2O8QA

Crystal structure of a protein with a cupin-like fold and unknown function (bxe_c0505) from burkholderia xenovorans lb400 at 1.55 a resolution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
129
structure length
122
Chain Sequence
GMKLQTTIQHEPKDGSGFDRREFFEYRDTGVNEATGGMFGAHVIRAIPPTWHTHTVGFQLFYVLRGWVEFEYEDIGAVMLEAGGSAFQPPGVRHRELRHSDDLEVLEIVSPAGFATSVVDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title Crystal structure of hypothetical protein (YP_555756.1) from Burkholderia xenovorans LB400 at 1.55 A resolution
rcsb
source organism Burkholderia xenovorans
molecule tags Metal binding protein
total genus 23
structure length 122
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2o8qA00
3LZZA 2VECA 2IXIA 1YFWA 4META 3O14A 2FMYA 1X7NA 4XFCA 2BNNA 3QACA 4JTOA 3H50A 1WA4A 2Q4SA 4HVOA 1SEFA 2GC2A 3H1MA 3DKWA 3ZDSA 4R52A 3CLPA 1HW5A 1J3PA 4XFIA 4BYYA 2IXLA 4IETA 4HMZA 3ETQA 3MYXA 1EP0A 2PA7A 3H1WA 3RYRA 3FE5A 1FT9A 5BUVA 3M70A 4QGNA 3M3IA 4L2NA 5FDBA 3USSA 1LB2A 4IEUA 4J1WA 5FQ0B 4QGLA 4PIYA 4EWEA 1IPKA 4IEXA 3NSTA 3C3VA 1YHFA 3D0JA 5J7MA 2PAEA 1WGPA 2QNKA 2Z2SB 3I59A 2OZ6A 4MV2A 3H9AA 1ZZBA 4WVZA 4OLLA 2EVXA 5BV6A 2XLFA 3SXWA 1ZRRA 3HQXA 4QX5A 2V09A 2DCTA 5BPXA 5C6CA 3DN7A 4IESA 2BGCA 4LUKA 4I0BA 4KWJA 4LULA 4UBHA 4E2GA 4NVPA 1QXJA 1PM7A 3TNQA 2QVSB 2UYAA 4QMAA 5E16A 4AVAA 3SCHA 1ZRDA 1TQ5A 4MUVA 5J3UA 4FAGA 1UIKA 2HJIA 4IEQA 2CV6A 2Q1ZB 2O1QA 1O4TA 4IEOA 4EWDA 3I7DA 4KWLA 5KBFA 3RNSA 4X6QB 3CEWA 4QM8A 2MHFA 2XGXA 2C0ZA 1O5LA 2EAAA 2GC1A 4P9GA 5JSRA 1J59A 1QWRA 3FFQA 2B8MA 4O9GA 3FX3A 5D1IA 3NKTA 4TLFA 3NJZA 1OD5A 3I59B 2PAMA 2GZWA 3I54A 5CVRA 1EYBA 4LEJA 2XHKA 2K9ZA 4EROA 5LRRA 2UYBA 5J48A 3E5QA 4HVRA 1ZX5A 3BPZA 3SCFA 1LR5A 3OCPA 4IEVA 5CU1A 4KL1A 1CAVA 3VHRA 4MGKE 1RL3A 3H3UA 4AVBA 3GYDA 4KWKA 5CADA 4HLTA 4EWAA 5KHIA 1FXZA 3ACLA 2OYZA 2ZCWA 2MPFA 2GC3A 4FT8A 2OA2A 5I93A 4EV0A 4A2UA 4AQ2A 3FJSA 4N9IA 1FI2A 1H1IA 1GQGA 2N7GA 4IEPA 3BU7A 4XFFA 3H1YA 3B02A 3KGLA 5I0RA 5JSPA 5LEKA 4PJYA 3KSCA 1YUDA 5E1RA 1ZZ6A 3CF6E 2UY8A 4XFHA 1O3SA 4Q0UA 1ZZ7A 5JR7B 2XKOA 2I45A 2BYVE 4BH9A 4L11A 4N9HA 3RZZA 4JVAA 4I02A 2IXCA 1J58A 4MGZE 3E5XA 2Q0AA 2QCSB 3KMHA 5KHJA 1Y9QA 2XL9A 4E2SA 3UKTA 1XE8A 4GULA 2D5HA 2IXKA 2PYTA 4Q0PA 1UCXA 3OF1A 4ZU4A 3BCWA 5KHKA 2ET1A 3KGZA 5I0SA 4DINB 2KXLA 5FLHA 3HIFA 4Q0SA 2GAUA 1CAVB 3NVCA 1Y3TA 3WW4A 3E5UA 4X6RB 3D82A 4I2OA 1NXMA 4XF9A 1NE6A 1VP6A 3IIAA 4KU7A 2HKXA 3ES4A 4UBGA 5JSOA 4Z07A 5FCCA 1OFNA 4E2QA 5FLJA 4ONUA 2BEOA 4ORFA 1CGPA 4BHPA 3WW2A 4HN1A 2PHDA 5I0UA 3RPQA 3IDCB 1YWKA 3E6CC 3H7JA 1UPIA 5KHGA 2D93A 4F8AA 1DZTA 3CJXA 3D0SA 5FLIA 1X82A 4Z82A 2Y0OA 4XF4A 3IDBB 1RUNA 3ROUA 1UW8A 3ST7A 4XFGA 3UKVA 4F7ZA 1O3RA 4KU8A 2Q30A 2BNMA 1RTVA 2ETEA 1O7FA 3EJKA 5I8TA 4XF3A 1NYWA 1ZRFA 2O8QA 4WBBA 3BALA 1OMIA 3MDPA 1CAUA 3QOPA 2OZJA 4FBFA 2OPKA 4IERA 3BB6A 1DZRA 4BIFA 3G7DA 3R6SA 3OGJA 1H1MA 2XL7A 3HT2A 4YSFA 3SHRA 4AVCA 1ZRCA 4XF0A 1SFNA 2B9UA 1CX4A 2D5FA 1O3TA 2CGPA 3NW4A 5LEJA 2D40A 4AXOA 1Q43A 1ZZ8A 2ZKLA 4YRDA 2IC1A 5I8YA 2H0VA 4LTAA 4YYOA 3PNAA 3EQEA 1G6NA 4Q0QA 2XKPA 2K0GA 5FPZA 1DGRA 5K8SA 4UXAA 3OD0A 4WZCA 3KCCA 4IEYA 1WLTA 5BY5A 4LA3A 2ET7A 4HZFA 1LRHA 2GH2A 3MPBA 1EY2A 2ATFA 2E9QA 4H7LA 4LLOA 3TNPB 1J3RA 1LKNA 5EFUA 3LAGA 1CAUB 4JTNA 3S0MA 2WC2A 2VQAA 1NZCA 3DL3A 4PIZA 4K8FA 5EZWA 1X8MA 2WFPA 3H7YA 3EO6A 1EPZA 3L2HA 4RD7A 1GQHA 3EBRA 4HBNA 3NL1A 4MGYE 4QGMA 3U0ZA 3LA3A 4MX3A 3E6DA 4FAHA 3HT1A 1UIJA 1I5ZA 5F1RA 4LA2A 3ELNA 5HI0A 2F4PA 3OTFA 4I09A 1JUHA 2PHLA 4QM9A 3S7IA 1SQ4A 1U12A 3LWCA 5JAXA 1UD1A 4B29A 3WW3A 3FWEA 1Q5OA 4J1XA 3WW1A 4AQ6A 4ZU7A 4Q0VA 2PTMA 5KHHA 1RC6A 2P17A 1RGSA 1J1LA 4XEZA 1YLLA 2B5HA 2PAKA 1VJ2A 3FZ3A 3RYKA 1DGWA 3E97A 4MZUA 5AVPA 4OFGA 3RDIA 2FQPA 3H3ZA 2CAUA 1V70A 1CAXB 2GC0A 1ZZCA 4YARA 3JZVA 2QDRA 1CAWA 1QY4A 2EA7A 2H6BA 1ZZ9A 2PFWA 1YFYA 4IEZA 4XFBA 4HN0A 1VR3A 1IPJA 2IXJA 1J3QA 4I0AA 1RUOA 3EHKA 1QXRA 3LA2A 3LOIA 3FHIB 4ZU5A 2XLGA 4IEWA 1NE4A 2GU9A 1L3JA 2XLAA 1I6XA 4D7SA 3SCGA 3H8UA 2CAVA 4XF1A 5JCTA 3U11A 4YNIA 1ZREA 1Q3EA 3N4MA 1PMIA 3ES1A 5FPXA 1OI6A 3CL1A 2MNGA 3E6BA 1O5UA 4XFAA 4O9EA 2IXHA 2BNOA 3LA7A 5T3NA 4XETA 1ZNPA 3IWZA 4CYDA 2UY9A 4D7TA 3CO2A 4R8HA 5C8WA 3MZHA 2H6CA 3IBMA 4PIXA 4I3PA 1ZVFA 4MGIE 1YFUA 3UKNA 4HSJA 2PQQA 5BXXA 1XE7A 1X8EA 4JV4A 5FQ0A 5I0TA 5I8SA 3DV8A 3PLQA 5I91A 2VPVA 3S7EA 4HSLA 5LRSA 2Z69A 4MH0E 4QXKA 3U10A 3GBFA 1CAWB 4Q29A 4LUMA 1YFXA 2QJVA 3RYPA 4HVQA 3PVBB 3SMHA 4I01A 1XRUA 1CAXA 1O3QA
chains in the Genus database with same CATH superfamily
1JOPA 3D8CA 2PHTA 1O6UA 2WRAA 5A1FA 4JDMA 4Y1XA 5A1AA 1C8M3 2R32A 2VZ3A 1LODA 5G04L 1HKDA 2EIEA 2FMYA 1X7NA 3NWKA 4BZ4A 1WA4A 2GP3A 3AP7A 1WBFA 1GYKA 4WVVA 2Q4SA 3K4ZA 1H6YA 4GWMA 1SEFA 4HVOA 3I3EA 1Z7S1 4RS5B 4DMIA 5DUVA 2DVDA 3DKWA 3PTYA 1H8TB 4AEKA 3VL9A 4R52A 4JCKA 3ZXFA 1LEMA 4Y1YA 2ZZJA 3V0BB 1R093 3OGGA 1DGLA 1KXGA 4QPIA 1CZTA 3WNXA 3TN93 4CP2A 4CRQA 1XNCA 3WG1A 5CEHA 4PQQA 3OYWA 4B1MA 4B7EA 4K40A 1LHOA 1COV3 1EP0A 2ZX2A 2JICA 3RJRA 3FE5A 2WLQA 4ISRA 3PL0A 5M0TA 4LJHA 3ALQA 5CAZA 1K5JA 5FDBA 1V9U2 3OY8A 1TZOA 1RMU3 2R6QA 2J1SA 2WO3A 3AMQA 4CTEA 1LB2A 2KD7A 2D97A 4EWEA 2ZMLA 3RZGA 1FOD3 2JD9A 5JZGA 1N3PA 2WL1A 4Q8LA 2W95A 5J7MA 1W9FA 2W46A 1OLMA 4IE6A 4M3CE 4Q4Y2 5JIUA 5A1LA 1LHWA 3WDUA 1W8ZA 2UWAA 3MIBA 2VMEA 3KCXA 2SBAA 1HB2A 2VNRA 4ARXA 5B2GB 4OLLA 2EVXA 3AP9A 3APBA 4FPGA 3RI9A 1VRH2 3N9PA 4XW3A 2W1SA 4XTMA 4QX5A 5F5IA 1APNA 4LHKA 5KR7A 1N47A 3UYJA 2A6ZA 5FZDA 3VZMA 5D8AA 2QTWB 5DAPA 2K46A 2VZSA 4FPHA 1VBC2 1WMEA 3SH5A 1AX2A 1O59A 2UYAA 4HKOA 1V6MA 3K4AA 5FREA 3POSA 1KFXL 3UJQA 4AVAA 3O1MA 1LAJA 3K48A 1AYN3 1AR81 1NX9A 3ZIWA 3I97A 1D0HA 4MUVA 4A7KA 3M1HA 1UIKA 3WF0A 5BNOB 4Z92B 4CCMA 4LBMA 2WWUA 2Q1ZB 1AL23 2O1QA 4N90A 3RG0A 3JD73 4A7ZA 5FKCA 3FBYA 1IG3A 1W03A 4K1YA 5KBFA 1HQNA 1QMJA 3J7MA 1BCXA 4X6QB 2F17A 2BOJA 1PMJX 3CEWA 3JXSA 3K51A 4QM8A 2QQPA 5A33A 3LFIA 3HPNA 2C0ZA 4OVEA 4PLNA 4PDWA 1O5LA 2ORZA 4DXRA 3KWVA 3JBG1 4FFGA 2QQOA 1HV1A 2WZR2 4P9YA 4XHXA 5A32A 5JSRA 1QWRA 1QHDA 3FFQA 1DG6A 3P6BA 2RVAA 2PN5A 2ZA9A 3NKTA 5A3LA 3NJZA 1PVC2 4XHBA 3I59B 1JODA 2CTVA 2OVUA 4DRRA 4GXLA 1QH6A 3C8XA 4OUEA 4Q4X1 2K9ZA 5BNNC 3J8F2 1PNFA 1UYXA 3VBUA 4K7JA 4G9SB 3HWJA 5LRRA 4CEYA 1K5MB 3BGAA 3W20A 4BXSV 4OULA 5DQ0A 3Q8CA 3Q9OA 3AB0A 4QB1A 2VQTA 4IEVA 4JC1A 1WW6A 1NQDA 2HEVF 4NMIA 4NHXA 2FDHA 5JXHA 1ENQA 1VMHA 4QB6A 3VHRA 3RZKA 1X33A 3O0VA 2Y6FA 2GH8A 3HMYA 4KBBA 3ZSJA 3GYDA 1PNGA 1ALYA 1FXZA 1A8DA 3ACLA 5GZFA 4CPBD 2ZCWA 1H2KA 2XXZA 4FT8A 2OA2A 3DPRB 4WM8C 4BLJA 1SLCA 5I93A 5DUXA 3PMEA 2XBO2 1DYKA 5FY5A 3AJZA 4XUPA 1DDLA 3ZYPA 4MXWB 1NY71 1FI2A 4HOOA 4IEPA 3NJVA 3G6JB 2ADDA 1D0GA 3ZDVA 5IFTA 3B02A 3KGLA 4FPFA 2AREA 2DBNA 3JU9A 4QX2A 3HR9A 1OF3A 3KSCA 3OEAA 4QX7A 1YUDA 4ISQA 3ZSLA 4XBNA 4RGAA 4Q0UA 3VDBA 2XKOA 4TYSA 5FZIA 1GP5A 4ZZ8A 2BYVE 5DZEA 5IVCA 4NROA 2YU2A 4DXTA 4JVAA 1LGBA 4MGZE 4BCUA 4WVMA 4OHZA 1W2NA 2R061 2QCSB 4QXCA 3ZYIB 2KR2A 4IV1A 4P9IA 3V56A 4RL7A 4KH9A 3LPGA 1GLHA 2ZGNA 4GB32 4QPGB 1RVF1 5FZOA 1T6BX 3CHXA 2ZPXA 3HBZA 4R4XA 2A6WA 1G9FA 3F95A 4YVWB 2OT7A 1QJY2 3B01A 4C0BA 4NAOA 2IXKA 3VZNA 4CSWA 2JG9C 4YVSB 4ZU4A 5KHKA 5IT6A 1IKPA 1AL0G 3KGZA 4NIAA 2W2IA 3CZUA 1NCQA 4LK6A 4CDWB 4GALA 2A3YA 1RUJ2 1F15A 3LPFA 4NHLA 1V6KA 2GAUA 2UU8A 2C9KA 1YC61 3I8TA 2OQ7A 4AFDA 4KWUA 5K0UC 1AUYA 3AMNA 1W6MA 3AMHA 4HK9A 3GZAA 4XBQA 3ASIA 4E4ZA 2FCVA 5JSOA 5FCCA 1PMHX 4ONUA 3RSJA 1OT5A 4FPKA 4N43C 3THDA 4BHPA 4XUOA 4COVA 5A70A 3LEIA 2PLV1 3VHNA 1SMVA 1AR71 1C3HA 3WY6A 5IVBA 2DCZA 4Z2WA 5FY4A 1F9KA 4F8AA 5ANNA 5FY9A 1WCDJ 4PHZA 4Y20B 1RITA 3WDXA 3D0SA 4LORA 1D4M1 2HWF2 4Z82A 3DKQA 2GNBA 1WMFA 4HETA 4CCOA 2YPDA 3IZOA 3VZLA 3T30A 3M3OA 4RN5A 2XWBB 2VM9A 5GJ6A 3U4XA 2VCCA 1UW8A 1FMD1 2BQPA 5A3TA 3I3BA 3UKVA 1XYPA 3R0RA 2VOTA 5C8CB 4K9SA 5C9AB 3KCYA 1YI9A 1RTVA 2ETEA 1O7FA 3EJKA 5JLVA 4FCAA 1YIFA 3PVOA 5FJHA 1XNKA 1LHUA 4L0PA 4QB2A 2O8QA 4XBLA 3M2MA 1OMIA 5DPNA 3MDPA 1AR62 3UNPA 1BK1A 3N9OA 3QOPA 1MEC3 3VV1A 2OPKA 2AC1A 3ZFFB 4CCJA 4RS5C 3BB6A 1DLCA 1XU2A 1UOFA 5LASA 1S0CA 1HXS2 1H8TC 3H8XA 3ZYJB 3V65A 4LMFA 4BPZA 3U14A 5AFEA 3JUUA 3OGJA 1HIXA 4AGGA 3BTAA 1H1MA 1X9TA 2ZGTA 4MOAA 4Y3OA 4BQ2A 4YSFA 2V4VA 5L19A 3ON7A 3RMYA 2RM21 5BNNA 4NR1A 2P37A 5CFDB 5K4LA 4QX1A 1L7QA 2DUQA 2IVJA 1CX4A 2D5FA 1QJEA 1WKYA 2BVVA 4FPJA 2DYCA 3VBSB 4D7YA 4V1PA 2ZHKA 4CUGA 1XNTA 2EXHA 3VB9A 4D6RA 2H0BA 4OZOA 5E6HA 1UKGA 3I2DA 2VVEA 2JXAA 5ACA3 4DY5A 1JZ4A 2P2KA 4U2AA 3NAPC 3EQEA 1IS5A 2NMNA 2VTXA 4LNVA 2WNEA 1DFQA 1MS0A 1C57A 4OYUA 2WAOA 4E8DA 4Y5SA 3AL5A 2RR11 3LDKA 5FMOS 2VBDA 4XC9A 3SQOA 4IEYA 4D0QA 1US2A 2X10A 1SZBA 4XQ4A 2VBBA 3WDTA 4LBQD 5CG9A 2C24A 1W9WA 4BK4A 4HZFA 3K2OA 4W50A 1OPMA 2GH2A 5GZEA 1W8FA 4IV3B 4TZDA 1Y4WA 5HCFA 1EY2A 3O0WA 1W39A 3TRSB 1UU6A 4AGRA 4Q4W2 5F6KA 4CZSA 1A3KA 1J3RA 1YI7A 3MIFA 3NV2A 4AYUA 1VMFA 1RHI3 3RWNA 3SXWA 1OH3A 2VZTA 4CP9A 5T5OA 2NPIA 1OPOA 1PGSA 4JAAA 3OGSA 5FZ1A 3MEPA 4PIZA 3VKMA 4IXLA 1NA1B 2B9VA 1D2QA 1NG0A 4S2DA 5EZWA 1KRIA 1V6JA 3WHUA 5HV0A 2VZOA 3I3MA 1EPZA 3L2HA 1OH4A 1YIPA 2RV9A 1BEV1 4BQ4A 2CDOA 3T2TA 1FNZA 4JGZB 3EBRA 4G3YC 2VOWA 2VULA 4MGYE 4QGMA 4CP0A 4CUAA 3KHCA 3O1TA 3E6DA 2VMGA 4LBOA 5BNQA 1UAIA 3FUQA 1UIJA 1I5ZA 1PK6B 4AG4A 4EZHA 3VBFB 2JG9A 4CCCA 4IE4A 3FFZA 5CFCA 2X29A 4P00B 3D3AA 4D8MA 3LIGA 1MS4A 1JUHA 1QH7A 1W99A 2YC2A 3IM0A 3NKGA 4C8DA 2R1DA 4UFIA 5A7NA 3T0BA 3P5BA 5K0UA 3WW3A 3FWEA 3WW1A 4WM7C 5JXGA 3AKQA 1AZDA 3BTZA 1OUSA 4Q0VA 2WS91 2PTMA 1WCUA 4MSVA 1RUH2 2J1EA 3WQ7A 4AFCA 1XJAA 1NOVA 5FZCA 2RMU3 4YG3A 3I2GA 1OA2A 1PO13 1VAVA 2P6CA 3LEGA 4LO6B 1F31A 4XEZA 1YLLA 2WKKA 5FZ6A 3VZJA 4D6SA 2PAKA 1VJ2A 3RYKA 2KA3A 2WABA 1N3QA 3TEYA 5IK7A 1ENSA 3ZYRA 1VAKA 1K5MC 2VGDA 5HV4A 2WZ8A 5FYVA 4RR3B 1GNHA 1WW5A 2CAUA 2ENRA 2GC0A 1QIQA 4BK5A 1XNAA 2GMPA 1CIYA 1HB3A 2OPWA 1SLBA 3JZVA 2VD7A 1CONA 4R4ZA 3WP3A 4CXYA 1QY4A 5GALA 1IPJA 5LEKA 2HWE2 4I0AA 3BUCA 1GICA 2XOMA 1R1A2 2YU1A 5F3EA 4LKSA 2VZ1A 3FHIB 4JGYB 3GALA 1TME3 5GLZA 4EQVA 2GNTA 2GU9A 4FXGB 4LHSA 4XABA 2PMWB 1V9U1 5JUVA 4Y33A 5EJ1B 1DIWA 3VGIA 4KNCA 5CKQA 3H8UA 1DQ0A 1DZQA 2OUJA 2TBVA 3HAGA 1UWWA 3POBA 3OGRA 3A4UA 4MHRA 4Q4Y1 1Q56A 4RHV3 1O8PA 2F4LA 1OC1A 5CIRA 3N9MA 2W1QA 5HXVA 2YUEA 3M8LA 3GHMA 4IE5A 4ASKA 5FRAA 4RS5A 4CCLA 3IT8A 3AMMA 1OI6A 1H8TA 1QOOA 2DURA 1VRH1 3V0BA 2J22A 3NV4A 1ULCA 1UX7A 5FZ7A 4H3WA 4XETA 3WLUA 4C91A 2VAUA 2YG0A 2ZGSA 5JPNB 1C28A 3B7MA 5FUIA 4D7TA 3CO2A 4M0NA 2X8KA 1DU3D 1HQWA 1ODNA 2WFF3 2H6CA 3IBMA 4XXAA 4B3NA 4BA6A 4FPEA 1E5SA 5FWEA 4YVWC 1WCKA 5GM0A 5A7SA 1I5PA 2BU9A 4G4FA 5IK5A 4YVSC 1HJFA 2QZ3A 4HANA 2VBPA 5FOBB 4JV4A 4LE3A 2EIGA 3CJIB 1F2NA 4QX3A 2RJ2A 4CDWC 4U36A 1PZ9A 5AFBA 1FPN2 1WW7A 4LBQB 4W6YA 2AZ5A 3WP4A 4FO9A 3HJRA 1OKQA 1AX1A 3PLQA 2WQ8A 2VPVA 3Q8AA 3UK9A 5F6LB 4OI4A 3EB7A 1VE0A 2P6HA 4RSUA 2RS52 5LRSA 3U10A 4YLZA 2C9AA 1W6OB 5IATA 3FBMA 4AI1A 3H8OA 1YFXA 4P5YA 4OHVA 2VZRA 1VBD2 5FY8A 3SLIA 3NJYA 3OEBA 5CG8A 2A6VA 5FK7A 2DF7A 2A6XA 4XDPA 5FUNA 3VN4A 5IVFA 1AYM3 1W06A 2ZEWA 3OOXA 4DUXA 3FLTA 1TMF2 4META 3WV6A 3ZN5A 2WZR1 1VBE2 3K3OA 4Y1UA 3AZWA 4QT6A 1ZBE2 1UYZA 4YGCA 5E8AA 3WNKA 3NNMA 1KJRA 4XFCA 4YPJA 4AOCA 1O4ZA 3H50A 4UOJA 2WBKA 3WHTA 3N9LA 1PVC1 3UT0A 5EHDA 1BK0A 1IPSA 5FOJB 3O1OA 1JW6A 5A6QA 2YC4A 3KHBA 3JQWA 1PO22 2P4EA 1CD3G 1JZ3A 3J8F1 2LRPA 3CLPA 4JKMA 4XAEA 1HV0A 1G9DA 2WNUC 5BNOA 5JOYA 4BQ1A 3I2KA 3I2OA 5IYYA 1C8M2 1J3PA 4YM2A 3CMGA 5E88A 1ACCA 3KV5A 3PUSA 3ZFEB 4XFIA 2VUAA 1NUKA 4GWIA 4TN7A 1LHVA 1Y9GA 1UZWA 2Y6GA 5H9SA 1AJKA 2VMDA 2YGLA 3T3YA 1W6NB 3ETQA 3MYXA 3AMPA 3H1WA 3RYRA 2XPJA 1RUD1 1W2AX 1GFF2 3UV9A 3M70A 1DQ5A 1HX6A 2A5ZA 2GN3A 4L2NA 3B69A 2JDAA 1R092 2VO5A 2YV8A 3USSA 5IAVA 4IEUA 1NCRB 3AK0A 4QKFA 4J1WA 3IAPA 5A3WA 3MIHA 3ZFFC 4QGLA 4DEVA 5D2AA 3TN92 3U78A 1IPKA 2WWJA 1YO8A 2EIBA 2PHUA 2XBO1 3C3VA 3DYOA 2W52A 3MO4A 4WM8B 5JI9A 1COV2 1HQLA 1FX5A 2QNKA 3I59A 1URXA 5LA2A 5HCHA 1DGRN 4S2HA 2X09A 4YW2A 2OZ6A 3SKVA 4FFHA 1ZZBA 1SCRA 2R49A 2XJTA 3GHNA 5CFDC 4Q4X3 3PVEA 1BVP1 1RMU2 4Q5OA 1K5MA 1KD7A 1QDOA 1XYNA 3HQXA 5FYBA 4QX0A 1WBLA 4DXZA 2V09A 3BOWA 3CQOA 3ZXEA 2DCTA 4A7YA 3WG4A 1FOD2 2FCUA 3T0AA 5JOXA 2BGCA 3T09A 1PIV1 4I0BA 5JXIA 4FTSA 4UW5A 4ZPIA 3B9IA 4P9XA 4UBHA 4NVPA 4WZFA 1REDA 4LITA 5LBBA 4AFAA 5C3PA 1PM7A 1BVVA 1LTEA 2QQJA 3TNQA 2D44A 2Q5TA 5E16A 2D43A 4GB31 1YRZA 4LHNA 3SCHA 3V64A 1TQ5A 1YJLA 2D3PA 3KD4A 4NAMA 4AI8A 3DPRA 1XSRA 1QJY1 4FOWA 3PJYA 2K2SA 4PI2A 1VBA1 1PM4A 2ZX0A 2BV4A 1OQEA 1S2KA 2HWD1 5BYNA 1Z0HA 4MXWA 1RUI3 2QQMA 2CV6A 5DG1A 5FYSA 4XJ8A 5HCAA 1W0NA 1O4TA 1RUJ1 2QQKA 3DECA 4IEOA 4Y5Z0 4EWDA 4IV3C 2DTYA 3RFRA 3ZXJA 1NKGA 3I7DA 2MEV3 4A45A 1AYN2 1ZBA3 2E32A 2ILMA 2ZXQA 3NRUA 3OBTA 4WV8A 5FYHA 3UL2A 2E51A 3WT3A 4URAA 5T5PA 2V72A 4P9GA 5KWRA 1RUC3 4IGOA 4BIOA 1AL22 2E31A 2LUWA 2R071 1NA1C 1NLSA 1UY3A 3AFKA 3HEIA 3JD72 3OPZA 4IE7A 4TXWA 5ANQA 5FO9B 1EAH2 4NJ4A 3VUOA 1RUF3 4H7MA 2GZWA 2VQUA 3N7KA 4QPGA 4AFMA 1VLNA 4JGZC 4TWTA 1D7PM 1Y7BA 2WO2A 4YVWA 2NN8A 5FZEA 3ZPOA 2B46X 4NE9A 1PK6C 5IK8A 1IZ3A 3VBFC 1W04A 4YVSA 2Y33A 2HWF1 3POYA 3BPZA 1KJLA 4CDWA 3PTRB 4HFSA 2ZAHA 3OCPA 4QHZA 4NWVA 1P8JA 5CU1A 1QOTA 4KL1A 4CDQB 2FCTA 3WOGA 3B5LB 4YZ4A 1Q8PA 1BMV2 3OBRA 4V2WA 4URTA 1STMA 5CADA 4HLTA 3JQXA 3M7AA 2VH9A 2VUJA 2YB7A 4LO5B 2JKXA 3WP5A 4LOTA 2VNOA 1HB4A 1HN0A 1UOGA 1AR61 4QX8A 4AQ2A 4N9IA 2A70A 4NIGA 1B35B 5FYCA 4RR3C 1AR73 1HXS1 1W3XA 1RIRA 5I0RA 4OCTA 4Y20A 1VALA 4BQXA 2ORXA 5LBCA 1OLME 1ZZ6A 1JUIA 3AYDA 3CF6E 2UY8A 3KQ4B 3SC7X 4YFZA 5JR7B 1A78A 2I45A 4ZY9A 1A6CA 1UOJA 3I2FA 5LW9A 1K42A 3EYPA 3RZZA 1POV3 4HKLA 2VCMA 4A6SA 1EPWA 5IWFA 1J58A 1DLLA 4UF0B 1E5HA 4JGYC 4YW5A 3KMHA 5C8CA 1PGL2 1WLDA 2RDSA 5KHJA 2WYFA 5C9AA 2ARAA 4WVWA 2AACA 2G4IA 2V5DA 2BFUS 3ACFA 3UKTA 3LIHA 1XE8A 5IW0A 4GULA 4LIVA 3QBQA 4GMP1 3N7JA 3NAPB 2Y6HA 1XXNA 3ZFFA 2KXLA 4CVUA 2A75A 4YGDA 2QE3A 4M0HA 5TSWA 4AHXA 3VD4A 4NRMA 3WQBA 3NVCA 3LEMA 1Y3TA 2A7AA 2Z42A 2CDPA 3AC0A 3R4DB 2JDHA 4DUWA 4LKDA 2JDPA 1GZTA 5FYMA 4BQWA 1S0JA 4AGVA 3GJAA 1WLWA 3C7FA 1DF0A 1OF4A 2LM3A 4XDQA 5CFDA 4DZGA 3ZKUA 2A71A 2PXJA 2RM23 4AVVA 1Q8OA 4E2QA 5FLJA 2BEOA 1YJKA 4Q4W1 1S1AA 1E57A 3VBSA 1CGPA 4CPBA 5I0UA 3RPQA 2QZ2A 3W58A 3ZXAC 1CZVA 5LA9A 4C1WA 4AEDA 2ZJCA 2QQNA 3CJIC 3DXUA 1UPIA 3H7JA 4O7XA 4UI9L 1U5YA 3LCPA 4UW3A 3RJ2X 2B7YA 2D93A 2P5BA 3ILFA 4RGGA 5KHGA 4GH4B 1N1VA 3MV11 4LO4B 4KBZA 2Y0OA 4BMEA 3IDBB 1V6NA 2XJQA 3OBZA 3PHMA 2GP5A 2VW2A 3VDAA 3B94A 3VBRB 1JYVA 4UWDA 1RINA 2E7QA 4F7ZA 1TG7A 4L92A 4XJWA 2BOIA 4IV3A 2I74A 3WVJA 2FZ1A 5I8TA 2LTNA 4OUSA 1IQDC 1NYWA 1SFYA 1ODMA 2ZZQA 4YW3A 5JDBA 1ZRFA 4GD4A 1I3HA 2HH9A 4WM7B 1RUH1 3WNNA 1OUXA 2OW4A 1HRV3 1BHGA 2G9ZA 4LOSA 2OZJA 3KF5A 4RFT0 5FBJA 5L73A 2JJ6A 3T08A 4IERA 1JYIA 4INDA 2XWJB 4B1LA 1DZRA 3O1VA 2E26A 2QQVA 4P14A 2R042 4OZXA 1HRI1 2Y0IA 4NHYA 1FAYA 3MHZA 3HT2A 1WD3A 3ZFEC 4JGZA 3BYWA 5LY2A 1GP6A 1PK6A 1UY1A 1ZRCA 1MEC2 1SFNA 3VBFA 3CDZB 3B3QE 5FZHA 3IDEA 2G9GA 4B8EA 1AR91 3NW4A 4GKYA 1MZFA 1Q43A 3FLPA 4SLIA 4DY3A 4IGPA 4YRDA 4L97A 3EXUA 5KC5A 4CCEA 3P1IA 4QHBA 2HWE1 2ES3A 1TVGA 3FMGA 2XG3A 1NCRC 4YM0A 4HT1T 4DOUA 4LTAA 1R1A1 5KXDA 2HBUA 3UJOA 2JB4A 1ND3C 2ZHLA 4LR4A 2K0GA 5DDJ3 3VDCA 1DGRA 3DEMA 3PMSA 2D3RA 4AI0A 5GZCA 3N7LA 4WZCA 1GSLA 2IFWA 3T0DA 1ULOA 2C26A 1W6PB 1OD3A 2GALA 5BY5A 3HVDA 1OOPB 4Y26A 5F2WA 1LESA 1A8MA 2P1BA 5ACA2 4XILA 4ES8A 2EIDA 2R0FA 4Q4V3 4RR3A 1RUE3 3ENRA 4JHTA 3J7HA 2ZGPA 1H2NA 1M4WA 1JHJA 2A3WA 4OI1A 2ATFA 2VU9A 1RXGA 5FZBA 1S4CA 3TNPB 4K6BA 1LKNA 3DCQA 1DQ2A 1CAUB 3ZKYA 4QDSA 2HLEA 3SISA 3K75B 4EN0A 3S0MA 1XE0A 5B4XA 2QDNA 2VC9A 1K12A 2VQAA 3DL3A 1ZYBA 3AVRA 2YPJA 1W8OA 1U5ZA 2Y8KA 2E33A 3MI8A 1X8MA 2EF6A 2GSYA 2VUCA 3H7YA 3K46A 4JGYA 4P5HA 4PI0A 4DXSA 5CB7A 2C1FA 2ZABA 1OA4A 1RXFA 4RD7A 3R4SA 5ABJC 1MZ6A 3NMBA 1FPN1 2P3YA 4MX3A 1RHI2 2AGSA 4GZ9A 3BN6A 3L9JT 4HKWA 4JDNA 2VTFA 3WINE 5F1RA 2PHRA 5FUPA 4LA2A 3ZMNA 2FHRA 2P34A 2RS51 1JS9A 4HK8A 3T4HB 2F4PA 3J7NA 3WNMA 4AI2A 4CXXA 5HI0A 2PHLA 2YDEA 4QM9A 1SFPA 2WWSA 4W4ZA 1U12A 3S7IA 1S55A 4QKNA 1UD1A 1VBD1 1Q5OA 1PGW2 5G05L 3ZX7A 4XUTA 4NIIA 1WLCA 4AQ6A 4UFJA 2BDRA 1XU1A 2UWBA 3MIDA 5KHHA 3MF6A 3ZYBA 3GGLA 1GBGA 1TMF1 2P17A 4UT5A 4UFLA 3O1PA 1J1LA 3I2HA 1VBE1 1WUVA 5K9YA 4AI3A 1ZBE1 2GNMA 2B5HA 5GKAC 2PHFA 3AP5A 2J42A 3FZ3A 1DGWA 3NJXA 4MZUA 2RS33 3C7OA 3PUAA 5AVPA 5T54A 5T52A 3TBDA 3ZSMA 3P3PA 4GKXA 1UO9A 2FQPA 4NHKA 4R9AA 3CJIA 1JOJA 1PO21 2NZ9A 4LBQA 4CCNA 1V70A 1CAXB 1VAMA 2HWC1 3C2UA 3J26N 2NM1A 2RMU2 4JRAA 4YARA 5C5UA 1PO12 4CDQC 1C8M1 5F3CA 1WWYA 2QDRA 2WNUB 1X36A 5AC93 3VHPA 1W6OA 2UWCA 5FY1A 1ZZ9A 2WO7A 1YFYA 2W08A 4XFBA 4HN0A 1VR3A 1DBNA 4ATFA 1GOFA 2VCAA 2ZOEB 3DXTA 2W91A 3W5MA 1J3QA 3KM5A 4UAPA 5A7QA 5A7WB 3VKOA 3EHKA 3O5SA 1QXRA 4NUBA 3LOIA 1OFSA 1QJU3 3M3CA 2VOXA 4CU8A 2IZWA 3QD6A 1L3JA 4QKBA 1CN1A 2DUOA 1R091 2JDKA 3SCGA 3T2QA 4D7SA 5A3MA 5C3QA 1CWPA 2EXJA 3TN91 1B35C 2CAVA 4QPIB 2G1MA 4R9DA 4LHLA 4YNIA 5FMOL 4GQ7A 3N4MA 1J84A 3J9SA 5F8PA 4BXFA 4YW6A 2J1RA 4HPKA 4XOGA 3ES1A 3PUHA 5FPXA 1E5IA 3CL1A 1GZCA 2JG8C 1TME2 4NOTA 4XXPA 2X05A 2DU0A 2JDMA 2IXHA 3ABZA 1SLIA 4O9EA 5DUWA 3ZN6A 1RMU1 4QPYA 1W3VA 2B42B 1AVBA 2BNOA 2E6VA 4QXBA 4RA0A 3ZFEA 4JRLA 2W3JA 2CGOA 3IWZA 1V6IA 1RJ8A 2TUNA 1FOD1 2FDIA 1H1AA 1ULEA 1HDKA 4RHV2 1QJX3 2D98A 2AH2A 1D2SA 2LALA 2O0OA 2RHPA 5FMCA 4YZ1A 2DCJA 3PU3A 2OKXA 5CKNA 3NO8A 2TNFA 4FI9A 2FMDA 2PQQA 1W6QB 1XE7A 2Y64A 4HSJA 1LGCA 1RUD3 5EXOA 1NLQA 5FP8A 5JIAA 1ENXA 5FAXA 3PUQA 5IUQA 3EMRA 2XDVA 1NLRA 3MW2A 2LS6A 4H55A 3N3HA 2NLRA 3DV8A 2FDJA 2HEWF 4WM8A 2WFF2 3TOJA 4XUNA 5I91A 4HSLA 2WT1A 1GZ9A 2HWB3 3VD9A 4LUMA 1BLZA 3QH7A 2DUPA 2BBAA 2HBTA 3WNPA 5LCWL 1S0GA 1NXD1 4HVQA 5F3IA 3PVBB 3MLKA 1H2LA 4LBNA 5FJKA 3RRDA 1AYN1 5JR2A 3WNOA 2FBEA 4M3CB 5FYZA 2ZX4A 3LZZA 2X5IC 3POEA 4FSJA 2RS11 4Z1VA 4E8CA 4TSVA 1W0OA 3WF1A 1AL21 5C7GA 1PIV3 5FMDA 1JN2P 2BNNA 2JDUA 2W94A 4P9WA 1UY2A 2YBSA 5EPAA 4ZXEA 4K1ZA 3ZO0B 3S57A 1EAH1 2PELA 4DNYA 3VLBB 4CA9A 4GH4C 3BIWE 2CYFA 2GC2A 2VMIA 3H1MA 1KDMA 3WQ1A 2PQSA 1CVNA 5A3PA 2JECA 3ZDSA 3ZSEA 1JYCA 1AYM2 2VOKA 4DQAA 5EWSA 1LULA 3GDBA 4AEJA 4W65A 3ZVXA 4EN6B 1HW5A 3LE0A 1VBA3 3HQRA 3PUIA 3VBRC 3BU0A 1QJFA 5F37A 3IN9A 2HWD3 2WAAA 3O1UA 3PIJA 1ASJ3 1EUUA 1PVXA 4HMZA 4FPYA 2Q8OA 1U5IA 1GU3A 4LO7A 3AZZA 4IUGA 1BMV1 2W87A 1FT9A 4EN9B 1V00A 5BUVA 2DVAA 1W0PA 3U37A 3USUA 1J1TA 3AJYA 3R05A 4QGNA 5B4NA 3RZHA 3M3IA 3TEWA 1MQTB 1POV0 4COZA 5SV8A 3AX4A 2NP0A 4AL9A 2AENA 2VZQA 3OD4A 4KQ7A 2XHNA 4IEXA 5FZ0A 3FL7A 3NSTA 4N43A 4QHOA 3D0JA 5CZKA 1F5JA 2R073 4W8JA 4R9BA 4E27A 2PAEA 1QQP3 2OIIA 1WGPA 5FPVA 2Z2SB 3KS7A 1W8TA 1AXKA 4GA9A 1R083 1BBT3 2GMMA 4MV2A 4GAZA 1OXCA 4F3JA 4WVZA 3ECQA 4M4PA 4CUBA 1DCSA 2OUHA 2KM2A 5H9RA 4Y22B 5BPXA 3A23A 1AF9A 2BWAA 3DN7A 1VBB3 4IESA 5EJ3A 2RDRA 4EYUA 5C6CA 3KT1A 1RUG3 1EV13 4M00A 3ZM8A 2D7FA 4LULA 1CJDA 4CDQA 3C7HA 5C71A 4KMQA 2ZKNA 4E2GA 4ZKTB 1SDWA 1K45A 3SNMA 3CZJA 5IVVA 1PGL1 2QVSB 5LZ6A 4Q4X2 2R7EB 3JB4C 1HLCA 1YQ8A 3PU8A 1Z78A 1UMZA 4MG2A 4FAGA 3ZLIA 3AL6A 4FOQA 5FPAA 2WA4A 2QQWA 5FYUA 2VZUA 4AVTA 2WO1A 1OOPC 5DZGA 4TTGA 1GOGA 4QQ2A 3VDDB 1CIWA 2XVGA 1B35A 1S0BA 2ZEZA 4A4AA 2DWRA 1V6LA 3WR0A 2JE9A 3NV1A 5FKBA 3PDQA 2W1UA 2XJRA 3V0AB 1WMXA 3D4KA 4MGSA 3RNSA 4JHZA 1F8VA 1DQ1A 1Z7S3 3JCIA 2XONA 2UURA 5EYYA 2VNVA 5FP9A 2W92A 1VRBA 3ORJA 2EAAA 4NIHA 1RUI2 5CKMA 4CU9A 4UF0A 1NY72 1ULPA 2ARXA 4GJZA 4O9GA 4IQPA 3FX3A 3RQ0A 3I3DA 2QQLA 2ZX1A 4A3ZA 4ZHNA 4B4RA 2WINB 1OD5A 1LU1A 2ZGRA 4LBLA 4FQZA 2MEV2 1OURA 3I54A 5CVRA 1VBC1 1EYBA 3VD3A 1JTZX 1ZBA2 3MIGA 3A0KA 1N3OA 2EALA 5C33A 4CEWC 4EROA 1GKBA 3LQCA 4PBPA 4PF1A 1QDCA 3WCRA 5J48A 1UKRA 3NAPA 1O91A 1L7RA 1RUC2 2D6MA 2WQ4A 4C1XA 5L7OB 3MFCA 1LR5A 1O4YA 3W59A 4XMAA 4KG8A 1RUF2 2R1BA 5DAVA 1WD4A 3OPWA 3O1SA 3BKZA 4MGKE 2RG4A 3ACHA 4LK7A 1YQCA 3H3UA 1B09A 3ILRA 1Q8SA 4S2FA 4AVBA 4BU2A 5LA0A 1A34A 4S2GA 1AXZA 2XJUA 4L99A 2MPFA 4BOWA 4D69A 1JZ7A 4YWAA 2GC3A 1S2BA 3WQ0A 5FPLA 5FIXA 4OMDA 2VE1A 2WT2A 4A2UA 3W21A 5J36A 1H1IA 1GQGA 3WDVA 3LOBA 5C4WB 3BU7A 3GCWA 4FFFA 2C6SA 3H1YA 3IMMA 3AKSA 5FPBA 2R041 3AZVA 5KC6A 5JSPA 4QAWA 1MS1A 2WNOA 4NO4A 1IS6A 2VMHA 3AKRA 4PJYA 4FP3A 5E1RA 3OUJA 1AR83 4OQ9A 1OQDA 2NQYA 4B4QA 2Y6LA 1O3SA 1TNFA 1ZZ7A 1QXPA 4L11A 4N9HA 1MEC1 3H8RA 1UX6A 3M3QA 3HNBM 4MGQA 2R16A 4I02A 5FK8A 2P3IA 3VBRA 2XVLA 1MS3A 4I0WB 3N36A 1AR72 4CCDA 2NMOA 1DQ6A 1H30A 1Y9QA 4IW3A 1U5XA 5FZ8A 2XL9A 4E2SA 4BISA 3VKFC 1H9PA 1OVPA 1GWMA 5FV3A 4WM7A 4QPIC 2E53A 2YHJA 2W0XA 4XZPA 3WF4A 4AFBA 3JBG3 1BKZA 1ND3B 2DFBA 5IFPA 3ZFGB 4HL0A 5JMCA 3HIFA 3K3NA 4Q0SA 2W39A 2IFRA 1PX3A 4E4SA 3GF6A 5FZ3A 1CAVB 5ACA1 1L7LA 4Q1RA 4X6RB 3FN9A 1NXMA 5IVJA 4I2OA 1HRI3 2YXSA 4XF9A 1NE6A 2EXKA 3ZN4A 4OQ8A 4KU7A 3SEEA 3MV01 1RJ7A 5F39A 3ES4A 4X8NA 3WCSA 1NQJA 1OFNA 1VMJA 3HN3A 1W9SA 5F3GA 3T1MA 1IOAA 1LHNA 2V73A 2JE7A 2PHDA 2JDNA 2L9LA 3OG2A 2ZAAA 4HN1A 4LIUA 4AZZA 3RS6A 1HJGA 1AR93 1SDDB 3J7LA 2RJLA 3RMXA 1J83A 2XQRA 1X9PA 1YWKA 3E6CC 1SACA 2BW8A 2FZ2A 2GN7A 2CNAA 3AYEA 5GLUA 1JXNA 2WSUA 5FZAA 3ZYGA 4Y4RA 3DGTA 1DZTA 2YFZA 3CJXA 2O14A 2RM22 4LKFA 1X82A 3LEKA 5DN2A 4LT5A 1POQA 2DCYA 1G7YA 1F5FA 5D8AC 1RHI1 5ABJB 5K0UB 1W6PA 3CKHA 4XYXA 1MS8A 1FNYA 5FYTA 4MXVA 1RUNA 1QJZA 3ST7A 1OOPA 3LF7A 2A3XA 2WYSA 3I2JA 1XBFA 1UNBA 3X29B 2ZGUA 5HXMA 2D6KA 1O3RA 1XC6A 3B93A 4KU8A 2Z79A 3WF3A 3BTYA 3OPTA 2BNMA 2HYXA 4YGBA 2I2SA 1PGW1 1LGNA 1LOBA 1GP4A 1SBFA 1WW4A 2ZGOA 3MBWA 4Q2FA 4WBBA 5FZ9A 1CAUA 3HN1A 5IVEA 1F4HA 4K20A 4FBFA 3O1RA 5L9RA 2NYYA 5C70A 3MPPG 2VY0A 3KQRA 2R063 4UFMA 5L9VA 2DFCA 3ZOIA 3R6SA 4AI9A 2Q8EA 3PIGA 2E7TA 1RVF3 1W9TA 2XL7A 4RFRB 5CISA 4PDWC 1GWLA 4AAXA 1F35A 5A3OA 3UESA 2JIJA 1SPPB 3SHRA 2W47A 2B9UA 1HRV2 1UOBA 2RMU1 1O3TA 1PO11 4W6XA 5CA6A 2CGPA 3POFA 1O8SA 3KV9A 5LEJA 4FFIA 2D40A 1ZZ8A 4YM3A 2ZKLA 1BYHA 1PZ7A 2Q1FA 4XUQA 3OUIA 1MQTC 4LLFA 1QKQA 1BXHA 1UZYA 2IC1A 2ID4A 4DIQA 1REFA 4YYOA 3LDBA 1LCLA 2BFUL 3PNAA 4CE8A 4Q0QA 4CXWA 2ADEA 1W05A 1IS3A 2GDFA 5FPZA 4QKDA 2ZGQA 2YYOA 3OD0A 3LFMA 4Q1PA 1LOFC 3KCCA 1VIWB 3KV6A 1UY4A 3WG3A 5BNPB 4KG0A 4QQLA 1W8HA 2PLV3 1S2EA 3ZYFA 4N53B 1LU2A 2J1VA 1H9WA 2ET7A 4NRPA 4CDXB 4FOYA 4N7UA 1LRHA 4AK3A 2YBKA 1W2UA 4COWA 5DDJ2 4PF5A 3PJQA 4H7LA 1FATA 2JG8B 4LLOA 1D4M3 5F2SA 5FO7B 1U0AA 3O12A 1GQPA 3HOBA 1ULDA 2HWC3 2B4KA 1H8VA 2WNUA 5EFUA 3LAGA 3SH4A 2XQXA 5LK5A 4JTNA 3NNGA 1ZA7A 2YFUA 4UFHA 2WC2A 2CY6A 1SBEA 4RHV1 3AFGA 4Y1ZA 1NZCA 5A7WA 1FMD3 1AJOA 1SLTA 1LOCA 3HD8B 4K8FA 3ILNA 4Q4V2 1RUE2 4QXHA 1XOYA 2WFPA 3ZXDA 3RZJA 1Q8QA 1LOGA 4CUCA 5I0DA 1UXZA 1YCIA 4XJAA 1N1YA 1GQHA 3MLLA 1H0BA 2XR4A 4HBNA 4QQOA 3NL1A 3VDDC 4AQSA 1GWKA 2VZPA 3C7GA 4YZ5A 3WNLA 1UMIA 4DRVA 4PLMA 2WFF1 4Y5TA 5C3SA 1SLAA 4IV1C 5EV7A 3HNMA 2ZACA 5JI7A 3WG2A 5A3NA 1SQ4A 4A3XA 1YQ2A 5KXEA 3KF3A 1KS4A 1UPSA 4OI2A 3LGRA 1DGWX 3J4UH 3BTXA 1NT0A 3P3NA 1UY0A 4ZU7A 4XJ9A 3RZMA 1YQ6A 1NCQC 1F4AA 1RC6A 4MLOA 3SKJE 4HG6B 3MLJA 2V4AA 2X5IB 4BJ0A 4Y24A 3AZYA 1XYOA 3FLRA 3I2IA 4K3UA 4QU1A 3E97A 1W6QA 1KQRA 3N7MA 3W5NA 4OFGA 4AQTA 3I3QA 2VUDA 3MW3A 2WT0A 4FTBA 2W68A 5L7OC 3H3ZA 3A22A 3FHQA 5GLVA 3ZR5A 3MUY1 1AYM1 3IPVB 4AR2A 3MW4A 2RR13 2YBPA 3CBNA 2YMZA 2EA7A 2FDFA 2H6BA 3SEPA 1FV3A 2C5DA 2RS32 1DHKB 5E89A 5IVYA 1C5HA 2DVBA 1MS9A 3BOPA 1JZ2A 4V2VA 1RUOA 2BRTA 2WN2A 5EP9A 3AYAA 3B00A 4ZU5A 4M3CA 3S30A 2BERA 1NE4A 1YQ5A 4IEWA 4UYBA 1GUIA 1G9BA 1RYYA 4A41A 1I6XA 2VW0A 3FC0A 4H2AA 5AC92 1TEIA 2RS13 3KLSA 5C4WC 4PQ9A 1WCSA 3MUZ1 3RGBA 5JCTA 4FTEA 2WLPA 3C7EA 1ZREA 1OKOA 5FZMA 1NA1A 3WDYA 4Q27A 2DDUA 4XAAA 2WR9A 2VCBA 1EAH3 3N9NA 1I1EA 1QJU2 3ETPA 3FHAA 5LK7B 1YYNA 2CWSA 2VQ0A 3CNAA 5A6ZA 1O5UA 5DABA 1BEV3 2YROA 3QCWA 1TE1B 4XVHA 3UGFA 1MPXA 5T3NA 1ULFA 4CYDA 3U1XA 2UY9A 3TAYA 2RDQA 4R8HA 4XIKA 4DO0A 5A7PA 5A3UA 3MZHA 4PIXA 3LB9A 4MGIE 4BB3A 2XH6A 4N7IA 4ASMB 1RB8G 4AHYA 5BXXA 3CU7A 4JDOA 4YZ2A 1G8WA 4QWNA 3RZLA 4OI0A 4P02B 1MQTA 4FPOB 3MGUA 4LQRA 4J6GA 3ZFGC 4AVSA 4CDUB 4D3WA 2D3SA 2WS93 5JOZA 1MS5A 1US3A 1CQ9A 1YEWA 3OB8A 2A1XA 2CGNA 1QJX2 4NRQA 4CCKA 4EJRA 1OSGA 1QNWA 1LOFA 1CAWB 2B39A 2XJVA 3HQUA 4Q29A 2YY1A 3VBOB 3VKLA 4AW7A 2FDKA 1CX1A 4QQHA 1RUD2 1Q8VA 2VXRA 4KI5M 3RYPA 3L2YA 1MACA 2F6BA 3SMHA 4GMP0 2IWGB 2WA3A 2HEYF 2E63A 1JU4A 3Q8EA 5GLWA 3AKPA 3K4DA 4Y22A 3ACGA 5FXZA 2VECA 2IXIA 1VB4A 1GV9A 5DXDA 1YFWA 1UF2C 1RUI1 3O14A 1N1TA 2WNVB 2ZEXA 2HWB2 2ZHNA 4RQPB 5F5QA 1JU3A 3F2ZA 3QACA 4JTOA 3GM8A 4YGEA 4DEQA 1CR7A 4TLGA 1BQPA 1ENRA 4BQ3A 2MEV1 1QF3A 1ZBA1 2J7MA 1BZWA 3GBWA 1ZM1A 3VBHB 1QEXA 2IUWA 4XQWA 1NAEA 4Y1VA 1V9U3 2EAKA 4CEWB 1RUC1 3CIHA 1W8NA 1PIV2 1UZVA 4JQTA 3VDDA 3ZXKA 4BYYA 2IXLA 5IAXA 5KXBA 2LW8A 4IETA 5EQUA 1MZ5A 4MVTA 2CHHA 5T5LA 3HNYM 1UZZA 4Q4Y3 4XCBA 3KVBA 1RUF1 3ATGA 2PA7A 1GZWB 3V0AA 3D5OA 2XMLA 3T2PA 2QQUA 3WZ1A 4BDVB 1VRH3 1IKQA 1VBA2 5FQ0B 1H6XA 5CFCC 4PIYA 2HWD2 2J1TA 2VNGA 1S0DA 1XPWA 4H14A 1ASJ2 1W8UA 2DV9A 3B9CA 4C90A 2ZTNA 5FR3A 1YHFA 1ND2B 1YXWA 4BWOA 2VJXA 3OJBA 5DG2A 1JBCA 1CZSA 1LENA 1GR3A 3DYPA 1IHMA 1S0EA 3VD5A 2RJKA 2Z4FA 3H9AA 1KDKA 5FWJA 1VBC3 5A80A 3WX5A 2Y26A 3GZEA 4KGGA 5BV6A 5GZDA 5EIYB 4O65A 2XLFA 1S0FA 1ZRRA 3IB3A 3MIEA 3I49A 1LECA 4PCRA 4RGKA 3RWKX 2ZBJA 1V6OA 5L7OA 2VMCA 3GCXA 2JEMA 2WUHA 4LUKA 2ZGKA 1X50A 2R072 4KWJA 4MO3M 1QQP2 2ZEYA 3U75A 3AVSA 4XZUG 4HXCA 4Y4YA 1ST8A 1R082 4JKKA 2ZHMA 1BBT2 3D6EA 1QXJA 4ZZ5A 4AAPA 2QKDA 1REEA 4QMAA 1YNAA 1W90A 2VW1A 4XPVA 2VVFA 3RVHA 2Y34A 1JYWA 1ZRDA 3ZMOA 2BWCA 4IDZA 2AEYA 5CYYA 2RE9A 5A6YA 5J3UA 3H0OA 1W28A 1VBB2 2HJIA 2SLIA 2ZX3A 1ONAA 5FMBA 1QOSA 1RUG2 5BNPC 1EV12 2Z5WA 4IEQA 1POV1 4M01A 5LB6A 2WZR3 2BGOA 4N53C 1MZEA 2CU5A 2QBXA 3A0NA 4CDXC 1LEDA 1COV1 5C4WA 2R0HA 3GZTB 3WUDA 2DCKA 1SHWB 3OYWB 2ARCA 1W9YA 1DYOA 3PVNA 1PVC3 1WCQA 2I07B 4KWLA 4YW7A 2FD8A 3QLQA 4NN0A 3AXDA 4SBVA 2R043 1GNYA 5FFOC 4DUVA 4NIDA 5EYXA 2MHFA 2GMEA 2XGXA 1T2XA 2O8OA 1HB1A 3WP6A 3OGVA 2GNDA 3J8F3 3M4FA 1H2MA 2GC1A 3OY8B 1V0AA 3Q8FA 1CPMA 1GNZA 1JOBA 5JPMB 5J37A 4OHYA 2WDBA 1J59A 5JZGB 1W6NA 2B8MA 3NNJA 5D1IA 5FP3A 4TLFA 4QD2A 1PZ8A 2JKBA 2PAMA 4AF9A 1Z7S2 2Y60A 4LEJA 3ZSKA 2XHKA 5FPUA 2EXIA 2DU1A 4FXKB 2D6OX 1NCRA 1G86A 4ITCA 1C5IA 2UYBA 3E5QA 1OLRA 1UL9A 4NPRA 1ND3A 5FY0A 4HVRA 1ZX5A 5D21A 3S5QA 3VZKA 3SCFA 3ZFGA 5GLTA 4AHWA 2XBO3 3GNEA 1UN1A 3PURA 4BQYA 1OA3A 2AR6A 3IMNA 5D8AB 4W6WA 1CAVA 4YW4A 4YW1A 3UETA 1RL3A 4NPLA 2BVBA 4AEDB 4FVVA 4YG6A 3VZOA 2CL2A 4KWKA 3ZYHA 5KHIA 4EWAA 1LJ7A 4JKLA 2OYZA 4K8RB 4IE0A 4D94A 1LOAA 1OBNA 3AXEA 2DBIA 3VKNA 1AHSA 5SV5A 5J96B 4A44A 3TEZA 2XUMA 5FBZA 3POWA 4EV0A 4MGTA 4B7KA 3MICA 5FP7A 3JD71 3FJSA 4FPCA 4BQ5A 2ZS6B 2N7GA 4K21A 2JX9A 4XFFA 5LBEA 1HN1A 2C4XA 2OX0A 1JYXA 1KS5A 4QQPA 3ZXLA 2WQZC 4GB33 4HONA 4XCAA 2JB8A 4C0HA 4UW4A 2J1AA 3N9QA 2JDYA 4COYA 4XFHA 5A33B 1QJY3 1MVQA 2Y6JA 2OS2A 4PDWB 5ABJA 2P3KA 3KVAA 1G9CA 4BH9A 2WN3A 5T55A 1HRV1 5A32B 2IXCA 1JMUB 1JHNA 2X53S 4GJYA 1RUJ3 3E5XA 5JWPA 2Q0AA 3BPSA 4FP2A 1G9AA 3T4VA 1W8WA 5FTTC 3WDWA 5C5TA 1EUTA 1GANA 2D6PA 1TNRA 4OMCA 1AR82 5BNOC 4AE2A 3AP4A 2D5HA 2PYTA 4Q0PA 3VBUB 1UCXA 1XNDA 3O7OA 3OF1A 5AVAA 2AUYA 3BCWA 4CEYB 2ET1A 4JQRA 5I0SA 3ZIXA 4DINB 4E9KA 3KV4A 4P9LA 5FLHA 4DS0A 1IG0A 3THTA 4YFWA 3KZ4C 1XQNA 1WZXA 3GBGA 4E4HA 3WW4A 3WXPA 3E5UA 4OUMA 5F5CA 2VOVA 3D82A 4LO8A 4N8MA 4XJZA 3POJA 1IS4A 1VP6A 3IIAA 3ZXGA 2J1UA 1SPPA 2HKXA 5DDJ1 3FUOA 3JBG2 4UBGA 3NNLA 5T50A 4Z07A 4QPWA 2WZPP 2HWF3 2YGMA 3OUHA 4ORFA 4LKEA 5F5AA 3TYJA 3WW2A 3S6PA 1LOEA 2XVKA 2ERFA 5HPOA 4UW6A 5CNAA 3IDCB 2BGPA 2QQIA 2BZDA 2ZGLA 2Y38A 2AYHA 1UXXX 1HRI2 3KB5A 2JD4A 4IGQA 4MYEA 1RUE1 4Q4V1 4CDUC 2TEPA 4E4DX 3VHOA 1NZIA 2PHWA 5LY1A 2XB6C 5HBAA 4Q26A 5J98B 5FLIA 3ZR6A 3WF2A 4MHUA 5L36A 2BPA2 2WZEA 3VBOC 2QFEA 4LE4A 4XF4A 4AHZA 5BNPA 1AR63 2DTWA 1AR92 3ROUA 1OVSA 3HBKA 1BJQA 1WA6X 3AP6A 1R1ZA 3QH6A 4RYDA 4N53A 3K77A 5LA1A 3OBAA 4XFGA 4WVMB 5F32A 4CU6A 4CDXA 3U07A 1HXS3 3R4UA 4IV1B 5F9TA 5JMOA 5FP4A 1PX4A 2Q30A 3DPRC 5FZOB 4L9BA 3I4IA 2OQ6A 2JG8A 1I9RA 2VVDA 4XF3A 3DF0A 1VPHA 2WNVC 4RQPC 3BALA 4Q8KA 3WSOA 3NQHA 4XQDA 2ZMNA 3H3LA 1UMHA 1NCQB 4KGQA 2EICA 1DP0A 5C3OA 1FYUA 5APAA 5FXVA 4XJUA 5LWBA 4LPLA 4IL7A 3WEZA 4BIFA 3THCA 3G7DA 3VBHC 5LATA 4BE3A 1W6MB 3LDRA 2P3JA 5FYYA 3TWIA 2ZGMA 4LXLA 4EE2A 4FPLA 4GMP3 4AVCA 4BM8A 4X8PA 2E7AA 4XF0A 2BUKA 3DUIA 1ZRIA 3GZUC 5FZ4A 5FXWA 2VZVA 4CU7A 1KITA 4AXOA 2ZMKA 3W9AA 2R062 4DPNA 4Z8BA 2Q8DA 1JI6A 1D4VB 3IIIA 4QPGC 4D6QA 4FQ4A 4XE9A 2RS31 5ISLA 3O0XA 5DAQA 1RVF2 4XURA 5I8YA 1IQAA 1W2TA 2H0VA 4YG0A 3BVCA 1XB9A 1CJPA 1Y9MA 2DVFA 1G6NA 2JIGA 2BTVC 2XKPA 4COUA 1QNYA 1MVEA 5LBFA 5JXJA 1ND2C 1JZ5A 5K8SA 4UXAA 1N1SA 2X5IA 1UYPA 4Q4W3 4PT6A 3BI3A 5AC91 2XJPA 4O61A 3IKWA 5JVVA 3IAQA 1WLTA 2ARBA 1H4HA 4F83A 5ERLA 4LA3A 4BMBA 5FYIA 4UFKA 1QJU1 3MPBA 4GH4A 3AKTA 4YM1A 3ME2A 2E9QA 2W5FA 3DYMA 5L9BA 3IPVA 3TEXA 1UYYA 2B45X 1C8NA 1UQXA 2PLV2 4ZONA 5IK4A 2FDGA 4AWDA 4M3CF 1QGLA 2A6YA 1JZ6A 2VTXJ 2Y6KA 2WJSA 1KFUL 2WIIB 2W1WA 4GIQA 3WD5A 2BP6A 3H42B 5IJRA 3E1F1 1UZ0A 3EO6A 4HPKB 3M3EA 5FZGA 2WSVA 4I30A 4XTPA 1D4M2 3INAA 4PLOA 5K7PA 3UGHA 4QDRA 1JYNA 3ZN6B 1OLQA 1C1LA 2HWC2 3LA3A 3U0ZA 1ZA4A 3GJBA 3KT7A 4FAHA 5BNNB 3HT1A 4PBOA 1RUH3 2G19A 5FO8B 2VR4A 1JH5A 1R64A 3ELNA 1QJX1 4ZXKA 3UGGA 2BBVA 1FMD2 5C8CC 3OTFA 2V5YA 4I09A 1W2OA 5C9AC 4Z2AA 5J09A 3NV3A 4NPMA 5F7UA 3LWCA 5JAXA 4B29A 1WMDA 1AX0A 2QUOA 4J1XA 2VXJA 3A7QA 3WUCA 1IGOA 1CESA 3MFAA 5JZGC 3BIEA 4XIOA 1VB2A 2CWMA 2JENA 1M06G 4YZ3A 2YC0A 1RGSA 2OXBA 3N35A 1KEXA 5H9PA 2HWB1 3MF9A 1AXYA 3Q8BA 5IHRA 5KXCA 2HWE3 4OHWA 1C4RA 4LBKA 3RDIA 4EN7B 1SCSA 2LROA 1R1A3 4CDUA 3THPA 3VD7A 5FXXA 1KGYA 3VBSC 1ZZCA 4DFSA 5GZGA 3S5AA 1XSQA 2JDZA 1PHMA 4B4PA 4R9CA 2CSGA 1OQ1A 3AYCA 3AZXA 2JWPA 4XMIA 5DAWA 1Y43B 5J1XA 1UU5A 1CAWA 5H9QA 3VBOA 2PFWA 3AM2A 4IEZA 4AEDC 4CP9B 1OHFA 3T2OA 3U4SA 3VL8A 2IXJA 3OSDA 4NHMA 2VMFA 4ATEA 4QDQA 3LA2A 4FOVA 4EN8B 2RDNA 2Q8CA 5C3RA 2JE8A 4JZRA 2XLGA 3KT4A 4ES9A 2XLAA 4NWWA 3NNFA 2Q1MA 1H4GA 3A21A 4P9JA 3RI8A 4EZ4A 1C1FA 3ACIA 3ZPYA 5HCBA 5CBLA 2RR12 2WNVA 4RQPA 4XF1A 1ASJ1 1DYPA 1GOHA 3U11A 1UU4A 2JG9B 4JX0A 5CFCB 4M4RA 1JYTA 1SLLA 4QU2A 1Q3EA 1PMIA 2IVIB 3SH3A 4A6OA 3LKJA 5JOWA 2MNGA 3E6BA 1DQ4A 4XFAA 3USUB 2HYKA 2R30A 1T6GC 3VBHA 5DAXA 5A7OA 3IDAA 2A73B 2VL4A 5DUUA 4A42A 5FY7A 5FZKA 3T1LA 3LA7A 4CEWA 5A6XA 2RS12 4BLIA 1SBDA 1ZNPA 1FPN3 1GMMA 1LNSA 1E5RA 2W9XA 3LSDA 1FV2A 4P08A 3JB8A 4MADA 4ASLA 3ITQA 4DB5A 4ET7A 5C8WA 4ZS2A 1QQP1 5FZLA 2RS53 4I3PA 2DVGA 1GZWA 1ZVFA 4N43B 3URFA 1JZ8A 3LSEA 1YFUA 1R081 2D6NA 5DZFA 1BBT1 3POIA 5T5JA 3UKNA 2VG9A 4CP1A 1XNBA 3VBUC 1VBD3 4AEMA 1X8EA 4ARYA 4CEYC 1BEV2 2BJSA 3POGA 1ULGA 4XDOA 3SITA 1S0IA 2AEZA 2PHXA 5FQ0A 3GXUA 5I0TA 1VBB1 5I8SA 2XJSA 3TB0A 5DMYA 1RUG1 1EV11 1TMF3 1ND2A 4XACA 3S7EA 4ZS3A 2Z69A 4MH0E 4LBJA 1VBE3 4QXKA 1ZBE3 3GBFA 2G9FA 2D6LX 4J25A 4I3GA 1QU0A 1K3IA 1MR5A 1CPNA 1SG3A 2QJVA 4GWNA 2XUEA 3BODA 1O3QA 2YZ4A 5FZFA 4OHXA 1TME1 3LD8A 4I01A 4L8QA 1XRUA 1CAXA 4GWJA 5EJZB 2WS92 1PO23
chains in the Genus database with same CATH topology
3D8CA 2PHTA 4JDMA 4Y1XA 1C8M3 2R32A 1LODA 1HKDA 2FMYA 4BZ4A 1X7NA 3NWKA 1WA4A 3AP7A 1WBFA 1GYKA 4WVVA 2Q4SA 4GWMA 4HVOA 1SEFA 1Z7S1 4RS5B 4DMIA 5DUVA 2DVDA 3DKWA 3PTYA 1H8TB 4AEKA 3VL9A 4R52A 4JCKA 3ZXFA 1LEMA 4Y1YA 2ZZJA 3V0BB 1R093 3OGGA 1DGLA 1KXGA 4QPIA 3WNXA 3TN93 4CP2A 4CRQA 1XNCA 3WG1A 3OYWA 4B7EA 4K40A 1LHOA 1COV3 1EP0A 2ZX2A 2JICA 3RJRA 3FE5A 2WLQA 4ISRA 5CAZA 3ALQA 5FDBA 1V9U2 3OY8A 1RMU3 2R6QA 4CTEA 3AMQA 1LB2A 2D97A 4EWEA 2ZMLA 1FOD3 5JZGA 1N3PA 2WL1A 4Q8LA 5J7MA 4Q4Y2 4M3CE 5JIUA 1LHWA 3WDUA 2UWAA 3MIBA 3KCXA 2SBAA 2VNRA 5B2GB 4OLLA 2EVXA 3AP9A 3APBA 4FPGA 3RI9A 1VRH2 4XW3A 4XTMA 4QX5A 1APNA 4LHKA 1N47A 2A6ZA 3VZMA 5D8AA 4FPHA 1VBC2 1WMEA 3SH5A 1AX2A 2UYAA 4HKOA 1V6MA 5FREA 3POSA 1KFXL 3UJQA 4AVAA 3K48A 1AYN3 1AR81 3ZIWA 1D0HA 4MUVA 4A7KA 3M1HA 1UIKA 5BNOB 4Z92B 4LBMA 2Q1ZB 1AL23 2O1QA 4N90A 3RG0A 3JD73 4A7ZA 3FBYA 4K1YA 5KBFA 1HQNA 1QMJA 1BCXA 4X6QB 2QQPA 3CEWA 3K51A 4QM8A 5A33A 2C0ZA 4OVEA 4PLNA 4PDWA 1O5LA 3JBG1 4P9YA 1HV1A 2WZR2 5A32A 4XHXA 5JSRA 1QWRA 1QHDA 3FFQA 1DG6A 2PN5A 2ZA9A 3NKTA 5A3LA 3NJZA 1PVC2 4XHBA 3I59B 2CTVA 2OVUA 4DRRA 4GXLA 1QH6A 4Q4X1 2K9ZA 5BNNC 3J8F2 1PNFA 3VBUA 4K7JA 4G9SB 3HWJA 5LRRA 4CEYA 1K5MB 4OULA 3Q9OA 3AB0A 4IEVA 4JC1A 1WW6A 1NQDA 2HEVF 1ENQA 3VHRA 1X33A 3O0VA 2GH8A 3HMYA 4KBBA 3ZSJA 3GYDA 1PNGA 1ALYA 1FXZA 1A8DA 3ACLA 5GZFA 2ZCWA 1H2KA 4FT8A 2OA2A 3DPRB 4WM8C 4BLJA 1SLCA 5I93A 5DUXA 3PMEA 2XBO2 1DYKA 3AJZA 1DDLA 3ZYPA 4MXWB 1NY71 1FI2A 4IEPA 3G6JB 1D0GA 3B02A 3KGLA 4FPFA 2AREA 3JU9A 3HR9A 3KSCA 1YUDA 4ISQA 3ZSLA 4XBNA 4RGAA 4Q0UA 2XKOA 4TYSA 2BYVE 5DZEA 4JVAA 1LGBA 4MGZE 4BCUA 4WVMA 4OHZA 2R061 2QCSB 3ZYIB 4IV1A 4P9IA 3V56A 4RL7A 4KH9A 1GLHA 2ZGNA 4GB32 4QPGB 1RVF1 4R4XA 3HBZA 2ZPXA 2A6WA 1G9FA 4YVWB 4C0BA 1QJY2 3B01A 2IXKA 3VZNA 2JG9C 4YVSB 4ZU4A 5KHKA 5IT6A 1IKPA 1AL0G 3KGZA 1NCQA 4CDWB 4GALA 2A3YA 1RUJ2 4NHLA 1V6KA 2GAUA 2UU8A 3I8TA 4AFDA 5K0UC 1AUYA 3AMNA 1W6MA 3AMHA 4HK9A 3GZAA 4XBQA 3ASIA 4E4ZA 5JSOA 5FCCA 4ONUA 3RSJA 4FPKA 4N43C 4BHPA 4COVA 2PLV1 3VHNA 1SMVA 1AR71 1C3HA 3WY6A 2DCZA 4Z2WA 1F9KA 4F8AA 1WCDJ 4Y20B 3WDXA 1RITA 3D0SA 1D4M1 2HWF2 4Z82A 2GNBA 1WMFA 4HETA 3VZLA 3M3OA 2XWBB 3U4XA 5GJ6A 1UW8A 1FMD1 2BQPA 3UKVA 1XYPA 3R0RA 5C8CB 4K9SA 5C9AB 3KCYA 1YI9A 1RTVA 2ETEA 1O7FA 3EJKA 4FCAA 1YIFA 3PVOA 1XNKA 1LHUA 4XBLA 2O8QA 3M2MA 1OMIA 3MDPA 1AR62 1BK1A 3QOPA 1MEC3 3VV1A 2OPKA 3ZFFB 4RS5C 3BB6A 1XU2A 1S0CA 1HXS2 1H8TC 3ZYJB 3V65A 4BPZA 5AFEA 3JUUA 3OGJA 1HIXA 4AGGA 3BTAA 1H1MA 2ZGTA 4YSFA 5L19A 3RMYA 2RM21 5BNNA 4NR1A 2P37A 5CFDB 2DUQA 1CX4A 2D5FA 4D7YA 2BVVA 4FPJA 2DYCA 3VBSB 4V1PA 2ZHKA 2EXHA 2H0BA 1UKGA 3I2DA 2VVEA 2JXAA 5ACA3 4DY5A 2P2KA 4U2AA 3NAPC 3EQEA 1IS5A 2NMNA 4LNVA 2WNEA 1DFQA 1MS0A 1C57A 2RR11 5FMOS 4IEYA 4XQ4A 3WDTA 4LBQD 5CG9A 4HZFA 1OPMA 2GH2A 5GZEA 4IV3B 4TZDA 5HCFA 1EY2A 3O0WA 1W39A 3TRSB 1UU6A 4AGRA 4Q4W2 5F6KA 4CZSA 1A3KA 1J3RA 1YI7A 3MIFA 3NV2A 4AYUA 1RHI3 3RWNA 5T5OA 2NPIA 1OPOA 1PGSA 4JAAA 3MEPA 4PIZA 3VKMA 4IXLA 1NA1B 1D2QA 1NG0A 4S2DA 5EZWA 1KRIA 1V6JA 3WHUA 1EPZA 3L2HA 1YIPA 1BEV1 3T2TA 1FNZA 4JGZB 3EBRA 4G3YC 2VOWA 2VULA 4MGYE 4QGMA 4CP0A 3E6DA 2VMGA 4LBOA 5BNQA 1UAIA 3FUQA 1UIJA 1I5ZA 1PK6B 4AG4A 3VBFB 2JG9A 5CFCA 3FFZA 2X29A 1MS4A 1JUHA 1QH7A 3IM0A 3NKGA 2R1DA 5K0UA 3WW3A 3FWEA 3WW1A 4WM7C 3AKQA 1AZDA 4Q0VA 2WS91 2PTMA 4MSVA 3WQ7A 1RUH2 4AFCA 1NOVA 2RMU3 4YG3A 1OA2A 1PO13 1VAVA 4LO6B 1F31A 4XEZA 1YLLA 2WKKA 3VZJA 2PAKA 1VJ2A 3RYKA 2KA3A 1N3QA 5IK7A 1ENSA 3ZYRA 1VAKA 1K5MC 2VGDA 4RR3B 1GNHA 1WW5A 2CAUA 2ENRA 2GC0A 2GMPA 1SLBA 3JZVA 1CONA 4R4ZA 3WP3A 1QY4A 5GALA 1IPJA 2HWE2 4I0AA 1GICA 1R1A2 3FHIB 4JGYB 3GALA 1TME3 5GLZA 2GNTA 2GU9A 4FXGB 1V9U1 1DIWA 3VGIA 4KNCA 3H8UA 1DQ0A 1DZQA 2OUJA 2TBVA 3HAGA 3A4UA 4Q4Y1 1Q56A 4RHV3 5CIRA 5HXVA 2YUEA 3M8LA 3GHMA 5FRAA 4RS5A 3IT8A 3AMMA 1OI6A 1H8TA 1QOOA 2DURA 1VRH1 3V0BA 3NV4A 1ULCA 4H3WA 4XETA 3WLUA 4C91A 5JPNB 2ZGSA 1C28A 3B7MA 4D7TA 3CO2A 4M0NA 2X8KA 2WFF3 1DU3D 1HQWA 4XXAA 2H6CA 3IBMA 4B3NA 4BA6A 4FPEA 4YVWC 1WCKA 5GM0A 4G4FA 5IK5A 4YVSC 2QZ3A 5FOBB 4HANA 4JV4A 4LE3A 2EIGA 3CJIB 1F2NA 5AFBA 4CDWC 4U36A 1PZ9A 1FPN2 1WW7A 4LBQB 4W6YA 2AZ5A 3WP4A 4FO9A 1OKQA 1AX1A 3PLQA 3UK9A 2VPVA 5F6LB 4OI4A 4RSUA 5LRSA 2RS52 3U10A 4YLZA 2C9AA 1W6OB 3FBMA 4AI1A 1YFXA 4OHVA 1VBD2 3SLIA 5CG8A 2A6VA 2DF7A 2A6XA 3VN4A 1AYM3 3FLTA 1TMF2 4META 3WV6A 3ZN5A 2WZR1 1VBE2 4Y1UA 3AZWA 4QT6A 1ZBE2 4YGCA 5E8AA 4XFCA 1KJRA 1O4ZA 3H50A 3WHTA 1PVC1 5FOJB 1JW6A 3JQWA 1PO22 1CD3G 3J8F1 3CLPA 1HV0A 1G9DA 2WNUC 5BNOA 5JOYA 4BQ1A 1C8M2 1J3PA 4YM2A 3ZFEB 5E88A 4XFIA 2VUAA 1LHVA 5H9SA 1AJKA 2YGLA 1W6NB 3ETQA 3MYXA 3AMPA 3H1WA 3RYRA 2XPJA 1RUD1 1GFF2 3UV9A 3M70A 1DQ5A 1HX6A 2A5ZA 2GN3A 4L2NA 3B69A 1R092 2YV8A 3USSA 4IEUA 1NCRB 3AK0A 4J1WA 3ZFFC 3MIHA 4QGLA 3TN92 1IPKA 1YO8A 2PHUA 2XBO1 3C3VA 2W52A 4WM8B 5JI9A 1COV2 1HQLA 1FX5A 2QNKA 3I59A 1URXA 1DGRN 4S2HA 4YW2A 2OZ6A 1ZZBA 1SCRA 2R49A 2XJTA 3GHNA 5CFDC 4Q4X3 3PVEA 1BVP1 1RMU2 3SXWA 1K5MA 1KD7A 1QDOA 1XYNA 3HQXA 4DXZA 1WBLA 2V09A 3BOWA 4A7YA 3ZXEA 2DCTA 3WG4A 1FOD2 5JOXA 2BGCA 1PIV1 4I0BA 4FTSA 4UW5A 3B9IA 4P9XA 4UBHA 4NVPA 4WZFA 1REDA 4AFAA 1PM7A 1BVVA 1LTEA 3TNQA 2D44A 2Q5TA 5E16A 2D43A 4GB31 1YRZA 4LHNA 3SCHA 3V64A 1TQ5A 1YJLA 2D3PA 3KD4A 4AI8A 3DPRA 1QJY1 4FOWA 3PJYA 2K2SA 1VBA1 2ZX0A 1OQEA 1S2KA 2HWD1 5BYNA 1Z0HA 4MXWA 1RUI3 2CV6A 5DG1A 4XJ8A 5HCAA 4Y5Z0 1O4TA 1RUJ1 4IEOA 4EWDA 4IV3C 2DTYA 3ZXJA 3I7DA 2MEV3 1AYN2 1ZBA3 2ILMA 3OBTA 3WT3A 4WV8A 3UL2A 2E51A 5T5PA 4P9GA 5KWRA 1RUC3 4BIOA 1AL22 2LUWA 2R071 1NA1C 1NLSA 3JD72 3AFKA 3OPZA 5FO9B 1EAH2 3VUOA 1RUF3 4H7MA 2GZWA 4AFMA 3N7KA 4QPGA 1VLNA 4JGZC 4TWTA 1Y7BA 4YVWA 2NN8A 2B46X 1PK6C 5IK8A 1IZ3A 3VBFC 4YVSA 2HWF1 3POYA 3BPZA 1KJLA 4CDWA 4HFSA 2ZAHA 3OCPA 4NWVA 5CU1A 1QOTA 4KL1A 4CDQB 3WOGA 3B5LB 4YZ4A 1Q8PA 1BMV2 3OBRA 4URTA 5CADA 4HLTA 3JQXA 3M7AA 2VH9A 2VUJA 4LO5B 3WP5A 2VNOA 1AR61 4AQ2A 4N9IA 2A70A 1B35B 4RR3C 1AR73 1HXS1 1RIRA 5I0RA 4Y20A 1VALA 1ZZ6A 1JUIA 3AYDA 3CF6E 2UY8A 4YFZA 5JR7B 1A78A 2I45A 1A6CA 3RZZA 1POV3 4HKLA 1EPWA 1J58A 1DLLA 4JGYC 4YW5A 3KMHA 5C8CA 1PGL2 1WLDA 5KHJA 5C9AA 4WVWA 2G4IA 2BFUS 3UKTA 1XE8A 4GULA 3QBQA 4GMP1 3N7JA 3NAPB 1XXNA 3ZFFA 2KXLA 2A75A 4YGDA 2QE3A 4M0HA 5TSWA 4AHXA 3NVCA 1Y3TA 2A7AA 2Z42A 3R4DB 1S0JA 4AGVA 4XDQA 1WLWA 1DF0A 2LM3A 4DZGA 5CFDA 2A71A 2RM23 4AVVA 1Q8OA 4E2QA 5FLJA 2BEOA 1YJKA 4Q4W1 1S1AA 1E57A 3VBSA 1CGPA 5I0UA 3RPQA 2QZ2A 3W58A 3ZXAC 4C1WA 4AEDA 2ZJCA 3CJIC 4UW3A 3H7JA 1UPIA 3RJ2X 1U5YA 3LCPA 2B7YA 2D93A 4RGGA 3ILFA 5KHGA 4GH4B 1N1VA 4LO4B 2Y0OA 4BMEA 3IDBB 1V6NA 2XJQA 3PHMA 2VW2A 3B94A 3VBRB 1RINA 2E7QA 4F7ZA 4L92A 4XJWA 4IV3A 2I74A 3WVJA 2FZ1A 5I8TA 2LTNA 4OUSA 1NYWA 1SFYA 2ZZQA 4YW3A 1ZRFA 5JDBA 1I3HA 4WM7B 1RUH1 2OW4A 1HRV3 5L73A 2OZJA 4RFT0 2JJ6A 4IERA 1JYIA 4INDA 2XWJB 1DZRA 4P14A 2R042 4OZXA 1HRI1 2Y0IA 1FAYA 3HT2A 1WD3A 3ZFEC 4JGZA 1PK6A 1ZRCA 1MEC2 1SFNA 3VBFA 3B3QE 3IDEA 2G9GA 4B8EA 1AR91 3NW4A 4GKYA 1MZFA 1Q43A 3FLPA 4SLIA 4DY3A 4YRDA 4L97A 3EXUA 5KC5A 4QHBA 2HWE1 2ES3A 3FMGA 2XG3A 1NCRC 4YM0A 4HT1T 4DOUA 4LTAA 1R1A1 5KXDA 3UJOA 1ND3C 2ZHLA 4LR4A 2K0GA 5DDJ3 1DGRA 3PMSA 2D3RA 4AI0A 5GZCA 3N7LA 4WZCA 1GSLA 2IFWA 1W6PB 2GALA 5BY5A 1OOPB 4Y26A 1LESA 1A8MA 5ACA2 4XILA 4ES8A 2R0FA 4Q4V3 4RR3A 1RUE3 3ENRA 2ZGPA 1H2NA 1M4WA 2A3WA 4OI1A 2ATFA 2VU9A 3TNPB 4K6BA 1LKNA 1DQ2A 1CAUB 4EN0A 3SISA 3S0MA 2QDNA 2VQAA 3DL3A 1ZYBA 2YPJA 1U5ZA 3MI8A 1X8MA 2EF6A 2GSYA 3H7YA 4JGYA 4P5HA 5CB7A 2C1FA 2ZABA 1OA4A 4RD7A 3R4SA 5ABJC 1MZ6A 1FPN1 4MX3A 1RHI2 2AGSA 4HKWA 3L9JT 4JDNA 3WINE 5F1RA 2PHRA 4LA2A 3ZMNA 2FHRA 2P34A 2RS51 4HK8A 5HI0A 2F4PA 4AI2A 2PHLA 2YDEA 4QM9A 2WWSA 3S7IA 1U12A 1S55A 1UD1A 1VBD1 1Q5OA 1PGW2 3ZX7A 1WLCA 4AQ6A 1XU1A 2UWBA 3MIDA 5KHHA 3MF6A 1GBGA 1TMF1 2P17A 1J1LA 1VBE1 1WUVA 5K9YA 4AI3A 1ZBE1 2GNMA 2B5HA 5GKAC 2PHFA 3AP5A 3FZ3A 1DGWA 4MZUA 2RS33 5AVPA 5T54A 5T52A 3TBDA 3ZSMA 3P3PA 4GKXA 2FQPA 4NHKA 4R9AA 3CJIA 1JOJA 1PO21 2NZ9A 4LBQA 1V70A 1CAXB 1VAMA 2HWC1 3C2UA 3J26N 2NM1A 2RMU2 4JRAA 4YARA 1PO12 4CDQC 1C8M1 2QDRA 2WNUB 1X36A 5AC93 3VHPA 1W6OA 2UWCA 1ZZ9A 4XFBA 1YFYA 2W08A 4HN0A 1VR3A 1DBNA 4ATFA 2ZOEB 1J3QA 3KM5A 3VKOA 3EHKA 3O5SA 1QXRA 3LOIA 1OFSA 1QJU3 3M3CA 2VOXA 2IZWA 3QD6A 1L3JA 1CN1A 2DUOA 1R091 3SCGA 4D7SA 5A3MA 2EXJA 3TN91 1B35C 2CAVA 4QPIB 4R9DA 5FMOL 4LHLA 4YNIA 4GQ7A 3N4MA 3J9SA 4HPKA 4XOGA 3ES1A 5FPXA 4NOTA 3CL1A 1GZCA 2JG8C 1TME2 4XXPA 2DU0A 4O9EA 2IXHA 5DUWA 1SLIA 3ZN6A 1RMU1 4QPYA 2B42B 1AVBA 2BNOA 2E6VA 4RA0A 3ZFEA 4JRLA 2CGOA 3IWZA 1V6IA 1RJ8A 2TUNA 1FOD1 1H1AA 1ULEA 1HDKA 4RHV2 1QJX3 2D98A 2AH2A 1D2SA 2LALA 2O0OA 2RHPA 4YZ1A 2DCJA 3NO8A 2TNFA 4HSJA 2FMDA 2PQQA 1W6QB 1XE7A 5JI7A 1G9CA 1LGCA 1RUD3 5EXOA 5JIAA 1ENXA 5FAXA 5IUQA 1NLRA 3MW2A 4H55A 3N3HA 2NLRA 3DV8A 2HEWF 4WM8A 3TOJA 2WFF2 5I91A 4HSLA 2WT1A 1GZ9A 2HWB3 4LUMA 3QH7A 2DUPA 1S0GA 1NXD1 4HVQA 3PVBB 3MLKA 1H2LA 4LBNA 3RRDA 1AYN1 2FBEA 4M3CB 2ZX4A 3LZZA 2X5IC 4FSJA 2RS11 4Z1VA 4TSVA 1W0OA 1AL21 1PIV3 1JN2P 2BNNA 4P9WA 3ZO0B 4K1ZA 1EAH1 2PELA 4DNYA 3VLBB 4GH4C 3BIWE 2CYFA 2GC2A 2VMIA 3H1MA 1KDMA 3WQ1A 1CVNA 2JECA 3ZDSA 3ZSEA 1JYCA 1AYM2 2VOKA 4DQAA 5EWSA 1LULA 4AEJA 4W65A 3ZVXA 4EN6B 1HW5A 1VBA3 3VBRC 3IN9A 2HWD3 1ASJ3 4HMZA 1PVXA 4FPYA 2Q8OA 1U5IA 4LO7A 3AZZA 1BMV1 1FT9A 4EN9B 1V00A 5BUVA 2DVAA 1W0PA 3USUA 1J1TA 3AJYA 3R05A 4QGNA 3M3IA 1MQTB 1POV0 4COZA 5SV8A 3AX4A 2NP0A 2AENA 3OD4A 4KQ7A 4IEXA 3NSTA 4N43A 3D0JA 1F5JA 2R073 4R9BA 4E27A 2PAEA 1QQP3 2OIIA 1WGPA 2Z2SB 3KS7A 1AXKA 4GA9A 1R083 1BBT3 2GMMA 4MV2A 4F3JA 4WVZA 3ECQA 5H9RA 2OUHA 2KM2A 4Y22B 5BPXA 1AF9A 2BWAA 3DN7A 1VBB3 4IESA 5EJ3A 5C6CA 3KT1A 1RUG3 1EV13 4M00A 2D7FA 4LULA 1CJDA 4CDQA 2ZKNA 4E2GA 4ZKTB 1SDWA 3SNMA 1PGL1 2QVSB 4Q4X2 3JB4C 1HLCA 1Z78A 1UMZA 4FAGA 4FOQA 2WA4A 4AVTA 1OOPC 5DZGA 4QQ2A 3VDDB 1CIWA 2XVGA 1B35A 1S0BA 2DWRA 1V6LA 3WR0A 2JE9A 3NV1A 2XJRA 3V0AB 3D4KA 3RNSA 1F8VA 1DQ1A 1Z7S3 3JCIA 2UURA 5EYYA 2EAAA 1RUI2 1NY72 2ARXA 4O9GA 4IQPA 3FX3A 3RQ0A 2ZX1A 4B4RA 2WINB 1OD5A 1LU1A 2ZGRA 4LBLA 4FQZA 2MEV2 3I54A 5CVRA 1VBC1 1EYBA 1JTZX 1ZBA2 3MIGA 3A0KA 1N3OA 2EALA 5C33A 4CEWC 4EROA 1GKBA 4PBPA 3WCRA 1QDCA 5J48A 1UKRA 3NAPA 1O91A 2WQ4A 1RUC2