WT0A 4GMP0 5C4WA 2VOWA 2XR4A 2HBTA 1IZ3A 3FN9A 4IERA 4UYBA 5C5TA 3PLQA 1K42A 5DUUA 1UXZA 5DG2A 1T2XA 2WR9A 3D5OA 2TEPA 1MS5A 1W8HA 2QQIA 4OQ9A 2XG3A 1TMF3 3AFKA 3VBUC 2MPFA 4GWIA 2VBBA 5FTTC 1ZRRA 2W87A 4AEDB 5BNPA 1LR5A 4XJUA 1AVBA 1CR7A 2XBO2 1MEC2 1UF2C 2CHHA 3O12A 1LECA 1TG7A 3C7HA 2NZ9A 2WUHA 4FOWA 1S0BA 3ZSLA 2HWB2 5LCWL 3MPBA 1W6MB 1CGPA 3WF0A 3U1XA 1HQLA 4IE5A 5FXZA 3U4SA 1OQEA 5E88A 2WAAA 3HAGA 1Z0HA 1OOPB 2DCTA 4BH9A 2ENRA 5C3PA 1NZIA 4A41A 1HRV3 1EV12 5BNQA 4FO9A 3VHNA 1RUNA 2XJUA 3OBAA 3N36A 1YI9A 3A4UA 2D3SA 1RUD3 3VBHB 5EV7A 3U75A 4JZRA 4AEMA 4CSWA 3OY8A 3AFGA 4HKOA 2WO3A 1BBT1 5GALA 1NY71 2G9ZA 4Q4V3 1QJU3 4XFHA 4KWUA 1NCQA 2B46X 5I8YA 1QNWA 3B69A 4Q4W3 5FO8B 1W8FA 4QM8A 5T50A 1GKBA 1OHFA 1DP0A 5LRSA 2ZHMA 1N3QA 1RUI2 3ETQA 3BCWA 4RL7A 3C3VA 5L7OA 4Q4V1 1GANA 1QDCA 2BZDA 4AVSA 4DUWA 1GR3A 5FUIA 5IFPA 2Y64A 3ZOIA 4BU2A 1V00A 4XFCA 4GQ7A 5BUVA 2EXJA 2UU8A 4XURA 2D6PA 2J1VA 3LEGA 3ZN4A 3LA7A 1YQ2A 1DU3D 1YIPA 2CWSA 1PO23 1KS4A 3H1MA 4A2UA 2BOIA 1AR63 4CUAA 2Q1MA 1DQ5A 1W2AX 1HJFA 1OBNA 3H3LA 4LBQD 5JR7B 3LQCA 1BBT3 2ZGQA 2NM1A 4QQHA 3DL3A 3SQOA 3ZIWA 3HBZA 1LOEA 3MPPG 4IEQA 4IEUA 2XHNA 4LHKA 2P6CA 2VTFA 4E27A 3WW3A 3ZFFB 4BE3A 5FZDA 3TN92 2ZXQA 2GMPA 4DUVA 3CEWA 4FPFA 4Y1ZA 5JOXA 3POIA 5FOBB 3J8F2 1IGOA 1RUJ3 3IKWA 4I0BA 2EIEA 3JD73 3VD7A 3BI3A 1S2KA 1W6OB 3SCFA 4I01A 2VW1A 2VZ3A 4YZ2A 3ZM8A 1K5MB 5HV4A 3RYKA 2DWRA 5LA0A 4PIXA 4YNIA 3PUHA 1FMD2 2Z4FA 1WMEA 4K1ZA 3WW4A 1WZXA 1XU1A 3KCCA 1IS4A 4GWJA 2W1SA 5T55A 1V6IA 2PHDA 3O0VA 2ZJCA 4XQDA 1PZ7A 1GU3A 1ND2B 2RM22 2ZABA 3JBG3 2Q8OA 3Q9OA 2C9AA 4ISRA 4QGNA 4A7ZA 1WCUA 4XJZA 3W59A 4U2AA 3VD5A 1UU6A 3P5BA 4PQ9A 4R4ZA 4YW7A 4E4HA 3BUCA 1OD3A 2A6ZA 1C8M1 1LAJA 1W04A 5FZOA 1DF0A 1N3PA 2VL4A 2RS51 4JC1A 2HWB3 3VBRB 3C7EA 2GP5A 3WG1A 2VPVA 2WZEA 4QQ2A 1S0EA 2ZEYA 3R4DB 1FNZA 4E8CA 3MIBA 5IW0A 3HVDA 1NCQC 2RJLA 4XEZA 1QEXA 2QQMA 3J26N 2Y6HA 2IWGB 4RFT0 1APNA 5I0SA 2QQLA 5CKMA 1WCQA 3JQWA 5EPAA 5A1FA 5JXIA 5FY5A 4M00A 2ZBJA 3E1F1 4AVTA 4MGTA 4AI9A 3OPZA 3N9QA 5IK5A 2Z69A 3RI8A 4LORA 4W50A 3EXUA 3SISA 4IEPA 4YVWC 1WLTA 3RZZA 4EN6B 2FDFA 2HWC3 3FJSA 4MLOA 3M70A 4AFBA 1O3RA 1GMMA 1F31A 2E51A 3WNPA 1QDOA 1V70A 4RHV1 2YU1A 3J7LA 5DZGA 4N43B 2X5IB 1DQ6A 5FBZA 2ZOEB 3WP3A 5IK8A 1JZ5A 1W2NA 3ZYFA 4P08A 4R9CA 1EUTA 5A3OA 3VV1A 2Y26A 1UQXA 2JE8A 2YV8A 3DUIA 1H8TB 1AR82 1RC6A 3OY8B 4EZ4A 3OUIA 4QU1A 3WNNA 5L9BA 4NMIA 3NQHA 3KV5A 2HEWF 1Q8QA 2WA3A 3J7MA 4NIDA 5FY0A 3MLJA 1BK0A 1BMV2 4LO7A 1QJFA 2GZWA 2VXJA 4XMIA 5JOYA 3I2GA 4WVWA 1UU4A 2QQOA 3ZXEA 5CFDB 3VKFC 1ZYBA 4LOSA 3SKJE 3WNMA 5AC92 2GMEA 1G9DA 1E5IA 5FQ0A 2YGLA 4LIUA 5FZFA 1PM7A 2I45A 5DAPA 5HV0A 3AKPA 2UWAA 3NJZA 3NKGA 4XXAA 3WV6A 2IXKA 1XNBA 2E26A 2ZX4A 2C9KA 4BMBA 4UBHA 1PGW2 1LGNA 1F8VA 1TME1 5LK5A 2BP6A 4JV4A 3DV8A 4AAPA 1BXHA 2PHRA 1K3IA 2ARBA 1W6NB 4I3PA 1PX4A 2AEYA 2VVEA 2LM3A 3NAPB 1QJX2 1URXA 2QDNA 3MUZ1 4QHBA 1PO11 5E16A 5LASA 4CDUA 4CVUA 4NIGA 5A3LA 5FZ1A 2BDRA 1UYYA 2HYKA 4P9LA 1C1FA 1O8PA 2E32A 1A6CA 3AMPA 2WO7A 1A78A 1NCQB 2E31A 1CN1A 2SLIA 3AVRA 4YVSA 3P3NA 3LSDA 2VUAA 4HT1T 4CCCA 5LW9A 4DXRA 3O1VA 1WA4A 3VL8A 2JG8C 2KA3A 2P17A 4CU6A 4RQPA 2YC4A 4FPCA 2V72A 3PDQA 1UYZA 1N1TA 4XETA 1R64A 2CNAA 1D4M1 2BU9A 5CKQA 2VOVA 2ES3A 1YI7A 5FLHA 2PHFA 4LPLA 1V6NA 4MADA 4IV1B 3ILFA 3GXUA 1UU5A 3GBFA 3WT3A 5AFBA 1CVNA 2HWD2 2JD4A 3I2JA 5C3SA 4GZ9A 1JH5A 3AZWA 4XVHA 3BOPA 3HIFA 4KI5M 4Y1YA 1RUD1 1UWWA 1AYN1 4XHXA 4ZXEA 1YJKA 5IK4A 3SXWA 5FPUA 4CXYA 3AMQA 2J1AA 2UURA 2HH9A 2JG9A 1OA4A 2PQQA 1V6OA 5FLJA 3DCQA
chains in the Genus database with same CATH topology
1JOPA 1S4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JOP A;  1S4C A; 
#chains in the Genus database with same CATH topology
 3T1M A;  3POF A;  4AED A;  1ZBA 2;  3POB A;  4ZZ5 A;  2XJT A;  2PMW B;  4UW5 A;  4NHK A;  5D8A A;  2EVX A;  2B4K A;  4LO4 B;  4GB3 2;  2KD7 A;  1I5P A;  1YWK A;  1GZT A;  4B1L A;  5A3T A;  4YLZ A;  2LUW A;  2O14 A;  4Y22 A;  3WEZ A;  4CDQ C;  1POQ A;  1W8O A;  4WVM A;  1O7F A;  3I2D A;  4URT A;  4FI9 A;  1AXZ A;  1N47 A;  2WWU A;  3MF6 A;  4NWW A;  3HJR A;  4JKK A;  1ZBE 3;  5F3G A;  4AWD A;  4CPB D;  4QDQ A;  5FJK A;  1NLS A;  5LK7 B;  2RS5 3;  3PVE A;  2LTN A;  5JSO A;  3ZYJ B;  3N4M A;  3GZU C;  2X10 A;  5LY2 A;  3R4U A;  5BPX A;  5L19 A;  2FDG A;  1LHO A;  1V9U 3;  4WV8 A;  4DQA A;  4DMI A;  3PU8 A;  3K77 A;  2ZKL A;  4GAL A;  2JWP A;  5BXX A;  4YW5 A;  2VCA A;  2ARX A;  1V6K A;  1ZZ6 A;  3UK9 A;  1AR7 3;  1VJ2 A;  2WWS A;  2VNO A;  1H9P A;  3D8C A;  4Y4R A;  2OXB A;  3HNB M;  2V5D A;  2YPJ A;  3IM0 A;  3PUR A;  2XGX A;  2GC3 A;  5LY1 A;  4FAH A;  4W6X A;  3UKT A;  1MS3 A;  4Y20 B;  5C3O A;  1NKG A;  4N53 A;  3RZM A;  2DTW A;  4TYS A;  2VCM A;  2CYF A;  3AP9 A;  4FXG B;  4BZ4 A;  3BTX A;  2W94 A;  3ZXK A;  2JEN A;  2UY8 A;  1C3H A;  4EN7 B;  4LKF A;  1RUF 1;  1CX1 A;  5HXV A;  2DFB A;  3N9O A;  4OHW A;  2IUW A;  3MIC A;  1LEN A;  2DFC A;  2VUC A;  2W1U A;  3J7N A;  3O1R A;  3PVO A;  1WMX A;  4YW6 A;  4LBJ A;  2AYH A;  3AXE A;  4UFK A;  4EJR A;  2MEV 1;  1QOT A;  4DRV A;  1GWK A;  3O7O A;  5BNP B;  2E6V A;  5FXX A;  4HK9 A;  3ZPO A;  1OC1 A;  3WZ1 A;  1W2T A;  4AW7 A;  1PO2 2;  3KCX A;  4M3C F;  3BYW A;  2OUJ A;  3L9J T;  2FZ2 A;  3WP4 A;  3WQB A;  3POJ A;  5FMC A;  4AYU A;  2CTV A;  3GF6 A;  4MGI E;  4O9E A;  5FZK A;  3UJQ A;  4Y1X A;  2YDE A;  5EZW A;  3BKZ A;  1C5H A;  3S6P A;  3USU A;  4NRO A;  2VO5 A;  1ZZ8 A;  1ZX5 A;  4O65 A;  4GA9 A;  4ARX A;  1JYI A;  2RG4 A;  1W9S A;  3T0D A;  2ZAC A;  1KDM A;  1U5X A;  1CJD A;  1Q43 A;  1POV 3;  3ACI A;  4GIQ A;  3ZFE A;  1ZRE A;  4OI4 A;  3GNE A;  1Z7S 2;  3WOG A;  4QD2 A;  4S2H A;  1LOF A;  5JZG A;  3THC A;  2FCT A;  4YGB A;  2J1E A;  2XUM A;  5FYS A;  4WM8 B;  4N53 C;  1TE1 B;  1QMJ A;  2QZ2 A;  1VAM A;  2VZR A;  4GB3 3;  2VMF A;  5DAQ A;  4Y3O A;  1GOG A;  2XBO 1;  2ORZ A;  2QTW B;  2P2K A;  1BQP A;  3FHI B;  4RFR B;  1GV9 A;  2B9V A;  3RWK X;  3BTZ A;  5F6L B;  1J3Q A;  1VBB 2;  1AR9 3;  2HWB 1;  2W1Q A;  1XYO A;  4QPY A;  5A7S A;  4SBV A;  1YO8 A;  5KHJ A;  1PX3 A;  4J1W A;  1MS9 A;  3ZKU A;  4ERO A;  3OJB A;  1V6L A;  4XZP A;  4GD4 A;  2VQU A;  2N7G A;  1ND3 C;  3NAP C;  2GNT A;  1AR9 1;  5C3R A;  4CDW B;  1FV2 A;  2NMO A;  4K8F A;  5I91 A;  1VAK A;  1RUF 2;  2P1B A;  2WT2 A;  3BGA A;  1AYM 3;  3J7H A;  4QX7 A;  3KV4 A;  4UI9 L;  1XXN A;  2D6M A;  5ANN A;  4GMP 1;  5FPL A;  1UY3 A;  2IXL A;  4AZZ A;  2QNK A;  1ZZC A;  4IEV A;  4YM0 A;  4I02 A;  2BVB A;  1COV 3;  1SLT A;  2A70 A;  4PDW C;  5GM0 A;  3ZDS A;  3ZX7 A;  2YBK A;  3ZO0 B;  2GN7 A;  4QHO A;  2VZV A;  4Q1P A;  4BHP A;  4CP0 A;  1H8T A;  3GJB A;  2Q0A A;  2VGD A;  1OF4 A;  4RR3 A;  4UXA A;  5DAV A;  5CYY A;  5GLV A;  4LJH A;  1JYT A;  2Y6K A;  1OLM E;  1QGL A;  1ZNP A;  3O14 A;  1VAL A;  4XF4 A;  2A6X A;  2J1S A;  4IEY A;  2WDB A;  3ME2 A;  2W68 A;  5LBB A;  3MV1 1;  4QQP A;  2X09 A;  2ARC A;  5F3E A;  3JCI A;  4K8R B;  1J1T A;  3ACF A;  5GKA C;  4LUK A;  2VME A;  1ULG A;  4Q4W 1;  4OHZ A;  5SV5 A;  2ZAA A;  1OH4 A;  1HB4 A;  1SDD B;  4JDO A;  3IWZ A;  3I3E A;  5GJ6 A;  5FJH A;  4B29 A;  1TVG A;  1R09 1;  4BYY A;  5BNO B;  3NWK A;  4JHT A;  3MF9 A;  3VDC A;  1JUI A;  2BW8 A;  4QPI A;  3AZX A;  5JIA A;  3RMY A;  4DRR A;  4E9K A;  2PEL A;  3CF6 E;  5FZL A;  4YSF A;  4AFD A;  3GM8 A;  1VRB A;  5CFC C;  1CAU A;  3AMH A;  1A34 A;  4AQS A;  4DS0 A;  3T2Q A;  1VRH 1;  3WDV A;  1BZW A;  3FZ3 A;  4DNY A;  2WZ8 A;  1KXG A;  4FPG A;  3B9I A;  1TNF A;  2QBX A;  3CNA A;  1E57 A;  1NE4 A;  4EYU A;  1O4T A;  3UT0 A;  4D6R A;  4IET A;  2MNG A;  2PHT A;  3IPV B;  5F5I A;  1MPX A;  1MS1 A;  4E2G A;  4XUO A;  1DQ2 A;  3J4U H;  5FPX A;  1JZ8 A;  1HDK A;  3AM2 A;  3FC0 A;  3AJY A;  2A6V A;  2VZS A;  1X8E A;  4DZG A;  2LAL A;  2G19 A;  5IVF A;  3D0J A;  2VOK A;  4WM8 C;  3CU7 A;  2A6W A;  1X7N A;  3H42 B;  3TNP B;  2VNV A;  1X33 A;  3EO6 A;  3G6J B;  3RZK A;  2ZMK A;  5JXH A;  4JHZ A;  1QJX 3;  1ST8 A;  1JZ2 A;  1NXD 1;  1U12 A;  2ETE A;  1RUC 1;  2A6Y A;  4PDW A;  2ZX3 A;  3VN4 A;  3AL6 A;  4HN0 A;  4QXH A;  3HQX A;  2D98 A;  4R8H A;  4WM7 C;  3UNP A;  5DDJ 1;  4CUC A;  1MVQ A;  5EYY A;  3M3C A;  4IGP A;  3BTA A;  3JBG 1;  2ZGR A;  3POW A;  3VZL A;  5K0U B;  2WQ4 A;  3ACL A;  3GJA A;  2E7A A;  3AB0 A;  5T5J A;  3GZE A;  4OHY A;  5JLV A;  1RIN A;  4FOV A;  1JOJ A;  4AI2 A;  1W3X A;  2PXJ A;  3TEY A;  3GGL A;  4Q26 A;  3HNY M;  5EP9 A;  3U10 A;  4N90 A;  4FCA A;  1PGW 1;  2LRP A;  4EWE A;  2RS3 3;  1KEX A;  3M8L A;  4EWA A;  1W03 A;  4ZZ8 A;  2ILM A;  5FYC A;  2HWF 1;  1G7Y A;  1QU0 A;  2YG0 A;  4RGK A;  1LNS A;  3MLL A;  3ZFG B;  1R1A 3;  4IEX A;  1CZV A;  4CU8 A;  3MHZ A;  4LIT A;  4MXW B;  4ISQ A;  1LHU A;  2RDR A;  4WM7 A;  1UMH A;  4L92 A;  1X50 A;  1OH3 A;  1Y43 B;  3LIH A;  1WD4 A;  1HRV 2;  4ORF A;  4XQW A;  3DEC A;  4QPG C;  1NY7 2;  1YFU A;  1YQ6 A;  3AX4 A;  1BVV A;  2VZP A;  3LA2 A;  1YFX A;  2RDN A;  5G04 L;  3N3H A;  4UFH A;  4AOC A;  4AED C;  4F83 A;  1DFQ A;  2JX9 A;  5BNN B;  4CEY C;  1A8D A;  3HNM A;  1ODM A;  3NNJ A;  5A6Z A;  2CU5 A;  1RHI 3;  5J98 B;  4LHL A;  3AMN A;  3ZSK A;  5FBJ A;  1DZT A;  4TZD A;  2WNV C;  3E6D A;  1XB9 A;  1U0A A;  5FCC A;  4IV1 C;  4RA0 A;  4XFA A;  2BGC A;  4YVW B;  4QQO A;  1ULE A;  2D93 A;  3PUA A;  1RHI 1;  3ZXG A;  2GMM A;  1UPI A;  1EYB A;  1DLL A;  4F3J A;  3ROU A;  1RIR A;  3FL7 A;  2J22 A;  1W6M A;  5F7U A;  5FYT A;  3VBF A;  5D21 A;  4LBO A;  1ZM1 A;  4DIN B;  4FP2 A;  2R04 3;  1SPP A;  4S2G A;  2AEN A;  4Y5S A;  3PME A;  5DUV A;  5J1X A;  1F35 A;  1UIK A;  2JDP A;  3F2Z A;  1SLB A;  4HBN A;  4X6R B;  1C28 A;  5IAV A;  4OUE A;  1O3S A;  1VBD 2;  1UZZ A;  2XQR A;  4ZU5 A;  2GN3 A;  3U14 A;  3A0K A;  1K12 A;  4JGY A;  4OI0 A;  1LOC A;  2EIB A;  1XSR A;  4MXW A;  5J3U A;  4QXK A;  2GC1 A;  4XUN A;  5H9S A;  4MXV A;  1FOD 2;  3U07 A;  1GLH A;  3ZFG A;  1XE0 A;  4UW4 A;  1XPW A;  1VB4 A;  5DAW A;  1X9P A;  3LGR A;  4Q1R A;  1MZF A;  3HQU A;  4MV2 A;  3VZM A;  4AGG A;  1WD3 A;  4CEW B;  2H0V A;  5FOJ B;  1V0A A;  4NOT A;  1BJQ A;  1YRZ A;  3CKH A;  3WUD A;  4UFJ A;  5B2G B;  2F4L A;  3TNQ A;  1NXM A;  2Y6G A;  1SG3 A;  1UZV A;  1SLL A;  4RSU A;  1Q8P A;  4OMC A;  4HOO A;  5K0U A;  2BGO A;  3LPG A;  4NAO A;  3Q8F A;  1UZ0 A;  2GSY A;  3WQ1 A;  5C70 A;  1UYX A;  2X29 A;  1D4M 3;  3DYO A;  3OCP A;  3P6B A;  5FMD A;  4BB3 A;  3BPS A;  4N43 C;  1RXF A;  3SHR A;  3V56 A;  4YM2 A;  4A44 A;  3LDK A;  3W58 A;  2BTV C;  4O9G A;  3OGS A;  2RS5 2;  4OVE A;  3MI8 A;  4PLO A;  4ATE A;  1IS5 A;  2B45 X;  2ZGP A;  4CA9 A;  5D1I A;  4Y1V A;  2YRO A;  4W65 A;  1XNT A;  4LXL A;  4FPH A;  2JD9 A;  2YU2 A;  1OFN A;  2Q1Z B;  1VBC 3;  3J9S A;  1H8T C;  2RR1 3;  3OG2 A;  5FZ7 A;  3VDA A;  1RUE 2;  4CCK A;  5IHR A;  3H8O A;  4AGV A;  4IW3 A;  4JTO A;  3POG A;  2Z2S B;  4XPV A;  1Q56 A;  2GH8 A;  2B7Y A;  5FYY A;  3PUQ A;  2AEZ A;  2MHF A;  4NN0 A;  4Q2F A;  5A7N A;  3SH5 A;  1D2Q A;  4JGZ A;  1RUC 3;  1OUX A;  4JQR A;  4XFI A;  2OW4 A;  1O4Z A;  2QCS B;  4LO8 A;  5I0R A;  2Q8E A;  1QQP 3;  4AFA A;  2TNF A;  1EP0 A;  1WLD A;  1R09 3;  4FFH A;  1VMJ A;  3OF1 A;  3OGG A;  1W99 A;  2WO1 A;  2WC2 A;  1QJU 1;  2WIN B;  3WX5 A;  5CFD C;  4OQ8 A;  1HV0 A;  5J37 A;  4MUV A;  3A0N A;  3M3I A;  1WW6 A;  1PGL 1;  1UN1 A;  2J7M A;  1KDK A;  4YFZ A;  4NIH A;  3ACG A;  1AR7 1;  1JI6 A;  1I9R A;  1Z7S 1;  1Y4W A;  5CG8 A;  1OKO A;  2BVV A;  3KHB A;  5F37 A;  4LLF A;  1H1A A;  2R1B A;  1ZRC A;  3SH4 A;  5CIR A;  2VVF A;  2JG8 A;  2Y6L A;  4Q0Q A;  1F9K A;  3VBH C;  3EHK A;  4PF5 A;  3RFR A;  2R0H A;  5E89 A;  4R52 A;  4MHR A;  2WAO A;  2D6L X;  5LAT A;  5H9R A;  3KQ4 B;  2CGP A;  2RVA A;  2Y0I A;  5J48 A;  4ZS2 A;  3ENR A;  3VBF C;  1LHW A;  2IFR A;  1K5M C;  4J1X A;  5C4W C;  2RS1 2;  4TTG A;  3KVB A;  5IK7 A;  2OYZ A;  3LFM A;  2VMH A;  1O4Y A;  3HT2 A;  3QAC A;  3O0W A;  5GLW A;  4AAX A;  3VDD B;  1F2N A;  4LK6 A;  2RDQ A;  4UWD A;  5IVJ A;  4DEQ A;  3VZO A;  3NJX A;  1PZ9 A;  1V9U 1;  2BNO A;  2CWM A;  1ASJ 2;  2Q4S A;  4UF0 A;  1S2E A;  1QJY 3;  1SBD A;  1HKD A;  1XJA A;  3URF A;  3RZG A;  2K0G A;  4CDW C;  5FZ9 A;  5JSP A;  1JZ3 A;  4RS5 B;  1HW5 A;  1QJU 2;  2JB8 A;  1GYK A;  3LEI A;  4QDR A;  5GZE A;  4DXT A;  1H6Y A;  4YM3 A;  1UYP A;  4Q8L A;  1ND3 B;  2A1X A;  1TME 2;  4DY5 A;  2MEV 3;  4HPK A;  1UIJ A;  4A7K A;  1CQ9 A;  2C6S A;  3AZY A;  1W2U A;  2VZ1 A;  4COY A;  2GH2 A;  1V6M A;  3OEA A;  1UOF A;  4RS5 A;  4D94 A;  2NMN A;  2D40 A;  2D97 A;  3NV3 A;  1S1A A;  1OLR A;  1HN1 A;  1UKR A;  1KRI A;  4FPY A;  3LWC A;  2YGM A;  5JI9 A;  4HKL A;  3ZDV A;  2F17 A;  1I3H A;  2QUO A;  1VBA 3;  4HAN A;  4YW2 A;  3VDD A;  4XF1 A;  1RUH 1;  1WKY A;  1TMF 1;  3RQ0 A;  5A3W A;  4BQY A;  3LOI A;  2WNU C;  5FP7 A;  1KFX L;  3WNO A;  5L7O C;  1OF3 A;  4OI1 A;  4LHS A;  1SDW A;  1Q3E A;  4RS5 C;  2BER A;  4R9A A;  4UAP A;  3ZN6 A;  4BQ3 A;  1L3J A;  2YMZ A;  4LKD A;  3W20 A;  1FYU A;  1S55 A;  2Y34 A;  3FHA A;  4HFS A;  2R1D A;  4YRD A;  5F9T A;  4CU9 A;  5CVR A;  3LFI A;  1HXS 3;  1AUY A;  2BNM A;  1PIV 3;  2OA2 A;  3BIW E;  3KZ4 C;  4H3W A;  4RYD A;  2W47 A;  4Q4X 1;  4QX3 A;  5F39 A;  3WF3 A;  5KBF A;  3AK0 A;  3CJI A;  5ACA 3;  1NUK A;  3HR9 A;  1X82 A;  4X6Q B;  3GCW A;  4MGQ A;  3NNM A;  1ACC A;  1BEV 3;  5FZ4 A;  3DYP A;  3JB4 C;  4XUT A;  2AUY A;  2QKD A;  4XHB A;  4MO3 M;  3QBQ A;  5I0T A;  3DKQ A;  2AAC A;  5CG9 A;  3TRS B;  4AFC A;  1RUG 2;  3H7Y A;  2VU9 A;  3TAY A;  2WNE A;  1SQ4 A;  1XRU A;  4HPK B;  3OGR A;  4Q4Y 3;  4WVZ A;  4D7Y A;  2QQP A;  3H8R A;  1ND3 A;  2ARE A;  5CU1 A;  1YNA A;  1SFN A;  4Q27 A;  5T5O A;  3VB9 A;  1LHV A;  1VRH 2;  4KBB A;  4KU8 A;  4JGZ B;  1AYM 1;  4FQZ A;  2ZKN A;  5FR3 A;  4N7U A;  2K2S A;  4GMP 3;  4HXC A;  1SFY A;  1XQN A;  2PHL A;  2RS1 3;  3B93 A;  1WW7 A;  1EUU A;  2FD8 A;  2WN2 A;  1BBT 2;  1ZRD A;  1OD5 A;  4D6Q A;  1UKG A;  4YVS C;  2P5B A;  4DY3 A;  3GHM A;  2Q1F A;  4Y24 A;  5CZK A;  5FZC A;  4LO6 B;  2ZGN A;  5A3M A;  4KH9 A;  5K9Y A;  1Y9Q A;  4I0W B;  5FPZ A;  5IT6 A;  3RMX A;  2VMG A;  1ZVF A;  2VH9 A;  3S30 A;  4CCM A;  2ZX0 A;  3WG2 A;  2PYT A;  4FFF A;  4AXO A;  3SEE A;  1XSQ A;  4MHU A;  2LRO A;  3VKO A;  4ARY A;  1R1Z A;  1W9W A;  3MIG A;  1X36 A;  2J1U A;  3MYX A;  1QOS A;  4UBG A;  3RVH A;  2VUD A;  4PCR A;  4BLJ A;  4BK4 A;  3K4Z A;  1PZ8 A;  3HD8 B;  2WS9 2;  5E1R A;  5APA A;  3NV4 A;  1RL3 A;  1DQ4 A;  1WLC A;  4QX5 A;  4QPW A;  5FK7 A;  2P4E A;  1J59 A;  2A3X A;  1HRI 3;  3CQO A;  5HI0 A;  1WBF A;  4JVA A;  1OPM A;  4A6O A;  1C57 A;  1PO1 3;  1WCK A;  4P02 B;  2R0F A;  3FLT A;  2XVK A;  3E5U A;  1FOD 1;  2JKX A;  5JR2 A;  1LUL A;  2RHP A;  2VXR A;  3HQR A;  4G3Y C;  3AZV A;  1LHN A;  2GU9 A;  2R06 2;  1QY4 A;  1VBE 1;  3WVJ A;  4AVA A;  4FBF A;  1H2N A;  5T3N A;  2ET7 A;  4WVM B;  4XXP A;  3W21 A;  4LT5 A;  1RUO A;  5HCF A;  4BME A;  2BEO A;  2V4V A;  1O3Q A;  2D6K A;  3N9L A;  3UGG A;  4AI1 A;  1JHJ A;  4MX3 A;  3B7M A;  4UFI A;  4BQ2 A;  4NJ4 A;  5JXJ A;  3C7O A;  3T0A A;  3GAL A;  1PK6 C;  1M4W A;  3WF1 A;  3VBO B;  2VQ0 A;  5BNN C;  1WCD J;  2WBK A;  1KS5 A;  4CP9 B;  3M3O A;  5DDJ 3;  1QNY A;  1XYP A;  4YZ5 A;  2VUJ A;  3ELN A;  4H2A A;  1XC6 A;  5GZF A;  2RJ2 A;  5CAD A;  4JTN A;  3ON7 A;  4FPE A;  4CZS A;  2H6C A;  2ZEW A;  4QKD A;  4NHM A;  1R1A 2;  1HX6 A;  1GQH A;  1MAC A;  3P3P A;  3NL1 A;  4V1P A;  5A70 A;  3H8X A;  2VBP A;  5DPN A;  1DDL A;  1PMI A;  3HBK A;  4LLO A;  4FOY A;  4YVW A;  1LOG A;  1BEV 2;  3IDC B;  2JKB A;  2CGN A;  4BCU A;  3ECQ A;  1QXR A;  4GAZ A;  1Q8O A;  1CAX B;  3AMM A;  3V0B A;  5ABJ C;  1O3T A;  5KXB A;  3O1P A;  2PLV 1;  1O5L A;  3EJK A;  4C91 A;  1AR8 3;  2BNN A;  4FSJ A;  2WZR 3;  2DVD A;  1PK6 B;  1KJL A;  2WJS A;  3PL0 A;  1DGW X;  4QX8 A;  3ATG A;  1DZQ A;  5DZF A;  1I5Z A;  4Z8B A;  3IPV A;  4CDU B;  4QKB A;  2XDV A;  2V5Y A;  4M0H A;  1LGC A;  4FXK B;  4CDX C;  1W6N A;  2GC2 A;  3ZXF A;  4WM7 B;  2E7Q A;  4J6G A;  4WBB A;  3JXS A;  4L8Q A;  3NV1 A;  3TBD A;  4AHW A;  5KXE A;  4P9Y A;  1XND A;  2IXH A;  3LA3 A;  3VKN A;  4AG4 A;  1HQW A;  4LOT A;  4NII A;  4A4A A;  3SMH A;  5C8C A;  5F3C A;  5I0U A;  1Z78 A;  1COV 2;  5FQ0 B;  1W05 A;  5FV3 A;  1JUH A;  2WNV A;  3VBF B;  4YFW A;  1CIY A;  4XJA A;  3VKL A;  3M7A A;  2YXS A;  3RZL A;  4F8A A;  1MEC 1;  2KXL A;  4Z82 A;  5C6C A;  4FTS A;  2O8Q A;  5ERL A;  3AJZ A;  4NE9 A;  1FAT A;  5CBL A;  3AYE A;  3OOX A;  5T54 A;  2NN8 A;  4LKE A;  4GJY A;  1OUR A;  3CIH A;  4PIY A;  1DCS A;  4XAE A;  3I8T A;  3PJY A;  2J1R A;  5L73 A;  1C4R A;  2ZAH A;  5JI7 A;  2JEM A;  1DLC A;  4Y33 A;  3N9N A;  5FYH A;  2VTX A;  1FPN 2;  3ZR6 A;  4CTE A;  4ET7 A;  3VD4 A;  4S2D A;  1XE8 A;  4BIF A;  2IVJ A;  5FP3 A;  4JDN A;  3LF7 A;  2O8O A;  3K4D A;  1LED A;  4QX2 A;  1Y9G A;  4HON A;  2FCV A;  4LBN A;  1QJZ A;  5C71 A;  4QGL A;  3H0O A;  5JXG A;  1ULO A;  2OUH A;  3MLK A;  1XNK A;  1RED A;  1NA1 C;  5FRE A;  1D0G A;  1B35 A;  1NCR A;  2E9Q A;  1NLQ A;  3ASI A;  3F95 A;  4YPJ A;  3S7E A;  4AEJ A;  1U5Z A;  3NJY A;  2YHJ A;  1YFW A;  3ABZ A;  1CD3 G;  3KB5 A;  4L9B A;  1UY0 A;  2V73 A;  1XOY A;  3D6E A;  4Y5T A;  3WDY A;  4FPK A;  3A21 A;  3ACH A;  4CUB A;  4LMF A;  3IN9 A;  2RMU 1;  1IQA A;  4LBK A;  4QDS A;  1DQ0 A;  5F5A A;  3VL9 A;  2IXJ A;  4MSV A;  3ZLI A;  5A1A A;  4M0N A;  3C2U A;  5FO7 B;  4CE8 A;  3RNS A;  1OXC A;  2YYO A;  3VBR C;  3JQX A;  1SCR A;  3R05 A;  4QGM A;  3FLP A;  2JIG A;  1PHM A;  2BWC A;  2DCK A;  2RM2 3;  3AYC A;  3JBG 2;  4I3G A;  5A6Y A;  3WG3 A;  2ZA9 A;  3IAP A;  5BNO C;  3C7G A;  2DBI A;  1J1L A;  2HWD 1;  3KT1 A;  4Q4V 2;  1HB3 A;  4MGY E;  1GOF A;  3GHN A;  4A7Y A;  1ND2 A;  1VPH A;  1XE7 A;  4QPI C;  3ES1 A;  3CMG A;  3VD3 A;  2NYY A;  3N7L A;  1MS8 A;  4D3W A;  3T08 A;  1ZRI A;  1RUI 3;  4I09 A;  4CEY B;  5LBE A;  2XQX A;  3HWJ A;  3WQ7 A;  1EAH 3;  5A1L A;  2W39 A;  4K7J A;  1DIW A;  3POS A;  1ENR A;  1FMD 1;  2VR4 A;  5EXO A;  1ZBE 1;  4YZ3 A;  1WLW A;  5H9P A;  2KR2 A;  3M3E A;  1W6O A;  3HN1 A;  1ENQ A;  4L97 A;  3RI9 A;  3ZYB A;  1EAH 1;  3AKR A;  3MW2 A;  1DGR N;  1Z7S 3;  3B02 A;  1S0F A;  2DUO A;  2QDR A;  3NO8 A;  4P9W A;  3NKT A;  3A22 A;  4MVT A;  2DF7 A;  3WHU A;  3ZFF A;  4B7K A;  5LEK A;  1C5I A;  5K0U C;  1PO2 1;  3THP A;  1W9Y A;  1ASJ 1;  4ZY9 A;  1W06 A;  2OKX A;  2PA7 A;  3ZYG A;  1OLQ A;  2JDH A;  2V4A A;  1H30 A;  3USS A;  2FDI A;  4P9G A;  3UKN A;  4V2V A;  4XUQ A;  3W9A A;  2A73 B;  1UOB A;  2R07 2;  3CL1 A;  4XBQ A;  4XUP A;  3I3M A;  4KBZ A;  1TZO A;  2ERF A;  1HB2 A;  1W0P A;  1S2B A;  3Q8E A;  4QB1 A;  3UET A;  3WG4 A;  4PT6 A;  3EMR A;  4XFF A;  3W5M A;  1KFU L;  3WD5 A;  3JD7 2;  1ASJ 3;  4V2W A;  2PAM A;  1QIQ A;  2AH2 A;  1Y3T A;  4HVO A;  3BU0 A;  3ZXJ A;  4H14 A;  4E4S A;  2FDH A;  5BV6 A;  4Y20 A;  1G9C A;  1RHI 2;  2ZHN A;  3VKM A;  2WQZ C;  4YGD A;  5BNO A;  4NWV A;  5FY9 A;  2RS1 1;  3T3Y A;  2DCJ A;  3BAL A;  2DVG A;  5KXC A;  1O91 A;  1SLC A;  2YBS A;  4A3X A;  5JPN B;  3KQR A;  1DYK A;  5BNP C;  2RMU 2;  3ITQ A;  4NUB A;  2OX0 A;  3MEP A;  4Y26 A;  4OI2 A;  1PGS A;  3TEX A;  3ZFF C;  2YFU A;  1HQN A;  3KSC A;  4E4Z A;  2DDU A;  4IGQ A;  2UWB A;  2A7A A;  4Y4Y A;  2W0X A;  1NT0 A;  2ORX A;  4M3C B;  1S4C A;  4W4Z A;  1H2K A;  2ZGS A;  2D3P A;  3IDE A;  4P9J A;  5F6K A;  2F4P A;  2Y0O A;  5IVC A;  5G05 L;  5EJZ B;  2VZU A;  4XW3 A;  3ZYP A;  2XVG A;  1AF9 A;  4EV0 A;  4PQQ A;  3AKT A;  5C9A C;  4B4Q A;  1UOG A;  4Y22 B;  4XF3 A;  2A5Z A;  4BQ5 A;  1W0O A;  3UYJ A;  4BXF A;  3I3Q A;  4HSL A;  4ES8 A;  4CDW A;  1W8W A;  1GOH A;  1PO1 2;  4NR1 A;  4CCN A;  5FLI A;  3M2M A;  3T2P A;  1ND2 C;  1W8U A;  1SBE A;  1MVE A;  4P9X A;  1O6U A;  1MQT A;  3VGI A;  5C9A B;  3OYW B;  2WWJ A;  3JD7 1;  5A3U A;  4BQ1 A;  1NE6 A;  4R4X A;  3T2O A;  4O7X A;  3V0A B;  3CLP A;  2WZR 1;  3KF5 A;  1GP6 A;  3OEB A;  1IOA A;  1ULD A;  4XTM A;  3K4A A;  2Q8C A;  3ZSJ A;  4ZU4 A;  1L7Q A;  5ACA 2;  4UT5 A;  1RJ7 A;  2JDN A;  1C1L A;  1EPZ A;  5CKN A;  4K9S A;  1WWY A;  2RV9 A;  3PVN A;  4HZF A;  4BIS A;  1QH6 A;  2W2I A;  4HN1 A;  5KHG A;  4IV1 A;  1WA6 X;  2BPA 2;  4N9H A;  5IAT A;  2WFP A;  4FOQ A;  4IV3 C;  3I2O A;  2QJV A;  2R16 A;  3HN3 A;  4YW1 A;  4QT6 A;  1MQT C;  1MS0 A;  3IB3 A;  3JU9 A;  4QX1 A;  5DDJ 2;  1QF3 A;  1O5U A;  4N7I A;  4Z07 A;  4H55 A;  4OHX A;  3IDA A;  5JZG B;  1ALY A;  1C8M 3;  2CDO A;  4XIO A;  4EWD A;  3QOP A;  5DG1 A;  2WL1 A;  3RS6 A;  3VZN A;  2W52 A;  1BCX A;  2W3J A;  5A80 A;  4LKS A;  2BUK A;  2Z42 A;  3M4F A;  3H3U A;  3RJ2 X;  4FT8 A;  4Q0S A;  2DUQ A;  1UXX X;  1UAI A;  2NPI A;  2XLF A;  4D7T A;  2EIG A;  3CJX A;  4XFB A;  2FDK A;  3AC0 A;  1EV1 3;  2UYB A;  4XJ9 A;  4FP3 A;  4Q4X 3;  1LOD A;  1WBL A;  1RUH 3;  1IPK A;  3EBR A;  3LEM A;  4FFI A;  4HL0 A;  3ZSE A;  1R08 1;  1W0N A;  4NIA A;  3LE0 A;  3T30 A;  4AQT A;  3FE5 A;  1CZT A;  2OPW A;  3ILN A;  2WQ8 A;  4JX0 A;  5A6Q A;  1LB2 A;  2FMD A;  4PF1 A;  1B09 A;  3N7K A;  4Q0U A;  2DU0 A;  2YB7 A;  4CEW C;  5A7W B;  2GNM A;  3GBG A;  3KS7 A;  4MOA A;  3NRU A;  5A32 A;  1H1I A;  3OYW A;  3TN9 1;  1SLI A;  4AK3 A;  4XAA A;  4XYX A;  5C9A A;  3D0S A;  1L7R A;  3SLI A;  3POY A;  1JYN A;  4YZ4 A;  1G9F A;  4CDX A;  4NVP A;  2EXI A;  1OT5 A;  4KL1 A;  2PHX A;  3VBU A;  1FAY A;  2DU1 A;  5JVV A;  4A3Z A;  5A32 B;  5LA2 A;  1F5J A;  3AZZ A;  1AL2 2;  1T6B X;  3SCH A;  4C0H A;  2Y38 A;  1ULC A;  3C7F A;  1H9W A;  3T4V A;  2QQW A;  3LDB A;  1H2M A;  2ADD A;  2DVA A;  2QQN A;  3UL2 A;  2WT1 A;  3RG0 A;  1OPO A;  5GLZ A;  2GC0 A;  2JJ6 A;  4N53 B;  5FXV A;  1LU2 A;  2HWE 2;  4OHV A;  4W6W A;  4XCA A;  5A7Q A;  4R9B A;  3ZYR A;  1UO9 A;  2OS2 A;  4Q29 A;  1P8J A;  1UL9 A;  4RHV 3;  1FPN 1;  1W3V A;  4OUL A;  4ASL A;  5LA1 A;  1XNA A;  2FQP A;  3WNX A;  4IQP A;  1NQD A;  4Y5Z 0;  5FFO C;  2DCY A;  1H0B A;  1LKN A;  1KD7 A;  2EF6 A;  5FZH A;  3RJR A;  4C1X A;  3CO2 A;  3N9P A;  4MZU A;  5AFE A;  3WDU A;  1I6X A;  2ZML A;  2CGO A;  3DGT A;  4PJY A;  4IXL A;  4CCO A;  2CAU A;  4PLN A;  3E6B A;  3WDW A;  3BOD A;  2ZGL A;  5KHI A;  1QJE A;  1GZW B;  2BFU S;  2VBD A;  4HET A;  5KC5 A;  2OQ6 A;  1S0I A;  4DEV A;  3ZMN A;  1RIT A;  5FAX A;  1IKQ A;  1IS3 A;  4BQ4 A;  3IT8 A;  4BM8 A;  3NJV A;  3H8U A;  4CP2 A;  5FPA A;  1UX6 A;  1DG6 A;  4ZU7 A;  1UX7 A;  5HXM A;  5E8A A;  4CPB A;  2C26 A;  5IAX A;  1PVC 2;  3FX3 A;  3III A;  4QXC A;  1FX5 A;  5FWE A;  2E33 A;  2Y33 A;  4M3C E;  4RR3 C;  1YIF A;  5EWS A;  5GLU A;  4DO0 A;  5AC9 3;  3P1I A;  4K3U A;  2BWA A;  3V0A A;  3KCY A;  3VBR A;  4I2O A;  2IXI A;  2JG9 B;  1NQJ A;  1YCI A;  1TEI A;  1C8M 2;  2BV4 A;  3LIG A;  3OUH A;  5LEJ A;  2VZQ A;  2HWE 1;  4YWA A;  2XJR A;  3ZXD A;  3TWI A;  4TLF A;  4ZS3 A;  1NG0 A;  2Q5T A;  5CFD A;  3WDT A;  4D6S A;  5AC9 1;  1RB8 G;  5DAX A;  1VBE 3;  2E7T A;  1VBD 3;  3KGZ A;  1RUJ 1;  5HBA A;  4QHZ A;  2RS3 1;  2A3W A;  4HK8 A;  2XJQ A;  3T1L A;  5K4L A;  1AR8 1;  2ZGM A;  3WLU A;  4LUM A;  4BIO A;  3LKJ A;  5F32 A;  3U4X A;  3D82 A;  4CEY A;  2GDF A;  3RGB A;  1G9A A;  4QKF A;  2WFF 3;  2EIC A;  1GIC A;  1LEM A;  2VY0 A;  3CBN A;  5D8A C;  1KGY A;  4IDZ A;  1SEF A;  5EFU A;  3L2Y A;  3QH6 A;  3ZMO A;  4ZXK A;  1QOO A;  4M3C A;  3MIH A;  1OQD A;  1QJX 1;  4AVB A;  5FYI A;  5DN2 A;  1JZ6 A;  3DPR A;  1W9F A;  3PIG A;  1JU4 A;  2WAB A;  3EQE A;  3UGH A;  5L9V A;  2X5I A;  4OMD A;  4N43 A;  1JOP A;  3VLB B;  5EYX A;  2ZPX A;  5F2W A;  5FDB A;  2ZX1 A;  3VHP A;  2UWC A;  4IGO A;  3NAP A;  4CXW A;  4L11 A;  2RDS A;  2JDK A;  2XVL A;  4GXL A;  3UES A;  1VR3 A;  4H7M A;  4Q4Y 2;  4TN7 A;  3VZK A;  2WNV B;  4XCB A;  1ZA7 A;  4K40 A;  4X8P A;  4LO5 B;  1QQP 1;  1D4M 2;  2JB4 A;  3KVA A;  2E53 A;  4CXX A;  5FPV A;  1VRH 3;  1H4G A;  1IQD C;  5C8C B;  1CX4 A;  3PMS A;  1DBN A;  2AC1 A;  1EY2 A;  2XKP A;  2XJP A;  4X8N A;  4LR4 A;  1HB1 A;  1ZBA 3;  1C8N A;  2A75 A;  4EN9 B;  3TYJ A;  1UMZ A;  3R0R A;  3K51 A;  3LEK A;  1IG0 A;  1NLR A;  3QLQ A;  5L7O B;  2C0Z A;  2C1F A;  4P5Y A;  3E6C C;  5DZE A;  5FZO B;  5FZM A;  4QKN A;  2CSG A;  4CU7 A;  3K2O A;  3DPR B;  4XMA A;  3VBO C;  1MZ6 A;  2NQY A;  4D7S A;  5JOW A;  4L0P A;  3RPQ A;  5DXD A;  4XFG A;  3ZIX A;  3VDB A;  2IXC A;  4P9I A;  3WW2 A;  1ENS A;  5C33 A;  3MGU A;  1LGB A;  4KQ7 A;  3U11 A;  2G4I A;  1UY4 A;  3KM5 A;  1VB2 A;  4I0A A;  3E5X A;  4AQ2 A;  2DYC A;  1I1E A;  5JMO A;  3AXD A;  3N7J A;  5JAX A;  1HRI 2;  3D3A A;  1YHF A;  1SCS A;  3EB7 A;  1GBG A;  1KQR A;  3H3Z A;  1K5M A;  2JDM A;  4UOJ A;  3AVS A;  3K3O A;  5IVB A;  4FTB A;  3I49 A;  3B9C A;  2VNG A;  1BLZ A;  4LA2 A;  3AP7 A;  4QM9 A;  4A42 A;  4E4D X;  2XBO 3;  1DQ1 A;  4FAG A;  4IEZ A;  1W2O A;  1AR9 2;  3N35 A;  1POV 1;  5F3I A;  3TB0 A;  4BJ0 A;  3T09 A;  5FRA A;  3AKQ A;  1JZ4 A;  4AHZ A;  2XLG A;  2J1T A;  1DZR A;  3O5S A;  4Q0V A;  4A45 A;  5ACA 1;  1Q8V A;  3WY6 A;  3FBY A;  2ZGT A;  4FFG A;  3POE A;  5BY5 A;  3B5L B;  4PLM A;  5HPO A;  1JXN A;  1AHS A;  1QH7 A;  3FLR A;  4K1Y A;  2CAV A;  4Q4Y 1;  4ATF A;  3V64 A;  2GNB A;  5C4W B;  1RUD 2;  1W6Q B;  1XBF A;  4TXW A;  2JE9 A;  4LBL A;  4UFL A;  4CCJ A;  3AP4 A;  2X5I C;  2JG9 C;  4Z92 B;  1PK6 A;  4B4R A;  1DYP A;  2WN3 A;  2JXA A;  3ZYI B;  3ZXA C;  4NRM A;  3NST A;  2PLV 2;  4KWJ A;  4GWN A;  4Q4W 2;  4MGS A;  2EID A;  5LBC A;  2MEV 2;  4AEK A;  5IYY A;  4C1W A;  3DYM A;  3M3Q A;  4HLT A;  3MIF A;  2WSV A;  1U5I A;  2VZT A;  2JEC A;  3AYD A;  4GB3 1;  3WCR A;  5C8W A;  5T52 A;  2VCC A;  3H7J A;  2B9U A;  3B00 A;  4E8D A;  2Q8D A;  1FT9 A;  4K21 A;  1GWM A;  3THD A;  3VBH A;  1CZS A;  3VBS A;  1SHW B;  2Z5W A;  5JSR A;  4ZHN A;  4EZH A;  2VD7 A;  4QX0 A;  2YC2 A;  3WW1 A;  1W8T A;  1QKQ A;  3S5A A;  1H4H A;  3MIE A;  1VBA 2;  1RUG 1;  2DCZ A;  5FUN A;  1A8M A;  5GZD A;  1JBC A;  3I2H A;  1V6J A;  4FVV A;  5M0T A;  4B1M A;  3HPN A;  3OB8 A;  4NPM A;  4CP9 A;  3WXP A;  4TWT A;  4AFM A;  4NHX A;  4KMQ A;  3NW4 A;  3KLS A;  3VBU B;  3T0B A;  3HT1 A;  3BTY A;  1PGL 2;  5F1R A;  3FMG A;  3FWE A;  4RQP C;  4XQ4 A;  1AR7 2;  3WNL A;  4U36 A;  2RR1 1;  2X8K A;  1JYW A;  2IVI B;  3QH7 A;  1LOB A;  1COV 1;  1O59 A;  1RJ8 A;  2P34 A;  4UW3 A;  3U78 A;  1K5J A;  4IE6 A;  2PHW A;  1JOB A;  5HCH A;  1CAW A;  3ZFG C;  5A6X A;  2QQU A;  1NA1 B;  4D8M A;  2BYV E;  3JZV A;  3G7D A;  5BYN A;  4AQ6 A;  1VMH A;  1RUG 3;  3ZXL A;  4PI2 A;  1FNY A;  3JB8 A;  5ISL A;  1W28 A;  1E5S A;  1AL2 3;  1D4V B;  2DV9 A;  5A3P A;  3OBR A;  5T5P A;  1J84 A;  1TQ5 A;  4HVQ A;  3IIA A;  2D5F A;  2GAL A;  4YYO A;  4FQ4 A;  1IG3 A;  3WF4 A;  1KJR A;  4QQL A;  3ZN6 B;  1RGS A;  4WZC A;  5KHH A;  3RSJ A;  4DFS A;  1DYO A;  2HWE 3;  1FPN 3;  2R32 A;  2XWJ B;  1CAX A;  3V0B B;  2W95 A;  4LA3 A;  2I74 A;  4RHV 2;  2TUN A;  4ZPI A;  2LW8 A;  4IE4 A;  5CIS A;  2RJK A;  4G9S B;  4D0Q A;  2W5F A;  5ANQ A;  3WP5 A;  3PTY A;  4I30 A;  1OOP A;  1FOD 3;  2VVD A;  4QWN A;  4AR2 A;  4LEJ A;  3LAG A;  4PHZ A;  4NHY A;  5JPM B;  4Q5O A;  3PU3 A;  1AJK A;  4IEW A;  5C3Q A;  3MZH A;  1YYN A;  4BK5 A;  1K45 A;  2D6O X;  4YAR A;  2VMD A;  3INA A;  2I07 B;  2KM2 A;  3PUI A;  1AR6 1;  3AYA A;  2HWC 2;  3DEM A;  1MQT B;  5FUP A;  4COZ A;  1ENX A;  1OA2 A;  1REE A;  3I3D A;  1D7P M;  2P3I A;  3LCP A;  4KG8 A;  3V65 A;  4GKY A;  1HJG A;  2WZP P;  1DGW A;  1H6X A;  3S0M A;  1NOV A;  1PIV 1;  3AKS A;  3K48 A;  3EYP A;  5KC6 A;  4BPZ A;  5KWR A;  3KHC A;  5C7G A;  3DN7 A;  2ID4 A;  5I93 A;  2OVU A;  1OMI A;  3H9A A;  4COV A;  4CRQ A;  1RVF 3;  3CJI B;  1H2L A;  4LHN A;  1VBB 3;  4UF0 B;  3BB6 A;  2PFW A;  3SCG A;  4ASK A;  4CDQ A;  3AP5 A;  5B4N A;  4F7Z A;  3ILR A;  4Q0P A;  3ZR5 A;  2W91 A;  2DVB A;  2OII A;  1G8W A;  2YBP A;  4B3N A;  4XIL A;  5J7M A;  3DKW A;  3KT7 A;  3O1O A;  1RUE 3;  2ZMN A;  1UD1 A;  3FUO A;  4LBQ A;  5IVY A;  4AHY A;  3K46 A;  4JRL A;  3IAQ A;  3PVB B;  4L99 A;  1R08 2;  3B01 A;  4XAC A;  1W90 A;  2VE1 A;  4LK7 A;  4YG6 A;  4B7E A;  1Q5O A;  3I2I A;  2B5H A;  3BN6 A;  2XOM A;  4IV3 A;  3MFA A;  3SEP A;  3APB A;  1BVP 1;  1YXW A;  1LTE A;  2P3K A;  2C24 A;  1RMU 1;  2QQK A;  4RD7 A;  5FY8 A;  3VHR A;  4AE2 A;  5CEH A;  5FO9 B;  2QFE A;  1NYW A;  4Q8K A;  1OLM A;  1R1A 1;  2GAU A;  2R07 1;  2XB6 C;  3RZH A;  2JG8 B;  4CUG A;  3O1T A;  4CYD A;  4Z2A A;  1GNH A;  1AX2 A;  2HWC 1;  3I59 A;  5FYB A;  4XE9 A;  1LES A;  1JN2 P;  1UZY A;  4RN5 A;  1HXS 1;  2VAU A;  2VOX A;  1W9T A;  2EAK A;  3T2T A;  2ARA A;  3VD9 A;  1UCX A;  3MDP A;  3LSE A;  1LJ7 A;  1WUV A;  4NAM A;  5FPB A;  5CA6 A;  2C4X A;  3E5Q A;  3OD0 A;  2PHU A;  2Y6F A;  2HWF 3;  4K20 A;  1AYN 2;  4UW6 A;  2RS3 2;  1LCL A;  2VEC A;  2AZ5 A;  2ZEX A;  1CIW A;  2R06 3;  2XL7 A;  2YPD A;  1J58 A;  1NAE A;  3IMM A;  4DB5 A;  5A33 B;  1AXK A;  2WLP A;  1CJP A;  3L2H A;  4P5H A;  3HMY A;  1GNY A;  4KU7 A;  3WF2 A;  1US2 A;  4QPG A;  2EXH A;  1AR6 2;  3SNM A;  2Z79 A;  2RMU 3;  4NPR A;  1UOJ A;  4GKX A;  4IEO A;  4RGG A;  4XC9 A;  4AL9 A;  3I7D A;  4NHL A;  1ZZ7 A;  4MYE A;  1YC6 1;  3OPW A;  3ETP A;  3TN9 3;  4LNV A;  1N1S A;  1AX1 A;  4BOW A;  2QQV A;  1D0H A;  1UMI A;  1OOP C;  1REF A;  3ZKY A;  3BU7 A;  1RMU 2;  1JU3 A;  1WMD A;  5FYU A;  5EIY B;  4IV3 B;  4KGG A;  3ZN5 A;  2YUE A;  2FZ1 A;  3BVC A;  5IVV A;  2VZO A;  2D3R A;  1ONA A;  2B8M A;  2D6N A;  2OZJ A;  3SC7 X;  5K7P A;  2B39 A;  3SH3 A;  1JZ7 A;  2R06 1;  2R49 A;  1BYH A;  1OFS A;  1YJL A;  1T6G C;  2C5D A;  1OA3 A;  1S0D A;  2EXK A;  2VG9 A;  2VC9 A;  1TME 3;  3NNG A;  3PHM A;  2QVS B;  4FPJ A;  4JCK A;  2VTX J;  4D69 A;  3W5N A;  3RWN A;  1VAV A;  2P6H A;  2ZGK A;  4H7L A;  2HJI A;  3O1M A;  3CHX A;  5IVE A;  1JYC A;  5SV8 A;  4OZO A;  1RUC 2;  2P37 A;  2WLQ A;  5JCT A;  4YW3 A;  3M1H A;  1IPS A;  1SAC A;  2O1Q A;  2WII B;  2YC0 A;  5LA9 A;  4B4P A;  4ITC A;  5C8C C;  3A7Q A;  2JIJ A;  1BK1 A;  3OGJ A;  4W8J A;  1W6P B;  5ABJ B;  2WZR 2;  3GBW A;  1MZE A;  1MS4 A;  1J83 A;  3T4H B;  4XF9 A;  3MUY 1;  1HRV 1;  2PN5 A;  5GZC A;  1GP4 A;  1B35 B;  1NCR B;  1QHD A;  5E6H A;  1X9T A;  5FMB A;  3Q8B A;  4ZON A;  1IS6 A;  2BOJ A;  5L36 A;  4IND A;  1VBC 1;  1BKZ A;  4JGY B;  5F5Q A;  5AVA A;  1Y9M A;  5FZ0 A;  3VBS C;  4K6B A;  2HLE A;  1CPM A;  1OSG A;  5DUW A;  1JS9 A;  4RGA A;  1B35 C;  1NCR C;  1RYY A;  1UY2 A;  4P00 B;  3AL5 A;  1SPP B;  5FMO S;  1UNB A;  1YFY A;  5TSW A;  4BXS V;  1W39 A;  4SLI A;  4PI0 A;  4BA6 A;  4BDV B;  1VBD 1;  3CZU A;  1J3P A;  3KGL A;  2IFW A;  3PIJ A;  2JE7 A;  2D7F A;  1GQG A;  2BFU L;  1GWL A;  2EAA A;  2QE3 A;  3GZT B;  3GZA A;  5EJ1 B;  5FXW A;  3QD6 A;  2DUR A;  1WW5 A;  4LUL A;  3VHO A;  1BHG A;  2WFF 1;  4O61 A;  2FBE A;  1GZC A;  3LD8 A;  1GUI A;  5IFT A;  2ZEZ A;  1SFP A;  4KGQ A;  1ZRF A;  3DXT A;  4XDO A;  4BQX A;  5JIU A;  3WUC A;  2WNU B;  4COW A;  1RUH 2;  1ULF A;  1TMF 2;  1G9B A;  5K8S A;  1GQP A;  5FYZ A;  4CP1 A;  2JDU A;  4GH4 B;  1ODN A;  5KXD A;  1AYN 3;  2FMY A;  1CES A;  4LIV A;  2G9F A;  1GSL A;  4IUG A;  5FZ3 A;  2VOT A;  1MEC 3;  3ZFE C;  1HRI 1;  4ASM B;  2ZGO A;  3KV6 A;  1WCS A;  2ET1 A;  2GP3 A;  5FP9 A;  1DHK B;  4DOU A;  3OSD A;  5LRR A;  1CAV A;  4UFM A;  1OI6 A;  4URA A;  5D2A A;  4YGE A;  3FHQ A;  3KT4 A;  4QB6 A;  1VBC 2;  4M01 A;  5HCA A;  3N7M A;  3U0Z A;  3ZVX A;  3B94 A;  2VJX A;  1OKQ A;  4XTP A;  1NA1 A;  1RUF 3;  3I4I A;  4JDM A;  1AJO A;  1CAW B;  3CZJ A;  2ZTN A;  1E5R A;  4IE7 A;  4LE3 A;  3S5Q A;  1BMV 1;  1CAV B;  5FZG A;  3UGF A;  1RMU 3;  2X05 A;  2VMC A;  4HVR A;  3VZJ A;  4N9I A;  3O1U A;  2BGP A;  4AHX A;  4AI8 A;  4TLG A;  4OLL A;  4KWL A;  4R9D A;  5LB6 A;  1UZW A;  3BIE A;  4FPO B;  4YM1 A;  2PQS A;  3OBZ A;  2AR6 A;  5FIX A;  2ZZJ A;  2HBU A;  2Y6J A;  3MFC A;  3VDD C;  2VW2 A;  3RZJ A;  1N1Y A;  2IZW A;  4HSJ A;  4IES A;  2K46 A;  4XZU G;  1A3K A;  5LBF A;  3SKV A;  3N9M A;  1JYX A;  3PTR B;  3IBM A;  1CON A;  2BBA A;  1Q8S A;  1YQ8 A;  1U5Y A;  4XJW A;  2NP0 A;  3VBS B;  4M4R A;  5T5L A;  1X8M A;  2VQA A;  5FZB A;  4PIZ A;  4DXS A;  1CWP A;  1J3R A;  5CFC B;  2D43 A;  2QQJ A;  1G86 A;  1VLN A;  2OPK A;  1JHN A;  4BQW A;  1Y7B A;  4MG2 A;  5B4X A;  4HG6 B;  4MGZ E;  2PLV 3;  5DAB A;  4DUX A;  4S2F A;  1PMJ X;  5FZI A;  5FZE A;  3I3B A;  2XUE A;  4OUM A;  4EQV A;  3GDB A;  4DXZ A;  4EN0 A;  3WP6 A;  1IKP A;  4E2Q A;  2VNR A;  5JWP A;  2F6B A;  4CCE A;  1AYM 2;  3VBO A;  3RDI A;  1F4A A;  1RTV A;  2BJS A;  2D5H A;  2HWD 3;  4FPL A;  5FP4 A;  2Q30 A;  4CEW A;  4GWM A;  3NMB A;  3RYP A;  1STM A;  1TNR A;  1WGP A;  1RUJ 2;  1UW8 A;  2Y60 A;  3WNK A;  1WMF A;  1F4H A;  3HOB A;  1QJY 2;  4Y1U A;  5LWB A;  4OYU A;  3GCX A;  1RUI 1;  4LTA A;  1N3O A;  3LZZ A;  4PBP A;  5CNA A;  1W6P A;  5EQU A;  5ABJ A;  5J96 B;  5JOZ A;  1XYN A;  1G6N A;  2WA4 A;  1D2S A;  5I0D A;  1VBE 2;  1FMD 3;  4PBO A;  3RYR A;  3KWV A;  2RR1 2;  3UJO A;  3CDZ B;  1KIT A;  3H50 A;  1ZA4 A;  5DMY A;  5FZ8 A;  2DTY A;  5CAZ A;  4YGC A;  1EPW A;  2AGS A;  4XAB A;  4C90 A;  2WKK A;  1RVF 1;  2WS9 1;  4XJ8 A;  2UYA A;  1US3 A;  5FP8 A;  2SBA A;  1CPN A;  2XML A;  2OT7 A;  3B3Q E;  5FY1 A;  4FTE A;  4JKL A;  1R09 2;  3RRD A;  2ADE A;  1VBA 1;  3Q8A A;  2WO2 A;  2I2S A;  4GH4 A;  3PNA A;  5CFC A;  1HIX A;  1RXG A;  4CCL A;  2WRA A;  5IUQ A;  2RM2 1;  2WNU A;  2WS9 3;  1XU2 A;  2YZ4 A;  3ALQ A;  1M06 G;  4AVC A;  2P3J A;  2VQT A;  3J8F 1;  1EV1 1;  3KMH A;  3LPF A;  1MZ5 A;  4WVV A;  2W46 A;  1YQ5 A;  1R08 3;  3OPT A;  5F5C A;  5FKB A;  3QCW A;  3C8X A;  1LRH A;  2EAL A;  2OQ7 A;  4JKM A;  5BNN A;  3GYD A;  3WR0 A;  4OFG A;  1DGR A;  1PIV 2;  3NNF A;  1OVS A;  4JGZ C;  5CB7 A;  4LQR A;  3ES4 A;  3VUO A;  5LZ6 A;  1IPJ A;  1ULP A;  3TEW A;  1AL2 1;  2VUL A;  1VP6 A;  3I2K A;  3Q8C A;  2XL9 A;  2CDP A;  4JQT A;  2BRT A;  2OZ6 A;  2EA7 A;  1L7L A;  3O0X A;  3OUJ A;  3R4S A;  4Q4X 2;  4AI0 A;  1W8Z A;  4QU2 A;  5KR7 A;  2O0O A;  3R6S A;  3ZSM A;  3J8F 3;  4GUL A;  2HWF 2;  4M4P A;  2W1W A;  5FMO L;  5I8S A;  4Z2W A;  4MGK E;  2VMI A;  5FK8 A;  1FXZ A;  1OVP A;  2DUP A;  1SZB A;  5FKC A;  3O1S A;  3FBM A;  3K75 B;  3MO4 A;  2HKX A;  3A23 A;  4L2N A;  3S57 A;  1GNZ A;  4TSV A;  2FDJ A;  5JMC A;  2CV6 A;  2W08 A;  4C8D A;  2XJS A;  1GZ9 A;  2W92 A;  4QAW A;  1OUS A;  1F15 A;  1YEW A;  1YLL A;  2NLR A;  4LBQ B;  3FFZ A;  3IMN A;  3FFQ A;  4ES9 A;  1PNF A;  4W6Y A;  4EN8 B;  2HEY F;  3ZYH A;  4QXB A;  1XNC A;  3KF3 A;  2D44 A;  5HCB A;  1RVF 2;  5DQ0 A;  2HEV F;  2WYS A;  3PUS A;  5IJR A;  3KD4 A;  4PDW B;  2FCU A;  1MR5 A;  4OZX A;  5AVP A;  5A7P A;  4AVV A;  5L9R A;  2P3Y A;  4QMA A;  2YY1 A;  3MW3 A;  1PVC 1;  1W8N A;  3TOJ A;  2R7E B;  1QWR A;  3DXU A;  2B42 B;  1LOF C;  1S0J A;  3MID A;  5JZG C;  2XPJ A;  3LOB A;  1QJY 1;  4XBN A;  4QPG B;  2XON A;  5C5U A;  2R6Q A;  1NX9 A;  3JUU A;  3MW4 A;  3ST7 A;  4YG3 A;  3HEI A;  1GFF 2;  5IWF A;  3OBT A;  2G1M A;  3I54 A;  2PTM A;  5GZG A;  4GH4 C;  1PVX A;  3IZO A;  5FZA A;  5A33 A;  1JOD A;  1JTZ X;  1YUD A;  4YW4 A;  1ZZB A;  1HXS 2;  3H1Y A;  4B8E A;  5JDB A;  3NVC A;  2JDY A;  1RUE 1;  3THT A;  2J42 A;  3X29 B;  3D4K A;  3UKV A;  4CDU C;  1YQC A;  1HN0 A;  1S0G A;  2VCB A;  3PJQ A;  5FYV A;  3LB9 A;  3WIN E;  1VMF A;  1PM4 A;  2PAE A;  4IL7 A;  3WQ0 A;  2XXZ A;  5F2S A;  1CAU B;  1ZBA 1;  2VW0 A;  4NRQ A;  4G4F A;  3U37 A;  2H0B A;  4JGY C;  1VBB 1;  2FHR A;  1HV1 A;  1PVC 3;  4JAA A;  2CY6 A;  5EHD A;  3DF0 A;  1AXY A;  1SBF A;  1QXP A;  3BPZ A;  4MET A;  3BOW A;  4QPI B;  5KHK A;  3I2F A;  2YFZ A;  2ZX2 A;  4HMZ A;  4N8M A;  1GZW A;  2XLA A;  4XDQ A;  2ATF A;  2E63 A;  2QZ3 A;  1FV3 A;  3OD4 A;  3MBW A;  2IC1 A;  2LS6 A;  4AI3 A;  2R04 2;  5H9Q A;  1WW4 A;  1DGL A;  5FZ6 A;  1FI2 A;  4QB2 A;  3H1W A;  2WNO A;  5DUX A;  1AX0 A;  1LU1 A;  2K9Z A;  2TBV A;  1H1M A;  2Y8K A;  2ZHL A;  3CJI C;  3KV9 A;  2XHK A;  3LDR A;  3SIT A;  4XBL A;  2HYX A;  1NZC A;  3USU B;  4E2S A;  2ZCW A;  4J25 A;  3TEZ A;  3AP6 A;  4KNC A;  4RR3 B;  5FYM A;  2R07 3;  4HKW A;  2W9X A;  4XF0 A;  1JYV A;  4XDP A;  1GP5 A;  2ZHK A;  4CDQ B;  2JDA A;  1BEV 1;  4OUS A;  1H8V A;  2V09 A;  4XIK A;  4A6S A;  3OTF A;  2ZZQ A;  1VE0 A;  4KG0 A;  1PMH X;  1POV 0;  2R30 A;  5EJ3 A;  1QXJ A;  5JUV A;  5FY7 A;  2DVF A;  1ZBE 2;  2L9L A;  2JDZ A;  2UY9 A;  2VM9 A;  4EE2 A;  3OGV A;  4KWK A;  2JIC A;  1PNG A;  3WCS A;  4BLI A;  2G9G A;  2ZS6 B;  4XOG A;  5D8A B;  3S7I A;  3FUQ A;  4NRP A;  1V9U 2;  3UV9 A;  3WDX A;  3WSO A;  4AGR A;  4CDX B;  1UY1 A;  4MH0 E;  2XKO A;  1LOA A;  5FWJ A;  2BBV A;  4ONU A;  1SLA A;  4LE4 A;  4LBM A;  1OQ1 A;  2XJV A;  2WSU A;  5GLT A;  5A7W A;  2XWB B;  4ZKT B;  4WZF A;  5I8T A;  3I59 B;  2A71 A;  4AF9 A;  2CL2 A;  2X53 S;  3E97 A;  2RE9 A;  4YG0 A;  2GND A;  5A3N A;  3MV0 1;  4NPL A;  5F8P A;  1N1V A;  2R04 1;  3NNL A;  4CCD A;  2DBN A;  4OCT A;  4P14 A;  2A3Y A;  1ZZ9 A;  4YZ1 A;  2BQP A;  2ZGU A;  3IDB B;  4BWO A;  4NO4 A;  4JRA A;  3I97 A;  1AL0 G;  4WM8 A;  5FY4 A;  1EAH 2;  1F5F A;  4DIQ A;  4DPN A;  1HLC A;  2H6B A;  1SMV A;  1O8S A;  3K3N A;  3NV2 A;  4GJZ A;  1UPS A;  1JW6 A;  4RQP B;  4C0B A;  3ZPY A;  2WYF A;  2WFF 2;  1IHM A;  5J09 A;  5J36 A;  4COU A;  1JMU B;  1S0C A;  2PAK A;  4Z1V A;  3ZFE B;  1E5H A;  3DPR C;  4YVS B;  3WHT A;  1QQP 2;  2XH6 A;  1AZD A;  1VIW B;  3ORJ A;  5A7O A;  4IE0 A;  1W6Q A;  2WT0 A;  4GMP 0;  5C4W A;  2VOW A;  2XR4 A;  2HBT A;  1IZ3 A;  3FN9 A;  4IER A;  4UYB A;  5C5T A;  3PLQ A;  1K42 A;  5DUU A;  1UXZ A;  5DG2 A;  1T2X A;  2WR9 A;  3D5O A;  2TEP A;  1MS5 A;  1W8H A;  2QQI A;  4OQ9 A;  2XG3 A;  1TMF 3;  3AFK A;  3VBU C;  2MPF A;  4GWI A;  2VBB A;  5FTT C;  1ZRR A;  2W87 A;  4AED B;  5BNP A;  1LR5 A;  4XJU A;  1AVB A;  1CR7 A;  2XBO 2;  1MEC 2;  1UF2 C;  2CHH A;  3O12 A;  1LEC A;  1TG7 A;  3C7H A;  2NZ9 A;  2WUH A;  4FOW A;  1S0B A;  3ZSL A;  2HWB 2;  5LCW L;  3MPB A;  1W6M B;  1CGP A;  3WF0 A;  3U1X A;  1HQL A;  4IE5 A;  5FXZ A;  3U4S A;  1OQE A;  5E88 A;  2WAA A;  3HAG A;  1Z0H A;  1OOP B;  2DCT A;  4BH9 A;  2ENR A;  5C3P A;  1NZI A;  4A41 A;  1HRV 3;  1EV1 2;  5BNQ A;  4FO9 A;  3VHN A;  1RUN A;  2XJU A;  3OBA A;  3N36 A;  1YI9 A;  3A4U A;  2D3S A;  1RUD 3;  3VBH B;  5EV7 A;  3U75 A;  4JZR A;  4AEM A;  4CSW A;  3OY8 A;  3AFG A;  4HKO A;  2WO3 A;  1BBT 1;  5GAL A;  1NY7 1;  2G9Z A;  4Q4V 3;  1QJU 3;  4XFH A;  4KWU A;  1NCQ A;  2B46 X;  5I8Y A;  1QNW A;  3B69 A;  4Q4W 3;  5FO8 B;  1W8F A;  4QM8 A;  5T50 A;  1GKB A;  1OHF A;  1DP0 A;  5LRS A;  2ZHM A;  1N3Q A;  1RUI 2;  3ETQ A;  3BCW A;  4RL7 A;  3C3V A;  5L7O A;  4Q4V 1;  1GAN A;  1QDC A;  2BZD A;  4AVS A;  4DUW A;  1GR3 A;  5FUI A;  5IFP A;  2Y64 A;  3ZOI A;  4BU2 A;  1V00 A;  4XFC A;  4GQ7 A;  5BUV A;  2EXJ A;  2UU8 A;  4XUR A;  2D6P A;  2J1V A;  3LEG A;  3ZN4 A;  3LA7 A;  1YQ2 A;  1DU3 D;  1YIP A;  2CWS A;  1PO2 3;  1KS4 A;  3H1M A;  4A2U A;  2BOI A;  1AR6 3;  4CUA A;  2Q1M A;  1DQ5 A;  1W2A X;  1HJF A;  1OBN A;  3H3L A;  4LBQ D;  5JR7 B;  3LQC A;  1BBT 3;  2ZGQ A;  2NM1 A;  4QQH A;  3DL3 A;  3SQO A;  3ZIW A;  3HBZ A;  1LOE A;  3MPP G;  4IEQ A;  4IEU A;  2XHN A;  4LHK A;  2P6C A;  2VTF A;  4E27 A;  3WW3 A;  3ZFF B;  4BE3 A;  5FZD A;  3TN9 2;  2ZXQ A;  2GMP A;  4DUV A;  3CEW A;  4FPF A;  4Y1Z A;  5JOX A;  3POI A;  5FOB B;  3J8F 2;  1IGO A;  1RUJ 3;  3IKW A;  4I0B A;  2EIE A;  3JD7 3;  3VD7 A;  3BI3 A;  1S2K A;  1W6O B;  3SCF A;  4I01 A;  2VW1 A;  2VZ3 A;  4YZ2 A;  3ZM8 A;  1K5M B;  5HV4 A;  3RYK A;  2DWR A;  5LA0 A;  4PIX A;  4YNI A;  3PUH A;  1FMD 2;  2Z4F A;  1WME A;  4K1Z A;  3WW4 A;  1WZX A;  1XU1 A;  3KCC A;  1IS4 A;  4GWJ A;  2W1S A;  5T55 A;  1V6I A;  2PHD A;  3O0V A;  2ZJC A;  4XQD A;  1PZ7 A;  1GU3 A;  1ND2 B;  2RM2 2;  2ZAB A;  3JBG 3;  2Q8O A;  3Q9O A;  2C9A A;  4ISR A;  4QGN A;  4A7Z A;  1WCU A;  4XJZ A;  3W59 A;  4U2A A;  3VD5 A;  1UU6 A;  3P5B A;  4PQ9 A;  4R4Z A;  4YW7 A;  4E4H A;  3BUC A;  1OD3 A;  2A6Z A;  1C8M 1;  1LAJ A;  1W04 A;  5FZO A;  1DF0 A;  1N3P A;  2VL4 A;  2RS5 1;  4JC1 A;  2HWB 3;  3VBR B;  3C7E A;  2GP5 A;  3WG1 A;  2VPV A;  2WZE A;  4QQ2 A;  1S0E A;  2ZEY A;  3R4D B;  1FNZ A;  4E8C A;  3MIB A;  5IW0 A;  3HVD A;  1NCQ C;  2RJL A;  4XEZ A;  1QEX A;  2QQM A;  3J26 N;  2Y6H A;  2IWG B;  4RFT 0;  1APN A;  5I0S A;  2QQL A;  5CKM A;  1WCQ A;  3JQW A;  5EPA A;  5A1F A;  5JXI A;  5FY5 A;  4M00 A;  2ZBJ A;  3E1F 1;  4AVT A;  4MGT A;  4AI9 A;  3OPZ A;  3N9Q A;  5IK5 A;  2Z69 A;  3RI8 A;  4LOR A;  4W50 A;  3EXU A;  3SIS A;  4IEP A;  4YVW C;  1WLT A;  3RZZ A;  4EN6 B;  2FDF A;  2HWC 3;  3FJS A;  4MLO A;  3M70 A;  4AFB A;  1O3R A;  1GMM A;  1F31 A;  2E51 A;  3WNP A;  1QDO A;  1V70 A;  4RHV 1;  2YU1 A;  3J7L A;  5DZG A;  4N43 B;  2X5I B;  1DQ6 A;  5FBZ A;  2ZOE B;  3WP3 A;  5IK8 A;  1JZ5 A;  1W2N A;  3ZYF A;  4P08 A;  4R9C A;  1EUT A;  5A3O A;  3VV1 A;  2Y26 A;  1UQX A;  2JE8 A;  2YV8 A;  3DUI A;  1H8T B;  1AR8 2;  1RC6 A;  3OY8 B;  4EZ4 A;  3OUI A;  4QU1 A;  3WNN A;  5L9B A;  4NMI A;  3NQH A;  3KV5 A;  2HEW F;  1Q8Q A;  2WA3 A;  3J7M A;  4NID A;  5FY0 A;  3MLJ A;  1BK0 A;  1BMV 2;  4LO7 A;  1QJF A;  2GZW A;  2VXJ A;  4XMI A;  5JOY A;  3I2G A;  4WVW A;  1UU4 A;  2QQO A;  3ZXE A;  5CFD B;  3VKF C;  1ZYB A;  4LOS A;  3SKJ E;  3WNM A;  5AC9 2;  2GME A;  1G9D A;  1E5I A;  5FQ0 A;  2YGL A;  4LIU A;  5FZF A;  1PM7 A;  2I45 A;  5DAP A;  5HV0 A;  3AKP A;  2UWA A;  3NJZ A;  3NKG A;  4XXA A;  3WV6 A;  2IXK A;  1XNB A;  2E26 A;  2ZX4 A;  2C9K A;  4BMB A;  4UBH A;  1PGW 2;  1LGN A;  1F8V A;  1TME 1;  5LK5 A;  2BP6 A;  4JV4 A;  3DV8 A;  4AAP A;  1BXH A;  2PHR A;  1K3I A;  2ARB A;  1W6N B;  4I3P A;  1PX4 A;  2AEY A;  2VVE A;  2LM3 A;  3NAP B;  1QJX 2;  1URX A;  2QDN A;  3MUZ 1;  4QHB A;  1PO1 1;  5E16 A;  5LAS A;  4CDU A;  4CVU A;  4NIG A;  5A3L A;  5FZ1 A;  2BDR A;  1UYY A;  2HYK A;  4P9L A;  1C1F A;  1O8P A;  2E32 A;  1A6C A;  3AMP A;  2WO7 A;  1A78 A;  1NCQ B;  2E31 A;  1CN1 A;  2SLI A;  3AVR A;  4YVS A;  3P3N A;  3LSD A;  2VUA A;  4HT1 T;  4CCC A;  5LW9 A;  4DXR A;  3O1V A;  1WA4 A;  3VL8 A;  2JG8 C;  2KA3 A;  2P17 A;  4CU6 A;  4RQP A;  2YC4 A;  4FPC A;  2V72 A;  3PDQ A;  1UYZ A;  1N1T A;  4XET A;  1R64 A;  2CNA A;  1D4M 1;  2BU9 A;  5CKQ A;  2VOV A;  2ES3 A;  1YI7 A;  5FLH A;  2PHF A;  4LPL A;  1V6N A;  4MAD A;  4IV1 B;  3ILF A;  3GXU A;  1UU5 A;  3GBF A;  3WT3 A;  5AFB A;  1CVN A;  2HWD 2;  2JD4 A;  3I2J A;  5C3S A;  4GZ9 A;  1JH5 A;  3AZW A;  4XVH A;  3BOP A;  3HIF A;  4KI5 M;  4Y1Y A;  1RUD 1;  1UWW A;  1AYN 1;  4XHX A;  4ZXE A;  1YJK A;  5IK4 A;  3SXW A;  5FPU A;  4CXY A;  3AMQ A;  2J1A A;  2UUR A;  2HH9 A;  2JG9 A;  1OA4 A;  2PQQ A;  1V6O A;  5FLJ A;  3DCQ A; 
#chains in the Genus database with same CATH homology
 1JOP A;  1S4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...