2O8QA

Crystal structure of a protein with a cupin-like fold and unknown function (bxe_c0505) from burkholderia xenovorans lb400 at 1.55 a resolution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
129
structure length
122
Chain Sequence
GMKLQTTIQHEPKDGSGFDRREFFEYRDTGVNEATGGMFGAHVIRAIPPTWHTHTVGFQLFYVLRGWVEFEYEDIGAVMLEAGGSAFQPPGVRHRELRHSDDLEVLEIVSPAGFATSVVDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Hypothetical protein
publication title Crystal structure of hypothetical protein (YP_555756.1) from Burkholderia xenovorans LB400 at 1.55 A resolution
rcsb
source organism Burkholderia xenovorans
total genus 23
structure length 122
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2o8qA00
2IXJA 3BB6A 2FMYA 4OFGA 1JUHA 4IETA 1ZZCA 4IERA 4XF9A 1X7NA 1CAUB 4XF3A 5I0TA 3KSCA 4BYYA 3MZHA 1DZTA 1PM7A 1GQGA 2BGCA 4QM9A 3O14A 3USSA 3WW4A 3SMHA 4XFFA 4K8FA 3E6CC 4KWKA 2HKXA 1CGPA 4BH9A 4LA2A 4ZU5A 1ZREA 5K8SA 2GU9A 3MDPA 2XLGA 3PLQA 5FQ0A 3D0SA 2B8MA 3H8UA 1O3TA 1XE7A 2PHDA 1WGPA 1ZRDA 3FWEA 3H7YA 2DCTA 3RDIA 5KHJA 1ZVFA 4XFHA 4R52A 4Q0PA 4EROA 2UYBA 3ETQA 2PAEA 4IEXA 1O5LA 1UD1A 1OI6A 4F7ZA 4DINB 1UIKA 5JSRA 1G6NA 2QCSB 1J3PA 3CLPA 3RYPA 2EAAA 2PTMA 1OD5A 4HMZA 4AVAA 5AVPA 4LA3A 4Q0SA 1ZZ7A 3MPBA 2Z2SB 2CAUA 2D40A 1ZRFA 1YWKA 2CV6A 3E97A 4R8HA 3PNAA 4KU8A 1YLLA 4MGKE 3E6DA 2BEOA 2OZJA 3LA3A 4CYDA 3RZZA 2B5HA 3I59B 5FLHA 2CAVA 5CADA 3ST7A 2PFWA 3ES1A 1O3QA 3NW4A 2CGPA 5T3NA 3ACLA 3LZZA 3IDBB 2XLFA 5FLJA 2D5HA 2ZCWA 4HSLA 4IEZA 3S7EA 1J3RA 4XF4A 4HN0A 3U10A 2ET7A 3CF6E 2PYTA 3ELNA 2N7GA 4Q0VA 3LA2A 1VR3A 3E5QA 3CJXA 1RGSA 5KHKA 2FQPA 1ZRCA 3EHKA 1I6XA 3U0ZA 1O3SA 1VJ2A 4X6RB 2C0ZA 4LUMA 4XETA 4L11A 1CAXA 3OCPA 5I8TA 2HJIA 3UKTA 3H3UA 1LKNA 1CAUA 2V09A 3DKWA 4IEQA 5JSOA 4Z07A 4LULA 1UIJA 3LWCA 1YFUA 2H0VA 4Q0UA 5E16A 2QNKA 4EWAA 1RUOA 3H50A 4AQ6A 2BNMA 5KHHA 5LEKA 4P9GA 3TNQA 1GQHA 3DL3A 3UKNA 2GC3A 3CEWA 5FPXA 4EV0A 3FE5A 1Y9QA 2PA7A 1RTVA 5EZWA 3SCFA 3RYRA 1CAXB 5J48A 1CAVB 2UYAA 2QJVA 3HT1A 4JVAA 2GC0A 1NE4A 1UPIA 2Q4SA 4XF1A 3H9AA 3IBMA 4F8AA 4HN1A 4NVPA 1Y3TA 4TLFA 4GULA 3RYKA 5HI0A 2IXHA 1J58A 1ZZBA 2P17A 3NL1A 3SCHA 4J1XA 4I2OA 4FAGA 3FX3A 3FZ3A 4KWLA 2XLAA 3H3ZA 1H1IA 2WC2A 4KU7A 2UY9A 4FT8A 4XFIA 5JCTA 3GYDA 5FCCA 4QXKA 5J7MA 3TNPB 2Y0OA 2IXLA 5JSPA 3SXWA 2PHLA 1V70A 3WW2A 1X8EA 4D7TA 1FT9A 5JAXA 3I59A 1ZNPA 4IEWA 2UY8A 2IXIA 1J59A 1EY2A 2VECA 4YARA 3KGLA 4E2SA 1EPZA 3PVBB 3NVCA 1DGRA 1EYBA 2K0GA 4ZU7A 1QXRA 4QGLA 3HQXA 5FLIA 3KMHA 3QOPA 1NE6A 4YSFA 1RL3A 4IEPA 3R6SA 1L3JA 3EBRA 2GZWA 2QVSB 5BUVA 4EWEA 1UW8A 4JTOA 1O7FA 4MX3A 1CX4A 2O1QA 1NZCA 3QACA 3H1YA 4KWJA 1ZZ8A 3ES4A 3I7DA 4O9EA 4OLLA 3RPQA 3NJZA 1ZZ9A 3OD0A 4HZFA 3D0JA 1CAWA 4LEJA 4XFGA 3E5XA 2XKOA 4HVRA 4IEUA 1HW5A 2D93A 3DN7A 4UBGA 5I0SA 3BALA 2OYZA 2OA2A 3OGJA 4AVCA 4LTAA 2BNOA 3NSTA 3SCGA 1J1LA 3CL1A 3CO2A 4XEZA 2H6CA 4ORFA 4MGIE 1YFWA 4I01A 5LEJA 1CAVA 1SEFA 1ZRRA 4LUKA 3U11A 1DZRA 4WVZA 4BIFA 3KCCA 4PJYA 4RD7A 1CAWB 4J1WA 2BNNA 4I09A 2BYVE 4HVOA 4HSJA 3EQEA 5E1RA 4XFBA 1OMIA 5KHIA 5C6CA 4MGYE 3ROUA 5J3UA 1RUNA 1X82A 1RC6A 2GC1A 3LOIA 4JTNA 2EA7A 2EVXA 4YRDA 1IPKA 2WFPA 3IWZA 5LRSA 2Q1ZB 1QWRA 2ET1A 5I0RA 1XE8A 2D5FA 4I0BA 1XRUA 5D1IA 1IPJA 4YYOA 1FXZA 1WA4A 1O5UA 5KBFA 3FJSA 4XFAA 3H1WA 2XL9A 5BY5A 4X6QB 5CU1A 4FAHA 4XFCA 4QM8A 2I45A 1LB2A 1LRHA 1O3RA 2OZ6A 1YFYA 1QY4A 3IDCB 2Z69A 3UKVA 5I0UA 3VHRA 2Q30A 2F4PA 2O8QA 3M3IA 3NKTA 4AXOA 3BCWA 4PIXA 4UBHA 4IEOA 3FFQA 3DV8A 3OF1A 5BV6A 4META 2QDRA 3D82A 3HT2A 3FHIB 2VQAA 5CVRA 1Q3EA 4I3PA 2E9QA 4JV4A 1OFNA 3OTFA 4MH0E 2IXCA 4ZU4A 2XKPA 3S7IA 2IXKA 1VP6A 3B02A 3JZVA 4WBBA 1ZZ6A 2MHFA 4AQ2A 5I91A 1X8MA 1QXJA 3WW1A 3ZDSA 3WW3A 3HIFA 2MPFA 4IESA 4UXAA 4EWDA 4AVBA 1EP0A 1FI2A 4WZCA 1SFNA 1Q5OA 2ZKLA 5FPZA 2H6BA 4MZUA 5FQ0B 4MV2A 1DGWA 4Z82A 2XHKA 3G7DA 3E5UA 4FBFA 3LA7A 1H1MA 3LAGA 5I8SA 3S0MA 4D7SA 3RNSA 4XF0A 4MGZE 3KGZA 3BU7A 3I54A 5JR7B 4HLTA 4HVQA 2IC1A 1PMIA 5BPXA 4Q0QA 1TQ5A 2XL7A 4N9HA 2VPVA 4PIZA 3C3VA 2GH2A 4B29A 3M70A 2GC2A 5F1RA 1I5ZA 1YUDA 4HBNA 1Q43A 1YHFA 3L2HA 4QX5A 2PQQA 5I8YA 4E2GA 4QGNA 3SHRA 1UCXA 4E2QA 2ETEA 3IIAA 2K9ZA 4L2NA 4QMAA 4H7LA 4YNIA 4O9GA 4ONUA 4I02A 4LLOA 5BXXA 1WLTA 2OPKA 3H1MA 3H7JA 3MYXA 1NXMA 4MUVA 2B9UA 3BPZA 4KL1A 3EO6A 1ZX5A 4N9IA 5LRRA 2PAKA 3E6BA 4IEVA 3N4MA 1J3QA 5FDBA 4I0AA 5C8WA 5I93A 2Q0AA 1LR5A 4Q29A 2GAUA 4BHPA 5EFUA 1O4TA 1YFXA 4IEYA 2XGXA 1NYWA 2ATFA 2PAMA 5KHGA 1SQ4A 1U12A 2KXLA 4QGMA 3GBFA 2MNGA 4PIYA 4A2UA 3EJKA
chains in the Genus database with same CATH superfamily
2IXJA 2Y38A 2YBPA 4Q4W1 2YYOA 4GKXA 5T5JA 1N1YA 1JUHA 1SLLA 4Q4V1 1SFPA 3VBHC 5FY5A 3OPTA 3CQOA 1CAUB 3MZHA 1F4HA 3AFKA 3FLTA 4QU2A 5FO7B 3KF3A 1IOAA 4UFHA 5FMDA 3SH5A 4FTBA 1GICA 3RI8A 1EPWA 1UAIA 1UPSA 3HVDA 3O14A 4XZPA 4AGVA 2R30A 3WOGA 4IGQA 4XFFA 1C5HA 2CHHA 2G9FA 1FATA 2D6OX 2VNVA 3MFCA 3IT8A 2W0XA 4CEYA 2HKXA 1F5JA 3J8F3 1H8TB 2PN5A 2GP5A 4YVSA 2D3SA 3PLQA 2XLGA 3ZSEA 3D0SA 2B8MA 4W8JA 4CDQB 2G9GA 3LDKA 2PHDA 3MW4A 1GOFA 3RMXA 4COWA 2P6CA 1FPN3 5I0DA 3VBOC 1J84A 1FPN2 3FWEA 2DCTA 1ULFA 3N3HA 4XFHA 5CZKA 5EYYA 4LBQB 5KHJA 3ZX7A 4QPIA 3SEPA 1U5XA 1J1TA 1D7PM 2PAEA 4S2DA 5IK4A 1LOFC 2VG9A 2FDKA 1AVBA 5FK8A 4OVEA 1W6PA 1LECA 4CUCA 4NIIA 3T09A 1WCDJ 2RMU1 2VTXA 4HG6B 5A7WB 1AX2A 3UJOA 3K3NA 4XHXA 3GF6A 1G6NA 1GWLA 1J3PA 4FFHA 5C4WA 3RYPA 1GYKA 1TE1B 4CRQA 2EAAA 4GWJA 2R1BA 1ND3C 2LM3A 3MO4A 2VW1A 2ZMKA 3T1MA 3PIGA 2CYFA 5GLUA 3LPFA 1LGBA 3S6PA 1ENRA 3M8LA 2HLEA 3O1UA 2QBXA 3MPBA 4M3CE 2Z2SB 3CU7A 4RFT0 3WG4A 1FV3A 1PK6C 3E97A 4RN5A 4JGZC 5FYIA 5LBEA 1WKYA 1W2NA 5GLVA 4QX3A 5LB6A 2PLV3 2VZ1A 1OOPB 2PLV2 2RE9A 2V72A 1YLLA 4KU8A 1FOD3 1UZZA 2GH8A 1PO23 2O8OA 2P3YA 1PO22 1REFA 1BBT1 3LA3A 1CR7A 2R043 2R042 3BOPA 1IKPA 3I59B 3PDQA 3HAGA 2HWD3 2R1DA 5CADA 2HWD2 2XBO3 3OBTA 2PFWA 2E63A 2WNEA 2XBO2 2GSYA 2YY1A 4MXWA 5T3NA 2CGPA 1N3PA 1UU5A 4QKFA 5F3IA 1OLRA 3NAPC 5FP4A 3DXUA 3LZZA 1GFF2 2A1XA 4TZDA 1R1A1 2ZGMA 4FPEA 3LIGA 5FY7A 1W9WA 2ZCWA 3WP6A 4IEZA 3S7EA 5JDBA 4K9SA 2A6XA 3OGVA 1OKQA 2VMGA 2GMMA 3AMNA 3KCXA 2XWJB 3DPRA 3LB9A 4LHNA 4UW5A 5A7QA 2Y8KA 5IVJA 1VR3A 2D43A 3E5QA 3O7OA 4RGKA 4D0QA 5JOXA 4Q8KA 1JZ7A 2YZ4A 1F31A 3I2GA 4XBQA 2Y33A 1OH3A 3WVJA 1O3SA 3ZMOA 5E88A 1O4YA 5LA2A 4BQWA 2V4VA 2DVBA 4KMQA 4XETA 4NO4A 2NP0A 4YW4A 4FTEA 4RR3A 2XG3A 3WG2A 1GV9A 1L7QA 1WUVA 1EUTA 1NQDA 4A6OA 4P9LA 4P9JA 4OYUA 1PO13 3DKWA 1PO12 2VC9A 2Q1MA 4XJWA 5JSOA 1RUJ3 2QZ2A 2QQKA 1WW6A 2GNMA 3LWCA 1YFUA 2H0VA 2HWE2 2IFRA 4QWNA 4EWAA 3JXSA 5EJ3A 1RUI3 5BNNC 4TYSA 1V9U1 2HWB1 5J36A 3VD9A 1H2NA 3TNQA 1QJEA 2R071 3R4DB 3RS6A 1EV13 1S0IA 1MS1A 2FDGA 4CTEA 4XIOA 5FWEA 5FPXA 1Y9QA 3MV11 1RTVA 4AQSA 3SCFA 2JKXA 1CAXB 1U5ZA 3APBA 5F3CA 4RL7A 4UW3A 4TSVA 3TEWA 4QB2A 1A8DA 2VR4A 4JVAA 4DXTA 4R4ZA 3WT3A 4UFKA 1NE4A 1YYNA 2Q4SA 1RUD3 1AR81 3PHMA 4AWDA 1RUD2 1W05A 2VZTA 4QPGC 1L7RA 2KD7A 4NVPA 1MS8A 5KXEA 1Y3TA 1TEIA 4MGSA 4PBOA 3T0BA 2Y34A 3RYKA 4HKLA 1U5IA 5A7SA 5HI0A 2IXHA 4LHLA 1UX6A 1ZA4A 3T1LA 1ZZBA 1UY4A 3NL1A 3VB9A 1TME3 1TME2 3MW3A 3ZDVA 1Y9MA 3N35A 3ALQA 2PELA 2WNVC 4J1XA 4BB3A 4ZZ5A 5F7UA 1ND2A 1CONA 3FX3A 2XLAA 2ZOEB 3POSA 3IAQA 3R4SA 5DAPA 4CP2A 1IPSA 2VAUA 3H3ZA 4IE5A 5KC5A 1POV0 3T4VA 2ES3A 4KU7A 1U5YA 1J83A 1OC1A 5DDJ3 5IHRA 1RUH2 2W5FA 5DDJ2 1N3OA 3WUCA 1JHJA 3OD4A 4H3WA 1W6OB 4Q5OA 4LK7A 5JSPA 1H8VA 1LGNA 4PDWB 4RGGA 4Y1XA 5JXJA 1V70A 2ZJCA 5D8AC 4LHSA 5FP3A 3F95A 3POFA 4K3UA 2WNUA 2QKDA 1ZNPA 1UMHA 3VBHA 4AW7A 1RUF3 1REDA 1RUF2 4OHYA 4YARA 3MICA 2BV4A 3AVRA 1I9RA 2JDZA 3FMGA 1O8SA 3G6JB 4R4XA 2VZUA 4JAAA 5AC91 5IK5A 3NV1A 4QU1A 2WLPA 2XUEA 3HQXA 2W08A 2HWC3 5C70A 4QXCA 4Y20B 2HWC2 5FYZA 4BK5A 1G86A 1QKQA 2WAOA 1LEMA 2A3WA 1E5RA 1BK0A 5IVFA 2VMDA 4AQ2A 2YGLA 1RL3A 2ZXQA 3J4UH 4W6XA 4AEDC 4B4RA 3O0XA 1AXKA 2DBNA 1STMA 2LALA 2GZWA 3VZOA 3BPSA 1DIWA 3K77A 4Q26A 5CEHA 2ZHLA 4MX3A 1CX4A 2NQYA 3NJYA 4XZUG 1WZXA 3VBOA 1JZ5A 2XVKA 4A7KA 4NWWA 3QACA 3WG1A 1QXPA 1ZZ8A 3ES4A 4NHKA 2LROA 4MGQA 1LOFA 4G4FA 4NROA 4R9DA 2R49A 3NJZA 3BIWE 4FOWA 3ZFEB 2W1UA 3I2IA 3U07A 3DYOA 3IPVB 1NT0A 1S0BA 1CJPA 3UGFA 2MEV3 3I2OA 1VBE3 5J1XA 2MEV2 4AFBA 1VBE2 3AM2A 3E5XA 1SCSA 5I0SA 3U0ZA 1VBD3 3IN9A 3MIHA 1BHGA 1ND3A 1VBD2 2AH2A 4FPHA 4K6BA 5JMCA 4S2FA 1OD3A 1XOYA 3OGJA 4LTAA 4XMAA 2QQNA 3NSTA 4AVVA 3C8XA 3CL1A 4UYBA 3JB8A 4CDWB 1TNFA 1G8WA 2VOVA 5EWSA 5BNQA 2K46A 2H6CA 2PHFA 4XAAA 1YI7A 4MGIE 1OLMA 1PK6A 3J8F1 3HQUA 3WQ0A 4I01A 4CDQC 3K48A 4S2GA 1SLIA 4JGZA 1JW6A 5F5IA 5C7GA 4NE9A 1V6JA 3Q8AA 5IK8A 5C3OA 1PM4A 1RXGA 1FPN1 1CAWB 1S0JA 3IAPA 2NZ9A 3T0AA 2BYVE 5A33B 4HSJA 1C8M2 1Q56A 3L9JT 2Q8CA 1C3HA 4NIGA 4XFBA 3ZXLA 1XNDA 3V0BA 3LSDA 1O8PA 5H9RA 1DP0A 4CDUC 2JE9A 4FPLA 4A42A 1H4HA 5ANQA 4DXRA 3EMRA 5JUVA 2WZEA 4HANA 2VW0A 1BZWA 4MGYE 4DEVA 3NAPA 5FO9B 4BDVB 4LBJA 4F83A 5J3UA 4Z1VA 4UOJA 1OH4A 3KM5A 5JZGB 4FOYA 2OS2A 3GBWA 2GC1A 2WO7A 2VE1A 3LOIA 4Y22B 3ZPOA 1I1EA 4XILA 2D6PA 2X53S 4YRDA 2UWBA 3VZMA 2WNOA 4IE6A 2WFPA 3IWZA 3U75A 4PF1A 2ZGTA 3CIHA 4EN9B 5GZFA 3T2PA 4PI0A 4Y5TA 3IM0A 5I0RA 2WBKA 2VQTA 1XE8A 1MEC3 1MEC2 2VU9A 1Y9GA 2AYHA 2JDKA 3B94A 4YZ1A 4OHZA 3NV3A 3WNLA 1OOPC 1GZCA 3WG3A 2HEVF 2RR13 2PLV1 3H1WA 4JKMA 5GZGA 1GQPA 4QXBA 1LHVA 1FOD1 2ARBA 4X6QB 1PO21 4FPFA 2EXJA 5BY5A 1M06G 3KLSA 2KA3A 4YW1A 4H2AA 4FPYA 2FHRA 2WZPP 5DXDA 3I2KA 1A78A 1W8NA 2Z79A 2ZX3A 3VD7A 4CZSA 1LRHA 4Z8BA 1O3RA 2HWD1 4UAPA 4CA9A 3BODA 2XBO1 2L9LA 5K9YA 1BVP1 4YM1A 2QTWB 2RVAA 4C0BA 2O8QA 4QQHA 2WWSA 4MLOA 5BNNA 3BCWA 1HB3A 4IEOA 4ET7A 1TMF3 5L9RA 3WHUA 1TMF2 4NHLA 4MGTA 1SLCA 3KHCA 2XJVA 4CCMA 5E89A 2A71A 2WFF3 3MUZ1 4XC9A 3AFGA 2WFF2 3D6EA 4A44A 3AJYA 3MIBA 5FY0A 4YW7A 1AF9A 5CVRA 1Q3EA 5LBBA 5T52A 3ATGA 3JQWA 3VDDC 4YW5A 2WS93 4E8CA 4LO7A 2WS92 3ZN4A 5CYYA 4ZS2A 2Y26A 3S7IA 5L19A 2XKPA 5CG8A 1VP6A 3B02A 1ZA7A 5LA9A 1W03A 2DDUA 1AYN3 5IVEA 1LNSA 2W39A 1AYN2 1G9AA 3LOBA 4QQLA 2P5BA 2JG9B 2P3IA 1QXJA 3FLRA 5L36A 4NN0A 1BMV2 4GD4A 1DYKA 1LCLA 2X5IB 1PO11 2DURA 4YM3A 1LU2A 1G9BA 3T2QA 1RUJ1 1FI2A 1OFSA 1V6KA 4HOOA 2WNVA 2H6BA 4JCKA 4LQRA 5JXIA 1DQ4A 5BNOB 3OUIA 3ILNA 1RUI1 1S4CA 2J1TA 3ZYHA 2P2KA 4LHKA 4YG0A 3WUDA 4FBFA 2RDNA 1R1ZA 1H0BA 2RS13 3K51A 3ZFGB 2RS12 1EV11 5I8SA 3S0MA 2OX0A 3RNSA 5F5QA 3AXDA 5C3QA 1FYUA 1ENSA 1NCQB 1GZWA 3I4IA 1KDKA 2HBUA 3OOXA 1QH7A 4SBVA 5D8AA 3I54A 4FOQA 3VBFB 5JR7B 4B7KA 4BU2A 3IMMA 1O91A 1Q8VA 3TWIA 1XPWA 1A8MA 1RUD1 3AKPA 4KQ7A 4HVQA 2IC1A 4KNCA 4R9AA 4XTMA 5FY1A 4N9HA 2AR6A 1OPOA 1W6QB 4L8QA 5EJZB 3AX4A 1POV3 2D6KA 2VZQA 1ZBA3 3SISA 3ZYGA 1OLQA 4DRRA 5CFCC 3M70A 1TME1 5FZ3A 3GGLA 2ZAHA 3P5BA 1I5ZA 2WZR2 3ZYPA 3D5OA 4WV8A 4HFSA 5DAQA 2GNBA 1QNWA 2AC1A 1DYPA 1YHFA 4BXSV 3GZAA 2JDUA 3AKSA 4GB32 1W3VA 2JD9A 4AEDA 3CBNA 4LBNA 3IIAA 4YWAA 3AP7A 3PUAA 4E4ZA 4NJ4A 2VOWA 4LBLA 4CDXB 3D4KA 5F2WA 1AR63 5B2GB 1AR62 5DDJ1 3ZFFB 4FPGA 1DQ0A 5A6XA 5B4NA 5BXXA 1HB1A 2FDIA 2E33A 2CL2A 5CB7A 3DECA 1W8OA 5GLTA 4XPVA 4HPKB 4R9BA 1E5IA 3VKLA 3N9NA 3P1IA 1V6MA 1RJ8A 1UL9A 1WW7A 2X8KA 3AZVA 3K75B 3ON7A 5L7OC 4IEVA 1TZOA 3WF2A 1RVF1 1J3QA 5FMOL 4RGAA 1LGCA 4Y4YA 4EN6B 1GNYA 2DVGA 2WO1A 3NRUA 4CSWA 1R092 2JX9A 3WF4A 3WX5A 4Q29A 1RUF1 1REEA 3H8OA 1O4TA 4DMIA 1K12A 2XGXA 1NYWA 4ASLA 1IS4A 2D98A 2HWC1 3PMEA 1U12A 4QGMA 3MIDA 4QQ2A 2MNGA 3QCWA 1KQRA 4P5YA 1YEWA 2VZOA 1N47A 3ZN6A 4BWOA 2RHPA 1L7LA 3EJKA 2OW4A 3ZMNA 4BM8A 4HK9A 4CDQA 3ETPA 1DYOA 2K2SA 3AB0A 3KV4A 3PJQA 3U4XA 3W5MA 3MPPG 4OFGA 3T3YA 3OBRA 4EZHA 3VZKA 5F5AA 3WNPA 1SPPA 4C1XA 1HB4A 2BBVA 1SLAA 1DZTA 2ENRA 3FFZA 4QM9A 4OMCA 5FZLA 1VB2A 4GXLA 3HR9A 3THPA 3VKNA 3USSA 1VB4A 5A7WA 4CDUA 1R082 4PHZA 2Y60A 3E6CC 2FCVA 5CIRA 5FUIA 4DEQA 2JKBA 2W47A 2FZ2A 2MEV1 3ZXJA 1VBE1 5K8SA 2GU9A 3MDPA 5FQ0A 3NNMA 1O3TA 3PU3A 4EQVA 1VBD1 2OXBA 4CDWC 1PIV3 2QQVA 5FMCA 1PGW2 1PIV2 2VJXA 4RSUA 4FTSA 4YVWB 3JCIA 4V2VA 5FRAA 3RDIA 1ZVFA 4D3WA 1QJU3 2BWCA 1JYCA 4EROA 1QJU2 1XBFA 2ZGSA 1UWWA 4DZGA 3RWNA 4IEXA 3BOWA 1O5LA 1CX1A 4K40A 1OOPA 4LE4A 1IKQA 1SLTA 4NIDA 3OPZA 3QH6A 4AGRA 2ZMLA 3PVNA 3M1HA 3VL8A 4XJ9A 2QCSB 3AC0A 1WCQA 2VUJA 4M00A 1C8NA 2EXIA 5CKMA 2YPDA 2D6NA 5FPUA 2FZ1A 2JDMA 1T2XA 2PTMA 2VD7A 2NPIA 4AEMA 2DWRA 3I2HA 1BKZA 3N7KA 3PVEA 4GALA 3BKZA 1MQTB 1VMJA 3HNMA 1K5JA 1ZZ7A 2D3PA 1QMJA 3CZJA 2CAUA 4YW3A 1ZRFA 1YWKA 5FZIA 4CUBA 5JZGC 1JOJA 3NNLA 4LKFA 3N9QA 3MIFA 4FFFA 2A6ZA 4CCKA 4DY5A 5DG2A 2GDFA 2XHNA 4GH4B 4PF5A 3RMYA 5LWBA 2AEZA 4MGKE 1K3IA 1QH6A 1POQA 2ZGOA 1LOCA 3E6DA 4P9XA 1FV2A 5LBFA 3VDDA 3LFMA 3TEXA 1BVVA 3AZZA 4LR4A 4LJHA 4PQ9A 1MEC1 5GZDA 3LEKA 4A7YA 3B7MA 5EJ1B 3VKMA 3ES1A 2F17A 5APAA 4JRLA 2WSVA 4OI2A 5G04L 5F8PA 2RR11 4CCNA 4DOUA 4KI5M 4YFZA 2BBAA 3W9AA 1OVPA 3FC0A 2Y64A 2WQ4A 1XYPA 5FLJA 4M0HA 1UOJA 4HSLA 4MXVA 3MIGA 5FZCA 3N9LA 3OYWA 3R05A 2ET7A 3HD8B 5A7OA 5A32A 1UOFA 3S5AA 4CCLA 2XDVA 4JDNA 4HT1T 4ES8A 3O1SA 3WQBA 4KGQA 2FQPA 4JGYB 1D0HA 3ZXKA 2XVLA 1AXYA 3VKOA 1GANA 2R6QA 5FUPA 1TMF1 2R7EB 4HKWA 1YQ2A 1FNZA 2BW8A 3GDBA 2P6HA 3TEZA 1JOPA 4L11A 4K1YA 5EIYB 2WFF1 1W6NB 3Q8CA 4HETA 2ZTNA 3T30A 1CAXA 3UK9A 5T55A 2BRTA 2C26A 3B69A 3H3UA 2WS91 2DV9A 1ZBE2 5JXGA 1BYHA 4IEQA 1AX1A 1CPMA 3I3BA 4PLNA 5LBCA 4Z07A 3H42B 5EV7A 4LULA 4CCEA 3PUHA 5HXVA 1AYN1 4WVMB 3U37A 4P00B 5DZGA 1UIJA 4K8RB 3VN4A 3VBUC 1WMFA 5JIAA 4RYDA 5DUXA 3MGUA 1BMV1 5KHHA 2J1UA 4P9GA 3UKNA 1O4ZA 3DL3A 1IGOA 4Y5Z0 1W99A 5JWPA 4FPJA 5CFCA 3M3QA 3I3MA 2BGOA 3SEEA 4FXGB 3V64A 3FE5A 2D3RA 2VUAA 1UZWA 3CJIB 4OZOA 3RYRA 2WNUC 2R063 2VGDA 2R062 1CAVB 2UYAA 3PUSA 2QJVA 5DMYA 3RZMA 4DIQA 3ZFGC 2WT1A 3H9AA 3IBMA 4KG8A 4HN1A 4F8AA 2RS11 2C9KA 4Q8LA 4DY3A 2RDSA 5IUQA 1OF4A 1AL23 1NCQC 1AL22 2VZVA 4UFIA 4UW4A 2SBAA 1VBB3 4XJUA 1VBB2 1J58A 2ADEA 1JZ8A 2PHWA 4P08A 4Y1UA 5KC6A 2FCUA 3VBRC 3JBG3 1NQJA 5HCBA 5L7OA 3JBG2 2R32A 4KWLA 5FZ8A 5T50A 1HQLA 4JDOA 1R64A 3CKHA 1HXS3 4FFIA 1HXS2 1Y7BA 3SKVA 1GNZA 5IYYA 2WUHA 4LIUA 4Y1ZA 4BQ3A 1V6IA 1ZBA1 3PU8A 3GHNA 5G05L 4G9SB 4NRQA 3KWVA 2VOTA 4Y20A 2UY9A 3USUB 4XFIA 1ONAA 3GALA 3W5NA 3GYDA 5FCCA 1HQNA 2HBTA 1W8HA 3PURA 4LITA 3QBQA 2IXLA 4RS5C 3SXWA 5IJRA 3AYDA 3I2JA 1DHKB 5ISLA 1X8EA 4YGBA 5LK5A 1G9CA 4JHZA 1QDCA 2VXRA 3OBZA 5FYCA 5FZBA 4FSJA 4IV1B 5IAVA 5T54A 1DGRN 3ZFFC 3POEA 4CU7A 2SLIA 3OGRA 2TEPA 1AR61 3ACGA 4XUNA 4DXZA 4ES9A 2IXIA 4QDSA 2F6BA 1AHSA 1JXNA 2JWPA 3HN3A 5J09A 4LO6B 1SBFA 2W91A 3KGLA 3LSEA 4E2SA 2BOIA 3PVBB 3AL5A 2VUCA 3NVCA 4OI4A 4Q1RA 1DGRA 2WWJA 2BP6A 2K0GA 1MS4A 2YV8A 1QQP2 4LO5B 3WQ1A 4CP9B 4QX7A 2VMHA 4ZU7A 4QGLA 4EN8B 5CBLA 1LOBA 2LS6A 3IDAA 4LK6A 1HQWA 1MVEA 2QFEA 5HCFA 3O1OA 4IEPA 3R6SA 3O5SA 1PVC2 4RQPB 3EBRA 1HB2A 2QVSB 4OHWA 3ZKUA 4CDWA 1RXFA 2ZX0A 4K21A 1O7FA 4QX1A 5EYXA 2NM1A 4ARYA 3DF0A 3WF3A 3H1YA 4KWJA 4MYEA 3I7DA 3KT7A 4XCAA 3M2MA 1N1TA 2YC4A 1ULEA 3M3CA 3RPQA 3WINE 1ZZ9A 3V0AA 4J6GA 3D0JA 3HEIA 1CAWA 1S0EA 1S0CA 1F2NA 4M3CB 3WDXA 3JB4C 2XQRA 2XKOA 2Q5TA 3GM8A 2D93A 3DN7A 4HVRA 4PLOA 2PHUA 3BALA 1W6MB 2OYZA 5HBAA 2OA2A 5FKCA 1CVNA 4JHTA 1RUE3 1RUE2 4XEZA 1HV1A 2ZZJA 1HRI3 1QGLA 4AG4A 1HRI2 4NAOA 1TVGA 3B00A 4XJZA 1DQ1A 1YFWA 4Q4Y3 4W65A 5JZGA 4Q4Y2 1AL0G 4IL7A 3VDBA 3OUHA 4LKSA 3VBSC 1IHMA 4LUKA 1SEFA 5JR2A 4WVZA 3S5QA 3KCCA 1H9WA 1S1AA 4YVWC 1PGW1 1PIV1 4DPNA 1JOBA 4RD7A 4EZ4A 3O1PA 3Q8BA 4COYA 5L9VA 1LHNA 1DBNA 2Y6KA 3ACIA 5FZOA 1QOSA 1RINA 5EQUA 2ZPXA 4MG2A 1QJU1 2E53A 2HWE3 2YG0A 2JE7A 1GU3A 5F32A 1ACCA 3T2OA 4GJYA 2VCAA 5EP9A 1LHUA 2OPWA 4LIVA 1YC61 2C5DA 3HWJA 1JU3A 1YI9A 2B42B 2BERA 5BNPC 5KWRA 1Q8OA 4IV3B 4UWDA 4K1ZA 4BK4A 2UU8A 5ANNA 2CDOA 4FVVA 1MR5A 1X82A 1RC6A 1W8ZA 2B39A 2JJ6A 2OQ6A 5H9PA 5A3OA 4C8DA 1MQTC 3V56A 3W20A 2RS32 1IPKA 3GNEA 1LHWA 4XYXA 4B7EA 5HCAA 4OQ8A 4HXCA 1CD3G 4Y5SA 1OSGA 1BLZA 2Q8OA 1K5MB 1H1AA 2Q1ZB 2RJKA 4CEWB 4DO0A 1WD4A 1S0DA 4I0BA 3SLIA 5D1IA 4XW3A 4IQPA 1CZVA 1FXZA 1FMD3 1HN0A 1O5UA 1PVXA 1FMD2 3TN92 3FJSA 3VV1A 4XFAA 2BPA2 1NZIA 1UYPA 2XL9A 5K0UB 5CU1A 5GZCA 4FAHA 4XFCA 1BCXA 1S2BA 5J96B 1NA1C 1XE0A 1E5SA 2I45A 5FPBA 2J7MA 1LB2A 5FZ7A 1OKOA 3IDCB 2Z69A 3VGIA 1ALYA 3VHRA 3NJXA 1PNGA 3VBUA 4M0NA 4EE2A 2B46X 4AXOA 4COZA 1RUH3 1UOGA 4PIXA 4UBHA 4YGCA 3MHZA 1SACA 5H9SA 3DV8A 4P5HA 1G7YA 3VD3A 2QDRA 3ZKYA 1GMMA 3FHIB 1VAKA 4XAEA 1D4M3 2YC0A 4JGYC 3WXPA 1D4M2 1YJLA 4JV4A 4E27A 4E4HA 2WN2A 3OTFA 2A6YA 3C2UA 3LKJA 1XYNA 2B7YA 2A75A 3H8RA 3ZFGA 1RUG3 5JVVA 3NKGA 1RUG2 4WBBA 4IXLA 5AVAA 4CE8A 5ACA3 5ACA2 3WDUA 1X8MA 1YXWA 3GCXA 3PUIA 3P6BA 5FK7A 1NCQA 3MLKA 5LY1A 2DTWA 3RZLA 5DUUA 5FOJB 1X50A 3ZDSA 2JG8B 1JN2P 3ZXDA 3A0NA 3WW3A 3HIFA 4BXFA 1UNBA 4IESA 2JDYA 3VBRA 4DS0A 3T2TA 2AZ5A 3S57A 4W4ZA 1VRH3 4WZCA 1VRH2 5JLVA 2BFUS 2ZX1A 1Q5OA 4TWTA 5DQ0A 4NRPA 3RGBA 4ISQA 2VO5A 5FYMA 1W6QA 5EPAA 4ARXA 5A6QA 2FCTA 2WT2A 4MV2A 4AI2A 1F35A 1SMVA 4Z82A 2W95A 1OPMA 2VNRA 3LA7A 3DEMA 4AI9A 4A6SA 1SHWB 1DCSA 4LMFA 4FCAA 4EJRA 1AYM3 4QPIB 1AYM2 4MSVA 2WJSA 4QT6A 4ATEA 4RS5A 4XMIA 3BI3A 3KGZA 3BU7A 4RHV3 2R061 4RHV2 2VCBA 1QHDA 1B09A 1UU4A 4H55A 4S2HA 3J7LA 1JZ3A 2DUOA 1HLCA 3I3EA 4XDQA 5ABJB 2XVGA 2JE8A 4FQ4A 3ZFFA 5C4WB 2EIBA 5JMOA 3PJYA 1LESA 5BPXA 1PMIA 4DUVA 1TQ5A 1NCRB 2PHTA 3VUOA 1AL21 3B01A 1UYYA 4IE7A 4OHVA 1W2UA 4PIZA 2QQIA 1VBB1 1H8TC 2GH2A 3ZO0B 4AGGA 1GP6A 4UFLA 4B29A 5A1LA 1OQ1A 4P14A 5JI9A 1JBCA 1K42A 3JBG1 4XOGA 5AFEA 1Y4WA 4JRAA 5F1RA 3THDA 1VLNA 1E57A 1VMFA 3L2HA 3F2ZA 3ILFA 1HXS1 3FUQA 4R9CA 3JD73 2WYFA 3JD72 3VZLA 5LATA 4FI9A 3A4UA 4QMAA 1C8M3 4H7LA 5FAXA 4QX2A 2J1AA 3AMQA 1WBFA 3AXEA 4I02A 1WBLA 4FFGA 5C5TA 3H1MA 3H7JA 4D94A 1NLSA 3WCRA 5GM0A 4GQ7A 4MHUA 2B9UA 2Q8DA 2ZGNA 4UFJA 3ZLIA 3DXTA 4QDRA 3EO6A 3OEAA 4NAMA 4N9IA 2OVUA 2Q8EA 5LRRA 1KDMA 2PAKA 1UY2A 4QX8A 2RDQA 4I0AA 4ZKTB 2LRPA 1H4GA 5C8WA 2Q0AA 3ORJA 1LR5A 1W8UA 5DG1A 3SC7X 1ZM1A 2DFCA 2GAUA 4BHPA 3GZEA 1YFXA 4IEYA 4ZXKA 4B4QA 1NLRA 2YUEA 5HXMA 2FD8A 3THTA 5DN2A 1EUUA 2WT0A 3U14A 5FFOC 2F4LA 2G19A 4LT5A 4WVWA 5JPMB 3ZR6A 5A3NA 5BYNA 1KITA 3GBFA 4V2WA 1NG0A 4W6YA 1JTZX 1SG3A 3KT1A 3LDRA 3RVHA 5D21A 3NNFA 5DABA 2DVFA 2DVDA 1RMU2 4JZRA 2FBEA 4XDOA 3VBSA 3OJBA 3ZXEA 2R0HA 4YVWA 2A3XA 2R041 4RR3B 1QDOA 2ZEYA 3ENRA 4I3GA 3DYMA 2QUOA 1S2KA 3J26N 2JICA 1H9PA 1ZZCA 4IERA 2CNAA 2LUWA 1X7NA 4XF3A 5I0TA 3KSCA 4AFMA 3A21A 3VD5A 4NWVA 1OUXA 4Y33A 2BGCA 3ASIA 1H2LA 3QH7A 1QF3A 1W9TA 5HV0A 2O14A 4AF9A 3WW4A 5CFDB 3SMHA 4HKOA 1PMHX 1T6BX 2VBBA 4GMP0 4LXLA 4Y4RA 2RDRA 5TSWA 3ZR5A 2A6VA 5FJHA 5BNPA 4KWKA 5A3TA 1HIXA 5C5UA 1CGPA 4AOCA 3A23A 2YDEA 1UY3A 3W59A 1DZQA 4ZXEA 1ZREA 3O0WA 2W46A 2ZA9A 2BZDA 1XE7A 1MQTA 2OUJA 1WGPA 2VVEA 4B8EA 4NPLA 2DF7A 1RUE1 1W2TA 2BDRA 2YROA 2VOKA 2TBVA 2PMWB 2XXZA 4HK8A 4R52A 3DKQA 5A3WA 1WLWA 3WP4A 1HRI1 2Z42A 4Q0PA 2UYBA 3TB0A 1ULOA 4O7XA 5FP9A 2YGMA 3SNMA 2VUDA 4F7ZA 4AK3A 4DINB 5FZ9A 5C8CB 1UZ0A 1W0OA 4NUBA 2D97A 4M4PA 2HYXA 4YM2A 3FHQA 1OBNA 3FLPA 2W3JA 4GIQA 3RJ2X 1V6OA 2QQJA 5KXDA 1NA1A 1OA3A 1OD5A 2GP3A 2HWE1 4AVAA 3KQ4B 3LPGA 4CP1A 1HJFA 2NLRA 2RS52 3UNPA 1JYVA 2NMOA 1COV3 1MS3A 1COV2 1UX7A 2D40A 1OXCA 2AACA 3POGA 3WEZA 3BTZA 4AVTA 1QJX3 1QJFA 1QJX2 1GBGA 2CV6A 4R8HA 4XJ8A 1N1VA 4YLZA 3VDCA 1HRV3 1HRV2 4IGPA 2ZHKA 1WMXA 4BMBA 1US3A 1FAYA 4Q4W3 4Q4W2 4CEWC 3AYCA 2TUNA 4JGYA 4AI0A 2D7FA 4IUGA 2DVAA 4CYDA 2XJTA 3RZZA 5CA6A 5J98B 3UL2A 1OVSA 4Z2WA 3VBHB 2ZX4A 3LCPA 3NW4A 3J7MA 5D2AA 3OGSA 1JS9A 1CIWA 5GKAC 2Q1FA 3WDVA 5A3UA 3BVCA 2WZR3 2Y6HA 2I74A 3ACHA 4GWMA 2W9XA 1BJQA 2D5HA 5JPNB 1J3RA 4GB33 1YCIA 4WVMA 1DLCA 3U10A 1F8VA 2PYTA 4D6RA 2IVIB 1HDKA 1VIWB 2VQUA 1OQEA 5JIUA 1V6NA 2CWSA 5FYHA 2CTVA 3CJXA 5FZGA 1RGSA 4KH9A 1ZRCA 1RUH1 3EHKA 1OLME 1I6XA 4NIAA 4BQXA 3K2OA 5JOWA 1VE0A 5LW9A 1Z78A 2EAKA 2ZBJA 4PDWC 2C0ZA 3KCYA 1XU1A 4V1PA 2ZKNA 3VBOB 2QQMA 5C3SA 1DDLA 3IIIA 5L73A 3QLQA 3AP6A 4QKBA 5I8TA 2HJIA 3ZIWA 2RM23 1D4M1 2RM22 3UKTA 2RMU2 2J42A 1CAUA 2V09A 3ZYIB 1R093 2IUWA 4FP2A 1BQPA 1GZTA 1KEXA 4QHBA 4L99A 3ZPYA 1UN1A 4K20A 1RUG1 1F5FA 2WO2A 4FPCA 3RZHA 2QQUA 2VH9A 3N36A 3N4MA 2JG8C 4LE3A 4AQ6A 1ND3B 2BNMA 4UFMA 4NR1A 2A7AA 1JYNA 1XU2A 1H8TA 4EN7B 2ZAAA 3IB3A 2B45X 5GLZA 4D7YA 1GUIA 4EV0A 1PGL2 4LBOA 1PK6B 1LJ7A 3O1VA 1O59A 2PA7A 5EZWA 3X29B 5J48A 4I0WB 2WA4A 4JGZB 4YG3A 4X8PA 1NUKA 1F15A 1LU1A 3HT1A 2WIIB 2EIEA 4LBQA 1G9FA 1WLCA 1BEV3 2ARXA 4QAWA 1UPIA 1BEV2 4FO9A 4LO4B 4E4SA 3KD4A 3PIJA 5LASA 1JYTA 4Z2AA 2WYSA 3ZFEC 1A3KA 2DU0A 1AYM1 2XPJA 1R083 5FZAA 1AR93 3JQXA 4GULA 2W94A 1AR92 5FO8B 2JIGA 3V0BB 3WP5A 4RHV1 2E7QA 1SCRA 2GNDA 1VAVA 1XJAA 4HONA 2VZRA 4OULA 1QU0A 5FXWA 4AFAA 5ABJC 1SZBA 2PHXA 5CG9A 3SCHA 3ZN5A 4I2OA 1NCRC 5A1FA 1WCUA 3C7OA 4ISRA 3VL9A 3RWKX 1XNTA 5FYYA 3MF6A 3LGRA 2ORXA 2WKKA 4AHXA 1VBA3 5A6ZA 1VBA2 4P02B 4C91A 1MACA 2A6WA 4NOTA 5JCTA 3I49A 4CU6A 4CXYA 5FTTC 5J7MA 2VNOA 5FZ0A 3TNPB 3HBKA 2Y0OA 2W52A 2HYKA 1PGSA 1WCSA 1UQXA 2E32A 2JB4A 4D7TA 2C6SA 3ZSLA 4EN0A 3JD71 3OGGA 1XSQA 2B4KA 3GBGA 2ZMNA 2ARCA 1T6GC 1UYXA 3I59A 1C8M1 3H8XA 2GALA 5IFPA 1K45A 4IEWA 2UY8A 4LKDA 1EY2A 2VECA 3THCA 4B3NA 5FMBA 1CN1A 1MS5A 4LPLA 4YW6A 2G1MA 1IG0A 2BVBA 2JB8A 4AFDA 1EYBA 5F6LB 3OG2A 4CUAA 1V9U3 1QXRA 2V5DA 3RG0A 1V9U2 4AQTA 5FLIA 4M3CA 5FZEA 1ODMA 3QOPA 1NE6A 1OQDA 3FBYA 5FJKA 4YSFA 2BJSA 1WCKA 2DCKA 2JIJA 2QQOA 4LBMA 5SV8A 2X09A 2VMIA 1DU3D 2LW8A 3LD8A 4WM7B 5BUVA 1WMDA 4EWEA 2YFUA 4KGGA 1KGYA 2XUMA 4AR2A 3AP5A 4D6SA 3OEBA 4G3YC 4NHXA 5AFBA 3I8TA 2C24A 3MUY1 4YM0A 5T5PA 3TYJA 3WCSA 1WW4A 2ZX2A 5FIXA 2XQXA 3H0OA 4NHMA 4XQDA 1AZDA 4LBKA 4QPGB 3L2YA 4GMP3 1GLHA 3MIEA 3OD0A 3Q8FA 4HZFA 5DZEA 2ZGUA 4LEJA 5IFTA 4YPJA 3VZNA 4XFGA 1S0GA 4GZ9A 1B35B 2UWCA 4U36A 3WSOA 1HW5A 3SITA 2WLQA 5CFDC 2ARAA 2JD4A 2WNVB 4AVCA 4BQ2A 3SCGA 2FMDA 1J1LA 2VMFA 1N3QA 1KJRA 2VTXJ 4ORFA 1H2MA 2I07B 2QE3A 3KV6A 1A6CA 1DQ6A 1W9FA 4UF0B 5E6HA 2Y6FA 2DUQA 5LEJA 4SLIA 1ZRRA 1H2KA 2D6MA 2NYYA 3UV9A 1OURA 2OT7A 1ZBE3 1S55A 4PJYA 4YGDA 1YQ6A 1YRZA 1W28A 3W21A 1YQCA 1GZWB 1UF2C 4CEWA 1F4AA 5D8AB 2JG9C 5LY2A 4OUSA 4CUGA 2R16A 5FXVA 3EQEA 3DYPA 5E1RA 1X9TA 2BOJA 5FXZA 5IVBA 2E31A 5C8CC 3KF5A 2X5IC 4LNVA 1JH5A 2VZ3A 2A3YA 4OUMA 1ULGA 2RJ2A 4BZ4A 3ROUA 5LK7B 1MZ6A 1PZ9A 2QDNA 3HNYM 4PCRA 1U0AA 4BISA 5BNOC 3J7HA 1XC6A 1IQDC 4GAZA 3ZXGA 2P4EA 5T5LA 2UWAA 1UMIA 1SLBA 4IDZA 3AZWA 1COV1 1UZVA 4UI9L 4AEDB 4CCJA 1WA6X 1UKGA 3NQHA 2ET1A 1W6OA 3T4HB 1H6XA 2GN7A 2P3KA 2BU9A 4PDWA 4D6QA 4YYOA 4GJZA 5DUVA 3VBFC 3ZXFA 1HRV1 4I30A 1WA4A 1YIPA 3N9MA 5KBFA 2PHRA 3C7HA 1ASJ3 3MBWA 3N7LA 1W90A 1ASJ2 1CJDA 3C7GA 1CESA 3AMHA 3POYA 4PLMA 1GWMA 3OB8A 4QM8A 3WF0A 3IKWA 3MLLA 2C4XA 3C7FA 3GHMA 4XJAA 2CY6A 4P9YA 3UETA 4AL9A 1VALA 1W9YA 2HWF3 2D6LX 3VHPA 2HWF2 2OZ6A 1KFUL 1JZ4A 3BTYA 4ITCA 4NPMA 1W2OA 3UKVA 1POV1 5I0UA 2Q30A 4BCUA 3M3IA 3NKTA 2JG8A 2BWAA 1Y43B 2WZR1 1RITA 4QB6A 4TLGA 5BV6A 2J1SA 4O65A 4YZ5A 2CGOA 3D82A 2J1RA 3HT2A 3WF1A 3KHBA 1MZFA 2V4AA 3J8F2 3IDEA 3FUOA 4GB31 5FYSA 3B5LB 3ZN6B 4HL0A 4CDXC 4NHYA 1DGWX 3N9PA 4GA9A 4URTA 1JZ2A 1OFNA 2YU2A 2IXCA 3WZ1A 1HN1A 4QHZA 2A70A 2IXKA 1OA4A 3TEYA 1DQ2A 3JZVA 1QIQA 2VZSA 3Q9OA 4Q27A 5A3PA 3M3EA 3RRDA 1SPPB 2BGPA 4CP0A 3OSDA 3ZFEA 2E6VA 1BXHA 1QQP3 4W6WA 3WW1A 2IWGB 1VAMA 2WN3A 3IPVA 5FOBB 2BFUL 2RM21 4M4RA 3ZYRA 5CAZA 4JKKA 4CDUB 3UESA 4CPBA 4BLIA 5ABJA 1R091 3T0DA 4AVBA 1EP0A 1MZ5A 1PVC3 2ZEZA 1NCRA 2LTNA 2KM2A 2O0OA 3OUJA 3ZIXA 4QPWA 3ZXAC 1XB9A 3MI8A 4TN7A 4WM8B 5FQ0B 1OT5A 3ABZA 3WD5A 1D2QA 2PQSA 1MZEA 1XNCA 5FBJA 3G7DA 4BQ1A 1NY72 2ZGKA 3E5UA 5KXBA 4XHBA 2XWBB 3R4UA 1XNKA 1EAH3 2YXSA 3SKJE 1Z0HA 1EAH2 4UW6A 1VBC3 1O6UA 1VBC2 4N7IA 1XXNA 1PGL1 4XF0A 4N53B 1NAEA 3KZ4C 3POWA 1W2AX 3GJBA 4QPYA 5IVVA 3I3DA 1GNHA 5FZ1A 5I91A 3O0VA 5A33A 3VHOA 1FOD2 3MV01 1BEV1 3EYPA 2WDBA 1GSLA 1HV0A 4HLTA 4AEKA 3VLBB 2AGSA 3HNBM 2OQ7A 1CZTA 3KT4A 2WSUA 5FR3A 3PVOA 4FP3A 4Q0QA 5A7PA 1R081 5FZHA 1AR91 1ENXA 2HH9A 2DBIA 4JQRA 3WDWA 1UYZA 1JI6A 3ME2A 2VVDA 1QJY3 3MF9A 3JUUA 1QJY2 1W8WA 2D44A 1APNA 3CDZB 2J1VA 3AZXA 1DGLA 2XB6C 3OY8B 4Y22A 3AP4A 4QKNA 3K4ZA 4AEJA 4PT6A 4P9WA 5CKNA 5FYUA 1YNAA 1Q43A 3ZM8A 4QX5A 4DB5A 2PQQA 2BUKA 4QGNA 3SHRA 2X05A 5FZ4A 1MVQA 1UCXA 2WR9A 2ETEA 3WNNA 1JYXA 2K9ZA 4XIKA 2ZABA 1JZ6A 1VBA1 3AKRA 5LCWL 4L92A 1AUYA 2GN3A 3A7QA 4N43B 4O9GA 4YZ4A 3PMSA 4ONUA 4IW3A 2DUPA 3VDDB 4LLOA 1WLTA 4MUVA 1NXD1 3MYXA 2FDFA 4M01A 1LTEA 3D3AA 2XJRA 1NOVA 3ZOIA 2ADDA 4OQ9A 4DNYA 4OHXA 5K7PA 5B4XA 3T08A 4Z92B 1RJ7A 2VL4A 1C4RA 1Q8QA 2I2SA 2OUHA 3E6BA 4TTGA 1PHMA 1OA2A 2YHJA 4AAXA 3IMNA 2GNTA 5FY9A 4WZFA 3ITQA 4L0PA 2Y6GA 3GZTB 5A7NA 2RS33 1ZYBA 1LAJA 5GJ6A 4AI1A 1RUJ2 4EYUA 5F9TA 3OYWB 4BJ0A 3UT0A 5A32B 2ATFA 4ZPIA 2PAMA 4IGOA 5CFDA 4E8DA 3BGAA 2ERFA 4OZXA 1RUI2 5KHGA 4JKLA 5FBZA 5FYVA 2KXLA 4GH4C 2VCCA 3PL0A 4C0HA 3TN93 3TBDA 2AUYA 1EV12 2ZHNA 2IVJA 2JDHA 3B9IA 5FZMA 4A2UA 4WM7C 5C9AB 2EIDA 3BB6A 5JXHA 2FMYA 2NMNA 1GP5A 4XCBA 2ZGPA 3UGGA 4AFCA 4Q4X3 2X29A 2YPJA 4LKEA 3FHAA 4Q4X2 5A70A 2JEMA 4IETA 4XF9A 4BYYA 3AP9A 2NN8A 2JG9A 2ZEXA 1PM7A 3HMYA 1GQGA 3P3PA 1IS6A 2WWUA 4Y3OA 5C8CA 2X5IA 4GMP1 1D2SA 4XUTA 1N1SA 1LOGA 4K8FA 1SBEA 3CNAA 1B35C 4JC1A 5FREA 2VZPA 2E7TA 4LA2A 4BH9A 4ZU5A 1MS9A 5H9QA 2J22A 5DAVA 5CFCB 3H8UA 4BQYA 5BNOA 4BOWA 3WR0A 1S0FA 3QD6A 5IAXA 1ZRDA 3H7YA 5JI7A 1RIRA 5LA1A 4B1LA 2RV9A 2V73A 2W1QA 3ETQA 2DCZA 2RG4A 1UY1A 2ZGRA 1S2EA 4ZY9A 1W8TA 1UD1A 3SQOA 4QQPA 1HJGA 3VBFA 1OI6A 3M4FA 2VM9A 1DF0A 4XABA 1UIKA 1ZBE1 2YU1A 3WHTA 4BPZA 5JSRA 3OBAA 2BQPA 1US2A 1QEXA 4AE2A 3CLPA 1GR3A 4A45A 1PZ8A 5J37A 1RVF3 2Y6LA 4CEYB 1RVF2 1W9SA 3ZSJA 2P1BA 3CZUA 5L7OB 4HMZA 4YVSB 4ASKA 3N7JA 4L9BA 5HCHA 5AVPA 3AKTA 1QOTA 4LA3A 5C3RA 4Q0SA 5M0TA 1WLDA 4XVHA 1PNFA 1CPNA 2VMEA 4OI0A 3CJIC 1W0NA 2JDPA 2Z5WA 4LOTA 4ZS3A 3RSJA 4OUEA 3R0RA 3PNAA 3U4SA 1QOOA 2E51A 2VULA 2EXHA 5F39A 4K7JA 1LULA 2XJUA 1PX4A 1W6PB 1DG6A 1CZSA 1OUSA 2B9VA 1AR73 3NMBA 1AJKA 3ZYJB 1AR72 1YQ5A 2HEWF 1I3HA 4CDXA 4XURA 2BEOA 2OZJA 4XACA 2QQLA 2GMPA 2W68A 3I2FA 1IG3A 5FP8A 2B5HA 4MHRA 3FBMA 4HPKA 4COVA 2QQWA 1RUC3 2CAVA 3FL7A 3CMGA 1RUC2 4M3CF 5FLHA 3ST7A 4AYUA 4BQ4A 2ZGLA 1IS5A 1O3QA 1UXZA 1CIYA 1YJKA 3ACLA 3U1XA 3PUQA 4DUWA 1ASJ1 1KRIA 3IDBB 5GALA 4E4DX 2XLFA 1X33A 2CSGA 3BTAA 4XUPA 2ILMA 5K4LA 3I97A 3AMMA 4L97A 1D4VB 1JUIA 1UO9A 4XF4A 4CXWA 1SFYA 4HN0A 4URAA 2HWF1 3CF6E 3ELNA 5JOZA 2N7GA 2DU1A 2JENA 2XOMA 3KV5A 3LA2A 3NV2A 4Q0VA 4CCCA 1H6YA 2VCMA 2AREA 2VBPA 5KHKA 1AXZA 2VW2A 2HEYF 4QQOA 2BVVA 2Y6JA 2ZGQA 1TNRA 1VJ2A 4X6RB 4LUMA 2A73B 4ZZ8A 3VD4A 2ZEWA 4IV1C 4MXWB 2XJSA 3LEIA 3OCPA 4XBLA 2ZHMA 4BA6A 4BE3A 4UT5A 3J9SA 4CU9A 1LKNA 2H0BA 4NPRA 3V0AB 4AHYA 1NKGA 1Z7S3 2PXJA 2C1FA 1Z7S2 4O61A 2JECA 1TG7A 3HQRA 1GKBA 3KVAA 3DPRB 1DFQA 4Q0UA 2QNKA 5E16A 1RUOA 4H7MA 1QQP1 3H50A 1RHI3 1RHI2 4DUXA 4DQAA 2RJLA 5LEKA 3OPWA 1GQHA 1HX6A 4YGEA 2GC3A 5FUNA 1KFXL 5ERLA 2YMZA 3M3OA 3ZVXA 4MVTA 4RQPC 2QQPA 1RMU3 3CEWA 3SH4A 4E9KA 5A3LA 1W06A 1PVC1 4XTPA 3J7NA 1X9PA 4WM8C 4GKYA 4ASMB 2ZS6B 5FWJA 3K4DA 2G4IA 1W39A 2ZACA 3NO8A 3RI9A 1C5IA 2EXKA 1NY71 2GC0A 2DYCA 3WLUA 3AJZA 4XF1A 2YFZA 1EAH1 5EHDA 5FZOB 1WWYA 4N53C 1VBC1 1AJOA 1C57A 4NRMA 4TLFA 3HBZA 5FY8A 4U2AA 3O12A 4AHZA 2W1WA 4WVVA 5FPLA 1M4WA 3ACFA 3AYEA 1KXGA 4PBPA 2RR12 2P17A 3WNOA 3BIEA 1Q8SA 3WDTA 4FXKB 3A22A 3LF7A 4FAGA 2J1EA 4ZHNA 1FNYA 3FZ3A 2EICA 4QXHA 2CU5A 4GWNA 2WAAA 2CDPA 4INDA 5F2SA 5JOYA 3ZYFA 1PMJX 3VDAA 3POIA 4BMEA 3NNJA 3WNXA 4OCTA 4AZZA 4N7UA 3TAYA 3MLJA 1VRBA 4XE9A 1H1IA 2WC2A 1QJY1 4XDPA 4FT8A 1G9DA 4Q4Y1 5IT6A 2OIIA 4JDMA 4QXKA 1ULCA 5C3PA 1D0GA 3RZJA 2P37A 2FDHA 4GH4A 4FQZA 1YO8A 4XQ4A 3B93A 4A3XA 2PHLA 3WW2A 1FT9A 3WP3A 4WM7A 4N43C 5KXCA 3O1RA 1MPXA 5JAXA 1WW5A 1LOAA 1WMEA 3BYWA 3U78A 1OHFA 2YC2A 1J59A 4LOSA 1UZYA 3C7EA 1ND2B 2DTYA 2RS53 5SV5A 5EXOA 1JU4A 3ILRA 4YW2A 4MO3M 4P9IA 2WA3A 1EPZA 4IV3C 4QPGA 5F3EA 2P34A 1QNYA 1UOBA 3B9CA 1I5PA 1LHOA 4LO8A 1W8FA 3AYAA 4AHWA 1DLLA 2VOXA 5F3GA 3VBUB 3JU9A 1JYWA 3KMHA 2XMLA 1LODA 4OI1A 3VZJA 2XJPA 5CKQA 5A6YA 1B35A 4N90A 4X8NA 2RS31 4Y1VA 1CWPA 4BQ5A 3N9OA 1K5MC 5F37A 1L3JA 2YBKA 3INAA 2EF6A 1UW8A 4LBQD 4MOAA 1SBDA 3MFAA 4JTOA 4Q4V3 4Q2FA 4Y24A 4Q4V2 2WNUB 5KR7A 3KB5A 2JDAA 3NV4A 2O1QA 4A41A 4AI8A 1NZCA 1W6NA 2FDJA 2VXJA 2YB7A 4UF0A 4N8MA 4AVSA 3K3OA 1ST8A 1FMD1 3TN91 5C33A 5C9AC 4O9EA 5K0UC 3IZOA 3K4AA 2VQ0A 4OLLA 1FX5A 4IE0A 2WINB 3FN9A 3POJA 4PI2A 1H30A 3HN1A 4Q4X1 1W04A 5GZEA 1OF3A 2XJQA 5IVYA 4CCOA 1C28A 2WL1A 3Q8EA 4IEUA 4UBGA 3VBRB 1IZ3A 5F5CA 1ULPA 3TOJA 2R0FA 2BNOA 3W58A 4KWUA 3CO2A 2G9ZA 4XXPA 2IFWA 1GZ9A 3MW2A 1ZBA2 4CU8A 2Z4FA 3RJRA 4CCDA 1KJLA 5E8AA 3N7MA 4ZONA 2EALA 3CJIA 3GJAA 4YG6A 3RFRA 4DFSA 3RZKA 2ZZQA 1SDDB 2W92A 1CAVA 1KS5A 5FYBA 3U11A 4A7ZA 1DZRA 2RMU3 4BIFA 5IVCA 2X10A 2XR4A 3I3QA 3SH3A 2YBSA 4RS5B 1VPHA 2CWMA 3KV9A 1ODNA 4OMDA 5IK7A 4J1WA 2BNNA 4I09A 4HVOA 1ULDA 5ACA1 3BU0A 4NIHA 1XNAA 1LOEA 2WQZC 1OMIA 4AAPA 4TXWA 1AX0A 3VKFC 1IQAA 5KHIA 5C6CA 3KVBA 3AKQA 5FZ6A 4CEYC 5CISA 3WY6A 3B3QE 4IE4A 4BLJA 1KS4A 5FPAA 3LFIA 1RUNA 4LLFA 1VRH1 4YVSC 3WQ7A 1UXXX 3M7AA 3WV6A 1RB8G 1KD7A 1PX3A 1NX9A 5FKBA 2A5ZA 2AENA 4Q1PA 4JTNA 1W0PA 2EA7A 1WD3A 4AI3A 3NNGA 2EVXA 5FXXA 1BBT3 4RA0A 5LRSA 3USUA 1BBT2 2VTFA 4QPIC 1QWRA 4FPOB 1HKDA 2D5FA 2WO3A 1UU6A 1XRUA 1ZRIA 4XXAA 1IPJA 3V65A 5FZFA 3ZYBA 5HV4A 4IV1A 4BIOA 3AL6A 5C4WC 1AR71 1UY0A 1Q8PA 3A0KA 4Y26A 1R1A3 3NAPB 4PQQA 1R1A2 2JXAA 3LEGA 4XQWA 5DAWA 4CXXA 3KS7A 2DFBA 5IATA 2DCYA 1P8JA 1PZ7A 1YFYA 1QY4A 5L9BA 1RUC1 1IS3A 1YIFA 1JYIA 4QHOA 1XSRA 3S30A 2F4PA 4CP9A 4GWIA 2C9AA 3AMPA 1XNBA 3LEMA 3FFQA 3ZSKA 1GOGA 3K46A 5IWFA 3UYJA 3OF1A 4META 1F9KA 4A3ZA 4RQPA 1SDWA 1LENA 3NWKA 2VQAA 3URFA 4ATFA 4F3JA 4WM8A 2EIGA 2JDNA 4I3PA 4W50A 2E9QA 3GCWA 3VBSB 4MH0E 4DRVA 1GWKA 4ZU4A 4H14A 1URXA 1XYOA 3UGHA 1W3XA 1ZZ6A 2XH6A 1LEDA 2GMEA 1C1LA 2MHFA 3BN6A 4N53A 4KBZA 4NMIA 2E26A 2E7AA 4C1WA 1A34A 3UJQA 3MEPA 5FZDA 2W2IA 4JX0A 2HWB3 2WABA 2HWB2 3EB7A 3P3NA 3DGTA 5A1AA 4FOVA 5BNNB 2R073 1JODA 2R072 3RQ0A 2ID4A 2P3JA 3HPNA 1DQ5A 1Z7S1 2MPFA 2VVFA 4UXAA 5FP7A 2OKXA 3WNMA 4EWDA 5A3MA 5BNPB 1W6MA 4JQTA 3DPRC 1MS0A 1SFNA 3DUIA 3GXUA 3BUCA 4QD2A 2ZKLA 5FPZA 2VY0A 3H3LA 4MZUA 2WZ8A 1DGWA 1RHI1 2XHKA 1QJZA 4QX0A 3LQCA 1AR83 1BK1A 2ORZA 2V5YA 1AR82 2BTVC 1H1MA 5T5OA 3HOBA 3LAGA 3OY8A 2XONA 3ZSMA 3AK0A 4D8MA 3O1TA 1RMU1 3PTYA 4D7SA 4YFWA 4RFRB 4RR3C 3GZUC 4YZ2A 4MGZE 5DZFA 3E1F1 4QKDA 1V6LA 4KG0A 3EXUA 4Y1YA 4N43A 4J25A 5DPNA 1GP4A 3TRSB 2W87A 3POBA 2Y0IA 5HPOA 4CVUA 3I2DA 5C71A 2XL7A 3AZYA 1NA1B 2AEYA 1UMZA 4A4AA 2VPVA 1RYYA 2WRAA 4IV3A 3C3VA 3O1MA 3CHXA 3KQRA 4DXSA 4B4PA 2GC2A 1YQ8A 5LA0A 3BTXA 1JHNA 3ECQA 1YUDA 4HBNA 4MADA 4C90A 3WNKA 2CGNA 5DUWA 3RZGA 5I8YA 4E2GA 1ENQA 4E2QA 3WDYA 1K5MA 3DCQA 1UKRA 4YZ3A 4L2NA 4COUA 1CQ9A 2VBDA 4YNIA 4QDQA 5IW0A 1V0AA 2VMCA 1JMUB 4D69A 4KBBA 5FY4A 2OPKA 5GLWA 1NXMA 5CNAA 3NJVA 4QB1A 5F6KA 5A80A 3AVSA 5K0UA 5AC93 3D8CA 2KR2A 3BPZA 2WQ8A 4KL1A 5AC92 5C9AA 5FZKA 2W1SA 1ZX5A 4XUQA 1VMHA 5DAXA 5FPVA 5FYTA 1XQNA 2DCJA 2UURA 3LIHA 4XBNA 1NLQA 4CPBD 3HJRA 5FDBA 1ND2C 1C1FA 1E5HA 5I93A 5FV3A 2QZ3A 2RS51 4LORA 5EFUA 2TNFA 1GOHA 4XUOA 2IZWA 5FMOS 5LZ6A 3LDBA 4FPKA 2VNGA 1QJX1 1X36A 3PTRB 1SQ4A 3VHNA 3LE0A 4PIYA 4B1MA 1V00A
chains in the Genus database with same CATH topology
2IXJA 2Y38A 4Q4W1 2YYOA 4GKXA 5T5JA 1N1YA 1JUHA 1SLLA 4Q4V1 3VBHC 1CAUB 3MZHA 3AFKA 3FLTA 4QU2A 5FO7B 4FTBA 1IOAA 3SH5A 1GICA 3RI8A 1EPWA 1UAIA 1UPSA 3O14A 4XZPA 4AGVA 2R30A 3WOGA 4XFFA 1C5HA 2G9FA 1FATA 2D6OX 3MFCA 3IT8A 2W0XA 4CEYA 2HKXA 1F5JA 3J8F3 1H8TB 2PN5A 4YVSA 2D3SA 3PLQA 2XLGA 3ZSEA 3D0SA 2B8MA 4CDQB 2G9GA 3MW4A 2PHDA 3RMXA 4COWA 1FPN3 3VBOC 1FPN2 3FWEA 5EYYA 2DCTA 1ULFA 3N3HA 4XFHA 5KHJA 4LBQB 3ZX7A 4QPIA 1U5XA 1J1TA 2PAEA 4S2DA 5IK4A 1LOFC 2VG9A 1AVBA 4OVEA 1W6PA 1LECA 1WCDJ 2RMU1 1AX2A 3UJOA 4XHXA 3GF6A 1G6NA 5C4WA 1J3PA 3RYPA 1GYKA 1TE1B 4CRQA 2EAAA 2R1BA 1ND3C 2LM3A 2VW1A 2ZMKA 3T1MA 2CYFA 5GLUA 1LGBA 3S6PA 1ENRA 3M8LA 3MPBA 4RFT0 4M3CE 2Z2SB 3CU7A 3WG4A 1FV3A 1PK6C 3E97A 4JGZC 5GLVA 2PLV3 1OOPB 2PLV2 2RE9A 4KU8A 1YLLA 1FOD3 2O8OA 2GH8A 1PO23 1UZZA 1PO22 1REFA 1BBT1 3LA3A 1CR7A 2R043 2R042 3BOPA 1IKPA 3I59B 3HAGA 2HWD3 2R1DA 5CADA 2HWD2 2XBO3 3OBTA 2PFWA 2E63A 2WNEA 2XBO2 2GSYA 2YY1A 4MXWA 5T3NA 2CGPA 1N3PA 1UU5A 1OLRA 3NAPC 3LZZA 1GFF2 4TZDA 1R1A1 2ZGMA 4FPEA 3WP6A 2ZCWA 4IEZA 3S7EA 5JDBA 4K9SA 2A6XA 1OKQA 2VMGA 2GMMA 3AMNA 3KCXA 2XWJB 3DPRA 3LB9A 4LHNA 4UW5A 1VR3A 2D43A 3E5QA 3O7OA 5JOXA 4Q8KA 2YZ4A 1F31A 4XBQA 1O3SA 3WVJA 3ZMOA 5E88A 1O4YA 2DVBA 4XETA 4NO4A 2NP0A 4YW4A 4FTEA 4RR3A 2XG3A 3WG2A 1GV9A 1WUVA 1NQDA 4P9LA 4P9JA 1PO13 3DKWA 1PO12 2Q1MA 4XJWA 5JSOA 1RUJ3 2QZ2A 1WW6A 2GNMA 3LWCA 1YFUA 2H0VA 2HWE2 2IFRA 4EWAA 5EJ3A 1RUI3 5BNNC 4TYSA 1V9U1 2HWB1 5J36A 1H2NA 3TNQA 3R4DB 2R071 3RS6A 1EV13 1S0IA 1MS1A 4CTEA 4XIOA 5FPXA 1Y9QA 1RTVA 4AQSA 3SCFA 1CAXB 1U5ZA 3APBA 4RL7A 4UW3A 4TSVA 1A8DA 4JVAA 4R4ZA 3WT3A 1NE4A 1YYNA 2Q4SA 1RUD3 1AR81 3PHMA 4AWDA 1RUD2 4QPGC 4NVPA 1MS8A 5KXEA 1Y3TA 1TEIA 4PBOA 3RYKA 4HKLA 1U5IA 5HI0A 2IXHA 4LHLA 1UX6A 1ZA4A 3T1LA 1ZZBA 3NL1A 1TME3 1TME2 3MW3A 3N35A 4J1XA 3ALQA 2PELA 2WNVC 1ND2A 1CONA 3FX3A 2XLAA 2ZOEB 3POSA 3R4SA 4CP2A 3H3ZA 5KC5A 1POV0 2ES3A 4KU7A 1U5YA 5DDJ3 1RUH2 5DDJ2 1N3OA 3WUCA 4H3WA 3OD4A 1W6OB 5JSPA 1H8VA 1LGNA 4PDWB 4RGGA 4Y1XA 1V70A 2ZJCA 5D8AC 4K3UA 2WNUA 2QKDA 1ZNPA 3VBHA 4AW7A 1RUF3 1REDA 1RUF2 4OHYA 4YARA 3MICA 1I9RA 2JDZA 3FMGA 4R4XA 3G6JB 5AC91 4JAAA 5IK5A 3NV1A 2WLPA 3HQXA 2W08A 2HWC3 4Y20B 2HWC2 1G86A 1QKQA 1LEMA 2A3WA 2YGLA 1RL3A 3J4UH 4W6XA 4AEDC 4B4RA 3O0XA 1AXKA 2LALA 2GZWA 3VZOA 1DIWA 4Q26A 2ZHLA 4MX3A 1CX4A 2NQYA 3VBOA 2XVKA 4A7KA 4NWWA 3QACA 3WG1A 1QXPA 1ZZ8A 3ES4A 4NHKA 1LOFA 4G4FA 4R9DA 2R49A 3NJZA 3BIWE 4FOWA 3ZFEB 3U07A 3IPVB 1S0BA 1CJPA 2MEV3 1VBE3 2MEV2 4AFBA 1VBE2 3AM2A 3E5XA 1SCSA 5I0SA 1VBD3 3IN9A 3MIHA 1ND3A 1VBD2 2AH2A 4FPHA 4K6BA 5JMCA 4S2FA 3OGJA 4XMAA 4LTAA 4AVVA 3NSTA 3CL1A 4CDWB 3JB8A 1TNFA 1G8WA 2VOVA 5EWSA 5BNQA 2H6CA 2PHFA 1YI7A 4MGIE 1PK6A 3J8F1 3WQ0A 4I01A 4CDQC 3K48A 4S2GA 1SLIA 4JGZA 1JW6A 1V6JA 5IK8A 1FPN1 1CAWB 1S0JA 2NZ9A 2BYVE 5A33B 4HSJA 1C8M2 1Q56A 3L9JT 1C3HA 4XFBA 3ZXLA 1XNDA 3V0BA 3LSDA 5H9RA 4CDUC 2JE9A 4FPLA 1H4HA 4HANA 2VW0A 1BZWA 4MGYE 3NAPA 5FO9B 4LBJA 4F83A 5J3UA 4Z1VA 3KM5A 5JZGB 4FOYA 3GBWA 2GC1A 1I1EA 3LOIA 4Y22B 4XILA 2D6PA 2X53S 4YRDA 2UWBA 3VZMA 2WFPA 3IWZA 2ZGTA 4EN9B 5GZFA 3IM0A 5I0RA 1XE8A 1MEC3 1MEC2 2VU9A 2AYHA 4YZ1A 3B94A 4OHZA 3NV3A 1OOPC 1GZCA 3WG3A 2HEVF 2RR13 2PLV1 3H1WA 5GZGA 1LHVA 1FOD1 2ARBA 4X6QB 1PO21 4FPFA 2EXJA 5BY5A 1M06G 3KLSA 2KA3A 4YW1A 4FPYA 2FHRA 2WZPP 5DXDA 1A78A 2Z79A 2ZX3A 4CZSA 1LRHA 4Z8BA 1O3RA 2HWD1 3BODA 2XBO1 5K9YA 1BVP1 4YM1A 4C0BA 2O8QA 4QQHA 2WWSA 4MLOA 5BNNA 3BCWA 4IEOA 1TMF3 3WHUA 1TMF2 4NHLA 1SLCA 2XJVA 5E89A 2A71A 2WFF3 3AFGA 2WFF2 3D6EA 3AJYA 3MIBA 1AF9A 5CVRA 1Q3EA 5T52A 3ATGA 3JQWA 3VDDC 4YW5A 2WS93 4LO7A 2WS92 3ZN4A 2Y26A 3S7IA 5L19A 2XKPA 5CG8A 1VP6A 3B02A 1AYN3 2W39A 1AYN2 1G9AA 3LOBA 4QQLA 2JG9B 2P3IA 1QXJA 3FLRA 5L36A 4NN0A 1BMV2 1DYKA 1LCLA 2X5IB 1PO11 2DURA 4YM3A 1LU2A 1G9BA 1RUJ1 1FI2A 1OFSA 1V6KA 2WNVA 2H6BA 4JCKA 1DQ4A 5BNOB 3ILNA 1RUI1 2P2KA 4LHKA 4YG0A 3WUDA 4FBFA 1R1ZA 1H0BA 2RS13 3K51A 3ZFGB 2RS12 1EV11 5I8SA 3S0MA 3RNSA 5F5QA 3AXDA 1FYUA 1ENSA 1NCQB 1GZWA 3I4IA 1KDKA 4SBVA 4B7KA 1QH7A 5D8AA 3VBFB 3I54A 4FOQA 5JR7B 1O91A 1Q8VA 3TWIA 1A8MA 1RUD1 3AKPA 4KQ7A 4HVQA 2IC1A 4KNCA 4R9AA 4XTMA 4N9HA 2AR6A 1OPOA 1W6QB 4L8QA 3AX4A 1POV3 2D6KA 1ZBA3 3SISA 3ZYGA 1OLQA 4DRRA 5CFCC 3M70A 1TME1 2ZAHA 1I5ZA 2WZR2 3ZYPA 3D5OA 4WV8A 4HFSA 2GNBA 1QNWA 1DYPA 1YHFA 3GZAA 3AKSA 4GB32 4AEDA 4LBNA 3IIAA 3AP7A 4E4ZA 2VOWA 4LBLA 4CDXB 3D4KA 1AR63 5B2GB 1AR62 5DDJ1 3ZFFB 4FPGA 1DQ0A 5BXXA 2CL2A 5CB7A 5GLTA 4XPVA 4HPKB 4R9BA 3VKLA 2X8KA 1V6MA 1RJ8A 1UL9A 1WW7A 3AZVA 5L7OC 4IEVA 3N4MA 1RVF1 1J3QA 5FMOL 4RGAA 1LGCA 4Y4YA 4EN6B 2DVGA 1R092 2JX9A 3WX5A 4Q29A 1RUF1 1REEA 1O4TA 4DMIA 2XGXA 1NYWA 4ASLA 1IS4A 2D98A 2HWC1 3PMEA 1U12A 4QGMA 3MIDA 4QQ2A 2MNGA 3QCWA 1KQRA 3ZN6A 1N47A 4BWOA 2RHPA 3EJKA 2OW4A 3ZMNA 4BM8A 4HK9A 4CDQA 3AB0A 2K2SA 3U4XA 3PJQA 3MPPG 4OFGA 3OBRA 3VZKA 4C1XA 2BBVA 1SLAA 1DZTA 2ENRA 3FFZA 4QM9A 1VB2A 4GXLA 3HR9A 3THPA 3VKNA 3USSA 1VB4A 4CDUA 1R082 3E6CC 5CIRA 2JKBA 2FZ2A 2MEV1 3ZXJA 1VBE1 5K8SA 2GU9A 3MDPA 5FQ0A 1O3TA 1VBD1 4CDWC 1PIV3 1PGW2 1PIV2 4RSUA 4FTSA 4YVWB 3JCIA 5FRAA 3RDIA 1ZVFA 4D3WA 1QJU3 2BWCA 1JYCA 4EROA 1QJU2 2ZGSA 4DZGA 3RWNA 4IEXA 3BOWA 1O5LA 4K40A 1OOPA 4LE4A 1IKQA 1SLTA 3OPZA 3QH6A 4AGRA 2ZMLA 3PVNA 3M1HA 3VL8A 4XJ9A 2QCSB 2VUJA 4M00A 1C8NA 2EXIA 2D6NA 2FZ1A 2PTMA 4AEMA 2NPIA 2DWRA 1BKZA 3N7KA 3PVEA 4GALA 1MQTB 1ZZ7A 2D3PA 1QMJA 4YW3A 2CAUA 1ZRFA 1YWKA 5JZGC 1JOJA 3MIFA 2A6ZA 4DY5A 5DG2A 2GDFA 4GH4B 4PF5A 3RMYA 4P9XA 4MGKE 1QH6A 2ZGOA 1LOCA 3E6DA 1FV2A 3VDDA 1BVVA 3AZZA 4LR4A 4PQ9A 5GZDA 1MEC1 4A7YA 3B7MA 3VKMA 3ES1A 4JRLA 2WSVA 4OI2A 2RR11 4DOUA 4YFZA 3W9AA 3FC0A 2WQ4A 1XYPA 5FLJA 4M0HA 4HSLA 4MXVA 3MIGA 3OYWA 3R05A 2ET7A 3HD8B 5A32A 4JDNA 4HT1T 4ES8A 4KGQA 2FQPA 4JGYB 1D0HA 3ZXKA 2XVLA 1AXYA 3VKOA 1GANA 2R6QA 1TMF1 4HKWA 1FNZA 2BW8A 4L11A 4K1YA 2WFF1 1W6NB 4HETA 2ZTNA 1CAXA 3UK9A 5T55A 3B69A 3H3UA 2WS91 2DV9A 1ZBE2 1BYHA 4IEQA 1AX1A 1CPMA 4PLNA 4Z07A 5EV7A 4LULA 5HXVA 1AYN1 4WVMB 5DZGA 1UIJA 3VN4A 3VBUC 1WMFA 5JIAA 5DUXA 3MGUA 1BMV1 5KHHA 4P9GA 3UKNA 1O4ZA 3DL3A 1IGOA 4Y5Z0 5JWPA 4FPJA 5CFCA 3M3QA 4FXGB 3V64A 3FE5A 2D3RA 2VUAA 3CJIB 3RYRA 2WNUC 2R063 2VGDA 2R062 1CAVB 2UYAA 2QJVA 3ZFGC 2WT1A 3H9AA 3IBMA 4KG8A 4HN1A 4F8AA 2RS11 4Q8LA 4DY3A 5IUQA 1AL23 1NCQC 1AL22 4UW4A 2SBAA 1VBB3 4XJUA 1VBB2 1J58A 2PHWA 4Y1UA 5KC6A 3VBRC 3JBG3 1NQJA 5HCBA 5L7OA 3JBG2 2R32A 4KWLA 5T50A 1HQLA 4JDOA 1HXS3 1HXS2 1Y7BA 1GNZA 4Y1ZA 1V6IA 1ZBA1 3GHNA 4G9SB 4Y20A 3USUB 2UY9A 4XFIA 1ONAA 3GALA 3GYDA 5FCCA 1HQNA 3QBQA 2IXLA 4RS5C 3SXWA 3AYDA 1DHKB 1X8EA 4YGBA 5LK5A 1G9CA 1QDCA 2VXRA 4FSJA 4IV1B 5T54A 1DGRN 3ZFFC 2SLIA 2TEPA 1AR61 4DXZA 4ES9A 2IXIA 2F6BA 1AHSA 1JXNA 5J09A 4LO6B 1SBFA 3KGLA 3LSEA 4E2SA 3PVBB 3NVCA 4OI4A 4AFDA 4Q1RA 3WQ1A 1DGRA 4LO5B 2K0GA 1MS4A 2YV8A 1QQP2 2VMHA 4ZU7A 4QGLA 4EN8B 5CBLA 1LOBA 1HQWA 1MVEA 2QFEA 5HCFA 4IEPA 3R6SA 3O5SA 1PVC2 4RQPB 3EBRA 2QVSB 4OHWA 4CDWA 2ZX0A 4K21A 1O7FA 5EYXA 2NM1A 3DF0A 3H1YA 4KWJA 4MYEA 3I7DA 3KT7A 3M2MA 1N1TA 3M3CA 1ULEA 3RPQA 3WINE 1ZZ9A 3V0AA 4J6GA 3D0JA 1CAWA 1S0EA 1S0CA 1F2NA 4M3CB 3WDXA 3JB4C 2XKOA 2Q5TA 4HVRA 2D93A 3DN7A 4PLOA 2PHUA 3BALA 1W6MB 2OYZA 5HBAA 2OA2A 1CVNA 1RUE3 1RUE2 4XEZA 1HV1A 2ZZJA 1HRI3 1QGLA 4AG4A 1HRI2 3B00A 4XJZA 1DQ1A 1YFWA 4Q4Y3 4W65A 5JZGA 4Q4Y2 1AL0G 4IL7A 3VBSC 1IHMA 4LUKA 1SEFA 4WVZA 3KCCA 1H9WA 1S1AA 4YVWC 1PGW1 1PIV1 4DPNA 4RD7A 4COYA 1LHNA 1DBNA 1QOSA 1RINA 2ZPXA 1QJU1 2E53A 2HWE3 2JE7A 1LHUA 2C5DA 3HWJA 1YI9A 2B42B 5BNPC 5KWRA 1Q8OA 4IV3B 4K1ZA 2UU8A 4FVVA 1MR5A 1X82A 1RC6A 2B39A 2JJ6A 5H9PA 1MQTC 3V56A 2RS32 1IPKA 3GNEA 1LHWA 4XYXA 4B7EA 5HCAA 1CD3G 1OSGA 2Q8OA 1K5MB 1H1AA 2Q1ZB 2RJKA 4CEWB 1WD4A 1S0DA 4I0BA 3SLIA 5D1IA 4XW3A 4IQPA 1FXZA 1FMD3 1O5UA 1PVXA 3VV1A 1FMD2 3TN92 3FJSA 2BPA2 4XFAA 2XL9A 5K0UB 5CU1A 5GZCA 4FAHA 4XFCA 1BCXA 1S2BA 5J96B 1NA1C 2I45A 1LB2A 3IDCB 2Z69A 3VGIA 1ALYA 3VHRA 1PNGA 3VBUA 4M0NA 2B46X 4AXOA 4COZA 1RUH3 4PIXA 4UBHA 4YGCA 1SACA 5H9SA 3DV8A 4P5HA 1G7YA 2QDRA 3FHIB 1VAKA 1D4M3 2YC0A 4JGYC 3WXPA 1D4M2 1YJLA 4JV4A 4E27A 3OTFA 2A6YA 3C2UA 3LKJA 1XYNA 2B7YA 2A75A 3ZFGA 1RUG3 5JVVA 3NKGA 1RUG2 4WBBA 4IXLA 5AVAA 5ACA3 5ACA2 3WDUA 1X8MA 1YXWA 1NCQA 3MLKA 2DTWA 5DUUA 5FOJB 1X50A 3ZDSA 2JG8B 1JN2P 3ZXDA 3A0NA 3WW3A 3HIFA 4IESA 3VBRA 4DS0A 3T2TA 2AZ5A 1VRH3 4WZCA 1VRH2 5JLVA 2BFUS 2ZX1A 1Q5OA 4TWTA 4ISQA 1W6QA 2WT2A 4MV2A 4AI2A 1SMVA 4Z82A 1OPMA 2VNRA 3LA7A 4FCAA 4EJRA 1AYM3 4QPIB 1AYM2 4MSVA 2WJSA 4QT6A 4ATEA 4RS5A 4XMIA 3KGZA 3BU7A 4RHV3 2R061 4RHV2 1QHDA 1B09A 1UU4A 4H55A 4S2HA 2DUOA 1HLCA 4XDQA 5ABJB 2XVGA 4FQ4A 3ZFFA 5C4WB 3PJYA 1LESA 5BPXA 1PMIA 1TQ5A 1NCRB 2PHTA 3VUOA 1AL21 3B01A 4OHVA 1W2UA 4PIZA 1VBB1 1H8TC 2GH2A 3ZO0B 4AGGA 4B29A 1OQ1A 4P14A 5JI9A 1JBCA 3JBG1 4XOGA 5AFEA 4JRAA 5F1RA 1VLNA 1E57A 3L2HA 3ILFA 1HXS1 3FUQA 4R9CA 3JD73 3JD72 3VZLA 3A4UA 4QMAA 1C8M3 4H7LA 5FAXA 3AMQA 1WBFA 3AXEA 4I02A 1WBLA 3H1MA 3H7JA 4D94A 1NLSA 3WCRA 5GM0A 4GQ7A 2B9UA 2ZGNA 3EO6A 4N9IA 2OVUA 5LRRA 1KDMA 2PAKA 4I0AA 4ZKTB 1H4GA 5C8WA 2Q0AA 1LR5A 5DG1A 1ZM1A 2DFCA 2GAUA 4BHPA 1YFXA 4IEYA 4ZXKA 4B4QA 1NLRA 2YUEA 3THTA 2WT0A 5FFOC 4LT5A 4WVWA 5JPMB 5BYNA 1KITA 3GBFA 4W6YA 1NG0A 1JTZX 3KT1A 2DVFA 2DVDA 1RMU2 2FBEA 3VBSA 3OJBA 3ZXEA 2R0HA 4YVWA 2A3XA 2R041 4RR3B 1QDOA 3ENRA 4I3GA 2QUOA 1S2KA 3J26N 2JICA 1H9PA 1ZZCA 4IERA 2CNAA 2LUWA 1X7NA 4XF3A 5I0TA 3KSCA 4AFMA 4NWVA 2BGCA 3ASIA 1H2LA 3QH7A 1QF3A 4AF9A 3WW4A 5CFDB 3SMHA 4HKOA 4GMP0 5TSWA 2A6VA 5BNPA 4KWKA 1HIXA 1CGPA 2YDEA 3W59A 1ZREA 1DZQA 3O0WA 2ZA9A 1XE7A 1MQTA 2OUJA 1WGPA 2VVEA 4B8EA 2DF7A 1RUE1 2YROA 2VOKA 2TBVA 4HK8A 3WP4A 4R52A 1WLWA 1HRI1 2Z42A 4Q0PA 2UYBA 3TB0A 2YGMA 3SNMA 4F7ZA 4AK3A 4DINB 5C8CB 1W0OA 2D97A 4YM2A 3FLPA 4GIQA 3RJ2X 1V6OA 5KXDA 1NA1A 1OA3A 1OD5A 2HWE1 4AVAA 4CP1A 2RS52 2NLRA 2NMOA 1COV3 1MS3A 1COV2 2D40A 4AVTA 1QJX3 1QJX2 1GBGA 2CV6A 4R8HA 4XJ8A 1N1VA 4YLZA 1HRV3 1HRV2 2ZHKA 4BMBA 1FAYA 4Q4W3 4Q4W2 4CEWC 3AYCA 2TUNA 4JGYA 4AI0A 2D7FA 2DVAA 4CYDA 2XJTA 3RZZA 5CA6A 5J98B 3UL2A 4Z2WA 3VBHB 2ZX4A 3LCPA 3NW4A 3WDVA 1CIWA 5GKAC 2WZR3 2I74A 4GWMA 1BJQA 2D5HA 5JPNB 1J3RA 4GB33 1YCIA 4WVMA 3U10A 1F8VA 2PYTA 1HDKA