1V0AA

Family 11 carbohydrate-binding module of cellulosomal cellulase lic26a-cel5e of clostridium thermocellum
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
173
structure length
170
Chain Sequence
b'SAVGEKMLDDFEGVLNWGSYSGEGAKVSTKIVSGKTGNGMEVSYTGTTDGYWGTVYSLPDGDWSKWLKISFDIKSVANEIRFMIAEKSINGVGDGEHWVYSITPDSSWKTIEIPFSSFRRRLDYQPPGQDMSGTLDLDNIDSIHFMYANNKSGKFVVDNIKLIGALEHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE H
publication title The Family 11 Carbohydrate-Binding Module of Clostridium Thermocellum Lic26A-Cel5E Accomodates Beta-1,4- and Beta-1,3-1,4-Mixed Linked Glucans at a Single Binding Site
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
total genus 34
structure length 170
sequence length 173
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2004-03-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 1v0aA01
1GWLA 4CPBD 2KR2A 4LKEA 4CP9B 3ZYFA 4LK7A 1WCUA 4YW7A 1UOJA 1V0AA 1W9FA 2Q1FA 4CPBA 3ZYHA 1W8TA 2VXJA 4A6SA 1W8UA 4LKDA 4YWAA 3ZYBA 1W8ZA 2WYFA 3ORJA 1HN0A 1GWMA 1W90A 1WMXA 3UT0A 4LKFA 2LRPA 5D21A 2C24A 4LJHA 4LK6A 4BQ5A 4BQ2A 4CP9A 1L7LA 1WZXA 4YW6A 4BQ4A 3F95A 2JWPA 1GWKA 2K46A 2O14A 1W8WA 2LROA 4AL9A 4BQ3A 1OKOA 1OH3A
chains in the Genus database with same CATH superfamily
5D8AB 5KHGA 5FYVA 4F7ZA 2FQPA 4P9JA 4Q27A 4XFHA 4AGRA 1JYTA 4DXRA 1LOFC 3ILFA 1QDCA 3J26N 4O9EA 4RS5C 4BISA 4CP9B 1S2EA 2XB6C 4XURA 2FCTA 3NJXA 2WUHA 1PX4A 5GZCA 5T5PA 5A7QA 2ZA9A 4YZ1A 3PUQA 5CZKA 2CY6A 3PLQA 4META 1DYPA 1QJU3 3H9AA 1N1YA 3WG1A 4QPGA 1W99A 1W0NA 2LRPA 4IW3A 4YVWB 2XUMA 3GALA 2K0GA 3ZYPA 2YY1A 1DHKB 2PQSA 2QTWB 3I7DA 3HQXA 4WVMB 3T2PA 4BQ1A 1DQ6A 3OG2A 5ACA1 1AXKA 2MEV3 1W9WA 4NIHA 1YQ5A 2VOKA 2VOTA 5JUVA 2WA3A 2IZWA 3LOIA 4A7ZA 2DDUA 1OFSA 2QZ2A 2Y6LA 3PDQA 3IMMA 5BNNA 1B35B 4NAOA 5FQ0A 2VULA 2XPJA 1UZVA 1HRV1 5DDJ2 1LGNA 1I3HA 3QLQA 3RI8A 3WV6A 3H8UA 2EAAA 3HAGA 4D8MA 1ODNA 2ZAAA 3KLSA 4U36A 1RINA 3UL2A 1CAUA 1DG6A 4CCOA 4V2WA 4N53A 1W6NB 1GR3A 1QKQA 2R16A 5FMCA 1KFXL 1VR3A 3N36A 2P3JA 3SH3A 3OOXA 4BQ5A 2GMPA 5FZAA 3GZTB 2W08A 2VUJA 4BMBA 2WNOA 1SBFA 2AENA 3VBRB 5JIUA 4YW2A 2OW4A 1VJ2A 2XLFA 1G9CA 2ET7A 2PAMA 5FLIA 4BIOA 5ABJB 4E9KA 1KJLA 3D82A 4XFGA 4LORA 4X6QB 1RITA 1X9TA 4HPKA 4QKDA 2HYKA 3H42B 4CCKA 5FMDA 1COV1 3WP3A 5DAPA 1CZTA 1UZZA 3CZJA 3VBHA 1AF9A 3WW4A 1F4HA 2ZX4A 3RYRA 5A6QA 1AZDA 1XE7A 2A6ZA 3SKJE 4XW3A 3S7IA 2ETEA 1NUKA 1PO11 4H7LA 4DEVA 3CZUA 5FWJA 1SPPB 5JXIA 5C8CA 3WCRA 3AJYA 1VBE3 1LU1A 4AW7A 1BK1A 5J09A 1W8NA 2CSGA 4NPRA 5JR7B 5FXVA 2BV4A 2WWSA 1DQ5A 2HWD2 3DL3A 1BMV1 3ZDSA 1MACA 2JIGA 4LO4B 1Q8VA 2RR13 2EIGA 2ZX2A 3KHCA 3R4UA 2XJUA 5BNNC 4UT5A 3SMHA 4G4FA 1ENRA 4W4ZA 1JZ3A 2ADDA 2ARBA 1E5IA 3RMYA 4DQAA 3AKSA 2BUKA 2H6BA 1W8TA 4CP0A 5T5OA 2Y64A 4QAWA 3KV4A 4Q1PA 1MZ5A 4LA3A 4FPCA 4QX7A 3B02A 1DDLA 3L9JT 4UXAA 1OPOA 3KT1A 1AR83 4N53C 4I3PA 2WT0A 4RA0A 1R083 4WBBA 1ULCA 4ASKA 4N43C 5FYUA 3SCFA 4IEQA 3C2UA 4UF0A 3R6SA 3JBG2 4AL9A 2ZGPA 1VP6A 1JUIA 2C9KA 3PVOA 4JGYA 1S0JA 1OKQA 2YBSA 3GF6A 3POYA 3C7FA 2RDRA 4DFSA 2FZ2A 2XBO2 5E1RA 1YFYA 4PDWB 3ETPA 3QD6A 5BNQA 2P2KA 1LRHA 2Q4SA 1GP5A 1QY4A 4GH4B 5FY0A 3VBHC 4IE6A 3POFA 1MZFA 2XJQA 5IVYA 4D7SA 3K77A 4FAHA 3F2ZA 4RS5B 2O0OA 4FFIA 2X5IA 4LKFA 2WKKA 1AYM2 5D21A 5F5AA 5C8CC 4IETA 4LBQA 4XIOA 2LUWA 1DCSA 1W06A 2ET1A 1RUE1 2G19A 1YJKA 4UW3A 2Q8CA 5JOZA 4GMP0 5LK7B 5I91A 4CU7A 4OHVA 2OS2A 3DPRC 3O0VA 3TN91 3ST7A 1FPN3 2HWF1 1UAIA 4CA9A 4QQ2A 4TLFA 1HDKA 3ZYFA 3IN9A 1WLDA 3OUJA 2E33A 3V56A 1PHMA 1R1A1 1J1LA 2EIEA 4L99A 5A7SA 1OF3A 1XYPA 3LQCA 3NJVA 1VBD2 3RJRA 3WT3A 2OQ6A 2VCAA 4URTA 4FTSA 3AMQA 4UBGA 4BWOA 1J59A 2ZGSA 2B39A 5FJKA 4HN0A 3KCCA 4GWNA 3OGRA 1NE4A 1UZWA 4LOSA 3WQBA 3ES1A 3OB8A 4C1WA 1XNAA 5AC92 1CR7A 2XKPA 2JDAA 2YFUA 4P14A 3ZVXA 3ZX7A 5HI0A 5I8YA 1JYVA 3BIWE 2BDRA 3I4IA 4EV0A 1SFPA 2D3SA 4RHV1 4PHZA 1RUOA 2J1AA 3NNMA 3AFKA 5F39A 3FFQA 4TTGA 3GBGA 1ND3C 3J8F3 2Y26A 5JLVA 1YYNA 2VMEA 2A5ZA 4RGKA 3LIHA 4LHLA 2ES3A 4K20A 2I07B 4KH9A 3LPFA 3ZYBA 4XAAA 4HVRA 5CFCC 2J1TA 1HB3A 2YMZA 5HV4A 1W6OB 1OOPA 2RS31 2ZEWA 2X5IC 3OGJA 4LXLA 2Y34A 4UFMA 3I2GA 3ES4A 1CJDA 3MIFA 3H8RA 2DVDA 1VMJA 3VD5A 3VDDB 2KD7A 1QOOA 1MQTA 2RM21 2DCJA 4FOQA 5JDBA 3VHNA 4FPOB 1VB2A 1LHUA 3VB9A 3ZFGA 3KMHA 5T3NA 4NE9A 4QHBA 1IS4A 3S30A 2OPKA 5F3EA 4Q4W2 5IAVA 4LK7A 4Y1YA 1PGL1 4FAGA 4RGGA 3IAQA 5GLZA 1D0GA 2QQWA 4JGZA 1H2MA 4IERA 5DUUA 2O1QA 3HQUA 4XABA 5EIYB 4QGLA 5BNNB 1WW4A 1K3IA 2LM3A 3BU7A 2WO1A 5G04L 3BI3A 3NNLA 2HWC2 4AHYA 3BGAA 1GNHA 2W39A 3KVAA 4MXVA 5C4WA 3ZIXA 4G3YC 4DMIA 2BNNA 2QQNA 1XQNA 3NAPA 5A6YA 5JR2A 2JG8B 2OT7A 2VMGA 3GZUC 1RUH1 2XHNA 4N53B 2EA7A 5KBFA 3S6PA 2D44A 3ZYIB 1MZEA 4M4PA 4AVAA 4FFHA 4N43B 1UPIA 1MS0A 5A33B 1Q43A 2WO7A 4IGPA 5DAVA 3DCQA 1RUI2 1GQHA 1S0CA 3MF9A 3VDAA 2G4IA 3THCA 1OBNA 3A0KA 1XRUA 5GZFA 3JZVA 2XXZA 5EWSA 3MW4A 1VE0A 4BMEA 2A71A 1WMXA 4L11A 4DUXA 4BZ4A 1W2AX 3VBHB 4AI0A 5JCTA 5KWRA 2XDVA 3BVCA 1UX6A 2WQ4A 2ENRA 1W2OA 1YUDA 1W6MA 1MQTC 4QB2A 5FZLA 1W9TA 2V73A 1HRI2 1LEMA 1IQAA 4UFJA 3ZFGC 2YYOA 4MH0E 5C8CB 1JU4A 1YQCA 3ZSJA 5LEJA 3RYKA 1KD7A 1D4M1 1PGW2 3DPRB 5FYTA 2XWBB 4FVVA 4BK5A 4JGZC 3SH5A 4DZGA 1WMEA 3GNEA 5BNPA 1RMU3 1RUF1 5KXEA 3D4KA 4PIYA 3ZXAC 3OBRA 5T55A 4LR4A 1VBA3 1R091 1UF2C 4AFMA 4S2GA 4K9SA 1GZTA 4JRLA 1ENSA 1V70A 4B3NA 3USSA 2UU8A 1EUUA 4E2SA 3C7HA 3PU8A 5FXZA 4COWA 1VMHA 4BQXA 3BTYA 5C4WC 2KA3A 4CU9A 4KNCA 5EXOA 2PXJA 3OGSA 2ZHNA 3WUCA 4XJAA 2WAOA 1NCRA 1OH3A 3AL5A 1WCDJ 1PIV3 1QJU2 2D6NA 4Q5OA 5JWPA 4H14A 4Q4V1 1QU0A 4FPHA 3WP4A 5J3UA 1Z7S3 1BVP1 1M4WA 1QXPA 1W3XA 4C0HA 5CNAA 2WC2A 5D2AA 5ANNA 2CNAA 3DKWA 3MIBA 3LEMA 5AFBA 4P02B 3HN1A 2MEV2 3U37A 2R071 3VUOA 3NW4A 2BEOA 1MR5A 1K5JA 5GLUA 2ORZA 3T1LA 2PHLA 1ND3B 4LQRA 4XETA 1SLLA 3ORJA 1QIQA 4IEYA 2XHKA 4ZY9A 1BBT3 2Q1MA 4P9GA 5FREA 1RUC2 4H3WA 5F5CA 2XR4A 5IK7A 2VMFA 3LEGA 3T4HB 2R49A 1KS5A 1PVXA 1SBDA 2WZR1 4LTAA 1Q8OA 3OEBA 4FFGA 3D0SA 2A3WA 3JQXA 5CFCB 2PTMA 4LE4A 2X5IB 1W6PB 4QX0A 3U4XA 1YJLA 4XUNA 4W8JA 1AL0G 1PO21 2K2SA 2Y60A 3P6BA 3K46A 4LBQB 4XZPA 1N1SA 5CKQA 3LEKA 4PCRA 1NCQA 5BPXA 1JZ6A 4QDSA 3ZYGA 3ZXJA 2C5DA 2EXHA 4OULA 1T6GC 4XVHA 2DVAA 1S0BA 4Y20B 5C3OA 3ZXEA 2RV9A 4UYBA 1OC1A 4FTEA 5LCWL 2FBEA 2BFUL 1TE1B 3T2OA 3WG3A 1MVEA 3K48A 2X29A 4QB1A 1JHNA 2Y0OA 4YW3A 2VTXA 4HMZA 5F5IA 1I6XA 2OA2A 1ZZ7A 5DAWA 2C24A 4XFAA 2TBVA 4BIFA 4DXZA 2OQ7A 4HK9A 5GM0A 3PUHA 3OBAA 2MHFA 3CDZB 5IYYA 3WW3A 3AJZA 1W6QA 1ZA4A 3VKMA 5A32B 3JCIA 4NO4A 4YM1A 1M06G 1NLRA 1PVC3 3HVDA 4TSVA 4ZONA 4XTPA 1XNBA 2Q1ZB 2XMLA 4N7IA 5J37A 3HT2A 3O5SA 2ZCWA 4MLOA 2EALA 4R4ZA 1HJGA 4QDRA 4SLIA 4CCDA 5CU1A 3RNSA 1UCXA 2RS12 3V0AB 2W5FA 2RR12 3O14A 4CUCA 1W2TA 5LZ6A 1G9BA 3W5NA 2LW8A 1XNKA 4K3UA 1JS9A 3RRDA 3IKWA 3ZXFA 3RZLA 4WVVA 3ITQA 5FYIA 5DDJ3 1E57A 4EN9B 5FK7A 1JXNA 1O4YA 2NQYA 4UFIA 3SH4A 3UJOA 5C33A 5C8WA 1A78A 3LFIA 5B2GB 3BU0A 4E4DX 1XPWA 5LY1A 2P3KA 4P00B 3NNGA 1XU1A 1UO9A 4BM8A 2RDSA 1YHFA 1R082 1AR71 2SBAA 1RVF1 1D2QA 5A1LA 2YHJA 5BXXA 4CPBA 2OXBA 3ZFGB 3IPVB 4LO7A 1IZ3A 3INAA 4Y24A 3AFGA 5JXJA 1IG3A 4AVVA 1ZBA2 5EQUA 4DS0A 4EROA 4CDUC 2IXIA 4YLZA 1X50A 4E8CA 1YNAA 1OLMA 2FHRA 3KCXA 4LMFA 1PGSA 4DRVA 3ZOIA 2NP0A 1ENQA 2XGXA 4PBPA 3PUIA 4IV1C 4PF5A 2VL4A 4L2NA 1IOAA 1CWPA 4FXGB 1WBFA 3GXUA 1O4ZA 2VQTA 1UOBA 1K45A 3I2DA 4YVSC 2ZEXA 3WW1A 1QJX1 2VD7A 5LRRA 3UGFA 2DYCA 3ILRA 3R4SA 4AI9A 3PUAA 4PF1A 1YFUA 5EJ3A 4JKKA 4JTOA 2RDNA 1UMIA 3VL9A 2XJPA 2BWCA 4QKBA 3O1TA 2W68A 3BALA 4QX2A 1FPN2 4XF9A 2RS52 2BTVC 3DN7A 3NV3A 4V1PA 5IK4A 3VBUA 4AWDA 2PQQA 4A4AA 2TEPA 3A4UA 4XQ4A 4CTEA 3AP4A 2W3JA 1L7LA 4JQRA 3H3LA 1TMF1 5LA0A 1JYIA 1KGYA 2LROA 2D6LX 2VZQA 2W95A 4FI9A 4R52A 2E6VA 4DXTA 4XDOA 4N90A 4Q4X2 3ZN6B 2D93A 3UJQA 3M3IA 1CVNA 1RHI1 1ZZ9A 1ULOA 2R042 5JSOA 4AK3A 1EV12 4FOVA 2B9VA 1OF4A 2GMMA 4BXSV 1DQ4A 1PK6B 2ZJCA 3KV5A 1YI7A 1LR5A 2AH2A 1J58A 3S5QA 3JBG3 4HOOA 4QMAA 4CU8A 1DF0A 2FDKA 4RGAA 2VMIA 4R9AA 2EXJA 4Y1UA 4PLMA 1VRH2 2QVSB 2HWE1 3B9IA 3KSCA 4AG4A 3ZFEA 2PA7A 2XBO3 2YG0A 3RQ0A 1RUD2 3VV1A 3GBFA 2X09A 4BQ4A 5ERLA 2HEWF 4MSVA 2EXKA 2DWRA 1KDMA 4MGYE 4CXYA 4OVEA 3N9QA 2X53S 4Q0UA 5A1AA 4YGCA 3R0RA 5K0UA 4MHUA 5FMOL 5D1IA 1AYM3 3KT4A 2A6WA 2E7TA 3PJYA 4AAPA 3CU7A 1V9U2 2VVDA 1UKGA 1W2NA 1QOSA 3APBA 3E97A 4Q0QA 1W2UA 3MUY1 3OGVA 4B29A 3FHIB 4XHBA 3VBUC 4XUPA 3LIGA 2VJXA 2A1XA 2IUWA 4AVCA 2B42B 3LDRA 4OFGA 4XFCA 2PLV1 5LB6A 4EWEA 1DZQA 4RN5A 4B7EA 2VNOA 1R64A 3MO4A 5EHDA 1VBD3 1CN1A 1ZBE2 2Y38A 1C8M2 4Y26A 2CGOA 2GZWA 1GANA 4ISQA 5LBCA 2LTNA 1VBB1 2XQRA 4LHNA 5GLTA 3JUUA 3VKLA 2CU5A 3NWKA 2C1FA 1PZ8A 2XG3A 4Q0VA 4YW5A 4IGQA 5AC93 4BCUA 4E4ZA 1WUVA 2C26A 1OA4A 1CAWA 2NYYA 3ZXLA 4AHXA 3CJIA 2RM23 4URAA 5BY5A 3AYEA 3B5LB 3FBMA 3PVNA 4H2AA 3ZR6A 5FO8B 4X8NA 4DO0A 1SDDB 2BVVA 4ZKTB 2FDIA 3T2TA 1V6IA 2PHFA 1OA3A 4UAPA 2K46A 1UYZA 2V72A 3U78A 1AL21 4BQWA 1OFNA 2A73B 2IXLA 2PFWA 3ZMNA 4ARXA 3MZHA 2FCUA 4CDUB 3VBOB 2JDMA 5FP8A 3BTAA 1HN1A 1S55A 5IVBA 1N47A 3PL0A 1AVBA 4IV1B 2XUEA 1Y7BA 5FLHA 3RGBA 2DBIA 2DVBA 4LE3A 3IDEA 3B3QE 4CCNA 1C5IA 4OUMA 2YBPA 5CYYA 4YVSB 1S0FA 1XE8A 4FPYA 4LJHA 1ULEA 2GN3A 4Q4W3 4GB31 3UV9A 5IUQA 3MIGA 1SFYA 1SLIA 4NIIA 1D2SA 5C3QA 4CDQA 2JWPA 1FOD1 2VG9A 3TB0A 1RMU2 2WSVA 4MXWA 4RYDA 4XYXA 4F83A 1VBA2 5J7MA 3PMEA 5A3PA 1WD3A 2HWC3 5FUPA 1N1VA 3V0BA 5F3IA 2WNVC 3E5XA 4XZUG 3UNPA 1BEV2 4XOGA 1D7PM 1AUYA 3AZYA 4HZFA 4QQLA 4ASMB 1NZIA 1RGSA 5F6LB 1CAVA 1PIV2 3WNOA 1G6NA 1OLQA 3WNNA 2VZVA 3OJBA 4X8PA 5DMYA 4XC9A 4XF3A 1V6OA 5EYYA 2DV9A 2GN7A 4NOTA 1GKBA 2I45A 5FCCA 3ZYRA 1FMD1 1Q56A 4MGIE 4AI1A 4NIGA 1H8TB 4FQ4A 1WA4A 5FYBA 4ATFA 3E1F1 1QF3A 1SEFA 1UYXA 4GH4C 1RUJ1 2E63A 4HG6B 1GWLA 2QZ3A 3V64A 2JICA 4X6RB 3BOPA 3WF2A 5A1FA 3WDWA 4NHKA 3WSOA 2D5HA 2PHXA 1E5RA 2YBKA 1W9FA 1N3PA 4GIQA 1KS4A 1O5LA 1UY2A 1H6XA 1V6JA 1RYYA 3NV1A 4NWWA 4QWNA 3AVSA 1QGLA 4AVBA 4E4SA 3FLTA 2CGNA 3I97A 5IATA 4LO8A 4CEWA 2HBTA 4ASLA 2BGOA 4RSUA 1QQP3 5KHIA 3M3CA 2P6CA 2PAEA 4ONUA 2BOIA 5A3WA 3TYJA 1HXS3 2NZ9A 4OMDA 2J1VA 2WZPP 4DRRA 4CDQC 4H7MA 3VBUB 5A7WB 2DU0A 4QQPA 5JZGA 2E26A 5ACA2 1PNFA 1SFNA 2I2SA 3NL1A 3T0DA 4K21A 1O5UA 1W04A 4MGTA 1ST8A 1QH7A 2WINB 2AGSA 2VQUA 4N7UA 1HRV2 2EICA 2RDQA 3EMRA 5A3MA 5K9YA 2Q8EA 3FWEA 1PVC2 4B4QA 2EXIA 4LBKA 4MO3M 4OHYA 3C7EA 5GLVA 1PMIA 2VECA 1IPSA 2MPFA 1TZOA 1JI6A 4XJZA 4IEVA 4OI1A 2EAKA 4M3CF 4BPZA 1PX3A 1S0DA 1H0BA 4MOAA 5FUNA 5CFDC 3WLUA 2YV8A 4WM8C 2ZBJA 3PHMA 4QHOA 4RD7A 2WZ8A 5KHKA 1IPJA 1DQ2A 3A22A 1ZX5A 3ASIA 5CIRA 4LIVA 1RUC3 1F5JA 3MLKA 4XJWA 5JSRA 2ATFA 2UWBA 3O1VA 4YW1A 2AACA 3USUA 4O7XA 3WF0A 4IE4A 3M4FA 2HWB3 4CCCA 3W21A 5FMBA 4CEYA 2LS6A 1F8VA 2E53A 5FIXA 5GALA 5FUIA 4CEWC 2W46A 1SLTA 3NQHA 3PTRB 2R7EB 3ACLA 3EB7A 4XUOA 3S0MA 1ND2A 1SQ4A 1PO12 1SCSA 2W94A 4EE2A 4HK8A 1VBC1 4E4HA 1ODMA 1RB8G 2Y6FA 4J25A 3S7EA 3T3YA 2VXRA 3T0BA 1XNTA 3I59A 2E9QA 2ZGOA 4ZHNA 2WLQA 4AI3A 1BMV2 2ID4A 3O0XA 1WKYA 3TNQA 2O8QA 4Q4Y1 3HBKA 3S5AA 2C9AA 3NNFA 1ZRCA 5HPOA 4TWTA 3AB0A 4ZU4A 5JXGA 4GQ7A 4KWLA 3VHOA 2E51A 2WNVB 4AQTA 2BPA2 3KT7A 1PMJX 2J42A 5C6CA 1XU2A 2PN5A 4QPGC 3WF4A 3H8OA 2RMU1 3OD4A 1DP0A 2YFZA 4AEDA 3WNMA 2WS91 3VBSA 3NRUA 1AR73 3POJA 4AGVA 4NMIA 3U11A 2RS13 1U12A 3AZVA 4MUVA 1GZWA 5F37A 3B00A 1POV3 2D3PA 3VDBA 2KR2A 4A2UA 2VW1A 4BXFA 2XH6A 1JZ2A 3VKFC 5FKCA 2FD8A 1XJAA 4R9BA 4JDMA 5T5LA 4D6SA 2IXCA 3H0OA 1UX7A 3M3OA 3P3PA 4LKSA 4OQ8A 4P9WA 3WF3A 4Z2WA 2B9UA 3N9OA 4CEYC 1W03A 2FDGA 2OUHA 2YPJA 2A75A 3LSEA 2Y6HA 1N3OA 4P5YA 5FYYA 4UW4A 3UYJA 2YPDA 4L0PA 1FYUA 5L36A 1NE6A 2RHPA 3CF6E 4AYUA 3S57A 2PHDA 3ACGA 1GICA 4HN1A 1WCKA 1YCIA 2YU1A 3K4ZA 5DN2A 5KXBA 5E8AA 1WA6X 1CJPA 1UMHA 4XAEA 2GP3A 1LHOA 2P3IA 1ZBA3 2ZTNA 4J6GA 2HWF2 4WM7A 3TN92 4HKLA 4CZSA 4CDQB 4JVAA 1UOJA 3FMGA 2ZHKA 3LE0A 1GOHA 1QJY1 1JZ8A 1RUG1 4MXWB 3FN9A 1DYOA 1OLME 4MZUA 1US3A 3A23A 4LT5A 1R1A2 1JUHA 1UL9A 3O12A 3V0BB 3B01A 1O3TA 1WGPA 4Y22B 3DECA 4QU2A 3L2HA 3LA3A 3FHAA 4XUTA 4CDXA 5KHJA 3WINE 4AEDC 3KM5A 4RR3A 3EQEA 3ON7A 5FYSA 1JYCA 5EZWA 4CCJA 2QQOA 5CKMA 5M0TA 5DUXA 2Z5WA 2AREA 1IS5A 1NA1A 2HBUA 5F8PA 2RS53 4LBJA 3MICA 2G9FA 2XONA 1J1TA 3PVBB 4Q8LA 2VVFA 4RHV2 5IVEA 5CFDB 2ZKLA 2O8OA 3UETA 4YFZA 1MS4A 1W3VA 3TRSB 1CX4A 3WDXA 2YC0A 5F5QA 4WM8B 2KM2A 4A6SA 1QNYA 4MGKE 4LNVA 4PI0A 5APAA 5FZEA 5I93A 4NRMA 1YFWA 3BTZA 4IEUA 4Q4X3 1OQEA 4DOUA 1ZRDA 4Y3OA 3TEZA 1CESA 2R043 1DLCA 4YG0A 2WYSA 1EV13 4BA6A 3HBZA 5HCAA 3ZSEA 2EIBA 2UY8A 5FP9A 5A7OA 2BRTA 1GWKA 4KBZA 2VCMA 4EN0A 4FBFA 3KQ4B 1F9KA 2RM22 3H7JA 4BJ0A 4JGYC 4NPMA 4CUGA 3G7DA 3B9CA 1VRH3 4PQQA 4WM7C 4OQ9A 3UK9A 3AL6A 5JPNB 1VALA 4XCAA 1YI9A 1RUD3 3EJKA 5A6XA 4QXHA 4KWKA 4AFAA 1GV9A 1OQDA 4Z92B 1W8OA 2XVLA 5FY8A 1WCSA 5C5TA 2J7MA 3SQOA 1T2XA 1YLLA 2P1BA 3MV11 5F32A 4I3GA 5FY7A 4BK4A 1F2NA 5JIAA 5KC5A 2Y6GA 2ZX1A 1D0HA 1YIFA 5C3PA 4D94A 1V9U3 4RR3C 2AEZA 4LULA 4P08A 4DIQA 4GWMA 2BOJA 1RTVA 3GJBA 1JOBA 3BPSA 1W39A 2XLAA 2ZABA 1C5HA 4QPGB 4JQTA 5FRAA 1NA1C 1H6YA 1I1EA 3LPGA 4XJ8A 1RUH2 2D6MA 5H9QA 1LOGA 1MEC1 1BJQA 3BTXA 3HIFA 2ZACA 3MF6A 3GCXA 3FC0A 2NM1A 4L9BA 3ECQA 3AXEA 5BUVA 3QH6A 2WO3A 1JTZX 2E7AA 4GKYA 3OD0A 4HSLA 4LBQD 3U07A 1ZBE3 1H8VA 1C8M3 5L7OA 5K7PA 1ULGA 4GAZA 5FQ0B 3HN3A 2BWAA 3CBNA 4LIUA 1UY4A 3Q8CA 1A8MA 3PVEA 1HJFA 2A6XA 2WO2A 1EYBA 1J3PA 3FE5A 3POEA 4CEYB 1WLCA 4A7YA 5JI9A 2ZGQA 1NY71 2BBAA 3ZLIA 2R061 1CAUB 3C7GA 4PIZA 2QQMA 1KJRA 3THPA 1CAXA 3ATGA 3N7LA 3H1MA 3I2KA 4MGZE 4OI0A 3NJZA 2A3YA 2DF7A 3CLPA 3GYDA 5J98B 1ZRRA 4EJRA 3O1UA 4QX3A 2F4PA 4IUGA 2VZUA 2YU2A 3AK0A 3D0JA 2NMNA 1CPMA 2VXJA 3K4DA 4GMP3 4WV8A 5FYHA 5AVPA 3RS6A 1Z0HA 1D4M2 4IE0A 4JHZA 4LPLA 4B8EA 5IJRA 3RZHA 3J9SA 1UWWA 2JIJA 4HPKB 1RUF2 3JB8A 1W9YA 1OOPC 1Y3TA 4YZ3A 5FZ9A 4HANA 4NN0A 5I8TA 2J1UA 3QH7A 3MW3A 2EF6A 2H0VA 2P4EA 1IG0A 4LBOA 2FMDA 1WLWA 2F17A 4M3CA 4BHPA 2BYVE 1WW7A 1BCXA 3JXSA 4EZ4A 3TWIA 3AMPA 4E2QA 1TNRA 2W92A 2FDFA 3OY8A 2OYZA 4AFCA 3VD7A 2E7QA 1FNZA 1JOJA 5H9SA 4AEDB 2D97A 4TZDA 1QQP2 4MVTA 3O1MA 1EP0A 3MEPA 3KWVA 4Q4V2 4CSWA 3VN4A 4YPJA 1HXS2 1DZRA 1NAEA 5A7NA 1Z78A 3AP7A 2GNBA 3HR9A 1BLZA 4JDNA 1J3QA 3HEIA 1TME1 5IAXA 2R072 2ZAHA 4XMAA 1AXZA 1FNYA 4PIXA 1QJZA 4Q0SA 1AR91 3EHKA 3ETQA 3M8LA 4IV3A 1X9PA 1BEV3 1C1LA 3E5QA 4L8QA 4QKNA 5DPNA 3H50A 4YW6A 4BDVB 1CZSA 2VNVA 1LHVA 5BNOA 1W8WA 5LATA 3NAPC 5CKNA 2JEMA 2WZR2 3D3AA 4XFFA 4YZ5A 3URFA 5JSPA 1AX0A 5CAZA 5C9AA 4GALA 5C3SA 4R8HA 3N3HA 3BOWA 4UF0B 1VAMA 1PO22 3K75B 4QXKA 4XJUA 2DBNA 1A34A 4AE2A 3T2QA 3I3BA 4QGMA 2WFF3 3D6EA 3MIHA 4Q0PA 2DVFA 5FZOA 1XXNA 2VMDA 4JGYB 2QQIA 1NX9A 3D8CA 1BKZA 4XDQA 4FPFA 1PM4A 1YEWA 1UIJA 2DFCA 4EWAA 3LCPA 4IEZA 4LA2A 2QUOA 2ZOEB 4YARA 4XTMA 4V2VA 4NHYA 2WBKA 2V4AA 2NLRA 4XQDA 4M4RA 3WD5A 2HWB2 1SHWB 2VOXA 4NIAA 2HEVF 2VU9A 4DINB 1G7YA 1HX6A 3ZM8A 4QPIA 1H1IA 4RR3B 2VBDA 3POGA 5L19A 1WCUA 1ASJ1 4Z1VA 2ZGMA 3GJAA 4Y1XA 2XJVA 4XUQA 3CIHA 5SV8A 1FT9A 1NA1B 5BNPC 1C1FA 2B45X 2JG9A 3ZN5A 1FX5A 1W8FA 2Y8KA 4NR1A 1QXJA 3BIEA 3VZKA 3AKTA 4Y5SA 2R1DA 2J1EA 5ACA3 4NAMA 4XEZA 4KU7A 2JECA 5FAXA 4AF9A 5FDBA 4ATEA 4ES8A 2FMYA 3QACA 2CGPA 2BVBA 2VZPA 2ZGTA 4NUBA 1QNWA 3FUQA 5SV5A 5FMOS 5BNOC 3MHZA 3T0AA 1LHNA 5EPAA 2P3YA 1HRV3 2XKOA 2ZGRA 3KF3A 3MI8A 2GH2A 5LA2A 1JZ7A 2WQ8A 1NCRC 4IE7A 4D7TA 4L92A 3KVBA 1X8EA 4B4PA 1UZYA 2MEV1 5C9AC 3RPQA 1BZWA 5FK8A 3POWA 3AKRA 4NVPA 5FZKA 5A7PA 5FR3A 2Q1FA 1H2LA 4FFFA 4GJZA 3AXDA 5IVFA 1AR72 1RVF2 3IDBB 3Q8FA 3X29B 2DCTA 3ZFFA 4CCMA 2PMWB 2WT2A 5FZ6A 4S2DA 4AAXA 4M0NA 5FZ0A 3WVJA 2DU1A 4P9XA 2OZJA 4NROA 3WG4A 3KV9A 2C0ZA 4RL7A 3N35A 3FLPA 4HKOA 1ULDA 4Q4Y3 3VBFA 1COV3 1GUIA 2GH8A 2IFRA 3MLJA 3ZO0B 1OOPB 5IVVA 4CDWA 2CWSA 1YQ2A 5HBAA 3MPPG 3IM0A 2VW0A 1H1AA 1UNBA 1NCQC 4SBVA 1V0AA 1RIRA 1MQTB 1PO13 5HV0A 2ARAA 3C8XA 5FZ1A 1Q8QA 1QJX2 4CP1A 3WDVA 2WS93 3AC0A 5B4XA 1DGWX 4OUSA 5FPLA 4XDPA 5LBEA 3OEAA 1XB9A 4HSJA 4ZS2A 4IEWA 3R05A 1IS6A 1V6KA 4MG2A 4JGZB 4S2FA 1URXA 2WNUA 1LKNA 4XHXA 3N4MA 4KG0A 2Z42A 2GSYA 1E5HA 1W0PA 2R32A 4BQ2A 1KQRA 1VBE1 2W1WA 3IAPA 3Q8EA 4N8MA 1O59A 2Z69A 2VC9A 1TMF2 3GZAA 3SNMA 2VOWA 2WABA 1KITA 5C4WB 4AFDA 1LGCA 2RE9A 1NT0A 2BNOA 2RR11 1LEDA 4Y1ZA 1RHI2 3NAPB 4E2GA 3SEPA 3SKVA 4I02A 2ZS6B 5ANQA 4Q8KA 1I5PA 2DTWA 1VAKA 2YDEA 2A6VA 2Y6JA 1W8ZA 1VB4A 4M00A 2BERA 4UFHA 1GMMA 2CDOA 5DZFA 4FT8A 3LWCA 4XBLA 5L9VA 1ZZ6A 1ZREA 3WP5A 4LBLA 1S0EA 4QM8A 3MIEA 2X05A 4IQPA 4YGEA 5DZEA 2HWE2 3KCYA 1AR81 2ZZQA 3WDYA 1R081 3VBFC 3GBWA 3TEXA 3DXTA 3VL8A 3ZIWA 4BOWA 1S0GA 5I0RA 4CDWC 1BYHA 5KR7A 4A3XA 5FJHA 5FP7A 5FP3A 3PIGA 5EFUA 4QT6A 1W6MB 1Y9MA 3AM2A 1EY2A 5FZMA 5A3NA 3GCWA 3UKVA 1XYOA 2DVGA 4EQVA 3TEYA 2WNEA 1NZCA 1RUE3 5FO7B 1GOGA 2GU9A 5FZGA 4HVQA 4DUWA 2QDRA 3WW2A 5D8AA 4RQPA 4OYUA 5KXCA 1O8PA 3TN93 4AI2A 2HWF3 5EV7A 5BNPB 3E6CC 1WCQA 2WNUC 1BVVA 4LUMA 4P9YA 1Q3EA 1XNDA 2PYTA 2DUPA 2PLV2 4BE3A 2JD4A 4OCTA 4CYDA 4FOYA 1O8SA 1R1A3 5DUWA 2NPIA 1SDWA 2VUAA 4CPBD 2XOMA 3H3UA 5A80A 4YVWA 1ZA7A 2YGMA 4D69A 4O61A 3POBA 5A6ZA 1SLCA 4COVA 1NOVA 3KHBA 3OPZA 4WVMA 1VBB2 3K51A 3RYPA 5GJ6A 1NCRB 2D98A 3FLRA 5FXXA 5C9AB 3K4AA 5FTTC 4CCLA 5C7GA 3LA2A 5DAXA 3ZKUA 2VNRA 2PHUA 5FZHA 4RHV3 3RWKX 1B35A 4KGQA 1EUTA 4YG6A 1P8JA 4LLOA 4OI2A 3VZLA 1PNGA 4YGBA 3TAYA 5DXDA 3T1MA 5FKBA 2ZMKA 5C3RA 4CUAA 2XVGA 4FP3A 1YIPA 1AL22 1G8WA 1OSGA 2X10A 1W6NA 2XL7A 3GHNA 2AEYA 1XOYA 4A42A 3WHTA 2RS33 3OUIA 5IT6A 3LA7A 1JU3A 1Y43B 4PLOA 3VHPA 3VBRA 4OZOA 1HV0A 2WJSA 3J8F1 2VZOA 5ABJA 1NCQB 1GYKA 5DAQA 4W6YA 5D8AC 4RQPC 3PJQA 2D5FA 4ZZ5A 4M01A 1QJFA 1NXD1 3UGHA 3ZFEC 2RVAA 2WQZC 4GKXA 4LHSA 2D6PA 3RZKA 5F2WA 3ZYJB 2O14A 4GB32 3BYWA 4QM9A 4QXBA 3I8TA 4XBNA 3GZEA 5L9RA 3O1PA 1GP6A 2PHTA 2VQ0A 2Y0IA 2PELA 5LBFA 4CVUA 2W0XA 3KF5A 1FOD2 4S2HA 2E32A 5K0UC 1H9PA 1K5MA 1NLQA 1SLAA 3IDAA 1BHGA 4YVWC 4K6BA 4ZU5A 3HNBM 5FOJB 3RMXA 1W6QB 3ABZA 2VZTA 4EN6B 4JCKA 1X7NA 5KC6A 3JB4C 5LWBA 2CHHA 1GZ9A 5FZFA 5CA6A 4FO9A 4LOTA 1RUH3 5TSWA 3W59A 1RL3A 1CPNA 1EAH1 1LOEA 1POQA 2VBPA 4Z82A 5CVRA 1H4GA 4LBMA 1XSRA 3NV4A 5LRSA 4QB6A 1FMD2 2CAVA 2ZGLA 3DXUA 5FOBB 2HH9A 2VE1A 3WR0A 1BK0A 1LOAA 1RUJ2 1TQ5A 2P6HA 2VGDA 3WUDA 2XL9A 4NRQA 5T54A 1AX1A 3VBFB 1FAYA 1AR61 2IC1A 4UFKA 3PMSA 3SXWA 5CB7A 2JDYA 4CDWB 3LDBA 3OBZA 2VMCA 3KGZA 5IWFA 2DCKA 2VUCA 2VQAA 4A45A 4MYEA 1ZZCA 2QCSB 3FHQA 3CJIC 2JJ6A 1LGBA 3CEWA 3RDIA 3HWJA 3H8XA 4FCAA 3AZWA 4PDWA 1O6UA 3MFAA 3BCWA 2JE8A 1W05A 2WFF2 3HNMA 1MVQA 3OSDA 4K8FA 4I0AA 5E16A 2J22A 1D4M3 4LO5B 3Q9OA 1YFXA 5HXVA 2GNMA 1SMVA 1RUF3 3M7AA 4RS5A 2GC1A 2TUNA 5IK5A 1K5MC 1TME3 1HKDA 3MGUA 4A3ZA 1R093 1XSQA 4W6XA 4BU2A 2WLPA 1QMJA 4FOWA 4COZA 5K4LA 1PM7A 2GP5A 2H0BA 5LY2A 3SITA 5FY1A 1SLBA 4C1XA 3WG2A 4M3CE 1AHSA 5FY4A 4EYUA 5F3CA 1CGPA 3VZJA 1CONA 5FPZA 5IVCA 4NIDA 4W65A 1DLLA 2NMOA 2ZHMA 4RFRB 1PMHX 1X82A 4PT6A 1RJ7A 1VBA1 4Q4V3 2VO5A 2ZGNA 4Z07A 2H6CA 2BW8A 5FO9B 1KRIA 2WN2A 4JKLA 2YB7A 2VTXJ 5EYXA 5FYCA 3LSDA 1CX1A 2I74A 1AYN1 2TNFA 2IVIB 4UW5A 5FPXA 2R073 3H7YA 1KXGA 5IHRA 4EN8B 2R1BA 4K1ZA 2YROA 2G9ZA 3W9AA 1L7QA 1Z7S1 3OBTA 5JOWA 2JE9A 3WNLA 2YC2A 2WZR3 1W0OA 1YC61 4K40A 3J7HA 4IL7A 1N3QA 4FPJA 4LK6A 1PO23 1IGOA 1C4RA 1XC6A 4PDWC 4CRQA 2Q5TA 4JRAA 4XF1A 2PAKA 1BBT1 2RJ2A 3WDUA 1AXYA 4RQPB 4EZHA 4AVTA 2Q8OA 4MGSA 3NJYA 1OD5A 1VBC2 3CNAA 3W58A 3ZFEB 5FPUA 3I54A 1U5YA 4YGDA 1W6OA 1UD1A 3RZGA 2JDKA 4YW7A 2B5HA 2QQLA 2WWJA 2XLGA 1UU6A 3E6DA 4D0QA 1DYKA 3VDDA 4KU8A 4OLLA 4HLTA 3VLBB 3WDTA 4Q4Y2 3Q8BA 1COV2 2JDHA 5K0UB 1JHJA 1O4TA 3N7JA 4JDOA 1FXZA 2VAUA 4OHXA 5DABA 4J1XA 3M3QA 2V5DA 4BH9A 5I0SA 4I0WB 1U5IA 3JD71 2ZKNA 4GA9A 3J7NA 4IEPA 5H9PA 3ROUA 1JW6A 2RMU2 2IXHA 4YRDA 2E31A 5AVAA 4AGGA 1A6CA 1BQPA 2WS92 4XILA 5JMOA 2QE3A 3D5OA 4FP2A 3WHUA 5JZGC 3ME2A 3P1IA 2BU9A 5CG8A 3ZSLA 4QU1A 4FXKB 4IEXA 2ZPXA 4N9IA 2FCVA 2Y33A 3ILNA 1PVC1 5A3OA 1H9WA 2BJSA 1G86A 1VLNA 2LALA 2DUOA 1LCLA 3FBYA 2G9GA 1J83A 2BP6A 4XFIA 2QFEA 1GQPA 2VZRA 4P5HA 1JH5A 5GLWA 2JG8A 3SISA 3UT0A 2W91A 3RJ2X 3MW2A 3N9LA 3U75A 3TEWA 4KQ7A 4N43A 3T09A 3I3MA 5A33A 1HV1A 1JYWA 4JZRA 3NSTA 3C7OA 3PTYA 5J1XA 2X8KA 4FQZA 1CAWB 3AZZA 3DUIA 1RVF3 1W9SA 3CJIB 3DEMA 1XNCA 4U2AA 1HQLA 5DDJ1 5FBZA 4CUBA 1HQNA 1KFUL 4IGOA 4Y33A 5H9RA 4OHZA 1LB2A 3GDBA 4K8RB 5KXDA 4PI2A 1IS3A 1JBCA 4UI9L 3VDDC 1G9DA 5A3LA 3HNYM 2VCBA 3N9NA 1DGLA 3ELNA 2EVXA 1QJY2 3MPBA 1LU2A 1RUG2 1K5MB 1REDA 2B8MA 3UKNA 1IKPA 1RJ8A 4FTBA 1DGWA 3NKTA 3ZR5A 1QEXA 3I2FA 1HW5A 4QDQA 3UGGA 4XBQA 1ZYBA 3B94A 3WNXA 2CDPA 2ZXQA 4DXSA 2F4LA 1JYXA 3BKZA 1ND2C 1LOCA 1OMIA 3DPRA 4XCBA 1WW6A 2YC4A 1QJEA 3PU3A 5IW0A 1QJX3 1S1AA 4Q26A 3VDCA 1H30A 1RUE2 3EBRA 3IDCB 1JOPA 3U1XA 3B7MA 2QDNA 3IMNA 4CU6A 1UY1A 2W1UA 4UFLA 2ORXA 2ARXA 4QD2A 4Q1RA 4UW6A 1JZ5A 4MV2A 1RUNA 3HMYA 1V6LA 4BYYA 1H2NA 3GM8A 2VOVA 2RG4A 2UWCA 1O91A 1U5XA 1UQXA 1VIWB 2JG8C 2OVUA 1UN1A 2MNGA 1TMF3 4E8DA 4PLNA 1GZCA 5DUVA 2HWD1 2VY0A 3N9MA 4NWVA 4I30A 1RHI3 5IVJA 4DB5A 1NQDA 2CAUA 3VBSC 5HXMA 1CAVB 3SLIA 2J1SA 3KQRA 3MBWA 4M0HA 4XF0A 4AQ2A 5DG2A 1UU4A 1REEA 4ARYA 4AQSA 3IIIA 1B09A 1ND3A 4H55A 4EWDA 4GZ9A 3THDA 5GKAC 2CYFA 4GULA 4ZXEA 4YYOA 1Q5OA 4FPEA 4NHMA 5FY5A 1G9AA 4XE9A 2QQPA 2ZEZA 4BLIA 2HWE3 5LA1A 5IK8A 2BZDA 5CFCA 5JOXA 1W6PA 2HLEA 1C28A 3JBG1 1Y9QA 3KD4A 2B4KA 5F3GA 1UIKA 4Y20A 3TBDA 4CP2A 1WZXA 2R30A 2RS32 4AEJA 5FYZA 5LK5A 2HJIA 4YM2A 4AVSA 2JDPA 1Y4WA 2ADEA 2XBO1 2RJLA 3M70A 4K1YA 4O65A 2W52A 5FZIA 3ZXGA 4CEWB 1HB4A 2VMHA 2W1QA 5HCFA 2UURA 2OX0A 3LDKA 4L97A 2ZX3A 3K3OA 3ZKYA 5LW9A 4XPVA 2W87A 4DEQA 1TEIA 1MEC2 3JQWA 5JZGB 1Q8SA 1AYM1 1OURA 1W8UA 5FZBA 2FDHA 2ZX0A 1UU5A 1PGL2 2PLV3 1DU3D 3VD9A 2WYFA 5A32A 3I2JA 2BBVA 1HN0A 4MX3A 5FBJA 3LZZA 2Z2SB 4KWUA 5FXWA 3RG0A 2JENA 3WEZA 1WW5A 5F1RA 3DV8A 2CWMA 4XMIA 4CDXC 3ENRA 5EJ1B 5IFPA 1VBB3 1WMDA 2RJKA 2VBBA 3W20A 4UBHA 1S2KA 3ZSKA 4LO6B 4AZZA 5CISA 1NY72 2WWUA 3V0AA 1STMA 1EPZA 2R062 2GC0A 2QNKA 4HKWA 4C8DA 2BFUS 3A21A 1VBD1 1TNFA 1LECA 2V5YA 1J3RA 1LULA 2OZ6A 3I2IA 4TXWA 3KV6A 5CEHA 5JAXA 1LESA 4TYSA 4XIKA 3ZXDA 3RVHA 4TLGA 5AC91 3I2OA 4Y1VA 1AL23 4PBOA 5ISLA 3I3DA 3USUB 3RZZA 1O3QA 4ES9A 4YG3A 3I2HA 1NQJA 1DBNA 2ZHLA 3UKTA 1IKQA 4HBNA 4IXLA 3IPVA 2FZ1A 4QX5A 3OPTA 2P34A 2QQUA 2OIIA 1ND2B 3RFRA 4DPNA 1ZVFA 4I01A 2ZEYA 2VCCA 1QOTA 3OCPA 1EAH3 4GB33 3I59B 3VZOA 2AZ5A 2D6KA 1H1MA 3KGLA 3VZMA 3WF1A 4INDA 1FOD3 3OUHA 4W50A 3A0NA 2YUEA 3WP6A 2P5BA 4AHWA 1TME2 5J36A 1R092 2CL2A 3GHMA 1SBEA 1AJOA 1Y9GA 3DKQA 1FV2A 3LEIA 3MFCA 3SHRA 1AR92 1OKOA 1AR63 1OVSA 1SCRA 2J1RA 3OYWA 3KZ4C 4Q4W1 4R9DA 4JX0A 5I8SA 2OPWA 3I3QA 3J4UH 1J84A 1V6MA 1MS8A 3VBSB 4LBNA 1Q8PA 1JYNA 1YRZA 2VTFA 2HWC1 1N1TA 4GXLA 2Y6KA 4KG8A 5CBLA 1GZWB 2AYHA 3LFMA 1APNA 4YWAA 2JXAA 1FMD3 2JD9A 3WNKA 1V6NA 2WA4A 2UYBA 2WFPA 3AMMA 4XFBA 1GQGA 4HXCA 3ZN6A 5L7OC 1RUJ3 4J1WA 1SG3A 3AKQA 3NO8A 3KB5A 3H3ZA 4P9IA 5GZGA 1PK6A 4AEKA 4BQ3A 5CADA 2A70A 1JN2P 1LODA 4ISRA 3V65A 1TVGA 4JHTA 1RUI1 3VKOA 2VZ1A 5KHHA 2BGCA 4LKEA 3O7OA 4NPLA 3ZPYA 1XE0A 5FV3A 5I0UA 4R9CA 1OLRA 4CXXA 2GNTA 1RXFA 1SACA 2JDUA 5JMCA 3ZPOA 1ASJ2 1LENA 5DG1A 4IEOA 5JOYA 4WVWA 1GLHA 4D6QA 2IXJA 3BB6A 4WM7B 4AR2A 3B93A 3MYXA 4OI4A 2WZEA 2OKXA 4D3WA 2YZ4A 1AYN3 1OHFA 2WIIB 3NNJA 3MUZ1 1X8MA 2HYXA 4MHRA 1HRI1 5FPAA 3VKNA 3FJSA 3GGLA 4BLJA 4P9LA 5IFTA 2R0FA 3HPNA 3BUCA 4YM0A 1QQP1 1UYYA 1H4HA 3QOPA 4QX8A 2D7FA 3JU9A 2AR6A 1HXS1 1PGW1 2CTVA 4DNYA 4CDXB 1OH4A 1U0AA 1IHMA 2P17A 4XF4A 2HKXA 5FZ3A 1A8DA 4NRPA 3U0ZA 5I0DA 2Q30A 1UY0A 5A70A 3FZ3A 1DQ1A 2C6SA 2VUDA 2QJVA 4GWIA 4N9HA 4D6RA 4JC1A 4Q29A 4Y5Z0 3AP5A 3LKJA 4A7KA 3BPZA 3CHXA 2UY9A 3U4SA 2ZMNA 1DQ0A 2JKXA 1QH6A 4Q2FA 1UW8A 4IV3C 1QJU1 5GZDA 3SC7X 1PK6C 1S4CA 2YGLA 1EPWA 2XJRA 4Z8BA 1CZVA 3NV2A 2JKBA 3ACFA 1C57A 5LEKA 4JTNA 1DFQA 2BGPA 1DGRN 3IT8A 1ENXA 1WMFA 2DCZA 3DF0A 2WAAA 5FZCA 4JAAA 3LAGA 3JD73 4FSJA 1RUC1 4LITA 3EXUA 4WVZA 1MS1A 1VBC3 1ONAA 1OUXA 1OT5A 2CV6A 3MIDA 4CDUA 1MS3A 3HD8B 3VBOA 2HWB1 4C90A 1C3HA 3A7QA 1ZNPA 3VZNA 4YZ4A 2VVEA 3CL1A 4XJ9A 1SZBA 2DUQA 3F95A 2ZGKA 3LB9A 5E88A 3SEEA 3HOBA 4GD4A 4IV1A 3AYCA 1MPXA 2VZ3A 2EIDA 4PQ9A 2ZMLA 4ZU7A 1UZ0A 3J7LA 1UOGA 2D43A 3P3NA 4YVSA 1I9RA 1VBE2 3CJXA 1C8NA 1UOFA 3AP6A 3PURA 1WWYA 2GAUA 4G9SB 4JV4A 3NKGA 4QPIC 1G9FA 1CIYA 1OXCA 1YWKA 4I09A 4QPYA 3VHRA 4C0BA 2IWGB 5G05L 4ITCA 4C91A 2XVKA 2RMU3 4LHKA 3PUSA 1OA2A 1WLTA 2JG9C 2ZZJA 3CMGA 4XACA 1W90A 4KGGA 1HIXA 2IVJA 5JVVA 4QQOA 1O3RA 3FUOA 4Z2AA 3ZDVA 2DFBA 1REFA 4YNIA 4UWDA 4LLFA 2QKDA 4IDZA 2GALA 3G6JB 4KI5M 2IXKA 2VNGA 3ZMOA 3WXPA 4B4RA 5L7OB 1ALYA 1O3SA 1AR82 1NXMA 2V09A 5C71A 3NVCA 4DY5A 3LOBA 5FPBA 5T5JA 2RS11 1LHWA 1X33A 1POV1 5GZEA 4Y4YA 1F15A 1CAXB 4TN7A 1L3JA 1ZM1A 1H8TA 2GMEA 2VM9A 2VH9A 4RFT0 5F7UA 3ZFFC 2Z4FA 3KS7A 3M3EA 2G1MA 4COUA 4HETA 5J96B 3U14A 4HFSA 1RC6A 3VBOC 5K8SA 4YSFA 3DYMA 4NJ4A 1ULFA 3OGGA 1NLSA 1QXRA 2P37A 3LF7A 4KBBA 4ZPIA 2K9ZA 3VD3A 5JXHA 3TNPB 2WR9A 1QJY3 2QBXA 1RUG3 1OQ1A 3CKHA 4AOCA 4KL1A 4ET7A 4BB3A 2WT1A 1GNZA 2L9LA 4PJYA 5HCHA 2IFWA 1CD3G 1HB2A 2VW2A 4XQWA 3OTFA 5EP9A 4M3CB 4W6WA 1GP4A 1UY3A 5FZ7A 1VPHA 2HWD3 4A41A 2JE7A 1RXGA 3OYWB 2GC2A 4AFBA 5FZ8A 3ACIA 4D7YA 1GBGA 1S2BA 3M1HA 1ZBA1 3WY6A 3E5UA 1F5FA 3OY8B 3RWNA 1VMFA 1DIWA 5A7WA 1OD3A 3O1OA 5C70A 4ZS3A 5AFEA 4BQYA 4AQ6A 1DGRA 3WCSA 1LTEA 2C4XA 5FP4A 1YXWA 1F31A 2HEYF 4CP9A 2XJTA 3IZOA 1BXHA 1X36A 2WL1A 1R1ZA 3RI9A 1NG0A 1UPSA 3CQOA 3DYPA 2GC3A 3AYAA 4IV3B 3WQ1A 2SLIA 3ZSMA 3VD4A 5BNOB 1FPN1 3ZYHA 2RS51 4FPGA 4ORFA 4AXOA 1I5ZA 2OUJA 3QBQA 2DCYA 3SCHA 2ZGUA 1H8TC 2VZSA 4K7JA 5E6HA 5I0TA 3M2MA 1QDOA 1GU3A 2W47A 3AX4A 3J8F2 2ERFA 2VR4A 2WDBA 2JB8A 3VGIA 4DUVA 2F6BA 3W5MA 1GFF2 2PHRA 4IESA 4Q4X1 5FZOB 1OVPA 4AHZA 3WQ7A 5CG9A 3Q8AA 5F6KA 2R041 2QQVA 3HT1A 3FFZA 2JDZA 3OPWA 1EV11 1IPKA 1E5SA 1HLCA 4MGQA 4O9GA 1NKGA 3B69A 4OMCA 4CE8A 2N7GA 1JZ4A 4GJYA 1YO8A 3LGRA 2DTYA 4E27A 4FPKA 2XWJB 4UOJA 4AEMA 3IIAA 4YM3A 3BN6A 1FV3A 5E89A 1W28A 4GWJA 1VRH1 1A3KA 4FPLA 4COYA 3O1SA 3FX3A 1MZ6A 3LD8A 1RUD1 4MADA 4QPIB 3IB3A 4CXWA 1F35A 1W8HA 3E6BA 1US2A 1MS5A 3HJRA 1TG7A 4ZZ8A 3N7MA 1O7FA 1T6BX 4XXPA 5JPMB 2JG9B 5LASA 5J48A 1MEC3 1UKRA 2R0HA 1EAH2 5T50A 4F3JA 3WNPA 5BV6A 1HQWA 4HONA 1HB1A 2WNVA 4OHWA 5JI7A 1V9U1 3U10A 4YW4A 1ZZ8A 3QCWA 3WZ1A 4OZXA 2VPVA 2YXSA 3O1RA 2D40A 1GOFA 1SPPA 1UXXX 1VAVA 2BNMA 5EJZB 1CIWA 3SCGA 4QQHA 3PNAA 3OF1A 4B7KA 4NHXA 1DZTA 5FY9A 3WOGA 4LUKA 4YFWA 1OPMA 1NYWA 5FYMA 4QKFA 1AR62 2Z79A 1UMZA 2ARCA 2XJSA 4CCEA 4WZCA 3RZMA 3ACHA 2R063 2B7YA 3MLLA 4A6OA 3AP9A 3N9PA 5BYNA 1AX2A 4B1MA 1ZBE1 3AVRA 1C8M1 1B35C 2WSUA 4NHLA 3T30A 4QHZA 3ZXKA 3ZFFB 2NN8A 2XQXA 5HCBA 5F2SA 4QX1A 2D6OX 1U5ZA 1KEXA 2DURA 3MV01 1OI6A 4AI8A 1V00A 1UYPA 1JODA 3T4VA 2JDNA 2A6YA 2PHWA 2V4VA 3POIA 5B4NA 4HL0A 4LEJA 3RSJA 4XXAA 1ZRFA 3ZN4A 4DY3A 3EYPA 4Y5TA 1CQ9A 1LJ7A 4EN7B 1LAJA 4LKDA 3WX5A 2GNDA 1AJKA 2R6QA 4Y4RA 3AZXA 3EO6A 3VBRC 5LA9A 3J7MA 1GWMA 1PZ9A 1ULPA 2QQJA 3L2YA 2WN3A 4QPWA 3HQRA 3THTA 5ABJC 1KDKA 4GMP1 1K42A 1WBLA 3H1WA 1QWRA 4F8AA 5DZGA 1ACCA 1L7RA 1S0IA 3AYDA 4WZFA 5L73A 1FATA 1ZZBA 4OUEA 1PZ7A 3H1YA 4GH4A 3C3VA 1IQDC 1D4VB 4I2OA 1H2KA 4KWJA 5FFOC 1LOFA 1K12A 5T52A 3I49A 2WNUB 4Y22A 2FDJA 5FZ4A 1AYN2 5F9TA 4IE5A 5DQ0A 4QGNA 4A44A 3MDPA 1QHDA 3CO2A 1FI2A 3BODA 4ZXKA 2KXLA 1WD4A 1AR93 2W2IA 3AMHA 3K2OA 4B1LA 2Q0AA 1Z7S2 2ILMA 5FZDA 3TOJA 3O0WA 1RUI3 1RMU1 2WRAA 3AMNA 5LBBA 1MS9A 5A3UA 5CFDA 3AKPA 1JMUB 2B46X 1ZRIA 2A7AA 2UWAA 1F4AA 4WM8A 2AUYA 2D3RA 1OUSA 1BBT2 1BEV1 2GDFA 4HVOA 1UXZA 4HT1T 3T08A 3UESA 3IBMA 2UYAA 2BQPA 2W9XA 3PIJA 1LNSA 4QXCA 3FL7A 3IWZA 3P5BA 2JB4A 1XBFA 1GSLA 1PIV1 3DGTA 5L9BA 3ALQA 3I3EA 1HRI3 5A3TA 2QQKA 2A3XA 3RZJA 1POV0 3NMBA 3N7KA 3POSA 4YZ2A 3R4DB 2WFF1 1YQ8A 2Q8DA 1XYNA 4JKMA 3K3NA 2W1SA 5FWEA 4R4XA 5C5UA 1LOBA 1GNYA 1VRBA 3DYOA 2AC1A 4I0BA 3WQ0A 1YQ6A 2JX9A 5FPVA 1ASJ3 4KMQA 5FLJA 3JD72
chains in the Genus database with same CATH topology
1GWLA 4CPBD 2KR2A 4LKEA 4CP9B 3ZYFA 4LK7A 1WCUA 4YW7A 1UOJA 1V0AA 1W9FA 2Q1FA 4CPBA 3ZYHA 1W8TA 2VXJA 4A6SA 1W8UA 4LKDA 4YWAA 3ZYBA 1W8ZA 2WYFA 3ORJA 1HN0A 1GWMA 1W90A 1WMXA 3UT0A 4LKFA 2LRPA 5D21A 2C24A 4LJHA 4LK6A 4BQ5A 4BQ2A 4CP9A 1L7LA 1WZXA 4YW6A 4BQ4A 3F95A 2JWPA 1GWKA 2K46A 2O14A 1W8WA 2LROA 4AL9A 4BQ3A 1OKOA 1OH3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GWL A;  4CPB D;  2KR2 A;  4LKE A;  4CP9 B;  3ZYF A;  4LK7 A;  1WCU A;  4YW7 A;  1UOJ A;  1V0A A;  1W9F A;  2Q1F A;  4CPB A;  3ZYH A;  1W8T A;  2VXJ A;  4A6S A;  1W8U A;  4LKD A;  4YWA A;  3ZYB A;  1W8Z A;  2WYF A;  3ORJ A;  1HN0 A;  1GWM A;  1W90 A;  1WMX A;  3UT0 A;  4LKF A;  2LRP A;  5D21 A;  2C24 A;  4LJH A;  4LK6 A;  4BQ5 A;  4BQ2 A;  4CP9 A;  1L7L A;  1WZX A;  4YW6 A;  4BQ4 A;  3F95 A;  2JWP A;  1GWK A;  2K46 A;  2O14 A;  1W8W A;  2LRO A;  4AL9 A;  4BQ3 A;  1OKO A;  1OH3 A; 
#chains in the Genus database with same CATH topology
 5D8A B;  5KHG A;  5FYV A;  4F7Z A;  2FQP A;  4P9J A;  4Q27 A;  4XFH A;  4AGR A;  1JYT A;  4DXR A;  1LOF C;  3ILF A;  1QDC A;  3J26 N;  4O9E A;  4RS5 C;  4BIS A;  4CP9 B;  1S2E A;  2XB6 C;  4XUR A;  2FCT A;  3NJX A;  2WUH A;  1PX4 A;  5GZC A;  5T5P A;  5A7Q A;  2ZA9 A;  4YZ1 A;  3PUQ A;  5CZK A;  2CY6 A;  3PLQ A;  4MET A;  1DYP A;  1QJU 3;  3H9A A;  1N1Y A;  3WG1 A;  4QPG A;  1W99 A;  1W0N A;  2LRP A;  4IW3 A;  4YVW B;  2XUM A;  3GAL A;  2K0G A;  3ZYP A;  2YY1 A;  1DHK B;  2PQS A;  2QTW B;  3I7D A;  3HQX A;  4WVM B;  3T2P A;  4BQ1 A;  1DQ6 A;  3OG2 A;  5ACA 1;  1AXK A;  2MEV 3;  1W9W A;  4NIH A;  1YQ5 A;  2VOK A;  2VOT A;  5JUV A;  2WA3 A;  2IZW A;  3LOI A;  4A7Z A;  2DDU A;  1OFS A;  2QZ2 A;  2Y6L A;  3PDQ A;  3IMM A;  5BNN A;  1B35 B;  4NAO A;  5FQ0 A;  2VUL A;  2XPJ A;  1UZV A;  1HRV 1;  5DDJ 2;  1LGN A;  1I3H A;  3QLQ A;  3RI8 A;  3WV6 A;  3H8U A;  2EAA A;  3HAG A;  4D8M A;  1ODN A;  2ZAA A;  3KLS A;  4U36 A;  1RIN A;  3UL2 A;  1CAU A;  1DG6 A;  4CCO A;  4V2W A;  4N53 A;  1W6N B;  1GR3 A;  1QKQ A;  2R16 A;  5FMC A;  1KFX L;  1VR3 A;  3N36 A;  2P3J A;  3SH3 A;  3OOX A;  4BQ5 A;  2GMP A;  5FZA A;  3GZT B;  2W08 A;  2VUJ A;  4BMB A;  2WNO A;  1SBF A;  2AEN A;  3VBR B;  5JIU A;  4YW2 A;  2OW4 A;  1VJ2 A;  2XLF A;  1G9C A;  2ET7 A;  2PAM A;  5FLI A;  4BIO A;  5ABJ B;  4E9K A;  1KJL A;  3D82 A;  4XFG A;  4LOR A;  4X6Q B;  1RIT A;  1X9T A;  4HPK A;  4QKD A;  2HYK A;  3H42 B;  4CCK A;  5FMD A;  1COV 1;  3WP3 A;  5DAP A;  1CZT A;  1UZZ A;  3CZJ A;  3VBH A;  1AF9 A;  3WW4 A;  1F4H A;  2ZX4 A;  3RYR A;  5A6Q A;  1AZD A;  1XE7 A;  2A6Z A;  3SKJ E;  4XW3 A;  3S7I A;  2ETE A;  1NUK A;  1PO1 1;  4H7L A;  4DEV A;  3CZU A;  5FWJ A;  1SPP B;  5JXI A;  5C8C A;  3WCR A;  3AJY A;  1VBE 3;  1LU1 A;  4AW7 A;  1BK1 A;  5J09 A;  1W8N A;  2CSG A;  4NPR A;  5JR7 B;  5FXV A;  2BV4 A;  2WWS A;  1DQ5 A;  2HWD 2;  3DL3 A;  1BMV 1;  3ZDS A;  1MAC A;  2JIG A;  4LO4 B;  1Q8V A;  2RR1 3;  2EIG A;  2ZX2 A;  3KHC A;  3R4U A;  2XJU A;  5BNN C;  4UT5 A;  3SMH A;  4G4F A;  1ENR A;  4W4Z A;  1JZ3 A;  2ADD A;  2ARB A;  1E5I A;  3RMY A;  4DQA A;  3AKS A;  2BUK A;  2H6B A;  1W8T A;  4CP0 A;  5T5O A;  2Y64 A;  4QAW A;  3KV4 A;  4Q1P A;  1MZ5 A;  4LA3 A;  4FPC A;  4QX7 A;  3B02 A;  1DDL A;  3L9J T;  4UXA A;  1OPO A;  3KT1 A;  1AR8 3;  4N53 C;  4I3P A;  2WT0 A;  4RA0 A;  1R08 3;  4WBB A;  1ULC A;  4ASK A;  4N43 C;  5FYU A;  3SCF A;  4IEQ A;  3C2U A;  4UF0 A;  3R6S A;  3JBG 2;  4AL9 A;  2ZGP A;  1VP6 A;  1JUI A;  2C9K A;  3PVO A;  4JGY A;  1S0J A;  1OKQ A;  2YBS A;  3GF6 A;  3POY A;  3C7F A;  2RDR A;  4DFS A;  2FZ2 A;  2XBO 2;  5E1R A;  1YFY A;  4PDW B;  3ETP A;  3QD6 A;  5BNQ A;  2P2K A;  1LRH A;  2Q4S A;  1GP5 A;  1QY4 A;  4GH4 B;  5FY0 A;  3VBH C;  4IE6 A;  3POF A;  1MZF A;  2XJQ A;  5IVY A;  4D7S A;  3K77 A;  4FAH A;  3F2Z A;  4RS5 B;  2O0O A;  4FFI A;  2X5I A;  4LKF A;  2WKK A;  1AYM 2;  5D21 A;  5F5A A;  5C8C C;  4IET A;  4LBQ A;  4XIO A;  2LUW A;  1DCS A;  1W06 A;  2ET1 A;  1RUE 1;  2G19 A;  1YJK A;  4UW3 A;  2Q8C A;  5JOZ A;  4GMP 0;  5LK7 B;  5I91 A;  4CU7 A;  4OHV A;  2OS2 A;  3DPR C;  3O0V A;  3TN9 1;  3ST7 A;  1FPN 3;  2HWF 1;  1UAI A;  4CA9 A;  4QQ2 A;  4TLF A;  1HDK A;  3ZYF A;  3IN9 A;  1WLD A;  3OUJ A;  2E33 A;  3V56 A;  1PHM A;  1R1A 1;  1J1L A;  2EIE A;  4L99 A;  5A7S A;  1OF3 A;  1XYP A;  3LQC A;  3NJV A;  1VBD 2;  3RJR A;  3WT3 A;  2OQ6 A;  2VCA A;  4URT A;  4FTS A;  3AMQ A;  4UBG A;  4BWO A;  1J59 A;  2ZGS A;  2B39 A;  5FJK A;  4HN0 A;  3KCC A;  4GWN A;  3OGR A;  1NE4 A;  1UZW A;  4LOS A;  3WQB A;  3ES1 A;  3OB8 A;  4C1W A;  1XNA A;  5AC9 2;  1CR7 A;  2XKP A;  2JDA A;  2YFU A;  4P14 A;  3ZVX A;  3ZX7 A;  5HI0 A;  5I8Y A;  1JYV A;  3BIW E;  2BDR A;  3I4I A;  4EV0 A;  1SFP A;  2D3S A;  4RHV 1;  4PHZ A;  1RUO A;  2J1A A;  3NNM A;  3AFK A;  5F39 A;  3FFQ A;  4TTG A;  3GBG A;  1ND3 C;  3J8F 3;  2Y26 A;  5JLV A;  1YYN A;  2VME A;  2A5Z A;  4RGK A;  3LIH A;  4LHL A;  2ES3 A;  4K20 A;  2I07 B;  4KH9 A;  3LPF A;  3ZYB A;  4XAA A;  4HVR A;  5CFC C;  2J1T A;  1HB3 A;  2YMZ A;  5HV4 A;  1W6O B;  1OOP A;  2RS3 1;  2ZEW A;  2X5I C;  3OGJ A;  4LXL A;  2Y34 A;  4UFM A;  3I2G A;  3ES4 A;  1CJD A;  3MIF A;  3H8R A;  2DVD A;  1VMJ A;  3VD5 A;  3VDD B;  2KD7 A;  1QOO A;  1MQT A;  2RM2 1;  2DCJ A;  4FOQ A;  5JDB A;  3VHN A;  4FPO B;  1VB2 A;  1LHU A;  3VB9 A;  3ZFG A;  3KMH A;  5T3N A;  4NE9 A;  4QHB A;  1IS4 A;  3S30 A;  2OPK A;  5F3E A;  4Q4W 2;  5IAV A;  4LK7 A;  4Y1Y A;  1PGL 1;  4FAG A;  4RGG A;  3IAQ A;  5GLZ A;  1D0G A;  2QQW A;  4JGZ A;  1H2M A;  4IER A;  5DUU A;  2O1Q A;  3HQU A;  4XAB A;  5EIY B;  4QGL A;  5BNN B;  1WW4 A;  1K3I A;  2LM3 A;  3BU7 A;  2WO1 A;  5G04 L;  3BI3 A;  3NNL A;  2HWC 2;  4AHY A;  3BGA A;  1GNH A;  2W39 A;  3KVA A;  4MXV A;  5C4W A;  3ZIX A;  4G3Y C;  4DMI A;  2BNN A;  2QQN A;  1XQN A;  3NAP A;  5A6Y A;  5JR2 A;  2JG8 B;  2OT7 A;  2VMG A;  3GZU C;  1RUH 1;  2XHN A;  4N53 B;  2EA7 A;  5KBF A;  3S6P A;  2D44 A;  3ZYI B;  1MZE A;  4M4P A;  4AVA A;  4FFH A;  4N43 B;  1UPI A;  1MS0 A;  5A33 B;  1Q43 A;  2WO7 A;  4IGP A;  5DAV A;  3DCQ A;  1RUI 2;  1GQH A;  1S0C A;  3MF9 A;  3VDA A;  2G4I A;  3THC A;  1OBN A;  3A0K A;  1XRU A;  5GZF A;  3JZV A;  2XXZ A;  5EWS A;  3MW4 A;  1VE0 A;  4BME A;  2A71 A;  1WMX A;  4L11 A;  4DUX A;  4BZ4 A;  1W2A X;  3VBH B;  4AI0 A;  5JCT A;  5KWR A;  2XDV A;  3BVC A;  1UX6 A;  2WQ4 A;  2ENR A;  1W2O A;  1YUD A;  1W6M A;  1MQT C;  4QB2 A;  5FZL A;  1W9T A;  2V73 A;  1HRI 2;  1LEM A;  1IQA A;  4UFJ A;  3ZFG C;  2YYO A;  4MH0 E;  5C8C B;  1JU4 A;  1YQC A;  3ZSJ A;  5LEJ A;  3RYK A;  1KD7 A;  1D4M 1;  1PGW 2;  3DPR B;  5FYT A;  2XWB B;  4FVV A;  4BK5 A;  4JGZ C;  3SH5 A;  4DZG A;  1WME A;  3GNE A;  5BNP A;  1RMU 3;  1RUF 1;  5KXE A;  3D4K A;  4PIY A;  3ZXA C;  3OBR A;  5T55 A;  4LR4 A;  1VBA 3;  1R09 1;  1UF2 C;  4AFM A;  4S2G A;  4K9S A;  1GZT A;  4JRL A;  1ENS A;  1V70 A;  4B3N A;  3USS A;  2UU8 A;  1EUU A;  4E2S A;  3C7H A;  3PU8 A;  5FXZ A;  4COW A;  1VMH A;  4BQX A;  3BTY A;  5C4W C;  2KA3 A;  4CU9 A;  4KNC A;  5EXO A;  2PXJ A;  3OGS A;  2ZHN A;  3WUC A;  4XJA A;  2WAO A;  1NCR A;  1OH3 A;  3AL5 A;  1WCD J;  1PIV 3;  1QJU 2;  2D6N A;  4Q5O A;  5JWP A;  4H14 A;  4Q4V 1;  1QU0 A;  4FPH A;  3WP4 A;  5J3U A;  1Z7S 3;  1BVP 1;  1M4W A;  1QXP A;  1W3X A;  4C0H A;  5CNA A;  2WC2 A;  5D2A A;  5ANN A;  2CNA A;  3DKW A;  3MIB A;  3LEM A;  5AFB A;  4P02 B;  3HN1 A;  2MEV 2;  3U37 A;  2R07 1;  3VUO A;  3NW4 A;  2BEO A;  1MR5 A;  1K5J A;  5GLU A;  2ORZ A;  3T1L A;  2PHL A;  1ND3 B;  4LQR A;  4XET A;  1SLL A;  3ORJ A;  1QIQ A;  4IEY A;  2XHK A;  4ZY9 A;  1BBT 3;  2Q1M A;  4P9G A;  5FRE A;  1RUC 2;  4H3W A;  5F5C A;  2XR4 A;  5IK7 A;  2VMF A;  3LEG A;  3T4H B;  2R49 A;  1KS5 A;  1PVX A;  1SBD A;  2WZR 1;  4LTA A;  1Q8O A;  3OEB A;  4FFG A;  3D0S A;  2A3W A;  3JQX A;  5CFC B;  2PTM A;  4LE4 A;  2X5I B;  1W6P B;  4QX0 A;  3U4X A;  1YJL A;  4XUN A;  4W8J A;  1AL0 G;  1PO2 1;  2K2S A;  2Y60 A;  3P6B A;  3K46 A;  4LBQ B;  4XZP A;  1N1S A;  5CKQ A;  3LEK A;  4PCR A;  1NCQ A;  5BPX A;  1JZ6 A;  4QDS A;  3ZYG A;  3ZXJ A;  2C5D A;  2EXH A;  4OUL A;  1T6G C;  4XVH A;  2DVA A;  1S0B A;  4Y20 B;  5C3O A;  3ZXE A;  2RV9 A;  4UYB A;  1OC1 A;  4FTE A;  5LCW L;  2FBE A;  2BFU L;  1TE1 B;  3T2O A;  3WG3 A;  1MVE A;  3K48 A;  2X29 A;  4QB1 A;  1JHN A;  2Y0O A;  4YW3 A;  2VTX A;  4HMZ A;  5F5I A;  1I6X A;  2OA2 A;  1ZZ7 A;  5DAW A;  2C24 A;  4XFA A;  2TBV A;  4BIF A;  4DXZ A;  2OQ7 A;  4HK9 A;  5GM0 A;  3PUH A;  3OBA A;  2MHF A;  3CDZ B;  5IYY A;  3WW3 A;  3AJZ A;  1W6Q A;  1ZA4 A;  3VKM A;  5A32 B;  3JCI A;  4NO4 A;  4YM1 A;  1M06 G;  1NLR A;  1PVC 3;  3HVD A;  4TSV A;  4ZON A;  4XTP A;  1XNB A;  2Q1Z B;  2XML A;  4N7I A;  5J37 A;  3HT2 A;  3O5S A;  2ZCW A;  4MLO A;  2EAL A;  4R4Z A;  1HJG A;  4QDR A;  4SLI A;  4CCD A;  5CU1 A;  3RNS A;  1UCX A;  2RS1 2;  3V0A B;  2W5F A;  2RR1 2;  3O14 A;  4CUC A;  1W2T A;  5LZ6 A;  1G9B A;  3W5N A;  2LW8 A;  1XNK A;  4K3U A;  1JS9 A;  3RRD A;  3IKW A;  3ZXF A;  3RZL A;  4WVV A;  3ITQ A;  5FYI A;  5DDJ 3;  1E57 A;  4EN9 B;  5FK7 A;  1JXN A;  1O4Y A;  2NQY A;  4UFI A;  3SH4 A;  3UJO A;  5C33 A;  5C8W A;  1A78 A;  3LFI A;  5B2G B;  3BU0 A;  4E4D X;  1XPW A;  5LY1 A;  2P3K A;  4P00 B;  3NNG A;  1XU1 A;  1UO9 A;  4BM8 A;  2RDS A;  1YHF A;  1R08 2;  1AR7 1;  2SBA A;  1RVF 1;  1D2Q A;  5A1L A;  2YHJ A;  5BXX A;  4CPB A;  2OXB A;  3ZFG B;  3IPV B;  4LO7 A;  1IZ3 A;  3INA A;  4Y24 A;  3AFG A;  5JXJ A;  1IG3 A;  4AVV A;  1ZBA 2;  5EQU A;  4DS0 A;  4ERO A;  4CDU C;  2IXI A;  4YLZ A;  1X50 A;  4E8C A;  1YNA A;  1OLM A;  2FHR A;  3KCX A;  4LMF A;  1PGS A;  4DRV A;  3ZOI A;  2NP0 A;  1ENQ A;  2XGX A;  4PBP A;  3PUI A;  4IV1 C;  4PF5 A;  2VL4 A;  4L2N A;  1IOA A;  1CWP A;  4FXG B;  1WBF A;  3GXU A;  1O4Z A;  2VQT A;  1UOB A;  1K45 A;  3I2D A;  4YVS C;  2ZEX A;  3WW1 A;  1QJX 1;  2VD7 A;  5LRR A;  3UGF A;  2DYC A;  3ILR A;  3R4S A;  4AI9 A;  3PUA A;  4PF1 A;  1YFU A;  5EJ3 A;  4JKK A;  4JTO A;  2RDN A;  1UMI A;  3VL9 A;  2XJP A;  2BWC A;  4QKB A;  3O1T A;  2W68 A;  3BAL A;  4QX2 A;  1FPN 2;  4XF9 A;  2RS5 2;  2BTV C;  3DN7 A;  3NV3 A;  4V1P A;  5IK4 A;  3VBU A;  4AWD A;  2PQQ A;  4A4A A;  2TEP A;  3A4U A;  4XQ4 A;  4CTE A;  3AP4 A;  2W3J A;  1L7L A;  4JQR A;  3H3L A;  1TMF 1;  5LA0 A;  1JYI A;  1KGY A;  2LRO A;  2D6L X;  2VZQ A;  2W95 A;  4FI9 A;  4R52 A;  2E6V A;  4DXT A;  4XDO A;  4N90 A;  4Q4X 2;  3ZN6 B;  2D93 A;  3UJQ A;  3M3I A;  1CVN A;  1RHI 1;  1ZZ9 A;  1ULO A;  2R04 2;  5JSO A;  4AK3 A;  1EV1 2;  4FOV A;  2B9V A;  1OF4 A;  2GMM A;  4BXS V;  1DQ4 A;  1PK6 B;  2ZJC A;  3KV5 A;  1YI7 A;  1LR5 A;  2AH2 A;  1J58 A;  3S5Q A;  3JBG 3;  4HOO A;  4QMA A;  4CU8 A;  1DF0 A;  2FDK A;  4RGA A;  2VMI A;  4R9A A;  2EXJ A;  4Y1U A;  4PLM A;  1VRH 2;  2QVS B;  2HWE 1;  3B9I A;  3KSC A;  4AG4 A;  3ZFE A;  2PA7 A;  2XBO 3;  2YG0 A;  3RQ0 A;  1RUD 2;  3VV1 A;  3GBF A;  2X09 A;  4BQ4 A;  5ERL A;  2HEW F;  4MSV A;  2EXK A;  2DWR A;  1KDM A;  4MGY E;  4CXY A;  4OVE A;  3N9Q A;  2X53 S;  4Q0U A;  5A1A A;  4YGC A;  3R0R A;  5K0U A;  4MHU A;  5FMO L;  5D1I A;  1AYM 3;  3KT4 A;  2A6W A;  2E7T A;  3PJY A;  4AAP A;  3CU7 A;  1V9U 2;  2VVD A;  1UKG A;  1W2N A;  1QOS A;  3APB A;  3E97 A;  4Q0Q A;  1W2U A;  3MUY 1;  3OGV A;  4B29 A;  3FHI B;  4XHB A;  3VBU C;  4XUP A;  3LIG A;  2VJX A;  2A1X A;  2IUW A;  4AVC A;  2B42 B;  3LDR A;  4OFG A;  4XFC A;  2PLV 1;  5LB6 A;  4EWE A;  1DZQ A;  4RN5 A;  4B7E A;  2VNO A;  1R64 A;  3MO4 A;  5EHD A;  1VBD 3;  1CN1 A;  1ZBE 2;  2Y38 A;  1C8M 2;  4Y26 A;  2CGO A;  2GZW A;  1GAN A;  4ISQ A;  5LBC A;  2LTN A;  1VBB 1;  2XQR A;  4LHN A;  5GLT A;  3JUU A;  3VKL A;  2CU5 A;  3NWK A;  2C1F A;  1PZ8 A;  2XG3 A;  4Q0V A;  4YW5 A;  4IGQ A;  5AC9 3;  4BCU A;  4E4Z A;  1WUV A;  2C26 A;  1OA4 A;  1CAW A;  2NYY A;  3ZXL A;  4AHX A;  3CJI A;  2RM2 3;  4URA A;  5BY5 A;  3AYE A;  3B5L B;  3FBM A;  3PVN A;  4H2A A;  3ZR6 A;  5FO8 B;  4X8N A;  4DO0 A;  1SDD B;  2BVV A;  4ZKT B;  2FDI A;  3T2T A;  1V6I A;  2PHF A;  1OA3 A;  4UAP A;  2K46 A;  1UYZ A;  2V72 A;  3U78 A;  1AL2 1;  4BQW A;  1OFN A;  2A73 B;  2IXL A;  2PFW A;  3ZMN A;  4ARX A;  3MZH A;  2FCU A;  4CDU B;  3VBO B;  2JDM A;  5FP8 A;  3BTA A;  1HN1 A;  1S55 A;  5IVB A;  1N47 A;  3PL0 A;  1AVB A;  4IV1 B;  2XUE A;  1Y7B A;  5FLH A;  3RGB A;  2DBI A;  2DVB A;  4LE3 A;  3IDE A;  3B3Q E;  4CCN A;  1C5I A;  4OUM A;  2YBP A;  5CYY A;  4YVS B;  1S0F A;  1XE8 A;  4FPY A;  4LJH A;  1ULE A;  2GN3 A;  4Q4W 3;  4GB3 1;  3UV9 A;  5IUQ A;  3MIG A;  1SFY A;  1SLI A;  4NII A;  1D2S A;  5C3Q A;  4CDQ A;  2JWP A;  1FOD 1;  2VG9 A;  3TB0 A;  1RMU 2;  2WSV A;  4MXW A;  4RYD A;  4XYX A;  4F83 A;  1VBA 2;  5J7M A;  3PME A;  5A3P A;  1WD3 A;  2HWC 3;  5FUP A;  1N1V A;  3V0B A;  5F3I A;  2WNV C;  3E5X A;  4XZU G;  3UNP A;  1BEV 2;  4XOG A;  1D7P M;  1AUY A;  3AZY A;  4HZF A;  4QQL A;  4ASM B;  1NZI A;  1RGS A;  5F6L B;  1CAV A;  1PIV 2;  3WNO A;  1G6N A;  1OLQ A;  3WNN A;  2VZV A;  3OJB A;  4X8P A;  5DMY A;  4XC9 A;  4XF3 A;  1V6O A;  5EYY A;  2DV9 A;  2GN7 A;  4NOT A;  1GKB A;  2I45 A;  5FCC A;  3ZYR A;  1FMD 1;  1Q56 A;  4MGI E;  4AI1 A;  4NIG A;  1H8T B;  4FQ4 A;  1WA4 A;  5FYB A;  4ATF A;  3E1F 1;  1QF3 A;  1SEF A;  1UYX A;  4GH4 C;  1RUJ 1;  2E63 A;  4HG6 B;  1GWL A;  2QZ3 A;  3V64 A;  2JIC A;  4X6R B;  3BOP A;  3WF2 A;  5A1F A;  3WDW A;  4NHK A;  3WSO A;  2D5H A;  2PHX A;  1E5R A;  2YBK A;  1W9F A;  1N3P A;  4GIQ A;  1KS4 A;  1O5L A;  1UY2 A;  1H6X A;  1V6J A;  1RYY A;  3NV1 A;  4NWW A;  4QWN A;  3AVS A;  1QGL A;  4AVB A;  4E4S A;  3FLT A;  2CGN A;  3I97 A;  5IAT A;  4LO8 A;  4CEW A;  2HBT A;  4ASL A;  2BGO A;  4RSU A;  1QQP 3;  5KHI A;  3M3C A;  2P6C A;  2PAE A;  4ONU A;  2BOI A;  5A3W A;  3TYJ A;  1HXS 3;  2NZ9 A;  4OMD A;  2J1V A;  2WZP P;  4DRR A;  4CDQ C;  4H7M A;  3VBU B;  5A7W B;  2DU0 A;  4QQP A;  5JZG A;  2E26 A;  5ACA 2;  1PNF A;  1SFN A;  2I2S A;  3NL1 A;  3T0D A;  4K21 A;  1O5U A;  1W04 A;  4MGT A;  1ST8 A;  1QH7 A;  2WIN B;  2AGS A;  2VQU A;  4N7U A;  1HRV 2;  2EIC A;  2RDQ A;  3EMR A;  5A3M A;  5K9Y A;  2Q8E A;  3FWE A;  1PVC 2;  4B4Q A;  2EXI A;  4LBK A;  4MO3 M;  4OHY A;  3C7E A;  5GLV A;  1PMI A;  2VEC A;  1IPS A;  2MPF A;  1TZO A;  1JI6 A;  4XJZ A;  4IEV A;  4OI1 A;  2EAK A;  4M3C F;  4BPZ A;  1PX3 A;  1S0D A;  1H0B A;  4MOA A;  5FUN A;  5CFD C;  3WLU A;  2YV8 A;  4WM8 C;  2ZBJ A;  3PHM A;  4QHO A;  4RD7 A;  2WZ8 A;  5KHK A;  1IPJ A;  1DQ2 A;  3A22 A;  1ZX5 A;  3ASI A;  5CIR A;  4LIV A;  1RUC 3;  1F5J A;  3MLK A;  4XJW A;  5JSR A;  2ATF A;  2UWB A;  3O1V A;  4YW1 A;  2AAC A;  3USU A;  4O7X A;  3WF0 A;  4IE4 A;  3M4F A;  2HWB 3;  4CCC A;  3W21 A;  5FMB A;  4CEY A;  2LS6 A;  1F8V A;  2E53 A;  5FIX A;  5GAL A;  5FUI A;  4CEW C;  2W46 A;  1SLT A;  3NQH A;  3PTR B;  2R7E B;  3ACL A;  3EB7 A;  4XUO A;  3S0M A;  1ND2 A;  1SQ4 A;  1PO1 2;  1SCS A;  2W94 A;  4EE2 A;  4HK8 A;  1VBC 1;  4E4H A;  1ODM A;  1RB8 G;  2Y6F A;  4J25 A;  3S7E A;  3T3Y A;  2VXR A;  3T0B A;  1XNT A;  3I59 A;  2E9Q A;  2ZGO A;  4ZHN A;  2WLQ A;  4AI3 A;  1BMV 2;  2ID4 A;  3O0X A;  1WKY A;  3TNQ A;  2O8Q A;  4Q4Y 1;  3HBK A;  3S5A A;  2C9A A;  3NNF A;  1ZRC A;  5HPO A;  4TWT A;  3AB0 A;  4ZU4 A;  5JXG A;  4GQ7 A;  4KWL A;  3VHO A;  2E51 A;  2WNV B;  4AQT A;  2BPA 2;  3KT7 A;  1PMJ X;  2J42 A;  5C6C A;  1XU2 A;  2PN5 A;  4QPG C;  3WF4 A;  3H8O A;  2RMU 1;  3OD4 A;  1DP0 A;  2YFZ A;  4AED A;  3WNM A;  2WS9 1;  3VBS A;  3NRU A;  1AR7 3;  3POJ A;  4AGV A;  4NMI A;  3U11 A;  2RS1 3;  1U12 A;  3AZV A;  4MUV A;  1GZW A;  5F37 A;  3B00 A;  1POV 3;  2D3P A;  3VDB A;  2KR2 A;  4A2U A;  2VW1 A;  4BXF A;  2XH6 A;  1JZ2 A;  3VKF C;  5FKC A;  2FD8 A;  1XJA A;  4R9B A;  4JDM A;  5T5L A;  4D6S A;  2IXC A;  3H0O A;  1UX7 A;  3M3O A;  3P3P A;  4LKS A;  4OQ8 A;  4P9W A;  3WF3 A;  4Z2W A;  2B9U A;  3N9O A;  4CEY C;  1W03 A;  2FDG A;  2OUH A;  2YPJ A;  2A75 A;  3LSE A;  2Y6H A;  1N3O A;  4P5Y A;  5FYY A;  4UW4 A;  3UYJ A;  2YPD A;  4L0P A;  1FYU A;  5L36 A;  1NE6 A;  2RHP A;  3CF6 E;  4AYU A;  3S57 A;  2PHD A;  3ACG A;  1GIC A;  4HN1 A;  1WCK A;  1YCI A;  2YU1 A;  3K4Z A;  5DN2 A;  5KXB A;  5E8A A;  1WA6 X;  1CJP A;  1UMH A;  4XAE A;  2GP3 A;  1LHO A;  2P3I A;  1ZBA 3;  2ZTN A;  4J6G A;  2HWF 2;  4WM7 A;  3TN9 2;  4HKL A;  4CZS A;  4CDQ B;  4JVA A;  1UOJ A;  3FMG A;  2ZHK A;  3LE0 A;  1GOH A;  1QJY 1;  1JZ8 A;  1RUG 1;  4MXW B;  3FN9 A;  1DYO A;  1OLM E;  4MZU A;  1US3 A;  3A23 A;  4LT5 A;  1R1A 2;  1JUH A;  1UL9 A;  3O12 A;  3V0B B;  3B01 A;  1O3T A;  1WGP A;  4Y22 B;  3DEC A;  4QU2 A;  3L2H A;  3LA3 A;  3FHA A;  4XUT A;  4CDX A;  5KHJ A;  3WIN E;  4AED C;  3KM5 A;  4RR3 A;  3EQE A;  3ON7 A;  5FYS A;  1JYC A;  5EZW A;  4CCJ A;  2QQO A;  5CKM A;  5M0T A;  5DUX A;  2Z5W A;  2ARE A;  1IS5 A;  1NA1 A;  2HBU A;  5F8P A;  2RS5 3;  4LBJ A;  3MIC A;  2G9F A;  2XON A;  1J1T A;  3PVB B;  4Q8L A;  2VVF A;  4RHV 2;  5IVE A;  5CFD B;  2ZKL A;  2O8O A;  3UET A;  4YFZ A;  1MS4 A;  1W3V A;  3TRS B;  1CX4 A;  3WDX A;  2YC0 A;  5F5Q A;  4WM8 B;  2KM2 A;  4A6S A;  1QNY A;  4MGK E;  4LNV A;  4PI0 A;  5APA A;  5FZE A;  5I93 A;  4NRM A;  1YFW A;  3BTZ A;  4IEU A;  4Q4X 3;  1OQE A;  4DOU A;  1ZRD A;  4Y3O A;  3TEZ A;  1CES A;  2R04 3;  1DLC A;  4YG0 A;  2WYS A;  1EV1 3;  4BA6 A;  3HBZ A;  5HCA A;  3ZSE A;  2EIB A;  2UY8 A;  5FP9 A;  5A7O A;  2BRT A;  1GWK A;  4KBZ A;  2VCM A;  4EN0 A;  4FBF A;  3KQ4 B;  1F9K A;  2RM2 2;  3H7J A;  4BJ0 A;  4JGY C;  4NPM A;  4CUG A;  3G7D A;  3B9C A;  1VRH 3;  4PQQ A;  4WM7 C;  4OQ9 A;  3UK9 A;  3AL6 A;  5JPN B;  1VAL A;  4XCA A;  1YI9 A;  1RUD 3;  3EJK A;  5A6X A;  4QXH A;  4KWK A;  4AFA A;  1GV9 A;  1OQD A;  4Z92 B;  1W8O A;  2XVL A;  5FY8 A;  1WCS A;  5C5T A;  2J7M A;  3SQO A;  1T2X A;  1YLL A;  2P1B A;  3MV1 1;  5F32 A;  4I3G A;  5FY7 A;  4BK4 A;  1F2N A;  5JIA A;  5KC5 A;  2Y6G A;  2ZX1 A;  1D0H A;  1YIF A;  5C3P A;  4D94 A;  1V9U 3;  4RR3 C;  2AEZ A;  4LUL A;  4P08 A;  4DIQ A;  4GWM A;  2BOJ A;  1RTV A;  3GJB A;  1JOB A;  3BPS A;  1W39 A;  2XLA A;  2ZAB A;  1C5H A;  4QPG B;  4JQT A;  5FRA A;  1NA1 C;  1H6Y A;  1I1E A;  3LPG A;  4XJ8 A;  1RUH 2;  2D6M A;  5H9Q A;  1LOG A;  1MEC 1;  1BJQ A;  3BTX A;  3HIF A;  2ZAC A;  3MF6 A;  3GCX A;  3FC0 A;  2NM1 A;  4L9B A;  3ECQ A;  3AXE A;  5BUV A;  3QH6 A;  2WO3 A;  1JTZ X;  2E7A A;  4GKY A;  3OD0 A;  4HSL A;  4LBQ D;  3U07 A;  1ZBE 3;  1H8V A;  1C8M 3;  5L7O A;  5K7P A;  1ULG A;  4GAZ A;  5FQ0 B;  3HN3 A;  2BWA A;  3CBN A;  4LIU A;  1UY4 A;  3Q8C A;  1A8M A;  3PVE A;  1HJF A;  2A6X A;  2WO2 A;  1EYB A;  1J3P A;  3FE5 A;  3POE A;  4CEY B;  1WLC A;  4A7Y A;  5JI9 A;  2ZGQ A;  1NY7 1;  2BBA A;  3ZLI A;  2R06 1;  1CAU B;  3C7G A;  4PIZ A;  2QQM A;  1KJR A;  3THP A;  1CAX A;  3ATG A;  3N7L A;  3H1M A;  3I2K A;  4MGZ E;  4OI0 A;  3NJZ A;  2A3Y A;  2DF7 A;  3CLP A;  3GYD A;  5J98 B;  1ZRR A;  4EJR A;  3O1U A;  4QX3 A;  2F4P A;  4IUG A;  2VZU A;  2YU2 A;  3AK0 A;  3D0J A;  2NMN A;  1CPM A;  2VXJ A;  3K4D A;  4GMP 3;  4WV8 A;  5FYH A;  5AVP A;  3RS6 A;  1Z0H A;  1D4M 2;  4IE0 A;  4JHZ A;  4LPL A;  4B8E A;  5IJR A;  3RZH A;  3J9S A;  1UWW A;  2JIJ A;  4HPK B;  1RUF 2;  3JB8 A;  1W9Y A;  1OOP C;  1Y3T A;  4YZ3 A;  5FZ9 A;  4HAN A;  4NN0 A;  5I8T A;  2J1U A;  3QH7 A;  3MW3 A;  2EF6 A;  2H0V A;  2P4E A;  1IG0 A;  4LBO A;  2FMD A;  1WLW A;  2F17 A;  4M3C A;  4BHP A;  2BYV E;  1WW7 A;  1BCX A;  3JXS A;  4EZ4 A;  3TWI A;  3AMP A;  4E2Q A;  1TNR A;  2W92 A;  2FDF A;  3OY8 A;  2OYZ A;  4AFC A;  3VD7 A;  2E7Q A;  1FNZ A;  1JOJ A;  5H9S A;  4AED B;  2D97 A;  4TZD A;  1QQP 2;  4MVT A;  3O1M A;  1EP0 A;  3MEP A;  3KWV A;  4Q4V 2;  4CSW A;  3VN4 A;  4YPJ A;  1HXS 2;  1DZR A;  1NAE A;  5A7N A;  1Z78 A;  3AP7 A;  2GNB A;  3HR9 A;  1BLZ A;  4JDN A;  1J3Q A;  3HEI A;  1TME 1;  5IAX A;  2R07 2;  2ZAH A;  4XMA A;  1AXZ A;  1FNY A;  4PIX A;  1QJZ A;  4Q0S A;  1AR9 1;  3EHK A;  3ETQ A;  3M8L A;  4IV3 A;  1X9P A;  1BEV 3;  1C1L A;  3E5Q A;  4L8Q A;  4QKN A;  5DPN A;  3H50 A;  4YW6 A;  4BDV B;  1CZS A;  2VNV A;  1LHV A;  5BNO A;  1W8W A;  5LAT A;  3NAP C;  5CKN A;  2JEM A;  2WZR 2;  3D3A A;  4XFF A;  4YZ5 A;  3URF A;  5JSP A;  1AX0 A;  5CAZ A;  5C9A A;  4GAL A;  5C3S A;  4R8H A;  3N3H A;  3BOW A;  4UF0 B;  1VAM A;  1PO2 2;  3K75 B;  4QXK A;  4XJU A;  2DBN A;  1A34 A;  4AE2 A;  3T2Q A;  3I3B A;  4QGM A;  2WFF 3;  3D6E A;  3MIH A;  4Q0P A;  2DVF A;  5FZO A;  1XXN A;  2VMD A;  4JGY B;  2QQI A;  1NX9 A;  3D8C A;  1BKZ A;  4XDQ A;  4FPF A;  1PM4 A;  1YEW A;  1UIJ A;  2DFC A;  4EWA A;  3LCP A;  4IEZ A;  4LA2 A;  2QUO A;  2ZOE B;  4YAR A;  4XTM A;  4V2V A;  4NHY A;  2WBK A;  2V4A A;  2NLR A;  4XQD A;  4M4R A;  3WD5 A;  2HWB 2;  1SHW B;  2VOX A;  4NIA A;  2HEV F;  2VU9 A;  4DIN B;  1G7Y A;  1HX6 A;  3ZM8 A;  4QPI A;  1H1I A;  4RR3 B;  2VBD A;  3POG A;  5L19 A;  1WCU A;  1ASJ 1;  4Z1V A;  2ZGM A;  3GJA A;  4Y1X A;  2XJV A;  4XUQ A;  3CIH A;  5SV8 A;  1FT9 A;  1NA1 B;  5BNP C;  1C1F A;  2B45 X;  2JG9 A;  3ZN5 A;  1FX5 A;  1W8F A;  2Y8K A;  4NR1 A;  1QXJ A;  3BIE A;  3VZK A;  3AKT A;  4Y5S A;  2R1D A;  2J1E A;  5ACA 3;  4NAM A;  4XEZ A;  4KU7 A;  2JEC A;  5FAX A;  4AF9 A;  5FDB A;  4ATE A;  4ES8 A;  2FMY A;  3QAC A;  2CGP A;  2BVB A;  2VZP A;  2ZGT A;  4NUB A;  1QNW A;  3FUQ A;  5SV5 A;  5FMO S;  5BNO C;  3MHZ A;  3T0A A;  1LHN A;  5EPA A;  2P3Y A;  1HRV 3;  2XKO A;  2ZGR A;  3KF3 A;  3MI8 A;  2GH2 A;  5LA2 A;  1JZ7 A;  2WQ8 A;  1NCR C;  4IE7 A;  4D7T A;  4L92 A;  3KVB A;  1X8E A;  4B4P A;  1UZY A;  2MEV 1;  5C9A C;  3RPQ A;  1BZW A;  5FK8 A;  3POW A;  3AKR A;  4NVP A;  5FZK A;  5A7P A;  5FR3 A;  2Q1F A;  1H2L A;  4FFF A;  4GJZ A;  3AXD A;  5IVF A;  1AR7 2;  1RVF 2;  3IDB B;  3Q8F A;  3X29 B;  2DCT A;  3ZFF A;  4CCM A;  2PMW B;  2WT2 A;  5FZ6 A;  4S2D A;  4AAX A;  4M0N A;  5FZ0 A;  3WVJ A;  2DU1 A;  4P9X A;  2OZJ A;  4NRO A;  3WG4 A;  3KV9 A;  2C0Z A;  4RL7 A;  3N35 A;  3FLP A;  4HKO A;  1ULD A;  4Q4Y 3;  3VBF A;  1COV 3;  1GUI A;  2GH8 A;  2IFR A;  3MLJ A;  3ZO0 B;  1OOP B;  5IVV A;  4CDW A;  2CWS A;  1YQ2 A;  5HBA A;  3MPP G;  3IM0 A;  2VW0 A;  1H1A A;  1UNB A;  1NCQ C;  4SBV A;  1V0A A;  1RIR A;  1MQT B;  1PO1 3;  5HV0 A;  2ARA A;  3C8X A;  5FZ1 A;  1Q8Q A;  1QJX 2;  4CP1 A;  3WDV A;  2WS9 3;  3AC0 A;  5B4X A;  1DGW X;  4OUS A;  5FPL A;  4XDP A;  5LBE A;  3OEA A;  1XB9 A;  4HSJ A;  4ZS2 A;  4IEW A;  3R05 A;  1IS6 A;  1V6K A;  4MG2 A;  4JGZ B;  4S2F A;  1URX A;  2WNU A;  1LKN A;  4XHX A;  3N4M A;  4KG0 A;  2Z42 A;  2GSY A;  1E5H A;  1W0P A;  2R32 A;  4BQ2 A;  1KQR A;  1VBE 1;  2W1W A;  3IAP A;  3Q8E A;  4N8M A;  1O59 A;  2Z69 A;  2VC9 A;  1TMF 2;  3GZA A;  3SNM A;  2VOW A;  2WAB A;  1KIT A;  5C4W B;  4AFD A;  1LGC A;  2RE9 A;  1NT0 A;  2BNO A;  2RR1 1;  1LED A;  4Y1Z A;  1RHI 2;  3NAP B;  4E2G A;  3SEP A;  3SKV A;  4I02 A;  2ZS6 B;  5ANQ A;  4Q8K A;  1I5P A;  2DTW A;  1VAK A;  2YDE A;  2A6V A;  2Y6J A;  1W8Z A;  1VB4 A;  4M00 A;  2BER A;  4UFH A;  1GMM A;  2CDO A;  5DZF A;  4FT8 A;  3LWC A;  4XBL A;  5L9V A;  1ZZ6 A;  1ZRE A;  3WP5 A;  4LBL A;  1S0E A;  4QM8 A;  3MIE A;  2X05 A;  4IQP A;  4YGE A;  5DZE A;  2HWE 2;  3KCY A;  1AR8 1;  2ZZQ A;  3WDY A;  1R08 1;  3VBF C;  3GBW A;  3TEX A;  3DXT A;  3VL8 A;  3ZIW A;  4BOW A;  1S0G A;  5I0R A;  4CDW C;  1BYH A;  5KR7 A;  4A3X A;  5FJH A;  5FP7 A;  5FP3 A;  3PIG A;  5EFU A;  4QT6 A;  1W6M B;  1Y9M A;  3AM2 A;  1EY2 A;  5FZM A;  5A3N A;  3GCW A;  3UKV A;  1XYO A;  2DVG A;  4EQV A;  3TEY A;  2WNE A;  1NZC A;  1RUE 3;  5FO7 B;  1GOG A;  2GU9 A;  5FZG A;  4HVQ A;  4DUW A;  2QDR A;  3WW2 A;  5D8A A;  4RQP A;  4OYU A;  5KXC A;  1O8P A;  3TN9 3;  4AI2 A;  2HWF 3;  5EV7 A;  5BNP B;  3E6C C;  1WCQ A;  2WNU C;  1BVV A;  4LUM A;  4P9Y A;  1Q3E A;  1XND A;  2PYT A;  2DUP A;  2PLV 2;  4BE3 A;  2JD4 A;  4OCT A;  4CYD A;  4FOY A;  1O8S A;  1R1A 3;  5DUW A;  2NPI A;  1SDW A;  2VUA A;  4CPB D;  2XOM A;  3H3U A;  5A80 A;  4YVW A;  1ZA7 A;  2YGM A;  4D69 A;  4O61 A;  3POB A;  5A6Z A;  1SLC A;  4COV A;  1NOV A;  3KHB A;  3OPZ A;  4WVM A;  1VBB 2;  3K51 A;  3RYP A;  5GJ6 A;  1NCR B;  2D98 A;  3FLR A;  5FXX A;  5C9A B;  3K4A A;  5FTT C;  4CCL A;  5C7G A;  3LA2 A;  5DAX A;  3ZKU A;  2VNR A;  2PHU A;  5FZH A;  4RHV 3;  3RWK X;  1B35 A;  4KGQ A;  1EUT A;  4YG6 A;  1P8J A;  4LLO A;  4OI2 A;  3VZL A;  1PNG A;  4YGB A;  3TAY A;  5DXD A;  3T1M A;  5FKB A;  2ZMK A;  5C3R A;  4CUA A;  2XVG A;  4FP3 A;  1YIP A;  1AL2 2;  1G8W A;  1OSG A;  2X10 A;  1W6N A;  2XL7 A;  3GHN A;  2AEY A;  1XOY A;  4A42 A;  3WHT A;  2RS3 3;  3OUI A;  5IT6 A;  3LA7 A;  1JU3 A;  1Y43 B;  4PLO A;  3VHP A;  3VBR A;  4OZO A;  1HV0 A;  2WJS A;  3J8F 1;  2VZO A;  5ABJ A;  1NCQ B;  1GYK A;  5DAQ A;  4W6Y A;  5D8A C;  4RQP C;  3PJQ A;  2D5F A;  4ZZ5 A;  4M01 A;  1QJF A;  1NXD 1;  3UGH A;  3ZFE C;  2RVA A;  2WQZ C;  4GKX A;  4LHS A;  2D6P A;  3RZK A;  5F2W A;  3ZYJ B;  2O14 A;  4GB3 2;  3BYW A;  4QM9 A;  4QXB A;  3I8T A;  4XBN A;  3GZE A;  5L9R A;  3O1P A;  1GP6 A;  2PHT A;  2VQ0 A;  2Y0I A;  2PEL A;  5LBF A;  4CVU A;  2W0X A;  3KF5 A;  1FOD 2;  4S2H A;  2E32 A;  5K0U C;  1H9P A;  1K5M A;  1NLQ A;  1SLA A;  3IDA A;  1BHG A;  4YVW C;  4K6B A;  4ZU5 A;  3HNB M;  5FOJ B;  3RMX A;  1W6Q B;  3ABZ A;  2VZT A;  4EN6 B;  4JCK A;  1X7N A;  5KC6 A;  3JB4 C;  5LWB A;  2CHH A;  1GZ9 A;  5FZF A;  5CA6 A;  4FO9 A;  4LOT A;  1RUH 3;  5TSW A;  3W59 A;  1RL3 A;  1CPN A;  1EAH 1;  1LOE A;  1POQ A;  2VBP A;  4Z82 A;  5CVR A;  1H4G A;  4LBM A;  1XSR A;  3NV4 A;  5LRS A;  4QB6 A;  1FMD 2;  2CAV A;  2ZGL A;  3DXU A;  5FOB B;  2HH9 A;  2VE1 A;  3WR0 A;  1BK0 A;  1LOA A;  1RUJ 2;  1TQ5 A;  2P6H A;  2VGD A;  3WUD A;  2XL9 A;  4NRQ A;  5T54 A;  1AX1 A;  3VBF B;  1FAY A;  1AR6 1;  2IC1 A;  4UFK A;  3PMS A;  3SXW A;  5CB7 A;  2JDY A;  4CDW B;  3LDB A;  3OBZ A;  2VMC A;  3KGZ A;  5IWF A;  2DCK A;  2VUC A;  2VQA A;  4A45 A;  4MYE A;  1ZZC A;  2QCS B;  3FHQ A;  3CJI C;  2JJ6 A;  1LGB A;  3CEW A;  3RDI A;  3HWJ A;  3H8X A;  4FCA A;  3AZW A;  4PDW A;  1O6U A;  3MFA A;  3BCW A;  2JE8 A;  1W05 A;  2WFF 2;  3HNM A;  1MVQ A;  3OSD A;  4K8F A;  4I0A A;  5E16 A;  2J22 A;  1D4M 3;  4LO5 B;  3Q9O A;  1YFX A;  5HXV A;  2GNM A;  1SMV A;  1RUF 3;  3M7A A;  4RS5 A;  2GC1 A;  2TUN A;  5IK5 A;  1K5M C;  1TME 3;  1HKD A;  3MGU A;  4A3Z A;  1R09 3;  1XSQ A;  4W6X A;  4BU2 A;  2WLP A;  1QMJ A;  4FOW A;  4COZ A;  5K4L A;  1PM7 A;  2GP5 A;  2H0B A;  5LY2 A;  3SIT A;  5FY1 A;  1SLB A;  4C1X A;  3WG2 A;  4M3C E;  1AHS A;  5FY4 A;  4EYU A;  5F3C A;  1CGP A;  3VZJ A;  1CON A;  5FPZ A;  5IVC A;  4NID A;  4W65 A;  1DLL A;  2NMO A;  2ZHM A;  4RFR B;  1PMH X;  1X82 A;  4PT6 A;  1RJ7 A;  1VBA 1;  4Q4V 3;  2VO5 A;  2ZGN A;  4Z07 A;  2H6C A;  2BW8 A;  5FO9 B;  1KRI A;  2WN2 A;  4JKL A;  2YB7 A;  2VTX J;  5EYX A;  5FYC A;  3LSD A;  1CX1 A;  2I74 A;  1AYN 1;  2TNF A;  2IVI B;  4UW5 A;  5FPX A;  2R07 3;  3H7Y A;  1KXG A;  5IHR A;  4EN8 B;  2R1B A;  4K1Z A;  2YRO A;  2G9Z A;  3W9A A;  1L7Q A;  1Z7S 1;  3OBT A;  5JOW A;  2JE9 A;  3WNL A;  2YC2 A;  2WZR 3;  1W0O A;  1YC6 1;  4K40 A;  3J7H A;  4IL7 A;  1N3Q A;  4FPJ A;  4LK6 A;  1PO2 3;  1IGO A;  1C4R A;  1XC6 A;  4PDW C;  4CRQ A;  2Q5T A;  4JRA A;  4XF1 A;  2PAK A;  1BBT 1;  2RJ2 A;  3WDU A;  1AXY A;  4RQP B;  4EZH A;  4AVT A;  2Q8O A;  4MGS A;  3NJY A;  1OD5 A;  1VBC 2;  3CNA A;  3W58 A;  3ZFE B;  5FPU A;  3I54 A;  1U5Y A;  4YGD A;  1W6O A;  1UD1 A;  3RZG A;  2JDK A;  4YW7 A;  2B5H A;  2QQL A;  2WWJ A;  2XLG A;  1UU6 A;  3E6D A;  4D0Q A;  1DYK A;  3VDD A;  4KU8 A;  4OLL A;  4HLT A;  3VLB B;  3WDT A;  4Q4Y 2;  3Q8B A;  1COV 2;  2JDH A;  5K0U B;  1JHJ A;  1O4T A;  3N7J A;  4JDO A;  1FXZ A;  2VAU A;  4OHX A;  5DAB A;  4J1X A;  3M3Q A;  2V5D A;  4BH9 A;  5I0S A;  4I0W B;  1U5I A;  3JD7 1;  2ZKN A;  4GA9 A;  3J7N A;  4IEP A;  5H9P A;  3ROU A;  1JW6 A;  2RMU 2;  2IXH A;  4YRD A;  2E31 A;  5AVA A;  4AGG A;  1A6C A;  1BQP A;  2WS9 2;  4XIL A;  5JMO A;  2QE3 A;  3D5O A;  4FP2 A;  3WHU A;  5JZG C;  3ME2 A;  3P1I A;  2BU9 A;  5CG8 A;  3ZSL A;  4QU1 A;  4FXK B;  4IEX A;  2ZPX A;  4N9I A;  2FCV A;  2Y33 A;  3ILN A;  1PVC 1;  5A3O A;  1H9W A;  2BJS A;  1G86 A;  1VLN A;  2LAL A;  2DUO A;  1LCL A;  3FBY A;  2G9G A;  1J83 A;  2BP6 A;  4XFI A;  2QFE A;  1GQP A;  2VZR A;  4P5H A;  1JH5 A;  5GLW A;  2JG8 A;  3SIS A;  3UT0 A;  2W91 A;  3RJ2 X;  3MW2 A;  3N9L A;  3U75 A;  3TEW A;  4KQ7 A;  4N43 A;  3T09 A;  3I3M A;  5A33 A;  1HV1 A;  1JYW A;  4JZR A;  3NST A;  3C7O A;  3PTY A;  5J1X A;  2X8K A;  4FQZ A;  1CAW B;  3AZZ A;  3DUI A;  1RVF 3;  1W9S A;  3CJI B;  3DEM A;  1XNC A;  4U2A A;  1HQL A;  5DDJ 1;  5FBZ A;  4CUB A;  1HQN A;  1KFU L;  4IGO A;  4Y33 A;  5H9R A;  4OHZ A;  1LB2 A;  3GDB A;  4K8R B;  5KXD A;  4PI2 A;  1IS3 A;  1JBC A;  4UI9 L;  3VDD C;  1G9D A;  5A3L A;  3HNY M;  2VCB A;  3N9N A;  1DGL A;  3ELN A;  2EVX A;  1QJY 2;  3MPB A;  1LU2 A;  1RUG 2;  1K5M B;  1RED A;  2B8M A;  3UKN A;  1IKP A;  1RJ8 A;  4FTB A;  1DGW A;  3NKT A;  3ZR5 A;  1QEX A;  3I2F A;  1HW5 A;  4QDQ A;  3UGG A;  4XBQ A;  1ZYB A;  3B94 A;  3WNX A;  2CDP A;  2ZXQ A;  4DXS A;  2F4L A;  1JYX A;  3BKZ A;  1ND2 C;  1LOC A;  1OMI A;  3DPR A;  4XCB A;  1WW6 A;  2YC4 A;  1QJE A;  3PU3 A;  5IW0 A;  1QJX 3;  1S1A A;  4Q26 A;  3VDC A;  1H30 A;  1RUE 2;  3EBR A;  3IDC B;  1JOP A;  3U1X A;  3B7M A;  2QDN A;  3IMN A;  4CU6 A;  1UY1 A;  2W1U A;  4UFL A;  2ORX A;  2ARX A;  4QD2 A;  4Q1R A;  4UW6 A;  1JZ5 A;  4MV2 A;  1RUN A;  3HMY A;  1V6L A;  4BYY A;  1H2N A;  3GM8 A;  2VOV A;  2RG4 A;  2UWC A;  1O91 A;  1U5X A;  1UQX A;  1VIW B;  2JG8 C;  2OVU A;  1UN1 A;  2MNG A;  1TMF 3;  4E8D A;  4PLN A;  1GZC A;  5DUV A;  2HWD 1;  2VY0 A;  3N9M A;  4NWV A;  4I30 A;  1RHI 3;  5IVJ A;  4DB5 A;  1NQD A;  2CAU A;  3VBS C;  5HXM A;  1CAV B;  3SLI A;  2J1S A;  3KQR A;  3MBW A;  4M0H A;  4XF0 A;  4AQ2 A;  5DG2 A;  1UU4 A;  1REE A;  4ARY A;  4AQS A;  3III A;  1B09 A;  1ND3 A;  4H55 A;  4EWD A;  4GZ9 A;  3THD A;  5GKA C;  2CYF A;  4GUL A;  4ZXE A;  4YYO A;  1Q5O A;  4FPE A;  4NHM A;  5FY5 A;  1G9A A;  4XE9 A;  2QQP A;  2ZEZ A;  4BLI A;  2HWE 3;  5LA1 A;  5IK8 A;  2BZD A;  5CFC A;  5JOX A;  1W6P A;  2HLE A;  1C28 A;  3JBG 1;  1Y9Q A;  3KD4 A;  2B4K A;  5F3G A;  1UIK A;  4Y20 A;  3TBD A;  4CP2 A;  1WZX A;  2R30 A;  2RS3 2;  4AEJ A;  5FYZ A;  5LK5 A;  2HJI A;  4YM2 A;  4AVS A;  2JDP A;  1Y4W A;  2ADE A;  2XBO 1;  2RJL A;  3M70 A;  4K1Y A;  4O65 A;  2W52 A;  5FZI A;  3ZXG A;  4CEW B;  1HB4 A;  2VMH A;  2W1Q A;  5HCF A;  2UUR A;  2OX0 A;  3LDK A;  4L97 A;  2ZX3 A;  3K3O A;  3ZKY A;  5LW9 A;  4XPV A;  2W87 A;  4DEQ A;  1TEI A;  1MEC 2;  3JQW A;  5JZG B;  1Q8S A;  1AYM 1;  1OUR A;  1W8U A;  5FZB A;  2FDH A;  2ZX0 A;  1UU5 A;  1PGL 2;  2PLV 3;  1DU3 D;  3VD9 A;  2WYF A;  5A32 A;  3I2J A;  2BBV A;  1HN0 A;  4MX3 A;  5FBJ A;  3LZZ A;  2Z2S B;  4KWU A;  5FXW A;  3RG0 A;  2JEN A;  3WEZ A;  1WW5 A;  5F1R A;  3DV8 A;  2CWM A;  4XMI A;  4CDX C;  3ENR A;  5EJ1 B;  5IFP A;  1VBB 3;  1WMD A;  2RJK A;  2VBB A;  3W20 A;  4UBH A;  1S2K A;  3ZSK A;  4LO6 B;  4AZZ A;  5CIS A;  1NY7 2;  2WWU A;  3V0A A;  1STM A;  1EPZ A;  2R06 2;  2GC0 A;  2QNK A;  4HKW A;  4C8D A;  2BFU S;  3A21 A;  1VBD 1;  1TNF A;  1LEC A;  2V5Y A;  1J3R A;  1LUL A;  2OZ6 A;  3I2I A;  4TXW A;  3KV6 A;  5CEH A;  5JAX A;  1LES A;  4TYS A;  4XIK A;  3ZXD A;  3RVH A;  4TLG A;  5AC9 1;  3I2O A;  4Y1V A;  1AL2 3;  4PBO A;  5ISL A;  3I3D A;  3USU B;  3RZZ A;  1O3Q A;  4ES9 A;  4YG3 A;  3I2H A;  1NQJ A;  1DBN A;  2ZHL A;  3UKT A;  1IKQ A;  4HBN A;  4IXL A;  3IPV A;  2FZ1 A;  4QX5 A;  3OPT A;  2P34 A;  2QQU A;  2OII A;  1ND2 B;  3RFR A;  4DPN A;  1ZVF A;  4I01 A;  2ZEY A;  2VCC A;  1QOT A;  3OCP A;  1EAH 3;  4GB3 3;  3I59 B;  3VZO A;  2AZ5 A;  2D6K A;  1H1M A;  3KGL A;  3VZM A;  3WF1 A;  4IND A;  1FOD 3;  3OUH A;  4W50 A;  3A0N A;  2YUE A;  3WP6 A;  2P5B A;  4AHW A;  1TME 2;  5J36 A;  1R09 2;  2CL2 A;  3GHM A;  1SBE A;  1AJO A;  1Y9G A;  3DKQ A;  1FV2 A;  3LEI A;  3MFC A;  3SHR A;  1AR9 2;  1OKO A;  1AR6 3;  1OVS A;  1SCR A;  2J1R A;  3OYW A;  3KZ4 C;  4Q4W 1;  4R9D A;  4JX0 A;  5I8S A;  2OPW A;  3I3Q A;  3J4U H;  1J84 A;  1V6M A;  1MS8 A;  3VBS B;  4LBN A;  1Q8P A;  1JYN A;  1YRZ A;  2VTF A;  2HWC 1;  1N1T A;  4GXL A;  2Y6K A;  4KG8 A;  5CBL A;  1GZW B;  2AYH A;  3LFM A;  1APN A;  4YWA A;  2JXA A;  1FMD 3;  2JD9 A;  3WNK A;  1V6N A;  2WA4 A;  2UYB A;  2WFP A;  3AMM A;  4XFB A;  1GQG A;  4HXC A;  3ZN6 A;  5L7O C;  1RUJ 3;  4J1W A;  1SG3 A;  3AKQ A;  3NO8 A;  3KB5 A;  3H3Z A;  4P9I A;  5GZG A;  1PK6 A;  4AEK A;  4BQ3 A;  5CAD A;  2A70 A;  1JN2 P;  1LOD A;  4ISR A;  3V65 A;  1TVG A;  4JHT A;  1RUI 1;  3VKO A;  2VZ1 A;  5KHH A;  2BGC A;  4LKE A;  3O7O A;  4NPL A;  3ZPY A;  1XE0 A;  5FV3 A;  5I0U A;  4R9C A;  1OLR A;  4CXX A;  2GNT A;  1RXF A;  1SAC A;  2JDU A;  5JMC A;  3ZPO A;  1ASJ 2;  1LEN A;  5DG1 A;  4IEO A;  5JOY A;  4WVW A;  1GLH A;  4D6Q A;  2IXJ A;  3BB6 A;  4WM7 B;  4AR2 A;  3B93 A;  3MYX A;  4OI4 A;  2WZE A;  2OKX A;  4D3W A;  2YZ4 A;  1AYN 3;  1OHF A;  2WII B;  3NNJ A;  3MUZ 1;  1X8M A;  2HYX A;  4MHR A;  1HRI 1;  5FPA A;  3VKN A;  3FJS A;  3GGL A;  4BLJ A;  4P9L A;  5IFT A;  2R0F A;  3HPN A;  3BUC A;  4YM0 A;  1QQP 1;  1UYY A;  1H4H A;  3QOP A;  4QX8 A;  2D7F A;  3JU9 A;  2AR6 A;  1HXS 1;  1PGW 1;  2CTV A;  4DNY A;  4CDX B;  1OH4 A;  1U0A A;  1IHM A;  2P17 A;  4XF4 A;  2HKX A;  5FZ3 A;  1A8D A;  4NRP A;  3U0Z A;  5I0D A;  2Q30 A;  1UY0 A;  5A70 A;  3FZ3 A;  1DQ1 A;  2C6S A;  2VUD A;  2QJV A;  4GWI A;  4N9H A;  4D6R A;  4JC1 A;  4Q29 A;  4Y5Z 0;  3AP5 A;  3LKJ A;  4A7K A;  3BPZ A;  3CHX A;  2UY9 A;  3U4S A;  2ZMN A;  1DQ0 A;  2JKX A;  1QH6 A;  4Q2F A;  1UW8 A;  4IV3 C;  1QJU 1;  5GZD A;  3SC7 X;  1PK6 C;  1S4C A;  2YGL A;  1EPW A;  2XJR A;  4Z8B A;  1CZV A;  3NV2 A;  2JKB A;  3ACF A;  1C57 A;  5LEK A;  4JTN A;  1DFQ A;  2BGP A;  1DGR N;  3IT8 A;  1ENX A;  1WMF A;  2DCZ A;  3DF0 A;  2WAA A;  5FZC A;  4JAA A;  3LAG A;  3JD7 3;  4FSJ A;  1RUC 1;  4LIT A;  3EXU A;  4WVZ A;  1MS1 A;  1VBC 3;  1ONA A;  1OUX A;  1OT5 A;  2CV6 A;  3MID A;  4CDU A;  1MS3 A;  3HD8 B;  3VBO A;  2HWB 1;  4C90 A;  1C3H A;  3A7Q A;  1ZNP A;  3VZN A;  4YZ4 A;  2VVE A;  3CL1 A;  4XJ9 A;  1SZB A;  2DUQ A;  3F95 A;  2ZGK A;  3LB9 A;  5E88 A;  3SEE A;  3HOB A;  4GD4 A;  4IV1 A;  3AYC A;  1MPX A;  2VZ3 A;  2EID A;  4PQ9 A;  2ZML A;  4ZU7 A;  1UZ0 A;  3J7L A;  1UOG A;  2D43 A;  3P3N A;  4YVS A;  1I9R A;  1VBE 2;  3CJX A;  1C8N A;  1UOF A;  3AP6 A;  3PUR A;  1WWY A;  2GAU A;  4G9S B;  4JV4 A;  3NKG A;  4QPI C;  1G9F A;  1CIY A;  1OXC A;  1YWK A;  4I09 A;  4QPY A;  3VHR A;  4C0B A;  2IWG B;  5G05 L;  4ITC A;  4C91 A;  2XVK A;  2RMU 3;  4LHK A;  3PUS A;  1OA2 A;  1WLT A;  2JG9 C;  2ZZJ A;  3CMG A;  4XAC A;  1W90 A;  4KGG A;  1HIX A;  2IVJ A;  5JVV A;  4QQO A;  1O3R A;  3FUO A;  4Z2A A;  3ZDV A;  2DFB A;  1REF A;  4YNI A;  4UWD A;  4LLF A;  2QKD A;  4IDZ A;  2GAL A;  3G6J B;  4KI5 M;  2IXK A;  2VNG A;  3ZMO A;  3WXP A;  4B4R A;  5L7O B;  1ALY A;  1O3S A;  1AR8 2;  1NXM A;  2V09 A;  5C71 A;  3NVC A;  4DY5 A;  3LOB A;  5FPB A;  5T5J A;  2RS1 1;  1LHW A;  1X33 A;  1POV 1;  5GZE A;  4Y4Y A;  1F15 A;  1CAX B;  4TN7 A;  1L3J A;  1ZM1 A;  1H8T A;  2GME A;  2VM9 A;  2VH9 A;  4RFT 0;  5F7U A;  3ZFF C;  2Z4F A;  3KS7 A;  3M3E A;  2G1M A;  4COU A;  4HET A;  5J96 B;  3U14 A;  4HFS A;  1RC6 A;  3VBO C;  5K8S A;  4YSF A;  3DYM A;  4NJ4 A;  1ULF A;  3OGG A;  1NLS A;  1QXR A;  2P37 A;  3LF7 A;  4KBB A;  4ZPI A;  2K9Z A;  3VD3 A;  5JXH A;  3TNP B;  2WR9 A;  1QJY 3;  2QBX A;  1RUG 3;  1OQ1 A;  3CKH A;  4AOC A;  4KL1 A;  4ET7 A;  4BB3 A;  2WT1 A;  1GNZ A;  2L9L A;  4PJY A;  5HCH A;  2IFW A;  1CD3 G;  1HB2 A;  2VW2 A;  4XQW A;  3OTF A;  5EP9 A;  4M3C B;  4W6W A;  1GP4 A;  1UY3 A;  5FZ7 A;  1VPH A;  2HWD 3;  4A41 A;  2JE7 A;  1RXG A;  3OYW B;  2GC2 A;  4AFB A;  5FZ8 A;  3ACI A;  4D7Y A;  1GBG A;  1S2B A;  3M1H A;  1ZBA 1;  3WY6 A;  3E5U A;  1F5F A;  3OY8 B;  3RWN A;  1VMF A;  1DIW A;  5A7W A;  1OD3 A;  3O1O A;  5C70 A;  4ZS3 A;  5AFE A;  4BQY A;  4AQ6 A;  1DGR A;  3WCS A;  1LTE A;  2C4X A;  5FP4 A;  1YXW A;  1F31 A;  2HEY F;  4CP9 A;  2XJT A;  3IZO A;  1BXH A;  1X36 A;  2WL1 A;  1R1Z A;  3RI9 A;  1NG0 A;  1UPS A;  3CQO A;  3DYP A;  2GC3 A;  3AYA A;  4IV3 B;  3WQ1 A;  2SLI A;  3ZSM A;  3VD4 A;  5BNO B;  1FPN 1;  3ZYH A;  2RS5 1;  4FPG A;  4ORF A;  4AXO A;  1I5Z A;  2OUJ A;  3QBQ A;  2DCY A;  3SCH A;  2ZGU A;  1H8T C;  2VZS A;  4K7J A;  5E6H A;  5I0T A;  3M2M A;  1QDO A;  1GU3 A;  2W47 A;  3AX4 A;  3J8F 2;  2ERF A;  2VR4 A;  2WDB A;  2JB8 A;  3VGI A;  4DUV A;  2F6B A;  3W5M A;  1GFF 2;  2PHR A;  4IES A;  4Q4X 1;  5FZO B;  1OVP A;  4AHZ A;  3WQ7 A;  5CG9 A;  3Q8A A;  5F6K A;  2R04 1;  2QQV A;  3HT1 A;  3FFZ A;  2JDZ A;  3OPW A;  1EV1 1;  1IPK A;  1E5S A;  1HLC A;  4MGQ A;  4O9G A;  1NKG A;  3B69 A;  4OMC A;  4CE8 A;  2N7G A;  1JZ4 A;  4GJY A;  1YO8 A;  3LGR A;  2DTY A;  4E27 A;  4FPK A;  2XWJ B;  4UOJ A;  4AEM A;  3IIA A;  4YM3 A;  3BN6 A;  1FV3 A;  5E89 A;  1W28 A;  4GWJ A;  1VRH 1;  1A3K A;  4FPL A;  4COY A;  3O1S A;  3FX3 A;  1MZ6 A;  3LD8 A;  1RUD 1;  4MAD A;  4QPI B;  3IB3 A;  4CXW A;  1F35 A;  1W8H A;  3E6B A;  1US2 A;  1MS5 A;  3HJR A;  1TG7 A;  4ZZ8 A;  3N7M A;  1O7F A;  1T6B X;  4XXP A;  5JPM B;  2JG9 B;  5LAS A;  5J48 A;  1MEC 3;  1UKR A;  2R0H A;  1EAH 2;  5T50 A;  4F3J A;  3WNP A;  5BV6 A;  1HQW A;  4HON A;  1HB1 A;  2WNV A;  4OHW A;  5JI7 A;  1V9U 1;  3U10 A;  4YW4 A;  1ZZ8 A;  3QCW A;  3WZ1 A;  4OZX A;  2VPV A;  2YXS A;  3O1R A;  2D40 A;  1GOF A;  1SPP A;  1UXX X;  1VAV A;  2BNM A;  5EJZ B;  1CIW A;  3SCG A;  4QQH A;  3PNA A;  3OF1 A;  4B7K A;  4NHX A;  1DZT A;  5FY9 A;  3WOG A;  4LUK A;  4YFW A;  1OPM A;  1NYW A;  5FYM A;  4QKF A;  1AR6 2;  2Z79 A;  1UMZ A;  2ARC A;  2XJS A;  4CCE A;  4WZC A;  3RZM A;  3ACH A;  2R06 3;  2B7Y A;  3MLL A;  4A6O A;  3AP9 A;  3N9P A;  5BYN A;  1AX2 A;  4B1M A;  1ZBE 1;  3AVR A;  1C8M 1;  1B35 C;  2WSU A;  4NHL A;  3T30 A;  4QHZ A;  3ZXK A;  3ZFF B;  2NN8 A;  2XQX A;  5HCB A;  5F2S A;  4QX1 A;  2D6O X;  1U5Z A;  1KEX A;  2DUR A;  3MV0 1;  1OI6 A;  4AI8 A;  1V00 A;  1UYP A;  1JOD A;  3T4V A;  2JDN A;  2A6Y A;  2PHW A;  2V4V A;  3POI A;  5B4N A;  4HL0 A;  4LEJ A;  3RSJ A;  4XXA A;  1ZRF A;  3ZN4 A;  4DY3 A;  3EYP A;  4Y5T A;  1CQ9 A;  1LJ7 A;  4EN7 B;  1LAJ A;  4LKD A;  3WX5 A;  2GND A;  1AJK A;  2R6Q A;  4Y4R A;  3AZX A;  3EO6 A;  3VBR C;  5LA9 A;  3J7M A;  1GWM A;  1PZ9 A;  1ULP A;  2QQJ A;  3L2Y A;  2WN3 A;  4QPW A;  3HQR A;  3THT A;  5ABJ C;  1KDK A;  4GMP 1;  1K42 A;  1WBL A;  3H1W A;  1QWR A;  4F8A A;  5DZG A;  1ACC A;  1L7R A;  1S0I A;  3AYD A;  4WZF A;  5L73 A;  1FAT A;  1ZZB A;  4OUE A;  1PZ7 A;  3H1Y A;  4GH4 A;  3C3V A;  1IQD C;  1D4V B;  4I2O A;  1H2K A;  4KWJ A;  5FFO C;  1LOF A;  1K12 A;  5T52 A;  3I49 A;  2WNU B;  4Y22 A;  2FDJ A;  5FZ4 A;  1AYN 2;  5F9T A;  4IE5 A;  5DQ0 A;  4QGN A;  4A44 A;  3MDP A;  1QHD A;  3CO2 A;  1FI2 A;  3BOD A;  4ZXK A;  2KXL A;  1WD4 A;  1AR9 3;  2W2I A;  3AMH A;  3K2O A;  4B1L A;  2Q0A A;  1Z7S 2;  2ILM A;  5FZD A;  3TOJ A;  3O0W A;  1RUI 3;  1RMU 1;  2WRA A;  3AMN A;  5LBB A;  1MS9 A;  5A3U A;  5CFD A;  3AKP A;  1JMU B;  2B46 X;  1ZRI A;  2A7A A;  2UWA A;  1F4A A;  4WM8 A;  2AUY A;  2D3R A;  1OUS A;  1BBT 2;  1BEV 1;  2GDF A;  4HVO A;  1UXZ A;  4HT1 T;  3T08 A;  3UES A;  3IBM A;  2UYA A;  2BQP A;  2W9X A;  3PIJ A;  1LNS A;  4QXC A;  3FL7 A;  3IWZ A;  3P5B A;  2JB4 A;  1XBF A;  1GSL A;  1PIV 1;  3DGT A;  5L9B A;  3ALQ A;  3I3E A;  1HRI 3;  5A3T A;  2QQK A;  2A3X A;  3RZJ A;  1POV 0;  3NMB A;  3N7K A;  3POS A;  4YZ2 A;  3R4D B;  2WFF 1;  1YQ8 A;  2Q8D A;  1XYN A;  4JKM A;  3K3N A;  2W1S A;  5FWE A;  4R4X A;  5C5U A;  1LOB A;  1GNY A;  1VRB A;  3DYO A;  2AC1 A;  4I0B A;  3WQ0 A;  1YQ6 A;  2JX9 A;  5FPV A;  1ASJ 3;  4KMQ A;  5FLJ A;  3JD7 2; 
#chains in the Genus database with same CATH homology
 1GWL A;  4CPB D;  2KR2 A;  4LKE A;  4CP9 B;  3ZYF A;  4LK7 A;  1WCU A;  4YW7 A;  1UOJ A;  1V0A A;  1W9F A;  2Q1F A;  4CPB A;  3ZYH A;  1W8T A;  2VXJ A;  4A6S A;  1W8U A;  4LKD A;  4YWA A;  3ZYB A;  1W8Z A;  2WYF A;  3ORJ A;  1HN0 A;  1GWM A;  1W90 A;  1WMX A;  3UT0 A;  4LKF A;  2LRP A;  5D21 A;  2C24 A;  4LJH A;  4LK6 A;  4BQ5 A;  4BQ2 A;  4CP9 A;  1L7L A;  1WZX A;  4YW6 A;  4BQ4 A;  3F95 A;  2JWP A;  1GWK A;  2K46 A;  2O14 A;  1W8W A;  2LRO A;  4AL9 A;  4BQ3 A;  1OKO A;  1OH3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...