1S4CA

Yhch protein (hi0227) copper complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
155
structure length
150
Chain Sequence
b'MIISSLTNPNFKVGLPKVIAEVCDYLNTLDLNALENGRHDINDQIYMNVMEPETAEPSSKKAELHHEYLDVQVLIRGTENIEVGATYPNLSKYEDYNEADDYQLCADIDDKFTVTMKPKMFAVFYPYEPHKPCCVEKIKKLVVKVPVKLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein HI0227
publication title Crystal structure of the bacterial YhcH protein indicates a role in sialic acid catabolism.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Structural genomics, unknown function
total genus 39
structure length 150
sequence length 155
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04074 DUF386 YhcH/YjgK/YiaL
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.370 Mainly Beta Sandwich Jelly Rolls YhcH/YjgK/YiaL 1s4cA00
1S4CA 1JOPA
chains in the Genus database with same CATH superfamily
3RS6A 3LAGA 1S1AA 4PDWB 4DUXA 4LBKA 3SC7X 4NE9A 4QHBA 5FPVA 2XR4A 3AMQA 5DXDA 1H6XA 4JGYA 4XMIA 5FLJA 4CCEA 3VD7A 4LT5A 1LHWA 1C3HA 2VVFA 4CUAA 3T4HB 5F7UA 2JG8A 1RUE1 1SBFA 4LNVA 3BB6A 5L7OA 2A75A 4LBQB 4JQRA 5EYXA 1LRHA 5ACA2 5I0TA 1Y9QA 3W5NA 4H55A 1RJ8A 4IE6A 1N3QA 1HW5A 3IAQA 4MGSA 5FCCA 2RJ2A 3OBTA 5C4WC 1CX1A 4M3CA 2ZHKA 3H3ZA 3WD5A 3C2UA 4W4ZA 3MIGA 3E97A 3ZSKA 3C3VA 4XABA 4RFRB 2B5HA 4WM7A 1XU1A 2OQ7A 4OI1A 2XUMA 4XFGA 4AOCA 3KD4A 1QJZA 2OKXA 4MV2A 1SFYA 4DRRA 3WDYA 4AQ6A 1UQXA 1SPPB 2VCCA 5L19A 1GP5A 4IGQA 4J25A 4QU2A 3U78A 4XJUA 4BZ4A 3KV5A 4F83A 3K4AA 1G9CA 4P9IA 2RS31 2AUYA 3LA7A 4E4ZA 2QQIA 4FQZA 2KM2A 5IAXA 3SXWA 3NJXA 5T55A 3P6BA 2P4EA 3LSEA 4URAA 1DGWA 1KDKA 1Q8QA 1TME2 2CAVA 1OOPA 2WINB 1IPSA 2Y6LA 1TMF2 3J8F2 2WDBA 4JKLA 4KG0A 3PTYA 4RR3A 5FZFA 4XJAA 3OJBA 1AR81 3PLQA 4FP2A 3AX4A 1QHDA 2P3KA 3NNFA 5KHHA 2ZGLA 5FV3A 5KHIA 2RV9A 1LNSA 5GLVA 2TUNA 4CEYC 4XFCA 1DQ0A 2ZKNA 2FD8A 5FMBA 3J26N 2W1UA 3C7HA 1XJAA 5I8SA 2JJ6A 2VZSA 3EYPA 1SEFA 2VY0A 4MHRA 3AYDA 2J1VA 4URTA 5DAWA 4Y24A 4AFBA 4QPIC 3U11A 1GYKA 2YU1A 4MYEA 5F3IA 3B7MA 4BQ4A 2NPIA 4HVOA 4QKDA 5FXZA 4AI2A 3FHAA 1KJLA 3GF6A 3LEMA 3F95A 1APNA 3VKNA 3R4DB 1RC6A 4OI4A 3ZX7A 2EF6A 1OA2A 1ZBE1 2JWPA 5H9QA 1JI6A 1XE7A 1E5RA 3Q8AA 3SLIA 3I59B 4CXWA 4XBLA 3I2OA 5AC91 2J1AA 2AEZA 1C8M1 2LS6A 4GH4C 5DAVA 4L92A 2VOTA 3JBG1 3NVCA 4IEYA 1A6CA 5CAZA 3POIA 2RM23 2WZR3 2D6PA 3H42B 1P8JA 4HONA 5A7WA 1W9WA 2MEV2 2X5IC 5JOYA 3NV4A 3O5SA 1J58A 2GH8A 3W21A 2ZMLA 2BGPA 3H8UA 3MBWA 1YLLA 3WLUA 3ZYIB 4RHV2 1RUF1 1LENA 4WBBA 1PGSA 5I91A 4OZOA 2AC1A 3VBRB 4UI9L 5LEKA 4ASMB 3LKJA 4B4PA 3A4UA 3SH5A 1W2AX 2J1SA 3VZNA 5FYYA 1BKZA 1C1FA 1JS9A 2P37A 2G9ZA 4IEPA 5L7OC 1VBC1 1G9DA 1RUC3 2FMYA 3NNLA 2NQYA 4MUVA 4A45A 1SZBA 4RGAA 1K3IA 1N1VA 2GC1A 2KR2A 2OIIA 4GB31 5FOBB 3WSOA 4A7YA 2P3IA 1FPN3 1MQTA 3I8TA 4GKYA 4UFHA 5FYSA 4N53B 3GHMA 4CU6A 4QT6A 1ENQA 3KT1A 2R6QA 4JGZA 4MLOA 3WP3A 4WM7C 1JZ6A 4LKFA 1D7PM 3IMNA 1NCRB 4CEWB 4CE8A 4YW1A 5HCBA 2XLAA 1EAH3 1FXZA 3SITA 3QACA 1YYNA 2VU9A 5JXGA 3B9IA 3VD5A 4FPYA 3CJIB 3H8OA 5EXOA 4D6QA 3OGSA 2WA4A 2EIDA 1CAVB 1XYOA 1OOPC 1FI2A 1S0GA 1T2XA 3HQRA 4O9EA 1F15A 1GSLA 4RR3C 5EYYA 4L8QA 4H3WA 4AHXA 1JU3A 1X9PA 4BHPA 1OLME 1SLAA 2J1UA 5C71A 1PO11 4UOJA 5JOZA 4AL9A 1PGW1 5DN2A 1OXCA 4JAAA 4E9KA 3NAPB 5J3UA 2ENRA 2YHJA 5FZ4A 3AM2A 3KT4A 1RUE3 5A3OA 5FYCA 3AMMA 5FYIA 5CFDB 2QVSB 2GNDA 2R062 2RS52 1ZZ7A 2Q1FA 3IDEA 5BNOA 2JKXA 2GU9A 2W2IA 3LD8A 3RZJA 2ZHLA 2FDJA 4CDQA 4DFSA 1U5ZA 3RZGA 2Q8EA 4NWVA 1GQHA 4BLJA 4CDXA 1V9U1 3NSTA 1H4GA 5GLUA 2BOIA 5BNNB 5DDJ1 1VRBA 4N7UA 3GZTB 3K4ZA 4YGDA 1NA1B 2P3YA 4PQ9A 1WCUA 2RR13 3HN1A 3CF6E 1Q8PA 4LO5B 2XBO1 5JIAA 1NXMA 4G4FA 4UW6A 4Y4YA 2OZJA 3FN9A 1IKPA 1GBGA 1WGPA 1ZVFA 3IKWA 2RS33 3NV1A 5APAA 1UY3A 2VNRA 4AWDA 1GV9A 1UYXA 2CL2A 1LR5A 4XQ4A 4RA0A 1W8TA 1W28A 2EXHA 2VECA 3KLSA 1E5HA 1H1AA 2A6VA 3P5BA 2V4AA 1AR83 1BXHA 2VUAA 1YIFA 3EMRA 4OMDA 4XTPA 2ZX1A 4B4QA 4Z92B 2VVDA 1POV0 2G4IA 2O8QA 2ZTNA 1PVC3 3M2MA 1VBB2 3BU7A 4UF0B 4DUVA 5A7OA 1PO21 3ZKUA 2DBNA 4QPWA 5DG2A 5CB7A 2HBTA 2MNGA 4A3ZA 3IM0A 1LU2A 3B93A 1W0NA 4COYA 3JD72 4OMCA 1URXA 4TSVA 3FX3A 2UWBA 3ZYPA 1CIWA 4OULA 3RMYA 2JDYA 1NAEA 1QNYA 1UU4A 3WNOA 3E5QA 1W05A 3GZUC 2VTXA 3QLQA 3WNNA 1W8OA 4BXSV 4BISA 5C8WA 5KXDA 1RUD1 2R0FA 2VXJA 5C3SA 5AC93 1C8M3 4XBNA 3WNXA 5CISA 1Y4WA 5FZGA 4QX0A 3LOBA 5F37A 3NWKA 3K48A 3TNPB 4QDRA 2GMEA 3VKFC 3H3UA 1VB4A 4YM3A 3MPBA 1OPMA 2VQAA 4UYBA 4IE7A 2VOWA 2A5ZA 5BV6A 1QQP3 4YW5A 5FZIA 3VZJA 1PIV1 5CKQA 2ZAHA 1MVQA 4I30A 5F5CA 4XTMA 4YM0A 3TB0A 3TBDA 4BPZA 4ZZ8A 3DEMA 4X8NA 4N9HA 1CPNA 1PNGA 3DPRA 4XE9A 2W91A 3VD4A 1LEDA 1DQ6A 2WYFA 1O3TA 1O8SA 2VNVA 4EWDA 3OGJA 1J84A 4KGGA 2DVBA 1UY4A 4UXAA 5A7SA 1B35B 1LOAA 2VZPA 2WFPA 5FO7B 2QJVA 2XWJB 4QX8A 1WLCA 1W6OA 4GB33 4EN6B 1H1IA 1ULFA 1UN1A 5DUUA 2ARBA 1GOGA 1JMUB 5HBAA 3WQ7A 3L2HA 4CDXC 4EE2A 1S0JA 1O91A 3S5QA 3B02A 5A1LA 1IS5A 4LLOA 4YW2A 2OS2A 2BFUS 1V6KA 3PTRB 4W6WA 5FIXA 4A3XA 3OSDA 4LITA 3PL0A 3ZXKA 5C9AA 3U4XA 2P5BA 3SNMA 1RHI2 3HR9A 1LOCA 5FP7A 2RJKA 3PUQA 4LKEA 1W04A 2WN3A 4NR1A 4UFLA 5FPBA 3RZKA 2WABA 1VAVA 1WKYA 4XUOA 1RUG2 2VMDA 2LALA 4DXRA 1R1A1 1WBLA 2KA3A 1SMVA 2ZPXA 2A7AA 4CP1A 4EN9B 1BVVA 3S57A 1XSQA 2NP0A 1UF2C 1OH4A 1QNWA 1YIPA 1OQEA 3AK0A 4UW5A 4UBHA 4XXAA 2ZEZA 1RUE2 5GKAC 4AQ2A 1PO13 1AXYA 4K20A 3MICA 4QQOA 3ZMOA 4M00A 5IFPA 5KXBA 1QXPA 1VALA 2A71A 4AG4A 3K77A 1MEC2 3EO6A 3OGRA 4XAEA 2H0BA 5GZCA 1UOGA 5K0UB 4EWAA 1H8TA 3BGAA 4IV3B 4CCJA 2WO7A 3I2JA 1QWRA 5FYMA 4AI1A 4IETA 5DAXA 3TAYA 4P14A 4AAXA 3GJBA 5FZ9A 1UU6A 4DZGA 2A6WA 1ZREA 3VBFA 1VBA3 2ES3A 2YPJA 2R16A 3KV9A 4K40A 3KCCA 1V9U3 3ZYGA 5DDJ3 2VW1A 1UIKA 3NMBA 4JDNA 4MZUA 3IN9A 2XBO3 3B01A 4O61A 3TN92 5B2GB 1AYN1 1S0CA 1WZXA 2VZRA 1NUKA 2GZWA 4P9LA 4XFBA 1EUUA 1RUI3 5LK5A 2CWMA 3VBUA 2HKXA 3HAGA 4IEUA 1F5FA 3IT8A 2VMFA 4QQHA 2O8OA 5F39A 2H0VA 3KGZA 3DPRC 4KI5M 1XE0A 2JB4A 3FLPA 1LOEA 4XUNA 1DQ1A 1HRI2 3M3CA 1W8WA 2XVGA 1WW5A 1PVXA 4YVSC 1D2SA 4HKWA 3U37A 4BCUA 5A32B 5HCFA 4Q26A 4QGLA 2GNBA 2ET1A 5C33A 1Q3EA 4OI0A 2MHFA 3ME2A 3QH7A 1ZBE2 5IYYA 1QGLA 1POV3 1ACCA 2WSUA 3LSDA 1EYBA 5AC92 4LTAA 4KWJA 1DFQA 5EQUA 5A1AA 4HVQA 3MV01 3O14A 4LEJA 3O12A 1TZOA 3IB3A 3JBG2 2XL9A 3R05A 4YGBA 5FZ0A 1FOD1 5FXVA 2D6OX 2PTMA 1U5IA 3MHZA 3SISA 2B8MA 4Q4V3 5LCWL 2ZHNA 4OHVA 2R041 4XF3A 5CEHA 2JDHA 5FP3A 1HKDA 4I0AA 1UPIA 1HLCA 5A1FA 2EA7A 5T5JA 5IATA 3LPFA 3QCWA 1RUF2 1ULGA 3FE5A 4CP9A 3M7AA 1PIV3 3POSA 4M4PA 1PX4A 3VZOA 1RB8G 1ZRIA 4ZHNA 4DO0A 3WUDA 2AYHA 4BWOA 3ZFFB 2Z69A 3BPZA 1VBC2 4QPGA 2FCVA 1RVF1 3TOJA 5A3TA 1NE4A 1KQRA 1V6NA 4NROA 2R1BA 4KWUA 1W2TA 5JSRA 2J22A 3N9OA 3POBA 1BEV2 2JDKA 4LO8A 1AVBA 1H8TC 3UV9A 4A44A 4FTSA 1ND3A 3WP5A 1JH5A 2BOJA 4LE4A 1L3JA 2C4XA 2RDQA 1QEXA 4P9GA 2Q5TA 2ZGUA 4NRQA 4Z82A 3VBFC 2EAKA 4OQ8A 4F8AA 4AQTA 2HYKA 2ZX2A 5T5LA 4HSLA 4P9JA 1AL22 5FWJA 3GDBA 3V0BA 4IESA 4GJYA 5LWBA 1IPJA 3VZMA 3KCYA 1YNAA 2RJLA 5J98B 4BQWA 1N1YA 4LPLA 3OUJA 4ONUA 2YC0A 2IXJA 4L9BA 4Y20A 1KD7A 2LROA 3JQXA 3Q8CA 1W2NA 5F2WA 3KF3A 4BA6A 4E4DX 2QZ2A 2DCYA 4ITCA 1RGSA 4PQQA 2GALA 5FZ6A 4CDWB 2WZ8A 1K42A 2OPWA 1WD4A 5JI7A 3I4IA 1PO12 3WOGA 1PGW2 1N47A 1VBE3 2E33A 2YBPA 1LGBA 3ZYHA 1GFF2 4TZDA 1B09A 4RHV1 1XBFA 3HT2A 1AR63 1POQA 1QJX3 2OXBA 3UJQA 2CDOA 1OQ1A 1H4HA 2X53S 1YQ8A 2PAMA 3MDPA 2BGCA 2WKKA 4P9YA 5CG8A 1QJY2 1R093 5JLVA 4AVSA 3OBRA 5GLZA 2ERFA 4R52A 4YG6A 3MFAA 1LKNA 4CP2A 3WDTA 3OPTA 5GLWA 4FOVA 4LR4A 5FUPA 1NCQA 4HSJA 1V00A 5LA9A 4NPLA 1O3SA 1HJFA 2UY8A 1K5MA 1G7YA 4WVMA 1C1LA 2XLFA 1AXZA 4PF5A 5FZAA 2P2KA 4YVWA 2WL1A 4ZS2A 1J1TA 1O5UA 1U12A 2K46A 1GICA 3T1MA 3W59A 2FDKA 1JZ5A 3H1WA 3KV6A 1LB2A 1C5HA 5A33B 3THCA 3NNJA 2VCBA 5C5UA 4FTBA 2RDSA 2BP6A 3VDDA 3TYJA 1RIRA 2R7EB 3MLKA 4K6BA 4BQ5A 2E9QA 1BZWA 3GM8A 1I5ZA 1Y9MA 4YW4A 2B39A 4XZPA 5FPUA 3BTZA 3ECQA 4LBNA 3S0MA 5FMCA 1LCLA 1OT5A 2PHRA 4AI9A 5FMOS 1XNAA 3B69A 1ODNA 1F8VA 1PO22 1UKRA 4QPGC 1O4ZA 2VUDA 2VXRA 3I3QA 3M8LA 3DN7A 4JQTA 1YQCA 2Y6GA 4LHNA 1OSGA 2VMHA 5BNOC 1MS3A 4KBZA 1UZWA 4X6QB 2HJIA 1GZWA 4WM8B 5C8CA 2B45X 5FLIA 1ND3C 1QJU1 2YMZA 1HV1A 4Y4RA 2VH9A 2HWB2 2RS51 3VL9A 5ACA3 2EICA 1PGL1 1VJ2A 1BCXA 1RUD2 3GNEA 5I8TA 2DU0A 2EIGA 2DU1A 4LBOA 1GKBA 3OGGA 4PIXA 4CCKA 4JCKA 2HWC2 4ISRA 3U75A 5ABJB 1WCQA 1AXKA 3PMEA 1ZA4A 2JEMA 2LM3A 4NJ4A 1XNDA 3OYWA 3N7JA 4XEZA 5CA6A 4FOQA 3USUB 4COUA 5L9RA 1IS4A 2QQJA 2XVLA 5F3CA 5BUVA 5JXIA 5IK7A 2ZABA 4N43A 2FDGA 1OMIA 3ZN6B 2XQXA 2LW8A 4Z2AA 5FK8A 1BJQA 5KR7A 4HK9A 1LESA 4ZXEA 1TME3 1PK6B 3J8F3 4MSVA 2B4KA 1TMF3 3QD6A 1F4HA 2DTWA 2EXIA 3Q8EA 1Q8SA 4JRAA 4NO4A 4HN0A 3VZLA 2NZ9A 4TLFA 4AHWA 1W0PA 4QXHA 1OVSA 4Y26A 3ZSMA 2NN8A 4XQDA 1UW8A 5JPMB 3LEKA 1M4WA 2BBAA 4IDZA 3ILRA 2PN5A 1RINA 2XH6A 2BVBA 4LO4B 1HDKA 2W0XA 1NCQC 3DYPA 1GR3A 2RDRA 3N3HA 3VBHA 1S0BA 2YDEA 3L9JT 5FYBA 1UKGA 2XONA 5E88A 5LY2A 1K5MC 2QQVA 5D2AA 2CYFA 3RWNA 5B4NA 1CAWB 2PHUA 3AC0A 4XDOA 3ZFEB 2IUWA 2PHDA 2EAAA 3ENRA 4NOTA 3O1RA 1UOBA 3ZFGA 4Y22B 1GNYA 1W6QB 4U2AA 4RS5C 4D7TA 3MIEA 3ZR5A 2BNNA 2VBPA 2Z42A 2HH9A 1R1A2 4K9SA 1X8EA 2NLRA 1JYVA 3VDDC 4N8MA 4Q0SA 3GHNA 4AI8A 1IQAA 1MR5A 2MEV3 3P1IA 5K9YA 4L11A 4Q4Y1 3S6PA 4IV1C 4BM8A 5JMCA 3AJYA 3VLBB 3WV6A 1WUVA 2PHXA 2WNUA 2PHTA 5D8AB 1QDCA 3N9NA 3AMHA 4FPKA 4C91A 5T5OA 3MFCA 5A70A 4RHV3 2K2SA 4ZPIA 3WG1A 1HJGA 1HQNA 2BPA2 2A3WA 3WNPA 5IK8A 4V2WA 1J3PA 3GBFA 4XF1A 3R4UA 1G9BA 1SLBA 2CU5A 4QPIA 4XQWA 4UFKA 3KB5A 1BBT1 4AI0A 4CA9A 5C8CC 2W3JA 3KCXA 4MXWB 4EJRA 4P00B 2F4PA 3T2TA 1WMFA 2EXKA 1AJOA 2O0OA 2JICA 1O6UA 2P6HA 3LDKA 3D3AA 3ZIXA 4XETA 2DCKA 2JG9B 4RQPB 3ATGA 4CU8A 1LGNA 4A2UA 2CSGA 1QH7A 4UAPA 2HWD1 5I8YA 2R49A 5ANNA 4S2DA 3VN4A 4BK5A 3N7KA 3GGLA 1LEMA 1S2BA 4K21A 4XZUG 3RG0A 3ZDSA 2JENA 3N7MA 1AYN2 5FZOB 2C0ZA 3PUIA 4CPBD 4RL7A 1FYUA 2QUOA 4HKOA 5H9SA 1SLTA 4IL7A 3UJOA 4FO9A 4FBFA 5SV8A 1E57A 2ZEWA 2PXJA 2ZEYA 5H9PA 1RUG1 5AFBA 2W52A 4FT8A 4N43C 4NIAA 1R64A 3QBQA 1W9FA 4YGEA 1YC61 4EROA 4QX5A 3DYOA 4ZU4A 1X8MA 2GAUA 1LHNA 2ZEXA 4Y1XA 4XUTA 2DWRA 4AQSA 1BK1A 5HV0A 1OUXA 2OVUA 3AVRA 2DV9A 2BV4A 4XCAA 3T0DA 1SBEA 3NV2A 4LMFA 1QH6A 4JTOA 1F5JA 1N3PA 3NNGA 4IGPA 4EN7B 2LRPA 1NXD1 2CHHA 2J1TA 1MEC1 2WT0A 3WT3A 4ZU5A 2VR4A 5DAPA 3VBHC 4KNCA 4QB2A 2RS53 1DLLA 1FOD2 2R063 2R0HA 4FP3A 2IFRA 2WZEA 1W2OA 3FLRA 3GBWA 4YZ5A 1DZRA 5IHRA 4ASKA 4H7MA 3ZFGC 2ZGMA 2R042 1U0AA 4R9DA 2DVGA 4LKSA 5F8PA 3O1UA 2HWF1 5JXJA 2JD9A 4G3YC 1Q8VA 3PVOA 3BUCA 5DG1A 2DFBA 1H0BA 1RJ7A 3NKTA 4R4XA 1MS4A 1AL0G 2YG0A 5FJKA 2C1FA 2F4LA 5FYTA 3SHRA 4BLIA 3MYXA 4YZ3A 2AENA 3TN91 1CZSA 1Y3TA 3RI9A 1AYM2 4OHWA 1GP6A 2Z2SB 2WQ8A 3ZXLA 5C4WB 4M0HA 3AKSA 4I09A 3PU8A 3URFA 1DF0A 1RVF2 2WNUC 5FP4A 2JDPA 2OW4A 1ALYA 4WZCA 2YROA 4MGZE 2VL4A 4MO3M 4CPBA 5TSWA 3NKGA 4HZFA 1HRI1 2EALA 1Q5OA 1WCSA 4TTGA 3OD4A 3OG2A 1WWYA 3LPGA 4S2HA 4ZS3A 1JOBA 3AP5A 1ONAA 4WZFA 2PELA 2X29A 4S2GA 2E7AA 4XYXA 3N9PA 3ST7A 1VBB3 4DOUA 4ET7A 2ZJCA 1FV3A 1XE8A 5LW9A 1S4CA 1X36A 5A80A 2P34A 2QBXA 4IUGA 5FK7A 3JD73 1Y43B 3HNYM 1O8PA 1T6GC 2WS91 1AF9A 5GZDA 4YARA 5FBJA 2N7GA 3GALA 3HQUA 4LK6A 1WW4A 1G6NA 4NHYA 5DZGA 3ZKYA 1OF3A 4CEYB 4LHKA 5FO9B 2R32A 2ZHMA 3F2ZA 3J7MA 5F2SA 3VV1A 3WEZA 3WQ0A 1CAXB 1YFXA 2J42A 3VBSA 1YEWA 1UYYA 2VW0A 4LIUA 4WVZA 4V1PA 3O1TA 3UL2A 3R4SA 4JHTA 3LE0A 4YYOA 5FPLA 2HWE2 4AEKA 1YXWA 3ZSLA 1IS3A 2WNVA 1YO8A 1ZZ9A 5D1IA 4HXCA 4K1YA 5EV7A 3SQOA 3RYRA 5C70A 1UZZA 4MGYE 1G9FA 3E5XA 5ANQA 2QKDA 4GH4B 2ARXA 4HK8A 4R8HA 1JYTA 3O1PA 3SH4A 1XOYA 4JKKA 3UKNA 1UYZA 2VW2A 2VO5A 1SFNA 1XNBA 2CNAA 2X5IB 3ALQA 4LQRA 4R9BA 5IVYA 1JYXA 2ZGTA 1NYWA 5JR2A 5IVBA 4KU7A 3RVHA 1ULCA 2AZ5A 3VDCA 4FPOB 5IAVA 1BEV1 5CADA 1JOJA 4LA3A 2IFWA 4UFMA 4Q0UA 2H6BA 1HX6A 2D6KA 2W46A 1JTZX 4JGYB 3AKPA 3WXPA 3UYJA 3ACIA 1JBCA 2X10A 2XWBB 4CSWA 4B29A 3KV4A 1NLSA 1CAUA 1GLHA 2VUCA 1BMV1 2FQPA 1AL21 1NG0A 2JG8B 5L7OB 2AR6A 4D6RA 1AR92 3TEZA 4IE4A 3CJIC 1DCSA 1RHI3 5FXWA 4J6GA 4NRPA 5KHGA 3CEWA 1RUG3 5FY9A 3HJRA 1QU0A 2JDNA 3KF5A 4M3CB 3OPZA 2QZ3A 2GC0A 4QX3A 1COV1 2TNFA 3BN6A 3KZ4C 3RI8A 2D98A 1MPXA 4UFIA 1CESA 4AE2A 2R072 3HOBA 4AI3A 1CX4A 2CV6A 3FL7A 5T5PA 1OH3A 3J4UH 1QJU2 2DURA 4GKXA 5DZFA 2WNOA 1QJY1 1PGL2 4GWMA 1QXJA 3WW3A 5KC5A 2F6BA 3ZOIA 4KU8A 2WBKA 1MEC3 4AGGA 4JC1A 1Q43A 2VQUA 3WQ1A 1OPOA 4AVCA 1BK0A 1OOPB 3SEEA 4BMEA 4DIQA 3VKLA 4RR3B 1VB2A 5T52A 1IG0A 5BNPA 1X82A 3BYWA 4TYSA 5LBBA 2WJSA 3CU7A 1QOOA 4FXGB 1AR71 5FPXA 3BU0A 1ZRRA 1LGCA 4IEQA 2TBVA 1QY4A 3VBSC 4YZ4A 3J7LA 5FDBA 3WF1A 3E6BA 2C9KA 1UAIA 4AVBA 4AHZA 4LBJA 3RJ2X 2E32A 4NVPA 3VGIA 4GIQA 3AFKA 3MIFA 3RNSA 4MOAA 5EJ3A 2I07B 4H7LA 3TN93 4RGKA 1W8HA 2WNVC 4GAZA 3ZYFA 2A6XA 4PIZA 4Q4W1 4LE3A 3NO8A 1CR7A 4PBOA 4KL1A 4QDQA 1TQ5A 3J7HA 2B9VA 4GMP1 4Q27A 3THTA 1W0OA 5DPNA 4ARXA 2VG9A 1TVGA 3CNAA 3EHKA 3ILFA 1XYPA 5I0RA 1HRI3 4CRQA 1J1LA 1H6YA 4YPJA 3VBOA 5A7WB 4QHOA 5HI0A 3WDUA 1NQDA 3PVEA 4BIOA 4KG8A 2W47A 1UY1A 3OUIA 1TE1B 1ODMA 2MPFA 2GDFA 1GNHA 3UNPA 2ILMA 3ACLA 4XOGA 1WD3A 2VE1A 3LDRA 4QD2A 2HWB1 2ORXA 1ZBE3 2CTVA 2VMGA 1Q8OA 4XC9A 3UETA 4OHYA 5J48A 3RWKX 3LA3A 3JBG3 1C5IA 2BWAA 2VOVA 4BH9A 1W90A 2BW8A 2HWC1 4KMQA 4QB6A 5GALA 5FYZA 5J36A 2RMU2 2WWJA 2X05A 1ZX5A 4Q4Y2 5GM0A 1WMXA 4YZ1A 3I3MA 4FXKB 3POGA 3W58A 2B7YA 4HT1T 3USSA 1MQTB 1U5XA 4OLLA 4CCLA 4Q5OA 2A73B 1GWMA 1UPSA 4QB1A 3KVAA 1RUF3 4CDUA 4E4HA 1OD5A 5FO8B 1XQNA 3NNMA 4LHSA 1YQ6A 4JGZB 4H2AA 4QXCA 2BBVA 1MS8A 1WCKA 5FQ0A 1JYNA 3OGVA 1HQLA 4YVSA 1VIWB 3WF2A 1BBT2 1DGWX 3N35A 4QKFA 3HN3A 4LO6B 1VBC3 2OUHA 4HANA 4G9SB 3GCWA 3I2FA 2C24A 4QM9A 4J1WA 4FOYA 1RTVA 4UT5A 3JQWA 2DUOA 1UX6A 3IAPA 2GN7A 2HWD2 3MO4A 5FZ8A 4A7KA 2W1SA 2L9LA 4ZONA 1BEV3 4A6SA 1OUSA 1DGRN 5HV4A 1KJRA 3PDQA 5BNPC 2BZDA 2GP3A 1W6PA 4XUPA 3FUQA 5G05L 3BI3A 3JZVA 1UU5A 4EN0A 3B5LB 1J3QA 2UU8A 2ZX4A 3AYEA 3EBRA 3T0AA 2PQQA 3ZXGA 2UYAA 1O4TA 4XHXA 1D2QA 1W3XA 4NWWA 3G6JB 1O59A 3ROUA 4ATFA 1AL23 5LA1A 2DYCA 4NMIA 3HNBM 3I3BA 2PHWA 3D8CA 4GJZA 4JV4A 5LASA 5BNOB 4HPKA 2PLV2 2VZ3A 3FUOA 4QXKA 5AVAA 3T0BA 4FPJA 4CDQB 1YJKA 3I2HA 3AKRA 1LOGA 3OY8A 4FFGA 4CDXB 5GZGA 1ZM1A 1HRV2 1HN1A 3IDBB 1COV3 1O5LA 3WINE 2DCTA 5KC6A 3H7JA 1SHWB 2XLGA 2DVFA 2Y0IA 4L2NA 1ND2A 4COVA 2VZOA 3VBOC 3DKWA 3JB4C 3A22A 2PA7A 3A0NA 4NPRA 2WR9A 4Z07A 1SCSA 3DECA 2J1RA 4IV3C 3VB9A 1G9AA 1QJY3 3WHTA 2UY9A 2JD4A 3DGTA 2ZX3A 2JE9A 2JB8A 3T2QA 2HWF2 4NHLA 3T3YA 4PHZA 1VAKA 1UMIA 3K2OA 2EIEA 1ZYBA 3IMMA 4HOOA 4OQ9A 1FATA 3H8XA 2D3SA 1S2KA 5EZWA 4XUQA 1VLNA 5DUVA 1SFPA 3CKHA 1C28A 5FR3A 1F31A 1UZYA 1U5YA 3FFQA 4CXYA 2OYZA 4CDWA 5E16A 2BDRA 3S7IA 2P17A 3S30A 4CXXA 3DV8A 4CCCA 5JZGB 4PLMA 4AZZA 5G04L 2Y38A 4IEVA 3M3EA 4RN5A 4CDUC 2C9AA 5FZDA 5JMOA 3LOIA 5T50A 2K9ZA 2ZOEB 2ZZJA 4NHXA 1S0IA 3RFRA 1ZA7A 1ZZCA 4BYYA 4I0WB 5DUWA 3WZ1A 2D3RA 4GMP3 3VD3A 4PJYA 4CUCA 1D4M2 1GOFA 2D93A 1QIQA 1PO23 2XUEA 3WNKA 2Y34A 3D5OA 2BRTA 2JE8A 4FOWA 2WNEA 1KITA 2PQSA 1WLTA 1HXS1 4QAWA 1X33A 2IXCA 2V72A 3MIHA 2WS92 3IIAA 3BODA 2Q1ZB 3RZMA 5FFOC 1S55A 1JYCA 3ITQA 5LA0A 2XMLA 1VBD2 2LUWA 4LXLA 4M01A 3CZUA 1JYIA 2HWB3 3DPRB 3E6DA 3SCHA 1GUIA 1UX7A 2E51A 1ST8A 1CVNA 1RUD3 3MLJA 2FDFA 1UCXA 2WT1A 1Q56A 1EY2A 4OUSA 5IVVA 4Z2WA 2HWC3 2WWUA 3OF1A 3DXUA 4Y5Z0 1W6OB 5K0UA 3I2KA 3SCFA 2D6MA 1EV12 2NMNA 4HFSA 4N7IA 2O1QA 4QMAA 5CNAA 1CZTA 1G86A 2G1MA 2PHFA 1AYM1 5FKBA 2VD7A 3KVBA 4DINB 2GC3A 2X09A 4NN0A 3WVJA 5C5TA 1REFA 1DZTA 4DXSA 5C9AB 2PAEA 2XGXA 1D0GA 1ND2C 1W9TA 1RUH2 5H9RA 4OHZA 3V64A 3PUHA 1A3KA 1LHOA 2AH2A 4L97A 5AVPA 3AXDA 1ULEA 5FZHA 1SLLA 1MS9A 3PUSA 4YGCA 1US3A 4B3NA 2VMIA 3UKTA 2BTVC 4JHZA 3AP9A 5F6LB 4B7KA 3O1MA 2D40A 1HB3A 2KXLA 5I93A 5L9BA 2DFCA 1FAYA 1BMV2 3NW4A 3UK9A 1PM7A 3MUZ1 1DDLA 2WLPA 3U07A 4P02B 1PMIA 1EP0A 3DL3A 4HL0A 4QQ2A 3K3OA 4B4RA 5CFCB 3AP4A 4EQVA 5FYVA 1H8TB 1CWPA 4CDWC 3ON7A 1R1A3 2ORZA 5LY1A 3VHOA 1COV2 5J09A 1RUNA 3WX5A 4XJWA 3E5UA 1MS1A 3O0VA 5FPZA 1DGRA 1H8VA 3VBFB 1GZ9A 3I2DA 2HWE1 1DYPA 2SLIA 4V2VA 4ES8A 1QDOA 3APBA 1FNYA 4QXBA 2Y60A 1ZRDA 2ZGOA 4XXPA 2BERA 3OEAA 2WO1A 3CDZB 3CIHA 4JTNA 4QGNA 1NLQA 2CWSA 1ASJ1 2VNGA 2ZBJA 4R9CA 3TWIA 1CGPA 3JUUA 1DIWA 1LULA 2RS12 5JWPA 3VBUB 5JAXA 1F4AA 3H7YA 5LRRA 3VHPA 5IVFA 1JZ8A 3AL6A 2IXKA 2JE7A 2P3JA 1AR72 2GMPA 4QWNA 3WR0A 4NRMA 4AEDA 3FZ3A 4B7EA 2VULA 1LOFA 2Y6JA 3KT7A 4R4ZA 3V0AA 5CBLA 2P1BA 5FZ7A 1JHNA 1W6MA 2D43A 3GJAA 4RS5A 3LB9A 1VRH1 1V6MA 4BE3A 5JOWA 2BEOA 2XQRA 3PUAA 3IPVB 5T3NA 2WLQA 4XFHA 4LBQD 1QOSA 1NQJA 1NY71 1AYN3 4CVUA 2A6ZA 5F5QA 1V70A 3IBMA 4Q4W2 1C4RA 3T1LA 1EUTA 1AR91 1YUDA 5FMDA 5E6HA 3I49A 2O14A 2WIIB 3JCIA 4IV1A 2FZ2A 2DF7A 2D6NA 5A3MA 2W39A 1ZBA1 2R30A 4D0QA 3ASIA 1DGLA 2Y6FA 4U36A 3WF0A 3ZXFA 3PVNA 1ZNPA 2VCAA 3I3EA 1DBNA 2DVAA 5C3RA 4DQAA 1FMD2 2VMEA 4AFDA 1O3RA 2R071 1ULPA 4X8PA 3U4SA 3HEIA 2W5FA 2ZMKA 3V65A 3WW1A 4NHKA 1OF4A 2YU2A 5K8SA 1TNFA 1HXS3 2WQ4A 3H3LA 3KM5A 4YW6A 4CP9B 1X50A 1X9TA 3JXSA 3MUY1 1Z78A 4MGKE 4I0BA 1WW6A 3UGFA 4D3WA 2ATFA 2JG9A 4UW4A 2VOKA 4ARYA 5KHJA 1RITA 5A3LA 1GZTA 2IVIB 1JHJA 1I6XA 3CMGA 2D6LX 5F3EA 3K75B 4DY5A 2DBIA 4AVVA 3GCXA 2G9GA 2CGPA 1FOD3 3LIHA 4QPGB 4W50A 1V0AA 5C6CA 5DAQA 5IK4A 4UFJA 1W2UA 1XC6A 1RUOA 3Q8FA 2R043 3M70A 4N9IA 1W06A 1KFXL 3WQBA 4C0HA 1CZVA 5JIUA 5JOXA 3J7NA 3BTAA 4PDWA 3NJVA 4TLGA 1ND3B 1OKQA 2C5DA 2FHRA 3M3QA 5E8AA 2ARAA 2WYSA 4D69A 3O1OA 5A6QA 3OEBA 3ZO0B 4O7XA 5C3PA 4W6YA 2HEYF 1MZEA 1AHSA 5CZKA 2ID4A 1DZQA 3MPPG 1PK6C 1AYM3 1RUJ2 1TEIA 1DHKB 2RG4A 5T54A 5KXCA 3V0BB 3OD0A 1W8ZA 1RVF3 3WCSA 4Q4X2 4LBQA 2YGLA 3WP6A 1V6LA 4Q8LA 3ZSEA 4ZY9A 4XHBA 4Y20B 4BQXA 4IEOA 3AMPA 4BQ1A 3HBZA 1OC1A 3U10A 4NUBA 1L7RA 2VZTA 2XB6C 2OA2A 3FHQA 5FZCA 4AEDC 3ZFEC 5LEJA 1WMEA 1LOFC 3C7FA 4OZXA 3A0KA 1BVP1 1CJPA 2HEVF 3VKMA 1UOJA 1W39A 3HVDA 4Q1PA 4Z8BA 2DTYA 2QTWB 5FY4A 5EIYB 5IK5A 1W6NB 1A8MA 5FREA 1SPPA 3N4MA 4W65A 3T08A 5FPAA 2C6SA 2Q30A 4LBLA 1JUHA 2Y6HA 4WVVA 2Z5WA 4OVEA 4CZSA 2RMU1 2ZXQA 4NIDA 1NCQB 4C0BA 2Q8DA 2VOXA 2XXZA 4INDA 4JVAA 3RZZA 4CP0A 1I3HA 1VMFA 2GH2A 3ACHA 1XSRA 4WVMB 3IDCB 3S5AA 2E7QA 3T30A 1DU3D 2HWE3 4YVWB 4XDPA 3BTXA 2UYBA 3AZZA 2WFF1 1Z7S2 2RM21 4YFZA 2BFUL 5A3NA 3MZHA 1PMJX 1UY2A 4DMIA 1L7QA 1HQWA 1V6OA 2XJSA 2YB7A 4KWLA 3MIDA 5FY0A 3VDDB 3BIWE 2IXIA 5FYUA 4ES9A 1ZZ8A 1GQGA 4DY3A 1DG6A 1OURA 2JG9C 4RQPC 1NX9A 1T6BX 4C8DA 3LCPA 4XACA 3I59A 3NJYA 2K0GA 2QQOA 1O7FA 1QJEA 4XFIA 4BMBA 1A34A 4EZHA 2A3XA 1PMHX 1RUC1 2XKOA 2BYVE 2E26A 1AJKA 4PLOA 4XFFA 2FDHA 3ZM8A 4XF0A 1GZWB 4PDWC 5C8CB 1FPN1 4IQPA 3C7OA 3P3NA 5IUQA 3ILNA 1C57A 2WZPP 5BNQA 1AR93 1JODA 4FPHA 2PLV1 2ZMNA 3VBRA 4QHZA 1WA6X 1D4VB 1RMU1 3AZXA 3BTYA 1DYOA 2BWCA 3O7OA 3FFZA 3LFIA 3POWA 2BJSA 1HRV1 4L0PA 4A4AA 1GU3A 1SLCA 1EAH1 1UWWA 1HXS2 2E7TA 2QNKA 3R0RA 1EPZA 3BKZA 2R073 5FZ3A 3OYWB 1IG3A 2XJUA 4TN7A 2Y8KA 2DVDA 2A3YA 3NQHA 1QJU3 4N53A 1PHMA 2V4VA 2Q8CA 4N43B 1REDA 5HXVA 3PIJA 2VBBA 1TG7A 3L2YA 3BOPA 3RMXA 1JXNA 3VUOA 2QFEA 4HG6B 1UMHA 2D97A 2IXHA 3V56A 1JW6A 1NCRA 4CEWA 4GD4A 4HN1A 2WQZC 4N90A 1C8NA 4M3CF 3HIFA 2XJQA 4NIIA 1TNRA 1HV0A 1W8UA 3HT1A 5JSPA 3T4VA 2WSVA 1M06G 2JDZA 1XNKA 3VHRA 2OT7A 3CJIA 3KHBA 5A7QA 2C26A 4CCOA 2IZWA 1WBFA 2D3PA 3CLPA 4KH9A 4LA2A 4YW7A 1OFNA 1CAVA 1WMDA 1CONA 3CQOA 3VBHB 4QX7A 2VBDA 1OLMA 3Q8BA 3RPQA 3WP4A 1SQ4A 1EPWA 2XKPA 2YY1A 2ZGNA 3MLLA 4PCRA 4E27A 5J7MA 3AP7A 3T09A 2XHNA 3DXTA 1N3OA 5CIRA 2PFWA 2RR11 3NAPA 3VZKA 3ZFGB 1NT0A 3BVCA 2BU9A 3X29B 5FUNA 3LEGA 4DB5A 5KHKA 4PLNA 5A6YA 3PVBB 4K1ZA 1ZZ6A 1E5IA 2YC4A 5CFDA 4JRLA 1D4M1 1AX0A 1JUIA 3OTFA 5A3UA 3IDAA 3ES1A 3KS7A 2EIBA 4AGVA 1ZZBA 3KQ4B 1OHFA 1ENRA 3KWVA 4K8RB 3LDBA 3ZMNA 4EYUA 4OUMA 3AZVA 3THPA 3QH6A 3M4FA 3AMNA 4NAOA 4YM1A 1ZRFA 5BNNA 1KS5A 2JDUA 4ZZ5A 3WG2A 2WNUB 1R082 1NA1A 2XJPA 4ASLA 4GWNA 1VBD1 3D6EA 1PVC1 3H0OA 4LLFA 2GMMA 5FZMA 3N9MA 4AVTA 1YWKA 3UESA 4FPFA 2ZGSA 4AGRA 5EWSA 4PIYA 2I45A 1OA3A 3AYCA 4QPIB 3E6CC 2EXJA 3Q9OA 1NE6A 3ZXDA 3CHXA 3CZJA 4PF1A 4WV8A 1WCDJ 5K4LA 1UMZA 1VP6A 2QQKA 2BQPA 2RMU3 1NOVA 5A3WA 1WLDA 2J7MA 4Q4Y3 1UXXX 5EHDA 4AAPA 5FLHA 5J37A 3VBRC 4IW3A 4BIFA 4XCBA 1EV11 1JOPA 5FKCA 4TWTA 4XAAA 4R9AA 3SH3A 1HIXA 3OCPA 5JVVA 5DZEA 2WFF3 1SCRA 1ASJ2 2DUQA 1Y9GA 4RD7A 4UF0A 4CYDA 5I0UA 2HYXA 4MVTA 1RUH1 2B42B 1AZDA 1GOHA 1BBT3 1QQP1 4HBNA 1GWLA 2Q4SA 4N53C 5LBCA 3O1VA 4GA9A 3IIIA 4IEWA 4CUGA 3HPNA 1ULOA 1UL9A 1AX1A 2UWAA 4IE0A 4JGYC 3RYKA 2IVJA 1LJ7A 2ZKLA 3ZXEA 4H14A 1VRH2 2HWD3 1YFUA 4XURA 4A41A 3TNQA 4DUWA 3ZVXA 1NCRC 1GQPA 3POJA 4RYDA 2W92A 5LATA 2E63A 4AXOA 3PJQA 1X7NA 2JG8C 3AXEA 1H9PA 3H1YA 1NY72 4AFAA 3J9SA 4DRVA 3PNAA 4C90A 1W8NA 3C8XA 4FVVA 5JUVA 3PHMA 2YV8A 2VTFA 4D7SA 3M1HA 2Z79A 1ZBA2 1KEXA 4RSUA 4I02A 3KMHA 1XU2A 4UW3A 1OBNA 3FWEA 2VMCA 5J96B 2PLV3 3DYMA 4M3CE 5LBEA 4BQ2A 3RQ0A 3UGHA 5F5IA 4WM7B 1RMU3 1US2A 3NAPC 4JKMA 2D5HA 1H2NA 5L36A 4AK3A 3VKOA 3K3NA 1HRV3 1W8FA 1B35A 3LA2A 5CFDC 3WW2A 3ETPA 1I5PA 2FCTA 5FY5A 2R1DA 5FY8A 4CU9A 1IGOA 3KSCA 3M3OA 2CGOA 5HCAA 1JN2P 4DPNA 2ZGKA 1ENXA 4XFAA 4K7JA 2RS11 3D4KA 4L99A 1WLWA 4O65A 2W08A 4OHXA 2FBEA 3THDA 5BNNC 5JI9A 1IS6A 2E6VA 2XOMA 1NA1C 3IWZA 3PMSA 5FMOL 3INAA 3AFGA 4ORFA 4XF9A 4YLZA 3TEYA 2HWF3 3MF9A 2I74A 5FJHA 2A1XA 4B1LA 3FMGA 2WAAA 2WWSA 2BNOA 4GMP0 4XIOA 1OLRA 4JZRA 1W99A 2WA3A 1VBA1 2ZACA 3AKQA 3GZAA 5CVRA 5FWEA 1AX2A 4RFT0 2YZ4A 3MV11 4I3GA 2HBUA 2WC2A 1V6JA 4MG2A 5ERLA 2Y0OA 5FZBA 3KGLA 3ACGA 3AKTA 3NV3A 2QQPA 3WCRA 5KWRA 1PZ8A 1LODA 4EWEA 1Y7BA 3P3PA 1YQ2A 2YXSA 4LJHA 4P9WA 5JSOA 5KXEA 3ZXJA 3ZXAC 3VBSB 4YG0A 1MZFA 1FMD1 1IPKA 2KD7A 3FHIB 1DQ2A 3N7LA 1D4M3 4IV3A 5EJ1B 1S0FA 3SEPA 1RUI1 1XNCA 1F2NA 4XW3A 1NKGA 3ABZA 3AL5A 5IVJA 5LB6A 4YG3A 1OFSA 5IW0A 3WY6A 5J1XA 4XVHA 5D21A 2WNVB 4FCAA 4MHUA 4YWAA 3ES4A 2WS93 5FUIA 5A6XA 2I2SA 4X6RB 3VD9A 1WA4A 4XMAA 1J83A 3G7DA 1VBD3 3POYA 3A21A 3NRUA 4QQPA 2D44A 3NL1A 1CIYA 1YFWA 3DF0A 1BYHA 3N36A 2RE9A 3U1XA 2ZAAA 4GWJA 5E89A 5IFTA 4AYUA 5CG9A 1REEA 1YJLA 4LK7A 1K45A 4IGOA 5FAXA 4XPVA 4XDQA 1POV1 1NZCA 1GZCA 4YW3A 1MQTC 4Q0VA 3ZDVA 4E2QA 2VVEA 2VJXA 2VC9A 4RGGA 1YHFA 4XJ9A 1UO9A 5JZGA 3ACFA 2WFF2 2RM22 3N9QA 2JKBA 2WZR2 4FTEA 2FZ1A 4JGZC 4CCNA 1R1ZA 3DCQA 2OUJA 1EV13 2XVKA 4KQ7A 5HCHA 4OCTA 5FZLA 4HKLA 4CEWC 4HLTA 5A32A 1VMJA 1CAUB 4Q4V1 4HETA 1RUJ1 2XJTA 1B35C 3RRDA 5FYHA 5F6KA 5FRAA 2V5YA 4YRDA 1HB4A 3I7DA 4Q4X1 2YGMA 1VMHA 1RUH3 4ATEA 1UZ0A 4CTEA 4YSFA 5L9VA 5DQ0A 1XB9A 3AJZA 3N9LA 5FTTC 2CAUA 1GP4A 1JU4A 4LOTA 4Y1UA 4CCMA 1RUC2 3LWCA 4D6SA 4QQLA 1H1MA 4XBQA 5FOJB 4CU7A 4M4RA 2XG3A 3AVSA 1FPN2 2W1WA 4XJ8A 4BDVB 2NYYA 4JDOA 2JIGA 2WT2A 3B00A 3I54A 2JDAA 3MGUA 3M3IA 3TRSB 4FQ4A 4CDQC 1QJFA 1OD3A 2UURA 1FV2A 1RMU2 4YM2A 5DMYA 4C1WA 1PX3A 2BNMA 3ZFFA 4AEJA 2VQTA 5BNPB 1IKQA 1IZ3A 1UD1A 1SACA 1EAH2 2VZQA 3POEA 2ADDA 3UKVA 5LA2A 1CN1A 5CU1A 2YFZA 2QQUA 3RSJA 3LF7A 3EXUA 1Z7S1 4PI2A 4FPCA 5EP9A 4ZKTB 5K0UC 5LK7B 1XYNA 1PZ9A 4Z1VA 3K46A 1SG3A 3ZLIA 1DYKA 3ZR6A 3BALA 3VHNA 4LO7A 1STMA 3MW2A 1VBE1 2QQLA 3LGRA 1DQ5A 4KBBA 3VDBA 5JR7B 2IXLA 4IEXA 4JX0A 2VCMA 2RS13 3GZEA 1QMJA 2WO2A 1XNTA 1AR61 2Y64A 1QJX1 4K8FA 1YRZA 4UBGA 5IJRA 2WAOA 2XDVA 4SLIA 3IZOA 1AR73 4J1XA 4YNIA 1R091 2VZUA 4YZ2A 4D94A 4O9GA 3BCWA 3HD8B 2PYTA 4FFFA 5CFCA 2AACA 3VBOB 3HNMA 2QQNA 3BIEA 4ZU7A 3DUIA 1VPHA 5GJ6A 4IEZA 4BOWA 5JZGC 2NM1A 4LOSA 4OUEA 3B9CA 2PMWB 5C3OA 1UY0A 2RR12 3B3QE 4AEMA 4FPGA 4Q4W3 4QU1A 4E2SA 2W87A 1IOAA 5F9TA 1OVPA 2GSYA 4GQ7A 2V09A 4Y5SA 4I3PA 5B4XA 3GBGA 1XXNA 2RS32 3W5MA 2V73A 2VPVA 2YBKA 4DXZA 4AFMA 5LZ6A 3UT0A 1CQ9A 2E53A 3RJRA 4GULA 2HLEA 1W9YA 1FMD3 1NLRA 1OLQA 2GNTA 5FP8A 3WDVA 4BJ0A 5JCTA 1AR82 3MEPA 1HB1A 4Q1RA 1MVEA 5FP9A 1OA4A 1ZRCA 4FPEA 4KWKA 3A23A 2QDRA 1PVC2 5CKMA 1F35A 4CDUB 5A6ZA 3T2PA 1DP0A 5JDBA 1D0HA 3MF6A 4QM8A 4Y1VA 1MS0A 2NMOA 4YVSB 5FQ0B 4GXLA 1PZ7A 1YCIA 1H9WA 3CL1A 3OOXA 5A33A 4HMZA 4JDMA 3JB8A 3RGBA 4NIGA 4BK4A 3IPVA 3ELNA 2QQMA 1XRUA 2ZX0A 4EV0A 2UWCA 5JPNB 2W68A 3KHCA 4F7ZA 2E31A 2GC2A 2GNMA 3PU3A 3ZPOA 3RZLA 2ETEA 5ACA1 4FPLA 1LHVA 1LAJA 3WG3A 2D5FA 3RYPA 5FBZA 1C8M2 3W9AA 4E2GA 3H8RA 3ZFFC 5EFUA 3B94A 1W6PB 4LKDA 3FBMA 2A6YA 4SBVA 5KBFA 5C9AC 3RZHA 4LBMA 4FAHA 5A3PA 2VNOA 1YFYA 3WHUA 4E8DA 2WO3A 1QQP2 4Y1YA 1SBDA 1RUJ3 1KDMA 3ZN5A 4A42A 4EN8B 4Q2FA 1MS5A 2Q8OA 4WM8A 1ULDA 4XJZA 3OUHA 3CBNA 4LULA 5DABA 5L73A 4Q4X3 3EQEA 1FT9A 1Z0HA 4HPKB 4CUBA 2GP5A 2ZGRA 3BPSA 3AP6A 2XHKA 1BHGA 3OY8B 1UZVA 2Y33A 3LQCA 1TME1 1H2KA 3MI8A 3J8F1 4IXLA 4BB3A 1TMF1 2FCUA 2PHLA 3BOWA 4FAGA 4E4SA 1BQPA 1V6IA 5A7NA 5ABJA 2V5DA 1JZ4A 1LU1A 3ZYBA 5EJZB 3WUCA 1R081 4GB32 4BU2A 1ND2B 3MIBA 5CFCC 1OI6A 2OPKA 3USUA 2A70A 3ZYRA 2CY6A 3AZWA 1XPWA 3SKJE 3I97A 4GALA 4DEVA 3K51A 1OQDA 5CKNA 2G19A 4K3UA 4MXVA 4QDSA 3EB7A 1MACA 1MZ6A 2GN3A 4PI0A 3ZN6A 5C3QA 5SV5A 4COZA 1I1EA 1N1SA 3T2OA 4W8JA 1PK6A 4GWIA 3ORJA 4Y1ZA 4NHMA 4QKBA 3WF4A 2OX0A 4UWDA 4XIKA 4BXFA 3K4DA 3ZYJB 5FZKA 2VZVA 1O4YA 2HEWF 1H30A 3AB0A 3C7GA 3ZN4A 2XJVA 2VZ1A 1Z7S3 2VUJA 1IQDC 4NAMA 4Q0QA 4Q0PA 4NIHA 1KFUL 4P9XA 5FY1A 3JU9A 1SDDB 2PAKA 2MEV1 1KXGA 3HMYA 4Y33A 2RVAA 1RYYA 3VBUC 2ADEA 4COWA 5DUXA 1RXGA 2YC2A 4IERA 1CAWA 3I2IA 4IE5A 4OYUA 3PIGA 3ZFEA 1LTEA 5CYYA 1JZ7A 5EPAA 4XF4A 4MH0E 4Y22A 1W6QA 2ET7A 1GMMA 3GYDA 4P5HA 1VR3A 2QCSB 4HVRA 4BQ3A 1W6NA 5JXHA 4PT6A 1OKOA 3W20A 1CD3G 3VDAA 2WRAA 3TEWA 4BQYA 2XJRA 2Y26A 4YFWA 4P5YA 1VBA2 2DCZA 3OBZA 4FI9A 1V9U2 1HB2A 1QF3A 1L7LA 5DDJ2 1LOBA 2VQ0A 1S0EA 2BVVA 5HPOA 3POFA 4FFHA 2WUHA 1N1TA 5D8AA 4DXTA 5IT6A 1E5SA 2G9FA 2XBO2 5HXMA 2QE3A 3WNLA 1H2MA 3DKQA 4FFIA 4LORA 5F3GA 4ZXKA 2BUKA 4LUMA 5FXXA 1GNZA 2RDNA 4MGTA 1RUI2 5BYNA 2CDPA 4AVAA 2BGOA 2FMDA 2Z4FA 4WM8C 5F1RA 4I2OA 2ZZQA 3C7EA 4MXWA 1LHUA 3PURA 4OFGA 4AW7A 4MADA 5GZFA 3CO2A 3HWJA 3WW4A 4FSJA 5BXXA 2ZCWA 3LEIA 1JZ3A 1J3RA 5LBFA 4RQPA 3WNMA 4LIVA 2JIJA 1QOTA 1UOFA 2W9XA 2QDNA 3OPWA 4DS0A 4I01A 3SCGA 1BLZA 5ABJC 1S0DA 1G8WA 3EJKA 2W95A 3HQXA 4QPYA 4AR2A 5FZOA 2OZ6A 3FC0A 3LIGA 1IHMA 4QX1A 4AHYA 2X8KA 2ZA9A 4P08A 2TEPA 5FY7A 1J59A 1WW7A 4DEQA 5IVCA 1SLIA 4QX2A 4Q29A 4S2FA 1DQ4A 1W3VA 2R061 3H1MA 4NPMA 2IWGB 3MW4A 5GZEA 2YYOA 4XILA 3LZZA 4Q4V2 3O0WA 2J1EA 5GLTA 3WF3A 5IVEA 4QKNA 3RDIA 3OB8A 4EZ4A 1S2EA 5LRSA 3LFMA 4ISQA 4MGIE 4Q8KA 3R6SA 2DCJA 1A8DA 3U0ZA 1SDWA 1PIV2 3O1SA 2AREA 4AF9A 2Q0AA 2WN2A 2VM9A 3S7EA 1QKQA 4A6OA 3U14A 3ZSJA 4D8MA 2JXAA 5AFEA 1KS4A 3WDXA 1NZIA 3TEXA 1KGYA 2F17A 3ETQA 4DNYA 3H50A 4TXWA 3D0SA 5IWFA 3AYAA 2JECA 1HN0A 3I3DA 5ISLA 2Q1MA 4M0NA 5E1RA 3SKVA 2VTXJ 4C1XA 1GWKA 2P6CA 2ARCA 3ZPYA 3AZYA 3KQRA 3QOPA 1R083 2IC1A 2W94A 4META 4Y3OA 4W6XA 2D7FA 5BPXA 1QXRA 1VBB1 2XL7A 4D7YA 1LECA 3VL8A 1CPMA 1PNFA 1K12A 1PM4A 4MX3A 3GXUA 3ZIWA 1VAMA 1RL3A 3NJZA 5C4WA 3JD71 2YBSA 4F3JA 4PBPA 1K5MB 5D8AC 1MZ5A 3PJYA 2AGSA 4AEDB 2XPJA 5FZ1A 4YVWC 4Y5TA 3V0AB 4LHLA 2W1QA 1H2LA 1YQ5A 1JYWA 2WZR1 1W6MB 3FBYA 1AUYA 2JX9A 4RS5B 4WVWA 5FZEA 3OBAA 1W03A 1FX5A 3CJXA 1UNBA 4B8EA 1RXFA 1ASJ3 1VBE2 2EVXA 1JZ2A 4E8CA 2ZGQA 5F32A 2OQ6A 4QGMA 2LTNA 1AR62 1QJX2 2DUPA 3A7QA 2JDMA 4IV1B 2QQWA 5F5AA 1F9KA 2B46X 5K7PA 2YFUA 1R092 2H6CA 1I9RA 1UIJA 3H9AA 3D82A 4CEYA 4MGQA 1ENSA 3D0JA 2DDUA 1CAXA 1CJDA 1GANA 1VRH3 3HBKA 1FNZA 4CCDA 4A7ZA 3UGGA 3WG4A 4LUKA 1K5JA 2Y6KA 4AFCA 3O0XA 5M0TA 1KRIA 4KGQA 3I2GA 2YUEA 3E1F1 3WDWA 3FJSA 1A78A 1DLCA 1UXZA 1UYPA 1YI9A 2RHPA 2FDIA 1YI7A 2VGDA 2YPDA 1ZBA3 2ZGPA 5I0DA 2VAUA 4GH4A 3SMHA 2SBAA 3MW3A 4GZ9A 5A7PA 2B9UA 5BY5A 1O3QA 1W9SA 2X5IA 4OI2A 3FLTA 1VE0A 4B1MA 2CGNA 1RHI1 5I0SA 5C7GA 2AEYA 2ZS6B
chains in the Genus database with same CATH topology
1S4CA 1JOPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S4C A;  1JOP A; 
#chains in the Genus database with same CATH topology
 3RS6 A;  3LAG A;  1S1A A;  4PDW B;  4DUX A;  4LBK A;  3SC7 X;  4NE9 A;  4QHB A;  5FPV A;  2XR4 A;  3AMQ A;  5DXD A;  1H6X A;  4JGY A;  4XMI A;  5FLJ A;  4CCE A;  3VD7 A;  4LT5 A;  1LHW A;  1C3H A;  2VVF A;  4CUA A;  3T4H B;  5F7U A;  2JG8 A;  1RUE 1;  1SBF A;  4LNV A;  3BB6 A;  5L7O A;  2A75 A;  4LBQ B;  4JQR A;  5EYX A;  1LRH A;  5ACA 2;  5I0T A;  1Y9Q A;  3W5N A;  4H55 A;  1RJ8 A;  4IE6 A;  1N3Q A;  1HW5 A;  3IAQ A;  4MGS A;  5FCC A;  2RJ2 A;  3OBT A;  5C4W C;  1CX1 A;  4M3C A;  2ZHK A;  3H3Z A;  3WD5 A;  3C2U A;  4W4Z A;  3MIG A;  3E97 A;  3ZSK A;  3C3V A;  4XAB A;  4RFR B;  2B5H A;  4WM7 A;  1XU1 A;  2OQ7 A;  4OI1 A;  2XUM A;  4XFG A;  4AOC A;  3KD4 A;  1QJZ A;  2OKX A;  4MV2 A;  1SFY A;  4DRR A;  3WDY A;  4AQ6 A;  1UQX A;  1SPP B;  2VCC A;  5L19 A;  1GP5 A;  4IGQ A;  4J25 A;  4QU2 A;  3U78 A;  4XJU A;  4BZ4 A;  3KV5 A;  4F83 A;  3K4A A;  1G9C A;  4P9I A;  2RS3 1;  2AUY A;  3LA7 A;  4E4Z A;  2QQI A;  4FQZ A;  2KM2 A;  5IAX A;  3SXW A;  3NJX A;  5T55 A;  3P6B A;  2P4E A;  3LSE A;  4URA A;  1DGW A;  1KDK A;  1Q8Q A;  1TME 2;  2CAV A;  1OOP A;  2WIN B;  1IPS A;  2Y6L A;  1TMF 2;  3J8F 2;  2WDB A;  4JKL A;  4KG0 A;  3PTY A;  4RR3 A;  5FZF A;  4XJA A;  3OJB A;  1AR8 1;  3PLQ A;  4FP2 A;  3AX4 A;  1QHD A;  2P3K A;  3NNF A;  5KHH A;  2ZGL A;  5FV3 A;  5KHI A;  2RV9 A;  1LNS A;  5GLV A;  2TUN A;  4CEY C;  4XFC A;  1DQ0 A;  2ZKN A;  2FD8 A;  5FMB A;  3J26 N;  2W1U A;  3C7H A;  1XJA A;  5I8S A;  2JJ6 A;  2VZS A;  3EYP A;  1SEF A;  2VY0 A;  4MHR A;  3AYD A;  2J1V A;  4URT A;  5DAW A;  4Y24 A;  4AFB A;  4QPI C;  3U11 A;  1GYK A;  2YU1 A;  4MYE A;  5F3I A;  3B7M A;  4BQ4 A;  2NPI A;  4HVO A;  4QKD A;  5FXZ A;  4AI2 A;  3FHA A;  1KJL A;  3GF6 A;  3LEM A;  3F95 A;  1APN A;  3VKN A;  3R4D B;  1RC6 A;  4OI4 A;  3ZX7 A;  2EF6 A;  1OA2 A;  1ZBE 1;  2JWP A;  5H9Q A;  1JI6 A;  1XE7 A;  1E5R A;  3Q8A A;  3SLI A;  3I59 B;  4CXW A;  4XBL A;  3I2O A;  5AC9 1;  2J1A A;  2AEZ A;  1C8M 1;  2LS6 A;  4GH4 C;  5DAV A;  4L92 A;  2VOT A;  3JBG 1;  3NVC A;  4IEY A;  1A6C A;  5CAZ A;  3POI A;  2RM2 3;  2WZR 3;  2D6P A;  3H42 B;  1P8J A;  4HON A;  5A7W A;  1W9W A;  2MEV 2;  2X5I C;  5JOY A;  3NV4 A;  3O5S A;  1J58 A;  2GH8 A;  3W21 A;  2ZML A;  2BGP A;  3H8U A;  3MBW A;  1YLL A;  3WLU A;  3ZYI B;  4RHV 2;  1RUF 1;  1LEN A;  4WBB A;  1PGS A;  5I91 A;  4OZO A;  2AC1 A;  3VBR B;  4UI9 L;  5LEK A;  4ASM B;  3LKJ A;  4B4P A;  3A4U A;  3SH5 A;  1W2A X;  2J1S A;  3VZN A;  5FYY A;  1BKZ A;  1C1F A;  1JS9 A;  2P37 A;  2G9Z A;  4IEP A;  5L7O C;  1VBC 1;  1G9D A;  1RUC 3;  2FMY A;  3NNL A;  2NQY A;  4MUV A;  4A45 A;  1SZB A;  4RGA A;  1K3I A;  1N1V A;  2GC1 A;  2KR2 A;  2OII A;  4GB3 1;  5FOB B;  3WSO A;  4A7Y A;  2P3I A;  1FPN 3;  1MQT A;  3I8T A;  4GKY A;  4UFH A;  5FYS A;  4N53 B;  3GHM A;  4CU6 A;  4QT6 A;  1ENQ A;  3KT1 A;  2R6Q A;  4JGZ A;  4MLO A;  3WP3 A;  4WM7 C;  1JZ6 A;  4LKF A;  1D7P M;  3IMN A;  1NCR B;  4CEW B;  4CE8 A;  4YW1 A;  5HCB A;  2XLA A;  1EAH 3;  1FXZ A;  3SIT A;  3QAC A;  1YYN A;  2VU9 A;  5JXG A;  3B9I A;  3VD5 A;  4FPY A;  3CJI B;  3H8O A;  5EXO A;  4D6Q A;  3OGS A;  2WA4 A;  2EID A;  1CAV B;  1XYO A;  1OOP C;  1FI2 A;  1S0G A;  1T2X A;  3HQR A;  4O9E A;  1F15 A;  1GSL A;  4RR3 C;  5EYY A;  4L8Q A;  4H3W A;  4AHX A;  1JU3 A;  1X9P A;  4BHP A;  1OLM E;  1SLA A;  2J1U A;  5C71 A;  1PO1 1;  4UOJ A;  5JOZ A;  4AL9 A;  1PGW 1;  5DN2 A;  1OXC A;  4JAA A;  4E9K A;  3NAP B;  5J3U A;  2ENR A;  2YHJ A;  5FZ4 A;  3AM2 A;  3KT4 A;  1RUE 3;  5A3O A;  5FYC A;  3AMM A;  5FYI A;  5CFD B;  2QVS B;  2GND A;  2R06 2;  2RS5 2;  1ZZ7 A;  2Q1F A;  3IDE A;  5BNO A;  2JKX A;  2GU9 A;  2W2I A;  3LD8 A;  3RZJ A;  2ZHL A;  2FDJ A;  4CDQ A;  4DFS A;  1U5Z A;  3RZG A;  2Q8E A;  4NWV A;  1GQH A;  4BLJ A;  4CDX A;  1V9U 1;  3NST A;  1H4G A;  5GLU A;  2BOI A;  5BNN B;  5DDJ 1;  1VRB A;  4N7U A;  3GZT B;  3K4Z A;  4YGD A;  1NA1 B;  2P3Y A;  4PQ9 A;  1WCU A;  2RR1 3;  3HN1 A;  3CF6 E;  1Q8P A;  4LO5 B;  2XBO 1;  5JIA A;  1NXM A;  4G4F A;  4UW6 A;  4Y4Y A;  2OZJ A;  3FN9 A;  1IKP A;  1GBG A;  1WGP A;  1ZVF A;  3IKW A;  2RS3 3;  3NV1 A;  5APA A;  1UY3 A;  2VNR A;  4AWD A;  1GV9 A;  1UYX A;  2CL2 A;  1LR5 A;  4XQ4 A;  4RA0 A;  1W8T A;  1W28 A;  2EXH A;  2VEC A;  3KLS A;  1E5H A;  1H1A A;  2A6V A;  3P5B A;  2V4A A;  1AR8 3;  1BXH A;  2VUA A;  1YIF A;  3EMR A;  4OMD A;  4XTP A;  2ZX1 A;  4B4Q A;  4Z92 B;  2VVD A;  1POV 0;  2G4I A;  2O8Q A;  2ZTN A;  1PVC 3;  3M2M A;  1VBB 2;  3BU7 A;  4UF0 B;  4DUV A;  5A7O A;  1PO2 1;  3ZKU A;  2DBN A;  4QPW A;  5DG2 A;  5CB7 A;  2HBT A;  2MNG A;  4A3Z A;  3IM0 A;  1LU2 A;  3B93 A;  1W0N A;  4COY A;  3JD7 2;  4OMC A;  1URX A;  4TSV A;  3FX3 A;  2UWB A;  3ZYP A;  1CIW A;  4OUL A;  3RMY A;  2JDY A;  1NAE A;  1QNY A;  1UU4 A;  3WNO A;  3E5Q A;  1W05 A;  3GZU C;  2VTX A;  3QLQ A;  3WNN A;  1W8O A;  4BXS V;  4BIS A;  5C8W A;  5KXD A;  1RUD 1;  2R0F A;  2VXJ A;  5C3S A;  5AC9 3;  1C8M 3;  4XBN A;  3WNX A;  5CIS A;  1Y4W A;  5FZG A;  4QX0 A;  3LOB A;  5F37 A;  3NWK A;  3K48 A;  3TNP B;  4QDR A;  2GME A;  3VKF C;  3H3U A;  1VB4 A;  4YM3 A;  3MPB A;  1OPM A;  2VQA A;  4UYB A;  4IE7 A;  2VOW A;  2A5Z A;  5BV6 A;  1QQP 3;  4YW5 A;  5FZI A;  3VZJ A;  1PIV 1;  5CKQ A;  2ZAH A;  1MVQ A;  4I30 A;  5F5C A;  4XTM A;  4YM0 A;  3TB0 A;  3TBD A;  4BPZ A;  4ZZ8 A;  3DEM A;  4X8N A;  4N9H A;  1CPN A;  1PNG A;  3DPR A;  4XE9 A;  2W91 A;  3VD4 A;  1LED A;  1DQ6 A;  2WYF A;  1O3T A;  1O8S A;  2VNV A;  4EWD A;  3OGJ A;  1J84 A;  4KGG A;  2DVB A;  1UY4 A;  4UXA A;  5A7S A;  1B35 B;  1LOA A;  2VZP A;  2WFP A;  5FO7 B;  2QJV A;  2XWJ B;  4QX8 A;  1WLC A;  1W6O A;  4GB3 3;  4EN6 B;  1H1I A;  1ULF A;  1UN1 A;  5DUU A;  2ARB A;  1GOG A;  1JMU B;  5HBA A;  3WQ7 A;  3L2H A;  4CDX C;  4EE2 A;  1S0J A;  1O91 A;  3S5Q A;  3B02 A;  5A1L A;  1IS5 A;  4LLO A;  4YW2 A;  2OS2 A;  2BFU S;  1V6K A;  3PTR B;  4W6W A;  5FIX A;  4A3X A;  3OSD A;  4LIT A;  3PL0 A;  3ZXK A;  5C9A A;  3U4X A;  2P5B A;  3SNM A;  1RHI 2;  3HR9 A;  1LOC A;  5FP7 A;  2RJK A;  3PUQ A;  4LKE A;  1W04 A;  2WN3 A;  4NR1 A;  4UFL A;  5FPB A;  3RZK A;  2WAB A;  1VAV A;  1WKY A;  4XUO A;  1RUG 2;  2VMD A;  2LAL A;  4DXR A;  1R1A 1;  1WBL A;  2KA3 A;  1SMV A;  2ZPX A;  2A7A A;  4CP1 A;  4EN9 B;  1BVV A;  3S57 A;  1XSQ A;  2NP0 A;  1UF2 C;  1OH4 A;  1QNW A;  1YIP A;  1OQE A;  3AK0 A;  4UW5 A;  4UBH A;  4XXA A;  2ZEZ A;  1RUE 2;  5GKA C;  4AQ2 A;  1PO1 3;  1AXY A;  4K20 A;  3MIC A;  4QQO A;  3ZMO A;  4M00 A;  5IFP A;  5KXB A;  1QXP A;  1VAL A;  2A71 A;  4AG4 A;  3K77 A;  1MEC 2;  3EO6 A;  3OGR A;  4XAE A;  2H0B A;  5GZC A;  1UOG A;  5K0U B;  4EWA A;  1H8T A;  3BGA A;  4IV3 B;  4CCJ A;  2WO7 A;  3I2J A;  1QWR A;  5FYM A;  4AI1 A;  4IET A;  5DAX A;  3TAY A;  4P14 A;  4AAX A;  3GJB A;  5FZ9 A;  1UU6 A;  4DZG A;  2A6W A;  1ZRE A;  3VBF A;  1VBA 3;  2ES3 A;  2YPJ A;  2R16 A;  3KV9 A;  4K40 A;  3KCC A;  1V9U 3;  3ZYG A;  5DDJ 3;  2VW1 A;  1UIK A;  3NMB A;  4JDN A;  4MZU A;  3IN9 A;  2XBO 3;  3B01 A;  4O61 A;  3TN9 2;  5B2G B;  1AYN 1;  1S0C A;  1WZX A;  2VZR A;  1NUK A;  2GZW A;  4P9L A;  4XFB A;  1EUU A;  1RUI 3;  5LK5 A;  2CWM A;  3VBU A;  2HKX A;  3HAG A;  4IEU A;  1F5F A;  3IT8 A;  2VMF A;  4QQH A;  2O8O A;  5F39 A;  2H0V A;  3KGZ A;  3DPR C;  4KI5 M;  1XE0 A;  2JB4 A;  3FLP A;  1LOE A;  4XUN A;  1DQ1 A;  1HRI 2;  3M3C A;  1W8W A;  2XVG A;  1WW5 A;  1PVX A;  4YVS C;  1D2S A;  4HKW A;  3U37 A;  4BCU A;  5A32 B;  5HCF A;  4Q26 A;  4QGL A;  2GNB A;  2ET1 A;  5C33 A;  1Q3E A;  4OI0 A;  2MHF A;  3ME2 A;  3QH7 A;  1ZBE 2;  5IYY A;  1QGL A;  1POV 3;  1ACC A;  2WSU A;  3LSD A;  1EYB A;  5AC9 2;  4LTA A;  4KWJ A;  1DFQ A;  5EQU A;  5A1A A;  4HVQ A;  3MV0 1;  3O14 A;  4LEJ A;  3O12 A;  1TZO A;  3IB3 A;  3JBG 2;  2XL9 A;  3R05 A;  4YGB A;  5FZ0 A;  1FOD 1;  5FXV A;  2D6O X;  2PTM A;  1U5I A;  3MHZ A;  3SIS A;  2B8M A;  4Q4V 3;  5LCW L;  2ZHN A;  4OHV A;  2R04 1;  4XF3 A;  5CEH A;  2JDH A;  5FP3 A;  1HKD A;  4I0A A;  1UPI A;  1HLC A;  5A1F A;  2EA7 A;  5T5J A;  5IAT A;  3LPF A;  3QCW A;  1RUF 2;  1ULG A;  3FE5 A;  4CP9 A;  3M7A A;  1PIV 3;  3POS A;  4M4P A;  1PX4 A;  3VZO A;  1RB8 G;  1ZRI A;  4ZHN A;  4DO0 A;  3WUD A;  2AYH A;  4BWO A;  3ZFF B;  2Z69 A;  3BPZ A;  1VBC 2;  4QPG A;  2FCV A;  1RVF 1;  3TOJ A;  5A3T A;  1NE4 A;  1KQR A;  1V6N A;  4NRO A;  2R1B A;  4KWU A;  1W2T A;  5JSR A;  2J22 A;  3N9O A;  3POB A;  1BEV 2;  2JDK A;  4LO8 A;  1AVB A;  1H8T C;  3UV9 A;  4A44 A;  4FTS A;  1ND3 A;  3WP5 A;  1JH5 A;  2BOJ A;  4LE4 A;  1L3J A;  2C4X A;  2RDQ A;  1QEX A;  4P9G A;  2Q5T A;  2ZGU A;  4NRQ A;  4Z82 A;  3VBF C;  2EAK A;  4OQ8 A;  4F8A A;  4AQT A;  2HYK A;  2ZX2 A;  5T5L A;  4HSL A;  4P9J A;  1AL2 2;  5FWJ A;  3GDB A;  3V0B A;  4IES A;  4GJY A;  5LWB A;  1IPJ A;  3VZM A;  3KCY A;  1YNA A;  2RJL A;  5J98 B;  4BQW A;  1N1Y A;  4LPL A;  3OUJ A;  4ONU A;  2YC0 A;  2IXJ A;  4L9B A;  4Y20 A;  1KD7 A;  2LRO A;  3JQX A;  3Q8C A;  1W2N A;  5F2W A;  3KF3 A;  4BA6 A;  4E4D X;  2QZ2 A;  2DCY A;  4ITC A;  1RGS A;  4PQQ A;  2GAL A;  5FZ6 A;  4CDW B;  2WZ8 A;  1K42 A;  2OPW A;  1WD4 A;  5JI7 A;  3I4I A;  1PO1 2;  3WOG A;  1PGW 2;  1N47 A;  1VBE 3;  2E33 A;  2YBP A;  1LGB A;  3ZYH A;  1GFF 2;  4TZD A;  1B09 A;  4RHV 1;  1XBF A;  3HT2 A;  1AR6 3;  1POQ A;  1QJX 3;  2OXB A;  3UJQ A;  2CDO A;  1OQ1 A;  1H4H A;  2X53 S;  1YQ8 A;  2PAM A;  3MDP A;  2BGC A;  2WKK A;  4P9Y A;  5CG8 A;  1QJY 2;  1R09 3;  5JLV A;  4AVS A;  3OBR A;  5GLZ A;  2ERF A;  4R52 A;  4YG6 A;  3MFA A;  1LKN A;  4CP2 A;  3WDT A;  3OPT A;  5GLW A;  4FOV A;  4LR4 A;  5FUP A;  1NCQ A;  4HSJ A;  1V00 A;  5LA9 A;  4NPL A;  1O3S A;  1HJF A;  2UY8 A;  1K5M A;  1G7Y A;  4WVM A;  1C1L A;  2XLF A;  1AXZ A;  4PF5 A;  5FZA A;  2P2K A;  4YVW A;  2WL1 A;  4ZS2 A;  1J1T A;  1O5U A;  1U12 A;  2K46 A;  1GIC A;  3T1M A;  3W59 A;  2FDK A;  1JZ5 A;  3H1W A;  3KV6 A;  1LB2 A;  1C5H A;  5A33 B;  3THC A;  3NNJ A;  2VCB A;  5C5U A;  4FTB A;  2RDS A;  2BP6 A;  3VDD A;  3TYJ A;  1RIR A;  2R7E B;  3MLK A;  4K6B A;  4BQ5 A;  2E9Q A;  1BZW A;  3GM8 A;  1I5Z A;  1Y9M A;  4YW4 A;  2B39 A;  4XZP A;  5FPU A;  3BTZ A;  3ECQ A;  4LBN A;  3S0M A;  5FMC A;  1LCL A;  1OT5 A;  2PHR A;  4AI9 A;  5FMO S;  1XNA A;  3B69 A;  1ODN A;  1F8V A;  1PO2 2;  1UKR A;  4QPG C;  1O4Z A;  2VUD A;  2VXR A;  3I3Q A;  3M8L A;  3DN7 A;  4JQT A;  1YQC A;  2Y6G A;  4LHN A;  1OSG A;  2VMH A;  5BNO C;  1MS3 A;  4KBZ A;  1UZW A;  4X6Q B;  2HJI A;  1GZW A;  4WM8 B;  5C8C A;  2B45 X;  5FLI A;  1ND3 C;  1QJU 1;  2YMZ A;  1HV1 A;  4Y4R A;  2VH9 A;  2HWB 2;  2RS5 1;  3VL9 A;  5ACA 3;  2EIC A;  1PGL 1;  1VJ2 A;  1BCX A;  1RUD 2;  3GNE A;  5I8T A;  2DU0 A;  2EIG A;  2DU1 A;  4LBO A;  1GKB A;  3OGG A;  4PIX A;  4CCK A;  4JCK A;  2HWC 2;  4ISR A;  3U75 A;  5ABJ B;  1WCQ A;  1AXK A;  3PME A;  1ZA4 A;  2JEM A;  2LM3 A;  4NJ4 A;  1XND A;  3OYW A;  3N7J A;  4XEZ A;  5CA6 A;  4FOQ A;  3USU B;  4COU A;  5L9R A;  1IS4 A;  2QQJ A;  2XVL A;  5F3C A;  5BUV A;  5JXI A;  5IK7 A;  2ZAB A;  4N43 A;  2FDG A;  1OMI A;  3ZN6 B;  2XQX A;  2LW8 A;  4Z2A A;  5FK8 A;  1BJQ A;  5KR7 A;  4HK9 A;  1LES A;  4ZXE A;  1TME 3;  1PK6 B;  3J8F 3;  4MSV A;  2B4K A;  1TMF 3;  3QD6 A;  1F4H A;  2DTW A;  2EXI A;  3Q8E A;  1Q8S A;  4JRA A;  4NO4 A;  4HN0 A;  3VZL A;  2NZ9 A;  4TLF A;  4AHW A;  1W0P A;  4QXH A;  1OVS A;  4Y26 A;  3ZSM A;  2NN8 A;  4XQD A;  1UW8 A;  5JPM B;  3LEK A;  1M4W A;  2BBA A;  4IDZ A;  3ILR A;  2PN5 A;  1RIN A;  2XH6 A;  2BVB A;  4LO4 B;  1HDK A;  2W0X A;  1NCQ C;  3DYP A;  1GR3 A;  2RDR A;  3N3H A;  3VBH A;  1S0B A;  2YDE A;  3L9J T;  5FYB A;  1UKG A;  2XON A;  5E88 A;  5LY2 A;  1K5M C;  2QQV A;  5D2A A;  2CYF A;  3RWN A;  5B4N A;  1CAW B;  2PHU A;  3AC0 A;  4XDO A;  3ZFE B;  2IUW A;  2PHD A;  2EAA A;  3ENR A;  4NOT A;  3O1R A;  1UOB A;  3ZFG A;  4Y22 B;  1GNY A;  1W6Q B;  4U2A A;  4RS5 C;  4D7T A;  3MIE A;  3ZR5 A;  2BNN A;  2VBP A;  2Z42 A;  2HH9 A;  1R1A 2;  4K9S A;  1X8E A;  2NLR A;  1JYV A;  3VDD C;  4N8M A;  4Q0S A;  3GHN A;  4AI8 A;  1IQA A;  1MR5 A;  2MEV 3;  3P1I A;  5K9Y A;  4L11 A;  4Q4Y 1;  3S6P A;  4IV1 C;  4BM8 A;  5JMC A;  3AJY A;  3VLB B;  3WV6 A;  1WUV A;  2PHX A;  2WNU A;  2PHT A;  5D8A B;  1QDC A;  3N9N A;  3AMH A;  4FPK A;  4C91 A;  5T5O A;  3MFC A;  5A70 A;  4RHV 3;  2K2S A;  4ZPI A;  3WG1 A;  1HJG A;  1HQN A;  2BPA 2;  2A3W A;  3WNP A;  5IK8 A;  4V2W A;  1J3P A;  3GBF A;  4XF1 A;  3R4U A;  1G9B A;  1SLB A;  2CU5 A;  4QPI A;  4XQW A;  4UFK A;  3KB5 A;  1BBT 1;  4AI0 A;  4CA9 A;  5C8C C;  2W3J A;  3KCX A;  4MXW B;  4EJR A;  4P00 B;  2F4P A;  3T2T A;  1WMF A;  2EXK A;  1AJO A;  2O0O A;  2JIC A;  1O6U A;  2P6H A;  3LDK A;  3D3A A;  3ZIX A;  4XET A;  2DCK A;  2JG9 B;  4RQP B;  3ATG A;  4CU8 A;  1LGN A;  4A2U A;  2CSG A;  1QH7 A;  4UAP A;  2HWD 1;  5I8Y A;  2R49 A;  5ANN A;  4S2D A;  3VN4 A;  4BK5 A;  3N7K A;  3GGL A;  1LEM A;  1S2B A;  4K21 A;  4XZU G;  3RG0 A;  3ZDS A;  2JEN A;  3N7M A;  1AYN 2;  5FZO B;  2C0Z A;  3PUI A;  4CPB D;  4RL7 A;  1FYU A;  2QUO A;  4HKO A;  5H9S A;  1SLT A;  4IL7 A;  3UJO A;  4FO9 A;  4FBF A;  5SV8 A;  1E57 A;  2ZEW A;  2PXJ A;  2ZEY A;  5H9P A;  1RUG 1;  5AFB A;  2W52 A;  4FT8 A;  4N43 C;  4NIA A;  1R64 A;  3QBQ A;  1W9F A;  4YGE A;  1YC6 1;  4ERO A;  4QX5 A;  3DYO A;  4ZU4 A;  1X8M A;  2GAU A;  1LHN A;  2ZEX A;  4Y1X A;  4XUT A;  2DWR A;  4AQS A;  1BK1 A;  5HV0 A;  1OUX A;  2OVU A;  3AVR A;  2DV9 A;  2BV4 A;  4XCA A;  3T0D A;  1SBE A;  3NV2 A;  4LMF A;  1QH6 A;  4JTO A;  1F5J A;  1N3P A;  3NNG A;  4IGP A;  4EN7 B;  2LRP A;  1NXD 1;  2CHH A;  2J1T A;  1MEC 1;  2WT0 A;  3WT3 A;  4ZU5 A;  2VR4 A;  5DAP A;  3VBH C;  4KNC A;  4QB2 A;  2RS5 3;  1DLL A;  1FOD 2;  2R06 3;  2R0H A;  4FP3 A;  2IFR A;  2WZE A;  1W2O A;  3FLR A;  3GBW A;  4YZ5 A;  1DZR A;  5IHR A;  4ASK A;  4H7M A;  3ZFG C;  2ZGM A;  2R04 2;  1U0A A;  4R9D A;  2DVG A;  4LKS A;  5F8P A;  3O1U A;  2HWF 1;  5JXJ A;  2JD9 A;  4G3Y C;  1Q8V A;  3PVO A;  3BUC A;  5DG1 A;  2DFB A;  1H0B A;  1RJ7 A;  3NKT A;  4R4X A;  1MS4 A;  1AL0 G;  2YG0 A;  5FJK A;  2C1F A;  2F4L A;  5FYT A;  3SHR A;  4BLI A;  3MYX A;  4YZ3 A;  2AEN A;  3TN9 1;  1CZS A;  1Y3T A;  3RI9 A;  1AYM 2;  4OHW A;  1GP6 A;  2Z2S B;  2WQ8 A;  3ZXL A;  5C4W B;  4M0H A;  3AKS A;  4I09 A;  3PU8 A;  3URF A;  1DF0 A;  1RVF 2;  2WNU C;  5FP4 A;  2JDP A;  2OW4 A;  1ALY A;  4WZC A;  2YRO A;  4MGZ E;  2VL4 A;  4MO3 M;  4CPB A;  5TSW A;  3NKG A;  4HZF A;  1HRI 1;  2EAL A;  1Q5O A;  1WCS A;  4TTG A;  3OD4 A;  3OG2 A;  1WWY A;  3LPG A;  4S2H A;  4ZS3 A;  1JOB A;  3AP5 A;  1ONA A;  4WZF A;  2PEL A;  2X29 A;  4S2G A;  2E7A A;  4XYX A;  3N9P A;  3ST7 A;  1VBB 3;  4DOU A;  4ET7 A;  2ZJC A;  1FV3 A;  1XE8 A;  5LW9 A;  1S4C A;  1X36 A;  5A80 A;  2P34 A;  2QBX A;  4IUG A;  5FK7 A;  3JD7 3;  1Y43 B;  3HNY M;  1O8P A;  1T6G C;  2WS9 1;  1AF9 A;  5GZD A;  4YAR A;  5FBJ A;  2N7G A;  3GAL A;  3HQU A;  4LK6 A;  1WW4 A;  1G6N A;  4NHY A;  5DZG A;  3ZKY A;  1OF3 A;  4CEY B;  4LHK A;  5FO9 B;  2R32 A;  2ZHM A;  3F2Z A;  3J7M A;  5F2S A;  3VV1 A;  3WEZ A;  3WQ0 A;  1CAX B;  1YFX A;  2J42 A;  3VBS A;  1YEW A;  1UYY A;  2VW0 A;  4LIU A;  4WVZ A;  4V1P A;  3O1T A;  3UL2 A;  3R4S A;  4JHT A;  3LE0 A;  4YYO A;  5FPL A;  2HWE 2;  4AEK A;  1YXW A;  3ZSL A;  1IS3 A;  2WNV A;  1YO8 A;  1ZZ9 A;  5D1I A;  4HXC A;  4K1Y A;  5EV7 A;  3SQO A;  3RYR A;  5C70 A;  1UZZ A;  4MGY E;  1G9F A;  3E5X A;  5ANQ A;  2QKD A;  4GH4 B;  2ARX A;  4HK8 A;  4R8H A;  1JYT A;  3O1P A;  3SH4 A;  1XOY A;  4JKK A;  3UKN A;  1UYZ A;  2VW2 A;  2VO5 A;  1SFN A;  1XNB A;  2CNA A;  2X5I B;  3ALQ A;  4LQR A;  4R9B A;  5IVY A;  1JYX A;  2ZGT A;  1NYW A;  5JR2 A;  5IVB A;  4KU7 A;  3RVH A;  1ULC A;  2AZ5 A;  3VDC A;  4FPO B;  5IAV A;  1BEV 1;  5CAD A;  1JOJ A;  4LA3 A;  2IFW A;  4UFM A;  4Q0U A;  2H6B A;  1HX6 A;  2D6K A;  2W46 A;  1JTZ X;  4JGY B;  3AKP A;  3WXP A;  3UYJ A;  3ACI A;  1JBC A;  2X10 A;  2XWB B;  4CSW A;  4B29 A;  3KV4 A;  1NLS A;  1CAU A;  1GLH A;  2VUC A;  1BMV 1;  2FQP A;  1AL2 1;  1NG0 A;  2JG8 B;  5L7O B;  2AR6 A;  4D6R A;  1AR9 2;  3TEZ A;  4IE4 A;  3CJI C;  1DCS A;  1RHI 3;  5FXW A;  4J6G A;  4NRP A;  5KHG A;  3CEW A;  1RUG 3;  5FY9 A;  3HJR A;  1QU0 A;  2JDN A;  3KF5 A;  4M3C B;  3OPZ A;  2QZ3 A;  2GC0 A;  4QX3 A;  1COV 1;  2TNF A;  3BN6 A;  3KZ4 C;  3RI8 A;  2D98 A;  1MPX A;  4UFI A;  1CES A;  4AE2 A;  2R07 2;  3HOB A;  4AI3 A;  1CX4 A;  2CV6 A;  3FL7 A;  5T5P A;  1OH3 A;  3J4U H;  1QJU 2;  2DUR A;  4GKX A;  5DZF A;  2WNO A;  1QJY 1;  1PGL 2;  4GWM A;  1QXJ A;  3WW3 A;  5KC5 A;  2F6B A;  3ZOI A;  4KU8 A;  2WBK A;  1MEC 3;  4AGG A;  4JC1 A;  1Q43 A;  2VQU A;  3WQ1 A;  1OPO A;  4AVC A;  1BK0 A;  1OOP B;  3SEE A;  4BME A;  4DIQ A;  3VKL A;  4RR3 B;  1VB2 A;  5T52 A;  1IG0 A;  5BNP A;  1X82 A;  3BYW A;  4TYS A;  5LBB A;  2WJS A;  3CU7 A;  1QOO A;  4FXG B;  1AR7 1;  5FPX A;  3BU0 A;  1ZRR A;  1LGC A;  4IEQ A;  2TBV A;  1QY4 A;  3VBS C;  4YZ4 A;  3J7L A;  5FDB A;  3WF1 A;  3E6B A;  2C9K A;  1UAI A;  4AVB A;  4AHZ A;  4LBJ A;  3RJ2 X;  2E32 A;  4NVP A;  3VGI A;  4GIQ A;  3AFK A;  3MIF A;  3RNS A;  4MOA A;  5EJ3 A;  2I07 B;  4H7L A;  3TN9 3;  4RGK A;  1W8H A;  2WNV C;  4GAZ A;  3ZYF A;  2A6X A;  4PIZ A;  4Q4W 1;  4LE3 A;  3NO8 A;  1CR7 A;  4PBO A;  4KL1 A;  4QDQ A;  1TQ5 A;  3J7H A;  2B9V A;  4GMP 1;  4Q27 A;  3THT A;  1W0O A;  5DPN A;  4ARX A;  2VG9 A;  1TVG A;  3CNA A;  3EHK A;  3ILF A;  1XYP A;  5I0R A;  1HRI 3;  4CRQ A;  1J1L A;  1H6Y A;  4YPJ A;  3VBO A;  5A7W B;  4QHO A;  5HI0 A;  3WDU A;  1NQD A;  3PVE A;  4BIO A;  4KG8 A;  2W47 A;  1UY1 A;  3OUI A;  1TE1 B;  1ODM A;  2MPF A;  2GDF A;  1GNH A;  3UNP A;  2ILM A;  3ACL A;  4XOG A;  1WD3 A;  2VE1 A;  3LDR A;  4QD2 A;  2HWB 1;  2ORX A;  1ZBE 3;  2CTV A;  2VMG A;  1Q8O A;  4XC9 A;  3UET A;  4OHY A;  5J48 A;  3RWK X;  3LA3 A;  3JBG 3;  1C5I A;  2BWA A;  2VOV A;  4BH9 A;  1W90 A;  2BW8 A;  2HWC 1;  4KMQ A;  4QB6 A;  5GAL A;  5FYZ A;  5J36 A;  2RMU 2;  2WWJ A;  2X05 A;  1ZX5 A;  4Q4Y 2;  5GM0 A;  1WMX A;  4YZ1 A;  3I3M A;  4FXK B;  3POG A;  3W58 A;  2B7Y A;  4HT1 T;  3USS A;  1MQT B;  1U5X A;  4OLL A;  4CCL A;  4Q5O A;  2A73 B;  1GWM A;  1UPS A;  4QB1 A;  3KVA A;  1RUF 3;  4CDU A;  4E4H A;  1OD5 A;  5FO8 B;  1XQN A;  3NNM A;  4LHS A;  1YQ6 A;  4JGZ B;  4H2A A;  4QXC A;  2BBV A;  1MS8 A;  1WCK A;  5FQ0 A;  1JYN A;  3OGV A;  1HQL A;  4YVS A;  1VIW B;  3WF2 A;  1BBT 2;  1DGW X;  3N35 A;  4QKF A;  3HN3 A;  4LO6 B;  1VBC 3;  2OUH A;  4HAN A;  4G9S B;  3GCW A;  3I2F A;  2C24 A;  4QM9 A;  4J1W A;  4FOY A;  1RTV A;  4UT5 A;  3JQW A;  2DUO A;  1UX6 A;  3IAP A;  2GN7 A;  2HWD 2;  3MO4 A;  5FZ8 A;  4A7K A;  2W1S A;  2L9L A;  4ZON A;  1BEV 3;  4A6S A;  1OUS A;  1DGR N;  5HV4 A;  1KJR A;  3PDQ A;  5BNP C;  2BZD A;  2GP3 A;  1W6P A;  4XUP A;  3FUQ A;  5G05 L;  3BI3 A;  3JZV A;  1UU5 A;  4EN0 A;  3B5L B;  1J3Q A;  2UU8 A;  2ZX4 A;  3AYE A;  3EBR A;  3T0A A;  2PQQ A;  3ZXG A;  2UYA A;  1O4T A;  4XHX A;  1D2Q A;  1W3X A;  4NWW A;  3G6J B;  1O59 A;  3ROU A;  4ATF A;  1AL2 3;  5LA1 A;  2DYC A;  4NMI A;  3HNB M;  3I3B A;  2PHW A;  3D8C A;  4GJZ A;  4JV4 A;  5LAS A;  5BNO B;  4HPK A;  2PLV 2;  2VZ3 A;  3FUO A;  4QXK A;  5AVA A;  3T0B A;  4FPJ A;  4CDQ B;  1YJK A;  3I2H A;  3AKR A;  1LOG A;  3OY8 A;  4FFG A;  4CDX B;  5GZG A;  1ZM1 A;  1HRV 2;  1HN1 A;  3IDB B;  1COV 3;  1O5L A;  3WIN E;  2DCT A;  5KC6 A;  3H7J A;  1SHW B;  2XLG A;  2DVF A;  2Y0I A;  4L2N A;  1ND2 A;  4COV A;  2VZO A;  3VBO C;  3DKW A;  3JB4 C;  3A22 A;  2PA7 A;  3A0N A;  4NPR A;  2WR9 A;  4Z07 A;  1SCS A;  3DEC A;  2J1R A;  4IV3 C;  3VB9 A;  1G9A A;  1QJY 3;  3WHT A;  2UY9 A;  2JD4 A;  3DGT A;  2ZX3 A;  2JE9 A;  2JB8 A;  3T2Q A;  2HWF 2;  4NHL A;  3T3Y A;  4PHZ A;  1VAK A;  1UMI A;  3K2O A;  2EIE A;  1ZYB A;  3IMM A;  4HOO A;  4OQ9 A;  1FAT A;  3H8X A;  2D3S A;  1S2K A;  5EZW A;  4XUQ A;  1VLN A;  5DUV A;  1SFP A;  3CKH A;  1C28 A;  5FR3 A;  1F31 A;  1UZY A;  1U5Y A;  3FFQ A;  4CXY A;  2OYZ A;  4CDW A;  5E16 A;  2BDR A;  3S7I A;  2P17 A;  3S30 A;  4CXX A;  3DV8 A;  4CCC A;  5JZG B;  4PLM A;  4AZZ A;  5G04 L;  2Y38 A;  4IEV A;  3M3E A;  4RN5 A;  4CDU C;  2C9A A;  5FZD A;  5JMO A;  3LOI A;  5T50 A;  2K9Z A;  2ZOE B;  2ZZJ A;  4NHX A;  1S0I A;  3RFR A;  1ZA7 A;  1ZZC A;  4BYY A;  4I0W B;  5DUW A;  3WZ1 A;  2D3R A;  4GMP 3;  3VD3 A;  4PJY A;  4CUC A;  1D4M 2;  1GOF A;  2D93 A;  1QIQ A;  1PO2 3;  2XUE A;  3WNK A;  2Y34 A;  3D5O A;  2BRT A;  2JE8 A;  4FOW A;  2WNE A;  1KIT A;  2PQS A;  1WLT A;  1HXS 1;  4QAW A;  1X33 A;  2IXC A;  2V72 A;  3MIH A;  2WS9 2;  3IIA A;  3BOD A;  2Q1Z B;  3RZM A;  5FFO C;  1S55 A;  1JYC A;  3ITQ A;  5LA0 A;  2XML A;  1VBD 2;  2LUW A;  4LXL A;  4M01 A;  3CZU A;  1JYI A;  2HWB 3;  3DPR B;  3E6D A;  3SCH A;  1GUI A;  1UX7 A;  2E51 A;  1ST8 A;  1CVN A;  1RUD 3;  3MLJ A;  2FDF A;  1UCX A;  2WT1 A;  1Q56 A;  1EY2 A;  4OUS A;  5IVV A;  4Z2W A;  2HWC 3;  2WWU A;  3OF1 A;  3DXU A;  4Y5Z 0;  1W6O B;  5K0U A;  3I2K A;  3SCF A;  2D6M A;  1EV1 2;  2NMN A;  4HFS A;  4N7I A;  2O1Q A;  4QMA A;  5CNA A;  1CZT A;  1G86 A;  2G1M A;  2PHF A;  1AYM 1;  5FKB A;  2VD7 A;  3KVB A;  4DIN B;  2GC3 A;  2X09 A;  4NN0 A;  3WVJ A;  5C5T A;  1REF A;  1DZT A;  4DXS A;  5C9A B;  2PAE A;  2XGX A;  1D0G A;  1ND2 C;  1W9T A;  1RUH 2;  5H9R A;  4OHZ A;  3V64 A;  3PUH A;  1A3K A;  1LHO A;  2AH2 A;  4L97 A;  5AVP A;  3AXD A;  1ULE A;  5FZH A;  1SLL A;  1MS9 A;  3PUS A;  4YGC A;  1US3 A;  4B3N A;  2VMI A;  3UKT A;  2BTV C;  4JHZ A;  3AP9 A;  5F6L B;  4B7K A;  3O1M A;  2D40 A;  1HB3 A;  2KXL A;  5I93 A;  5L9B A;  2DFC A;  1FAY A;  1BMV 2;  3NW4 A;  3UK9 A;  1PM7 A;  3MUZ 1;  1DDL A;  2WLP A;  3U07 A;  4P02 B;  1PMI A;  1EP0 A;  3DL3 A;  4HL0 A;  4QQ2 A;  3K3O A;  4B4R A;  5CFC B;  3AP4 A;  4EQV A;  5FYV A;  1H8T B;  1CWP A;  4CDW C;  3ON7 A;  1R1A 3;  2ORZ A;  5LY1 A;  3VHO A;  1COV 2;  5J09 A;  1RUN A;  3WX5 A;  4XJW A;  3E5U A;  1MS1 A;  3O0V A;  5FPZ A;  1DGR A;  1H8V A;  3VBF B;  1GZ9 A;  3I2D A;  2HWE 1;  1DYP A;  2SLI A;  4V2V A;  4ES8 A;  1QDO A;  3APB A;  1FNY A;  4QXB A;  2Y60 A;  1ZRD A;  2ZGO A;  4XXP A;  2BER A;  3OEA A;  2WO1 A;  3CDZ B;  3CIH A;  4JTN A;  4QGN A;  1NLQ A;  2CWS A;  1ASJ 1;  2VNG A;  2ZBJ A;  4R9C A;  3TWI A;  1CGP A;  3JUU A;  1DIW A;  1LUL A;  2RS1 2;  5JWP A;  3VBU B;  5JAX A;  1F4A A;  3H7Y A;  5LRR A;  3VHP A;  5IVF A;  1JZ8 A;  3AL6 A;  2IXK A;  2JE7 A;  2P3J A;  1AR7 2;  2GMP A;  4QWN A;  3WR0 A;  4NRM A;  4AED A;  3FZ3 A;  4B7E A;  2VUL A;  1LOF A;  2Y6J A;  3KT7 A;  4R4Z A;  3V0A A;  5CBL A;  2P1B A;  5FZ7 A;  1JHN A;  1W6M A;  2D43 A;  3GJA A;  4RS5 A;  3LB9 A;  1VRH 1;  1V6M A;  4BE3 A;  5JOW A;  2BEO A;  2XQR A;  3PUA A;  3IPV B;  5T3N A;  2WLQ A;  4XFH A;  4LBQ D;  1QOS A;  1NQJ A;  1NY7 1;  1AYN 3;  4CVU A;  2A6Z A;  5F5Q A;  1V70 A;  3IBM A;  4Q4W 2;  1C4R A;  3T1L A;  1EUT A;  1AR9 1;  1YUD A;  5FMD A;  5E6H A;  3I49 A;  2O14 A;  2WII B;  3JCI A;  4IV1 A;  2FZ2 A;  2DF7 A;  2D6N A;  5A3M A;  2W39 A;  1ZBA 1;  2R30 A;  4D0Q A;  3ASI A;  1DGL A;  2Y6F A;  4U36 A;  3WF0 A;  3ZXF A;  3PVN A;  1ZNP A;  2VCA A;  3I3E A;  1DBN A;  2DVA A;  5C3R A;  4DQA A;  1FMD 2;  2VME A;  4AFD A;  1O3R A;  2R07 1;  1ULP A;  4X8P A;  3U4S A;  3HEI A;  2W5F A;  2ZMK A;  3V65 A;  3WW1 A;  4NHK A;  1OF4 A;  2YU2 A;  5K8S A;  1TNF A;  1HXS 3;  2WQ4 A;  3H3L A;  3KM5 A;  4YW6 A;  4CP9 B;  1X50 A;  1X9T A;  3JXS A;  3MUY 1;  1Z78 A;  4MGK E;  4I0B A;  1WW6 A;  3UGF A;  4D3W A;  2ATF A;  2JG9 A;  4UW4 A;  2VOK A;  4ARY A;  5KHJ A;  1RIT A;  5A3L A;  1GZT A;  2IVI B;  1JHJ A;  1I6X A;  3CMG A;  2D6L X;  5F3E A;  3K75 B;  4DY5 A;  2DBI A;  4AVV A;  3GCX A;  2G9G A;  2CGP A;  1FOD 3;  3LIH A;  4QPG B;  4W50 A;  1V0A A;  5C6C A;  5DAQ A;  5IK4 A;  4UFJ A;  1W2U A;  1XC6 A;  1RUO A;  3Q8F A;  2R04 3;  3M70 A;  4N9I A;  1W06 A;  1KFX L;  3WQB A;  4C0H A;  1CZV A;  5JIU A;  5JOX A;  3J7N A;  3BTA A;  4PDW A;  3NJV A;  4TLG A;  1ND3 B;  1OKQ A;  2C5D A;  2FHR A;  3M3Q A;  5E8A A;  2ARA A;  2WYS A;  4D69 A;  3O1O A;  5A6Q A;  3OEB A;  3ZO0 B;  4O7X A;  5C3P A;  4W6Y A;  2HEY F;  1MZE A;  1AHS A;  5CZK A;  2ID4 A;  1DZQ A;  3MPP G;  1PK6 C;  1AYM 3;  1RUJ 2;  1TEI A;  1DHK B;  2RG4 A;  5T54 A;  5KXC A;  3V0B B;  3OD0 A;  1W8Z A;  1RVF 3;  3WCS A;  4Q4X 2;  4LBQ A;  2YGL A;  3WP6 A;  1V6L A;  4Q8L A;  3ZSE A;  4ZY9 A;  4XHB A;  4Y20 B;  4BQX A;  4IEO A;  3AMP A;  4BQ1 A;  3HBZ A;  1OC1 A;  3U10 A;  4NUB A;  1L7R A;  2VZT A;  2XB6 C;  2OA2 A;  3FHQ A;  5FZC A;  4AED C;  3ZFE C;  5LEJ A;  1WME A;  1LOF C;  3C7F A;  4OZX A;  3A0K A;  1BVP 1;  1CJP A;  2HEV F;  3VKM A;  1UOJ A;  1W39 A;  3HVD A;  4Q1P A;  4Z8B A;  2DTY A;  2QTW B;  5FY4 A;  5EIY B;  5IK5 A;  1W6N B;  1A8M A;  5FRE A;  1SPP A;  3N4M A;  4W65 A;  3T08 A;  5FPA A;  2C6S A;  2Q30 A;  4LBL A;  1JUH A;  2Y6H A;  4WVV A;  2Z5W A;  4OVE A;  4CZS A;  2RMU 1;  2ZXQ A;  4NID A;  1NCQ B;  4C0B A;  2Q8D A;  2VOX A;  2XXZ A;  4IND A;  4JVA A;  3RZZ A;  4CP0 A;  1I3H A;  1VMF A;  2GH2 A;  3ACH A;  1XSR A;  4WVM B;  3IDC B;  3S5A A;  2E7Q A;  3T30 A;  1DU3 D;  2HWE 3;  4YVW B;  4XDP A;  3BTX A;  2UYB A;  3AZZ A;  2WFF 1;  1Z7S 2;  2RM2 1;  4YFZ A;  2BFU L;  5A3N A;  3MZH A;  1PMJ X;  1UY2 A;  4DMI A;  1L7Q A;  1HQW A;  1V6O A;  2XJS A;  2YB7 A;  4KWL A;  3MID A;  5FY0 A;  3VDD B;  3BIW E;  2IXI A;  5FYU A;  4ES9 A;  1ZZ8 A;  1GQG A;  4DY3 A;  1DG6 A;  1OUR A;  2JG9 C;  4RQP C;  1NX9 A;  1T6B X;  4C8D A;  3LCP A;  4XAC A;  3I59 A;  3NJY A;  2K0G A;  2QQO A;  1O7F A;  1QJE A;  4XFI A;  4BMB A;  1A34 A;  4EZH A;  2A3X A;  1PMH X;  1RUC 1;  2XKO A;  2BYV E;  2E26 A;  1AJK A;  4PLO A;  4XFF A;  2FDH A;  3ZM8 A;  4XF0 A;  1GZW B;  4PDW C;  5C8C B;  1FPN 1;  4IQP A;  3C7O A;  3P3N A;  5IUQ A;  3ILN A;  1C57 A;  2WZP P;  5BNQ A;  1AR9 3;  1JOD A;  4FPH A;  2PLV 1;  2ZMN A;  3VBR A;  4QHZ A;  1WA6 X;  1D4V B;  1RMU 1;  3AZX A;  3BTY A;  1DYO A;  2BWC A;  3O7O A;  3FFZ A;  3LFI A;  3POW A;  2BJS A;  1HRV 1;  4L0P A;  4A4A A;  1GU3 A;  1SLC A;  1EAH 1;  1UWW A;  1HXS 2;  2E7T A;  2QNK A;  3R0R A;  1EPZ A;  3BKZ A;  2R07 3;  5FZ3 A;  3OYW B;  1IG3 A;  2XJU A;  4TN7 A;  2Y8K A;  2DVD A;  2A3Y A;  3NQH A;  1QJU 3;  4N53 A;  1PHM A;  2V4V A;  2Q8C A;  4N43 B;  1RED A;  5HXV A;  3PIJ A;  2VBB A;  1TG7 A;  3L2Y A;  3BOP A;  3RMX A;  1JXN A;  3VUO A;  2QFE A;  4HG6 B;  1UMH A;  2D97 A;  2IXH A;  3V56 A;  1JW6 A;  1NCR A;  4CEW A;  4GD4 A;  4HN1 A;  2WQZ C;  4N90 A;  1C8N A;  4M3C F;  3HIF A;  2XJQ A;  4NII A;  1TNR A;  1HV0 A;  1W8U A;  3HT1 A;  5JSP A;  3T4V A;  2WSV A;  1M06 G;  2JDZ A;  1XNK A;  3VHR A;  2OT7 A;  3CJI A;  3KHB A;  5A7Q A;  2C26 A;  4CCO A;  2IZW A;  1WBF A;  2D3P A;  3CLP A;  4KH9 A;  4LA2 A;  4YW7 A;  1OFN A;  1CAV A;  1WMD A;  1CON A;  3CQO A;  3VBH B;  4QX7 A;  2VBD A;  1OLM A;  3Q8B A;  3RPQ A;  3WP4 A;  1SQ4 A;  1EPW A;  2XKP A;  2YY1 A;  2ZGN A;  3MLL A;  4PCR A;  4E27 A;  5J7M A;  3AP7 A;  3T09 A;  2XHN A;  3DXT A;  1N3O A;  5CIR A;  2PFW A;  2RR1 1;  3NAP A;  3VZK A;  3ZFG B;  1NT0 A;  3BVC A;  2BU9 A;  3X29 B;  5FUN A;  3LEG A;  4DB5 A;  5KHK A;  4PLN A;  5A6Y A;  3PVB B;  4K1Z A;  1ZZ6 A;  1E5I A;  2YC4 A;  5CFD A;  4JRL A;  1D4M 1;  1AX0 A;  1JUI A;  3OTF A;  5A3U A;  3IDA A;  3ES1 A;  3KS7 A;  2EIB A;  4AGV A;  1ZZB A;  3KQ4 B;  1OHF A;  1ENR A;  3KWV A;  4K8R B;  3LDB A;  3ZMN A;  4EYU A;  4OUM A;  3AZV A;  3THP A;  3QH6 A;  3M4F A;  3AMN A;  4NAO A;  4YM1 A;  1ZRF A;  5BNN A;  1KS5 A;  2JDU A;  4ZZ5 A;  3WG2 A;  2WNU B;  1R08 2;  1NA1 A;  2XJP A;  4ASL A;  4GWN A;  1VBD 1;  3D6E A;  1PVC 1;  3H0O A;  4LLF A;  2GMM A;  5FZM A;  3N9M A;  4AVT A;  1YWK A;  3UES A;  4FPF A;  2ZGS A;  4AGR A;  5EWS A;  4PIY A;  2I45 A;  1OA3 A;  3AYC A;  4QPI B;  3E6C C;  2EXJ A;  3Q9O A;  1NE6 A;  3ZXD A;  3CHX A;  3CZJ A;  4PF1 A;  4WV8 A;  1WCD J;  5K4L A;  1UMZ A;  1VP6 A;  2QQK A;  2BQP A;  2RMU 3;  1NOV A;  5A3W A;  1WLD A;  2J7M A;  4Q4Y 3;  1UXX X;  5EHD A;  4AAP A;  5FLH A;  5J37 A;  3VBR C;  4IW3 A;  4BIF A;  4XCB A;  1EV1 1;  1JOP A;  5FKC A;  4TWT A;  4XAA A;  4R9A A;  3SH3 A;  1HIX A;  3OCP A;  5JVV A;  5DZE A;  2WFF 3;  1SCR A;  1ASJ 2;  2DUQ A;  1Y9G A;  4RD7 A;  4UF0 A;  4CYD A;  5I0U A;  2HYX A;  4MVT A;  1RUH 1;  2B42 B;  1AZD A;  1GOH A;  1BBT 3;  1QQP 1;  4HBN A;  1GWL A;  2Q4S A;  4N53 C;  5LBC A;  3O1V A;  4GA9 A;  3III A;  4IEW A;  4CUG A;  3HPN A;  1ULO A;  1UL9 A;  1AX1 A;  2UWA A;  4IE0 A;  4JGY C;  3RYK A;  2IVJ A;  1LJ7 A;  2ZKL A;  3ZXE A;  4H14 A;  1VRH 2;  2HWD 3;  1YFU A;  4XUR A;  4A41 A;  3TNQ A;  4DUW A;  3ZVX A;  1NCR C;  1GQP A;  3POJ A;  4RYD A;  2W92 A;  5LAT A;  2E63 A;  4AXO A;  3PJQ A;  1X7N A;  2JG8 C;  3AXE A;  1H9P A;  3H1Y A;  1NY7 2;  4AFA A;  3J9S A;  4DRV A;  3PNA A;  4C90 A;  1W8N A;  3C8X A;  4FVV A;  5JUV A;  3PHM A;  2YV8 A;  2VTF A;  4D7S A;  3M1H A;  2Z79 A;  1ZBA 2;  1KEX A;  4RSU A;  4I02 A;  3KMH A;  1XU2 A;  4UW3 A;  1OBN A;  3FWE A;  2VMC A;  5J96 B;  2PLV 3;  3DYM A;  4M3C E;  5LBE A;  4BQ2 A;  3RQ0 A;  3UGH A;  5F5I A;  4WM7 B;  1RMU 3;  1US2 A;  3NAP C;  4JKM A;  2D5H A;  1H2N A;  5L36 A;  4AK3 A;  3VKO A;  3K3N A;  1HRV 3;  1W8F A;  1B35 A;  3LA2 A;  5CFD C;  3WW2 A;  3ETP A;  1I5P A;  2FCT A;  5FY5 A;  2R1D A;  5FY8 A;  4CU9 A;  1IGO A;  3KSC A;  3M3O A;  2CGO A;  5HCA A;  1JN2 P;  4DPN A;  2ZGK A;  1ENX A;  4XFA A;  4K7J A;  2RS1 1;  3D4K A;  4L99 A;  1WLW A;  4O65 A;  2W08 A;  4OHX A;  2FBE A;  3THD A;  5BNN C;  5JI9 A;  1IS6 A;  2E6V A;  2XOM A;  1NA1 C;  3IWZ A;  3PMS A;  5FMO L;  3INA A;  3AFG A;  4ORF A;  4XF9 A;  4YLZ A;  3TEY A;  2HWF 3;  3MF9 A;  2I74 A;  5FJH A;  2A1X A;  4B1L A;  3FMG A;  2WAA A;  2WWS A;  2BNO A;  4GMP 0;  4XIO A;  1OLR A;  4JZR A;  1W99 A;  2WA3 A;  1VBA 1;  2ZAC A;  3AKQ A;  3GZA A;  5CVR A;  5FWE A;  1AX2 A;  4RFT 0;  2YZ4 A;  3MV1 1;  4I3G A;  2HBU A;  2WC2 A;  1V6J A;  4MG2 A;  5ERL A;  2Y0O A;  5FZB A;  3KGL A;  3ACG A;  3AKT A;  3NV3 A;  2QQP A;  3WCR A;  5KWR A;  1PZ8 A;  1LOD A;  4EWE A;  1Y7B A;  3P3P A;  1YQ2 A;  2YXS A;  4LJH A;  4P9W A;  5JSO A;  5KXE A;  3ZXJ A;  3ZXA C;  3VBS B;  4YG0 A;  1MZF A;  1FMD 1;  1IPK A;  2KD7 A;  3FHI B;  1DQ2 A;  3N7L A;  1D4M 3;  4IV3 A;  5EJ1 B;  1S0F A;  3SEP A;  1RUI 1;  1XNC A;  1F2N A;  4XW3 A;  1NKG A;  3ABZ A;  3AL5 A;  5IVJ A;  5LB6 A;  4YG3 A;  1OFS A;  5IW0 A;  3WY6 A;  5J1X A;  4XVH A;  5D21 A;  2WNV B;  4FCA A;  4MHU A;  4YWA A;  3ES4 A;  2WS9 3;  5FUI A;  5A6X A;  2I2S A;  4X6R B;  3VD9 A;  1WA4 A;  4XMA A;  1J83 A;  3G7D A;  1VBD 3;  3POY A;  3A21 A;  3NRU A;  4QQP A;  2D44 A;  3NL1 A;  1CIY A;  1YFW A;  3DF0 A;  1BYH A;  3N36 A;  2RE9 A;  3U1X A;  2ZAA A;  4GWJ A;  5E89 A;  5IFT A;  4AYU A;  5CG9 A;  1REE A;  1YJL A;  4LK7 A;  1K45 A;  4IGO A;  5FAX A;  4XPV A;  4XDQ A;  1POV 1;  1NZC A;  1GZC A;  4YW3 A;  1MQT C;  4Q0V A;  3ZDV A;  4E2Q A;  2VVE A;  2VJX A;  2VC9 A;  4RGG A;  1YHF A;  4XJ9 A;  1UO9 A;  5JZG A;  3ACF A;  2WFF 2;  2RM2 2;  3N9Q A;  2JKB A;  2WZR 2;  4FTE A;  2FZ1 A;  4JGZ C;  4CCN A;  1R1Z A;  3DCQ A;  2OUJ A;  1EV1 3;  2XVK A;  4KQ7 A;  5HCH A;  4OCT A;  5FZL A;  4HKL A;  4CEW C;  4HLT A;  5A32 A;  1VMJ A;  1CAU B;  4Q4V 1;  4HET A;  1RUJ 1;  2XJT A;  1B35 C;  3RRD A;  5FYH A;  5F6K A;  5FRA A;  2V5Y A;  4YRD A;  1HB4 A;  3I7D A;  4Q4X 1;  2YGM A;  1VMH A;  1RUH 3;  4ATE A;  1UZ0 A;  4CTE A;  4YSF A;  5L9V A;  5DQ0 A;  1XB9 A;  3AJZ A;  3N9L A;  5FTT C;  2CAU A;  1GP4 A;  1JU4 A;  4LOT A;  4Y1U A;  4CCM A;  1RUC 2;  3LWC A;  4D6S A;  4QQL A;  1H1M A;  4XBQ A;  5FOJ B;  4CU7 A;  4M4R A;  2XG3 A;  3AVS A;  1FPN 2;  2W1W A;  4XJ8 A;  4BDV B;  2NYY A;  4JDO A;  2JIG A;  2WT2 A;  3B00 A;  3I54 A;  2JDA A;  3MGU A;  3M3I A;  3TRS B;  4FQ4 A;  4CDQ C;  1QJF A;  1OD3 A;  2UUR A;  1FV2 A;  1RMU 2;  4YM2 A;  5DMY A;  4C1W A;  1PX3 A;  2BNM A;  3ZFF A;  4AEJ A;  2VQT A;  5BNP B;  1IKQ A;  1IZ3 A;  1UD1 A;  1SAC A;  1EAH 2;  2VZQ A;  3POE A;  2ADD A;  3UKV A;  5LA2 A;  1CN1 A;  5CU1 A;  2YFZ A;  2QQU A;  3RSJ A;  3LF7 A;  3EXU A;  1Z7S 1;  4PI2 A;  4FPC A;  5EP9 A;  4ZKT B;  5K0U C;  5LK7 B;  1XYN A;  1PZ9 A;  4Z1V A;  3K46 A;  1SG3 A;  3ZLI A;  1DYK A;  3ZR6 A;  3BAL A;  3VHN A;  4LO7 A;  1STM A;  3MW2 A;  1VBE 1;  2QQL A;  3LGR A;  1DQ5 A;  4KBB A;  3VDB A;  5JR7 B;  2IXL A;  4IEX A;  4JX0 A;  2VCM A;  2RS1 3;  3GZE A;  1QMJ A;  2WO2 A;  1XNT A;  1AR6 1;  2Y64 A;  1QJX 1;  4K8F A;  1YRZ A;  4UBG A;  5IJR A;  2WAO A;  2XDV A;  4SLI A;  3IZO A;  1AR7 3;  4J1X A;  4YNI A;  1R09 1;  2VZU A;  4YZ2 A;  4D94 A;  4O9G A;  3BCW A;  3HD8 B;  2PYT A;  4FFF A;  5CFC A;  2AAC A;  3VBO B;  3HNM A;  2QQN A;  3BIE A;  4ZU7 A;  3DUI A;  1VPH A;  5GJ6 A;  4IEZ A;  4BOW A;  5JZG C;  2NM1 A;  4LOS A;  4OUE A;  3B9C A;  2PMW B;  5C3O A;  1UY0 A;  2RR1 2;  3B3Q E;  4AEM A;  4FPG A;  4Q4W 3;  4QU1 A;  4E2S A;  2W87 A;  1IOA A;  5F9T A;  1OVP A;  2GSY A;  4GQ7 A;  2V09 A;  4Y5S A;  4I3P A;  5B4X A;  3GBG A;  1XXN A;  2RS3 2;  3W5M A;  2V73 A;  2VPV A;  2YBK A;  4DXZ A;  4AFM A;  5LZ6 A;  3UT0 A;  1CQ9 A;  2E53 A;  3RJR A;  4GUL A;  2HLE A;  1W9Y A;  1FMD 3;  1NLR A;  1OLQ A;  2GNT A;  5FP8 A;  3WDV A;  4BJ0 A;  5JCT A;  1AR8 2;  3MEP A;  1HB1 A;  4Q1R A;  1MVE A;  5FP9 A;  1OA4 A;  1ZRC A;  4FPE A;  4KWK A;  3A23 A;  2QDR A;  1PVC 2;  5CKM A;  1F35 A;  4CDU B;  5A6Z A;  3T2P A;  1DP0 A;  5JDB A;  1D0H A;  3MF6 A;  4QM8 A;  4Y1V A;  1MS0 A;  2NMO A;  4YVS B;  5FQ0 B;  4GXL A;  1PZ7 A;  1YCI A;  1H9W A;  3CL1 A;  3OOX A;  5A33 A;  4HMZ A;  4JDM A;  3JB8 A;  3RGB A;  4NIG A;  4BK4 A;  3IPV A;  3ELN A;  2QQM A;  1XRU A;  2ZX0 A;  4EV0 A;  2UWC A;  5JPN B;  2W68 A;  3KHC A;  4F7Z A;  2E31 A;  2GC2 A;  2GNM A;  3PU3 A;  3ZPO A;  3RZL A;  2ETE A;  5ACA 1;  4FPL A;  1LHV A;  1LAJ A;  3WG3 A;  2D5F A;  3RYP A;  5FBZ A;  1C8M 2;  3W9A A;  4E2G A;  3H8R A;  3ZFF C;  5EFU A;  3B94 A;  1W6P B;  4LKD A;  3FBM A;  2A6Y A;  4SBV A;  5KBF A;  5C9A C;  3RZH A;  4LBM A;  4FAH A;  5A3P A;  2VNO A;  1YFY A;  3WHU A;  4E8D A;  2WO3 A;  1QQP 2;  4Y1Y A;  1SBD A;  1RUJ 3;  1KDM A;  3ZN5 A;  4A42 A;  4EN8 B;  4Q2F A;  1MS5 A;  2Q8O A;  4WM8 A;  1ULD A;  4XJZ A;  3OUH A;  3CBN A;  4LUL A;  5DAB A;  5L73 A;  4Q4X 3;  3EQE A;  1FT9 A;  1Z0H A;  4HPK B;  4CUB A;  2GP5 A;  2ZGR A;  3BPS A;  3AP6 A;  2XHK A;  1BHG A;  3OY8 B;  1UZV A;  2Y33 A;  3LQC A;  1TME 1;  1H2K A;  3MI8 A;  3J8F 1;  4IXL A;  4BB3 A;  1TMF 1;  2FCU A;  2PHL A;  3BOW A;  4FAG A;  4E4S A;  1BQP A;  1V6I A;  5A7N A;  5ABJ A;  2V5D A;  1JZ4 A;  1LU1 A;  3ZYB A;  5EJZ B;  3WUC A;  1R08 1;  4GB3 2;  4BU2 A;  1ND2 B;  3MIB A;  5CFC C;  1OI6 A;  2OPK A;  3USU A;  2A70 A;  3ZYR A;  2CY6 A;  3AZW A;  1XPW A;  3SKJ E;  3I97 A;  4GAL A;  4DEV A;  3K51 A;  1OQD A;  5CKN A;  2G19 A;  4K3U A;  4MXV A;  4QDS A;  3EB7 A;  1MAC A;  1MZ6 A;  2GN3 A;  4PI0 A;  3ZN6 A;  5C3Q A;  5SV5 A;  4COZ A;  1I1E A;  1N1S A;  3T2O A;  4W8J A;  1PK6 A;  4GWI A;  3ORJ A;  4Y1Z A;  4NHM A;  4QKB A;  3WF4 A;  2OX0 A;  4UWD A;  4XIK A;  4BXF A;  3K4D A;  3ZYJ B;  5FZK A;  2VZV A;  1O4Y A;  2HEW F;  1H30 A;  3AB0 A;  3C7G A;  3ZN4 A;  2XJV A;  2VZ1 A;  1Z7S 3;  2VUJ A;  1IQD C;  4NAM A;  4Q0Q A;  4Q0P A;  4NIH A;  1KFU L;  4P9X A;  5FY1 A;  3JU9 A;  1SDD B;  2PAK A;  2MEV 1;  1KXG A;  3HMY A;  4Y33 A;  2RVA A;  1RYY A;  3VBU C;  2ADE A;  4COW A;  5DUX A;  1RXG A;  2YC2 A;  4IER A;  1CAW A;  3I2I A;  4IE5 A;  4OYU A;  3PIG A;  3ZFE A;  1LTE A;  5CYY A;  1JZ7 A;  5EPA A;  4XF4 A;  4MH0 E;  4Y22 A;  1W6Q A;  2ET7 A;  1GMM A;  3GYD A;  4P5H A;  1VR3 A;  2QCS B;  4HVR A;  4BQ3 A;  1W6N A;  5JXH A;  4PT6 A;  1OKO A;  3W20 A;  1CD3 G;  3VDA A;  2WRA A;  3TEW A;  4BQY A;  2XJR A;  2Y26 A;  4YFW A;  4P5Y A;  1VBA 2;  2DCZ A;  3OBZ A;  4FI9 A;  1V9U 2;  1HB2 A;  1QF3 A;  1L7L A;  5DDJ 2;  1LOB A;  2VQ0 A;  1S0E A;  2BVV A;  5HPO A;  3POF A;  4FFH A;  2WUH A;  1N1T A;  5D8A A;  4DXT A;  5IT6 A;  1E5S A;  2G9F A;  2XBO 2;  5HXM A;  2QE3 A;  3WNL A;  1H2M A;  3DKQ A;  4FFI A;  4LOR A;  5F3G A;  4ZXK A;  2BUK A;  4LUM A;  5FXX A;  1GNZ A;  2RDN A;  4MGT A;  1RUI 2;  5BYN A;  2CDP A;  4AVA A;  2BGO A;  2FMD A;  2Z4F A;  4WM8 C;  5F1R A;  4I2O A;  2ZZQ A;  3C7E A;  4MXW A;  1LHU A;  3PUR A;  4OFG A;  4AW7 A;  4MAD A;  5GZF A;  3CO2 A;  3HWJ A;  3WW4 A;  4FSJ A;  5BXX A;  2ZCW A;  3LEI A;  1JZ3 A;  1J3R A;  5LBF A;  4RQP A;  3WNM A;  4LIV A;  2JIJ A;  1QOT A;  1UOF A;  2W9X A;  2QDN A;  3OPW A;  4DS0 A;  4I01 A;  3SCG A;  1BLZ A;  5ABJ C;  1S0D A;  1G8W A;  3EJK A;  2W95 A;  3HQX A;  4QPY A;  4AR2 A;  5FZO A;  2OZ6 A;  3FC0 A;  3LIG A;  1IHM A;  4QX1 A;  4AHY A;  2X8K A;  2ZA9 A;  4P08 A;  2TEP A;  5FY7 A;  1J59 A;  1WW7 A;  4DEQ A;  5IVC A;  1SLI A;  4QX2 A;  4Q29 A;  4S2F A;  1DQ4 A;  1W3V A;  2R06 1;  3H1M A;  4NPM A;  2IWG B;  3MW4 A;  5GZE A;  2YYO A;  4XIL A;  3LZZ A;  4Q4V 2;  3O0W A;  2J1E A;  5GLT A;  3WF3 A;  5IVE A;  4QKN A;  3RDI A;  3OB8 A;  4EZ4 A;  1S2E A;  5LRS A;  3LFM A;  4ISQ A;  4MGI E;  4Q8K A;  3R6S A;  2DCJ A;  1A8D A;  3U0Z A;  1SDW A;  1PIV 2;  3O1S A;  2ARE A;  4AF9 A;  2Q0A A;  2WN2 A;  2VM9 A;  3S7E A;  1QKQ A;  4A6O A;  3U14 A;  3ZSJ A;  4D8M A;  2JXA A;  5AFE A;  1KS4 A;  3WDX A;  1NZI A;  3TEX A;  1KGY A;  2F17 A;  3ETQ A;  4DNY A;  3H50 A;  4TXW A;  3D0S A;  5IWF A;  3AYA A;  2JEC A;  1HN0 A;  3I3D A;  5ISL A;  2Q1M A;  4M0N A;  5E1R A;  3SKV A;  2VTX J;  4C1X A;  1GWK A;  2P6C A;  2ARC A;  3ZPY A;  3AZY A;  3KQR A;  3QOP A;  1R08 3;  2IC1 A;  2W94 A;  4MET A;  4Y3O A;  4W6X A;  2D7F A;  5BPX A;  1QXR A;  1VBB 1;  2XL7 A;  4D7Y A;  1LEC A;  3VL8 A;  1CPM A;  1PNF A;  1K12 A;  1PM4 A;  4MX3 A;  3GXU A;  3ZIW A;  1VAM A;  1RL3 A;  3NJZ A;  5C4W A;  3JD7 1;  2YBS A;  4F3J A;  4PBP A;  1K5M B;  5D8A C;  1MZ5 A;  3PJY A;  2AGS A;  4AED B;  2XPJ A;  5FZ1 A;  4YVW C;  4Y5T A;  3V0A B;  4LHL A;  2W1Q A;  1H2L A;  1YQ5 A;  1JYW A;  2WZR 1;  1W6M B;  3FBY A;  1AUY A;  2JX9 A;  4RS5 B;  4WVW A;  5FZE A;  3OBA A;  1W03 A;  1FX5 A;  3CJX A;  1UNB A;  4B8E A;  1RXF A;  1ASJ 3;  1VBE 2;  2EVX A;  1JZ2 A;  4E8C A;  2ZGQ A;  5F32 A;  2OQ6 A;  4QGM A;  2LTN A;  1AR6 2;  1QJX 2;  2DUP A;  3A7Q A;  2JDM A;  4IV1 B;  2QQW A;  5F5A A;  1F9K A;  2B46 X;  5K7P A;  2YFU A;  1R09 2;  2H6C A;  1I9R A;  1UIJ A;  3H9A A;  3D82 A;  4CEY A;  4MGQ A;  1ENS A;  3D0J A;  2DDU A;  1CAX A;  1CJD A;  1GAN A;  1VRH 3;  3HBK A;  1FNZ A;  4CCD A;  4A7Z A;  3UGG A;  3WG4 A;  4LUK A;  1K5J A;  2Y6K A;  4AFC A;  3O0X A;  5M0T A;  1KRI A;  4KGQ A;  3I2G A;  2YUE A;  3E1F 1;  3WDW A;  3FJS A;  1A78 A;  1DLC A;  1UXZ A;  1UYP A;  1YI9 A;  2RHP A;  2FDI A;  1YI7 A;  2VGD A;  2YPD A;  1ZBA 3;  2ZGP A;  5I0D A;  2VAU A;  4GH4 A;  3SMH A;  2SBA A;  3MW3 A;  4GZ9 A;  5A7P A;  2B9U A;  5BY5 A;  1O3Q A;  1W9S A;  2X5I A;  4OI2 A;  3FLT A;  1VE0 A;  4B1M A;  2CGN A;  1RHI 1;  5I0S A;  5C7G A;  2AEY A;  2ZS6 B; 
#chains in the Genus database with same CATH homology
 1S4C A;  1JOP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...