4FTBA

Crystal structure of the authentic flock house virus particle
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
344
structure length
321
Chain Sequence
TQTAPVPQQNVPRLTRLSQPGLAFLKCAFAPPDFNTDPGKGIPDRFEGKVVSRKDVLNQSISFTAGQDTFILIAPTPGVAYWSASVPAGTFPTSATTFNPVNYPGFTSMFGTTSTSRSDQVSSFRYASMNVGIYPTSNLMQFAGSITVWKCPVKLSTVQFPVATDPATSSLVHTLVGLDGVLAVGPDNFSESFIKGVFSQSACNEPDFEFNDILEGIQTLPPANVSLGSTGQPFTMDSGAEATSGVVGWGNMDTIVIRVSAPEGAVNSAILKAWSCIEYRPNPNAMLYQFGHDSPPLDEVALQEYRTVARSLPVAVIAAQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords Capsid protein beta
publication title Structural study of virus assembly intermediates reveals maturation event sequence and a staging position for externalized lytic peptides
rcsb
source organism Flock house virus
total genus 73
structure length 321
sequence length 344
chains with identical sequence B, C
ec nomenclature ec 3.4.23.44: Nodavirus endopeptidase.
pdb deposition date 2012-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ftbA00
4CDWB 5LK7B 1RUD1 3VBRB 1AR73 2GSYA 2WZR1 1AL23 2ZTNA 4Q4W3 4QPGC 2WZR2 4CDQC 4QPGB 1ND3B 1SMVA 1BEV1 1FOD1 4WM7C 2MEV1 1BBT1 1FPN1 1FOD2 2WS93 4CDUC 4Q4V3 1FMD1 5AC92 4CDUB 1PIV3 2WWSA 4WM8C 5C4WC 4FTEA 1AYM1 1WCDJ 1RUI1 5A33B 5C4WB 1Z7S2 1AYM2 3JB8A 2RR12 5FOJB 1VBD3 2XBO3 1MEC1 2RS32 4CEWA 1K5MA 2HWE2 1MEC2 2BUKA 1NY72 1RHI1 4RHV1 1B35C 5BNNC 1RHI2 2R043 4Q4X2 1RUH3 1B35B 4RQPA 1PVC3 4YVWB 1AYN1 1PGW1 1POV1 2ZAHA 1RUG2 1R093 5A32B 1TME2 1RVF1 3LOBA 5BNPB 2X5IA 3VBOC 4YVSA 1NCQA 3VBOB 1COV3 1NCRC 1RUJ1 1HXS3 1RUJ2 1NCRB 1QJX1 1ZBA1 4CEYC 2PLV3 5ACA2 1ZBA2 1EAH1 4CEYB 4EJRA 1NA1B 1EAH2 3ZFEA 1X33A 1TMF2 5JZGC 1QQP2 1R1A1 1MQTC 1RUF1 2RS13 3JD73 1HRI2 1QJU2 2TBVA 3NAPC 1EV12 4GH4B 3NAPB 1VBB1 4RS5C 1ASJ3 3DPRB 2DF7A 1PO23 1AR91 1RMU1 3J8F1 1AR92 1RMU2 5CFCC 5K0UC 5K0UB 1AR81 1VBE3 2HWB1 1HRV1 2Y26A 2RMU1 4Q4W1 5C9AA 1AR62 1V9U1 2RMU2 1ZBE1 5BNOA 1H8TA 1VRH2 2WFF1 1Z7S3 1ZBE2 2ZZQA 5CFDC 2RR13 4QPIC 5CFDB 2GH8A 4QPIB 1RUE1 1RUE2 2RS33 1GFF2 2HWE3 1QJY3 2RM22 1C8NA 5DDJ2 4Q4X3 1VB4A 1PO12 1OOPB 4RFT0 3S6PA 1RUG3 4N53A 3VDDA 1TME3 1RUC3 4Q4Y3 4IV3A 2HWD2 3CJIA 3TN91 1D4M3 4CDXB 5ACA3 3ZFFC 5L7OB 4GMP3 3ZFFB 4JGYA 1C8M1 1NOVA 1TMF3 2RS51 1HXS1 1VBA3 2R072 3VBRC 1QQP3 4Y4YA 1RUD2 1BMV1 1HRI3 5C8CA 1QJU3 1ND3C 1IHMA 4CDWA 3VBSC 4GB33 1EV13 3VBSB 1BEV2 2MEV2 1BBT2 1FPN2 1FMD2 4IV1C 4QPGA 5D8AC 4CDQA 4IV1B 5D8AB 1HX6A 1RUI2 4WM7A 3VBFC 2R061 4CDUA 1PGL1 3VBFB 1PO21 1RB8G 1AR63 4WM8A 1R081 5A33A 5C4WA 1VRH3 4NWVA 4YVWC 4RHV2 1VBE1 1AYN2 1PGW2 2RM23 4Z92B 5DDJ3 1B35A 5BNNA 5BNPC 3JB4C 1PO13 1RVF2 2FZ1A 4RQPB 5A32A 3JBG1 2QQPA 1CJDA 5FMOL 4AEDC 1QJX2 1NA1C 5FMOS 4AEDB 4PDWC 3VBOA 4PDWB 1X36A 3VBHC 1NCRA 4LLFA 1ND2C 3VBHB 1NCQB 1ND2B 2HWC1 4CEYA 1R1A2 2XPJA 5ABJC 5ABJB 1RUF2 2R073 5JZGA 2HWF1 4GH4C 3DPRC 1RUD3 1MQTA 1VBB2 2WZR3 3J8F2 3ZFGC 1VBC1 3NAPA 1VBC2 3ZFGB 1BEV3 1FOD3 4RS5A 1AR82 2MEV3 1AR71 1BBT3 1FPN3 2HWB2 5AC93 1AL21 1HRV2 1FMD3 1AL22 4Q4W2 2FZ2A 5K0UA 5CFCA 1V9U2 4N43C 1AYM3 2WFF2 4NWWA 4N43B 2WS91 4Q4V1 2WS92 1PIV1 3HAGA 1PIV2 1MEC3 1RHI3 5CFDA 4RHV3 4QPIA 5BNOB 1OOPC 1H8TB 1F2NA 1VBD1 4Y5Z0 2XBO1 1AYN3 2XBO2 3M8LA 1POV3 2BPA2 2R041 1RUH1 1PVC1 1RVF3 1PVC2 3TN92 4CDXC 1R091 1RUJ3 1R092 5L7OC 1QJX3 1QJZA 1ZBA3 1EAH3 4JGZC 1C8M2 1COV1 3CJIB 4JGZB 2IZWA 1CD3G 2RS52 1HXS2 2PLV1 3ZFFA 3IDEA 1R1A3 4RR3C 4RR3B 1BMV2 4GMP0 1RUF3 1F8VA 1HQNA 3VBRA 3VBUC 3VBUB 1VBB3 3JD71 2RS11 1AR93 1ND3A 1RMU3 2RS12 3J8F3 3VBSA 1AR83 1ASJ1 2R062 2HWB3 1HRV3 1OPOA 4IV1A 1ASJ2 5D8AA 1PGL2 2RMU3 1PO22 1V9U3 1R082 1VAKA 1ZBE3 1VB2A 2WFF3 4CDQB 3VBFA 5AC91 1VBE2 4WM7B 1RUE3 4CEWC 1K5MC 4CEWB 1Z7S1 4WM8B 1K5MB 4YVWA 2RR11 4RQPC 4SBVA 2RS31 1M06G 2HWE1 1QJY1 3JBG2 1NY71 1QJY2 1OHFA 4Q4X1 5BNPA 2HWD3 5BNNB 2X5IC 4YVSC 3TN93 1RUG1 1NCQC 2X5IB 4YVSB 1AL0G 1TME1 4AEDA 1RUC1 1A6CA 1NA1A 2HWC2 4Q4Y1 4PDWA 1RUC2 4Q4Y2 1C8M3 1AUYA 2BFUL 3VBHA 3ZFEC 1D4M1 1ND2A 2BFUS 3ZFEB 1D4M2 2RS53 1NG0A 2VQ0A 5ACA1 2HWF2 4GMP1 5ABJA 1TMF1 1VBA1 5J98B 1VBA2 1W39A 4GH4A 1QQP1 5JZGB 3DPRA 1AR72 1HRI1 1QJU1 1MQTB 3ZFGA 4GB31 1EV11 1RUI3 4GB32 2R063 4Q4V2 4RS5B 5C9AC 1R083 5C9AB 4N43A 5BNOC 1H8TC 5CFCB 4FTBA 1VBD2 3FBMA 5J96B 1AR61 2WLPA 1VRH1 4FTSA 1OOPA 2R042 1RUH2 4BCUA 2RM21 1E57A 4N53C 3JBG3 3VDDC 5DDJ1 4N53B 3VDDB 1PO11 1POV0 4IV3C 3ZXAC 3CJIC 2BBVA 4FSJA 4IV3B 4CDXA 1COV2 5L7OA 2HWC3 2HWD1 2PLV2 4JGZA 4JGYC 5GKAC 4JGYB 2HWF3 4RR3A 2R071 3JD72 5C8CC 4CDWC 3VBUA 5C8CB 1VBC3 1DDLA
chains in the Genus database with same CATH superfamily
4CCJA 1G9BA 1LOFA 3N3HA 4NMIA 1DYPA 3OUIA 1AR73 2CSGA 3UGHA 3OPTA 5T5JA 1U5XA 1XNKA 5JXHA 3B9CA 3KVAA 3H1MA 1K12A 2DURA 4ZHNA 2I2SA 3ZOIA 4QHZA 4WM7C 4ZXKA 1FPN1 4K20A 2WS93 1IKPA 2D98A 2ARAA 3N35A 2Y64A 2VBDA 3OBTA 5FUPA 4CE8A 5IK7A 3WNNA 5C4WC 3TEYA 1WCDJ 4E8DA 3WNPA 2P34A 3KCYA 5C4WB 4COUA 2VZUA 4PF5A 5FOJB 4AI0A 3AYDA 1ONAA 1WLDA 4YSFA 1JOJA 1SZBA 1XNBA 4QB1A 1K5MA 2HWE2 5FBJA 2VW0A 5F3CA 1RHI1 2B4KA 3L9JT 3UETA 5BNNC 5F8PA 2D43A 1UXZA 3FFQA 4XZPA 1Q8QA 1ENXA 2JDUA 2C6SA 2DCJA 2YDEA 2ZAHA 1RUG2 3B00A 1R093 3W5NA 5A32B 3OG2A 1C4RA 1LB2A 2VOTA 4NR1A 1RVF1 3DCQA 4WVVA 5FUNA 3SC7X 3LOBA 4JQTA 1NCQA 2WT0A 5FJHA 1GP4A 1DHKB 1NCRC 1RUJ1 1XNDA 5DUUA 4XMIA 2OA2A 4A3XA 2EXJA 1NCRB 1ZRCA 3AMMA 5FY4A 1Q8OA 1EAH1 3AZYA 5A3WA 5JPMB 2L9LA 1JZ7A 5JMCA 1C57A 2Y33A 5FV3A 4XYXA 3IDBB 2XR4A 4HT1T 2A71A 1U5IA 4W4ZA 5T5OA 5JZGC 3RZJA 3HIFA 3O0VA 2OW4A 2Y0IA 3U07A 4DB5A 3CEWA 5F7UA 4P5HA 3LFMA 2P3IA 3O1RA 2OZ6A 3MIHA 4LNVA 3J4UH 4AVCA 1QXRA 2WNUC 3GCWA 3AXEA 1FAYA 1V0AA 1UY3A 1QJU2 2DBIA 4CVUA 2WNUB 1G86A 5JSRA 2Z2SB 4LTAA 1SLAA 5IUQA 1CVNA 1EV12 4HPKB 1WMFA 4KG8A 3THTA 5FO8B 1REFA 5JWPA 1ZRFA 3DPRB 1FXZA 2JDMA 1RMU1 3J8F1 4IE4A 4MADA 5CU1A 3O1OA 1AR92 1C1LA 3H0OA 3VHPA 1I3HA 2A3WA 5K0UC 1RXFA 2NP0A 3FLRA 4AFAA 1HJFA 5K0UB 3WNKA 4B4RA 1AR81 1GZWB 3SMHA 1VBE3 3WDTA 1HRV1 5K9YA 3LA3A 5CISA 2YFZA 1OUSA 4MHUA 1JZ6A 1G7YA 2RMU2 4PT6A 1AR62 1QMJA 2XQRA 1ZBE1 1HJGA 1H8TA 1VRH2 2R0HA 4GWMA 4XFGA 3KGLA 3LA7A 4JKMA 4YM0A 3WNOA 5K8SA 1UZ0A 4QPIC 3FHAA 4ARYA 3RSJA 4QPIB 3I2DA 2XJQA 2XKPA 4KWLA 4XBNA 3CL1A 1O3QA 3ROUA 4KWJA 3HMYA 1W3XA 5CB7A 2JDPA 4PIZA 4QXBA 1JU4A 3FFZA 5AFBA 3OUJA 4RFT0 2DVFA 1MZ6A 1V70A 1AHSA 1LU2A 3OPZA 5A6XA 2PQSA 2CHHA 3IPVA 4UFHA 2VNOA 4N7UA 5DAQA 1JOPA 2JDHA 2HBTA 2RV9A 4PLOA 3VZMA 4BQWA 3TN91 4AWDA 2RDQA 1FATA 2D6NA 3GBGA 3TBDA 1YI7A 4UW5A 1RTVA 3EBRA 4XUNA 1LHVA 3ZFFC 4AI8A 3IB3A 3ZFFB 1IGOA 5FP4A 1MS3A 2LTNA 1DZTA 3E5UA 3A22A 4OHZA 2PHWA 4R52A 1HXS1 4Q0SA 4YZ4A 4AFMA 5J7MA 2WC2A 1LULA 3VBRC 2IVJA 4B29A 1QQP3 2JDNA 2EALA 5KXEA 4XTPA 5FR3A 1JBCA 1JYIA 1BMV1 4HN1A 3PNAA 1S0BA 4LKFA 5FZGA 3ZX7A 4UBGA 3BGAA 2JB4A 4DEVA 3WG3A 1UX7A 3T0BA 5IVFA 4L92A 3ZYFA 5I0UA 2EIBA 1OI6A 3NWKA 5LEJA 1SACA 3SCGA 1SEFA 4QM9A 4ASMB 2ZGOA 1BBT2 1LGNA 1ULDA 1MS5A 2HEVF 2I07B 2V4VA 3ZXFA 4CA9A 4A4AA 4LBKA 1NAEA 1W06A 3D0JA 1U5YA 2JWPA 1N1TA 3I2IA 3EQEA 1TE1B 4Y1YA 4GULA 4BQXA 2DVGA 4WM7A 5J3UA 1F31A 1ZZCA 5E6HA 2GNDA 1PK6C 2A70A 4AI1A 1PO21 1RB8G 1PK6B 4Z82A 1GOHA 3NV4A 4JKKA 4DRRA 5C4WA 1IPJA 2MHFA 5A7SA 3O0WA 1FX5A 1N1SA 4GZ9A 2Q4SA 1YJKA 4ES9A 2C9AA 4QDRA 4UT5A 3C7GA 3I3MA 1AYN2 1LEMA 3D5OA 4JCKA 5F3EA 2RM23 3OOXA 2D40A 2VGDA 5BNNA 3GZEA 1PO13 1E5HA 3IKWA 3OB8A 2FZ1A 5A32A 4NIGA 3HWJA 2VZVA 3I54A 2VZ1A 1QJX2 4AL9A 2XMLA 2WYFA 2YV8A 4FQZA 4NN0A 5BUVA 3GZAA 5A1FA 3I3QA 5FZDA 1EYBA 1PZ7A 1NCRA 2J1RA 3CZUA 3ELNA 3PUAA 1J3QA 5FPVA 1UMIA 4FPKA 2C4XA 3OYWA 1SBDA 1ULFA 4D8MA 3NKTA 4QQHA 5ABJC 5A7OA 2QUOA 3KV5A 5FRAA 5FZ8A 2PN5A 5ABJB 4QX8A 4QWNA 1OLME 4XMAA 3BU0A 2W91A 4LKEA 5JZGA 4R9BA 4QKFA 3WF1A 5LRRA 3IAQA 4COVA 4MGKE 1A34A 3USUB 3T1LA 2GC2A 1NLQA 1U12A 4QM8A 4UBHA 2WNUA 4LA3A 5DG2A 4BK4A 4KU7A 4M01A 3BTZA 3VZJA 4HPKA 1VBC1 2VTXJ 2Y60A 1F4HA 4M4RA 1JUIA 5GLTA 1GP6A 3LPFA 3C8XA 4FOVA 4JVAA 5F2SA 5AC93 4QGNA 1FPN3 4AAPA 2P2KA 1S0EA 3MICA 1AL22 4Q4W2 1EUUA 1W6OB 5K0UA 4W8JA 2DFBA 4YGEA 1GZWA 1QXPA 3GNEA 4C1WA 4N43C 2E31A 1RYYA 4N43B 1BKZA 4YG6A 3WDYA 2C0ZA 1V6KA 4LUKA 1PIV1 4AEMA 3QLQA 3HAGA 2LM3A 4S2HA 4WZFA 3U4XA 3VHNA 3ZPYA 4JZRA 4LMFA 4N7IA 5DAWA 1RHI3 1FNYA 1UOGA 4FO9A 4QPIA 2FMYA 2EXIA 1TQ5A 5BYNA 1IS5A 5F5QA 1S2KA 4Y5Z0 2XBO1 3VHOA 1XE8A 1MZFA 3M8LA 4WVZA 3B93A 5FYIA 3WDUA 3NNGA 3HT2A 1BVP1 2D6OX 5CKMA 2WLQA 1E5IA 1HQLA 1JS9A 4GWNA 1RUH1 3GXUA 2E9QA 1IPKA 3B02A 1RVF3 4W6XA 3U78A 3WX5A 4L97A 1D4VB 3VB9A 2H6CA 4FAGA 1MS0A 3LKJA 3ZLIA 1RUJ3 3HBZA 2PHUA 4BXSV 5L7OC 3WDVA 2WT1A 4R9AA 2X29A 1QJZA 2ZX3A 4XAAA 1QIQA 3VN4A 4RA0A 1EAH3 2ADEA 5LA9A 5F5AA 4Q5OA 1I5PA 2WWJA 5GLUA 1C8M2 2W39A 3ZSEA 4AQ2A 5J37A 4DEQA 2YYOA 3I2HA 3ZR6A 4N90A 4DMIA 2PLV1 4YZ1A 4M0NA 3ZFFA 2AENA 4AHYA 5HV0A 4FPOB 3LDKA 2FCVA 2JIGA 4EN9B 4UW4A 2VULA 5IK4A 5DN2A 3VBRA 5KXBA 3MPBA 2E7AA 2VNVA 1O4TA 1J84A 4FPFA 4I3GA 3VKFC 4D69A 3PUSA 4JAAA 3A7QA 5CIRA 5I93A 3JD71 2RS11 5FYSA 3AP5A 4BA6A 4COWA 5LA0A 3I2GA 1LGBA 1RMU3 2DWRA 3J8F3 3M4FA 4LO6B 5L9BA 4NIAA 4KBZA 4DY5A 4IDZA 1UMZA 3HJRA 3VDAA 1W0NA 4XJWA 3SCHA 4AHWA 4ASKA 4DRVA 4NHXA 5T50A 1AR83 2BV4A 4G4FA 3D0SA 3ACIA 1HRV3 2FHRA 2W47A 1ASJ2 1LEDA 5BNQA 5A3MA 3GHMA 2TEPA 2XJPA 2ZXQA 4P9IA 1O4YA 1ZBE3 3ZXJA 2VMFA 4HSJA 3VL8A 2C5DA 1SLIA 2GMEA 2R49A 1PK6A 1PX3A 1UZZA 5FOBB 1G6NA 3WP4A 4X8NA 4Y24A 3TRSB 4LBMA 4HL0A 4Y22B 4LULA 3KQ4B 4CEWC 5CG9A 4HMZA 4CEWB 1N3PA 1D2QA 4FPCA 5JR2A 4E9KA 1NE4A 2JG8C 4KGQA 3Q8BA 4HN0A 4RQPC 2JG8B 3WNLA 1VIWB 3K4DA 1W9WA 2OIIA 2PHXA 2HWE1 2IC1A 1US3A 2ZGPA 3J7MA 3P3PA 4ISRA 1FV3A 3JBG2 1JTZX 1QJY2 3JXSA 4R9DA 3N9LA 2UWCA 1E5RA 2WNEA 5EPAA 5FLJA 2RJ2A 2DCTA 4DIQA 4BQ5A 4QU2A 4R9CA 3LPGA 3M70A 3MV11 1YXWA 4G3YC 4YVSC 1RUG1 1LNSA 2WFPA 3INAA 3TN93 4URAA 1Q43A 4YGDA 4YVSB 3WCSA 1N3QA 1XOYA 3AMNA 4PIYA 4CTEA 4QX0A 1MR5A 4I09A 4AK3A 3WG2A 2ZJCA 2A3YA 1W9YA 4Q4Y2 4A7KA 2NZ9A 3KSCA 4NIDA 3R4UA 4QQ2A 2D3PA 5DAXA 1ZX5A 1D4M1 3ZFEC 4AGGA 4CXXA 3ZFEB 2KA3A 2QQIA 3T2TA 1S0JA 4PIXA 3VKNA 2Q1MA 4JDNA 2HWF2 1CAWB 2V5DA 1UZWA 2F6BA 1RINA 2WSUA 3I3BA 4GMP1 2W1WA 5ABJA 2ARCA 3SQOA 3LD8A 2D93A 3CNAA 1DGLA 2GMMA 1VBA1 4H7LA 4IEWA 2PXJA 3K2OA 1W39A 2JD4A 2ZCWA 3L2HA 1J1TA 1Y9GA 3N9PA 2P4EA 4XJAA 2WKKA 3K4AA 1LHOA 2FDGA 2JECA 4CCOA 5IK8A 1QJU1 5LK5A 4MSVA 3NVCA 3U37A 4Z07A 2ZEWA 2BNMA 5FPXA 3J7LA 4GB31 1WMXA 4I02A 1DLLA 1EV11 1PX4A 2IXKA 4OI2A 4RFRB 1CPMA 3VD3A 4EN6B 4UFMA 3ZN4A 2XL9A 4Y4RA 5I8SA 2QDNA 4E4SA 2VZTA 2GMPA 4IEOA 4N43A 2WIIB 5BNOC 1OBNA 1UYYA 1WBLA 1JN2P 2B7YA 2WNOA 2BJSA 3KCXA 4YWAA 5KHJA 1VBD2 1Q8SA 2MNGA 3I97A 3IBMA 1AR61 2WLPA 3OY8B 3W59A 2GC3A 1BCXA 5F2WA 1W8NA 1VRH1 5GZFA 4NE9A 5A6YA 2VD7A 4IEPA 1I9RA 3TB0A 4XF1A 1LOCA 2R042 4F83A 3DGTA 2BYVE 2E7QA 4PLMA 3JUUA 2R1BA 3AC0A 3O1MA 3MW3A 4P5YA 3VDDC 5IVCA 3ZSMA 2E63A 5A7WB 5AVPA 1RUNA 4OUEA 3VDDB 4ASLA 4IV3C 3ZXAC 1OF4A 1I6XA 4IV3B 2VOKA 3T2QA 1COV2 4AW7A 5DUXA 1KDKA 2QQOA 4EE2A 5L7OA 2VPVA 5IT6A 2D3RA 3VGIA 1OQEA 4CU6A 1D2SA 4LKDA 1DLCA 3MI8A 1L7QA 4JGYC 5DAVA 4E2SA 2VW2A 2G19A 2LUWA 3G6JB 3NV1A 4JGYB 5F3IA 5GKAC 3WQBA 3A21A 2ZX0A 2XVGA 1WW6A 4V1PA 4BQYA 1Q3EA 2RHPA 2W87A 3H1YA 4KGGA 1WLCA 1JYCA 2PTMA 2UWBA 4Y1XA 5F5IA 1MS9A 1CAUB 1KRIA 4XQDA 5DAPA 3PVEA 2Q8CA 4S2DA 5E88A 2YBPA 4L11A 3PTRB 3NQHA 1G8WA 5FZ7A 4HONA 4CDWC 5C3RA 1VBC3 2W0XA 4YZ5A 2HBUA 4CDWB 3V56A 4FBFA 4IGQA 3NMBA 4BPZA 4BZ4A 1QNWA 2WZR1 1GNYA 2JE7A 2ZTNA 4LORA 4P14A 1PZ9A 1HB2A 4ZPIA 2NMOA 4CDQC 1CWPA 4BXFA 2E33A 2FDJA 3WW2A 2Z79A 3PVBB 5JI7A 1NXMA 1BBT1 2BP6A 1CIWA 2PAKA 1FOD2 4XIOA 3SEEA 5CADA 4LHSA 2RDRA 1PIV3 4JC1A 2A7AA 1MACA 1YFXA 3K48A 1AX0A 2VZRA 4K21A 1AYM2 5A6QA 1DQ5A 1XYOA 2RR12 5D21A 4Y22A 2OX0A 3N9MA 2XBO3 4K9SA 3AKSA 2Y38A 1MEC1 2VOVA 3IT8A 4FOWA 4CEWA 1LOAA 1X50A 3K4ZA 3GZTB 2BUKA 1HB4A 4S2GA 3C7FA 1DG6A 2JG8A 1S2BA 1RUH3 4ZZ5A 3POBA 4RQPA 3WG1A 3RYPA 1AYN1 2LALA 4GKYA 3RMXA 3OBZA 3K3OA 4PCRA 2W92A 1TME2 4AFCA 2V5YA 2D5FA 4P9XA 5T5PA 4FFHA 4DXRA 4OHVA 4RL7A 3VLBB 4YVSA 2YXSA 3I2KA 3MUZ1 5FZEA 3DL3A 3TEXA 1NT0A 4JRLA 1QJX1 3B94A 5HPOA 1ZBA1 4AVAA 4QX3A 2PLV3 1DCSA 5A6ZA 1F15A 5E1RA 4EJRA 1NA1B 2AZ5A 3ZFEA 1W9SA 3I2OA 5FQ0B 4FCAA 3ZDSA 2Y6GA 3LGRA 5FYHA 3O1SA 4MZUA 1CAWA 4HG6B 2J1TA 3N9OA 2OUHA 5IYYA 4Q0QA 4C0BA 2Q30A 1MQTC 3BTAA 3I8TA 3JD73 2RS13 3PU3A 2AEZA 3POYA 4NVPA 5EJ1B 3QBQA 2ATFA 4CSWA 3ZMNA 2Q5TA 3AMHA 1VRBA 4QGLA 3RVHA 3TEZA 4FP3A 4LT5A 4NHMA 1ZRDA 2Q8EA 3DV8A 4R4XA 1GQGA 4Y3OA 2UWAA 3U10A 1KS5A 2DF7A 2DVBA 3RZHA 2G9GA 2QQJA 1OXCA 4D7SA 3HQRA 4META 4KWKA 1LESA 3OEAA 3T09A 5H9RA 5J1XA 5CVRA 2Y26A 1SLBA 1FI2A 4Q4W1 3BOPA 3TNPB 2WABA 5F1RA 1HB3A 4CU7A 3K75B 5BNOA 3H42B 4OZOA 4XUTA 4AVSA 1S4CA 1VMFA 5CFDC 3OY8A 3RYKA 2A3XA 5CFDB 1VE0A 3UT0A 5I8TA 4G9SB 1XYNA 3ASIA 1RUE2 4OI4A 1ULGA 1X9TA 4QQOA 2HWE3 4YW4A 1RGSA 3S7EA 4B7EA 1C8NA 5DDJ2 3IMMA 2AYHA 3ILNA 4IGPA 4B4PA 3DF0A 1NUKA 1VMJA 1N1YA 4TWTA 4OQ9A 3WHTA 1OOPB 2DU1A 3SH5A 1PMHX 1QDCA 5A7WA 3S6PA 1RUG3 5F37A 1IKQA 1AXZA 5FY0A 3VDDA 3GCXA 2D97A 3KQRA 4FPGA 2DV9A 1Y7BA 2WUHA 4FPLA 3KF5A 1P8JA 4IE6A 2ZGNA 2HWD2 4IV3A 1QJEA 4Q1PA 1H1AA 3DYMA 3VHRA 5C6CA 1FNZA 5C70A 1AXKA 1D4M3 4HK8A 1LJ7A 2ORZA 1Q5OA 5EV7A 5A3OA 5FP3A 2V4AA 3HPNA 3B5LB 1T6GC 3UK9A 5L36A 1T6BX 2P5BA 5DMYA 4GMP3 1YQCA 2W3JA 1C8M1 4JGYA 2VH9A 4WBBA 2BU9A 2WN3A 4BMEA 5FP8A 5HXVA 2VTFA 3RQ0A 1VBA3 4KQ7A 1V6NA 1ZM1A 1C28A 1MPXA 4YARA 2XVKA 5L19A 4D6SA 5A1LA 4QX2A 4LEJA 3PL0A 3QCWA 4IL7A 4QDSA 4W6WA 4V2VA 4Y4YA 1RUD2 3UJOA 4DZGA 4EQVA 1PNGA 4GXLA 2X05A 1W8TA 3VZNA 3VKMA 3FZ3A 3WY6A 3WDXA 1QJU3 1YYNA 4CDWA 5KXCA 1WW4A 1DQ4A 2UU8A 4GB33 1XQNA 1EV13 1HDKA 2VZ3A 3ZKUA 5A3LA 2BOJA 4HETA 3ETQA 1FMD2 5D8AC 4DXSA 2BWCA 4CDQA 1JZ5A 3BTYA 5D8AB 5ANQA 1UN1A 3EO6A 3POFA 4JV4A 4QPYA 4QXKA 1Y3TA 4LXLA 5KC5A 3W21A 1FT9A 1RUI2 1VAVA 4TYSA 3AYCA 3I2FA 3ZKYA 1MZEA 2IFRA 2AUYA 3PUHA 1UPSA 1Z0HA 2DDUA 3MF6A 1AR63 1SCSA 4BQ2A 2ADDA 5FZOB 1AF9A 4ARXA 1MS4A 3VDBA 1VRH3 5CKNA 4FP2A 3KM5A 4GIQA 1V6MA 4HOOA 4KL1A 1ZYBA 2WRAA 3OEBA 5BPXA 4DOUA 4MG2A 1V6JA 1WMDA 2XOMA 2Y6FA 2J1SA 5SV5A 1WD3A 4IXLA 5LWBA 4B3NA 1XU1A 3MIFA 4X6QB 5C5TA 4OMDA 3N9NA 3RI9A 1ULCA 4BB3A 3LCPA 1GNZA 3BPSA 1KD7A 2H0BA 4GWJA 2DCYA 3JBG1 4HKOA 1CX1A 1BQPA 1DZQA 4AEDC 3IMNA 2WL1A 5BNPC 1NE6A 4A41A 4AEDB 4FFIA 4RSUA 3SISA 4NPLA 3T2PA 2GP3A 1X36A 1CZSA 2VOXA 2D6PA 3CMGA 3MPPG 4Y20B 4LLFA 2AEYA 3ZO0B 5JPNB 2WT2A 2W2IA 2JIJA 3O0XA 1GBGA 3WP6A 3CQOA 5FK7A 3AL6A 1W8OA 4K7JA 3TWIA 4ZU7A 5CEHA 1W3VA 4UF0B 4C1XA 2W08A 5FQ0A 5C71A 4NO4A 2XPJA 4LUMA 5JXJA 4FXKB 4KWUA 5I0SA 3JZVA 1SFNA 3CU7A 3UYJA 1RITA 1RUF2 2X10A 1Y43B 2HWF1 5LBBA 1O5LA 2AH2A 3LE0A 1BVVA 2RDSA 3DPRC 4JQRA 3D8CA 2UY8A 3MW2A 1MQTA 1QY4A 1VBB2 2WO1A 4DUWA 5HI0A 2WZR3 5LY1A 3O1VA 1OUXA 1J83A 1IZ3A 3VV1A 2VE1A 2HH9A 4KI5M 1YNAA 3U0ZA 1UOJA 3WXPA 1CPNA 1UPIA 3VD5A 1AX1A 1BBT3 5HV4A 2WAAA 2BVBA 1ULEA 1NLRA 2Z69A 1A8MA 1V9U2 1XJAA 2ZBJA 3AJZA 4PQQA 2VNGA 3WW1A 1L3JA 5T55A 1QJFA 3Q8AA 5FZAA 2WS92 1O5UA 1W2TA 2ENRA 4XOGA 5CYYA 5H9QA 1MEC3 5EHDA 4Y26A 2Q8OA 5JOWA 3QH6A 3WF2A 5LA1A 3D82A 5A7PA 5IVEA 5CFDA 4HK9A 2XJUA 3S0MA 1VBD1 1GQHA 2Q0AA 4LBNA 1V6LA 5C7GA 1LHNA 3IZOA 1AYN3 1Q8VA 1X9PA 4XFCA 3H1WA 4OFGA 3ZYBA 3SXWA 2VY0A 4XTMA 2BPA2 4B7KA 1CJPA 3SITA 1WCKA 2R041 4A45A 1PVC1 3WT3A 2VCMA 4Q26A 4B1MA 1X7NA 1LHUA 1W6MB 3O7OA 3HNMA 1NZCA 3J7NA 1RJ7A 3E6CC 1R092 2OS2A 2WDBA 4LIVA 1W6QB 4BQ4A 5FYYA 1QJX3 1ZBA3 1I1EA 1SBEA 4BLIA 3DKQA 2XJSA 1WCSA 1TVGA 2VJXA 3RFRA 3WV6A 4Q0VA 3R05A 1COV1 3CJIB 3KZ4C 5JOYA 1W03A 2IZWA 2YU2A 4IEVA 5I8YA 4NUBA 2DU0A 1G9DA 4QGMA 1KGYA 1W9FA 3UKTA 4EWDA 4MXWB 2XJRA 4RR3C 5KHIA 2ET1A 5KHGA 4RR3B 1UIJA 1ENSA 2ZHLA 5FY8A 3RS6A 2WQ8A 3SH3A 4IE7A 4NPRA 1F8VA 1HQNA 2JD9A 3WLUA 4QXCA 2PA7A 3FMGA 5AVAA 4Q8KA 3D3AA 4L9BA 2VMHA 2WO2A 4A2UA 1BLZA 1LU1A 1CR7A 3R4SA 4ZONA 1OLMA 4AFDA 2FD8A 1GZCA 2X53S 4MX3A 5FPLA 5F3GA 2CGOA 4H55A 4MV2A 3BALA 3POIA 2YROA 1U0AA 5FO7B 4OI1A 1LOBA 4LQRA 3NKGA 1J58A 1KFXL 2R062 3LAGA 5FMCA 3SLIA 2WA3A 3LFIA 5D8AA 1PGL2 4BYYA 1OVPA 2XXZA 2VZQA 1AJOA 3KD4A 1VAKA 1PM4A 4P00B 2HLEA 4HVQA 4LBLA 3NL1A 5B4XA 1VBE2 1OH4A 2PMWB 5FLHA 2NQYA 4I0BA 5FZOA 4AQ6A 4IE0A 2UYAA 1ZA4A 2E26A 3PJQA 4WM8B 4A7ZA 2PHFA 3BTXA 5HCAA 2RR11 2CYFA 4K6BA 1MS1A 4BISA 2E6VA 5FY1A 5JIUA 5FZ1A 3T30A 1OC1A 1UXXX 4Q8LA 5L73A 2ETEA 4EV0A 1MVQA 2JDAA 2X5IC 3AKQA 4MLOA 1APNA 3CZJA 1UKRA 4F8AA 1IPSA 1GWLA 2X5IB 4UOJA 1VMHA 4FPYA 1H4GA 1TME1 4AEDA 1RUC1 1A6CA 1ZZBA 2HWC2 1AVBA 1QH6A 2OXBA 4OCTA 2XQXA 1OFNA 2P17A 2A73B 4Y20A 2HYKA 1C8M3 1AUYA 2Y6JA 3C3VA 3I2JA 1PMIA 1VP6A 2IUWA 2EIEA 3OCPA 4WVWA 3MIBA 4YRDA 1NG0A 3DXUA 1XPWA 2JDKA 2VQ0A 4L2NA 4LKSA 1JOBA 4UF0A 3ZYRA 5E16A 2CDPA 4UFLA 2J1EA 2FBEA 4FT8A 2YY1A 1W2OA 2A75A 1HV0A 2GC0A 5FPAA 3H3LA 1GZ9A 1QH7A 5J98B 3ILRA 5IHRA 1WLWA 3VKLA 4ZKTB 4XBLA 3F2ZA 3DPRA 3VZLA 2XG3A 3PVOA 3AKRA 4P9JA 4FFGA 3EJKA 2GN7A 2J1VA 2D6LX 2XHNA 2DUQA 3HBKA 5HCFA 4WV8A 1SLCA 3POWA 5GM0A 4Y5SA 5GJ6A 2OQ7A 1SLLA 4YLZA 3T08A 2FDHA 2DTYA 4F7ZA 2E53A 5FAXA 2ZA9A 4NHKA 4E4DX 2OUJA 3ZPOA 1UF2C 3ORJA 4JRAA 4Q29A 4Q4V2 3A4UA 2QQWA 2ARBA 4RS5B 4LIUA 4COZA 1QNYA 3NNFA 4BH9A 2VBPA 3J7HA 2AACA 5CFCB 1AX2A 1W0PA 5LCWL 3FHQA 3S5QA 4CCNA 5J96B 2BTVC 5KR7A 3O5SA 3OPWA 2ZS6B 3C7EA 2LW8A 4K3UA 3MZHA 2G9ZA 4FVVA 2RJLA 2BWAA 2PELA 3AYAA 1BZWA 3OD4A 4YM1A 5JSPA 4O61A 2DUPA 2FCUA 4M00A 4BCUA 3WUCA 4YNIA 5LASA 5H9SA 1NXD1 3DXTA 4N53C 3JBG3 5DDJ1 4N53B 1UMHA 3RI8A 2RJKA 3KMHA 4AHZA 1POV0 3OGSA 5IAVA 4L99A 1PMJX 4MYEA 4FSJA 2ZKLA 5JSOA 1W6QA 5T54A 1HB1A 4URTA 4LPLA 3LEKA 5E8AA 1UIKA 5C8WA 2O8OA 5FDBA 1XE7A 2HWD1 4GJZA 3UKNA 5D2AA 2ZMLA 4QX7A 3T4HB 2VAUA 3UKVA 4UWDA 1L7LA 1O91A 1BK1A 4TSVA 4XDQA 2WR9A 3UJQA 2XLAA 3AMPA 4LE4A 2PAEA 4ZXEA 4C90A 3M1HA 4OUSA 3HN3A 2HWF3 2ZGRA 4RR3A 1QU0A 4CXYA 3LF7A 1R64A 1G9CA 3C7HA 1CAXB 4UFKA 3KHCA 4XF9A 2B46X 3LB9A 5C8CC 5FO9B 4OULA 3PDQA 5C8CB 3H3ZA 1DDLA 1WWYA 5C3QA 2GNBA 1RUD1 3ZXKA 4MGZE 2Q1FA 3NV2A 4XF4A 1HN1A 4ITCA 4QPGC 2B45X 3IM0A 1RL3A 4NHLA 1XB9A 4QPGB 2O8QA 1ND3B 1SMVA 4C8DA 1ALYA 2VXRA 3U11A 4FAHA 1XBFA 5FXVA 5C5UA 2JB8A 1H1IA 5GLWA 1FMD1 4FPEA 5BXXA 4CDUC 4IUGA 5AC92 1W8HA 4CDUB 4KBBA 2WWSA 2ZHMA 4BQ3A 2EICA 4CUBA 4ZU4A 4FTEA 2E51A 4E2GA 1RUI1 3LIGA 5IK5A 1Z7S2 1S0DA 3QD6A 3JB8A 4M3CE 2JDZA 3BODA 4UI9L 1VBD3 2P6CA 4CP9B 5KWRA 3E5XA 1C1FA 2RS32 1WD4A 2VZSA 4OVEA 3H7YA 1NY72 3I49A 1GSLA 2D6KA 4XDPA 4Z2AA 4PI2A 1RHI2 2R043 4Q4X2 4TLGA 2ZOEB 3WQ7A 1PVC3 4YVWB 1XXNA 4UAPA 2QJVA 4OMCA 2QCSB 1YQ8A 1O3SA 3OJBA 1S0FA 4PBOA 5EZWA 3QACA 5FXWA 1XYPA 3LEMA 2VQUA 4DY3A 2CGPA 2BERA 2WAOA 2FDKA 5BNPB 2X5IA 5FZ3A 1VJ2A 2W1QA 1COV3 1KFUL 1ZZ7A 1Y9MA 5LRSA 1HXS3 1RUJ2 5KBFA 4BWOA 1W8UA 1WBFA 1GR3A 2WQZC 3GM8A 5JXIA 5ACA2 3ITQA 4DXTA 2F4LA 3ACGA 1EAH2 3GALA 5FY9A 1WLTA 3N9QA 1JODA 1IS6A 1TMF2 4KNCA 2K0GA 1WW7A 4Z2WA 3Q8FA 2J7MA 3USUA 2Q1ZB 3R4DB 5LW9A 4YFWA 3D6EA 4XFHA 2BRTA 2EAAA 3AP9A 2IXCA 4CP2A 4MXVA 1OPMA 4BMBA 1RUF1 5C3PA 2ZX2A 1HRI2 3SCFA 3RWNA 4EN8B 5KHHA 4OUMA 3ZSKA 3IDCB 3NAPC 5DUVA 2JE8A 1QOSA 4GH4B 3NAPB 2OYZA 3U4SA 1VBB1 1F9KA 3E6DA 4MH0E 1W6OA 2P37A 3ME2A 1XU2A 1PO23 1AR91 1VAMA 1W2NA 3V0AB 1RMU2 5FZMA 4H14A 1YRZA 4RGGA 3AP6A 3FL7A 1H2MA 4CZSA 2QQNA 1TEIA 1UOBA 1VLNA 2RMU1 1GYKA 2Y6LA 3R0RA 1YJLA 4M4PA 1V9U1 1S0CA 4RGAA 3TOJA 4XUQA 4WVMB 3BB6A 4XE9A 3ECQA 1ZBE2 1QWRA 2ZZQA 2RR13 1JHNA 4CPBA 5G05L 3ZR5A 4H3WA 1IQAA 2GH8A 4YW7A 2BQPA 5FK8A 1J59A 5FYZA 4K40A 1GFF2 1UY4A 1IG0A 5JAXA 1PNFA 4IQPA 4A6OA 2UURA 3WW4A 4YZ2A 5FY7A 2PHDA 2NYYA 4MVTA 4N53A 4NJ4A 2VVFA 4P9YA 1TME3 3ABZA 4XHBA 2C24A 3RDIA 1RUC3 4ZU5A 4TTGA 2JXAA 4J25A 4I01A 1UQXA 5CKQA 1J3PA 1HLCA 1H2KA 2QTWB 1OVSA 3CHXA 2XJVA 2ERFA 1SCRA 4K8FA 5CNAA 5EJ3A 4CDXB 4EN7B 4CCEA 3WUDA 2ARXA 3CBNA 2DYCA 2EA7A 4XF3A 1NOVA 1DFQA 1YLLA 2B9UA 3RZLA 3PUQA 1QKQA 1Y4WA 3NNMA 1W6NB 4LHKA 3SEPA 5KXDA 1F5JA 2R072 2VU9A 4LK6A 5ANNA 2I45A 3M3CA 4HVOA 2ZGMA 1XNAA 2YG0A 1UNBA 2HEYF 3POSA 3OBAA 1CAXA 1W2AX 5DZEA 4GALA 4QQLA 4N8MA 3HEIA 1LR5A 5FY5A 5C8CA 1IHMA 2DVDA 4IGOA 4DUXA 3L2YA 2BEOA 3PMEA 3WR0A 5HBAA 1O59A 1ZA7A 4XJ8A 2W94A 5FMDA 3S7IA 1BEV2 3PUIA 3UESA 2DBNA 3WP3A 2MEV2 3KWVA 3E6BA 4IV1C 1H9PA 4QPGA 2AREA 1LENA 5DPNA 4IV1B 1OQ1A 1GANA 2O14A 2FDIA 1YQ2A 1YC61 2WBKA 4JTNA 2WZEA 1UKGA 2R061 2ZMKA 2NM1A 3I59B 4L0PA 4CDUA 1PGL1 3CLPA 3H8OA 2XONA 1DF0A 2W1SA 1MS8A 3OSDA 4QKBA 1YI9A 3WINE 1JZ2A 4JX0A 2KR2A 3ZSJA 4CP9A 4RHV2 1VBE1 2Z4FA 3EMRA 2VG9A 4QPWA 3LSDA 4ATFA 1GWKA 2YBKA 3Q9OA 3RMYA 4CPBD 2F4PA 5EYYA 4OLLA 4M3CF 2XJTA 1IS3A 1PGW2 2DCKA 3T4VA 2GH2A 2XVLA 5FZLA 5DDJ3 4AI2A 4MOAA 2VQAA 4XCAA 5HXMA 4NHYA 3VL9A 5FKCA 5KHKA 3MIEA 2EAKA 3B3QE 4PI0A 4NOTA 1GICA 4OZXA 1NA1C 3PHMA 3ZSLA 4Z8BA 1LGCA 2ES3A 3H7JA 4PDWC 2BVVA 5A3NA 2QVSB 2XB6C 3WNXA 4LBOA 4PDWB 4I0AA 1OA3A 2QQLA 2W68A 5F39A 2VCBA 3O1PA 1W8FA 2BOIA 2G9FA 2WZ8A 1ODNA 1ACCA 1ZRIA 1NCQB 2CAUA 2HWC1 4Q27A 5GLVA 1W2UA 4NROA 1DQ2A 1LOGA 2QZ2A 1R1A2 2XWBB 3BKZA 4NAOA 5CAZA 3C2UA 1UW8A 4LOTA 3T2OA 2KM2A 4XABA 3FUOA 1QHDA 5EP9A 4QB6A 1O4ZA 3AK0A 3VBUA 4XPVA 5A3TA 2IXLA 4XBQA 1WCUA 3P5BA 3QH7A 3N7LA 1RUD3 4MO3M 3URFA 4O9GA 1RUOA 2E32A 3WZ1A 4PHZA 3FBYA 2Y6KA 3HNBM 1IOAA 3FJSA 1QOOA 1D0HA 1YIFA 3ZFGC 3ETPA 3NAPA 4UW3A 5CG8A 1MVEA 1VBC2 1SG3A 3ZFGB 1VPHA 3MUY1 3MFAA 4LO8A 5L9RA 1UOFA 2HWB2 5GZDA 1AL21 3W58A 3V0AA 1FMD3 1JYTA 2YUEA 1XNCA 1EPWA 2H0VA 5B2GB 2FZ2A 1GMMA 3ZXGA 4NIHA 2WN2A 2JG9C 4NPMA 2WFF2 4UW6A 4NWWA 2JG9B 4XUOA 2NLRA 5GALA 4Q4V1 4FPJA 1EPZA 1ULPA 3AX4A 5DQ0A 1U5ZA 1C5HA 1UWWA 1WUVA 2CAVA 4Q0UA 4AZZA 4CCCA 4CYDA 1PIV2 3WNMA 3MLKA 2GU9A 4YG3A 3GZUC 2FCTA 4XIKA 2K46A 2HJIA 3LA2A 1SDDB 1SPPB 2YZ4A 1OOPC 1H8TB 1F2NA 1YFUA 4A3ZA 5A7NA 1GU3A 3RRDA 2XBO2 4AHXA 1BHGA 3M2MA 4HVRA 2Z5WA 4LK7A 3NW4A 3DKWA 4GQ7A 2VM9A 3A23A 3B9IA 2WZPP 1VR3A 4HXCA 5FZFA 1N1VA 1W6PB 4DNYA 1QEXA 1OA4A 1H1MA 3RZZA 4CCLA 2VMCA 2A5ZA 2BZDA 2W9XA 2FQPA 3KT4A 1SQ4A 3W5MA 1CN1A 2OQ6A 2ZZJA 3B7MA 4IEXA 4LO5B 2VVDA 1AXYA 3HR9A 4DUVA 4AR2A 2BNOA 3GJAA 4JGZC 4R4ZA 2TNFA 4JGZB 5JLVA 4AQTA 2IXHA 4A6SA 3OGJA 3RWKX 1CD3G 2RS52 2ZGUA 4D94A 1CAUA 1PVXA 1RXGA 3BVCA 1OA2A 4XVHA 2XKOA 4PF1A 2VXJA 3WCRA 3BCWA 1W6NA 4JHZA 2NPIA 4BDVB 1UY0A 4HSLA 4DO0A 1RUF3 3E5QA 5DZFA 1HIXA 2WA4A 4AXOA 4CUGA 1WGPA 1JHJA 1CAVB 2F17A 2OKXA 2R6QA 4I0WB 2A6YA 1VBB3 1GKBA 4NIIA 2WO3A 4CXWA 3ACFA 3ENRA 1AR93 2RS12 1ZVFA 3PLQA 5FPUA 3PURA 5EWSA 1ASJ1 2X8KA 4EZ4A 1ENQA 3AZZA 4IV1A 3LDBA 1CX4A 4XFFA 3WG4A 4XHXA 2RMU3 3ZYJB 3AL5A 4AAXA 1UY2A 1V9U3 1R082 1YO8A 1TNRA 3GBWA 3I59A 2R1DA 3NJZA 3Q8CA 3ACLA 4BIFA 5AC91 3FX3A 5FCCA 3IN9A 3NJVA 4WM7B 1Z78A 1LTEA 4HFSA 4ORFA 3U75A 3HNYM 4IW3A 3GBFA 1ENRA 1US2A 2FMDA 2P3YA 3AKPA 3MGUA 5FYCA 1Z7S1 3WF4A 1K42A 3IDAA 2GAUA 2ZABA 3KB5A 2SLIA 1AZDA 4XFIA 2A6VA 4SBVA 2RS31 2PQQA 1M06G 3NJXA 1QJY1 4LJHA 4P9LA 2R0FA 4JDMA 1K45A 3D4KA 1NY71 1O6UA 4KMQA 1J3RA 2VZPA 4BHPA 1Q56A 4Q4X1 4QX1A 4ZS3A 1YWKA 4QMAA 4Y1ZA 5K4LA 2ORXA 5G04L 1BJQA 5K7PA 5BNNB 3UV9A 4RD7A 5J36A 5FMBA 2C9KA 1W9TA 2WQ4A 1PZ8A 4XUPA 1AL0G 1OKQA 1UL9A 5FZHA 3LIHA 1CZTA 5H9PA 2C26A 4Q4Y1 1JZ3A 1NA1A 3T3YA 4PDWA 4K1ZA 3RGBA 3BIEA 3VZKA 2BFUL 3DN7A 1XC6A 2BFUS 3P6BA 4TN7A 1D4M2 4WZCA 4YW2A 3THPA 5CBLA 1WA4A 3ILFA 5ACA1 1DGWA 4L8QA 2R7EB 2VMDA 3MO4A 3LZZA 4EN0A 3AP4A 1DGWX 3DYPA 4O9EA 1DZRA 1QOTA 3OYWB 2V09A 1TMF1 3I7DA 4XACA 3LQCA 1VBA2 4OHWA 3GHNA 1A78A 4U36A 2K9ZA 4RYDA 5JZGB 4KH9A 2SBAA 5FP7A 5IFPA 1OQDA 3MLLA 5GLZA 4AG4A 1DQ6A 3W20A 1AR72 4K1YA 1HRI1 2VTXA 1UZVA 1V00A 2J1UA 3NNLA 2EIGA 3ZFGA 5FZ6A 3K3NA 4AVVA 4GB32 1WA6X 4DFSA 3KV6A 2R063 2EVXA 3MEPA 3OGGA 5IVVA 2VCCA 1REDA 2ZGQA 3PVNA 3MIDA 3WQ1A 5C9AC 2W52A 1NQJA 2Y8KA 4CU8A 4Q0PA 3SH4A 1O3RA 2JG9A 5FYBA 5C9AB 2GNMA 2BW8A 2YGLA 5FYUA 3FBMA 2CV6A 4LHNA 4FQ4A 2OPWA 4AVTA 2B42B 2XWJB 1NKGA 1UX6A 1SPPA 1WKYA 2D5HA 1DGRN 3P1IA 4FTSA 4GWIA 1Q8PA 1OOPA 2GN3A 4M3CB 3FHIB 4XQ4A 4Z1VA 3CO2A 5FWEA 1DGRA 4YGBA 5E89A 1I5ZA 3ST7A 1LOEA 5JCTA 3FUQA 1WW5A 3N7JA 1DQ1A 2DVAA 2VECA 3U14A 2CGNA 4A42A 2WNVC 4V2WA 3AM2A 3RZKA 1SHWB 5FKBA 1W6PA 1YUDA 2WNVB 3CJIC 1JYWA 1E5SA 4E8CA 3S30A 2AGSA 4D7YA 5LA2A 3RG0A 4AGVA 3RJ2X 2DUOA 3RJRA 4NRMA 2QQUA 1IS4A 2DCZA 2VCAA 3B01A 2HWC3 3THCA 1HV1A 2YPDA 2PFWA 4H7MA 1SLTA 4NRQA 3WF0A 2BBAA 4QQPA 3VD9A 4JGZA 4XZUG 4CP0A 1NQDA 4EWEA 4QDQA 1NZIA 1HQWA 4D0QA 5A70A 5GZCA 2OT7A 3I3EA 4IE5A 1C3HA 1FV2A 4IEYA 1HKDA 1KS4A 2WJSA 2ZEXA 4YPJA 1ST8A 5FBZA 4EZHA 4XXAA 2R071 4D3WA 2BNNA 1QGLA 1RJ8A 1CAVA 1H8VA 3FLTA 3H8RA 1MZ5A 1H30A 1A3KA 2YFUA 5D1IA 5LK7B 4NAMA 3VBRB 5L9VA 4PJYA 2GSYA 3E97A 1AL23 3EHKA 1T2XA 4LITA 2WZR2 3N7MA 4Q4W3 3WSOA 5C3OA 5JDBA 4I2OA 2VL4A 3AVSA 2IWGB 2ZHKA 2QKDA 1QDOA 4E27A 5FP9A 1BEV1 1FOD1 3RZMA 1EP0A 2MEV1 1W8ZA 3PJYA 4FPHA 2YBSA 3LEIA 4I30A 1V6IA 1GOFA 2AC1A 4Q4V3 1URXA 3ZVXA 5KC6A 2VUJA 2YB7A 5C3SA 1KJRA 4WM8C 4AI3A 1UO9A 3SNMA 1AYM1 5DZGA 5FZBA 5A33B 3S57A 1OMIA 2XLFA 2V72A 3LEGA 2IFWA 1OT5A 1PHMA 2JEMA 1XNTA 2IXJA 2XL7A 4B1LA 4XAEA 5A7QA 1MEC2 1ODMA 4XCBA 1L7RA 4CUCA 3IIAA 4RHV1 1B35C 4RS5A 1NX9A 3MYXA 4KU8A 3ZM8A 2P6HA 3ZXEA 4CCKA 1B35B 3GGLA 4D6RA 1CESA 5CZKA 3B69A 3ZDVA 4E4ZA 1PGW1 3OD0A 1POV1 3H8XA 2VNRA 3AKTA 3C7OA 2IXIA 4M0HA 4EROA 1EUTA 3KS7A 3M3OA 2OPKA 3OGVA 2RE9A 3EXUA 1W99A 4UXAA 4W50A 1UAIA 2CU5A 5FZCA 1LAJA 5I0RA 3VUOA 5FTTC 5A80A 5LEKA 5JOXA 3DECA 3TNQA 4QX5A 3VBOC 4HZFA 5F5CA 3VBOB 5EJZB 1C5IA 3GDBA 1G9FA 3J26N 4LBQB 4AF9A 5M0TA 1JZ4A 1BK0A 1IG3A 1DP0A 5FZIA 3M3EA 5GZEA 5IVYA 4CEYC 3BUCA 5A3PA 2ZX4A 1ZBA2 4CEYB 3CJXA 1LECA 1W04A 3OUHA 4QHOA 2DFCA 4LO7A 1VALA 3SKJE 3ZIXA 5B4NA 1X33A 1NLSA 2RVAA 3JQXA 2Y6HA 1DYKA 3OBRA 3FLPA 3LDRA 1DIWA 3H9AA 1QQP2 1R1A1 3APBA 4XILA 2VMGA 3WF3A 3S5AA 5JI9A 5FFOC 4F3JA 1KDMA 4IERA 2TBVA 2YC2A 3KCCA 3T1MA 3Q8EA 2WYSA 1GV9A 4QKDA 4D7TA 4CCDA 3WDWA 4JHTA 4RS5C 1ASJ3 1JH5A 1S55A 3EYPA 2GZWA 2PAMA 4B8EA 3ZN6B 1XE0A 5CFCC 1KEXA 3NSTA 3M3IA 3AZVA 1CIYA 4IESA 1YCIA 3GJBA 3AYEA 2JKXA 2HWB1 2EIDA 3FC0A 5C9AA 4LLOA 3RPQA 5TSWA 4OYUA 4YM2A 1W0OA 3VD7A 2WFF1 1LHWA 4FFFA 4GD4A 4XEZA 1Z7S3 2VW1A 2KXLA 5EFUA 2UYBA 1H6YA 5FZKA 4MGQA 1CONA 2D44A 4D6QA 1RUE1 4LE3A 5LB6A 2ID4A 4CCMA 2RS33 5FYMA 3BIWE 2RM22 1QJY3 1F4AA 2YPJA 4AEJA 1JZ8A 1OFSA 4M3CA 4QU1A 4J6GA 4YGCA 1KXGA 5LZ6A 5F6LB 2KD7A 2WWUA 4Q4X3 1VB4A 1OKOA 1W6MA 3POEA 1JI6A 3SHRA 4B4QA 1PO12 4OHYA 2YHJA 4IEQA 1WMEA 3WHUA 4XQWA 2CDOA 1OLRA 4BIOA 3HD8B 3ZIWA 3AJYA 4EYUA 3RZGA 4GA9A 2WNVA 1WCQA 1W8WA 1RIRA 4Q4Y3 2LROA 5J48A 5F6KA 4BOWA 2CY6A 3CJIA 4AE2A 2EXHA 1OF3A 1GUIA 3CF6E 4MXWA 3H50A 5CA6A 3N7KA 4DS0A 3VKOA 1IQDC 4AFBA 5ACA3 1KJLA 4YG0A 5L7OB 3FWEA 3USSA 4E4HA 1YFWA 1LODA 5A1AA 2QQMA 4FOQA 1PGSA 5JUVA 3T0DA 3IAPA 4XF0A 1PM7A 1TMF3 2RS51 4DINB 2VUDA 1OURA 2NN8A 5FXXA 4X6RB 2VOWA 3HQUA 2B5HA 4LO4B 5IATA 3KLSA 3ON7A 5HCHA 2D7FA 3BU7A 2O0OA 3MV01 2QQVA 3O1TA 1YQ6A 1HRI3 5FIXA 1ND3C 1W90A 5JIAA 3KT7A 1V6OA 1ZREA 4XW3A 3VBSC 4MGTA 3K51A 4UFIA 4AVBA 4LBJA 3HT1A 3VBSB 3VD4A 3HQXA 2HYXA 2BGOA 1FPN2 1JW6A 1JYXA 3ACHA 5LBFA 2JENA 1YFYA 4AYUA 4SLIA 4E2QA 1HX6A 4R8HA 4AQSA 4MGYE 4YW6A 1KITA 3GF6A 2CL2A 4HBNA 4HKLA 3VBFC 4MGIE 3VBFB 4ONUA 5IW0A 4XXPA 4WM8A 1S1AA 4YW3A 1R081 5A33A 4DPNA 2AR6A 3LOIA 3U1XA 1G9AA 2VBBA 4IEUA 4NWVA 3A0NA 4P08A 4P9WA 4TXWA 4YVWC 3N4MA 3BPZA 1YEWA 3AP7A 1O8SA 2YMZA 5FYTA 3TEWA 1O3TA 3V65A 3ZYHA 4I3PA 4BJ0A 4W6YA 3I3DA 3H8UA 4Z92B 1LKNA 4S2FA 1J1LA 2J1AA 4XDOA 1B35A 1BXHA 3WEZA 5FREA 2LS6A 4HLTA 2E7TA 4CRQA 3JB4C 3MDPA 2NMNA 4IETA 1XSQA 3MHZA 3KVBA 1RVF2 2C1FA 4QAWA 4RQPB 1ZNPA 4W65A 5JMOA 2QQPA 1CJDA 2FDFA 5FMOL 3J9SA 3HN1A 4ISQA 4YW5A 5FMOS 2J42A 3KHBA 3PIJA 2ZGTA 1Y9QA 2Y0OA 1F35A 5FLIA 3VBOA 2XUMA 2ZEZA 4LBQA 3M3QA 1R1ZA 2JDYA 3VBHC 4UFJA 3RNSA 1ND2C 1LRHA 3VBHB 3V0BB 4CEYA 1ND2B 2A6XA 4N9IA 2VUCA 1K5JA 4RN5A 2ET7A 5T5LA 2IVIB 4LR4A 3AFGA 2VUAA 3ZYGA 5FUIA 2MPFA 2B39A 4AOCA 5FPBA 3W9AA 2R32A 3AZXA 4BU2A 1GNHA 1BYHA 1TNFA 2R073 3WW3A 1H4HA 4X8PA 1TG7A 4GH4C 2P3KA 3ZN5A 4QHBA 4KG0A 2TUNA 2B8MA 1UU6A 4Y33A 4P9GA 3ZXDA 4MUVA 1FYUA 1QF3A 3J8F2 5FWJA 4O7XA 3H3UA 1SFPA 2YC4A 5DG1A 5FZ4A 1D0GA 1UYZA 3P3NA 5T52A 3TYJA 1BEV3 1SBFA 1DYOA 1FOD3 2PHTA 1AR82 2MEV3 1AR71 2JX9A 2Z42A 3NNJA 4LA2A 1EY2A 1HRV2 4N9HA 3ZN6A 3ZYIB 2VO5A 2G1MA 4AEKA 2ZACA 5CFCA 5LY2A 4C91A 2CNAA 3NRUA 4XETA 4Y1VA 3O1UA 1AYM3 3PMSA 5FYVA 2CTVA 3BYWA 4AGRA 4FOYA 2WS91 1ZRRA 3KT1A 4TLFA 4K8RB 2A6WA 1F5FA 4XJZA 5IWFA 3X29B 1KQRA 1YQ5A 3MW4A 5EXOA 3BI3A 2ZX1A 1RC6A 3NJYA 1UY1A 5DXDA 3UGFA 4H2AA 4UYBA 1DQ0A 4Y1UA 4RHV3 2QZ3A 2ZAAA 3PIGA 3ZYPA 5BNOB 1OH3A 3AVRA 4QKNA 1CGPA 2I74A 5I0DA 4ZY9A 4DXZA 1OLQA 2OVUA 2DTWA 5FJKA 4QXHA 2CWMA 5JVVA 1POV3 2GALA 3DEMA 3WOGA 5JR7B 1ZZ6A 3WD5A 4PLNA 1ZZ8A 1PVC2 1UCXA 4YYOA 3VZOA 1XRUA 3TN92 4CDXC 1R091 1GQPA 1UYXA 2YU1A 3PTYA 2ZGSA 3AZWA 2GC1A 2PHLA 2ILMA 2OZJA 4HANA 4HKWA 1X8EA 5IJRA 5F32A 4C0HA 2XH6A 3CKHA 3AB0A 3KV4A 1JXNA 3OTFA 4LBQD 1N47A 4Y5TA 1DBNA 2ZGLA 4LOSA 1OD5A 5EYXA 5BY5A 2JICA 1HXS2 4O65A 1H6XA 5F9TA 1O8PA 3WVJA 5FXZA 3IDEA 3AMQA 2R30A 1REEA 1R1A3 1OD3A 4JTOA 1UZYA 1BMV2 3POJA 3T0AA 3O12A 4CU9A 4GMP0 4BM8A 2VVEA 3BN6A 4OQ8A 3VBUC 3POGA 1DU3D 3VBUB 1H2NA 1LOFC 2VQTA 2HKXA 1CQ9A 2GP5A 1POQA 1OSGA 3HOBA 2CWSA 1JMUB 1ND3A 1UU5A 4XJUA 5BV6A 2ZMNA 1QXJA 1STMA 1NYWA 3VBSA 4CP1A 4PBPA 4CUAA 3G7DA 4QD2A 1GZTA 3I4IA 4MHRA 4P02B 2HWB3 4NRPA 5AFEA 1OPOA 2QBXA 1GLHA 2XUEA 1PO22 2XGXA 2ZEYA 4AI9A 3GYDA 1JU3A 4EWAA 2JKBA 1VB2A 2WFF3 2V73A 4YW1A 4CDQB 4DQAA 2RDNA 3VBFA 5DUWA 2GNTA 1JYVA 2Y34A 5APAA 1RUE3 2P3JA 5IAXA 1WZXA 1K5MC 4INDA 3WP5A 2N7GA 4ZS2A 1K5MB 4YVWA 4XJ9A 3EB7A 4GKXA 2WINB 4BQ1A 1ZZ9A 4QB2A 4ATEA 3QOPA 2ZHNA 2XLGA 5IVBA 2ZKNA 3NV3A 3MLJA 2BGCA 1GOGA 1N3OA 2BDRA 4JDOA 2VR4A 1OHFA 5BNPA 2HWD3 2EXKA 2H6BA 4FXGB 4XFAA 4GJYA 4QT6A 1X8MA 2A1XA 1NCQC 2UY9A 2XDVA 2W95A 1GWMA 1H2LA 1RUC2 2W46A 5EQUA 2WSVA 4J1XA 2QNKA 4ZZ8A 4GAZA 1A8DA 2J22A 2WO7A 3VBHA 2ZGKA 4ES8A 4YFZA 3V0BA 1ND2A 2RS53 5EIYB 1H0BA 2QE3A 2W5FA 5LATA 3LWCA 1S0IA 2QQKA 3JQWA 1HN0A 3JCIA 3K46A 3KGZA 3O14A 3WQ0A 1M4WA 1JYNA 3UGGA 3ES4A 5FZ9A 1SFYA 3DYOA 4GH4A 1K3IA 1QQP1 5LBEA 2XHKA 4FI9A 3N36A 5ERLA 4COYA 2G4IA 4LHLA 3K77A 5FPZA 2QDRA 2HEWF 1SDWA 3UNPA 1XSRA 5FZ0A 2K2SA 1MQTB 3MF9A 2O1QA 2D6MA 5DABA 2R16A 3UL2A 4XC9A 1RUI3 3CDZB 5T3NA 1YHFA 5J09A 1JUHA 2B9VA 2X09A 1UU4A 4Q2FA 3TAYA 4WVMA 5IFTA 3MFCA 1R083 4BK5A 1B09A 5JOZA 3ATGA 1H8TC 1H9WA 3JU9A 4ET7A 3PU8A 4YZ3A 4FTBA 3F95A 1TZOA 3V64A 3IWZA 1LCLA 4YM3A 2P1BA 2D3SA 2JE9A 2ZPXA 5I0TA 5LBCA 2QFEA 3VDCA 4A44A 2LRPA 4TZDA 1UD1A 4PQ9A 4A7YA 3AFKA 1X82A 4JKLA 1D7PM 2VMEA 4XFBA 1ULOA 3BOWA 3R6SA 1RUH2 3E1F1 5ISLA 2YGMA 1CZVA 2RM21 1O7FA 1E57A 3HVDA 1UYPA 4MGSA 5GZGA 1W05A 2YC0A 4IEZA 3ZXLA 4J1WA 1PO11 3IPVB 2BBVA 2W1UA 2JJ6A 4RGKA 4CDXA 3DUIA 4U2AA 1GP5A 3MBWA 5I91A 5C33A 2VZOA 2RG4A 2VC9A 3A0KA 3OF1A 2PLV2 3IIIA 2BGPA 1S0GA 4OI0A 1S2EA 1HW5A 1AJKA 3CIHA 3LSEA 3ALQA 3ES1A 4Q1RA 3THDA 5JXGA 2A6ZA 5IVJA 3M7AA 4XURA 4BLJA 2VMIA 3AXDA 2GDFA 5SV8A 5HCBA 3MIGA 4OHXA 3FN9A 2PYTA 3FE5A 3KF3A 2EF6A 3KV9A 5A3UA 3SKVA 3ZMOA 3OGRA 3JD72 2PHRA 2Q8DA 3RYRA 1YIPA 1W28A 3NO8A 4BE3A
chains in the Genus database with same CATH topology
1G9BA 1LOFA 3N3HA 1DYPA 1AR73 5T5JA 1U5XA 1XNKA 3B9CA 3H1MA 2DURA 2I2SA 4ZXKA 4WM7C 1FPN1 4K20A 2WS93 1IKPA 2D98A 3N35A 3OBTA 5IK7A 5C4WC 1WCDJ 2P34A 3KCYA 5C4WB 4COUA 4PF5A 5FOJB 4AI0A 3AYDA 1ONAA 1WLDA 4YSFA 1JOJA 1XNBA 1K5MA 2HWE2 2VW0A 1RHI1 3L9JT 5BNNC 2D43A 3FFQA 4XZPA 1Q8QA 1ENXA 2DCJA 2YDEA 2ZAHA 1RUG2 3B00A 1R093 5A32B 1C4RA 1LB2A 4NR1A 1RVF1 4WVVA 3LOBA 1NCQA 2WT0A 3VHNA 5DUUA 1DHKB 1NCRC 1RUJ1 1XNDA 4A3XA 4XMIA 2OA2A 2EXJA 1NCRB 1ZRCA 3AMMA 1Q8OA 1EAH1 3AZYA 5JPMB 5JMCA 1C57A 4XYXA 3IDBB 4HT1T 2A71A 1U5IA 5T5OA 5JZGC 3HIFA 3O0VA 2OW4A 2Y0IA 3U07A 4DB5A 3CEWA 4P5HA 2P3IA 2OZ6A 3MIHA 4LNVA 3J4UH 4AVCA 1QXRA 2WNUC 3AXEA 1FAYA 1QJU2 2WNUB 1G86A 5JSRA 2Z2SB 4LTAA 1SLAA 5IUQA 1CVNA 1EV12 4HPKB 1WMFA 4KG8A 3THTA 5FO8B 1REFA 5JWPA 1ZRFA 3DPRB 1FXZA 1RMU1 3J8F1 5CU1A 1AR92 1C1LA 3H0OA 3VHPA 1I3HA 2A3WA 5K0UC 2NP0A 3FLRA 4AFAA 5K0UB 4B4RA 1AR81 1GZWB 3SMHA 1VBE3 3WDTA 1HRV1 5K9YA 3LA3A 1G7YA 2RMU2 1AR62 1QMJA 4XFGA 1ZBE1 2R0HA 1H8TA 1VRH2 4GWMA 3KGLA 3LA7A 4YM0A 4QPIC 3RSJA 4QPIB 3I2DA 2XJQA 2XKPA 4KWLA 4XBNA 3CL1A 1O3QA 3ROUA 4KWJA 3HMYA 5CB7A 4PIZA 3FFZA 5AFBA 4RFT0 2DVFA 1MZ6A 1V70A 1AHSA 1LU2A 3OPZA 3IPVA 2VNOA 4N7UA 4PLOA 3VZMA 3TN91 4AWDA 1FATA 2D6NA 3GBGA 3TBDA 1YI7A 4UW5A 1RTVA 3EBRA 1LHVA 3ZFFC 4AI8A 3ZFFB 1IGOA 1MS3A 2LTNA 1DZTA 3E5UA 4OHZA 2PHWA 4R52A 1HXS1 4Q0SA 4YZ4A 4AFMA 5J7MA 2WC2A 1LULA 3VBRC 4B29A 1QQP3 2EALA 5KXEA 4XTPA 1JBCA 1JYIA 1BMV1 4HN1A 3PNAA 1S0BA 3ZX7A 4UBGA 3WG3A 4L92A 5I0UA 1OI6A 3NWKA 5LEJA 1SACA 3SCGA 1SEFA 4QM9A 4ASMB 2ZGOA 1BBT2 1LGNA 1ULDA 1MS5A 2HEVF 2I07B 3ZXFA 4LBKA 3D0JA 1U5YA 1N1TA 3EQEA 1TE1B 4Y1YA 4GULA 2DVGA 4WM7A 5J3UA 1F31A 1ZZCA 2GNDA 1PK6C 2A70A 4AI1A 1PO21 1RB8G 1PK6B 4Z82A 3NV4A 4DRRA 5C4WA 1IPJA 2MHFA 3O0WA 1FX5A 1N1SA 2Q4SA 1YJKA 4ES9A 2C9AA 1AYN2 1LEMA 3D5OA 4JCKA 2RM23 2D40A 2VGDA 5BNNA 1PO13 3IKWA 2FZ1A 5A32A 3HWJA 3I54A 1QJX2 2YV8A 4NN0A 4FQZA 5BUVA 3GZAA 1EYBA 1PZ7A 1NCRA 3ELNA 1J3QA 4FPKA 3OYWA 1SBDA 1ULFA 3NKTA 4QQHA 5ABJC 2QUOA 5FRAA 5ABJB 2PN5A 4XMAA 5JZGA 4R9BA 5LRRA 4COVA 4MGKE 3USUB 3T1LA 2GC2A 1U12A 4QM8A 4UBHA 2WNUA 4LA3A 5DG2A 4KU7A 4M01A 3VZJA 4HPKA 1VBC1 5GLTA 1JUIA 4JVAA 4FOVA 5AC93 4QGNA 1FPN3 2P2KA 1S0EA 3MICA 1AL22 4Q4W2 1W6OB 5K0UA 4YGEA 2DFBA 1GZWA 1QXPA 3GNEA 4C1WA 4N43C 4N43B 1BKZA 4YG6A 3WDYA 2C0ZA 1V6KA 4LUKA 1PIV1 4AEMA 3QLQA 3HAGA 2LM3A 4S2HA 4WZFA 3U4XA 3ZPYA 4N7IA 1RHI3 1FNYA 4FO9A 4QPIA 2FMYA 2EXIA 1TQ5A 5BYNA 1IS5A 5F5QA 1S2KA 4Y5Z0 2XBO1 3VHOA 1XE8A 1MZFA 3M8LA 4WVZA 3B93A 3WDUA 3HT2A 1BVP1 2D6OX 2WLQA 1HQLA 4GWNA 1RUH1 2E9QA 1IPKA 3B02A 1RVF3 4W6XA 3WX5A 4L97A 1D4VB 2H6CA 4FAGA 1MS0A 3LKJA 1RUJ3 3HBZA 2PHUA 5L7OC 3WDVA 2WT1A 4R9AA 2X29A 1QJZA 2ZX3A 3VN4A 4RA0A 1EAH3 5GLUA 1C8M2 2W39A 3ZSEA 4AQ2A 5J37A 2YYOA 4N90A 4DMIA 2PLV1 4YZ1A 4M0NA 3ZFFA 2AENA 4AHYA 4FPOB 4EN9B 4UW4A 2VULA 5IK4A 3VBRA 5KXBA 3MPBA 2E7AA 1O4TA 4FPFA 4I3GA 3VKFC 4D69A 4JAAA 5CIRA 5I93A 3JD71 2RS11 3AP5A 4BA6A 4COWA 4I2OA 1LGBA 1RMU3 2DWRA 3J8F3 3M4FA 4LO6B 4DY5A 1UMZA 4XJWA 3SCHA 4AHWA 4DRVA 5T50A 1AR83 4G4FA 3D0SA 1HRV3 2FHRA 1ASJ2 1LEDA 5BNQA 5A3MA 3GHMA 2TEPA 2XJPA 4P9IA 1O4YA 1ZBE3 3ZXJA 4HSJA 3VL8A 2C5DA 1SLIA 2GMEA 2R49A 1PK6A 1UZZA 5FOBB 1G6NA 3WP4A 4X8NA 4Y24A 3TRSB 4LBMA 4HL0A 4Y22B 4LULA 4CEWC 5CG9A 4HMZA 4CEWB 1N3PA 1D2QA 4FPCA 4E9KA 1NE4A 2JG8C 4KGQA 4HN0A 4RQPC 2JG8B 1VIWB 2OIIA 2PHXA 2HWE1 2IC1A 2ZGPA 3P3PA 4ISRA 4R9DA 1FV3A 3JBG2 1JTZX 1QJY2 2UWCA 2WNEA 5FLJA 2DCTA 4QU2A 4R9CA 3M70A 1YXWA 4G3YC 4YVSC 1RUG1 3TN93 2WFPA 3INAA 1G9CA 1Q43A 4YGDA 4YVSB 3WCSA 1N3QA 4PIYA 3AMNA 4CTEA 1MR5A 4I09A 4AK3A 3WG2A 2ZJCA 2A3YA 4Q4Y2 4A7KA 2NZ9A 3KSCA 3R4UA 4QQ2A 2D3PA 3ZFEC 1ZX5A 1D4M1 4AGGA 3ZFEB 2KA3A 3T2TA 1S0JA 4PIXA 3VKNA 2Q1MA 4JDNA 2HWF2 1CAWB 4GMP1 2F6BA 1RINA 2WSUA 5ABJA 2D93A 3CNAA 1DGLA 2GMMA 1VBA1 4H7LA 4IEWA 1W39A 2JD4A 2ZCWA 3L2HA 1J1TA 4XJAA 2WKKA 1LHOA 2JECA 5IK8A 1QJU1 5LK5A 4MSVA 3NVCA 4Z07A 2BNMA 5FPXA 4GB31 4I02A 1DLLA 1EV11 2IXKA 4OI2A 1CPMA 4EN6B 3ZN4A 2XL9A 5I8SA 2QDNA 4E4SA 2GMPA 4IEOA 4N43A 2WIIB 5BNOC 1WBLA 1JN2P 2B7YA 5KHJA 3KCXA 1VBD2 1Q8SA 2MNGA 3OY8B 3IBMA 1AR61 2WLPA 3W59A 2GC3A 1BCXA 1VRH1 5GZFA 3TB0A 4IEPA 1I9RA 4XF1A 1LOCA 2R042 4F83A 3DGTA 2BYVE 2E7QA 4PLMA 3JUUA 2R1BA 3MW3A 3VDDC 3ZSMA 2E63A 5AVPA 1RUNA 3VDDB 4ASLA 4IV3C 3ZXAC 1I6XA 4IV3B 2VOKA 1COV2 4AW7A 5DUXA 1KDKA 5L7OA 2VPVA 5IT6A 2D3RA 3VGIA 1OQEA 1D2SA 3MI8A 4JGYC 4E2SA 2VW2A 2LUWA 3NV1A 3G6JB 5GKAC 4JGYB 2ZX0A 2XVGA 1WW6A 4V1PA 1Q3EA 2RHPA 3H1YA 4KGGA 1WLCA 1JYCA 2PTMA 2UWBA 4Y1XA 1KRIA 1MS9A 1CAUB 4XQDA 3PVEA 4S2DA 5E88A 4L11A 1G8WA 4CDWC 2W0XA 1VBC3 4YZ5A 4CDWB 3V56A 4FBFA 4BPZA 4BZ4A 1QNWA 2WZR1 2JE7A 4P14A 2ZTNA 1PZ9A 2NMOA 4CDQC 3WW2A 2Z79A 3PVBB 5JI7A 1NXMA 1BBT1 2PAKA 1CIWA 4XIOA 1FOD2 5CADA 1PIV3 4JC1A 2A7AA 1MACA 1YFXA 3K48A 1AX0A 4K21A 1AYM2 1DQ5A 1XYOA 2RR12 4Y22A 4K9SA 2XBO3 3AKSA 2Y38A 1MEC1 2VOVA 3IT8A 4FOWA 4CEWA 1LOAA 1X50A 3GZTB 2BUKA 4S2GA 1DG6A 2JG8A 1S2BA 1RUH3 4RQPA 3WG1A 3RYPA 1AYN1 2LALA 4GKYA 3RMXA 4PCRA 1TME2 4AFCA 2V5YA 2D5FA 4P9XA 5T5PA 4OHVA 4RL7A 3VLBB 4YVSA 2YXSA 3DL3A 4JRLA 1QJX1 3B94A 1ZBA1 4AVAA 2PLV3 5E1RA 4EJRA 1NA1B 2AZ5A 3ZFEA 5FQ0B 4FCAA 3ZDSA 3LGRA 4MZUA 1CAWA 2OUHA 4Q0QA 4C0BA 2Q30A 1MQTC 3BTAA 3I8TA 3JD73 2RS13 3POYA 4NVPA 3QBQA 2ATFA 3ZMNA 2Q5TA 3AMHA 4QGLA 4LT5A 4FP3A 4NHMA 1ZRDA 3DV8A 4R4XA 1GQGA 2UWAA 3U10A 1KS5A 2DF7A 2DVBA 2G9GA 4D7SA 4META 4KWKA 1LESA 5H9RA 5CVRA 2Y26A 1SLBA 1FI2A 4Q4W1 3BOPA 3TNPB 5F1RA 5BNOA 4AVSA 5CFDC 3OY8A 3RYKA 2A3XA 5CFDB 5I8TA 4G9SB 1XYNA 3ASIA 1RUE2 4OI4A 1ULGA 4B7EA 4QQOA 2HWE3 4YW4A 1RGSA 3S7EA 1C8NA 5DDJ2 2AYHA 3ILNA 4B4PA 3DF0A 1N1YA 4TWTA 3WHTA 1OOPB 2DU1A 3SH5A 1QDCA 3S6PA 1RUG3 1IKQA 1AXZA 3VDDA 2D97A 3KQRA 4FPGA 2DV9A 1Y7BA 4FPLA 4IV3A 2ZGNA 2HWD2 4Q1PA 1H1AA 3VHRA 5C6CA 1FNZA 1AXKA 1D4M3 4HK8A 1LJ7A 1Q5OA 5EV7A 5L36A 3B5LB 1T6GC 3UK9A 4GMP3 4JGYA 1C8M1 2VH9A 4WBBA 4BMEA 5HXVA 3RQ0A 1VBA3 4KQ7A 1V6NA 1ZM1A 1C28A 4YARA 5L19A 2XVKA 4LEJA 4W6WA 3QCWA 4IL7A 3UJOA 4DZGA 4Y4YA 1RUD2 1PNGA 4GXLA 3VZNA 3WY6A 3VKMA 3FZ3A 3WDXA 1QJU3 1YYNA 4CDWA 5KXCA 1WW4A 1DQ4A 2UU8A 4GB33 1XQNA 1EV13 1HDKA 5A3LA 4HETA 3ETQA 1FMD2 5D8AC 2BWCA 4CDQA 5D8AB 1UN1A 3EO6A 4JV4A 4QPYA 4QXKA 1Y3TA 5KC5A 1FT9A 1RUI2 1VAVA 4TYSA 3AYCA 1MZEA 2IFRA 2AUYA 1UPSA 1Z0HA 3MF6A 1AR63 1SCSA 1AF9A 1MS4A 1VRH3 4FP2A 3KM5A 4GIQA 1V6MA 4KL1A 4DOUA 1ZYBA 5J09A 5BPXA 1V6JA 1WMDA 5SV5A 1WD3A 4IXLA 4B3NA 1XU1A 3MIFA 4X6QB 3RI9A 1ULCA 3LCPA 1GNZA 1KD7A 2H0BA 2DCYA 3JBG1 4HKOA 1BQPA 1DZQA 4AEDC 3IMNA 2WL1A 1NE6A 4AEDB 4RSUA 3SISA 1X36A 2VOXA 2D6PA 3MPPG 4Y20B 4LLFA 3ZO0B 5JPNB 2WT2A 3O0XA 1GBGA 3WP6A 4K7JA 3TWIA 4ZU7A 4C1XA 2W08A 5FQ0A 2XPJA 4NO4A 4LUMA 4FXKB 5I0SA 3JZVA 1SFNA 3CU7A 1RITA 1RUF2 1Y43B 2HWF1 1O5LA 2AH2A 1BVVA 3DPRC 4JQRA 3D8CA 2UY8A 3MW2A 1MQTA 1QY4A 1VBB2 5HI0A 2WZR3 1IZ3A 3VV1A 1YNAA 3U0ZA 3WXPA 1CPNA 1UPIA 1AX1A 1BBT3 2BVBA 1ULEA 1NLRA 2Z69A 1A8MA 1V9U2 2ZBJA 3AJZA 2VNGA 3WW1A 1L3JA 5T55A 2WS92 1O5UA 4XOGA 2ENRA 5H9QA 1MEC3 4Y26A 2Q8OA 5JOWA 3QH6A 3D82A 5CFDA 4HK9A 2XJUA 3S0MA 2Q0AA 1GQHA 1VBD1 4LBNA 1V6LA 1LHNA 1AYN3 1Q8VA 4XFCA 3H1WA 4OFGA 3SXWA 2VY0A 4XTMA 2BPA2 4B7KA 1CJPA 3SITA 1WCKA 2R041 1PVC1 3WT3A 4Q26A 1X7NA 1LHUA 1W6MB 3O7OA 1NZCA 1RJ7A 3E6CC 1R092 1W6QB 1QJX3 1ZBA3 1I1EA 1SBEA 4BLIA 2XJSA 1WCSA 3WV6A 4Q0VA 3R05A 1COV1 3CJIB 3KZ4C 5JOYA 2IZWA 4IEVA 5I8YA 2DU0A 1G9DA 4QGMA 3UKTA 4EWDA 4MXWB 2XJRA 4RR3C 5KHIA 2ET1A 5KHGA 4RR3B 1UIJA 1ENSA 2ZHLA 3RS6A 3SH3A 1F8VA 4NPRA 1HQNA 3WLUA 4Q8KA 2PA7A 3FMGA 5AVAA 4L9BA 2VMHA 4A2UA 1LU1A 1CR7A 3R4SA 4AFDA 1GZCA 2X53S 4MX3A 2CGOA 4H55A 4MV2A 3BALA 2YROA 1U0AA 5FO7B 4OI1A 1LOBA 3NKGA 1J58A 1KFXL 2R062 3LAGA 3SLIA 2WA3A 1PGL2 5D8AA 4BYYA 1AJOA 3KD4A 1VAKA 4HVQA 4LBLA 3NL1A 1VBE2 5FLHA 2NQYA 4I0BA 4AQ6A 2UYAA 1ZA4A 3PJQA 4WM8B 4A7ZA 2PHFA 5HCAA 2RR11 2CYFA 4K6BA 1MS1A 2E6VA 5JIUA 4Q8LA 5L73A 2ETEA 4EV0A 1MVQA 2X5IC 3AKQA 4MLOA 1APNA 4F8AA 1UKRA 2X5IB 4FPYA 1H4GA 1TME1 4AEDA 1RUC1 1A6CA 1ZZBA 2HWC2 1AVBA 1QH6A 1OFNA 2P17A 2A73B 4Y20A 2HYKA 1C8M3 1AUYA 3C3VA 1PMIA 1VP6A 3OCPA 4WVWA 3MIBA 4YRDA 1NG0A 4L2NA 2VQ0A 3ZYRA 5E16A 2FBEA 4FT8A 2YY1A 2A75A 1HV0A 2GC0A 1GZ9A 1QH7A 5J98B 3ILRA 1WLWA 3VKLA 4ZKTB 4XBLA 3VZLA 3DPRA 2XG3A 3PVOA 3AKRA 4P9JA 3EJKA 2GN7A 2D6LX 5HCFA 2DUQA 4WV8A 1SLCA 3POWA 5GM0A 5GJ6A 1SLLA 4YLZA 2DTYA 4F7ZA 2E53A 5FAXA 2ZA9A 4NHKA 4E4DX 2OUJA 1UF2C 4Q29A 4JRAA 4Q4V2 3A4UA 2ARBA 4RS5B 4COZA 1QNYA 4BH9A 5CFCB 1AX2A 1W0PA 5J96B 2BTVC 3O5SA 2ZS6B 4K3UA 3MZHA 4FVVA 2RJLA 2BWAA 2PELA 3AYAA 1BZWA 3OD4A 4YM1A 5JSPA 2DUPA 4M00A 4BCUA 3WUCA 4YNIA 5H9SA 1NXD1 4N53C 3JBG3 5DDJ1 4N53B 3RI8A 2RJKA 3KMHA 4AHZA 1POV0 4L99A 4MYEA 4FSJA 2ZKLA 5JSOA 1W6QA 5T54A 4URTA 5E8AA 1UIKA 5C8WA 2O8OA 5FDBA 1XE7A 2HWD1 3UKNA 2ZMLA 3UKVA 1O91A 1BK1A 4TSVA 4XDQA 3UJQA 2XLAA 3AMPA 4LE4A 2PAEA 4C90A 3M1HA 4OUSA 2HWF3 2ZGRA 4RR3A 1QU0A 1CAXB 4XF9A 2B46X 3LB9A 5C8CC 5FO9B 4OULA 5C8CB 3H3ZA 1DDLA 2GNBA 1RUD1 3ZXKA 4MGZE 3NV2A 4XF4A 4ITCA 4QPGC 2B45X 3IM0A 1RL3A 4NHLA 4QPGB 2O8QA 1ND3B 1SMVA 1ALYA 2VXRA 3U11A 4FAHA 5K8SA 1H1IA 5GLWA 1FMD1 4FPEA 5BXXA 4CDUC 5AC92 4CDUB 4KBBA 2WWSA 2ZHMA 4ZU4A 4FTEA 2E51A 4E2GA 1RUI1 5IK5A 1Z7S2 1S0DA 3QD6A 3JB8A 4M3CE 2JDZA 3BODA 1VBD3 5KWRA 3E5XA 1C1FA 2RS32 1WD4A 4OVEA 3H7YA 1NY72 1GSLA 2D6KA 1RHI2 2R043 4Q4X2 2ZOEB 3WQ7A 1PVC3 4YVWB 1XXNA 2QJVA 2QCSB 1O3SA 3OJBA 1S0FA 4PBOA 5EZWA 3QACA 1XYPA 4DY3A 2CGPA 5BNPB 2X5IA 1VJ2A 1COV3 1KFUL 1ZZ7A 5LRSA 1HXS3 1RUJ2 5KBFA 4BWOA 1WBFA 1GR3A 2WQZC 5ACA2 1EAH2 3GALA 1WLTA 1IS6A 1TMF2 4KNCA 2K0GA 1WW7A 4Z2WA 3USUA 2Q1ZB 3R4DB 4YFWA 3D6EA 4XFHA 2EAAA 3AP9A 2IXCA 4CP2A 4MXVA 1OPMA 4BMBA 1RUF1 2ZX2A 1HRI2 3SCFA 3RWNA 4EN8B 5KHHA 4OUMA 3ZSKA 3IDCB 3NAPC 5DUVA 1QOSA 4GH4B 3NAPB 2OYZA 1VBB1 1F9KA 3E6DA 4MH0E 1W6OA 2P37A 3ME2A 1XU2A 1PO23 1AR91 1VAMA 3V0AB 1RMU2 4H14A 1YRZA 4RGGA 3AP6A 1H2MA 4CZSA 1TEIA 1VLNA 2RMU1 1GYKA 3R0RA 1YJLA 1V9U1 1S0CA 4RGAA 3TOJA 4WVMB 3BB6A 4XE9A 3ECQA 1ZBE2 1QWRA 2ZZQA 2RR13 1JHNA 4H3WA 1IQAA 2GH8A 1J59A 2BQPA 4K40A 1GFF2 5JAXA 1PNFA 4IQPA 2UURA 3WW4A 4YZ2A 2PHDA 2NYYA 4MVTA 4N53A 2VVFA 4P9YA 1TME3 4XHBA 3RDIA 1RUC3 4ZU5A 2JXAA 4I01A 1J3PA 1HLCA 1H2KA 2XJVA 2ERFA 1SCRA 4K8FA 5CNAA 5EJ3A 4CDXB 4EN7B 3WUDA 2ARXA 2DYCA 2EA7A 4XF3A 1NOVA 1DFQA 1YLLA 2B9UA 1QKQA 1W6NB 4LHKA 5KXDA 1F5JA 2VU9A 2R072 2I45A 3M3CA 4HVOA 2ZGMA 3POSA 2HEYF 1CAXA 5DZEA 4GALA 4QQLA 1LR5A 5C8CA 1IHMA 2DVDA