3RDIA

Domain-domain flexibility leads to allostery within the camp receptor protein (crp)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILFYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Domain-Domain Flexibility Leads to Allostery within the Cam Receptor Protein (Crp)
rcsb
source organism Escherichia coli
molecule tags Transcription regulator
molecule keywords Catabolite gene activator
total genus 62
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rdiA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3rdiA01
3I53A 4YFNF 3QP5A 3FX3A 2IXCA 4UBHA 3KEQA 2A6HF 4A2UA 3RTRA 3NRVA 2DI3A 4XFFA 4H0EA 5FLXK 3BJ6A 3KEOA 2QQAA 2ISYA 2O6GE 5BPXA 5CVUA 1ZZ9A 2JTVA 2GAUA 2PFWA 4HV6A 2Z3YA 1LR5A 3CF6E 4B8XA 1T39A 4UV8A 1S6LA 4RB1A 3G73A 4ESBA 5J7MA 1ZVFA 2Z33A 4QGMA 2HKXA 3RYPA 1KGSA 4XFHA 4LLOA 1QGPA 4RAYA 4YRDA 4WCGA 4QXKA 1SMTA 2FSWA 5CYVA 3MQ0A 1EY2A 5CADA 2XIGA 5D5XB 1SFEA 5TRDA 1LRHA 5D8KB 4LEJA 1RNLA 3WTWC 2R7DA 2VC0A 4M71A 3GX4X 1BN5A 2EFQA 3FXQA 1YLLA 4L0YB 4HF0A 2H27A 3CLOA 3IL2A 1IAWA 1ZAOA 2X4HA 3IKVA 1QY4A 3QOPA 2HGCA 4CICA 3D0JA 1B59A 3ECOA 5L3FA 3F23A 2STWA 5LHIA 2CWEA 2IXKA 4UUVA 5E1WA 4A0YA 4A6DA 1ULYA 3R0AA 5HVQC 1CAVB 5I8TA 1JE8A 3FM5A 2EJRA 4OIRF 1Y9QA 2MH2A 3KZYA 1EPZA 3MZYA 4MQVA 6PAXA 4M73A 1IN7A 4XSZF 3JSPA 2PN6A 4A5NA 2DPUA 4U88A 3EO6A 5I0UA 3UKVA 2LDUA 1FX7A 1FP1D 2GXGA 3GUDA 2LF7A 1BI2A 2IXIA 1RIOH 4ZZDA 2H94A 1F4KA 2V6CA 5A2QZ 2OD5A 2PBIA 3ZDSA 5FFXA 1XSDA 3BP8A 2KKOA 4ZZLA 1LVAA 2E9QA 3I59A 1YFUA 4YFKF 3KGZA 1ON2A 1FYMA 4I7HA 1VJ2A 2CAUA 2V1XA 2V9VA 3S0MA 4A0ZA 2MLGA 2KXLA 4MEYF 3DFGA 3H7YA 1V3FA 3FHIB 4EMSA 4JV4A 1STZA 2O1QA 2X0LA 3TO9A 4WXDA 1KA8A 3M70A 5CJ9A 1G6NA 5JFRA 1R5GA 2FQPA 3DKWA 3F22A 1XCVA 4IVNA 3ST7A 2GA2A 3WW1A 2QDRA 4OMYA 4TV7A 4MQ9F 5J6XA 3FFQA 1TW2A 4KU7A 3J81K 4LK0F 2A5YB 4MNUA 1FT9A 5D6FA 2V79A 3K69A 2HQRA 1JGSA 3IHUA 1XDSA 5I0TA 4LUKA 1BIAA 4KWLA 1F1ZA 2RV8A 4Q48A 2UZKA 2MPFA 4HSLA 5E16A 4ZU4A 2HFHA 1DGRA 3WTTC 1U3EM 4WXHA 3NQOA 2NRAC 1DUXC 4KWJA 4KICA 1O5UA 4IEXA 4UVBA 1JXSA 4IETA 1T38A 1J3QA 1Z1DA 5D5VB 1SAXA 1GXPA 2TDXA 3V4GA 1I6XA 2VT2A 1O3RA 1Z05A 1X7NA 1KQ0A 1R1TA 1J1LA 4P9UA 1Q43A 4X6QB 4RGXA 4HQEA 3REOA 5FPXA 1B4AA 4Q0UA 2QZ8A 1RUOA 5KHGA 2XRNA 2XUBA 3LAPA 3IC7A 3WW4A 2OA4A 2NNYA 3H7JA 5CU1A 4EWDA 2Q1ZB 4CDGA 1ON1A 1S7OA 4LFUA 2XAJA 5HLIA 1U8RA 4LA2A 4TLFA 5I8SA 3U0ZA 4EJVA 3FM3A 4HX7A 2J5PA 3RYRA 4XF3A 3BOQA 4KYWA 4FAHA 3IRRA 2XKOA 1CAUB 2R3SA 1ZRFA 1P92A 3KP6A 3RI4A 2FU4A 2P6SA 3WTZA 4UXNA 1DDNA 2PTMA 2DQRA 5J3UA 2RQPA 5BPDA 3LSTA 3E97A 5BXXA 3SHFA 4XLNF 4ENJA 1E2XA 4HW0A 2YX7A 4ENMA 5D4SA 3ELNA 5L3BA 2CAVA 1NXMA 4E2SA 3M8FA 2B5HA 4KDPA 4GULA 2W25A 1EH8A 4LB5A 1CAWA 2C0ZA 3ROUA 1W4MA 3WGGA 4KMFA 2BNOA 1QQIA 1RUNA 4JBAA 4M6XA 2Z69A 2GA1A 4R1HA 3T1BA 1UD1A 1HSJA 4G94A 3BZ6A 5HI0A 1JHFA 2O8QA 1U5TA 3BPVA 3H50A 4QMAA 4MTEA 1U5TC 1NE6A 5KVRA 3LOIA 3U2RA 1RL3A 4RS8A 4YFXF 3BJAA 1SD4A 3EYIA 4G6QA 1ZZ8A 4OMZA 3LA7A 2ELHA 4GO1A 4OIPF 5DCMB 3WTVC 3GFMA 4R8HA 3KZZA 2QBYA 4EVIA 4WVZA 3OTFA 5JSOA 1XE8A 1I5ZA 4AVAA 5HS9A 2DTRA 1TNSA 1QNTA 3QRFF 2A3SA 3QU3A 2P4WA 2P7CB 3LWFA 5HDKA 3BB6A 1T2KA 4P5OA 1P6RA 3F8FA 2RNJA 3HRTA 5LEKA 1Z6RA 5FLJA 5HLHA 2PG4A 4HX4A 3EJKA 4EJTA 2OA2A 1X82A 5E8IA 2A6EF 5AIQA 1SFNA 1YUDA 5JVTA 4IHTA 3BPXA 4IHSA 3PNAA 2JRTA 2ZBKA 5DEQA 3J80Z 3IKTA 3D82A 1XE7A 3LAGA 2GC0A 4BHBA 1ZARA 4MGRA 4WZCA 1R58A 2A68F 1U78A 1ZZ7A 2LKPA 1KU3A 2VBZA 3JSOA 2FMLA 3QACA 4ZYEA 2H09A 4PIYA 2DK8A 5FD6A 5CLSA 1CAXA 3J81Z 2DCTA 4HZFA 1FSEA 1S7AA 2W85A 3U10A 1OMIA 4IEUA 4I0BA 3KP2A 5D6EA 1D3YA 3E5UA 1CX4A 2CO5A 3BALA 1J9IA 2V1UA 5L3GA 2O61A 5FQ0B 1XGMA 3ECHA 3DN7A 4HLTA 4L9VA 3FZ3A 3IRQA 3HUGA 4U7BA 4FX0A 5DD8A 5KHHA 3ELKA 1ONVA 2W84A 1IPJA 2E1NA 4S05A 2HKOA 2HS5A 2IVMA 4G7HF 3B02A 2IC1A 4E2GA 1OR7A 1WRJA 5E8GA 1AWCA 2IPQX 1DPRA 1TBXA 2IJLA 2IXJA 5FDBA 2QYOA 2VXZA 1UPIA 3WGIA 5I0SA 3L2CA 4OFGA 3GEZA 4BNCA 1LDJA 3F72A 2XKPA 1K6OA 5JR7B 3GYDA 1FBSA 2XAGA 5LGTA 2WWYA 2PQQA 4N9IA 4J1XA 4L0ZB 1LEBA 2OQGA 1YFXA 4MGIE 2L3DA 3MCZA 5ICFA 4MGZE 2R7FA 4JTNA 3E6BA 5KK1A 4CGZA 4HN0A 4A6EA 2H6CA 2W57A 4RB0A 4XLPF 3EETA 3U1DA 5K5OA 1SD5A 4IF4A 3CUQA 5HLGA 3UKTA 1QWRA 3HT2A 4UVAA 2XROA 4QM9A 3FXRA 5BUVA 1L0OC 2VOOA 1XGNA 5H6QA 2HR3A 4LA3A 3V8LA 5D5WB 5KHKA 4LD5A 4D0PA 4AIJA 1PM7A 4KU8A 3KLOA 3TOAA 2D93A 3FF5A 1EV7A 3CO2A 2EAAA 1SFXA 4AXOA 2L54A 2EV6A 1TQIA 5E1RA 2RDPA 3WODF 4AVCA 1QBJA 1UW8A 3RPUA 5DDGA 2IT0A 1JUHA 2IA0A 4DNCA 5K5QA 2VOPA 4O5VA 1TQ5A 2H0VA 2EVXA 5FB2A 5CVJA 1BC8C 2CFXA 4P55A 1L3LA 4B29A 4IESA 1VP6A 2MBFA 4KNYA 3C18A 2STTA 1UIJA 1G4DA 3QP6A 4AQ2A 1H0MA 1ZZBA 1H1IA 2P7VB 2OZUA 3T0YA 3C1DA 4ASNA 3W6JB 2FQ3A 4CZZA 2M87A 2QWWA 2XL7A 5BPIA 2O0YA 2OU2A 5ILUA 2EK5A 4HOBA 1J75A 5FQ0A 2WFPA 1UFMA 1REPC 3TDZC 4UNOA 1EH6A 4DINB 4R52A 3ACLA 3WW2A 4KIFA 4L11A 5F64A 2IA1A 1MDMA 5KHJA 1U5TB 2Z99A 1S29A 1ZN2A 2AS5F 5IT3A 4UXAA 2PFBA 2FXAA 2RC4A 2WC2A 2M8EA 1IZ1A 2C6YA 2GIVA 3LWCA 1V4RA 2BNNA 2VECA 1D8KA 4UVCA 5HS8A 3CO6C 4Q47A 1RI7A 2YX4A 1CAXB 3VEPA 1ZLJA 4MH0E 3LA2A 4LK1F 2A69F 5L3CA 1FYKA 4WWCA 1DP7P 2HYFA 1K78B 3NL1A 5F6FA 4EJUA 1Z91A 2MNGA 4EV0A 4HX8A 3CUQC 5DD4A 3ZMDA 4IPAA 3FZVA 2RGVA 4QWQA 2FBKA 2LNBA 1BI3A 3I58A 3QU6A 1YHFA 2FRHA 2FF4A 1FYLA 3O3KA 1XGOA 4K8FA 2JPBA 3GBFA 1YFWA 2Q0OA 4KN4X 4BAYA 4XF1A 3VHRA 1YW7A 2G7HA 3JZVA 3L7WA 1PDNC 1RTVA 5D4RA 2PJPA 2VBXA 2OZJA 2P6TA 1NZCA 2M30A 2Y0MA 1OI6A 4KL1A 4QLCU 1ZHFA 1P4AA 2BGCA 5F1RA 2D1VA 1O4TA 3T5XA 1TQMA 1R5HA 3FJSA 1RC6A 1FC3A 3WU0A 2BE5F 2MC3A 1USTA 2VC1A 4ETSA 4XFAA 3IDBB 2P8TA 4HN1A 1Q1HA 4NQWA 2ESHA 4HVQA 3C3VA 1WKMA 2HJIA 5JHUA 1NYWA 4L2NA 3H1MA 3TNQA 1YFYA 3IBMA 2CW0F 2ZXJA 2GC2A 2XV4S 1MJAA 3L2HA 1G3YA 4HF2A 4CYDA 3GFJA 2VT3A 4ORFA 2P17A 2PHDA 4IEQA 1NE4A 4D7SA 3K9TA 2A07F 1X3UA 1XMKA 3V8JA 4LGWA 4X6RB 4ZYHA 2EA2A 4KMUX 4XFIA 2XL9A 3JAMZ 4O3MA 2F5FA 3F8BA 2FBIA 4EQQA 1R22A 1MDMB 2ZNZA 2ZCWA 1LNWA 2QVOA 4QM8A 3MFKA 3Q5FA 2Q0AA 3RPQA 4P9FA 1DZTA 1ZYRF 4YYOA 3E6CC 4XF9A 2KRFA 2CYYA 3H8UA 3HT1A 4META 2Y48A 5BQTA 2ETEA 1ZNPA 2K86A 1IN5A 3ZMSA 1J3RA 4HVRA 4JK1X 3M8EA 5JCTA 2M1BA 1U2WA 3JTHA 3I59B 4XETA 3DV8A 3FMSA 4EGZA 2K9ZA 1TNTA 2QJVA 1XSXA 3SXWA 2QQBA 1QZZA 3M9AA 4LB6B 1SD7A 5FPZA 4Q0SA 1ZH5A 4EJOA 3WGHA 4L18B 2KJBA 2OBPA 2PMUA 5JR3A 2UY8A 4M72A 2EV0A 5K5RA 4RAZA 3L00A 5C8WA 1HKTA 2QENA 3BDDA 3E5QA 2QM3A 4A0XA 5FCCA 1W5TA 3RKWA 5L3EA 2XGXA 4FX4A 1FXZA 3CDHA 4ESFA 1QXJA 1XDUA 3WU1B 1UHWA 1IRGA 1K79A 3BCWA 1BI0A 2IRFG 5BS6A 2FOKA 3GXOA 4LTAA 5AIPA 2G7UA 4I0AA 4CHUA 4L9NA 4IRIA 3H3UA 1LDKB 5I91A 1SD6A 2DBBA 5AONA 2ESNA 4B09A 1YFHA 2DU9A 3O2PE 3V7CA 1SEFA 1YO5C 3KFWX 5FFZA 3H9AA 4OIOF 2DFIA 5ICEA 4BH9A 3F8NA 4GGGA 3FWEA 3ETQA 2FA5A 2QCSB 1HW2A 3FHZA 4L5JA 3I64A 3E5XA 1SQ4A 4Y15A 5CVIA 3KETA 2GWRA 4RD7A 5CVVA 3CUQB 2PHLA 3CJXA 4N9HA 3O14A 3J7AO 1I1GA 1YW9A 2YSRA 3TGNA 3EYYA 1O3QA 5LGNA 2CV6A 2Q4SA 3SCGA 1IXRC 3HHGA 5KHIA 3K1MA 2ZKZA 5K8SA 4HAMA 3RYKA 3T8RA 2EFPA 2KJCA 3R6SA 3HYIA 2VBYA 3R4KA 1GQHA 2NYXA 1G3TA 1R1UA 1AOYA 3NVCA 1XB4A 1RZ4A 1GVJA 4YARA 2DK5A 3V7SA 1O7LA 4ZU5A 1QPMA 1P4XA 2QQ9A 2ZO4A 3RIRA 3LFKA 4I98B 1J59A 5EEHA 1TTYA 1FPQA 3OF1A 2MA3A 1U12A 2J5OA 1WWXA 4PCQA 3BJOA 1T6SA 2GQQA 2HYGD 1LDDA 2HEOA 2MHFA 1MJBA 5LGUA 1YLFA 3OCPA 3JAMK 3SXYA 2CG4A 4EJWA 2FNPA 4BHCA 3SCHA 3SFZA 4MGYE 4HBLA 3V8KA 2K4JA 3VB2A 5CVRA 1W7PB 3GW2A 4OOIA 4WX9A 3F8CA 1WA4A 4F8AA 2P5VA 2D40A 4F7ZA 3ZPLA 2A61A 4HV5A 5JSPA 3K2ZA 1K7AA 3I5UA 5KBFA 1VR3A 3IIAA 1OPCA 3ZMTA 1KU9A 1R36A 1ZZ6A 3NW4A 4BYYA 2FNAA 1UCXA 5H20A 4KFCA 2ACJA 1O57A 3FMRA 3EDPA 1IN4A 2F2EA 4UHTA 5DYMA 1HBXG 3OV8A 3D0SA 5HOOA 1ZGAA 4LLGF 3P9IA 4LMYA 5LLQA 1R23A 3PFIA 1X8MA 3SHRA 2HQNA 4Q5SF 4YNIA 3RKXA 4MZUA 4EWAA 3PVBB 2CQKA 2B0LA 1YTYA 4ENNA 2DO7A 4IRHA 1J3PA 3MPBA 3DPLC 2HTSA 1ZX5A 4IERA 2LF8A 3VODA 4BIFA 5EFUA 4LULA 4HLYA 1ZRDA 2XHKA 1V70A 1XD7A 3ULQB 2IXHA 4UV9A 2H6BA 3DF8A 4EWEA 4H7LA 5A2QK 5J48A 4KUMA 3AAFA 2I45A 5DCMA 2M45A 1ZGJA 2PMHA 2YU3A 4Z2YA 4MEXF 2K02A 3SZPA 3L9FA 4IEWA 2UY9A 5FLHA 2ZFWA 1KQ9A 2NS0A 1S3JA 3IWFA 4FAGA 3MEXA 2VN2A 4Y17A 3TO7A 3TKYA 2D1HA 3T8TA 3GLXA 3ZN1A 1TQPA 2VODA 4HVOA 2GC1A 1H9GA 4AD9A 3P7NA 2PAEA 1FWZA 5I0RA 1B9MA 3TDUC 3ZMVA 4HLXA 2K0GA 2O8XA 4U7DA 3ISPA 3K1PA 4R79A 4I02A 4L9JA 1KQ8A 1XRUA 3HRSA 3DL3A 1FP2A 2UYBA 4MUVA 2QBYB 1R00A 1Z7UA 3BPZA 4GCVA 2KIFA 4IRGA 2GH2A 4Q4ZF 2Z5UA 2N7GA 2OZ6A 4N0BA 1BC7C 1A04A 5K1YA 5E20A 1IW7F 3DP7A 5BOXA 5DUKA 3USSA 3PQKA 2GZWA 3M3IA 3SZTA 3RZZA 4G9YA 1FBUA 4JQFA 5C6CA 2PAKA 1OYWA 2D2WA 1ZZCA 3KLNA 1CAVA 3G7DA 1WI9A 3TO6A 5LHGA 3Q9VA 2QNKA 2F5EA 3I0TA 2BYVE 2YPRA 2LSOA 3RNSA 1OYIA 4OLLA 1P4WA 1TLHB 1I1SA 1HXDA 2M5WA 2PEXA 2F5DA 4Z82A 4G8XA 3KP7A 4U0VA 1IPKA 2DT5A 3KGLA 3FXUA 2MLKA 3I4PA 4XFBA 4MV2A 3GZ5A 4CXFA 1D5VA 3DEUA 5LRRA 3FE5A 3LA3A 1CAUA 1GHCA 4IEPA 3COAC 4EM2A 3K0LA 4MX3A 2HTJA 5JAXA 3W6KB 3EBRA 1RGSA 4Q0VA 1OFNA 4BXUA 5J8FA 4PDKA 2L4MA 2COMA 2XASA 1VTNC 1CF7B 2PA7A 2F5CA 3ABUA 1H9TA 3Q9SA 4M74A 5BY5A 2L02A 5BMZA 1CGPA 2Y75A 1UIKA 4GXOA 1D8JA 3N4MA 4J1WA 5TJJA 1YWKA 3GYHX 4G6DA 5LHHA 1ZG3A 3WE2A 4XRFA 2VBWA 3VFZA 5HDGA 3O6BB 4EM1A 2FBHA 4Q0QA 4OU0A 3ZP5A 1Z6TA 1FY7A 4PGGA 3WTUC 2EFWA 1BJAA 3OOPA 1Y3TA 2ZMEA 3NJZA 2DLLA 2RVCA 1B9NA 4EROA 3IDCB 3F6VA 4FHTA 3K1NA 1USSA 2ET1A 3ML6A 4AIKA 1LQ1A 1FBQA 4IEZA 3I71A 2Z2SB 1O7FA 1TW3A 3PLQA 3VOEA 1CF7A 5I93A 4LLLA 2RN7A 1YYVA 5ERIA 5E18F 3N97A 3NEUA 4PJYA 1BI1A 3ERED 3P9CA 3HOTA 4HBNA 4U0WA 2UYAA 1PMIA 4YIIA 5ILSA 2ET7A 2HWVA 1YQAA 5FLXZ 2XAHA 3KP3A 3MWMA 1PP7U 3HTSB 1YS6A 5LEJA 4FBFA 1B1BA 4A5MA 2VQAA 3SMHA 4M9SA 2F4PA 1MGTA 1ZLKA 3BWGA 1OD5A 4MGKE 1EP0A 2VPVA 2QUFA 2ATFA 4PIXA 4MTDA 4QX5A 3D5LA 1XSVA 3LAJA 4E2QA 2MH9A 2EFNA 3MAJA 3SQNA 2B9UA 4XFCA 5L3DA 3JW4A 1IF1A 5DUIA 4ESJA 3TQNA 2KIUA 5FO5A 4OINF 1EYBA 5HDNA 4KA4A 3CEWA 1MKMA 4LLNA 3SCFA 2W24A 5FD5A 4ONUA 4A12A 4XBFA 1DZRA 4O9EA 3S7IA 3QPTA 1SMYF 1PUEE 3NSTA 2BEOA 3LQQA 1LEAA 1J7KA 3WTXC 3G3ZA 3ES4A 3ZMUA 1ZREA 4ZYGA 2MD5A 4AVPA 2EV5A 2P5LC 5D5UB 1UCRA 3GF2A 1ZRRA 4Q29A 1IUYA 3HSEA 5LBQA 1C0WA 1Q5OA 4I3PA 2ADUA 1WSUA 1FLIA 5DV5A 2ZNYA 4QGLA 1FI2A 1SFUA 1QXRA 3H1WA 4LUMA 4NHJA 1Y0UA 4M9ZA 5BV6A 1G3WA 2CGPA 2Q2EA 3HRMA 2BNMA 2FEZA 1DGWA 1GQGA 2IA2A 3HOSA 3WG9A 2K4BA 5DCFA 5I8YA 2JSCA 3HIFA 4WXCA 1YS7A 2GC3A 3CL1A 2L01A 2XAFA 3FMQA 4KIBA 4KN7X 2UWMA 4EGYA 1MD0A 4M9XA 1YIOA 3H3ZA 4HSJA 4IEOA 1ODDA 5ICCA 2GU9A 4I2OA 1ZRCA 4PZJA 5IT9K 3M7GA 1Z9CA 2XLAA 1HKSA 4K2EA 3BY6A 1J0RA 1F9NA 1OKRA 1MJ9A 3I54A 2ZMEB 1YG2A 2HZTA 4KWKA 4JVAA 4GYIA 1NHAA 4KT5C 1S8NA 3IWZA 3QAHA 3H1YA 2KIMA 2HDCA 2DQLA 2Y0OA 4ZYDA 3BROA 4P9GA 2XVCA 4G7ZF 1LJ9A 2O3FA 2YR2A 5IT9Z 4I01A 3E6DA 4XF0A 2XLFA 3ZN0A 3DXJF 1FNNA 3GFIA 1HW5A 3HHHA 2QVSB 1JHHA 2Q30A 4Q0PA 2ISZA 1L3JA 1W7PA 5FGMA 2UXXA 3CO7C 3BU7A 4LG0A 3HTUA 3I7DA 3V7RA 4IEVA 2V09A 2BV6A 4ENKA 2E7XA 2IW5A 3WE3A 3ABTA 3J80K 3KP4A 4LG0B 4I09A 3RJPA 4HA8A 2Z9OA 2OQRA 3RKYA 4OIQF 4Y13A 3NKTA 4BHPA 3R0JA 4AVBA 4IEYA 3ZQ7A 5E1ZB 4G7OF 1HQCA 5ED4A 4AQ6A 5EZWA 5FLIA 3R60A 2FMYA 4XSXF 2ZJ2A 2EWNA 1FZPB 2L4AA 1IN6A 2GXBA 1PP8F 2HOEA 2WV0A 2OPKA 1IN8A 1P2FA 4RGSA 2AXLA 1IXCA 3EHKA 4HMZA 3S7EA 2EA4A 2EB7A 2PLYA 3QPHA 1O3SA 2ZKLA 3LQRA 1U6GA 3GVAA 3DPTA 5H6RA 3P9KA 4ZH4F 2XLGA 3HRUA 1HW1A 5J8CA 2ETHA 4L5IA 2V1DA 1B6AA 1CAWB 4AIHA 3KMHA 3JTGA 2O03A 1DPUA 3GWZA 3KP5A 3CLPA 4M6YA 2IXLA 2K7LA 3E6MA 1LKNA 1IXSB 4RB3C 3U11A 3C7JA 3GO5A 4PIZA 1BBYA 5ICGA 4DQ2A 1T98A 3MYXA 5AVPA 4XF4A 1O5LA 3GZ6A 3EQEA 5LRSA 5E17F 2PYTA 2OYZA 4WF2A 3U9GA 2E7WA 4YIFA 2PAMA 2QLZA 4BQAA 4ON0A 2G9WA 4ZU7A 1Q3EA 1BOAA 1W5SA 3ES1A 4JTOA 1J58A 1WQ2A 3WTYC 2PI0A 3B73A 4MHGA 3TNPB 3S2WA 4O9GA 1FSHA 4NB5A 3DQVC 4CO8A 3UKNA 4XEZA 3CJNA 4Z07A 4FT8A 4O6JA 4QGNA 1WGPA 4YSFA 1YW8A 5JI6A 3GFLA 1R1VA 1E17A 3WW3A 2WTEA 4HQMA 4WBBA 1G3SA 4RGRA 4E70A 2XAQA 1EH7A 5E1XA 1BIBA 4IXAA 4IJAA 1XN7A 1W7PD 2JPCA 2NAZA 3KCCA 4LJZF 3WTSC 1R7JA 3CUOA 3HSRA 3H92A 2D5FA 1X8EA 1QO0D 4KIGA 1H1MA 4L9TA 5D1IA 2VE9A 1IRFA 1LB2A 4U0YA 1KU2A 4S04A 1WLTA 3TOBA 2EFOA 4UBGA 3KSCA 2JZYA 4HDUA 2DW4A 2FE3A 3EUHA 4P96A 2CSOA 1KYWA 3F8MA 3R61A 3C3WA 5ILVA 3PQJA 1F5TA 2RKHA 2D45A 2VE8A 4RGUA 1I27A 3MDPA 2JT1A 3OGJA 2Q8KA 1GXQA 2K27A 1J5YA 5D8LB 4EM0B 4HYEA 3EQLF 2PQ8A 1XCBA 1T0FA 1MZBA 2IP2A 3OD0A 4PGHA 3HQXA 1O3TA 1ZG1A 2DPDA 4YG2F 2VONA 2E1CA 4D7TA 2BBYA 2DAOA 4HF1A 2D5HA 2UXNA 4AWXB 4GYGA 4HDVA 1J2XA 4NVPA 1OYYA 3F3XA 1XMAA 1HKQA 1HSTA 3RDIA 3F21A 1QZYA 3KE2A 4XFGA 3LZZA 2P5KA 3MZHA 1ZG5A 4RB2C 1KYZA 1K78A 3HSFA 1UB9A 3E3VA 3ZMZA 1UHMA 5T3NA 3CTAA 3F6OA 5JSRA 3M1EA 2NNNA 2OAZA 5HS7A 1FOKA 2EA7A 3L09A 2B8MA 5EEGA 4WK8F 1XGSA 1KU7A 1BM9A
chains in the Genus database with same CATH superfamily
1VBA3 4OAYA 4UBHA 2WSUA 2ISYA 4IL6C 5BPXA 4D5FA 4EATA 1MNMC 3DXUA 3VYSB 4B1LA 3MLJA 1LR5A 2Z3YA 4WM8C 3SKJE 1XSRA 2ZACA 4UV8A 1S6LA 3LEGA 2Z33A 4QGMA 2HKXA 3RYPA 1W8OA 1IUFA 3TN91 4LLOA 2HQ5A 4RAYA 4YRDA 2XJSA 4WCGA 2FSWA 5CYVA 2Y6JA 4AI8A 1SFEA 1LRHA 1ZBA1 1V5GA 5FYVA 2DVGA 1WWYA 1AR73 2VTXA 4M71A 3GX4X 3W2VA 3EUKL 3VBHA 2LS6A 2X6WA 1AR81 4HF0A 4SLIA 3VDCA 3IL2A 1ZAOA 3DGTA 5DTDA 2X4HA 3IKVA 1QY4A 3QOPA 2VVEA 4X1EA 4CICA 1ZTRA 2VR4A 2Y6GA 3OS1A 5L3FA 1UOBA 3DYPA 3CDZB 1CQTA 3B5LB 4DYCA 2XPJA 2FUG2 1O4ZA 2OUHA 2D3RA 1CAVB 1NCRC 4AQTA 5I8TA 5CPRB 2JVGA 4NOTA 3KPHA 4CP1A 4MIMA 3JBG2 2VJXA 2AENA 2QF7A 4M73A 3I4MJ 1GNYA 2DPUA 2E51A 2HWC1 2AACA 4FTEA 2X05A 1XYNA 1REFA 3WF2A 4XK4A 1BI2A 1WJDA 5E3NA 1RIOH 4ZZDA 2H94A 2NQYA 2V6CA 3QH7A 5A2QZ 2DFHA 3GM8A 2ZA9A 3TP0A 2PBIA 4FP2A 1OD3A 1MBGA 2R073 1I1EA 3POJA 4ZZLA 1BKZA 3HM5A 1DQ1A 2XVKA 4C2MJ 1YFUA 4DUVA 5B4NA 4JYKA 3CJTB 2VCAA 1FYMA 4A0ZA 3ZN6A 4MEYF 5IFTA 3MW2A 5A1LA 2RV9A 3K6GA 4PBPA 1STZA 4Y5TA 2A6TA 2X0LA 3EPZA 1AL21 3O7OA 3M70A 5CJ9A 1G6NA 4MXWB 4NN0A 5LBCA 3DKWA 4PDWB 1XCVA 3M3OA 3OYFA 4XILA 4F83A 5H9SA 4BQWA 3ONQA 1W03A 3WW1A 5HNHA 2YFUA 1C8M2 1W8WA 4MQ9F 5IYYA 3FFQA 1TW2A 3ZXSA 2ZAAA 5FJ8J 3J81K 2GIZA 3CJQB 4OHYA 5J4YA 3DU6A 4LUKA 1F1ZA 1W0UA 3C7EA 2RV8A 3VSLA 1TMF3 4RM2A 4Q48A 2ZXQA 3KV4A 1VAKA 3CP2A 2HFHA 1ITYA 3CZUA 4WXHA 3ZN6B 4KBBA 2WO2A 1KITA 2DA3A 2EZIA 4KICA 1BXHA 4UVBA 4DMIA 1J3QA 2LY9A 2VT2A 1RUC1 4IUGA 2WNUA 5FPXA 1B4AA 4Q0UA 1QA6A 3ACHA 3THPA 3IC7A 3WW4A 1EAH2 3SQOA 1Z0XA 3FXOA 1BBT3 2OA4A 2NNYA 5CU1A 1B35A 4EWDA 2W92A 1U8RA 4FVVA 2XAJA 4TLFA 1ZR2A 4EJVA 4HX7A 1GP4A 2Y6KA 4UW5A 1TWHJ 5ANQA 4Y7NJ 3RYRA 4XF3A 3MFAA 2BGOA 3IB3A 1AKHB 2QTWB 2ZX4A 4FAHA 5GZGA 5LASA 1QJZA 3ZXJA 1CAUB 1UY2A 3S30A 1P92A 4DS0A 2E5ZA 3RI4A 2P6SA 2KDOA 1N3QA 5J3UA 2FD8A 1LKXA 3E97A 4LK6A 5BXXA 1DLCA 4XLNF 3W21A 1E2XA 3LE0A 3ZSMA 3CLQA 4OHXA 1NXMA 2B5HA 4DYRA 4CDXB 1OF4A 2R1DA 4EE2A 4ITVA 4IKFA 2OX0A 3WGGA 1I3AA 3W3CA 4KMFA 4ZZ8A 1QQIA 1I3QJ 1JI6A 1AA7A 5JIUA 3HZJA 2GA1A 4R1HA 5GLTA 4JGYA 1FPN2 1AYM1 2F4LA 4HG2A 2BZTA 1JHFA 3T2QA 2CY6A 2IBDA 1D4M2 4QMAA 5C3RA 5AC93 1NE6A 5C8CA 4KGQA 3BJAA 4NDLA 4NPMA 1XS9A 4Q8KA 3WDWA 4IL7A 3LA7A 2ELHA 2WRAA 4GO1A 4CDQB 1RINA 4BE1A 4R8HA 5FP9A 1LAJA 1AR91 4IO9F 1S2KA 4XLEA 4YIRX 1Q1VA 3MFCA 1GZ9A 1XE8A 4EN9B 1SACA 5JSOA 1I5ZA 2PELA 3I3QA 3CDIA 3Q8AA 1KDKA 2EAKA 1LNSA 4YW2A 4Y22A 2I2SA 1UOGA 2P7CB 3LWFA 3D5OA 2MW8A 1ETOA 1D0HA 3GALA 4FCAA 2W94A 1P6RA 2EIBA 3F8FA 1ZA7A 3HRTA 1R6RA 5HLHA 1UMZA 5JPNB 1B8IB 3GTPJ 5EYXA 4QSHA 1QJX3 1X82A 3OJBA 2W47A 5AIQA 1N77A 5FY7A 1QJY3 4NC6A 4DGWB 3PNAA 2JRTA 1UYXA 5DEQA 2M4KA 1W0PA 5FO9B 1MMDA 3NJYA 2NMNA 4NIHA 1XE7A 4BHBA 1ZARA 2EF6A 1R58A 2A68F 4OHVA 2LKPA 4A42A 1KS5A 5FD6A 4DZPA 3VZLA 1RB8G 3DLLF 3LPFA 1RUE3 1UYYA 1FSEA 1U5YA 1ZBE2 4IEUA 4I0BA 3T4VA 2Y8KA 1L7QA 3QODA 3E5UA 1CX4A 3BALA 5LY1A 3VHOA 1HOMA 5CKMA 1XGMA 3WNLA 3ECHA 3FL7A 3DN7A 4L9VA 4XCAA 2H1LA 5A3OA 2WUHA 3QYFA 4U7BA 2X29A 3R0RA 5DD8A 4DNYA 2UUZA 3HNBM 3VYTB 4S05A 2DBIA 3IAPA 1W6OB 4E2GA 5M5WJ 5E8GA 1UXXX 1VRH2 1DPRA 4IQJA 3H3LA 2IJLA 2ZX3A 1I9RA 5J1YA 5FDBA 5H9QA 2QYOA 1YJWI 3L2CA 4BNCA 1DQ6A 3D8CA 4GMP1 3NNGA 1BW5A 1JZ8A 3GYDA 1CJPA 1O6UA 4TXWA 5B66C 2WWYA 1PMHX 4K40A 2VJ4A 4L0ZB 1LEBA 3GLLA 3CD6I 2P3JA 1OCCH 2L3DA 3MCZA 4JTNA 3J4UH 5KK1A 3WNXA 3L2VA 5CKTA 4HN0A 4A6EA 2IFRA 4RB0A 4HG6B 5CFCA 3U1DA 3KT4A 5LY2A 1IQAA 4V1PA 3LB9A 3CUQA 2BVVA 2DFCA 4AL9A 1MZ6A 4J6GA 1ETVA 3VDDA 4QM9A 4CDUC 1TZOA 1L0OC 2JB8A 5A7PA 5J96B 4BS9A 2HR3A 2VJ5A 3CQZJ 4LA3A 5KHKA 3QD6A 2HXOA 4AIJA 4KU8A 2DA5A 5LD2C 4ZXKA 2RR13 3C2HA 1B72A 4AM3A 4COUA 2EV6A 1TQIA 2ZGLA 1HN1A 2P3YA 4EN6B 4M3EA 2A7AA 5EPAA 2RS33 4YG3A 3FUOA 4WVVA 3RPUA 1FOD1 2IT0A 4DNCA 5K5QA 1R71A 2XRLA 1RHI1 3OB8A 5CVJA 2WYFA 2CFXA 2JE8A 4QPIA 1ASJ2 1R9TJ 2STTA 1NLQA 2D3PA 1PZ8A 3QP6A 1Y1VJ 2OZUA 3NRUA 4AW7A 3T0YA 3TAYA 2AYHA 3A4UA 4CZZA 3ZFGC 5A7SA 3RQIA 4XJZA 3VSKA 2O0YA 5BPIA 5F6LB 1W8UA 4HOBA 1UAAA 1J75A 2J1UA 1REPC 2ZZJA 4AOCA 4DINB 3MICA 2HLEA 2RS12 2IA1A 3Q0VA 5FY0A 1S29A 5A7WA 5CA6A 4UXAA 2KR2A 1GNHA 2M8EA 3I49A 2TRTA 4ZS3A 1ODNA 2VECA 1RMU1 1D8KA 2RNGA 2VJJA 2WNVC 1CAXB 1LHNA 1UMHA 3WNNA 4MH0E 1OF3A 4IQ4A 4LK1F 5L3CA 1E5IA 4M3BA 1DP7P 3S1QJ 3NL1A 1K78B 1ODMA 2VXRA 1JW6A 4HKLA 1X4OA 2ZJCA 1H9PA 5DD4A 1OCPA 4IPAA 4V19K 4CP9A 2HVQA 1IG3A 1APNA 2RGVA 4QWQA 3L2YA 2LNBA 3POYA 1JKQC 1BI3A 3I58A 3QU6A 1R092 3GXUA 2P3IA 1YHFA 2C9AA 2PLV1 2ERFA 4CRQA 4B4RA 2JPBA 3I2JA 1WVRA 4A3BJ 2D3SA 2LROA 3HEIA 5C5UA 4PBOA 3VL8A 2VGDA 1ZKGA 4A3JJ 5FYYA 4BLJA 3WT3A 1PDNC 3THDA 2FDHA 5D4RA 2PJPA 1GWMA 2JG8B 2VBXA 2OZJA 3FUQA 4JC1A 1H2LA 3OGVA 3AM2A 5E3OA 4P5YA 4QLCU 5JZGB 1P4AA 4N4NB 1SLTA 5CFCB 4E6KG 4JHZA 1LE8A 5HV4A 4IV1B 4JX5A 3T5XA 5ACA2 1R5HA 1UOFA 1RC6A 1FC3A 3O1TA 2AXTC 3APBA 5LA9A 2MC3A 4QX3A 2XJUA 2OVUA 4ETSA 4XFAA 1DP0A 4NQWA 3C3VA 1A31A 3ESWB 1QOSA 5JMCA 4BDYA 1NYWA 4TN7A 1AYN2 3OPZA 1FX5A 1MJAA 2XC7A 5DUWA 3GFJA 4TTGA 2VT3A 4NR1A 4YW1A 1HCRA 2DMQA 2VD7A 4BQQA 1ND2B 3VBHC 2OTLI 5K0UB 1FPN1 3VZMA 4CPBA 5GP9A 3C7OA 1N3OA 4BMEA 2BHZA 3HOZJ 3OR2C 2FBIA 4A3CJ 3NNMA 4EQQA 2QQ8A 4WM7A 2OCEA 2ZCWA 2QVOA 4PJ0C 3JREA 3RPQA 3AYCA 5A3LA 2R7ZJ 2R5YA 3VBUA 4B44A 5GJ6A 4BLIA 3B00A 5BQTA 4AF9A 1Y56A 4K8RB 1J3RA 3ZMSA 4JX6A 1FJLA 3RZLA 1UU6A 1U2WA 1D0XA 2XGEA 2WDBA 3I59B 3E0JB 4DUXA 4EGZA 2BRTA 4QX1A 3HUGB 3UK9A 2QQBA 1W2TA 3M9AA 1X3WB 1GWKA 1XC5A 4QX7A 3WGHA 4PCRA 5GZFA 2KJBA 2ZJRF 2OBPA 2PMUA 4OUSA 1RUC2 2R32A 5HCBA 4XRMA 1PO12 2WLPA 4M72A 1ZBA3 3D6EA 3L00A 1OR7C 1HKTA 5M5YJ 2WJSA 3E5QA 1C5IA 4A0XA 3LD8A 5FCCA 3V0AB 3RKWA 4WVWA 3EUAA 1QXJA 2VOWA 1UHWA 1GV5A 1BI0A 1EPWA 5BS6A 3GXOA 4LTAA 4CDUA 5FZHA 2BDRA 4CHUA 3LSDA 4L9NA 4X8PA 4N53B 2DBBA 1LHVA 5AONA 1YNAA 4JDMA 2F6CA 3ILFA 3W5NA 1ENSA 4B09A 1P9QC 3I3DA 3BZKA 4IV3C 5FFZA 4ZDLA 5IAVA 2OTJI 3ACIA 4BH9A 3F8NA 4GGGA 3ETQA 1HW2A 3LMMA 3I64A 1GLHA 2WLQA 2PHLA 3CJXA 3J7AO 1I1GA 2JQ7A 5IOZA 1YW9A 3B6CA 1O3QA 2QQVA 2CV6A 2Q4SA 2HBTA 3F2ZA 2W1SA 5K0UA 5KHIA 4FTBA 4HAMA 1UL9A 3ZKYA 2DYRH 1UG0A 1UHSA 3LEMA 3R4KA 2J1AA 1ORKA 4RLFA 3U1XA 4H55A 2DMUA 3OPTA 4IV3A 5IVCA 2WO1A 4IOAF 1J59A 1IC8A 3OF1A 4C30A 2ZB9A 2E71A 4PCQA 2V7FA 3H42B 4ES8A 1VQOI 4YVSC 2FBEA 1N25A 1H8TB 5LGUA 2M9HA 2CL2A 2FNPA 3SCHA 4CXWA 3SFZA 2ORZA 4HBLA 1PMJX 4BQ2A 4E7HA 2D6LX 1H8AC 4WX9A 1ENHA 1TME3 3ZYHA 4F7ZA 5LK7B 3ZPLA 5JSPA 1E3PA 1TNFA 1ACIA 1SLBA 2E32A 4AYUA 3PMEA 4TYSA 1R36A 1VQ4I 1VQKI 1X3ZB 4D7NA 2FNAA 2R6QA 4A6SA 1OKQA 5FFOC 4KFCA 1O57A 2F2EA 1YI2I 1UF2C 1WJEA 1WJAA 2YC0A 2VZRA 3P9IA 5GAGJ 4BU2A 2HQNA 1NAEA 2CQKA 1VBA1 4M3CE 3VBSB 5FP7A 3A01A 3S14J 1W28A 4BDVB 1J3PA 2HU9A 3DPLC 2HTSA 4Y4RA 5FZMA 2LF8A 3GCMA 1RKTA 4YM3A 2R7XA 1MS0A 4N53A 5LWBA 2IXHA 2E7AA 1FMVA 2H6BA 1URXA 3JRHA 1VBC1 5J48A 3CJIC 4KUMA 3RJ2X 4B8EA 3F0CA 1Y7BA 4MEXF 3LIGA 1BOBA 1TT5B 4KT6A 4IEWA 4QX0A 5FLHA 1S3JA 3IWFA 2ME6A 1WFXA 2MEV3 1UZYA 1VQ8I 1YXWA 1J09A 2BFUL 2TBVA 3ZN1A 2VODA 1Y6IA 3ZOBA 1FWZA 5I0RA 1S0CA 2B7EA 3JRDA 1JZ7A 1QNWA 2YB7A 2DMPA 1BVP1 3GCXA 4L9JA 5IVVA 3OG2A 4Q4X1 4MUVA 1MBKA 3JD72 1JJ6C 2YYOA 2NN8A 2VOXA 1Y4WA 2XHNA 1WJCA 2ARAA 1XB9A 1BC7C 4XE9A 1A04A 5FRNA 3DBLB 1W36C 4BUPA 2M3AA 1DIWA 2GZWA 4CCJA 4UW6A 1MQTA 2R062 3OGSA 2W48A 2WS91 1OYWA 1ULOA 2AUYA 2IGMA 2JUGA 5LHGA 2KM2A 3L1PA 2QNKA 3AP9A 5FWEA 2A6XA 3THCA 3K10A 2W00A 4OLLA 1P4WA 4E7KA 3RZMA 2WAOA 1I39A 4N53C 1OURA 3D4KA 2J1EA 3KGLA 1X58A 3FXUA 1LOAA 2H8RA 2MLKA 3I4PA 5C4WB 3PO3J 2XJQA 2GP5A 3GZ5A 2HPIA 4MO7A 2WAQA 5LRRA 1G8XA 4GMP3 4URTA 3COAC 2W2IA 4MX3A 5FZKA 5JAXA 1EV12 3OYAA 3CF2A 3T2OA 4S0HB 4Q0VA 4D6QA 3VBFC 2XASA 1G9CA 2ZXIA 2WAEA 1KFUL 1PO21 2VULA 2KA3A 5A3TA 5EQUA 5GKAC 3N4MA 1VB4A 3WF0A 2FDKA 3GYHX 4G6DA 2JD4A 5LHHA 1ZG3A 3OSFA 1OQEA 1ZK8A 2XH6A 1WLCA 4N4OB 3AXEA 4PLNA 1T08B 5IVBA 1E3OC 4I3GA 4KG0A 3ZP5A 2XJRA 4C2TA 5FMCA 3AL0C 2VPRA 4PDWA 4CP9B 3NJZA 4YVSB 4Q26A 5EJ3A 1UPSA 2RVCA 1OQYA 3WU2C 4EROA 3MUZ1 2TEPA 3HVDA 1USSA 5A7NA 1OKOA 3SYTA 4AIKA 1LQ1A 2DCEA 3WY6A 4FI9A 1FBQA 4A3DJ 1O7FA 1TW3A 3PLQA 2FDIA 3VOEA 4MOAA 3PIOF 2CUZA 2KISA 1MSFC 3LL7A 5GM0A 4PJYA 4LE4A 1DQ5A 1X4PA 2ZXHA 2Y9YA 1R081 9ANTA 1PMIA 2CNAA 4CDQC 4R9AA 4BB3A 5KC6A 2XAHA 3M3EA 1PP7U 1YS6A 5LEJA 4E4DX 1B1BA 2VQAA 3VKFC 2JG9C 3K75B 3ZR5A 4BXFA 1VQ7I 3MLLA 1H88C 5FY4A 5SV8A 4PIXA 4R9DA 3OOXA 3AJZA 1XSVA 2MFZA 3LAJA 2EFNA 4II2A 4HL0A 5FO7B 2FOWA 3TQNA 2KIUA 3U37A 4TWTA 1BLZA 4XLHA 4KA4A 1X2MA 4Q1RA 4JQTA 4JP0A 4LLNA 1IKQA 2VW2A 2W24A 1AYM3 4A12A 2KPMA 5J40A 1FMD2 1UYZA 1KGYA 1PUEE 2W95A 4UFIA 4GWIA 2R7RA 4W6XA 2VBBA 5FUIA 5JPMB 1BMV2 2CWMA 3R05A 3M4OJ 3C7GA 1UCRA 1ZRRA 4QDSA 5ERLA 3OYMA 3K4KA 1JHJA 4I3PA 4Q1PA 1T8IA 4JDOA 1FI2A 1SFUA 1ZA4A 3H1WA 4NHJA 5EF6A 1Y0UA 4CZCA 3VD7A 3NJXA 1G3WA 5C3EJ 1Z67A 1T95A 2CGPA 2BNMA 2FEZA 2RDSA 4BJ6C 1NA1A 3HOSA 4RS5C 3OGRA 5GLVA 5FZ7A 2QSHX 5BNPB 5CNAA 2GOMA 3SH4A 3B7MA 3T08A 3A4CA 3CL1A 1Z7S3 2L01A 3WP5A 3FMQA 4KIBA 1UJ8A 2UWMA 2BTVC 3FMGA 2AH2A 3A21A 1YIOA 3H3ZA 3TRSB 4HSJA 3CC2I 3B3QE 4GB31 2L9NA 5ICCA 3WDTA 2R30A 1GVDA 5DDJ1 5IT9K 4XMAA 3P3PA 5FKBA 4AVSA 3ZFEA 1Q56A 2K9SA 5B3SH 2WV1A 1LOEA 1NHAA 2ZSHB 5FKMA 1S8NA 5CBLA 3QAHA 3DEEA 2Y60A 1YI7A 4MADA 2DQLA 1K4SA 1GZWA 4P9GA 2PJRA 2MC4A 2XVCA 4PK4A 2R5ZA 1XNCA 3RMYA 1IV8A 2E63A 3QWLA 4I01A 3GTKJ 2XLFA 3ZN0A 2QKLB 4K3UA 5IYBJ 3GFIA 4P9WA 3RZJA 2Z4FA 4LORA 1NLSA 2QVSB 3ZQFA 2WNUB 4Q4X2 4FPOB 1JHHA 3MHZA 2B42B 1SCSA 1L3JA 4QHOA 1N75A 4BJ0A 2UXXA 2VZ3A 3OY8A 1D1CA 3V7RA 3BR2A 5FZFA 4ENKA 3WE3A 2AEYA 2WB1N 3KP4A 3IIIA 4I09A 4HA8A 3GMEA 5L9VA 1NQJA 3RKYA 4KISA 3PIJA 3ZXEA 1W6MA 1Q8OA 2ARXA 3VDDC 2VIXA 3ZQ7A 1W2NA 4G7OF 3A22A 3LOBA 5JLVA 3OIPA 2FMYA 3S16J 1KJLA 3BIEA 3VD9A 1NTCA 2YC2A 2AHQA 1YQCA 2OPKA 1IN8A 1VBB1 4IE6A 4DUWA 4KQ7A 4XORA 3AL0B 2OUMA 2NVXJ 1T6BX 2YGLA 1YQ8A 5GLWA 5T52A 2F4MB 1QIQA 1O3SA 3LQRA 1ENQA 3KM5A 1U6GA 3IDAA 4XUNA 5FLVA 4B47A 3U07A 3P5JA 5K7HA 3BG9A 4Y4YA 1W6OA 4L5IA 3J26N 5C9AA 1CAWB 1PUFA 2D6NA 4CP2A 4AIHA 2BY3A 1QZEA 2K2SA 4Q4X3 3GTQJ 2CTVA 3CLPA 1O4XA 4A3LJ 4M6YA 2DOEA 4A7ZA 1QQP3 1UMIA 4FFGA 1US2A 3DKYA 1YJ9I 3C7FA 4PIZA 3GZNB 1MZEA 3IMNA 1BBYA 5ICGA 2VMGA 3MMYB 4XZUG 1O5LA 2QQLA 2BW3B 2PYTA 1Q8QA 3U9GA 5T5JA 5LK5A 3A0HC 2BP6A 3SLIA 4DQAA 2QLZA 3W58A 3T3YA 1OPOA 2G9WA 1SAUA 5BNOA 1BOAA 2ZGPA 3ES1A 3NAPC 1J58A 4ATFA 4AI2A 3B73A 1V0AA 4O9GA 3KZ4C 5DAQA 3WR0A 3KEYA 5A6QA 1W5CC 4O6JA 4NQWB 1WGPA 1YW8A 3AP5A 5JI6A 1VRBA 4XMYA 1E17A 3WW3A 3RSJA 4HQMA 1NH3A 1AUYA 2JIJA 2XAQA 1EH7A 4IXAA 2NOGA 2DVAA 1POV3 1VQ9I 2FX0A 4XOPA 1XN7A 1OQ1A 2JPCA 3ZFFA 5C3SA 3KCCA 3HNMA 3WTSC 2GMMA 4BA6A 4GIQA 2A6ZA 2VZOA 4NWVA 4FP3A 5EZHA 1FTTA 5JVVA 1QO0D 2ZSIB 4L9TA 1Z78A 3DKXA 1S7EA 4S04A 1WBFA 1WLTA 3HB9A 2HVRA 2EFOA 1PO23 3AVRA 2DW4A 3NV1A 3EUHA 3MO4A 3DPRB 4JZRA 1MW7A 3I97A 1I3HA 2DVBA 4WM7B 2D45A 2VE8A 3MDPA 3ON7A 4RGUA 3VPRA 4A3KJ 1GXQA 3GHNA 2ZGNA 5FBZA 3OUHA 5D8LB 2WSVA 3EQLF 1XCBA 2IP2A 4XONA 2RDQA 4DEVA 3TN93 1ZG1A 3CKHA 2E1CA 1QJY2 4E4ZA 4ZYAA 3LCPA 4CUBA 5IW0A 1VBB3 4GYGA 4HDVA 3HQUA 4NVPA 1DQ2A 3O5SA 4JGYC 3WZ1A 1MNDA 1HKQA 1HSTA 1XMAA 3F21A 1CX1A 4MXVA 4XFGA 2P5KA 5GAHJ 1ZG5A 1UB9A 1UHMA 4K20A 2C1FA 3IAQA 3KHCA 3G1LA 1DGWX 4P9XA 1QDCA 2OAZA 3OEAA 3U78A 1FOKA 2EA7A 1NCQC 5L9BA 2B8MA 4NHLA 5JR2A 3Q8CA 3ZXAC 2A6YA 1KU7A 2L9VA 4RA2A 2L5QA 1BM9A 3QP5A 1XPXA 2IXCA 4XL9A 4LOTA 3RTRA 1YEWA 3PNYA 1QKQA 4XFFA 1VNDA 2XVLA 2O6GE 5KXEA 1ZZ9A 5LBEA 2GAUA 2DJIA 2PFWA 3T09A 4HV6A 4B8XA 2P3KA 4RB1A 3G73A 4ESBA 4IE0A 4PJNA 1SMVA 1E3HA 5EYYA 4XFHA 1QGPA 5CAZA 4QXKA 1SMTA 1S0GA 3MQ0A 1EY2A 4QQPA 4S2DA 5FRMA 4XTMA 4BE3A 2PHRA 3T0AA 3FXLA 5TRDA 2J7MA 4DY5A 1U5ZA 3WX5A 5D21A 3S2HJ 1UYPA 2W9XA 3KQ4B 2R7DA 4G3YC 1W9WA 1SVMA 4P9LA 4FQZA 3LSMA 3VKLA 4FXGB 3H9JA 4NC8A 1M06G 3ALQA 3CLOA 2W87A 1UKGA 1TZLA 4IV3B 3NV2A 1B59A 1QU3A 2GBYA 4YG0A 2ZC2A 3F23A 2STWA 5LHIA 5J4VA 2W0XA 4AFMA 2RAEA 1HRI3 3NAPA 2GMEA 4X0GA 3R0AA 3U21A 1CJDA 3OYJA 1WH7A 3PM1A 1R082 4NRQA 4E9KA 3ZQGA 4CSWA 2MH2A 2EXHA 5FK7A 1GQPA 2VMIA 4CCLA 5DDJ2 4A5NA 1P7JA 3EO6A 1TL8A 2LDUA 2GXGA 3GUDA 1Y9GA 2LF7A 5K7PA 2IXIA 3WP4A 4FE4A 1F4KA 4C8DA 2RM21 1RUD3 5T5LA 1CESA 5B2GB 3ZDSA 1PZ7A 2ID4A 2V9PA 5I0DA 4GJZA 2CYFA 3BP8A 4BQNA 2JDUA 4BWOA 1KRIA 2E9QA 1W6NA 4UUTA 3I59A 1FV3A 3KGZA 2CAUA 1VJ2A 4W8JA 3D5RC 2V9VA 4KBZA 1X19A 2KXLA 1IV6A 1JYXA 2AO9A 2RM22 5LA0A 2L7KA 3DFGA 1WZ2A 2VG9A 3H7YA 5D8AC 4ABZA 5IK5A 1WW6A 3NNLA 5FYIA 2O1QA 3PJQA 3TO9A 3IMMA 2E26A 1M1EB 3VBOA 4A3FJ 5LCWL 4AE2A 1UX7A 1F31A 2JENA 4A41A 1D1BA 3SEQA 2R7UA 1FMD1 1H8TC 4XKBA 4M6VA 2DCYA 2PLV2 1FT9A 1HB4A 1R091 2HQRA 3UJOA 4BJ5C 1XDSA 3UYJA 1BIAA 1LOCA 3VYRB 3JBG1 4HSLA 2MPFA 1GYKA 5BNQA 3VD4A 2CUEA 4CCDA 5E16A 3OUJA 2Q1FA 1U3EM 3NQOA 4PSWA 4IEXA 3ZIWA 4I99C 1DYOA 4IETA 1T38A 5IP7J 1Z1DA 5D5VB 1SAXA 5IY5H 1AR63 2TDXA 2JDMA 4D7YA 3BG6A 3W9AA 3UESA 2R16A 5KHDA 2D6KA 1HF0A 3SEPA 1Q43A 1FAYA 4V2FA 1DBNA 4BQXA 2XRNA 2E31A 2XUBA 3RCOA 1AL23 4CDQA 3LAPA 2WS92 2VQLA 3GJBA 1KEXA 4I6ZA 1ST8A 4JX4A 4W6YA 4JX0A 3AKPA 2ZGMA 3DPRC 3H7JA 4IEJA 3IH3A 4ANJA 1X1AA 1S7OA 4LA2A 3U0ZA 2WA3A 3PU8A 4XLCA 3DCQA 2EILH 2J5PA 2EIDA 4CDWC 5ACA3 4AIDA 2X1DA 1PZ9A 2XF5A 4FFHA 2Z79A 1W99A 2R3SA 3VBFB 1MZ5A 1HJFA 4IHYA 2AZ5A 3WTZA 4Q2FA 4EJRA 3H5NA 1JKRC 3BC8A 5BPDA 4FQ4A 1T6GC 1CZSA 2YPDA 3SHFA 1MEC2 4RBOA 2ZMEC 2WY8Q 5D4SA 5L3BA 4OZOA 3VDBA 1WI3A 2PHXA 2W25A 4OHZA 1EH8A 4AU7A 1CAWA 1D5YA 4MGQA 4M6XA 4PHZA 2EZKA 1I5PA 2IVIB 3NMBA 2XPUA 4IXLA 4D69A 1JZ5A 3K7AJ 1QJY1 1E57A 1DZQA 1U5TA 4MTEA 3S32A 3U2RA 2K40A 1VBC2 4NHXA 2IGNA 1SD4A 1AX1A 3ZQQA 5F8PA 4LMFA 1EV11 1JKOC 1RUE2 1SBDA 3BTXA 5DCMB 1ULPA 3WTVC 2VY0A 2BXZA 4N7IA 1ACCA 1QHDA 2HOSA 4DXSA 1F2NA 3OTFA 1R1A3 4R4XA 5HS9A 4ASKA 3AFHA 1QNTA 3ASNH 5CFDA 3KV5A 3I2GA 5B4XA 2A3SA 1US3A 3QU3A 4XACA 2GNDA 3BB6A 4GWMA 2CW8A 2YU9J 5EDNA 1ZBE1 1K45A 4B3NA 5C71A 5LEKA 1Z6RA 5FLJA 1BL0A 4W6WA 5C4WC 2UWAA 2HOTA 4N90A 3CZ6A 2VZVA 4I0WB 5GADJ 1B35C 1H2MA 4WM7C 3ZR6A 3LQCA 3WUDA 4FETA 1UX6A 3IKTA 1OOPC 4MGRA 3J8F3 4BMBA 2Z5WA 2FMLA 4ZYEA 3OEBA 1RUI3 5K9YA 1CAXA 1N78A 3I8TA 5LW9A 3ZYJB 2DA4A 5IP9J 3Q8EA 1S7AA 5EV7A 1JN2P 4A45A 2BW8A 1R4NB 1D3YA 4DEQA 3Q9OA 3BLYA 4II3A 5JMOA 4QU1A 1RIRA 3LDRA 2VVFA 3FZ3A 3PJRA 1JOBA 3HUGA 2NVYJ 2WQZC 1TWAJ 3ELKA 1ONVA 2E1NA 2ZOEB 2HKOA 2CDOA 1K83J 4XBQA 4M3CB 3GHMA 2IPQX 3T1MA 1TBXA 2HOAA 2IXJA 1OFSA 4M3CA 3GEZA 4HSRA 2DTZA 1C8M3 1LDJA 4FO9A 1D4M1 3F72A 2DU0A 3SEZA 1KJRA 1POQA 4CXXA 3VBRB 1NQDA 5LBBA 5DG1A 2XAGA 5LGTA 2V72A 5FYHA 2COBA 1DGLA 4NIAA 4CEYC 5FPUA 1GMMA 4XLPF 3EETA 1QRYA 5K5OA 1SD5A 4IF4A 1GZCA 2XXZA 1AR62 3K77A 2JDZA 5L73A 3X2QH 4ZJZA 2Y31A 4ZC3A 4OUMA 1ULCA 5D5WB 4D0PA 3TOAA 2D93A 1C57A 3IKWA 3FF5A 1SFXA 3H35A 2OXBA 4L97A 4AXOA 4LOCA 1ZBE3 3HDDA 2RDPA 2ZKNA 2HDDA 1QBJA 2Y64A 1UW8A 1G9BA 3A2KA 1Z21A 4FPCA 4Y22B 1TQ5A 3POFA 2PX9A 2D98A 4Z1VA 1BC8C 4IHVA 2CFOA 5IYDJ 5FPLA 4B29A 5CQEA 1W6PA 4CDWB 4IESA 2VL8A 5FYCA 2WZR3 2QQNA 2M34A 2EINH 4KNYA 1MQTB 1MSEC 1XYOA 4AQ2A 1H0MA 1ZZBA 3O1MA 1H1IA 3AMNA 4XTPA 4ASNA 5L7OC 2Q8OA 2M87A 5C8CC 2EXIA 2OU2A 1JYVA 2YPJA 1EH6A 3AVSA 1DQUA 3ACLA 4R52A 3HOUJ 3AYEA 4KIFA 3M7AA 5F64A 1MDMA 2R5ZB 3TBDA 1ZGWA 1PK6C 4XVHA 4AYBN 1C8M1 3BG5A 2ZHNA 5IT3A 3ZFEC 2ADEA 2C6YA 4CUCA 2PHFA 2GIVA 3LWCA 1PO11 5HS8A 3CO6C 2QUOA 1XBFA 3VEPA 4AVTA 3LDBA 1AYN1 2XGCA 2DUPA 3LA2A 1AYM2 3ME2A 4G6TB 1Z91A 2W1OA 2MNGA 4HX8A 3CUQC 4MGSA 4PFPA 5F3GA 3ABMH 2EIKH 2ELJA 4K7JA 2ZEZA 3S2DJ 1W39A 1HDPA 3JU9A 3RG0A 3AG4H 4K8FA 4HKWA 2V5DA 2XDVA 1BMV1 1AXKA 1YFWA 2Q0OA 4KN4X 2C9KA 2DCZA 5JZGC 1HB1A 1X36A 5CB7A 1A35A 1IJWC 3QOEA 2WBKA 1X1PA 4PQ9A 5JDBA 4GFBA 2LH9A 1QH7A 3FLTA 4NAMA 5IT6A 2RMU3 3RKQA 3OPWA 2DVDA 1NZCA 2BBAA 4KL1A 3OY8B 4UOJA 2BGCA 4AZZA 5F1RA 1F4HA 1O4TA 2J1RA 1HV0A 3FJSA 3H0OA 4CCMA 4B48A 4ARYA 2R041 4GALA 1CIWA 2DV9A 2P8TA 1Q1HA 2HJIA 3MIEA 4M0NA 3TNQA 1YFYA 4LPLA 2ZXJA 2GC2A 1IDZA 4YGEA 4HF2A 2VW0A 4FSJA 1LESA 3OBZA 4IEQA 2IAIA 3LF7A 4IE7A 4A3EJ 2NVUB 3K9TA 1XMKA 1AR93 4ZYHA 4KMUX 2WFF3 4XFIA 3ZFEB 5B1AH 2QQPA 4LHLA 1X1CA 3K3NA 3DCFA 4OMDA 2JA5J 3JR9A 2Q0AA 5IOYA 1ZYRF 5IK4A 2KRFA 3N7KA 3GDBA 2CYYA 1QDOA 2WQ8A 3AZYA 1RUI2 3H8UA 3ZMOA 1YIJI 3HT1A 4XKCA 3VKMA 2HWB3 4EQVA 4J00A 4PI0A 2ETEA 5BNNA 3V42A 3M8EA 3K46A 2IS6A 2M1BA 2CW7A 3RQ4A 2R7TA 3JTHA 1W6NB 4XETA 4PDWC 2WINB 1QGLA 1TNTA 1BCXA 3N3HA 2DVFA 3SXWA 5KWRA 1QZZA 2HI3A 1SD7A 4LB6B 1ZH5A 4EJOA 3VZNA 3NWTA 3DU5A 4L18B 2HWD2 2O8KA 4ZDOA 2DF7A 5JR3A 2HWF1 5K5RA 4RAZA 1KONA 5FYUA 2QM3A 5DAPA 1NCRA 2V1NA 5L3EA 4FX4A 2G1MA 4ESFA 1SEUA 1IRGA 1K79A 1C3HA 2EIJH 2O0OA 2WN2A 3QCWA 2E2IJ 1W2UA 2GXAA 2IRFG 3MIDA 4UY8I 4XUTA 3ASIA 4K21A 5FOJB 1MBHA 5FZIA 4IRIA 4UW4A 1KZHA 3T30A 1SD6A 3LSPA 2ESNA 3HJEA 3LFIA 3O2PE 4BGDA 3V7CA 1SEFA 1YRNB 1GSLA 4OIOF 2JSPA 4G9SB 4GH4B 3FWEA 2FA5A 1S0DA 2QCSB 3NARA 4DYQA 5T5PA 3E5XA 1SQ4A 2GWRA 5CVVA 2WNVA 4N9HA 3O14A 1F5JA 2YSRA 1POV1 2VQGA 3TGNA 4F55A 3EYYA 2P4EA 4WV8A 2GN7A 1PK6B 3SCGA 3N36A 2BZDA 4I30A 3K1MA 2DA2A 4MG2A 3AX4A 3OBAA 2BVMA 5JLXA 2EFPA 2G19A 3CMYA 3HJRA 3N9NA 1A34A 1Y0NA 2DTYA 2N8GA 1VBE1 3NVCA 1QJU2 1XB4A 2YU1A 1GVJA 2VI6A 2HWF2 3V7SA 4LBJA 4QPYA 3BCBA 1Y39A 1P4XA 2QQ9A 1F35A 4QB2A 2R1BA 2B39A 3OIOA 1Z3XA 1TTYA 5EEHA 2VPLA 1RUG3 1WWXA 3OMYA 3I3BA 2GQQA 1WJFA 1D4M3 4L0PA 1LDDA 1GDTA 1PVC2 5FUPA 1VQPI 1WW7A 3U14A 2ECCA 3AFKA 4RGGA 1MJBA 2KD7A 1LFPA 3BTYA 1QJX2 3V56A 3JAMK 3SXYA 1LHOA 2WKKA 4JAAA 4MGYE 4LO4B 4E7LA 2ARCA 2PMWB 4YW5A 1W7PB 2IGKA 4OOIA 2XBO2 3F8CA 2P5VA 3KB5A 1NLRA 3WF1A 4HV5A 3RJRA 3I5UA 1KU9A 1IS3A 4BYYA 2LC2A 3BR5A 2ACJA 2LKXA 2RE9A 2VTFA 3FMRA 3VBFA 4AC0A 1HBXG 3OV8A 3D0SA 5HOOA 4K1YA 4OCTA 1ZGAA 1S0IA 4GDFA 4ATEA 3W59A 4NO4A 3SHRA 3ABLH 3WG2A 2B0LA 2DO7A 1ZX5A 5JXGA 3ZYRA 3M8LA 1UO9A 2W1UA 4LULA 2LRDA 2XHKA 1V70A 1VAVA 3CHXA 1XD7A 5FP8A 1S55A 3UGHA 4S2GA 5FRAA 1QHHD 4Y33A 1H6XA 1X33A 3AAFA 4XQWA 2BY1A 2I45A 2FDJA 3PU3A 2ZGQA 1F4AA 2O8OA 5DAWA 3L9FA 4FISA 3AKTA 1BHGA 4FE7A 5C70A 1MNEA 2SBAA 3S15J 3GZTB 3UT0A 3MKYB 3T8TA 3GLXA 4HVOA 2GC1A 2QQJA 1H9GA 3P7NA 1HKDA 2PAEA 2JICA 3TDUC 3ZXLA 2WZ8A 3AKRA 3S6PA 2K0GA 4HSTA 4CEWC 3KVBA 2O8XA 4CA9A 5F04A 1KQ8A 3HRSA 1HJGA 1D0ZA 3DL3A 4TLGA 2KRCA 1VBD1 1FP2A 1AHDP 2UYBA 3WQ7A 4C0HA 3C7HA 3ZOIA 2KIFA 1U5IA 4IRGA 2GH2A 1W36D 4Q4ZF 1AF9A 4OQ9A 2N7GA 4DY3A 5FYZA 2VU9A 3VZOA 2YXSA 5K1YA 2G9ZA 5E20A 3CJRB 1QMJA 1OOPA 4RFRB 3VKNA 5BOXA 1JYIA 4C0BA 1WD4A 3RZZA 1AR92 3PSFA 3DWLE 4JQFA 4B4PA 1AR83 2A3YA 5C6CA 2PAKA 3OIQA 4IOCF 2IXSA 2D2WA 3INAA 1ZZCA 4HXCA 2D97A 2RG4A 3Q9VA 3HXLA 2JN6A 5L9RA 1C1LA 3I0TA 1X9TA 2DXIA 2YPRA 2RM23 4NUBA 3DF0A 1DU0A 3DPRA 4AVZA 1CIYA 1OC1A 1SCRA 2LTPA 4XAAA 1HXDA 4UFMA 3W5MA 1IS4A 3O8HA 3AKQA 4IV1C 2I8DA 2KRHA 4G8XA 2W46A 1SZBA 1LGCA 4AGRA 2KZVA 2VC9A 1IPKA 2DT5A 2HDWA 3A03A 2ORXA 4SBVA 3BZCA 4MV2A 2E34A 3FISA 1WZXA 4KWUA 2EQRA 4IGPA 3LA3A 1CAUA 3M3CA 3B9IA 4EM2A 3H1CA 3PDQA 4ZDPA 1L7LA 2HTJA 2YY1A 5A6ZA 3W6KB 2PMZA 2GNBA 3EBRA 4XJ9A 4Z2WA 1DP3A 1OFNA 5J8FA 2L4MA 2COMA 1VTNC 1FEXA 3RQ0A 2PA7A 2F5CA 4D6RA 1LENA 4XNFA 3Q9SA 5BMZA 2X85A 2Y75A 4QD2A 1JBCA 4ARXA 4YGCA 2GMPA 4GXOA 1JYNA 4A3GJ 1YWKA 3BTCA 1OLMA 3WE2A 3IP4B 5GAEJ 2VBDA 3CF5F 4XRFA 3BTZA 3VFZA 2JDYA 5HDGA 4OI2A 2RS52 5IYCJ 4Q0QA 1Z6TA 5F5CA 1MMAA 4DXRA 3A7QA 3C2UA 3OOPA 2I5UA 2JG9B 4ZONA 5DXDA 3LPGA 4HT1T 1GU3A 3IDCB 4HK9A 3F6VA 4FHTA 2ET1A 3ML6A 2BY2A 2B9SA 4IV1A 2KDZA 3I71A 4LBQB 3ACFA 5C4JJ 2VKEA 3JRFA 4LLLA 5I93A 2RN7A 1YYVA 1OH4A 5E18F 3H5AA 4AFBA 2XBO3 2VUJA 3JQWA 1ENRA 2UYAA 2O7OA 4YIIA 4Z2AA 5FLXZ 3WD5A 1BW6A 3HTSB 1XOYA 4A5MA 4M9SA 4LKDA 1MGTA 1ZLKA 4OUEA 1OD5A 4MGKE 2QQOA 1EP0A 2VPVA 2XQXA 2JA7J 2F4OB 2ATFA 1XNTA 3MKZA 5HCFA 4MTDA 4BQ4A 5HLTA 3FXMA 2B7YA 1QF3A 3IDEA 1DFQA 4MLOA 3WCRA 3WG1A 4QDQA 4XFCA 1PO13 5L3DA 2BGPA 5A6YA 4ESJA 3F9KA 2C24A 4HRIA 4OINF 1WMXA 5HDNA 4RMNA 5DAXA 1I6HJ 3CEWA 4J25A 1MKMA 4YRVA 5EG0B 3MF9A 1Y43B 4EYUA 2EICA 4UB6C 1UQXA 4XBFA 3A0NA 1ND2C 2VZUA 3BGAA 3VBHB 5C7GA 3QLQA 4UT5A 4MVTA 4BXSV 3GGLA 2RJKA 1COV3 5IVFA 2VMEA 2LY1A 1ZREA 4ZYGA 2MD5A 4AVPA 5CG9A 2NLRA 3WDVA 1SBEA 3PUSA 5D5UB 3T2TA 2WAAA 4CDXA 4CU9A 3HSEA 5LBQA 3CJIA 4GA9A 3GF6A 2GALA 3OSDA 3HOXJ 4RS5B 5LFAA 1U9OA 3M3YJ 2NS7A 4FASD 3KQRA 2Y2ZA 1A6CA 3BG3A 2XSDC 3M4FA 3HRMA 3SH5A 1Y8RB 3WP6A 4U87A 5A33A 3GBGA 2P6CA 2R7QA 3WG9A 5KCMA 3CCMI 2JSCA 4FPFA 5DUVA 1WLDA 2JKXA 3HIFA 4WXCA 3S5AA 4JDNA 3PVEA 4Q4W2 4KN7X 3V64A 1PX3A 3NWKA 4FPGA 1AX2A 3WQ0A 1S72I 2LR8A 2GU9A 2VM9A 2ZGKA 2R071 3BQYA 4FPHA 4UUSB 3M7GA 4YZ5A 1Z9CA 3KS7A 3WHCA 1HKSA 3BY6A 1J0RA 1F9NA 4FPEA 3VDDB 1NX9A 3CCRI 2GOXB 4JVAA 1NKGA 2KHMA 2XB6C 1XNAA 4C3IJ 3AK0A 2CQ7A 1V5EA 2GDFA 3MIBA 3H1YA 2HDCA 1SDWA 3ZX7A 3BROA 1MS5A 2W7NA 2JDNA 4G7ZF 1G59A 2VKHA 1FOD2 1W06A 5TISC 4BQ3A 1SDDB 1Z3YA 2DA6A 3OYCA 3E6DA 4XF0A 3HMYA 1QJX1 1MH4A 1HW5A 4IDZA 4RAGA 2Q30A 1R49A 3A0BC 1W7PA 3TBIA 1QQP2 2CHHA 2HWB1 3QYEA 3VD3A 1XE0A 2E7XA 2IW5A 1COV1 3ABTA 1XG1A 1WCQA 4LG0B 3TEXA 2LM3A 2JECA 2KFDA 2VUCA 4Y13A 1QJU1 4BBSJ 3R0JA 1WW4A 2W52A 4IEYA 1RUJ2 3BTJA 1HQCA 2DA1A 3LSIA 1QOOA 3OYWB 4XSXF 4K6BA 2Z42A 1JYCA 1FZPB 2L4AA 1YIPA 1LULA 1OSGA 1SC7A 2HWE1 2A3WA 3ZXDA 1F9KA 4D3WA 2GXBA 2W4SA 2P37A 2HOEA 5CKNA 2CSGA 1P2FA 3JRGA 4RGSA 4ET7A 1FOD3 4BCUA 2TUNA 3S7EA 4AHXA 2EB7A 2PLYA 2VOVA 5FY8A 1IZ3A 2V6EA 1W8NA 2GNTA 3GVAA 3DPTA 1JHNA 3TEYA 2BY0A 2XLGA 4XC9A 3NNFA 3T4HB 1HW1A 2JK3A 4XMIA 1J83A 2ETHA 1V6JA 1B6AA 2FMDA 5KXBA 3JTGA 2X9DA 1MVEA 2ZXWH 5FAXA 4UFKA 2CV2A 3E6MA 1IXSB 1H0BA 1VFCA 4XCBA 3C7JA 2X5IA 1MQTC 3HGGA 4MFEA 1P7IA 4ZPIA 4MXWA 3OGGA 4DQ2A 1T98A 2Y34A 3MYXA 3CMGA 5E17F 2OYZA 1RXGA 1V55H 4YIFA 2PAMA 4ON0A 1RXFA 1D4VB 2HWD1 3L2QA 5F3EA 2E36A 1S0EA 1MS3A 1ULFA 4JTOA 5JIAA 2OKXA 3WDXA 3WTYC 1AR72 2VXJA 3S2WA 3TNPB 1LVKA 1AX0A 3FC0A 3ZM8A 4B3XA 3CJNA 3BIWE 3JUUA 4BY7J 2CDPA 3GNEA 1B72B 4GZ9A 1R1VA 2Z1DA 2WTEA 4A69C 4CXYA 1G3SA 1YJNI 1UY4A 3LSEA 2JX9A 5E1XA 2BWCA 1OCZH 1QJEA 1MEC1 4NIGA 2WL1A 2JUCA 3N9LA 4B43A 3CMMA 4HNVA 1W7PD 5ABJA 5C33A 4LJZF 3VB9A 5DQ0A 1R7JA 5TGTA 3H92A 2D5FA 4CU8A 4N43B 2D43A 2DT7B 1APLC 2M7AA 4UBGA 3E1F1 2JZYA 4RQPA 1IRZA 2FE3A 5CFDC 5F6KA 5LBFA 3ZYFA 2ENRA 1KYWA 3F8MA 1WJBA 1ULEA 1F5TA 1GOHA 2RKHA 3H8XA 3AJYA 3G6JB 1N1YA 3G2BA 5F27A 2Q8KA 2K27A 3MZ8A 4XW3A 1QVTA 4EM0B 1VIWB 1QNYA 4LKFA 3HQXA 1O3TA 1GUIA 1J1TA 1W1WE 2VONA 1VE0A 2BBYA 4XR6A 4AHWA 4KITB 5FMOL 2ZJQF 4DXZA 5A3NA 1J2XA 2KQRA 3WHBA 3HKZN 2RJLA 1OYYA 4ZTJA 5J98B 4XN0A 1DDLA 2ADDA 4GXLA 2ZTNA 3HSFA 3E3VA 3ZMZA 4LKSA 4AI1A 4XBLA 3F6OA 3PUQA 1T56A 5JSRA 1GZTA 3ZDVA 3CCYA 5EEGA 4YPJA 3C2BA 2R7OA 4A3ZA 3FX3A 1OVSA 3KEQA 2A6HF 5CFCC 3CNAA 4C1WA 1VMJA 2DI3A 1JYWA 3Q0WA 2IGOA 1AXYA 1Y9MA 2NYYA 5FLXK 3BJ6A 4RA0A 3J8F1 2QQAA 3W2AA 3ZN5A 3S57A 2FZ2A 5FPAA 3CF6E 5HODA 1T39A 2Y38A 1OLRA 5J7MA 1ZVFA 5FZEA 1R1ZA 3BTLA 5C44J 3TP3A 3KF3A 3V0BA 5CADA 4E27A 1BYHA 2XIGA 5D5XB 3AXDA 4KI5M 4K1ZA 1V5FA 2JMWA 2V26A 5D8KB 4LEJA 2VC0A 4XKWA 2Y6HA 2EFQA 1EUTA 3FXQA 3UGFA 3OYGA 3ZMNA 4K9SA 4L0YB 5LA2A 2H27A 3CZJA 1IAWA 4B4QA 1BVVA 3MKLA 3NNJA 3EYPA 3D0JA 3ECOA 3HN3A 2AEZA 5A7WB 4FOVA 1H8VA 1NT0A 1ERDA 5HBAA 2IXKA 4UUVA 1VMFA 1AJKA 4M00A 2A05A 3CCEI 3QPSA 5HVQC 4XQ4A 3SH3A 2CUFA 1GUUA 4QB6A 2EJRA 1W9YA 1UY0A 2PXJA 2GP3A 3KZYA 1EPZA 1AJOA 3MZYA 4MQVA 6PAXA 1IN7A 4XSZF 2PN6A 1FV2A 4LR4A 2WZEA 4NPRA 4U88A 3PUHA 1F8VA 2KZGA 3DEMA 2L7FP 5EJ1B 2YU2A 1R093 4F91B 1R4MB 1SFYA 1JUPA 3M1HA 4LO8A 1NUKA 2OD5A 1YHQI 3JBG3 1F15A 4GD4A 2LREA 2RS13 5CYYA 1NA1C 4P08A 5M3FJ 1JMUB 3VDXA 2K46A 1O91A 3CC7I 1B09A 1ON2A 4ASMB 1W2OA 1AR61 3S0MA 5E8AA 3CIHA 4W65A 3TL4X 3OOUA 1RUJ1 1NCQA 3TW7A 1V3FA 3MBWA 1VQ6I 3FHIB 3VBRA 1PGW2 2BW3A 3URFA 4QXBA 1KA8A 3PMSA 3OSGA 5JFRA 5T50A 1R5GA 4AI9A 3F22A 5FIXA 4TZDA 3O0VA 4IVNA 2GA2A 3PL0A 1AZDA 3RSNA 2QDRA 4RR3A 5KR7A 4TV7A 3D5SC 1SLIA 1CWPA 1N1TA 4RHV2 3VYUB 5J6XA 2JVHA 4KU7A 5IK8A 2BU9A 3BTIA 1Z7S2 2V79A 1V00A 3IHUA 2A1XA 1LU2A 3MPPG 4KWLA 1OHFA 4ZY9A 1K5MB 3DXTA 5A1FA 5C4XJ 2UZKA 2XWBB 4ITCA 2XVGA 2R7SA 4J01A 3BOWA 1VALA 2ZAHA 3K48A 1O8SA 2JG8A 1GXPA 2JEMA 3V4GA 4PF1A 1XSQA 1O3RA 1Z05A 1X7NA 1KQ0A 1R1TA 4P9UA 1LE8B 2DODA 4HQEA 1H6YA 4CCOA 1RUOA 2E5NA 3VZJA 1ZR4A 4GJYA 3ETPA 1ON1A 5EIYB 4C2UA 3HD8B 4OAZA 5DUUA 1B8IA 3FM3A 1STMA 1GANA 1K42A 1SPPA 4XIOA 3E7LA 1YIFA 2MYSA 4KYWA 5ANNA 2NPIA 2XKOA 1ZRFA 1BZWA 3KP6A 2FU4A 4UXNA 1DDNA 2DQRA 3ZGKA 2IZWA 1LFBA 3LSTA 3J7AY 4RS5A 4HW0A 2C6SA 2CAVA 3O1RA 4AFCA 3M8FA 2KP6A 3L2UA 4EEFG 2P81A 2Q2EB 2WB1A 3ROUA 1RESA 1W4MA 1JJ8C 2G9FA 3LSKA 2BNOA 5EHDA 5DM7F 4JBAA 3O1OA 3QYBA 2CMPA 2Z69A 3TOJA 2M8GX 1X50A 5FROA 4IGQA 2P1BA 3BZ6A 5HI0A 4MYEA 5GTHC 2E19A 3BPVA 3P3NA 4XXAA 3BKZA 1R1A2 1U5TC 3LOCA 5KVRA 3LOIA 4V2WA 1RL3A 4RS8A 1CR7A 1LEDA 2VE1A 2WO3A 3EYIA 4G6QA 4F52A 1ZZ8A 4OMZA 4AEDB 3KWVA 3HOBA 2BOIA 3HPNA 3KZZA 4EVIA 4QQLA 3I2DA 3L9JT 2EZHA 5HCHA 2JIGA 3QBQA 4AVAA 2VMDA 2PQSA 5IP6A 2DTRA 3QRFF 2ZGRA 3MGUA 4YELA 5D2AA 3THTA 2G0EA 3VBUC 4DZGA 1AL0G 2G4IA 4P5OA 2VQHA 3BCAA 2RNJA 1N1SA 4YW3A 3PNVA 3CBNA 2PG4A 1UN1A 3AG3H 2CQXA 4D0QA 2ZS6B 5ABJC 4EJTA 2RS32 5HXVA 1V9U2 2DFBA 3C2GA 2OA2A 5E8IA 2A6EF 1XNDA 3KYDB 1HN0A 3CMEI 3G1OA 2WAFA 1H89C 1C1FA 2BVBA 4IHTA 4IHSA 2HQAA 3U75A 1RVF1 3J80Z 4P14A 4GKYA 3LAGA 1ZZ7A 2LRPA 1DU6A 1XJAA 1KU3A 2VBZA 3JSOA 1HA8A 4M4PA 3KVAA 3QACA 3V65A 2DK8A 1YRZA 5J3LA 5CLSA 3ECQA 4XJUA 4XJAA 1HLVA 3J81Z 2DCTA 2DU1A 4HZFA 1RKWA 2W85A 3BI3A 3U10A 3O0WA 1OMIA 1C4RA 3OWTA 4QHZA 5D6EA 3MKWB 1HQNA 2DT6A 2CO5A 1OLTA 3PUFA 1POV0 1OVPA 1WCDJ 1J9IA 5L3GA 5GPAA 2IVJA 2E2HJ 4DOZA 2K9MA 3FFZA 2FZ1A 1W0NA 4BE0A 3J7HA 1PVXA 3KD4A 3PTYA 5KHHA 2W84A 1IPJA 3MN2A 5K7ZA 5FBJA 5GZEA 2O9LA 1W2AX 1WRJA 4PJMA 2MGQA 3HPGA 2VXZA 1UPIA 3AZVA 3WGIA 5I0SA 5C3OA 4Q4V2 2P34A 4OFGA 5JI7A 2MSYA 1LU1A 2ZMLA 3K3OA 2XKPA 5JR7B 3DTIA 5FZGA 1CVNA 3SC7X 4W4ZA 1S2BA 2VMCA 1GLNA 2OQGA 4O61A 3K4BA 3RZHA 4WM8A 4XOGA 2JA8J 1WBLA 3E6BA 4GB32 1FOXA 4CGZA 2H6CA 3WNPA 2W57A 2DYCA 1HLCA 1ZELA 3RWKX 4D94A 1VBE3 5C9AB 4C3JJ 4CU6A 4L92A 5HLGA 3UKTA 2UWBA 3HT2A 1DQ0A 1WCSA 2WA4A 4BIOA 2XROA 1Z0HA 3MW3A 3VGIA 3FXRA 5BUVA 3ZRGA 1XQNA 4Y24A 1UNBA 4NRMA 2B45X 3KCXA 3V8LA 4JKKA 4LD5A 1PM7A 3KLOA 4LE3A 3I2FA 3CO2A 1AYN3 1G2HA 4IQPA 2PJRB 3K4LA 2Q8DA 3CCQI 3WODF 1CQ9A 4E4SA 5E3MA 4B1RA 1JUHA 4EN0A 2IA0A 2Q8EA 2VOPA 4O5VA 3N05A 4UF0B 4RAFA 1RRJA 5FB2A 2KLOA 1VI0A 2RMU2 3CCSI 3BQZA 2OV7A 4QT6A 2WO7A 4AHYA 1VP6A 4LBMA 5GLUA 2VCCA 2ZMNA 2MBFA 1BEV2 3AZWA 2IFWA 1UIJA 4LLFA 1G4DA 2Q8CA 4UFLA 4H14A 3C1DA 4CU7A 3EXUA 3W6JB 1IPSA 4U2AA 2VOKA 3DBRB 2WFPA 1UFMA 1H2KA 3TDZC 4UNOA 2R92J 1JOJA 2BV4A 3WW2A 4BE2A 4L11A 2L2OA 5KHJA 1U5TB 2Z99A 3T1LA 1IO2A 1ZN2A 2AS5F 4S2HA 2LTNA 2PFBA 2FXAA 2RC4A 1PIV1 5L36A 4HONA 1VZ0A 2JDPA 2HEWF 3ILNA 2BNNA 4UVCA 4Q47A 2A6WA 3A23A 2YX4A 1ZM1A 1ZLJA 2YBKA 5A70A 1FYKA 3VBSA 2HYFA 1AKHA 4EV0A 2OC6A 4NRPA 4B4CA 1CD3G 3N7MA 3FZVA 4XHBA 2FBKA 3PVNA 1C5HA 5LA1A 4NBQA 4LITA 1BA5A 2FRHA 2X10A 2FF4A 2A5WA 3O3KA 1IGOA 4JQRA 3GBFA 4BZ4A 2WFF1 1COV2 4UAPA 5FZ9A 4XF1A 3VHRA 1YW7A 4E7JA 1RHI2 2BFUS 5F2WA 3L7WA 3POEA 5GZDA 1RTVA 3H8OA 2EIGA 2R7WA 1CONA 4LBLA 2P6TA 5L19A 4AEKA 2Y0MA 4XRSG 4YZ2A 1GOFA 4AG4A 2BERA 2VUMJ 4B7EA 1I50J 2NZ9A 1TQMA 1BBT2 3WU0A 3J9SA 1KDMA 4OWRB 1USTA 4LHSA 3POSA 2VO5A 3ENRA 4HN1A 2XAUA 2ESHA 4HVQA 1WKMA 1MPXA 5JHUA 4L2NA 4BQ1A 4DBQA 1A3KA 2XV4S 5IUQA 2RJ2A 1PGL2 3L2HA 1G3YA 3ZXGA 2R7VA 5ISLA 4ORFA 2VQUA 4D7SA 2R072 4NJ4A 1O59A 1X3UA 3PVOA 4WVMA 4LGWA 3VZKA 2EA2A 1H2NA 1VQLI 2HWF3 2HVSA 3MIHA 2WT2A 3BG7A 4Q4W1 1NG7A 3JAMZ 4O3MA 3F8BA 3I4IA 3HBKA 1PIV3 4QWNA 3FK7A 5A3PA 2D6MA 1R22A 1MDMB 4XAEA 2ZNZA 4QM8A 3P6BA 3Q5FA 1WJ5A 1DZTA 4YYOA 2QKDA 3E6CC 3GTMJ 4QDRA 2LBFB 3MV01 2VB6A 2Y6LA 1TME1 5D8AB 1ND3B 3AP4A 3C8XA 2WIIB 1ZNPA 5FKKA 1NK2P 3ZKUA 5JCTA 1HIXA 1LGNA 3PIGA 2OJED 1KXGA 1JXNA 3V0AA 5FWJA 2QJVA 2VW1A 1XSXA 1HRI1 3ZLIA 5FPZA 1RMU3 2V4VA 3BU0A 3OBRA 4Q0SA 2WNEA 2AQEA 2FCUA 4FOWA 3JD71 3RI8A 2VKVA 1QU0A 5HPOA 4IW3A 2JE7A 2DJNA 2EV0A 4RN5A 2J42A 3VV1A 4C3HJ 5C8WA 2QENA 2V5YA 1UZZA 1IDYA 2CH0A 2CWSA 1W5TA 3WINE 1OFCX 3ORJA 4YEJA 1IG7A 3LSRA 3OL4A 4BJTA 2YGMA 4NROA 1XDUA 5FZ3A 4Y52J 3BR3A 3BCWA 3TEWA 3CC4I 2XSJC 2FOKA 2QE3A 5HCAA 3BT9A 3AKZA 3ZO0B 3UNPA 2G7UA 4I0AA 1LDKB 5I91A 1OLME 2DOFA 5F2SA 3PFYA 1IGNA 2MEV1 1YFHA 5F08A 1YO5C 3H9AA 4Y1ZA