3WQ1A

Structure of hyperthermophilic family 12 endocellulase from pyrococcus furiosus in complex with cello-oligosaccharide
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
270
structure length
270
Chain Sequence
KVLKIRYPDDGEWPGAPIDKDGDGNPEFYIEINLWNILNATGFAEMTYNLTSGVLHYVQQLDNIVLRDRSNWVHGYPEIFYGNKPWNANYATDGPIPLPSKVSNLTDFYLTISYKLEPKNGLPINFAIESWLTREAWRTTGINSDEQEVMIWIYYDGLQPAGSKVKEIVVPIIVNGTPVNATFEVWKANIGWEYVAFRIKTPIKEGTVTIPYGAFISVAANISSLPNYTELYLEDVEIGTEFGTPSTTSAHLEWWITNITLTPLDRPLIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Endoglucanase A
publication title Structure of hyperthermophilic family 12 endocellulase from Pyrococcus furiosus in complex with cello-oligosaccharide
rcsb
source organism Pyrococcus furiosus
total genus 73
structure length 270
sequence length 270
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2014-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wq1A00
1PVXA 4HKLA 1OA4A 2VG9A 3AKRA 5EJ3A 5HXVA 2NQYA 1NLRA 3AMQA 2VUJA 2DFBA 3O7OA 3VZLA 1XYOA 5K7PA 1XYPA 1BCXA 1C5IA 1H1AA 1UU6A 3AMMA 4IXLA 1HIXA 1F5JA 1HV0A 3VL8A 1XNCA 1XYNA 4S2DA 3WP3A 2DCKA 3AMPA 1BK1A 3LB9A 3WT3A 1QH6A 2JENA 1IGOA 4S2HA 2BVVA 1XXNA 1XNBA 2JICA 2QZ2A 4XQ4A 1OLRA 3WXPA 4H7MA 4NPRA 2DCZA 1OA2A 1UU5A 1TE1B 3RI9A 3VLBB 3MF6A 1OLQA 4XPVA 4S2FA 4S2GA 3AKSA 2BWAA 3VZMA 3ZSEA 3WQ0A 3AKPA 2QZ3A 2JEMA 2DCYA 1REFA 1YNAA 1KS4A 3MFAA 3MF9A 2F6BA 3VZJA 1H4GA 2B45X 3HD8B 3EXUA 3WP4A 2D97A 3VZOA 3WX5A 4XQWA 1KS5A 3VL9A 3WR0A 2NLRA 4HKWA 1HV1A 1M4WA 3WP6A 2C1FA 1ENXA 3AKTA 1W2UA 1QH7A 3VZNA 1UKRA 1UU4A 4HKOA 3RI8A 1H4HA 1C5HA 1REEA 1REDA 3AMHA 4XQDA 1XNKA 5K9YA 3VZKA 3VGIA 2B46X 1BVVA 3B7MA 2D98A 3B5LB 1H0BA 2BWCA 3MFCA 3WP5A 4HK9A 2DCJA 2VULA 2VGDA 2B42B 3AMNA 3VHNA 1XNDA 1AXKA 1T6GC 3VHOA 3M4FA 2Z79A 4HK8A 3WQ7A 3LGRA 1OA3A 3AKQA 2BW8A 3WQ1A 1H8VA 3WY6A 2DFCA 3VHPA
chains in the Genus database with same CATH superfamily
3B94A 4L8QA 4NVPA 3AZZA 4ZZ5A 4XIKA 4IERA 5BNPA 4B1MA 3GF6A 3ES1A 3WF3A 1V6OA 3T4HB 2NN8A 2GH2A 4FQ4A 2QBXA 3ABZA 3SH5A 4KBBA 3FUQA 3ACGA 3VKFC 1BCXA 2PAEA 4CCDA 4DUWA 1H8TA 1ULGA 2B8MA 2ZABA 1H9PA 1DQ2A 3ILRA 3I3EA 5DUUA 5KXEA 2GC3A 4UWDA 2WNEA 3PU3A 1ULDA 1X8MA 2ET7A 2LW8A 3R4SA 5FZIA 2W0XA 3LA3A 1OHFA 1LHOA 1XNCA 1G86A 1GICA 1Q5OA 2O14A 3W9AA 5A3PA 4ZHNA 1ND3B 1ZX5A 4YVWC 3T2TA 3CIHA 1GANA 1O91A 3LOIA 3K77A 2R7EB 3WT3A 1PZ8A 2DUPA 4O61A 2QQVA 4GALA 5GZFA 4ET7A 4CE8A 1KITA 5FPZA 5H9SA 1LNSA 4B4RA 1H30A 1BQPA 2XMLA 1W8ZA 1OA2A 1PO23 5C3PA 2JB8A 2ZTNA 3MPBA 3PVEA 5ACA3 1H9WA 4LK7A 1FMD2 5APAA 5C8WA 1W0NA 4FXKB 4GXLA 1NY71 4GMP0 2D93A 1QJU3 2J1SA 1OOPA 3M3IA 1SEFA 2W94A 4BA6A 2XHKA 5FK7A 4HZFA 2CWMA 2HWB3 1AXYA 5I8TA 3HJRA 4Y20A 5CFCC 1BBT1 2YBSA 5HCAA 4CEWC 1O3TA 4FPGA 1ENQA 4YGCA 5DAWA 1JUIA 4HPKB 4QKDA 4YWAA 2KXLA 3C3VA 4Q0VA 1MEC3 2VY0A 4E8DA 2ZHMA 5KHKA 4YFZA 1RUH1 5IJRA 2VU9A 1JZ3A 3CJIB 2R071 1N3QA 3OPTA 3HT1A 3ZX7A 1S0CA 5FO9B 3WD5A 2UYBA 1VJ2A 1U5XA 3ZMNA 2JDZA 4QPIC 4X8NA 1RUD2 1BK0A 2P37A 2VC9A 5A3LA 5EV7A 2FQPA 2UY9A 3EJKA 4RFT0 5KHJA 2XJRA 5KXBA 2V4VA 3IPVB 4NPMA 1X9TA 5G04L 2C1FA 4LULA 4NIAA 1SG3A 5E8AA 5FQ0A 2GC0A 4OFGA 5A7SA 5CFDA 1BMV1 2LM3A 1POV3 5EIYB 2OT7A 1S0EA 4AVVA 2RS51 2BQPA 2YPJA 1Y4WA 2DCTA 4LORA 4YW2A 4XQDA 5FYZA 2OPKA 3VBSC 1R1A1 5EJ1B 3AZXA 3J4UH 4YPJA 3ZFFB 3B93A 3CNAA 2HEYF 1RJ8A 1O4ZA 3PVOA 3EBRA 3VBHA 4BK5A 1G9BA 5FPLA 3O1PA 4GIQA 2QNKA 2FCUA 4IETA 1YLLA 4XCAA 1ZZ7A 3V0BB 2FDKA 2HWC3 3WF4A 4E2SA 2ZGOA 1K42A 2VZPA 3AMNA 1ASJ1 1UW8A 3UGGA 3AJYA 3H7JA 1JTZX 3K4DA 4N9HA 4DB5A 1IQAA 1OA3A 1W8TA 1DGWA 4D7YA 3UNPA 4UFMA 1MACA 3O0WA 4PLMA 5FZ7A 2QQWA 3FJSA 3RYKA 1LRHA 3KQ4B 4FAGA 1U0AA 3E6DA 1HX6A 1UZWA 1DFQA 1ST8A 2RVAA 3PNAA 1LTEA 5EWSA 1Z0HA 1W04A 4HOOA 4Q5OA 1W2AX 5FYSA 1RTVA 3T1LA 1D2SA 3N7LA 3FX3A 4RR3C 3EHKA 3VHRA 2WJSA 2VTXJ 3I59B 1J1TA 1ND2B 4MHRA 5BUVA 5FWEA 1NCRB 2E33A 2D3SA 2GAUA 2UY8A 3N9OA 1SFYA 4IXLA 3VKMA 2WFPA 4CCNA 1OF3A 2FZ2A 4Y22B 1F5JA 1U12A 2BNMA 2ZACA 4Q4V2 4XOGA 4EV0A 4NHKA 2IWGB 4LLOA 4UFKA 1ND3A 2Q1MA 2RR12 3LDBA 1W2NA 1XE8A 3P3PA 4GH4C 3WP3A 1GZTA 1O4TA 3LCPA 1UY2A 2ZHNA 4QU2A 4QX8A 4TN7A 4AQSA 1ZRDA 2G9ZA 2VOVA 1NKGA 4S2HA 3WNNA 3H8XA 5HBAA 5CFCB 3FMGA 4ASLA 2A73B 4AFDA 4NPRA 1LOAA 2VZTA 4LKFA 5J48A 3AX4A 3KLSA 1QF3A 4P9YA 1KGYA 3CU7A 1POV0 4YNIA 5F2WA 2PHDA 4MGSA 5FWJA 1CAUB 4KG8A 1N1YA 1QQP3 2Q1ZB 2BWAA 2ZX3A 4QDQA 4UFLA 5JI7A 1JMUB 1RIRA 2UWAA 4WVWA 5FUNA 3AKPA 3I3DA 4O7XA 5LK7B 2P3KA 5I0RA 4HPKA 1HW5A 3N9PA 3SCHA 2QQJA 3ZXJA 2WZPP 4CDUC 1AYN1 2D6OX 3MI8A 2DBNA 2J1UA 1XE0A 1VBA3 2WL1A 3GDBA 2B4KA 4UW5A 3CJIA 3C7OA 5C3QA 4QX0A 2JX9A 4IV3C 3VN4A 4RA0A 5C8CC 5JSOA 1QKQA 1AR62 3VD9A 3CZJA 5FDBA 1NY72 3WHTA 4YYOA 3WX5A 2ZEYA 4MO3M 3ZFGC 4I0BA 2Y34A 2PHTA 2HH9A 3IPVA 5FZBA 2RMU1 5FXXA 4FXGB 5EHDA 4R4ZA 4CDWB 1OH3A 1SZBA 1WD3A 1UNBA 4CP0A 3MLLA 1BBT2 3SQOA 4UBGA 2WQZC 1VAMA 1QDCA 1RVF2 2E6VA 4XUNA 5E16A 1W03A 3WVJA 1QXPA 2R062 4FT8A 3RMYA 3KGZA 4K1YA 3I7DA 4UFHA 1HKDA 2DWRA 3I2HA 1RUH2 2QQUA 2XVKA 4FPOB 3ZFFA 4YSFA 1VBC1 2R072 5A3UA 5CZKA 4YGBA 3WNMA 2PLV2 1UWWA 3LA7A 2VM9A 1DQ4A 1AL21 4XCBA 4Y26A 4FPKA 4Q1PA 1IPKA 2CNAA 3DECA 1K3IA 4LHSA 3BB6A 2P3JA 5KHGA 3SC7X 3V0BA 4WM7B 3IDBB 1VIWB 1VR3A 5K8SA 1UMZA 3MYXA 5F6KA 3OB8A 1OPOA 1F4AA 4QDRA 1VBD3 1Z7S2 2D6NA 2W47A 4GB33 3QD6A 1BMV2 2R1DA 3MDPA 3BALA 4OHZA 3ZFEC 2JDUA 1Q8PA 4M01A 2RS52 5GJ6A 5L7OB 2XR4A 1RHI1 2O8QA 5FZKA 4XW3A 2EIGA 3CHXA 5DPNA 5KC6A 2RJKA 4NOTA 2BJSA 3WNPA 3TEYA 4Q1RA 2WYFA 1DYPA 4XURA 1PK6C 5FUPA 1OPMA 2PHUA 1R092 3G6JB 1JH5A 3CEWA 3D8CA 1CPNA 1H1AA 3ROUA 1W05A 1RGSA 5FZ9A 5HV4A 3I59A 1ND2A 2QE3A 2QQLA 2ZKLA 1NCRA 3AMMA 1JYWA 1J84A 4Y22A 4A44A 4FOWA 3KQRA 5JXHA 4JDMA 3AVSA 3LEIA 4BHPA 1J58A 1RUJ3 4Q4Y1 5DG1A 5FZ1A 4B29A 2D6MA 4NPLA 5HCHA 1G7YA 4OUEA 4XDPA 1HQWA 2OPWA 1U5ZA 4B8EA 4CCJA 2JENA 1BKZA 1IOAA 4JKLA 4CCCA 3BIEA 1ZBA1 1JU3A 1DU3D 4XXPA 4CA9A 5GZGA 4H7MA 3TNPB 1EV13 2ZGQA 2CAVA 2WS93 1WCKA 3N7JA 2ILMA 2BOIA 4QQOA 3OBZA 5JMCA 1CAUA 4MX3A 5GZDA 3NQHA 2VCMA 3AKSA 1UN1A 2YFUA 4LO4B 1MS4A 2WQ8A 5LY2A 4AGRA 4QB2A 4MGYE 1UCXA 4CCOA 2IXLA 1ULCA 1HB3A 4CPBA 5A6QA 2JEMA 4Q4W1 1OD3A 2RG4A 1HN1A 2E7AA 2WA3A 3BPSA 2BUKA 1REFA 4NIGA 1KS4A 3MEPA 3O1SA 3MFAA 4X6QB 5BNOC 3LSDA 3B00A 1HN0A 2WO7A 1D0HA 2A3WA 1AYM1 2DVGA 4PCRA 4AHYA 4BU2A 2Y6LA 2D3RA 3J8F3 3OD4A 1RUI3 2P17A 3AC0A 1MZEA 4LJHA 3U07A 5CYYA 1LULA 2WO3A 3WP6A 3ZMOA 4CDWA 1TME3 4FPYA 4NWWA 3Q8FA 2V5YA 2X53S 3AKTA 4AEMA 4EWDA 1WCSA 3T0BA 4OQ8A 1KEXA 4L0PA 1QXRA 3M7AA 4ZZ8A 4FPJA 1NAEA 1AYN2 2ZPXA 4PJYA 1H1IA 2HKXA 3SISA 1GP4A 5C3OA 4UBHA 1PGW1 5FCCA 3VGIA 4LO7A 3TN91 5FJHA 4NROA 3UYJA 5F7UA 2ZX0A 1AR83 3MFCA 4BPZA 5J09A 2EXHA 3CZUA 1MS5A 1RXFA 3WNLA 4XUPA 4WM7A 3VBOB 3AL5A 3AM2A 4DINB 4BIOA 1CWPA 3W59A 1DYKA 5GZEA 1CJDA 1LU2A 1WMEA 2GNMA 1J83A 2R042 3P5BA 2A1XA 3BYWA 4EYUA 1C8M3 4JKKA 3BOWA 4CPBD 1W3XA 4XFAA 1YQ6A 2H0VA 3ETQA 1F9KA 3VHOA 4FP3A 2Z79A 3NAPB 4BISA 5FLIA 1W9YA 2YXSA 4YFWA 1SFNA 4FFHA 5EFUA 3VBFC 1OQDA 4CU9A 5L7OA 3KWVA 3U14A 5I91A 2RDRA 3AKQA 1LECA 4IEVA 3VD3A 2RS33 4FVVA 1VBB1 2DFCA 3AFGA 2OW4A 1PVXA 1U5YA 3BTAA 3IDAA 1VBC2 4KWJA 4HONA 5B2GB 2XJUA 2WZ8A 1X50A 3VDDB 4Z1VA 5FP9A 2OKXA 3ZYRA 1NZCA 2A6ZA 2GU9A 4KH9A 1AF9A 3WCRA 5J37A 4OHXA 4QX1A 1GV9A 1EUTA 3GZUC 3T30A 3SH3A 3IIAA 1D4VB 3HN1A 2V73A 3I2JA 1MZFA 2IFWA 3FLPA 5JR2A 1HV0A 1RUC1 2D44A 5A6ZA 3B9IA 1RHI2 4HN0A 2R6QA 2RM22 3A21A 1IHMA 3LB9A 5CKQA 4MADA 1QH6A 1WKYA 2GC1A 1HRV3 2BERA 3ECQA 1DQ1A 1LJ7A 3ZPYA 2V4AA 3MIDA 3OG2A 3GZEA 1OQEA 1QNWA 3QH6A 2HWE1 4M00A 4U2AA 3GBWA 2E26A 3OGRA 4YVWB 3VLBB 3OF1A 4GWMA 3SEEA 1A6CA 2KR2A 2PTMA 3KV6A 1RUE3 2BNOA 5GLUA 1DLCA 3T0DA 2JKBA 5C3RA 2FHRA 3GCXA 4Y24A 4K40A 1CAXB 1PMJX 1X82A 4Q4Y2 2XXZA 4UT5A 5FBJA 2RS11 2RHPA 2VMFA 3DEMA 4I09A 4QM8A 1ZRFA 5JOYA 4BQ5A 4XEZA 3J7MA 4L2NA 1PM7A 1ZBA2 1S0DA 2JJ6A 3SEPA 3PURA 3LZZA 4FFIA 2JDAA 3KF5A 5FZ8A 4CEWB 3VDCA 5C6CA 1Q8VA 1GNYA 3QLQA 4BJ0A 1US3A 4ZKTB 3RZJA 3KCCA 1MS1A 1H1MA 3AYAA 3J26N 2WLPA 2XHNA 4AF9A 1ZZ9A 1HV1A 1DP0A 3GXUA 3SCGA 5KWRA 3JD71 3IKWA 1AR72 3O1RA 2FD8A 4JRLA 4D6SA 1W8FA 4I2OA 1LCLA 2RDSA 5F32A 4QPIB 2VW2A 4PT6A 4QPYA 1DDLA 4IGQA 5DUWA 4P9IA 2D6KA 2J42A 4CVUA 4COWA 3PTYA 4TYSA 1VPHA 2WN2A 3OBTA 3NNJA 4AGGA 4E2QA 4DUVA 1KRIA 2XOMA 3V56A 1A8MA 1DBNA 1OH4A 1QJZA 2VCCA 2VR4A 1XB9A 2YUEA 3VBOA 5IHRA 4QAWA 2GP3A 5CISA 4KU7A 3VBSB 4I0AA 2WAAA 3ZN4A 2NMNA 1Q8OA 1Y9QA 4GWJA 1UIJA 1QJY3 1W06A 1ZBE3 4LA2A 3THCA 1LODA 1V9U3 2JG9C 3NAPA 1AXKA 3RZHA 1COV1 5HV0A 2WNVC 3HQUA 3KHBA 3WQ7A 1CN1A 1WLDA 2GNTA 1KFUL 1PO11 5FP3A 1GMMA 3WQ1A 3TYJA 2K46A 5A80A 4NAOA 1PGW2 3PIGA 5F5AA 5A7NA 1J1LA 2WWUA 3TN92 5IVYA 5DZGA 3NNLA 3F95A 3PJYA 3THDA 4DIQA 2NQYA 4LTAA 3I2FA 3O7OA 4P9GA 4P5YA 3VDDA 5LBCA 4JHTA 2FDFA 1UZYA 5T3NA 3S6PA 3ZSJA 1GNZA 3GHMA 2OA2A 1QOTA 1XYPA 2BEOA 3BN6A 4J1XA 4Y5TA 1K5MC 3UJQA 4QX2A 3H3UA 1G9FA 3QH7A 4RN5A 2JDPA 4EN7B 1AXZA 1GBGA 3RRDA 3LPGA 1ULFA 2AH2A 4QPGC 3V64A 3G7DA 2WFF2 4HVRA 4MGIE 4RR3B 3KVAA 3AMPA 2A75A 1CAWB 3OPZA 4MVTA 2ZGPA 3RS6A 5KHHA 3HT2A 4LBOA 1RXGA 4CRQA 5FMCA 5IYYA 2LS6A 5T52A 3D4KA 2DVDA 3OEAA 3ACLA 4PQQA 4YVWA 4GH4B 3SMHA 4LLFA 5F6LB 5LBBA 4QKNA 1DGRA 1WW5A 1FMD1 1ODNA 2TBVA 4CEYC 3LDKA 2ZX1A 1ULPA 1CQ9A 3EYPA 2WO1A 1SMVA 2YU2A 4K7JA 1CAXA 1RUC2 3I54A 2JD9A 3J9SA 4RQPC 2P6CA 3WW4A 4AGVA 4IESA 4F83A 3POGA 4QDSA 3T3YA 2X5IC 1AX1A 1VBE3 2SBAA 4GKXA 4H2AA 3WHUA 4BZ4A 5J98B 2AUYA 4JAAA 1HQNA 4TSVA 4CEWA 1LEMA 5CFCA 5CAZA 2FBEA 3KB5A 4Z8BA 1DIWA 2WYSA 4QU1A 4LO8A 3ZPOA 3FBYA 5A3MA 4Q4X1 4A3XA 1PO21 4CDUB 3I2DA 4QQLA 1S0GA 2ERFA 3VV1A 1S4CA 2NLRA 2FCVA 1MS9A 1RUD1 2LUWA 2XJQA 3FE5A 3OCPA 4HKWA 4Y4YA 4IV3B 5C8CB 3S30A 1GR3A 4BQ1A 5FZ4A 2HWB1 5T55A 4HXCA 1QWRA 4QPIA 1LEDA 3IZOA 4BQ4A 1FT9A 5GLTA 1H2KA 3ZFGB 2BGCA 4LKSA 2GNBA 1NX9A 4ISQA 4Y1YA 2VVFA 2W1UA 1MEC1 1MPXA 1VMHA 2WZEA 4LKEA 1VLNA 5GALA 5IT6A 3UGHA 5JDBA 5K0UC 1AJKA 2EIDA 3BTZA 4W6YA 2L9LA 5C7GA 2DCJA 4FPFA 2VULA 4AI1A 3VBSA 2NM1A 4P02B 4QB6A 2YG0A 2WR9A 4XACA 1QJX3 1UY1A 2C5DA 3O5SA 2PHWA 3ZXFA 5IVVA 4IDZA 4AEDC 2J1RA 3VBUC 3M3CA 5H9PA 4BQ2A 1XU1A 2PHRA 1DZRA 2VXJA 1SCRA 3CJXA 2VO5A 4N53C 4BQWA 2JIJA 5HI0A 1XRUA 1HXS3 5GKAC 1GQHA 4IQPA 4BK4A 5FLJA 5C71A 3H9AA 5FZOB 2WBKA 2DVFA 2VG9A 2ZHLA 3AKRA 4RHV1 5EJ3A 3ZFEB 5FYVA 4CDQC 4MGKE 4XFFA 4YZ4A 4P9LA 2IXKA 5BPXA 3ZXDA 1LOCA 1NXD1 3WG1A 3BUCA 4AAPA 4ES9A 3C7FA 1LOBA 3LIHA 2WWSA 5F9TA 2WIIB 5SV5A 3HBZA 4G3YC 4DXTA 2ZS6B 4IL7A 3N9LA 4EQVA 4OI0A 2O8OA 1F31A 1PK6B 2ZGUA 4A6SA 5CBLA 4YW5A 1RC6A 2VZOA 3IDEA 2BBAA 1PO12 1SACA 4RR3A 5FMDA 3T08A 4WVZA 4C0BA 1CAWA 3OY8B 4EWAA 2RR11 1F8VA 2G19A 1OF4A 2J7MA 1ENRA 1NZIA 2X29A 4YZ2A 2ET1A 2OZ6A 3ZYGA 4KGQA 1C8NA 2BVVA 3AZWA 1OUSA 4CSWA 1EYBA 1LESA 1PHMA 1OSGA 2VNOA 1VE0A 2Q4SA 4GH4A 1WUVA 2YHJA 4DXSA 1W0PA 2VQTA 4UAPA 1FV3A 3ITQA 4HT1T 4JDOA 1AR92 2J1EA 3ZR6A 2EA7A 3USUB 4LKDA 1HRI3 1HLCA 2E7QA 3HQXA 4B4PA 4ZU7A 3DL3A 1BJQA 4AVCA 2MHFA 1TQ5A 3FBMA 5FPXA 2XGXA 5D8AC 1W6MB 1W6PB 1V6IA 2F4PA 2HWF3 3ZKUA 3M70A 4BCUA 2WSVA 2Q8OA 3K51A 3MICA 3RPQA 4JC1A 1LGCA 4Q0PA 2ZGNA 5GLVA 4AL9A 3WNKA 3ZYFA 2AC1A 2F6BA 1SBEA 4NRPA 5FZLA 1RMU3 1H4GA 1OD5A 2ORZA 2R32A 5G05L 1F4HA 4MOAA 1AR61 3ACFA 4CDUA 1DZQA 4NHLA 1ZA4A 3T1MA 4R52A 4BDVB 1G9CA 1JHJA 5T5LA 3B9CA 3IMMA 2LALA 5F3EA 5BNOB 1LKNA 1M4WA 4IV3A 3RJRA 2LTNA 2ZGSA 1V6KA 5C8CA 1YI7A 1S2EA 2LROA 1QQP1 5IVJA 2EAKA 1L7QA 3FUOA 3IWZA 4D6RA 3RZKA 3U10A 3U4XA 1K5JA 2Y0IA 5JWPA 1IS3A 3VBRC 4P14A 3ZFGA 3OGSA 1RVF1 3N9MA 3RG0A 4BQXA 1REEA 5IK7A 4NAMA 4FTSA 2R061 2C9AA 3OBRA 2JDYA 4HSJA 2OVUA 1POQA 2YFZA 1YCIA 2VJXA 4ZU5A 1OLMA 4YLZA 1IQDC 3UKTA 3LIGA 5FZFA 2PLV1 2I2SA 4JVAA 4Q4X2 1PO22 5ACA2 1CR7A 2WZR3 2XBO3 1C4RA 3KD4A 1UY0A 1QJU2 1UPSA 1JZ2A 5J96B 2DVBA 3HIFA 4CTEA 3HQRA 2VGDA 4GZ9A 1BLZA 1VALA 1IPJA 1Z7S1 2HWB2 1V6LA 1W8HA 1W8OA 2VNVA 3E97A 3NV4A 3THTA 5FRAA 4H14A 3ZDVA 1TMF3 5AFBA 4QKFA 3AXEA 4IE5A 4YZ3A 5DAXA 1F35A 4E2GA 5ANNA 5FZOA 3S57A 1MEC2 3PDQA 4K3UA 3O1OA 5LEKA 4WV8A 5B4NA 1EPZA 3NV3A 4M0NA 3ZFEA 1D4M3 4AFCA 2W2IA 1HB2A 1CD3G 2Y60A 3T0AA 3VBFB 3SCFA 3TEXA 3MLJA 2BGPA 5CADA 3DGTA 1R091 5DG2A 2ZZQA 5K7PA 4MXVA 3POEA 2TUNA 5F8PA 4JDNA 4XAAA 3WCSA 2Y6GA 1SBDA 1V0AA 3L2YA 5DQ0A 5L9RA 3J7HA 4HG6B 3UK9A 1PK6A 1HIXA 5FZEA 5E89A 2DTWA 4L11A 3T2QA 5IW0A 4HVQA 1W3VA 4AHWA 1GWMA 5LEJA 5DDJ1 4EJRA 4DMIA 1CZSA 3OY8A 4NRQA 3I49A 1QEXA 3H3ZA 3MUZ1 4INDA 2H6CA 5HCBA 3DPRC 4FAHA 4LEJA 4M0HA 3E1F1 1IGOA 2ZXQA 5DZFA 4RHV2 1I6XA 3KS7A 4Y3OA 3HAGA 1OLRA 5ANQA 1NXMA 3O0VA 4YRDA 3TAYA 2VMDA 1UU5A 5CU1A 1ZZ8A 5FMOL 3USUA 4YARA 2VUAA 3MF6A 5AC93 4DQAA 2HWC2 2K0GA 4BOWA 1XJAA 3M3QA 1LENA 1DQ5A 1GOGA 1BEV3 1W6MA 1W6PA 3JQWA 1QDOA 1NLQA 1SFPA 3SH4A 3P1IA 1A78A 3WW1A 4X6RB 4D8MA 4QQ2A 2XDVA 2PXJA 1N1SA 4OHVA 4GJYA 1GZ9A 3SKJE 1UKGA 2I07B 2J1VA 4KQ7A 1LGBA 4A7ZA 4FI9A 4DY5A 3CLPA 1D0GA 3VKNA 3AP9A 1EV11 5FO7B 4JKMA 2UWCA 4ZPIA 4A3ZA 5BNOA 5FZ3A 3M3OA 2XLFA 3CO2A 2W87A 3KZ4C 1W2UA 3FL7A 3DN7A 1PM4A 3BTXA 1O8PA 2MEV1 4ZXKA 4AWDA 3VB9A 2DYCA 4H7LA 3QBQA 5I8YA 1REDA 4CP1A 3KT7A 2E7TA 3VZKA 1IZ3A 1VAVA 1OUXA 3M8LA 4ARYA 3C7EA 3ENRA 3MGUA 4CUGA 3U75A 3P6BA 3A7QA 1NUKA 2D6LX 3DV8A 5CG8A 2IVIB 1GWKA 2GSYA 2VCBA 2BU9A 4IE6A 1GP5A 1G6NA 1XPWA 5C70A 3J8F1 1OVPA 1RUI1 2W46A 3UJOA 3ZR5A 4P00B 3H1YA 4UW3A 4AR2A 3U1XA 4XBLA 2HYXA 2VZ1A 3USSA 2R041 4XETA 1QQP2 3ZIXA 1TME1 2ZHKA 4PI0A 4OZXA 4A7KA 1UZ0A 2IC1A 5F5CA 4LBNA 3GNEA 4IEQA 1CZTA 4XHXA 4AEJA 5BNQA 4JGZC 3U78A 4XIOA 2R073 5C3SA 1VBA2 4HKLA 5IVBA 2F4LA 2JG9B 3NKGA 4GWNA 5FFOC 3KCYA 5IWFA 4R9BA 4QB1A 1JZ8A 2WNVB 2XH6A 3VBFA 1RUF3 1LGNA 1BXHA 4IEXA 4M3CB 3O1MA 2XJTA 1RUG3 4CCEA 2QDRA 1NYWA 1IPSA 1GOHA 3GYDA 4FPLA 3TOJA 4SLIA 2C0ZA 1SLBA 5FYBA 4NIDA 4HFSA 4LIUA 1LHVA 2JE7A 5FP4A 4A6OA 4CCKA 1N1VA 2FDIA 3O1UA 1CVNA 2RJLA 1GOFA 5FOBB 1JODA 1W9TA 4KGGA 4X8PA 2IXIA 4A2UA 3OYWB 3AZVA 2VUCA 1SLLA 2PAMA 2V09A 4HETA 1A3KA 3IAPA 4YM1A 5C9AC 1W6QB 1PNFA 4KWLA 1A34A 1OFSA 1R1A3 2DTYA 2PYTA 2BRTA 4NMIA 4P9WA 3WLUA 4MGTA 3C8XA 5IFTA 1K5MB 1OXCA 2W1WA 3ORJA 4ARXA 2VL4A 2EVXA 2RM21 3HNMA 3R05A 5FPBA 4QPGB 4COVA 3ALQA 2Q0AA 1AZDA 1WLTA 4M3CF 5IK8A 2A3YA 1KJRA 4AK3A 1TE1B 3RDIA 5LA1A 1U5IA 4D0QA 5F5QA 3QACA 1ASJ3 4OZOA 2WUHA 5L9VA 1VAKA 4GB32 3ZSEA 2BV4A 1AHSA 1ODMA 5T5PA 1O6UA 1AVBA 1R081 4QXHA 1DYOA 2QZ3A 1UIKA 5DDJ2 3I8TA 2QQKA 1WMDA 1KDMA 1L7LA 1PVC3 2QCSB 3GBFA 4B3NA 4CEYB 4KMQA 3AVRA 4BQYA 1TG7A 2VOTA 3AYDA 1XE7A 2PQQA 1S0JA 2UU8A 4MV2A 2GMEA 2BZDA 2AZ5A 1UMHA 4RQPB 4FTBA 4WZFA 2GNDA 4TWTA 5CKMA 3WP4A 1JYIA 2NP0A 2NPIA 3AP4A 4MSVA 1I5ZA 3NJZA 4G9SB 3PU8A 2X5IB 3LEMA 1JW6A 4G4FA 3LPFA 5BNNC 4XBQA 2OIIA 3GHNA 3S5QA 3H8UA 1CIYA 4QXCA 3N4MA 4IW3A 5CEHA 3HMYA 4Z2WA 1AR71 3NNGA 4IUGA 1RUJ2 3IN9A 4HKOA 4BIFA 2C24A 3FFQA 3I97A 4XJWA 1HB4A 4B4QA 4NN0A 3MV11 1XNKA 2OQ6A 5K9YA 1C1FA 3FHAA 3ZO0B 4F3JA 3B7MA 4N43C 1H0BA 1K12A 4Y5Z0 4OQ9A 1YO8A 3W21A 5IVCA 4KWUA 1W8NA 4FPEA 3K4AA 4LE3A 1WD4A 1ZYBA 1EV12 1JYTA 2WS92 4AHXA 3A0KA 3L9JT 2VTXA 3KGLA 3Q8AA 3HBKA 2ORXA 4LK6A 2WNOA 1V6MA 4YGEA 3UL2A 2GZWA 2HBTA 2JKXA 2XWBB 3X29B 1D2QA 1HDKA 4C0HA 5K0UB 2ARAA 4CUBA 2QJVA 5ABJC 2JXAA 1MVQA 2QKDA 4XJ8A 5A3OA 5JIAA 2MEV2 1VB4A 4JTOA 2P3IA 1XBFA 5FXVA 3NJVA 1DGRN 3NMBA 2XG3A 1QJEA 1CONA 2ZEWA 2ZGKA 3PL0A 2JG9A 3JBG3 4AEDB 1TZOA 4A4AA 2CYFA 3ACHA 3VBUB 1BHGA 2WNVA 4GJZA 4M3CA 3DYOA 4AZZA 4QX7A 4XF0A 4Y1XA 3RYRA 2AREA 3H1WA 4N53B 3VKOA 2BGOA 3PTRB 2RMU3 1WWYA 1EY2A 3J8F2 1RUI2 4EN6B 1CGPA 2A7AA 5JZGC 1OBNA 1TME2 3RSJA 4CDQB 1PIV3 4GAZA 4QGLA 2HEWF 3OYWA 2YC0A 2PN5A 3I2KA 1ONAA 1SLTA 2JDNA 3IB3A 1W6QA 4FOYA 3MPPG 5FAXA 1ACCA 5F5IA 1RL3A 4PLNA 4S2DA 2WFF1 5LBEA 1K5MA 4DPNA 3CBNA 3O1VA 1XQNA 1AL23 2J22A 3GZTB 4PDWC 4LHKA 4QPGA 1AR82 2QZ2A 1H2LA 1B35C 3RWKX 1YXWA 3WW2A 2WAOA 2NMOA 1IG3A 2DCZA 5DABA 1N3PA 3I3QA 4P9JA 3ZYPA 2WA4A 4M4PA 1I1EA 1V70A 1SLIA 1OLQA 1QOSA 4XHBA 4DRRA 1UXXX 4BH9A 4BLJA 2R30A 3NNFA 5LK5A 3S5AA 3K46A 1LB2A 5IATA 2CAUA 1UAIA 4IEPA 5FMBA 1OI6A 3GM8A 1UY4A 4CEYA 3WOGA 1QOOA 3CQOA 4JCKA 5I0SA 5KC5A 2RS32 1X9PA 3R4DB 5FKBA 2XKOA 1JUHA 4AVBA 5LWBA 1RINA 3TBDA 4MXWB 3KM5A 5D8AB 4RQPA 1NA1C 2VVDA 2VMHA 1YC61 2VUDA 2TEPA 3JB8A 1JYNA 4DXZA 3WUCA 4LE4A 2X5IA 2IUWA 4OI2A 5C5TA 3MW4A 1ULEA 1PGSA 4JQRA 4AQ2A 2QDNA 2VOKA 1SPPB 3UETA 2P4EA 4WM8C 5FY7A 1NG0A 4F8AA 2D5HA 2VBPA 2CDOA 4JV4A 4ZXEA 4JQTA 3RWNA 4COUA 3ON7A 1ZRIA 3EO6A 3VZNA 2DDUA 1R082 1MQTC 4XDOA 2CGPA 3HN3A 4FFFA 2FDJA 3RZMA 3GCWA 5J3UA 1ENSA 2EALA 4XILA 4NWVA 5FZMA 1UXZA 2A71A 2D98A 2WNUC 4JRAA 5AVAA 1EUUA 4QT6A 2BFUL 5DUXA 4ISRA 2XB6C 5KXCA 2BVBA 3VBRB 4UXAA 2XJVA 4COYA 1UZVA 4PI2A 5J7MA 4W50A 3K3NA 2AGSA 4UOJA 1IKPA 4R9AA 4PF1A 1NQJA 3NNMA 4GULA 1HB1A 4N9IA 3ZKYA 3HNBM 5FZAA 5K0UA 2WDBA 2JE8A 1RUE2 3AJZA 3DXTA 4OCTA 1K45A 4Q4W3 5FZ6A 2JWPA 5GLWA 3KMHA 5JAXA 3VD5A 3BU7A 4N90A 1YQCA 3I2OA 2ES3A 1J3PA 4FTEA 3O0XA 1OFNA 4RGKA 3VHPA 1XNTA 1OLME 4AEDA 5DMYA 1CJPA 4HN1A 3VBUA 5HPOA 2XJSA 4PIYA 1AYM3 2ETEA 4YVSC 4N53A 4PHZA 4JGYC 4LITA 3WF2A 2HBUA 4NRMA 2QVSB 4UW4A 3PMEA 3VD7A 1VRH3 4KNCA 4CXWA 3H42B 1C57A 1L7RA 1V6JA 1YFWA 1YEWA 4QQPA 3ZYIB 1ZM1A 4CDQA 5A7WB 4Y1ZA 1HJGA 2W91A 3HNYM 1O8SA 3ZVXA 4P5HA 1W8WA 1QGLA 4LHNA 3MV01 2BOJA 4NE9A 4GMP1 1CX4A 2X09A 1GQGA 1HXS1 2DCKA 4QXKA 3TN93 1YWKA 1S2BA 4YM3A 1E5HA 2FCTA 2J1AA 2ZCWA 3H7YA 3NKTA 4RD7A 5D1IA 5GM0A 2UWBA 5H9RA 2JICA 2VOXA 5SV8A 1ZNPA 3WNXA 4E4SA 2Y64A 4K6BA 4LHLA 4ASMB 1FXZA 5IK4A 2YC4A 1NT0A 3DKWA 3PUAA 4CCMA 4NUBA 5FY8A 3ZXEA 1VRBA 5FY1A 2YYOA 3DPRB 3GJAA 4XPVA 1YFUA 1AR91 2VE1A 2YU1A 4S2FA 3ZXKA 4CXYA 1QJY2 1ZBE2 2OZJA 3OUHA 3LFIA 4ES8A 2Q8CA 1V9U2 4QGMA 4FSJA 3O14A 4OMDA 5B4XA 1JU4A 1UOBA 1VBB3 2W3JA 1S0IA 2WABA 1CX1A 3WDWA 1YJKA 2KM2A 5A1AA 3VDAA 1JZ4A 4MXWA 4D3WA 5KXDA 5D8AA 3NV2A 2H6BA 4O65A 3ZIWA 4CU8A 1WMFA 2D3PA 3BVCA 2OYZA 4HMZA 1Y9GA 2DU0A 4BMEA 4YW1A 2WT2A 4V1PA 2TNFA 4CZSA 5JPMB 1SPPA 3FZ3A 3ASIA 4Q8LA 4MG2A 1HRI1 3POYA 5IUQA 4AOCA 4IV1C 4Y4RA 1RITA 3KV5A 4IGOA 3ZN5A 4C1XA 1SCSA 4SBVA 5DZEA 4CP2A 1UKRA 1UU4A 2HWF1 1O5LA 2VMIA 3ZSLA 3WUDA 2QQOA 5C4WC 2G1MA 2CTVA 3ZXGA 4H3WA 3EB7A 1GZWB 2HWE3 3BI3A 2BWCA 2YBKA 4L99A 4B7KA 4BQ3A 2I45A 3VBRA 4KBZA 1WW4A 2GMMA 1GWLA 1YIFA 3WZ1A 4CDXC 4XMAA 2WT1A 4NIIA 2QFEA 5FO8B 3W5NA 2VXRA 1KJLA 2XONA 3B3QE 3LA2A 3NW4A 4A41A 4DY3A 5ACA1 1FPN3 4KU8A 2LRPA 3U0ZA 5J36A 2HWD3 4JZRA 1QJU1 2Z5WA 2B42B 4EZHA 4GD4A 5FY0A 3WQBA 2RS13 3UKNA 1YRZA 3LGRA 4RL7A 1S2KA 3FHQA 2A6YA 4XABA 3V0AB 4AVSA 2R16A 1EPWA 3OTFA 4QMAA 1LOFC 3PJQA 3WP5A 1O7FA 1VBE2 3LF7A 5F39A 4CUCA 1S0BA 2EXKA 3D82A 3DXUA 3K48A 2UURA 5BY5A 1EAH3 4YG0A 5DUVA 5FZDA 3JCIA 1XYOA 2WINB 3E5XA 5FPUA 1UL9A 1FOD3 2D40A 4JGZB 4RGAA 2WZR1 4LBMA 3URFA 3WDYA 2XL7A 2B9VA 3JD73 3O12A 4FCAA 4L92A 5A7WA 2CGOA 1PNGA 1GFF2 1RUNA 2NYYA 1I3HA 4LIVA 4A45A 5FY9A 2GMPA 4XTMA 4J1WA 3T09A 3A22A 4PIXA 4NIHA 2AENA 1POV1 1TMF1 3I3MA 5FMOS 5FYCA 3WDVA 2AYHA 3OPWA 1BK1A 2FMYA 1UO9A 1UOJA 2VD7A 4QWNA 3D6EA 4QX5A 5F37A 1RB8G 4KWKA 5A3WA 3WSOA 3SKVA 1D4M1 1PX4A 1B09A 5FIXA 5C9AB 1GNHA 2VZSA 3WNOA 1OURA 4R9DA 1JOPA 2Q5TA 3WDTA 2XKPA 1I9RA 5JI9A 3DPRA 4YG6A 3HPNA 3POBA 2JDKA 1QJX2 5FYIA 3TB0A 4NHXA 4S2GA 5A32B 1COV3 1ZVFA 2HWC1 2VW1A 3GJBA 3MLKA 5D2AA 4Q26A 4K21A 4C8DA 1TVGA 2K2SA 3DF0A 3PLQA 2YB7A 3ZLIA 3ILNA 4PBOA 5LA0A 1GKBA 1HXS2 2I74A 1YQ2A 2CGNA 1MZ5A 1BVP1 4OLLA 4U36A 2XLGA 2QQIA 3MIBA 4LUKA 4AI0A 3H8OA 1F15A 3APBA 4XFHA 3RGBA 1OKQA 3BCWA 5IFPA 4LMFA 4D94A 2ID4A 1PMIA 2DF7A 1HJFA 3KT1A 4AI3A 4AVAA 2ZKNA 1S1AA 4XQWA 3WR0A 5AC91 3E6CC 4IEZA 3ZN6B 4FQZA 1XSRA 4IE0A 3ATGA 4XBNA 4CU7A 5J1XA 5FK8A 1X36A 2GN7A 3ZSMA 1H6XA 5A1LA 5FPAA 5JMOA 4DS0A 1C3HA 2DV9A 4QD2A 5CNAA 1ZREA 5JLVA 2GALA 1IKQA 1MZ6A 1UX7A 1ZRRA 5FTTC 5BNNB 2A70A 1GZWA 1X8EA 2P6HA 2EIEA 2WKKA 4Q29A 1GLHA 2CWSA 1Q8QA 1Z78A 2CDPA 4AQ6A 4Z92B 3LKJA 2FDGA 5IK5A 4EE2A 3H1MA 3L2HA 4RS5C 1FMD3 1PZ7A 4CUAA 5IAXA 1WA6X 4XJ9A 4B7EA 3FWEA 2Y26A 1HRI2 4N43B 5EYXA 3HOBA 1YHFA 2YV8A 3E6BA 2XL9A 3SITA 2P1BA 2VZRA 2ZEXA 1T6GC 4YZ1A 4RFRB 3IDCB 5F2SA 4HK8A 4W6WA 2HWF2 3BKZA 1YYNA 4XE9A 4WVVA 5DAPA 5HXMA 3V0AA 3W5MA 3WG2A 1G9AA 4EN0A 2XPJA 5L73A 1H2MA 4AI8A 3DCQA 2DUOA 3AFKA 3FLRA 4OVEA 5ABJB 5L19A 1VBA1 4XAEA 3WF1A 4DUXA 2HEVF 4XZPA 2XUEA 4Q4X3 3AMQA 2VBDA 1RMU2 3ME2A 5BV6A 5A7QA 4L9BA 2IVJA 4QPWA 2CSGA 1RUD3 1X7NA 4JGZA 5FYHA 2ZAHA 4D7TA 1C5IA 2BYVE 1JI6A 2WO2A 1NE6A 5LRRA 4XFIA 5KHIA 4ATEA 1F5FA 3KVBA 4URAA 3BPZA 2PAKA 3B01A 3SHRA 4PF5A 4QX3A 4TLGA 3POIA 1CZVA 1XYNA 1SHWB 4XUQA 4AAXA 1W6NB 4M3CE 3NJXA 2Y6JA 5FYYA 5JZGB 2RV9A 3NWKA 4META 3RYPA 4LUMA 5C9AA 1RUF1 3B69A 3DYMA 1FI2A 4MLOA 3NJYA 1W99A 2VZVA 1RUG1 1JBCA 1E5SA 3N9QA 3VKLA 3R0RA 2VZUA 4HL0A 4AFBA 4AVTA 2WZR2 2XBO2 1FAYA 4JX0A 3AZYA 5A32A 2Z2SB 2PA7A 3GZAA 1WBFA 3LSEA 2A6XA 3D0SA 4PDWB 4UF0B 2B9UA 1B35B 1VBD1 4XDQA 4P08A 4GB31 1TMF2 5LCWL 1UPIA 3I4IA 3HWJA 4CP9B 3NV1A 2MNGA 2ZOEB 3LOBA 1RYYA 1FYUA 4TTGA 3A4UA 1YUDA 3C7GA 3LEKA 2VECA 4RHV3 4XC9A 1YJLA 3U11A 5IVEA 4Q0SA 1JYVA 2B39A 3MF9A 2YDEA 1LHNA 3CDZB 1D4M2 3ZM8A 4AQTA 5C33A 5GZCA 1IS5A 1EP0A 1PMHX 1WCUA 2D97A 5LRSA 2JG8C 3VZOA 2EF6A 5EZWA 2ZGTA 2CV6A 2JDHA 3WV6A 1WW6A 2PHLA 3ZN6A 1H2NA 2PELA 2W39A 5FZCA 1NA1B 4XVHA 1DCSA 1VMJA 3AP5A 4TXWA 4ZS3A 4AHZA 4Q4V3 3N7KA 2ZX2A 3JZVA 4LA3A 5T50A 5HCFA 2RR13 1RUJ1 3BTYA 1PVC1 5BNNA 2A6WA 2JDMA 2XUMA 4WM8B 5JCTA 1Q56A 1QHDA 3MUY1 1SLCA 4ZONA 2ARBA 5I8SA 3KT4A 1M06G 1MQTB 4XJUA 2NZ9A 4V2WA 5IVFA 2JECA 3C2UA 3WF0A 3GBGA 1E5RA 4Q8KA 1NCQC 3K4ZA 5ERLA 2WS91 4GKYA 1AJOA 4N43A 4ITCA 5AC92 4DFSA 2WNUB 3ACIA 4W6XA 2VVEA 3D5OA 3BIWE 2VZQA 5BNPC 1BEV2 4WBBA 4F7ZA 1Q43A 2VQAA 1ZZBA 3KV4A 4PQ9A 4LR4A 1D7PM 4XFCA 3MW2A 3N7MA 4ORFA 3OEBA 4QHZA 4J25A 5ABJA 4PLOA 3MIHA 1H8TC 1OKOA 1OQ1A 2W68A 2IXJA 1AR63 2ZZJA 5JSPA 1P8JA 1YQ8A 4MUVA 3ZXAC 3VZLA 5CA6A 2H0BA 4D6QA 1CAVB 4LOSA 5BXXA 2R0FA 1FNYA 1UU6A 3DKQA 3LE0A 3PVNA 4L97A 4XJAA 4YW3A 4YVSB 1BBT3 4KI5M 2P34A 1V00A 2PFWA 4JGYB 4LOTA 5LW9A 1RVF3 5I0UA 2ZJCA 2R063 5I0TA 3IAQA 4GWIA 1W6NA 2ZGLA 4CU6A 5JZGA 4QM9A 2BNNA 2V72A 1RUH3 4E8CA 2JIGA 2PMWB 3Q9OA 4CYDA 5JOWA 1OOPC 3JBG1 2VH9A 2PLV3 5A1FA 1XXNA 2CL2A 1DGLA 1DQ6A 4HVOA 5LBFA 3JUUA 1AR81 1R1ZA 1ZZCA 4I3PA 4DZGA 4R9CA 2OXBA 4FOVA 3RI9A 3AL6A 3RJ2X 3MW3A 2FDHA 4NJ4A 1FATA 1Z7S3 4UF0A 2VOWA 3AYCA 2C26A 4PDWA 5E88A 4C90A 1B35A 1JHNA 1QIQA 4FP2A 2DBIA 2Z69A 5JXIA 1PIV1 1C8M1 2VMEA 3VUOA 1GU3A 4QQHA 2RS53 3ETPA 5FZHA 4BB3A 2KD7A 4CP9A 4XYXA 1S55A 3THPA 1O3RA 3W58A 3R6SA 5FZGA 5FXWA 1ALYA 1YNAA 1DF0A 2WWJA 3Q8BA 4BXSV 5K4LA 2RS31 3DUIA 4OMCA 3ZXLA 4ATFA 5A33B 4NHMA 3LAGA 4BXFA 1SDWA 2E31A 3I3BA 4A42A 1RUF2 1R093 2YPDA 1RUG2 2IFRA 5CFDC 1YFYA 2VTFA 1JZ7A 1W6OB 1UF2C 2AACA 2YROA 3VL9A 2N7GA 4AW7A 4LXLA 3ES4A 4OUSA 5C5UA 4R4XA 1DG6A 1NA1A 2E63A 1LAJA 2ARXA 1VBD2 2EIBA 2BFUS 4K20A 2B7YA 3NRUA 4H55A 3UESA 5DDJ3 5FXZA 1C1LA 3VBHC 2O0OA 1H4HA 4LBKA 1R1A2 3AMHA 4WM8A 1W0OA 5EYYA 2IXCA 5EPAA 4IV1B 1BVVA 1I5PA 4YW7A 2WT0A 1MQTA 1HRV1 4FFGA 4HK9A 1QXJA 3D0JA 3I2GA 3POJA 3IM0A 3NL1A 3EMRA 1W9WA 2EAAA 4P9XA 4Y33A 4XZUG 5DN2A 5EXOA 5JOZA 3A23A 3EQEA 3IBMA 5C4WB 4GQ7A 2WNUA 1ASJ2 5I0DA 2XQXA 5LY1A 1JYCA 3JQXA 3P3NA 4LNVA 1RUE1 5FREA 5EQUA 3OUJA 2D43A 2DUQA 4CDXB 5JXJA 2EICA 2EXJA 1H8VA 1PVC2 5FP7A 3S0MA 3AK0A 1RUOA 3KV9A 1L3JA 3N3HA 2W9XA 3H8RA 1UYZA 1IS6A 3W20A 3JXSA 4AG4A 1UOFA 4XF3A 2A6VA 2W1QA 2A3XA 3M3EA 1WCQA 2YC2A 4XXAA 4KL1A 1CAVA 2CHHA 4DO0A 1ND3C 3K3OA 3TEZA 4WZCA 1ZRCA 4YVSA 4MYEA 2MEV3 4JGYA 1CIWA 4JTNA 1G9DA 2DURA 1DGWX 1Y43B 4BMBA 5JVVA 4UI9L 3BODA 1US2A 3LFMA 3T2OA 4BLIA 1AYN3 3O1TA 2ARCA 3LQCA 1S0FA 3PMSA 3LEGA 4OUMA 3OSDA 4HANA 5D21A 4BWOA 2PHXA 4XF1A 1NOVA 3H3LA 2W1SA 3OD0A 1OVSA 4QHBA 2WC2A 4NR1A 1VP6A 2XQRA 2W5FA 4MGQA 4FPHA 1GSLA 1MVEA 2YBPA 3RQ0A 4GA9A 4JHZA 3KCXA 2R043 2Q1FA 2ADDA 3JB4C 3PHMA 5I93A 1JZ6A 1VRH1 3ELNA 4PIZA 2OX0A 3VZMA 1QJY1 1ZBE1 3ZOIA 4QXBA 3CJIC 2VNRA 4HSLA 3WQ0A 1V9U1 2G9GA 2BPA2 3AP6A 3MIEA 3NO8A 4K9SA 2KA3A 3UGFA 2DCYA 3ZDSA 3H0OA 5FZ0A 2CY6A 2E9QA 2W92A 2ZGMA 3LDRA 3POSA 5CVRA 5A33A 1O3SA 1VBC3 3JBG2 4OI1A 2Y33A 4ZU4A 4IEOA 1W9FA 4Z82A 1Y3TA 2CU5A 3VZJA 5DAQA 3GALA 3FFZA 4AFAA 1KD7A 3OBAA 4AFMA 1W6OA 1O3QA 4ZS2A 2C4XA 3POFA 1BZWA 4LBQB 1C28A 2RMU2 4DEQA 1KS5A 1WW7A 4IEWA 4E9KA 3F2ZA 1NLSA 2OUHA 2Y6HA 1X33A 3ZFFC 5JPNB 1PIV2 1C8M2 1H6YA 1FX5A 2VMGA 3H50A 4D69A 4LO6B 5A6XA 1GUIA 2HYKA 4NO4A 1YFXA 1W39A 4Q0QA 2GC2A 1JN2P 1QJFA 1RHI3 3PIJA 3ZYHA 5JUVA 5A7OA 3ST7A 5BYNA 2RM23 2UYAA 3HEIA 1SQ4A 3ZYJB 2X10A 4IV1A 2VW0A 3OUIA 2B46X 1UYXA 1WMXA 1AL22 1AUYA 2Z4FA 2FZ1A 4LT5A 2VQUA 4EN9B 2HJIA 3WG4A 3BOPA 2D6PA 5LA2A 2ZMLA 1AX0A 4R8HA 2B5HA 4XTPA 5C4WA 3RMXA 2OQ7A 5L9BA 4C1WA 2WLQA 2XVGA 3UT0A 4UYBA 2X05A 2JB4A 1WZXA 3OGVA 1DQ0A 1OT5A 2F17A 2ZBJA 4MHUA 5E6HA 1XU2A 5T5OA 3BGAA 5AVPA 1JOBA 1KDKA 1R083 3FC0A 2Q8DA 3KHCA 5LZ6A 5F1RA 3CMGA 4CDXA 4Q4Y3 2YGMA 4RS5B 4E4DX 3IMNA 3UV9A 4AI9A 1YI9A 1MR5A 3OGJA 1PZ9A 2VMCA 3M1HA 1FNZA 4AXOA 1GZCA 1OA4A 3MZHA 1VBE1 1J3QA 1ND2C 1ZBA3 3ILFA 1LHUA 1NCRC 2Y38A 1HRV2 3CL1A 1Q8SA 2E32A 3PVBB 4O9EA 4WVMB 5HXVA 1NLRA 3RFRA 1N47A 1O4YA 3E5QA 2YMZA 4EWEA 2QQNA 5JSRA 1LOFA 1STMA 2D5FA 5A70A 5LASA 1WLWA 4LPLA 4ZY9A 1UX6A 4IGPA 1YIPA 3IT8A 4FBFA 1PGL1 4IEUA 5T54A 1FPN1 5EP9A 2FMDA 2D7FA 4UW6A 2Z42A 1AR73 2ENRA 4E27A 2HWD1 4N7UA 4K8RB 2QQMA 5JR7B 2OS2A 4IE4A 1XSQA 2E51A 3VL8A 3JU9A 1G8WA 1JOJA 4FOQA 5CIRA 2G9FA 3WW3A 2W08A 3SNMA 3N9NA 1W28A 3MO4A 3S7EA 2VBBA 5DAVA 1T6BX 4XQ4A 3IIIA 2ZAAA 4XFGA 3D3AA 1EAH1 4HBNA 1LHWA 1V6NA 2DVAA 4UFIA 1Y9MA 1DZTA 2R49A 4YW4A 1FOD1 3QCWA 2Y8KA 4RGGA 5FPVA 1QJX1 1UOGA 3DYPA 3VDBA 5JOXA 3RZGA 3K2OA 4Q4W2 4BYYA 3TWIA 2Q30A 1TNRA 2Y0OA 4A7YA 4YZ5A 2ZGRA 5FP8A 4ONUA 1JZ5A 1NE4A 1J59A 4KG0A 3S7IA 2GH8A 3HVDA 1LOGA 4LO5B 5FYUA 3SLIA 4RSUA 2OUJA 4AI2A 4K1ZA 4AE2A 2VZ3A 2ZMKA 4W8JA 4CDWC 3WINE 2Q8EA 3TRSB 3WEZA 1AYM2 3BU0A 1URXA 3EXUA 5CG9A 1QNYA 4LBQA 4LBLA 5FYMA 1Y7BA 5JIUA 2ATFA 1R64A 5EJZB 1UQXA 5FBZA 1DHKB 1FV2A 5F3IA 1VRH2 2IXHA 2YZ4A 3B02A 3PUSA 2RJ2A 4URTA 5JXGA 2AR6A 2BBVA 3Q8EA 4OHYA 1ZA7A 1O59A 3AXDA 3MHZA 1W2OA 4OHWA 5A3TA 2JG8B 3FHIB 2WFF3 4YGDA 1WBLA 3RI8A 1C5HA 4WM7C 2RDQA 4I3GA 1WGPA 4DEVA 1N3OA 4M4RA 4RYDA 2GDFA 4K8FA 4CXXA 4LQRA 1AX2A 3K75B 1MS3A 3ZSKA 4TLFA 1NQDA 2G4IA 4E4ZA 5ISLA 2IZWA 3MBWA 1JXNA 3FN9A 3I2IA 5FJKA 4XF9A 2XJPA 3N35A 5L7OC 1JYXA 3N36A 4XFBA 2Y6FA 5CKNA 4QHOA 4Q27A 4MH0E 4W65A 5FOJB 4FPCA 1XNDA 3R4UA 1Q3EA 5DXDA 1UZZA 3M4FA 1SBFA 1RUC3 2AEZA 4RS5A 1KFXL 1RJ7A 1T2XA 4Q0UA 2WRAA 4EN8B 5A6YA 1A8DA 2P3YA 2RDNA 3MIGA 1VBB2 3KSCA 2BTVC 4EZ4A 2QQPA 1NCQB 2BW8A 2PHFA 2A5ZA 2QUOA 1QMJA 5F3GA 3INAA 4BM8A 4MGZE 3E5UA 1O5UA 3WDUA 3RNSA 4WVMA 1HQLA 1WCDJ 1XNAA 4LBQD 5BNPB 3NVCA 2P5BA 3AP7A 4N8MA 4ASKA 2WN3A 3KF3A 2VUJA 2DFBA 2VAUA 1E5IA 4Q2FA 1IG0A 1UYYA 1RMU1 5KBFA 4YW6A 2ZA9A 2XWJB 1IS4A 1F2NA 3AYEA 3OJBA 4C91A 1H8TB 2P2KA 4Y5SA 2JD4A 2O1QA 5GLZA 2SLIA 5E1RA 4N7IA 2J1TA 5CB7A 5M0TA 1APNA 4BE3A 2C9KA 2JE9A 1UY3A 5FLHA 4CCLA 1SDDB 3MIFA 1MS0A 5LB6A 4NHYA 3TNQA 3U37A 3OOXA 5A7PA 4TZDA 3POWA 4YM0A 1TNFA 2E53A 3PUIA 2HWE2 2Y6KA 1JS9A 5T5JA 2VCAA 1XNBA 4LBJA 3UKVA 2R0HA 3QOPA 3WG3A 4PBPA 4XF4A 2HLEA 3WXPA 3OGGA 5FR3A 5LA9A 3GGLA 3TEWA 2X8KA 5KR7A 1GP6A 2V5DA 2VQ0A 2ZX4A 4I30A 4IE7A 1PGL2 3U4SA 3WDXA 4E4HA 1FPN2 2XBO1 1OOPB 2WQ4A 1CESA 5FY4A 1KXGA 2HWD2 4J6GA 4Z2AA 5IAVA 3T4VA 4EROA 3PUHA 2YY1A 4Y20B 2RS12 5LATA 4COZA 1W9SA 2R1BA 3J7LA 4I0WB 3RVHA 5FUIA 2ADEA 4XMIA 1VMFA 1UYPA 3NSTA 3RZZA 2K9ZA 1XOYA 2QTWB 2PQSA 2ZEZA 1QU0A 1VB2A 2ZMNA 1J3RA 2XVLA 4Y1VA 3LD8A 4QKBA 2C6SA 1OMIA 4FO9A 5FY5A 5F3CA 2B45X 3AB0A 3HD8B 1EAH2 5H9QA 1W2TA 5TSWA 2WSUA 4DXRA 4DNYA 1N1TA 1FOD2 2RE9A 2BDRA 3HR9A 3Q8CA 4V2VA 1GYKA 3FLTA 4HLTA 1MS8A 3JD72 4OULA 5A3NA 1ENXA 5FYTA 1DLLA 1LU1A 1UMIA 2EXIA 2MPFA 3LWCA 1TEIA 1QH7A 4GMP3 4XJZA 3CF6E 4OI4A 5FQ0B 2JG8A 1OC1A 3T2PA 4YG3A 1WA4A 1PO13 5CFDB 1XC6A 4XUTA 1W8UA 3ZYBA 4Z07A 3VBOC 4W4ZA 4DOUA 3RZLA 4Y1UA 1BYHA 4D7SA 3M2MA 1UD1A 3PUQA 1W90A 5L36A 4UFJA 3B5LB 1QY4A 1YQ5A 2VPVA 2GN3A 2AEYA 3V65A 3J7NA 3NAPC 5FKCA 4DRVA 3VBHB 1KQRA 1SLAA 5FV3A 4O9GA 2VNGA 4OYUA 1LR5A 1AR93 3CKHA 4AYUA 1LOEA 4I01A 1WLCA 2YGLA 4XUOA 4AEKA 2XLAA 1ZZ6A 2W52A 2BP6A 4IEYA 4YM2A 1COV2 1CPMA 3VHNA 1GQPA 1ULOA 3SXWA 4MZUA 5AFEA 4Q4V1 2GP5A 1BEV1 3A0NA 2DU1A 3C7HA 1E57A 1AL0G 1NCQA 1PX3A 4QGNA 3VD4A 3VDDC 4B1LA 2W95A 3WY6A 4I02A
chains in the Genus database with same CATH topology
3B94A 4L8QA 4NVPA 3AZZA 4XIKA 4IERA 5BNPA 3GF6A 3ES1A 1V6OA 2NN8A 2GH2A 4FQ4A 3SH5A 4KBBA 3FUQA 3VKFC 1BCXA 2PAEA 1H8TA 1ULGA 2B8MA 2ZABA 1H9PA 1DQ2A 3ILRA 5DUUA 5KXEA 2GC3A 2WNEA 1ULDA 1X8MA 2ET7A 3R4SA 2W0XA 3LA3A 1OHFA 1LHOA 1XNCA 1G86A 1GICA 1Q5OA 3W9AA 1ND3B 1ZX5A 4YVWC 3T2TA 1GANA 1O91A 3LOIA 3WT3A 1PZ8A 2DUPA 4GALA 5GZFA 1KITA 5FPZA 5H9SA 4B4RA 1H30A 1BQPA 1OA2A 1PO23 2ZTNA 3MPBA 3PVEA 5ACA3 1H9WA 1FMD2 4FXKB 4GXLA 1NY71 4GMP0 2D93A 1QJU3 3M3IA 1OOPA 1SEFA 4BA6A 2XHKA 4HZFA 2CWMA 2HWB3 1AXYA 5I8TA 4Y20A 5CFCC 1BBT1 5HCAA 4CEWC 1O3TA 4FPGA 1ENQA 4YGCA 1JUIA 4HPKB 2KXLA 3C3VA 4Q0VA 1MEC3 2VY0A 2ZHMA 5KHKA 4YFZA 1RUH1 2VU9A 3CJIB 2R071 1N3QA 3ZX7A 3HT1A 1S0CA 5FO9B 3WD5A 2UYBA 1VJ2A 1U5XA 3ZMNA 2JDZA 4QPIC 4X8NA 1RUD2 2P37A 5KHJA 5KXBA 5EV7A 2FQPA 2UY9A 3EJKA 4RFT0 2XJRA 3IPVB 2C1FA 4LULA 5FQ0A 5E8AA 2GC0A 4OFGA 5CFDA 1BMV1 2LM3A 1POV3 1S0EA 4AVVA 2RS51 2BQPA 2YPJA 2DCTA 4YW2A 3VBSC 4XQDA 2OPKA 1R1A1 3AZXA 3J4UH 3ZFFB 3B93A 3CNAA 2HEYF 1RJ8A 1O4ZA 3PVOA 3EBRA 3VBHA 1G9BA 4GIQA 2QNKA 4IETA 1YLLA 1ZZ7A 3V0BB 2HWC3 4E2SA 2ZGOA 3AMNA 1ASJ1 1UW8A 3AJYA 3H7JA 1JTZX 4N9HA 4DB5A 1IQAA 1OA3A 1DGWA 4D7YA 1MACA 3O0WA 4PLMA 3FJSA 3RYKA 1LRHA 4FAGA 1U0AA 3E6DA 1HX6A 1DFQA 3PNAA 1LTEA 5EWSA 1Z0HA 1RTVA 3T1LA 1D2SA 3N7LA 3FX3A 4RR3C 3EHKA 3VHRA 2WJSA 5BUVA 3I59B 1J1TA 1ND2B 1NCRB 2UY8A 2D3SA 2GAUA 4IXLA 3VKMA 1SFYA 2WFPA 2FZ2A 4Y22B 1F5JA 1U12A 2BNMA 2ZACA 4Q4V2 4XOGA 4EV0A 4NHKA 2IWGB 4LLOA 1ND3A 2Q1MA 2RR12 1XE8A 3P3PA 4GH4C 3WP3A 1O4TA 3LCPA 4QU2A 2ZHNA 4AQSA 1ZRDA 2VOVA 4S2HA 5HBAA 3FMGA 4ASLA 2A73B 4AFDA 4NPRA 1LOAA 5J48A 3AX4A 3KLSA 1QF3A 4P9YA 3CU7A 1POV0 4YNIA 2PHDA 1CAUB 4KG8A 1N1YA 1QQP3 2Q1ZB 2BWAA 2ZX3A 5JI7A 1RIRA 2UWAA 4WVWA 3AKPA 5LK7B 2P3KA 5I0RA 4HPKA 1HW5A 3SCHA 3ZXJA 2WZPP 4CDUC 1AYN1 2D6OX 3MI8A 2WL1A 1VBA3 4UW5A 3CJIA 3VN4A 2JX9A 4IV3C 4RA0A 5C8CC 5JSOA 1QKQA 1AR62 5FDBA 1NY72 3WHTA 4YYOA 3WX5A 5A3LA 3ZFGC 4I0BA 3IPVA 2PHTA 2RMU1 4FXGB 4CP0A 4R4ZA 4CDWB 1WD3A 3MLLA 1BBT2 4UBGA 2WQZC 1VAMA 1QDCA 1RVF2 2E6VA 5E16A 3WVJA 1QXPA 2R062 4FT8A 3RMYA 3KGZA 4K1YA 3I7DA 3ZFFA 1HKDA 2DWRA 4FPOB 1RUH2 2XVKA 4YSFA 1VBC1 2R072 4YGBA 2PLV2 3LA7A 1DQ4A 1AL21 4Y26A 4FPKA 4Q1PA 1IPKA 2CNAA 3BB6A 2P3JA 5KHGA 3V0BA 4WM7B 3IDBB 1VIWB 1VR3A 5K8SA 1UMZA 3MYXA 5F6KA 1OPOA 1VBD3 1Z7S2 2D6NA 4GB33 3QD6A 1BMV2 2R1DA 3MDPA 3BALA 4OHZA 3ZFEC 4M01A 1Q8PA 2RS52 5GJ6A 5L7OB 1RHI1 2O8QA 4XW3A 2EIGA 5KC6A 2RJKA 4NOTA 4Q1RA 1DYPA 1PK6C 1OPMA 2PHUA 1R092 3G6JB 1JH5A 3CEWA 3D8CA 1CPNA 1H1AA 3ROUA 1RGSA 3I59A 1ND2A 2QE3A 2ZKLA 1NCRA 3AMMA 4Y22A 4FOWA 3KQRA 4JDMA 4BHPA 1J58A 1RUJ3 4Q4Y1 5DG1A 4B29A 2D6MA 1G7YA 1HQWA 1U5ZA 4B8EA 2JENA 1BKZA 1IOAA 1ZBA1 1DU3D 4XXPA 5GZGA 4H7MA 3TNPB 1EV13 2ZGQA 2CAVA 2WS93 1WCKA 3N7JA 2ILMA 4QQOA 5JMCA 1CAUA 4MX3A 5GZDA 3AKSA 1UN1A 4LO4B 1MS4A 4AGRA 4MGYE 1UCXA 2IXLA 1ULCA 2JEMA 4Q4W1 2E7AA 2WA3A 2BUKA 1REFA 1KS4A 3MEPA 3MFAA 4X6QB 5BNOC 3LSDA 3B00A 1D0HA 2A3WA 1AYM1 2DVGA 4PCRA 4AHYA 2D3RA 3J8F3 3OD4A 1RUI3 2P17A 1MZEA 3WP6A 3U07A 3ZMOA 1LULA 4CDWA 1TME3 4FPYA 4NWWA 2V5YA 2X53S 3AKTA 4AEMA 4EWDA 1WCSA 1QXRA 3M7AA 4FPJA 1AYN2 2ZPXA 4PJYA 1H1IA 2HKXA 3SISA 4UBHA 1PGW1 5FCCA 3VGIA 4LO7A 3TN91 5J09A 2ZX0A 1AR83 3MFCA 4BPZA 2EXHA 1MS5A 4WM7A 3VBOB 3AM2A 4DINB 4BIOA 3W59A 1DYKA 5GZEA 1CJDA 1LU2A 1WMEA 2GNMA 2R042 1C8M3 3BOWA 4XFAA 2H0VA 3ETQA 1F9KA 3VHOA 4FP3A 2Z79A 3NAPB 5FLIA 2YXSA 4YFWA 1SFNA 5EFUA 3VBFC 5L7OA 1OQDA 5I91A 3AKQA 4IEVA 1LECA 2RS33 4FVVA 1VBB1 2DFCA 3AFGA 2OW4A 1PVXA 1U5YA 3BTAA 1VBC2 4KWJA 5B2GB 2XJUA 1X50A 3VDDB 4Z1VA 3ZYRA 1NZCA 2A6ZA 2GU9A 4KH9A 1AF9A 3WCRA 5J37A 4OHXA 1GV9A 3GZUC 3SH3A 3IIAA 1D4VB 3HN1A 2V73A 1MZFA 2IFWA 3FLPA 1HV0A 1RUC1 2D44A 3B9IA 1RHI2 4HN0A 2R6QA 2RM22 1IHMA 3LB9A 1QH6A 2GC1A 1HRV3 3ECQA 1DQ1A 1LJ7A 3ZPYA 3MIDA 1OQEA 1QNWA 3QH6A 2HWE1 4M00A 4U2AA 3GBWA 4YVWB 3VLBB 3OF1A 4GWMA 1A6CA 2PTMA 1RUE3 2BNOA 5GLUA 2JKBA 2FHRA 4Y24A 4K40A 1CAXB 1X82A 4Q4Y2 2RS11 2RHPA 4I09A 4QM8A 1ZRFA 5JOYA 4XEZA 4L2NA 1PM7A 1ZBA2 1S0DA 2JJ6A 5CFCB 3LZZA 4CEWB 5C6CA 1Q8VA 3QLQA 4ZKTB 3KCCA 1MS1A 1H1MA 3AYAA 3J26N 2WLPA 4AF9A 1ZZ9A 1HV1A 3SCGA 5KWRA 3JD71 3IKWA 1AR72 4JRLA 4I2OA 1LCLA 4QPIB 2VW2A 4QPYA 1DDLA 5DUWA 4P9IA 2D6KA 4COWA 3PTYA 4TYSA 3OBTA 4E2QA 4AGGA 1KRIA 3V56A 1A8MA 1DBNA 1QJZA 3VBOA 2YUEA 4KU7A 3VBSB 4I0AA 3ZN4A 2NMNA 1Q8OA 1Y9QA 1UIJA 1QJY3 1ZBE3 4LA2A 1LODA 1V9U3 2JG9C 3NAPA 1AXKA 1COV1 2WNVC 3WQ7A 1CN1A 1WLDA 2GNTA 1KFUL 1PO11 3WQ1A 3TYJA 1PGW2 1J1LA 3TN92 5DZGA 3PJYA 2NQYA 4LTAA 3O7OA 4P9GA 3VDDA 1UZYA 5T3NA 3S6PA 3ZSJA 1GNZA 3GHMA 2OA2A 1QOTA 1XYPA 2BEOA 4J1XA 1K5MC 3UJQA 3H3UA 1G9FA 3QH7A 4EN7B 1AXZA 1GBGA 3RRDA 1ULFA 2AH2A 4QPGC 3V64A 3G7DA 2WFF2 4HVRA 4MGIE 4RR3B 3AMPA 2A75A 1CAWB 3OPZA 4MVTA 2ZGPA 3RS6A 5KHHA 3HT2A 4LBOA 4CRQA 5T52A 3D4KA 2DVDA 4YVWA 3ACLA 4GH4B 3SMHA 4LLFA 5F6LB 1DGRA 1WW5A 1FMD1 2TBVA 4CEYC 2ZX1A 1CQ9A 1SMVA 4K7JA 1CAXA 1RUC2 3I54A 3J9SA 4RQPC 4AGVA 4IESA 4F83A 2X5IC 1AX1A 1VBE3 2SBAA 4GKXA 3WHUA 4BZ4A 5J98B 2AUYA 4JAAA 1HQNA 4TSVA 4CEWA 1LEMA 5CFCA 5CAZA 2FBEA 3KB5A 4Z8BA 1DIWA 5A3MA 4LO8A 3FBYA 4Q4X1 4A3XA 1PO21 4CDUB 3I2DA 4QQLA 1S0GA 2ERFA 3VV1A 2NLRA 2LUWA 1MS9A 1RUD1 2XJQA 3FE5A 3OCPA 4HKWA 4Y4YA 4IV3B 5C8CB 3S30A 1GR3A 4BQ1A 2HWB1 5T55A 1QWRA 4QPIA 1LEDA 1FT9A 5GLTA 1H2KA 3ZFGB 2BGCA 2GNBA 4ISQA 4FSJA 4Y1YA 2VVFA 1MEC1 5GALA 5IT6A 1VLNA 5JDBA 5K0UC 1AJKA 4W6YA 2DCJA 4FPFA 2VULA 4AI1A 3VBSA 2NM1A 1QJX3 2C5DA 3O5SA 2PHWA 3ZXFA 4AEDC 3VBUC 3M3CA 5H9PA 1XU1A 2PHRA 1DZRA 1SCRA 3CJXA 4N53C 5HI0A 1XRUA 1HXS3 5GKAC 1GQHA 4IQPA 5FLJA 3H9AA 2DVFA 2VG9A 2ZHLA 3AKRA 4RHV1 5EJ3A 3ZFEB 4CDQC 4MGKE 4XFFA 4YZ4A 4P9LA 2IXKA 5BPXA 3ZXDA 1LOCA 1NXD1 3WG1A 4ES9A 5F9TA 1LOBA 2WWSA 2WIIB 5SV5A 3HBZA 4G3YC 2ZS6B 4IL7A 4OI0A 2O8OA 1F31A 1PK6B 2ZGUA 5CBLA 4YW5A 1RC6A 3IDEA 1PO12 1SACA 4RR3A 4WVZA 4C0BA 1CAWA 3OY8B 4EWAA 2RR11 1F8VA 4YZ2A 1ENRA 2X29A 2ET1A 2OZ6A 3ZYGA 4KGQA 1C8NA 2BVVA 3AZWA 1EYBA 1LESA 1PHMA 1OSGA 2VNOA 2Q4SA 4GH4A 1WUVA 2YHJA 1W0PA 1FV3A 4HT1T 4JDOA 1AR92 2EA7A 3USUB 1HRI3 1HLCA 2E7QA 3HQXA 4B4PA 4ZU7A 3DL3A 1BJQA 4AVCA 2MHFA 1TQ5A 3FBMA 5FPXA 2XGXA 5D8AC 1W6MB 1W6PB 1V6IA 2F4PA 2HWF3 3M70A 4BCUA 2WSVA 2Q8OA 3K51A 3MICA 3RPQA 4JC1A 1LGCA 4Q0PA 2ZGNA 5GLVA 2F6BA 1SBEA 1RMU3 1H4GA 1OD5A 2R32A 1AR61 4CDUA 1DZQA 4NHLA 1ZA4A 3T1MA 4R52A 1G9CA 5T5LA 3B9CA 2LALA 5BNOB 1LKNA 1M4WA 4IV3A 3RJRA 2LTNA 2ZGSA 1V6KA 5C8CA 1YI7A 1QQP1 2EAKA 3FUOA 3IWZA 3U10A 3U4XA 2Y0IA 5JWPA 1IS3A 3VBRC 4P14A 3ZFGA 3RG0A 1RVF1 1REEA 5IK7A 4FTSA 2R061 2C9AA 3OBRA 4HSJA 2OVUA 1YCIA 4ZU5A 4YLZA 3UKTA 2PLV1 2I2SA 4JVAA 4Q4X2 1PO22 5ACA2 1CR7A 2WZR3 2XBO3 1C4RA 3KD4A 1QJU2 1UPSA 5J96B 2DVBA 3HIFA 4CTEA 2VGDA 1VALA 1IPJA 1Z7S1 2HWB2 1V6LA 3E97A 3THTA 3NV4A 5FRAA 4H14A 1TMF3 5AFBA 3AXEA 4YZ3A 4E2GA 1MEC2 4K3UA 5LEKA 4WV8A 1EPZA 3NV3A 4M0NA 3ZFEA 1D4M3 4AFCA 1CD3G 3VBFB 3SCFA 3MLJA 5CADA 3DGTA 1R091 5DG2A 2ZZQA 5K7PA 4MXVA 2TUNA 4JDNA 3WCSA 3L2YA 1SBDA 1PK6A 1HIXA 5E89A 2DTWA 4L11A 4HVQA 4AHWA 5LEJA 5DDJ1 4EJRA 4DMIA 3OY8A 3H3ZA 4INDA 2H6CA 5HCBA 3DPRC 4FAHA 4LEJA 4M0HA 1IGOA 5DZFA 4RHV2 1I6XA 3KS7A 3HAGA 1OLRA 1NXMA 3O0VA 4YRDA 3TAYA 1UU5A 5CU1A 1ZZ8A 5FMOL 3USUA 4YARA 2VUAA 3MF6A 5AC93 4DQAA 2HWC2 2K0GA 4BOWA 3M3QA 1LENA 1DQ5A 1BEV3 1W6MA 1W6PA 3JQWA 1QDOA 3SH4A 3WW1A 1A78A 4X6RB 4QQ2A 1N1SA 4OHVA 1GZ9A 1UKGA 2I07B 4KQ7A 1LGBA 4A7ZA 4DY5A 3CLPA 1D0GA 3VKNA 3AP9A 1EV11 5FO7B 2UWCA 5BNOA 3M3OA 2XLFA 3CO2A 3KZ4C 1W2UA 3DN7A 4ZXKA 2MEV1 4AWDA 2DYCA 4H7LA 3QBQA 5I8YA 1REDA 4CP1A 3KT7A 2E7TA 3VZKA 1IZ3A 1VAVA 3M8LA 3ENRA 3MGUA 2D6LX 3DV8A 5CG8A 2GSYA 1G6NA 3J8F1 1RUI1 3UJOA 4UW3A 3H1YA 4XBLA 3USSA 3ZIXA 2R041 4XETA 1QQP2 1TME1 2ZHKA 4OZXA 4A7KA 2IC1A 4LBNA 3GNEA 4IEQA 4XHXA 4AEJA 5BNQA 4JGZC 4XIOA 2R073 1VBA2 4HKLA 2JG9B 3NKGA 4GWNA 5FFOC 3KCYA 4R9BA 2WNVB 2XH6A 3VBFA 1RUF3 1LGNA 1BXHA 4IEXA 4M3CB 2XJTA 1RUG3 2QDRA 1NYWA 3GYDA 4FPLA 3TOJA 4SLIA 2C0ZA 1SLBA 4HFSA 1LHVA 2JE7A 1N1VA 1CVNA 2RJLA 5FOBB 4KGGA 4X8PA 2IXIA 4A2UA 3OYWB 3AZVA 1SLLA 2PAMA 2V09A 4HETA 1A3KA 4YM1A 5C9AC 1W6QB 1PNFA 4KWLA 1OFSA 1R1A3 2DTYA 2PYTA 4P9WA 3WLUA 1K5MB 2EVXA 2RM21 3R05A 4QPGB 4COVA 3ALQA 2Q0AA 1AZDA 1WLTA 4M3CF 5IK8A 2A3YA 1KJRA 4AK3A 1TE1B 3RDIA 1U5IA 5F5QA 3QACA 1ASJ3 1VAKA 4GB32 3ZSEA 1AHSA 5T5PA 1AVBA 1R081 5DDJ2 2QZ3A 1UIKA 3I8TA 1WMDA 1KDMA 1PVC3 2QCSB 4B3NA 3GBFA 4CEYB 3AYDA 1XE7A 2PQQA 1S0JA 2UU8A 4MV2A 2GMEA 2AZ5A 4RQPB 4FTBA 4WZFA 2GNDA 4TWTA 3WP4A 1JYIA 2NP0A 2NPIA 3AP4A 4MSVA 1I5ZA 3NJZA 4G9SB 2X5IB 1JW6A 4G4FA 5BNNC 4XBQA 2OIIA 3GHNA 3H8UA 3N4MA 3HMYA 4Z2WA 1AR71 1RUJ2 3IN9A 4HKOA 4BIFA 3FFQA 4XJWA 4B4QA 4NN0A 1XNKA 5K9YA 1C1FA 4F3JA 3ZO0B 3B7MA 4N43C 1H0BA 4Y5Z0 1YO8A 4FPEA 4LE3A 1WD4A 1ZYBA 1EV12 2WS92 4AHXA 3A0KA 3L9JT 3KGLA 4YGEA 1V6MA 3UL2A 2GZWA 2XWBB 3X29B 1D2QA 1HDKA 4C0HA 5K0UB 2QJVA 5ABJC 2JXAA 1MVQA 2QKDA 4XJ8A 5JIAA 2MEV2 1VB4A 4JTOA 2P3IA 1DGRN 2XG3A 1CONA 2ZGKA 2JG9A 3JBG3 4AEDB 2CYFA 3VBUB 2WNVA 4M3CA 4XF0A 4Y1XA 3RYRA 2AREA 3H1WA 4N53B 3VKOA 2RMU3 3J8F2 1EY2A 4EN6B 1RUI2 1CGPA 2A7AA 5JZGC 1TME2 3RSJA 4CDQB 1PIV3 4QGLA 2HEWF 3OYWA 2YC0A 2PN5A 1ONAA 1SLTA 1W6QA 4FOYA 3MPPG 5FAXA 1RL3A 4PLNA 4S2DA 2WFF1 4DPNA 1K5MA 1XQNA 1AL23 3GZTB 4PDWC 4LHKA 4QPGA 1AR82 2QZ2A 1H2LA 1B35C 1YXWA 3WW2A 2NMOA 2DCZA 1N3PA 4P9JA 3ZYPA 2WA4A 1I1EA 1V70A 1SLIA 1OLQA 1QOSA 4XHBA 4DRRA 4BH9A 4BLJA 2R30A 5LK5A 1LB2A 2CAUA 1UAIA 4IEPA 1OI6A 5KC5A 4CEYA 3WOGA 1QOOA 4JCKA 5I0SA 2RS32 3R4DB 2XKOA 1JUHA 4AVBA 1RINA 3TBDA 4MXWB 3KM5A 5D8AB 4RQPA 1NA1C 2VVDA 2VMHA 2TEPA 3JB8A 4DXZA 3WUCA 4LE4A 2X5IA 4OI2A 3MW4A 1ULEA 1PGSA 4JQRA 4AQ2A 2QDNA 2VOKA 4WM8C 1NG0A 4F8AA 2D5HA 4JV4A 3RWNA 4COUA 3EO6A 3VZNA 1R082 1MQTC 2CGPA 5J3UA 1ENSA 2EALA 4XILA 4NWVA 2A71A 2D98A 2WNUC 4JRAA 5AVAA 4QT6A 2BFUL 5DUXA 4ISRA 2XB6C 5KXCA 2BVBA 3VBRB 4UXAA 2XJVA 4COYA 5J7MA 2AGSA 1IKPA 4R9AA 1NQJA 4GULA 4N9IA 5K0UA 1RUE2 3AJZA 4Q4W3 5GLWA 3KMHA 5JAXA 3BU7A 4N90A 2ES3A 1J3PA 4FTEA 3O0XA 1OFNA 3VHPA 4AEDA 1CJPA 4HN1A 3VBUA 2XJSA 4PIYA 1AYM3 2ETEA 4YVSC 4N53A 4JGYC 2QVSB 4UW4A 3PMEA 1VRH3 4KNCA 1C57A 1V6JA 1YFWA 4CDQA 4QQPA 3ZYIB 1ZM1A 4Y1ZA 3ZVXA 4P5HA 1QGLA 4LHNA 4GMP1 1CX4A 1GQGA 1HXS1 2DCKA 4QXKA 3TN93 1YWKA 1S2BA 4YM3A 2ZCWA 3H7YA 3NKTA 5D1IA 4RD7A 5GM0A 2UWBA 5H9RA 2JICA 2VOXA 5SV8A 1ZNPA 3WNXA 4E4SA 4K6BA 4LHLA 4ASMB 5IK4A 1FXZA 3DKWA 3ZXEA 2YYOA 3DPRB 4XPVA 3ZXKA 1YFUA 1AR91 4S2FA 1QJY2 1ZBE2 2OZJA 4ES8A 1V9U2 4QGMA 3O14A 1VBB3 1S0IA 3WDWA 1YJKA 2KM2A 4MXWA 4D3WA 5KXDA 5D8AA 3NV2A 2H6BA 3ZIWA 1WMFA 2D3PA 2OYZA 4HMZA 2DU0A 4BMEA 4YW1A 2WT2A 4V1PA 2TNFA 4CZSA 5JPMB 3FZ3A 3ASIA 4Q8LA 1HRI1 3POYA 5IUQA 4IV1C 1RITA 3ZN5A 4C1XA 1SCSA 4SBVA 5DZEA 4CP2A 1UKRA 1UU4A 2HWF1 1O5LA 2VMIA 3ZSLA 3WUDA 5C4WC 3ZXGA 2CTVA 4H3WA 1GZWB 2HWE3 2BWCA 4L99A 4B7KA 2I45A 3VBRA 1WW4A 2GMMA 1YIFA 3WZ1A 4CDXC 4XMAA 2WT1A 2QFEA 5FO8B 2VXRA 1KJLA 3B3QE 3LA2A 3NW4A 4DY3A 5ACA1 1FPN3 4KU8A 3U0ZA 5J36A 2HWD3 1QJU1 2Z5WA 2B42B 2RS13 3UKNA 1YRZA 3LGRA 4RL7A 1S2KA 2A6YA 3V0AB 4AVSA 2R16A 1EPWA 3OTFA 4QMAA 1LOFC 3PJQA 3WP5A 1O7FA 1VBE2 1S0BA 2EXKA 3D82A 3K48A 2UURA 5BY5A 1EAH3 4YG0A 5DUVA 3JCIA 1XYOA 2WINB 3E5XA 1UL9A 1FOD3 2D40A 4JGZB 4RGAA 2WZR1 4LBMA 3URFA 3WDYA 2XL7A 3JD73 3O12A 4FCAA 4L92A 2CGOA 1PNGA 1GFF2 1RUNA 2NYYA 1I3HA 2GMPA 4XTMA 4J1WA 4PIXA 2AENA 1POV1 1TMF1 5FMOS 3WDVA 2AYHA 1BK1A 2FMYA 4QX5A 3D6EA 1RB8G 4KWKA 1D4M1 1B09A 5C9AB 1GNHA 4R9DA 2Q5TA 3WDTA 2XKPA 1I9RA 5JI9A 3DPRA 4YG6A 3TB0A 1QJX2 4S2GA 5A32B 1COV3 1ZVFA 2HWC1 2VW1A 3MLKA 4Q26A 4K21A 2K2SA 3DF0A 3PLQA 3ILNA 4PBOA 1GKBA 1HXS2 2I74A 2CGNA 1MZ5A 1BVP1 4OLLA 4U36A 2XLGA 4LUKA 3MIBA 4AI0A 3APBA 4XFHA 1OKQA 3BCWA 4D94A 1PMIA 2DF7A 3KT1A 4AI3A 4AVAA 2ZKNA 1S1AA 4XQWA 3WR0A 5AC91 3E6CC 4IEZA 3ZN6B 4FQZA 3ATGA 4XBNA 1X36A 2GN7A 3ZSMA 4DS0A 1C3HA 2DV9A 4QD2A 5CNAA 1ZREA 5JLVA 2GALA 1IKQA 1MZ6A 1ZRRA 5FTTC 5BNNB 2A70A 1GZWA 1X8EA 2WKKA 4Q29A 1GLHA 2CWSA 1Q8QA 1Z78A 4AQ6A 4Z92B 3LKJA 5IK5A 3H1MA 3L2HA 4RS5C 1FMD3 1PZ7A 4B7EA 4XJ9A 3FWEA 2Y26A 1HRI2 4N43B 5EYXA 1YHFA 2YV8A 3E6BA 2XL9A 3SITA 4YZ1A 1T6GC 3IDCB 4HK8A 4W6WA 2HWF2 1YYNA 4XE9A 4WVVA 3V0AA 3WG2A 1G9AA 4EN0A 2XPJA 5L73A 1H2MA 4AI8A 3FLRA 2DUOA 3AFKA 4OVEA 5ABJB 5L19A 1VBA1 2HEVF 4XZPA 4Q4X3 3AMQA 1RMU2 3ME2A 5BV6A 4L9BA 4JGZA 1RUD3 1X7NA 2ZAHA 4D7TA 1C5IA 2BYVE 1NE6A 5LRRA 4XFIA 5KHIA 4ATEA 1F5FA 3BPZA 2PAKA 3B01A 3SHRA 4PF5A 1XYNA 1W6NB 4M3CE 5JZGB 3NWKA 4META 3RYPA 4LUMA 5C9AA 1RUF1 3B69A 1FI2A 4MLOA 1RUG1 1JBCA 3VKLA 4AFBA 4AVTA 3R0RA 4HL0A 2WZR2 2XBO2 1FAYA 3AZYA 5A32A 2Z2SB 2PA7A 3GZAA 1WBFA 3LSEA 2A6XA 3D0SA 4PDWB 2B9UA 1B35B 1VBD1 4XDQA 4GB31 1TMF2 1UPIA 3I4IA 3HWJA 3NV1A 2MNGA 2ZOEB 3LOBA 1FYUA 3A4UA 1YUDA 3U11A 2VECA 4RHV3 1YJLA 4Q0SA 2B39A 3MF9A 2YDEA 1LHNA 4AQTA 1D4M2 5C33A 5GZCA 1IS5A 1EP0A 2D97A 5LRSA 2JG8C 3VZOA 2EF6A 5EZWA 2ZGTA 2CV6A 3WV6A 1WW6A 2PHLA 3ZN6A 1H2NA 2PELA 2W39A 1NA1B 3AP5A 4AHZA 4Q4V3 3N7KA 2ZX2A 3JZVA 4LA3A 5T50A 5HCFA 2RR13 1RUJ1 1PVC1 5BNNA 2A6WA