2O8QA

Crystal structure of a protein with a cupin-like fold and unknown function (bxe_c0505) from burkholderia xenovorans lb400 at 1.55 a resolution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
129
structure length
122
Chain Sequence
GMKLQTTIQHEPKDGSGFDRREFFEYRDTGVNEATGGMFGAHVIRAIPPTWHTHTVGFQLFYVLRGWVEFEYEDIGAVMLEAGGSAFQPPGVRHRELRHSDDLEVLEIVSPAGFATSVVDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title Crystal structure of hypothetical protein (YP_555756.1) from Burkholderia xenovorans LB400 at 1.55 A resolution
rcsb
source organism Burkholderia xenovorans
molecule tags Metal binding protein
total genus 23
structure length 122
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2o8qA00
5FPXA 2BNNA 5KBFA 4X6QB 1Y3TA 1UPIA 4HSLA 2N7GA 2Y0OA 3EBRA 1CAUB 3KCCA 3WW1A 2D5FA 2IXCA 3RDIA 5KHHA 3IDBB 3KSCA 2VQAA 2ZCWA 4HSJA 2XHKA 1OMIA 3S7IA 1CGPA 2ET1A 2UY9A 5CADA 2C0ZA 5EFUA 3LA7A 3MPBA 5I0UA 5K8SA 2HKXA 3QACA 1ZX5A 2D5HA 4R8HA 4N9HA 2QNKA 2K9ZA 1NYWA 1X7NA 3ELNA 3ACLA 2D40A 4FAGA 3IBMA 2PTMA 3KMHA 5T3NA 4IEUA 1ZRDA 1RUNA 4CYDA 2IXLA 4E2QA 1ZREA 1QXJA 4AVAA 1YFXA 1ZRRA 4XF3A 3JZVA 3FJSA 4UXAA 5JAXA 3RPQA 1J3QA 3NW4A 3ZDSA 2B8MA 5I0TA 5I8TA 2XLAA 4OFGA 1J58A 4I3PA 4META 4QMAA 5I91A 4Q0VA 1CAXB 4ONUA 3FWEA 2OPKA 2VPVA 2PAEA 1YLLA 4HLTA 3E5XA 2QDRA 2GC1A 4JTOA 1FXZA 2XLGA 3D82A 2Q0AA 5CU1A 3ES1A 4B29A 4Q0QA 3PLQA 2B9UA 1Q5OA 5FPZA 4YNIA 2OZ6A 4XF9A 4Q0PA 2GH2A 4XFIA 5E1RA 5I0RA 3ROUA 3BU7A 5BPXA 2PHLA 3RYRA 3H7JA 5FQ0A 1CAVB 4O9EA 4IEVA 1YFYA 2BEOA 5LRSA 3NKTA 3S7EA 1G6NA 4L2NA 4LUMA 4LTAA 3PNAA 3R6SA 1UD1A 4QXKA 4XEZA 2PHDA 1Q43A 4MH0E 3DV8A 1X8EA 2IC1A 1ZRFA 1IPJA 2IXHA 1WLTA 4L11A 3RZZA 5J48A 3EJKA 3WW2A 2XL9A 3KGZA 2ZKLA 4Q29A 4K8FA 2DCTA 5JR7B 2IXKA 4WBBA 1CAWA 3H1YA 3O14A 1NE4A 5C8WA 2FMYA 5FQ0B 3HQXA 1V70A 1XE7A 1FT9A 2H0VA 4XF0A 4XF1A 2PQQA 4HVQA 3RYPA 1QY4A 3I7DA 1SEFA 4D7SA 1ZZ9A 1RUOA 2K0GA 4D7TA 2VECA 2ET7A 4YSFA 2V09A 1XE8A 4IERA 2PAMA 5FLHA 3I59A 4XFGA 5I93A 1HW5A 4ZU7A 2KXLA 1CAWB 3H7YA 3MDPA 5BUVA 3ST7A 5FCCA 5FLIA 2MNGA 1DZRA 2Q1ZB 4ORFA 4A2UA 2PFWA 4HBNA 2PAKA 1YWKA 2BGCA 4GULA 4KWJA 4FT8A 4Z07A 4PIXA 5JSPA 1O7FA 1NXMA 2EA7A 1CX4A 4I09A 2OYZA 4Z82A 2CV6A 2ATFA 3EO6A 1U12A 5CVRA 1J3PA 2FQPA 3H1MA 4IEOA 4UBHA 2UY8A 4YARA 3PVBB 2HJIA 4XFFA 1LR5A 5F1RA 2BYVE 1O3SA 4EROA 1OD5A 1YFUA 4BIFA 4AXOA 2I45A 3H1WA 3CO2A 4XFCA 4OLLA 5BY5A 1O5UA 3NSTA 3MZHA 3SMHA 2CGPA 4E2SA 1VR3A 2GC0A 5KHIA 1IPKA 2P17A 1X82A 3CEWA 1ZZCA 3LOIA 4YYOA 1VJ2A 1LKNA 4H7LA 2WC2A 4J1WA 4AQ2A 4FBFA 4MUVA 1ZZ8A 2BNOA 1H1IA 3H9AA 4E2GA 4XFAA 3DKWA 4WVZA 3D0SA 3B02A 1QWRA 4J1XA 5FDBA 1Q3EA 3DL3A 4EWDA 1O3RA 3U0ZA 2XKPA 5EZWA 4KU8A 3RYKA 4IEQA 2Z2SB 3BCWA 3EQEA 4I01A 4N9IA 3N4MA 5KHGA 2O1QA 3ETQA 4JTNA 4IEYA 1YUDA 2GZWA 4HZFA 4MGYE 1O5LA 1ZZ6A 4KL1A 5J7MA 4HN1A 1TQ5A 1WA4A 2GAUA 4XF4A 2O8QA 4MGZE 3E97A 1GQGA 4UBGA 3OF1A 4F8AA 3UKVA 2XGXA 1EYBA 3M3IA 5JSRA 3GBFA 4KWKA 4F7ZA 3FHIB 4EWEA 3NVCA 3WW3A 4QX5A 4LULA 3OCPA 3QOPA 4Q0UA 4AVCA 1EPZA 1CAUA 2QCSB 1UIJA 4TLFA 3ES4A 4IETA 2OA2A 1RTVA 3MYXA 3OGJA 2OZJA 3LA2A 4NVPA 1Y9QA 3H8UA 3OTFA 3UKNA 3E6CC 5KHJA 4LA3A 3HIFA 2E9QA 3H3ZA 4LEJA 1SQ4A 1DGRA 3H3UA 1I5ZA 1J3RA 5LEKA 2XL7A 3FE5A 3FX3A 5I0SA 4I02A 1L3JA 4QGNA 4O9GA 4XFHA 3C3VA 3IIAA 4PJYA 1DGWA 1WGPA 1VP6A 4KWLA 3NL1A 1GQHA 4HVRA 1UW8A 2Z69A 3FZ3A 2CAUA 4IEWA 4MZUA 1ZNPA 3S0MA 3L2HA 2IXIA 1OFNA 4BHPA 1YHFA 2B5HA 3E5UA 4DINB 3DN7A 5BXXA 4I0BA 3BPZA 4IEPA 3UKTA 4EWAA 1X8MA 3TNPB 2Q4SA 2GC3A 4EV0A 3E6BA 3I59B 1PM7A 5I8SA 1YFWA 4HMZA 1PMIA 1ZZBA 4XETA 2F4PA 4R52A 3I54A 2PA7A 2EAAA 1XRUA 3CL1A 2UYAA 2UYBA 1J1LA 1CAXA 4LLOA 4X6RB 5KHKA 3BB6A 1JUHA 1UCXA 2QJVA 2XKOA 2D93A 4I0AA 4QM9A 3LA3A 5JSOA 2BNMA 2XLFA 4LUKA 3E6DA 5J3UA 1O3QA 3LZZA 3FFQA 3IWZA 4AQ6A 4WZCA 1ZRCA 5D1IA 2WFPA 1QXRA 1RGSA 3D0JA 4YRDA 5C6CA 3CF6E 3LWCA 4IEZA 3E5QA 4PIYA 4IESA 4MGKE 1ZVFA 3HT2A 4I2OA 4MV2A 1SFNA 1OI6A 1CAVA 2CAVA 4QGMA 4MX3A 2GC2A 4KU7A 1RC6A 2IXJA 4HN0A 5E16A 1EP0A 3LAGA 4RD7A 1O4TA 1UIKA 1O3TA 3U10A 1EY2A 2ETEA 2PYTA 4P9GA 1NZCA 2Q30A 2EVXA 2MHFA 1FI2A 4JV4A 3EHKA 4BYYA 5BV6A 1H1MA 5JCTA 4IEXA 3VHRA 3HT1A 4ZU4A 2GU9A 1DZTA 1NE6A 3SCFA 3M70A 4Q0SA 5LRRA 3CJXA 3KGLA 3H50A 3OD0A 2H6CA 3SCHA 3GYDA 3NJZA 5FLJA 4BH9A 2MPFA 4HVOA 4MGIE 1RL3A 4FAHA 1LRHA 3BALA 4JVAA 3USSA 4PIZA 3SCGA 3CLPA 4AVBA 3SHRA 3SXWA 3IDCB 5AVPA 3G7DA 4XFBA 1J59A 4ZU5A 1ZZ7A 1I6XA 4QGLA 5LEJA 2QVSB 3RNSA 1LB2A 4QM8A 2H6BA 3WW4A 5HI0A 5I8YA 4LA2A 3TNQA 3U11A
chains in the Genus database with same CATH superfamily
2BNNA 3ACFA 2QE3A 4O7XA 5CZKA 4JCKA 5F9TA 1ASJ1 1MS0A 5KXBA 1UPIA 1WZXA 1SLAA 3HPNA 4FPYA 2GP3A 4JDNA 4XHBA 1QJU1 1UAIA 1MQTB 2HWD2 2N7GA 4YM0A 3KCCA 4GMP1 4XVHA 1COV1 5D8AC 2HWB3 2WLPA 4FCAA 2V73A 1AL23 4QB2A 3RJRA 1NCQC 1ND2B 1VAMA 2YPDA 3KSCA 5DAQA 1OPMA 5IVFA 4QX7A 1IS4A 4ISRA 1LU2A 1HN1A 2DBIA 2XHKA 1OMIA 4KBBA 1UYXA 2ET1A 4WZFA 2O14A 5AC92 5IAXA 3HN1A 1HB4A 3LA7A 3MPBA 5I0UA 5K7PA 1PNGA 1WCUA 4K7JA 3ZOIA 4NOTA 1RUH2 2HBUA 2D5HA 3MF6A 1KFXL 1Q8QA 2W46A 4G3YC 1DQ4A 2QTWB 3VDDA 1TME3 3ASIA 1H4GA 3NKGA 4CDWC 3VBFC 3IT8A 4QX3A 4OI0A 2PTMA 2W08A 2WO2A 4LBJA 3WNMA 4E8DA 5GLUA 3LEMA 4PT6A 4BQ3A 2JDNA 3I2DA 3IMNA 3N7JA 2QKDA 4IDZA 1BVP1 5J36A 1RUNA 3OUJA 4XE9A 1AR62 2QZ3A 4HONA 1ZREA 5M0TA 4AW7A 1KS5A 2ZGLA 5EQUA 3GBWA 3U75A 2EIDA 4PLOA 2A75A 3CZJA 2WYSA 4DRRA 5IUQA 2WT2A 1AYN3 1MEC3 1FOD2 2XHNA 5I8TA 5I0TA 3ZKUA 1GP4A 2WQZC 4EQVA 3PUAA 4NHMA 1AX1A 2P5BA 4KNCA 4Y1XA 1AF9A 4Q4X3 2VVDA 3VDDB 2CY6A 1G7YA 1BHGA 1WMXA 4ZPIA 5DAXA 4ZXKA 1QF3A 5T5OA 4K40A 2J1SA 3U07A 4Q0VA 5BNNC 3M1HA 1CAXB 4ONUA 2FDJA 5L7OC 3O12A 5FZ1A 2VPVA 4LBMA 1RXGA 3KLSA 4YLZA 2EXIA 2LRPA 1AYM2 5CKMA 2XLGA 1Q56A 4AHZA 4M00A 3JBG2 3UJOA 1F4HA 4B29A 1QJEA 3PLQA 1HXS2 3AJYA 4UW5A 5FPZA 4XF9A 4GIQA 2DBNA 4M01A 3N36A 2GH2A 5AC91 5JOXA 5C5TA 1O8PA 1WMDA 2HEVF 5I0RA 2P3YA 1XB9A 2VZRA 4XBLA 1W2OA 2PHLA 3DPRC 3AMQA 3OBZA 3BN6A 1RUH1 5AFEA 5JOWA 3B3QE 3RYRA 3J7HA 4XUQA 3SKJE 1CAVB 1AJOA 3BIWE 3W9AA 3TAYA 1WBLA 3A21A 4D7YA 3SH3A 2RS33 4OUEA 3ZXJA 1CONA 3B93A 5LRSA 2KD7A 1PVC2 3LIHA 1DQ2A 4AWDA 5FP7A 3UYJA 3ZPOA 4XXAA 1JODA 3A0KA 4XMIA 5FTTC 1DGRN 1UD1A 4XEZA 4EN6B 1RMU3 5FZGA 2JDHA 4C1XA 5BNOC 3B00A 3WZ1A 3WP3A 1X8EA 3H8RA 4JQTA 3WG3A 1IPJA 4K1ZA 2ZX1A 1KDMA 4AOCA 1WCKA 4QHBA 4ARYA 3TN92 1AR93 1BEV3 2FCVA 3ZFGC 5J48A 1HRI3 1W6OA 1MVQA 4TLGA 4DFSA 2XL9A 4G4FA 4Q29A 3AMNA 5GZEA 1NQJA 4Q4W3 5FYZA 1FOD1 2IXKA 3SNMA 3EYPA 1XNBA 3GCWA 5FZOA 5C8WA 4BCUA 1BK1A 3ZMOA 3KT7A 1F5FA 1AX2A 1XE7A 2PMWB 4LR4A 4XF1A 4HVQA 3ENRA 1XPWA 5A7WA 4CP9A 4BK5A 4GMP0 1SEFA 5DABA 4L92A 3NNGA 4D7SA 2VW0A 5JDBA 4PI2A 3TEXA 2WZ8A 5FY5A 1RUOA 4FPJA 4YG3A 3MBWA 4DO0A 2K0GA 4D7TA 4DNYA 4QHZA 2VECA 3AC0A 1Y9MA 5H9RA 3VB9A 1NXD1 2V09A 4HK8A 1ENXA 1US2A 4CEWC 1QJY2 3K75B 2RMU2 4DPNA 1PZ7A 2EXJA 3OY8B 3FFZA 3MHZA 4P9XA 3V64A 1W9SA 3ZSKA 5JR2A 5DQ0A 3J8F2 3VBRC 5FV3A 3IIIA 1CZTA 4KI5M 5HPOA 1HLCA 3HQUA 4NRMA 2A1XA 4L9BA 3PVEA 1WLCA 3MDPA 2ES3A 5ACA1 5GLVA 5FCCA 1A8DA 5FLIA 3U78A 2XH6A 3ZN5A 4ORFA 2CHHA 2YBSA 1VBB2 3FUQA 1GSLA 5A7WB 4F83A 2YBKA 3GZTB 5K4LA 1T6BX 4CCEA 2OQ7A 5KC6A 2WO1A 1PGL2 4AVTA 1UYYA 2YGMA 3WXPA 2SBAA 1GUIA 2VH9A 4LBQA 4QB6A 2D3PA 4MOAA 1JOBA 4U36A 1JS9A 2Z79A 4CCNA 3H8XA 3IDAA 1PVC1 2WAAA 4I09A 5JUVA 3BUCA 4Q26A 4V1PA 4CEYB 5FWJA 3AKQA 5A80A 4Q5OA 1LODA 3UJQA 1V6LA 2XB6C 1G9BA 1G9CA 1U12A 2B39A 2QQJA 2WNOA 2A3XA 3KCYA 1J3PA 3H1MA 4RGGA 2BZDA 2HEWF 4IEOA 2JIJA 4UAPA 5FZ8A 4XBQA 5CFCA 4KQ7A 4WVMA 4YW4A 1RUI3 1ZBA2 1QHDA 2IWGB 2CGOA 2Y60A 4HG6B 4LIUA 3OGRA 4OMDA 3THDA 5F1RA 2A70A 3WVJA 4UFHA 3FLRA 5IK7A 4I0WB 4DS0A 5SV8A 4AXOA 2R1DA 3CO2A 4OHWA 3WD5A 4D6QA 5BY5A 1DCSA 1REEA 1C8M1 5JXHA 1JZ6A 2JDZA 2WYFA 4L99A 3MIDA 4MADA 1OUXA 3NSTA 1DYOA 1NA1C 5FMCA 2CGPA 1LOBA 3C2UA 1LJ7A 2GC0A 2VW2A 2NYYA 5BNPA 5KHIA 1X82A 2DCJA 2ZEZA 3NRUA 1ZZCA 4QWNA 1AR83 3O0WA 1IOAA 1MZ5A 5LA0A 4TYSA 2Y6KA 4WVMB 3WQ7A 3BTYA 1N1TA 5GZFA 3KF3A 1QJY1 2BNOA 2ZHMA 1JI6A 2RMU1 3LIGA 4CP2A 4UYBA 4CDUB 2VGDA 2W1UA 1S1AA 4E2GA 1ULFA 1JYVA 4XFAA 3HNMA 3KF5A 4OHVA 4K9SA 5E89A 4DEQA 1WBFA 2QQNA 5CFDC 2VOXA 3B02A 4NWVA 5F8PA 3HJRA 4CCJA 1ULOA 4LLFA 4PLMA 2DTYA 2WNVA 4EWDA 5C5UA 3O1PA 4JGYC 2W1SA 1N47A 1RHI2 2VXJA 3O5SA 1CX1A 1G9FA 1HQNA 4A6OA 5EZWA 4A42A 3APBA 4IEQA 2VULA 4N9IA 1PGL1 3N4MA 2HWB2 4D69A 5BNPB 2PHXA 2TUNA 4CU8A 1TG7A 4XUOA 4LK6A 1FAYA 5C70A 3TBDA 2J7MA 2MEV3 4FQ4A 1QQP1 4HN1A 4QPYA 4NHLA 4WM7C 3ZFEA 5JZGA 1AR73 3M3CA 4XTMA 3OPTA 2A6VA 4XTPA 1ENSA 2VUJA 2TEPA 3VBUA 2ZHLA 1SMVA 5EXOA 1PIV3 3E97A 4RS5C 4UBGA 1EAH1 4XAEA 1ZBA1 1NCRA 2XGXA 2ZHKA 4GH4C 5DPNA 4MXWB 3UKVA 5A1FA 1JZ8A 2P37A 3DCQA 4GA9A 3FHIB 4EWEA 3NVCA 2VOKA 3T0BA 5DXDA 3QOPA 1AXYA 3KV6A 4PDWA 4AVCA 3RWNA 3UL2A 3VZMA 2YU1A 4BA6A 2QQVA 1MS3A 4IETA 4QU1A 4YZ2A 1DYPA 1WA6X 3H8UA 4MVTA 3R4SA 3UKNA 3T2TA 2FBEA 1R093 1IQDC 2RE9A 4XZPA 5FK8A 5GLZA 1WW5A 3ZYJB 5JZGB 3DEMA 1VBD1 3BTAA 4QPIA 2OUJA 3P3PA 1H8TC 3H3UA 5L73A 4YZ1A 1UNBA 3A0NA 1UXZA 1BLZA 1YEWA 3LPFA 1DDLA 1W03A 2DDUA 2VQUA 4CCCA 1AYN2 1LAJA 1QEXA 2VOWA 1HQLA 4OYUA 3NNFA 1NCRB 5K0UC 4O9GA 4XFHA 3C3VA 4Q4X2 1E5SA 4RSUA 4Y24A 3CKHA 4ZKTB 1D4M3 1DQ5A 1DQ6A 1VP6A 2FZ1A 1S2BA 1LULA 4KG8A 4RL7A 4IE4A 1GQHA 1UW8A 2Z69A 2ZGRA 3AFKA 4YG6A 4EJRA 4ITCA 3KVAA 2JKXA 4CUAA 5FJKA 3L2HA 1RHI1 2XG3A 2IXIA 5CAZA 1YIFA 1LGNA 2NPIA 4XJWA 2WZEA 2BOIA 3ILRA 2WAOA 1RUJ2 5LW9A 3M3EA 1VMFA 3BPZA 4I0BA 3UKTA 4EWAA 4AEDC 5HV4A 4DOUA 1QJZA 3WOGA 3I4IA 1LHNA 2GC3A 2WUHA 4XC9A 3M3QA 5BYNA 1GP6A 1O4ZA 1Z0HA 2VOVA 2WT1A 3I59B 3S5QA 1NT0A 1W8FA 2VMEA 4YW3A 4HMZA 2ZGMA 1XBFA 4P9LA 3WHUA 3VBOA 2TBVA 2SLIA 2PA7A 5C33A 2EAAA 3ZXAC 1QH6A 1I1EA 1OSGA 1J1LA 1UQXA 4X6RB 4K20A 2GNBA 1JUHA 2XWJB 2YBPA 2P2KA 4XCAA 2D93A 2G4IA 4I0AA 4AGRA 3ACIA 3TEYA 4AEMA 2VCBA 4AGGA 5JI7A 5JSOA 1XQNA 2WO3A 3LDBA 3N9NA 2GSYA 1YQ5A 2CDOA 2J1TA 3POFA 4XJAA 5FMOS 5C4WB 1E5IA 2YUEA 5CG9A 4GXLA 3LF7A 2FD8A 3WSOA 1RMU2 3PURA 4L0PA 5D1IA 5JPNB 2WNEA 1QXRA 4BWOA 2WL1A 1RGSA 1R083 3FMGA 2Y38A 1MQTC 1AR92 3LEKA 3KV4A 2CSGA 3KQRA 4IEZA 3VUOA 1OQEA 3P6BA 5ANNA 1ND2C 5T54A 4Q4W2 5F3IA 4YW1A 1DBNA 3VD3A 1CVNA 2RDNA 4B3NA 4K1YA 1XSRA 4I2OA 1IKPA 3ZPYA 2VMIA 5F3CA 5IVEA 2JG9A 3WY6A 4MX3A 3SITA 2IXJA 4XUTA 3WG4A 5FYSA 2JDPA 5DUWA 1EP0A 1WMEA 3POJA 3POBA 5LY1A 3GZUC 1O4TA 2UWCA 3TN91 3Q9OA 4C1WA 1S0DA 1W2UA 2AH2A 5CA6A 1FMD2 4RQPA 1BQPA 1H6YA 3O1OA 3U10A 2JD4A 4RR3A 1APNA 2KM2A 4LHKA 5FPBA 2XBO1 3VBSB 1RUF1 3CJIA 4JV4A 5BV6A 1NX9A 3EHKA 1W8HA 3R4DB 2VTXJ 1RUJ1 3HT1A 4ASKA 5F5AA 4HPKA 2C9KA 3I3DA 1RUE1 4LITA 5A6ZA 5H9SA 5JMOA 4P9JA 3H50A 2L9LA 3OD0A 4FOYA 5CYYA 3OGGA 2H6CA 4YW2A 1ZA4A 2I07B 1TVGA 4R9BA 3GYDA 1W6PA 1YC61 2MPFA 2C1FA 3VZJA 5JPMB 5G04L 2VZQA 4UFJA 2VNOA 4NJ4A 1LRHA 1AXKA 1UU4A 1WMFA 5L36A 1W8NA 3SCGA 3QCWA 3WDVA 5A33B 4RR3B 1RB8G 1RUD2 3SXWA 3MEPA 3CJIB 3MFAA 3IN9A 4UFIA 4Y26A 1SLLA 3VDDC 1E57A 4PBPA 2XOMA 1W3VA 3ZM8A 2LUWA 3VLBB 4EN8B 4OCTA 4FXGB 4HPKB 4ZY9A 4CTEA 2RS51 1J59A 3AYAA 4ZU5A 3ZSLA 3ZYGA 2VE1A 1CIWA 4QGLA 2QVSB 4XJ9A 1X33A 1RYYA 4CU7A 1JYNA 1ZA7A 1W9YA 1JXNA 1RUI2 3WW4A 4LO8A 3GCXA 4FFFA 4AFCA 3N9PA 4LA2A 5FZ7A 3ZXGA 1W6PB 4BM8A 1WD4A 1WCQA 2RM23 2R30A 5FK7A 3THTA 1Z7S2 2XJTA 4QX1A 4X6QB 4CXYA 1A78A 5FFOC 4BQ2A 3PMEA 4CA9A 3EBRA 5FP4A 2BUKA 2D5FA 1IS3A 2XONA 5B4NA 1W6NA 4L8QA 5ABJB 3AVSA 1VRH3 5KHHA 3B7MA 2VMGA 3VKLA 4ASMB 3WF1A 2XUEA 5JXGA 4UT5A 2F4LA 3PDQA 4HL0A 2Q8CA 3GNEA 4D3WA 4P9YA 3JD73 1FMD1 2ADEA 2DWRA 2A6YA 3MUY1 4IV1A 5FBZA 3AYDA 4LKSA 4M3CF 4B4QA 4AGVA 5CEHA 2ZX4A 2JECA 1UX6A 1QMJA 2ZX3A 3NJXA 4FXKB 1LTEA 1VBA3 4GWIA 3WNKA 2VMHA 5ISLA 1R1ZA 2LTNA 3N3HA 4NWWA 4ZS2A 3VBHA 2JICA 5A6QA 3BTZA 2DUQA 2RHPA 4R8HA 1GZWB 2QNKA 5FZ6A 1FPN3 2K9ZA 3AK0A 2HYKA 2FMDA 1Z78A 3TB0A 4AHWA 4JQRA 2BGPA 2D40A 3MLLA 1L7RA 4N90A 3K3OA 1W6NB 3IBMA 4AQSA 4N7UA 5T3NA 5A1AA 5FYMA 2HWF2 4IEUA 2B46X 3WNNA 2VMCA 3NNJA 4CYDA 4IV1B 2DU0A 4FOWA 3WNPA 1QXJA 5J96B 4AVAA 4FPCA 3ZFFA 2HWC1 1RUD1 1OQDA 3WX5A 1G8WA 2MEV2 3FJSA 4RFT0 2C6SA 4ZZ8A 4UXAA 1AR72 3DXUA 4JDMA 5EP9A 3ZMNA 4BOWA 3M2MA 5JAXA 2X8KA 5ERLA 4S2HA 2J1RA 3AVRA 3IZOA 2FDKA 2OUHA 1C1LA 4FTBA 2WT0A 2D44A 2QQMA 4OFGA 1UMHA 4YVSB 5JOZA 3V0BA 1PIV2 1NAEA 1Q8OA 2EF6A 4META 1ND3A 4AI8A 5A6YA 3KHCA 4DB5A 4OHZA 1LGCA 2BV4A 2OS2A 2GP5A 2GN7A 2G19A 2I74A 5FRAA 1LCLA 4Y22A 1Z7S1 3WUDA 3FWEA 4GKXA 4E4SA 2OPKA 3FLPA 5A7QA 1YLLA 1N3OA 4H55A 1FX5A 4IQPA 3AX4A 2W9XA 4HLTA 4B4PA 4GWJA 4JTOA 1GNYA 3D4KA 1HX6A 4P9IA 2Q0AA 4NIAA 4COYA 5CU1A 3AP7A 2B42B 3O1MA 1LEDA 3ZXDA 1A34A 4CDQB 4JHTA 5JI9A 2B9UA 3WG2A 1OKQA 3FHQA 2UU8A 4W6WA 3ZSMA 2R062 4K3UA 1JYTA 4E9KA 4JGZA 1SFYA 2W2IA 2VZTA 2Y6HA 2JDUA 3MICA 2XWBB 3Q8AA 1PZ8A 4LO7A 3ROUA 4CP0A 4CEYC 4B7EA 2ZMKA 4IEVA 2QBXA 4FSJA 1PO12 2HYXA 3UESA 1MVEA 2R49A 5EWSA 2PLV3 2XXZA 5FYIA 3S7EA 4L2NA 2PHTA 1MS9A 2V72A 3PNAA 4FPLA 1STMA 1HRV3 4LTAA 4YFZA 4NO4A 5FPAA 2HWF1 4NHKA 5A3UA 4XW3A 4YWAA 1LOEA 3DV8A 4J25A 1ZRFA 1PO22 2A73B 5FZCA 2A71A 3TOJA 3HWJA 1YQCA 5LB6A 5FZ0A 4XOGA 4A45A 3U37A 1R1A3 5IVYA 2Q1FA 1VMJA 5FP8A 3QLQA 4JHZA 3PUHA 5JR7B 3OYWA 3A23A 2Y33A 2ZMNA 2YDEA 3USUB 4BISA 2FCTA 4WBBA 3H1YA 1NE4A 1XSQA 2RR13 3K4DA 4IGQA 3C7EA 3HQXA 1V70A 5FMDA 1ODMA 4KGQA 1QY4A 1RVF3 4AR2A 3J7LA 4LXLA 3F2ZA 3L9JT 2ZMLA 1KFUL 3WCRA 5JOYA 1GOGA 1JMUB 2ENRA 1VPHA 1YQ8A 4CDUC 4JKMA 1QJFA 1F4AA 4EZHA 2PQSA 4YSFA 2WDBA 2ZX0A 2WZR2 2PAMA 4FFGA 2Y6JA 1I3HA 2RVAA 5FLHA 5FO9B 3OD4A 5DZEA 3A22A 4P9WA 5I93A 1EV11 2E6VA 4NE9A 2BU9A 3ZX7A 4ZU7A 2KXLA 3AP5A 5E88A 5BNPC 4AEDB 2R061 1ACCA 3ILNA 3TWIA 2BVBA 1DZRA 3I49A 4WM8B 3I3MA 3LEIA 4FQZA 3GBGA 1IQAA 2W1QA 2PFWA 4BIOA 5FPUA 1UMIA 1GMMA 3ZR6A 4GULA 1O8SA 2VQ0A 4BQ4A 5C9AA 4KWJA 1GOFA 1PO11 2R16A 4PIXA 2NN8A 5DDJ2 5JSPA 1NUKA 1DFQA 1JTZX 4URAA 3ETPA 5FXXA 2OKXA 3DYPA 2CV6A 3EO6A 5EHDA 2RS11 1K12A 4Z2AA 3O1RA 1SLTA 3CBNA 1IZ3A 1PO21 2IFRA 2G9FA 5D21A 2YGLA 1OA2A 2WN2A 5F5QA 2BBAA 1LHVA 1WKYA 2D97A 2UY8A 2Z4FA 1SLBA 4IE7A 4IXLA 2XQXA 4QU2A 4R9CA 1O3SA 4EROA 1OD5A 3OB8A 1BJQA 5GALA 2JG8A 4XABA 1K5MA 5JZGC 1H2LA 4LPLA 4YZ3A 2O0OA 3EXUA 3LKJA 4TXWA 4XFCA 2QQLA 3OEAA 4OLLA 4OVEA 1AJKA 3N9QA 2GDFA 2AYHA 1ONAA 3VL8A 4XDQA 1W0OA 4GALA 2GMPA 4XDPA 3MZHA 1KITA 3MLKA 3ZSEA 4LORA 1NCRC 5FZHA 4AFMA 2HWD1 1VR3A 3ZIWA 1Q8PA 3NAPA 2QFEA 2WNUA 1V6OA 3LOIA 1VJ2A 2WJSA 1L7LA 4CUGA 1LKNA 2P34A 4H7LA 1LNSA 1Y7BA 4P00B 4AFDA 2D3SA 5I0DA 2VD7A 2WZR1 1A8MA 3ZXLA 3INAA 1W8ZA 4H7MA 4ZXEA 1ZM1A 5C3OA 2CNAA 2V4VA 2ZGNA 3Q8BA 4QX8A 3DKWA 3KV5A 1UU5A 2W95A 1K5MB 3D0SA 4BK4A 3MPPG 4J1XA 5FDBA 2HWE3 1Q3EA 1VALA 4Q4Y3 5FY1A 1W8UA 3C7OA 2XKPA 2P3JA 4YGDA 4PBOA 3RYKA 1UMZA 5IVCA 1YI9A 2EICA 3BCWA 3OBTA 4LJHA 3GXUA 1RJ8A 2LALA 4A3ZA 1B35A 1VRH2 1X9PA 2O1QA 4RHV3 3SC7X 4C8DA 5DDJ1 5LBCA 3WQBA 4MGYE 2GZWA 2XVLA 1F15A 3JD72 4KL1A 3TEWA 2DTWA 1TQ5A 1WA4A 5A3PA 1AR61 4TN7A 4LNVA 3I2KA 2ZKNA 2O8QA 2A6WA 2VZVA 4DXTA 5LY2A 1GQGA 3OF1A 3AXEA 2A6ZA 5C4WC 2X10A 1R64A 1O4YA 3FBMA 3HBKA 3OJBA 5JIAA 5F37A 4W6YA 3M3IA 4XXPA 4BB3A 2UURA 3DGTA 4KWKA 4CUCA 3T0DA 2VVEA 3AP9A 4FOVA 3LFIA 3MIHA 2VM9A 4CCDA 1X50A 4QX5A 4AF9A 1W6MA 2QZ2A 4CPBA 2VZPA 1CAUA 3GJBA 4BQXA 5J98B 3WDUA 1BBT3 3POEA 4B1MA 1XU2A 3ES4A 2OA2A 4DIQA 1RTVA 4GQ7A 3PTYA 1H30A 1WWYA 2ZX2A 4AFBA 1O3QA 3BOWA 4LO4B 4NVPA 2YC4A 1ENRA 1Y9QA 4S2DA 3OTFA 5C3RA 4N43A 2WFF3 4QXCA 4Z2WA 3HIFA 4Q4V3 5FIXA 4CCOA 2R073 3FBYA 2X5IA 1DGRA 5JWPA 1I5ZA 4QPGA 1GQPA 1AYM1 1POV3 4MHUA 1W6OB 2VAUA 3LGRA 4BQWA 2D6PA 3KV9A 5I0SA 1L3JA 3JBG1 3PUSA 3BGAA 1W90A 3ZR5A 1YCIA 3D6EA 3IKWA 1HXS1 5F3EA 4YGBA 3O1UA 4AI2A 4YM2A 3WT3A 2ZAAA 1RXFA 2F17A 3M7AA 5FZOB 3VBSC 1YJLA 1RUG3 1NKGA 2IUWA 4NRQA 1UN1A 1H2KA 4CCLA 4CP9B 4UFKA 2FDFA 2CAUA 2VUCA 3UNPA 5KR7A 4NMIA 2D43A 2VBBA 5A6XA 2XR4A 2YV8A 1DF0A 3PVNA 2WR9A 4N43B 4NPMA 3K2OA 4AEJA 2KR2A 4CPBD 2C4XA 3OOXA 2B5HA 1QJX3 3IPVA 4QXHA 4DINB 3T1MA 2W3JA 3SEPA 3HNYM 5FOJB 4LOTA 4S2GA 3NV3A 1GZCA 4EV0A 3AMMA 5JXJA 5FZEA 1LOCA 2BERA 4OI2A 1PMIA 2P1BA 4HKOA 5L9RA 2Q8EA 4RR3C 4TWTA 3W5NA 4NAMA 2BWAA 5HCFA 5IW0A 4R52A 2OT7A 1MR5A 3CJIC 4FVVA 4LBNA 4LE3A 3RWKX 4ET7A 1S55A 1SDWA 4TSVA 4UOJA 5C7GA 3CU7A 4COZA 5T5LA 2UYBA 5LA2A 4LLOA 4LKEA 5A3TA 5KHKA 2WS93 3IM0A 1JBCA 1OVPA 4R9DA 1UCXA 2XKOA 3NMBA 4P5YA 3SLIA 3PIGA 2EXHA 2XLFA 4HFSA 4LBQB 4CDXA 3E1F1 1VE0A 1LOAA 4M3CA 1HRV2 1DGWX 1V9U3 5TSWA 4WZCA 3S6PA 4B1LA 3SKVA 1ULDA 2DCYA 4AL9A 1C28A 2AEZA 3BU0A 3D0JA 4LBQD 1XYPA 2YU2A 1BCXA 1XJAA 4FP2A 4YGCA 5D8AA 4GJZA 5CFCB 3RZJA 1R1A2 3ME2A 1C5IA 1NCQA 3LWCA 3PTRB 1F8VA 3E5QA 5ABJC 2GNTA 2CWMA 1YQ2A 2ORXA 3K4AA 1OXCA 4XJ8A 1KD7A 1OHFA 4LKFA 3J8F1 4MV2A 1POQA 1PGW2 1DYKA 1W8WA 4AFAA 1VBC2 4KU7A 3O1TA 1X9TA 5FYBA 1JHNA 2Y6GA 4GB33 4HN0A 2X05A 4PQQA 3LAGA 1VBB1 1OD3A 1UIKA 4GKYA 1U5XA 4NUBA 4X8NA 3UETA 5DAVA 3BYWA 1O3TA 1CIYA 3I8TA 4FO9A 5GZDA 3AM2A 1OLRA 2PYTA 4PF1A 1UZ0A 1AL22 1GU3A 2MHFA 1FI2A 4BYYA 2JDAA 4ARXA 1H1MA 4BXSV 3W5MA 2XJSA 4S2FA 1XC6A 3VBFA 3BIEA 5SV5A 1NZIA 3C8XA 1QOOA 1VBE3 3M70A 4Q0SA 1ZBE3 4XZUG 1F9KA 5FZIA 1W06A 4B8EA 3HN3A 3ZO0B 2B45X 3KHBA 4NIGA 5T55A 4IV1C 4IUGA 2W91A 3ZLIA 2PHUA 5APAA 5FYVA 1LGBA 3LOBA 3M4FA 2WNVB 5FKCA 2R043 2W92A 2YB7A 2IVIB 1RL3A 3KM5A 4FAHA 4MG2A 3I3EA 1U5IA 3KD4A 1YXWA 1TME2 4NPLA 3HAGA 4XQWA 4E4DX 3K77A 2HBTA 1K45A 1UO9A 2ZBJA 4YVSC 5EV7A 4AVBA 3SHRA 1RUC3 2BBVA 2BFUL 5C3SA 4GZ9A 4XBNA 4JKLA 2E26A 1TMF3 3ORJA 5AVPA 5BNNA 3VZOA 3RVHA 4COWA 2W68A 1JOJA 3ZFEB 1XE0A 2EIBA 2YZ4A 2A3YA 1ZZ7A 5L7OA 1GWMA 4HOOA 1I6XA 3WG1A 4D6SA 2OVUA 2W1WA 1ASJ3 5F32A 3VBUB 1SBFA 1VIWB 1G9AA 3KWVA 2RV9A 1OURA 1QJU3 1MEC2 2EALA 2ZZJA 3JXSA 3GHMA 4GMP3 5I8YA 1COV3 4BDVB 5LZ6A 4Z92B 1A6CA 3CDZB 5T52A 1OLMA 5T5JA 3AKRA 1HQWA 1WCDJ 1RIRA 1Y3TA 3N7MA 4GWMA 2BP6A 4OZOA 4R4ZA 5IAVA 3T09A 4EN7B 3ZSJA 1SBEA 4PDWB 2BGOA 4OHYA 4Q27A 4CDQC 4N53A 1VBC1 3UGHA 3WNXA 1SLCA 3EB7A 1VMHA 1QNWA 3IDBB 2YFZA 4HKWA 2B9VA 3DPRA 3GZEA 1ALYA 3OPWA 2J22A 4HSJA 1AX0A 2B7YA 1Q8VA 2HWB1 4P02B 3SH5A 1CN1A 4Y1YA 4QPIB 3S7IA 1AL21 1FNZA 4QQ2A 2UY9A 5CADA 2E33A 2C0ZA 5EFUA 3BKZA 2ARXA 5K8SA 5J37A 3QACA 1DLLA 3KZ4C 3RQ0A 3IB3A 3VL9A 3LPGA 1SZBA 3WF2A 5BNOA 4N9HA 5FR3A 2DFCA 2JDMA 4AI1A 4QX0A 1X7NA 1W9FA 5A7SA 3ZYBA 4QDQA 1JU4A 4NPRA 4N53B 2PELA 4Q4Y2 3M8LA 2VZSA 4XJUA 5A3MA 4YVWA 1N1YA 3KMHA 4HK9A 4UW4A 4AZZA 4QT6A 5IFTA 3N35A 2WRAA 4OMCA 3K46A 5HCBA 2RS32 1OFSA 2GNMA 2IVJA 1TME1 3BOPA 3I3QA 1LOFA 4FPKA 5CB7A 5CBLA 1YFXA 1UYPA 1ZRRA 3HEIA 4COVA 3JZVA 2PHWA 2Y34A 5DUVA 3ZVXA 4W6XA 2NMOA 3Q8FA 2V4AA 1GWLA 2NP0A 1BEV2 1HRI2 1J58A 1SHWB 2X29A 4I3PA 3VBOB 1K5JA 5I91A 3TRSB 3ZXKA 4U2AA 1AYN1 1MEC1 2HLEA 5CG8A 2JD9A 2W94A 1REFA 4XQ4A 2YC0A 3J7MA 3N9LA 4GJYA 3HOBA 4YVWB 4LT5A 4B4RA 4Q4X1 3NV2A 3POSA 4XJZA 3WR0A 5KXDA 1BBT2 2DCKA 2PAEA 3LDKA 5KXEA 4IE5A 2XMLA 5LA1A 1DGLA 1XNTA 3E5XA 5FYUA 5IVBA 1PX3A 1GNHA 1MS5A 2WFF2 4WM8C 5DUUA 4OI1A 5AC93 5IK5A 1AUYA 4Q4V2 2R072 2RJLA 3T3YA 2XJRA 3VD4A 5HBAA 3KB5A 2FDHA 4W50A 1RUH3 2R1BA 2YXSA 3BODA 2QDNA 4LE4A 4LQRA 2ZGQA 3U1XA 2R0HA 4IGOA 5A3NA 2E53A 1CZVA 4PI0A 4LO6B 1UY4A 2NZ9A 1OLQA 5F5CA 3GALA 4NROA 5B2GB 2ZEXA 3KVBA 3RJ2X 2JXAA 3H7JA 5LK7B 1URXA 2JG9B 2AENA 1SACA 1OA4A 4O9EA 5FZ9A 3UT0A 1YFYA 4AHXA 2G9GA 1H2NA 1NLQA 1UZYA 2P6CA 3NKTA 3N7KA 3MIGA 3VDCA 3WF4A 4RQPB 2WA3A 2BPA2 2DF7A 2R32A 2PHDA 4CU9A 2ILMA 1W3XA 4MH0E 5A3OA 3W58A 2RS31 1QJX2 1FOD3 1W05A 2DV9A 2VMFA 1JUIA 3B01A 1TEIA 4DMIA 1UOFA 2CDPA 2WKKA 3EJKA 4DY5A 3LD8A 3WW2A 1RMU1 3KGZA 4FI9A 4RFRB 1UZVA 4K8FA 3D5OA 1NA1A 5FZBA 1H1AA 2TNFA 1PK6A 3LFMA 5FYHA 1NG0A 3GHNA 3URFA 1CAWA 1WLWA 5FZLA 1FATA 1AR91 1BEV1 1WW6A 2FMYA 4M4PA 3IDEA 5CIRA 1DG6A 1HRI1 4NIIA 4D94A 1FT9A 2H0VA 4XF0A 3RYPA 4JC1A 1NQDA 1J83A 4Q4W1 4DY3A 4QKDA 2OIIA 2VL4A 3FC0A 5FZAA 1OVSA 4YW6A 3DYMA 4FPFA 2E31A 1AXZA 1AYM3 1ZZ9A 5AVAA 1OUSA 4M4RA 3C7HA 1CJPA 5CFDA 3P5BA 4K21A 5IWFA 2ET7A 1W6QA 1K5MC 1V6KA 3RZKA 1XE8A 5FBJA 1H4HA 1T2XA 4JGYA 3RZGA 4QD2A 2W87A 2JE8A 5DG2A 5T50A 1IS6A 5ACA3 4NRPA 2AACA 1BZWA 1KEXA 4P08A 1AR82 2AEYA 4XFGA 3SEEA 4EE2A 2D6MA 2WO7A 1EUUA 1HW5A 1PK6B 3WEZA 4XHXA 1IGOA 1CAWB 1K3IA 2CWSA 1V6MA 2YROA 3ST7A 1W9WA 2MNGA 3O7OA 1KJLA 1RINA 4A2UA 2VG9A 3C7FA 4WM7A 5LCWL 5DZFA 5J1XA 3ZYFA 1UPSA 1UZWA 3B94A 1PVC3 2PAKA 1YWKA 4HXCA 5F2WA 4ASLA 2FDGA 4GB32 1LU1A 1OC1A 4FT8A 3MGUA 2Z5WA 4Z07A 1S0BA 2VJXA 3NJYA 4Y3OA 4WV8A 3O1SA 1O7FA 4NR1A 1OF3A 1W6QB 4Y33A 1NXMA 1DU3D 1CX4A 3MV01 1L7QA 2DYCA 4L97A 1JYIA 1SDDB 2K2SA 5IYYA 2ATFA 4JAAA 1KS4A 4A6SA 1CJDA 4PQ9A 3P3NA 2WQ8A 5CVRA 3WP4A 2VC9A 1V6IA 3WP6A 2C5DA 1GYKA 2ZGTA 4OZXA 2LS6A 1VBE2 3AZXA 4A44A 1ZBE2 4UBHA 5IVVA 1GANA 1S2EA 2X09A 3VBHB 1C8M3 4YM3A 3PVBB 2HJIA 3I2FA 3JUUA 4BIFA 2RDRA 1PVXA 1V6NA 4FOQA 1H8TA 2Y6LA 1RUI1 4BQ1A 4XIOA 1FV3A 5GM0A 4E4HA 5A32A 3WDYA 1K42A 4HKLA 4Y4RA 3ILFA 5CKQA 1O5UA 3ZN6A 1OH4A 4LKDA 2DVAA 4HT1T 4CE8A 1O6UA 3FL7A 3HR9A 5K0UA 5DMYA 1QJY3 2ZZQA 4XMAA 2RMU3 4E2SA 2VTXA 1RUC2 1IPKA 2P17A 3CNAA 2XJQA 2WINB 2W47A 3CEWA 5DAPA 3ZFFB 4FTSA 3V56A 4AQTA 1TMF2 1US3A 2WC2A 1R092 3NNLA 1IPSA 3H42B 3M3OA 4FBFA 1H9WA 3PVOA 3WNLA 1OOPA 5EYYA 4A7YA 5E8AA 3RZMA 3MFCA 1AR81 1PNFA 3V0BB 4UF0A 5C3QA 4N43C 4CCMA 5IK8A 3MO4A 2CYFA 2VUAA 1ND3B 2ID4A 1SBDA 1QWRA 3ZXEA 4H3WA 5H9QA 1JU3A 4AEDA 5BNQA 1OT5A 4BXFA 1W0NA 1GFF2 1S0GA 5FZ3A 3U0ZA 3H8OA 1D4M2 4Y22B 4QQOA 3I2JA 4KU8A 3VZKA 1QQP3 3LEGA 1HDKA 4KBZA 3AKPA 5JLVA 3QH7A 1HJGA 1UY0A 5KHGA 1FYUA 2G9ZA 2IFWA 2OW4A 4H14A 4Y1VA 4JTNA 3QD6A 5LA9A 2ZGUA 5DUXA 1REDA 3J26N 3WDTA 4B7KA 1ZZ6A 1EAH3 1ZBA3 3NV4A 1OOPB 1YYNA 2VVFA 4AI9A 4CU6A 1MZEA 3VDBA 1XYNA 1BXHA 2MEV1 4QQHA 2VZOA 5EIYB 4JGZB 5CISA 2VU9A 1AR71 3AZYA 1EYBA 3GBFA 1GP5A 4F7ZA 2ZEYA 3LB9A 4TZDA 2LM3A 4SLIA 2CTVA 4YGEA 1PIV1 4Q0UA 3LSEA 1EPZA 1LEMA 1GKBA 2QCSB 3PMSA 5FY9A 1N1VA 1KGYA 4TLFA 1TNFA 2UWAA 1VBD3 4BQ5A 4Y20A 5CFCC 4P14A 2ZGSA 1ND2A 1KRIA 4JX0A 3PL0A 3GDBA 3E6CC 3JB4C 4Q8LA 4XACA 1MZFA 2E9QA 3NWKA 2R7EB 4Q8KA 3H3ZA 4LEJA 2XVGA 5IATA 1SQ4A 2WABA 4XILA 2JEMA 1QU0A 1XNCA 4C91A 1R091 3B9CA 3FE5A 5L9VA 1XOYA 1PHMA 3CHXA 3FX3A 1R082 2ZGPA 4HETA 3RMXA 2NMNA 3OYWB 3PJYA 5KXCA 1XYOA 2AR6A 4CCKA 1RHI3 5JXIA 4D6RA 4PJYA 4TTGA 4N8MA 2H0BA 4KWLA 3ACGA 2NLRA 3WNOA 5IFPA 4IEWA 3WCSA 4XIKA 4Y20B 1CPNA 4MZUA 3MV11 4IW3A 4FPHA 3ZKYA 4E27A 3G6JB 1D4M1 2BTVC 1OFNA 3H0OA 3MW4A 4PLNA 4BHPA 3AYCA 3L2YA 1LESA 5FY4A 2DVDA 1GZ9A 1YHFA 3E5UA 2VZ1A 1TNRA 3DN7A 4AVSA 3VD9A 4MYEA 1X8MA 2Q4SA 2VQTA 1QH7A 2WNVC 3FN9A 3WQ0A 3E6BA 4FFIA 4KGGA 2BWCA 5DN2A 1PM7A 1SLIA 3LE0A 3HD8B 4CP1A 5A7NA 2QUOA 3THPA 1YJKA 3AZZA 4GWNA 2W39A 1YFWA 5FWEA 1H2MA 3JCIA 2LW8A 2YY1A 4XETA 2DVFA 3LDRA 1UY2A 2VZUA 1VAKA 4ZZ5A 1XRUA 2UYAA 1CAXA 3ZFEC 4IGPA 1U5YA 5K9YA 3LA3A 5C9AB 2PN5A 4IV3A 4BJ0A 4D8MA 5FYYA 2BNMA 2XJPA 3WDXA 1JYWA 3VBUC 1JZ7A 5J3UA 1JYCA 3LZZA 3AL5A 4CSWA 4AQ6A 2AZ5A 1KDKA 3GM8A 3IAPA 4MGSA 3AP6A 4BE3A 2J1EA 2R0FA 3PUIA 1ZRCA 1F2NA 1W8TA 4V2VA 2WFPA 2PHRA 2ZOEB 3HQRA 3HVDA 4KG0A 2Y64A 4PDWC 3CZUA 5C6CA 1UU6A 2BVVA 1OH3A 2OQ6A 5L9BA 1D7PM 2JE9A 3D8CA 4I30A 4PIYA 4UFMA 4A3XA 4AYUA 2XJUA 3WINE 1R081 5HCAA 3HT2A 2JG8B 1SFNA 2CAVA 1CAVA 4QGMA 3T0AA 4CVUA 5HCHA 2EIGA 3VHOA 1NOVA 1XXNA 1N3PA 1RC6A 4JDOA 4QPIC 1HB1A 2XBO3 1RUF3 2RM22 1GLHA 4IV3B 5E16A 4ES8A 3BI3A 5FOBB 2JB4A 4RD7A 1W99A 2BW8A 3LCPA 1OF4A 3KQ4B 1RUJ3 3I3BA 4IE6A 3OGSA 4DRVA 2ZTNA 1RUE3 2DFBA 3GJAA 1EY2A 3R4UA 1E5RA 2JJ6A 2DVBA 2Q30A 3NAPB 2EVXA 4PHZA 5HXMA 2WNUB 2KA3A 4QDRA 5JCTA 4MGQA 4AI3A 2EIEA 3K4ZA 3BTXA 2XQRA 1BKZA 3B9IA 2GU9A 1DZTA 4N53C 3SCFA 1PMJX 3AL6A 4AVVA 5ACA2 5JMCA 1HB3A 3AKSA 4MHRA 2RDQA 4Y5TA 2ZAHA 2CGNA 3KGLA 5C8CA 4XDOA 2DU1A 1DIWA 1VBA2 1UY1A 2PHFA 2VXRA 3WV6A 5J09A 4CRQA 3Q8CA 4AE2A 1HN0A 4K8RB 1KJRA 4DXZA 1FPN2 1S4CA 1GR3A 5FJHA 2DUPA 2BOJA 2V5DA 4JVAA 4Q2FA 5LWBA 5D2AA 3CMGA 3GZAA 5A70A 2RS53 3CLPA 3VN4A 1B35B 5IHRA 2WQ4A 4FPGA 2JDKA 3T2PA 3TYJA 2A3WA 2WLQA 4BZ4A 2QQIA 2WWUA 3VBOC 1IKQA 2AC1A 4AI0A 1UY3A 1I5PA 4BU2A 5IK4A 5EJZB 4RN5A 2AREA 3G7DA 2CL2A 1AL0G 1G86A 1SPPA 1H8VA 1UXXX 1DP0A 3I2GA 4ISQA 3OY8A 4YVWC 1QXPA 5FP9A 4DQAA 3NQHA 5FYCA 1Y9GA 1IS5A 1YQ6A 2OXBA 4AHYA 5C8CB 3KT4A 2P6HA 1S0IA 3DF0A 1W2AX 4XAAA 1LOFC 1C8M2 2W5FA 3J4UH 3U11A 5FPXA 3J9SA 5KBFA 4G9SB 4OQ8A 1GV9A 1ODNA 1JHJA 2G1MA 4FP3A 1QDOA 3DECA 4GAZA 4HSLA 2C26A 3WHTA 1W6MB 2Y0OA 1FMD3 4AK3A 1CAUB 2VO5A 3ACHA 3WW1A 1QOTA 3NJVA 2IXCA 4MLOA 4OQ9A 3RDIA 1D0GA 5CKNA 2RM21 3R05A 3VD5A 4QKNA 3A7QA 1VLNA 2Y0IA 4JRLA 3ATGA 1RITA 2P3IA 2VQAA 5F6LB 2QQPA 4CEYA 2J1VA 1CD3G 2ZCWA 4J6GA 1SPPB 2ADDA 3H3LA 4ZHNA 4K6BA 4XPVA 5F7UA 1JZ3A 1CGPA 1VRH1 2JG9C 2D3RA 2X5IB 4DEVA 2X53S 4QPGB 3RZHA 1MACA 5LBBA 2GNDA 2VCMA 2HKXA 3JD71 4ZONA 5EPAA 2RJ2A 3WUCA 1VRBA 1ZX5A 1HB2A 2BQPA 1QDCA 1ST8A 4RQPC 3CIHA 3D3AA 4FFHA 1NYWA 2OPWA 3DYOA 1LHOA 3ELNA 5FZMA 4LBOA 1LOGA 3ACLA 1VBA1 1LECA 2Q8OA 3DKQA 4Y1UA 4FAGA 3DXTA 2HWC3 4R4XA 4LHLA 1RUD3 1JH5A 3FUOA 2VNVA 4UWDA 3I97A 4LHSA 5LBFA 1VAVA 1FPN1 1FNYA 2VR4A 3FHAA 1QQP2 1JYXA 1ZRDA 4URTA 4E4ZA 2PLV2 1CPMA 4W65A 5A1LA 1UOJA 2IXLA 4QX2A 4E2QA 5G05L 5JIUA 3VV1A 3IPVB 1XU1A 2VBDA 3MUZ1 4DZGA 4XF3A 1HIXA 4MGTA 1ENQA 4E8CA 1CR7A 5L19A 1EAH2 2YG0A 2E63A 5A7OA 2DVGA 3RPQA 1GOHA 1BYHA 1J3QA 3N7LA 3NW4A 4QXBA 3ZDSA 1QNYA 2B8MA 2V5YA 2ZACA 4CDUA 2XLAA 2ARCA 2R6QA 3UGFA 4LK7A 3POYA 1Z7S3 4QMAA 3ZYPA 1S0JA 4BQYA 5EJ3A 2WA4A 3OG2A 2OX0A 2D6OX 3RRDA 3QBQA 1JOPA 4LO5B 4A4AA 1ULGA 2NM1A 2RR12 1D0HA 5A7PA 4RGKA 2VZ3A 4N7IA 3RI8A 2AGSA 1QOSA 1OA3A 2JWPA 1RVF2 5B4XA 1V6JA 1PK6C 1VBD2 3JB8A 4CDXB 1BK0A 1SCRA 4M3CB 1UWWA 4BPZA 2QDRA 4UW6A 2GC1A 1W28A 1U0AA 1M06G 1FXZA 3WQ1A 3ZDVA 3D82A 2ZS6B 4EN0A 3I2HA 5HXVA 3ES1A 2HEYF 1PMHX 4Q0QA 3AZWA 4M3CE 2ZJCA 4C0HA 1Q5OA 1U5ZA 2J1AA 5D8AB 4YNIA 1UOBA 2ARAA 2OZ6A 1UKRA 3ITQA 4Q0PA 4UFLA 1NCQB 2A7AA 2WIIB 4XFIA 5E1RA 4BMEA 1D2SA 5LK5A 3BU7A 5BPXA 4MXWA 3O0XA 3KCXA 3BPSA 4NHYA 5FQ0A 3GF6A 2HWF3 3AJZA 4JRAA 3X29B 4EN9B 2A6XA 3Q8EA 2BEOA 1CQ9A 4W8JA 3SISA 1AHSA 5C71A 2YMZA 1G6NA 1W04A 4LUMA 1W8OA 3T2QA 1OBNA 3ECQA 3AKTA 4DUVA 3ABZA 1LHWA 3R6SA 1MS1A 3VBHC 5GZGA 1YI7A 4QXKA 3SH4A 1O59A 1Q43A 1TE1B 5IJRA 5F5IA 2I2SA 2WN3A 2PLV1 2IC1A 2W52A 2ERFA 2GMEA 4LBLA 2IXHA 1CZSA 4FPEA 4CDWB 3RG0A 1WLTA 1DLCA 4L11A 3VBFB 4UI9L 1HRV1 3RZZA 4WVWA 4WVVA 2FCUA 1W9TA 4R9AA 1Y43B 2JE7A 2ZKLA 2PXJA 3VDAA 2DCTA 4INDA 3UGGA 3R0RA 3VHNA 1JZ2A 1PZ9A 3N9OA 1O91A 1H0BA 3O14A 4A7KA 5FQ0B 1R1A1 3THCA 3ZFFC 3WLUA 2PQQA 1GZTA 2GH8A 4DUWA 3I7DA 2P4EA 3JU9A 1G9DA 3W59A 2VNGA 4QQLA 2RR11 2FHRA 1C4RA 1PGW1 1T6GC 4OI4A 3TEZA 4QQPA 3WDWA 4AG4A 1RVF1 5FXZA 2QQKA 4RYDA 2BFUS 1ND3C 1EV13 3POIA 4IERA 3WF0A 5BNNB 3T30A 2R063 2VMDA 3ALQA 1Y4WA 4DXRA 3MIFA 3I59A 3POGA 3K48A 5FMBA 5L7OB 1WLDA 2VY0A 2VW1A 4OHXA 4XCBA 2ORZA 1CWPA 2UWBA 3HMYA 1KQRA 3H7YA 4GD4A 4BLIA 1QIQA 5BUVA 3CQOA 3FLTA 1SG3A 1PO13 1WW7A 2Q1ZB 1UOGA 5FPVA 1XNKA 2WWSA 5KC5A 2Z42A 4HBNA 1JN2P 3B5LB 2BGCA 3HNBM 5FXVA 4D0QA 1OOPC 2FZ2A 2QQOA 2HWE2 2XBO2 1RUF2 4Q1PA 3ZFGA 4AAXA 4IL7A 2RS13 1OLME 2EAKA 5C4WA 5FMOL 1PO23 1CESA 4JGZC 3DPRB 2ZABA 1RUE2 2EA7A 1F35A 2D6LX 2OYZA 4Z82A 4CZSA 3MW2A 2Q8DA 3K51A 3OGVA 4RHV2 3VKMA 3ZYIB 4AEKA 3VD7A 4BLJA 3RFRA 2FQPA 5FO8B 5CNAA 2W0XA 2JIGA 3ZIXA 4I3GA 1NY72 1ZYBA 3UK9A 2RJKA 3NV1A 3OSDA 1B09A 5FP3A 5GJ6A 5IVJA 2HH9A 4LBKA 1OPOA 4YARA 2XJVA 3AXDA 4XFFA 1LR5A 2XDVA 2BYVE 3K3NA 1PGSA 4Y1ZA 3UV9A 5BNOB 2FDIA 1YFUA 4JKKA 2VBPA 1PM4A 1ULCA 1YIPA 2NQYA 4NIDA 4LMFA 2I45A 3LSDA 2HWD3 3H1WA 4RA0A 4CEWA 3P1IA 3ZFGB 3JQWA 3MLJA 5T5PA 1DQ1A 3VKNA 2P3KA 3O0VA 1IHMA 1LENA 5FYTA 3VHPA 4F3JA 2BRTA 3VBRA 1IG0A 3MI8A 4CXXA 1HJFA 1DQ0A 2WZR3 3SMHA 2RS52 2BJSA 1M4WA 1YO8A 4YPJA 3VBSA 4A7ZA 5F6KA 5DAWA 1UL9A 2E7AA 1UKGA 2GALA 3PUQA 4LIVA 4QKBA 5FAXA 5A3WA 4YYOA 3V65A 1GICA 4Y5SA 4DUXA 1V00A 4J1WA 3OEBA 3OUIA 2ZXQA 4QKFA 1MS4A 2WSUA 3RSJA 4AQ2A 4MUVA 1ZZ8A 2VCCA 1H1IA 3H9AA 4HANA 2IZWA 4CUBA 3W21A 2A5ZA 3ZXFA 4A41A 3NO8A 2VUDA 5EYXA 2GMMA 3OBAA 2Q1MA 4WVZA 5F39A 1VB2A 5E6HA 2YYOA 4CEWB 3DL3A 1O3RA 1UX7A 4LHNA 3V0AB 3VKFC 3MIEA 5DDJ3 3AYEA 1HV1A 3S5AA 1RUG2 3VBRB 5LBEA 5IT6A 1WCSA 4CXWA 2Z2SB 3AP4A 3EQEA 4FPOB 4I01A 5A33A 2BDRA 1AR63 2HWE1 1A3KA 3ETQA 4Q4Y1 4W4ZA 4Z1VA 3W20A 5GKAC 4IEYA 1YUDA 4HZFA 1O5LA 2D7FA 5J7MA 1OQ1A 5GLWA 2ZEWA 4RHV1 2GAUA 1D2QA 3AZVA 4XF4A 2B4KA 5KWRA 1J84A 4MGZE 5FY7A 5C9AC 1J1TA 3WP5A 3JQXA 1NY71 4QB1A 3MIBA 2D98A 1YNAA 4F8AA 4YFWA 2WBKA 1V0AA 1XNDA 1BMV2 2DUOA 2O8OA 4YW5A 5JSRA 3GGLA 1NLSA 1ULEA 1NLRA 4QHOA 3WW3A 4LULA 4MXVA 3OCPA 5FREA 3N9MA 5FZFA 1QGLA 1C1FA 3OUHA 1UIJA 5FUNA 5C3PA 1EUTA 2HWC2 5GZCA 5ABJA 1HKDA 2WS92 1UF2C 5FY0A 3MYXA 2E32A 1X36A 3OGJA 2OZJA 5FKBA 3LA2A 3PIJA 4CDWA 3SQOA 1MZ6A 3A4UA 2YFUA 5KHJA 3I2OA 4LA3A 1FV2A 1BBT1 3JBG3 4XUPA 2JG8C 4OUMA 1V9U2 1HXS3 4P5HA 4COUA 5EJ1B 4DXSA 1J3RA 2E7QA 1DZQA 1GWKA 4IV3C 5LEKA 2WFF1 2XL7A 4X8PA 3T4HB 1Q8SA 3T2OA 1S2KA 1S0EA 2XPJA 4I02A 4Q4V1 1NA1B 5F3GA 2R071 2C24A 3F95A 3AFGA 4QGNA 4O65A 2C9AA 1GZWA 4Q1RA 3BVCA 4YW7A 3IIAA 3NAPC 1POV1 1DGWA 1WGPA 2WNUC 3NL1A 4LOSA 5FPLA 4HVRA 2XVKA 1BVVA 3FZ3A 5GLTA 2RDSA 3NNMA 1AZDA 4ZS3A 4NAOA 4YZ5A 5A3LA 1ZNPA 1DHKB 1MPXA 1UZZA 4M0HA 5FY8A 4ATFA 3S0MA 1RUG1 1HV0A 2YPJA 4YM1A 2YHJA 5CFDB 4RS5A 2J42A 4EZ4A 2DCZA 1LHUA 2VTFA 4GH4A 5DZGA 2JENA 5FZKA 4IEPA 4YG0A 5JVVA 5BXXA 1W2TA 4YZ4A 4JGYB 3TNPB 3TN93 2ZPXA 4SBVA 1S0FA 1W39A 3EMRA 5FO7B 1MS8A 3DUIA 2Y6FA 5H9PA 2WZPP 1QJX1 3IMMA 4UW3A 2Y26A 4YVSA 2J1UA 4JZRA 5I8SA 3RGBA 3AMPA 3MF9A 5FUIA 1ZZBA 2VCAA 1GBGA 1B35C 2F4PA 3PU8A 4KH9A 1AVBA 2WSVA 2AUYA 3PJQA 4C0BA 3I54A 3AB0A 1H9PA 1OKOA 1KXGA 3CL1A 4XYXA 1TZOA 4WM7B 1BMV1 1XNAA 3BB6A 2RG4A 2QJVA 4QM9A 3ZYRA 5FXWA 4QPWA 2R042 2EXKA 2VNRA 3AMHA 5C8CC 5FUPA 4RS5B 3S30A 4M0NA 4LUKA 5DG1A 4NIHA 3E6DA 3OPZA 2GN3A 3FFQA 3IWZA 4GH4B 2WS91 3RZLA 5LATA 3U4XA 2K46A 4RGAA 2E51A 3KS7A 4ATEA 4BMBA 4QDSA 4NHXA 5LASA 2YC2A 3O1VA 1WUVA 5F2SA 4CDQA 1EPWA 2JX9A 3J8F3 4YRDA 1V9U1 1ULPA 3CF6E 2E7TA 2JB8A 1SFPA 1UYZA 3C7GA 1QKQA 1YRZA 4IESA 1D4VB 1N3QA 4MGKE 3RI9A 1JZ4A 1ASJ2 1VBB3 1ZVFA 4MSVA 4PF5A 4OULA 1QJU2 3U14A 1OI6A 1H8TB 3T08A 1COV2 2GC2A 3POWA 4H2AA 5A32B 4Y5Z0 2X5IC 2XUMA 1C3HA 4QAWA 4QPGC 2ZHNA 3ZN6B 1RJ7A 2VOTA 3MW3A 1I9RA 5K0UB 3ZYHA 2F6BA 2ETEA 4P9GA 2QQUA 4V2WA 2WWJA 1C8NA 1NZCA 4GB31 3ZN4A 1EV12 3T1LA 1JZ5A 2ZGOA 3OBRA 1VB4A 4IEXA 2JDYA 3PU3A 3VHRA 4ZU4A 4MO3M 4KMQA 3ON7A 4O61A 1NE6A 4C90A 3IAQA 3VKOA 3VZNA 5LRRA 3CJXA 3T4VA 3U4SA 4UF0B 3USUA 3WF3A 3SCHA 3RS6A 2D6KA 5HV0A 2Q5TA 3B69A 4KWUA 4XURA 3NJZA 3I2IA 1SCSA 5FLJA 1VBE1 2ZGKA 5FZ4A 1ZBE1 1W2NA 2QQWA 4HVOA 3VZLA 4PCRA 4MGIE 4BH9A 4ES9A 2D6NA 4EYUA 1WD3A 2ZA9A 4Z8BA 1H6XA 4OUSA 3BALA 2Y8KA 2CU5A 3HBZA 1MQTA 3USSA 4PIZA 1GNZA 2DURA 5FZDA 2RS12 1E5HA 1PX4A 4XUNA 2R041 3RMYA 3IDCB 4XQDA 4FTEA 2LROA 1C5HA 3J7NA 1WW4A 1W0PA 1F31A 1ZRIA 4XFBA 5AFBA 1IG3A 4IE0A 2JKBA 4AAPA 1P8JA 2ARBA 1C57A 1RUC1 1S0CA 3PHMA 5LEJA 3RNSA 1TMF1 1LB2A 3VGIA 4QM8A 2H6BA 3QH6A 5HI0A 5ANQA 4CDXC 4NN0A 1JW6A 3KT1A 3LQCA 3V0AA 3S57A 1N1SA 1F5JA 1POV0 1VBC3 3TNQA 4WM8A 4Y4YA
chains in the Genus database with same CATH topology
2BNNA 2QE3A 4JCKA 5F9TA 1ASJ1 1MS0A 5KXBA 1UPIA 1SLAA 4FPYA 4JDNA 4XHBA 1QJU1 1UAIA 1MQTB 2HWD2 2N7GA 4YM0A 3KCCA 4GMP1 1COV1 5D8AC 2HWB3 2WLPA 4FCAA 2V73A 1AL23 3RJRA 1NCQC 1ND2B 1VAMA 3KSCA 1OPMA 1IS4A 4ISRA 1LU2A 2XHKA 1OMIA 4KBBA 2ET1A 4WZFA 5AC92 3HN1A 5K7PA 3LA7A 3MPBA 5I0UA 1PNGA 4K7JA 4NOTA 1RUH2 3MF6A 2D5HA 1KFXL 1Q8QA 4G3YC 1DQ4A 3VDDA 1TME3 3ASIA 1H4GA 3NKGA 4CDWC 3VBFC 3IT8A 4OI0A 2PTMA 2W08A 4LBJA 5GLUA 3I2DA 3IMNA 3N7JA 2QKDA 5J36A 1BVP1 1RUNA 4XE9A 1AR62 2QZ3A 1ZREA 4AW7A 1KS5A 2ZGLA 3GBWA 4PLOA 2A75A 4DRRA 5IUQA 2WT2A 1AYN3 1MEC3 1FOD2 5I8TA 5I0TA 2WQZC 4NHMA 1AX1A 4KNCA 4Y1XA 1AF9A 4Q4X3 2VVDA 3VDDB 2CY6A 1G7YA 4ZXKA 1QF3A 5T5OA 4K40A 3U07A 4Q0VA 5BNNC 3M1HA 1CAXB 4ONUA 5L7OC 3O12A 2VPVA 4LBMA 3KLSA 4YLZA 2EXIA 1AYM2 2XLGA 1Q56A 4AHZA 4M00A 3JBG2 3UJOA 4B29A 3PLQA 1HXS2 3AJYA 4UW5A 5FPZA 4XF9A 4GIQA 4M01A 3N36A 2GH2A 5AC91 5JOXA 1WMDA 2HEVF 5I0RA 4XBLA 2PHLA 3DPRC 3AMQA 1RUH1 5AFEA 5JOWA 3B3QE 3RYRA 1CAVB 1AJOA 3BIWE 3W9AA 3TAYA 1WBLA 4D7YA 3SH3A 2RS33 3ZXJA 1CONA 3B93A 5LRSA 1PVC2 1DQ2A 4AWDA 4XXAA 3A0KA 4XMIA 5FTTC 1DGRN 1UD1A 4XEZA 4EN6B 1RMU3 4C1XA 5BNOC 3B00A 3WZ1A 3WP3A 1X8EA 3WG3A 1IPJA 4K1ZA 2ZX1A 1KDMA 1WCKA 4QHBA 3TN92 1AR93 1BEV3 3ZFGC 5J48A 1HRI3 1W6OA 1MVQA 4DFSA 2XL9A 4G4FA 4Q29A 3AMNA 5GZEA 1NQJA 4Q4W3 1FOD1 2IXKA 3SNMA 1XNBA 5C8WA 4BCUA 1BK1A 3ZMOA 3KT7A 1F5FA 1AX2A 1XE7A 4LR4A 4XF1A 4HVQA 3ENRA 4GMP0 1SEFA 4L92A 4D7SA 2VW0A 5JDBA 1RUOA 4FPJA 4YG3A 2K0GA 4D7TA 4DNYA 2VECA 5H9RA 1NXD1 2V09A 4HK8A 1ENXA 4CEWC 1QJY2 4DPNA 2RMU2 1PZ7A 2EXJA 3OY8B 3FFZA 4P9XA 3V64A 3ZSKA 3J8F2 3VBRC 1HLCA 4L9BA 3PVEA 1WLCA 3MDPA 2ES3A 5ACA1 5GLVA 5FCCA 1A8DA 5FLIA 3ZN5A 2XH6A 4ORFA 1VBB2 3FUQA 1GSLA 4F83A 3GZTB 5KC6A 1PGL2 4AVTA 2YGMA 3WXPA 2SBAA 2VH9A 4LBQA 2D3PA 4U36A 2Z79A 1PVC1 4I09A 4Q26A 4V1PA 4CEYB 3AKQA 3UJQA 1LODA 1G9BA 1V6LA 2XB6C 1G9CA 1U12A 2B39A 2A3XA 3KCYA 1J3PA 3H1MA 4RGGA 4IEOA 2HEWF 4XBQA 5CFCA 4KQ7A 4WVMA 4YW4A 1RUI3 1ZBA2 1QHDA 2IWGB 2CGOA 5F1RA 2A70A 3WVJA 5IK7A 3FLRA 4I0WB 4DS0A 5SV8A 4AXOA 2R1DA 3CO2A 4OHWA 3WD5A 5BY5A 1REEA 1C8M1 2JDZA 4L99A 3MIDA 3NSTA 1NA1C 2CGPA 1LOBA 3C2UA 1LJ7A 2GC0A 2VW2A 2NYYA 5BNPA 5KHIA 1X82A 2DCJA 1ZZCA 1AR83 3O0WA 1IOAA 1MZ5A 4TYSA 3WQ7A 4WVMB 1N1TA 5GZFA 4CP2A 1QJY1 2BNOA 2ZHMA 2RMU1 4CDUB 2VGDA 1S1AA 4E2GA 1ULFA 4XFAA 5E89A 4OHVA 4K9SA 1WBFA 5CFDC 2VOXA 3B02A 4NWVA 4LLFA 4PLMA 2DTYA 2WNVA 4EWDA 4JGYC 1N47A 1RHI2 3O5SA 1G9FA 1HQNA 5EZWA 3APBA 4IEQA 2VULA 4N9IA 1PGL1 3N4MA 2HWB2 4D69A 5BNPB 2PHXA 2TUNA 1FAYA 3TBDA 2MEV3 4FQ4A 1QQP1 4HN1A 4QPYA 4NHLA 4WM7C 3ZFEA 5JZGA 1AR73 3M3CA 4XTMA 2A6VA 4XTPA 1ENSA 2VUJA 2TEPA 3VBUA 2ZHLA 1SMVA 5EXOA 1PIV3 3E97A 4RS5C 4UBGA 1EAH1 3UKVA 1ZBA1 1NCRA 2XGXA 2ZHKA 4GH4C 4MXWB 2P37A 4GA9A 3FHIB 4EWEA 3NVCA 2VOKA 5DXDA 3QOPA 1AXYA 4PDWA 4AVCA 3RWNA 3UL2A 3VZMA 4BA6A 1MS3A 4IETA 4YZ2A 1DYPA 3H8UA 4MVTA 3R4SA 3UKNA 3T2TA 2FBEA 1R093 2RE9A 4XZPA 5GLZA 3ZYJB 1WW5A 5JZGB 1VBD1 3BTAA 4QPIA 2OUJA 3P3PA 1H8TC 3H3UA 5L73A 4YZ1A 3A0NA 1DDLA 1AYN2 2VOWA 1HQLA 1NCRB 5K0UC 4O9GA 4XFHA 3C3VA 4Q4X2 4RSUA 4Y24A 4ZKTB 1D4M3 1DQ5A 1DQ6A 1VP6A 2FZ1A 1S2BA 1LULA 4KG8A 4RL7A 1GQHA 1UW8A 2Z69A 2ZGRA 3AFKA 4YG6A 4EJRA 4ITCA 3L2HA 1RHI1 2XG3A 2IXIA 5CAZA 1YIFA 1LGNA 2NPIA 4XJWA 3ILRA 1RUJ2 3M3EA 4I0BA 3BPZA 3UKTA 4EWAA 4AEDC 4DOUA 1QJZA 3WOGA 3I4IA 1LHNA 2GC3A 5BYNA 3M3QA 2WT1A 1O4ZA 1Z0HA 2VOVA 3I59B 4YW3A 4HMZA 2ZGMA 4P9LA 3WHUA 3VBOA 2TBVA 2SLIA 2PA7A 5C33A 2EAAA 3ZXAC 1QH6A 1I1EA 1OSGA 1J1LA 4X6RB 4K20A 2GNBA 1JUHA 2XWJB 2P2KA 2D93A 2G4IA 4I0AA 4AGRA 4AEMA 4AGGA 5JI7A 5JSOA 1XQNA 1O3QA 2GSYA 4XJAA 5C4WB 5CG9A 5FMOS 2YUEA 4GXLA 1RMU2 5D1IA 5JPNB 2WNEA 1QXRA 4BWOA 2WL1A 1RGSA 1R083 3FMGA 2Y38A 1MQTC 1AR92 3VUOA 3KQRA 4IEZA 1OQEA 1ND2C 5T54A 4Q4W2 4YW1A 1DBNA 1CVNA 4B3NA 4K1YA 4I2OA 1IKPA 3ZPYA 2VMIA 2JG9A 4MX3A 3SITA 2IXJA 3WG4A 5DUWA 1EP0A 1WMEA 3GZUC 1O4TA 2UWCA 3Q9OA 4C1WA 1S0DA 1W2UA 2AH2A 5CA6A 1FMD2 4RQPA 1BQPA 3U10A 2JD4A 4RR3A 1APNA 2KM2A 4LHKA 3VBSB 2XBO1 1RUF1 3CJIA 4JV4A 5BV6A 3EHKA 3R4DB 1RUJ1 3HT1A 4HPKA 1RUE1 5H9SA 4P9JA 3H50A 4FOYA 3OD0A 3OGGA 2H6CA 4YW2A 1ZA4A 2I07B 4R9BA 3GYDA 1W6PA 2MPFA 2C1FA 3VZJA 5JPMB 2VNOA 1LRHA 1AXKA 1UU4A 1WMFA 5L36A 3SCGA 3QCWA 3WDVA 5A33B 4RR3B 1RB8G 1RUD2 3SXWA 3MEPA 3CJIB 3MFAA 3IN9A 4Y26A 1SLLA 3VDDC 1E57A 4PBPA 2LUWA 3VLBB 4EN8B 4FXGB 4HPKB 4CTEA 2RS51 1J59A 3AYAA 4ZU5A 3ZSLA 3ZYGA 1CIWA 4QGLA 2QVSB 4XJ9A 1X33A 1JXNA 1RUI2 3WW4A 4LO8A 4LA2A 3ZXGA 1W6PB 4BM8A 1WD4A 2RM23 3THTA 2R30A 1Z7S2 2XJTA 4X6QB 1A78A 5FFOC 3PMEA 3EBRA 2BUKA 2D5FA 1IS3A 1W6NA 4L8QA 5ABJB 1VRH3 5KHHA 3B7MA 2VMGA 3VKLA 4ASMB 4HL0A 3GNEA 4D3WA 4P9YA 3JD73 1FMD1 4IV1A 2DWRA 2A6YA 5FBZA 3AYDA 4M3CF 4B4QA 4AGVA 2ZX4A 2JECA 1UX6A 1QMJA 2ZX3A 4FXKB 1LTEA 1VBA3 2VMHA 1R1ZA 2LTNA 3N3HA 4NWWA 3VBHA 2JICA 2DUQA 2RHPA 4R8HA 1GZWB 2QNKA 1FPN3 2K9ZA 3AK0A 2HYKA 2FMDA 1Z78A 3TB0A 4AHWA 4JQRA 2D40A 3MLLA 4N90A 1W6NB 3IBMA 4AQSA 4N7UA 5T3NA 2HWF2 4IEUA 2B46X 4CYDA 4IV1B 2DU0A 4FOWA 1QXJA 5J96B 4AVAA 4FPCA 3ZFFA 2HWC1 1RUD1 1OQDA 3WX5A 1G8WA 2MEV2 3FJSA 4RFT0 4UXAA 1AR72 4JDMA 4BOWA 5JAXA 3ZMNA 3M2MA 2X8KA 4S2HA 4FTBA 2OUHA 1C1LA 2WT0A 2D44A 4YVSB 4OFGA 5JOZA 3V0BA 1PIV2 2EF6A 1Q8OA 4META 4AI8A 1ND3A 4DB5A 4OHZA 1LGCA 2GN7A 2I74A 5FRAA 1LCLA 4Y22A 1Z7S1 3WUDA 3FWEA 4GKXA 4E4SA 2OPKA 3FLPA 1YLLA 1N3OA 4H55A 1FX5A 4IQPA 3AX4A 4HLTA 4B4PA 4JTOA 3D4KA 1HX6A 4P9IA 2Q0AA 4COYA 5CU1A 3AP7A 2B42B 1LEDA 3ZXDA 4CDQB 5JI9A 2B9UA 3WG2A 1OKQA 3ZSMA 2UU8A 4W6WA 2R062 4K3UA 4E9KA 4JGZA 1SFYA 3MICA 3ROUA 2XWBB 4LO7A 1PZ8A 4CP0A 4CEYC 4B7EA 2ZMKA 4IEVA 4FSJA 1PO12 1MVEA 2R49A 5EWSA 2PLV3 3S7EA 4L2NA 2PHTA 1MS9A 4LTAA 3PNAA 4FPLA 4YFZA 1HRV3 4NO4A 2HWF1 4NHKA 4XW3A 1LOEA 3DV8A 1ZRFA 1PO22 2A73B 2A71A 3TOJA 3HWJA 4XOGA 1R1A3 3QLQA 5JR7B 3OYWA 2ZMNA 2YDEA 3USUB 4WBBA 3H1YA 1NE4A 2RR13 3HQXA 1V70A 4KGQA 1QY4A 1RVF3 3L9JT 2ZMLA 1KFUL 3WCRA 5JOYA 2ENRA 4CDUC 4YSFA 2ZX0A 2WZR2 2PAMA 1I3HA 5FLHA 5FO9B 3OD4A 5DZEA 4P9WA 5I93A 1EV11 2E6VA 3ZX7A 4ZU7A 2KXLA 3AP5A 5E88A 5BNPC 2R061 3ILNA 3TWIA 2BVBA 1DZRA 4WM8B 4FQZA 3GBGA 1IQAA 2PFWA 4BIOA 4GULA 2VQ0A 5C9AA 4KWJA 1PO11 2R16A 4PIXA 2NN8A 5DDJ2 5JSPA 1DFQA 1JTZX 2CV6A 3EO6A 2RS11 1SLTA 1IZ3A 1PO21 2IFRA 2G9FA 2YGLA 1OA2A 5F5QA 1LHVA 2D97A 2UY8A 1SLBA 4IXLA 4R9CA 1O3SA 4QU2A 4EROA 1OD5A 5GALA 1BJQA 2JG8A 1K5MA 5JZGC 1H2LA 4YZ3A 2O0OA 3EXUA 3LKJA 4XFCA 4OLLA 4OVEA 1AJKA 2GDFA 2AYHA 1ONAA 3VL8A 4XDQA 1W0OA 4GALA 2GMPA 3MZHA 1KITA 3MLKA 3ZSEA 4AFMA 1NCRC 2HWD1 1VR3A 3ZIWA 1Q8PA 3NAPA 2QFEA 2WNUA 1V6OA 3LOIA 1VJ2A 2WJSA 1LKNA 2P34A 4H7LA 1Y7BA 4AFDA 2D3SA 2WZR1 1A8MA 3ZXLA 3INAA 4H7MA 1ZM1A 2CNAA 2ZGNA 3DKWA 1UU5A 1K5MB 3D0SA 3MPPG 4J1XA 5FDBA 2HWE3 1Q3EA 1VALA 4Q4Y3 2XKPA 2P3JA 4YGDA 4PBOA 3RYKA 1UMZA 1YI9A 3BCWA 3OBTA 1RJ8A 2LALA 1B35A 1VRH2 4RHV3 2O1QA 5DDJ1 4MGYE 2GZWA 2XVLA 4KL1A 3JD72 2DTWA 1TQ5A 1WA4A 1AR61 4LNVA 2ZKNA 2O8QA 2A6WA 1GQGA 3OF1A 3AXEA 2A6ZA 5C4WC 3FBMA 1O4YA 3OJBA 5JIAA 4W6YA 3M3IA 4XXPA 2UURA 3DGTA 4KWKA 2VVEA 3AP9A 4FOVA 3MIHA 1X50A 4QX5A 4AF9A 1W6MA 2QZ2A 1CAUA 5J98B 3WDUA 1BBT3 1XU2A 3ES4A 2OA2A 1RTVA 4GQ7A 3PTYA 1H30A 2ZX2A 4AFBA 3BOWA 4LO4B 4NVPA 4S2DA 1ENRA 1Y9QA 3OTFA 4N43A 2WFF3 4Z2WA 3HIFA 4Q4V3 2R073 3FBYA 2X5IA 1DGRA 5JWPA 1I5ZA 4QPGA 1AYM1 1POV3 1W6OB 3LGRA 2D6PA 5I0SA 1L3JA 3JBG1 1YCIA 3D6EA 3IKWA 1HXS1 4YGBA 4AI2A 4YM2A 3WT3A 2ZAAA 3M7AA 3VBSC 1YJLA 1RUG3 1UN1A 1H2KA 2CAUA 2D43A 2YV8A 1DF0A 3PVNA 4N43B 4AEJA 2B5HA 1QJX3 3IPVA 4DINB 3T1MA 5FOJB 4S2GA 3NV3A 1GZCA 4EV0A 3AMMA 1LOCA 4OI2A 1PMIA 4HKOA 4RR3C 4TWTA 2BWAA 5HCFA 3TN91 4R52A 3CJIC 1MR5A 4FVVA 4AFCA 4LBNA 4LE3A 1S55A 1SDWA 4TSVA 3CU7A 4COZA 5T5LA 2UYBA 4LLOA 5KHKA 2WS93 3IM0A 1JBCA 4R9DA 1UCXA 2XKOA 3SLIA 2EXHA 2XLFA 4HFSA 4LBQB 4CDXA 1LOAA 4M3CA 1HRV2 1DGWX 1V9U3 5TSWA 4WZCA 3S6PA 1ULDA 2DCYA 1C28A 3D0JA 4LBQD 1XYPA 5D8AA 1BCXA 4FP2A 4YGCA 5CFCB 1R1A2 3ME2A 1C5IA 1NCQA 3LWCA 1F8VA 3E5QA 5ABJC 2GNTA 2CWMA 4XJ8A 1KD7A 1OHFA 3J8F1 4MV2A 1PGW2 1DYKA 4AFAA 1VBC2 4KU7A 1JHNA 4GB33 4HN0A 3LAGA 1VBB1 1UIKA 4GKYA 1U5XA 4X8NA 1O3TA 3I8TA 4FO9A 5GZDA 3AM2A 1OLRA 2PYTA 1AL22 2MHFA 1FI2A 4BYYA 1H1MA 2XJSA 4S2FA 3VBFA 5SV5A 3M70A 1QOOA 1VBE3 4Q0SA 1ZBE3 4B8EA 1F9KA 3ZO0B 2B45X 5T55A 4IV1C 2PHUA 1LGBA 3LOBA 3M4FA 2WNVB 2R043 3KM5A 1RL3A 4FAHA 1U5IA 3KD4A 1YXWA 1TME2 4XQWA 3HAGA 4E4DX 2ZBJA 4YVSC 5EV7A 4AVBA 3SHRA 1RUC3 2BBVA 2BFUL 4XBNA 5AVPA 1TMF3 5BNNA 3VZOA 4COWA 2W68A 1JOJA 3ZFEB 2YZ4A 2A3YA 1ZZ7A 5L7OA 1I6XA 3WG1A 2OVUA 1ASJ3 3VBUB 1SBFA 1VIWB 1G9AA 1QJU3 1MEC2 2EALA 2ZZJA 3GHMA 4GMP3 5I8YA 1COV3 4Z92B 1A6CA 5T52A 5T5JA 3AKRA 1HQWA 1WCDJ 1RIRA 1Y3TA 3N7MA 4GWMA 4R4ZA 4EN7B 3ZSJA 1SBEA 4PDWB 4OHYA 4Q27A 4CDQC 4N53A 1VBC1 3WNXA 1SLCA 1QNWA 3IDBB 4HKWA 3DPRA 1ALYA 4HSJA 1AX0A 2B7YA 1Q8VA 2HWB1 3SH5A 1CN1A 4Y1YA 4QPIB 3S7IA 1AL21 1FNZA 4QQ2A 2UY9A 5CADA 2C0ZA 5EFUA 2ARXA 5K8SA 5J37A 3QACA 1DLLA 3KZ4C 3RQ0A 3VL9A 5BNOA 4N9HA 2DFCA 4AI1A 1X7NA 4NPRA 4N53B 2PELA 4Q4Y2 3M8LA 4XJUA 5A3MA 4YVWA 1N1YA 3KMHA 4HK9A 4UW4A 4QT6A 3N35A 5HCBA 2RS32 1OFSA 2GNMA 1TME1 3BOPA 1LOFA 4FPKA 5CB7A 5CBLA 1YFXA 1ZRRA 4COVA 3JZVA 2PHWA 5DUVA 3ZVXA 4W6XA 2NMOA 2NP0A 1BEV2 1HRI2 1J58A 2X29A 4I3PA 3VBOB 5I91A 3TRSB 3ZXKA 4U2AA 1AYN1 1MEC1 5CG8A 1REFA 4XQ4A 2YC0A 4YVWB 4LT5A 4B4RA 4Q4X1 3NV2A 3POSA 4XJZA 3WR0A 5KXDA 1BBT2 2DCKA 2PAEA 5KXEA 1DGLA 3E5XA 1GNHA 1MS5A 2WFF2 4WM8C 5DUUA 4OI1A 5AC93 5IK5A 1AUYA 4Q4V2 2R072 2RJLA 2XJRA 5HBAA 3KB5A 1RUH3 2R1BA 2YXSA 3BODA 2QDNA 4LE4A 2ZGQA 2R0HA 2E53A 4LO6B 2NZ9A 1OLQA 3GALA 5B2GB 3RJ2X 2JXAA 3H7JA 5LK7B 1URXA 2JG9B 2AENA 1SACA 1OA4A 4O9EA 1YFYA 4AHXA 2G9GA 1H2NA 1UZYA 3NKTA 3N7KA 3MIGA 4RQPB 2WA3A 2BPA2 2DF7A 2R32A 2PHDA 2ILMA 4MH0E 3W58A 2RS31 1QJX2 1FOD3 2DV9A 1JUIA 3B01A 1TEIA 4DMIA 2WKKA 3EJKA 4DY5A 3WW2A 1RMU1 3KGZA 4K8FA 3D5OA 1NA1A 1H1AA 2TNFA 1PK6A 1NG0A 3GHNA 3URFA 1CAWA 1WLWA 1FATA 1AR91 1BEV1 1WW6A 2FMYA 5CIRA 3IDEA 4D94A 1DG6A 1HRI1 1FT9A 2H0VA 4XF0A 3RYPA 4JC1A 1NQDA 4Q4W1 4DY3A 2OIIA 3FC0A 4FPFA 5AVAA 1AXZA 1AYM3 1ZZ9A 1CJPA 5CFDA 4K21A 2ET7A 1W6QA 1K5MC 1V6KA 1XE8A 1H4HA 4JGYA 4QD2A 5ACA3 5DG2A 5T50A 1IS6A 1BZWA 1AR82 4XFGA