4FTBA

Crystal structure of the authentic flock house virus particle
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
344
structure length
321
Chain Sequence
b'TQTAPVPQQNVPRLTRLSQPGLAFLKCAFAPPDFNTDPGKGIPDRFEGKVVSRKDVLNQSISFTAGQDTFILIAPTPGVAYWSASVPAGTFPTSATTFNPVNYPGFTSMFGTTSTSRSDQVSSFRYASMNVGIYPTSNLMQFAGSITVWKCPVKLSTVQFPVATDPATSSLVHTLVGLDGVLAVGPDNFSESFIKGVFSQSACNEPDFEFNDILEGIQTLPPANVSLGSTGQPFTMDSGAEATSGVVGWGNMDTIVIRVSAPEGAVNSAILKAWSCIEYRPNPNAMLYQFGHDSPPLDEVALQEYRTVARSLPVAVIAAQN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein beta
publication title Structural study of virus assembly intermediates reveals maturation event sequence and a staging position for externalized lytic peptides
rcsb
source organism Flock house virus
molecule tags Virus
total genus 73
structure length 321
sequence length 344
chains with identical sequence B, C
ec nomenclature ec 3.4.23.44: Nodavirus endopeptidase.
pdb deposition date 2012-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ftbA00
1AR92 1AR61 1TME2 1R092 1VB4A 4YVSB 1PIV2 5C4WC 3DPRB 1NCRB 4PDWC 1QJX2 5J96B 1B35B 1C8M2 1HXS3 3M8LA 5FMOS 1AR73 3IDEA 3VBOC 1MEC2 3J8F1 1VBE2 1RUH3 1RUJ1 4SBVA 4EJRA 2TBVA 1COV3 1RVF2 2XBO2 5C4WA 4FTSA 5CFCB 1F8VA 3VBUB 1QJY1 1AR83 1M06G 1POV0 1QQP1 1W39A 2RMU3 1POV3 2RS53 1EAH2 1VBA2 4Q4W1 4IV1B 2WS93 1QJU2 1ND2B 1ASJ2 2WFF3 3NAPA 2HWF3 1RUC3 2HWC3 2BFUS 1VRH3 2VQ0A 1CJDA 1NA1A 5CFDC 1PO22 1PGW1 4LLFA 4IV3B 1BBT2 1R1A1 4Q4Y2 4Q4V3 5BNOC 1BMV1 2WZR3 1HRV1 5FMOL 1TMF1 1MQTC 1HXS2 1RUI3 1PO11 1AR72 1PVC2 2R071 5BNNB 1D4M3 4NWVA 5CFDA 1RUE1 4IV1C 1R082 2R043 1ND2C 1QJZA 1VBB2 4GH4A 4RHV3 5BNOA 4WM8B 2BBVA 1K5MC 1VBD1 1CD3G 1AR82 3VBRB 2RMU2 1MQTA 2HWB2 1RMU3 2RS52 4CDUA 5ABJA 1V9U2 4Z92B 1AYM3 4CDQC 2HWF2 3TN92 3JD71 1RUC2 1R093 2WWSA 4RQPB 1VRH2 3JB4C 1K5MA 1OPOA 1GFF2 1NY71 5L7OC 1PIV3 2HWE3 5ACA3 4YVWA 4Q4V2 1QJX3 1H8TA 1ND3A 5K0UC 1AL23 1VBC3 1ZBE1 1VB2A 1FPN2 1RUG3 1VBE3 2DF7A 1RUI2 3HAGA 1HRI3 3VBHA 5C4WB 5AC91 4GMP0 1RUD2 4RR3A 5J98B 4JGZA 4PDWB 2MEV1 2R042 4RHV2 5K0UA 2RM21 5BNPC 1VBA3 1EV12 3ZFGC 2ZAHA 1QJU3 1FMD2 1RMU2 1NA1B 5A32A 5DDJ1 1RUF3 1DDLA 4CDXA 2R061 1AYM2 4CEYA 1PO23 2WLPA 1BBT3 1BEV2 4RFT0 4Q4Y3 2HWE2 5BNPA 5ACA2 3ZFGA 1PGL2 3ZFFA 4JGYA 5CFDB 1AL22 1VBC2 3S6PA 4Y5Z0 1PVC3 1Z7S1 1RUG2 1HRI2 5BNOB 3NAPC 4N53A 4RS5A 1R083 3J8F3 3VBSC 1MQTB 1VBB3 1NA1C 1RUJ3 1VAKA 3JB8A 1HX6A 4Q4X2 4CDUB 5ABJB 2HWD2 2HWB3 1SMVA 2RS31 1RUH1 1QJY3 5A33A 1V9U3 1AYN2 1QQP3 1RUF2 1ZBA1 1K5MB 3TN93 1COV1 3VBSA 1FOD2 4YVWB 2GSYA 5D8AA 2WS91 1AUYA 4CDQB 1AR62 4GH4C 2WFF1 2X5IA 4JGZB 2HWC1 1R1A3 4GB31 1FPN3 5L7OB 1HRV3 4CDUC 1RUD3 5ABJC 1OOPA 1X33A 5K0UB 4QPIC 4CDWA 2R073 3J8F2 2WZR1 1RUJ2 5A32B 1RUE3 1NOVA 3JBG1 2RR11 3VDDC 1RHI1 2GH8A 1EV13 1NG0A 4YVWC 1FMD3 1D4M1 4QPGA 1H8TC 1ND3C 1QJY2 2PLV1 2FZ2A 1QQP2 3DPRA 1NCRA 2BFUL 2IZWA 2RS11 4QPIA 3VBFC 4Q4W2 3VBHC 4N43A 5BNPB 3ZFGB 4RR3C 4JGZC 1BEV3 3VDDA 3FBMA 1OHFA 5LK7B 1PGW2 1AR91 5CFCA 5JZGA 1TME1 1R091 1R1A2 3VBFA 1BMV2 1HRV2 1PIV1 1TMF2 1ZBE3 4GMP3 4CDXC 1X36A 1PO12 1QJX1 4CEYC 2R072 1C8M1 5AC93 4Q4X3 5A33B 5C8CA 2HWD3 1MEC1 1RUE2 3NAPB 1VBE1 4IV3A 3VBSB 3ZFFC 1AYN3 4JGYC 1HQNA 1VBD2 1RVF1 2XBO1 1FOD3 4N53C 5DDJ3 4RS5C 4WM7C 4NWWA 4CEWC 2Y26A 2R063 1E57A 1EAH1 1VBA1 4Y4YA 5BNNA 1QJU1 1AR63 1ASJ1 3JD72 1OOPB 1NY72 4WM8A 1PO21 1BBT1 4GH4B 4CEWA 4WM7A 1NCQC 4Q4Y1 1ZBE2 1Z7S3 1WCDJ 4QPGB 5AC92 1HXS1 5D8AC 1AR71 3CJIC 4FTBA 1PVC1 4RQPA 2MEV2 4QPIB 2X5IC 2FZ1A 4N43B 1R081 4AEDC 5FOJB 1NCQA 1VBB1 2RM22 2RS33 1A6CA 4Q4W3 3VDDB 1C8NA 5C9AC 1AR81 3ZFEC 1OOPC 5DDJ2 1H8TB 2RMU1 1ND3B 1ZBA3 2HWB1 4CDWC 1POV1 2RS51 2R062 3CJIA 5JZGB 4PDWA 1V9U1 3VBFB 3VBHB 2HWF1 3TN91 4RR3B 3VBOA 1RUC1 4AEDA 1VRH1 4QPGC 4YVSC 5C9AA 3ZFEA 1TMF3 5C8CB 3DPRC 4GB33 1NCRC 1PO13 4Q4V1 2ZZQA 1B35C 1Z7S2 4N43C 1AL0G 1FPN1 1RUI1 4FSJA 4CDXB 1RUD1 4YVSA 4CEYB 1VBD3 3JBG3 2RR13 5CFCC 1RHI3 3VBUC 5JZGC 2R041 2RS32 1B35A 4RHV1 1RUH2 2PLV3 1F2NA 3ZFFB 4JGYB 1EV11 1ZBA2 2RS13 1COV2 1FMD1 1RMU1 3JD73 5C8CC 4N53B 1AYM1 4RS5B 4WM7B 4CEWB 3VBUA 1IHMA 2BUKA 2WS92 4IV3C 2WFF2 1BEV1 1AR93 1TME3 2HWE1 2HWC2 4IV1A 5ACA1 1ND2A 4GB32 2XPJA 1PGL1 1AL21 1VBC1 5BNNC 1RUG1 2MEV3 1NCQB 1HRI1 1C8M3 2WZR2 4GMP1 1MEC3 4CDQA 3ZXAC 3JBG2 2RR12 2RM23 1RHI2 4WM8C 5D8AB 2QQPA 3CJIB 4Q4X1 3VBRC 1D4M2 2ZTNA 2HWD1 2PLV2 2X5IB 5L7OA 1RVF3 2XBO3 3VBOB 4AEDB 2RS12 4FTEA 1AYN1 4BCUA 3LOBA 2BPA2 1RUF1 5GKAC 5C9AB 1EAH3 3ZFEB 4RQPC 1FOD1 1ASJ3 4CDWB 1RB8G 3VBRA
chains in the Genus database with same CATH superfamily
4IEOA 3I3MA 1LOBA 4CPBA 2XKOA 4EWDA 2WT1A 4ES9A 3BIWE 1Q8VA 4PI2A 3KCCA 5IK5A 5FR3A 3WP5A 4MG2A 4DQAA 1S2EA 4NPMA 4UF0B 1GZCA 3D4KA 3SITA 4BPZA 1Y4WA 3DPRB 3NRUA 4DMIA 3T1MA 1QJX2 5DABA 3WQ7A 4IEZA 4DEQA 4LHKA 4JZRA 1AR73 3OCPA 3ZSEA 4IEYA 1MEC2 1JMUB 5FZDA 4EE2A 3THDA 4KGQA 2JDUA 4G9SB 2D97A 3RGBA 5T5JA 4L92A 1JYWA 4BQ1A 1WMFA 2VUDA 4D69A 4SBVA 1IS5A 3DL3A 2VCBA 2BJSA 1J84A 3ZSLA 5GM0A 1RVF2 4FTSA 1T6GC 1QJY1 4XJZA 3GGLA 3IDBB 5A70A 1IS3A 2NM1A 2ZGKA 4F83A 3M1HA 4XYXA 1POV3 2RS53 5LBCA 1OFNA 4WZFA 1G9FA 2WS93 4B1MA 1ND2B 2PQSA 2HYXA 2WZPP 3MPBA 4CTEA 4OVEA 3T2TA 1I5ZA 1UQXA 4CU6A 1UZWA 3AXEA 4ZU4A 1UPSA 1GNHA 1V00A 4CCEA 1LOFA 4HBNA 4OUMA 3VHNA 3HQUA 1S1AA 3A0KA 1SCRA 3I3QA 1BBT2 2C9KA 1FV2A 3OBTA 2JJ6A 2IXJA 2PHXA 2JWPA 4LJHA 4YARA 2IVIB 2E51A 1CGPA 3WNLA 4S2HA 3ZN4A 4AGGA 3POYA 1W9YA 3DEMA 4XHBA 5FMOL 2ZS6B 5SV8A 2YB7A 2WNEA 1LAJA 4QDRA 2Q1FA 1PO11 5EJ3A 2R071 3GZEA 4LBOA 2X09A 2OUHA 3N9PA 5FXWA 3GDBA 3LOIA 1JZ4A 1ZZ7A 5CFDA 1S4CA 3MV01 4OLLA 4M0NA 1K12A 3GALA 4IETA 1BCXA 1N47A 2R043 4Y20B 1GUIA 1QNYA 2JDAA 3EMRA 4XFFA 1GV9A 3AZYA 2BBVA 2VD7A 1SFPA 1VALA 1AR82 2A3WA 1QOSA 4E4HA 1MQTA 2WFPA 3AKQA 5JCTA 1JHNA 2ZX4A 3ZN5A 2GNTA 5ANQA 2XG3A 1V9U2 5FZKA 2D5FA 4CCLA 1R1ZA 4PF5A 4JV4A 4AYUA 4OFGA 2HWF2 4P9IA 4ATEA 3JD71 4YW3A 4H55A 1NX9A 1RUC2 5I8TA 5FPAA 5JOZA 5FPLA 2OQ6A 2P3KA 4LLOA 4D7SA 2VO5A 1MS8A 1JU3A 1H2KA 2JX9A 1YWKA 5FREA 1UYYA 1WCSA 3MLKA 2X53S 2Y6FA 1JN2P 3N9OA 5B4XA 2HWE3 4LE4A 4QX2A 4XJ8A 3SLIA 3R6SA 4YVWA 4HKWA 4AEJA 3WQ1A 2ZHKA 2WLQA 1H8TA 5T5PA 3W9AA 4NIGA 4YG0A 4HSJA 4AG4A 2NPIA 1G6NA 5A1LA 1ZBE1 2VCMA 4WVMA 4Y1XA 3W21A 2VVDA 4EZ4A 3BB6A 3VKFC 1RUI2 4LKEA 5F37A 3VBHA 2DBNA 5C4WB 1V6MA 3VHOA 2VM9A 1H6XA 1UOJA 5FY9A 1TVGA 5J98B 3UGFA 5AC91 4JGZA 3AVRA 3AYCA 1SQ4A 2Z4FA 2D3PA 4R4XA 1ZX5A 4IDZA 1W8FA 5K0UA 5BY5A 2WWJA 3LEMA 4FP3A 2Y33A 1BXHA 2RM21 1VBA3 1XE8A 4XF9A 4CZSA 2PAEA 1YEWA 2ZEZA 3G6JB 5C3RA 1NA1B 4YM2A 1W0OA 5EPAA 1RUF3 4XILA 2VBDA 4AHWA 2R061 4H14A 4ARYA 3WW4A 2YGLA 2C1FA 1UY2A 1J3RA 4CEYA 3M3CA 3ACLA 3CLPA 4OQ9A 4FQZA 1BEV2 3F2ZA 4DXRA 4CU9A 1ZZ6A 3VL9A 4Q4Y3 5A3UA 1GQPA 5ACA2 5BUVA 3ZFGA 3CIHA 1QH7A 4XAAA 1V6NA 3ZFFA 2W1UA 2VNRA 4Q29A 4K9SA 3WX5A 2CDPA 1UL9A 2ZGTA 1WZXA 1H2NA 3VHRA 4Z2WA 4YRDA 1RUG2 2WNVC 4AI9A 1G9DA 3ZDVA 1HRI2 1XE0A 1PNGA 1ZM1A 1ULDA 3ILFA 1LEDA 4PQ9A 1UWWA 4Q0UA 1JYCA 4YM3A 5IVFA 4FTEA 4MADA 4HN0A 2P5BA 2W95A 3N35A 4LIUA 1G9AA 4JHTA 4OI2A 5DUUA 2ZPXA 1VAKA 3SEPA 1REDA 3EYPA 4YSFA 4E4SA 4L0PA 2W1SA 4QXHA 4FT8A 5CEHA 3IBMA 4LO8A 3WNXA 2ZHMA 5IFTA 3O1TA 3WXPA 1QJY3 2EXHA 2J1UA 2JDKA 4XDQA 3B01A 2YMZA 1GOHA 4IGOA 1K5MB 1W6OA 5H9PA 1COV1 3FX3A 4UFJA 2IFWA 4Y24A 5F1RA 1MS1A 3ZSJA 4F3JA 3TRSB 2TUNA 2GSYA 3FHAA 2IXHA 3VZOA 4B4QA 4EZHA 1YFXA 3TEWA 2BNNA 4A42A 3H8XA 1IS4A 2WNUA 4UAPA 2E9QA 1W6PA 3AXDA 5LASA 4COYA 1KJRA 4NHKA 4N9IA 2HWC1 5FZ0A 2ZAAA 3VKMA 2J42A 1F35A 1FPN3 3AZVA 4V2VA 3ITQA 1MZFA 2WQ8A 2UWCA 5FY5A 4LNVA 5LWBA 2RV9A 5IK7A 1S55A 3LDKA 1ZRDA 1WBFA 1JYNA 1DFQA 3I2KA 3BPSA 1WLTA 4P02B 2A70A 5D1IA 1K45A 1XNBA 5JXGA 2R073 1W6QB 5JOYA 4TZDA 1IG3A 3HOBA 1CAXB 1ZA7A 1ULPA 1RUJ2 5A32B 2EIGA 3JBG1 1W6NA 4PT6A 5F5AA 3N7JA 3FHIB 5FY4A 5FZOB 4FOWA 4BDVB 2DCKA 2LUWA 1D4M1 2I2SA 4RSUA 4XCAA 1ND3C 1NT0A 1SPPA 4KWJA 5T5LA 3WCRA 3C7GA 2JDMA 4TXWA 4DRRA 2FZ2A 1SG3A 1AXYA 2OUJA 3NMBA 4PIZA 3ORJA 3WG4A 3ECQA 2J1SA 1DGRN 4CXXA 4Q4W2 4AVBA 4LO7A 5BNPB 4QQLA 5FJKA 4XUOA 3ZYHA 1HN0A 4XF0A 2GC0A 3DKWA 2CDOA 1IPKA 1D2SA 2DU1A 3JQWA 1Y7BA 1GZWA 3VDDA 1CX1A 5EXOA 3FBMA 3K75B 4L2NA 5LK7B 2ORXA 5E1RA 1QU0A 4MO3M 4URTA 2VXJA 4OUEA 2Q8DA 4MGTA 3EB7A 5GZGA 1WW6A 1DG6A 5CFCA 3WVJA 1O91A 1GZ9A 3PVNA 4XJAA 3C8XA 3OUIA 4BXSV 2X8KA 1UD1A 3RJRA 3OY8B 1XU2A 5F2SA 3VBFA 2ORZA 5DPNA 4XAEA 3CQOA 4PHZA 4BLJA 1ZBE3 4CDXC 5EV7A 2W52A 2Y60A 2VZUA 3WLUA 2R6QA 4CYDA 4DINB 5AC93 1NE4A 3MO4A 4Q4X3 5FP8A 3IT8A 4AVTA 5A33B 3O1OA 1QWRA 4XF3A 4EV0A 1QDOA 1RUE2 1VBE1 5A80A 2PYTA 3WNMA 5DN2A 2CWMA 1UU6A 3KF5A 1MS0A 1UX7A 4PLOA 1YUDA 1U5YA 3EO6A 1ULEA 1LU1A 3OYWB 4MGKE 2VMIA 4BQ4A 2VCCA 3USSA 4PIYA 1FOD3 2JG9A 1ENRA 3AZWA 2CSGA 3GYDA 3NJXA 2VZRA 1BJQA 3MLJA 4LA2A 4NWWA 3S7IA 2B8MA 3WW1A 4TYSA 2R063 5IVBA 1QJU1 4TTGA 3APBA 1ZZ8A 1AR63 5FP3A 5DG2A 2QZ3A 3RSJA 3USUA 3IZOA 4LK7A 2E7QA 1E5SA 2OA2A 2ZX1A 1LJ7A 2QVSB 4PIXA 4SLIA 2P3YA 4WM8A 3IDCB 3O1VA 3KF3A 1PO21 1QDCA 1U0AA 2ZGRA 2ADDA 4KU7A 4XZUG 4WM7A 2D93A 1DLLA 1NCQC 2HLEA 3RZLA 4A3XA 5JR2A 4P14A 2WUHA 3BODA 3NV3A 3AL6A 4XF1A 1SLLA 2VJXA 4Y26A 1HXS1 3U1XA 3SH3A 4WV8A 3PU8A 4RQPA 2P34A 4E2SA 1JZ2A 1I6XA 5IUQA 3AKRA 3W5MA 4C91A 1AXKA 1V70A 4N43B 3GHMA 3G7DA 5LCWL 4XQDA 1RUNA 2DCYA 5FZEA 5EJ1B 2BEOA 4M3CE 3L2YA 4IGQA 3AMNA 1TQ5A 3LA7A 2VE1A 2VXRA 4BH9A 1G7YA 4LK6A 1OOPC 1H8TB 2RMU1 2A6YA 1IG0A 2CNAA 4CDWC 1JOBA 1XSQA 1UKGA 1BZWA 1GSLA 4PDWA 4LBLA 4HONA 3VBHB 3ZDSA 4AVVA 4B7KA 4Z8BA 3TN91 2O1QA 4HSLA 2N7GA 3IMMA 3R0RA 4W6WA 3RDIA 5IYYA 1I5PA 3PVBB 3UYJA 2Y34A 2C0ZA 5FKCA 2PQQA 5K7PA 5JOWA 3B02A 1R64A 3E1F1 1NCRC 5AFBA 4WBBA 2ERFA 4AZZA 1AHSA 5A7NA 4LPLA 1C1FA 3DYOA 1FNYA 2D5HA 3I3EA 2PN5A 4IEXA 5GLTA 4V1PA 4O9EA 2HKXA 3VD9A 4JDOA 2ZZJA 4KQ7A 1RUD1 3PMEA 2V72A 5E8AA 1WCKA 5GALA 4CEYB 1VBD3 1GWLA 1GP4A 2A71A 2CWSA 3H3LA 3JBG3 3N36A 3OGJA 4HK8A 4UF0A 1FXZA 1JW6A 4Q0VA 5JZGC 3KM5A 2LRPA 1D2QA 5FK7A 4AVSA 4H7LA 3ETPA 4Q0PA 4RHV1 1DHKB 1QEXA 3ZO0B 2W46A 4UFMA 4XQWA 1Q8PA 2IVJA 5FUIA 2A1XA 3K51A 2D6PA 1O5UA 1XYNA 3O14A 1EV11 2JE9A 2B39A 4ZU5A 3ZFFB 4D7YA 1PMJX 3B9CA 5ANNA 4Y22A 5F3CA 1IS6A 1GP5A 2H0VA 1UXXX 2JG8C 2GNDA 2BVVA 5FZ7A 1ZREA 1QF3A 5C8CC 2WN2A 1MZ6A 1AYM1 1W3VA 5EYYA 4CEWB 1PZ7A 4D3WA 3LPFA 4LTAA 4J25A 4ARXA 5C5UA 3O1MA 1W0NA 2WS92 3O1UA 1SEFA 2HYKA 2ZGUA 3GHNA 2PHLA 3DN7A 4HFSA 5FV3A 1ND2A 1XB9A 3GF6A 1PGL1 2R32A 4RFRB 2DTYA 1AL21 4O65A 4H2AA 3WW3A 1GQGA 3NNJA 4LO6B 2NP0A 4IEQA 3MIEA 5BNNC 4XUNA 4YGEA 5T52A 1UY3A 2MEV3 1T6BX 1H1IA 3R4DB 1UU4A 2W9XA 1K5JA 3VN4A 1LB2A 1WKYA 3LFMA 1YQCA 3J4UH 4XURA 5FCCA 2XH6A 1XYOA 3DYPA 2H6BA 4YW7A 3T2QA 3LEGA 1DYKA 1RHI2 2NMNA 3CJIB 3BPZA 1DQ1A 1UCXA 4I0BA 2HWD1 2GNBA 2RDRA 2VZSA 3M3OA 4AI3A 5L7OA 3KSCA 3AKTA 4AEDB 2RS12 2DTWA 2VGDA 2QUOA 3LDRA 4HPKA 3T30A 1AYN1 3MIBA 4BCUA 4CA9A 2VMEA 1QJEA 3BTAA 1UY4A 3DV8A 4JCKA 3K4AA 2IUWA 3BU7A 4M01A 1T2XA 3FLRA 2R49A 4QX1A 4Y20A 3H42B 3ZFEB 5C9AB 1CZVA 2HEWF 2DCZA 4XEZA 2WT2A 4DXTA 1RB8G 1Z78A 5L9BA 2YBPA 1W9SA 3ALQA 4DO0A 1JYTA 5IW0A 2ZACA 3I4IA 3NKGA 4E8DA 5FLJA 2GC1A 1XSRA 3N9NA 5D2AA 1AR92 1TME2 3RQ0A 1SZBA 4FAHA 2QQNA 3U07A 4AHXA 1OSGA 4IGPA 1NKGA 2PHTA 5A3MA 4X6QB 5FP9A 1XNAA 3IIAA 4KU8A 1OURA 2JD9A 4ZXKA 4CPBD 5DUVA 4FOQA 3R4UA 1W8OA 2BGPA 2PXJA 5J96B 1B35B 1C8M2 3H3ZA 5F3IA 1HXS3 2LROA 3M8LA 3MFAA 1JZ3A 1UIKA 4ES8A 5JUVA 3IDEA 2FMYA 3Q8FA 3VBOC 3J8F1 2RDSA 4A7ZA 2ZMNA 1Q56A 3K3OA 2PHWA 1DGLA 1RUH3 1YHFA 4YW2A 3LE0A 5FP7A 4AE2A 1PNFA 1HQLA 2DVGA 1OPMA 2TBVA 1P8JA 4A6OA 4LHSA 2FDIA 3H8UA 3CJXA 2QJVA 2XBO2 5C4WA 5CFCB 2RJKA 1F8VA 1KFUL 3AZXA 4KBZA 5FLHA 3VBUB 5A1FA 4XE9A 5EIYB 5KXEA 5E16A 3AKSA 5KHIA 2K9ZA 1POV0 1QQP1 1NZIA 2RMU3 3ES1A 3I59B 1GP6A 4CUGA 2P37A 3FN9A 3J7LA 1OUSA 1EAH2 1VBA2 2SLIA 1STMA 2Y0OA 1ASJ2 2VQTA 4PBOA 4BJ0A 5JMOA 5LATA 1GR3A 4B1LA 3TEXA 3LCPA 4DRVA 2NQYA 4GWJA 3S0MA 1CJDA 1NA1A 1A8DA 2R30A 5F39A 3J7MA 5CFDC 3PTYA 3CKHA 4Y1YA 4LOSA 5JWPA 1AF9A 2ZABA 1UXZA 4NRPA 5FXZA 4COVA 4Q4Y2 3RG0A 1MACA 1S0DA 2WZR3 4IE5A 2W39A 1Y9GA 2VL4A 3V0AA 3ABZA 2JG9B 5F5CA 1TMF1 3T4VA 1PK6A 1MQTC 3Q8CA 4K20A 4K7JA 1RXGA 1ST8A 2EAAA 2HJIA 2JXAA 1ULOA 3CL1A 4X8PA 4XJ9A 1ULCA 1OD3A 5L19A 3OEAA 4XTMA 5A1AA 1LENA 4UW4A 3OUHA 4R9CA 1J3PA 4RHV3 2YGMA 3RYKA 1OD5A 4L97A 4WM8B 3ZSKA 1QY4A 1CD3G 1LR5A 1ZRRA 1W8NA 3FC0A 4IERA 3VBRB 3VGIA 1LOEA 1LCLA 1QXRA 3PURA 3A4UA 3UL2A 4JKKA 1QIQA 3AYEA 3NWKA 4PQQA 4CUBA 3UJQA 4KH9A 3RZJA 4R52A 5FZ6A 2WQ4A 2C24A 4OI0A 2VZTA 1AYM3 1SFYA 4CDQC 5F3GA 3PUQA 3WR0A 2ZJCA 3LEKA 4S2FA 3HVDA 4OULA 1R093 3MF6A 1NQJA 1H9PA 1VRH2 2QDRA 2UYBA 4RQPB 1AX0A 5AVAA 5LW9A 2ZEXA 1K5MA 3NL1A 1GFF2 1L3JA 2DURA 1PIV3 1OT5A 4FP2A 2ILMA 4K8FA 5EWSA 4AQSA 5FZBA 3ZM8A 2GDFA 5FUNA 4LT5A 1GLHA 4Q4V2 2E31A 3ZVXA 1O8SA 2D6OX 1OFSA 3FWEA 4FO9A 1AL23 3WT3A 5K0UC 2QQVA 3OSDA 4NMIA 1XE7A 3KT4A 5JPMB 4LITA 2B9VA 3TB0A 1VB2A 1SHWB 4XW3A 1FPN2 4W8JA 3IB3A 4IW3A 1XJAA 4QGLA 3ZX7A 1X8MA 1Y9QA 4GMP0 1I3HA 3D0SA 4Y1UA 3RMXA 3DXTA 5JOXA 3P6BA 1MS4A 2WIIB 4PDWB 3WP4A 2VECA 3VD4A 1E5IA 4YM0A 4EQVA 4YW6A 1KRIA 3KT7A 1YRZA 4CXWA 2IC1A 2YUEA 2R1BA 5F9TA 4Z2AA 4P5HA 3GXUA 3E5UA 4XABA 5FPBA 4GKXA 1W6QA 3JZVA 3ZFGC 2JE8A 1UOBA 4LIVA 1RMU2 1CAXA 5DUWA 4HVQA 3I2DA 3QCWA 4QKNA 5A32A 1W8UA 2ZKLA 3ZXLA 1QXJA 5FZOA 4L8QA 4K1YA 1EY2A 1JYIA 2BVBA 4HVOA 3RZMA 3I7DA 2XB6C 4HKOA 4LHLA 3ETQA 1PMHX 1UW8A 2WLPA 3AB0A 3J9SA 2P6CA 3FUOA 2K2SA 4GALA 4RFT0 4DY3A 3ACHA 2Q0AA 1PZ8A 3HN1A 1N1YA 5IAVA 2P3JA 4XOGA 5BNPA 3HNMA 3DYMA 1XPWA 1Q8OA 3OGGA 1RYYA 2RJ2A 2W92A 3I2FA 3O1RA 1VBC2 3S6PA 3KV9A 4Y5Z0 3ENRA 1S2KA 1I9RA 3H3UA 4JTOA 1ULFA 1PVC3 1Z7S1 3P3NA 5CU1A 5FXXA 4CCJA 3GCWA 1OKOA 3GZAA 2FCVA 2WZEA 5BNOB 4Y22B 1AX2A 2GU9A 3NAPC 4N53A 4RS5A 1CPNA 4Y1ZA 4BYYA 1WD4A 3VUOA 1S0BA 4PI0A 1J3QA 1R083 3I2IA 3J8F3 4RA0A 5D21A 3OY8A 1VBB3 2WSUA 2JECA 4YZ2A 1WMEA 3CDZB 1YC61 1HX6A 4Q4X2 4HK9A 4P9XA 4OHXA 3IAQA 1PX3A 2AGSA 2HWB3 4FPGA 4Q0SA 1SMVA 2RS31 3UT0A 4DUXA 1F5FA 1WLDA 3LZZA 5A33A 1QQP3 1W2NA 3H7JA 2ZXQA 5IWFA 2WRAA 5J1XA 4NVPA 4Y5SA 1LGCA 3LIGA 2B4KA 4NN0A 2CL2A 1FOD2 3PUSA 1QJFA 1BQPA 1LOAA 4YFZA 4QX0A 2EA7A 2VZOA 4FXGB 2TNFA 3J26N 3OYWA 1JZ8A 5D8AA 3ZXFA 3FFZA 5CVRA 5G04L 2WAOA 2VOWA 1AR62 4GH4C 2WFF1 2X5IA 2E33A 4BISA 4K8RB 4JHZA 4LO4B 2EF6A 1O4YA 2BV4A 2Z79A 5JI7A 2JDYA 2QNKA 4OHYA 4X6RB 1YQ8A 1X7NA 5L7OB 2LM3A 4DXSA 1MVEA 4CDUC 3HIFA 3PU3A 5ABJC 1GICA 3RZHA 1O4TA 4HPKB 4LO5B 4J1XA 2AEYA 4KWUA 5BXXA 2PMWB 4QM8A 2V5DA 2ADEA 3IKWA 4U36A 1JODA 1WLCA 5FO8B 4BK5A 2JD4A 4IEVA 1NOVA 1UZ0A 2IFRA 2RR11 5DG1A 4LKDA 3VDDC 5KWRA 2GH8A 3AMHA 3MIGA 4META 4LQRA 3RZZA 1BYHA 2WO1A 4KG0A 5T55A 1FMD3 4NOTA 3AP6A 1TZOA 3NJYA 3ZXJA 3JCIA 4DPNA 4EN8B 3TNPB 1FX5A 1A8MA 1PZ9A 1X50A 5FJHA 4LE3A 2PA7A 4XCBA 2BFUL 4I30A 4AWDA 2PELA 3TEYA 3VBFC 2O8QA 4N43A 1CN1A 4RR3C 1VJ2A 3ACFA 4MLOA 3TEZA 4BK4A 5CISA 1V6LA 3L9JT 4P9LA 4UFIA 4GKYA 1OHFA 2BERA 2FDHA 3GBWA 3ZPOA 3GZUC 4KWKA 3OEBA 1A78A 1PGW2 3LKJA 1VR3A 1NZCA 2XJRA 3P5BA 1UAIA 2FQPA 2RDQA 3LFIA 4NRMA 1R1A2 2R1DA 4RL7A 5FZGA 2SBAA 4YYOA 4AFCA 3HNBM 2BDRA 1BMV2 2E7TA 2V4VA 1HRV2 3WNNA 1REFA 4MHUA 4IE7A 4MX3A 3UKVA 1K3IA 1XBFA 5EQUA 4GMP3 2UY8A 4IESA 1MS5A 1X36A 2F6BA 4XUQA 5B4NA 2ZX3A 1Q8SA 2V4AA 1SLBA 1QJX1 3ZYJB 4DS0A 4COZA 3H8RA 3DKQA 3MYXA 3BYWA 3VHPA 5C33A 3DF0A 1MEC1 3ZXGA 4Q8KA 1UZZA 3M7AA 2VMHA 4QQPA 5K4LA 4IV3A 5DAWA 5JI9A 1YO8A 2CY6A 4Q0QA 1DIWA 3VBSB 5FPUA 4JGYC 5SV5A 2PTMA 1VBD2 1BK0A 1KDMA 5FY7A 4ASMB 1HLCA 1RVF1 5L9VA 5FYUA 3H9AA 4BZ4A 1YXWA 3ACGA 1CWPA 5CAZA 2ZCWA 4WM7C 4KL1A 1SLTA 1GBGA 1Y9MA 3LGRA 1E57A 3V0AB 3Q8EA 1L7QA 1V6IA 1PK6B 4CCDA 3TNQA 1JU4A 4B29A 4QB6A 3AJYA 3PMSA 5F8PA 2IXKA 1CAVB 5LBEA 4CCNA 5T3NA 1OOPB 3Q9OA 1NY72 4AQTA 2WR9A 1ZA4A 1BBT1 5FYZA 2QE3A 1GANA 4CEWA 2VNVA 3N3HA 1GWMA 3AP9A 1C1LA 1Z7S3 1Q3EA 5L36A 1W6MB 4B7EA 1WCDJ 2JDHA 5HV0A 3HT1A 4K1ZA 3KHCA 2XJPA 1OQ1A 1IPSA 4A7YA 4MGSA 2CGNA 2GNMA 4QX8A 1O6UA 5KHHA 3HBKA 2MEV2 4QPIB 1DCSA 2D43A 2FZ1A 3WSOA 3LA2A 1S0GA 4XFAA 1VIWB 2OVUA 1W28A 2XL7A 3KMHA 3OBRA 2VW1A 3ZXKA 3N7KA 4QT6A 3U10A 5FOJB 2RS33 1X9PA 4LBQD 1FT9A 2ARXA 3AFKA 3KV5A 1JI6A 1AR81 1O8PA 1RXFA 1ZRIA 2QCSB 2QQKA 4JTNA 5DDJ2 3TAYA 1Q43A 1C3HA 1QOOA 4JRAA 4DB5A 3HQXA 2W1WA 5HCHA 2Z69A 3CJIA 5JZGB 5HCBA 3O1PA 2VTFA 5FOBB 3D5OA 1VAVA 2AR6A 3OUJA 5A3LA 3BTYA 1V9U1 4HOOA 2DWRA 3MUY1 5DMYA 3SKVA 2DVAA 2HWF1 4MXWA 5CBLA 1C5IA 2ES3A 1RUC1 2VQAA 2FDFA 4AEDA 2PHFA 2C26A 3GM8A 1OA2A 4QPGC 1DGWA 1J1LA 3GCXA 1S0EA 2JG8B 2BBAA 5C9AA 1L7LA 3AKPA 1QGLA 3ZFEA 5C8CB 1VRBA 4LBKA 4ATFA 3DPRC 4E27A 1PO13 2ZZQA 2OQ7A 5L9RA 1C57A 3H1MA 3AYAA 3PUHA 4NHMA 3NNMA 1JTZX 1JYXA 2WZ8A 4QQHA 3ZXEA 2WO3A 2D6LX 2VCAA 5DAPA 1RUI1 2Y6HA 1CPMA 4NR1A 3PIGA 3AM2A 5HI0A 3B5LB 1OQDA 2DUQA 2UY9A 5I8SA 3FMGA 1WA6X 4LORA 3ZLIA 2J7MA 3BOWA 1DYPA 4YGBA 2RR13 2GP5A 4W6YA 1AXZA 5FK8A 3VKLA 5F2WA 2BOIA 2FCTA 4GJZA 2RJLA 1B35A 1IZ3A 1RUH2 2Q8CA 5A6ZA 4M0HA 3ROUA 3I2GA 3SXWA 4G3YC 5KHKA 3KGLA 1ZBA2 1TG7A 4FPHA 3S7EA 5HV4A 4D6QA 5GZCA 2B46X 2O14A 3JD73 3N4MA 4TSVA 2FDKA 2JDNA 4OUSA 4WVWA 4Y1VA 1O5LA 1U12A 2Y6JA 1V6OA 3VLBB 3AP4A 2DUPA 4N53B 4JX0A 4RS5B 4DUVA 5JIAA 3VBUA 1IHMA 2ARAA 2ZEWA 3FFQA 3E6CC 2YHJA 4WVZA 1O7FA 5A3TA 1BEV1 1LEMA 1YI7A 3I59A 3PL0A 3E6DA 3RZKA 4W65A 2GALA 3NV2A 5ACA1 1F4HA 4GB32 2XUMA 1SDWA 5FYHA 1O3TA 4XACA 5LA2A 3VZMA 1FV3A 1CVNA 2DVFA 3PLQA 4LMFA 5BYNA 4FFIA 4MV2A 4AAPA 4FAGA 3CEWA 1RUG1 4R9DA 4LBMA 4YG3A 2V09A 3VKNA 1HRI1 3B94A 3T3YA 4F7ZA 4AFBA 3WZ1A 2WZR2 1PHMA 2EVXA 1IPJA 4RD7A 5CA6A 1W8ZA 1MEC3 2WJSA 1M4WA 3ZXAC 4ASKA 4BB3A 2RM23 5D8AB 2QQPA 2ZEYA 2CU5A 3IWZA 1NQDA 2WL1A 3PUAA 4XJWA 2PLV2 4GIQA 2X5IB 1IKQA 1LTEA 3POFA 4O7XA 1RVF3 4TLFA 2DVDA 2VR4A 4R8HA 3VBOB 4LXLA 4FBFA 1LHUA 2B42B 4QU2A 3KZ4C 2BPA2 4M3CA 1JUIA 1YCIA 5APAA 4FFHA 3W59A 5GKAC 3UV9A 1SLAA 3HJRA 3UGHA 1TE1B 1O4ZA 4EWAA 3DGTA 3A22A 3VBRA 3OD0A 2XQRA 3EQEA 3WF2A 4FOVA 1RJ8A 4HZFA 3N7LA 2C6SA 2R16A 1S2BA 4OZOA 3S5QA 4LEJA 1R092 3ELNA 3WEZA 3OB8A 1WCQA 3KD4A 4BQ3A 2DV9A 4YVSB 2Q1MA 5A6XA 1GOGA 1NXMA 2CAUA 1PIV2 3AVSA 1JH5A 2YZ4A 4HANA 3PDQA 3CF6E 1ALYA 4QB1A 5IJRA 5JIUA 2XVLA 2W87A 3AJZA 3RFRA 5FPZA 3S5AA 2GMPA 4GD4A 3QOPA 4YZ4A 5FMOS 4GZ9A 5FKBA 3WOGA 2QQMA 1EUUA 4AI1A 5KXBA 4FQ4A 3WINE 2G19A 5K9YA 4W6XA 1HJGA 5EFUA 1RUJ1 4D94A 4BM8A 4EJRA 3MUZ1 1DQ0A 5T54A 1Y3TA 3WHTA 1COV3 4QKDA 4NAOA 4LBJA 3U11A 1CONA 1EUTA 1J1TA 2JDPA 1J58A 3RI8A 2DYCA 1AR83 3M70A 4HL0A 1LECA 3A7QA 1M06G 1W39A 2P2KA 3AYDA 3LPGA 3KVAA 3CBNA 3C7FA 4AK3A 5IAXA 2EALA 2BNMA 4Q4W1 3VB9A 3KWVA 2JE7A 4UW5A 5A7WB 1NUKA 3MBWA 1CIYA 1DF0A 4Q5OA 2F17A 2HWF3 4ZPIA 1RUC3 2HWC3 1HB4A 3POGA 2ARCA 2BFUS 2WC2A 5A3WA 1IQAA 1DQ4A 2MNGA 3K2OA 4LLFA 3ZYPA 4IV3B 2UURA 4TN7A 3VD5A 3BGAA 3BIEA 3KT1A 4MVTA 5IVYA 5ISLA 1W99A 3I3DA 4NIIA 2WDBA 2WO7A 2VOVA 3WG1A 5CADA 3OGRA 5FZCA 3RPQA 2B9UA 3NO8A 4LOTA 1WLWA 4D6SA 2DCJA 4RGAA 5HXMA 1DQ5A 1RUI3 3ES4A 2JICA 1AR72 4P9WA 3OJBA 1X8EA 1PVC2 2ENRA 3JU9A 2VZ3A 1LGNA 1HQWA 1D4M3 2I45A 5I0UA 2XWBB 4EN7B 3MZHA 1RUE1 4Z07A 3WNKA 4CCKA 2HH9A 4IV1C 1R082 5B2GB 4I0WB 3WP3A 5FZ1A 1QJZA 1VBB2 2WYFA 4S2GA 5BNOA 1BLZA 3WV6A 3U0ZA 1US2A 1K5MC 4YG6A 4XUPA 2VMDA 2YPDA 5LEKA 1Q5OA 1ENSA 4H3WA 1W04A 2HWB2 5DAVA 4MXVA 2NYYA 5I91A 2VZPA 1K42A 1CIWA 4HVRA 1NE6A 2RS52 3VDCA 3VD7A 5BNNA 4Z92B 1MS3A 4AEKA 5C70A 4YWAA 3T2PA 3BUCA 2XJQA 3MIFA 4EWEA 3T1LA 4FPYA 2WWSA 3N7MA 4KBBA 1OKQA 3RRDA 3ILRA 3D82A 1O3RA 1OPOA 5C3OA 3HN3A 4QHOA 1RJ7A 4TWTA 5ACA3 1SBFA 3U4SA 2ID4A 2G1MA 4QD2A 1EPWA 5C5TA 2D44A 2Y6LA 3NW4A 1ND3A 2GN7A 1H1AA 3B7MA 4JDMA 2YG0A 4NHLA 4ZZ8A 1RUG3 1VBE3 2RE9A 2EAKA 3HAGA 3MW4A 1HRI3 3SEEA 4AGVA 4COWA 3THTA 4HKLA 4OI4A 4QHZA 4MSVA 1XRUA 3H0OA 5M0TA 3NNGA 2A6XA 1W9FA 4MXWB 2R042 4AHZA 4CP9A 1J83A 2GC3A 3HD8B 1LESA 3MEPA 2H0BA 2HBUA 3LF7A 4I2OA 2F4LA 3POWA 5BNPC 1VMJA 2ZX2A 5FTTC 2ZAHA 1OLQA 1QJU3 2A6WA 2DDUA 5KXCA 1FMD2 4XXPA 4MGQA 1JBCA 3T4HB 1A34A 4I0AA 5LA9A 1LODA 3KLSA 3RNSA 1E5HA 1CAWB 1DDLA 4CDXA 3SCGA 2DFCA 3FBYA 2BWAA 2ET7A 1PO23 4ZS2A 3ZR5A 4IEWA 4PBPA 4DIQA 4XTPA 2VZ1A 4JKLA 4P9GA 5FZMA 5CG8A 4JDNA 3RWNA 1QOTA 2HWE2 4MHRA 3TWIA 2A3XA 3EJKA 3HWJA 4DZGA 2NZ9A 5FFOC 2A75A 3FZ3A 4YFWA 2ZGQA 4J1WA 4JQRA 4I3PA 3SKJE 4S2DA 2E63A 1EYBA 3AK0A 1JZ7A 2ZGMA 1FAYA 1HDKA 1W03A 2J1VA 3LIHA 1W3XA 2JEMA 4ZHNA 1Y43B 1ACCA 4QM9A 1QXPA 3SH5A 3CHXA 5AFEA 2A6ZA 1ZYBA 2WA3A 1LOFC 1YNAA 5FY8A 4A7KA 4BHPA 5LA0A 1RUJ3 1KD7A 2QQOA 5J09A 4CDUB 3V0BB 3ON7A 5ABJB 1W2TA 2D3SA 2VOKA 1WGPA 5C71A 3V65A 1WUVA 3M3EA 1C28A 1OBNA 1WA4A 1ZZBA 5DZEA 2IXIA 4CP2A 4EN6B 3UKTA 4QXKA 3LSDA 4BXFA 5A6YA 4BQXA 3E5XA 1RUF2 1OH3A 5I93A 4NAMA 3TN93 5F3EA 4AW7A 4UW3A 3S30A 1VMFA 3VBSA 2YC4A 1GOFA 2PAMA 3WNPA 4C0HA 1HW5A 2D3RA 5AVPA 4UBGA 5LBBA 5ERLA 2YBKA 2VTXJ 4AL9A 2VUAA 5BV6A 5A7OA 5FZ9A 2LS6A 2XJTA 2WS91 5JVVA 3SH4A 4TLGA 3JUUA 1CR7A 4UXAA 3BCWA 1OH4A 3I97A 3M2MA 3MF9A 3HR9A 5FY1A 3KHBA 3H7YA 4XIKA 3IN9A 5LB6A 1VE0A 2FHRA 1AJKA 5FWJA 3B3QE 1KXGA 3ASIA 2W0XA 1CX4A 4U2AA 4IXLA 1RUD3 1CAVA 4YNIA 3C2UA 2Y6GA 2XVGA 5FP4A 3SC7X 1OOPA 3MW2A 3DECA 4CDWA 3BKZA 4M3CB 3WCSA 1UNBA 4XMAA 2BYVE 3JQXA 3FLTA 4CU8A 5I0SA 2P6HA 2IXCA 5JPNB 1UKRA 2WT0A 4FPEA 5LY1A 1NYWA 1RUE3 5FZAA 3U37A 5FDBA 1HV1A 2VBPA 4IUGA 4X8NA 2D6MA 1RHI1 3MV11 3PUIA 1EV13 2EIEA 1W6MA 3MICA 1SBEA 4YVWC 1OC1A 5F32A 3THCA 5BNQA 3T0DA 5IVVA 1H8TC 5EYXA 2AH2A 4D0QA 1QJY2 5EJZB 2RVAA 4AQ2A 4OQ8A 2KM2A 1PM4A 4B4PA 1QNWA 3NNFA 3AMQA 2CTVA 3DUIA 3NQHA 4W4ZA 1NCRA 2IZWA 4QPIA 2RS11 2OS2A 5FUPA 3IPVA 3VBHC 3MW3A 3VZLA 2WWUA 1XNDA 3K4DA 4JVAA 4AXOA 4D7TA 4JGZC 3UJOA 5HCAA 3M4FA 3KV4A 1J59A 5JMCA 4QAWA 3O0XA 3NNLA 3I8TA 4UW6A 5GZFA 4JC1A 2LALA 1US3A 1W06A 1BKZA 2I07B 2Z42A 5LA1A 2J1RA 2W1QA 3POSA 3SHRA 4AHYA 4NIAA 1AR91 5JZGA 1TME1 2K0GA 2WNOA 1GNYA 1B09A 1RINA 1KFXL 1VPHA 4MYEA 1CAUB 3OPTA 2BP6A 1ONAA 3Q8AA 1PO12 1OA4A 2P3IA 4AI0A 3ZYFA 4XFBA 2R072 2JG8A 1C8M1 1D7PM 1XU1A 4CEYC 3K48A 2VUJA 3MGUA 5C8CA 2WNVB 1XYPA 1XXNA 1F9KA 1SLCA 2HWD3 4XBLA 4JAAA 4XUTA 3T0AA 4JQTA 2XLAA 3M3IA 4ET7A 2QFEA 3ZFFC 1AYN3 4UWDA 5GLVA 4IQPA 3I49A 1QMJA 4Q26A 1GZTA 2ZMKA 2XBO1 4NUBA 4BWOA 3H8OA 3NKTA 2DUOA 4YZ3A 2JIJA 1OI6A 1PVXA 4C90A 2AEZA 3THPA 1POQA 3C7OA 4CEWC 3QH6A 4L9BA 1TNFA 2FBEA 2Y26A 4JRLA 4COUA 3SCHA 3B9IA 4UFLA 1RITA 1EAH1 1VBA1 2JIGA 2VULA 4RGGA 1CQ9A 1XNCA 2Z2SB 4GWMA 4UFKA 3KCXA 4Y4YA 5T5OA 4NE9A 1ASJ1 3JD72 4AR2A 2VUCA 3ZIWA 3FUQA 1IOAA 3IMNA 4BMEA 4XC9A 2W91A 1RC6A 5KHGA 2YC0A 4NPRA 2OX0A 1PM7A 3MIDA 5DAQA 2IWGB 3VDBA 2VAUA 2JENA 3WP6A 3WG3A 2VMCA 3D6EA 3R05A 2KXLA 4Q4Y1 3SNMA 2VNOA 1ZBE2 2WYSA 2XHKA 1D0GA 4R4ZA 4E9KA 5K8SA 1N1SA 4QPGB 4K3UA 5AC92 4E4DX 2YFZA 4EN0A 3WY6A 3CJIC 3ZPYA 4FTBA 1QHDA 3WF0A 5FIXA 5JAXA 4NHYA 4NROA 4Y3OA 2CYFA 2HEYF 3WDWA 2WNUC 3CZUA 1OLME 1I1EA 1H9WA 5HBAA 1X9TA 3WHUA 3P1IA 4XMIA 3TYJA 4AEDC 4Z1VA 2WINB 5CKMA 4XIOA 2RM22 5A7PA 1A6CA 2UYAA 1DLCA 4N7UA 5C9AC 3UKNA 3ZFEC 2VTXA 1DGRA 1HIXA 1HV0A 1LOCA 1ND3B 3NJZA 4AFAA 1WCUA 4Z82A 1SACA 3BU0A 2Y0IA 3ZXDA 2R062 1BVVA 4QXCA 1QKQA 1HJFA 5TSWA 2DCTA 2UWBA 2RDNA 3KQ4B 5FZ4A 5LY2A 4CVUA 4AF9A 2JKXA 2FDGA 2VVFA 3VBOA 1DQ6A 3PTRB 1VRH1 1HB2A 1LHVA 1NLQA 1N3PA 3CZJA 2NMOA 5LZ6A 4CP9B 1TMF3 1AX1A 1JS9A 4CUAA 3IM0A 2Q30A 4BIFA 4BIOA 4Q4V1 1B35C 1ZZ9A 2CGPA 2KA3A 1L7RA 3R4SA 3MPPG 3KQRA 1MVQA 1V0AA 2Q1ZB 2B45X 3FJSA 1AL0G 1FPN1 1RTVA 3MI8A 4FSJA 3GJBA 2EIBA 4CDXB 1YI9A 4BMBA 1G9BA 1W8TA 5E88A 4YVSA 1UYXA 1WMDA 1UYZA 5FYTA 2NLRA 2BTVC 1RHI3 3VBUC 3TBDA 5CFCC 1TEIA 5E89A 2ZHLA 4MOAA 1VP6A 3N9MA 4FPJA 3H50A 1LNSA 2H6CA 3AP5A 1O59A 5DUXA 4O9GA 3I54A 1NAEA 4B3NA 2RS13 1COV2 1RMU1 1QH6A 1ZNPA 1H1MA 3B93A 4QDQA 2C4XA 4IEPA 3BALA 5FZFA 4Y4RA 1F31A 1PX4A 1OUXA 1XNTA 5E6HA 1XC6A 1PGSA 4HT1T 4XZPA 2GZWA 4CU7A 3U78A 1H30A 3W5NA 3RZGA 4LUKA 4FFFA 1JOJA 1GU3A 4P9JA 2QZ2A 2YROA 1VAMA 5BPXA 1RIRA 3HPNA 4ZS3A 5A7SA 3VZNA 5CKNA 1AR93 4QKFA 2W08A 1NLRA 2YBSA 2YV8A 1TME3 1ZZCA 2HWC2 4YW4A 1H4HA 1UOGA 3FL7A 2OPWA 2JG9C 1ENXA 5A7WA 3MIHA 4RGKA 4XBNA 1W2AX 1VBC1 3C3VA 2A7AA 1JUHA 2VU9A 4YLZA 4ORFA 1NCQB 1C8M3 4GQ7A 4LBNA 4UT5A 5IK8A 1MPXA 5DXDA 3KB5A 2TEPA 4Y5TA 4AVCA 2V5YA 5DQ0A 5A3PA 3HBZA 4ISQA 2ZGSA 2QKDA 4CDQA 3JBG2 2PAKA 1N3OA 4WM8C 4BQYA 2BGOA 5FMBA 5H9QA 4Q4X1 3VBRC 4FVVA 1D4M2 2ZTNA 1EP0A 4M00A 2BW8A 2YY1A 3PIJA 3LWCA 1F4AA 4BOWA 1YJLA 2W68A 2XBO3 1OA3A 2PHUA 3OGSA 5FYBA 5KHJA 4UYBA 2V73A 4ZZ5A 2BWCA 4DEVA 1LHOA 4L11A 4Q1PA 1MS9A 4Q27A 1XNKA 2O0OA 3BN6A 1UN1A 4CUCA 2AREA 1EAH3 2VMFA 4RQPC 1S0JA 1FOD1 3U4XA 1ASJ3 4CDWB 4CRQA 1YQ6A 4J6GA 3BOPA 1OXCA 2WO2A 3J7HA 3V56A 2X29A 1N3QA 5IFPA 4UFHA 1AR61 3Q8BA 1UIJA 5FMCA 2YYOA 4YPJA 3V64A 1VB4A 1JXNA 4ZONA 4DNYA 4N90A 2OKXA 2VQUA 1NXD1 3I2JA 4P00B 3AMMA 1WMXA 3VZJA 4IE4A 1YQ5A 4XQ4A 4A44A 5FMDA 4K21A 1NCRB 3GNEA 4PDWC 3IPVB 2BRTA 4G4FA 4FPLA 3WF1A 3GZTB 2GP3A 1VBE2 4GWNA 2A6VA 1DP0A 2WBKA 5J36A 3ZSMA 1A3KA 2EXKA 3QBQA 4A41A 4INDA 3E97A 1XQNA 2ZA9A 1OVPA 1G86A 4HG6B 3PVEA 4Q8LA 2XOMA 2L9LA 1YQ2A 2A5ZA 4MZUA 2FDJA 2F4PA 1YIPA 3O7OA 5CB7A 4XDOA 2VG9A 4OHWA 3KGZA 4YM1A 2QQWA 2P4EA 2QQUA 3AFGA 4IV1B 1WW4A 3GBFA 4H7MA 1QJU2 4C0BA 1YJKA 3RVHA 2WFF3 1C4RA 3NAPA 2XVKA 2Q8OA 3WDXA 1KS4A 2ATFA 2PHRA 3CNAA 3NSTA 1FATA 4GA9A 1VRH3 2VQ0A 2BNOA 1YYNA 3OPWA 4KG8A 5FQ0B 3H1WA 1PO22 4MGIE 1PGW1 1CAWA 5KBFA 1F5JA 1R1A1 3VD3A 4Q2FA 4CCMA 4Q4V3 5BNOC 3ZN6B 1BMV1 2EXJA 2UU8A 3C7EA 4FPOB 1HRV1 4FOYA 2CV6A 3RMYA 1SLIA 4WVVA 1ZVFA 5CG9A 5A3NA 1HXS2 3FHQA 4BQ2A 5JXJA 3WF4A 1WBLA 4P5YA 1VMHA 4P08A 1LOGA 5BNNB 2R0FA 1JZ5A 2XR4A 4HLTA 1KITA 4NWVA 3LAGA 1S0CA 3ILNA 5KC6A 4I01A 1N1TA 4YGCA 5A3OA 1FYUA 3OPZA 3H1YA 4GULA 1ULGA 1APNA 4HMZA 1ND2C 4AFDA 4CCOA 5C7GA 4JKMA 2YFUA 3KV6A 4GH4A 4NHXA 4CP0A 1IGOA 4XDPA 2JB8A 3I2OA 4HN1A 1VBD1 4M4PA 2E26A 2YC2A 5IATA 3SCFA 2RMU2 1SCSA 1RMU3 2Y64A 1U5ZA 3A0NA 3V0BA 2DBIA 4CDUA 3NV1A 5ABJA 2XLFA 3DXUA 5FY0A 4OCTA 3WG2A 2PFWA 2BOJA 4ONUA 4ITCA 4NPLA 4QB2A 3TN92 2J1TA 3LDBA 4B4RA 2WN3A 3POIA 5CNAA 2IXLA 2E7AA 1OVSA 3JB4C 2Q5TA 2R0HA 4CP1A 2QTWB 5EZWA 1NY71 5L7OC 4XXAA 5JXIA 1CESA 2A73B 3X29B 1SFNA 1W8HA 1CJPA 5FLIA 1DZTA 1QJX3 2VC9A 2OPKA 2Z5WA 3OG2A 2JKBA 5GZEA 4XHXA 4CE8A 1VBC3 2AZ5A 2VOXA 4RYDA 1BK1A 4XETA 3SISA 3WF3A 1LULA 4XFIA 1RGSA 1ODMA 5FO9B 3VL8A 2XMLA 2DF7A 3UESA 5FAXA 5EP9A 1KGYA 4CCCA 3ZIXA 3MDPA 4NO4A 4PLNA 3LQCA 1RUD2 5FPVA 4RR3A 3WDYA 1UMHA 1SBDA 1Z0HA 3ACIA 3K77A 1UO9A 2ZX0A 3RJ2X 4NIDA 2MEV1 2P1BA 4RN5A 1OF3A 4QGNA 4RHV2 5FYYA 4CSWA 3GBGA 3O0VA 2ET1A 1BVP1 3O12A 4NJ4A 1EV12 1W90A 3EXUA 4A3ZA 1Q8QA 2ARBA 3OBAA 4I09A 2I74A 4BQ5A 5DDJ1 4OZXA 3RS6A 1CZTA 3LEIA 3MHZA 3T08A 2D6NA 3L2HA 3ZYRA 1C5HA 2BZDA 3D3AA 1AYM2 5H9RA 5C4WC 2E6VA 1UU5A 1F15A 3O5SA 5JDBA 1CZSA 1KS5A 2RHPA 5FZ8A 1GMMA 1JZ6A 1BBT3 4LKFA 3WNOA 4KNCA 4A45A 2ZKNA 2W94A 2GMEA 3HNYM 1DZRA 1PGL2 1W2UA 4JGYA 1AJOA 3J7NA 3SQOA 1AL22 2BQPA 3ZMOA 5C8WA 5CFDB 2Q8EA 4ZY9A 4LKSA 1DYOA 4XFHA 1HB3A 4AI8A 1IKPA 1JYVA 3AMPA 4D8MA 4C1XA 2ZHNA 1H0BA 3HEIA 4N7IA 2MHFA 3OBZA 2B5HA 3VBSC 3I2HA 1MQTB 2YPJA 1NA1C 3T2OA 2ZGOA 1E5RA 2QDNA 3JB8A 4YW5A 1CAUA 4BE3A 4EYUA 4QXBA 4E2GA 4XJUA 4LBQA 1REEA 2HWD2 5JR7B 5GLZA 5LEJA 4UBHA 2OXBA 4M3CF 1YLLA 2BGCA 1JOPA 1RUH1 4XPVA 3OOXA 2WNVA 1YFWA 3K4ZA 1V9U3 1AYN2 2GAUA 3ATGA 4QX7A 1LU2A 3PNAA 1PK6C 1ZBA1 3CO2A 1IQDC 1H4GA 3ZR6A 5C6CA 4GXLA 5GZDA 4BLIA 4A4AA 1LHNA 4YVWB 5KC5A 3UGGA 4QHBA 5HPOA 2Q4SA 2Y6KA 5J37A 5FZHA 3BTZA 1UMIA 1UOFA 4I02A 3WQ0A 4WVMB 1AUYA 1GYKA 1H2MA 3WDTA 3VV1A 4CDQB 3UNPA 4IL7A 1G8WA 3AC0A 4FCAA 4QPYA 2XKPA 4LUMA 4FPKA 4JGZB 1V6JA 4LA3A 4MGZE 1R1A3 4OMCA 4QGMA 4GB31 4XBQA 2YU1A 5H9SA 3RI9A 3W58A 2ZOEB 1HRV3 3POEA 2J22A 2VY0A 4QKBA 2VPVA 5GLUA 1X33A 1LRHA 2DFBA 5CYYA 4LR4A 5K0UB 4QPIC 4CXYA 5F6LB 3J8F2 4ZXEA 2GH2A 2D6KA 2WZR1 4K40A 2VZQA 3FLPA 3VDAA 4WZCA 5FXVA 3URFA 5I0RA 3INAA 5JSOA 4QU1A 4UI9L 1UYPA 1X82A 2A3YA 3PJYA 5IK4A 1OF4A 3WUCA 1NG0A 4PF1A 2VZVA 3CU7A 3IDAA 2RG4A 4QPGA 4QX3A 4ISRA 1HKDA 2PLV1 2ZMLA 5HCFA 2OYZA 4NRQA 1QQP2 3DPRA 3ME2A 1OMIA 2G9GA 4FFGA 2XXZA 4I3GA 3ZFGB 2K46A 3JXSA 4FI9A 2VW0A 1BEV3 5JSRA 1W05A 2VOTA 3POBA 4F8AA 5IT6A 5LRSA 1DU3D 3WD5A 5F7UA 3A23A 2AC1A 2GC2A 1FNZA 4BU2A 2ETEA 2BU9A 1DZQA 4OHZA 2WAAA 4QX5A 1MR5A 3K46A 3VZKA 2WQZC 2XDVA 2W3JA 2XHNA 2YU2A 3K3NA 1R091 1H8VA 4KWLA 2E53A 5EHDA 4Q1RA 1JHJA 3WDUA 2W2IA 1KJLA 2VVEA 4UOJA 2QBXA 1FI2A 1PIV1 1TMF2 3E6BA 5F5IA 2B7YA 3ZYGA 1V6KA 1D0HA 4OHVA 4QMAA 3DCQA 2OT7A 4PJYA 4FPFA 3T09A 5IVCA 2CHHA 1UMZA 3NAPB 3ZMNA 3BVCA 1ODNA 4XVHA 5JXHA 1O3SA 3NJVA 1BHGA 1W6OB 1WWYA 1YIFA 2WABA 4EROA 3QACA 1WW5A 2HEVF 4MGYE 3MFCA 2C5DA 2EIDA 2NN8A 3PVOA 1VLNA 4L99A 2D40A 2FCUA 1HQNA 1S0FA 2AENA 1AVBA 1LGBA 1MZEA 4GAZA 1RL3A 2R7EB 5FYIA 3C7HA 2XUEA 1TNRA 1WD3A 2LTNA 1UZVA 3AX4A 4N53C 4RS5C 5DDJ3 4YZ5A 4ZU7A 2WNUB 2VBBA 4KGGA 5FO7B 2E32A 5L73A 1W6PB 1W0PA 3AP7A 3PJQA 4AI2A 4C1WA 2WSVA 3AL5A 4W50A 4M4RA 1GNZA 2QQIA 4N9HA 4OYUA 1PMIA 2W5FA 4QDSA 4XFGA 4EN9B 3I3BA 3S57A 3NV4A 2OIIA 2AACA 2VW2A 3WW2A 5DZFA 1UPIA 3E5QA 5FWEA 5FZLA 1HB1A 3NVCA 1W2OA 5CIRA 1EPZA 1KEXA 2OZJA 4GH4B 5CKQA 1LHWA 5GLWA 5FRAA 1W6NB 1KQRA 2XL9A 1W9TA 3OF1A 4R9BA 5J3UA 1UF2C 3CMGA 2YDEA 1SPPB 4AEMA 5KXDA 1G9CA 5D8AC 1AR71 1PVC1 2AUYA 2XONA 2D98A 4KI5M 2GN3A 2X5IC 4XFCA 4FXKB 4IEUA 3N9QA 4E2QA 5GJ6A 1R081 5KR7A 5FBZA 2QQJA 1NCQA 1VBB1 3O1SA 1NLSA 4Q4W3 1GZWB 3VDDB 1C8NA 4FPCA 3QLQA 4LULA 3HQRA 4ASLA 2O8OA 1ZBA3 2HWB1 2ZGPA 1POV1 2RS51 3GJAA 2VNGA 3LB9A 3B69A 2ZGLA 2WA4A 4GJYA 1U5XA 4QPWA 2EICA 3BTXA 2G4IA 4QQOA 3VBFB 4YZ1A 2C9AA 1S0IA 4RR3B 3ZYBA 4AOCA 4NIHA 3ZKUA 4YGDA 3HT2A 4GWIA 5LRRA 1ENQA 3BI3A 4YVSC 5CZKA 5FPXA 4OI1A 3O0WA 3RYRA 3D8CA 5F5QA 2JB4A 4GB33 4HETA 3WDVA 2DU0A 3SMHA 2HBTA 1YFYA 3ZYIB 3B00A 1Z7S2 2VMGA 2UWAA 2WKKA 4IE6A 4N43C 4QWNA 4V2WA 3QD6A 1DBNA 3UETA 3ZOIA 4AQ6A 2XLGA 4O61A 5DZGA 1D4VB 3ST7A 2CGOA 1GKBA 3LSEA 5A7QA 4DUWA 2J1AA 4PLMA 5FZIA 4Y33A 5LBFA 4C8DA 1OLRA 2QQLA 3RWKX 5JSPA 3OGVA 2XQXA 5IVJA 1UZYA 2R041 3LA3A 1UY0A 3OD4A 5FYSA 3M3QA 4BA6A 1ZRCA 2RS32 4URAA 1YFUA 2PLV3 3RYPA 3AZZA 3U14A 3USUB 1W8WA 3MLLA 1F2NA 2LW8A 4AGRA 1SDDB 4B8EA 4E8CA 1AZDA 2ZGNA 5J7MA 4DFSA 5F6KA 1UX6A 2X10A 4JGYB 2AYHA 1KDKA 4P9YA 4DOUA 1FMD1 5JLVA 4N8MA 5I0TA 2DVBA 5A6QA 1UY1A 2OZ6A 4DY5A 4AFMA 5FZ3A 2G9FA 2JDZA 5HXVA 3U75A 4WM7B 3ZKYA 2XWJB 5LK5A 2PHDA 5FBJA 4D6RA 2J1EA 2BUKA 4IV3C 4A2UA 4PCRA 2P17A 2KR2A 3IAPA 3KCYA 2WFF2 3EHKA 5C3PA 5DAXA 1OQEA 5FYCA 2HWE1 2XGXA 3FE5A 4IV1A 4LBQB 3A21A 4MH0E 1WW7A 3T0BA 2XPJA 4YW1A 1N1VA 1URXA 3F95A 3IIIA 4OMDA 3WUDA 5I0DA 2EXIA 4QQ2A 3N9LA 4AAXA 5C3QA 5J48A 4A6SA 1RUOA 1W9WA 3D0JA 3POJA 2CAVA 3HMYA 3UK9A 3WQBA 3VKOA 4DXZA 2Y8KA 3LD8A 5FQ0A 1MZ5A 3TOJA 2Y38A 1HN1A 4GMP1 4BQWA 2G9ZA 3KVBA 4IE0A 4XF4A 2RR12 1O3QA 3ZN6A 1XOYA 2ZBJA 2OW4A 4MUVA 4KMQA 4R9AA 2YXSA 2X05A 4AVAA 5I8YA 5IVEA 3W20A 1DQ2A 2XJUA 2D7FA 2FMDA 3EBRA 4HXCA 1U5IA 2GMMA 1LKNA 4E4ZA 2W47A 1ZRFA 5T50A 1GQHA 1OLMA 3P3PA 2KD7A 3LOBA 2VH9A 1GWKA 1RUF1 1H6YA 3PHMA 3QH7A 5C3SA 3KS7A 2XJSA 4LHNA 5G05L 5FYMA 3OTFA 4K6BA 1H2LA 2MPFA 5FYVA 5IHRA 1DGWX 4ZKTB 2FD8A 2XJVA
chains in the Genus database with same CATH topology
4IEOA 1LOBA 4EWDA 2XKOA 2WT1A 4ES9A 3BIWE 1Q8VA 3KCCA 5IK5A 3WP5A 4DQAA 1GZCA 3D4KA 3SITA 3DPRB 4DMIA 3T1MA 1QJX2 3WQ7A 4IEZA 4LHKA 1AR73 3OCPA 3ZSEA 4IEYA 1MEC2 4KGQA 4G9SB 2D97A 5T5JA 4L92A 4BQ1A 1WMFA 4D69A 4SBVA 1IS5A 3DL3A 3ZSLA 5GM0A 1RVF2 4FTSA 1T6GC 1QJY1 4XJZA 3IDBB 1IS3A 2NM1A 2ZGKA 4F83A 3M1HA 4XYXA 1POV3 2RS53 1OFNA 4WZFA 1G9FA 2WS93 1ND2B 2WZPP 3MPBA 4CTEA 4OVEA 3T2TA 1I5ZA 3AXEA 4ZU4A 1UPSA 1GNHA 1V00A 1LOFA 4HBNA 4OUMA 3VHNA 1S1AA 3A0KA 1SCRA 1BBT2 3OBTA 1FV2A 2JJ6A 2IXJA 2PHXA 2E51A 1CGPA 4S2HA 3ZN4A 4AGGA 3POYA 4XHBA 5FMOL 2ZS6B 5SV8A 2WNEA 1PO11 5EJ3A 2R071 4LBOA 2OUHA 3LOIA 1ZZ7A 5CFDA 4OLLA 4M0NA 3GALA 4IETA 1BCXA 1N47A 2R043 4Y20B 1QNYA 4XFFA 1GV9A 3AZYA 2BBVA 1VALA 1AR82 2A3WA 1QOSA 1MQTA 2WFPA 3AKQA 5JCTA 1JHNA 2ZX4A 3ZN5A 2GNTA 2XG3A 1V9U2 2D5FA 1R1ZA 4PF5A 4JV4A 4AYUA 4OFGA 2HWF2 4P9IA 4ATEA 3JD71 4YW3A 4H55A 1RUC2 5I8TA 5JOZA 2P3KA 4D7SA 4LLOA 1MS8A 1H2KA 2JX9A 1YWKA 5FREA 1WCSA 3MLKA 2X53S 1JN2P 2HWE3 4LE4A 4XJ8A 3SLIA 3R6SA 4YVWA 4HKWA 4AEJA 3WQ1A 2ZHKA 2WLQA 1H8TA 5T5PA 3W9AA 4YG0A 4HSJA 4AG4A 2NPIA 1G6NA 1ZBE1 4WVMA 4Y1XA 2VVDA 3BB6A 3VKFC 1RUI2 3VBHA 5C4WB 1V6MA 3VHOA 5AC91 5J98B 4JGZA 3AYCA 1SQ4A 2D3PA 4R4XA 1ZX5A 5K0UA 5BY5A 4FP3A 1BXHA 2RM21 1VBA3 1XE8A 4XF9A 4CZSA 2PAEA 3G6JB 1NA1B 4YM2A 1W0OA 1RUF3 4XILA 4AHWA 2R061 4H14A 3WW4A 2YGLA 2C1FA 1J3RA 4CEYA 3M3CA 3ACLA 3CLPA 4FQZA 1BEV2 1ZZ6A 3VL9A 4Q4Y3 5ACA2 5BUVA 3ZFGA 1QH7A 1V6NA 3ZFFA 2VNRA 4Q29A 4K9SA 3WX5A 1UL9A 2ZGTA 1H2NA 3VHRA 4Z2WA 4YRDA 1RUG2 2WNVC 1G9DA 1HRI2 4PQ9A 1PNGA 1ZM1A 1ULDA 3ILFA 1LEDA 4Q0UA 1JYCA 4YM3A 4HN0A 3N35A 1G9AA 4OI2A 5DUUA 2ZPXA 1VAKA 1REDA 4YSFA 4E4SA 4FT8A 3IBMA 4LO8A 3WNXA 2ZHMA 3WXPA 1QJY3 2EXHA 4XDQA 3B01A 2YMZA 1K5MB 1W6OA 5H9PA 1COV1 3FX3A 2IFWA 4Y24A 5F1RA 1MS1A 3ZSJA 4F3JA 3TRSB 2TUNA 2GSYA 2IXHA 3VZOA 4B4QA 1YFXA 2BNNA 1IS4A 2WNUA 2E9QA 1W6PA 3AXDA 4COYA 1KJRA 4NHKA 4N9IA 2HWC1 3VKMA 2ZAAA 1FPN3 3AZVA 5IK7A 1MZFA 2UWCA 4LNVA 1S55A 1ZRDA 1WBFA 1DFQA 1WLTA 2A70A 5D1IA 1XNBA 2R073 1W6QB 5JOYA 4TZDA 1CAXB 1RUJ2 5A32B 2EIGA 3JBG1 1W6NA 3N7JA 3FHIB 4FOWA 2DCKA 2LUWA 1D4M1 2I2SA 4RSUA 1ND3C 5T5LA 4KWJA 3WCRA 4DRRA 2FZ2A 1AXYA 2OUJA 4PIZA 3WG4A 3ECQA 1DGRN 4Q4W2 4AVBA 4LO7A 5BNPB 4QQLA 4XF0A 2GC0A 3DKWA 1IPKA 1D2SA 2DU1A 3JQWA 1Y7BA 1GZWA 3VDDA 5EXOA 3FBMA 5LK7B 4L2NA 5E1RA 1QU0A 4URTA 5GZGA 1WW6A 1DG6A 5CFCA 3WVJA 1O91A 1GZ9A 3PVNA 4XJAA 2X8KA 1UD1A 3RJRA 3OY8B 1XU2A 3VBFA 4BLJA 1ZBE3 4CDXC 5EV7A 2W52A 3WLUA 2R6QA 4DINB 5AC93 1NE4A 4Q4X3 3IT8A 4AVTA 5A33B 1QWRA 4XF3A 4EV0A 1QDOA 1RUE2 1VBE1 2PYTA 2CWMA 1UU6A 1MS0A 4PLOA 1YUDA 1U5YA 3EO6A 1ULEA 1LU1A 3OYWB 4MGKE 2VMIA 3USSA 4PIYA 1FOD3 2JG9A 1ENRA 3AZWA 3GYDA 1BJQA 3MLJA 4LA2A 4NWWA 3S7IA 2B8MA 3WW1A 4TYSA 2R063 1QJU1 3APBA 1ZZ8A 1AR63 5DG2A 2QZ3A 3RSJA 3USUA 2E7QA 2ZX1A 2OA2A 1LJ7A 2QVSB 4PIXA 4SLIA 4WM8A 3IDCB 1PO21 1QDCA 1U0AA 2ZGRA 4KU7A 4WM7A 2D93A 1DLLA 1NCQC 4A3XA 4P14A 3BODA 3NV3A 4XF1A 1SLLA 1HXS1 3SH3A 4WV8A 4RQPA 2P34A 4E2SA 1I6XA 5IUQA 3AKRA 4C91A 1AXKA 1V70A 4N43B 3GHMA 3G7DA 4XQDA 1RUNA 2DCYA 2BEOA 4M3CE 3L2YA 3AMNA 1TQ5A 3LA7A 2VXRA 4BH9A 1G7YA 1OOPC 1H8TB 2RMU1 2A6YA 2CNAA 4CDWC 1UKGA 1BZWA 1GSLA 4PDWA 4LBLA 3VBHB 3ZDSA 4AVVA 4B7KA 4Z8BA 3TN91 2O1QA 4HSLA 2N7GA 4W6WA 3R0RA 3RDIA 3PVBB 2C0ZA 2PQQA 5K7PA 5JOWA 3B02A 1NCRC 5AFBA 4WBBA 2ERFA 1AHSA 1C1FA 1FNYA 2D5HA 4IEXA 2PN5A 5GLTA 4V1PA 4O9EA 2HKXA 4JDOA 2ZZJA 4KQ7A 1RUD1 3PMEA 5E8AA 1WCKA 5GALA 4CEYB 1VBD3 3OGJA 4HK8A 2A71A 2CWSA 3JBG3 3N36A 1FXZA 1JW6A 4Q0VA 5JZGC 3KM5A 1D2QA 4AVSA 4H7LA 4RHV1 4Q0PA 1DHKB 3ZO0B 4XQWA 1Q8PA 3K51A 2D6PA 1O5UA 1XYNA 3O14A 1EV11 2JE9A 2B39A 4ZU5A 3ZFFB 4D7YA 3B9CA 4Y22A 1IS6A 2H0VA 2JG8C 2GNDA 2BVVA 1ZREA 1QF3A 5C8CC 1MZ6A 1AYM1 5EYYA 4CEWB 1PZ7A 4D3WA 4LTAA 2WS92 1SEFA 2HYKA 2ZGUA 3GHNA 2PHLA 3DN7A 4HFSA 1ND2A 3GF6A 1PGL1 2R32A 2DTYA 1AL21 3WW3A 1GQGA 4LO6B 2NP0A 4IEQA 3MIEA 5BNNC 4YGEA 5T52A 2MEV3 1H1IA 3R4DB 1UU4A 3VN4A 1LB2A 5FCCA 3J4UH 2XH6A 1XYOA 2H6BA 1DYKA 1RHI2 2NMNA 3CJIB 3BPZA 1DQ1A 1UCXA 4I0BA 2HWD1 2GNBA 3M3OA 4AI3A 5L7OA 3KSCA 3AKTA 4AEDB 2RS12 2DTWA 2VGDA 2QUOA 4HPKA 4FTEA 1AYN1 3MIBA 4BCUA 3BTAA 4JCKA 5DZFA 4E27A 3DV8A 4M01A 3BU7A 5C9AB 3FLRA 2R49A 4Y20A 3ZFEB 2HEWF 2DCZA 4XEZA 2WT2A 1RB8G 1Z78A 3ALQA 2ZACA 3I4IA 3NKGA 5FLJA 2GC1A 1AR92 1TME2 3RQ0A 4FAHA 3U07A 4AHXA 1OSGA 5A3MA 2PHTA 4X6QB 3IIAA 4KU8A 4ZXKA 5DUVA 4FOQA 3R4UA 5J96B 1B35B 1C8M2 3H3ZA 1HXS3 3M8LA 3MFAA 1UIKA 4ES8A 3IDEA 2FMYA 3VBOC 3J8F1 4A7ZA 2ZMNA 1Q56A 2PHWA 1DGLA 1RUH3 1YHFA 4YW2A 4AE2A 1PNFA 1HQLA 2DVGA 1OPMA 2TBVA 3H8UA 3CJXA 2QJVA 2XBO2 5C4WA 5CFCB 2RJKA 1F8VA 1KFUL 3AZXA 5FLHA 3VBUB 4XE9A 5KXEA 5E16A 3AKSA 5KHIA 2K9ZA 1POV0 1QQP1 2RMU3 3ES1A 3I59B 2P37A 1EAH2 1VBA2 2SLIA 2Y0OA 1ASJ2 4PBOA 1GR3A 3LCPA 4DRVA 2NQYA 3S0MA 1CJDA 1NA1A 1A8DA 2R30A 5CFDC 3PTYA 4Y1YA 5JWPA 1AF9A 2ZABA 4COVA 4Q4Y2 3RG0A 1MACA 1S0DA 2WZR3 2W39A 3V0AA 2JG9B 1TMF1 1PK6A 1MQTC 4K20A 4K7JA 2EAAA 2HJIA 2JXAA 3CL1A 4X8PA 4XJ9A 1ULCA 5L19A 4XTMA 1LENA 4UW4A 4R9CA 1J3PA 4RHV3 2YGMA 3RYKA 1OD5A 4L97A 4WM8B 3ZSKA 1QY4A 1CD3G 1LR5A 1ZRRA 3VBRB 3FC0A 4IERA 3VGIA 1LOEA 1LCLA 1QXRA 3UL2A 3A4UA 3AYEA 3NWKA 3UJQA 4KH9A 4R52A 2WQ4A 4OI0A 1AYM3 1SFYA 4CDQC 3WR0A 2ZJCA 4S2FA 4OULA 1R093 3MF6A 1NQJA 1H9PA 1VRH2 2QDRA 2UYBA 4RQPB 1AX0A 5AVAA 1K5MA 3NL1A 1GFF2 1L3JA 2DURA 1PIV3 4FP2A 2ILMA 4K8FA 5EWSA 4AQSA 2GDFA 4LT5A 1GLHA 4Q4V2 3ZVXA 2D6OX 1OFSA 3FWEA 4FO9A 1AL23 3WT3A 5K0UC 1XE7A 3KT4A 5JPMB 3TB0A 1VB2A 4XW3A 1FPN2 4QGLA 3ZX7A 1X8MA 1Y9QA 4GMP0 1I3HA 3D0SA 4Y1UA 3RMXA 5JOXA 1MS4A 2WIIB 4PDWB 3WP4A 2VECA 4YM0A 1KRIA 3KT7A 1YRZA 2IC1A 2YUEA 2R1BA 5F9TA 4P5HA 3E5UA 4GKXA 1W6QA 3JZVA 3ZFGC 1RMU2 1CAXA 5DUWA 4HVQA 3I2DA 3QCWA 5A32A 2ZKLA 3ZXLA 1QXJA 4L8QA 4K1YA 1EY2A 1JYIA 2BVBA 4HVOA 3I7DA 2XB6C 4HKOA 4LHLA 3ETQA 1UW8A 2WLPA 3AB0A 3J9SA 3FUOA 4GALA 2K2SA 4RFT0 4DY3A 2Q0AA 1PZ8A 3HN1A 1N1YA 2P3JA 4XOGA 5BNPA 1Q8OA 3OGGA 1VBC2 3S6PA 4Y5Z0 3ENRA 1S2KA 1I9RA 3H3UA 4JTOA 1ULFA 1PVC3 1Z7S1 3P3NA 5CU1A 3GZAA 5BNOB 4Y22B 1AX2A 2GU9A 3NAPC 4N53A 4RS5A 1CPNA 4Y1ZA 4BYYA 1WD4A 3VUOA 1S0BA 1J3QA 1R083 3J8F3 4RA0A 3OY8A 1VBB3 2WSUA 2JECA 4YZ2A 1WMEA 1HX6A 4Q4X2 4HK9A 4P9XA 4OHXA 2AGSA 2HWB3 4FPGA 4Q0SA 1SMVA 2RS31 1F5FA 1WLDA 3LZZA 5A33A 1QQP3 3H7JA 4NVPA 1LGCA 4NN0A 2CL2A 1FOD2 1BQPA 1LOAA 4YFZA 2EA7A 4FXGB 2TNFA 3J26N 3OYWA 5D8AA 3ZXFA 3FFZA 5CVRA 2VOWA 1AR62 4GH4C 2WFF1 2X5IA 4LO4B 2EF6A 1O4YA 2Z79A 5JI7A 2QNKA 4OHYA 4X6RB 1X7NA 5L7OB 2LM3A 1MVEA 4CDUC 3HIFA 5ABJC 1GICA 1O4TA 4HPKB 4LO5B 4J1XA 5BXXA 4QM8A 3IKWA 4U36A 1WLCA 5FO8B 2JD4A 4IEVA 1NOVA 2IFRA 2RR11 5DG1A 3VDDC 5KWRA 2GH8A 3AMHA 3MIGA 4META 3RZZA 1BYHA 4KG0A 5T55A 1FMD3 4NOTA 3AP6A 3ZXJA 3JCIA 4DPNA 4EN8B 3TNPB 1FX5A 1A8MA 1PZ9A 1X50A 4LE3A 2PA7A 4AWDA 2BFUL 4I30A 2PELA 3VBFC 2O8QA 4N43A 1CN1A 4RR3C 1VJ2A 4MLOA 1V6LA 3L9JT 4P9LA 4GKYA 1OHFA 3GBWA 3GZUC 4KWKA 1A78A 1PGW2 3LKJA 2XJRA 1VR3A 1NZCA 4YARA 1UAIA 2FQPA 4RL7A 1R1A2 2R1DA 4YYOA 4AFCA 2SBAA 1BMV2 2E7TA 1HRV2 1REFA 3UKVA 4MX3A 4GMP3 2UY8A 4IESA 1MS5A 1X36A 2F6BA 2ZX3A 1Q8SA 1SLBA 1QJX1 3ZYJB 4DS0A 4COZA 3MYXA 5C33A 3VHPA 3DF0A 1MEC1 3ZXGA 4Q8KA 1UZZA 3M7AA 2VMHA 4QQPA 4IV3A 5JI9A 1YO8A 2CY6A 4Q0QA 1DIWA 3VBSB 4JGYC 5SV5A 2PTMA 1VBD2 1KDMA 4ASMB 1HLCA 1RVF1 3H9AA 4BZ4A 1YXWA 5CAZA 2ZCWA 4WM7C 4KL1A 1SLTA 1GBGA 3LGRA 1E57A 3V0AB 1V6IA 1PK6B 3TNQA 4B29A 3AJYA 3PMSA 2IXKA 1CAVB 5T3NA 1OOPB 3Q9OA 1NY72 4AQTA 1ZA4A 1BBT1 2QE3A 1GANA 4CEWA 3N3HA 3AP9A 1C1LA 1Z7S3 1Q3EA 5L36A 1W6MB 4B7EA 1WCDJ 3HT1A 4K1ZA 2XJPA 1OQ1A 4A7YA 2CGNA 2GNMA 5KHHA 2MEV2 4QPIB 2D43A 2FZ1A 3LA2A 1S0GA 4XFAA 1VIWB 2OVUA 2XL7A 3KMHA 3OBRA 2VW1A 3ZXKA 3N7KA 4QT6A 3U10A 5FOJB 2RS33 4LBQD 1FT9A 2ARXA 3AFKA 1AR81 4JTNA 2QCSB 3TAYA 5DDJ2 1Q43A 1C3HA 1QOOA 4JRAA 4DB5A 3HQXA 2Z69A 3CJIA 5JZGB 5HCBA 5FOBB 3D5OA 1VAVA 2AR6A 5A3LA 1V9U1 2DWRA 2DVAA 2HWF1 4MXWA 5CBLA 1C5IA 2ES3A 1RUC1 2VQAA 4AEDA 2PHFA 1OA2A 4QPGC 1DGWA 1J1LA 1S0EA 2JG8B 5C9AA 3AKPA 1QGLA 3ZFEA 5C8CB 4LBKA 4ATFA 3DPRC 1PO13 2ZZQA 1C57A 3H1MA 3AYAA 4NHMA 1JTZX 4QQHA 3ZXEA 2D6LX 1RUI1 5HI0A 1CPMA 4NR1A 3AM2A 3B5LB 1OQDA 2DUQA 2UY9A 5I8SA 3FMGA 4YGBA 3BOWA 1DYPA 2RR13 4W6YA 1AXZA 3VKLA 2RJLA 1B35A 1IZ3A 1RUH2 4M0HA 3ROUA 3SXWA 4G3YC 5KHKA 3KGLA 1ZBA2 4FPHA 3S7EA 5GZCA 2B46X 3JD73 3N4MA 4TSVA 4OUSA 4WVWA 4Y1VA 1O5LA 1U12A 1V6OA 3VLBB 3AP4A 2DUPA 4N53B 4RS5B 5JIAA 3VBUA 1IHMA 3FFQA 3E6CC 2YHJA 4WVZA 1O7FA 1BEV1 1LEMA 1YI7A 3I59A 3E6DA 4W65A 2GALA 3NV2A 5ACA1 4GB32 2XUMA 1SDWA 1O3TA 3VZMA 1FV3A 1CVNA 2DVFA 3PLQA 5BYNA 4MV2A 4FAGA 3CEWA 1RUG1 4R9DA 4LBMA 4YG3A 2V09A 3VKNA 1HRI1 3B94A 4F7ZA 4AFBA 3WZ1A 2WZR2 1PHMA 2EVXA 1IPJA 4RD7A 5CA6A 1MEC3 2WJSA 1M4WA 3ZXAC 2RM23 5D8AB 2QQPA 3IWZA 1NQDA 2WL1A 4XJWA 2PLV2 4GIQA 2X5IB 1IKQA 1LTEA 1RVF3 4TLFA 2DVDA 4R8HA 3VBOB 4FBFA 1LHUA 2B42B 4QU2A 3KZ4C 2BPA2 4M3CA 1JUIA 1YCIA 3W59A 5GKAC 3UV9A 1SLAA 1TE1B 1O4ZA 4EWAA 3DGTA 3VBRA 3OD0A 3EQEA 4FOVA 1RJ8A 4HZFA 3N7LA 2R16A 1S2BA 4LEJA 1R092 3ELNA 3KD4A 2DV9A 4YVSB 2Q1MA 1NXMA 2CAUA 1PIV2 4HANA 1JH5A 2YZ4A 5C4WC 5JIUA 3CF6E 1ALYA 2XVLA 3AJZA 5FPZA 2GMPA 3QOPA 4YZ4A 5FMOS 3WOGA 4AI1A 5KXBA 4FQ4A 3WINE 5K9YA 4W6XA 5EFUA 1RUJ1 4D94A 4BM8A 4EJRA 1DQ0A 5T54A 1Y3TA 3WHTA 1COV3 4LBJA 3U11A 1CONA 1J1TA 1J58A 3RI8A 2DYCA 1AR83 3M70A 4HL0A 1LECA 1M06G 1W39A 2P2KA 3AYDA 4AK3A 2EALA 2BNMA 4Q4W1 2JE7A 4UW5A 1DF0A 2HWF3 1RUC3 2HWC3 2BFUS 2WC2A 1IQAA 1DQ4A 2MNGA 3ZYPA 4LLFA 4IV3B 2UURA 3KT1A 4MVTA 2VOVA 3WG1A 5CADA 3RPQA 2B9UA 3NO8A 1WLWA 2DCJA 4RGAA 1DQ5A 1RUI3 3ES4A 2JICA 1AR72 4P9WA 3OJBA 1X8EA 1PVC2 2ENRA 3JU9A 1LGNA 1HQWA 1D4M3 2I45A 5I0UA 2XWBB 4EN7B 3MZHA 1RUE1 4Z07A 4IV1C 1R082 5B2GB 4I0WB 3WP3A 1QJZA 1VBB2 4S2GA 5BNOA 3U0ZA 3WV6A 1K5MC 4YG6A 5LEKA 1Q5OA 1ENSA 4H3WA 5I91A 2HWB2 4MXVA 2NYYA 1CIWA 4HVRA 1NE6A 2RS52 5BNNA 4Z92B 1MS3A 4AEKA 2XJQA 3MIFA 4EWEA 3T1LA 4FPYA 2WWSA 3N7MA 4KBBA 1OKQA 3RRDA 3ILRA 3D82A 1O3RA 1OPOA 1RJ7A 4TWTA 5ACA3 1SBFA 4QD2A 1EPWA 2D44A 3NW4A 1ND3A 2GN7A 1H1AA 3B7MA 4JDMA 4NHLA 1RUG3 1VBE3 2RE9A 2EAKA 3HAGA 3MW4A 1HRI3 4AGVA 4COWA 3THTA 4HKLA 4OI4A 4MSVA 1XRUA 3H0OA 2A6XA 4MXWB 2R042 4AHZA 2GC3A 3HD8B 1LESA 3MEPA 2H0BA 4I2OA 3POWA 5BNPC 2ZX2A 5FTTC 2ZAHA 1OLQA 1QJU3 2A6WA 5KXCA 1FMD2 4XXPA 1JBCA 4I0AA 3RNSA 1LODA 3KLSA 1CAWB 1DDLA 4CDXA 3SCGA 2DFCA 3FBYA 2BWAA 2ET7A 1PO23 4IEWA 4PBPA 4XTPA 4P9GA 5CG8A 4JDNA 3RWNA 1QOTA 2HWE2 3TWIA 2A3XA 3EJKA 3HWJA 4DZGA 2NZ9A 5FFOC