1V0AA

Family 11 carbohydrate-binding module of cellulosomal cellulase lic26a-cel5e of clostridium thermocellum
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
173
structure length
170
Chain Sequence
SAVGEKMLDDFEGVLNWGSYSGEGAKVSTKIVSGKTGNGMEVSYTGTTDGYWGTVYSLPDGDWSKWLKISFDIKSVANEIRFMIAEKSINGVGDGEHWVYSITPDSSWKTIEIPFSSFRRRLDYQPPGQDMSGTLDLDNIDSIHFMYANNKSGKFVVDNIKLIGALEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ENDOGLUCANASE H
publication title The Family 11 Carbohydrate-Binding Module of Clostridium Thermocellum Lic26A-Cel5E Accomodates Beta-1,4- and Beta-1,3-1,4-Mixed Linked Glucans at a Single Binding Site
pubmed doi rcsb
source organism Clostridium thermocellum
total genus 34
structure length 170
sequence length 173
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2004-03-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 1v0aA01
1V0AA 1WCUA 4YW7A 3ORJA 4LK7A 2O14A 1OKOA 1WZXA 3ZYHA 4BQ2A 2LROA 2JWPA 4BQ5A 4BQ4A 1WMXA 3UT0A 1W8UA 5D21A 3ZYBA 4BQ3A 1GWKA 4CPBA 1W8WA 4AL9A 4CPBD 1GWLA 2Q1FA 4LKFA 1GWMA 1W8ZA 4LK6A 3F95A 2K46A 1L7LA 1HN0A 4A6SA 4LJHA 4LKEA 2KR2A 2WYFA 3ZYFA 1OH3A 1W90A 2LRPA 4LKDA 2C24A 2VXJA 4YW6A 1W8TA 4YWAA 1W9FA 4CP9A 4CP9B 1UOJA
chains in the Genus database with same CATH superfamily
1QQP1 4Y1UA 3HNMA 2GMEA 3LIGA 1W28A 1A3KA 2JDHA 3KM5A 5FZOA 4Q4X2 3HT2A 3AYAA 3DXUA 3ZXFA 4N7UA 3VD3A 4CCDA 3M3IA 5CU1A 3HOBA 5A6YA 1V70A 1HQNA 3SH3A 5C9AA 4D8MA 4Q4V2 1PMHX 3FWEA 5IUQA 1NUKA 5ACA1 1QF3A 4FPYA 4E4HA 4ES8A 1NOVA 3T1MA 2BZDA 4EZHA 5M0TA 1H1MA 2RS51 4I01A 1XE8A 1IKPA 3LA3A 2DCJA 2QZ3A 3LGRA 1GYKA 5CBLA 3KQ4B 4LPLA 4XEZA 4Y4RA 5DQ0A 3HD8B 4AHXA 4CUGA 5EJ3A 2PHTA 3HR9A 4HONA 4HANA 1UMHA 2AREA 2ORXA 1ASJ1 1WLWA 2V4AA 2RM22 4XDOA 4YRDA 4JDOA 1UXZA 3LEGA 2H0VA 3M3EA 2CWSA 4NIDA 2D97A 4YLZA 3H3LA 3RS6A 4ONUA 3ALQA 5CA6A 5JOZA 4GALA 1OURA 3OPTA 4LK6A 2X10A 3PUIA 4JGZA 4IL7A 2Z4FA 2R0FA 2OZ6A 3GJAA 1LOFA 3J8F1 4W6XA 2W87A 3W5NA 1CAWB 1UZWA 3GBGA 4N9HA 4AQSA 1ZA4A 2E51A 4EWDA 4R9DA 4WVMA 2VCBA 4RHV3 1QDCA 2BFUS 3PUSA 5B4XA 3FX3A 1MS1A 4NRQA 2K9ZA 3T0AA 1KRIA 2YGMA 2WS93 3WD5A 1GKBA 4RQPC 2ET7A 4YGCA 1W06A 3MYXA 1W99A 4XZPA 5FO9B 4OQ8A 1LODA 5HBAA 4CCNA 1V6IA 3VUOA 3H8OA 3I59B 1RUD2 5ANQA 5F1RA 5IVJA 4ZY9A 4N90A 3Q8EA 4UFMA 1AR91 1HN0A 5FAXA 2KR2A 2LRPA 4YNIA 2PAKA 1Q8QA 4PIYA 1ULFA 4RGKA 2XJUA 3RYRA 3LQCA 3VBRC 4DPNA 2IC1A 2QQWA 1SLIA 2WA4A 4AXOA 4DB5A 4CU8A 4MHRA 5GKAC 2OIIA 2VVEA 3AC0A 2VH9A 3HMYA 4YVWC 4IEQA 2HWC1 4A6OA 4DFSA 4A2UA 5FZOB 3MLKA 2V4VA 1VBE2 1J3PA 5FXXA 1ND3A 1YI7A 4MVTA 1VRH2 1W3VA 1AR81 2RJ2A 3VD7A 3C7OA 4EE2A 2VCAA 4Y22B 3WHUA 4IE6A 2D6KA 4AHZA 1YWKA 1A8DA 2YY1A 4QPIA 4BU2A 4FFHA 2Q1MA 2RS12 1S0JA 4N8MA 5BNNC 2B5HA 3VBOB 2QTWB 2WAAA 3BIEA 4UXAA 1SBFA 2J1TA 4OUSA 2C1FA 2WO2A 1O5UA 2QQMA 1C8M2 3N36A 3NKGA 2DCTA 4LO8A 5LK5A 4MGKE 2BV4A 3GZTB 3THCA 3WF1A 4NJ4A 1SBEA 1HDKA 5FY1A 5AVPA 3VZOA 3ZN4A 1HW5A 3QBQA 5A33A 3ZIXA 3ZKUA 1IPJA 1CVNA 1CN1A 1Z7S1 5FLHA 5IAVA 2VPVA 5FO8B 3WQ1A 4XAEA 3JQXA 1R083 1CZVA 3QH6A 5CYYA 5FPLA 1ZRIA 3KF3A 4NE9A 3RDIA 4XF4A 5F5QA 2C26A 3PNAA 4AEKA 5CZKA 1GICA 4LLOA 2JJ6A 3VB9A 5ABJC 1OMIA 1SHWB 2ARXA 2OPKA 3FE5A 4FOQA 2A73B 1LECA 4YM1A 4ZKTB 3OY8A 4GH4C 1PM7A 1GQHA 1KD7A 2CHHA 2Y60A 4KGQA 2H6BA 2E7TA 2E63A 1ZZBA 3ORJA 4WV8A 5HCFA 5FBJA 3ZXAC 2QQNA 5A7PA 2XH6A 1NCRA 4IV1A 1OOPB 2JIJA 1ZRRA 1FXZA 2VZSA 5FZEA 5C8CB 1UD1A 3JZVA 3U07A 3O1SA 1OLQA 4BJ0A 1BBT3 3WOGA 5A6QA 4AF9A 1UY2A 1H2KA 1YO8A 3AP4A 3VBUB 1EV11 3RWNA 3WNMA 2XKPA 3N7MA 1AZDA 2W92A 5BPXA 4UT5A 3WZ1A 5DXDA 3I2KA 1AVBA 3RJRA 4AFMA 1PO21 1ENQA 3BI3A 4XHBA 4FCAA 2FZ2A 2D98A 4JKKA 4UFJA 2PQQA 4OCTA 2JG9C 4Q4Y1 2IXKA 1TEIA 2CGOA 4EJRA 1URXA 1K5JA 2DURA 3SH5A 5C5UA 2ZEWA 1VBD2 3MUY1 5DUXA 1GZTA 4YM0A 2JDUA 4Q0SA 2B9UA 5FY5A 2XONA 4FXKB 4A44A 3UNPA 1WMXA 5DAXA 1RUE1 4OUMA 2A3YA 2J1AA 4J25A 5C5TA 2NN8A 4I2OA 1IS4A 2KXLA 2XXZA 1G6NA 4H55A 4PQ9A 1ULEA 5CB7A 1DQ6A 4DIQA 4YGEA 2JG8B 3MIHA 1QJX2 1GZWA 5ERLA 1AX0A 2J1SA 4QPIB 1MZEA 1SFYA 5FP8A 1M4WA 3BIWE 5I93A 1NY71 3CMGA 4L8QA 1APNA 5HV4A 2ZTNA 2Y6FA 3SLIA 2DDUA 4KU7A 2D3RA 2JB8A 3LEIA 4CEWC 1W6OB 3GHNA 2LTNA 1WKYA 2JDAA 2DUQA 2XMLA 3ON7A 3SKJE 1NT0A 1YFWA 4XZUG 2Y6HA 3Q8BA 3T2TA 1GOGA 2O8OA 4DUVA 3N9NA 4IGQA 5FOJB 4OI4A 3WDUA 2CDOA 4QHBA 1R091 4X8NA 2WNOA 5G05L 2JECA 5GALA 2Z79A 1W6QB 3KB5A 3Q8CA 1Y9GA 3U0ZA 2XL9A 2VW1A 4AAXA 4IEPA 2Y6LA 5T54A 2DBNA 4JGYB 1IPSA 1FPN3 2G9ZA 4XDQA 4EZ4A 4LXLA 5L9VA 3WG3A 3OBTA 4P02B 2VOKA 4BISA 1ULDA 2C4XA 4B4QA 2FCTA 4OYUA 4RQPA 3HNYM 4IXLA 4I09A 1OUSA 3LSEA 1POV0 2PLV1 3OY8B 1X33A 2VTXJ 2GMPA 3RGBA 1W2OA 1FOD2 4NIIA 4AR2A 5EFUA 1HXS1 3RG0A 1N47A 4XQWA 4I0BA 1C28A 4BQ2A 3KQRA 2ERFA 5BUVA 5DZEA 1VB4A 4IV1B 4O7XA 1VBA1 4CDUC 3NO8A 3B00A 2VZRA 4RS5B 1OA4A 1FI2A 4AL9A 2V5DA 4N53B 2VW2A 4KG8A 5BXXA 1OVPA 1AL22 1JI6A 2D7FA 1C8NA 1JUIA 4QPYA 5D1IA 5JI7A 4D0QA 2KM2A 3NV1A 1GNYA 4GWNA 2CNAA 4YVWA 1TME1 1UQXA 4LR4A 3T4VA 5FFOC 2W1SA 4NHYA 1IS5A 1K5MB 2Y34A 1ZVFA 3MBWA 1TMF2 5IFTA 4JKLA 4WBBA 3MFAA 5C3OA 1OPOA 4PIZA 1BVP1 4K8FA 5F2SA 4BQ4A 2W5FA 1RC6A 1XNCA 2YMZA 1V6OA 2YZ4A 4P5HA 3PL0A 4WM8B 3ZR5A 4ASLA 3KT4A 1K45A 4AVAA 1IHMA 3CIHA 5BNNA 5J48A 2EF6A 1GZWB 4M3CE 1VBC3 4PLNA 1WW4A 4LIUA 2DVGA 1IG3A 1OH3A 1RUH3 4P9YA 5JPNB 3V0BA 5JVVA 4M3CA 4LHNA 2D3SA 4XFHA 3ZLIA 1UOJA 1XBFA 2KA3A 3CKHA 4AGRA 4PBOA 5APAA 1VAKA 5AC92 2D40A 4FP3A 5FUIA 5A3OA 1YLLA 3H7JA 5A1LA 2LROA 1JUHA 1OLMA 3BOWA 2H0BA 2WNVC 3OBZA 4XUPA 3MHZA 2WT1A 4U36A 4YYOA 4BOWA 4XBNA 4CDWC 2G19A 1FT9A 1RB8G 3RQ0A 3TAYA 2AR6A 1RJ8A 1EUTA 2BW8A 1PNFA 4UW5A 5DDJ1 1ZRCA 5FZLA 3ZN6A 3AFGA 4ZS2A 1G9CA 1KFXL 2R042 4XBLA 4JZRA 2HKXA 1HIXA 3FLPA 4MH0E 4UBHA 2FDFA 4BMEA 1AR63 2HJIA 2JD4A 2ZA9A 5C33A 3LCPA 4IEXA 1RYYA 4Y3OA 2XR4A 5I8TA 1OFSA 4CDXC 4N7IA 4HOOA 3ZSKA 5G04L 4IEVA 1JODA 1UOGA 3K3NA 2OVUA 3WY6A 5FLJA 1GNHA 2JIGA 1NG0A 2RJKA 1K3IA 3AP7A 5A7OA 2B46X 4HT1T 4QPGC 3T30A 5C71A 2J7MA 3RSJA 3MUZ1 4OMCA 5C3RA 3N9PA 4YG6A 1RHI1 5IYYA 4OUEA 1O8SA 2JG9A 3KHBA 4C91A 2JDPA 1BCXA 3WLUA 1MS8A 3NJXA 1UPIA 4CZSA 4YW1A 2VZ1A 1EY2A 3UGGA 5JSRA 4K7JA 3PVOA 4QB1A 4LNVA 3WG4A 5JDBA 4COUA 4JAAA 1COV2 4XC9A 2HWE2 4JRAA 3A22A 1NA1C 2BVVA 2VOWA 1W8OA 1ZBA3 2G1MA 3ACLA 3AVSA 3USSA 3CU7A 4IEOA 5K7PA 4AGGA 4Q4X3 3WNNA 4LHSA 2Q8CA 3WEZA 3KCXA 3HQXA 2HYXA 3UK9A 4LBQA 4W6YA 4J1XA 4YW4A 5FP4A 3WX5A 1C57A 4B1LA 4Q4V3 2FQPA 3DYOA 1US2A 2W39A 4C1WA 4CEWA 3WG1A 3D8CA 5FZGA 1W2UA 2QNKA 3KD4A 4N43B 1J83A 3U75A 1UX6A 3DYPA 4N9IA 5CISA 4WM7B 1MQTB 1G9AA 3FUOA 2JKBA 1JYTA 4XTPA 1WCDJ 4EQVA 3ABZA 3GDBA 5LWBA 2NYYA 2JWPA 4F8AA 3T09A 2DFBA 1B35B 2RM23 2WLPA 2HH9A 5C7GA 1XC6A 1HRV2 1PHMA 4Q26A 1RVF2 1UKRA 3D3AA 3VKOA 5JOWA 3ZXGA 5GLVA 3WSOA 3NSTA 4Q1PA 2B42B 1UU4A 2DCKA 3D6EA 3ZPOA 1O3QA 4XURA 2Q4SA 1LHUA 3C8XA 3VDDC 1ST8A 3K3OA 1SFNA 3KV4A 4HN1A 4PLMA 3BGAA 4CP9A 2WQ4A 2ZBJA 4XFBA 4J6GA 5F7UA 4CDUA 3IAPA 5DZGA 2BBAA 3VZLA 2P5BA 5E6HA 1BJQA 2RVAA 4LE4A 3O0XA 4IEYA 1CAUB 2D6OX 2JICA 3L9JT 5FMOL 3JU9A 2QJVA 2ID4A 4NHLA 2W0XA 2A6WA 4O9EA 3UGFA 4FPGA 4OHYA 1RUD3 3AB0A 1KXGA 4COZA 5J09A 1JZ8A 1GQGA 2UY9A 5GM0A 4HMZA 3SKVA 5D2AA 2X29A 5JIUA 3NAPC 2GP5A 1DGRN 1WMEA 4PDWB 4EROA 3W21A 5LW9A 1RL3A 2SLIA 2W91A 1JZ2A 2FMDA 4ZU5A 4M00A 4TXWA 4AAPA 2SBAA 1LRHA 3I2DA 3AZWA 3KF5A 2BGOA 1GR3A 1H6YA 2WZR2 4CCOA 1E5IA 1LGBA 5A32B 4V2VA 1AXYA 1YQ5A 3AVRA 3NW4A 2IFRA 3BVCA 4G4FA 2WDBA 3VBSC 3ZYBA 1KFUL 4EN9B 3EJKA 1XU2A 2RS31 5KHGA 1VBE3 3CJIB 3TEXA 3POEA 1LHWA 1MR5A 1OSGA 2UY8A 4CUAA 3AP9A 5D8AB 1NXD1 2CV6A 4HL0A 4AI8A 3HBKA 2YC4A 4DRRA 1LOBA 3IDBB 4FO9A 1SZBA 1RIRA 1RUG2 4Y20A 1N1VA 2DTWA 1X50A 3PVEA 2RR12 2RS13 4CEYB 2OA2A 2ZABA 3DKQA 5FPXA 3B9CA 1ZRDA 3DPRA 4BIFA 3RFRA 1QJY2 1J3RA 3K75B 1DG6A 4OMDA 5FBZA 2R6QA 4XTMA 3ZFGA 2PAEA 3V56A 1C8M3 1UYZA 1R081 4CDWA 3KWVA 2UYAA 3SNMA 2P6CA 1QDOA 3TWIA 2IWGB 4BCUA 3VBHC 3I3DA 5FUNA 4BWOA 4EN7B 1NYWA 5HCAA 2ZGKA 5GZFA 1F2NA 4LUMA 3WV6A 5K0UA 1QJFA 3CDZB 3EYPA 4LJHA 4U2AA 3TBDA 1R1A1 1G9FA 1EYBA 1F35A 5FWEA 3TN91 4Z1VA 1S2EA 4XE9A 4Y1XA 3WNXA 5L7OB 1X36A 4KMQA 5DPNA 4CDXA 1V9U2 1AX1A 3QH7A 4FXGB 2XVLA 4CP9B 1JZ7A 1J1TA 4YZ3A 1H30A 5BNOB 3W58A 4MGQA 3WNLA 1AR72 1C3HA 1LCLA 1BBT1 1YQ2A 2E26A 2W47A 1YXWA 3AL6A 3TOJA 2E6VA 1IGOA 3ZX7A 4CUCA 1FNZA 1C1FA 1CQ9A 1QJEA 2PN5A 5HPOA 2QDNA 5T5OA 4IE7A 4Z2AA 1LEDA 1WBLA 1WGPA 2WZEA 1REEA 4KH9A 1UOBA 2K46A 2CGNA 4TYSA 5I0DA 4NPLA 2B39A 3FUQA 1UZZA 1XPWA 3ZPYA 1N3PA 3RJ2X 5JXIA 1W0PA 2NPIA 1XJAA 4QX7A 4CCJA 4CDQC 4V2WA 2ZGMA 1W05A 5FZ0A 2D5FA 1IS3A 3SEPA 1S0IA 4QQOA 5FYSA 3I3EA 4X6QB 4QPWA 3POFA 1G7YA 1POV1 2CU5A 4SLIA 3OD4A 1Q8PA 4E4SA 3LE0A 4Q2FA 5CFCC 4Y5SA 3BTXA 3RZLA 1VBD3 4JQRA 3HIFA 4JVAA 3WXPA 2O1QA 4XFIA 1HRI1 3VDBA 4DXTA 3T2QA 5A3MA 3AZXA 1RMU2 1OKQA 5EPAA 3SCFA 1F4HA 1W8ZA 4BLJA 5LZ6A 1O4ZA 3N7LA 1JH5A 5A7SA 4HKLA 2YBKA 3OPWA 4P9IA 1QJX3 2VQAA 4AQ6A 2FDGA 2BP6A 3MZHA 4LKSA 2X5IC 3U4SA 3I8TA 4PF5A 1JMUB 5KC5A 1W9FA 1DIWA 4B29A 3DPRB 3NNLA 3H3ZA 2GNDA 1UU5A 1UY0A 2E33A 1GSLA 2XDVA 2XHKA 2Z2SB 4Q0PA 1SACA 4RR3A 5FZBA 3ZFGB 2EAKA 4QXBA 1SPPA 1ODMA 1UL9A 2OQ6A 2VNRA 4D3WA 3O1OA 4E2GA 1FPN1 1RITA 2NM1A 1QHDA 3NWKA 2IXLA 3NJYA 3P3NA 2J1UA 1GP4A 1QH7A 2VZPA 2WWJA 4XIOA 3CZUA 4Y24A 3N3HA 3VDDA 4Z92B 3AYDA 4NUBA 4UFIA 5K0UB 1I6XA 2ET1A 1PGW1 1STMA 1ULOA 1VMHA 2VZQA 2V73A 2GNBA 3AX4A 4XQDA 5IAXA 3M3QA 4MGZE 4D94A 1PK6B 1YCIA 2HYKA 2P1BA 4LA2A 5FYYA 3VKFC 3M70A 3ZSJA 4CU7A 3H8RA 3H3UA 4R52A 4AFAA 1VP6A 2VO5A 5H9SA 4A3XA 4HPKB 1VAVA 3H42B 2VMIA 1XNKA 3SCHA 4AVVA 1ZYBA 1FOD3 1OI6A 2GDFA 4V1PA 5EJZB 5BY5A 2WT2A 1HB2A 5A80A 2WT0A 1ALYA 3LSDA 3ZYIB 2UWAA 1I5PA 1ND2C 3NAPA 3O5SA 1ZA7A 2XJSA 1DCSA 1XNTA 1PIV2 4UYBA 1FNYA 3AKTA 3MICA 4XYXA 5I0RA 2VQ0A 3FN9A 1NQDA 1HX6A 4ATFA 1RXFA 1AL23 4CRQA 3WF2A 1AXZA 4COYA 4XPVA 2Y33A 5F3EA 3UETA 5E1RA 1CAVB 4DY5A 1GUIA 1N1SA 3VBSA 3OCPA 5EZWA 3GZEA 1K42A 1TMF3 3UJQA 1I5ZA 5FYMA 2WKKA 1X9TA 5L19A 2NLRA 2OT7A 1VLNA 1ZBE2 2DVAA 3TEWA 1VBC1 2ZOEB 3HBZA 1MZ6A 1RUH1 2P37A 2X53S 2VG9A 1AR92 4M4PA 1BLZA 2DBIA 1GOHA 3UKTA 4B4PA 1PGL2 4LBJA 3I2JA 4CCKA 5CFDB 2W2IA 2FDHA 1K12A 1W6NA 4EN6B 2OUHA 3K4ZA 1ULPA 4YW6A 2LW8A 1UZ0A 3JUUA 5FUPA 2BU9A 1AJKA 3VZJA 4BIOA 2VMGA 4GB32 2HWC2 3AJYA 5FZ8A 2VUAA 4C0HA 3VBHA 3ZXKA 4RR3B 3S5AA 2BFUL 2YBPA 3KZ4C 1SPPB 3PUHA 5A7WA 1BK0A 2JB4A 3RZMA 1AYN2 3N9MA 5AC93 5JOYA 4QDRA 1WA6X 3JD72 3R6SA 2XQRA 2VECA 2XOMA 4YG3A 2WFF1 3NNJA 3QD6A 3TNPB 2DVDA 2BOJA 2HBTA 2DVFA 3DN7A 4IUGA 4DS0A 5A3LA 2WNUB 1RJ7A 2RJLA 4HFSA 3V0AB 5K9YA 1S55A 3ZFEB 1DZRA 4YGDA 4K6BA 4DXZA 2VVFA 5CIRA 1PO12 5JR7B 4E2QA 1DQ5A 2R043 4AZZA 4QX8A 2RDSA 4I0AA 4YFZA 5J96B 5I0SA 1ZRFA 4BYYA 2RG4A 5DUWA 4KGGA 1OQDA 3SEEA 2JE7A 3ETQA 3CQOA 1YNAA 3HEIA 3R05A 2VMCA 2G4IA 1Z7S2 3VDAA 1VMFA 5LRSA 5FZ1A 4K1YA 1YJLA 2D6NA 2JDKA 3MIFA 4MLOA 1CR7A 1SQ4A 2Y26A 3ZXDA 2LUWA 1RUC2 4O65A 2A6XA 4CPBD 1O3RA 3KLSA 3I2FA 4CDQA 1KGYA 4W8JA 1QJZA 3C7GA 2GNMA 2W52A 4S2FA 5LCWL 2CSGA 2B45X 1N3OA 4QX5A 1YFXA 4ORFA 1S0DA 4PCRA 5F6LB 4OQ9A 3VLBB 4L2NA 4Z8BA 1G9BA 2R32A 3E5XA 5CFCA 1TG7A 1ZBA1 4MXWA 3D4KA 4YW7A 5T5PA 3VBFC 3ZN5A 5A6ZA 5KHHA 1ZZ6A 1VPHA 2AACA 2IXJA 4YZ1A 1O4YA 1W04A 1COV3 5JZGC 4BQ3A 3H50A 4Q4V1 2HWE3 2LALA 3MV01 5FYCA 5C9AB 3SXWA 2VM9A 5C4WC 4XW3A 2HWB2 2P3KA 1YHFA 3E1F1 2X5IA 4M01A 3TB0A 2VUDA 1O91A 1WA4A 2NP0A 2BNOA 2BWAA 2R30A 4NRMA 4ZXKA 2EIBA 3THPA 4ARXA 1L7RA 2ZHMA 3IB3A 1SCSA 2BBVA 3ZKYA 2LM3A 1W03A 2DVBA 3NQHA 4Y26A 2RE9A 3OJBA 2RM21 1J1LA 3I2OA 2YU2A 5FP7A 5C3QA 3AP5A 3B9IA 1NZIA 2VE1A 2L9LA 2ZZJA 3IN9A 1MS5A 3KGZA 3KT1A 3MFCA 3MW4A 3AK0A 1DGRA 4LA3A 1A34A 1BMV1 1BKZA 4A42A 3K48A 3PVNA 4XBQA 4BK4A 2XLAA 4LBNA 1UNBA 3T4HB 3WCRA 3ZSLA 2IZWA 4AW7A 4K9SA 5K8SA 4FTEA 4LOSA 4AVSA 1EAH2 1XOYA 1RVF3 1CPNA 1S1AA 4JGZB 4QQHA 5E89A 5F3CA 1YFYA 5FV3A 2CWMA 4QGNA 2OYZA 3W5MA 5H9RA 4WVMB 2ZKNA 3LKJA 3WDXA 4BHPA 4QX3A 2JD9A 1DYOA 4MHUA 1H1IA 4Y1YA 4ATEA 2QQUA 5A3NA 2Y38A 5J3UA 1JZ5A 1DQ4A 2JX9A 3R4DB 1ND2A 4HVQA 4Y5TA 4K3UA 3RRDA 2GN3A 1RUD1 1H8VA 1NCQC 2VUJA 3PURA 4L92A 3VKNA 4F7ZA 4JKMA 4NHXA 5JXHA 3NNGA 3OYWA 4QXKA 3WG2A 2WO7A 5I8YA 4BH9A 3ZXEA 3RNSA 3NNFA 1PMIA 2Q8DA 2EA7A 3LF7A 4IEWA 4ZZ5A 4ZZ8A 4MXVA 4LKDA 1OH4A 1OF4A 3FFQA 3MIBA 3MGUA 3LDKA 1PMJX 2FCUA 3K2OA 1BEV1 2G9FA 3LPGA 4Q5OA 2C5DA 5JAXA 4FFFA 5JOXA 2XJPA 3ZYHA 1VBE1 4DNYA 4AEJA 2HEYF 2Y0OA 3O1PA 4BXSV 1VBA2 2H6CA 4XIKA 3WUDA 2WZR3 4KI5M 4RN5A 1ND3B 2CYFA 1X82A 3WW2A 3UL2A 2VBPA 5LEJA 4GULA 2FDJA 1G8WA 3GHMA 3ZOIA 1LOEA 5GZCA 2RS11 2ZPXA 5JXGA 5JMCA 2E53A 1GP6A 1UN1A 3WDVA 4NPRA 2VY0A 5KXEA 1P8JA 2AGSA 5IK4A 1QNYA 2HWD1 1C8M1 2R062 1WLDA 1RUG3 4GJYA 1D2SA 1GOFA 2ARBA 3E5QA 3NV4A 2RR13 4CU6A 3S5QA 3WDYA 2J1RA 1YUDA 5T50A 3BTAA 4RA0A 4BQ5A 3NV3A 1QJY3 4HN0A 2Y64A 3ZFFC 2VGDA 3UKVA 5A33B 5I91A 2W3JA 1HB1A 3I97A 4CCCA 2QQKA 1DGWX 5IHRA 1HQWA 2ZEZA 3TEYA 5FZ7A 1TE1B 4IGOA 1QY4A 3PIGA 2QVSB 3RZKA 1MZFA 3IPVA 1EPWA 4CP1A 1MACA 5JI9A 5LBEA 3IZOA 4IEZA 4AOCA 4INDA 2IXHA 5I8SA 1D2QA 2UWCA 2HEWF 1FAYA 1XYPA 3OUJA 4HK9A 1A6CA 1XB9A 3SQOA 4ASKA 4XDPA 1W6PA 4OI1A 1V9U3 2PHRA 4QB2A 1UZVA 4YZ4A 2ZMLA 4ZXEA 3GZUC 2QDRA 2R16A 4NWVA 2Q8EA 5FYHA 5LATA 4S2DA 1NCRB 1JW6A 1D4M2 1UWWA 3AP6A 1C1LA 4R9AA 3D5OA 4AI0A 3MDPA 1AR73 1S2BA 2P3YA 4ZONA 4K8RB 1YFUA 4BQWA 3CEWA 5GLWA 5DDJ2 1DDLA 3ZDSA 3VBRA 2ATFA 1YC61 2ZAAA 4NROA 4CU9A 3P6BA 4Y33A 1XYOA 4SBVA 5CNAA 2DYCA 1QXPA 3VBFA 4B8EA 2ZGUA 2VD7A 1NE6A 3HN3A 4CCLA 1LOCA 5F5IA 4DINB 4EWEA 1VBD1 4NHMA 4DXRA 5KXCA 4OHVA 1DYPA 2K2SA 2HWF2 1VJ2A 3I49A 2KD7A 5GZDA 3M1HA 3K46A 2WL1A 3H8UA 3WNKA 2R49A 2DF7A 2VMFA 5DAQA 5CG8A 3WF4A 3OG2A 4COVA 2NMNA 4LQRA 2OW4A 5JWPA 3O12A 2WIIB 3LA2A 1Z0HA 3IMMA 4PI2A 4UBGA 2ZHNA 4HETA 5FTTC 2TBVA 4F83A 3ZR6A 3E5UA 4ZS3A 1RMU3 1QJU1 3D82A 4YW3A 4QB6A 3DYMA 4IDZA 3J7HA 4HZFA 5BV6A 1DLLA 2ENRA 4H7LA 5A7NA 2CL2A 2FHRA 3DUIA 3V64A 3LA7A 3LOBA 1JYXA 4K40A 1OC1A 1OF3A 2UWBA 4M4RA 4QM9A 1YIFA 3MO4A 1BVVA 3O1VA 5FWJA 2WZ8A 1QOSA 5F5CA 1MPXA 1W39A 1SLCA 1SFPA 4NIGA 2JEMA 3WDTA 5L9RA 4XACA 4P08A 1UU6A 4QDQA 4MV2A 4GJZA 2Q1FA 3B5LB 5ABJA 5LBBA 2V72A 3AZVA 1UOFA 4BB3A 4PF1A 1E5HA 1MS4A 4NPMA 4QU1A 1CJPA 4GH4A 2QQLA 3KV9A 4Q4W2 1ENSA 3S6PA 2PAMA 4L0PA 5DAPA 3VD4A 1OXCA 3OGGA 4RQPB 1UY4A 3VKLA 5IVCA 1GMMA 2XVKA 1LGCA 1FOD1 1UY1A 2A75A 3BPSA 4JHZA 4LMFA 1DZQA 2YROA 3AL5A 3WF0A 1NCQA 3LEKA 4O61A 2O14A 3VD9A 3O14A 4AEDC 2R072 1E5SA 2DUOA 2XLFA 5HXMA 4AEMA 3MIEA 4S2GA 1XSQA 2GH8A 1RINA 3N9QA 4H7MA 2WFPA 4W6WA 4I3GA 3MF9A 1XNBA 2VUCA 4MZUA 1AL21 1X9PA 3AXDA 3GYDA 3VBRB 1LR5A 2I07B 2WYFA 2F4PA 5JIAA 5CADA 1DQ1A 3PMEA 4UAPA 3LOIA 4XJAA 4YVWB 1PIV3 2XBO2 4E4ZA 3THTA 1H8TC 1TMF1 3AYEA 1YIPA 1OQEA 1EUUA 3ACHA 3OSDA 4J1WA 4AI9A 1KDMA 2GC1A 2YC0A 2ETEA 2VULA 3AMHA 3WHTA 1AYM2 5LA9A 2P34A 5DUVA 2ZGQA 1Y9MA 1YEWA 4AQ2A 4Y1VA 2TEPA 1QXRA 2BTVC 4FPEA 3KV6A 5BNNB 3ETPA 3F95A 1F15A 3FC0A 1WCQA 4ZU7A 4PI0A 1ZBE3 1JOPA 4GXLA 1U5ZA 4IV3C 4XFCA 4AK3A 5IATA 5IVVA 4QGMA 5EYXA 1LHNA 5JUVA 1AR93 2WJSA 5FZMA 1WW7A 3N9LA 4AI2A 3AJZA 1SLBA 3FBYA 2GC2A 3V0BB 4E27A 1T6GC 3DECA 2YB7A 4M3CB 5FYVA 2BGPA 3ZFFA 4EYUA 3F2ZA 5AC91 1V6NA 3I7DA 1DF0A 3ACGA 4YSFA 4YVSC 1LHVA 1E5RA 4GB33 4PIXA 2HWC3 3IDEA 5J7MA 2ZX4A 2RS32 4AG4A 4E4DX 5FZHA 2ZS6B 3I4IA 2WABA 4QMAA 5J98B 3WQ0A 4K20A 4HSJA 1RTVA 1UCXA 1AYN3 1LTEA 1ACCA 5FO7B 5A7QA 2WZPP 5ABJB 4BM8A 4NWWA 3RMYA 5FJHA 1W9YA 4RHV1 2WINB 3JD73 5LBFA 1UMIA 4CXXA 5B2GB 3VHOA 3ZN6B 4GH4B 2EIGA 4GZ9A 1CESA 1WD3A 4DOUA 2WS91 1RUI2 1W9WA 1H2NA 4MG2A 3ES1A 4KWKA 2BOIA 5FJKA 5DN2A 5AFEA 3J7LA 3WUCA 3IDCB 2CY6A 4HG6B 3OOXA 1W6MA 3ACFA 1PO13 1XE0A 2W46A 1PM4A 3BCWA 3SISA 3K51A 1MVQA 4LE3A 2ZGOA 1ONAA 5EXOA 4CUBA 3RMXA 3MIGA 3QCWA 2YU1A 5CKNA 1WBFA 1Z7S3 3DXTA 4JHTA 5FYBA 5IVEA 4LO5B 3T2OA 1BZWA 3WP3A 3WF3A 1GV9A 1R1A2 4FPCA 4OLLA 2BERA 4Q8LA 3TN92 2FCVA 2JG9B 1RUC3 1C5HA 1V6JA 4YW2A 5JR2A 4MYEA 1WW6A 1XNAA 1U5IA 2VXJA 2A6ZA 3WNOA 3AKPA 3U11A 2JENA 3FLRA 4AFDA 1ZM1A 1S0BA 3KVAA 5L9BA 1SEFA 2EXKA 4QHZA 1COV1 1LU2A 3RZJA 3O1MA 2HWE1 2RMU2 1J59A 2UYBA 5HV0A 3JBG2 3DV8A 2D93A 5A6XA 3B69A 1QOTA 1Q8OA 2BNMA 1L3JA 1NLSA 5JSPA 2I2SA 1Y43B 4UF0A 4XMIA 4JDNA 1FMD2 3UGHA 2XPJA 4MGTA 1NXMA 2BWCA 3CBNA 2XL7A 4LBQB 2Q30A 1U0AA 1VRH3 2B7YA 1ENXA 3I54A 5FYTA 4ET7A 2JDMA 2ZCWA 2HWB3 3L2HA 4CEWB 4QKFA 4BMBA 5IVBA 1Q5OA 1S0GA 1FV2A 1C5IA 5TSWA 1YQ6A 1HB4A 3WINE 2VU9A 5ISLA 3OD0A 2EALA 4OHZA 2BDRA 4CXYA 2WNVA 1JYCA 3PTRB 4AVTA 4AFCA 4AQTA 5FRAA 2V09A 4CP0A 2EXJA 4YZ5A 4AGVA 3GF6A 3UYJA 1HRI2 2PHDA 1JYVA 4XFFA 1AHSA 3VN4A 5DAWA 3H0OA 1RVF1 3GBFA 1JU3A 1POQA 3OGSA 4L11A 3NKTA 2EIDA 1TQ5A 2ES3A 5DG1A 4HKWA 2IXCA 2D3PA 4XUTA 4A6SA 5EJ1B 1SG3A 1V6MA 3M7AA 2AC1A 4FP2A 4YZ2A 4UFHA 5EYYA 1REDA 1TZOA 3Q8FA 4P9WA 1EAH3 2R1BA 2YC2A 3VBOC 3USUA 3BU7A 2J22A 5FY4A 4AEDA 2ILMA 1VAMA 1PNGA 1DGLA 4FPOB 3RI8A 1IOAA 4LK7A 4CDUB 5BNPC 2WWUA 5FDBA 1V6LA 4QPGA 3VZMA 5CEHA 1R1ZA 2W68A 3BKZA 3VHNA 1F8VA 1PX4A 1W2NA 1CX1A 1UX7A 3W20A 1KQRA 4XUQA 5FXVA 1BK1A 3HQRA 3ZSMA 3OUHA 1RUJ2 4K21A 4XABA 3O1RA 1H8TA 3J26N 1RUF2 1VBB2 5EIYB 2ZACA 2ZX2A 3NNMA 1H2MA 2GMMA 2W1QA 4XF0A 4EN0A 4DRVA 4C0BA 2YG0A 4LHKA 2YDEA 3OGVA 5FPVA 1NA1A 5FQ0A 2RDRA 1REFA 4FQ4A 2Y6KA 4R9CA 4AWDA 2P4EA 3O7OA 4ARYA 3KSCA 2IVIB 1JYNA 2OZJA 1G86A 3PUQA 2NQYA 3S7IA 3ZMOA 2R0HA 5FPUA 1OOPC 1VBA3 1KEXA 4FFIA 5F39A 5C8CC 3ENRA 3N35A 3H1YA 4YARA 1PVC2 2AEYA 4GWJA 3VBUC 2ZX0A 2VTFA 4NN0A 4PQQA 2MEV2 1IPKA 1RUG1 2D6MA 3VL9A 4IE4A 4Y20B 3RVHA 5LY2A 4YVSA 5LASA 1MEC2 5B4NA 1J3QA 4YM3A 1QJY1 3ZMNA 4UFKA 3OGRA 1SLLA 1QQP2 2WNVB 4KBZA 5FZAA 4BE3A 4KWUA 3EB7A 1S0CA 5FK7A 2R063 3PHMA 2EVXA 5CG9A 1DGWA 4RD7A 1W8UA 4CDWB 2VJXA 3I3QA 1ULCA 1C4RA 4FBFA 4LHLA 1QU0A 4H14A 2X8KA 4FPKA 5ACA2 3O1TA 5H9QA 3LFMA 2R1DA 1MVEA 1QOOA 2RS52 2CAUA 4QKDA 1AX2A 2ZXQA 1Y4WA 2JG8C 2NZ9A 5T3NA 4WVZA 5FZKA 1CONA 4B7EA 5E8AA 2A71A 5JXJA 1ZZ9A 2VNVA 4MSVA 3WP5A 4CDXB 3LDRA 5FY8A 3USUB 3MF6A 4AYUA 3VL8A 3OBRA 1ASJ2 3C7FA 4OZXA 3IKWA 3N4MA 3BTZA 1AR71 5DAVA 2NMOA 2YYOA 4QPGB 5ANNA 1BYHA 4OFGA 4BXFA 4O9GA 1OVSA 3HJRA 1DFQA 3I2HA 3AMPA 2AUYA 3Q9OA 1X7NA 2YPDA 4URAA 1IS6A 2HLEA 2WFF2 1S0EA 3DF0A 3JCIA 4DEVA 1D4M3 2BVBA 2XKOA 3VZNA 3POWA 3R4UA 5F3IA 2AYHA 2D43A 1UY3A 3J8F2 3WR0A 4FAHA 2VBBA 2VC9A 4JGYC 5DDJ3 5FIXA 3VDCA 2PXJA 4UFLA 4YVSB 2BNNA 5HXVA 4H3WA 3VZKA 3M2MA 1NA1B 2XVGA 2XWJB 3WNPA 1DP0A 2WA3A 1YQ8A 4OHXA 3I59A 5C3SA 1UPSA 2J42A 3ZYJB 4EN8B 1ENRA 5J36A 2XGXA 2ZGPA 4FSJA 3HWJA 3TEZA 2HWF3 1D0GA 1RMU1 5EQUA 4IV1C 2C9AA 1Y3TA 2A5ZA 4DQAA 1F5JA 2ZGTA 4RS5C 3PU8A 4FQZA 4N53C 2PTMA 1Q8SA 4QX1A 4Y1ZA 1QEXA 1ZREA 1O4TA 1NKGA 2W9XA 4G3YC 5F3GA 2GU9A 3GALA 3AMQA 3AKSA 3H1WA 4HVRA 1ZBA2 2XHNA 4P5YA 2OUJA 4QWNA 4QQLA 2WN2A 1KS4A 1K5MC 1CJDA 3LB9A 4AFBA 1WW5A 2ARCA 1WZXA 2VOVA 3GBWA 3ASIA 2WUHA 1YRZA 2YXSA 4E2SA 1VIWB 2VR4A 1N3QA 3L2YA 1AR82 1SDDB 1UIJA 4Y22A 5FKBA 4GKYA 1RXGA 3OF1A 1W0NA 3CF6E 4WM8C 4XFGA 3VDDB 2PHWA 3VBOA 1AR61 1A8MA 2A70A 5FYUA 5LY1A 2F4LA 3C2UA 4GWIA 2K0GA 3N9OA 5FPBA 3IM0A 5BNPA 1LEMA 4GIQA 4Q4W3 1BXHA 3AM2A 3U4XA 2WSUA 4AHYA 2ZHKA 1OKOA 1QKQA 4C1XA 4GMP3 4CXWA 3OPZA 1VMJA 3SITA 4HLTA 4XVHA 1PVXA 4ASMB 1BMV2 4CPBA 4JX0A 3ITQA 2R073 1DQ2A 1LU1A 2ZKLA 2C0ZA 2PYTA 1F5FA 1OA2A 1X8EA 2YFUA 4QQ2A 1I1EA 3NAPB 1WLTA 4CCEA 5FMDA 3J7NA 2VMHA 1PIV1 2JKXA 1VALA 1H0BA 1YQCA 2R7EB 3CL1A 4Y5Z0 2F17A 2P3IA 3DCQA 4YFWA 1KJLA 3KVBA 2CDPA 2WWSA 4KNCA 2XWBB 1PGSA 4HK8A 5L73A 1JN2P 3FMGA 5IFPA 5J1XA 1XSRA 3ZXLA 3FHIB 4H2AA 1CIWA 2XBO3 4Z82A 3VBSB 4Q4X1 1OOPA 5FMBA 4UI9L 4LIVA 3AYCA 2IVJA 4L9BA 3GM8A 3E6DA 4QGLA 4Z2WA 1HLCA 5C8CA 1ZBE1 4XMAA 1LB2A 5FLIA 3TNQA 4UOJA 3A0NA 1AYM3 2AEZA 3VBUA 3ZSEA 2VOTA 4MUVA 3RYPA 1EV12 1QGLA 1O59A 2ZGSA 1PGL1 1YJKA 2VNGA 3BUCA 1ODNA 3VHRA 3I3BA 4GMP0 4FOWA 4JC1A 3NV2A 5KR7A 1PO22 4QD2A 1I9RA 1W6NB 2YBSA 4XQ4A 1ZZCA 4IE5A 4Q4Y2 3OBAA 1CZTA 3FBMA 5K4LA 3MIDA 3WP4A 1BEV2 2A6YA 1ULGA 2OXBA 4FPFA 4GB31 4BA6A 1S4CA 2VZVA 4CE8A 3ZYGA 3FHAA 4TWTA 4WVVA 2Q8OA 5KBFA 3RZZA 2BRTA 3VBHB 3UKNA 5A1FA 5FKCA 3UT0A 5F8PA 1AYN1 4P14A 1DYKA 1RUE2 5A7WB 4FTSA 3PMSA 2JG8A 1W8WA 3JD71 3BN6A 3E6BA 4L99A 4Q0UA 3IDAA 1OLRA 2ZGNA 4META 2RS33 5A3WA 5LBCA 3T0BA 1LAJA 1JYWA 1LOGA 2YFZA 1U12A 1JS9A 4TLFA 1S0FA 5FP3A 3PVBB 1HRV3 3VHPA 4XJWA 3ZYRA 3BU0A 2VAUA 1NY72 4LUKA 1HJGA 2B8MA 3E6CC 2BUKA 2Z42A 1OQ1A 3JQWA 2HWD2 5BNPB 1PO11 1XRUA 4KU8A 1W6OA 4G9SB 3KCYA 4XF9A 2PELA 2JDNA 2Q1ZB 2VCCA 3KCCA 4CVUA 4N43C 1EPZA 1RUI3 5DZFA 4PLOA 3POIA 3FFZA 1MQTC 4LOTA 4WM7C 5T55A 5DUUA 1OD3A 3HT1A 4Q29A 4FT8A 1CX4A 1GANA 1R092 1YYNA 3ILFA 4D69A 4XETA 1GWKA 1ZNPA 1W6QA 2VBDA 4DUXA 3POBA 1RUC1 3BYWA 1B35C 1TNRA 4LKFA 1F9KA 4JGYA 2Y6GA 2EICA 4JTNA 4NR1A 4C8DA 1FYUA 1GLHA 2J1VA 3DL3A 2CTVA 4IETA 5IVYA 4CDQB 2XG3A 1JZ4A 2HBUA 3AZYA 5KHKA 2DTYA 1WLCA 2JE9A 1D4VB 1UYPA 3B93A 4KL1A 4LORA 5FYZA 1R1A3 3B7MA 1XU1A 2PLV2 3LEMA 4M3CF 3TN93 5HCHA 3NMBA 2Z5WA 5GZEA 1ZZ8A 3ST7A 5CFCB 4QXCA 1HXS2 3S0MA 1GP5A 4MXWB 2QQJA 2HEVF 1CD3G 2ZEYA 3U37A 3GCXA 1GQPA 3MLLA 2XQXA 3RI9A 4RS5A 2RMU3 5CKMA 3ZO0B 1VRH1 4N53A 5KHIA 3RYKA 2QQPA 3JBG3 1H9WA 2HWB1 1HV0A 3PTYA 3WW1A 3C7EA 5FY7A 2X5IB 4M0HA 3CZJA 1LESA 3VKMA 1WMDA 2JDZA 1U5XA 3LFIA 5I0TA 4AHWA 1FMD3 4BPZA 1LULA 3OTFA 1TME2 1W8NA 1K5MA 3KS7A 1OUXA 3PIJA 3R0RA 4LO7A 4Q27A 1AF9A 3K4AA 1JHNA 1CPMA 2UU8A 3LAGA 4JCKA 2PHFA 4PDWC 3UJOA 2DU0A 1W8FA 4R4ZA 1SBDA 4LT5A 1POV3 3MV11 4OVEA 4KBBA 4WM8A 1QIQA 1CIYA 4D6QA 1OHFA 5FZ6A 3TYJA 4UW3A 5F37A 4RGAA 4BQXA 3A0KA 3W59A 1GWLA 1N1YA 1V00A 3H7YA 4AI1A 1MZ5A 3PU3A 1HRI3 4OI0A 1WUVA 5LRRA 1EAH1 3CJIC 1QJU2 4RFT0 2A3WA 5GLUA 2CGPA 5IK8A 2DCYA 2VCMA 1UZYA 3FZ3A 4FPLA 4JTOA 4MX3A 4QDSA 4UW6A 2C24A 1TNFA 5D8AC 4LBOA 4D6SA 1JZ3A 5FK8A 4NO4A 4GA9A 3BTYA 1WCUA 2GAUA 2IXIA 3HQUA 4LBMA 5EHDA 4CEYC 1SDWA 2VL4A 3PDQA 3ILRA 4HKOA 4XJZA 2GP3A 1WCSA 1IQDC 3AXEA 1ND2B 3CNAA 4XFAA 5T52A 4BQYA 1OT5A 3POSA 2FD8A 5F6KA 4CSWA 3A7QA 3D0JA 5CKQA 2JE8A 5FZIA 2DFCA 4XUOA 4A7KA 2WQZC 3OYWB 4PHZA 1QNWA 2GH2A 5EP9A 4Z07A 1B09A 3I2GA 4D7SA 5HCBA 1WCKA 4BLIA 2RHPA 4A7YA 1BQPA 1RUJ3 1XQNA 2VMDA 3H8XA 1XYNA 1H6XA 1RUF3 3T2PA 5L7OC 1VBB3 4NIHA 1W9SA 2WYSA 4GAZA 5GJ6A 5H9PA 1NLRA 2GSYA 5JZGA 3KHCA 2V5YA 4A7ZA 3MLJA 3ILNA 5C6CA 5FZ4A 5LA0A 3BOPA 5C4WA 3U10A 1H1AA 4PJYA 1W9TA 5BNOC 4IQPA 3LD8A 3LZZA 4E8DA 3EHKA 4JRLA 2E7QA 3NRUA 4OI2A 1QJX1 1ZX5A 1RHI2 2ZHLA 4LULA 4W50A 3T08A 3ME2A 3WDWA 3WT3A 3VV1A 4NVPA 5FCCA 3MW2A 3IBMA 3RZGA 4P9LA 5E88A 2XJTA 1PVC3 1LHOA 1US3A 2P17A 3S30A 4AVBA 3PLQA 1MS9A 2R061 1H4HA 3EQEA 2MEV3 2QQVA 2OX0A 4TZDA 2EXIA 2BEOA 3FJSA 5FZDA 3T0DA 4P9XA 1RUOA 2ZMNA 1W2AX 1MEC3 3MEPA 3IWZA 3NJZA 1R64A 2C6SA 1F31A 1QQP3 3EMRA 4XJ9A 3I3MA 4UW4A 1AUYA 2I45A 1O6UA 1S2KA 2ZMKA 2E7AA 3HN1A 4FPJA 5T5JA 3C7HA 4RSUA 5FXWA 2PFWA 3TRSB 4E9KA 5ACA3 3ZXJA 3WCSA 3IPVB 1Y9QA 1UF2C 4DEQA 2RS53 1JOBA 2QBXA 3J7MA 2E31A 4N43A 4WZCA 5IK5A 2XUMA 4WM7A 1MQTA 5DMYA 5HI0A 2PHLA 1OLME 5C8WA 2XJQA 4XF1A 3FHQA 3OB8A 1Q43A 2A1XA 4XOGA 4GKXA 3QLQA 1W6PB 3NJVA 4GD4A 3KV5A 3DPRC 3NVCA 2I74A 3IT8A 1B35A 4YG0A 1ASJ3 1YI9A 1D4M1 4ISQA 4OHWA 2B4KA 3ZFGC 1DBNA 1NAEA 4PBPA 5CVRA 1VR3A 4JV4A 4D7TA 4XILA 3CO2A 1PZ8A 3WW3A 4CP2A 4RYDA 1D0HA 2DUPA 2VMEA 5LA1A 4QX0A 5A3TA 4RHV2 1Z78A 2BPA2 3MI8A 4IEUA 2PHUA 2MPFA 3BPZA 2WFF3 4FI9A 2ORZA 4BDVB 2WS92 5K0UC 3M8LA 3VBFB 3WP6A 4FAGA 1G9DA 1JZ6A 1KITA 5KC6A 3J8F3 3PUAA 1HJFA 1M06G 2O0OA 4YGBA 5JZGB 1PK6C 2HWF1 2IUWA 1OD5A 1UKGA 3D0SA 5FZ9A 1CWPA 4X6RB 2E32A 1JXNA 3B94A 1CAUA 2ADEA 2GC3A 5C4WB 2RDNA 3G7DA 2ZEXA 4NHKA 5IJRA 5IWFA 5C3PA 1NZCA 4IERA 2GC0A 4KWLA 2RV9A 1LJ7A 4MGSA 4A3ZA 4R8HA 1CAXA 2OS2A 2YV8A 3HAGA 3R4SA 1U5YA 1L7LA 1VRBA 1UMZA 4K1ZA 2A7AA 4XJUA 5KXDA 2W08A 5FMCA 3GZAA 5KWRA 4QU2A 2O8QA 4PDWA 2P6HA 3O0WA 2Y6JA 3ELNA 1ZZ7A 1LGNA 4WZFA 4P9JA 3U78A 4QM8A 2WRAA 4GWMA 2GALA 1LKNA 1QH6A 5A32A 4XUNA 1JYIA 5C70A 2XB6C 2QUOA 2W1UA 3CHXA 3SCGA 3N7KA 4A41A 5A70A 5BNQA 1AXKA 1UYXA 1DZTA 2QE3A 4NOTA 5FZCA 4TN7A 5I0UA 4LBKA 1GFF2 3CJIA 4FVVA 4ISRA 3AZZA 3SC7X 4UWDA 4DY3A 1DHKB 3MW3A 5D8AA 4QX2A 4CYDA 1NX9A 1W0OA 2DV9A 2BGCA 2ZGLA 4JDMA 1AR83 4LBQD 3LWCA 3ES4A 4W65A 5E16A 5LB6A 4DMIA 1RUNA 1LNSA 4Q4W1 2WAOA 2R041 4E8CA 4TLGA 1Y7BA 1FATA 4CEYA 2D5HA 2WBKA 5FR3A 5CFDC 4IESA 4GMP1 3WW4A 3POGA 2B9VA 2QCSB 4QT6A 3RWKX 1NQJA 3A23A 3K4DA 4URTA 4XJ8A 5LEKA 1DLCA 2OKXA 1NCQB 2VZOA 2R071 2RDQA 2EAAA 2VOXA 2XUEA 1R082 3GJBA 4MADA 3THDA 5GLZA 2EXHA 4FTBA 4F3JA 3H9AA 4RR3C 2FDKA 2VTXA 3DEMA 2ZJCA 4Q1RA 4RFRB 4AI3A 2GZWA 3DGTA 3INAA 5FPAA 1KJRA 3QOPA 4LTAA 4CA9A 2VVDA 5L7OA 3JB4C 3OUIA 3ZYFA 4D6RA 2VZTA 4IE0A 1A78A 1QWRA 1OFNA 1BHGA 4ZU4A 1O5LA 2WSVA 2WNUC 2XBO1 3AMNA 3HPNA 2BJSA 4OZOA 4B3NA 2AZ5A 1O7FA 3ZFEC 4I3PA 3X29B 1W3XA 3N7JA 3DKWA 5BNOA 3O1UA 5FXZA 2VNOA 1NLQA 4KWJA 1AYM1 1BBT2 1SLAA 3GCWA 1WWYA 1XE7A 4LO6B 4Q0VA 3LDBA 3KT7A 5J37A 1D7PM 4QAWA 4DZGA 2MHFA 3PJYA 4LBLA 3G6JB 4QHOA 4FOYA 2XJRA 1CAXB 1MS3A 1UYYA 2N7GA 4LEJA 1DU3D 1WD4A 1Q56A 3ECQA 3IMNA 2VW0A 5EWSA 4B7KA 1V6KA 3AKRA 1JOJA 2ADDA 1EV13 3AKQA 5EV7A 4EWAA 3P3PA 1XNDA 2A3XA 2BQPA 4FFGA 4TSVA 2PQSA 1PO23 3O0VA 2W94A 2QZ2A 4YM2A 3T1LA 2FBEA 4IGPA 5FMOS 3ZFFB 2Z69A 1PX3A 2WNEA 4L97A 4Q4Y3 4EV0A 2WN3A 1TVGA 2P3JA 1HKDA 1E57A 1BEV3 2C9KA 1OBNA 1WMFA 3ACIA 1UO9A 3FLTA 5KXBA 1HQLA 1HV1A 1CZSA 1HRV1 1N1TA 1QXJA 2WLQA 3A21A 4ZHNA 1RUE3 3NL1A 1T2XA 5AVAA 3V65A 3CJXA 4R4XA 5C9AC 4MGIE 2VQTA 5KHJA 5IW0A 1PZ9A 3UESA 1SCRA 1GZ9A 3FL7A 5T5LA 1JTZX 1RUI1 4ZPIA 4XHXA 3GXUA 3P1IA 2WQ8A 3KMHA 3K77A 1UXXX 3E97A 3ZIWA 1J58A 2E9QA 4HVOA 4LO4B 3KGLA 2HWD3 1HB3A 1PZ7A 2D6LX 2Y8KA 4GQ7A 1W6MB 4DO0A 2PHXA 4MOAA 4FPHA 2Q0AA 3B02A 5D21A 3HNBM 3M3OA 5A1AA 1FPN2 4NAOA 1H9PA 5GLTA 1LENA 2W95A 3C3VA 3P5BA 2VZ3A 2LS6A 4M0NA 5JLVA 3RZHA 1R093 3CLPA 4CCMA 4JQTA 1FX5A 4Q0QA 3U14A 3BALA 2TNFA 4P9GA 5JMOA 4WVWA 1MS0A 2ZX1A 1UIKA 4QKBA 3OEBA 1PGW2 5SV5A 3WQBA 5AFBA 3APBA 3EXUA 2FZ1A 1PK6A 2UURA 4JGZC 4MO3M 4RGGA 5FPZA 1JBCA 3ROUA 4Q8KA 1IZ3A 1LOFC 3JXSA 5IK7A 5FY9A 1V0AA 2Q5TA 3Q8AA 4HPKA 2OQ7A 4IW3A 2ZX3A 3T3YA 2RMU1 2WZR1 2PLV3 2G9GA 3ZDVA 1UW8A 4RL7A 5F9TA 5FZ3A 5FOBB 3JBG1 2D44A 1HXS3 1DQ0A 5FZFA 4NIAA 3J4UH 2P2KA 1OPMA 2PMWB 4IV3A 2PA7A 2XLGA 5F2WA 1FMD1 1GWMA 4KG0A 4YPJA 5JPMB 4UF0B 2EIEA 4X8PA 5JCTA 1L7QA 2VXRA 5A3UA 3J9SA 3B01A 2FMYA 1Q8VA 2YGLA 1NE4A 2GNTA 3AFKA 5FREA 5A3PA 3GGLA 4HBNA 1GNZA 2ARAA 3LPFA 1W8TA 2QQIA 4NMIA 3B3QE 4I0WB 4XF3A 1CAVA 2RR11 2FDIA 4B4RA 2DWRA 4C90A 2W1WA 1TME3 2QQOA 3IIAA 3LIHA 1XXNA 2WO1A 2WO3A 1O3TA 3IIIA 3EBRA 2VZUA 2QKDA 4QQPA 3GNEA 3M4FA 2QFEA 5LA2A 2J1EA 3AMMA 1F4AA 2Y0IA 3PJQA 3WVJA 4A45A 1CGPA 5IT6A 3EO6A 1VBC2 3HVDA 2DCZA 2DU1A 1RUH2 3IAQA 5CAZA 2AH2A 1ND3C 1IKQA 4I02A 4XCAA 4KQ7A 1GZCA 4R9BA 4ES9A 5CFDA 1AL0G 5DABA 4LKEA 1J84A 3A4UA 4QXHA 2WR9A 1SLTA 2YHJA 4QPIC 1QJU3 4B1MA 1V9U1 3ZYPA 4A4AA 2GN7A 2TUNA 4AEDB 4D7YA 4MGYE 3BB6A 2IFWA 3MPBA 2ZZQA 2VQUA 3W9AA 2WC2A 4XAAA 1Q3EA 1JU4A 3WQ7A 1I3HA 4HXCA 1KS5A 4BZ4A 5L36A 1QMJA 3BODA 3OGJA 4XXAA 1H4GA 1HN1A 1IG0A 4W4ZA 5FP9A 1AJOA 3H1MA 3ZVXA 4Y4YA 4DUWA 1GU3A 1T6BX 3UV9A 3QACA 2OPWA 3JB8A 4CTEA 3SHRA 3S7EA 1RUJ1 1FV3A 2X05A 1O8PA 2WNUA 3RPQA 3ZM8A 1AR62 4COWA 3V0AA 1RUF1 2JDYA 2YPJA 1VBB1 4NRPA 1CAWA 1H8TB 1W90A 4YW5A 3ZFEA 2BYVE 4BQ1A 3VD5A 5SV8A 1GBGA 1VE0A 4AVCA 1W2TA 2MNGA 4QKNA 3S57A 4YWAA 1IQAA 2XJVA 4DXSA 1VB2A 1W8HA 4BK5A 5F32A 1O3SA 2CAVA 5FQ0B 4I30A 3POYA 4OULA 1LOAA 4P00B 5FYIA 2ZAHA 3U1XA 4S2HA 2ZGRA 1SMVA 1OA3A 4HSLA 4XXPA 2F6BA 3SH4A 5BYNA 3ATGA 1EP0A 2D6PA 4XCBA 5FY0A 5LK7B 1H2LA 4PT6A 4IV3B 4TTGA 1JHJA 1NCRC 1X8MA 2A6VA 2YUEA 3OEAA 5IVFA 3SMHA 5GZGA 2JXAA 3URFA 2AENA 1PVC1 4LLFA 1UAIA 3MPPG 5JSOA 4FOVA 3M3CA 4AE2A 2MEV1 3I2IA 1RHI3 4NAMA 1KDKA 3POJA 4ITCA 5F5AA 3VGIA 1MEC1 1RGSA 4LITA 5DG2A 2X09A
chains in the Genus database with same CATH topology
1V0AA 1WCUA 4YW7A 3ORJA 4LK7A 2O14A 1OKOA 1WZXA 3ZYHA 4BQ2A 2LROA 2JWPA 4BQ5A 4BQ4A 1WMXA 3UT0A 1W8UA 5D21A 3ZYBA 4BQ3A 1GWKA 4CPBA 1W8WA 4AL9A 4CPBD 1GWLA 2Q1FA 4LKFA 1GWMA 1W8ZA 4LK6A 3F95A 2K46A 1L7LA 1HN0A 4A6SA 4LJHA 4LKEA 2KR2A 2WYFA 3ZYFA 1OH3A 1W90A 2LRPA 4LKDA 2C24A 2VXJA 4YW6A 1W8TA 4YWAA 1W9FA 4CP9A 4CP9B 1UOJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V0A A;  1WCU A;  4YW7 A;  3ORJ A;  4LK7 A;  2O14 A;  1OKO A;  1WZX A;  3ZYH A;  4BQ2 A;  2LRO A;  2JWP A;  4BQ5 A;  4BQ4 A;  1WMX A;  3UT0 A;  1W8U A;  5D21 A;  3ZYB A;  4BQ3 A;  1GWK A;  4CPB A;  1W8W A;  4AL9 A;  4CPB D;  1GWL A;  2Q1F A;  4LKF A;  1GWM A;  1W8Z A;  4LK6 A;  3F95 A;  2K46 A;  1L7L A;  1HN0 A;  4A6S A;  4LJH A;  4LKE A;  2KR2 A;  2WYF A;  3ZYF A;  1OH3 A;  1W90 A;  2LRP A;  4LKD A;  2C24 A;  2VXJ A;  4YW6 A;  1W8T A;  4YWA A;  1W9F A;  4CP9 A;  4CP9 B;  1UOJ A; 
#chains in the Genus database with same CATH topology
 1QQP 1;  4Y1U A;  3HNM A;  2GME A;  3LIG A;  1W28 A;  1A3K A;  2JDH A;  3KM5 A;  5FZO A;  4Q4X 2;  3HT2 A;  3AYA A;  3DXU A;  3ZXF A;  4N7U A;  3VD3 A;  4CCD A;  3M3I A;  5CU1 A;  3HOB A;  5A6Y A;  1V70 A;  1HQN A;  3SH3 A;  5C9A A;  4D8M A;  4Q4V 2;  1PMH X;  3FWE A;  5IUQ A;  1NUK A;  5ACA 1;  1QF3 A;  4FPY A;  4E4H A;  4ES8 A;  1NOV A;  3T1M A;  2BZD A;  4EZH A;  5M0T A;  1H1M A;  2RS5 1;  4I01 A;  1XE8 A;  1IKP A;  3LA3 A;  2DCJ A;  2QZ3 A;  3LGR A;  1GYK A;  5CBL A;  3KQ4 B;  4LPL A;  4XEZ A;  4Y4R A;  5DQ0 A;  3HD8 B;  4AHX A;  4CUG A;  5EJ3 A;  2PHT A;  3HR9 A;  4HON A;  4HAN A;  1UMH A;  2ARE A;  2ORX A;  1ASJ 1;  1WLW A;  2V4A A;  2RM2 2;  4XDO A;  4YRD A;  4JDO A;  1UXZ A;  3LEG A;  2H0V A;  3M3E A;  2CWS A;  4NID A;  2D97 A;  4YLZ A;  3H3L A;  3RS6 A;  4ONU A;  3ALQ A;  5CA6 A;  5JOZ A;  4GAL A;  1OUR A;  3OPT A;  4LK6 A;  2X10 A;  3PUI A;  4JGZ A;  4IL7 A;  2Z4F A;  2R0F A;  2OZ6 A;  3GJA A;  1LOF A;  3J8F 1;  4W6X A;  2W87 A;  3W5N A;  1CAW B;  1UZW A;  3GBG A;  4N9H A;  4AQS A;  1ZA4 A;  2E51 A;  4EWD A;  4R9D A;  4WVM A;  2VCB A;  4RHV 3;  1QDC A;  2BFU S;  3PUS A;  5B4X A;  3FX3 A;  1MS1 A;  4NRQ A;  2K9Z A;  3T0A A;  1KRI A;  2YGM A;  2WS9 3;  3WD5 A;  1GKB A;  4RQP C;  2ET7 A;  4YGC A;  1W06 A;  3MYX A;  1W99 A;  4XZP A;  5FO9 B;  4OQ8 A;  1LOD A;  5HBA A;  4CCN A;  1V6I A;  3VUO A;  3H8O A;  3I59 B;  1RUD 2;  5ANQ A;  5F1R A;  5IVJ A;  4ZY9 A;  4N90 A;  3Q8E A;  4UFM A;  1AR9 1;  1HN0 A;  5FAX A;  2KR2 A;  2LRP A;  4YNI A;  2PAK A;  1Q8Q A;  4PIY A;  1ULF A;  4RGK A;  2XJU A;  3RYR A;  3LQC A;  3VBR C;  4DPN A;  2IC1 A;  2QQW A;  1SLI A;  2WA4 A;  4AXO A;  4DB5 A;  4CU8 A;  4MHR A;  5GKA C;  2OII A;  2VVE A;  3AC0 A;  2VH9 A;  3HMY A;  4YVW C;  4IEQ A;  2HWC 1;  4A6O A;  4DFS A;  4A2U A;  5FZO B;  3MLK A;  2V4V A;  1VBE 2;  1J3P A;  5FXX A;  1ND3 A;  1YI7 A;  4MVT A;  1VRH 2;  1W3V A;  1AR8 1;  2RJ2 A;  3VD7 A;  3C7O A;  4EE2 A;  2VCA A;  4Y22 B;  3WHU A;  4IE6 A;  2D6K A;  4AHZ A;  1YWK A;  1A8D A;  2YY1 A;  4QPI A;  4BU2 A;  4FFH A;  2Q1M A;  2RS1 2;  1S0J A;  4N8M A;  5BNN C;  2B5H A;  3VBO B;  2QTW B;  2WAA A;  3BIE A;  4UXA A;  1SBF A;  2J1T A;  4OUS A;  2C1F A;  2WO2 A;  1O5U A;  2QQM A;  1C8M 2;  3N36 A;  3NKG A;  2DCT A;  4LO8 A;  5LK5 A;  4MGK E;  2BV4 A;  3GZT B;  3THC A;  3WF1 A;  4NJ4 A;  1SBE A;  1HDK A;  5FY1 A;  5AVP A;  3VZO A;  3ZN4 A;  1HW5 A;  3QBQ A;  5A33 A;  3ZIX A;  3ZKU A;  1IPJ A;  1CVN A;  1CN1 A;  1Z7S 1;  5FLH A;  5IAV A;  2VPV A;  5FO8 B;  3WQ1 A;  4XAE A;  3JQX A;  1R08 3;  1CZV A;  3QH6 A;  5CYY A;  5FPL A;  1ZRI A;  3KF3 A;  4NE9 A;  3RDI A;  4XF4 A;  5F5Q A;  2C26 A;  3PNA A;  4AEK A;  5CZK A;  1GIC A;  4LLO A;  2JJ6 A;  3VB9 A;  5ABJ C;  1OMI A;  1SHW B;  2ARX A;  2OPK A;  3FE5 A;  4FOQ A;  2A73 B;  1LEC A;  4YM1 A;  4ZKT B;  3OY8 A;  4GH4 C;  1PM7 A;  1GQH A;  1KD7 A;  2CHH A;  2Y60 A;  4KGQ A;  2H6B A;  2E7T A;  2E63 A;  1ZZB A;  3ORJ A;  4WV8 A;  5HCF A;  5FBJ A;  3ZXA C;  2QQN A;  5A7P A;  2XH6 A;  1NCR A;  4IV1 A;  1OOP B;  2JIJ A;  1ZRR A;  1FXZ A;  2VZS A;  5FZE A;  5C8C B;  1UD1 A;  3JZV A;  3U07 A;  3O1S A;  1OLQ A;  4BJ0 A;  1BBT 3;  3WOG A;  5A6Q A;  4AF9 A;  1UY2 A;  1H2K A;  1YO8 A;  3AP4 A;  3VBU B;  1EV1 1;  3RWN A;  3WNM A;  2XKP A;  3N7M A;  1AZD A;  2W92 A;  5BPX A;  4UT5 A;  3WZ1 A;  5DXD A;  3I2K A;  1AVB A;  3RJR A;  4AFM A;  1PO2 1;  1ENQ A;  3BI3 A;  4XHB A;  4FCA A;  2FZ2 A;  2D98 A;  4JKK A;  4UFJ A;  2PQQ A;  4OCT A;  2JG9 C;  4Q4Y 1;  2IXK A;  1TEI A;  2CGO A;  4EJR A;  1URX A;  1K5J A;  2DUR A;  3SH5 A;  5C5U A;  2ZEW A;  1VBD 2;  3MUY 1;  5DUX A;  1GZT A;  4YM0 A;  2JDU A;  4Q0S A;  2B9U A;  5FY5 A;  2XON A;  4FXK B;  4A44 A;  3UNP A;  1WMX A;  5DAX A;  1RUE 1;  4OUM A;  2A3Y A;  2J1A A;  4J25 A;  5C5T A;  2NN8 A;  4I2O A;  1IS4 A;  2KXL A;  2XXZ A;  1G6N A;  4H55 A;  4PQ9 A;  1ULE A;  5CB7 A;  1DQ6 A;  4DIQ A;  4YGE A;  2JG8 B;  3MIH A;  1QJX 2;  1GZW A;  5ERL A;  1AX0 A;  2J1S A;  4QPI B;  1MZE A;  1SFY A;  5FP8 A;  1M4W A;  3BIW E;  5I93 A;  1NY7 1;  3CMG A;  4L8Q A;  1APN A;  5HV4 A;  2ZTN A;  2Y6F A;  3SLI A;  2DDU A;  4KU7 A;  2D3R A;  2JB8 A;  3LEI A;  4CEW C;  1W6O B;  3GHN A;  2LTN A;  1WKY A;  2JDA A;  2DUQ A;  2XML A;  3ON7 A;  3SKJ E;  1NT0 A;  1YFW A;  4XZU G;  2Y6H A;  3Q8B A;  3T2T A;  1GOG A;  2O8O A;  4DUV A;  3N9N A;  4IGQ A;  5FOJ B;  4OI4 A;  3WDU A;  2CDO A;  4QHB A;  1R09 1;  4X8N A;  2WNO A;  5G05 L;  2JEC A;  5GAL A;  2Z79 A;  1W6Q B;  3KB5 A;  3Q8C A;  1Y9G A;  3U0Z A;  2XL9 A;  2VW1 A;  4AAX A;  4IEP A;  2Y6L A;  5T54 A;  2DBN A;  4JGY B;  1IPS A;  1FPN 3;  2G9Z A;  4XDQ A;  4EZ4 A;  4LXL A;  5L9V A;  3WG3 A;  3OBT A;  4P02 B;  2VOK A;  4BIS A;  1ULD A;  2C4X A;  4B4Q A;  2FCT A;  4OYU A;  4RQP A;  3HNY M;  4IXL A;  4I09 A;  1OUS A;  3LSE A;  1POV 0;  2PLV 1;  3OY8 B;  1X33 A;  2VTX J;  2GMP A;  3RGB A;  1W2O A;  1FOD 2;  4NII A;  4AR2 A;  5EFU A;  1HXS 1;  3RG0 A;  1N47 A;  4XQW A;  4I0B A;  1C28 A;  4BQ2 A;  3KQR A;  2ERF A;  5BUV A;  5DZE A;  1VB4 A;  4IV1 B;  4O7X A;  1VBA 1;  4CDU C;  3NO8 A;  3B00 A;  2VZR A;  4RS5 B;  1OA4 A;  1FI2 A;  4AL9 A;  2V5D A;  4N53 B;  2VW2 A;  4KG8 A;  5BXX A;  1OVP A;  1AL2 2;  1JI6 A;  2D7F A;  1C8N A;  1JUI A;  4QPY A;  5D1I A;  5JI7 A;  4D0Q A;  2KM2 A;  3NV1 A;  1GNY A;  4GWN A;  2CNA A;  4YVW A;  1TME 1;  1UQX A;  4LR4 A;  3T4V A;  5FFO C;  2W1S A;  4NHY A;  1IS5 A;  1K5M B;  2Y34 A;  1ZVF A;  3MBW A;  1TMF 2;  5IFT A;  4JKL A;  4WBB A;  3MFA A;  5C3O A;  1OPO A;  4PIZ A;  1BVP 1;  4K8F A;  5F2S A;  4BQ4 A;  2W5F A;  1RC6 A;  1XNC A;  2YMZ A;  1V6O A;  2YZ4 A;  4P5H A;  3PL0 A;  4WM8 B;  3ZR5 A;  4ASL A;  3KT4 A;  1K45 A;  4AVA A;  1IHM A;  3CIH A;  5BNN A;  5J48 A;  2EF6 A;  1GZW B;  4M3C E;  1VBC 3;  4PLN A;  1WW4 A;  4LIU A;  2DVG A;  1IG3 A;  1OH3 A;  1RUH 3;  4P9Y A;  5JPN B;  3V0B A;  5JVV A;  4M3C A;  4LHN A;  2D3S A;  4XFH A;  3ZLI A;  1UOJ A;  1XBF A;  2KA3 A;  3CKH A;  4AGR A;  4PBO A;  5APA A;  1VAK A;  5AC9 2;  2D40 A;  4FP3 A;  5FUI A;  5A3O A;  1YLL A;  3H7J A;  5A1L A;  2LRO A;  1JUH A;  1OLM A;  3BOW A;  2H0B A;  2WNV C;  3OBZ A;  4XUP A;  3MHZ A;  2WT1 A;  4U36 A;  4YYO A;  4BOW A;  4XBN A;  4CDW C;  2G19 A;  1FT9 A;  1RB8 G;  3RQ0 A;  3TAY A;  2AR6 A;  1RJ8 A;  1EUT A;  2BW8 A;  1PNF A;  4UW5 A;  5DDJ 1;  1ZRC A;  5FZL A;  3ZN6 A;  3AFG A;  4ZS2 A;  1G9C A;  1KFX L;  2R04 2;  4XBL A;  4JZR A;  2HKX A;  1HIX A;  3FLP A;  4MH0 E;  4UBH A;  2FDF A;  4BME A;  1AR6 3;  2HJI A;  2JD4 A;  2ZA9 A;  5C33 A;  3LCP A;  4IEX A;  1RYY A;  4Y3O A;  2XR4 A;  5I8T A;  1OFS A;  4CDX C;  4N7I A;  4HOO A;  3ZSK A;  5G04 L;  4IEV A;  1JOD A;  1UOG A;  3K3N A;  2OVU A;  3WY6 A;  5FLJ A;  1GNH A;  2JIG A;  1NG0 A;  2RJK A;  1K3I A;  3AP7 A;  5A7O A;  2B46 X;  4HT1 T;  4QPG C;  3T30 A;  5C71 A;  2J7M A;  3RSJ A;  3MUZ 1;  4OMC A;  5C3R A;  3N9P A;  4YG6 A;  1RHI 1;  5IYY A;  4OUE A;  1O8S A;  2JG9 A;  3KHB A;  4C91 A;  2JDP A;  1BCX A;  3WLU A;  1MS8 A;  3NJX A;  1UPI A;  4CZS A;  4YW1 A;  2VZ1 A;  1EY2 A;  3UGG A;  5JSR A;  4K7J A;  3PVO A;  4QB1 A;  4LNV A;  3WG4 A;  5JDB A;  4COU A;  4JAA A;  1COV 2;  4XC9 A;  2HWE 2;  4JRA A;  3A22 A;  1NA1 C;  2BVV A;  2VOW A;  1W8O A;  1ZBA 3;  2G1M A;  3ACL A;  3AVS A;  3USS A;  3CU7 A;  4IEO A;  5K7P A;  4AGG A;  4Q4X 3;  3WNN A;  4LHS A;  2Q8C A;  3WEZ A;  3KCX A;  3HQX A;  2HYX A;  3UK9 A;  4LBQ A;  4W6Y A;  4J1X A;  4YW4 A;  5FP4 A;  3WX5 A;  1C57 A;  4B1L A;  4Q4V 3;  2FQP A;  3DYO A;  1US2 A;  2W39 A;  4C1W A;  4CEW A;  3WG1 A;  3D8C A;  5FZG A;  1W2U A;  2QNK A;  3KD4 A;  4N43 B;  1J83 A;  3U75 A;  1UX6 A;  3DYP A;  4N9I A;  5CIS A;  4WM7 B;  1MQT B;  1G9A A;  3FUO A;  2JKB A;  1JYT A;  4XTP A;  1WCD J;  4EQV A;  3ABZ A;  3GDB A;  5LWB A;  2NYY A;  2JWP A;  4F8A A;  3T09 A;  2DFB A;  1B35 B;  2RM2 3;  2WLP A;  2HH9 A;  5C7G A;  1XC6 A;  1HRV 2;  1PHM A;  4Q26 A;  1RVF 2;  1UKR A;  3D3A A;  3VKO A;  5JOW A;  3ZXG A;  5GLV A;  3WSO A;  3NST A;  4Q1P A;  2B42 B;  1UU4 A;  2DCK A;  3D6E A;  3ZPO A;  1O3Q A;  4XUR A;  2Q4S A;  1LHU A;  3C8X A;  3VDD C;  1ST8 A;  3K3O A;  1SFN A;  3KV4 A;  4HN1 A;  4PLM A;  3BGA A;  4CP9 A;  2WQ4 A;  2ZBJ A;  4XFB A;  4J6G A;  5F7U A;  4CDU A;  3IAP A;  5DZG A;  2BBA A;  3VZL A;  2P5B A;  5E6H A;  1BJQ A;  2RVA A;  4LE4 A;  3O0X A;  4IEY A;  1CAU B;  2D6O X;  2JIC A;  3L9J T;  5FMO L;  3JU9 A;  2QJV A;  2ID4 A;  4NHL A;  2W0X A;  2A6W A;  4O9E A;  3UGF A;  4FPG A;  4OHY A;  1RUD 3;  3AB0 A;  1KXG A;  4COZ A;  5J09 A;  1JZ8 A;  1GQG A;  2UY9 A;  5GM0 A;  4HMZ A;  3SKV A;  5D2A A;  2X29 A;  5JIU A;  3NAP C;  2GP5 A;  1DGR N;  1WME A;  4PDW B;  4ERO A;  3W21 A;  5LW9 A;  1RL3 A;  2SLI A;  2W91 A;  1JZ2 A;  2FMD A;  4ZU5 A;  4M00 A;  4TXW A;  4AAP A;  2SBA A;  1LRH A;  3I2D A;  3AZW A;  3KF5 A;  2BGO A;  1GR3 A;  1H6Y A;  2WZR 2;  4CCO A;  1E5I A;  1LGB A;  5A32 B;  4V2V A;  1AXY A;  1YQ5 A;  3AVR A;  3NW4 A;  2IFR A;  3BVC A;  4G4F A;  2WDB A;  3VBS C;  3ZYB A;  1KFU L;  4EN9 B;  3EJK A;  1XU2 A;  2RS3 1;  5KHG A;  1VBE 3;  3CJI B;  3TEX A;  3POE A;  1LHW A;  1MR5 A;  1OSG A;  2UY8 A;  4CUA A;  3AP9 A;  5D8A B;  1NXD 1;  2CV6 A;  4HL0 A;  4AI8 A;  3HBK A;  2YC4 A;  4DRR A;  1LOB A;  3IDB B;  4FO9 A;  1SZB A;  1RIR A;  1RUG 2;  4Y20 A;  1N1V A;  2DTW A;  1X50 A;  3PVE A;  2RR1 2;  2RS1 3;  4CEY B;  2OA2 A;  2ZAB A;  3DKQ A;  5FPX A;  3B9C A;  1ZRD A;  3DPR A;  4BIF A;  3RFR A;  1QJY 2;  1J3R A;  3K75 B;  1DG6 A;  4OMD A;  5FBZ A;  2R6Q A;  4XTM A;  3ZFG A;  2PAE A;  3V56 A;  1C8M 3;  1UYZ A;  1R08 1;  4CDW A;  3KWV A;  2UYA A;  3SNM A;  2P6C A;  1QDO A;  3TWI A;  2IWG B;  4BCU A;  3VBH C;  3I3D A;  5FUN A;  4BWO A;  4EN7 B;  1NYW A;  5HCA A;  2ZGK A;  5GZF A;  1F2N A;  4LUM A;  3WV6 A;  5K0U A;  1QJF A;  3CDZ B;  3EYP A;  4LJH A;  4U2A A;  3TBD A;  1R1A 1;  1G9F A;  1EYB A;  1F35 A;  5FWE A;  3TN9 1;  4Z1V A;  1S2E A;  4XE9 A;  4Y1X A;  3WNX A;  5L7O B;  1X36 A;  4KMQ A;  5DPN A;  4CDX A;  1V9U 2;  1AX1 A;  3QH7 A;  4FXG B;  2XVL A;  4CP9 B;  1JZ7 A;  1J1T A;  4YZ3 A;  1H30 A;  5BNO B;  3W58 A;  4MGQ A;  3WNL A;  1AR7 2;  1C3H A;  1LCL A;  1BBT 1;  1YQ2 A;  2E26 A;  2W47 A;  1YXW A;  3AL6 A;  3TOJ A;  2E6V A;  1IGO A;  3ZX7 A;  4CUC A;  1FNZ A;  1C1F A;  1CQ9 A;  1QJE A;  2PN5 A;  5HPO A;  2QDN A;  5T5O A;  4IE7 A;  4Z2A A;  1LED A;  1WBL A;  1WGP A;  2WZE A;  1REE A;  4KH9 A;  1UOB A;  2K46 A;  2CGN A;  4TYS A;  5I0D A;  4NPL A;  2B39 A;  3FUQ A;  1UZZ A;  1XPW A;  3ZPY A;  1N3P A;  3RJ2 X;  5JXI A;  1W0P A;  2NPI A;  1XJA A;  4QX7 A;  4CCJ A;  4CDQ C;  4V2W A;  2ZGM A;  1W05 A;  5FZ0 A;  2D5F A;  1IS3 A;  3SEP A;  1S0I A;  4QQO A;  5FYS A;  3I3E A;  4X6Q B;  4QPW A;  3POF A;  1G7Y A;  1POV 1;  2CU5 A;  4SLI A;  3OD4 A;  1Q8P A;  4E4S A;  3LE0 A;  4Q2F A;  5CFC C;  4Y5S A;  3BTX A;  3RZL A;  1VBD 3;  4JQR A;  3HIF A;  4JVA A;  3WXP A;  2O1Q A;  4XFI A;  1HRI 1;  3VDB A;  4DXT A;  3T2Q A;  5A3M A;  3AZX A;  1RMU 2;  1OKQ A;  5EPA A;  3SCF A;  1F4H A;  1W8Z A;  4BLJ A;  5LZ6 A;  1O4Z A;  3N7L A;  1JH5 A;  5A7S A;  4HKL A;  2YBK A;  3OPW A;  4P9I A;  1QJX 3;  2VQA A;  4AQ6 A;  2FDG A;  2BP6 A;  3MZH A;  4LKS A;  2X5I C;  3U4S A;  3I8T A;  4PF5 A;  1JMU B;  5KC5 A;  1W9F A;  1DIW A;  4B29 A;  3DPR B;  3NNL A;  3H3Z A;  2GND A;  1UU5 A;  1UY0 A;  2E33 A;  1GSL A;  2XDV A;  2XHK A;  2Z2S B;  4Q0P A;  1SAC A;  4RR3 A;  5FZB A;  3ZFG B;  2EAK A;  4QXB A;  1SPP A;  1ODM A;  1UL9 A;  2OQ6 A;  2VNR A;  4D3W A;  3O1O A;  4E2G A;  1FPN 1;  1RIT A;  2NM1 A;  1QHD A;  3NWK A;  2IXL A;  3NJY A;  3P3N A;  2J1U A;  1GP4 A;  1QH7 A;  2VZP A;  2WWJ A;  4XIO A;  3CZU A;  4Y24 A;  3N3H A;  3VDD A;  4Z92 B;  3AYD A;  4NUB A;  4UFI A;  5K0U B;  1I6X A;  2ET1 A;  1PGW 1;  1STM A;  1ULO A;  1VMH A;  2VZQ A;  2V73 A;  2GNB A;  3AX4 A;  4XQD A;  5IAX A;  3M3Q A;  4MGZ E;  4D94 A;  1PK6 B;  1YCI A;  2HYK A;  2P1B A;  4LA2 A;  5FYY A;  3VKF C;  3M70 A;  3ZSJ A;  4CU7 A;  3H8R A;  3H3U A;  4R52 A;  4AFA A;  1VP6 A;  2VO5 A;  5H9S A;  4A3X A;  4HPK B;  1VAV A;  3H42 B;  2VMI A;  1XNK A;  3SCH A;  4AVV A;  1ZYB A;  1FOD 3;  1OI6 A;  2GDF A;  4V1P A;  5EJZ B;  5BY5 A;  2WT2 A;  1HB2 A;  5A80 A;  2WT0 A;  1ALY A;  3LSD A;  3ZYI B;  2UWA A;  1I5P A;  1ND2 C;  3NAP A;  3O5S A;  1ZA7 A;  2XJS A;  1DCS A;  1XNT A;  1PIV 2;  4UYB A;  1FNY A;  3AKT A;  3MIC A;  4XYX A;  5I0R A;  2VQ0 A;  3FN9 A;  1NQD A;  1HX6 A;  4ATF A;  1RXF A;  1AL2 3;  4CRQ A;  3WF2 A;  1AXZ A;  4COY A;  4XPV A;  2Y33 A;  5F3E A;  3UET A;  5E1R A;  1CAV B;  4DY5 A;  1GUI A;  1N1S A;  3VBS A;  3OCP A;  5EZW A;  3GZE A;  1K42 A;  1TMF 3;  3UJQ A;  1I5Z A;  5FYM A;  2WKK A;  1X9T A;  5L19 A;  2NLR A;  2OT7 A;  1VLN A;  1ZBE 2;  2DVA A;  3TEW A;  1VBC 1;  2ZOE B;  3HBZ A;  1MZ6 A;  1RUH 1;  2P37 A;  2X53 S;  2VG9 A;  1AR9 2;  4M4P A;  1BLZ A;  2DBI A;  1GOH A;  3UKT A;  4B4P A;  1PGL 2;  4LBJ A;  3I2J A;  4CCK A;  5CFD B;  2W2I A;  2FDH A;  1K12 A;  1W6N A;  4EN6 B;  2OUH A;  3K4Z A;  1ULP A;  4YW6 A;  2LW8 A;  1UZ0 A;  3JUU A;  5FUP A;  2BU9 A;  1AJK A;  3VZJ A;  4BIO A;  2VMG A;  4GB3 2;  2HWC 2;  3AJY A;  5FZ8 A;  2VUA A;  4C0H A;  3VBH A;  3ZXK A;  4RR3 B;  3S5A A;  2BFU L;  2YBP A;  3KZ4 C;  1SPP B;  3PUH A;  5A7W A;  1BK0 A;  2JB4 A;  3RZM A;  1AYN 2;  3N9M A;  5AC9 3;  5JOY A;  4QDR A;  1WA6 X;  3JD7 2;  3R6S A;  2XQR A;  2VEC A;  2XOM A;  4YG3 A;  2WFF 1;  3NNJ A;  3QD6 A;  3TNP B;  2DVD A;  2BOJ A;  2HBT A;  2DVF A;  3DN7 A;  4IUG A;  4DS0 A;  5A3L A;  2WNU B;  1RJ7 A;  2RJL A;  4HFS A;  3V0A B;  5K9Y A;  1S55 A;  3ZFE B;  1DZR A;  4YGD A;  4K6B A;  4DXZ A;  2VVF A;  5CIR A;  1PO1 2;  5JR7 B;  4E2Q A;  1DQ5 A;  2R04 3;  4AZZ A;  4QX8 A;  2RDS A;  4I0A A;  4YFZ A;  5J96 B;  5I0S A;  1ZRF A;  4BYY A;  2RG4 A;  5DUW A;  4KGG A;  1OQD A;  3SEE A;  2JE7 A;  3ETQ A;  3CQO A;  1YNA A;  3HEI A;  3R05 A;  2VMC A;  2G4I A;  1Z7S 2;  3VDA A;  1VMF A;  5LRS A;  5FZ1 A;  4K1Y A;  1YJL A;  2D6N A;  2JDK A;  3MIF A;  4MLO A;  1CR7 A;  1SQ4 A;  2Y26 A;  3ZXD A;  2LUW A;  1RUC 2;  4O65 A;  2A6X A;  4CPB D;  1O3R A;  3KLS A;  3I2F A;  4CDQ A;  1KGY A;  4W8J A;  1QJZ A;  3C7G A;  2GNM A;  2W52 A;  4S2F A;  5LCW L;  2CSG A;  2B45 X;  1N3O A;  4QX5 A;  1YFX A;  4ORF A;  1S0D A;  4PCR A;  5F6L B;  4OQ9 A;  3VLB B;  4L2N A;  4Z8B A;  1G9B A;  2R32 A;  3E5X A;  5CFC A;  1TG7 A;  1ZBA 1;  4MXW A;  3D4K A;  4YW7 A;  5T5P A;  3VBF C;  3ZN5 A;  5A6Z A;  5KHH A;  1ZZ6 A;  1VPH A;  2AAC A;  2IXJ A;  4YZ1 A;  1O4Y A;  1W04 A;  1COV 3;  5JZG C;  4BQ3 A;  3H50 A;  4Q4V 1;  2HWE 3;  2LAL A;  3MV0 1;  5FYC A;  5C9A B;  3SXW A;  2VM9 A;  5C4W C;  4XW3 A;  2HWB 2;  2P3K A;  1YHF A;  3E1F 1;  2X5I A;  4M01 A;  3TB0 A;  2VUD A;  1O91 A;  1WA4 A;  2NP0 A;  2BNO A;  2BWA A;  2R30 A;  4NRM A;  4ZXK A;  2EIB A;  3THP A;  4ARX A;  1L7R A;  2ZHM A;  3IB3 A;  1SCS A;  2BBV A;  3ZKY A;  2LM3 A;  1W03 A;  2DVB A;  3NQH A;  4Y26 A;  2RE9 A;  3OJB A;  2RM2 1;  1J1L A;  3I2O A;  2YU2 A;  5FP7 A;  5C3Q A;  3AP5 A;  3B9I A;  1NZI A;  2VE1 A;  2L9L A;  2ZZJ A;  3IN9 A;  1MS5 A;  3KGZ A;  3KT1 A;  3MFC A;  3MW4 A;  3AK0 A;  1DGR A;  4LA3 A;  1A34 A;  1BMV 1;  1BKZ A;  4A42 A;  3K48 A;  3PVN A;  4XBQ A;  4BK4 A;  2XLA A;  4LBN A;  1UNB A;  3T4H B;  3WCR A;  3ZSL A;  2IZW A;  4AW7 A;  4K9S A;  5K8S A;  4FTE A;  4LOS A;  4AVS A;  1EAH 2;  1XOY A;  1RVF 3;  1CPN A;  1S1A A;  4JGZ B;  4QQH A;  5E89 A;  5F3C A;  1YFY A;  5FV3 A;  2CWM A;  4QGN A;  2OYZ A;  3W5M A;  5H9R A;  4WVM B;  2ZKN A;  3LKJ A;  3WDX A;  4BHP A;  4QX3 A;  2JD9 A;  1DYO A;  4MHU A;  1H1I A;  4Y1Y A;  4ATE A;  2QQU A;  5A3N A;  2Y38 A;  5J3U A;  1JZ5 A;  1DQ4 A;  2JX9 A;  3R4D B;  1ND2 A;  4HVQ A;  4Y5T A;  4K3U A;  3RRD A;  2GN3 A;  1RUD 1;  1H8V A;  1NCQ C;  2VUJ A;  3PUR A;  4L92 A;  3VKN A;  4F7Z A;  4JKM A;  4NHX A;  5JXH A;  3NNG A;  3OYW A;  4QXK A;  3WG2 A;  2WO7 A;  5I8Y A;  4BH9 A;  3ZXE A;  3RNS A;  3NNF A;  1PMI A;  2Q8D A;  2EA7 A;  3LF7 A;  4IEW A;  4ZZ5 A;  4ZZ8 A;  4MXV A;  4LKD A;  1OH4 A;  1OF4 A;  3FFQ A;  3MIB A;  3MGU A;  3LDK A;  1PMJ X;  2FCU A;  3K2O A;  1BEV 1;  2G9F A;  3LPG A;  4Q5O A;  2C5D A;  5JAX A;  4FFF A;  5JOX A;  2XJP A;  3ZYH A;  1VBE 1;  4DNY A;  4AEJ A;  2HEY F;  2Y0O A;  3O1P A;  4BXS V;  1VBA 2;  2H6C A;  4XIK A;  3WUD A;  2WZR 3;  4KI5 M;  4RN5 A;  1ND3 B;  2CYF A;  1X82 A;  3WW2 A;  3UL2 A;  2VBP A;  5LEJ A;  4GUL A;  2FDJ A;  1G8W A;  3GHM A;  3ZOI A;  1LOE A;  5GZC A;  2RS1 1;  2ZPX A;  5JXG A;  5JMC A;  2E53 A;  1GP6 A;  1UN1 A;  3WDV A;  4NPR A;  2VY0 A;  5KXE A;  1P8J A;  2AGS A;  5IK4 A;  1QNY A;  2HWD 1;  1C8M 1;  2R06 2;  1WLD A;  1RUG 3;  4GJY A;  1D2S A;  1GOF A;  2ARB A;  3E5Q A;  3NV4 A;  2RR1 3;  4CU6 A;  3S5Q A;  3WDY A;  2J1R A;  1YUD A;  5T50 A;  3BTA A;  4RA0 A;  4BQ5 A;  3NV3 A;  1QJY 3;  4HN0 A;  2Y64 A;  3ZFF C;  2VGD A;  3UKV A;  5A33 B;  5I91 A;  2W3J A;  1HB1 A;  3I97 A;  4CCC A;  2QQK A;  1DGW X;  5IHR A;  1HQW A;  2ZEZ A;  3TEY A;  5FZ7 A;  1TE1 B;  4IGO A;  1QY4 A;  3PIG A;  2QVS B;  3RZK A;  1MZF A;  3IPV A;  1EPW A;  4CP1 A;  1MAC A;  5JI9 A;  5LBE A;  3IZO A;  4IEZ A;  4AOC A;  4IND A;  2IXH A;  5I8S A;  1D2Q A;  2UWC A;  2HEW F;  1FAY A;  1XYP A;  3OUJ A;  4HK9 A;  1A6C A;  1XB9 A;  3SQO A;  4ASK A;  4XDP A;  1W6P A;  4OI1 A;  1V9U 3;  2PHR A;  4QB2 A;  1UZV A;  4YZ4 A;  2ZML A;  4ZXE A;  3GZU C;  2QDR A;  2R16 A;  4NWV A;  2Q8E A;  5FYH A;  5LAT A;  4S2D A;  1NCR B;  1JW6 A;  1D4M 2;  1UWW A;  3AP6 A;  1C1L A;  4R9A A;  3D5O A;  4AI0 A;  3MDP A;  1AR7 3;  1S2B A;  2P3Y A;  4ZON A;  4K8R B;  1YFU A;  4BQW A;  3CEW A;  5GLW A;  5DDJ 2;  1DDL A;  3ZDS A;  3VBR A;  2ATF A;  1YC6 1;  2ZAA A;  4NRO A;  4CU9 A;  3P6B A;  4Y33 A;  1XYO A;  4SBV A;  5CNA A;  2DYC A;  1QXP A;  3VBF A;  4B8E A;  2ZGU A;  2VD7 A;  1NE6 A;  3HN3 A;  4CCL A;  1LOC A;  5F5I A;  4DIN B;  4EWE A;  1VBD 1;  4NHM A;  4DXR A;  5KXC A;  4OHV A;  1DYP A;  2K2S A;  2HWF 2;  1VJ2 A;  3I49 A;  2KD7 A;  5GZD A;  3M1H A;  3K46 A;  2WL1 A;  3H8U A;  3WNK A;  2R49 A;  2DF7 A;  2VMF A;  5DAQ A;  5CG8 A;  3WF4 A;  3OG2 A;  4COV A;  2NMN A;  4LQR A;  2OW4 A;  5JWP A;  3O12 A;  2WII B;  3LA2 A;  1Z0H A;  3IMM A;  4PI2 A;  4UBG A;  2ZHN A;  4HET A;  5FTT C;  2TBV A;  4F83 A;  3ZR6 A;  3E5U A;  4ZS3 A;  1RMU 3;  1QJU 1;  3D82 A;  4YW3 A;  4QB6 A;  3DYM A;  4IDZ A;  3J7H A;  4HZF A;  5BV6 A;  1DLL A;  2ENR A;  4H7L A;  5A7N A;  2CL2 A;  2FHR A;  3DUI A;  3V64 A;  3LA7 A;  3LOB A;  1JYX A;  4K40 A;  1OC1 A;  1OF3 A;  2UWB A;  4M4R A;  4QM9 A;  1YIF A;  3MO4 A;  1BVV A;  3O1V A;  5FWJ A;  2WZ8 A;  1QOS A;  5F5C A;  1MPX A;  1W39 A;  1SLC A;  1SFP A;  4NIG A;  2JEM A;  3WDT A;  5L9R A;  4XAC A;  4P08 A;  1UU6 A;  4QDQ A;  4MV2 A;  4GJZ A;  2Q1F A;  3B5L B;  5ABJ A;  5LBB A;  2V72 A;  3AZV A;  1UOF A;  4BB3 A;  4PF1 A;  1E5H A;  1MS4 A;  4NPM A;  4QU1 A;  1CJP A;  4GH4 A;  2QQL A;  3KV9 A;  4Q4W 2;  1ENS A;  3S6P A;  2PAM A;  4L0P A;  5DAP A;  3VD4 A;  1OXC A;  3OGG A;  4RQP B;  1UY4 A;  3VKL A;  5IVC A;  1GMM A;  2XVK A;  1LGC A;  1FOD 1;  1UY1 A;  2A75 A;  3BPS A;  4JHZ A;  4LMF A;  1DZQ A;  2YRO A;  3AL5 A;  3WF0 A;  1NCQ A;  3LEK A;  4O61 A;  2O14 A;  3VD9 A;  3O14 A;  4AED C;  2R07 2;  1E5S A;  2DUO A;  2XLF A;  5HXM A;  4AEM A;  3MIE A;  4S2G A;  1XSQ A;  2GH8 A;  1RIN A;  3N9Q A;  4H7M A;  2WFP A;  4W6W A;  4I3G A;  3MF9 A;  1XNB A;  2VUC A;  4MZU A;  1AL2 1;  1X9P A;  3AXD A;  3GYD A;  3VBR B;  1LR5 A;  2I07 B;  2WYF A;  2F4P A;  5JIA A;  5CAD A;  1DQ1 A;  3PME A;  4UAP A;  3LOI A;  4XJA A;  4YVW B;  1PIV 3;  2XBO 2;  4E4Z A;  3THT A;  1H8T C;  1TMF 1;  3AYE A;  1YIP A;  1OQE A;  1EUU A;  3ACH A;  3OSD A;  4J1W A;  4AI9 A;  1KDM A;  2GC1 A;  2YC0 A;  2ETE A;  2VUL A;  3AMH A;  3WHT A;  1AYM 2;  5LA9 A;  2P34 A;  5DUV A;  2ZGQ A;  1Y9M A;  1YEW A;  4AQ2 A;  4Y1V A;  2TEP A;  1QXR A;  2BTV C;  4FPE A;  3KV6 A;  5BNN B;  3ETP A;  3F95 A;  1F15 A;  3FC0 A;  1WCQ A;  4ZU7 A;  4PI0 A;  1ZBE 3;  1JOP A;  4GXL A;  1U5Z A;  4IV3 C;  4XFC A;  4AK3 A;  5IAT A;  5IVV A;  4QGM A;  5EYX A;  1LHN A;  5JUV A;  1AR9 3;  2WJS A;  5FZM A;  1WW7 A;  3N9L A;  4AI2 A;  3AJZ A;  1SLB A;  3FBY A;  2GC2 A;  3V0B B;  4E27 A;  1T6G C;  3DEC A;  2YB7 A;  4M3C B;  5FYV A;  2BGP A;  3ZFF A;  4EYU A;  3F2Z A;  5AC9 1;  1V6N A;  3I7D A;  1DF0 A;  3ACG A;  4YSF A;  4YVS C;  1LHV A;  1E5R A;  4GB3 3;  4PIX A;  2HWC 3;  3IDE A;  5J7M A;  2ZX4 A;  2RS3 2;  4AG4 A;  4E4D X;  5FZH A;  2ZS6 B;  3I4I A;  2WAB A;  4QMA A;  5J98 B;  3WQ0 A;  4K20 A;  4HSJ A;  1RTV A;  1UCX A;  1AYN 3;  1LTE A;  1ACC A;  5FO7 B;  5A7Q A;  2WZP P;  5ABJ B;  4BM8 A;  4NWW A;  3RMY A;  5FJH A;  1W9Y A;  4RHV 1;  2WIN B;  3JD7 3;  5LBF A;  1UMI A;  4CXX A;  5B2G B;  3VHO A;  3ZN6 B;  4GH4 B;  2EIG A;  4GZ9 A;  1CES A;  1WD3 A;  4DOU A;  2WS9 1;  1RUI 2;  1W9W A;  1H2N A;  4MG2 A;  3ES1 A;  4KWK A;  2BOI A;  5FJK A;  5DN2 A;  5AFE A;  3J7L A;  3WUC A;  3IDC B;  2CY6 A;  4HG6 B;  3OOX A;  1W6M A;  3ACF A;  1PO1 3;  1XE0 A;  2W46 A;  1PM4 A;  3BCW A;  3SIS A;  3K51 A;  1MVQ A;  4LE3 A;  2ZGO A;  1ONA A;  5EXO A;  4CUB A;  3RMX A;  3MIG A;  3QCW A;  2YU1 A;  5CKN A;  1WBF A;  1Z7S 3;  3DXT A;  4JHT A;  5FYB A;  5IVE A;  4LO5 B;  3T2O A;  1BZW A;  3WP3 A;  3WF3 A;  1GV9 A;  1R1A 2;  4FPC A;  4OLL A;  2BER A;  4Q8L A;  3TN9 2;  2FCV A;  2JG9 B;  1RUC 3;  1C5H A;  1V6J A;  4YW2 A;  5JR2 A;  4MYE A;  1WW6 A;  1XNA A;  1U5I A;  2VXJ A;  2A6Z A;  3WNO A;  3AKP A;  3U11 A;  2JEN A;  3FLR A;  4AFD A;  1ZM1 A;  1S0B A;  3KVA A;  5L9B A;  1SEF A;  2EXK A;  4QHZ A;  1COV 1;  1LU2 A;  3RZJ A;  3O1M A;  2HWE 1;  2RMU 2;  1J59 A;  2UYB A;  5HV0 A;  3JBG 2;  3DV8 A;  2D93 A;  5A6X A;  3B69 A;  1QOT A;  1Q8O A;  2BNM A;  1L3J A;  1NLS A;  5JSP A;  2I2S A;  1Y43 B;  4UF0 A;  4XMI A;  4JDN A;  1FMD 2;  3UGH A;  2XPJ A;  4MGT A;  1NXM A;  2BWC A;  3CBN A;  2XL7 A;  4LBQ B;  2Q30 A;  1U0A A;  1VRH 3;  2B7Y A;  1ENX A;  3I54 A;  5FYT A;  4ET7 A;  2JDM A;  2ZCW A;  2HWB 3;  3L2H A;  4CEW B;  4QKF A;  4BMB A;  5IVB A;  1Q5O A;  1S0G A;  1FV2 A;  1C5I A;  5TSW A;  1YQ6 A;  1HB4 A;  3WIN E;  2VU9 A;  5ISL A;  3OD0 A;  2EAL A;  4OHZ A;  2BDR A;  4CXY A;  2WNV A;  1JYC A;  3PTR B;  4AVT A;  4AFC A;  4AQT A;  5FRA A;  2V09 A;  4CP0 A;  2EXJ A;  4YZ5 A;  4AGV A;  3GF6 A;  3UYJ A;  1HRI 2;  2PHD A;  1JYV A;  4XFF A;  1AHS A;  3VN4 A;  5DAW A;  3H0O A;  1RVF 1;  3GBF A;  1JU3 A;  1POQ A;  3OGS A;  4L11 A;  3NKT A;  2EID A;  1TQ5 A;  2ES3 A;  5DG1 A;  4HKW A;  2IXC A;  2D3P A;  4XUT A;  4A6S A;  5EJ1 B;  1SG3 A;  1V6M A;  3M7A A;  2AC1 A;  4FP2 A;  4YZ2 A;  4UFH A;  5EYY A;  1RED A;  1TZO A;  3Q8F A;  4P9W A;  1EAH 3;  2R1B A;  2YC2 A;  3VBO C;  3USU A;  3BU7 A;  2J22 A;  5FY4 A;  4AED A;  2ILM A;  1VAM A;  1PNG A;  1DGL A;  4FPO B;  3RI8 A;  1IOA A;  4LK7 A;  4CDU B;  5BNP C;  2WWU A;  5FDB A;  1V6L A;  4QPG A;  3VZM A;  5CEH A;  1R1Z A;  2W68 A;  3BKZ A;  3VHN A;  1F8V A;  1PX4 A;  1W2N A;  1CX1 A;  1UX7 A;  3W20 A;  1KQR A;  4XUQ A;  5FXV A;  1BK1 A;  3HQR A;  3ZSM A;  3OUH A;  1RUJ 2;  4K21 A;  4XAB A;  3O1R A;  1H8T A;  3J26 N;  1RUF 2;  1VBB 2;  5EIY B;  2ZAC A;  2ZX2 A;  3NNM A;  1H2M A;  2GMM A;  2W1Q A;  4XF0 A;  4EN0 A;  4DRV A;  4C0B A;  2YG0 A;  4LHK A;  2YDE A;  3OGV A;  5FPV A;  1NA1 A;  5FQ0 A;  2RDR A;  1REF A;  4FQ4 A;  2Y6K A;  4R9C A;  4AWD A;  2P4E A;  3O7O A;  4ARY A;  3KSC A;  2IVI B;  1JYN A;  2OZJ A;  1G86 A;  3PUQ A;  2NQY A;  3S7I A;  3ZMO A;  2R0H A;  5FPU A;  1OOP C;  1VBA 3;  1KEX A;  4FFI A;  5F39 A;  5C8C C;  3ENR A;  3N35 A;  3H1Y A;  4YAR A;  1PVC 2;  2AEY A;  4GWJ A;  3VBU C;  2ZX0 A;  2VTF A;  4NN0 A;  4PQQ A;  2MEV 2;  1IPK A;  1RUG 1;  2D6M A;  3VL9 A;  4IE4 A;  4Y20 B;  3RVH A;  5LY2 A;  4YVS A;  5LAS A;  1MEC 2;  5B4N A;  1J3Q A;  4YM3 A;  1QJY 1;  3ZMN A;  4UFK A;  3OGR A;  1SLL A;  1QQP 2;  2WNV B;  4KBZ A;  5FZA A;  4BE3 A;  4KWU A;  3EB7 A;  1S0C A;  5FK7 A;  2R06 3;  3PHM A;  2EVX A;  5CG9 A;  1DGW A;  4RD7 A;  1W8U A;  4CDW B;  2VJX A;  3I3Q A;  1ULC A;  1C4R A;  4FBF A;  4LHL A;  1QU0 A;  4H14 A;  2X8K A;  4FPK A;  5ACA 2;  3O1T A;  5H9Q A;  3LFM A;  2R1D A;  1MVE A;  1QOO A;  2RS5 2;  2CAU A;  4QKD A;  1AX2 A;  2ZXQ A;  1Y4W A;  2JG8 C;  2NZ9 A;  5T3N A;  4WVZ A;  5FZK A;  1CON A;  4B7E A;  5E8A A;  2A71 A;  5JXJ A;  1ZZ9 A;  2VNV A;  4MSV A;  3WP5 A;  4CDX B;  3LDR A;  5FY8 A;  3USU B;  3MF6 A;  4AYU A;  3VL8 A;  3OBR A;  1ASJ 2;  3C7F A;  4OZX A;  3IKW A;  3N4M A;  3BTZ A;  1AR7 1;  5DAV A;  2NMO A;  2YYO A;  4QPG B;  5ANN A;  1BYH A;  4OFG A;  4BXF A;  4O9G A;  1OVS A;  3HJR A;  1DFQ A;  3I2H A;  3AMP A;  2AUY A;  3Q9O A;  1X7N A;  2YPD A;  4URA A;  1IS6 A;  2HLE A;  2WFF 2;  1S0E A;  3DF0 A;  3JCI A;  4DEV A;  1D4M 3;  2BVB A;  2XKO A;  3VZN A;  3POW A;  3R4U A;  5F3I A;  2AYH A;  2D43 A;  1UY3 A;  3J8F 2;  3WR0 A;  4FAH A;  2VBB A;  2VC9 A;  4JGY C;  5DDJ 3;  5FIX A;  3VDC A;  2PXJ A;  4UFL A;  4YVS B;  2BNN A;  5HXV A;  4H3W A;  3VZK A;  3M2M A;  1NA1 B;  2XVG A;  2XWJ B;  3WNP A;  1DP0 A;  2WA3 A;  1YQ8 A;  4OHX A;  3I59 A;  5C3S A;  1UPS A;  2J42 A;  3ZYJ B;  4EN8 B;  1ENR A;  5J36 A;  2XGX A;  2ZGP A;  4FSJ A;  3HWJ A;  3TEZ A;  2HWF 3;  1D0G A;  1RMU 1;  5EQU A;  4IV1 C;  2C9A A;  1Y3T A;  2A5Z A;  4DQA A;  1F5J A;  2ZGT A;  4RS5 C;  3PU8 A;  4FQZ A;  4N53 C;  2PTM A;  1Q8S A;  4QX1 A;  4Y1Z A;  1QEX A;  1ZRE A;  1O4T A;  1NKG A;  2W9X A;  4G3Y C;  5F3G A;  2GU9 A;  3GAL A;  3AMQ A;  3AKS A;  3H1W A;  4HVR A;  1ZBA 2;  2XHN A;  4P5Y A;  2OUJ A;  4QWN A;  4QQL A;  2WN2 A;  1KS4 A;  1K5M C;  1CJD A;  3LB9 A;  4AFB A;  1WW5 A;  2ARC A;  1WZX A;  2VOV A;  3GBW A;  3ASI A;  2WUH A;  1YRZ A;  2YXS A;  4E2S A;  1VIW B;  2VR4 A;  1N3Q A;  3L2Y A;  1AR8 2;  1SDD B;  1UIJ A;  4Y22 A;  5FKB A;  4GKY A;  1RXG A;  3OF1 A;  1W0N A;  3CF6 E;  4WM8 C;  4XFG A;  3VDD B;  2PHW A;  3VBO A;  1AR6 1;  1A8M A;  2A70 A;  5FYU A;  5LY1 A;  2F4L A;  3C2U A;  4GWI A;  2K0G A;  3N9O A;  5FPB A;  3IM0 A;  5BNP A;  1LEM A;  4GIQ A;  4Q4W 3;  1BXH A;  3AM2 A;  3U4X A;  2WSU A;  4AHY A;  2ZHK A;  1OKO A;  1QKQ A;  4C1X A;  4GMP 3;  4CXW A;  3OPZ A;  1VMJ A;  3SIT A;  4HLT A;  4XVH A;  1PVX A;  4ASM B;  1BMV 2;  4CPB A;  4JX0 A;  3ITQ A;  2R07 3;  1DQ2 A;  1LU1 A;  2ZKL A;  2C0Z A;  2PYT A;  1F5F A;  1OA2 A;  1X8E A;  2YFU A;  4QQ2 A;  1I1E A;  3NAP B;  1WLT A;  4CCE A;  5FMD A;  3J7N A;  2VMH A;  1PIV 1;  2JKX A;  1VAL A;  1H0B A;  1YQC A;  2R7E B;  3CL1 A;  4Y5Z 0;  2F17 A;  2P3I A;  3DCQ A;  4YFW A;  1KJL A;  3KVB A;  2CDP A;  2WWS A;  4KNC A;  2XWB B;  1PGS A;  4HK8 A;  5L73 A;  1JN2 P;  3FMG A;  5IFP A;  5J1X A;  1XSR A;  3ZXL A;  3FHI B;  4H2A A;  1CIW A;  2XBO 3;  4Z82 A;  3VBS B;  4Q4X 1;  1OOP A;  5FMB A;  4UI9 L;  4LIV A;  3AYC A;  2IVJ A;  4L9B A;  3GM8 A;  3E6D A;  4QGL A;  4Z2W A;  1HLC A;  5C8C A;  1ZBE 1;  4XMA A;  1LB2 A;  5FLI A;  3TNQ A;  4UOJ A;  3A0N A;  1AYM 3;  2AEZ A;  3VBU A;  3ZSE A;  2VOT A;  4MUV A;  3RYP A;  1EV1 2;  1QGL A;  1O59 A;  2ZGS A;  1PGL 1;  1YJK A;  2VNG A;  3BUC A;  1ODN A;  3VHR A;  3I3B A;  4GMP 0;  4FOW A;  4JC1 A;  3NV2 A;  5KR7 A;  1PO2 2;  4QD2 A;  1I9R A;  1W6N B;  2YBS A;  4XQ4 A;  1ZZC A;  4IE5 A;  4Q4Y 2;  3OBA A;  1CZT A;  3FBM A;  5K4L A;  3MID A;  3WP4 A;  1BEV 2;  2A6Y A;  1ULG A;  2OXB A;  4FPF A;  4GB3 1;  4BA6 A;  1S4C A;  2VZV A;  4CE8 A;  3ZYG A;  3FHA A;  4TWT A;  4WVV A;  2Q8O A;  5KBF A;  3RZZ A;  2BRT A;  3VBH B;  3UKN A;  5A1F A;  5FKC A;  3UT0 A;  5F8P A;  1AYN 1;  4P14 A;  1DYK A;  1RUE 2;  5A7W B;  4FTS A;  3PMS A;  2JG8 A;  1W8W A;  3JD7 1;  3BN6 A;  3E6B A;  4L99 A;  4Q0U A;  3IDA A;  1OLR A;  2ZGN A;  4MET A;  2RS3 3;  5A3W A;  5LBC A;  3T0B A;  1LAJ A;  1JYW A;  1LOG A;  2YFZ A;  1U12 A;  1JS9 A;  4TLF A;  1S0F A;  5FP3 A;  3PVB B;  1HRV 3;  3VHP A;  4XJW A;  3ZYR A;  3BU0 A;  2VAU A;  1NY7 2;  4LUK A;  1HJG A;  2B8M A;  3E6C C;  2BUK A;  2Z42 A;  1OQ1 A;  3JQW A;  2HWD 2;  5BNP B;  1PO1 1;  1XRU A;  4KU8 A;  1W6O A;  4G9S B;  3KCY A;  4XF9 A;  2PEL A;  2JDN A;  2Q1Z B;  2VCC A;  3KCC A;  4CVU A;  4N43 C;  1EPZ A;  1RUI 3;  5DZF A;  4PLO A;  3POI A;  3FFZ A;  1MQT C;  4LOT A;  4WM7 C;  5T55 A;  5DUU A;  1OD3 A;  3HT1 A;  4Q29 A;  4FT8 A;  1CX4 A;  1GAN A;  1R09 2;  1YYN A;  3ILF A;  4D69 A;  4XET A;  1GWK A;  1ZNP A;  1W6Q A;  2VBD A;  4DUX A;  3POB A;  1RUC 1;  3BYW A;  1B35 C;  1TNR A;  4LKF A;  1F9K A;  4JGY A;  2Y6G A;  2EIC A;  4JTN A;  4NR1 A;  4C8D A;  1FYU A;  1GLH A;  2J1V A;  3DL3 A;  2CTV A;  4IET A;  5IVY A;  4CDQ B;  2XG3 A;  1JZ4 A;  2HBU A;  3AZY A;  5KHK A;  2DTY A;  1WLC A;  2JE9 A;  1D4V B;  1UYP A;  3B93 A;  4KL1 A;  4LOR A;  5FYZ A;  1R1A 3;  3B7M A;  1XU1 A;  2PLV 2;  3LEM A;  4M3C F;  3TN9 3;  5HCH A;  3NMB A;  2Z5W A;  5GZE A;  1ZZ8 A;  3ST7 A;  5CFC B;  4QXC A;  1HXS 2;  3S0M A;  1GP5 A;  4MXW B;  2QQJ A;  2HEV F;  1CD3 G;  2ZEY A;  3U37 A;  3GCX A;  1GQP A;  3MLL A;  2XQX A;  3RI9 A;  4RS5 A;  2RMU 3;  5CKM A;  3ZO0 B;  1VRH 1;  4N53 A;  5KHI A;  3RYK A;  2QQP A;  3JBG 3;  1H9W A;  2HWB 1;  1HV0 A;  3PTY A;  3WW1 A;  3C7E A;  5FY7 A;  2X5I B;  4M0H A;  3CZJ A;  1LES A;  3VKM A;  1WMD A;  2JDZ A;  1U5X A;  3LFI A;  5I0T A;  4AHW A;  1FMD 3;  4BPZ A;  1LUL A;  3OTF A;  1TME 2;  1W8N A;  1K5M A;  3KS7 A;  1OUX A;  3PIJ A;  3R0R A;  4LO7 A;  4Q27 A;  1AF9 A;  3K4A A;  1JHN A;  1CPM A;  2UU8 A;  3LAG A;  4JCK A;  2PHF A;  4PDW C;  3UJO A;  2DU0 A;  1W8F A;  4R4Z A;  1SBD A;  4LT5 A;  1POV 3;  3MV1 1;  4OVE A;  4KBB A;  4WM8 A;  1QIQ A;  1CIY A;  4D6Q A;  1OHF A;  5FZ6 A;  3TYJ A;  4UW3 A;  5F37 A;  4RGA A;  4BQX A;  3A0K A;  3W59 A;  1GWL A;  1N1Y A;  1V00 A;  3H7Y A;  4AI1 A;  1MZ5 A;  3PU3 A;  1HRI 3;  4OI0 A;  1WUV A;  5LRR A;  1EAH 1;  3CJI C;  1QJU 2;  4RFT 0;  2A3W A;  5GLU A;  2CGP A;  5IK8 A;  2DCY A;  2VCM A;  1UZY A;  3FZ3 A;  4FPL A;  4JTO A;  4MX3 A;  4QDS A;  4UW6 A;  2C24 A;  1TNF A;  5D8A C;  4LBO A;  4D6S A;  1JZ3 A;  5FK8 A;  4NO4 A;  4GA9 A;  3BTY A;  1WCU A;  2GAU A;  2IXI A;  3HQU A;  4LBM A;  5EHD A;  4CEY C;  1SDW A;  2VL4 A;  3PDQ A;  3ILR A;  4HKO A;  4XJZ A;  2GP3 A;  1WCS A;  1IQD C;  3AXE A;  1ND2 B;  3CNA A;  4XFA A;  5T52 A;  4BQY A;  1OT5 A;  3POS A;  2FD8 A;  5F6K A;  4CSW A;  3A7Q A;  3D0J A;  5CKQ A;  2JE8 A;  5FZI A;  2DFC A;  4XUO A;  4A7K A;  2WQZ C;  3OYW B;  4PHZ A;  1QNW A;  2GH2 A;  5EP9 A;  4Z07 A;  1B09 A;  3I2G A;  4D7S A;  5HCB A;  1WCK A;  4BLI A;  2RHP A;  4A7Y A;  1BQP A;  1RUJ 3;  1XQN A;  2VMD A;  3H8X A;  1XYN A;  1H6X A;  1RUF 3;  3T2P A;  5L7O C;  1VBB 3;  4NIH A;  1W9S A;  2WYS A;  4GAZ A;  5GJ6 A;  5H9P A;  1NLR A;  2GSY A;  5JZG A;  3KHC A;  2V5Y A;  4A7Z A;  3MLJ A;  3ILN A;  5C6C A;  5FZ4 A;  5LA0 A;  3BOP A;  5C4W A;  3U10 A;  1H1A A;  4PJY A;  1W9T A;  5BNO C;  4IQP A;  3LD8 A;  3LZZ A;  4E8D A;  3EHK A;  4JRL A;  2E7Q A;  3NRU A;  4OI2 A;  1QJX 1;  1ZX5 A;  1RHI 2;  2ZHL A;  4LUL A;  4W50 A;  3T08 A;  3ME2 A;  3WDW A;  3WT3 A;  3VV1 A;  4NVP A;  5FCC A;  3MW2 A;  3IBM A;  3RZG A;  4P9L A;  5E88 A;  2XJT A;  1PVC 3;  1LHO A;  1US3 A;  2P17 A;  3S30 A;  4AVB A;  3PLQ A;  1MS9 A;  2R06 1;  1H4H A;  3EQE A;  2MEV 3;  2QQV A;  2OX0 A;  4TZD A;  2EXI A;  2BEO A;  3FJS A;  5FZD A;  3T0D A;  4P9X A;  1RUO A;  2ZMN A;  1W2A X;  1MEC 3;  3MEP A;  3IWZ A;  3NJZ A;  1R64 A;  2C6S A;  1F31 A;  1QQP 3;  3EMR A;  4XJ9 A;  3I3M A;  4UW4 A;  1AUY A;  2I45 A;  1O6U A;  1S2K A;  2ZMK A;  2E7A A;  3HN1 A;  4FPJ A;  5T5J A;  3C7H A;  4RSU A;  5FXW A;  2PFW A;  3TRS B;  4E9K A;  5ACA 3;  3ZXJ A;  3WCS A;  3IPV B;  1Y9Q A;  1UF2 C;  4DEQ A;  2RS5 3;  1JOB A;  2QBX A;  3J7M A;  2E31 A;  4N43 A;  4WZC A;  5IK5 A;  2XUM A;  4WM7 A;  1MQT A;  5DMY A;  5HI0 A;  2PHL A;  1OLM E;  5C8W A;  2XJQ A;  4XF1 A;  3FHQ A;  3OB8 A;  1Q43 A;  2A1X A;  4XOG A;  4GKX A;  3QLQ A;  1W6P B;  3NJV A;  4GD4 A;  3KV5 A;  3DPR C;  3NVC A;  2I74 A;  3IT8 A;  1B35 A;  4YG0 A;  1ASJ 3;  1YI9 A;  1D4M 1;  4ISQ A;  4OHW A;  2B4K A;  3ZFG C;  1DBN A;  1NAE A;  4PBP A;  5CVR A;  1VR3 A;  4JV4 A;  4D7T A;  4XIL A;  3CO2 A;  1PZ8 A;  3WW3 A;  4CP2 A;  4RYD A;  1D0H A;  2DUP A;  2VME A;  5LA1 A;  4QX0 A;  5A3T A;  4RHV 2;  1Z78 A;  2BPA 2;  3MI8 A;  4IEU A;  2PHU A;  2MPF A;  3BPZ A;  2WFF 3;  4FI9 A;  2ORZ A;  4BDV B;  2WS9 2;  5K0U C;  3M8L A;  3VBF B;  3WP6 A;  4FAG A;  1G9D A;  1JZ6 A;  1KIT A;  5KC6 A;  3J8F 3;  3PUA A;  1HJF A;  1M06 G;  2O0O A;  4YGB A;  5JZG B;  1PK6 C;  2HWF 1;  2IUW A;  1OD5 A;  1UKG A;  3D0S A;  5FZ9 A;  1CWP A;  4X6R B;  2E32 A;  1JXN A;  3B94 A;  1CAU A;  2ADE A;  2GC3 A;  5C4W B;  2RDN A;  3G7D A;  2ZEX A;  4NHK A;  5IJR A;  5IWF A;  5C3P A;  1NZC A;  4IER A;  2GC0 A;  4KWL A;  2RV9 A;  1LJ7 A;  4MGS A;  4A3Z A;  4R8H A;  1CAX A;  2OS2 A;  2YV8 A;  3HAG A;  3R4S A;  1U5Y A;  1L7L A;  1VRB A;  1UMZ A;  4K1Z A;  2A7A A;  4XJU A;  5KXD A;  2W08 A;  5FMC A;  3GZA A;  5KWR A;  4QU2 A;  2O8Q A;  4PDW A;  2P6H A;  3O0W A;  2Y6J A;  3ELN A;  1ZZ7 A;  1LGN A;  4WZF A;  4P9J A;  3U78 A;  4QM8 A;  2WRA A;  4GWM A;  2GAL A;  1LKN A;  1QH6 A;  5A32 A;  4XUN A;  1JYI A;  5C70 A;  2XB6 C;  2QUO A;  2W1U A;  3CHX A;  3SCG A;  3N7K A;  4A41 A;  5A70 A;  5BNQ A;  1AXK A;  1UYX A;  1DZT A;  2QE3 A;  4NOT A;  5FZC A;  4TN7 A;  5I0U A;  4LBK A;  1GFF 2;  3CJI A;  4FVV A;  4ISR A;  3AZZ A;  3SC7 X;  4UWD A;  4DY3 A;  1DHK B;  3MW3 A;  5D8A A;  4QX2 A;  4CYD A;  1NX9 A;  1W0O A;  2DV9 A;  2BGC A;  2ZGL A;  4JDM A;  1AR8 3;  4LBQ D;  3LWC A;  3ES4 A;  4W65 A;  5E16 A;  5LB6 A;  4DMI A;  1RUN A;  1LNS A;  4Q4W 1;  2WAO A;  2R04 1;  4E8C A;  4TLG A;  1Y7B A;  1FAT A;  4CEY A;  2D5H A;  2WBK A;  5FR3 A;  5CFD C;  4IES A;  4GMP 1;  3WW4 A;  3POG A;  2B9V A;  2QCS B;  4QT6 A;  3RWK X;  1NQJ A;  3A23 A;  3K4D A;  4URT A;  4XJ8 A;  5LEK A;  1DLC A;  2OKX A;  1NCQ B;  2VZO A;  2R07 1;  2RDQ A;  2EAA A;  2VOX A;  2XUE A;  1R08 2;  3GJB A;  4MAD A;  3THD A;  5GLZ A;  2EXH A;  4FTB A;  4F3J A;  3H9A A;  4RR3 C;  2FDK A;  2VTX A;  3DEM A;  2ZJC A;  4Q1R A;  4RFR B;  4AI3 A;  2GZW A;  3DGT A;  3INA A;  5FPA A;  1KJR A;  3QOP A;  4LTA A;  4CA9 A;  2VVD A;  5L7O A;  3JB4 C;  3OUI A;  3ZYF A;  4D6R A;  2VZT A;  4IE0 A;  1A78 A;  1QWR A;  1OFN A;  1BHG A;  4ZU4 A;  1O5L A;  2WSV A;  2WNU C;  2XBO 1;  3AMN A;  3HPN A;  2BJS A;  4OZO A;  4B3N A;  2AZ5 A;  1O7F A;  3ZFE C;  4I3P A;  3X29 B;  1W3X A;  3N7J A;  3DKW A;  5BNO A;  3O1U A;  5FXZ A;  2VNO A;  1NLQ A;  4KWJ A;  1AYM 1;  1BBT 2;  1SLA A;  3GCW A;  1WWY A;  1XE7 A;  4LO6 B;  4Q0V A;  3LDB A;  3KT7 A;  5J37 A;  1D7P M;  4QAW A;  4DZG A;  2MHF A;  3PJY A;  4LBL A;  3G6J B;  4QHO A;  4FOY A;  2XJR A;  1CAX B;  1MS3 A;  1UYY A;  2N7G A;  4LEJ A;  1DU3 D;  1WD4 A;  1Q56 A;  3ECQ A;  3IMN A;  2VW0 A;  5EWS A;  4B7K A;  1V6K A;  3AKR A;  1JOJ A;  2ADD A;  1EV1 3;  3AKQ A;  5EV7 A;  4EWA A;  3P3P A;  1XND A;  2A3X A;  2BQP A;  4FFG A;  4TSV A;  2PQS A;  1PO2 3;  3O0V A;  2W94 A;  2QZ2 A;  4YM2 A;  3T1L A;  2FBE A;  4IGP A;  5FMO S;  3ZFF B;  2Z69 A;  1PX3 A;  2WNE A;  4L97 A;  4Q4Y 3;  4EV0 A;  2WN3 A;  1TVG A;  2P3J A;  1HKD A;  1E57 A;  1BEV 3;  2C9K A;  1OBN A;  1WMF A;  3ACI A;  1UO9 A;  3FLT A;  5KXB A;  1HQL A;  1HV1 A;  1CZS A;  1HRV 1;  1N1T A;  1QXJ A;  2WLQ A;  3A21 A;  4ZHN A;  1RUE 3;  3NL1 A;  1T2X A;  5AVA A;  3V65 A;  3CJX A;  4R4X A;  5C9A C;  4MGI E;  2VQT A;  5KHJ A;  5IW0 A;  1PZ9 A;  3UES A;  1SCR A;  1GZ9 A;  3FL7 A;  5T5L A;  1JTZ X;  1RUI 1;  4ZPI A;  4XHX A;  3GXU A;  3P1I A;  2WQ8 A;  3KMH A;  3K77 A;  1UXX X;  3E97 A;  3ZIW A;  1J58 A;  2E9Q A;  4HVO A;  4LO4 B;  3KGL A;  2HWD 3;  1HB3 A;  1PZ7 A;  2D6L X;  2Y8K A;  4GQ7 A;  1W6M B;  4DO0 A;  2PHX A;  4MOA A;  4FPH A;  2Q0A A;  3B02 A;  5D21 A;  3HNB M;  3M3O A;  5A1A A;  1FPN 2;  4NAO A;  1H9P A;  5GLT A;  1LEN A;  2W95 A;  3C3V A;  3P5B A;  2VZ3 A;  2LS6 A;  4M0N A;  5JLV A;  3RZH A;  1R09 3;  3CLP A;  4CCM A;  4JQT A;  1FX5 A;  4Q0Q A;  3U14 A;  3BAL A;  2TNF A;  4P9G A;  5JMO A;  4WVW A;  1MS0 A;  2ZX1 A;  1UIK A;  4QKB A;  3OEB A;  1PGW 2;  5SV5 A;  3WQB A;  5AFB A;  3APB A;  3EXU A;  2FZ1 A;  1PK6 A;  2UUR A;  4JGZ C;  4MO3 M;  4RGG A;  5FPZ A;  1JBC A;  3ROU A;  4Q8K A;  1IZ3 A;  1LOF C;  3JXS A;  5IK7 A;  5FY9 A;  1V0A A;  2Q5T A;  3Q8A A;  4HPK A;  2OQ7 A;  4IW3 A;  2ZX3 A;  3T3Y A;  2RMU 1;  2WZR 1;  2PLV 3;  2G9G A;  3ZDV A;  1UW8 A;  4RL7 A;  5F9T A;  5FZ3 A;  5FOB B;  3JBG 1;  2D44 A;  1HXS 3;  1DQ0 A;  5FZF A;  4NIA A;  3J4U H;  2P2K A;  1OPM A;  2PMW B;  4IV3 A;  2PA7 A;  2XLG A;  5F2W A;  1FMD 1;  1GWM A;  4KG0 A;  4YPJ A;  5JPM B;  4UF0 B;  2EIE A;  4X8P A;  5JCT A;  1L7Q A;  2VXR A;  5A3U A;  3J9S A;  3B01 A;  2FMY A;  1Q8V A;  2YGL A;  1NE4 A;  2GNT A;  3AFK A;  5FRE A;  5A3P A;  3GGL A;  4HBN A;  1GNZ A;  2ARA A;  3LPF A;  1W8T A;  2QQI A;  4NMI A;  3B3Q E;  4I0W B;  4XF3 A;  1CAV A;  2RR1 1;  2FDI A;  4B4R A;  2DWR A;  4C90 A;  2W1W A;  1TME 3;  2QQO A;  3IIA A;  3LIH A;  1XXN A;  2WO1 A;  2WO3 A;  1O3T A;  3III A;  3EBR A;  2VZU A;  2QKD A;  4QQP A;  3GNE A;  3M4F A;  2QFE A;  5LA2 A;  2J1E A;  3AMM A;  1F4A A;  2Y0I A;  3PJQ A;  3WVJ A;  4A45 A;  1CGP A;  5IT6 A;  3EO6 A;  1VBC 2;  3HVD A;  2DCZ A;  2DU1 A;  1RUH 2;  3IAQ A;  5CAZ A;  2AH2 A;  1ND3 C;  1IKQ A;  4I02 A;  4XCA A;  4KQ7 A;  1GZC A;  4R9B A;  4ES9 A;  5CFD A;  1AL0 G;  5DAB A;  4LKE A;  1J84 A;  3A4U A;  4QXH A;  2WR9 A;  1SLT A;  2YHJ A;  4QPI C;  1QJU 3;  4B1M A;  1V9U 1;  3ZYP A;  4A4A A;  2GN7 A;  2TUN A;  4AED B;  4D7Y A;  4MGY E;  3BB6 A;  2IFW A;  3MPB A;  2ZZQ A;  2VQU A;  3W9A A;  2WC2 A;  4XAA A;  1Q3E A;  1JU4 A;  3WQ7 A;  1I3H A;  4HXC A;  1KS5 A;  4BZ4 A;  5L36 A;  1QMJ A;  3BOD A;  3OGJ A;  4XXA A;  1H4G A;  1HN1 A;  1IG0 A;  4W4Z A;  5FP9 A;  1AJO A;  3H1M A;  3ZVX A;  4Y4Y A;  4DUW A;  1GU3 A;  1T6B X;  3UV9 A;  3QAC A;  2OPW A;  3JB8 A;  4CTE A;  3SHR A;  3S7E A;  1RUJ 1;  1FV3 A;  2X05 A;  1O8P A;  2WNU A;  3RPQ A;  3ZM8 A;  1AR6 2;  4COW A;  3V0A A;  1RUF 1;  2JDY A;  2YPJ A;  1VBB 1;  4NRP A;  1CAW A;  1H8T B;  1W90 A;  4YW5 A;  3ZFE A;  2BYV E;  4BQ1 A;  3VD5 A;  5SV8 A;  1GBG A;  1VE0 A;  4AVC A;  1W2T A;  2MNG A;  4QKN A;  3S57 A;  4YWA A;  1IQA A;  2XJV A;  4DXS A;  1VB2 A;  1W8H A;  4BK5 A;  5F32 A;  1O3S A;  2CAV A;  5FQ0 B;  4I30 A;  3POY A;  4OUL A;  1LOA A;  4P00 B;  5FYI A;  2ZAH A;  3U1X A;  4S2H A;  2ZGR A;  1SMV A;  1OA3 A;  4HSL A;  4XXP A;  2F6B A;  3SH4 A;  5BYN A;  3ATG A;  1EP0 A;  2D6P A;  4XCB A;  5FY0 A;  5LK7 B;  1H2L A;  4PT6 A;  4IV3 B;  4TTG A;  1JHJ A;  1NCR C;  1X8M A;  2A6V A;  2YUE A;  3OEA A;  5IVF A;  3SMH A;  5GZG A;  2JXA A;  3URF A;  2AEN A;  1PVC 1;  4LLF A;  1UAI A;  3MPP G;  5JSO A;  4FOV A;  3M3C A;  4AE2 A;  2MEV 1;  3I2I A;  1RHI 3;  4NAM A;  1KDK A;  3POJ A;  4ITC A;  5F5A A;  3VGI A;  1MEC 1;  1RGS A;  4LIT A;  5DG2 A;  2X09 A; 
#chains in the Genus database with same CATH homology
 1V0A A;  1WCU A;  4YW7 A;  3ORJ A;  4LK7 A;  2O14 A;  1OKO A;  1WZX A;  3ZYH A;  4BQ2 A;  2LRO A;  2JWP A;  4BQ5 A;  4BQ4 A;  1WMX A;  3UT0 A;  1W8U A;  5D21 A;  3ZYB A;  4BQ3 A;  1GWK A;  4CPB A;  1W8W A;  4AL9 A;  4CPB D;  1GWL A;  2Q1F A;  4LKF A;  1GWM A;  1W8Z A;  4LK6 A;  3F95 A;  2K46 A;  1L7L A;  1HN0 A;  4A6S A;  4LJH A;  4LKE A;  2KR2 A;  2WYF A;  3ZYF A;  1OH3 A;  1W90 A;  2LRP A;  4LKD A;  2C24 A;  2VXJ A;  4YW6 A;  1W8T A;  4YWA A;  1W9F A;  4CP9 A;  4CP9 B;  1UOJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...