3WQ1A

Structure of hyperthermophilic family 12 endocellulase from pyrococcus furiosus in complex with cello-oligosaccharide
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
270
structure length
270
Chain Sequence
b'KVLKIRYPDDGEWPGAPIDKDGDGNPEFYIEINLWNILNATGFAEMTYNLTSGVLHYVQQLDNIVLRDRSNWVHGYPEIFYGNKPWNANYATDGPIPLPSKVSNLTDFYLTISYKLEPKNGLPINFAIESWLTREAWRTTGINSDEQEVMIWIYYDGLQPAGSKVKEIVVPIIVNGTPVNATFEVWKANIGWEYVAFRIKTPIKEGTVTIPYGAFISVAANISSLPNYTELYLEDVEIGTEFGTPSTTSAHLEWWITNITLTPLDRPLIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoglucanase A
publication title Structure of hyperthermophilic family 12 endocellulase from Pyrococcus furiosus in complex with cello-oligosaccharide
rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 73
structure length 270
sequence length 270
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2014-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wq1A00
2C1FA 2JENA 2QZ3A 1KS4A 5K7PA 4IXLA 1XNKA 4S2GA 1HV0A 1OA2A 3VL8A 3WQ1A 2NQYA 2DFCA 1BVVA 1OLRA 3VZOA 4NPRA 3AKSA 3O7OA 2B46X 3LB9A 4XQ4A 3WT3A 2B42B 4HK9A 1UU5A 2DCZA 2Z79A 3VHPA 3VZJA 3ZSEA 2D97A 1OA3A 4S2HA 3AMHA 2VUJA 3LGRA 1NLRA 1REDA 2BW8A 3MF6A 2JEMA 3M4FA 1BCXA 1REEA 1M4WA 3AMQA 1HV1A 1OA4A 5EJ3A 2BVVA 3AMPA 3VZNA 4S2DA 3VLBB 1XXNA 3AMMA 1HIXA 1F5JA 1QH7A 1UKRA 1YNAA 1TE1B 2JICA 2QZ2A 3AKPA 2NLRA 4S2FA 2D98A 2DCJA 4XPVA 3WQ7A 4XQWA 1UU6A 3WY6A 1XNCA 1QH6A 3MFAA 1KS5A 3VZKA 3WP5A 1H8VA 3RI9A 3WQ0A 3B7MA 1T6GC 3B5LB 2BWAA 3WR0A 1ENXA 2BWCA 3AMNA 3WP3A 2DCKA 3WXPA 1C5IA 3VHOA 1XNDA 1XYPA 4H7MA 3AKQA 2B45X 2VULA 1OLQA 2DFBA 4HKLA 3VHNA 1H4HA 3VZMA 3MFCA 3MF9A 3RI8A 5HXVA 1IGOA 1XNBA 4HK8A 3VL9A 2F6BA 4XQDA 3AKTA 1H1AA 1PVXA 3WP6A 1REFA 3EXUA 1XYOA 4HKOA 3HD8B 3VGIA 3WP4A 2VGDA 1H4GA 4HKWA 1W2UA 5K9YA 1H0BA 1UU4A 2VG9A 1C5HA 1XYNA 2DCYA 3VZLA 1AXKA 3AKRA 1BK1A 3WX5A
chains in the Genus database with same CATH superfamily
2C5DA 2RDSA 1VBD3 3J4UH 5FTTC 2ZHMA 3CMGA 4CA9A 1YIPA 2P3YA 2VW0A 4QDSA 1J3PA 3I2DA 4UFKA 2Y0IA 4K7JA 5EP9A 4INDA 2ZPXA 4AI1A 1EV12 5GZDA 4CDUC 4RHV3 4IEQA 3ZKYA 1DLCA 4LNVA 4ONUA 2D6LX 3UGGA 3QACA 3ACIA 1SPPA 1MEC3 2WT2A 3RVHA 1S0EA 2IVIB 4R9BA 4OMDA 4NWVA 2FMDA 1AXYA 4HONA 3AZXA 3H3ZA 4FPOB 4Y5TA 2VMCA 4GB32 3VDDC 3ZFFC 4AI0A 1APNA 3FUQA 4QAWA 3WEZA 3AKSA 4XFCA 3DPRA 4AE2A 1R082 2FCTA 1CGPA 4IV3A 1LGCA 4HSLA 5CZKA 3TBDA 4Y20B 2NYYA 2VTXJ 2VBDA 1KDMA 2VD7A 1AR71 4FP2A 2HWE3 1JUIA 2PTMA 2VR4A 1UOBA 1WUVA 2W95A 4WM8C 5FPVA 4QX8A 4A3ZA 1NZCA 1BJQA 3ZO0B 2VBPA 3KQ4B 3WNKA 1V70A 4DOUA 1NX9A 2XJUA 1Q8OA 3WNLA 4COZA 4OYUA 4OFGA 4D6RA 1DZQA 4Y1XA 1K3IA 2VOWA 2XLAA 3CZJA 5KHHA 4DUVA 1CESA 4H7LA 1D0GA 1RGSA 5A7QA 2ZCWA 4MSVA 3LEKA 1UYPA 1NCRB 3H3LA 3POFA 3U4XA 4A44A 1HIXA 3OBZA 4S2FA 5JDBA 1OQEA 1W2OA 3ZIXA 5T52A 2YUEA 1DCSA 1NAEA 3T4HB 3ZDVA 1Q43A 5K8SA 2WSVA 1SZBA 1KS5A 1H8VA 1PNGA 1RUI1 3A7QA 1PK6A 3RYKA 3BTYA 1QJY3 5IK4A 5KHGA 2JDYA 3LZZA 2OKXA 5KXBA 5L9BA 4IW3A 1RUF3 1YJLA 2E32A 2X09A 3AMNA 4P9XA 4XC9A 2WO1A 4Y5Z0 4LO8A 2LTNA 2EXJA 2VM9A 1JZ7A 1FOD2 1GQPA 2WYSA 1W3VA 2V09A 3ZLIA 5HPOA 1GUIA 1XYPA 1W03A 2CAUA 1JOJA 1AYN2 4I30A 3OGGA 3FWEA 5FYSA 1JYCA 3J9SA 4LBNA 2R062 5FFOC 4BLIA 3AP7A 1MS9A 2GH8A 1FPN2 2AGSA 3BVCA 3MF9A 3MFCA 4GWJA 4IV3C 5FP7A 3WD5A 4OI2A 5BYNA 1XNBA 3RZZA 1X9PA 4Y26A 5KHIA 3CZUA 3D82A 3P5BA 2WC2A 2JG9A 1RHI1 3R0RA 1OBNA 1XYOA 1GP4A 1O4ZA 1E5RA 5JSOA 3DV8A 3FFQA 4IV1A 3AVRA 2MEV1 5FK7A 3KCCA 2I07B 3CO2A 1UU4A 1CZSA 3LEIA 4IEOA 5DAVA 3SHRA 5CFCB 2GMMA 4FVVA 3D6EA 3DGTA 4WV8A 2P1BA 2VOTA 1C8M3 3RWNA 4QX0A 3BIEA 4QPIA 2D5FA 4K9SA 4TYSA 4YVWB 1TG7A 4DB5A 3POGA 3KB5A 3NNLA 2OT7A 2PLV2 4JCKA 1RUE2 2GC0A 2NZ9A 3H8RA 1Y9GA 1PGL2 3WINE 3GDBA 4W6XA 5CG9A 1FX5A 3NV3A 3EQEA 3HAGA 4UBHA 5FZ4A 1U12A 1PK6C 4QXKA 2ZBJA 1K42A 2JE9A 2E63A 3GCXA 4NE9A 5A33B 3H1WA 2CGOA 1YJKA 3C7OA 3M2MA 1MPXA 2E31A 2CYFA 2K46A 1VR3A 4OHZA 1XJAA 5IHRA 4G3YC 4KU7A 5FPUA 5FZGA 4MZUA 1VMJA 4IEYA 4RSUA 5T5LA 2RMU1 5FUPA 4NMIA 1NY71 2HWF1 3TYJA 1OH4A 2ZAHA 3LPGA 4IUGA 3WW3A 2ZX2A 4DY3A 3T30A 2OVUA 3AXEA 1MVQA 1XNAA 3T2QA 1ZBE2 5EYYA 2G9GA 5JZGB 2JG9C 1QJEA 3JD73 2FCUA 4K8FA 2K2SA 4YGEA 2XOMA 2JDHA 3HJRA 1UN1A 4IV1C 3AMPA 1LKNA 5F6KA 4XBQA 3VKMA 5FPAA 5HCHA 4O9GA 1W6OA 5JIUA 4W8JA 1CZVA 1ZZCA 4YG0A 1RUH2 4URTA 2XBO1 4XPVA 3OF1A 3I49A 3BTZA 4QQHA 1QJX1 5DDJ2 4P02B 1DGLA 4FT8A 1US3A 4ZKTB 1F15A 4CZSA 2WIIB 2WNUC 4KWJA 1W9SA 1C3HA 5FP4A 1QY4A 5A7WA 3QH6A 3VZKA 2XVGA 3WQ0A 1EAH2 5C3PA 5L7OA 1VBA3 1AYM1 1TMF3 3MIEA 1HKDA 2AH2A 5F39A 3RQ0A 1AR62 4DUXA 1MZFA 3OD4A 1UY4A 2CSGA 5L9VA 1COV2 4D6SA 3DKWA 1ZYBA 3FN9A 2WO3A 2XUMA 3E5UA 3ZXDA 2JB4A 1ZA7A 2PHFA 1TQ5A 3J7HA 4K20A 2JIGA 4QHZA 3VBSA 4LA2A 5J09A 3WW1A 1F5FA 2GC1A 4BQ1A 3ZYGA 4H3WA 2AYHA 3RI8A 2FDFA 5GZFA 4GD4A 1V6MA 3VL9A 3CIHA 1W6PB 3AP5A 3PMSA 5I0SA 2H6BA 4G9SB 4YRDA 4ARXA 4IEPA 4LK6A 3S5AA 1W06A 4KL1A 5GZGA 4XDQA 5FLJA 2W91A 3MEPA 1US2A 3UKVA 4AVTA 3PLQA 3PVBB 1ZRIA 3GZEA 2ZGPA 4TTGA 1CAWB 4Y5SA 2DVGA 3CJIA 4COVA 4RFRB 4UW6A 1NE6A 2YHJA 2W47A 3PU3A 5IUQA 1Q5OA 3AYCA 3W21A 4Z2WA 5LA9A 1H2NA 4M0NA 1VBE1 1R1A2 3N7LA 4GWIA 1U5ZA 1XC6A 2RM22 3JUUA 2IXLA 3HEIA 4DNYA 1RB8G 4X6RB 1QIQA 4LKEA 2Q8EA 4D6QA 3BU0A 5IVJA 3S0MA 1JW6A 1BK1A 5FZEA 3WDUA 4OMCA 2RS33 4YGCA 1PIV2 4MV2A 4MXWA 4EE2A 5C7GA 4XFHA 3KSCA 5C3QA 1KJLA 1VB2A 2H0VA 4JVAA 2EVXA 3A0NA 4M3CA 1Q3EA 1U0AA 1VLNA 4LHLA 4OUEA 5L7OC 4KH9A 5K7PA 3NNFA 4LHSA 1HB1A 4CCEA 2GZWA 1RTVA 3NL1A 1BHGA 1L7RA 1W6NB 2VZOA 4Q0SA 3VKFC 2FD8A 4NIAA 1GICA 4OI1A 2V5YA 4YW3A 4XTMA 1J3QA 1DZRA 5FYHA 2RR12 4YG3A 4NPRA 1CAXB 3PVOA 1W8HA 4Q27A 1CPNA 1LR5A 1DYPA 5FZBA 5LBBA 3VBSC 5FOBB 3KT7A 4YW6A 2VMEA 4FOQA 1CONA 5LY1A 2YBPA 3VBHB 3VKOA 3GNEA 2EXKA 3B3QE 5AFEA 3JBG2 5FR3A 3RWKX 3ZSEA 2WZR1 4P08A 4F83A 5IVEA 3B9CA 1LECA 2J1EA 2RDQA 4XBLA 2OPKA 2P2KA 4BISA 1KFUL 1NQDA 2B8MA 2B39A 2XHNA 2VQAA 2KM2A 1AF9A 3LCPA 4CDQB 2V4AA 3FL7A 4XJZA 4ZU7A 2JDUA 2ZABA 2VY0A 3TEXA 2X05A 1DP0A 2VZ3A 4BMEA 4GQ7A 1W2TA 4XAEA 4JDMA 2D43A 2P34A 3LAGA 5F5QA 4PHZA 3TEZA 1W8UA 2P3KA 1QHDA 1AR83 1WA4A 2CU5A 1ULDA 4DEQA 2ADDA 2YGMA 3H7YA 5GZEA 4DMIA 5KC5A 1QH6A 1QJU1 1YO8A 4PDWA 3TN92 5J7MA 4R9DA 1AR91 2IZWA 2VCMA 1V6LA 3O1MA 1ENSA 1SACA 1XBFA 5IWFA 1ONAA 2RE9A 3INAA 1T6GC 1ZRCA 1RMU1 2UU8A 1QQP2 2QBXA 5FKCA 4CPBA 2D3PA 1WLCA 3NQHA 2DCKA 3DXUA 1LGBA 2PYTA 4JGZB 1UXZA 4LBQA 4Q4V3 3M3OA 2BGPA 5IJRA 4AI2A 3VUOA 1SLIA 4WVVA 3LQCA 1G9DA 2QQPA 4FXKB 5A3LA 4I01A 2R041 1IS4A 1ZZBA 5C4WB 3N4MA 2HEWF 3FLTA 5HV4A 2BQPA 3IZOA 5F2SA 1RYYA 1ODNA 1J83A 1UW8A 2ATFA 5FZ9A 5JR7B 5LASA 5GLUA 1Q56A 4XABA 3SH4A 3ON7A 4CEYA 3ZR5A 2EAAA 4B29A 5I8TA 3QBQA 3HQXA 1DIWA 4LIUA 1WW7A 4N7UA 4YVSB 4QDRA 3KV6A 5FY5A 2ZGUA 2HKXA 3ZMNA 2VBBA 3ZXLA 2WFF2 3ENRA 1HDKA 5T55A 1VAMA 1LHVA 3BODA 3EMRA 3ZSMA 1JYVA 4RS5A 1SBEA 4DO0A 1EPZA 4HZFA 2J1RA 1LCLA 5FLHA 1C57A 5FZCA 1OD3A 5KXEA 1GZTA 4IE7A 3POIA 1BMV1 2BUKA 1F4AA 4Y1VA 1GWMA 5IK8A 1BYHA 1LOFA 4Q4W1 4CP0A 2CV6A 1WLTA 1TME1 3NW4A 4YW5A 1R1ZA 1H9WA 5CB7A 4PDWC 3U78A 4LT5A 1AR73 1X82A 1Q8QA 3NAPB 4B4PA 3GBFA 2A6YA 2WBKA 3V0AA 3PJYA 5FYZA 4LITA 3JCIA 1HXS1 3HNYM 4QM9A 1HV0A 1RUG1 3TOJA 2HWD1 3RJ2X 2W87A 4LHKA 1A8MA 1MS8A 1H8TA 3U75A 3SH5A 2VZSA 4QHOA 1J1TA 4IDZA 3BTAA 1J3RA 1PZ7A 2QFEA 4OI4A 4CDWB 5ABJA 3Q9OA 4DFSA 1YQCA 2X5IB 2DUPA 1D2SA 3USUA 4PQ9A 5FO7B 4BB3A 2G1MA 3N9QA 4Y1UA 4FPHA 4DUWA 3MO4A 5DPNA 5KHKA 3WCRA 4DXZA 1UY0A 3O1UA 3IN9A 3NMBA 1AL22 3ZYIB 2D7FA 3M3QA 1DZTA 2YGLA 3GHNA 1ZX5A 4QPGA 5J98B 1DGRN 4KNCA 1IS6A 2J1TA 2VCBA 2ET7A 4AI3A 1RUI3 4NHYA 1NLRA 4XEZA 4IEZA 5FPLA 5AC92 2Z5WA 4QQOA 1ASJ1 5DZEA 4XMIA 2PQQA 3RS6A 1R64A 1YHFA 2BVVA 5DN2A 2O1QA 3BN6A 2BNNA 1LOAA 3LDKA 1GWLA 1W0PA 2A5ZA 2YMZA 4RS5C 2FQPA 3J26N 4LBKA 2OW4A 4YSFA 1S2BA 1SQ4A 4HVRA 5A1LA 4DPNA 1OVPA 2FCVA 1WCKA 2HJIA 2XJPA 5C6CA 1NCQA 5BNNA 1LOFC 3N9PA 3SCFA 4J25A 4WM7B 5JCTA 1PGSA 1KD7A 1UL9A 2IFRA 2ZMKA 3LIGA 4LR4A 1JZ3A 1VRH2 3DEMA 1N1SA 3AX4A 5A32B 1K5MB 1JHJA 3LA7A 1OFNA 1RHI3 2WDBA 4Q4X1 4UXAA 2BWCA 4OZXA 3UJOA 1FMD1 4MGIE 3VBFA 4AHWA 1AX1A 3O1OA 1YLLA 5BPXA 1FV3A 2MEV3 3B93A 3U07A 2ZZQA 3IDBB 3WZ1A 2PHTA 1OKQA 2VC9A 2V72A 1GMMA 2B45X 4QMAA 5ABJC 3T1MA 4H55A 5FMCA 3MUY1 5A7NA 3V0BB 4HKLA 3ELNA 3GF6A 3E5XA 3VZMA 1F4HA 2E26A 2ZAAA 4LUKA 1J1LA 1UZVA 2VMHA 2G19A 3DCQA 3NSTA 3ZFEB 4XFBA 2CAVA 4QX1A 4MGQA 2DUQA 3LFIA 5FMOS 3IPVA 4I3GA 1WD4A 3T09A 3VBUA 5CISA 4ZU5A 2EICA 1GOGA 2HWB2 3KMHA 5FYBA 1MQTC 2FHRA 3SH3A 4YZ5A 5CEHA 5KHJA 1ZA4A 2YDEA 3UNPA 1UMIA 1POQA 1QEXA 4XCAA 3SQOA 5CAZA 1ENRA 5I0RA 4AEJA 3KLSA 4Y4YA 4D3WA 2DU0A 5F5CA 4PI0A 3RMYA 3IMNA 1W6QB 3EO6A 4BHPA 4AWDA 1R091 2VVFA 3IM0A 3HQUA 4PQQA 3HNMA 2F4PA 1C8NA 3LSEA 5IVBA 1IQDC 1ZBA2 3EYPA 5FMBA 1NCQC 3AVSA 2RMU3 4PBPA 5A80A 1SLTA 2JENA 1R081 3CEWA 4XYXA 2ZACA 4ES9A 4OUSA 4IXLA 3FMGA 5JXGA 1LOGA 4HN1A 2VTXA 3W59A 3K3NA 4BDVB 2A1XA 4BQXA 4HN0A 5FPZA 1ULPA 3ZYBA 4CTEA 5BNPA 1VBD2 2JXAA 1SHWB 5IFPA 5FZ7A 1W8TA 4RGKA 4A2UA 4P5HA 2DFCA 1UXXX 4A6OA 3GJAA 5F3IA 2JE7A 3N9OA 4AEDB 4HPKB 3ETQA 2WABA 1WMXA 4QX3A 4XDPA 4U2AA 1TNRA 1OKOA 4AQ6A 4DQAA 5FO9B 4RHV2 2XBO3 1V00A 3CJXA 3L2YA 5F1RA 4XJ9A 3AJZA 1QJX3 4FPLA 4MGKE 3WDYA 1C1LA 5EZWA 2ZKNA 2DCZA 2Q8OA 4EJRA 3I4IA 2A75A 2CHHA 3VHPA 1HRI2 1ZNPA 5I0DA 4M3CE 1BBT1 1HRV2 1AJKA 4YW4A 1NOVA 3I2GA 4MADA 1OURA 5IVVA 5JXIA 1VALA 3I2OA 3MICA 4JQRA 2VUJA 2E7AA 5EYXA 2KR2A 4LOSA 3VBUC 4A42A 1AYM3 1RUC2 3W9AA 4CRQA 1ND3B 3NVCA 4BK5A 5JI9A 3ZN4A 2Q8DA 4ARYA 1JI6A 5LATA 4WVMB 5A3NA 4LBMA 1HV1A 2ZMLA 4EN7B 1RITA 3AFGA 3NV1A 2HWE2 1VMFA 2QQKA 2WWUA 3C7GA 1D2QA 1SDDB 4YZ4A 1NA1B 2NLRA 4MGTA 1UYYA 1SBFA 2DCJA 1FOD1 2UWAA 2WT1A 4XETA 3VBOA 4CCCA 3WF0A 5IYYA 1JU4A 1DHKB 3LSDA 3WOGA 2DBNA 1AYN1 3HN3A 4U36A 5LK5A 3SISA 3ZN6A 2X29A 4JDOA 2EIGA 2F17A 2VZUA 2R061 2VXJA 5CKQA 3I59A 3OOXA 4F7ZA 1FPN1 1I9RA 2QTWB 4W6WA 5C70A 4AEKA 5A3PA 4QKBA 4NWWA 2VZTA 1OVSA 4UW5A 2WWSA 2Y6FA 1TZOA 3R6SA 3WP3A 4W4ZA 4PLMA 2VVEA 4CEWA 2WO2A 2G4IA 2WINB 1YFWA 4Q1PA 5BNPC 4SLIA 5F7UA 5FMOL 3SLIA 1D4VB 4MG2A 1AJOA 4ZPIA 4ZS3A 1LEMA 2VULA 1SLAA 4LEJA 1QJY2 1VBE3 2OA2A 4Y1YA 2ID4A 4BQ3A 4KBZA 3POJA 1JXNA 1RUF2 3POBA 3MZHA 2E7TA 1IQAA 1U5YA 2BP6A 2Y6KA 4P9IA 1SFYA 3KS7A 4OHXA 3JB8A 3H7JA 4XQDA 3WF2A 4IGOA 3NJVA 3SKJE 1MS5A 1ST8A 2Y26A 4D94A 5FMDA 2QQUA 2R0FA 3NAPC 1ZRDA 5F5AA 4CDUA 2CWSA 2PLV1 4QD2A 1D7PM 2FDIA 1WCSA 1RUE1 4YW7A 1T2XA 1N3QA 2HBUA 1PGL1 2YBKA 1GZWA 2Q1ZB 3S7IA 3JQXA 3OGRA 3DYPA 1W99A 2VG9A 4AI9A 1V6KA 5GLWA 1HJGA 3ZDSA 3KT1A 1Z0HA 2C6SA 2X5IC 3HT2A 3BKZA 3ZPYA 5B2GB 4YNIA 2WNEA 2XUEA 2WNVC 1UZ0A 3JXSA 3VBOC 4FPGA 3UK9A 3VD5A 1KJRA 1UYZA 3VN4A 1YCIA 1FNZA 1HLCA 5HXMA 1KS4A 4QQ2A 3RZGA 2WZR3 3LEGA 3PIJA 5D8AA 1VJ2A 3VDAA 1XNKA 4B3NA 2RG4A 3K2OA 3ZSLA 1A3KA 4GKYA 2NQYA 2XLGA 3NWKA 3OYWA 4CDXB 5I8SA 4CEWC 4GH4A 1W3XA 1BEV2 2VZRA 4BQ2A 4CP9A 5JOWA 3L2HA 4QPIB 4COUA 3LFMA 4KWUA 4RGAA 4UF0A 4TXWA 4UWDA 4X8PA 4E2SA 5DG2A 5C5TA 3WT3A 3MIFA 4YLZA 4N43B 3AZYA 2WJSA 2XQRA 1CJPA 1WMFA 1NT0A 1RUH1 4FPEA 4XUPA 1WD3A 2J1AA 1QXRA 3MV01 2OYZA 3TWIA 1PO12 3OSDA 4EN8B 5C71A 1QJU3 1WLWA 5FZFA 3ZXFA 1AR93 2BEOA 4AR2A 2IXJA 3K51A 3KWVA 1RMU3 4XZPA 5BNOA 1VBC2 2ENRA 4D69A 2QDNA 4B1MA 1CAVA 1LHNA 4S2DA 4GMP1 5BY5A 4WVZA 1AR61 1W04A 4RFT0 1LODA 2VUAA 1COV1 2JICA 1ZZ8A 1ULFA 3IAPA 5CKMA 1G7YA 4XUNA 4DZGA 2NMNA 3ALQA 3JD72 2R043 3J7MA 3NKGA 1DDLA 3PJQA 3VBRB 4FQZA 3WSOA 4AOCA 4CUGA 2J1UA 3KHBA 2A70A 4P5YA 3DYOA 1UY2A 3MFAA 4LO4B 3ZFEC 4CXWA 4BQ5A 2XQXA 1X33A 2Q1FA 3UL2A 2H6CA 3O1RA 2TNFA 5FZ6A 1Y9QA 1VP6A 4EN9B 3B7MA 3VV1A 2QJVA 4Y24A 1QGLA 4MLOA 4RQPB 5D8AC 2CWMA 3LA2A 2CDOA 4XJAA 1PM4A 5ACA2 3MGUA 1G6NA 2BGOA 5C9AA 5JWPA 1GFF2 4C1XA 5J1XA 3FBYA 5IVFA 1CIWA 1S1AA 3I8TA 4H7MA 3WF4A 2YFUA 4GH4C 2XKOA 4I09A 2ZX3A 3LF7A 3RZKA 1OLQA 1TMF2 3HMYA 3PL0A 4B1LA 5JAXA 2MPFA 4OZOA 4Y4RA 3M3EA 2Y6GA 5FY4A 1H30A 2WR9A 4META 1CAUA 3I3DA 3D5OA 3P3PA 1R1A1 3I3BA 5FQ0B 4D7YA 4WZFA 2ARBA 2JDZA 4YWAA 3WF3A 3LKJA 4Q4W3 5F3GA 4RL7A 3M8LA 4XXAA 1TME3 4FFHA 3UGFA 2JDAA 4AFMA 1PIV1 1W05A 2VOVA 4PCRA 1G9CA 3OCPA 2RHPA 5JPNB 3IWZA 2DVDA 1SCRA 1S0GA 2BBAA 1HXS3 5KBFA 3THCA 3ZFGA 1N1YA 4AVCA 2HWD3 3MLLA 5BNOC 1O91A 1WKYA 5D2AA 2HLEA 1C5HA 4FPYA 4W6YA 1DG6A 4LE3A 1UF2C 4XJUA 1AUYA 3KT4A 5J48A 3U4SA 2DU1A 3RJRA 1E5IA 1AXKA 2DDUA 2W08A 2GP5A 2VUDA 1UMHA 1TEIA 5FXVA 1CIYA 1MZEA 3SITA 3WX5A 5LBFA 4UT5A 4Y22B 4QWNA 3J8F2 2RR11 5FZLA 3ZYJB 2OXBA 4NRPA 2AENA 2A6WA 2QQNA 2Y6HA 5F6LB 3WG1A 3O1TA 2XJRA 4CCMA 4E9KA 4CU7A 1DU3D 1OLME 3MI8A 4FOYA 1GNHA 2XJTA 4R8HA 3JBG1 2PAMA 1OA2A 2WS92 3VL8A 3AP9A 1TVGA 3WF1A 3LIHA 1ASJ3 1CX4A 4FFGA 5C9AC 1ULOA 3CKHA 4LTAA 3VZOA 2WQ4A 2FDGA 1GP5A 5GALA 4CXXA 1LB2A 3MPBA 4MGYE 1X9TA 3WW4A 1NA1C 4QXCA 4HK9A 1S0BA 2WNUA 1OOPA 4YM1A 2Z79A 5I0TA 4C91A 4O61A 5GJ6A 3VZJA 4MHUA 1JBCA 1KGYA 1OA3A 5K0UB 3PUQA 1UD1A 2RS52 4CXYA 2ZMNA 2GU9A 2LUWA 3IDEA 4B7EA 4CUBA 1OF3A 1GR3A 2BTVC 4NUBA 4QGMA 1W8WA 2BW8A 4YYOA 3TN91 4E8DA 1QOOA 1ZM1A 4RR3B 1BCXA 3I3EA 3Q8AA 1D4M3 4Q4X3 5FZOB 4BH9A 3FLRA 5L36A 1FMD3 4QU2A 3VZNA 3ZFGC 1PMHX 1AX0A 1QQP1 3ZXKA 1LHOA 1JHNA 2RJ2A 4CCLA 5FDBA 2VQ0A 4TSVA 4DY5A 3OY8B 3ZVXA 1IOAA 2BU9A 2VUCA 4EZ4A 4N53B 1PX4A 3FHAA 3THTA 3PURA 3B69A 1RUJ2 3WY6A 4JGYB 1XNCA 4QB2A 3QH7A 4W50A 3ROUA 4MOAA 4WBBA 3KVAA 4LBLA 2J1SA 1O8PA 2DYCA 4D0QA 3UYJA 1GV9A 4N7IA 2ZX4A 4XUOA 3T4VA 1X36A 3RDIA 3WQBA 1ND2B 2LALA 2JE8A 4F8AA 4R9CA 4R4XA 4LORA 4ISRA 2IXKA 4R4ZA 2BPA2 3UGHA 4FTEA 2WFF1 2W1WA 4EWEA 4P9LA 5BXXA 2YYOA 3HT1A 2P5BA 4BIOA 2PMWB 2RDRA 3HPNA 1S0DA 4N9IA 4Y3OA 1R093 4GIQA 4XILA 2O8OA 4Y20A 4JV4A 5IW0A 4Q4V2 4E2QA 2GSYA 2VMDA 4LUMA 1S4CA 1OOPC 3AM2A 3OBAA 5FUNA 2XB6C 5LA0A 2WLQA 1VAVA 4JRAA 5GLTA 2UWBA 2WZEA 1R083 1UCXA 2JJ6A 4EV0A 2LROA 1UKGA 5LA1A 3AZVA 3IDCB 1H4GA 1UNBA 2BOJA 2B9VA 2EIEA 2CGNA 2XGXA 1S0IA 1WA6X 4I0WB 1DGRA 1JS9A 5CVRA 4FCAA 3BI3A 3R4DB 2Y60A 1NCRA 1B35B 1PVC1 2V4VA 2WLPA 5FZDA 1ACCA 1NYWA 2FZ2A 3A4UA 3ZSKA 3AKRA 3OB8A 3ZR6A 1ALYA 2QE3A 2IVJA 3JB4C 3NV4A 5FZ1A 2CDPA 3WDTA 1FV2A 3CL1A 3QCWA 2VNRA 3ILFA 2FZ1A 4SBVA 4FPKA 4QQPA 5FPBA 1BBT3 1SDWA 5K4LA 2PHRA 1HB3A 4S2GA 1QDCA 1OFSA 1LULA 5FYMA 5JOXA 2VOKA 2BJSA 4JKKA 1IG0A 2OQ7A 1QXJA 1EP0A 5EJZB 5I8YA 5AC91 5FY1A 2AREA 2EIBA 2D44A 1RVF1 1XE7A 5KC6A 3SEEA 2B46X 2OUJA 3ECQA 3ZPOA 1C28A 2ZOEB 3PDQA 1IPJA 1FOD3 5EPAA 3U14A 4K1ZA 1WCQA 4CPBD 1LU2A 4OQ9A 4GA9A 2ZGSA 1AYN3 5CFDB 3AXDA 1C4RA 4A4AA 1FI2A 3BPZA 4LBQD 4XFFA 2R063 1FNYA 3N9MA 2OIIA 3OGJA 1IKPA 1FPN3 5IATA 1VBB1 3DKQA 3MF6A 4ASLA 2BFUL 1JZ8A 1A8DA 4C1WA 2BVBA 2J22A 4JDNA 2AUYA 5FYIA 3NJZA 1VRH1 2RVAA 3N7KA 1EUTA 5CFCA 1BZWA 2E33A 1QH7A 1WBFA 1YNAA 3I2KA 3PVEA 2D3SA 1NCRC 2WQ8A 4UAPA 1RUI2 3H9AA 1W2AX 4NAMA 2GDFA 5IVCA 2E6VA 4YVWA 2DCTA 2IFWA 1X8MA 5HV0A 1KEXA 1WW6A 4K40A 2DVAA 2F4LA 4QPGB 1O3SA 2A6ZA 2ORZA 1JH5A 3MLJA 3POYA 3T08A 4IL7A 4UFJA 2YZ4A 4K1YA 4Q8KA 2Z4FA 2Q0AA 3WR0A 4ZZ8A 1W8NA 3ETPA 2AEYA 2PLV3 2W1UA 4Q1RA 1M06G 1RUE3 3MDPA 4GJZA 2CNAA 3T2PA 5IK5A 2R1BA 1OH3A 4LLFA 5A33A 2HWB1 3MIHA 1MS0A 3HIFA 3ES4A 4RN5A 5A3WA 3AKQA 3OUHA 4GAZA 2A6VA 2Y6JA 5A1AA 1AZDA 5J96B 5FV3A 1RHI2 3MUZ1 5BNNB 3PNAA 4M4RA 2XVLA 1JZ5A 1IGOA 3HBZA 3KV5A 2QQOA 5EIYB 4HANA 1WBLA 2JECA 3WP6A 4DRRA 1REFA 5JXJA 3FX3A 4JHZA 4OHYA 3MV11 4HETA 1ZBA1 1HJFA 2QUOA 4FBFA 4ZU4A 1O5LA 2ARCA 5TSWA 4BYYA 1JU3A 5JVVA 5JZGA 4J6GA 1N3OA 2XL9A 4KQ7A 4ZXEA 4B8EA 3TEYA 1XPWA 1ZZ9A 4IGQA 4HT1T 2TUNA 3ZXEA 5FZMA 2RDNA 1OHFA 4NOTA 1QU0A 4Q0QA 3MW4A 5CFCC 2AR6A 1YQ2A 5A3UA 4A45A 4AVBA 2V73A 5FBZA 4I3PA 1EY2A 4YVWC 4F3JA 3JQWA 3NNMA 1AL0G 3I2FA 1Z7S2 1RUD2 1RUH3 5APAA 1PO21 2VMFA 3O1PA 5JMOA 3P3NA 4COWA 1O8SA 1HRI1 4LPLA 3FFZA 1HRV1 4RA0A 5E8AA 2ZGRA 3M7AA 2Q8CA 3MLKA 3I3QA 5GKAC 1JZ4A 4IE6A 1NQJA 2RMU2 1RUC1 4XOGA 3KQRA 4P14A 4GMP3 4NJ4A 1AR63 3O7OA 3PTRB 3LB9A 4LO7A 4UFHA 3GHMA 1COV3 5FP8A 2WZPP 2ADEA 3H1YA 1LTEA 4GZ9A 4XJ8A 4V2WA 2MHFA 4UFLA 2YV8A 1UOJA 1KRIA 1UYXA 4K3UA 4BE3A 1SFNA 2ZEWA 1W6PA 3ES1A 3Q8EA 2Q5TA 3PVNA 3URFA 5T54A 3CNAA 1WMDA 2WYFA 4W65A 2HWC1 2XXZA 5JZGC 2JEMA 4MX3A 1CAWA 3H8UA 3AZWA 3IT8A 2C26A 5A7SA 3WHUA 4A7ZA 5LZ6A 1GU3A 3VD3A 3VLBB 4BXSV 2P6HA 4J1WA 1DYKA 5SV8A 1VIWB 2QZ2A 1UKRA 3M3CA 1TE1B 3NRUA 2BZDA 4A41A 1JOPA 4XE9A 5DUWA 4K8RB 4EQVA 2GMPA 2X8KA 2WSUA 3QOPA 1YIFA 1VB4A 1WWYA 1W28A 3E6CC 2ORXA 3WP5A 2W0XA 1R1A3 4OI0A 1YFUA 4N90A 1V6IA 3W20A 4ZHNA 3MPPG 1MQTA 1YUDA 2UWCA 1ENXA 2DVFA 3AL5A 3E5QA 4ORFA 4QXHA 5HCBA 5C8CB 1PIV3 5J36A 1V9U2 2ZJCA 1LNSA 1JYNA 1DGWA 2QCSB 1D0HA 3BU7A 4KI5M 1W6NA 4OULA 1CR7A 1UX7A 3CF6E 4TN7A 3GALA 1W6MB 3EJKA 4E4HA 2UYBA 2KA3A 1EPWA 3WNMA 4FPCA 1CAXA 4V1PA 2JG8B 1Q8PA 2P6CA 2GN3A 4XF3A 3VDBA 2X10A 4MVTA 3ZN6B 3A22A 3HBKA 3VBHA 2SLIA 2D40A 4LKDA 1N3PA 2RR13 5DAQA 4BOWA 1IPKA 2D6NA 1O3QA 2WUHA 3KM5A 4Z8BA 4K6BA 2WN3A 1FAYA 4XAAA 2ZGKA 3HN1A 1XQNA 2D5HA 3X29B 1OPOA 2VGDA 4KU8A 3JBG3 4IETA 5A6ZA 1DQ5A 4CDQA 4L8QA 4UYBA 4BU2A 2IXHA 1NZIA 1QWRA 3A21A 4DINB 1HN1A 2YC2A 4IQPA 2VXRA 2XONA 1HQWA 3H0OA 1CD3G 4L2NA 4NIIA 1XSQA 3AB0A 1ZREA 4URAA 1BEV1 3UT0A 2VNGA 2G9ZA 4Q2FA 2XJQA 5C3OA 4CP1A 2PHXA 1H6XA 5CFDC 4Q26A 4CDUB 4XIKA 4PBOA 4AF9A 1X7NA 5C8WA 3GCWA 3TB0A 4Z92B 1P8JA 2GAUA 1YEWA 5FY7A 1OLMA 1YYNA 4Q4Y2 2YBSA 4XTPA 4OHVA 5FO8B 1PO11 1XE8A 3TN93 4AQSA 4D7SA 3CHXA 4JGZA 1GZCA 2XMLA 4O7XA 3VDDB 3ZFFB 1XU1A 4ATFA 3GM8A 1EV11 4CCDA 4YGDA 3FBMA 1QQP3 1VBC1 2A6XA 5F5IA 5FXZA 4TZDA 5C4WA 1EYBA 4QDQA 3CQOA 4E4SA 4XF0A 4LBJA 3ME2A 4YGBA 5CA6A 1OUSA 4AL9A 5H9QA 3EB7A 4WM8B 1MR5A 4GB31 4Y33A 5IT6A 1O4YA 3VBHC 2BNOA 4M01A 2HWF3 4L99A 3U1XA 2RS12 1OI6A 2R072 1YI7A 4MXVA 4XXPA 3I97A 5G04L 1WGPA 4QB6A 1WCUA 4YVSA 1G9BA 2QQLA 5DUUA 1IZ3A 3FZ3A 1X8EA 3Q8BA 5B4XA 2P37A 1W8OA 2WKKA 3N35A 2R32A 4CCJA 2VCAA 4CDQC 3O1VA 3PUSA 1AR92 4I0AA 5ACA1 1MVEA 5FJHA 2C9AA 2WFF3 4XQWA 4GWNA 1RMU2 3C2UA 2HH9A 5EXOA 1UZYA 1MEC2 5D1IA 1TMF1 4YARA 1G9AA 4DXSA 3O12A 2I45A 4QX2A 3RI9A 3ZOIA 3NAPA 5DUXA 3T2OA 5JXHA 4XW3A 1W39A 4FAGA 3WNXA 2AACA 1ZVFA 2WO7A 2C9KA 2JDMA 5CU1A 4Z2AA 1SPPB 4IE0A 3N9LA 4LKFA 4E4ZA 1C5IA 4HVOA 4JGZC 5HBAA 1MACA 1H2LA 4CDWA 2XR4A 3DPRB 2X5IA 1LESA 1JOBA 2W2IA 3P1IA 4MUVA 3WDVA 4AFAA 4IV3B 1QJZA 1C1FA 4P9YA 1PVC3 2C24A 2PFWA 2HYKA 3FUOA 2WNVA 5C4WC 3RFRA 1QKQA 2C4XA 1DF0A 2PAKA 4XACA 4LO5B 5F37A 1GANA 5FJKA 4WZCA 1NG0A 2FDJA 3T1LA 5G05L 1SEFA 2EXIA 1DGWX 4FO9A 4B7KA 3K77A 3U10A 1SLLA 5L19A 2P3JA 3J8F1 2J7MA 1U5IA 2WA3A 4YVSC 2XH6A 3OPTA 4PLNA 2Y34A 5DABA 5A3TA 1QNWA 4XDOA 3E97A 1ULCA 5DZFA 5A6QA 1GLHA 5LB6A 4YFZA 4QHBA 2GNMA 2WS91 5AC93 1W8FA 2OX0A 1RVF3 5E88A 1F35A 5E89A 2A73B 1YQ5A 5A70A 2DBIA 2Z2SB 3OJBA 4ZY9A 4YPJA 4C0HA 1Q8VA 5LBEA 4AQ2A 3WDWA 4FSJA 4YW2A 3H8OA 4BM8A 1PK6B 2P3IA 1IG3A 1POV1 2ZZJA 4WM7A 2JDPA 2B9UA 3BALA 2A3XA 2YFZA 5A32A 5FOJB 3A0KA 4IE4A 4PF1A 1FT9A 1K5MA 5FY0A 3DXTA 1VBB3 1NXD1 2HEVF 3GJBA 3RNSA 2HYXA 3G6JB 2RS51 1UOGA 1UX6A 2MNGA 4OCTA 1IHMA 3DYMA 1VRH3 5FAXA 4AXOA 4HLTA 1YFYA 3BB6A 4CDWC 4QQLA 5GLZA 4Q0PA 5E6HA 3TNPB 4IEWA 2YY1A 5FIXA 3V0BA 2EALA 5FY8A 1H1IA 2D6MA 3Q8CA 4NHXA 4Z07A 3RZLA 3LDBA 2BYVE 3ZFEA 2ZTNA 1I5ZA 2WWJA 1UPSA 3I2IA 5FCCA 3T0AA 4OQ8A 4NHKA 2JG9B 3O14A 4S2HA 5FLIA 1MS1A 1OC1A 1WMEA 1WZXA 4AI8A 4XZUG 1RUJ1 5EFUA 2XWBB 3NKTA 3OPZA 3GGLA 1C8M2 1DYOA 4IV1B 3WCSA 1ZRRA 1S2KA 2R0HA 1WW5A 1REEA 3ZM8A 1XNTA 2R7EB 4HMZA 1OF4A 1Y9MA 4EROA 1A34A 1PZ9A 3MIBA 4LA3A 1ZBE1 3T0BA 3C7EA 2HWB3 1LJ7A 4DS0A 1W6QA 1OD5A 4E4DX 3KF3A 3SCHA 4H14A 3N7MA 2WNUB 5JMCA 3BCWA 2DUOA 3R4UA 4BPZA 1D4M2 4JX0A 3K4DA 5JLVA 3VD9A 1BLZA 4UW3A 3ORJA 2TEPA 3UKNA 4A7KA 3AZZA 2NP0A 1IPSA 1I6XA 4L9BA 4QPWA 2W46A 3K46A 5EQUA 4ET7A 2W3JA 2J1VA 5H9SA 5DDJ1 4WM7C 4XBNA 3IMMA 4E2GA 5HI0A 2ARXA 1ZBA3 1IS5A 4EYUA 5GZCA 5JUVA 1K5MC 4PIYA 1LOEA 4HOOA 4CCNA 2XVKA 4IE5A 3I7DA 1EAH1 3WXPA 3WNNA 2VZPA 3H1MA 4AFDA 3MHZA 2VW1A 2VCCA 3BTXA 3LEMA 2ERFA 5H9RA 4AK3A 2XG3A 4MGSA 1GZ9A 1CN1A 4PIXA 1UY1A 4AEDA 1PMJX 3RGBA 4HPKA 4AAPA 1H6YA 1XOYA 2I2SA 2DV9A 4HSJA 3POEA 4AHYA 3UESA 1ULEA 1S0FA 2DVBA 5LY2A 3H3UA 3SKVA 4CUAA 1J59A 3WDXA 4Q0UA 1BKZA 3THPA 3ATGA 3SXWA 3RSJA 5FPXA 4LIVA 3EXUA 1PO23 4FXGB 4P9JA 3WP4A 1G8WA 5E16A 3SEPA 4LOTA 1NUKA 1ND3A 1R092 2AC1A 2ZX0A 3ACHA 4JAAA 1HRI3 4WVMA 1HRV3 4IESA 3VB9A 2ZEYA 1UMZA 1W6OB 3D0SA 3S57A 2DWRA 3H50A 3IB3A 4Q29A 1GNZA 1RUC3 2VE1A 3RRDA 1VBA2 2EIDA 1V6OA 2JDKA 5A7OA 1O3RA 1NA1A 1QNYA 2D3RA 3BOWA 3OG2A 4IGPA 4JTOA 4LHNA 1UO9A 4FAHA 2EXHA 5A7WB 1S0CA 1E57A 1JYXA 3T3YA 4JKMA 2C1FA 2RM21 3ZYFA 5L7OB 4V2VA 4NR1A 3OUJA 3ZKUA 4LQRA 4XVHA 2VTFA 2WRAA 3N7JA 4KBBA 3CDZB 1X50A 1Z78A 1RIRA 3WLUA 1CX1A 1HQNA 1CJDA 5EJ1B 4LK7A 3WQ1A 2HWC3 2R1DA 3OPWA 1RUG3 4ISQA 4TLFA 2VNVA 2CGPA 4XF1A 2IC1A 2Q1MA 3GYDA 1QMJA 5FZHA 5JSRA 3VBSB 2VZQA 1QXPA 3K75B 4YZ2A 1BBT2 2OZ6A 2PA7A 3ILNA 3F95A 3ZIWA 1O5UA 4AEDC 4CCOA 4H2AA 4EN6B 2BNMA 2W1SA 4I2OA 5A7PA 2W1QA 4GMP0 4NROA 3SC7X 4TWTA 1V6JA 3IDAA 3C8XA 4AQTA 3ACLA 5FZ8A 2EA7A 2P17A 5B4NA 4YFWA 5GLVA 5DAXA 5LCWL 3CJIB 3ASIA 4NPMA 4NN0A 1M4WA 3AMQA 1ND3C 1JUHA 2JD9A 2RS32 2UURA 1W90A 3AYDA 4DEVA 1YI9A 3DL3A 1CZTA 5C3SA 2WFPA 3AKPA 3MYXA 1DQ1A 5EV7A 3DPRC 1LRHA 3L9JT 3WQ7A 1T6BX 5AFBA 2ZKLA 3J7NA 5F8PA 4MXWB 2ZGMA 5J37A 5GM0A 3LDRA 3ST7A 3RYPA 1PNFA 3DN7A 4M3CB 1I1EA 1JYIA 4AHZA 3AYAA 4FTSA 1ZZ6A 1V6NA 3HWJA 5DUVA 2A71A 1VAKA 2WQZC 5A3OA 2BWAA 4M3CF 3BYWA 3AP6A 4BJ0A 1L7QA 4ZZ5A 4QKDA 1UY3A 2KXLA 1XE0A 2E9QA 3I2JA 4AVSA 2ARAA 2CY6A 3VHRA 3C3VA 3RMXA 4L92A 4CDXA 5LRSA 3U37A 3LA3A 4JRLA 5FZ3A 3I54A 4QPYA 3IAQA 4XJWA 3SMHA 4QGLA 1H4HA 3VD7A 5JR2A 2GNTA 2GNBA 2VMGA 4Q5OA 1WCDJ 5HXVA 2BFUS 3EBRA 3EHKA 4N43A 5FRAA 5FZKA 1BEV3 3AKTA 5LWBA 4EN0A 1H1AA 1F2NA 2K9ZA 4KG0A 4E27A 5FZAA 1GQGA 4BMBA 5CNAA 3S5QA 1Z7S1 1AR82 1RUD1 2VW2A 2PQSA 4ITCA 5K9YA 1N47A 1FYUA 1PO13 5CADA 3B00A 4A6SA 2GMEA 4E8CA 1JYTA 1EV13 3B01A 3B94A 2DCYA 2IXCA 3VZLA 1VBC3 3ZX7A 5ANNA 4NIDA 2QQMA 5JOZA 4QX7A 3WG2A 2WL1A 3KV9A 4O65A 3VBRA 2E51A 4PDWB 3IIIA 1RL3A 1VPHA 1YQ6A 1GP6A 4Z1VA 4GB33 1RJ8A 1PGW2 2ETEA 5T5PA 3QD6A 3LWCA 1ENQA 1O59A 1PZ8A 3QLQA 2BGCA 3RZJA 1VE0A 3GZTB 3MW2A 1O7FA 4RQPA 4L0PA 4XFAA 4AGVA 4LBQB 4C0BA 3THDA 4JC1A 2O14A 4KWKA 1H2KA 4NPLA 4QKNA 4R52A 1F8VA 2R16A 4FFFA 2GN7A 3FHQA 3GXUA 5DZGA 1OQDA 4I0BA 1BVVA 3GBWA 3MW3A 4CDXC 4CU6A 2QNKA 4FPFA 1KXGA 3ZXJA 1H2MA 4QPIC 4CU9A 5ACA3 4HXCA 2BDRA 2B42B 1UU5A 1GKBA 3OEBA 4CEYB 1YWKA 2EF6A 2VVDA 1HX6A 4PLOA 4N43C 5FQ0A 1PHMA 2N7GA 1KFXL 2D97A 2XDVA 5FXWA 3OGVA 4YG6A 2Q4SA 4QKFA 3UJQA 1BQPA 1QJFA 5T3NA 3M3IA 2JX9A 2RJKA 2VOXA 1AL21 1LENA 3PTYA 3KHCA 3OBTA 2XJSA 4G4FA 3UV9A 3V64A 3T2TA 3BPSA 2R6QA 5A1FA 2IWGB 3K4AA 4RS5B 5FKBA 5T50A 3NNJA 3D4KA 4XURA 1LU1A 1XXNA 3WUDA 4LMFA 1V9U1 1AR72 3SCGA 4CE8A 2E7QA 3K4ZA 1UAIA 2Z42A 2YC0A 1UOFA 1UU6A 2VPVA 1L7LA 3GZAA 1OSGA 4Y22A 3VBRC 2Y64A 5FBJA 4AGGA 2B5HA 3OTFA 4UFMA 1XB9A 4IERA 4NRMA 3V0AB 3K3OA 2PHUA 4BQ4A 4XUTA 2ET1A 3B5LB 4ATEA 3HR9A 4FQ4A 4GJYA 1W0OA 1H8TB 3B9IA 3D3AA 3J8F3 4RQPC 4ZS2A 2VQUA 4QT6A 4AFBA 5F9TA 3DF0A 5FREA 5ABJB 1FATA 4YM0A 3USUB 4A7YA 5E1RA 2GP3A 5DQ0A 5L73A 4DRVA 1EUUA 3CBNA 3OD0A 1UIJA 2ZEXA 1NXMA 4ZXKA 4L97A 2WS93 3O0WA 2IXIA 1RC6A 4NO4A 3U11A 3KF5A 5FWJA 4LXLA 1S2EA 2F6BA 2W94A 2DURA 2D6PA 3FC0A 4IEXA 1KITA 3Q8FA 4IEUA 5FYTA 1JZ2A 1MQTB 2JD4A 4YZ3A 4FPJA 5K0UA 4D8MA 5C3RA 3W5NA 1POV3 1VMHA 4HKOA 2OQ6A 3RPQA 2QQJA 4RR3A 4XF4A 5FZOA 4JTNA 2Y0OA 3V65A 3W58A 2RS53 1O6UA 4Q4Y1 2VJXA 5LK7B 3OY8A 2ZGTA 3T0DA 1Y4WA 3KGLA 5LEKA 4N53A 3ZYHA 1NCQB 1IS3A 2NPIA 3KVBA 5KXCA 1DQ6A 4JGYA 4YW1A 2XL7A 3KD4A 1SLCA 5DAWA 5M0TA 2XPJA 1A6CA 2MEV2 4PIZA 3ABZA 3N3HA 3N9NA 1GYKA 2WN2A 3WHTA 5KR7A 4Z82A 2PHLA 2LRPA 2H0BA 2GNDA 2UY9A 3ILRA 4AYUA 2XKPA 2JDNA 1RUJ3 4ZONA 3VBFB 3CJIC 4MGZE 3BGAA 1HB4A 1ND2A 1LHUA 2PELA 2RS11 1SLBA 2R071 2PN5A 1W9TA 2QQIA 3ACFA 3HOBA 5D21A 2EAKA 3KGZA 1V0AA 1YC61 1ZBE3 2LM3A 3E1F1 4QXBA 4R9AA 4C90A 4XQ4A 3KV4A 1VBD1 4P00B 1XU2A 1HQLA 3AC0A 1GOFA 2D93A 2WAAA 1GQHA 4K21A 2XHKA 1DQ0A 1MS3A 2JIJA 3SNMA 4EWAA 3OEAA 1UPIA 5AVPA 3IPVB 1QDOA 3VBUB 2I74A 5ISLA 3AMHA 2P4EA 4RHV1 4UBGA 3WW2A 5K0UC 4LBOA 2K0GA 1MEC1 5DDJ3 1E5SA 2W92A 3KCYA 3M4FA 3MIGA 4XFGA 3ZYPA 5I93A 2OS2A 4QU1A 2ZXQA 4RR3C 4MYEA 3BOPA 3FE5A 1EAH3 1GWKA 2VAUA 4NHMA 4O9EA 1NY72 2HWF2 3LE0A 2SBAA 4HG6B 4RYDA 2VL4A 1B35A 4UW4A 2YROA 2WA4A 4CP2A 4X6QB 4JZRA 5BNQA 3RYRA 3WG3A 3WNPA 4N53C 1W0NA 2HWE1 3TRSB 2ZGOA 3WV6A 2X53S 3C7FA 3UETA 1UZZA 3V56A 3LD8A 4JGYC 3PMEA 5DAPA 2NM1A 3HNBM 1YQ8A 2ES3A 5FYCA 3ZMOA 3FJSA 4NIHA 1A78A 2NMOA 3ZYRA 1JZ6A 5FP9A 5T5JA 4M00A 2QDRA 2D6OX 3PIGA 4Y1ZA 1S0JA 3M70A 4MO3M 5ERLA 5BNPB 2XBO2 2YU2A 4KGQA 1AX2A 1QJX2 5BUVA 3LPFA 3H8XA 3RZHA 1XNDA 4QX5A 2BBVA 1ND2C 1CPMA 2PHWA 4DIQA 1MZ5A 2TBVA 5LA2A 4P9WA 5J3UA 5FXXA 2VZVA 2JKBA 2DF7A 1AYM2 2FBEA 1E5HA 2B4KA 4M0HA 4GULA 2PHDA 5LW9A 4KMQA 1K5JA 4GXLA 1DQ4A 1ODMA 3IKWA 4J1XA 5F32A 1CWPA 5CFDA 5LEJA 1QJY1 5IAVA 5DMYA 2Q30A 2R49A 2RM23 3WNOA 4AVVA 1RUF1 1F31A 2O0OA 2W5FA 4EZHA 3O0XA 1QOSA 1PVC2 1XRUA 4XHXA 3UKTA 3VDCA 2G9FA 1UZWA 1L3JA 4HKWA 3NO8A 3K48A 2Y33A 1H0BA 1HN0A 2VNOA 4YM2A 1I3HA 5FYUA 2VZ1A 3F2ZA 4ASMB 2WZ8A 3MBWA 1BVP1 1STMA 3CLPA 5IAXA 1RXGA 1YFXA 2CTVA 3VBOB 2WNVB 3HVDA 1GBGA 4MH0E 1W8ZA 1RXFA 1B35C 1UWWA 2ZGNA 5KWRA 2D6KA 1H1MA 1RUNA 2PAEA 4FI9A 4LJHA 2FDHA 3VKNA 4CEYC 1N1TA 3I59B 1DLLA 3DECA 1OQ1A 2QZ3A 2L9LA 4FOVA 4AZZA 2RV9A 2ZGQA 5FZIA 2KD7A 1NE4A 1LGNA 3O0VA 5DG1A 4HL0A 5H9PA 5CKNA 1VBE2 1RVF2 2ZS6B 3D8CA 1Y43B 1SFPA 4CEWB 2Y38A 2YXSA 4UOJA 2O8QA 1TNFA 2QKDA 1C8M1 1YXWA 5L9RA 4AAXA 1OLRA 1XSRA 3ZXGA 1QOTA 4FTBA 1OT5A 3ZSJA 2W68A 1MZ6A 5IK7A 3WVJA 4HBNA 4GALA 4CCKA 4QGNA 5FP3A 1LEDA 4GWMA 1O3TA 1VBB2 2Z69A 1WW4A 4DXRA 2JWPA 3KCXA 4OLLA 2ZX1A 4P9GA 2OZJA 4JHTA 5F3CA 1PM7A 1N1VA 2XJVA 3ACGA 4AW7A 1D4M1 4D7TA 3AYEA 4RGGA 4COYA 1GZWB 4ASKA 5A6XA 1OMIA 2BV4A 2R30A 2W39A 4AVAA 3VKLA 1H8TC 5CIRA 5C33A 3TAYA 2PXJA 2GC2A 3E6BA 1G86A 3P6BA 1JTZX 4DXTA 4CVUA 5HCFA 2W9XA 3AMMA 2XLFA 1LAJA 1O4TA 2D98A 3AJYA 2WZR2 3IIAA 3RZMA 2JKXA 4AGRA 1ULGA 4CU8A 4HVQA 5JPMB 1GOHA 1F9KA 4ES8A 1DBNA 3CU7A 3NV2A 2GC3A 2Y8KA 5FWEA 2VECA 4OUMA 2ILMA 4JQTA 4JKLA 3AK0A 4QPGC 5D8AB 4AFCA 3JD71 1YRZA 1Q8SA 3NJYA 3USSA 2YB7A 2YPDA 1PX3A 5LBCA 1KQRA 1GSLA 2DTWA 4N9HA 4WVWA 4LO6B 4L11A 3NJXA 2DTYA 2VH9A 3OYWB 1Z7S3 1RUD3 4GH4B 5EHDA 3VHOA 1K45A 4CP9B 4UI9L 3ZXAC 4OVEA 4UF0B 1KDKA 1QJU2 3NNGA 3W5MA 4FFIA 4XIOA 3TNQA 3OUIA 3POSA 1ZRFA 1JODA 3AL6A 4BQYA 5BNNC 1Y7BA 5BV6A 4TLGA 3ITQA 1OPMA 3DUIA 1VBA1 3LOBA 1SCSA 5FYYA 4BIFA 4NIGA 1B09A 2E53A 1UIKA 2AZ5A 4UFIA 1HW5A 1ZZ7A 4PI2A 4X8NA 2BERA 3VGIA 5BNOB 4C8DA 1LOCA 3PUIA 1I5PA 2R042 1CAVB 2VQTA 2Y6LA 3VBFC 1W2UA 3FHIB 2IUWA 1G9FA 2LW8A 2LS6A 3A23A 2UY8A 4NRQA 2BRTA 1CQ9A 2BOIA 3U0ZA 2ZGLA 4NAOA 1PO22 2GH2A 4Q0VA 4B4RA 4GKXA 2WNOA 1AXZA 2ZHNA 4I02A 1HB2A 3PU8A 3PHMA 3I2HA 3PUHA 4EWDA 2WAOA 4LKSA 5FYVA 5CBLA 1IKQA 3FLPA 3G7DA 3AP4A 4PJYA 4OHWA 4BK4A 4XMAA 3I3MA 3JU9A 4BZ4A 2ZA9A 2A7AA 2YG0A 3LOIA 1NKGA 2QQWA 2YPJA 4BXFA 1W9FA 3RG0A 4KGGA 5C8CA 4BQWA 4PF5A 1AL23 2JB8A 5C9AB 1UQXA 1DQ2A 1BMV2 4XFIA 4XF9A 3OBRA 5JSPA 5I91A 5CYYA 1Y3TA 4N8MA 2FDKA 4Q4W2 1LHWA 1S55A 3B02A 1W6MA 1TME2 4AG4A 1RJ7A 2CL2A 3BUCA 3OGSA 1V9U3 2RS31 3H42B 5IFTA 2JG8A 3WG4A 1CAUB 5A6YA 2HWC2 1HXS2 1RUG2 1AHSA 2HWD2 3M1HA 3VD4A 1U5XA 3POWA 3E6DA 4CSWA 1J58A 3LGRA 5KXDA 1K12A 1REDA 5F3EA 5FZ0A 1LOBA 5JIAA 4AHXA 2VO5A 1DFQA 1W9WA 2ZHLA 3ZFGB 3S6PA 2XWJB 5A3MA 3R05A 1OA4A 1SBDA 5EJ3A 4IEVA 4M4PA 4A3XA 1F5JA 3IBMA 1URXA 1JMUB 3WUCA 1VRBA 3GZUC 1SG3A 3D0JA 2AEZA 1BK0A 4YZ1A 2ZHKA 5I0UA 1NLQA 2A3WA 1QF3A 4BLJA 1H9PA 2GALA 3BIWE 2YU1A 5JI7A 4XHBA 4RD7A 1AVBA 2QQVA 3AFKA 4LLOA 1ASJ2 3TEWA 2FMYA 5JOYA 1CVNA 1GNYA 2VU9A 5LRRA 5T5OA 4AEMA 5CG8A 2J42A 4BCUA 2NN8A 4BWOA 2W52A 3C7HA 3S30A 4LE4A 5C8CC 5C5UA 1JYWA 1MS4A 3O1SA 4FP3A 5SV5A 1BXHA 4NHLA 3PUAA 3VDDA 4KWLA 2OPWA 2VMIA 2ZEZA 2UYAA 4HFSA 4KG8A 4MHRA 3ZFFA 5ANQA 3ZN5A 3APBA 5HCAA 3KZ4C 3O5SA 5FUIA 1AR81 1OXCA 2A3YA 2DFBA 4XCBA 4Q4Y3 1OUXA 4NVPA 4Q8LA 2OUHA 5EWSA 3VHNA 4CYDA 1NLSA 5F2WA 4QB1A 3R4SA 1OOPB 2V5DA 2JG8C 2B7YA 4HK8A 4QM8A 4Q4X2 4LULA 2QVSB 3MIDA 4WM8A 4BA6A 1W2NA 1RUOA 3HQRA 1FMD2 1FXZA 1PVXA 1W9YA 2YC4A 4YM3A 5IVYA 3S7EA 4B4QA 4CUCA 5FK8A 1J84A 5DXDA 1RINA 2WT0A 3HD8B 1SMVA 3N36A 4Q4V1 3JZVA 5FY9A 3J7LA 1PGW1 1WLDA 4XUQA 2HBTA 3GBGA 2RJLA 4FOWA 2C0ZA 1POV0 5AVAA 2HEYF 1PMIA 2RS13 2R073 1XYNA 4PT6A 1JN2P
chains in the Genus database with same CATH topology
2C5DA 3J4UH 1VBD3 5FTTC 2ZHMA 1YIPA 2VW0A 1J3PA 3I2DA 2Y0IA 4K7JA 4INDA 2ZPXA 4AI1A 1EV12 5GZDA 4CDUC 4RHV3 4IEQA 4LNVA 4ONUA 2D6LX 3QACA 1MEC3 2WT2A 1S0EA 4R9BA 4NWVA 2FMDA 1AXYA 3AZXA 3H3ZA 4FPOB 3VDDC 4GB32 3ZFFC 4AI0A 1APNA 3FUQA 3AKSA 4XFCA 3DPRA 4AE2A 1R082 1CGPA 4IV3A 1LGCA 4HSLA 3TBDA 4Y20B 2NYYA 1KDMA 1AR71 4FP2A 2HWE3 1JUIA 2PTMA 1WUVA 4WM8C 1NZCA 1BJQA 3ZO0B 1V70A 4DOUA 2XJUA 1Q8OA 4COZA 4OFGA 1DZQA 4Y1XA 2VOWA 2XLAA 5KHHA 1CESA 4H7LA 1D0GA 1RGSA 2ZCWA 4MSVA 1NCRB 3U4XA 1HIXA 4S2FA 5JDBA 1OQEA 3ZIXA 5T52A 2YUEA 1Q43A 5K8SA 2WSVA 1KS5A 1H8VA 1PNGA 1RUI1 1PK6A 3RYKA 1QJY3 5IK4A 5KHGA 3LZZA 5KXBA 1RUF3 1YJLA 4P9XA 3AMNA 4Y5Z0 4LO8A 2LTNA 2EXJA 1FOD2 2V09A 1XYPA 2CAUA 1JOJA 1AYN2 4I30A 3OGGA 3FWEA 1JYCA 3J9SA 4LBNA 2R062 5FFOC 4BLIA 3AP7A 1MS9A 2GH8A 1FPN2 2AGSA 3MF9A 3MFCA 3WD5A 4IV3C 4OI2A 5BYNA 1XNBA 3RZZA 4Y26A 5KHIA 3D82A 2WC2A 2JG9A 1RHI1 3R0RA 1XYOA 1O4ZA 5JSOA 3DV8A 3FFQA 4IV1A 2MEV1 3KCCA 2I07B 3CO2A 1UU4A 4IEOA 3SHRA 5CFCB 2GMMA 4FVVA 3D6EA 3DGTA 4WV8A 1C8M3 3RWNA 4QPIA 2D5FA 4K9SA 4TYSA 4YVWB 4DB5A 3KB5A 2PLV2 4JCKA 1RUE2 2GC0A 2NZ9A 1PGL2 3WINE 4W6XA 5CG9A 1FX5A 3NV3A 3EQEA 3HAGA 4UBHA 1U12A 1PK6C 4QXKA 2ZBJA 2JE9A 2E63A 5A33B 3H1WA 2CGOA 1YJKA 3M2MA 2CYFA 1VR3A 4OHZA 4G3YC 4KU7A 4MZUA 4IEYA 4RSUA 5T5LA 2RMU1 1NY71 2HWF1 3TYJA 2ZAHA 3WW3A 2ZX2A 2OVUA 3AXEA 1MVQA 5JZGB 1ZBE2 5EYYA 2G9GA 2JG9C 3JD73 4K8FA 2K2SA 4YGEA 1UN1A 4IV1C 3AMPA 1LKNA 5F6KA 4XBQA 3VKMA 4O9GA 1W6OA 5JIUA 1ZZCA 4YG0A 1RUH2 4URTA 2XBO1 4XPVA 3OF1A 4QQHA 1QJX1 5DDJ2 1DGLA 4FT8A 4ZKTB 4CZSA 2WIIB 2WNUC 4KWJA 1C3HA 1QY4A 3QH6A 3VZKA 2XVGA 3WQ0A 1EAH2 5L7OA 1VBA3 1AYM1 1TMF3 3MIEA 1HKDA 2AH2A 3RQ0A 1AR62 1MZFA 3OD4A 1COV2 3DKWA 1ZYBA 2XUMA 3E5UA 3ZXDA 2PHFA 1TQ5A 4K20A 3VBSA 4LA2A 5J09A 3WW1A 1F5FA 2GC1A 4BQ1A 3ZYGA 4H3WA 2AYHA 3RI8A 5GZFA 3VL9A 1V6MA 1W6PB 3AP5A 3PMSA 5I0SA 2H6BA 4G9SB 4YRDA 4IEPA 4KL1A 5GZGA 4XDQA 5FLJA 3MEPA 3UKVA 4AVTA 3PLQA 3PVBB 2ZGPA 1CAWB 2DVGA 3CJIA 4COVA 4UW6A 1NE6A 2YHJA 5IUQA 1Q5OA 3AYCA 4Z2WA 1H2NA 4M0NA 1VBE1 1R1A2 3N7LA 1U5ZA 2RM22 3JUUA 2IXLA 4DNYA 1RB8G 4X6RB 3S0MA 1JW6A 1BK1A 3WDUA 2RS33 4YGCA 1PIV2 4MV2A 4MXWA 4XFHA 3KSCA 1KJLA 1VB2A 2H0VA 4JVAA 2EVXA 3A0NA 4M3CA 1Q3EA 1U0AA 1VLNA 4LHLA 5L7OC 4KH9A 5K7PA 2GZWA 1RTVA 3NL1A 1W6NB 4Q0SA 3VKFC 1GICA 4OI1A 2V5YA 4YW3A 4XTMA 1J3QA 1DZRA 2RR12 4YG3A 4NPRA 1CAXB 3PVOA 4Q27A 1CPNA 1LR5A 1DYPA 3VBSC 5FOBB 3KT7A 4FOQA 1CONA 3VBHB 3VKOA 3GNEA 2EXKA 3B3QE 5AFEA 3JBG2 3ZSEA 4F83A 2WZR1 3B9CA 1LECA 4XBLA 2OPKA 2P2KA 1KFUL 1NQDA 2B8MA 2B39A 2VQAA 2KM2A 1AF9A 3LCPA 4CDQB 4ZU7A 4XJZA 2ZABA 2VY0A 4BMEA 4GQ7A 4JDMA 2D43A 2P34A 3LAGA 5F5QA 2P3KA 1QHDA 1AR83 1WA4A 1ULDA 2YGMA 3H7YA 5GZEA 4DMIA 5KC5A 1QH6A 1QJU1 1YO8A 4PDWA 3TN92 5J7MA 4R9DA 1AR91 2IZWA 1V6LA 1ENSA 1SACA 1ONAA 2RE9A 3INAA 1T6GC 1ZRCA 1RMU1 2UU8A 1QQP2 2D3PA 1WLCA 4JGZB 2DCKA 4LBQA 1LGBA 2PYTA 4Q4V3 3VUOA 3M3OA 4AI2A 1SLIA 4WVVA 1G9DA 2QQPA 4FXKB 5A3LA 4I01A 2R041 1IS4A 1ZZBA 5C4WB 3N4MA 2HEWF 3FLTA 2BQPA 1UW8A 2ATFA 5JR7B 4CEYA 5GLUA 1Q56A 3SH4A 5I8TA 2EAAA 4B29A 3QBQA 3HQXA 1DIWA 1WW7A 4N7UA 4YVSB 2ZGUA 2HKXA 3ZMNA 3ZXLA 2WFF2 3ENRA 1HDKA 5T55A 1VAMA 1LHVA 3BODA 3ZSMA 4RS5A 1SBEA 1EPZA 4HZFA 1LCLA 5FLHA 1C57A 5KXEA 1BMV1 2BUKA 4Y1VA 5IK8A 1BYHA 1LOFA 4Q4W1 4CP0A 2CV6A 1WLTA 1TME1 3NW4A 4YW5A 1R1ZA 1H9WA 5CB7A 4PDWC 4LT5A 1AR73 1X82A 1Q8QA 3NAPB 4B4PA 3GBFA 2A6YA 3V0AA 3PJYA 3JCIA 1HXS1 4QM9A 1HV0A 1RUG1 3TOJA 2HWD1 3RJ2X 4LHKA 1A8MA 1MS8A 1H8TA 3SH5A 1J1TA 3BTAA 1J3RA 1PZ7A 2QFEA 4OI4A 4CDWB 5ABJA 3Q9OA 4DFSA 2X5IB 2DUPA 1D2SA 3USUA 4PQ9A 5FO7B 4Y1UA 4FPHA 5KHKA 3WCRA 4DXZA 3IN9A 1AL22 3ZYIB 2D7FA 3M3QA 1DZTA 2YGLA 3GHNA 1ZX5A 4QPGA 5J98B 1DGRN 4KNCA 1IS6A 4AI3A 2ET7A 1RUI3 1NLRA 4XEZA 4IEZA 5AC92 2Z5WA 4QQOA 1ASJ1 5DZEA 4XMIA 2PQQA 3RS6A 1YHFA 2BVVA 2O1QA 2BNNA 1LOAA 1W0PA 2A5ZA 2YMZA 4RS5C 2FQPA 3J26N 4LBKA 2OW4A 4YSFA 1S2BA 1SQ4A 4HVRA 4DPNA 1WCKA 2HJIA 2XJPA 5C6CA 1NCQA 5BNNA 1LOFC 3SCFA 4WM7B 5JCTA 1PGSA 1KD7A 1UL9A 2IFRA 2ZMKA 4LR4A 1VRH2 5A32B 1N1SA 3AX4A 1K5MB 3LA7A 1OFNA 1RHI3 4UXAA 4Q4X1 2BWCA 4OZXA 3UJOA 1FMD1 4MGIE 3VBFA 4AHWA 1AX1A 1YLLA 5BPXA 1FV3A 2MEV3 3B93A 3U07A 2ZZQA 3IDBB 3WZ1A 2PHTA 1OKQA 4QMAA 5ABJC 2B45X 3T1MA 4H55A 3V0BB 4HKLA 3ELNA 3GF6A 3E5XA 3VZMA 2ZAAA 4LUKA 1J1LA 2VMHA 3ZFEB 3NSTA 4XFBA 2CAVA 2DUQA 5FMOS 3IPVA 4I3GA 1WD4A 3VBUA 4ZU5A 2HWB2 3KMHA 5KHJA 4YZ5A 1MQTC 2FHRA 3SH3A 1ZA4A 2YDEA 5CAZA 1ENRA 5I0RA 4AEJA 3KLSA 4Y4YA 4D3WA 2DU0A 3RMYA 3IMNA 1W6QB 3EO6A 4BHPA 4AWDA 1R091 2VVFA 3IM0A 3LSEA 2F4PA 1C8NA 1ZBA2 1NCQC 2RMU3 4PBPA 1SLTA 2JENA 1R081 3CEWA 4XYXA 2ZACA 4ES9A 4OUSA 4IXLA 3FMGA 1LOGA 4HN1A 3W59A 5BNPA 4HN0A 5FPZA 4CTEA 1VBD2 2JXAA 4A2UA 4P5HA 2DFCA 2JE7A 4AEDB 4HPKB 3ETQA 4AQ6A 4DQAA 4U2AA 1TNRA 5FO9B 4RHV2 2XBO3 1V00A 3CJXA 3L2YA 5F1RA 4XJ9A 3AJZA 1QJX3 4FPLA 4MGKE 3WDYA 1C1LA 5EZWA 2ZKNA 2DCZA 2Q8OA 4EJRA 3I4IA 2A75A 3VHPA 1HRI2 1ZNPA 4M3CE 1BBT1 1HRV2 1AJKA 4YW4A 1NOVA 1VALA 3MICA 4JQRA 2VUJA 2E7AA 5EYXA 3VBUC 1AYM3 1RUC2 3W9AA 4CRQA 1ND3B 3NVCA 5JI9A 3ZN4A 4WVMB 4LBMA 1HV1A 2ZMLA 4EN7B 1RITA 3AFGA 3NV1A 2HWE2 1D2QA 4YZ4A 1NA1B 2NLRA 2DCJA 1SBFA 2UWAA 1FOD1 3VBOA 2WT1A 4XETA 1DHKB 3LSDA 3WOGA 1AYN1 4U36A 5LK5A 3SISA 3ZN6A 2X29A 4JDOA 2EIGA 2R061 3I59A 4F7ZA 1FPN1 1I9RA 4W6WA 4AEKA 4NWWA 4UW5A 2WWSA 3R6SA 3WP3A 4PLMA 2VVEA 4CEWA 2WINB 2G4IA 1YFWA 4Q1PA 5BNPC 4SLIA 5FMOL 3SLIA 1D4VB 1AJOA 1LEMA 2VULA 1SLAA 4LEJA 1QJY2 1VBE3 2OA2A 4Y1YA 1JXNA 1RUF2 3MZHA 2E7TA 1IQAA 1U5YA 4P9IA 1SFYA 3KS7A 4OHXA 3JB8A 3H7JA 4XQDA 1MS5A 2Y26A 4D94A 2R0FA 3NAPC 1ZRDA 4CDUA 2CWSA 2PLV1 4QD2A 1WCSA 1RUE1 1N3QA 1PGL1 1GZWA 2Q1ZB 3S7IA 3JQXA 2VG9A 1V6KA 5GLWA 3ZDSA 3KT1A 1Z0HA 2X5IC 3HT2A 3ZPYA 5B2GB 4YNIA 2WNEA 3VBOC 2WNVC 4FPGA 3UK9A 1KJRA 3VN4A 1YCIA 1FNZA 1HLCA 1KS4A 4QQ2A 2WZR3 5D8AA 1VJ2A 1XNKA 4B3NA 3ZSLA 1A3KA 4GKYA 2NQYA 2XLGA 3NWKA 3OYWA 4CDXB 5I8SA 4CEWC 4GH4A 1BEV2 5JOWA 3L2HA 4QPIB 4COUA 4RGAA 4X8PA 4E2SA 5DG2A 3WT3A 3MIFA 4YLZA 4N43B 3AZYA 2WJSA 1CJPA 1WMFA 1RUH1 4FPEA 1WD3A 3TWIA 1QXRA 2OYZA 4EN8B 1PO12 1QJU3 1WLWA 3ZXFA 1AR93 2BEOA 2IXJA 3K51A 1RMU3 4XZPA 5BNOA 1VBC2 2ENRA 4D69A 2QDNA 1CAVA 1LHNA 4S2DA 4GMP1 5BY5A 4WVZA 1AR61 4RFT0 1LODA 2VUAA 1COV1 2JICA 1ZZ8A 1ULFA 1G7YA 4DZGA 2NMNA 3ALQA 3JD72 2R043 1DDLA 3NKGA 3PJQA 3VBRB 4FQZA 2A70A 3ZFEC 3MFAA 4LO4B 1X33A 3UL2A 2H6CA 2TNFA 1Y9QA 1VP6A 4EN9B 3B7MA 3VV1A 2QJVA 4Y24A 1QGLA 4MLOA 4RQPB 5D8AC 2CWMA 3LA2A 4XJAA 5ACA2 3MGUA 1G6NA 5C9AA 5JWPA 1GFF2 4C1XA 3FBYA 1CIWA 1S1AA 3I8TA 4H7MA 4GH4C 2XKOA 4I09A 2ZX3A 1OLQA 1TMF2 3HMYA 5JAXA 2MPFA 3M3EA 1H30A 4META 1CAUA 3D5OA 3P3PA 1R1A1 5FQ0B 4D7YA 4WZFA 2ARBA 2JDZA 3LKJA 4Q4W3 4RL7A 3M8LA 4XXAA 1TME3 4AFMA 1PIV1 2VOVA 4PCRA 1G9CA 3OCPA 2RHPA 5JPNB 3IWZA 2DVDA 1SCRA 1S0GA 5KBFA 1HXS3 3ZFGA 1N1YA 4AVCA 2HWD3 3MLLA 5BNOC 1O91A 1C5HA 4FPYA 4W6YA 1DG6A 4LE3A 1UF2C 4XJUA 1AUYA 3KT4A 5J48A 2DU1A 3RJRA 1AXKA 2W08A 1TEIA 3WX5A 1MZEA 3SITA 4Y22B 3J8F2 2RR11 3ZYJB 2AENA 2A6WA 5F6LB 3WG1A 2XJRA 4E9KA 1DU3D 3MI8A 4FOYA 1GNHA 2XJTA 4R8HA 3JBG1 2PAMA 1OA2A 2WS92 3VL8A 3AP9A 1ASJ3 1CX4A 5C9AC 4LTAA 3VZOA 2WQ4A 5GALA 1LB2A 3MPBA 4MGYE 3WW4A 1NA1C 4HK9A 1S0BA 2WNUA 1OOPA 4YM1A 2Z79A 5I0TA 4C91A 5GJ6A 3VZJA 1JBCA 1OA3A 5K0UB 1UD1A 2RS52 2ZMNA 2GU9A 2LUWA 3IDEA 4B7EA 2BTVC 1GR3A 4QGMA 4YYOA 3TN91 2BW8A 1QOOA 1ZM1A 4RR3B 1BCXA 1D4M3 4Q4X3 4BH9A 3FLRA 5L36A 1FMD3 4QU2A 3VZNA 3ZFGC 1AX0A 1QQP1 3ZXKA 1LHOA 1JHNA 5FDBA 2VQ0A 4TSVA 4DY5A 3OY8B 3ZVXA 1IOAA 4N53B 3THTA 3B69A 1RUJ2 3WY6A 4JGYB 1XNCA 3QH7A 3ROUA 4WBBA 4LBLA 2DYCA 1GV9A 4N7IA 2ZX4A 1X36A 3RDIA 1ND2B 2LALA 4F8AA 4R9CA 4R4XA 4ISRA 2IXKA 4R4ZA 2BPA2 4FTEA 2WFF1 4EWEA 4P9LA 5BXXA 2YYOA 3HT1A 4BIOA 1S0DA 4N9IA 1R093 4GIQA 4XILA 2O8OA 4Y20A 4JV4A 4E2QA 4Q4V2 2GSYA 4LUMA 1OOPC 3AM2A 2XB6C 2WLQA 1VAVA 4JRAA 5GLTA 2UWBA 4EV0A 1R083 1UCXA 2JJ6A 1UKGA 3AZVA 3IDCB 1H4GA 2CGNA 2XGXA 1S0IA 4I0WB 1DGRA 5CVRA 4FCAA 3R4DB 1NCRA 1B35B 1PVC1 2WLPA 1NYWA 2FZ2A 3A4UA 3ZSKA 3AKRA 1ALYA 2QE3A 3JB4C 3NV4A 3WDTA 1FV2A 3CL1A 3QCWA 2VNRA 3ILFA 2FZ1A 4SBVA 4FPKA 4QQPA 1BBT3 1SDWA 2PHRA 4S2GA 1QDCA 1OFSA 1LULA 5JOXA 2VOKA 1QXJA 1EP0A 5I8YA 5AC91 2AREA 2D44A 1RVF1 1XE7A 5KC6A 2B46X 2OUJA 3ECQA 1C28A 2ZOEB 1IPJA 1FOD3 4K1ZA 1LU2A 4GA9A 2ZGSA 1AYN3 5CFDB 3AXDA 1C4RA 1FI2A 3BPZA 4LBQD 4XFFA 2R063 1FNYA 2OIIA 3OGJA 1IKPA 1FPN3 1VBB1 3MF6A 4ASLA 2BFUL 1A8DA 4C1WA 2BVBA 4JDNA 2AUYA 3NJZA 1VRH1 3N7KA 5CFCA 1BZWA 1QH7A 1WBFA 1YNAA 3PVEA 2D3SA 1NCRC 1RUI2 3H9AA 2GDFA 2E6VA 4YVWA 2DCTA 2IFWA 1X8MA 1WW6A 4K40A 2DVAA 4QPGB 1O3SA 2A6ZA 3MLJA 1JH5A 3POYA 4IL7A 2YZ4A 4K1YA 4Q8KA 2Q0AA 3WR0A 4Q1RA 2PLV3 1M06G 1RUE3 3MDPA 5IK5A 2CNAA 2R1BA 4LLFA 5A33A 2HWB1 3MIHA 1MS0A 3HIFA 3ES4A 3AKQA 2A6VA 1AZDA 5J96B 1RHI2 5BNNB 3PNAA 2XVLA 1IGOA 3HBZA 4HANA 1WBLA 2JECA 3WP6A 4DRRA 1REFA 3FX3A 4OHYA 4HETA 1ZBA1 2QUOA 4FBFA 4ZU4A 1O5LA 4BYYA 5TSWA 5JZGA 5JVVA 4J6GA 1N3OA 2XL9A 4KQ7A 4B8EA 1ZZ9A 4HT1T 2TUNA 3ZXEA 4NOTA 1OHFA 1QU0A 4Q0QA 3MW4A 5CFCC 2AR6A 4AVBA 2V73A 5FBZA 4I3PA 1EY2A 4YVWC 4F3JA 3JQWA 1AL0G 1Z7S2 1RUD2 1RUH3 1PO21 3P3NA 4COWA 1HRI1 3FFZA 1HRV1 4RA0A 5E8AA 2ZGRA 3M7AA 3MLKA 5GKAC 1NQJA 2RMU2 1RUC1 4XOGA 3KQRA 4P14A 4GMP3 1AR63 3O7OA 4LO7A 3LB9A 3GHMA 1COV3 2WZPP 3H1YA 1LTEA 4XJ8A 2MHFA 2YV8A 1KRIA 4K3UA 4BE3A 1SFNA 3ES1A 1W6PA 2Q5TA 3PVNA 3URFA 5T54A 3CNAA 1WMDA 4W65A 2HWC1 5JZGC 2JEMA 4MX3A 1CAWA 3H8UA 3AZWA 3IT8A 3WHUA 4A7ZA 3VLBB 4J1WA 5SV8A 1DYKA 1VIWB 2QZ2A 1UKRA 3M3CA 1TE1B 4XE9A 5DUWA 2GMPA 2X8KA 2WSUA 3QOPA 1YIFA 1VB4A 3E6CC 3WP5A 2W0XA 1R1A3 4OI0A 1YFUA 4N90A 1V6IA 3MPPG 1MQTA 1YUDA 2UWCA 1ENXA 2DVFA 4ORFA 3E5QA 5HCBA 5C8CB 5J36A 1PIV3 1V9U2 2ZJCA 1DGWA 2QCSB 1D0HA 3BU7A 1W6NA 4OULA 1CR7A 3CF6E 3GALA 1W6MB 3EJKA 2UYBA 2KA3A 1EPWA 4FPCA 1CAXA 4V1PA 2JG8B 1Q8PA 2GN3A 4XF3A 4MVTA 3ZN6B 3VBHA 2SLIA 2D40A 1N3PA 2RR13 4BOWA 1IPKA 2D6NA 1O3QA 3KM5A 4Z8BA 4K6BA 1FAYA 2ZGKA 3HN1A 1XQNA 2D5HA 3X29B 1OPOA 2VGDA 4KU8A 3JBG3 4IETA 1DQ5A 4CDQA 4L8QA 2IXHA 1QWRA 4DINB 4IQPA 2VXRA 1HQWA 3H0OA 1CD3G 4L2NA 3AB0A 1ZREA 1BEV1 2VNGA 4Q2FA 2XJQA 4CP1A 2PHXA 5CFDC 4Q26A 4CDUB 4XIKA 4PBOA 4AF9A 1X7NA 5C8WA 4Z92B 3TB0A 2GAUA 1YYNA 4Q4Y2 5FO8B 4XTPA 4OHVA 1PO11 1XE8A 3TN93 4AQSA 4D7SA 4JGZA 1GZCA 3VDDB 3ZFFB 1XU1A 4ATFA 1EV11 4YGDA 3FBMA 1QQP3 1VBC1 2A6XA 4TZDA 5C4WA 1EYBA 4E4SA 4XF0A 4LBJA 3ME2A 4YGBA 5CA6A 5H9QA 4WM8B 1MR5A 4GB31 5IT6A 1O4YA 3VBHC 2BNOA 4M01A 2HWF3 4L99A 2RS12 1OI6A 2R072 1YI7A 4MXVA 4XXPA 1G9BA 1WGPA 4YVSA 5DUUA 1IZ3A 3FZ3A 1X8EA 2P37A 2WKKA 3N35A 2R32A 4CDQC 1AR92 4I0AA 5ACA1 1MVEA 2C9AA 2WFF3 4XQWA 4GWNA 1RMU2 3C2UA 5EXOA 1UZYA 1MEC2 5D1IA 1TMF1 4YARA 1G9AA 3O12A 2I45A 3RI9A 3NAPA 5DUXA 4XW3A 1W39A 4FAGA 3WNXA 1ZVFA 5CU1A 4E4ZA 1C5IA 4HVOA 4JGZC 5HBAA 1MACA 1H2LA 4CDWA 4MUVA 3DPRB 2X5IA 1LESA 3WDVA 4AFAA 4DY3A 4IV3B 1QJZA 1C1FA 4P9YA 1PVC3 2PFWA 2HYKA 3FUOA 2WNVA 5C4WC 1QKQA 2PAKA 1DF0A 4LO5B 1GANA 4WZCA 1NG0A 3T1LA 1SEFA 2EXIA 1DGWX 4FO9A 4B7KA 3U10A 1SLLA 5L19A 2P3JA 3J8F1 1U5IA 2WA3A 4YVSC 2XH6A 4PLNA 1QNWA 3E97A 1ULCA 5DZFA 1GLHA 4YFZA 4QHBA 2GNMA 2WS91 5AC93 1RVF3 5E88A 5E89A 2A73B 2Z2SB 3OJBA 4C0HA 4FSJA 1Q8VA 4AQ2A 3WDWA 4YW2A 4BM8A 1PK6B 2P3IA 1POV1 2ZZJA 4WM7A 2B9UA 3BALA 2A3XA 5FOJB 5A32A 3A0KA 1FT9A 1K5MA 1VBB3 1NXD1 2HEVF 3RNSA 3G6JB 2RS51 1UX6A 2MNGA 1IHMA 1VRH3 5FAXA 4AXOA 4HLTA 1YFYA 3BB6A 4CDWC 4QQLA 5GLZA 4Q0PA 3TNPB 4IEWA 2YY1A 3V0BA 2EALA 1H1IA 2D6MA 4Z07A 2BYVE 3ZFEA 2ZTNA 1I5ZA 5FCCA 1UPSA 4NHKA 2JG9B 3O14A 4S2HA 5FLIA 1MS1A 1WMEA 4AI8A 5EFUA 1RUJ1 2XWBB 3NKTA 3OPZA 1C8M2 4IV1B 3WCSA 1ZRRA 1S2KA 2R0HA 1WW5A 1REEA 4HMZA 4EROA 1PZ9A 3MIBA 4LA3A 1ZBE1 2HWB3 1LJ7A 4DS0A 1W6QA 1OD5A 4E4DX 3SCHA 4H14A 3N7MA 2WNUB 5JMCA 3BCWA 2DUOA 3R4UA 4BPZA 1D4M2 5JLVA 3UKNA 4UW3A 4A7KA 2TEPA 2NP0A 3AZZA 1I6XA 4L9BA 5H9SA 5DDJ1 4WM7C 4XBNA 4E2GA 5HI0A 2ARXA 1ZBA3 1IS5A 5GZCA 1K5MC 4PIYA 1LOEA 2XVKA 3I7DA 1EAH1 3WXPA 4AFDA 3H1MA 2VW1A 2ERFA 5H9RA 4AK3A 2XG3A 1GZ9A 1CN1A 4PIXA 4AEDA 4HPKA 2I2SA 2DV9A 4HSJA 4AHYA 1ULEA 1S0FA 2DVBA 3H3UA 1J59A 3WDXA 4Q0UA 1BKZA 3THPA 3ATGA 3SXWA 3RSJA 5FPXA 3EXUA 1PO23 4FXGB 4P9JA 3WP4A 1G8WA 5E16A 1ND3A 1R092 2ZX0A 4JAAA 1HRI3 4WVMA 1HRV3 4IESA 1UMZA 1W6OB 3D0SA 2DWRA 3H50A 4Q29A 1GNZA 1RUC3 3RRDA 1VBA2 1V6OA 1O3RA 1NA1A 1QNYA 2D3RA 3BOWA 4JTOA 4LHNA 4FAHA 2EXHA 1S0CA 1E57A 2C1FA 2RM21 5L7OB 4NR1A 3N7JA 4KBBA 1X50A 1Z78A 1RIRA 3WLUA 1HQNA 1CJDA 3WQ1A 2HWC3 2R1DA 1RUG3 4ISQA 4TLFA 2CGPA 4XF1A 2IC1A 2Q1MA 3GYDA 1QMJA 5JSRA 3VBSB 1QXPA 4YZ2A 1BBT2 2OZ6A 2PA7A 3ILNA 3ZIWA 1O5UA 4AEDC 4EN6B 2BNMA 4I2OA 4GMP0 4TWTA 1V6JA 4AQTA 3ACLA 2EA7A 2P17A 4YFWA 5GLVA 3CJIB 3ASIA 4NN0A 1M4WA 3AMQA 1ND3C 1JUHA 2RS32 2UURA 3AYDA 1YI9A 3DL3A 2WFPA 3AKPA 3MYXA 1DQ1A 5EV7A 3DPRC 1LRHA 3L9JT 3WQ7A 5AFBA 2ZKLA 4MXWB 2ZGMA 5J37A 5GM0A 3ST7A 3RYPA 1PNFA 3DN7A 4M3CB 1I1EA 1JYIA 4AHZA 3AYAA 4FTSA 1ZZ6A 1V6NA 3HWJA 5DUVA 2A71A 1VAKA 2WQZC 2BWAA 4M3CF 3AP6A 2KXLA 2E9QA 4AVSA 2CY6A 3VHRA 3C3VA 3RMXA