2O8QA

Crystal structure of a protein with a cupin-like fold and unknown function (bxe_c0505) from burkholderia xenovorans lb400 at 1.55 a resolution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
129
structure length
122
Chain Sequence
GMKLQTTIQHEPKDGSGFDRREFFEYRDTGVNEATGGMFGAHVIRAIPPTWHTHTVGFQLFYVLRGWVEFEYEDIGAVMLEAGGSAFQPPGVRHRELRHSDDLEVLEIVSPAGFATSVVDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of hypothetical protein (YP_555756.1) from Burkholderia xenovorans LB400 at 1.55 A resolution
rcsb
source organism Burkholderia xenovorans
molecule tags Metal binding protein
molecule keywords Hypothetical protein
total genus 23
structure length 122
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2o8qA00
2VPVA 4R8HA 3FHIB 3I7DA 3EQEA 2D93A 5K8SA 4I09A 1YFWA 4ZU5A 2C0ZA 2PYTA 4IEUA 3SHRA 2D5FA 5D1IA 1QXJA 3H1WA 1YLLA 4XF4A 4LTAA 1X8EA 1ZZ9A 1O3TA 3ES1A 2B9UA 2PAEA 5LRSA 3OF1A 2FMYA 1NZCA 4YARA 1G6NA 4TLFA 2GU9A 4YSFA 4AVBA 2IC1A 4MGYE 4XFHA 4Q0PA 4HLTA 4LA3A 5FDBA 4XF9A 1ZVFA 4UXAA 5JSPA 4I0AA 4DINB 2BYVE 5E16A 5I8YA 5AVPA 1J3PA 3HQXA 3MYXA 3SXWA 4F8AA 5BXXA 5T3NA 2DCTA 5KHHA 3EBRA 4JVAA 1CAVB 1CAVA 1J1LA 4IEXA 1O5LA 2XLAA 1YWKA 1XE8A 4LUMA 4KU7A 5J3UA 5KHGA 2GC0A 5KHJA 4AVAA 2N7GA 3VHRA 3H50A 4PIZA 5I8TA 4XETA 1HW5A 4MGKE 2I45A 5BUVA 1O5UA 3MDPA 3TNQA 5FQ0B 5FQ0A 4WZCA 4KU8A 2Y0OA 1YUDA 1H1MA 5JSOA 3R6SA 1V70A 3LA2A 3B02A 4XFCA 3ES4A 4Q0QA 5J48A 3FFQA 4Q0SA 4EWDA 2CAVA 1GQHA 1RC6A 2QJVA 4GULA 3SCHA 1CAUB 1CAUA 2PTMA 2QVSB 3ZDSA 4FAGA 3HT1A 3OCPA 1RGSA 3ELNA 3LZZA 2CAUA 4IETA 3D0SA 3RPQA 2O1QA 3SMHA 1XE7A 2IXLA 3NSTA 3E6DA 2KXLA 4P9GA 4JTNA 1I6XA 5I0SA 1O3QA 2IXIA 1RUOA 4WBBA 3FWEA 2PQQA 2OZJA 3U10A 5C6CA 3NL1A 4OLLA 1EPZA 4O9GA 1NYWA 3E5QA 1NE6A 1LKNA 1Y3TA 4D7SA 5FPXA 4D7TA 3HT2A 5FLJA 3BCWA 1ZRRA 3DV8A 1RUNA 2XKPA 1I5ZA 3S7IA 3M3IA 2QNKA 2Q30A 4XEZA 2GC1A 3RYKA 2GZWA 2F4PA 4QMAA 3QACA 4QGLA 3PVBB 1FXZA 2E9QA 1OD5A 1L3JA 2Q1ZB 1ZZCA 4X6QB 5KBFA 3FZ3A 1X8MA 4IEQA 4BH9A 1DGWA 1ZREA 2UYAA 3FX3A 1CAWB 1CAWA 1U12A 3CL1A 2XL7A 5I91A 1NXMA 2ZCWA 4ZU7A 2Z69A 4Z07A 4LULA 4BHPA 4QX5A 4EROA 1VP6A 3ACLA 1EP0A 4XFFA 2MHFA 1UW8A 3TNPB 4PIYA 2EA7A 2XLGA 4YRDA 1O3SA 3I59B 3I59A 3H1YA 4IERA 4J1XA 1J3RA 1FI2A 1UD1A 4EV0A 1YHFA 2XKOA 2UY8A 3SCFA 5CU1A 4I2OA 4Q0UA 3FE5A 5HI0A 2OYZA 3CF6E 1SQ4A 1ZX5A 4LA2A 3KGZA 2WFPA 1Q3EA 3WW1A 1GQGA 3UKNA 3D0JA 2Q0AA 4IEOA 5CVRA 3LAGA 3S0MA 3DN7A 5JAXA 2IXCA 4HMZA 1RTVA 3RZZA 4XF3A 4OFGA 3E5XA 1LB2A 4L11A 3UKVA 5F1RA 1ZZ6A 1VR3A 5I0RA 5KHIA 3MZHA 5I8SA 3IDBB 3DL3A 2BNMA 3H1MA 5EZWA 2IXJA 4XF1A 3RYPA 3OD0A 4IESA 3WW3A 3FJSA 4HBNA 4XFAA 1RL3A 4XFBA 1J59A 1CGPA 1WA4A 5JSRA 4FT8A 5C8WA 3WW2A 1YFUA 2XL9A 4UBGA 5EFUA 4I0BA 2H0VA 1UIJA 1JUHA 4IEYA 1PMIA 4HN1A 2VQAA 2HJIA 2BNNA 2H6BA 4QXKA 4LEJA 1QXRA 3GYDA 4QGNA 3ST7A 4Q29A 3UKTA 2K0GA 2OPKA 4J1WA 1O3RA 4YYOA 3ETQA 2O8QA 4RD7A 2FQPA 3BPZA 3H8UA 1IPKA 3IDCB 3LOIA 1DZRA 2D5HA 3CLPA 1ZNPA 3M70A 4NVPA 4YNIA 2QCSB 4Z82A 1DGRA 3EJKA 3NKTA 4HZFA 4MGIE 3H3UA 4MZUA 4EWEA 1OMIA 3H7YA 3LA3A 4MH0E 2ETEA 4LLOA 1J58A 4HVOA 1XRUA 4L2NA 3PNAA 3SCGA 1QY4A 4XFIA 3I54A 3NVCA 4FAHA 3D82A 3E6BA 3CEWA 4QM8A 2OZ6A 3DKWA 4WVZA 4HVQA 5JCTA 5CADA 4KWKA 3KSCA 3RYRA 5E1RA 1LR5A 1DZTA 3QOPA 2BEOA 3KCCA 4AVCA 2EAAA 4MGZE 2PAKA 1X7NA 4ORFA 5BPXA 3N4MA 2XLFA 3H7JA 3CJXA 3BB6A 2PAMA 1SFNA 4EWAA 3S7EA 4R52A 1ZZ8A 1ZRDA 1ZZ7A 2BNOA 3BU7A 3RDIA 1ZZBA 4CYDA 1Q5OA 5LRRA 3LWCA 4I02A 1Q43A 2GH2A 4E2GA 2GAUA 1CX4A 4E2SA 4HN0A 5FLHA 4IEVA 4QM9A 4PJYA 1PM7A 2ET1A 3BALA 2BGCA 4QGMA 3IBMA 2CGPA 4AQ2A 1Y9QA 2XHKA 3U11A 4H7LA 5FCCA 2D40A 4A2UA 1TQ5A 2PHLA 3HIFA 1EY2A 4MV2A 4AXOA 3C3VA 2Q4SA 4LUKA 2VECA 1J3QA 4ONUA 1UPIA 4Q0VA 1EYBA 4F7ZA 4O9EA 2UY9A 4MX3A 2ET7A 5BV6A 4META 1IPJA 3O14A 5LEJA 5LEKA 3USSA 2QDRA 1FT9A 3H9AA 1CAXA 1CAXB 2GC3A 5BY5A 3EHKA 4XFGA 2Z2SB 2K9ZA 3PLQA 3OGJA 4KL1A 3IWZA 5I0TA 1QWRA 2B8MA 1X82A 1OI6A 2MNGA 2PFWA 4B29A 2EVXA 1LRHA 2IXKA 4N9HA 3OTFA 4BYYA 3H3ZA 2PHDA 3EO6A 4I3PA 4HVRA 5KHKA 2IXHA 2ATFA 4IEPA 2ZKLA 1O4TA 4PIXA 1OFNA 2MPFA 4HSLA 3JZVA 4KWLA 2HKXA 1O7FA 3G7DA 1VJ2A 1UCXA 4BIFA 5FLIA 4E2QA 4UBHA 1YFYA 1ZRFA 4KWJA 1YFXA 4IEZA 3IIAA 2PA7A 1NE4A 5JR7B 3L2HA 3LA7A 4IEWA 3NJZA 3NW4A 3WW4A 2UYBA 3GBFA 3KGLA 3KMHA 4X6RB 5I93A 2XGXA 4JV4A 4I01A 3E5UA 3CO2A 4AQ6A 2H6CA 2CV6A 3U0ZA 5FPZA 3E6CC 4N9IA 2P17A 4JTOA 3MPBA 1SEFA 2V09A 3RNSA 2GC2A 4K8FA 3ROUA 2OA2A 1H1IA 1WLTA 5J7MA 1WGPA 4FBFA 3E97A 4HSJA 4XF0A 5I0UA 4MUVA 1UIKA 4ZU4A 2WC2A 1ZRCA 2B5HA
chains in the Genus database with same CATH superfamily
2YC0A 1MVQA 2BWCA 5FZAA 2OQ7A 2PLV2 3FHIB 3ZXFA 5JI7A 3TN93 3C8XA 1S0DA 3I2JA 4O7XA 2D93A 4V1PA 2DV9A 5F37A 1UAIA 1OA4A 2VU9A 2W9XA 2WZR3 4N7UA 2HWC2 5CFDC 1K12A 4QQHA 5DPNA 4E4SA 1QF3A 4X8NA 4W4ZA 2D5FA 3ZSKA 5AC91 1W3XA 1QXJA 2A6YA 2R1BA 4LLFA 4CDQC 1VMJA 1DU3D 1UOGA 3GHMA 4XF4A 2RS53 1OOPC 1QJX1 4BQ1A 1AYM1 3JCIA 3OEAA 1QJX3 1WCKA 1OKQA 3ACGA 3KQ4B 4TTGA 2WA3A 5CISA 1ZZ9A 2P6HA 3WP3A 3WNKA 3ES1A 1LOCA 4BLJA 2B9UA 3T4HB 5EWSA 2JD4A 4PLNA 2Q8EA 1APNA 3OF1A 1LHVA 1S4CA 1VB4A 1V6IA 1NZCA 2O8OA 5GLUA 1BEV3 1C1LA 1B09A 1D2SA 1A6CA 1QJY1 4GWIA 1AL22 2CDPA 2EF6A 4WM7A 3BI3A 2VZOA 2Y6HA 4Q27A 5HCFA 2JDMA 1BK1A 2KR2A 1LECA 2YBSA 4LA3A 2PELA 3B9IA 4RSUA 5EHDA 3CQOA 4RQPA 4UXAA 3LDKA 3VBFA 1JYVA 3Q8AA 2DCKA 1H4GA 1IG0A 1KFXL 2I2SA 4HK9A 1SBFA 4E8DA 1J3PA 1WW5A 5JMOA 3MIFA 3NNMA 4N43C 3ZXEA 3VD4A 2GNMA 1POQA 2YU1A 5FZOB 1R093 4Q8KA 1OLMA 2VNRA 2ZX2A 2VMEA 1TMF3 1JTZX 4AL9A 5A80A 1S0FA 5L7OB 4JDOA 4ISRA 1K5JA 1DCSA 1PGW2 1YWKA 1XE8A 4CCKA 3IMMA 4DIQA 2VZ1A 1SZBA 1HRV1 3N7LA 3FFZA 1H8TA 4RA0A 1JZ8A 2N7GA 1HIXA 1COV3 4QXCA 4XILA 4BE3A 1V9U2 4MGKE 1UQXA 2QFEA 2LM3A 5FUPA 3A0KA 1WD3A 2W46A 1VRBA 4QDRA 5FMBA 4IV3C 2VULA 5FZIA 4CVUA 4WZCA 4QPIA 2Y0OA 2VZPA 2VY0A 3POSA 1SBEA 1DQ4A 1FV3A 1H1MA 1W99A 1YUDA 4FI9A 1V70A 1S0IA 3R6SA 3MO4A 4UFJA 4CDXC 1W0OA 1I9RA 3WP5A 3ES4A 1GR3A 1W2AX 2PHFA 5LBEA 1HJFA 2JECA 2CAVA 3LEIA 4IDZA 1GQHA 4K1ZA 2DUQA 1Y43B 2XR4A 1AYM3 2ZHMA 4GULA 5L9BA 1FNYA 1CAUA 2E32A 2HWD2 3ZDSA 4LR4A 4XJ9A 2ZOEB 5FZ0A 3OCPA 3IDAA 5IAVA 1RGSA 2IUWA 3LZZA 3EXUA 5IAXA 1HRI3 3UGGA 1OT5A 4NUBA 4PI0A 4LHLA 1GFF2 2DFBA 2ZKNA 3AL5A 1XE7A 3MUZ1 1QJY3 2ZTNA 5ANNA 3UT0A 3E6DA 2KXLA 2OVUA 4MOAA 4UFLA 1JOPA 5I0SA 4A3ZA 4LKEA 1FNZA 1WMEA 2P3KA 2WS92 3WDYA 1W2NA 4MHRA 3PJQA 3DXTA 3POBA 3AYEA 4QHOA 1AR62 2A1XA 5C6CA 2ZZJA 3NL1A 1VRH2 4COZA 4IV3B 1GQPA 3VL9A 4GWJA 1RUH3 2A6ZA 4D7SA 5K0UC 4YG3A 3TEXA 3UYJA 3T0AA 5FLJA 2P34A 1US2A 4Y22A 5A3UA 1SMVA 2XKPA 2B4KA 5CKNA 3S7IA 1W8FA 3RRDA 1RUE2 3BODA 2YUEA 5GKAC 1QQP2 3HQUA 5L36A 1X9PA 3ASIA 2ZJCA 3QACA 4QGLA 2AEZA 3PVBB 3JD71 1FXZA 1MZFA 3WF2A 3RGBA 4XBNA 2E31A 1L3JA 3AKSA 1ZZCA 4X6QB 2O14A 1D0HA 1DF0A 1H9WA 2YC2A 1C4RA 3QBQA 4RR3A 2D6OX 4CU9A 4B1LA 1CJDA 1W6PB 5FYZA 3WG4A 4I30A 5DN2A 2W2IA 3FX3A 4NWWA 1U12A 2B39A 2R30A 5BNOA 2Z4FA 4JQTA 4Z92B 1PGW1 1UKGA 3DXUA 1PIV2 1PM4A 1HB4A 1GZWB 2YHJA 5I91A 1BJQA 1OFSA 1CZTA 4P5HA 4Y1VA 1CPMA 4BHPA 4MXWB 4QX5A 4ATEA 3OYWA 1VP6A 4YGBA 4UAPA 3D4KA 2OUJA 1EV13 3LFMA 1GZTA 1YIFA 2XBO3 3ZMNA 5IJRA 4AGRA 2A71A 3O1VA 1RUJ2 2J1VA 4YRDA 2E53A 4AI8A 3I59A 2OXBA 4IERA 1MS8A 3MV01 1MS1A 3HMYA 3LKJA 4RL7A 5G04L 3RSJA 2XKOA 3WNMA 1AR93 1YQ6A 4XJUA 3U07A 3WF1A 1AR83 5CU1A 1XNKA 4AGVA 4HKOA 4X8PA 4BQXA 3U1XA 2EIEA 1ZBA3 1SQ4A 1JZ7A 1IQAA 2R041 2VR4A 2WFPA 3J9SA 4GALA 5DAXA 4CDUA 2QQVA 3B69A 1XU2A 3WW1A 1GQGA 4E8CA 4P5YA 3JB4C 4KI5M 5C3PA 1QH7A 2RS11 3AFKA 4XMAA 3HAGA 5CVRA 3LAGA 2VZVA 3RZHA 3S0MA 5CIRA 3GALA 2A6XA 5JVVA 1NCQC 5AC93 1GMMA 3W9AA 1OVPA 3QH7A 3WINE 2Q8OA 2G9FA 3AVRA 3V0AB 2CDOA 1HXS3 3M3OA 4LHKA 3I2DA 4L11A 2JG9B 5DDJ3 5K9YA 5I8SA 2WSVA 3IDBB 1H6XA 4LHSA 4QU2A 5FKBA 3H1MA 3M4FA 3KLSA 4XJWA 2XVLA 4EN7B 1F4HA 5A6YA 4AI0A 3RYPA 2GP5A 4AHWA 1JYTA 4HBNA 3MIGA 4AFBA 4CDXA 2PHRA 4JGZB 2VZQA 2ZHNA 2PLV3 1VBA1 3KS7A 4XAAA 4XJ8A 5FP8A 3WNXA 1W0NA 5DAQA 4C1WA 2XPJA 4R9DA 2JDKA 5EFUA 3GCWA 2WABA 1SDDB 1FX5A 1UIJA 1JUHA 4S2FA 1AVBA 2OIIA 2VQAA 2ZBJA 4KGQA 1G9AA 2W52A 4IGPA 3K48A 5C9AB 5CFCC 4AEKA 3J7NA 5A3NA 2ZS6B 3GYDA 4Q4V2 4QGNA 3ST7A 1A8DA 2YZ4A 2GALA 2QE3A 1S0BA 2DWRA 3I2IA 4B4PA 2WINB 4J1WA 5I0DA 5C5UA 3ZLIA 2WZ8A 1RUJ1 4HONA 1LHWA 4KG0A 5JMCA 4A7ZA 2W5FA 4FP2A 3AJZA 3ETQA 1VIWB 4NPMA 2O8QA 4RD7A 2XJPA 1VLNA 3FLRA 4KGGA 1H6YA 4ASKA 2WUHA 4MVTA 2JENA 2D98A 1VALA 4CCEA 2YXSA 2J1AA 2WSUA 1NT0A 4FPLA 1UXXX 3WHTA 2XJRA 1LCLA 1UMHA 1ZBA2 3ACFA 1P8JA 1BXHA 1S2EA 2R061 4D3WA 5BYNA 3JQWA 4N43A 3RZKA 1WZXA 1F2NA 3GZAA 4ES8A 1R091 2R073 5H9QA 3H7YA 4PQQA 5ACA1 2EXKA 1J58A 2QQJA 4XACA 5FZ1A 3ZSJA 3PNAA 4W6XA 2VZTA 2D97A 3U14A 4N53C 1HXS2 2KA3A 3O5SA 3ZXKA 1RXFA 4AHYA 1U5IA 1DG6A 4NWVA 5CB7A 3C7OA 3MPPG 2Q8DA 1G9FA 5C9AC 5CFCB 4YW3A 4QQPA 1S0EA 4IUGA 2V4AA 3AP9A 2WT2A 3WNNA 2PXJA 3SEEA 1CD3G 1DHKB 1FV2A 1PO22 2CL2A 5CA6A 1FMD3 4WVZA 1UMIA 4XUPA 4HVQA 2PN5A 3ZFEB 5CADA 3T0DA 2YV8A 3KSCA 3HNMA 5E1RA 1WW7A 3RYRA 4HPKB 3WY6A 4QB6A 3VZKA 3QD6A 2BEOA 2LROA 5F5CA 3ZXAC 2YC4A 2EALA 4XUQA 4YM2A 2VCAA 4FPKA 3QCWA 4MGZE 2PAKA 2P3JA 2EXHA 2A6WA 1MQTC 3UV9A 1WBFA 1UPSA 5C3QA 1C8NA 2XLFA 5CAZA 3BB6A 2OW4A 4DQAA 1JYCA 3S7EA 4AI2A 4R52A 3FMGA 4PDWB 1ZRDA 2G4IA 3VGIA 4E4HA 5KXEA 1ZZ7A 4XTPA 1AYM2 2VTXJ 4QKNA 3OBZA 4H14A 3LWCA 4P9WA 4DXRA 3J8F2 3DECA 5FO9B 1L7QA 2E51A 3BGAA 2RDSA 3VDCA 2RJKA 2UURA 2GAUA 4MYEA 3HD8B 3VBHA 4DB5A 1EAH2 5FLHA 2HLEA 2EICA 4IEVA 1VBB3 2IFWA 4CU6A 1WLCA 2XONA 4YFZA 4CUAA 3NJYA 2F4LA 3GBWA 5FZ9A 4OMCA 1PGL1 2CGPA 1W2OA 1ND3B 5C4WB 5FZ8A 2XHKA 2NPIA 4Y4YA 2SLIA 5KC5A 4ZHNA 1UYPA 2WO3A 4MV2A 4LBQD 2YMZA 4GB33 4YZ4A 3OEBA 3UGFA 1MQTB 3RWKX 4LUKA 2VECA 1J3QA 3LDBA 4LBQB 3GGLA 4F7ZA 1JYXA 3ZFGA 4G4FA 3AMPA 1VAVA 3CHXA 2UY9A 4C91A 1R1A1 2RMU3 1ND3C 5C4WC 1OF4A 1R1A3 3ORJA 1M06G 1QGLA 1SDWA 2ET7A 2HBUA 2BGOA 3CZJA 4D8MA 4LBNA 4MLOA 4BMEA 4WM8A 5LEJA 5FMOL 5A7WB 1AR63 1MZEA 2X8KA 4N8MA 4YGCA 2Y26A 5GLZA 5FY9A 4IGQA 2FCUA 1W2UA 3CJIB 5DABA 1DFQA 3H42B 4MADA 2QDRA 2PQSA 3BUCA 3ZSMA 3ZX7A 2D6KA 1LOFC 3H9AA 2GC3A 5BY5A 4WZFA 3B7MA 3EHKA 3QH6A 3UJOA 3AKQA 4MO3M 1YIPA 3C7EA 4QX3A 4LHNA 1KEXA 1QNYA 1QQP3 2XB6C 2FDJA 2JDYA 3VB9A 2XHNA 1UY0A 4K21A 5FREA 5L73A 2BERA 1OQEA 4B29A 2E7QA 1VAMA 1W8TA 4N9HA 1IOAA 3JBG3 2D6PA 3MFAA 4K9SA 4RS5C 3H3ZA 2RS31 4BYYA 3JD73 4C90A 2ATFA 4P00B 3PU8A 4IEPA 1XYOA 1LNSA 1O4TA 2W1SA 4FOWA 1REDA 1K42A 1BQPA 1HN0A 3OD4A 4FOQA 3TN92 4CUGA 3RZMA 1HV0A 2MPFA 2P5BA 4HSLA 2FZ2A 3JZVA 3WF4A 5A1FA 1KS5A 2HWF1 5A7QA 4AF9A 2O0OA 2V73A 1Q8PA 4LE4A 5GZCA 1RMU1 4IV1A 1JU3A 4CCJA 3AKTA 4RS5B 1EV12 2RVAA 2WBKA 2J42A 5FYSA 2UU8A 4JX0A 2XBO2 2NLRA 3THTA 4K1YA 4A3XA 4IEZA 1O8SA 4TZDA 4RHV2 5FZDA 1S2BA 1NE4A 2PA7A 2R0HA 2VNOA 3ZFGC 3LA7A 4DUWA 4IEWA 2FD8A 3ZSLA 1VBE3 1XNTA 3NJZA 4B3NA 3WW4A 2XQXA 2UYBA 2VVDA 4H7MA 4YM3A 3OG2A 4LO6B 3RZLA 3VZJA 2JDPA 5IVCA 1YO8A 4JV4A 2ZMLA 3HNBM 4I01A 3DEMA 2H6CA 2CV6A 2ZHKA 4Q1RA 5FPZA 3E6CC 3EYPA 4N9IA 2FDKA 4JTOA 3VD9A 1UNBA 2V09A 3MLKA 4FQZA 4WVMB 2Z5WA 2WFF3 3HVDA 5CYYA 3ROUA 1WLTA 4QD2A 5ABJA 4JGYB 1PO21 3VBSB 5DG1A 3IB3A 3LEGA 2OS2A 2YBPA 3NNJA 4FBFA 5JXHA 4P02B 5HXMA 3OY8A 5DXDA 3E97A 4XF0A 2DVDA 5I0UA 4LMFA 4MUVA 5DUWA 4CDQA 2BRTA 5GZGA 1TE1B 2WT0A 3I8TA 1ULCA 4Q4X3 4IW3A 5DUVA 5FYMA 3NWKA 1OURA 2JDHA 2XOMA 1SG3A 1RUI2 4BB3A 4CA9A 4JZRA 1MZ5A 4SLIA 4EN8B 3EQEA 5GLWA 5ABJC 4NHMA 2RR12 5K8SA 2V5DA 2HWF3 4ZU5A 2C0ZA 2PYTA 4HXCA 4IEUA 4BIOA 3M3CA 5FBZA 5T5OA 1OH4A 1HKDA 2WAAA 5DMYA 3LQCA 4LTAA 1AXKA 2HWD3 2IWGB 1O3TA 3ZYFA 3PURA 4A7YA 2Y33A 4TLFA 3M2MA 3H8RA 2GU9A 5LA0A 2XXZA 2BPA2 1AR73 4AVBA 3ON7A 3GDBA 3CNAA 2IC1A 4XFHA 4K40A 1FMD2 1GP6A 1YRZA 4FPCA 1Q8QA 2WS93 4LKSA 1ZVFA 2Q5TA 2JD9A 3VBFB 1GSLA 2ORXA 2BYVE 2P2KA 4JKKA 4N90A 3AP5A 5E16A 4DXTA 5I8YA 4W50A 5AVPA 4UW3A 5LA1A 4PLMA 3VLBB 4K20A 3SKVA 3CZUA 5HCHA 4YZ3A 4F8AA 3ZN5A 4LBJA 2WR9A 2ZACA 2W92A 3VHPA 2JXAA 4QXBA 1SBDA 2P3YA 1ZRIA 2PHTA 3H3LA 4IE0A 3AFGA 4RFRB 1W8WA 1O5LA 2W1QA 1HB1A 3H8OA 1BBT2 1YC61 3BVCA 2K2SA 5KHGA 5J3UA 3MI8A 2GC0A 4JCKA 4UFHA 4XBLA 5FIXA 3WCSA 1W90A 1H8TB 1GLHA 4AVAA 5CG8A 3SH3A 2VG9A 3W21A 1QEXA 4OI4A 2E6VA 4LO8A 2I45A 4FQ4A 4UF0B 2VXJA 1Z0HA 3HN1A 3KVAA 3U78A 2QQKA 1YXWA 5A6ZA 5BUVA 4CPBD 4PBOA 3DF0A 3AK0A 4QAWA 3VZNA 2YDEA 3MGUA 5A6QA 1RUG2 4YZ1A 1XPWA 3GXUA 2B9VA 1UYZA 2RR13 5ANQA 1OVSA 3PU3A 4FVVA 3LIHA 4QU1A 3RG0A 3AP6A 5JZGB 1DGRN 2D44A 2YFZA 2C1FA 4S2DA 4QT6A 4XABA 3NV3A 4XMIA 3MV11 1BK0A 1BMV2 2GNBA 2QJVA 1JZ2A 2BV4A 2PTMA 1WWYA 3W20A 2BJSA 4EQVA 3M7AA 4FAGA 1HRI1 1YI7A 3ELNA 2CAUA 1KRIA 1UKRA 2DU0A 1QJEA 4IETA 4WV8A 1QOOA 3WNPA 3AZVA 3NV2A 5SV8A 2WNUB 3KQRA 4KG8A 1MS5A 3NSTA 1IGOA 2XMLA 4JRLA 1C1FA 4P9GA 5T52A 4D94A 1WCSA 5BNOC 1GYKA 2XWBB 3FWEA 4OZOA 2VH9A 5KR7A 1W6NB 2VTFA 4FXKB 5FP4A 1EPZA 2VUDA 3MLJA 4KMQA 4YGDA 3N36A 1EUUA 2BQPA 1JOJA 1LKNA 3IDEA 3O12A 5IVFA 1AX0A 5FPXA 1ULGA 1OF3A 2HYXA 1QH6A 4UW6A 2VAUA 3HT2A 2WQ8A 5JWPA 1GWMA 4Y22B 5JDBA 1KJRA 3BCWA 2BTVC 3DV8A 1A78A 3MUY1 4R9CA 4XYXA 5A6XA 4MGTA 1ALYA 5DDJ2 5JZGC 2W1WA 2QNKA 1BBT3 2Q30A 3DYOA 2PHXA 2GC1A 1T2XA 2NZ9A 3N3HA 2GZWA 5FYBA 2F4PA 3PVEA 4QMAA 1PVC1 4NHYA 1B35C 3ZN4A 1OD5A 1W9FA 2D3SA 3K77A 4RGAA 2ILMA 1V9U1 2GP3A 2JE8A 3OUIA 4IGOA 5KBFA 3FZ3A 1X8MA 4IEQA 4RR3B 1FPN2 1DGWA 3PIJA 4BH9A 1W6PA 1GNZA 2VUAA 2BGPA 4XPVA 1HRV2 3IN9A 3ITQA 4DZGA 2FDGA 3AZZA 2OKXA 5BNOB 3SH4A 1MEC1 2XL7A 1ND2A 4CRQA 5FPLA 1GZWA 1FOD2 4UW5A 3SLIA 4Z07A 4LULA 3WR0A 4MXWA 5FO8B 4I0WB 5JOZA 3ACLA 5JIAA 2E63A 1QOSA 1SLIA 2WQZC 4NHLA 4XFFA 2JIGA 3X29B 4YZ5A 3VBOB 4LBOA 1NX9A 2HWB3 4YFWA 4P9YA 1NCRB 1Z7S3 1DIWA 4ZY9A 5B4XA 4JDNA 4AHZA 2XLGA 5GLVA 1V6OA 1UZZA 3H1YA 2QZ3A 5D2AA 4BK5A 1J3RA 1FI2A 1WA6X 1UD1A 2B45X 4LJHA 1N1YA 5LBFA 2UY8A 3SCFA 4I2OA 3LFIA 5G05L 2X05A 4DUXA 3FE5A 5IT6A 2HEVF 1C8M3 2UWBA 2ZMNA 4YM0A 2NMOA 5FBJA 3ZFFC 1JI6A 2DVFA 1K5MA 1DQ1A 1IZ3A 4NAOA 2V4VA 3V64A 4CCMA 3BKZA 2QQMA 2HEWF 1NOVA 5J36A 1QOTA 3IZOA 1Q8SA 1F5JA 1PO13 1SLBA 3R05A 3UKNA 4D7YA 1BZWA 3IPVA 1TZOA 2W95A 5F39A 4LBKA 5JAXA 1IG3A 2IXCA 4HMZA 2VNVA 3DCQA 3RZZA 4XF3A 3TBDA 4MGSA 3E5XA 3VBUC 4Z1VA 1XJAA 5EP9A 4RHV3 2LW8A 4XUOA 5KHIA 4EN9B 1WLDA 3LCPA 2JE9A 5H9PA 1CIWA 2D6LX 5FXXA 3DL3A 1BCXA 3KHCA 2BNMA 3T30A 3U4SA 5FRAA 3K4ZA 3WNLA 5JPNB 2IXJA 2JICA 2XVKA 4IESA 3WW3A 3FJSA 4YZ2A 1NG0A 1W04A 2JB4A 1CGPA 1H2LA 1RUI3 4JGZA 4XHXA 3OUJA 2GMEA 4FPFA 3SNMA 5A3PA 5AFEA 2DCZA 3OJBA 3WW2A 4C0BA 3B93A 2ZX1A 1YFUA 2VMFA 3ZFFB 4A7KA 1VPHA 3UGHA 1BVVA 1RMU3 3B94A 2VMCA 3O1RA 4IEYA 4Q1PA 3WDWA 5IYYA 4HN1A 1IKQA 2TUNA 4AYUA 2AYHA 2HJIA 5DUUA 3KCXA 3THCA 5C9AA 3PUHA 3N7MA 3WXPA 4AZZA 1ENSA 1ZA4A 3KZ4C 5H9RA 3USUA 2K0GA 2A3WA 3ATGA 5FR3A 3HBZA 5F7UA 2VE1A 4YYOA 4CSWA 1FATA 3WZ1A 3OBTA 2VQTA 1W6OA 3NNFA 3A0NA 4G3YC 4FFFA 2FQPA 4H2AA 4OUEA 3BPZA 3IDCB 1HQNA 2R072 2R49A 5J98B 1DQ6A 2GH8A 1AR72 1F9KA 1OLME 1XC6A 3M70A 5LATA 5ACA2 5JXJA 1CPNA 4UYBA 4OQ8A 2BVBA 4V2WA 1PK6B 1XBFA 3WQ1A 2JB8A 4N43B 1DGRA 3EJKA 4HZFA 3FUOA 1X33A 3A21A 4K7JA 3IMNA 4PT6A 3H3UA 4A6OA 4MZUA 4KQ7A 2CGOA 3AB0A 1JW6A 3K4AA 2VCBA 3RJRA 3B9CA 3LDRA 4MH0E 3WCRA 2BZDA 2XJSA 4GB32 1XRUA 2V72A 5L7OC 2DURA 4J6GA 1O4ZA 1AXYA 1V6NA 3GF6A 2AACA 3POFA 5DAVA 4ASMB 4IQPA 2WAOA 3NVCA 4FAHA 3GCXA 5CFCA 1VBC3 2ZZQA 3POEA 3WDUA 2ERFA 3KHBA 1DYKA 3CEWA 5LA9A 5FY7A 5H9SA 2VXRA 2VM9A 3PUIA 3T2TA 4D6SA 3MF9A 2JG8B 2EXIA 1S55A 5FMDA 1BEV1 1LODA 2AENA 1E5RA 5FPVA 4WM7C 4URTA 5E89A 5JCTA 3RZGA 3ZFEA 1AR61 3CU7A 4RYDA 1LGBA 4SBVA 1NKGA 5FY8A 4NR1A 2LUWA 3QOPA 5EYXA 4AEJA 4BM8A 5M0TA 3KCCA 4AVCA 2WNOA 4OVEA 5FZCA 2G19A 4WVWA 4ZS3A 3RMYA 2ZGNA 4AHXA 1X7NA 2HWE2 4ORFA 5BPXA 3SEPA 3CJXA 5FZEA 3ZDVA 3HPNA 1AJOA 1SFNA 4EWAA 2Y38A 2HWD1 3ZPOA 1D4M3 3AKPA 1V6JA 1ZZ8A 4XAEA 4Y1XA 1PNGA 1G8WA 5FMCA 4NIAA 3ZYHA 2NM1A 4CYDA 5LCWL 4ET7A 5KXBA 2JIJA 3W5NA 3T2OA 3M3EA 4Z2AA 1BBT1 3K2OA 3TEYA 4P9LA 1ZYBA 1Q43A 2QUOA 2R16A 2XJQA 4C8DA 4CP1A 1NLRA 1PNFA 2WJSA 3HWJA 2VO5A 3WF0A 4HG6B 1QXPA 1RUG3 4R9AA 5C70A 1W6QA 1E57A 2ET1A 2GN3A 2WNVA 3JUUA 4FO9A 3LB9A 1KDMA 2ZGOA 4QGMA 4FTSA 1SFPA 3OUHA 2R063 1ND3A 5C4WA 1DLCA 3AC0A 4FFGA 1GP4A 3U11A 4BISA 4FTEA 5FCCA 3MHZA 4M3CA 4CDWC 4QPGC 4A2UA 4HANA 5FK7A 3ZOIA 2DF7A 2XQRA 2C26A 1EY2A 1R1A2 3ETPA 1U5ZA 3OBRA 3Q8EA 3THPA 1S0CA 1K3IA 2R32A 3C3VA 5KXCA 2JKBA 1MQTA 2Q4SA 2H0BA 4DY5A 3ALQA 3MW4A 3VBRB 2DUOA 5FPBA 2Y34A 1BYHA 1PHMA 3ZFGB 1D7PM 2MEV2 4HOOA 3MIHA 1Z7S1 1COV1 5K7PA 5FZFA 4BWOA 5LWBA 3KVBA 5BNNB 2JDNA 1ENXA 4UT5A 2L9LA 3VD7A 4WM8B 4BA6A 4AGGA 3I2GA 4AFCA 5LEKA 1LENA 3WUDA 4AK3A 2OPWA 5IVEA 1HB2A 4B7KA 1SPPA 2YYOA 4H55A 1CONA 2RR11 3CJIA 1WCQA 3RMXA 1H30A 3VBFC 2PHUA 1UU6A 2AGSA 3LSEA 2FBEA 1QJU3 1NA1C 4Q4Y1 2RS13 1PZ9A 2BOIA 1WW6A 1AX2A 5EQUA 2VVFA 4NRMA 4OCTA 5IK4A 4CDWB 4YVSB 2W39A 5A3OA 3D8CA 3AZYA 1LHOA 1A3KA 2B8MA 4GQ7A 4PF1A 4WM8C 5FZHA 3WV6A 5IW0A 5CEHA 1OI6A 1U5YA 1W9YA 3WOGA 1SCRA 2PFWA 1NCQA 4FOVA 3I3MA 1LRHA 2IXKA 4A41A 1LHNA 4NRPA 3AYAA 3OTFA 2C5DA 4LBMA 3VD3A 4TWTA 1PVC3 1RVF2 4NMIA 2PHDA 3SQOA 2VQUA 2FDIA 1XYNA 2R0FA 4CCCA 2IXHA 5A3TA 1UYXA 3TB0A 1FPN3 3O1MA 4GD4A 2RHPA 2ZKLA 2ADEA 2OX0A 2QQLA 4L97A 3AMMA 1Y9MA 4OZXA 2IVIB 2Y6GA 1DGWX 3FUQA 4TSVA 1YJKA 2W3JA 1UXZA 3IM0A 4EN0A 5L19A 4BQ5A 2WZR1 3ACHA 1O7FA 1QDOA 3FBYA 4JC1A 5A3WA 4QPYA 1UCXA 2DCYA 4IV1B 3NV4A 1V0AA 5IVVA 2BBAA 2CY6A 5FLIA 5LASA 4AWDA 4JHZA 3KWVA 2QQPA 1D0GA 2VMDA 1KDKA 3B00A 5IATA 1NA1B 1YFYA 1I5PA 4KWJA 1CIYA 1ZRFA 3RJ2X 3KT4A 1J83A 1MEC2 1VRH3 1GUIA 4OMDA 1HV1A 4RGGA 3L2HA 3APBA 3J7LA 2EXJA 1WMXA 3M1HA 5JR7B 3T1MA 4CEYB 5F3EA 3A4UA 1UY2A 2A75A 2XUMA 3KGLA 3KMHA 1CJPA 4X6RB 3SKJE 1ENRA 3PIGA 4P9JA 2WNUC 5DZFA 2VZRA 2D3RA 2I07B 3UESA 1LGNA 5T50A 4AEDB 5F9TA 4AQ6A 3U0ZA 1AL21 3O0WA 4KH9A 4S2GA 1OSGA 2ORZA 1JODA 1KFUL 2NYYA 4BXFA 4CEYC 3I2OA 3WT3A 1UY3A 4RN5A 4ZS2A 1H1IA 2CWMA 1DLLA 4JGYA 3VBSA 2GNDA 2XBO1 2WWUA 4FTBA 1JXNA 2J1EA 5A3MA 3KV5A 3W5MA 3VV1A 1EPWA 1OH3A 1RUC2 1OA2A 3K3OA 3OY8B 4GIQA 4QKBA 4HSJA 4D69A 4OULA 1QMJA 1UIKA 1UZWA 2HWC1 2QQNA 2WC2A 4ZU4A 5SV5A 2LS6A 5C3SA 1S0JA 2HWC3 1XU1A 4OI1A 2VPVA 1QJFA 5FZ6A 3AYDA 1F35A 2DYCA 1Q56A 5JIUA 2JJ6A 4XIOA 2OT7A 4Y1ZA 4LNVA 1I3HA 1F15A 1YQCA 2R071 4B1MA 2P6CA 4COYA 4YW7A 1HN1A 1RYYA 3PMSA 5D1IA 4B4QA 3VDDA 2RM22 3H1WA 3S5QA 4GWNA 1T6GC 3J7MA 1N3OA 2XDVA 3ZKUA 1VBD2 2VOKA 1OPOA 1VB2A 1WCUA 5DDJ1 5J1XA 2PAEA 1C57A 3CDZB 5L9VA 2YY1A 1S2KA 2FMYA 4YARA 1G6NA 4FPGA 3FBMA 1W8NA 1WCDJ 1LU2A 1YQ5A 3ZFEC 2G1MA 4QX7A 1UU5A 5FZ4A 4Q0PA 4HLTA 3A22A 4XF9A 5DQ0A 3RVHA 1CWPA 1KD7A 4O61A 3WDTA 4DINB 5A70A 4M00A 5JOWA 1OUXA 5J96B 4HL0A 3THDA 1BEV2 1LU1A 3VBHC 3TEZA 4HETA 1SFYA 1RUH1 4LOSA 3SXWA 5HCBA 5BXXA 1JUIA 2DCTA 1JYIA 5A1LA 4JVAA 4PDWC 1CAVA 2DVAA 4FXGB 5D8AC 1ULDA 5JXGA 3NKGA 3WQBA 1NUKA 5EJ1B 5CBLA 3VUOA 1D4M2 2XLAA 1MPXA 3B3QE 4YPJA 4LUMA 4QX8A 1HB3A 4KU7A 1ASJ3 4YVWA 1RUC3 2VOVA 1WMFA 1DZQA 2QQUA 1Y4WA 4KWUA 3VHRA 3H50A 4PIZA 5I8TA 1FOD1 1HW5A 4UF0A 5HPOA 2WLPA 1V6MA 5IK8A 1FYUA 2GDFA 3ZYIB 3PL0A 3MDPA 5D8AB 5FQ0A 4QWNA 2WA4A 4NAMA 1L7LA 2SBAA 2ZGTA 3S57A 4HK8A 4XHBA 5AVAA 4ZXKA 4BDVB 5LA2A 3B02A 3JBG2 2NQYA 4H3WA 5J48A 4P14A 4Q0SA 3JD72 3N9NA 5FXWA 4EWDA 1S1AA 5JZGA 4BQ3A 3T2PA 1MVEA 1CR7A 3VDDC 2A5ZA 1UOJA 1OQ1A 4Y20B 1H1AA 1RC6A 1VMFA 3SCHA 3WLUA 3ZXGA 3EMRA 4XW3A 2YU2A 3VZLA 2FCTA 4BCUA 4XXAA 4BQYA 1YYNA 4XCBA 3D0SA 3GBGA 2DBIA 2WNUA 2W94A 1AR71 2IXLA 3VBUA 3ZYRA 1ACCA 1TME1 5IVBA 3SC7X 5BNPA 4Y26A 1I6XA 2NP0A 1W03A 2RG4A 2IXIA 2QZ2A 1FPN1 5FMOS 3ZN6A 1RUOA 1H2MA 4WBBA 2R7EB 2PQQA 4Q4W3 2OZJA 3U10A 3OPWA 4FCAA 4XVHA 1W6NA 5FUIA 3KT1A 4CP2A 3LF7A 3FC0A 4I3GA 4O9GA 1NYWA 1RIRA 4GMP3 4XDPA 2ZGSA 4NIDA 3E5QA 2VW2A 4XXPA 4AI9A 1O6UA 2KM2A 3OGRA 4YG0A 2BFUL 1GICA 5FYVA 1X36A 4JGZC 2AREA 3GNEA 3G6JB 1TMF1 4PQ9A 4D7TA 4R4ZA 3KM5A 5A1AA 1ULPA 3POWA 2HBTA 2DVGA 1NXD1 2AC1A 1GOHA 1I5ZA 1C28A 1D4VB 1LJ7A 1NAEA 3AZXA 1A34A 3T1LA 1E5HA 1UYYA 3KF5A 3MFCA 1GWLA 2IVJA 1HRV3 3POGA 1RUE1 2TBVA 3ME2A 3B5LB 2JX9A 4CPBA 4M4PA 2E9QA 3VZMA 3AL6A 1FOD3 1H8VA 4UFMA 1AUYA 4QKDA 1WUVA 1GKBA 2J1TA 3K75B 3N9OA 5F5QA 5HV4A 3ZXDA 3GJBA 2ARBA 3O1UA 1ZREA 2AH2A 1CAWA 1POV1 1LGCA 1REEA 1VBA2 2CNAA 1H0BA 2R1DA 3DGTA 4AOCA 5JXIA 2ZGMA 3NO8A 1ND2B 1NXMA 3J8F3 2VZSA 2Z69A 1VE0A 3J8F1 3WHUA 5J37A 4CEWA 1JZ3A 2LTNA 4Q4Y3 3T4VA 1EP0A 2JDUA 1IQDC 1RHI3 2JKXA 1X9TA 4Q26A 1GU3A 1TG7A 5LBCA 4IE6A 4XOGA 1WW4A 2FCVA 2MHFA 4CCDA 3VBOA 1W9SA 1UW8A 3TNPB 1NCRA 4A45A 5FYYA 3WG2A 4ISQA 2WZR2 2JEMA 3O0XA 4ARXA 1ST8A 5A33B 2CWSA 3O0VA 4DEQA 3AP4A 4R4XA 4RQPC 4EV0A 1IS4A 1LHUA 5FXVA 1N1VA 1DP0A 3MEPA 2W47A 1NQJA 4IE5A 4LO7A 3T08A 4FFIA 4LIVA 3ZXJA 1TME3 4CE8A 2Z79A 2OYZA 2CGNA 3ZYPA 2WKKA 1ZX5A 1K5MB 3HR9A 3KGZA 1OC1A 4F83A 1Q3EA 4PLOA 5E6HA 2VCCA 2BU9A 2VZUA 2VOXA 4LQRA 5T55A 3D0JA 3A7QA 4IEOA 5IFPA 2ZGLA 5FWJA 4XURA 3VZOA 3IPVB 4DXSA 2WLQA 3AYCA 5GZEA 2VW0A 2ZX0A 3RQ0A 4ITCA 1CVNA 4YVWC 1HXS1 3I3BA 4EZHA 4AFDA 5CFDB 5B4NA 5FZBA 1ZZ6A 4XDOA 5F1RA 5I0RA 3ENRA 3NRUA 3MZHA 2XUEA 3ZR5A 1W9TA 3VBRC 2VW1A 4GH4B 4OHYA 4C1XA 2RS33 2ZMKA 3UL2A 3ZYGA 3ZPYA 5EZWA 4QPIC 2VBBA 3OD0A 4XCAA 1US3A 5BNNC 3ABZA 1W8ZA 4XFAA 4XFBA 4YVSC 3TN91 1J59A 1WA4A 5JSRA 2PLV1 4FT8A 3AZWA 5C8WA 3V0BB 3N9PA 3ZFFA 2XL9A 1VBA3 2MEV1 2VQ0A 5C5TA 2D6NA 2WDBA 4C0HA 4GA9A 1AZDA 1BVP1 2V5YA 2GMMA 3PUQA 4LO5B 4NPRA 4YW4A 2H6BA 4XQ4A 2I74A 4Y3OA 3IIIA 3FLPA 3UKTA 3USUB 5BNNA 5A32B 5FOJB 1BMV1 2ENRA 5F6KA 1VBD3 1A8MA 4AI3A 1O3RA 1JYWA 5FJHA 4QQ2A 3R4SA 1W6OB 5C8CB 5APAA 4JAAA 1IPKA 3KB5A 2ZEYA 3BIWE 3NJVA 3W59A 4AR2A 4IV1C 2D5HA 3CLPA 1XNCA 1RUG1 4NVPA 4N7IA 2WO2A 1XB9A 4P9IA 3OGVA 1PK6A 3TEWA 2UWAA 4BPZA 5ISLA 2R043 4QB1A 4Z82A 4CP0A 3NKTA 1HRI2 4DRRA 5IHRA 3AMHA 4HKLA 3VBSC 4QPGB 4EWEA 1IKPA 1YEWA 2ETEA 2EIDA 2F6BA 2VJXA 1EUTA 1PVXA 2PMWB 4LLOA 4XUTA 5C8CC 4HVOA 1UO9A 5LK7B 3ZXLA 1PO23 2XJUA 4NN0A 1AL0G 3WQ7A 3SCGA 1QIQA 1QY4A 2QTWB 2YGLA 3UNPA 1O59A 3I54A 3ZM8A 4NIHA 1WBLA 2WNEA 5CKMA 1GBGA 3NQHA 4B7EA 3E6BA 2EAKA 2BOJA 3VKLA 4FP3A 2AEYA 1R083 3ECQA 4QM8A 1RUH2 2VUCA 5K0UA 2JG8A 3LIGA 5ABJB 1W8OA 1IPSA 2A70A 4ES9A 4QKFA 1BKZA 4WVVA 4QPWA 2EIBA 4KWKA 4XTMA 5HV0A 2JWPA 3CBNA 5DZEA 5JUVA 1DZTA 2D6MA 3H0OA 2TEPA 5DAPA 1GWKA 3POYA 2GNTA 4XIKA 1GP5A 3MICA 1F8VA 1KGYA 5FP3A 1LULA 5FPUA 1HDKA 4Q4X2 1W05A 3OGGA 1CESA 5IVJA 1O91A 1J1TA 2BNOA 3EB7A 3AMNA 3BU7A 2BWAA 5FP7A 1OPMA 1DYPA 2P37A 2Y60A 4GKYA 4BQ4A 2R062 3OSDA 3GJAA 4CEWC 2HYKA 1XSQA 3C2UA 1CX4A 1SLAA 1GZ9A 5F32A 3WDVA 1HJGA 4HN0A 4E2SA 1H4HA 4CDUC 1Y7BA 2YROA 4PJYA 1W6QB 4Q4W1 2WNVB 5FKCA 4B4RA 1Z7S2 3IBMA 5GZFA 3URFA 2VNGA 4OYUA 4AFAA 4AQ2A 2DUPA 1NY71 3PUAA 4H7LA 4M3CB 5GJ6A 2K46A 4BQWA 1TQ5A 1W8HA 5DG2A 3POJA 2ZGKA 4BOWA 1C8M2 4OHZA 2YG0A 3LSDA 3MIDA 3D3AA 1IS6A 1KJLA 4ONUA 2OUHA 3T2QA 3VBRA 5CNAA 3AXDA 2OQ6A 3IKWA 2VL4A 3NAPA 4XQDA 1N1SA 4FPJA 1ZA7A 2RMU1 3WVJA 1XSRA 3ILFA 3MBWA 4MX3A 5FYIA 3BTYA 5ERLA 2X53S 5D21A 1ONAA 4Y24A 2A73B 1R092 2YB7A 1QJU2 4NHXA 4A44A 4DPNA 4META 5BV6A 1KQRA 4UFKA 2A3YA 5DUXA 4AVVA 2ARCA 2Q1FA 3W58A 1LOGA 3AMQA 2ZAAA 2ZA9A 1LOBA 1XXNA 1SPPB 4BXSV 2VC9A 2W91A 4M0HA 2QQIA 2RMU2 3GZEA 4BZ4A 5FJKA 1MACA 3PVNA 2X10A 1CAXB 1COV2 1JH5A 2C6SA 3O1PA 4XE9A 4AAPA 2Z2SB 2VOWA 1HQLA 2WFF1 2K9ZA 4W8JA 2XG3A 1AYN1 4S2HA 4CDWA 2DU1A 3C7FA 3OGJA 3Q8BA 4YVSA 4KL1A 1RITA 4L92A 5JI9A 3M3QA 3JXSA 1QWRA 1V00A 3NV1A 5FWEA 4M01A 4Q4V1 3SITA 1C3HA 1X82A 2CSGA 3ZVXA 1UF2C 4QX2A 2TNFA 2MNGA 1NCQB 3L9JT 1ODNA 1DDLA 2J1RA 1OUSA 3BU0A 4ZZ5A 5LY1A 4W6WA 4HVRA 2DVBA 1C8M1 2F17A 2RM21 5FZLA 1O8PA 2QDNA 4LE3A 3P6BA 4QDQA 3HNYM 1PX3A 2Y64A 3WDXA 3OGSA 4AI1A 3UETA 3NJXA 1XNDA 3I49A 2X5IB 2HKXA 3G7DA 3D6EA 4N53A 1MS3A 1LEDA 3LEKA 4LT5A 4BIFA 1LEMA 1RUF2 2RS51 4CZSA 2RE9A 2XH6A 2GN7A 4P08A 4AW7A 4UBHA 1NA1A 1B35B 2RV9A 4G9SB 3N9MA 3MW2A 4CP9A 2ARAA 1KITA 5KWRA 1AXZA 3F2ZA 4A6SA 2HWE1 3S6PA 3HN3A 4PBPA 4CEYA 2W87A 2X5IC 2AR6A 1DYOA 1NY72 4MSVA 3NW4A 2VBDA 4CCOA 1CZVA 3A23A 3GBFA 4GWMA 4LOTA 5IK7A 4FSJA 5I93A 3V56A 3VHNA 3LGRA 4XZPA 4BK4A 1UN1A 4FPOB 2XGXA 4YW6A 1POV3 1ZBA1 3K51A 3E5UA 4OHXA 4JRAA 1TNRA 2UWCA 4AEDA 4JKLA 4CXYA 1VBE2 2DDUA 4J25A 4OI0A 3VBOC 4COVA 3MPBA 1SEFA 3RNSA 4FPYA 2C4XA 2VMGA 3TRSB 3C7GA 5J7MA 1OQDA 1WGPA 1ULEA 1W6MB 5CG9A 3LEMA 5F3GA 3DPRB 2A7AA 1S0GA 1ASJ2 4RHV1 2JG9C 1UMZA 3AKRA 1W06A 4CXXA 1PIV3 2X29A 4XJZA 3V65A 4FPHA 3M8LA 1OOPA 4IE7A 3ZO0B 1ZRCA 4L99A 2B5HA 2LRPA 3INAA 1QHDA 2ZEZA 1PK6C 2ZAHA 1H2NA 1PZ7A 4R8HA 4FOYA 1WMDA 1W0PA 3I7DA 1J84A 5FY5A 3SISA 4DFSA 1ZBE3 3VD5A 2HWB2 1U0AA 4GJYA 5A7OA 3PHMA 4NROA 4I09A 1LTEA 1YFWA 2B7YA 4Y5SA 4Q8LA 3SHRA 3K3NA 3L2YA 3VDDB 1EAH3 1NQDA 3WF3A 1YLLA 3E1F1 1UOBA 3PDQA 4PI2A 4DS0A 1TNFA 3FHAA 3VKFC 1X8EA 1GANA 4KBBA 4PCRA 5LRSA 4LBLA 2ZPXA 3RI9A 1GOGA 1W3VA 1W8UA 4WM7B 4NJ4A 4YSFA 1VBE1 4LO4B 1PZ8A 1JHNA 4MGYE 4Y33A 4Y4RA 3DKQA 2ID4A 3J4UH 5FDBA 4RQPB 5JSPA 3DYPA 3MLLA 2R042 3ILRA 4I0AA 4Q4W2 2Y6LA 3N9LA 3P5BA 4CUBA 2MEV3 2ZGUA 4DUVA 3HQXA 1K5MC 5GM0A 1AL23 3MYXA 3BPSA 1XOYA 4DMIA 2C9KA 4GH4C 4W6YA 2J7MA 5FZOA 5T3NA 1Q8OA 5KHHA 3EBRA 5TSWA 5IFTA 1CAVB 4NRQA 1J1LA 5L7OA 4URAA 4IEXA 1G86A 5EIYB 1F5FA 3DUIA 3NMBA 4UW4A 4BJ0A 1ASJ1 1W39A 1JZ5A 5FYTA 2CHHA 1OHFA 3FHQA 4HKWA 4YVWB 5C71A 5KHJA 2VOTA 5C7GA 1VBC1 1T6BX 2VBPA 5A7SA 2RS12 2DCJA 2JDAA 4XETA 5FOBB 1UZVA 3T3YA 1FMD1 1UZ0A 2WZEA 1IHMA 1UX7A 4AQSA 2R6QA 4GXLA 3BTXA 1O5UA 3KV9A 3DYMA 4LPLA 4Y1YA 3TNQA 5D8AA 5FQ0B 2BBVA 4KU8A 4QPIB 4DRVA 3TYJA 4YGEA 1JMUB 1SLLA 1VAKA 1JN2P 1N1TA 3KF3A 3UJQA 5JSOA 2AZ5A 3JB8A 4HFSA 3LA2A 3GZUC 3AM2A 2P4EA 3NNLA 4XFCA 4Q0QA 3FFQA 4EYUA 3AVSA 4L8QA 1STMA 3I2HA 1OD3A 4YWAA 1EAH1 1DQ5A 4IL7A 1RHI2 4E4ZA 3O7OA 4Y20A 2D7FA 2VMHA 3IT8A 3RS6A 5JOYA 1AYN3 1OA3A 2JG8C 1CAUB 5FV3A 5T5LA 3T0BA 2QVSB 4ATFA 1RUD3 2G9GA 2VZ3A 3B01A 1WKYA 5FUNA 3HT1A 1G9CA 3AX4A 4DY3A 5JPMB 2ZGQA 2ZX3A 1SCSA 2Q8CA 3RPQA 2O1QA 3SMHA 4QB2A 1XYPA 1AR81 5HXVA 3VBUB 4QXHA 5FY0A 1TME2 5BNPB 1JZ6A 4JTNA 5C3OA 4Q2FA 5B2GB 1O3QA 3ZN6B 3MIBA 3F95A 3P3NA 3P1IA 1PGSA 3J26N 4V2VA 4OQ9A 4OLLA 3PJYA 2HH9A 1QJU1 4IV3A 4E27A 2QQWA 2WIIB 4MHUA 2FHRA 1QJY2 2X09A 3WQ0A 1PMHX 1NE6A 4YG6A 4ZZ8A 1Y3TA 3BTAA 3RFRA 1LOAA 1TMF2 1RINA 3OOXA 3WUCA 4AFMA 3BTZA 1ZRRA 5E88A 1Y9GA 2Y8KA 5BNPC 3Q8CA 1RUNA 1ULFA 1QKQA 3I3QA 3HOBA 2XJTA 3N7KA 1HQWA 1YQ8A 3M3IA 3KD4A 4XEZA 3T09A 3RYKA 3LPFA 2ZEWA 4GKXA 1PX4A 2FDFA 1TVGA 2YFUA 1ODMA 5FZ3A 2HWE3 3ACIA 5FYUA 4ZKTB 5F2WA 2WFF2 1V9U3 2Q1ZB 4E9KA 2IFRA 4Q4Y2 4QHBA 3BOPA 3U37A 3WNOA 3R4DB 4JDMA 1OKOA 2VCMA 5F2SA 2UYAA 1CAWB 4OHVA 1KS4A 3CL1A 3O1OA 3CJIC 1AF9A 5F5AA 1V6LA 2ZCWA 1QJZA 5FK8A 4ZU7A 3OPZA 4CEWB 1HLCA 4BQ2A 3OYWB 2XVGA 4EROA 4XJAA 1RHI1 3PTYA 3WG3A 1EV11 2CTVA 3ZSEA 4IXLA 3WD5A 2LALA 2WNVC 4O65A 4M3CF 2EA7A 1IS5A 4PIYA 4ARYA 1I1EA 1BLZA 2HWF2 5FY1A 2ES3A 5F6LB 1O3SA 3I59B 1UU4A 3OBAA 4Y5Z0 4J1XA 2CYFA 4JKMA 4L0PA 5A33A 4JGYC 1PO12 2HEYF 1OLQA 1PIV1 1YHFA 4TN7A 5FZ7A 2PHWA 1JBCA 3JQXA 1MS0A 1YJLA 3UK9A 1AR91 3J7HA 4Q0UA 1CN1A 4CU7A 4Z2WA 3U4XA 5HI0A 2ZX4A 3CF6E 4PHZA 1UOFA 2W08A 5LK5A 4LA2A 3KV6A 2AUYA 1LOEA 1UY4A 3FL7A 4AEDC 1GOFA 4CDUB 1JZ4A 4Z8BA 4FPEA 2XWJB 1RJ8A 4KBZA 1D2QA 3BYWA 2Q0AA 3MIEA 4UWDA 3D5OA 3RI8A 3WP4A 1CZSA 4GZ9A 2FDHA 2WN3A 3DN7A 3GHNA 2EIGA 1QQP1 2Z42A 1RTVA 3VN4A 3V0AA 4OFGA 1UY1A 4CCLA 1LB2A 1GNYA 2JG9A 1L7RA 3POIA 5GALA 5IWFA 5CFDA 3HQRA 1VR3A 2ZGPA 3UKVA 3ZKYA 4BLIA 4K6BA 4DEVA 5FXZA 2Q1MA 4CCNA 4TLGA 5EJZB 5JOXA 4GH4A 1G9DA 1GZCA 5L9RA 4YW5A 5AC92 5GZDA 3WSOA 4CUCA 4INDA 2RDQA 3O1TA 5FAXA 4XF1A 2ZEXA 4JQRA 2E7AA 3LPGA 1UZYA 1N3QA 1RL3A 4UFIA 2ZHLA 1ZBE1 4CDXB 2W68A 2WS91 1XNAA 2D43A 2RJ2A 4XZUG 1MZ6A 1OLRA 1QU0A 3V0BA 4LK7A 4UBGA 3WG1A 3PMEA 5EYYA 3HBKA 1YNAA 4I0BA 4GMP0 4DOUA 2BW8A 2H0VA 4TXWA 5A7NA 2ZGRA 1PMIA 1PVC2 1RVF3 3R0RA 1ZM1A 2BNNA 4QXKA 1C5HA 2VGDA 3ZYBA 4ZXEA 2IZWA 1QXRA 2JDZA 3LE0A 4LEJA 4Q29A 1VMHA 4AQTA 3ZR6A 5A32A 3BOWA 1QJX2 2OPKA 2RDNA 1VRH1 3CKHA 5F3CA 5FO7B 1NLSA 3K46A 3QLQA 5A3LA 1RUJ3 2NN8A 4DO0A 1PGL2 1W9WA 1QDCA 1R1ZA 4NIIA 5LBBA 4B8EA 5C8CA 2Y0IA 2WWJA 3OB8A 3TWIA 3LOIA 3H8UA 1IS3A 3LD8A 3AXEA 2WQ4A 3VL8A 4COUA 4MG2A 1DZRA 2G9ZA 1AR82 4D0QA 1ZNPA 4Y1UA 3OPTA 3VDAA 2J22A 2VUJA 4M3CE 1AX1A 1ZBE2 3FN9A 1H8TC 1U5XA 4YNIA 2YPDA 2QCSB 4LKFA 2WRAA 1AHSA 4OUSA 5F3IA 2Y6KA 4AVTA 4QDSA 1WD4A 5IVYA 4MGIE 2ZABA 1V6KA 4K3UA 4OI2A 4DXZA 2BDRA 2BUKA 3AJYA 4XC9A 4QPGA 2FZ1A 2Y6FA 1OMIA 1NCRC 3LA3A 3N35A 5A7PA 2J1UA 2DTYA 2WO1A 3TAYA 4E4DX 5ACA3 3BIEA 3H8XA 4L2NA 4UOJA 4TYSA 1TEIA 4MGQA 3MF6A 5FYCA 4OHWA 5LZ6A 4XFIA 4ZONA 4YW1A 4DNYA 2E33A 1RUC1 5DAWA 3WP6A 5J09A 3D82A 3WEZA 4QX0A 1XNBA 5LB6A 3SH5A 4GAZA 2OZ6A 1R081 2B42B 5K0UB 3K4DA 2GSYA 3Q9OA 3DKWA 2W1UA 1E5SA 1W2TA 3NNGA 2YBKA 1YI9A 4NO4A 5CKQA 1REFA 3ZIWA 4D6RA 4HPKA 2DFCA 1LR5A 1JOBA 1VBC2 1RUI1 4M4RA 1ENQA 4CXWA 1G9BA 1JHJA 2WYSA 4AVSA 3VHOA 5KXDA 2EAAA 1RB8G 4GMP1 1N3PA 2P3IA 4OUMA 4YLZA 5GLTA 3H7JA 3N4MA 2PAMA 2DTWA 4QQLA 4Y5TA 3VKMA 3R4UA 1JU4A 4EN6B 4PDWA 4LXLA 1D4M1 4Q4V3 1W28A 2B46X 2ADDA 2BFUS 3PUSA 3RDIA 1ZZBA 1SACA 1Q5OA 5LRRA 2QQOA 4I02A 3JBG1 2FMDA 2GH2A 3AP7A 4E2GA 3BN6A 1BHGA 4LORA 3CIHA 1LESA 3VBHB 2RM23 3GZTB 1CX1A 5F5IA 5BNQA 4QM9A 3JU9A 1GNHA 2CU5A 1G7YA 1PM7A 1VBB1 3BALA 1XE0A 1K45A 2BGCA 3KT7A 4CU8A 1Q8VA 3LOBA 1JS9A 2QBXA 4AE2A 1Y9QA 3I3EA 5JR2A 5CZKA 3MW3A 5FPAA 5T54A 4NIGA 2D40A 1OBNA 4RR3C 2PHLA 3HIFA 1RUF3 4AXOA 2E7TA 3P3PA 1AYN2 5JLVA 1RUD2 5FZKA 1YCIA 4A42A 3IAPA 1UPIA 4JHTA 4Q0VA 3O1SA 4KNCA 1EYBA 2QKDA 4LBQA 5EPAA 3I3DA 3RWNA 1RUD1 3HEIA 3NAPB 2VMIA 2HWB1 4O9EA 1HX6A 1RUE3 2J1SA 4HT1T 2WYFA 5EXOA 5T5PA 4UI9L 1NZIA 2VVEA 4NOTA 4PF5A 1O4YA 1FAYA 5FYHA 1DBNA 2YGMA 1F4AA 1IPJA 3O14A 3ZIXA 1PMJX 5C3RA 2GMPA 5A7WA 2WL1A 2WN2A 3I2FA 5FP9A 4RFT0 4K8RB 4EZ4A 4W65A 3I4IA 5KC6A 1GV9A 2VD7A 1ND2C 4LIUA 4LK6A 3USSA 2DBNA 2ARXA 4AAXA 2WWSA 2RS32 4IE4A 5K4LA 1FT9A 1UL9A 1M4WA 1CAXA 1E5IA 4ASLA 4XFGA 4RGKA 3VKNA 4NPLA 5EV7A 5EJ3A 5LY2A 3RZJA 3PLQA 3I97A 3S30A 3IWZA 3DPRC 1QNWA 4Q5OA 5I0TA 2P1BA 1URXA 5FZGA 3ZYJB 1RJ7A 2BP6A 2EVXA 3TOJA 1RMU2 1AJKA 5FFOC 4Q4X1 4QQOA 3C7HA 4YW2A 2NMNA 3FLTA 1MR5A 4I3PA 3NAPC 3EO6A 4CTEA 5KHKA 4BU2A 2A3XA 5T5JA 1DGLA 1NLQA 1AR92 2E26A 1DQ2A 4XBQA 1VBB2 2ZXQA 3HJRA 5LW9A 4PIXA 4D6QA 1OFNA 1XQNA 5DZGA 4YM1A 3PTRB 2VTXA 4KWLA 4NHKA 1SHWB 2X5IA 4MXVA 3ZMOA 2WZPP 5FZMA 1MEC3 3IAQA 4AG4A 1VJ2A 4N53B 5IK5A 2A6VA 2WO7A 4L9BA 4RS5A 1RUF1 2RS52 3U75A 5HBAA 4GB31 1POV0 1Z78A 3ILNA 4E2QA 1LOFA 4M0NA 3CMGA 1B35A 4U36A 2C24A 4XUNA 4EE2A 3KV4A 1H2KA 1RXGA 5E8AA 3KCYA 1YFXA 4A4AA 4CP9B 3IIAA 2XJVA 1SLTA 2KD7A 1YQ2A 5FY4A 3Q8FA 5FTTC 4U2AA 2RJLA 3S5AA 1CQ9A 1SLCA 4QHZA 1N47A 3WX5A 1MS4A 1UWWA 1KXGA 1R64A 3GM8A 3CO2A 4XQWA 5IUQA 2BVVA 3PVOA 1R082 4QX1A 1X50A 3N7JA 5AFBA 2P17A 2YPJA 1C5IA 1PO11 1RVF1 1DQ0A 5C33A 4F3JA 2GC2A 4NE9A 4WVMA 5F8PA 4EJRA 1LAJA 1UX6A 4K8FA 4P9XA 4BMBA 2OA2A 4COWA 1JYNA 4XDQA 2D3PA 4ZPIA 4AEMA 1W6MA 1VBD1 4LITA 1ULOA 4FFHA 2C9AA 3DPRA 3N9QA 2RDRA 3VDBA 1OXCA 4GJZA 1WLWA 3I2KA 1H9PA 2Y6JA 1F31A 3VKOA 4R9BA 4CDQB 1MS9A 5HCAA 1OOPB 2JE7A 2W0XA 2WT1A 4LKDA
chains in the Genus database with same CATH topology
2YC0A 1MVQA 2BWCA 2PLV2 3FHIB 3ZXFA 5JI7A 3TN93 1S0DA 2D93A 4V1PA 2DV9A 1UAIA 1OA4A 2VU9A 2WZR3 4N7UA 2HWC2 5CFDC 4QQHA 4E4SA 1QF3A 4X8NA 3ZSKA 2D5FA 5AC91 1QXJA 2A6YA 2R1BA 4LLFA 4CDQC 1DU3D 4XF4A 3GHMA 2RS53 1OOPC 1QJX1 4BQ1A 1AYM1 3JCIA 1QJX3 1WCKA 1OKQA 2WA3A 1ZZ9A 3WP3A 3ES1A 1LOCA 4BLJA 2B9UA 5EWSA 2JD4A 4PLNA 1APNA 3OF1A 1LHVA 1VB4A 1V6IA 1NZCA 2O8OA 5GLUA 1BEV3 1C1LA 1B09A 1D2SA 1A6CA 1QJY1 4WM7A 1AL22 2EF6A 5HCFA 4Q27A 1BK1A 4RSUA 1LECA 4LA3A 2PELA 3B9IA 4RQPA 4UXAA 3VBFA 2DCKA 1H4GA 1KFXL 2I2SA 4HK9A 1SBFA 1J3PA 1WW5A 3MIFA 4N43C 3ZXEA 2GNMA 1R093 4Q8KA 2VNRA 2ZX2A 1TMF3 1JTZX 1S0FA 5L7OB 4JDOA 4ISRA 1YWKA 1PGW2 1XE8A 1HRV1 3N7LA 3FFZA 1H8TA 4RA0A 2N7GA 1HIXA 1COV3 4XILA 4BE3A 1V9U2 4MGKE 2QFEA 2LM3A 3A0KA 1WD3A 4IV3C 2VULA 4WZCA 4QPIA 2Y0OA 2VY0A 3POSA 1SBEA 1DQ4A 1FV3A 1H1MA 1YUDA 3R6SA 1V70A 1S0IA 4CDXC 1W0OA 1I9RA 3WP5A 3ES4A 1GR3A 2PHFA 2JECA 2CAVA 1GQHA 4K1ZA 2DUQA 1Y43B 1AYM3 2ZHMA 4GULA 1FNYA 1CAUA 3ZDSA 2HWD2 4LR4A 4XJ9A 2ZOEB 3OCPA 1RGSA 3LZZA 3EXUA 1HRI3 4LHLA 1GFF2 2DFBA 2ZKNA 1XE7A 1QJY3 2ZTNA 3E6DA 2KXLA 2OVUA 5I0SA 1FNZA 1WMEA 2P3KA 2WS92 3WDYA 3PJQA 1AR62 3AYEA 5C6CA 2ZZJA 3NL1A 1VRH2 4COZA 4IV3B 3VL9A 1RUH3 2A6ZA 4D7SA 5K0UC 4YG3A 5FLJA 2P34A 4Y22A 1SMVA 2XKPA 3S7IA 3RRDA 1RUE2 3BODA 2YUEA 5GKAC 1QQP2 5L36A 3ASIA 2ZJCA 3QACA 4QGLA 3PVBB 3JD71 1FXZA 1MZFA 4XBNA 1L3JA 3AKSA 1ZZCA 4X6QB 1D0HA 1DF0A 1H9WA 3QBQA 1C4RA 4RR3A 2D6OX 1CJDA 1W6PB 3WG4A 4I30A 3FX3A 4NWWA 1U12A 2R30A 2B39A 5BNOA 4Z92B 1PGW1 1UKGA 1PIV2 2YHJA 1GZWB 5I91A 1BJQA 1OFSA 4P5HA 4Y1VA 1CPMA 4BHPA 4MXWB 4QX5A 4ATEA 3OYWA 1VP6A 4YGBA 3D4KA 2OUJA 1EV13 1YIFA 2XBO3 3ZMNA 4AGRA 2A71A 1RUJ2 4YRDA 2E53A 4AI8A 3I59A 4IERA 1MS8A 1MS1A 3HMYA 3LKJA 4RL7A 3RSJA 2XKOA 1AR93 4XJUA 3U07A 1AR83 5CU1A 1XNKA 4AGVA 4HKOA 4X8PA 1ZBA3 1SQ4A 1IQAA 2R041 2WFPA 3J9SA 4GALA 4CDUA 3B69A 1XU2A 3WW1A 1GQGA 3JB4C 1QH7A 2RS11 3AFKA 4XMAA 3HAGA 5CVRA 3LAGA 3S0MA 5CIRA 3GALA 2A6XA 5JVVA 1NCQC 5AC93 3W9AA 3QH7A 3WINE 2Q8OA 2G9FA 3V0AB 1HXS3 3M3OA 4LHKA 3I2DA 4L11A 2JG9B 5DDJ3 5K9YA 5I8SA 2WSVA 3IDBB 4QU2A 3H1MA 3M4FA 3KLSA 4XJWA 2XVLA 4EN7B 4AI0A 3RYPA 4AHWA 4HBNA 3MIGA 4AFBA 4CDXA 2PHRA 4JGZB 2ZHNA 2PLV3 1VBA1 3KS7A 3WNXA 4XJ8A 4BMEA 4C1WA 2XPJA 4R9DA 5EFUA 1UIJA 1FX5A 4S2FA 1JUHA 1AVBA 2OIIA 2VQAA 2ZBJA 4KGQA 1G9AA 2W52A 3K48A 5C9AB 5CFCC 4AEKA 2ZS6B 3GYDA 4Q4V2 4QGNA 3ST7A 1A8DA 2YZ4A 2GALA 2QE3A 1S0BA 2DWRA 4B4PA 2WINB 4J1WA 1RUJ1 1LHWA 4KG0A 5JMCA 4A7ZA 4FP2A 3AJZA 3ETQA 1VIWB 2O8QA 4RD7A 2XJPA 1VLNA 3FLRA 4KGGA 4MVTA 2JENA 2D98A 1VALA 2YXSA 2WSUA 4FPLA 3WHTA 2XJRA 1LCLA 1ZBA2 4D3WA 1BXHA 5BYNA 2R061 3JQWA 4N43A 1F2NA 3GZAA 4ES8A 1R091 2R073 5H9QA 3H7YA 5ACA1 2EXKA 1J58A 3ZSJA 3PNAA 4W6XA 2D97A 4N53C 1HXS2 2KA3A 3O5SA 3ZXKA 4AHYA 1U5IA 1DG6A 4NWVA 5CB7A 3MPPG 5C9AC 1G9FA 5CFCB 4YW3A 4QQPA 1S0EA 3AP9A 2WT2A 1CD3G 1DHKB 1FV2A 1PO22 2CL2A 5CA6A 1FMD3 4WVZA 4HVQA 2PN5A 3ZFEB 5CADA 2YV8A 3KSCA 5E1RA 3RYRA 1WW7A 4HPKB 3WY6A 3VZKA 3QD6A 2BEOA 3ZXAC 2EALA 4YM2A 4FPKA 3QCWA 4MGZE 2PAKA 2P3JA 2EXHA 2A6WA 1MQTC 3UV9A 1WBFA 1UPSA 5CAZA 1C8NA 2XLFA 3BB6A 2OW4A 4DQAA 1JYCA 3S7EA 4AI2A 4R52A 3FMGA 4PDWB 1ZRDA 2G4IA 3VGIA 5KXEA 1ZZ7A 4XTPA 1AYM2 4H14A 3LWCA 4P9WA 3J8F2 5FO9B 2E51A 2RJKA 2UURA 2GAUA 4MYEA 3HD8B 3VBHA 4DB5A 1EAH2 5FLHA 4IEVA 1VBB3 2IFWA 1WLCA 4YFZA 3GBWA 1PGL1 2CGPA 1ND3B 5C4WB 2XHKA 2NPIA 4Y4YA 2SLIA 5KC5A 4MV2A 4LBQD 2YMZA 4GB33 4YZ4A 1MQTB 4LUKA 2VECA 1J3QA 4LBQB 4F7ZA 3ZFGA 4G4FA 3AMPA 1VAVA 2UY9A 4C91A 1R1A1 2RMU3 1ND3C 5C4WC 1R1A3 1M06G 1QGLA 1SDWA 2ET7A 4LBNA 4MLOA 4WM8A 5LEJA 5FMOL 1AR63 1MZEA 2X8KA 4YGCA 2Y26A 5GLZA 3CJIB 1W2UA 1DFQA 2QDRA 3ZSMA 3ZX7A 2D6KA 1LOFC 3H9AA 2GC3A 5BY5A 4WZFA 3B7MA 3EHKA 3QH6A 3UJOA 3AKQA 1YIPA 4LHNA 2XB6C 1QNYA 1QQP3 4K21A 5FREA 5L73A 1OQEA 4B29A 2E7QA 1VAMA 4N9HA 1IOAA 3JBG3 2D6PA 3MFAA 4K9SA 4RS5C 3H3ZA 2RS31 4BYYA 3JD73 4C90A 2ATFA 4IEPA 1XYOA 1O4TA 4FOWA 1REDA 1BQPA 3OD4A 4FOQA 3TN92 1HV0A 2MPFA 4HSLA 2FZ2A 3JZVA 1KS5A 2HWF1 4AF9A 2O0OA 2V73A 1Q8PA 4LE4A 5GZCA 1RMU1 4IV1A 3AKTA 4RS5B 1EV12 2UU8A 2XBO2 2NLRA 3THTA 4K1YA 4A3XA 4IEZA 4TZDA 4RHV2 1S2BA 1NE4A 2PA7A 2R0HA 2VNOA 3ZFGC 3LA7A 4IEWA 3ZSLA 1VBE3 3NJZA 4B3NA 3WW4A 2UYBA 2VVDA 4H7MA 4YM3A 4LO6B 3VZJA 1YO8A 4JV4A 2ZMLA 4I01A 3E6CC 2H6CA 2CV6A 2ZHKA 4Q1RA 5FPZA 4N9IA 4JTOA 2V09A 3MLKA 4FQZA 4WVMB 2Z5WA 2WFF3 3ROUA 1WLTA 4QD2A 4JGYB 1PO21 3VBSB 5DG1A 4FBFA 3OY8A 5DXDA 3E97A 4XF0A 2DVDA 5I0UA 4MUVA 5DUWA 4CDQA 5GZGA 1TE1B 2WT0A 3I8TA 1ULCA 4Q4X3 5DUVA 3NWKA 1RUI2 4SLIA 1MZ5A 4EN8B 3EQEA 5GLWA 5ABJC 4NHMA 2RR12 5K8SA 2HWF3 4ZU5A 2C0ZA 2PYTA 4IEUA 4BIOA 3M3CA 5FBZA 5T5OA 1HKDA 4LTAA 1AXKA 2HWD3 2IWGB 1O3TA 4A7YA 4TLFA 3M2MA 2GU9A 2BPA2 1AR73 4AVBA 3CNAA 2IC1A 4XFHA 4K40A 1FMD2 1YRZA 4FPCA 1Q8QA 2WS93 1ZVFA 2Q5TA 3VBFB 1GSLA 2BYVE 2P2KA 4N90A 3AP5A 5E16A 5I8YA 5AVPA 4UW3A 4PLMA 3VLBB 4K20A 4YZ3A 4F8AA 3ZN5A 4LBJA 2ZACA 3VHPA 2JXAA 1SBDA 2PHTA 3AFGA 1O5LA 1BBT2 2K2SA 5KHGA 5J3UA 3MI8A 2GC0A 4JCKA 4XBLA 3WCSA 1H8TB 1GLHA 4AVAA 5CG8A 3SH3A 2VG9A 4OI4A 2E6VA 4LO8A 2I45A 4FQ4A 1Z0HA 3HN1A 5BUVA 1YXWA 4PBOA 3DF0A 3AK0A 3VZNA 2YDEA 3MGUA 1RUG2 4YZ1A 2RR13 4FVVA 3RG0A 3AP6A 5JZGB 1DGRN 2D44A 4S2DA 2C1FA 4QT6A 3NV3A 4XMIA 1BMV2 2GNBA 2QJVA 2PTMA 3M7AA 4FAGA 1HRI1 1YI7A 3ELNA 2CAUA 1KRIA 1UKRA 2DU0A 4WV8A 4IETA 1QOOA 3AZVA 3NV2A 5SV8A 2WNUB 3KQRA 4KG8A 1MS5A 3NSTA 1IGOA 5T52A 4JRLA 1C1FA 4P9GA 4D94A 1WCSA 5BNOC 1GYKA 2XWBB 3FWEA 2VH9A 1W6NB 4FXKB 1EPZA 3MLJA 4YGDA 3N36A 2BQPA 1JOJA 1LKNA 3IDEA 3O12A 1AX0A 5FPXA 1ULGA 5JWPA 4UW6A 1QH6A 3HT2A 4Y22B 5JDBA 1KJRA 3BCWA 2BTVC 3DV8A 1A78A 4R9CA 4XYXA 1ALYA 5DDJ2 5JZGC 2QNKA 1BBT3 2Q30A 2PHXA 2GC1A 2NZ9A 3N3HA 2GZWA 2F4PA 3PVEA 4QMAA 1PVC1 1B35C 3ZN4A 1OD5A 2D3SA 4RGAA 2ILMA 1V9U1 5KBFA 3FZ3A 1X8MA 4IEQA 4RR3B 1FPN2 1DGWA 4BH9A 1W6PA 1GNZA 2VUAA 4XPVA 1HRV2 3IN9A 4DZGA 3AZZA 5BNOB 3SH4A 1MEC1 2XL7A 1ND2A 4CRQA 1GZWA 1FOD2 4UW5A 3SLIA 4Z07A 4LULA 3WR0A 4MXWA 5FO8B 4I0WB 5JOZA 3ACLA 5JIAA 2E63A 1QOSA 1SLIA 2WQZC 4NHLA 4XFFA 4YZ5A 3VBOB 4LBOA 2HWB3 4YFWA 4P9YA 1NCRB 1Z7S3 1DIWA 4AHZA 4JDNA 2XLGA 5GLVA 1V6OA 1UZZA 3H1YA 2QZ3A 1J3RA 1FI2A 1UD1A 2B45X 1N1YA 2UY8A 3SCFA 4I2OA 5IT6A 3FE5A 2HEVF 1C8M3 2UWBA 2ZMNA 4YM0A 2NMOA 3ZFFC 2DVFA 1K5MA 1DQ1A 1IZ3A 3V64A 2HEWF 1NOVA 5J36A 1QOTA 1Q8SA 1F5JA 1PO13 1SLBA 3R05A 3UKNA 4D7YA 1BZWA 3IPVA 4LBKA 5JAXA 2IXCA 4HMZA 3RZZA 4XF3A 3TBDA 3E5XA 3VBUC 4Z1VA 4RHV3 5KHIA 4EN9B 1WLDA 3LCPA 2JE9A 5H9PA 1CIWA 2D6LX 3DL3A 1BCXA 2BNMA 5FRAA 5JPNB 2IXJA 2JICA 2XVKA 4IESA 3WW3A 3FJSA 4YZ2A 1NG0A 1CGPA 1H2LA 1RUI3 4JGZA 4XHXA 4FPFA 2GMEA 3SNMA 5AFEA 2DCZA 3OJBA 3WW2A 4C0BA 3B93A 2ZX1A 1YFUA 3ZFFB 4A7KA 1BVVA 1RMU3 3B94A 4IEYA 4Q1PA 3WDWA 4HN1A 1IKQA 2TUNA 4AYUA 2AYHA 2HJIA 5DUUA 3KCXA 5C9AA 3N7MA 3WXPA 1ENSA 1ZA4A 3KZ4C 5H9RA 3USUA 2K0GA 2A3WA 3ATGA 3HBZA 4YYOA 1FATA 3WZ1A 3OBTA 1W6OA 3A0NA 4G3YC 2FQPA 3BPZA 3IDCB 1HQNA 2R072 2R49A 5J98B 1DQ6A 1AR72 1F9KA 2GH8A 5ACA2 3M70A 1CPNA 2BVBA 1PK6B 3WQ1A 4N43B 1DGRA 3EJKA 4HZFA 3FUOA 1X33A 4K7JA 3IMNA 3H3UA 4MZUA 4KQ7A 2CGOA 3AB0A 1JW6A 3RJRA 3WCRA 3B9CA 4MH0E 2XJSA 4GB32 1XRUA 5L7OC 2DURA 4J6GA 1O4ZA 1AXYA 1V6NA 3GF6A 4ASMB 4IQPA 3NVCA 4FAHA 5CFCA 1VBC3 2ZZQA 3WDUA 2ERFA 1DYKA 3CEWA 5H9SA 2VXRA 3T2TA 3MF9A 2JG8B 1S55A 2EXIA 5ABJA 1BEV1 1LODA 2AENA 5JCTA 4WM7C 4URTA 5E89A 3ZFEA 1AR61 3CU7A 1LGBA 4SBVA 4NR1A 2LUWA 3QOPA 5EYXA 4AEJA 4BM8A 3KCCA 4AVCA 4OVEA 4WVWA 3RMYA 2ZGNA 4AHXA 1X7NA 2HWE2 4ORFA 5BPXA 3CJXA 1AJOA 1SFNA 4EWAA 2Y38A 2HWD1 1D4M3 3AKPA 1V6JA 1ZZ8A 4Y1XA 1PNGA 1G8WA 2NM1A 4CYDA 5KXBA 3M3EA 1BBT1 4P9LA 1ZYBA 1Q43A 2QUOA 2R16A 2XJQA 4CP1A 1NLRA 1PNFA 2WJSA 3HWJA 1QXPA 1RUG3 4R9AA 1W6QA 1E57A 2ET1A 2GN3A 2WNVA 3JUUA 4FO9A 3LB9A 1KDMA 2ZGOA 4QGMA 4FTSA 2R063 1ND3A 5C4WA 3U11A 4FTEA 5FCCA 4M3CA 4CDWC 4QPGC 4A2UA 4HANA 2DF7A 3OBRA 1EY2A 1R1A2 1U5ZA 3THPA 1S0CA 2R32A 3C3VA 5KXCA 2JKBA 1MQTA 2Q4SA 2H0BA 4DY5A 3ALQA 3MW4A 3VBRB 2DUOA 1BYHA 1PHMA 3ZFGB 2MEV2 3MIHA 1Z7S1 1COV1 5K7PA 4BWOA 5BNNB 1ENXA 4WM8B 4BA6A 4AGGA 4AFCA 5LEKA 1LENA 3WUDA 4AK3A 4B7KA 2YYOA 4H55A 1CONA 2RR11 3CJIA 3RMXA 1H30A 3VBFC 2PHUA 1UU6A 2AGSA 3LSEA 2FBEA 1QJU3 1NA1C 4Q4Y1 2RS13 1PZ9A 1WW6A 1AX2A 2VVFA 5IK4A 4CDWB 4YVSB 2W39A 3D8CA 3AZYA 1LHOA 1A3KA 2B8MA 4GQ7A 4WM8C 3WV6A 1OI6A 1U5YA 3WOGA 1SCRA 2PFWA 1NCQA 4FOVA 1LRHA 2IXKA 1LHNA 3AYAA 3OTFA 2C5DA 4LBMA 3X29B 4TWTA 1PVC3 1RVF2 2PHDA 1XYNA 2R0FA 2IXHA 3TB0A 1FPN3 2RHPA 2ZKLA 4L97A 3AMMA 4OZXA 4TSVA 1DGWX 3FUQA 1YJKA 4EN0A 3IM0A 5L19A 2WZR1 1O7FA 1QDOA 3FBYA 4JC1A 4QPYA 1UCXA 2DCYA 4IV1B 3NV4A 2CY6A 5FLIA 4AWDA 2QQPA 1D0GA 1KDKA 3B00A 1NA1B 1YFYA 1ZRFA 4KWJA 3RJ2X 3KT4A 1MEC2 1VRH3 4AEMA 1HV1A 4RGGA 3L2HA 3APBA 3M1HA 2EXJA 5JR7B 3T1MA 4CEYB 3A4UA 2A75A 2XUMA 3KGLA 3KMHA 1CJPA 4X6RB 1ENRA 4P9JA 2WNUC 5DZFA 2D3RA 2I07B 1LGNA 5T50A 4AEDB 5F9TA 4AQ6A 3U0ZA 1AL21 3O0WA 4KH9A 4S2GA 1OSGA 2NYYA 1KFUL 4CEYC 3WT3A 1H1IA 2CWMA 1DLLA 4JGYA 3VBSA 2GNDA 2XBO1 4FTBA 1JXNA 5A3MA 3VV1A 1EPWA 1RUC2 1OA2A 3OY8B 4GIQA 4HSJA 4D69A 4OULA 1QMJA 1UIKA 2HWC1 4ZU4A 2WC2A 5SV5A 1S0JA 2HWC3 1XU1A 4OI1A 2VPVA 3AYDA 2DYCA 1Q56A 5JIUA 2JJ6A 4XIOA 4Y1ZA 4LNVA 1I3HA 2R071 4COYA 3PMSA 5D1IA 4B4QA 3VDDA 2RM22 3H1WA 4GWNA 1T6GC 1N3OA 1VBD2 2VOKA 1OPOA 1VB2A 5DDJ1 2PAEA 1C57A 2YY1A 1S2KA 2FMYA 4YARA 1G6NA 4FPGA 3FBMA 1WCDJ 1LU2A 3ZFEC 1UU5A 4Q0PA 4HLTA 4XF9A 1KD7A 3WDTA 4DINB 4M00A 5JOWA 5J96B 4HL0A 1BEV2 1LU1A 3VBHC 4HETA 1SFYA 1RUH1 3SXWA 5HCBA 5BXXA 1JUIA 2DCTA 1JYIA 4JVAA 4PDWC 1CAVA 2DVAA 4FXGB 5D8AC 1ULDA 3NKGA 5CBLA 3VUOA 1D4M2 2XLAA 3B3QE 4LUMA 4KU7A 1ASJ3 4YVWA 1RUC3 2VOVA 1WMFA 1DZQA 3VHRA 3H50A 4PIZA 5I8TA 1FOD1 1HW5A 2WLPA 1V6MA 5IK8A 1FYUA 2GDFA 3ZYIB 3MDPA 5D8AB 5FQ0A 2WA4A 2SBAA 2ZGTA 4HK8A 4XHBA 5AVAA 4ZXKA 3B02A 3JBG2 2NQYA 4H3WA 5J48A 4P14A 4Q0SA 3JD72 4EWDA 1S1AA 5JZGA 1MVEA 1CR7A 3VDDC 2A5ZA 4Y20B 1OQ1A 1H1AA 1RC6A 3SCHA 3WLUA 3ZXGA 4XW3A 3VZLA 4BCUA 4XXAA 1YYNA 3D0SA 3GBGA 2WNUA 1AR71 2IXLA 3VBUA 3ZYRA 1TME1 5BNPA 4Y26A 1I6XA 2NP0A 2IXIA 2QZ2A 1FPN1 5FMOS 3ZN6A 1RUOA 1H2MA 4WBBA 2PQQA 4Q4W3 2OZJA 3U10A 4FCAA 1W6NA 4CP2A 3KT1A 3FC0A 4I3GA 4O9GA 1NYWA 1RIRA 4GMP3