1V0AA

Family 11 carbohydrate-binding module of cellulosomal cellulase lic26a-cel5e of clostridium thermocellum
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
173
structure length
170
Chain Sequence
SAVGEKMLDDFEGVLNWGSYSGEGAKVSTKIVSGKTGNGMEVSYTGTTDGYWGTVYSLPDGDWSKWLKISFDIKSVANEIRFMIAEKSINGVGDGEHWVYSITPDSSWKTIEIPFSSFRRRLDYQPPGQDMSGTLDLDNIDSIHFMYANNKSGKFVVDNIKLIGALEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE H
publication title The Family 11 Carbohydrate-Binding Module of Clostridium Thermocellum Lic26A-Cel5E Accomodates Beta-1,4- and Beta-1,3-1,4-Mixed Linked Glucans at a Single Binding Site
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
total genus 34
structure length 170
sequence length 173
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2004-03-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 1v0aA01
4CPBD 1W8UA 4LKFA 2O14A 1V0AA 1OH3A 3UT0A 4CP9A 1GWLA 2JWPA 4LK7A 4AL9A 1WMXA 3ZYFA 1OKOA 1GWKA 2LROA 2K46A 1W8WA 1UOJA 1WZXA 2LRPA 1HN0A 1W8ZA 1W8TA 4LKEA 1W9FA 4YW6A 4LKDA 4BQ2A 1L7LA 2C24A 2KR2A 4YW7A 3F95A 3ORJA 4CPBA 4A6SA 4LK6A 5D21A 4CP9B 2WYFA 4YWAA 3ZYHA 1W90A 4BQ3A 3ZYBA 4LJHA 1GWMA 1WCUA 4BQ5A 2VXJA 4BQ4A 2Q1FA
chains in the Genus database with same CATH superfamily
1S0IA 1RUF1 2XWBB 3H3UA 3OCPA 2QDNA 3JU9A 5FPZA 1QMJA 3KHBA 4BQ1A 3T0DA 4IL7A 2BWAA 5JLVA 4W6YA 4PLNA 1UY1A 5CFCB 1AZDA 3EMRA 4LBNA 5DAPA 5GM0A 2JDKA 2JDMA 1S0DA 3AMQA 3LEKA 2O0OA 4Q4Y1 4QQHA 3AFKA 4A41A 4AVSA 2AR6A 2WNOA 4YM0A 3RQ0A 3VBSB 2HWE2 2ZX4A 3CZJA 3ILRA 4QX0A 3K77A 4MGYE 4XJAA 4LO5B 4A6SA 4BQYA 4M00A 1D7PM 1LAJA 1OVPA 1JZ5A 5FZAA 5A6ZA 3ON7A 1GZTA 1W05A 4CCEA 3QACA 2ETEA 3IMNA 2XJUA 1HQNA 1T6GC 3VBRC 3DN7A 3H3ZA 5DDJ1 4GB31 4A44A 4XHXA 2XQRA 2VECA 1UU6A 1CQ9A 2D6PA 1N3OA 5IWFA 3RRDA 3RGBA 3WCRA 1CAXB 2LROA 2XVLA 3ZPOA 4IEYA 2DUOA 4FO9A 2XMLA 3T1MA 4BK5A 1GUIA 5A80A 1G9CA 1TZOA 5JPNB 4SBVA 2FDJA 4Y1UA 5FYBA 3BIEA 3ZR5A 3MICA 1GZWB 1H8TB 1WBLA 4ZS2A 5L73A 2ZGLA 3VBFC 1DGWX 3POIA 2RMU1 1JOBA 1HQLA 1L3JA 3INAA 2BNOA 3HPNA 4P00B 3ACFA 1FMD2 4NAMA 2BDRA 2F6BA 3EJKA 5FZOB 1MACA 4EN9B 2F17A 4XQ4A 4Q4W1 1XXNA 2VQAA 4IE5A 1OF3A 1EAH1 3M3IA 4RHV1 2VMHA 2JIGA 4XAEA 5FO7B 4EN7B 1S0GA 1CPNA 4YZ1A 3B94A 2DTYA 2EIDA 1TMF1 3T30A 5J09A 4L9BA 2A3YA 3POJA 3RZLA 3WNMA 4TN7A 1AR83 2JXAA 3A23A 3WW4A 1LKNA 1LGCA 2VNGA 2ZZQA 3PJYA 3Q8CA 4RGAA 5I0RA 2GAUA 1O3TA 4FTBA 1UZVA 1LEDA 1F15A 4E8DA 3BU0A 2Z79A 4YNIA 3AP4A 1MS8A 3WY6A 3LSEA 1MZFA 4JKLA 2J7MA 2W91A 4LHKA 1RL3A 3H9AA 2VVFA 3KVAA 1OLQA 1WW5A 5CIRA 5GZGA 3U4XA 1JBCA 4COWA 5FR3A 1NLSA 4IXLA 1ND3B 1OD5A 3WG2A 1C3HA 1VAMA 1PVC1 4QXBA 3QLQA 4U2AA 1RUOA 3MIHA 3WDTA 5C8CC 4AHYA 2RS51 4A45A 5FP8A 2YBSA 3WLUA 1OURA 4I3GA 5CADA 1ND2A 3UGFA 1IS3A 2R0HA 3KB5A 2JDAA 3SCHA 1L7LA 5APAA 3GJBA 1AR93 1GZ9A 2VMCA 3NSTA 3O1RA 2XLAA 1JHJA 2LTNA 4Y1XA 4GMP0 4K1YA 1MPXA 3VBSA 3DPRA 2OUJA 3AM2A 4ARXA 2HWE1 2Q4SA 1EUUA 2MEV3 4WM8C 3IWZA 5K4LA 1H4GA 3M8LA 2BBVA 1LB2A 2R063 3HJRA 4LIVA 5C3SA 1UF2C 5TSWA 4I09A 3NL1A 2H6BA 3W9AA 1WLWA 3AXEA 3AZXA 3ZFGA 4FBFA 1UCXA 3OBRA 3U11A 2QVSB 4RYDA 4PBOA 2ATFA 3RJ2X 1VBE3 4QX3A 5FZHA 1C8M1 1VAVA 3AVSA 3I2IA 1K45A 4QQOA 5LEJA 1WGPA 5CG8A 1HV1A 1H4HA 3USSA 3NAPC 4P9XA 3QD6A 4QHOA 3POEA 1FPN2 2PAKA 3H7YA 3JQWA 4MH0E 2ZGPA 1WCSA 4IV1A 4EZ4A 2A71A 1GZWA 1H8TA 3A21A 3N9OA 3IPVA 4EWAA 1OH3A 1QJY2 3FLRA 4H2AA 3RYRA 2QQNA 1JZ8A 2JG9B 5FPUA 4OHWA 1NXD1 1W8OA 4AXOA 1G6NA 5A33B 1FMD1 1RMU3 4XUOA 3WW3A 2RM22 3UJOA 1AR71 4OI1A 3ZIXA 3W21A 4GMP1 4M4RA 1DF0A 1NXMA 1CN1A 4JQTA 2JB8A 4AZZA 4YZ4A 2J1EA 4EN6B 4CEYB 1DLCA 2R7EB 2DFCA 4YWAA 2XR4A 4QX2A 3JB4C 3KQRA 1KJRA 1SPPB 5IK7A 4COZA 1ODMA 1X8MA 2GSYA 2JEMA 2JDHA 4Y20B 3D6EA 2E9QA 2AGSA 1K5MA 4QKFA 5FPVA 4CYDA 4URAA 1ZBE2 5JR2A 4HSJA 5FZLA 3VBRA 2C1FA 5JWPA 2VD7A 1GR3A 2AEYA 3USUA 3MPPG 1DGRA 2WAOA 4X6RB 3VL8A 4NIIA 3POSA 3KZ4C 4Y5Z0 4AGGA 4DZGA 1EYBA 2ID4A 3T1LA 1Z7S3 4FTSA 4QXKA 1O3QA 2OVUA 3JD73 5BNPC 1N3QA 5EFUA 2QJVA 5HCFA 2Q8CA 3U78A 3C7HA 2W46A 4P9IA 2QQMA 4U36A 5FFOC 2YU1A 4FPHA 4IGOA 2BBAA 5FZ8A 2ZXQA 1PO22 1VMFA 4XVHA 3N7LA 3B5LB 2WINB 5FYVA 3ZMOA 3W58A 4JRAA 3T4VA 4QGMA 1SCSA 4NRMA 4NWWA 1H9WA 1GZCA 2IXCA 4ORFA 2Y6HA 3K3OA 1X8EA 3VKFC 1KRIA 4KBZA 3F2ZA 3T08A 2ZX1A 1RUG2 2EIGA 1J3QA 3MIGA 1X9TA 2WNUB 4NPMA 5JI7A 2GN3A 2BEOA 3N7MA 4I0AA 2OPWA 1IHMA 1W3VA 3O0VA 2DDUA 1W06A 1VBC2 1XNKA 3GDBA 4P08A 1F4AA 1Y4WA 2VOTA 3NQHA 5FUPA 4HKLA 3THTA 4A3ZA 5JI9A 5DUWA 4GIQA 3CIHA 3PMSA 4OULA 4KL1A 1LU2A 4DINB 1VRH2 1DGWA 1G9FA 1BKZA 2ZX3A 3IMMA 1W99A 5H9SA 2FBEA 2QUOA 2C6SA 3H1YA 2BPA2 3IM0A 2VC9A 2RDRA 3OY8B 5IVYA 3OUJA 4UFIA 1FPN1 2DCKA 5GZDA 1E5RA 3KHCA 1GANA 4IEPA 4B29A 2WSUA 1NG0A 3I2HA 1HN0A 4AGVA 2WZR3 5A3TA 2P34A 4DY5A 1QJY1 4DMIA 1YUDA 5A33A 4NROA 1QH7A 1KGYA 2ZMLA 4D6SA 2VCAA 2RM21 1BBT3 4BMBA 4Q4X3 1ULFA 2Y33A 4FPEA 2BNMA 1DYKA 3VBOA 3FHQA 3FFZA 4XF0A 4YVWC 5GKAC 3ZYBA 5JOXA 4Q2FA 4OYUA 5JIAA 4CEYA 3N9LA 1NCQC 5J1XA 3HNMA 1VBD3 3M1HA 5FZ6A 4Z2WA 1QJFA 3R4DB 4WM8A 4A4AA 1LOEA 4PCRA 5EXOA 2VQUA 3PUHA 3RMYA 1DQ2A 5T52A 4NRQA 1C8NA 1NE6A 4AVVA 2V4VA 3JXSA 1PIV2 1ZBE1 4DXSA 1DHKB 2VAUA 5JOYA 3OGVA 2JD9A 2FDHA 1XYOA 2R071 5IHRA 1LULA 3B3QE 1C1FA 4AI9A 2E33A 2AC1A 2HWC3 3RJRA 1JYWA 3MLLA 2WL1A 1UZYA 2EXKA 2PHLA 3NAPA 1JW6A 4WBBA 2XGXA 2YXSA 3RWKX 1OKQA 3U07A 1EV13 4RS5C 1B35B 1SFYA 1NZIA 1PO21 1S0BA 4P9GA 4F7ZA 2L9LA 4W8JA 1MVQA 5F3CA 3Q8FA 4WVMA 5FLIA 3LA2A 4KU7A 4Y4YA 4UWDA 1RYYA 1JOJA 4A6OA 2HH9A 2WSVA 1NY72 1OPMA 2HBTA 4MXWB 1VBA3 1W2NA 5J96B 1QJU2 4BPZA 5BYNA 5FMCA 2EVXA 1RUG1 2WNUA 4L92A 3UL2A 2ARBA 4D0QA 1BZWA 4Q1RA 4CA9A 3K3NA 3HR9A 4OZOA 2A73B 2OX0A 2D6MA 2A75A 1LHOA 4LNVA 2ZA9A 3PVNA 2X5IC 5CISA 1VBC1 4W50A 3TNPB 1O4ZA 1Y9GA 2WT2A 3WP3A 3H0OA 1FXZA 1VRH1 4AVBA 3LFIA 1CJDA 5A7NA 4AQ6A 3WF2A 1LHVA 4QKNA 3WQ7A 1MS5A 1CX1A 2CNAA 1AF9A 1QNYA 1BMV2 1Y7BA 3GM8A 5LA9A 1US3A 2XJQA 4PJYA 4YW7A 2YZ4A 4XJUA 1YI9A 3NV4A 4FPKA 5C71A 4GZ9A 5FZ1A 5BNPA 2TUNA 3PU3A 4W4ZA 3D0SA 4HPKB 3S30A 3V0AB 3N9PA 2C5DA 1ENSA 3NJYA 3POFA 4BJ0A 4Q4X2 3WP6A 4OUEA 4SLIA 4CPBD 1POV0 1NX9A 1D4M3 3R05A 2O8OA 2EA7A 4OVEA 5EZWA 1N3PA 4BMEA 5FYSA 1ULOA 2R16A 3JB8A 3ASIA 4YVSB 1YYNA 3H8XA 1H2MA 5IVJA 1W6QA 1QJX1 1GWKA 2W0XA 1PGW1 3FLTA 4LA3A 4E4DX 5BNNC 3WUCA 3ZLIA 1KFUL 5JSRA 2DVBA 5CFDB 1W6OA 1NT0A 2CTVA 4JGZB 2WS93 4TSVA 3ORJA 1R081 4GH4B 4COYA 4F83A 3O1MA 4S2GA 2GZWA 1K5JA 4WM7C 1CX4A 3BODA 1PIV1 2PA7A 4BDVB 1E5SA 1QQP2 4CDXC 1LGBA 3JBG3 3Q8BA 2WO3A 4Y26A 2Y64A 1HN1A 2VQ0A 1V0AA 5FZKA 4B4PA 1WLDA 2YROA 4Y5SA 4CP2A 4LBJA 3UKNA 2GC3A 2BVVA 5BPXA 5L9VA 3KM5A 4L99A 1JUHA 2PAMA 3RYKA 2VJXA 1DGLA 2FCVA 4Q26A 5LK5A 1WLTA 3RZJA 5AC92 1B35A 5D2AA 2WABA 1QJZA 1AYM2 1MZ6A 1JHNA 1NCRC 2W08A 3VBHC 4CTEA 4XDOA 1JN2P 4LR4A 1X33A 5JPMB 1UY4A 5A7QA 4IE7A 4CU8A 2D3RA 4BIFA 2VZVA 2EALA 1YFYA 1GOHA 2BGCA 1VBA2 3NNJA 4XBLA 3UGHA 2DV9A 1ULCA 1BJQA 4NN0A 1J59A 4DEQA 3AKRA 3W20A 5A3UA 3MBWA 5DABA 4TTGA 1W9TA 5ANNA 4QWNA 3C7GA 3AP5A 3AK0A 1FOD2 1HRV3 2J22A 2ORXA 1HV0A 2KR2A 4K1ZA 5JOZA 1RUF3 2DU0A 1LOAA 1W8FA 2UWBA 3GNEA 5GLZA 1VAKA 3SMHA 2E6VA 1KEXA 2BOIA 2Z2SB 3C7FA 3BGAA 3MIFA 4QPGC 1SCRA 1YEWA 1UYPA 5AVAA 4Q4Y3 3RMXA 3ZOIA 1OUXA 1UXZA 3HMYA 5KHGA 5L9BA 1GMMA 4QXHA 2ZX2A 5F6LB 4KG8A 3AP9A 4I01A 3MW4A 5JXHA 3AC0A 1D4M2 1YFUA 3H1WA 5GLTA 1JZ4A 1JZ6A 1QOOA 1OA2A 3E97A 5H9QA 3H8RA 4QM8A 1ZREA 4RS5A 4RQPC 5FY9A 2R1DA 1H6XA 3LA3A 4QQLA 1OSGA 1WD4A 5FZCA 1DZQA 3WEZA 3SKVA 4RN5A 4AVCA 4M0HA 5DDJ3 4GB33 4MYEA 3WHTA 2R0FA 4COUA 1LRHA 3O12A 2W1QA 1JU3A 1JU4A 1PK6C 4BXFA 2IXLA 1P8JA 1VB2A 2LS6A 3PUIA 4HN1A 4LOSA 4MADA 2GH8A 2GNTA 3LWCA 1KITA 3PUSA 4OCTA 3T0AA 4CDWB 3OBAA 4FSJA 4AQTA 5JMCA 1CZSA 1YQ2A 4NJ4A 5LBFA 1VPHA 4HK9A 5SV8A 4GH4A 4OHZA 2XJRA 5BNOC 5LCWL 5LRSA 3NNMA 4KWKA 4LKFA 4FPOB 3JBG2 2Y26A 4PDWC 1PHMA 3RZGA 3MFAA 1ZRRA 4UXAA 5JXJA 1O8SA 2QCSB 1QQP1 2XXZA 2I45A 3CNAA 4LE4A 4XIKA 5IVBA 2OKXA 3AJZA 3ZFEC 3H3LA 4E4ZA 2YC0A 1DQ1A 2C26A 4QX1A 3UETA 1WUVA 2BUKA 2AUYA 2PLV1 1BXHA 1J84A 4XBNA 1E5HA 1YJKA 2B4KA 4LLOA 1HRI2 2Y0OA 3TB0A 1G9DA 4DOUA 4Q4W3 5A3NA 1V6MA 2IXIA 4LBKA 4N53C 2UWCA 1EAH3 1KJLA 2W5FA 4RHV3 3VKNA 3AYEA 2WZ8A 3VZLA 5AC91 5JUVA 5FYYA 4MGTA 1X7NA 3WNXA 1U5YA 2BGOA 2R49A 4W6WA 1TMF3 1AYM1 4XXAA 1UD1A 1GU3A 5A6YA 3E5UA 2WA4A 2A1XA 1NLRA 2H6CA 2XUMA 4QMAA 3AZWA 2WLPA 4HVRA 2KD7A 2PHTA 3ZKYA 2WJSA 4MUVA 4LHLA 4DY3A 5F3IA 2WAAA 2W3JA 2ZACA 3DXUA 4NIDA 1DBNA 1W8WA 2JENA 5FY5A 2D5HA 2A5ZA 3V0BB 1HX6A 3AMNA 1W9FA 3VD5A 3SISA 5FPLA 1J1TA 2ZS6B 1F5FA 2ZZJA 5FMBA 3F95A 4B4QA 3GCXA 4G4FA 4FPJA 1OMIA 1UMZA 2B9VA 1IPSA 3M2MA 3OG2A 4QQPA 4AHZA 1F35A 2CHHA 3WP4A 4AHXA 1FOD1 1AX1A 3BALA 4XUQA 4WM7A 5FK7A 5FO9B 1JOPA 3ZM8A 3T4HB 3KF3A 1OOPC 2CY6A 1JZ2A 3LD8A 4HXCA 1UWWA 5DXDA 1KS4A 3R4UA 4Q4Y2 5KR7A 4JV4A 4XE9A 1AXZA 3V56A 1K42A 4BH9A 1HXS2 1XNDA 1NOVA 1RJ7A 2WN2A 4LBQD 5C3PA 2C9KA 1HB4A 1OKOA 2ZX0A 4YM1A 3GHNA 2XL9A 1N1YA 3NKTA 4HONA 5EV7A 5IAXA 2ARCA 2HWE3 3VDBA 4RR3C 2YMZA 1UW8A 4QAWA 5FY0A 5I0TA 4D3WA 1GSLA 4GB32 2YYOA 1Y9QA 1NYWA 5FJHA 1NCRA 3VBHA 4URTA 3GF6A 3LDRA 4XXPA 1KDMA 4QKDA 5DQ0A 1YLLA 4YW5A 5I8SA 2PQSA 1D2SA 4J1WA 3MW2A 3FJSA 3WNNA 1H1IA 1C8M3 3BB6A 4CDUB 3H50A 3CQOA 1V6NA 4LPLA 4N9HA 3VZJA 3CJIC 5FO8B 3O1SA 1O3SA 3Q8AA 2W94A 5F3GA 4AI1A 1X50A 4GQ7A 5FZFA 4Q0QA 3VLBB 2XLFA 4A2UA 1W9WA 4QB6A 2IXHA 4QPIC 3I8TA 5DG1A 5FQ0B 5KXBA 1GOFA 1XNBA 2HKXA 4IV3B 1RUJ2 2C4XA 2RMU2 5FZ9A 5T55A 4IDZA 4ET7A 5C4WC 3PUQA 3ZDSA 5IATA 5D8AC 3T3YA 3VL9A 1ZRDA 3N7KA 4YRDA 1XBFA 2FMYA 2IXKA 2OS2A 3KGLA 1UPIA 1SMVA 1W6MA 4MGZE 5FYCA 3GCWA 3JUUA 2ZEXA 5F1RA 1F4HA 3HVDA 4YZ2A 4CEWC 4BWOA 1FMD3 3VKMA 5BY5A 3I2DA 5FZBA 3AKQA 1AR73 2RDQA 1HRI1 4NRPA 1PMHX 2GH2A 4ARYA 1DYPA 4GMP3 2LW8A 1AX2A 2HEWF 4MHRA 3U14A 4H14A 2DVGA 3MPBA 3NO8A 3VN4A 1WCDJ 2ET7A 4XMAA 2X10A 4OFGA 1PZ7A 4RQPA 2KXLA 1K12A 2RJKA 1C5HA 1UNBA 5A7PA 4D94A 4XW3A 2TEPA 2DBNA 5H9PA 3J8F2 1Y43B 2IVJA 3GJAA 5T50A 2R6QA 2YPDA 4JGYC 4Q29A 4PBPA 1GKBA 2FZ2A 4JKKA 1PVC2 3OTFA 3IZOA 4ASKA 1OT5A 3UGGA 4PIZA 4FOWA 1XNCA 5T54A 2DBIA 4KGQA 2RS52 4BM8A 2R041 3SH3A 4LLFA 3CEWA 3HIFA 3MIEA 5BNOA 3RZKA 1COV1 1UZ0A 2GNBA 2YFZA 1DYOA 1ND2B 1D0GA 2JKBA 1S2KA 3EBRA 1O7FA 4PDWA 5F39A 5FBJA 1JYVA 2WZPP 4XAAA 4A7YA 2ZTNA 4FXGB 4CVUA 1GNYA 3QH6A 1J83A 2BP6A 3PURA 2GN7A 4ASMB 5EJ1B 4XFHA 3D82A 2G4IA 4P9WA 3V64A 1XNAA 1EPZA 3MDPA 3DPRB 4NVPA 4JVAA 1HXS1 3ZSMA 1YQ8A 1XSQA 2DCYA 3D5OA 5L36A 3BTXA 3BOPA 2DCZA 1I5ZA 2E7AA 2VMIA 1G86A 4UT5A 4YG6A 5DZFA 4L0PA 4XYXA 5EPAA 2WT0A 4MGIE 2VU9A 2A3WA 4NHKA 1ULGA 1MZ5A 4OI4A 3VGIA 2EXHA 2WLQA 2UYBA 3ROUA 4IEZA 3ZFGB 5CYYA 3OGRA 1PO12 2CAUA 1CPMA 4KBBA 3UKTA 2Q8OA 1C8M2 1V6IA 1WMDA 2ADEA 4LBMA 5C70A 1MEC1 5JSOA 4LULA 3POBA 4BLIA 1FAYA 3EQEA 4CDUA 1UAIA 4I3PA 5LRRA 3ZFFA 4P02B 1ZBA2 2FMDA 2P4EA 2FD8A 1DGRN 1JYXA 4BQ2A 3OEAA 3T2TA 3B9CA 3BYWA 4XUTA 4IESA 1UPSA 2EXIA 2HWF2 3LGRA 5E6HA 5GZEA 5FQ0A 3FUOA 3FLPA 4IV1B 1LTEA 3OYWA 1SFNA 1GLHA 2PQQA 4P5YA 2OQ6A 4IV3A 1FPN3 1QOSA 2OPKA 3LEMA 3AYDA 1VMHA 4AEDA 3NVCA 1RUJ1 3ZSJA 3IPVB 4JKMA 4B8EA 3WD5A 4MGQA 1PX3A 3WG1A 2XKPA 2YG0A 3WDXA 1QJY3 4KWUA 5C5TA 4Z92B 1ENXA 1GOGA 1AR72 3DKWA 2NP0A 4W65A 5LY1A 3VD7A 1OUSA 1NA1A 5FK8A 1BYHA 3RI8A 1AR62 4N43A 1LOFC 1XRUA 3MFCA 5M0TA 2RM23 4XABA 3TRSB 4FPCA 1KFXL 1Q8QA 4P14A 4UOJA 4A7KA 4KWJA 1LOCA 5FUIA 1QEXA 1W6PB 3EXUA 1OFSA 4KMQA 4ZY9A 1C1LA 4XJ9A 4RR3A 1WCKA 4Y4RA 4E4HA 2PFWA 1FNZA 2RE9A 2XB6C 3M3OA 4LK6A 2ZPXA 1K5MB 4N90A 2UWAA 1V6LA 3VBRB 3HQUA 1SLCA 4EQVA 2WA3A 4AEMA 4BQ5A 5B4XA 2DUPA 4CCLA 3USUB 4BA6A 1MQTC 1ZBE3 3J8F1 5FTTC 3KSCA 1JZ3A 4UW4A 1MS3A 3KMHA 4HVQA 4Y1YA 4E4SA 2DCJA 4TLFA 2YFUA 2P2KA 4I0BA 1UY3A 4LEJA 4CCKA 1LCLA 1ONAA 1H9PA 1ASJ2 1YWKA 3AP6A 3U37A 1R1ZA 3IIIA 1CZVA 2CV6A 3SLIA 1W8ZA 4QPIA 3PHMA 3ACLA 3SITA 4HKOA 4AI0A 4WVZA 3VBFB 4CPBA 2QZ3A 2YC4A 2Q1ZB 4YFWA 5FWEA 1PO23 5D8AA 1IZ3A 3MIDA 5FP4A 3I2FA 3KLSA 1WA4A 2FDIA 3ZXLA 3PUAA 2QQUA 4D7YA 4CEWA 2VCBA 1SG3A 4N7UA 4CCCA 2XUEA 1H0BA 2PXJA 3VBUC 2G9GA 3UT0A 4HZFA 3GZAA 1GWLA 1VBB2 2OA2A 2VW1A 3IDCB 1SBFA 5KXDA 1RUG3 4NHMA 2LRPA 1G9BA 2VTFA 1UIJA 2VMEA 2E32A 1RINA 2ET1A 1PO11 4HN0A 5CFDC 4WVVA 1VBC3 4X6QB 2Z5WA 4Q0PA 2HJIA 2E31A 5DAQA 4DPNA 1QDOA 2GNDA 2VQTA 1VRH3 1ZBA1 4X8PA 2WKKA 4JGYA 4EJRA 4XFGA 4RFRB 2HWF1 5EYXA 3GALA 1S0JA 4IEXA 3WOGA 2BTVC 1R091 1BVVA 3I2OA 2ZHLA 3J9SA 2J1AA 2TBVA 1RUD2 1SACA 2WNEA 1XC6A 2VTXA 3IAQA 1YC61 2XL7A 3RG0A 3D0JA 3ZO0B 1HLCA 2JG8C 4Q0VA 1W6NA 1A6CA 4CXYA 1AR61 1XU2A 4QHZA 1QXJA 2NQYA 3VBOB 4AOCA 1PNGA 1UX6A 3AMPA 1FX5A 1RUI2 1W9YA 3WG3A 1QJEA 3J7NA 3LEIA 4MG2A 1W6PA 2AACA 4WM8B 1X82A 5A1FA 4FPLA 3M70A 4Y22B 2YU2A 3ZXFA 4UW3A 1LR5A 1BCXA 1R083 1TME2 5BXXA 2VR4A 3WZ1A 3TEZA 2R072 1RXFA 1PIV3 1XQNA 1HKDA 2GP5A 3NV2A 3OF1A 4LA2A 2WT1A 4UBHA 3TOJA 4AQ2A 2IFWA 2VZUA 2Y6KA 2JDZA 2DVDA 4LBQB 1LJ7A 5F8PA 3TN92 3WQ1A 2P3KA 3NAPB 4GKYA 4QDRA 2XKOA 3BIWE 4Q8KA 1ASJ1 4C0BA 3X29B 2BW8A 1M4WA 3PTYA 5FREA 3I2JA 3UKVA 1ZZBA 4W6XA 1KDKA 1UY2A 3OPWA 2EAKA 3VBFA 1H1MA 1CAVA 4Y1VA 1REEA 1UYXA 1WLCA 2DVAA 4WVMB 2W1WA 2WIIB 1H8VA 5GZFA 5KHKA 2WNVC 4O65A 4E27A 2JB4A 5HV4A 4AWDA 1UXXX 4YW1A 1POV3 4H7MA 2E7QA 1LOFA 3OGJA 3PL0A 1DZRA 3H42B 4Q27A 3R6SA 3BKZA 2ZGMA 3UJQA 2AZ5A 5LZ6A 3OOXA 3WQ0A 2OZ6A 1ACCA 4LE3A 1QJU3 1VBB1 1QNWA 4QU1A 5F5CA 4C1WA 2G1MA 2ADDA 2W92A 3DUIA 1XE0A 1VP6A 1XU1A 3FHAA 3KVBA 3AXDA 1FNYA 1IG3A 3EHKA 3VZMA 5J7MA 1UYZA 5IYYA 4A7ZA 3SH4A 2NPIA 4AFMA 5CA6A 2WN3A 4QD2A 1MQTA 3ACIA 5BUVA 3LZZA 4DIQA 2FQPA 2J1VA 3B9IA 4E8CA 5K0UC 2K46A 3WINE 4GJZA 3DF0A 5FZGA 2ZGQA 3WF4A 5BNPB 4WVWA 1BEV1 5C8CA 3IB3A 1RUD1 2JIJA 2OQ7A 3U10A 4JHZA 4QHBA 3K2OA 4XPVA 5HXMA 2QQWA 4R9AA 4XFAA 3TAYA 4YGDA 4JC1A 3HD8B 2OW4A 3T2PA 1PNFA 1C28A 4NMIA 1QIQA 5AFBA 3AJYA 1NUKA 1EPWA 5K9YA 3CJXA 2OYZA 3H8OA 1O91A 5T3NA 4UYBA 1QJX2 1PGW2 1IS6A 1W6QB 1V9U1 3AKTA 4NE9A 1YQ5A 3QBQA 4B1LA 1RUI1 3KWVA 3L2YA 5FZ4A 4CCNA 2BQPA 1RGSA 4XCBA 4Z1VA 1W6OB 5I93A 2HBUA 2XJVA 2X8KA 2GC1A 3IDBB 3MF9A 1R082 4Y22A 5T5JA 3CL1A 3B02A 2VY0A 4V1PA 5C9AC 2ZJCA 2UY8A 2VH9A 4XQDA 5F32A 1IPKA 2ZMKA 3MGUA 1TME1 2ZGUA 4C91A 1US2A 3ZX7A 3I3QA 3P3PA 1CAUB 3V65A 4FAHA 1QQP3 1YXWA 1C4RA 3HNYM 3C7OA 2YB7A 4LBQA 4Q4V2 1CJPA 4AFBA 1JYNA 1RUH2 4LKSA 2PYTA 1YFWA 2BOJA 3CBNA 3MIBA 4GWJA 2QTWB 3TN91 4D69A 3O1VA 1NZCA 4JDOA 4IQPA 3R4SA 2OUHA 3W5MA 1WMXA 4QDSA 1A8MA 2V5DA 5AC93 4Z82A 1LENA 4NUBA 1AYM3 3KT1A 2PHFA 2W52A 5HCAA 1D2QA 2JG8A 3PDQA 2VVDA 5GZCA 1ZA7A 4TZDA 5E16A 4P9YA 4YVWB 1R1A2 5I0UA 1W90A 4H3WA 4BQ3A 2EIEA 3N7JA 2GMEA 1NCQB 4TWTA 5G05L 3E5QA 5FYUA 4LUKA 2IFRA 2K9ZA 4XJWA 4RGGA 3KT4A 3T2OA 4UI9L 4MXVA 1AJOA 1IS5A 1YQ6A 1OQ1A 4IUGA 3VDDC 1FOD3 1RXGA 1W2UA 2V5YA 3O1UA 5KXCA 3KCYA 2LALA 3RI9A 1ENRA 2BGPA 1W2OA 4E9KA 1GV9A 2QQKA 1EY2A 4IGPA 4XEZA 3FUQA 1S2EA 3GZTB 5J98B 2UY9A 1T2XA 2ZGSA 2NLRA 1LOGA 4GD4A 3LPGA 5F5IA 3WDWA 4YGCA 4ITCA 1H2LA 4AFAA 4ZXEA 4PQQA 3SNMA 2WQ8A 2VZOA 1WKYA 1O6UA 1QF3A 2RR12 4FPFA 4RS5B 4LO7A 3U0ZA 4XACA 3K75B 3BN6A 4L2NA 1YFXA 4CCJA 4G9SB 1GQGA 2HYXA 1ULPA 2WNVA 4LUMA 5CAZA 2NM1A 3ZKUA 4PI0A 1W8TA 2WFPA 1BHGA 1PGSA 2BZDA 4XF3A 5DPNA 3NWKA 2C9AA 5F5QA 3GBGA 1PZ9A 3GZEA 5IVEA 2A7AA 4IEVA 4X8NA 5FP3A 2JKXA 4AFDA 4A42A 3T0BA 2CYFA 2WQZC 4AAPA 1H2KA 2X5IB 1I9RA 4XZPA 4P5HA 1CAUA 5FP9A 1YNAA 3VUOA 3P6BA 4UW6A 1GP5A 5JMOA 2PLV2 4ZU5A 2VMFA 3DECA 4Q4V1 1RUH1 5T5OA 2A3XA 3WF3A 4CU9A 4OQ8A 4WZCA 1UYYA 4CCMA 3ZXKA 4D8MA 4LKDA 1HRI3 1ULEA 3ZN6B 1W03A 1IOAA 4YW4A 1H6YA 1LECA 5F2WA 1V6JA 1F9KA 5D21A 2XPJA 1NE4A 2NN8A 1WWYA 1J58A 2YUEA 3FL7A 3I3BA 4OUMA 1F31A 3ZYRA 5ABJC 1W2TA 3LAGA 3Q9OA 5KBFA 2P6HA 5FPXA 5J48A 3WCSA 3ETPA 1LHNA 2D97A 4HK8A 2IXJA 1RUE2 2XOMA 3M3EA 4PI2A 1CD3G 4YVWA 3WR0A 1R1A1 4BQWA 4LK7A 1NCQA 3WX5A 4AG4A 2JDUA 2VZ3A 5BNNB 1DQ0A 3KV6A 1DP0A 2E53A 4QM9A 1ZA4A 4OMDA 1Q8VA 2VZSA 3H8UA 4P9JA 3KQ4B 3ES4A 5CU1A 1CVNA 2VZPA 4AEKA 4ES9A 4GKXA 2WO1A 4PT6A 1Q8OA 5LATA 2G9ZA 5EJ3A 5IFTA 2VBPA 4WM7B 5FPAA 5C9AA 1GNZA 2CGOA 2DURA 1O4TA 1COV3 3FMGA 4HG6B 4ZXKA 3SCFA 4MGKE 3K4AA 4CDXB 5LA0A 1STMA 4AAXA 2W68A 2Y6GA 1RTVA 4HFSA 3ZIWA 4B1MA 4XQWA 5A3OA 2P3IA 4JTNA 4IW3A 5FJKA 3S5QA 3TEWA 1POQA 3A4UA 3LIHA 5KWRA 1UZWA 1HXS3 2IZWA 3G6JB 4FP2A 2XLGA 2PHDA 1AL0G 3M7AA 2SBAA 5A7WB 1QXRA 3WXPA 1Y9MA 2RR11 1Y3TA 1E5IA 5FYIA 1KD7A 4EE2A 3A22A 4YSFA 4CDQC 3VBHB 1NCRB 3J7HA 1APNA 4MOAA 4NOTA 4DS0A 4XZUG 1W04A 3AVRA 1A8DA 4BISA 2YDEA 2CDPA 4AR2A 2VZTA 3SCGA 3HQXA 3I59B 4IEQA 3VHPA 2PN5A 4BHPA 1ZVFA 2R1BA 3CF6E 1ZZCA 3MV01 1MEC3 4EWDA 3AKPA 4LJHA 4YG0A 3LA7A 1V70A 1PM4A 4C90A 1SBEA 2D3SA 2ZGRA 4CXXA 2YV8A 3DV8A 4ES8A 5I0DA 4N7IA 1WCQA 2VMGA 3OBTA 3E6CC 4QQ2A 2D3PA 4P9LA 2X5IA 4K7JA 4HOOA 3KV5A 1A78A 1GICA 3MZHA 3OUIA 4QB1A 1RUJ3 2RMU3 1ODNA 3C2UA 3SH5A 4Z8BA 3VDDA 1W9SA 1W6MB 2PTMA 1W3XA 2HEYF 2K0GA 4EZHA 1C5IA 4S2HA 4Y33A 3I7DA 3O14A 4FTEA 1WA6X 2I07B 1ZRCA 1UU4A 2DF7A 4QPGB 3IBMA 3PVEA 2XONA 1MS9A 4UW5A 3SKJE 3ZXEA 5FOBB 3ZN6A 1CESA 1SFPA 2ZAAA 2PHWA 3ATGA 2RG4A 3RZHA 2W2IA 2FDGA 1AX0A 4K20A 4ZS3A 1FATA 3LDKA 4C0HA 5GJ6A 2ZKLA 5F5AA 2DWRA 5JZGC 5JCTA 5L9RA 1YO8A 2P5BA 4M01A 1W8HA 4RQPB 3SC7X 3W59A 3ZN4A 2PAEA 3AMHA 2Q1MA 2RS12 2GMPA 2XQXA 5IUQA 1JH5A 4LOTA 2E63A 3HBZA 4H7LA 1RUE1 1NQJA 2VBBA 2VPVA 3FWEA 1PK6B 5BNNA 3J8F3 1OH4A 1OLMA 1UZZA 3UYJA 4BLJA 1N47A 4XTPA 4FFIA 3W5NA 2MNGA 4R4ZA 1AXYA 3B7MA 2BJSA 4DEVA 4HL0A 2FDFA 3WG4A 2R042 1PVC3 3RYPA 5HCHA 1COV2 3RSJA 5BNOB 3Q8EA 2RS53 4YPJA 3NMBA 2GMMA 2Q0AA 4PDWB 3HOBA 5FMOS 1OXCA 4ZU7A 3K46A 3LQCA 4CDXA 4XBQA 5JOWA 4ZU4A 3POGA 4FQ4A 4CUCA 5FBZA 3ZFEB 4FOYA 1O8PA 4L8QA 4FXKB 4XETA 2BVBA 1Q8PA 2RS31 4UFJA 2PELA 4JTOA 2DU1A 2ZKNA 3KCXA 1B09A 1HJFA 3AL6A 5FYZA 1TG7A 2FCTA 1SHWB 2JDYA 4GJYA 4MHUA 4N53B 5A7WA 4LO6B 2A6XA 5DG2A 4EWEA 5JDBA 4XFFA 5LBCA 5L7OC 5C7GA 5IK8A 1BMV1 3DYPA 2QQJA 3M3CA 3U1XA 1BK1A 1ALYA 4K8RB 2VVEA 4BQ4A 5IVCA 1PMIA 2XHNA 1MEC2 4RL7A 5ABJA 3AB0A 3K4DA 3I59A 1F8VA 1PO13 4F3JA 1DLLA 1O5LA 3DYOA 2RV9A 1U12A 2VBDA 4I02A 4KGGA 4XTMA 5FXWA 3ZFFB 4OI2A 1TEIA 2PHXA 3OGSA 3VDCA 1WZXA 1UMHA 3ECQA 1ZBA3 4M3CE 4Q1PA 5A6QA 3ZSLA 3C7EA 4XF9A 3OYWB 1QU0A 5EWSA 2HWF3 4AEDB 3ZXAC 5J36A 2F4PA 4LXLA 2WO2A 5FZEA 2Y0IA 3ILFA 5JXGA 3S0MA 5E89A 2WYFA 4DQAA 3MI8A 1RIRA 1UMIA 3FBYA 2D40A 3KV4A 1GFF2 1MR5A 1OOPB 2WS91 4JDNA 3L2HA 4MV2A 4BZ4A 1NA1B 1YJLA 3E1F1 2NZ9A 4N43B 2GC0A 1GNHA 3IDAA 3GHMA 4QPGA 3AKSA 4EYUA 1AR63 5C5UA 3LSDA 2XBO2 4CRQA 4XF1A 1LODA 1C57A 1TE1B 1GQHA 5D1IA 4LO4B 5HBAA 1UU5A 1RUC2 5CFCC 4RR3B 4ZONA 5CEHA 2XG3A 1IKPA 3GGLA 5FMDA 4J1XA 2VW2A 4FFHA 1PM7A 1UL9A 2EAAA 2WR9A 3APBA 4BE3A 4CCDA 3VBSC 4QGNA 2RS11 3MUY1 2JICA 4IEWA 2QQLA 1W0OA 2R32A 4UFHA 3VHRA 4XILA 2VGDA 2FCUA 1PK6A 1T6BX 2D6KA 5HPOA 1XB9A 1S4CA 4NPLA 1U5IA 3AZZA 3DYMA 1MZEA 3MHZA 4KQ7A 1UOFA 5FYTA 5I91A 4I2OA 4AQSA 4R9BA 2WUHA 2WWJA 3FN9A 4NO4A 1QH6A 4FAGA 1DZTA 4XOGA 5DZEA 3IKWA 4Y5TA 1QGLA 2H0VA 1W2AX 4FVVA 2WO7A 4QPIB 1ASJ3 5F2SA 3VV1A 1SLAA 2ZMNA 5FKCA 3HBKA 2Y6FA 4DUWA 2IWGB 3PU8A 5C4WB 2W1UA 3ZR6A 4R4XA 4FQZA 1LGNA 2O1QA 3GXUA 4JZRA 3J26N 5D8AB 4Z07A 5F3EA 3VKLA 4AE2A 4ZHNA 3ZYPA 3ZFEA 5FZDA 5K0UB 1S2BA 3IN9A 2EIBA 4FFFA 5EHDA 3POYA 4CEWB 4ATFA 2B45X 1XPWA 1H8TC 3MV11 1FYUA 3BTYA 5A3LA 2V09A 1WCUA 2VXJA 4N53A 2HWB2 3J4UH 2Y6LA 2OIIA 5CKNA 3VHNA 1URXA 4RD7A 5A70A 4GALA 1I1EA 2P3YA 1IPJA 3B69A 2DCTA 4PF1A 3VHOA 4HKWA 2ZBJA 3WVJA 5DUUA 1VBB3 1GP6A 2FHRA 4UFKA 3FX3A 3NJXA 4PQ9A 2B8MA 4OUSA 1X36A 5FAXA 5JZGA 2QQPA 4AHWA 3EB7A 3THPA 3FE5A 5JAXA 3D4KA 4XF4A 1GQPA 1O59A 2WWSA 4J25A 4FPGA 4IE0A 5CBLA 4QU2A 3CHXA 1RHI2 2ES3A 5FLJA 4JGYB 2QBXA 1A34A 2QNKA 2UU8A 1R092 2P1BA 4L11A 1AYN2 1K5MC 2ZEZA 2GDFA 3DCQA 1D0HA 1LHWA 1O4YA 1RVF2 2E51A 4GWMA 1L7RA 5BNQA 4NIGA 1OPOA 2Y8KA 3POWA 1WW7A 1ZM1A 3ACGA 3EO6A 4IE4A 1BEV3 5IW0A 2Y34A 4PLMA 3LKJA 1RUD3 4NWVA 3ZSEA 3BPZA 5FWJA 3PMEA 2V72A 2ZHNA 2ARXA 1OBNA 1ND3C 1OOPA 3CU7A 1JUIA 1W6NB 2G19A 3MW3A 1OVSA 1W0NA 1OC1A 3OB8A 4NIAA 1SDWA 5EP9A 4BB3A 1S0CA 1F5JA 1REFA 1PMJX 3VZKA 1TQ5A 4YW2A 3LOBA 4K8FA 3N9QA 2XBO1 5LB6A 4ATEA 2JDNA 1V9U3 4WV8A 1DFQA 4KG0A 1RUI3 3ABZA 2QE3A 1CIYA 2HWD2 2JECA 1RUC1 3QCWA 4META 5FKBA 3THDA 3FC0A 3NV1A 4DFSA 5L19A 4O61A 3QOPA 3AP7A 3UK9A 1WW4A 5L7OA 4DO0A 1D4VB 1Z0HA 5FRAA 5IT6A 2RDSA 3NW4A 4J6GA 1ZYBA 4LIUA 4QX7A 5FY1A 1IQAA 2OT7A 1TME3 1AXKA 3AZVA 2J1UA 3ES1A 1DQ5A 4BYYA 4XDQA 2R073 1A3KA 1S1AA 5F9TA 4RGKA 3LEGA 3CJIA 2W47A 4YGEA 2A70A 2BV4A 3OGGA 3LF7A 5CKMA 3TBDA 3E5XA 3I3DA 2WFF1 3BOWA 3VD3A 2A6WA 3TN93 1VIWB 3VZOA 2YPJA 1AL22 1ST8A 1JMUB 3N36A 3WDVA 4ZKTB 1CR7A 4UF0B 2VTXJ 4M4PA 3SXWA 1CAVB 5ERLA 1PGL1 4YLZA 5C4WA 3JQXA 3LIGA 2VOKA 5C3QA 4MX3A 1GWMA 5K0UA 4CP9A 1N1SA 2BU9A 3S57A 4LORA 1VR3A 3WQBA 4Y3OA 2WDBA 3DEMA 1QOTA 5FYMA 5FPBA 2Q8DA 1HIXA 3ZYFA 2HWB1 2JG9C 2RJLA 3I97A 3I4IA 4INDA 1UIKA 4XFBA 3O0XA 3SQOA 3RS6A 2WZEA 5CFCA 3O5SA 5LBEA 1IQDC 4D6RA 3ELNA 3I3MA 4M3CB 2B9UA 3E6DA 3THCA 1GP4A 3VBOC 4QX8A 1SLLA 1PZ8A 4HBNA 2CGPA 2QQOA 1JYIA 5FLHA 4CEYC 3CKHA 1IG0A 5C3OA 4LMFA 1LOBA 1MQTB 1ZNPA 2BFUS 1NKGA 1RHI1 3PVOA 4IGQA 1TNFA 1I6XA 3WF0A 2EF6A 5KHIA 3ITQA 1ENQA 1AYN1 1BEV2 1X9PA 1E57A 5A1LA 5C8CB 1CWPA 1RVF1 3I3EA 2VUDA 5HCBA 4B3NA 3NV3A 2Q5TA 3PNAA 1JYCA 4F8AA 2WRAA 3OPZA 5FXXA 5C8WA 1BLZA 1H2NA 3RNSA 4BK4A 3MUZ1 2YC2A 2I2SA 1CAXA 3GBWA 2NMOA 4AVAA 4Q5OA 5A1AA 1IS4A 3C3VA 5K8SA 1V9U2 1AUYA 1VRBA 1QJX3 2Y38A 4IEOA 2RJ2A 3VBUB 1WBFA 1NAEA 4HANA 1JYTA 3DXTA 3WDYA 4KH9A 2HWD1 4EV0A 1MVEA 5F6KA 1FV3A 3C8XA 3ETQA 4UFLA 3O1TA 3AX4A 3I54A 1YIPA 3P1IA 3ZYGA 5FZOA 2Q30A 2BYVE 1IKQA 5FZIA 5GALA 5CVRA 1XYPA 5H9RA 1S0EA 4GAZA 3U4SA 2ZGNA 1RUNA 3BTZA 4R8HA 2AYHA 1AR82 2VOWA 1OFNA 1EUTA 5DAWA 1U5ZA 2VL4A 2WNUC 4QPWA 4GULA 5KC5A 4LT5A 2P3JA 1G8WA 2IVIB 3ENRA 4Q4V3 1BQPA 3KV9A 1RUH3 4OHYA 1ZRFA 3LFMA 1AL21 4UF0A 2QFEA 4Q0UA 3N3HA 5LK7B 2P6CA 4ASLA 3BPSA 2D5FA 1HQWA 5EJZB 4DXTA 3AL5A 1ULDA 3T2QA 1ND3A 2JG8B 1UOJA 3KD4A 4AEJA 3HN3A 1Z78A 1TNRA 1BK0A 5FY4A 1XJAA 2V4AA 5A3PA 5KXEA 1HB2A 2RDNA 2HLEA 5FUNA 2IUWA 4NHXA 1AR92 1R1A3 3OJBA 2GNMA 5FY7A 1VALA 2ERFA 2VNRA 2VXRA 4AF9A 3ZYHA 4NIHA 5IJRA 2D93A 1J3RA 2LM3A 4M3CA 4E2QA 2DYCA 5B4NA 2MEV2 5A7OA 2WQ4A 5DAVA 1OLME 3ACHA 3HEIA 3SEEA 2B7YA 2R062 4R9CA 4S2FA 3WP5A 3NJZA 4QX5A 3S7EA 3ZDVA 4ZZ5A 1XSRA 4RSUA 2P37A 3WT3A 2N7GA 4EROA 2CSGA 5ISLA 4D6QA 1N1VA 2J1RA 4TLGA 4A3XA 3AYCA 2VMDA 1XYNA 5KHHA 4BXSV 1VBE2 4FOQA 5DMYA 2BRTA 3A0KA 1Q5OA 1SDDB 4I0WB 3J7LA 4M0NA 1SEFA 1JS9A 3O1PA 3O7OA 4KNCA 4COVA 2RR13 3FFQA 4CU7A 1RITA 1M06G 1W8UA 4XFIA 2YGMA 4B7EA 2WNVB 3JCIA 2E7TA 5AFEA 2UYAA 3MF6A 1QDCA 3VB9A 4JAAA 1B35C 2JE7A 3VBUA 3N35A 1Q3EA 4MGSA 4GWNA 1ZZ8A 4N9IA 2JE8A 3LE0A 1Q43A 4K21A 1DU3D 5FMOL 2AREA 1RMU2 3ZXDA 2XVGA 2JG9A 3WNOA 1QHDA 4AFCA 1JODA 5SV5A 3BI3A 2ILMA 4L97A 1WMEA 2ZEYA 3CO2A 3L9JT 3NNLA 4QGLA 1AVBA 4AK3A 3VD9A 3TEXA 4XURA 3KT7A 2AH2A 5FZ3A 1OHFA 3ZN5A 4AI2A 1AR81 4YM3A 1W28A 1F2NA 4Y24A 4CE8A 1W39A 4ISQA 3ALQA 3FBMA 5E88A 1ZRIA 2PLV3 2R30A 3VDAA 1SPPA 4IE6A 1UN1A 4Y20A 2X09A 2ZOEB 2X05A 4XCAA 4FT8A 3ZXJA 4EN0A 5JSPA 1OLRA 4XDPA 2XJSA 2EICA 3BTAA 2CDOA 5I8YA 5J3UA 1U0AA 1Z7S2 2D6LX 5HV0A 2C24A 1EP0A 2B39A 2J1SA 5DZGA 2AEZA 1LNSA 2VUJA 3JD72 2Q8EA 3RZMA 3S5AA 4WZFA 2VNOA 2X29A 2XJPA 4MLOA 2ZGOA 2W87A 4FCAA 5CZKA 5EYYA 1VLNA 4D7SA 3OD4A 5LBBA 5BV6A 1G9AA 2XVKA 3B01A 4LHSA 1DQ4A 1RUE3 2YBPA 4O9EA 2ZGTA 5EQUA 1AR91 1KXGA 4RA0A 4HETA 2Z69A 5FV3A 5A7SA 5B2GB 5DAXA 4E2GA 2WC2A 3LCPA 2ZHMA 3G7DA 4YVSC 3CMGA 5GLVA 5C9AB 4XJ8A 2B42B 2CL2A 2MEV1 1JTZX 4JQRA 4YYOA 1GBGA 4BCUA 3O0WA 3LDBA 4XUNA 4LTAA 1YCIA 3PIJA 1SBDA 2A6VA 1YIFA 1RJ8A 2R061 2UURA 1YHFA 2VM9A 2Z42A 3D3AA 4IETA 3WW2A 3ZSKA 4YW3A 4HMZA 1CONA 1NQDA 1OA3A 3NRUA 3OSDA 1AHSA 1DIWA 2YBKA 4JGZC 4JX0A 4YG3A 4GH4C 5CB7A 1VE0A 1DCSA 5CKQA 2VW0A 1YI7A 1H30A 1VBE1 3N9MA 4RFT0 1UKRA 2RS33 3ZPYA 2DVFA 2O14A 4FP3A 4QXCA 2ZHKA 3NJVA 2WBKA 4DRVA 4H55A 2Y60A 1YRZA 3S7IA 4DNYA 2ZEWA 3OPTA 3RZZA 2ENRA 1LEMA 1VB4A 5LW9A 5FCCA 3OY8A 1R64A 4LQRA 4XFCA 4C8DA 1WW6A 2WZR2 2GP3A 4K9SA 4XMIA 5A3WA 4Z2AA 3GYDA 1LESA 1FI2A 5FOJB 1OD3A 4ISRA 2VO5A 4MO3M 4CUBA 2E26A 1RMU1 3CZUA 5G04L 3RFRA 1N1TA 2X53S 1BBT2 2ZAHA 5C33A 1JZ7A 5C3RA 4OZXA 3HQRA 5A3MA 2W9XA 3SEPA 3UESA 5LA1A 3IIAA 1OA4A 5CNAA 1VBD2 3NKGA 3ZYIB 4K40A 5FZ0A 3VDDB 2C0ZA 5A32B 1VJ2A 4DXZA 3HN1A 4OQ9A 4ZZ8A 3A0NA 1PX4A 4N8MA 2Y6JA 3KGZA 2VUCA 1U5XA 4XHBA 1SLBA 4LBOA 2ZCWA 2QQVA 5HXVA 4DB5A 5JIUA 3QH7A 4YM2A 2OZJA 4CZSA 5FP7A 2O8QA 1REDA 1WMFA 3K4ZA 1SLIA 4NHLA 5ANQA 4GA9A 5FXZA 3ST7A 2HWC2 4K6BA 3MLKA 1S55A 1HB1A 1G7YA 1Z7S1 4JCKA 4OHVA 4DUXA 2JJ6A 5LEKA 3JD71 3WUDA 1GYKA 4PF5A 3PTRB 1HDKA 5I0SA 2H0BA 3HWJA 5FYHA 2RS13 1EV12 1V00A 4NAOA 3ILNA 1UO9A 4ONUA 3UV9A 3N9NA 4CSWA 5C6CA 5ACA1 4OI0A 4DRRA 5LA2A 2J1TA 4TXWA 3RPQA 3ZVXA 3P5BA 4MZUA 1HB3A 1MS4A 2P17A 4IEUA 1JI6A 1XE8A 4CUGA 5GLUA 2R043 2XHKA 4XIOA 1POV1 5JR7B 4FFGA 4CCOA 5ACA3 1ZX5A 4OMCA 4AYUA 1CIWA 1RB8G 4MXWA 2TNFA 4CDWC 3ME2A 1I3HA 1NY71 3KS7A 2IC1A 2B46X 1I5PA 1QJU1 4Q8LA 3M4FA 4B4RA 2D43A 4Q0SA 3IAPA 1KS5A 1UOGA 1VMJA 1YQCA 2RS32 3RWNA 3WSOA 5IFPA 1OF4A 3WF1A 4AL9A 3B93A 4YZ3A 4IERA 4E2SA 2HEVF 3TWIA 2D6OX 1V6OA 3IDEA 5DN2A 2JE9A 2QDRA 4R52A 4YW6A 1ZZ9A 5FZMA 2ORZA 1AJKA 1FT9A 2V73A 5J37A 2CWMA 4JRLA 4NPRA 3JZVA 3SHRA 3MEPA 2I74A 1S0FA 5ABJB 1SZBA 2SLIA 4ZPIA 4AI3A 2FDKA 2XWJB 2WZR1 3MO4A 5EIYB 3WW1A 4FPYA 2FZ1A 4KWLA 5T5PA 4HPKA 2Z4FA 2EXJA 2GC2A 4QDQA 4EN8B 3VD4A 3V0AA 2DUQA 5IAVA 3TYJA 1XE7A 2W39A 5FXVA 1CAWB 1BBT1 2G9FA 4Q4X1 2WWUA 3T09A 1LU1A 1DQ6A 2VOVA 2XJTA 2B5HA 2K2SA 3UNPA 2ARAA 1WD3A 4CP0A 3HT2A 4O9GA 4FOVA 4YVSA 1J1LA 2PMWB 1VBD1 2KA3A 4R9DA 2VG9A 3VKOA 5A32A 1Q56A 3PLQA 1O5UA 1OQDA 4GXLA 4Y1ZA 4QT6A 2WS92 1BVP1 3WDUA 4AVTA 5FDBA 3GBFA 2RVAA 5CFDA 1CZTA 2A6ZA 4JGZA 3KF5A 1DG6A 1HJGA 2QQIA 4NHYA 4OHXA 1MS1A 3AMMA 3DKQA 2Q1FA 3MLJA 2VOXA 3H7JA 2ZGKA 3NNGA 4DUVA 3O1OA 1J3PA 2MHFA 2XBO3 1Q8SA 4AGRA 2QKDA 2PHUA 3BVCA 2HWC1 4HVOA 1RUC3 2BFUL 2VZ1A 2VULA 4CDQB 2F4LA 2KM2A 4YARA 1W8NA 4CXWA 3EYPA 4M3CF 2VZQA 3OUHA 4JDMA 4C1XA 2NYYA 1EV11 4LHNA 3CDZB 4MVTA 3A7QA 3WNPA 3VZNA 5DUVA 1UY0A 2NMNA 1UX7A 5I8TA 4XC9A 5ACA2 2CWSA 4KI5M 5KC6A 4V2WA 4FI9A 2HYKA 4XUPA 1K3IA 2GU9A 2PHRA 3TNQA 3WNLA 2WFF3 3S6PA 4UBGA 5AVPA 3R0RA 4BU2A 2DFBA 1VBA1 4LITA 4O7XA 2CGNA 3I2GA 1DDLA 4CDUC 3ZFFC 2VZRA 4YZ5A 1OQEA 1TVGA 4OLLA 1W0PA 3E6BA 2D98A 3AZYA 4LBLA 2DTWA 2BNNA 1UQXA 4LKEA 4UAPA 5CG9A 1HRV2 4IV3C 4AEDC 3BUCA 3OD0A 3BU7A 3TEYA 1RUF2 4JHTA 5DUXA 2JX9A 4HT1T 4KU8A 4BOWA 3RDIA 5HI0A 3D8CA 4HSLA 2CU5A 2HWB3 4S2DA 1O3RA 2D44A 5T5LA 1NA1C 1QY4A 3FZ3A 5LWBA 4N43C 5JZGB 1CGPA 3PVBB 1SQ4A 3KCCA 3ZYJB 5IVFA 3IT8A 5LASA 4D7TA 3AYAA 4NR1A 2YGLA 1LHUA 2VE1A 5F37A 5LY2A 1RHI3 1D4M1 2BERA 2MPFA 1CAWA 1KQRA 3HAGA 3ZMNA 4AW7A 4K3UA 1QXPA 2YHJA 4MSVA 5DDJ2 5JXIA 1R093 1QKQA 2JD4A 1PVXA 1AYN3 4LO8A 2WYSA 1V6KA 3I2KA 1IGOA 5FZ7A 1OI6A 2OXBA 3RVHA 5F7UA 1RVF3 3ZXGA 5IVVA 4GWIA 2CAVA 4DXRA 3GZUC 4BIOA 2W1SA 2XDVA 1FV2A 4HLTA 4CDWA 4YFZA 4PIXA 4UFMA 2VCCA 1NLQA 4QPYA 3HT1A 3P3NA 2BWCA 4PIYA 1QWRA 1ND2C 2XH6A 3AFGA 3K51A 4CU6A 3JBG1 5K7PA 5E1RA 2W95A 3BCWA 2YY1A 3PIGA 1HW5A 3M3QA 1RC6A 2HWD3 2LUWA 3H1MA 4PHZA 3MYXA 5L7OB 4CDQA 3OEBA 3DPRC 1ZZ7A 5E8AA 5IK5A 4PLOA 4Q4W2 3DGTA 5GLWA 1EAH2 4RHV2 4BQXA 1XNTA 4V2VA 4TYSA 1XOYA 3CLPA 1UKGA 1TMF2 3I49A 3FHIB 3WHUA 1JXNA 4QKBA 5A6XA 2D6NA 4AI8A 4CUAA 1UOBA 3CJIB 2WFF2 3ZFGC 1SLTA 2JWPA 5JVVA 5FIXA 2JDPA 2ZABA 2VNVA 1MS0A 1L7QA 3HNBM 1H1AA 3LPFA 4XJZA 2VUAA 3NNFA 3U75A 1PGL2 3WV6A 4CP1A 3K48A 3LOIA 3J7MA 1AL23 3OBZA 4G3YC 4YGBA 3LB9A 3WNKA 3DL3A 5FY8A 4I30A 2AENA 5IK4A 3B00A 2VCMA 2QZ2A 4QB2A 4CP9B 2D7FA 2RHPA 2GALA 1ZZ6A 3V0BA 5KHJA 3PJQA 2A6YA 4IV1C 3URFA 2J42A 4B7KA 3N4MA 1HRV1
chains in the Genus database with same CATH topology
4CPBD 1W8UA 4LKFA 2O14A 1V0AA 1OH3A 3UT0A 4CP9A 1GWLA 2JWPA 4LK7A 4AL9A 1WMXA 3ZYFA 1OKOA 1GWKA 2LROA 2K46A 1W8WA 1UOJA 1WZXA 2LRPA 1HN0A 1W8ZA 1W8TA 4LKEA 1W9FA 4YW6A 4LKDA 4BQ2A 1L7LA 2C24A 2KR2A 4YW7A 3F95A 3ORJA 4CPBA 4A6SA 4LK6A 5D21A 4CP9B 2WYFA 4YWAA 3ZYHA 1W90A 4BQ3A 3ZYBA 4LJHA 1GWMA 1WCUA 4BQ5A 2VXJA 4BQ4A 2Q1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CPB D;  1W8U A;  4LKF A;  2O14 A;  1V0A A;  1OH3 A;  3UT0 A;  4CP9 A;  1GWL A;  2JWP A;  4LK7 A;  4AL9 A;  1WMX A;  3ZYF A;  1OKO A;  1GWK A;  2LRO A;  2K46 A;  1W8W A;  1UOJ A;  1WZX A;  2LRP A;  1HN0 A;  1W8Z A;  1W8T A;  4LKE A;  1W9F A;  4YW6 A;  4LKD A;  4BQ2 A;  1L7L A;  2C24 A;  2KR2 A;  4YW7 A;  3F95 A;  3ORJ A;  4CPB A;  4A6S A;  4LK6 A;  5D21 A;  4CP9 B;  2WYF A;  4YWA A;  3ZYH A;  1W90 A;  4BQ3 A;  3ZYB A;  4LJH A;  1GWM A;  1WCU A;  4BQ5 A;  2VXJ A;  4BQ4 A;  2Q1F A; 
#chains in the Genus database with same CATH topology
 1S0I A;  1RUF 1;  2XWB B;  3H3U A;  3OCP A;  2QDN A;  3JU9 A;  5FPZ A;  1QMJ A;  3KHB A;  4BQ1 A;  3T0D A;  4IL7 A;  2BWA A;  5JLV A;  4W6Y A;  4PLN A;  1UY1 A;  5CFC B;  1AZD A;  3EMR A;  4LBN A;  5DAP A;  5GM0 A;  2JDK A;  2JDM A;  1S0D A;  3AMQ A;  3LEK A;  2O0O A;  4Q4Y 1;  4QQH A;  3AFK A;  4A41 A;  4AVS A;  2AR6 A;  2WNO A;  4YM0 A;  3RQ0 A;  3VBS B;  2HWE 2;  2ZX4 A;  3CZJ A;  3ILR A;  4QX0 A;  3K77 A;  4MGY E;  4XJA A;  4LO5 B;  4A6S A;  4BQY A;  4M00 A;  1D7P M;  1LAJ A;  1OVP A;  1JZ5 A;  5FZA A;  5A6Z A;  3ON7 A;  1GZT A;  1W05 A;  4CCE A;  3QAC A;  2ETE A;  3IMN A;  2XJU A;  1HQN A;  1T6G C;  3VBR C;  3DN7 A;  3H3Z A;  5DDJ 1;  4GB3 1;  4A44 A;  4XHX A;  2XQR A;  2VEC A;  1UU6 A;  1CQ9 A;  2D6P A;  1N3O A;  5IWF A;  3RRD A;  3RGB A;  3WCR A;  1CAX B;  2LRO A;  2XVL A;  3ZPO A;  4IEY A;  2DUO A;  4FO9 A;  2XML A;  3T1M A;  4BK5 A;  1GUI A;  5A80 A;  1G9C A;  1TZO A;  5JPN B;  4SBV A;  2FDJ A;  4Y1U A;  5FYB A;  3BIE A;  3ZR5 A;  3MIC A;  1GZW B;  1H8T B;  1WBL A;  4ZS2 A;  5L73 A;  2ZGL A;  3VBF C;  1DGW X;  3POI A;  2RMU 1;  1JOB A;  1HQL A;  1L3J A;  3INA A;  2BNO A;  3HPN A;  4P00 B;  3ACF A;  1FMD 2;  4NAM A;  2BDR A;  2F6B A;  3EJK A;  5FZO B;  1MAC A;  4EN9 B;  2F17 A;  4XQ4 A;  4Q4W 1;  1XXN A;  2VQA A;  4IE5 A;  1OF3 A;  1EAH 1;  3M3I A;  4RHV 1;  2VMH A;  2JIG A;  4XAE A;  5FO7 B;  4EN7 B;  1S0G A;  1CPN A;  4YZ1 A;  3B94 A;  2DTY A;  2EID A;  1TMF 1;  3T30 A;  5J09 A;  4L9B A;  2A3Y A;  3POJ A;  3RZL A;  3WNM A;  4TN7 A;  1AR8 3;  2JXA A;  3A23 A;  3WW4 A;  1LKN A;  1LGC A;  2VNG A;  2ZZQ A;  3PJY A;  3Q8C A;  4RGA A;  5I0R A;  2GAU A;  1O3T A;  4FTB A;  1UZV A;  1LED A;  1F15 A;  4E8D A;  3BU0 A;  2Z79 A;  4YNI A;  3AP4 A;  1MS8 A;  3WY6 A;  3LSE A;  1MZF A;  4JKL A;  2J7M A;  2W91 A;  4LHK A;  1RL3 A;  3H9A A;  2VVF A;  3KVA A;  1OLQ A;  1WW5 A;  5CIR A;  5GZG A;  3U4X A;  1JBC A;  4COW A;  5FR3 A;  1NLS A;  4IXL A;  1ND3 B;  1OD5 A;  3WG2 A;  1C3H A;  1VAM A;  1PVC 1;  4QXB A;  3QLQ A;  4U2A A;  1RUO A;  3MIH A;  3WDT A;  5C8C C;  4AHY A;  2RS5 1;  4A45 A;  5FP8 A;  2YBS A;  3WLU A;  1OUR A;  4I3G A;  5CAD A;  1ND2 A;  3UGF A;  1IS3 A;  2R0H A;  3KB5 A;  2JDA A;  3SCH A;  1L7L A;  5APA A;  3GJB A;  1AR9 3;  1GZ9 A;  2VMC A;  3NST A;  3O1R A;  2XLA A;  1JHJ A;  2LTN A;  4Y1X A;  4GMP 0;  4K1Y A;  1MPX A;  3VBS A;  3DPR A;  2OUJ A;  3AM2 A;  4ARX A;  2HWE 1;  2Q4S A;  1EUU A;  2MEV 3;  4WM8 C;  3IWZ A;  5K4L A;  1H4G A;  3M8L A;  2BBV A;  1LB2 A;  2R06 3;  3HJR A;  4LIV A;  5C3S A;  1UF2 C;  5TSW A;  4I09 A;  3NL1 A;  2H6B A;  3W9A A;  1WLW A;  3AXE A;  3AZX A;  3ZFG A;  4FBF A;  1UCX A;  3OBR A;  3U11 A;  2QVS B;  4RYD A;  4PBO A;  2ATF A;  3RJ2 X;  1VBE 3;  4QX3 A;  5FZH A;  1C8M 1;  1VAV A;  3AVS A;  3I2I A;  1K45 A;  4QQO A;  5LEJ A;  1WGP A;  5CG8 A;  1HV1 A;  1H4H A;  3USS A;  3NAP C;  4P9X A;  3QD6 A;  4QHO A;  3POE A;  1FPN 2;  2PAK A;  3H7Y A;  3JQW A;  4MH0 E;  2ZGP A;  1WCS A;  4IV1 A;  4EZ4 A;  2A71 A;  1GZW A;  1H8T A;  3A21 A;  3N9O A;  3IPV A;  4EWA A;  1OH3 A;  1QJY 2;  3FLR A;  4H2A A;  3RYR A;  2QQN A;  1JZ8 A;  2JG9 B;  5FPU A;  4OHW A;  1NXD 1;  1W8O A;  4AXO A;  1G6N A;  5A33 B;  1FMD 1;  1RMU 3;  4XUO A;  3WW3 A;  2RM2 2;  3UJO A;  1AR7 1;  4OI1 A;  3ZIX A;  3W21 A;  4GMP 1;  4M4R A;  1DF0 A;  1NXM A;  1CN1 A;  4JQT A;  2JB8 A;  4AZZ A;  4YZ4 A;  2J1E A;  4EN6 B;  4CEY B;  1DLC A;  2R7E B;  2DFC A;  4YWA A;  2XR4 A;  4QX2 A;  3JB4 C;  3KQR A;  1KJR A;  1SPP B;  5IK7 A;  4COZ A;  1ODM A;  1X8M A;  2GSY A;  2JEM A;  2JDH A;  4Y20 B;  3D6E A;  2E9Q A;  2AGS A;  1K5M A;  4QKF A;  5FPV A;  4CYD A;  4URA A;  1ZBE 2;  5JR2 A;  4HSJ A;  5FZL A;  3VBR A;  2C1F A;  5JWP A;  2VD7 A;  1GR3 A;  2AEY A;  3USU A;  3MPP G;  1DGR A;  2WAO A;  4X6R B;  3VL8 A;  4NII A;  3POS A;  3KZ4 C;  4Y5Z 0;  4AGG A;  4DZG A;  1EYB A;  2ID4 A;  3T1L A;  1Z7S 3;  4FTS A;  4QXK A;  1O3Q A;  2OVU A;  3JD7 3;  5BNP C;  1N3Q A;  5EFU A;  2QJV A;  5HCF A;  2Q8C A;  3U78 A;  3C7H A;  2W46 A;  4P9I A;  2QQM A;  4U36 A;  5FFO C;  2YU1 A;  4FPH A;  4IGO A;  2BBA A;  5FZ8 A;  2ZXQ A;  1PO2 2;  1VMF A;  4XVH A;  3N7L A;  3B5L B;  2WIN B;  5FYV A;  3ZMO A;  3W58 A;  4JRA A;  3T4V A;  4QGM A;  1SCS A;  4NRM A;  4NWW A;  1H9W A;  1GZC A;  2IXC A;  4ORF A;  2Y6H A;  3K3O A;  1X8E A;  3VKF C;  1KRI A;  4KBZ A;  3F2Z A;  3T08 A;  2ZX1 A;  1RUG 2;  2EIG A;  1J3Q A;  3MIG A;  1X9T A;  2WNU B;  4NPM A;  5JI7 A;  2GN3 A;  2BEO A;  3N7M A;  4I0A A;  2OPW A;  1IHM A;  1W3V A;  3O0V A;  2DDU A;  1W06 A;  1VBC 2;  1XNK A;  3GDB A;  4P08 A;  1F4A A;  1Y4W A;  2VOT A;  3NQH A;  5FUP A;  4HKL A;  3THT A;  4A3Z A;  5JI9 A;  5DUW A;  4GIQ A;  3CIH A;  3PMS A;  4OUL A;  4KL1 A;  1LU2 A;  4DIN B;  1VRH 2;  1DGW A;  1G9F A;  1BKZ A;  2ZX3 A;  3IMM A;  1W99 A;  5H9S A;  2FBE A;  2QUO A;  2C6S A;  3H1Y A;  2BPA 2;  3IM0 A;  2VC9 A;  2RDR A;  3OY8 B;  5IVY A;  3OUJ A;  4UFI A;  1FPN 1;  2DCK A;  5GZD A;  1E5R A;  3KHC A;  1GAN A;  4IEP A;  4B29 A;  2WSU A;  1NG0 A;  3I2H A;  1HN0 A;  4AGV A;  2WZR 3;  5A3T A;  2P34 A;  4DY5 A;  1QJY 1;  4DMI A;  1YUD A;  5A33 A;  4NRO A;  1QH7 A;  1KGY A;  2ZML A;  4D6S A;  2VCA A;  2RM2 1;  1BBT 3;  4BMB A;  4Q4X 3;  1ULF A;  2Y33 A;  4FPE A;  2BNM A;  1DYK A;  3VBO A;  3FHQ A;  3FFZ A;  4XF0 A;  4YVW C;  5GKA C;  3ZYB A;  5JOX A;  4Q2F A;  4OYU A;  5JIA A;  4CEY A;  3N9L A;  1NCQ C;  5J1X A;  3HNM A;  1VBD 3;  3M1H A;  5FZ6 A;  4Z2W A;  1QJF A;  3R4D B;  4WM8 A;  4A4A A;  1LOE A;  4PCR A;  5EXO A;  2VQU A;  3PUH A;  3RMY A;  1DQ2 A;  5T52 A;  4NRQ A;  1C8N A;  1NE6 A;  4AVV A;  2V4V A;  3JXS A;  1PIV 2;  1ZBE 1;  4DXS A;  1DHK B;  2VAU A;  5JOY A;  3OGV A;  2JD9 A;  2FDH A;  1XYO A;  2R07 1;  5IHR A;  1LUL A;  3B3Q E;  1C1F A;  4AI9 A;  2E33 A;  2AC1 A;  2HWC 3;  3RJR A;  1JYW A;  3MLL A;  2WL1 A;  1UZY A;  2EXK A;  2PHL A;  3NAP A;  1JW6 A;  4WBB A;  2XGX A;  2YXS A;  3RWK X;  1OKQ A;  3U07 A;  1EV1 3;  4RS5 C;  1B35 B;  1SFY A;  1NZI A;  1PO2 1;  1S0B A;  4P9G A;  4F7Z A;  2L9L A;  4W8J A;  1MVQ A;  5F3C A;  3Q8F A;  4WVM A;  5FLI A;  3LA2 A;  4KU7 A;  4Y4Y A;  4UWD A;  1RYY A;  1JOJ A;  4A6O A;  2HH9 A;  2WSV A;  1NY7 2;  1OPM A;  2HBT A;  4MXW B;  1VBA 3;  1W2N A;  5J96 B;  1QJU 2;  4BPZ A;  5BYN A;  5FMC A;  2EVX A;  1RUG 1;  2WNU A;  4L92 A;  3UL2 A;  2ARB A;  4D0Q A;  1BZW A;  4Q1R A;  4CA9 A;  3K3N A;  3HR9 A;  4OZO A;  2A73 B;  2OX0 A;  2D6M A;  2A75 A;  1LHO A;  4LNV A;  2ZA9 A;  3PVN A;  2X5I C;  5CIS A;  1VBC 1;  4W50 A;  3TNP B;  1O4Z A;  1Y9G A;  2WT2 A;  3WP3 A;  3H0O A;  1FXZ A;  1VRH 1;  4AVB A;  3LFI A;  1CJD A;  5A7N A;  4AQ6 A;  3WF2 A;  1LHV A;  4QKN A;  3WQ7 A;  1MS5 A;  1CX1 A;  2CNA A;  1AF9 A;  1QNY A;  1BMV 2;  1Y7B A;  3GM8 A;  5LA9 A;  1US3 A;  2XJQ A;  4PJY A;  4YW7 A;  2YZ4 A;  4XJU A;  1YI9 A;  3NV4 A;  4FPK A;  5C71 A;  4GZ9 A;  5FZ1 A;  5BNP A;  2TUN A;  3PU3 A;  4W4Z A;  3D0S A;  4HPK B;  3S30 A;  3V0A B;  3N9P A;  2C5D A;  1ENS A;  3NJY A;  3POF A;  4BJ0 A;  4Q4X 2;  3WP6 A;  4OUE A;  4SLI A;  4CPB D;  1POV 0;  1NX9 A;  1D4M 3;  3R05 A;  2O8O A;  2EA7 A;  4OVE A;  5EZW A;  1N3P A;  4BME A;  5FYS A;  1ULO A;  2R16 A;  3JB8 A;  3ASI A;  4YVS B;  1YYN A;  3H8X A;  1H2M A;  5IVJ A;  1W6Q A;  1QJX 1;  1GWK A;  2W0X A;  1PGW 1;  3FLT A;  4LA3 A;  4E4D X;  5BNN C;  3WUC A;  3ZLI A;  1KFU L;  5JSR A;  2DVB A;  5CFD B;  1W6O A;  1NT0 A;  2CTV A;  4JGZ B;  2WS9 3;  4TSV A;  3ORJ A;  1R08 1;  4GH4 B;  4COY A;  4F83 A;  3O1M A;  4S2G A;  2GZW A;  1K5J A;  4WM7 C;  1CX4 A;  3BOD A;  1PIV 1;  2PA7 A;  4BDV B;  1E5S A;  1QQP 2;  4CDX C;  1LGB A;  3JBG 3;  3Q8B A;  2WO3 A;  4Y26 A;  2Y64 A;  1HN1 A;  2VQ0 A;  1V0A A;  5FZK A;  4B4P A;  1WLD A;  2YRO A;  4Y5S A;  4CP2 A;  4LBJ A;  3UKN A;  2GC3 A;  2BVV A;  5BPX A;  5L9V A;  3KM5 A;  4L99 A;  1JUH A;  2PAM A;  3RYK A;  2VJX A;  1DGL A;  2FCV A;  4Q26 A;  5LK5 A;  1WLT A;  3RZJ A;  5AC9 2;  1B35 A;  5D2A A;  2WAB A;  1QJZ A;  1AYM 2;  1MZ6 A;  1JHN A;  1NCR C;  2W08 A;  3VBH C;  4CTE A;  4XDO A;  1JN2 P;  4LR4 A;  1X33 A;  5JPM B;  1UY4 A;  5A7Q A;  4IE7 A;  4CU8 A;  2D3R A;  4BIF A;  2VZV A;  2EAL A;  1YFY A;  1GOH A;  2BGC A;  1VBA 2;  3NNJ A;  4XBL A;  3UGH A;  2DV9 A;  1ULC A;  1BJQ A;  4NN0 A;  1J59 A;  4DEQ A;  3AKR A;  3W20 A;  5A3U A;  3MBW A;  5DAB A;  4TTG A;  1W9T A;  5ANN A;  4QWN A;  3C7G A;  3AP5 A;  3AK0 A;  1FOD 2;  1HRV 3;  2J22 A;  2ORX A;  1HV0 A;  2KR2 A;  4K1Z A;  5JOZ A;  1RUF 3;  2DU0 A;  1LOA A;  1W8F A;  2UWB A;  3GNE A;  5GLZ A;  1VAK A;  3SMH A;  2E6V A;  1KEX A;  2BOI A;  2Z2S B;  3C7F A;  3BGA A;  3MIF A;  4QPG C;  1SCR A;  1YEW A;  1UYP A;  5AVA A;  4Q4Y 3;  3RMX A;  3ZOI A;  1OUX A;  1UXZ A;  3HMY A;  5KHG A;  5L9B A;  1GMM A;  4QXH A;  2ZX2 A;  5F6L B;  4KG8 A;  3AP9 A;  4I01 A;  3MW4 A;  5JXH A;  3AC0 A;  1D4M 2;  1YFU A;  3H1W A;  5GLT A;  1JZ4 A;  1JZ6 A;  1QOO A;  1OA2 A;  3E97 A;  5H9Q A;  3H8R A;  4QM8 A;  1ZRE A;  4RS5 A;  4RQP C;  5FY9 A;  2R1D A;  1H6X A;  3LA3 A;  4QQL A;  1OSG A;  1WD4 A;  5FZC A;  1DZQ A;  3WEZ A;  3SKV A;  4RN5 A;  4AVC A;  4M0H A;  5DDJ 3;  4GB3 3;  4MYE A;  3WHT A;  2R0F A;  4COU A;  1LRH A;  3O12 A;  2W1Q A;  1JU3 A;  1JU4 A;  1PK6 C;  4BXF A;  2IXL A;  1P8J A;  1VB2 A;  2LS6 A;  3PUI A;  4HN1 A;  4LOS A;  4MAD A;  2GH8 A;  2GNT A;  3LWC A;  1KIT A;  3PUS A;  4OCT A;  3T0A A;  4CDW B;  3OBA A;  4FSJ A;  4AQT A;  5JMC A;  1CZS A;  1YQ2 A;  4NJ4 A;  5LBF A;  1VPH A;  4HK9 A;  5SV8 A;  4GH4 A;  4OHZ A;  2XJR A;  5BNO C;  5LCW L;  5LRS A;  3NNM A;  4KWK A;  4LKF A;  4FPO B;  3JBG 2;  2Y26 A;  4PDW C;  1PHM A;  3RZG A;  3MFA A;  1ZRR A;  4UXA A;  5JXJ A;  1O8S A;  2QCS B;  1QQP 1;  2XXZ A;  2I45 A;  3CNA A;  4LE4 A;  4XIK A;  5IVB A;  2OKX A;  3AJZ A;  3ZFE C;  3H3L A;  4E4Z A;  2YC0 A;  1DQ1 A;  2C26 A;  4QX1 A;  3UET A;  1WUV A;  2BUK A;  2AUY A;  2PLV 1;  1BXH A;  1J84 A;  4XBN A;  1E5H A;  1YJK A;  2B4K A;  4LLO A;  1HRI 2;  2Y0O A;  3TB0 A;  1G9D A;  4DOU A;  4Q4W 3;  5A3N A;  1V6M A;  2IXI A;  4LBK A;  4N53 C;  2UWC A;  1EAH 3;  1KJL A;  2W5F A;  4RHV 3;  3VKN A;  3AYE A;  2WZ8 A;  3VZL A;  5AC9 1;  5JUV A;  5FYY A;  4MGT A;  1X7N A;  3WNX A;  1U5Y A;  2BGO A;  2R49 A;  4W6W A;  1TMF 3;  1AYM 1;  4XXA A;  1UD1 A;  1GU3 A;  5A6Y A;  3E5U A;  2WA4 A;  2A1X A;  1NLR A;  2H6C A;  2XUM A;  4QMA A;  3AZW A;  2WLP A;  4HVR A;  2KD7 A;  2PHT A;  3ZKY A;  2WJS A;  4MUV A;  4LHL A;  4DY3 A;  5F3I A;  2WAA A;  2W3J A;  2ZAC A;  3DXU A;  4NID A;  1DBN A;  1W8W A;  2JEN A;  5FY5 A;  2D5H A;  2A5Z A;  3V0B B;  1HX6 A;  3AMN A;  1W9F A;  3VD5 A;  3SIS A;  5FPL A;  1J1T A;  2ZS6 B;  1F5F A;  2ZZJ A;  5FMB A;  3F95 A;  4B4Q A;  3GCX A;  4G4F A;  4FPJ A;  1OMI A;  1UMZ A;  2B9V A;  1IPS A;  3M2M A;  3OG2 A;  4QQP A;  4AHZ A;  1F35 A;  2CHH A;  3WP4 A;  4AHX A;  1FOD 1;  1AX1 A;  3BAL A;  4XUQ A;  4WM7 A;  5FK7 A;  5FO9 B;  1JOP A;  3ZM8 A;  3T4H B;  3KF3 A;  1OOP C;  2CY6 A;  1JZ2 A;  3LD8 A;  4HXC A;  1UWW A;  5DXD A;  1KS4 A;  3R4U A;  4Q4Y 2;  5KR7 A;  4JV4 A;  4XE9 A;  1AXZ A;  3V56 A;  1K42 A;  4BH9 A;  1HXS 2;  1XND A;  1NOV A;  1RJ7 A;  2WN2 A;  4LBQ D;  5C3P A;  2C9K A;  1HB4 A;  1OKO A;  2ZX0 A;  4YM1 A;  3GHN A;  2XL9 A;  1N1Y A;  3NKT A;  4HON A;  5EV7 A;  5IAX A;  2ARC A;  2HWE 3;  3VDB A;  4RR3 C;  2YMZ A;  1UW8 A;  4QAW A;  5FY0 A;  5I0T A;  4D3W A;  1GSL A;  4GB3 2;  2YYO A;  1Y9Q A;  1NYW A;  5FJH A;  1NCR A;  3VBH A;  4URT A;  3GF6 A;  3LDR A;  4XXP A;  1KDM A;  4QKD A;  5DQ0 A;  1YLL A;  4YW5 A;  5I8S A;  2PQS A;  1D2S A;  4J1W A;  3MW2 A;  3FJS A;  3WNN A;  1H1I A;  1C8M 3;  3BB6 A;  4CDU B;  3H50 A;  3CQO A;  1V6N A;  4LPL A;  4N9H A;  3VZJ A;  3CJI C;  5FO8 B;  3O1S A;  1O3S A;  3Q8A A;  2W94 A;  5F3G A;  4AI1 A;  1X50 A;  4GQ7 A;  5FZF A;  4Q0Q A;  3VLB B;  2XLF A;  4A2U A;  1W9W A;  4QB6 A;  2IXH A;  4QPI C;  3I8T A;  5DG1 A;  5FQ0 B;  5KXB A;  1GOF A;  1XNB A;  2HKX A;  4IV3 B;  1RUJ 2;  2C4X A;  2RMU 2;  5FZ9 A;  5T55 A;  4IDZ A;  4ET7 A;  5C4W C;  3PUQ A;  3ZDS A;  5IAT A;  5D8A C;  3T3Y A;  3VL9 A;  1ZRD A;  3N7K A;  4YRD A;  1XBF A;  2FMY A;  2IXK A;  2OS2 A;  3KGL A;  1UPI A;  1SMV A;  1W6M A;  4MGZ E;  5FYC A;  3GCW A;  3JUU A;  2ZEX A;  5F1R A;  1F4H A;  3HVD A;  4YZ2 A;  4CEW C;  4BWO A;  1FMD 3;  3VKM A;  5BY5 A;  3I2D A;  5FZB A;  3AKQ A;  1AR7 3;  2RDQ A;  1HRI 1;  4NRP A;  1PMH X;  2GH2 A;  4ARY A;  1DYP A;  4GMP 3;  2LW8 A;  1AX2 A;  2HEW F;  4MHR A;  3U14 A;  4H14 A;  2DVG A;  3MPB A;  3NO8 A;  3VN4 A;  1WCD J;  2ET7 A;  4XMA A;  2X10 A;  4OFG A;  1PZ7 A;  4RQP A;  2KXL A;  1K12 A;  2RJK A;  1C5H A;  1UNB A;  5A7P A;  4D94 A;  4XW3 A;  2TEP A;  2DBN A;  5H9P A;  3J8F 2;  1Y43 B;  2IVJ A;  3GJA A;  5T50 A;  2R6Q A;  2YPD A;  4JGY C;  4Q29 A;  4PBP A;  1GKB A;  2FZ2 A;  4JKK A;  1PVC 2;  3OTF A;  3IZO A;  4ASK A;  1OT5 A;  3UGG A;  4PIZ A;  4FOW A;  1XNC A;  5T54 A;  2DBI A;  4KGQ A;  2RS5 2;  4BM8 A;  2R04 1;  3SH3 A;  4LLF A;  3CEW A;  3HIF A;  3MIE A;  5BNO A;  3RZK A;  1COV 1;  1UZ0 A;  2GNB A;  2YFZ A;  1DYO A;  1ND2 B;  1D0G A;  2JKB A;  1S2K A;  3EBR A;  1O7F A;  4PDW A;  5F39 A;  5FBJ A;  1JYV A;  2WZP P;  4XAA A;  4A7Y A;  2ZTN A;  4FXG B;  4CVU A;  1GNY A;  3QH6 A;  1J83 A;  2BP6 A;  3PUR A;  2GN7 A;  4ASM B;  5EJ1 B;  4XFH A;  3D82 A;  2G4I A;  4P9W A;  3V64 A;  1XNA A;  1EPZ A;  3MDP A;  3DPR B;  4NVP A;  4JVA A;  1HXS 1;  3ZSM A;  1YQ8 A;  1XSQ A;  2DCY A;  3D5O A;  5L36 A;  3BTX A;  3BOP A;  2DCZ A;  1I5Z A;  2E7A A;  2VMI A;  1G86 A;  4UT5 A;  4YG6 A;  5DZF A;  4L0P A;  4XYX A;  5EPA A;  2WT0 A;  4MGI E;  2VU9 A;  2A3W A;  4NHK A;  1ULG A;  1MZ5 A;  4OI4 A;  3VGI A;  2EXH A;  2WLQ A;  2UYB A;  3ROU A;  4IEZ A;  3ZFG B;  5CYY A;  3OGR A;  1PO1 2;  2CAU A;  1CPM A;  4KBB A;  3UKT A;  2Q8O A;  1C8M 2;  1V6I A;  1WMD A;  2ADE A;  4LBM A;  5C70 A;  1MEC 1;  5JSO A;  4LUL A;  3POB A;  4BLI A;  1FAY A;  3EQE A;  4CDU A;  1UAI A;  4I3P A;  5LRR A;  3ZFF A;  4P02 B;  1ZBA 2;  2FMD A;  2P4E A;  2FD8 A;  1DGR N;  1JYX A;  4BQ2 A;  3OEA A;  3T2T A;  3B9C A;  3BYW A;  4XUT A;  4IES A;  1UPS A;  2EXI A;  2HWF 2;  3LGR A;  5E6H A;  5GZE A;  5FQ0 A;  3FUO A;  3FLP A;  4IV1 B;  1LTE A;  3OYW A;  1SFN A;  1GLH A;  2PQQ A;  4P5Y A;  2OQ6 A;  4IV3 A;  1FPN 3;  1QOS A;  2OPK A;  3LEM A;  3AYD A;  1VMH A;  4AED A;  3NVC A;  1RUJ 1;  3ZSJ A;  3IPV B;  4JKM A;  4B8E A;  3WD5 A;  4MGQ A;  1PX3 A;  3WG1 A;  2XKP A;  2YG0 A;  3WDX A;  1QJY 3;  4KWU A;  5C5T A;  4Z92 B;  1ENX A;  1GOG A;  1AR7 2;  3DKW A;  2NP0 A;  4W65 A;  5LY1 A;  3VD7 A;  1OUS A;  1NA1 A;  5FK8 A;  1BYH A;  3RI8 A;  1AR6 2;  4N43 A;  1LOF C;  1XRU A;  3MFC A;  5M0T A;  2RM2 3;  4XAB A;  3TRS B;  4FPC A;  1KFX L;  1Q8Q A;  4P14 A;  4UOJ A;  4A7K A;  4KWJ A;  1LOC A;  5FUI A;  1QEX A;  1W6P B;  3EXU A;  1OFS A;  4KMQ A;  4ZY9 A;  1C1L A;  4XJ9 A;  4RR3 A;  1WCK A;  4Y4R A;  4E4H A;  2PFW A;  1FNZ A;  2RE9 A;  2XB6 C;  3M3O A;  4LK6 A;  2ZPX A;  1K5M B;  4N90 A;  2UWA A;  1V6L A;  3VBR B;  3HQU A;  1SLC A;  4EQV A;  2WA3 A;  4AEM A;  4BQ5 A;  5B4X A;  2DUP A;  4CCL A;  3USU B;  4BA6 A;  1MQT C;  1ZBE 3;  3J8F 1;  5FTT C;  3KSC A;  1JZ3 A;  4UW4 A;  1MS3 A;  3KMH A;  4HVQ A;  4Y1Y A;  4E4S A;  2DCJ A;  4TLF A;  2YFU A;  2P2K A;  4I0B A;  1UY3 A;  4LEJ A;  4CCK A;  1LCL A;  1ONA A;  1H9P A;  1ASJ 2;  1YWK A;  3AP6 A;  3U37 A;  1R1Z A;  3III A;  1CZV A;  2CV6 A;  3SLI A;  1W8Z A;  4QPI A;  3PHM A;  3ACL A;  3SIT A;  4HKO A;  4AI0 A;  4WVZ A;  3VBF B;  4CPB A;  2QZ3 A;  2YC4 A;  2Q1Z B;  4YFW A;  5FWE A;  1PO2 3;  5D8A A;  1IZ3 A;  3MID A;  5FP4 A;  3I2F A;  3KLS A;  1WA4 A;  2FDI A;  3ZXL A;  3PUA A;  2QQU A;  4D7Y A;  4CEW A;  2VCB A;  1SG3 A;  4N7U A;  4CCC A;  2XUE A;  1H0B A;  2PXJ A;  3VBU C;  2G9G A;  3UT0 A;  4HZF A;  3GZA A;  1GWL A;  1VBB 2;  2OA2 A;  2VW1 A;  3IDC B;  1SBF A;  5KXD A;  1RUG 3;  4NHM A;  2LRP A;  1G9B A;  2VTF A;  1UIJ A;  2VME A;  2E32 A;  1RIN A;  2ET1 A;  1PO1 1;  4HN0 A;  5CFD C;  4WVV A;  1VBC 3;  4X6Q B;  2Z5W A;  4Q0P A;  2HJI A;  2E31 A;  5DAQ A;  4DPN A;  1QDO A;  2GND A;  2VQT A;  1VRH 3;  1ZBA 1;  4X8P A;  2WKK A;  4JGY A;  4EJR A;  4XFG A;  4RFR B;  2HWF 1;  5EYX A;  3GAL A;  1S0J A;  4IEX A;  3WOG A;  2BTV C;  1R09 1;  1BVV A;  3I2O A;  2ZHL A;  3J9S A;  2J1A A;  2TBV A;  1RUD 2;  1SAC A;  2WNE A;  1XC6 A;  2VTX A;  3IAQ A;  1YC6 1;  2XL7 A;  3RG0 A;  3D0J A;  3ZO0 B;  1HLC A;  2JG8 C;  4Q0V A;  1W6N A;  1A6C A;  4CXY A;  1AR6 1;  1XU2 A;  4QHZ A;  1QXJ A;  2NQY A;  3VBO B;  4AOC A;  1PNG A;  1UX6 A;  3AMP A;  1FX5 A;  1RUI 2;  1W9Y A;  3WG3 A;  1QJE A;  3J7N A;  3LEI A;  4MG2 A;  1W6P A;  2AAC A;  4WM8 B;  1X82 A;  5A1F A;  4FPL A;  3M70 A;  4Y22 B;  2YU2 A;  3ZXF A;  4UW3 A;  1LR5 A;  1BCX A;  1R08 3;  1TME 2;  5BXX A;  2VR4 A;  3WZ1 A;  3TEZ A;  2R07 2;  1RXF A;  1PIV 3;  1XQN A;  1HKD A;  2GP5 A;  3NV2 A;  3OF1 A;  4LA2 A;  2WT1 A;  4UBH A;  3TOJ A;  4AQ2 A;  2IFW A;  2VZU A;  2Y6K A;  2JDZ A;  2DVD A;  4LBQ B;  1LJ7 A;  5F8P A;  3TN9 2;  3WQ1 A;  2P3K A;  3NAP B;  4GKY A;  4QDR A;  2XKO A;  3BIW E;  4Q8K A;  1ASJ 1;  4C0B A;  3X29 B;  2BW8 A;  1M4W A;  3PTY A;  5FRE A;  3I2J A;  3UKV A;  1ZZB A;  4W6X A;  1KDK A;  1UY2 A;  3OPW A;  2EAK A;  3VBF A;  1H1M A;  1CAV A;  4Y1V A;  1REE A;  1UYX A;  1WLC A;  2DVA A;  4WVM B;  2W1W A;  2WII B;  1H8V A;  5GZF A;  5KHK A;  2WNV C;  4O65 A;  4E27 A;  2JB4 A;  5HV4 A;  4AWD A;  1UXX X;  4YW1 A;  1POV 3;  4H7M A;  2E7Q A;  1LOF A;  3OGJ A;  3PL0 A;  1DZR A;  3H42 B;  4Q27 A;  3R6S A;  3BKZ A;  2ZGM A;  3UJQ A;  2AZ5 A;  5LZ6 A;  3OOX A;  3WQ0 A;  2OZ6 A;  1ACC A;  4LE3 A;  1QJU 3;  1VBB 1;  1QNW A;  4QU1 A;  5F5C A;  4C1W A;  2G1M A;  2ADD A;  2W92 A;  3DUI A;  1XE0 A;  1VP6 A;  1XU1 A;  3FHA A;  3KVB A;  3AXD A;  1FNY A;  1IG3 A;  3EHK A;  3VZM A;  5J7M A;  1UYZ A;  5IYY A;  4A7Z A;  3SH4 A;  2NPI A;  4AFM A;  5CA6 A;  2WN3 A;  4QD2 A;  1MQT A;  3ACI A;  5BUV A;  3LZZ A;  4DIQ A;  2FQP A;  2J1V A;  3B9I A;  4E8C A;  5K0U C;  2K46 A;  3WIN E;  4GJZ A;  3DF0 A;  5FZG A;  2ZGQ A;  3WF4 A;  5BNP B;  4WVW A;  1BEV 1;  5C8C A;  3IB3 A;  1RUD 1;  2JIJ A;  2OQ7 A;  3U10 A;  4JHZ A;  4QHB A;  3K2O A;  4XPV A;  5HXM A;  2QQW A;  4R9A A;  4XFA A;  3TAY A;  4YGD A;  4JC1 A;  3HD8 B;  2OW4 A;  3T2P A;  1PNF A;  1C28 A;  4NMI A;  1QIQ A;  5AFB A;  3AJY A;  1NUK A;  1EPW A;  5K9Y A;  3CJX A;  2OYZ A;  3H8O A;  1O91 A;  5T3N A;  4UYB A;  1QJX 2;  1PGW 2;  1IS6 A;  1W6Q B;  1V9U 1;  3AKT A;  4NE9 A;  1YQ5 A;  3QBQ A;  4B1L A;  1RUI 1;  3KWV A;  3L2Y A;  5FZ4 A;  4CCN A;  2BQP A;  1RGS A;  4XCB A;  4Z1V A;  1W6O B;  5I93 A;  2HBU A;  2XJV A;  2X8K A;  2GC1 A;  3IDB B;  3MF9 A;  1R08 2;  4Y22 A;  5T5J A;  3CL1 A;  3B02 A;  2VY0 A;  4V1P A;  5C9A C;  2ZJC A;  2UY8 A;  2VH9 A;  4XQD A;  5F32 A;  1IPK A;  2ZMK A;  3MGU A;  1TME 1;  2ZGU A;  4C91 A;  1US2 A;  3ZX7 A;  3I3Q A;  3P3P A;  1CAU B;  3V65 A;  4FAH A;  1QQP 3;  1YXW A;  1C4R A;  3HNY M;  3C7O A;  2YB7 A;  4LBQ A;  4Q4V 2;  1CJP A;  4AFB A;  1JYN A;  1RUH 2;  4LKS A;  2PYT A;  1YFW A;  2BOJ A;  3CBN A;  3MIB A;  4GWJ A;  2QTW B;  3TN9 1;  4D69 A;  3O1V A;  1NZC A;  4JDO A;  4IQP A;  3R4S A;  2OUH A;  3W5M A;  1WMX A;  4QDS A;  1A8M A;  2V5D A;  5AC9 3;  4Z82 A;  1LEN A;  4NUB A;  1AYM 3;  3KT1 A;  2PHF A;  2W52 A;  5HCA A;  1D2Q A;  2JG8 A;  3PDQ A;  2VVD A;  5GZC A;  1ZA7 A;  4TZD A;  5E16 A;  4P9Y A;  4YVW B;  1R1A 2;  5I0U A;  1W90 A;  4H3W A;  4BQ3 A;  2EIE A;  3N7J A;  2GME A;  1NCQ B;  4TWT A;  5G05 L;  3E5Q A;  5FYU A;  4LUK A;  2IFR A;  2K9Z A;  4XJW A;  4RGG A;  3KT4 A;  3T2O A;  4UI9 L;  4MXV A;  1AJO A;  1IS5 A;  1YQ6 A;  1OQ1 A;  4IUG A;  3VDD C;  1FOD 3;  1RXG A;  1W2U A;  2V5Y A;  3O1U A;  5KXC A;  3KCY A;  2LAL A;  3RI9 A;  1ENR A;  2BGP A;  1W2O A;  4E9K A;  1GV9 A;  2QQK A;  1EY2 A;  4IGP A;  4XEZ A;  3FUQ A;  1S2E A;  3GZT B;  5J98 B;  2UY9 A;  1T2X A;  2ZGS A;  2NLR A;  1LOG A;  4GD4 A;  3LPG A;  5F5I A;  3WDW A;  4YGC A;  4ITC A;  1H2L A;  4AFA A;  4ZXE A;  4PQQ A;  3SNM A;  2WQ8 A;  2VZO A;  1WKY A;  1O6U A;  1QF3 A;  2RR1 2;  4FPF A;  4RS5 B;  4LO7 A;  3U0Z A;  4XAC A;  3K75 B;  3BN6 A;  4L2N A;  1YFX A;  4CCJ A;  4G9S B;  1GQG A;  2HYX A;  1ULP A;  2WNV A;  4LUM A;  5CAZ A;  2NM1 A;  3ZKU A;  4PI0 A;  1W8T A;  2WFP A;  1BHG A;  1PGS A;  2BZD A;  4XF3 A;  5DPN A;  3NWK A;  2C9A A;  5F5Q A;  3GBG A;  1PZ9 A;  3GZE A;  5IVE A;  2A7A A;  4IEV A;  4X8N A;  5FP3 A;  2JKX A;  4AFD A;  4A42 A;  3T0B A;  2CYF A;  2WQZ C;  4AAP A;  1H2K A;  2X5I B;  1I9R A;  4XZP A;  4P5H A;  1CAU A;  5FP9 A;  1YNA A;  3VUO A;  3P6B A;  4UW6 A;  1GP5 A;  5JMO A;  2PLV 2;  4ZU5 A;  2VMF A;  3DEC A;  4Q4V 1;  1RUH 1;  5T5O A;  2A3X A;  3WF3 A;  4CU9 A;  4OQ8 A;  4WZC A;  1UYY A;  4CCM A;  3ZXK A;  4D8M A;  4LKD A;  1HRI 3;  1ULE A;  3ZN6 B;  1W03 A;  1IOA A;  4YW4 A;  1H6Y A;  1LEC A;  5F2W A;  1V6J A;  1F9K A;  5D21 A;  2XPJ A;  1NE4 A;  2NN8 A;  1WWY A;  1J58 A;  2YUE A;  3FL7 A;  3I3B A;  4OUM A;  1F31 A;  3ZYR A;  5ABJ C;  1W2T A;  3LAG A;  3Q9O A;  5KBF A;  2P6H A;  5FPX A;  5J48 A;  3WCS A;  3ETP A;  1LHN A;  2D97 A;  4HK8 A;  2IXJ A;  1RUE 2;  2XOM A;  3M3E A;  4PI2 A;  1CD3 G;  4YVW A;  3WR0 A;  1R1A 1;  4BQW A;  4LK7 A;  1NCQ A;  3WX5 A;  4AG4 A;  2JDU A;  2VZ3 A;  5BNN B;  1DQ0 A;  3KV6 A;  1DP0 A;  2E53 A;  4QM9 A;  1ZA4 A;  4OMD A;  1Q8V A;  2VZS A;  3H8U A;  4P9J A;  3KQ4 B;  3ES4 A;  5CU1 A;  1CVN A;  2VZP A;  4AEK A;  4ES9 A;  4GKX A;  2WO1 A;  4PT6 A;  1Q8O A;  5LAT A;  2G9Z A;  5EJ3 A;  5IFT A;  2VBP A;  4WM7 B;  5FPA A;  5C9A A;  1GNZ A;  2CGO A;  2DUR A;  1O4T A;  1COV 3;  3FMG A;  4HG6 B;  4ZXK A;  3SCF A;  4MGK E;  3K4A A;  4CDX B;  5LA0 A;  1STM A;  4AAX A;  2W68 A;  2Y6G A;  1RTV A;  4HFS A;  3ZIW A;  4B1M A;  4XQW A;  5A3O A;  2P3I A;  4JTN A;  4IW3 A;  5FJK A;  3S5Q A;  3TEW A;  1POQ A;  3A4U A;  3LIH A;  5KWR A;  1UZW A;  1HXS 3;  2IZW A;  3G6J B;  4FP2 A;  2XLG A;  2PHD A;  1AL0 G;  3M7A A;  2SBA A;  5A7W B;  1QXR A;  3WXP A;  1Y9M A;  2RR1 1;  1Y3T A;  1E5I A;  5FYI A;  1KD7 A;  4EE2 A;  3A22 A;  4YSF A;  4CDQ C;  3VBH B;  1NCR B;  3J7H A;  1APN A;  4MOA A;  4NOT A;  4DS0 A;  4XZU G;  1W04 A;  3AVR A;  1A8D A;  4BIS A;  2YDE A;  2CDP A;  4AR2 A;  2VZT A;  3SCG A;  3HQX A;  3I59 B;  4IEQ A;  3VHP A;  2PN5 A;  4BHP A;  1ZVF A;  2R1B A;  3CF6 E;  1ZZC A;  3MV0 1;  1MEC 3;  4EWD A;  3AKP A;  4LJH A;  4YG0 A;  3LA7 A;  1V70 A;  1PM4 A;  4C90 A;  1SBE A;  2D3S A;  2ZGR A;  4CXX A;  2YV8 A;  3DV8 A;  4ES8 A;  5I0D A;  4N7I A;  1WCQ A;  2VMG A;  3OBT A;  3E6C C;  4QQ2 A;  2D3P A;  4P9L A;  2X5I A;  4K7J A;  4HOO A;  3KV5 A;  1A78 A;  1GIC A;  3MZH A;  3OUI A;  4QB1 A;  1RUJ 3;  2RMU 3;  1ODN A;  3C2U A;  3SH5 A;  4Z8B A;  3VDD A;  1W9S A;  1W6M B;  2PTM A;  1W3X A;  2HEY F;  2K0G A;  4EZH A;  1C5I A;  4S2H A;  4Y33 A;  3I7D A;  3O14 A;  4FTE A;  1WA6 X;  2I07 B;  1ZRC A;  1UU4 A;  2DF7 A;  4QPG B;  3IBM A;  3PVE A;  2XON A;  1MS9 A;  4UW5 A;  3SKJ E;  3ZXE A;  5FOB B;  3ZN6 A;  1CES A;  1SFP A;  2ZAA A;  2PHW A;  3ATG A;  2RG4 A;  3RZH A;  2W2I A;  2FDG A;  1AX0 A;  4K20 A;  4ZS3 A;  1FAT A;  3LDK A;  4C0H A;  5GJ6 A;  2ZKL A;  5F5A A;  2DWR A;  5JZG C;  5JCT A;  5L9R A;  1YO8 A;  2P5B A;  4M01 A;  1W8H A;  4RQP B;  3SC7 X;  3W59 A;  3ZN4 A;  2PAE A;  3AMH A;  2Q1M A;  2RS1 2;  2GMP A;  2XQX A;  5IUQ A;  1JH5 A;  4LOT A;  2E63 A;  3HBZ A;  4H7L A;  1RUE 1;  1NQJ A;  2VBB A;  2VPV A;  3FWE A;  1PK6 B;  5BNN A;  3J8F 3;  1OH4 A;  1OLM A;  1UZZ A;  3UYJ A;  4BLJ A;  1N47 A;  4XTP A;  4FFI A;  3W5N A;  2MNG A;  4R4Z A;  1AXY A;  3B7M A;  2BJS A;  4DEV A;  4HL0 A;  2FDF A;  3WG4 A;  2R04 2;  1PVC 3;  3RYP A;  5HCH A;  1COV 2;  3RSJ A;  5BNO B;  3Q8E A;  2RS5 3;  4YPJ A;  3NMB A;  2GMM A;  2Q0A A;  4PDW B;  3HOB A;  5FMO S;  1OXC A;  4ZU7 A;  3K46 A;  3LQC A;  4CDX A;  4XBQ A;  5JOW A;  4ZU4 A;  3POG A;  4FQ4 A;  4CUC A;  5FBZ A;  3ZFE B;  4FOY A;  1O8P A;  4L8Q A;  4FXK B;  4XET A;  2BVB A;  1Q8P A;  2RS3 1;  4UFJ A;  2PEL A;  4JTO A;  2DU1 A;  2ZKN A;  3KCX A;  1B09 A;  1HJF A;  3AL6 A;  5FYZ A;  1TG7 A;  2FCT A;  1SHW B;  2JDY A;  4GJY A;  4MHU A;  4N53 B;  5A7W A;  4LO6 B;  2A6X A;  5DG2 A;  4EWE A;  5JDB A;  4XFF A;  5LBC A;  5L7O C;  5C7G A;  5IK8 A;  1BMV 1;  3DYP A;  2QQJ A;  3M3C A;  3U1X A;  1BK1 A;  1ALY A;  4K8R B;  2VVE A;  4BQ4 A;  5IVC A;  1PMI A;  2XHN A;  1MEC 2;  4RL7 A;  5ABJ A;  3AB0 A;  3K4D A;  3I59 A;  1F8V A;  1PO1 3;  4F3J A;  1DLL A;  1O5L A;  3DYO A;  2RV9 A;  1U12 A;  2VBD A;  4I02 A;  4KGG A;  4XTM A;  5FXW A;  3ZFF B;  4OI2 A;  1TEI A;  2PHX A;  3OGS A;  3VDC A;  1WZX A;  1UMH A;  3ECQ A;  1ZBA 3;  4M3C E;  4Q1P A;  5A6Q A;  3ZSL A;  3C7E A;  4XF9 A;  3OYW B;  1QU0 A;  5EWS A;  2HWF 3;  4AED B;  3ZXA C;  5J36 A;  2F4P A;  4LXL A;  2WO2 A;  5FZE A;  2Y0I A;  3ILF A;  5JXG A;  3S0M A;  5E89 A;  2WYF A;  4DQA A;  3MI8 A;  1RIR A;  1UMI A;  3FBY A;  2D40 A;  3KV4 A;  1GFF 2;  1MR5 A;  1OOP B;  2WS9 1;  4JDN A;  3L2H A;  4MV2 A;  4BZ4 A;  1NA1 B;  1YJL A;  3E1F 1;  2NZ9 A;  4N43 B;  2GC0 A;  1GNH A;  3IDA A;  3GHM A;  4QPG A;  3AKS A;  4EYU A;  1AR6 3;  5C5U A;  3LSD A;  2XBO 2;  4CRQ A;  4XF1 A;  1LOD A;  1C57 A;  1TE1 B;  1GQH A;  5D1I A;  4LO4 B;  5HBA A;  1UU5 A;  1RUC 2;  5CFC C;  4RR3 B;  4ZON A;  5CEH A;  2XG3 A;  1IKP A;  3GGL A;  5FMD A;  4J1X A;  2VW2 A;  4FFH A;  1PM7 A;  1UL9 A;  2EAA A;  2WR9 A;  3APB A;  4BE3 A;  4CCD A;  3VBS C;  4QGN A;  2RS1 1;  3MUY 1;  2JIC A;  4IEW A;  2QQL A;  1W0O A;  2R32 A;  4UFH A;  3VHR A;  4XIL A;  2VGD A;  2FCU A;  1PK6 A;  1T6B X;  2D6K A;  5HPO A;  1XB9 A;  1S4C A;  4NPL A;  1U5I A;  3AZZ A;  3DYM A;  1MZE A;  3MHZ A;  4KQ7 A;  1UOF A;  5FYT A;  5I91 A;  4I2O A;  4AQS A;  4R9B A;  2WUH A;  2WWJ A;  3FN9 A;  4NO4 A;  1QH6 A;  4FAG A;  1DZT A;  4XOG A;  5DZE A;  3IKW A;  4Y5T A;  1QGL A;  2H0V A;  1W2A X;  4FVV A;  2WO7 A;  4QPI B;  1ASJ 3;  5F2S A;  3VV1 A;  1SLA A;  2ZMN A;  5FKC A;  3HBK A;  2Y6F A;  4DUW A;  2IWG B;  3PU8 A;  5C4W B;  2W1U A;  3ZR6 A;  4R4X A;  4FQZ A;  1LGN A;  2O1Q A;  3GXU A;  4JZR A;  3J26 N;  5D8A B;  4Z07 A;  5F3E A;  3VKL A;  4AE2 A;  4ZHN A;  3ZYP A;  3ZFE A;  5FZD A;  5K0U B;  1S2B A;  3IN9 A;  2EIB A;  4FFF A;  5EHD A;  3POY A;  4CEW B;  4ATF A;  2B45 X;  1XPW A;  1H8T C;  3MV1 1;  1FYU A;  3BTY A;  5A3L A;  2V09 A;  1WCU A;  2VXJ A;  4N53 A;  2HWB 2;  3J4U H;  2Y6L A;  2OII A;  5CKN A;  3VHN A;  1URX A;  4RD7 A;  5A70 A;  4GAL A;  1I1E A;  2P3Y A;  1IPJ A;  3B69 A;  2DCT A;  4PF1 A;  3VHO A;  4HKW A;  2ZBJ A;  3WVJ A;  5DUU A;  1VBB 3;  1GP6 A;  2FHR A;  4UFK A;  3FX3 A;  3NJX A;  4PQ9 A;  2B8M A;  4OUS A;  1X36 A;  5FAX A;  5JZG A;  2QQP A;  4AHW A;  3EB7 A;  3THP A;  3FE5 A;  5JAX A;  3D4K A;  4XF4 A;  1GQP A;  1O59 A;  2WWS A;  4J25 A;  4FPG A;  4IE0 A;  5CBL A;  4QU2 A;  3CHX A;  1RHI 2;  2ES3 A;  5FLJ A;  4JGY B;  2QBX A;  1A34 A;  2QNK A;  2UU8 A;  1R09 2;  2P1B A;  4L11 A;  1AYN 2;  1K5M C;  2ZEZ A;  2GDF A;  3DCQ A;  1D0H A;  1LHW A;  1O4Y A;  1RVF 2;  2E51 A;  4GWM A;  1L7R A;  5BNQ A;  4NIG A;  1OPO A;  2Y8K A;  3POW A;  1WW7 A;  1ZM1 A;  3ACG A;  3EO6 A;  4IE4 A;  1BEV 3;  5IW0 A;  2Y34 A;  4PLM A;  3LKJ A;  1RUD 3;  4NWV A;  3ZSE A;  3BPZ A;  5FWJ A;  3PME A;  2V72 A;  2ZHN A;  2ARX A;  1OBN A;  1ND3 C;  1OOP A;  3CU7 A;  1JUI A;  1W6N B;  2G19 A;  3MW3 A;  1OVS A;  1W0N A;  1OC1 A;  3OB8 A;  4NIA A;  1SDW A;  5EP9 A;  4BB3 A;  1S0C A;  1F5J A;  1REF A;  1PMJ X;  3VZK A;  1TQ5 A;  4YW2 A;  3LOB A;  4K8F A;  3N9Q A;  2XBO 1;  5LB6 A;  4ATE A;  2JDN A;  1V9U 3;  4WV8 A;  1DFQ A;  4KG0 A;  1RUI 3;  3ABZ A;  2QE3 A;  1CIY A;  2HWD 2;  2JEC A;  1RUC 1;  3QCW A;  4MET A;  5FKB A;  3THD A;  3FC0 A;  3NV1 A;  4DFS A;  5L19 A;  4O61 A;  3QOP A;  3AP7 A;  3UK9 A;  1WW4 A;  5L7O A;  4DO0 A;  1D4V B;  1Z0H A;  5FRA A;  5IT6 A;  2RDS A;  3NW4 A;  4J6G A;  1ZYB A;  4LIU A;  4QX7 A;  5FY1 A;  1IQA A;  2OT7 A;  1TME 3;  1AXK A;  3AZV A;  2J1U A;  3ES1 A;  1DQ5 A;  4BYY A;  4XDQ A;  2R07 3;  1A3K A;  1S1A A;  5F9T A;  4RGK A;  3LEG A;  3CJI A;  2W47 A;  4YGE A;  2A70 A;  2BV4 A;  3OGG A;  3LF7 A;  5CKM A;  3TBD A;  3E5X A;  3I3D A;  2WFF 1;  3BOW A;  3VD3 A;  2A6W A;  3TN9 3;  1VIW B;  3VZO A;  2YPJ A;  1AL2 2;  1ST8 A;  1JMU B;  3N36 A;  3WDV A;  4ZKT B;  1CR7 A;  4UF0 B;  2VTX J;  4M4P A;  3SXW A;  1CAV B;  5ERL A;  1PGL 1;  4YLZ A;  5C4W A;  3JQX A;  3LIG A;  2VOK A;  5C3Q A;  4MX3 A;  1GWM A;  5K0U A;  4CP9 A;  1N1S A;  2BU9 A;  3S57 A;  4LOR A;  1VR3 A;  3WQB A;  4Y3O A;  2WDB A;  3DEM A;  1QOT A;  5FYM A;  5FPB A;  2Q8D A;  1HIX A;  3ZYF A;  2HWB 1;  2JG9 C;  2RJL A;  3I97 A;  3I4I A;  4IND A;  1UIK A;  4XFB A;  3O0X A;  3SQO A;  3RS6 A;  2WZE A;  5CFC A;  3O5S A;  5LBE A;  1IQD C;  4D6R A;  3ELN A;  3I3M A;  4M3C B;  2B9U A;  3E6D A;  3THC A;  1GP4 A;  3VBO C;  4QX8 A;  1SLL A;  1PZ8 A;  4HBN A;  2CGP A;  2QQO A;  1JYI A;  5FLH A;  4CEY C;  3CKH A;  1IG0 A;  5C3O A;  4LMF A;  1LOB A;  1MQT B;  1ZNP A;  2BFU S;  1NKG A;  1RHI 1;  3PVO A;  4IGQ A;  1TNF A;  1I6X A;  3WF0 A;  2EF6 A;  5KHI A;  3ITQ A;  1ENQ A;  1AYN 1;  1BEV 2;  1X9P A;  1E57 A;  5A1L A;  5C8C B;  1CWP A;  1RVF 1;  3I3E A;  2VUD A;  5HCB A;  4B3N A;  3NV3 A;  2Q5T A;  3PNA A;  1JYC A;  4F8A A;  2WRA A;  3OPZ A;  5FXX A;  5C8W A;  1BLZ A;  1H2N A;  3RNS A;  4BK4 A;  3MUZ 1;  2YC2 A;  2I2S A;  1CAX A;  3GBW A;  2NMO A;  4AVA A;  4Q5O A;  5A1A A;  1IS4 A;  3C3V A;  5K8S A;  1V9U 2;  1AUY A;  1VRB A;  1QJX 3;  2Y38 A;  4IEO A;  2RJ2 A;  3VBU B;  1WBF A;  1NAE A;  4HAN A;  1JYT A;  3DXT A;  3WDY A;  4KH9 A;  2HWD 1;  4EV0 A;  1MVE A;  5F6K A;  1FV3 A;  3C8X A;  3ETQ A;  4UFL A;  3O1T A;  3AX4 A;  3I54 A;  1YIP A;  3P1I A;  3ZYG A;  5FZO A;  2Q30 A;  2BYV E;  1IKQ A;  5FZI A;  5GAL A;  5CVR A;  1XYP A;  5H9R A;  1S0E A;  4GAZ A;  3U4S A;  2ZGN A;  1RUN A;  3BTZ A;  4R8H A;  2AYH A;  1AR8 2;  2VOW A;  1OFN A;  1EUT A;  5DAW A;  1U5Z A;  2VL4 A;  2WNU C;  4QPW A;  4GUL A;  5KC5 A;  4LT5 A;  2P3J A;  1G8W A;  2IVI B;  3ENR A;  4Q4V 3;  1BQP A;  3KV9 A;  1RUH 3;  4OHY A;  1ZRF A;  3LFM A;  1AL2 1;  4UF0 A;  2QFE A;  4Q0U A;  3N3H A;  5LK7 B;  2P6C A;  4ASL A;  3BPS A;  2D5F A;  1HQW A;  5EJZ B;  4DXT A;  3AL5 A;  1ULD A;  3T2Q A;  1ND3 A;  2JG8 B;  1UOJ A;  3KD4 A;  4AEJ A;  3HN3 A;  1Z78 A;  1TNR A;  1BK0 A;  5FY4 A;  1XJA A;  2V4A A;  5A3P A;  5KXE A;  1HB2 A;  2RDN A;  2HLE A;  5FUN A;  2IUW A;  4NHX A;  1AR9 2;  1R1A 3;  3OJB A;  2GNM A;  5FY7 A;  1VAL A;  2ERF A;  2VNR A;  2VXR A;  4AF9 A;  3ZYH A;  4NIH A;  5IJR A;  2D93 A;  1J3R A;  2LM3 A;  4M3C A;  4E2Q A;  2DYC A;  5B4N A;  2MEV 2;  5A7O A;  2WQ4 A;  5DAV A;  1OLM E;  3ACH A;  3HEI A;  3SEE A;  2B7Y A;  2R06 2;  4R9C A;  4S2F A;  3WP5 A;  3NJZ A;  4QX5 A;  3S7E A;  3ZDV A;  4ZZ5 A;  1XSR A;  4RSU A;  2P37 A;  3WT3 A;  2N7G A;  4ERO A;  2CSG A;  5ISL A;  4D6Q A;  1N1V A;  2J1R A;  4TLG A;  4A3X A;  3AYC A;  2VMD A;  1XYN A;  5KHH A;  4BXS V;  1VBE 2;  4FOQ A;  5DMY A;  2BRT A;  3A0K A;  1Q5O A;  1SDD B;  4I0W B;  3J7L A;  4M0N A;  1SEF A;  1JS9 A;  3O1P A;  3O7O A;  4KNC A;  4COV A;  2RR1 3;  3FFQ A;  4CU7 A;  1RIT A;  1M06 G;  1W8U A;  4XFI A;  2YGM A;  4B7E A;  2WNV B;  3JCI A;  2E7T A;  5AFE A;  2UYA A;  3MF6 A;  1QDC A;  3VB9 A;  4JAA A;  1B35 C;  2JE7 A;  3VBU A;  3N35 A;  1Q3E A;  4MGS A;  4GWN A;  1ZZ8 A;  4N9I A;  2JE8 A;  3LE0 A;  1Q43 A;  4K21 A;  1DU3 D;  5FMO L;  2ARE A;  1RMU 2;  3ZXD A;  2XVG A;  2JG9 A;  3WNO A;  1QHD A;  4AFC A;  1JOD A;  5SV5 A;  3BI3 A;  2ILM A;  4L97 A;  1WME A;  2ZEY A;  3CO2 A;  3L9J T;  3NNL A;  4QGL A;  1AVB A;  4AK3 A;  3VD9 A;  3TEX A;  4XUR A;  3KT7 A;  2AH2 A;  5FZ3 A;  1OHF A;  3ZN5 A;  4AI2 A;  1AR8 1;  4YM3 A;  1W28 A;  1F2N A;  4Y24 A;  4CE8 A;  1W39 A;  4ISQ A;  3ALQ A;  3FBM A;  5E88 A;  1ZRI A;  2PLV 3;  2R30 A;  3VDA A;  1SPP A;  4IE6 A;  1UN1 A;  4Y20 A;  2X09 A;  2ZOE B;  2X05 A;  4XCA A;  4FT8 A;  3ZXJ A;  4EN0 A;  5JSP A;  1OLR A;  4XDP A;  2XJS A;  2EIC A;  3BTA A;  2CDO A;  5I8Y A;  5J3U A;  1U0A A;  1Z7S 2;  2D6L X;  5HV0 A;  2C24 A;  1EP0 A;  2B39 A;  2J1S A;  5DZG A;  2AEZ A;  1LNS A;  2VUJ A;  3JD7 2;  2Q8E A;  3RZM A;  3S5A A;  4WZF A;  2VNO A;  2X29 A;  2XJP A;  4MLO A;  2ZGO A;  2W87 A;  4FCA A;  5CZK A;  5EYY A;  1VLN A;  4D7S A;  3OD4 A;  5LBB A;  5BV6 A;  1G9A A;  2XVK A;  3B01 A;  4LHS A;  1DQ4 A;  1RUE 3;  2YBP A;  4O9E A;  2ZGT A;  5EQU A;  1AR9 1;  1KXG A;  4RA0 A;  4HET A;  2Z69 A;  5FV3 A;  5A7S A;  5B2G B;  5DAX A;  4E2G A;  2WC2 A;  3LCP A;  2ZHM A;  3G7D A;  4YVS C;  3CMG A;  5GLV A;  5C9A B;  4XJ8 A;  2B42 B;  2CL2 A;  2MEV 1;  1JTZ X;  4JQR A;  4YYO A;  1GBG A;  4BCU A;  3O0W A;  3LDB A;  4XUN A;  4LTA A;  1YCI A;  3PIJ A;  1SBD A;  2A6V A;  1YIF A;  1RJ8 A;  2R06 1;  2UUR A;  1YHF A;  2VM9 A;  2Z42 A;  3D3A A;  4IET A;  3WW2 A;  3ZSK A;  4YW3 A;  4HMZ A;  1CON A;  1NQD A;  1OA3 A;  3NRU A;  3OSD A;  1AHS A;  1DIW A;  2YBK A;  4JGZ C;  4JX0 A;  4YG3 A;  4GH4 C;  5CB7 A;  1VE0 A;  1DCS A;  5CKQ A;  2VW0 A;  1YI7 A;  1H30 A;  1VBE 1;  3N9M A;  4RFT 0;  1UKR A;  2RS3 3;  3ZPY A;  2DVF A;  2O14 A;  4FP3 A;  4QXC A;  2ZHK A;  3NJV A;  2WBK A;  4DRV A;  4H55 A;  2Y60 A;  1YRZ A;  3S7I A;  4DNY A;  2ZEW A;  3OPT A;  3RZZ A;  2ENR A;  1LEM A;  1VB4 A;  5LW9 A;  5FCC A;  3OY8 A;  1R64 A;  4LQR A;  4XFC A;  4C8D A;  1WW6 A;  2WZR 2;  2GP3 A;  4K9S A;  4XMI A;  5A3W A;  4Z2A A;  3GYD A;  1LES A;  1FI2 A;  5FOJ B;  1OD3 A;  4ISR A;  2VO5 A;  4MO3 M;  4CUB A;  2E26 A;  1RMU 1;  3CZU A;  5G04 L;  3RFR A;  1N1T A;  2X53 S;  1BBT 2;  2ZAH A;  5C33 A;  1JZ7 A;  5C3R A;  4OZX A;  3HQR A;  5A3M A;  2W9X A;  3SEP A;  3UES A;  5LA1 A;  3IIA A;  1OA4 A;  5CNA A;  1VBD 2;  3NKG A;  3ZYI B;  4K40 A;  5FZ0 A;  3VDD B;  2C0Z A;  5A32 B;  1VJ2 A;  4DXZ A;  3HN1 A;  4OQ9 A;  4ZZ8 A;  3A0N A;  1PX4 A;  4N8M A;  2Y6J A;  3KGZ A;  2VUC A;  1U5X A;  4XHB A;  1SLB A;  4LBO A;  2ZCW A;  2QQV A;  5HXV A;  4DB5 A;  5JIU A;  3QH7 A;  4YM2 A;  2OZJ A;  4CZS A;  5FP7 A;  2O8Q A;  1RED A;  1WMF A;  3K4Z A;  1SLI A;  4NHL A;  5ANQ A;  4GA9 A;  5FXZ A;  3ST7 A;  2HWC 2;  4K6B A;  3MLK A;  1S55 A;  1HB1 A;  1G7Y A;  1Z7S 1;  4JCK A;  4OHV A;  4DUX A;  2JJ6 A;  5LEK A;  3JD7 1;  3WUD A;  1GYK A;  4PF5 A;  3PTR B;  1HDK A;  5I0S A;  2H0B A;  3HWJ A;  5FYH A;  2RS1 3;  1EV1 2;  1V00 A;  4NAO A;  3ILN A;  1UO9 A;  4ONU A;  3UV9 A;  3N9N A;  4CSW A;  5C6C A;  5ACA 1;  4OI0 A;  4DRR A;  5LA2 A;  2J1T A;  4TXW A;  3RPQ A;  3ZVX A;  3P5B A;  4MZU A;  1HB3 A;  1MS4 A;  2P17 A;  4IEU A;  1JI6 A;  1XE8 A;  4CUG A;  5GLU A;  2R04 3;  2XHK A;  4XIO A;  1POV 1;  5JR7 B;  4FFG A;  4CCO A;  5ACA 3;  1ZX5 A;  4OMC A;  4AYU A;  1CIW A;  1RB8 G;  4MXW A;  2TNF A;  4CDW C;  3ME2 A;  1I3H A;  1NY7 1;  3KS7 A;  2IC1 A;  2B46 X;  1I5P A;  1QJU 1;  4Q8L A;  3M4F A;  4B4R A;  2D43 A;  4Q0S A;  3IAP A;  1KS5 A;  1UOG A;  1VMJ A;  1YQC A;  2RS3 2;  3RWN A;  3WSO A;  5IFP A;  1OF4 A;  3WF1 A;  4AL9 A;  3B93 A;  4YZ3 A;  4IER A;  4E2S A;  2HEV F;  3TWI A;  2D6O X;  1V6O A;  3IDE A;  5DN2 A;  2JE9 A;  2QDR A;  4R52 A;  4YW6 A;  1ZZ9 A;  5FZM A;  2ORZ A;  1AJK A;  1FT9 A;  2V73 A;  5J37 A;  2CWM A;  4JRL A;  4NPR A;  3JZV A;  3SHR A;  3MEP A;  2I74 A;  1S0F A;  5ABJ B;  1SZB A;  2SLI A;  4ZPI A;  4AI3 A;  2FDK A;  2XWJ B;  2WZR 1;  3MO4 A;  5EIY B;  3WW1 A;  4FPY A;  2FZ1 A;  4KWL A;  5T5P A;  4HPK A;  2Z4F A;  2EXJ A;  2GC2 A;  4QDQ A;  4EN8 B;  3VD4 A;  3V0A A;  2DUQ A;  5IAV A;  3TYJ A;  1XE7 A;  2W39 A;  5FXV A;  1CAW B;  1BBT 1;  2G9F A;  4Q4X 1;  2WWU A;  3T09 A;  1LU1 A;  1DQ6 A;  2VOV A;  2XJT A;  2B5H A;  2K2S A;  3UNP A;  2ARA A;  1WD3 A;  4CP0 A;  3HT2 A;  4O9G A;  4FOV A;  4YVS A;  1J1L A;  2PMW B;  1VBD 1;  2KA3 A;  4R9D A;  2VG9 A;  3VKO A;  5A32 A;  1Q56 A;  3PLQ A;  1O5U A;  1OQD A;  4GXL A;  4Y1Z A;  4QT6 A;  2WS9 2;  1BVP 1;  3WDU A;  4AVT A;  5FDB A;  3GBF A;  2RVA A;  5CFD A;  1CZT A;  2A6Z A;  4JGZ A;  3KF5 A;  1DG6 A;  1HJG A;  2QQI A;  4NHY A;  4OHX A;  1MS1 A;  3AMM A;  3DKQ A;  2Q1F A;  3MLJ A;  2VOX A;  3H7J A;  2ZGK A;  3NNG A;  4DUV A;  3O1O A;  1J3P A;  2MHF A;  2XBO 3;  1Q8S A;  4AGR A;  2QKD A;  2PHU A;  3BVC A;  2HWC 1;  4HVO A;  1RUC 3;  2BFU L;  2VZ1 A;  2VUL A;  4CDQ B;  2F4L A;  2KM2 A;  4YAR A;  1W8N A;  4CXW A;  3EYP A;  4M3C F;  2VZQ A;  3OUH A;  4JDM A;  4C1X A;  2NYY A;  1EV1 1;  4LHN A;  3CDZ B;  4MVT A;  3A7Q A;  3WNP A;  3VZN A;  5DUV A;  1UY0 A;  2NMN A;  1UX7 A;  5I8T A;  4XC9 A;  5ACA 2;  2CWS A;  4KI5 M;  5KC6 A;  4V2W A;  4FI9 A;  2HYK A;  4XUP A;  1K3I A;  2GU9 A;  2PHR A;  3TNQ A;  3WNL A;  2WFF 3;  3S6P A;  4UBG A;  5AVP A;  3R0R A;  4BU2 A;  2DFB A;  1VBA 1;  4LIT A;  4O7X A;  2CGN A;  3I2G A;  1DDL A;  4CDU C;  3ZFF C;  2VZR A;  4YZ5 A;  1OQE A;  1TVG A;  4OLL A;  1W0P A;  3E6B A;  2D98 A;  3AZY A;  4LBL A;  2DTW A;  2BNN A;  1UQX A;  4LKE A;  4UAP A;  5CG9 A;  1HRV 2;  4IV3 C;  4AED C;  3BUC A;  3OD0 A;  3BU7 A;  3TEY A;  1RUF 2;  4JHT A;  5DUX A;  2JX9 A;  4HT1 T;  4KU8 A;  4BOW A;  3RDI A;  5HI0 A;  3D8C A;  4HSL A;  2CU5 A;  2HWB 3;  4S2D A;  1O3R A;  2D44 A;  5T5L A;  1NA1 C;  1QY4 A;  3FZ3 A;  5LWB A;  4N43 C;  5JZG B;  1CGP A;  3PVB B;  1SQ4 A;  3KCC A;  3ZYJ B;  5IVF A;  3IT8 A;  5LAS A;  4D7T A;  3AYA A;  4NR1 A;  2YGL A;  1LHU A;  2VE1 A;  5F37 A;  5LY2 A;  1RHI 3;  1D4M 1;  2BER A;  2MPF A;  1CAW A;  1KQR A;  3HAG A;  3ZMN A;  4AW7 A;  4K3U A;  1QXP A;  2YHJ A;  4MSV A;  5DDJ 2;  5JXI A;  1R09 3;  1QKQ A;  2JD4 A;  1PVX A;  1AYN 3;  4LO8 A;  2WYS A;  1V6K A;  3I2K A;  1IGO A;  5FZ7 A;  1OI6 A;  2OXB A;  3RVH A;  5F7U A;  1RVF 3;  3ZXG A;  5IVV A;  4GWI A;  2CAV A;  4DXR A;  3GZU C;  4BIO A;  2W1S A;  2XDV A;  1FV2 A;  4HLT A;  4CDW A;  4YFZ A;  4PIX A;  4UFM A;  2VCC A;  1NLQ A;  4QPY A;  3HT1 A;  3P3N A;  2BWC A;  4PIY A;  1QWR A;  1ND2 C;  2XH6 A;  3AFG A;  3K51 A;  4CU6 A;  3JBG 1;  5K7P A;  5E1R A;  2W95 A;  3BCW A;  2YY1 A;  3PIG A;  1HW5 A;  3M3Q A;  1RC6 A;  2HWD 3;  2LUW A;  3H1M A;  4PHZ A;  3MYX A;  5L7O B;  4CDQ A;  3OEB A;  3DPR C;  1ZZ7 A;  5E8A A;  5IK5 A;  4PLO A;  4Q4W 2;  3DGT A;  5GLW A;  1EAH 2;  4RHV 2;  4BQX A;  1XNT A;  4V2V A;  4TYS A;  1XOY A;  3CLP A;  1UKG A;  1TMF 2;  3I49 A;  3FHI B;  3WHU A;  1JXN A;  4QKB A;  5A6X A;  2D6N A;  4AI8 A;  4CUA A;  1UOB A;  3CJI B;  2WFF 2;  3ZFG C;  1SLT A;  2JWP A;  5JVV A;  5FIX A;  2JDP A;  2ZAB A;  2VNV A;  1MS0 A;  1L7Q A;  3HNB M;  1H1A A;  3LPF A;  4XJZ A;  2VUA A;  3NNF A;  3U75 A;  1PGL 2;  3WV6 A;  4CP1 A;  3K48 A;  3LOI A;  3J7M A;  1AL2 3;  3OBZ A;  4G3Y C;  4YGB A;  3LB9 A;  3WNK A;  3DL3 A;  5FY8 A;  4I30 A;  2AEN A;  5IK4 A;  3B00 A;  2VCM A;  2QZ2 A;  4QB2 A;  4CP9 B;  2D7F A;  2RHP A;  2GAL A;  1ZZ6 A;  3V0B A;  5KHJ A;  3PJQ A;  2A6Y A;  4IV1 C;  3URF A;  2J42 A;  4B7K A;  3N4M A;  1HRV 1; 
#chains in the Genus database with same CATH homology
 4CPB D;  1W8U A;  4LKF A;  2O14 A;  1V0A A;  1OH3 A;  3UT0 A;  4CP9 A;  1GWL A;  2JWP A;  4LK7 A;  4AL9 A;  1WMX A;  3ZYF A;  1OKO A;  1GWK A;  2LRO A;  2K46 A;  1W8W A;  1UOJ A;  1WZX A;  2LRP A;  1HN0 A;  1W8Z A;  1W8T A;  4LKE A;  1W9F A;  4YW6 A;  4LKD A;  4BQ2 A;  1L7L A;  2C24 A;  2KR2 A;  4YW7 A;  3F95 A;  3ORJ A;  4CPB A;  4A6S A;  4LK6 A;  5D21 A;  4CP9 B;  2WYF A;  4YWA A;  3ZYH A;  1W90 A;  4BQ3 A;  3ZYB A;  4LJH A;  1GWM A;  1WCU A;  4BQ5 A;  2VXJ A;  4BQ4 A;  2Q1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...