3RDIA

Domain-domain flexibility leads to allostery within the camp receptor protein (crp)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILFYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Catabolite gene activator
publication title Domain-Domain Flexibility Leads to Allostery within the Cam Receptor Protein (Crp)
rcsb
source organism Escherichia coli
total genus 62
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rdiA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3rdiA01
1E17A 5KK1A 1R1VA 1ZH5A 1J3RA 1YYVA 4XBFA 2WC2A 4JTNA 1XGOA 4A0ZA 3BP8A 3TDZC 4IF4A 1QWRA 2HGCA 4YNIA 3I54A 3U0ZA 2FMLA 5D5VB 5D6FA 1QXJA 3TOBA 1XD7A 3WGGA 4DINB 2FQPA 1FYKA 2DU9A 1K7AA 2P5VA 4XF9A 5I8TA 3WTTC 3HIFA 1T6SA 3P9CA 2K4JA 1Z7UA 3DF8A 4G7OF 4YRDA 3JSOA 2H6BA 1C0WA 2MHFA 3K1MA 1JUHA 3FHIB 1IN5A 3U2RA 1LQ1A 3C3VA 2H6CA 2ATFA 2KRFA 5FLJA 2DPUA 1XRUA 1FYMA 1FT9A 2BGCA 1J2XA 4XETA 4I0BA 1HSTA 4KL1A 1ZAOA 3QU6A 2FU4A 4FX4A 2O8QA 2BV6A 2DW4A 1FZPB 4EWDA 4KU7A 5I8SA 4MEYF 1TQ5A 2XHKA 2RDPA 4ESBA 5J7MA 4YFKF 2WFPA 1ULYA 3EO6A 2Z99A 3VODA 1U8RA 1V3FA 2EWNA 2ZKZA 2MC3A 1E2XA 1QNTA 2J5OA 4LTAA 1ZLKA 4NVPA 1ZREA 4E2GA 5D1IA 3WTZA 2DAOA 5D4RA 3BPZA 5EZWA 1HW5A 2M45A 3MZHA 5FCCA 4J1XA 1LEBA 1F4KA 1KYZA 1FYLA 3V7RA 1T39A 3CTAA 3GLXA 4OLLA 2KJCA 1UHWA 2IA1A 4MGIE 3KP5A 2XKPA 1ZVFA 3BROA 3I59B 1KU9A 5BMZA 5LGUA 5LHGA 2EFQA 1VJ2A 3F8NA 3HRUA 2W84A 4XFFA 3GFIA 4LB6B 1RGSA 1HKTA 5ILUA 1GXPA 1XGMA 4Y13A 4ENKA 3GBFA 4HV6A 4I7HA 5FGMA 3Q9SA 3T8TA 4M73A 1IRFA 4WVZA 2UY8A 4MEXF 3RTRA 2QVSB 4FAHA 4UVBA 2ZXJA 5I0UA 5CVVA 4BAYA 4WX9A 1PUEE 1GVJA 1KA8A 2B5HA 2ESNA 5FD6A 5KVRA 4BHBA 1FSHA 1YWKA 1WA4A 1YW7A 3T1BA 4M74A 3Q9VA 2VECA 2YX7A 2IJLA 2XVCA 5D4SA 1BC8C 1TNSA 2XL9A 3Q5FA 2O03A 4G6DA 3MAJA 3NRVA 3W6KB 2AS5F 4GCVA 3E5UA 4GXOA 3O6BB 1HW1A 5BY5A 4M72A 4PCQA 4X6RB 3ZDSA 2ZNYA 1YFUA 3FWEA 1DPUA 1UCRA 1FY7A 2XKOA 1T98A 1Z9CA 2A68F 4OIRF 3NL1A 2XAJA 4EJUA 1XE7A 4KWKA 1IN7A 3GFMA 1YIOA 2F5EA 4MGYE 4UVCA 3BJOA 2XUBA 3KP2A 1ZHFA 1YUDA 5F64A 3T8RA 4HN0A 2OZUA 3ZQ7A 4EJOA 4OFGA 2DQLA 5FFXA 5KHHA 2RGVA 2EA4A 4LG0A 2K0GA 2MPFA 4ZU7A 3RKYA 3C3WA 3ZMDA 2ZJ2A 1FOKA 2XLAA 2QM3A 4IPAA 1IUYA 1IN4A 4HVRA 4H7LA 1FSEA 3LAGA 2W25A 2Q8KA 3EHKA 4Q4ZF 1QZZA 3TO9A 2C6YA 5E8GA 1BI0A 1B59A 4WXDA 3F3XA 3QP6A 1Y3TA 2XAHA 2XROA 3TO7A 4EMSA 3BU7A 4FT8A 5LHHA 3LQRA 1BC7C 4IESA 5C8WA 5JFRA 5BXXA 1S7AA 2YR2A 4A0XA 4AVBA 3F6VA 1J5YA 1DGRA 2DK5A 4Y17A 5HOOA 4E70A 4XFAA 3I71A 2KXLA 4R52A 2OA2A 4L2NA 2PMUA 4MV2A 1JHFA 1FX7A 3I53A 2ELHA 2BNNA 3J80K 4QM8A 4N9HA 3V7CA 3MFKA 1Q5OA 4LLGF 4KT5C 1IPJA 1WSUA 1XSXA 2GAUA 1WRJA 3PQJA 2HYFA 2GWRA 1EH7A 1YW9A 3ISPA 4HSJA 1X8EA 2CO5A 3HTSB 3H92A 2VBZA 1BOAA 4YIFA 4IHSA 3ACLA 3RIRA 5D8KB 2HOEA 3F23A 3EQEA 3E5QA 4KMUX 1KU7A 4IRGA 1XGNA 1Z91A 2ISYA 3CJXA 2QQ9A 1D8JA 2VOPA 3U9GA 2LNBA 4IRHA 5ILSA 2L01A 4HDUA 1ZG1A 1XDSA 3VEPA 3R60A 4AVAA 2D5FA 5K8SA 5I93A 2R7DA 2ZNZA 3FF5A 4P96A 1T38A 4WXHA 3FZ3A 5KBFA 1PDNC 4XFBA 2A3SA 2VT2A 3WTUC 3UKTA 2XAFA 3KZZA 1YLFA 2QBYB 2DCTA 3OV8A 4Q0PA 2Q0AA 4RGUA 1F5TA 2BNMA 1ZGJA 2P6SA 1LJ9A 4G7HF 2RC4A 4HZFA 1U78A 3FXUA 3HT2A 1CGPA 3WW3A 2OPKA 3EDPA 3ULQB 5L3DA 4CZZA 2JSCA 4PGGA 1LB2A 3HYIA 3KP7A 1YFWA 2D1VA 2MNGA 2RQPA 3M8EA 5H20A 1VR3A 5HI0A 2IXKA 4AD9A 3ECHA 1ZRFA 5JR7B 2MLGA 5EFUA 3O3KA 5AIPA 2JPCA 4QXKA 2V79A 2D1HA 1FXZA 2ACJA 1IAWA 4CXFA 1K79A 3MQ0A 2L4AA 4ESJA 1R1UA 3V4GA 1ZZ7A 2D2WA 3HHGA 1NZCA 2LDUA 2AXLA 4HLYA 5AVPA 2PLYA 2FSWA 2VC0A 1HXDA 2PA7A 5I0RA 3R61A 1Y0UA 3FFQA 5E1ZB 3C1DA 2GU9A 4F8AA 3BZ6A 1LKNA 2O3FA 1CF7A 4IEOA 4AWXB 4HQEA 4MZUA 2WWYA 3K1NA 3E6BA 3WU1B 4P9GA 1QZYA 3R0AA 3EETA 1O3TA 4O9EA 2O1QA 1MGTA 2FE3A 1TQIA 3VOEA 3H1YA 1SFNA 3KZYA 4MX3A 4Y15A 4DNCA 5HLGA 3IHUA 1HKQA 3BDDA 2XAGA 5JR3A 2L54A 4OOIA 1XB4A 3M1EA 4LJZF 5AIQA 3U11A 3L2HA 5LLQA 1UCXA 4U7DA 2MBFA 1YFHA 3WU0A 3J80Z 4HV5A 3EBRA 5D5WB 2EV6A 4ZYHA 4ORFA 1I1GA 4E2QA 1SD6A 3V7SA 2VQAA 3WG9A 1YG2A 5ICFA 4E2SA 3BB6A 4GYGA 2VBWA 3OD0A 2P8TA 4EM0B 4HOBA 5KHKA 3T5XA 4MHGA 3H1WA 2FQ3A 1FBUA 2LKPA 4KICA 5CVRA 3M9AA 3E6CC 4M71A 4AIJA 3MPBA 4CICA 2VE9A 1IRGA 4LA2A 3CEWA 5DV5A 3MYXA 2E7XA 4QGLA 2MA3A 4HAMA 3RKWA 1IXSB 5HS7A 2ET7A 5J8CA 2IT0A 5HS8A 5DD4A 3L00A 2A6EF 4M9SA 3IRQA 3I7DA 2DQRA 4DQ2A 1WQ2A 5I8YA 1O57A 3HRSA 4MQVA 1SMTA 1EH8A 3H9AA 2P4WA 1B4AA 3V8LA 3MDPA 3ST7A 1W4MA 1STZA 5HLIA 3WW4A 3M7GA 3U10A 2RKHA 1R22A 5LEKA 3DPTA 3NJZA 2OA4A 2KIMA 1B6AA 3S2WA 1W7PD 2HS5A 5CADA 3K0LA 5E8IA 1ZLJA 1FLIA 3KLNA 2VXZA 4HA8A 3E6DA 1IZ1A 2BE5F 2IXJA 1Z1DA 5EEHA 4YG2F 4LLNA 1KQ0A 5FLIA 3RKXA 4O5VA 5HDKA 1D8KA 3E5XA 4RD7A 4QWQA 2FRHA 1XN7A 3BPVA 2WTEA 4OMZA 3QACA 4UXAA 3IKVA 2Z2SB 3ZP5A 1QBJA 3NSTA 4WBBA 3VHRA 1T0FA 3ZMTA 3OF1A 4LG0B 5K5OA 3ABTA 1GQHA 1SFEA 5BV6A 3TOAA 3FHZA 2H27A 2IW5A 2JPBA 2N7GA 4LGWA 1WGPA 4S05A 2V1DA 2Y75A 1UIJA 1ZG5A 3JAMK 1HW2A 4ENNA 2PTMA 3R4KA 5TJJA 1FC3A 3HTUA 3EJKA 2A6HF 2EA7A 3SCGA 1SMYF 4LA3A 4F7ZA 2XV4S 4HVOA 1U5TA 1ONVA 3SZPA 4QM9A 1IN6A 4YIIA 2F5CA 3ES1A 1B9NA 4RB1A 2FMYA 2L4MA 1PM7A 1O7FA 3ZMZA 1CAUA 3RPUA 2UY9A 3CUOA 4R8HA 1H1MA 1QY4A 3KGLA 4HX7A 4KIGA 3GYDA 1G3TA 5FO5A 3L2CA 1AWCA 1Z6RA 3OCPA 2KIUA 3NEUA 1L3JA 1DZTA 3LOIA 1TW3A 4N0BA 4IEWA 5T3NA 3R6SA 3DXJF 3NW4A 1DDNA 3PNAA 3F22A 2IXCA 4PJYA 2RNJA 3IWZA 3KE2A 3EYIA 5E16A 4KU8A 1ODDA 4EWEA 2QYOA 3M3IA 4QGNA 3E97A 2YSRA 2RV8A 5K5RA 1JXSA 2IA0A 3G3ZA 4L9NA 3TO6A 4P9UA 4A6EA 2OZJA 1ZGAA 1UFMA 4MGKE 3K1PA 2Q4SA 2E7WA 4UV8A 2GC0A 4EM2A 2PHLA 4AIHA 1MJAA 2VODA 2ETHA 2JT1A 4Q48A 1O3RA 1QQIA 4HLXA 1EP0A 1IW7F 4I09A 3N4MA 2LSOA 5D5UB 2ZMEB 2DBBA 1LDDA 1RI7A 1XMKA 3F72A 2Q1ZB 2HR3A 2EV0A 3ES4A 2Q0OA 4HVQA 4NHJA 4HLTA 5KHGA 2UZKA 4QGMA 3F8MA 2PAEA 5CVJA 2CQKA 2PMHA 3H1MA 3ZMVA 3TQNA 2GC1A 4L5JA 4UVAA 3CUQA 4UBGA 3G73A 4HF1A 5LHIA 5D5XB 3HQXA 3HSRA 3SQNA 4YARA 4EV0A 4RB2C 4R1HA 3LQQA 3BOQA 3RDIA 4XSXF 2DLLA 1ZRCA 2IC1A 4NB5A 3WTYC 1GXQA 3U1DA 4TLFA 4LUMA 4META 3C7JA 2QCSB 1LVAA 2BNOA 2CYYA 3V8JA 5DEQA 4BHPA 2CAUA 2K86A 2D93A 4B09A 3CL1A 3IC7A 3CO2A 3LZZA 4KN7X 3TKYA 3H7JA 4RGSA 4XF4A 1CF7B 1H9GA 2LF7A 1OFNA 5FLXK 1BI1A 3JSPA 3LWFA 4CYDA 4Z07A 5DD8A 1WKMA 2MH2A 1U3EM 4PIXA 1CAWA 1RNLA 1YS7A 1ZZBA 2XAQA 3JAMZ 1O5UA 1WLTA 4M6XA 4XLPF 5ILVA 1O3QA 2PQQA 3IKTA 2V9VA 3BJAA 2NYXA 1UD1A 2Z33A 4EROA 3EQLF 4RB3C 1TLHB 1OYYA 1LDJA 1JHHA 2GZWA 1BI2A 3CLPA 2M5WA 1YS6A 2ZKLA 4XF1A 2ZBKA 5JHUA 1NXMA 2UXXA 3LFKA 4B29A 3WTVC 3CF6E 2EAAA 2ZO4A 1ZYRF 2IA2A 3JW4A 4I01A 2B8MA 1FWZA 1XDUA 4ZU5A 2VE8A 3GYHX 1Z05A 2JTVA 3H7YA 2ETEA 1QXRA 4BH9A 1TQPA 4MTEA 4EWAA 4XRFA 5J3UA 4KWJA 3SCFA 4LMYA 3SZTA 2P7VB 1IXCA 4PIZA 2VONA 2K7LA 1J3PA 2HZTA 3BWGA 3FMRA 2K27A 4YFNF 3I5UA 2CW0F 3ROUA 2FBHA 4O6JA 1MD0A 5ICCA 1I1SA 2VOOA 4PDKA 2BYVE 3B02A 1REPC 5HVQC 3GUDA 1HBXG 4A12A 4AQ6A 4Z82A 1EY2A 3JTGA 3KP6A 5E1WA 3WTSC 1BIBA 2ZMEA 2B0LA 2XIGA 4XEZA 1EPZA 4WF2A 5LBQA 2PAKA 1ZNPA 4Q0SA 3E6MA 3HOTA 3TDUC 4TV7A 2IXHA 4XFHA 2C0ZA 4ZZLA 3KSCA 2E1NA 2X4HA 2EB7A 4KN4X 3VB2A 1ZX5A 3GF2A 2FF4A 4XF3A 4MNUA 3DKWA 3MWMA 4CGZA 3M70A 3EUHA 3B73A 3D0JA 5JAXA 1Q43A 2COMA 1LRHA 1R00A 2GQQA 2PAMA 4RAYA 1OYIA 4XSZF 1X3UA 3K9TA 2IXLA 2NRAC 3PQKA 4FAGA 1J3QA 1Z6TA 2YU3A 2PN6A 3ETQA 2VT3A 4ON0A 5A2QZ 5CYVA 5ICGA 4JV4A 4MH0E 3GX4X 1VP6A 4AQ2A 2QLZA 2D45A 2W85A 4IXAA 1V70A 3J81K 1MJ9A 1IXRC 5C6CA 4L11A 2OYZA 3P7NA 2HKOA 1PMIA 5FLXZ 2H0VA 4HMZA 3S7IA 3DN7A 4UXNA 2Z5UA 1DPRA 1XGSA 1CAXA 1S29A 3F8FA 5F1RA 4G94A 2EVXA 1USTA 5AONA 2E9QA 1U5TB 2PEXA 1B9MA 3SXYA 5FDBA 1FP1D 5ICEA 4P5OA 1CX4A 1O4TA 3HRTA 1OKRA 2L3DA 4LUKA 1P92A 1DUXC 2WV0A 5CLSA 1CAUB 2P17A 4IERA 2Q30A 1ZARA 4MGZE 2O6GE 4ZYEA 3CJNA 5I91A 2GC2A 2PYTA 1R58A 4IEXA 4R79A 3SCHA 2FXAA 1VTNC 4BYYA 5FD5A 1MKMA 5L3CA 3IDBB 3LWCA 1CAVA 3R0JA 2HDCA 1YFYA 1P6RA 5D6EA 3KEOA 3BCWA 2GIVA 5CVUA 3H50A 2KJBA 3MZYA 3AAFA 1LR5A 3FMSA 2JRTA 1P2FA 4KA4A 4L18B 4QX5A 4YYOA 1EV7A 3DV8A 1GQGA 1FNNA 1FPQA 2FBIA 3FMQA 4KNYA 2GXBA 1YQAA 1D5VA 1DZRA 1ZZ8A 3K2ZA 3GZ6A 2OD5A 2IVMA 1UB9A 1I6XA 2GA2A 4A6DA 1DP7P 5EEGA 2IXIA 4MQ9F 2K4BA 2CSOA 4J1WA 2UXNA 4IEVA 3WTXC 4EJVA 2QJVA 5BPXA 2M8EA 1U12A 1UHMA 4Z2YA 4CDGA 5LRSA 4MTDA 5K5QA 4Q0UA 2NNNA 2ESHA 5DYMA 4NQWA 3I4PA 1XMAA 1ZRRA 4EJTA 3HUGA 5DUKA 1RIOH 4IVNA 1J1LA 3FJSA 2VPVA 2M30A 1P4AA 4M9ZA 4FX0A 4QLCU 1UW8A 3F8CA 3DFGA 4LB5A 1HSJA 2UWMA 2CGPA 2KKOA 1MDMA 2XLGA 1IF1A 2QENA 2YX4A 1OMIA 2V6CA 3FXRA 5HLHA 4L0ZB 5CJ9A 1WI9A 3CUQB 4YSFA 2RVCA 5JSPA 4LLLA 1LEAA 2L02A 4Q29A 4KFCA 5JVTA 1GHCA 4D7SA 4RAZA 3DEUA 2NNYA 3K69A 3SHRA 4IEUA 1J59A 4HX4A 4KDPA 3FM5A 2P5KA 1NHAA 2BEOA 1P4WA 1X82A 4LULA 2HQNA 4HF0A 5FQ0A 3QOPA 3ZN1A 1JGSA 1BN5A 4HN1A 3WTWC 3SMHA 1OR7A 2Y0MA 4XFIA 5KHJA 5TRDA 1F9NA 1S6LA 3OTFA 1B1BA 3I58A 3KGZA 4I2OA 1H9TA 4L9VA 1PP8F 3J81Z 2M1BA 4IETA 3ABUA 2VBXA 5JCTA 1J9IA 1CAWB 4LLOA 4EQQA 5LGNA 4OIPF 1KU2A 3J7AO 4N9IA 1W7PA 2CV6A 2YPRA 4KIBA 4OMYA 3EYYA 2XL7A 2MLKA 2PHDA 1A04A 2STWA 4ONUA 4X6QB 2DK8A 3GW2A 3M8FA 3D0SA 4U0WA 4O3MA 2MD5A 4WWCA 4BNCA 3TNQA 4KIFA 1K78A 4ZYDA 2Q2EA 1RC6A 4PIYA 1YO5C 4A5MA 2MH9A 1QPMA 1R23A 1OD5A 3ZPLA 5E1RA 3QRFF 5BPDA 4HBLA 3H3UA 3KCCA 5I0TA 1YLLA 3MEXA 5LRRA 2LF8A 5DCMA 4P55A 4UHTA 1UPIA 3O14A 1RZ4A 4I3PA 5IT3A 2FNPA 2NS0A 5E18F 4LK0F 4EJWA 4I0AA 3FXQA 2Z3YA 4Q0QA 2EFWA 4KUMA 2R7FA 2IPQX 3WGIA 1TW2A 1U5TC 1FI2A 1KQ8A 4K8FA 5IT9Z 2PBIA 5HDGA 4KWLA 5LEJA 1XCBA 3OOPA 3L7WA 3D82A 3VFZA 1UIKA 3KEQA 4LD5A 3N97A 4HBNA 2O0YA 4GULA 3L9FA 4AXOA 5DCFA 1USSA 3RYKA 1BIAA 2QZ8A 1HQCA 3GWZA 2FA5A 1ON1A 5BPIA 3ZMSA 3OGJA 5FFZA 2ZFWA 1P4XA 4H0EA 1S3JA 1RUNA 2CFXA 2V09A 2XGXA 1NE4A 3S0MA 4ETSA 3SHFA 5E1XA 2A07F 2ET1A 2HTJA 1TBXA 1BI3A 2F2EA 3WODF 3H3ZA 3NQOA 1PP7U 2D5HA 4HQMA 1J75A 4Q5SF 2NAZA 4WXCA 3RNSA 4XLNF 2HWVA 1F1ZA 1YFXA 1R1TA 2HEOA 4IJAA 4B8XA 3ML6A 2G7HA 3NVCA 1JE8A 5K1YA 1G3WA 1K6OA 4RGRA 4M9XA 1G3YA 1SD4A 5A2QK 4I02A 3CO6C 4MGRA 1FP2A 5ERIA 1W5SA 4IEQA 4L9TA 5BQTA 1V4RA 2OQGA 4ASNA 4ENMA 2K9ZA 3DL3A 1ZZCA 4EVIA 2XLFA 3REOA 1FBQA 2EFOA 4UV9A 1XE8A 4IRIA 4XFCA 1D3YA 2KIFA 1X7NA 3IDCB 4AIKA 1U6GA 4BHCA 3USSA 4OINF 5DDGA 2ZCWA 3CLOA 1U2WA 1SD5A 3CUQC 3IWFA 1CAXB 3KP3A 2Z9OA 4U0VA 6PAXA 2VN2A 5H6RA 2IP2A 3D5LA 2W24A 3JZVA 2K02A 2OAZA 3H8UA 2HKXA 4XF0A 2DFIA 2B9UA 1FBSA 2G9WA 3KFWX 3G7DA 3QP5A 3HRMA 2OU2A 2IRFG 5J48A 1LDKB 3FZVA 5JSRA 4RGXA 3PFIA 1BM9A 2A61A 4HYEA 4RS8A 4HSLA 2BBYA 3HSEA 4ZYGA 2GH2A 4FBFA 1O3SA 3L09A 2F5FA 3RZZA 5HS9A 2QNKA 1J0RA 1CAVB 2FOKA 4OIOF 4KMFA 4PGHA 2DO7A 5L3FA 4FHTA 2GA1A 3C18A 1R5GA 3GFJA 2CG4A 4CHUA 2P7CB 2VC1A 3IBMA 4U88A 3LA3A 3GVAA 1SFUA 4JK1X 2OQRA 3PVBB 5FPXA 4BIFA 2ADUA 1SFXA 3I59A 3WGHA 2QVOA 1SEFA 4A5NA 1BBYA 1ZRDA 1EYBA 5L3BA 2QDRA 4D0PA 1I5ZA 3FM3A 4UUVA 1ZZ6A 2HYGD 2P5LC 3HHHA 4HF2A 2DI3A 1TQMA 2G7UA 1QGPA 1LNWA 1KYWA 4Q0VA 5L3EA 1XSDA 4JBAA 4BQAA 1YTYA 4M6YA 1L3LA 3DP7A 4AVCA 2OZ6A 4JTOA 3ZN0A 4IHTA 5CVIA 3I0TA 4BXUA 2HFHA 4MUVA 4EGYA 3T0YA 3ECOA 3GEZA 2OBPA 1MDMB 5E20A 1RL3A 2EFNA 3S7EA 2DT5A 3TNPB 3W6JB 3WE3A 3GXOA 3JTHA 2JZYA 2DPDA 3DQVC 4IEPA 1Q1HA 4QMAA 1OPCA 3IRRA 4L9JA 4G6QA 4UBHA 5CU1A 4G9YA 5BOXA 2F4PA 4IEYA 3PLQA 4D7TA 1ZZ9A 3LA7A 3IIAA 2M87A 2PJPA 3SXWA 4LFUA 3HSFA 5ED4A 1O5LA 4HW0A 3I64A 4I98B 2D40A 1ZG3A 1SQ4A 4XFGA 3E3VA 3GFLA 2DTRA 1RUOA 5FQ0B 5JI6A 3WW2A 1L0OC 1QO0D 3F21A 3RYPA 4RB0A 1NE6A 1R36A 3BPXA 5L3GA 4OU0A 3QAHA 4WZCA 2O8XA 3ELNA 4L0YB 2UYAA 2H09A 3QPHA 2TDXA 4KYWA 1AOYA 2QQBA 1W5TA 4S04A 5LGTA 1I27A 3LAJA 1YW8A 2W57A 3KLOA 2QWWA 2FEZA 2XASA 1H0MA 2GXGA 2HTSA 4AVPA 3RPQA 2ISZA 1W7PB 2HQRA 3QPTA 4ZH4F 4HDVA 3HOSA 3F6OA 1G6NA 2Y0OA 2QQAA 2X0LA 3RJPA 2PG4A 1OI6A 1TNTA 3KETA 4GGGA 1J58A 2EK5A 3ERED 1KU3A 1R5HA 4OIQF 2HJIA 2PFWA 1R7JA 5HDNA 2Z69A 1K78B 1S8NA 3KP4A 2E1CA 2GC3A 2EV5A 3LA2A 1NYWA 3P9KA 3HT1A 1T2KA 5FLHA 1XSVA 1Q3EA 2FNAA 4LEJA 5DUIA 4PZJA 1ON2A 3LAPA 4EGZA 3KMHA 1J7KA 1OYWA 3IL2A 1TTYA 5I0SA 5DCMB 5D8LB 2PFBA 1Y9QA 4A0YA 1KGSA 4ZU4A 4O9GA 2RN7A 3BJ6A 1XCVA 3V8KA 2QUFA 4WCGA 5H6QA 1IN8A 4YFXF 5FPZA 5J6XA 3CDHA 3O2PE 4A2UA 1G4DA 4ENJA 2F5DA 1KQ9A 3FE5A 4G8XA 4GYIA 1BJAA 1SD7A 2STTA 2Y48A 5IT9K 5E17F 3QU3A 3ZMUA 2I45A 3NKTA 1MZBA 5JSOA 2J5PA 2V1UA 4HX8A 3RI4A 3BY6A 5FB2A 3WW1A 2PI0A 2A69F 2V1XA 1IPKA 3GO5A 1G3SA 1HKSA 4CO8A 1O7LA 1YHFA 2PQ8A 3FX3A 4G7ZF 2H94A 2EJRA 3MCZA 2EA2A 1RTVA 3ELKA 5BUVA 2CWEA 4UNOA 3P9IA 4LK1F 1MJBA 4JVAA 3BALA 4K2EA 3GZ5A 5KHIA 3DPLC 5J8FA 2UYBA 3SFZA 3LSTA 5BS6A 4JQFA 4WK8F 2P6TA 4ESFA 1SAXA 1X8MA 4IEZA 3RYRA 2R3SA 4L5IA 1H1IA 3UKNA 3TGNA 2XRNA 2O61A 1ZN2A 3COAC 1DGWA 3WE2A 2QBYA 3F8BA 4U0YA 3CO7C 1EH6A 4U7BA 2FBKA 2VBYA 4GO1A 4P9FA 4ZZDA 4EM1A 2EFPA 2CAVA 3UKVA 5F6FA 1WWXA 2A5YB 4Q47A 1S7OA
chains in the Genus database with same CATH superfamily
2DYSH 4RHV1 4UB6C 2EXIA 5DXDA 5L9BA 4AFCA 1CJDA 1WGXA 2XJTA 2QF7A 3T2TA 4JTNA 4NHMA 4A7ZA 3BP8A 1RITA 1AR71 4DEQA 4LIVA 1W8UA 4QU1A 1MVEA 1MBEA 5D6FA 5FZ0A 2VUCA 2F4MB 3PUIA 1FYKA 2DU9A 2VBPA 2YUSA 1K7AA 5TGTA 1FNZA 5FZEA 4XF9A 4YZ1A 5I8TA 1T6SA 1AR72 1DDLA 2JJ7A 4QDQA 2QEXI 2MHFA 3FHIB 1TT0A 2HXIA 3C3VA 1TT5B 3ZN6A 1ZA7A 1H2LA 2K9MA 1J2XA 3CZUA 3S57A 2RREA 1IOAA 4LHNA 2FU4A 1UU5A 2BV6A 2DW4A 4EWDA 2HI3A 3ITQA 3FUQA 5I8SA 4MEYF 4M00A 2BGPA 2XHKA 3NWTA 5J7MA 4YFKF 1ULYA 3EO6A 3T2QA 5EYXA 1V3FA 2EWNA 1E2XA 1WLWA 1UPSA 1H30A 3C7GA 5D1IA 1Y6IA 1SCSA 4AHYA 3WF2A 1GBGA 3HOYJ 5EZWA 1RVF2 2EINH 1LEBA 1F4KA 1W3VA 2J22A 3O1OA 3ON7A 3O1TA 2EZKA 5FZ8A 4OLLA 2VW0A 2XVGA 2EF6A 1BEV2 2IA1A 4Y26A 3WT3A 3KP5A 2XKPA 5KCMA 4CCKA 5DTDA 4W65A 3I59B 1KU9A 5BMZA 4F92B 4U2AA 3KVAA 2EFQA 3JQWA 3F8NA 2NOJB 1P7JA 3QQAA 4XFFA 3OPTA 4M3FA 1HKTA 4BUPA 3MEPA 1GV9A 3WG2A 3M8JA 2Y38A 3BTJA 1N25A 4I7HA 5EG0B 3VZKA 3Q9SA 3ENRA 2FOWA 1H9PA 1RHI3 4WVZA 1Z7S1 2XGEA 4MEXF 1MQTC 1D7PM 3JRIA 2HWC2 5F08A 4DZJA 3RFRA 1SLIA 4NHXA 4AEDA 2ESNA 2P6HA 4LO6B 1GVDA 4HNVA 3AYEA 3HOVJ 2EIMH 4A3FJ 1YJWI 1YW7A 1XNTA 4M74A 1HC8A 4QQ2A 3VBOC 1AF9A 3I2KA 3RZLA 1V5FA 5A7WB 3Q5FA 2W1SA 2R063 4G6DA 3GLLA 3W6KB 2AS5F 2VKDA 4QKDA 4XAEA 4QTRA 1AHSA 3P1IA 3L2WA 5L73A 4GXOA 3O6BB 1A8MA 3VBUA 5BY5A 3S1MJ 3EMRA 4LHLA 3DKYA 4GMP3 2XBO3 4ZDPA 1DPUA 3OYHA 3SC7X 2XKOA 2A68F 1VQ9I 3ZXAC 1ALYA 3VD5A 3LSDA 1IN7A 1VZ0A 2O14A 5A7OA 3MKLA 2Z79A 3GFMA 2F5EA 2D6PA 2UURA 2L9SA 3BJOA 2XUBA 2L7MP 2Y69H 1A6IA 3IAPA 4HN0A 5EHDA 4EJOA 5KHHA 2RGVA 1IS5A 5LATA 3RKYA 1R1A3 3ZMDA 5IWFA 2XLAA 3K77A 4FQZA 1Y9MA 2GN3A 1GZ9A 4IPAA 2FX0A 1IUYA 4HVRA 4XRSA 3LAGA 1MEC3 3WP3A 5K4LA 5A3TA 2C6YA 5E8GA 3HC7A 2XAHA 3TO7A 4AF9A 2ZKNA 2R042 3POEA 4JQRA 4BK5A 3J7YJ 4IESA 3SJMA 4DY5A 2D44A 1UOJA 1GZWA 4AVBA 1J5YA 3RI8A 4Q4Y2 2DA2A 4L2NA 5H9PA 5E3MA 2L7FP 2L7KA 1G86A 4P08A 5FY0A 3J80K 3M4FA 4QM8A 1OUSA 2M3AA 5ABJB 4DRRA 3MFKA 3HG9A 4WM8C 3OYDA 2VR4A 2HYFA 4BOWA 4HSJA 3Q8BA 3KT4A 3HTSB 5K0UA 3NNGA 1BOAA 4YIFA 3ACLA 3UL2A 1AKHA 4QDRA 4Q4X3 5D8KB 4XONA 1WLCA 3LFIA 4IV1A 3KLSA 2QQ8A 2ID6A 2R061 1PGL1 3T2OA 2LNBA 1HCRA 2L01A 4HPKB 1NQDA 1FV2A 1GYKA 4OHYA 3MBWA 4XKVA 2WQ8A 3VEPA 2OPTA 5I93A 2WAAA 3D5SC 2R7DA 1IJWC 4GMP1 1T38A 2UWCA 5CPRB 2ELJA 1PGL2 5KBFA 3AVRA 4XFBA 2A3SA 3JRHA 2IGNA 3KZZA 2QBYB 3WY6A 1GDTA 2IVJA 1XC5A 3Q8EA 3VD7A 1RUF2 1LJ9A 4G7HF 2V7FA 4AYBN 4BQXA 5DDJ3 3HT2A 5IJRA 1E3OC 2DFEA 3S8PA 5GLVA 1BCXA 4A69C 2VUJA 2JSCA 3BZKA 3KP7A 1R5ID 2D1VA 1YFWA 2MNGA 2ZXQA 5H20A 4XMIA 4BIOA 2AEYA 1R1A1 3ECHA 2HVRA 2MLGA 4E8DA 1AL22 3K4CA 1UY4A 4QXKA 3HN3A 1MEC1 4LMFA 2ACJA 3OGGA 4XABA 1VBE3 4CXFA 1K79A 1OFCX 1I5PA 2FDHA 3KEYA 4II3A 1ETKA 2K9NA 1AJKA 5C3EJ 1COV2 3DBHB 3MHZA 4RA2A 1QJY3 2HYKA 2LM3A 4HLYA 5AVPA 2PLYA 2FSWA 3WVJA 1HXDA 1YX3A 1VAMA 2BHYA 2XWJB 3FFQA 2VNGA 1K12A 3H5AA 2VOTA 4ASLA 5B1AH 1YIJI 2XJQA 4UWDA 5GZFA 3A21A 4IEOA 4UW6A 1PVEA 2K5CA 3K1NA 5IK7A 5FK7A 3HOWJ 2HQ5A 3H0OA 4TWTA 4O9EA 3N35A 2CMPA 2I2SA 3WP4A 1O4ZA 5FKCA 4MX3A 3IHUA 2A71A 1W36C 2XG3A 3WDXA 4Q4X1 1MSEC 2F6CA 2L54A 1ND2C 1V6MA 5AIQA 4COYA 4RM2A 3CBNA 1LHOA 1UCXA 3K46A 1GP4A 1J1TA 4B43A 3WU0A 1OURA 1Q8OA 5FOBB 4XRMA 3EBRA 3F0CA 5F3GA 1UZYA 5D5WB 2DYRH 1AYN3 3TBDA 4W8JA 3WG9A 4UUSB 4LOTA 3KV6A 3BB6A 3OSDA 4PDWB 3DYMA 3OD0A 1OD3A 4MHRA 2IBDA 1IKQA 1P8JA 4HOBA 4DEVA 3T5XA 5CFCB 4E7JA 1LHVA 2LKPA 4M3CA 5FRAA 3AL0C 4BDZA 1W90A 5FPVA 4LA2A 4IO9F 2NM1A 3PL0A 4HAMA 1IXSB 1U9OA 1FMD3 2IT0A 5HS8A 5DD4A 2XB5A 3BQZA 3RG0A 2ZGPA 5GPCA 2ZMLA 3I7DA 2X5IA 4OVEA 3DWLE 5FP8A 2WB1N 1SMTA 1TVGA 5BNPA 3OIPA 4BE3A 1U9NA 2DFFA 4XC9A 3AYCA 1QJY1 3GZAA 2DDAA 4CDWC 4NOTA 3TL4X 4XUNA 3DPTA 2BP6A 3J7NA 2OA4A 3QH6A 3ZFFC 2XUMA 3HQUA 2V26A 4QQHA 2CL2A 4UFHA 3K0LA 5E8IA 1I3QJ 4HA8A 1NAEA 3VBRB 2C1FA 1HOMA 1KQ0A 5FLIA 3RKXA 5AVAA 1U5ZA 1D8KA 2D43A 5FYSA 3WQ7A 1XN7A 2CQXA 4YW3A 3WU2C 2VKHA 3ZP5A 3I2JA 3VHRA 4LG0B 2HNHA 2CTVA 1XQNA 1OC1A 5FYHA 1FNYA 1NK2P 2QQUA 1SFEA 2QE3A 2P81A 2H8WA 2XWBB 5ISLA 1LKXA 3WLUA 2BXYA 1VMFA 4LGWA 2V1DA 1MZEA 3URFA 3WINE 3EJKA 1OKOA 3AG1H 1L7LA 2WUHA 3SCGA 1AYN1 1LOFA 1CIWA 3LGRA 4X6AJ 5J1UA 2Z4FA 4QX0A 3G6JB 3SKVA 2Z16A 2VPRA 3S17J 1T33A 3O12A 4FPHA 3AMPA 2FMYA 1XTAA 1PM7A 4RLQA 1O7FA 1JS9A 3ZMZA 3RPUA 1H1MA 5FXVA 5EF6A 4QWNA 1UAAA 1H88C 4P9JA 4IQ4A 1WD3A 4IEWA 5T3NA 3NW4A 3K4ZA 3A4CA 2A5ZA 3CCJI 1KFXL 1ZYBA 1STMA 3HPGA 3ATGA 3GALA 2IXCA 4F93B 4DXZA 2CU5A 2LROA 3HWJA 1ODDA 2RDSA 4EWEA 5KNLA 2WIIB 1LGCA 3OYCA 1Z78A 2RV8A 1JXSA 1QJX3 3G3ZA 4JRAA 2H1LA 3TO6A 4A3LJ 1ZGAA 2RMU3 1JZ7A 4MGKE 3K1PA 5EJZB 4AIHA 4ARXA 2VJ5A 2ARCA 1LE8A 4XRSG 1JZ3A 1ND3A 2P3IA 1S2EA 1IG0A 4G12A 4PJJA 4E7ZA 1XG1A 1A78A 4XJUA 2YZ4A 1XMKA 1OA4A 2HWF3 2YBKA 2EXHA 2EV0A 4KWUA 3BTYA 2Q0OA 4LE3A 1WHUA 5KHGA 1R4NB 4W6WA 3F8MA 3ZMVA 1TZLA 3HVDA 1XS9A 4L99A 5FO9B 4PT6A 1NQJA 4L5JA 3ZFGC 2HOAA 4UVAA 3CUQA 4HF1A 1RUG2 3HSRA 4EV0A 4CRQA 1CJPA 4AEDC 4Z2AA 4CPBD 4Y1YA 3BOQA 2JX9A 4FVVA 4Y22B 4TLFA 4LUMA 3TRSB 1OLTA 4META 3FUOA 3BCAA 3MIFA 5F5AA 1NG6A 2CAUA 3IC7A 3LZZA 4CU8A 3TKYA 1D4M1 2XJPA 1HN1A 2B42B 4KBBA 1ZBA3 2LF7A 5FLXK 4NHLA 3VBUC 3O5SA 3LWFA 5FROA 1LESA 2AR6A 1KRIA 2JDPA 1U3EM 1CAWA 1YS7A 2WFF2 4D0QA 2CWSA 5ANQA 1O3QA 2CS3A 5FWJA 1D4M2 2B7YA 3KPHA 3N7MA 3MUY1 1TLHB 2ZX4A 1TNFA 4SLIA 2DVGA 5FZ6A 4GDFA 3I3BA 4L0PA 1UZVA 3OMYA 1GWMA 3RZHA 1Q56A 4YVWA 1NXMA 2UXXA 3LFKA 1HJGA 1QJX1 1E5IA 4B29A 1HV1A 4B1RA 2EAAA 2ZO4A 3GM8A 4OI0A 4GJYA 4I01A 1VAKA 2E7TA 2KISA 3PUFA 1RUI3 4HG2A 1G9CA 3S3NA 3INAA 3BG3A 3CF2A 1G59A 1TQPA 4MTEA 1JOPA 4XRFA 1JU4A 4EWAA 1VIWB 4KWJA 3BT9A 4PIZA 3PTRB 2VY0A 4R4XA 1J3PA 3FMRA 2XONA 3ROUA 2W00A 1JODA 5D21A 3VB9A 1LODA 1I1SA 1LNSA 1D0GA 4PDKA 1MNEA 1APLC 5HVQC 3GUDA 2ZJQF 4W1UA 4A12A 4Z82A 1EY2A 4ZYAA 1IUFA 2Y34A 1BIBA 5CG9A 4Q5OA 5K0UC 5IVBA 2BY3A 1ZNPA 3E6MA 1XMXA 3TDUC 1G9DA 2ZHNA 3SEQA 3THTA 4XFHA 1V9U3 4IV1C 2E1NA 1LJ7A 2X4HA 3ALQA 2EB7A 4GKYA 5H9RA 1NH3A 1WMDA 4CVUA 5FP9A 1SFOJ 4XF3A 2X6YA 5DAWA 3ABLH 2P2KA 3KZ4C 3RI9A 2M4GA 1ZBA1 1TWAJ 2LKSA 2VVDA 1Q43A 2COMA 1QXPA 1QKQA 2K2SA 1R00A 1JYVA 2GQQA 3BGAA 1I1EA 4RAYA 3OSFA 4IQPA 5H9QA 3GTJJ 3RJRA 2LVSA 4FAGA 1J3QA 1MBKA 4LBJA 1Z6TA 2AQFA 2PELA 3HXLA 3ETQA 4QQOA 2OX0A 5H2FC 2HWD2 3ZXKA 3B9IA 3OBZA 4N43B 3WG1A 2DTWA 2IS1A 4PFPA 4AVVA 4H14A 1OXCA 1XB9A 4UFKA 1EJ9A 2A75A 1OISA 1IS4A 4OUSA 1G7YA 5C6CA 3E7LA 1JZ6A 4DYQA 2C9AA 2R7RA 2WNUA 2HEWF 1M4WA 3B3QE 1V6KA 3RSNA 5A1LA 3AZZA 2NMOA 2E9QA 2PX9A 1B9MA 2WNEA 2XDVA 4ASKA 4YZ3A 4BDVB 3O1RA 3LSKA 1SMVA 1JN2P 1LU1A 1P92A 4XMAA 1DUXC 5JR2A 1CAUB 2P17A 3AYAA 3UR3C 3A22A 3QOEA 1ZARA 3JB8A 2O6GE 2EIJH 1PO23 3FXMA 1VTNC 5FD5A 5L3CA 4WZFA 3LWCA 1AU7A 1YFYA 2W52A 5B5EC 3KEOA 2KD7A 2XF6A 5CVUA 1AXYA 4OZXA 3VSLA 4YG6A 1P2FA 4KA4A 4QX5A 1A34A 3JRDA 4KNYA 1X58A 2NN8A 2R5ZB 1ZZ8A 1MBHA 4M6VA 4BY7J 5T50A 1V9U1 3ZYRA 4N53B 1UB9A 4A6DA 4YRVA 2XQRA 1DP7P 5BNOA 5IY5H 2GNBA 4J1WA 1C8M3 3BIEA 2P0WA 2JN6A 2BJSA 3SDBA 4UF0A 4XTMA 1Q1VA 3LSMA 5K5QA 3C8XA 3RVHA 4C2TA 2JDKA 3ZPOA 3I4PA 5DUKA 4IE0A 1M1EB 2M30A 4M9ZA 2Z5WA 4QLCU 5JXIA 4Q4V3 5BNNB 4LB5A 2DF7A 3WG3A 2KKOA 2VAUA 3J8F3 2QENA 3VLBB 3B69A 1OMIA 2TUNA 3OBRA 3FXRA 5E3LA 1WI3A 5IVJA 4D6QA 1MR5A 2Y64A 1WI9A 5IK4A 2L02A 4ASMB 4Q29A 5T5PA 2VASA 2BQPA 2WBKA 1W6OA 3JD73 2NNYA 1ERDA 3W21A 1RUJ3 3SHRA 4LT5A 1BMV2 2X5IC 1GU3A 3MW2A 1WW7A 4I6ZA 4KDPA 3FM5A 4C9YA 5DZGA 3WCRA 2EALA 5JVGF 1KDMA 4LNVA 3VD9A 4HF0A 2EPFA 5FQ0A 5BNPC 3QOPA 1CESA 3ZN1A 3A2KA 2GIZA 2F4LA 4HN1A 3SMHA 2GM4A 4FTSA 2Y0MA 4XFIA 1DQ6A 4IW3A 3OTFA 3THCA 3I58A 2CW8A 5DG2A 3ZKYA 1H9TA 1RUC3 4P9IA 1PO21 4M3CE 4EQQA 1A35A 1KU2A 1WWYA 4KIBA 1S0GA 2L0KA 2XL7A 1BVP1 1EF4A 5FYZA 2HBUA 5M5YJ 3DEWA 1REFA 4O3MA 2IGMA 4A7YA 5DUXA 4KIFA 2RAEA 2VOWA 1PO22 3RZJA 4IHYA 1ORKA 3VYTB 2E60A 2MH9A 1OD5A 3QRFF 5LASA 5BPDA 1DYPA 4DXTA 2R16A 3LQCA 1N3PA 3MEXA 2DVBA 3KV5A 2WY7Q 3AKZA 1C8M1 4K6BA 1ZBE1 5E18F 5LBCA 2Z3YA 4BACA 2HWB2 2E5ZA 1LOFC 4KMQA 2R7OA 3D1NI 2IPQX 2JXAA 3WGIA 2LH9A 5LA9A 5IT9Z 3HKZN 2R7SA 4RQPA 5LEJA 1ZBE2 4O65A 4Q4V1 3VFZA 4AAXA 4BEHB 4BXFA 1NY71 3KEQA 3J8F1 4LD5A 3N97A 1VB2A 2EZLA 1WMFA 3ZFEB 5DCFA 3E1F1 3HZJA 5FREA 3RYKA 3SKJE 1FYUA 5KWRA 5FY7A 2FA5A 2NVYJ 2GP5A 4IDZA 5JZGA 3ZMSA 1DLCA 4DYRA 1OBNA 3USUA 4H0EA 2GDFA 1RUNA 3K2OA 4DZGA 3JD71 1B8IB 1RUJ1 2KA3A 3U37A 3TEYA 3SHFA 5D8AA 5DPNA 3I3EA 5E1XA 1J84A 3POBA 1TBXA 1BI3A 5FYCA 4P9WA 3WODF 2V5DA 4II2A 1PX4A 2NAZA 4XE9A 4WXCA 5F0FA 1RUC1 1F1ZA 1YFXA 1R1TA 4RA0A 4B8EA 4M3EA 4IJAA 2NPIA 1ND3C 3ML6A 3NVCA 1G3WA 1GWKA 1K6OA 1BK1A 2W0XA 2O9LA 4UFIA 5BQTA 4EEFG 3W58A 4ASNA 3REOA 5FPAA 4IRIA 1X7NA 4XN3A 2VJJA 3HL2A 1WH5A 5FY4A 5T55A 4IQJA 1HQLA 1RMU3 4Y1ZA 1OLRA 4CCMA 3CUQC 4UB8C 1CAXB 4W4ZA 4D3WA 2N8GA 4ZTFA 1ZR2A 3HOUJ 3GF6A 2IP2A 1VBB2 3JZVA 3IH3A 2OAZA 2HKXA 3Q0UA 5HCAA 1VQ5I 2DFIA 2ZHKA 3JQXA 5J36A 1FBSA 2QQPA 5EP9A 1XNKA 3VKLA 2A61A 4HYEA 4HSLA 4ZYGA 4K7JA 3L09A 2CDOA 3CCLI 1LAJA 3SFIA 3RZZA 3MI8A 3ZO0B 2WS93 4IUGA 1CAVB 4RGGA 2FOKA 1PUFB 2WJSA 5KAFC 3ZR8X 1POQA 2O8KA 3C18A 3GZTB 2L9RA 3GFJA 1KD7A 1FOD2 1XE0A 4KG8A 4PBOA 3OL3A 3ZXDA 3LA3A 3S93A 4CEYC 1BKZA 2JIJA 3JBG3 5FPXA 1OCPA 3AP4A 3I59A 1WPKA 2OV7A 2DA6A 3VZLA 1EYBA 4XIKA 5L3BA 1OT5A 2QDRA 2J42A 1I5ZA 3TAYA 3TBIA 5M5XJ 1TQMA 4YVWC 1QGPA 1WCKA 1UAIA 3FBYA 4QPYA 5C71A 5EG0A 4JBAA 1S1AA 1YTYA 4BL0B 4AVCA 3ZN0A 4IHTA 2BVBA 3LDKA 5GJ6A 4HK9A 4KT6A 3I0TA 2XH6A 2HFHA 4QPGB 2X09A 4EGYA 5GLZA 5HXVA 3ECOA 2BFUL 1LENA 2HXOA 2XVLA 4FFIA 3S7EA 2RS53 4L9BA 3W6JB 1TP4A 2VTXJ 1W2NA 5IFTA 3TW6A 1AX0A 5A7WA 4XJZA 3MIDA 4G9YA 4IEYA 1ZZ9A 3LA7A 4BXSV 2M87A 3UJQA 3PIGA 5ED4A 4ZS2A 4HW0A 4K8RB 4WVMB 1RMU1 1WBLA 3RZMA 3PU3A 3GFLA 2DTRA 1RUE3 3CCUI 3OG2A 5JXHA 4S0HB 1QO0D 2RJLA 5JIAA 2DURA 3BYWA 2G9FA 2J1UA 1MIJA 1ZKGA 1ETVA 1RMU2 3B94A 3B7MA 4YM1A 1I27A 2OCCH 2DTZA 2VH9A 4NIDA 2R072 2W57A 1NCQB 2GXGA 2NVUB 4AVPA 4JDOA 2WINB 3GTPJ 1RYYA 2WS91 1HB2A 3D5RC 2QQAA 1S2BA 4N4NB 3BG7A 2IWGB 4AM3A 1Q8PA 1J58A 1R5HA 5C8CB 1V5EA 1ZGWA 3OUJA 1DGRM 4BXXJ 5JPNB 3L2VA 4F52A 2ZAHA 4LK6A 2YPDA 3LA2A 1NYWA 3JBG1 3HAGA 2JG9C 4CZCA 2HU9A 3V42A 1T2KA 1U5IA 4E7HA 2VI6A 1GNHA 4LEJA 4LR4A 4P9LA 5C70A 3ZVXA 4JOMA 3H3VK 1OYWA 2ZS6B 4ZJZA 1TTYA 4AEMA 2QQMA 3SH5A 3SISA 1A31A 1KGSA 2R7WA 2L9LA 1VRBA 4ZU4A 5IK8A 2WNUC 1IN8A 5EJ1B 4YFXF 5FPZA 5IT6A 3VV1A 2HOTA 2RJKA 4XCAA 1G4DA 3KT7A 4ENJA 2F5DA 3FE5A 4M3GA 3UKGA 1N3QA 5ABJA 3ZXJA 5C4JJ 3DXUA 2J5PA 5APAA 5FY5A 3Q0WA 1XPXA 3QH7A 1U5XA 2RS51 2PI0A 2WZ8A 2A69F 1IPKA 1O7LA 1SDWA 4YG3A 1APNA 1RUD3 1ENSA 3ZFGB 1ITYA 1BR2A 1UJ8A 2P4EA 3P9IA 4HPKA 1LEDA 4Q1RA 3KIOA 1SDDB 3DPLC 4JQFA 3GZNB 4ESFA 2O8OA 1AYM2 3K7AJ 3HDDA 3RYRA 1RUE1 2UV1A 1SBFA 5DAPA 3TGNA 2O61A 3ZKUA 1LFPA 1S2KA 3VZMA 2VMFA 2QBYA 1QOTA 3NV2A 5F04A 4W50A 1DCSA 2OUHA 4BJ6C 4OHXA 4XACA 2M7BA 3H5NA 2EFPA 5BNOC 4Q47A 4LO8A 1S7OA 2O5RA 5FZOB 4K1YA 1RUE2 5KK1A 3NNLA 4FOQA 1J3RA 3VBUB 1RIRA 5CA6A 1VQ4I 4XNFA 3GJBA 1MACA 1QWRA 4D7MA 3O0VA 5FXWA 4A3JJ 1N1TA 4E4DX 4DINB 4AVTA 2YYOA 3ZPYA 3ZOBA 1RC9A 2P5VA 5GZGA 3WTTC 3VHOA 2BV4A 2K4JA 3PURA 1Z7UA 3MD2A 1VFCA 3K1MA 4E27A 3U2RA 1LQ1A 1YC61 2E35A 2DPUA 2NYYA 1CVNA 5E8AA 3DPRB 1FT9A 3CJRB 4I0BA 2K3FA 2LBFB 3OIQA 5GTHC 1R64A 3QU6A 2ZHMA 4FX4A 2BU9A 2YBPA 1FZPB 3J7LA 4KU7A 1GV5A 2WT0A 1TQ5A 1LTEA 5LK7B 1WBFA 1IV8A 2RDPA 4ESBA 4FTBA 2A3YA 4ZZ8A 2H8RA 5KAIC 3VODA 2J1SA 4IGOA 1QNTA 2J5OA 2FDJA 4UY8I 4Q4W3 1ZREA 4E2GA 1IHMA 3LSJA 4JX5A 5A3MA 1AZDA 2XR4A 2BY1A 1HRI3 2MEV3 2M45A 2A05A 5FCCA 2W94A 1UF2C 1CR7A 1RUD1 2W1UA 2VJIA 5A3PA 3BG5A 3DF0A 1POV3 1KYZA 1HKDA 3CQZJ 1OLME 2KJCA 3H1CA 4UW5A 4MGIE 1CZSA 5F1JA 1NTCA 2XRLA 3THDA 2JE8A 4C0BA 1Z77A 4UUSA 4WVVA 2EIKH 4LB6B 2DA4A 3MZ8A 4PDWA 3F9KA 2VOKA 1HV0A 3Q8AA 4LE4A 1RUD2 3VDDB 5E79C 2ZGLA 4ENKA 2DFCA 1MH4A 4XXAA 5FGMA 5HV0A 4EN9B 1W28A 3T8TA 2ME6A 1MVQA 2VQLA 1EAH3 5GAGJ 2GNMA 2LG4A 1XNAA 5FRNA 4XVHA 1AL0G 1IZ3A 5CVVA 4WX9A 2DCKA 1KA8A 5FD6A 1VBA3 4QPOA 2DXIA 1JJ8C 1FSHA 1IV6A 3IAM2 1X50A 3CCMI 5DAXA 2PQSA 2VECA 2MW8A 2IJLA 3K4LA 4OYUA 2XJRA 5D4SA 1BC8C 5LBFA 3I4MJ 1S55A 3WUCA 2VPLA 1RKWA 3BTCA 4AI3A 3WF3A 1DU3D 1Z67A 2CSGA 4RR3B 3FFZA 4I99C 1UKRA 1JU3A 4PCQA 2OUJA 1FPN2 2Y6LA 1ODMA 1GOGA 1EV13 5DM7F 1YFUA 3FWEA 5B4XA 1FY7A 1VB4A 1T98A 1Z9CA 4OIRF 4K9SA 4CA0A 3P5BA 3NL1A 4EJUA 2V72A 4KWKA 3GZUC 5D8AC 5J96B 4DOZA 3RJ2X 2VZUA 4LKSA 5KXCA 1YIOA 4MGYE 1LHWA 4UVCA 4J01A 1YUDA 5F64A 3T8RA 2OZUA 3OEAA 2PXJA 2OTLI 1BW6A 2EA4A 4LG0A 4ZU7A 1MMAA 4Q4W1 4AGGA 5FUNA 2GOXB 1PVC3 1FOKA 4MVTA 5JOWA 1FSEA 2MEV1 3RQ0A 3BUCA 5T52A 2W25A 2HOSA 1HN0A 4UI9L 2DFHA 2BWAA 4RBOA 1ENQA 3TO9A 1S4CA 2I74A 5FZBA 3LDBA 1BI0A 1B59A 4WXDA 2F4OB 4XKCA 2XROA 1R083 1T8IA 3BU7A 5AFEA 4W6YA 1PO12 3HBKA 3KZIC 3BG9A 2MEV2 4K1ZA 1JKQC 5J1YA 1RJ8A 1C8NA 3F6VA 3ZLIA 4Y17A 1NZIA 4E70A 2DU1A 1N75A 4R52A 4GD4A 3AZYA 2OA2A 4MV2A 3I53A 2ELHA 1WJDA 4ITVA 2QBXA 2BHZA 3EB7A 5L7OA 4DZPA 1EAH1 3GCMA 4LLGF 3DYPA 1VBC3 1IPJA 2GAUA 2RNGA 1AXZA 1WRJA 4SBVA 1UMIA 1X8EA 2VBZA 5KC5A 4DPNA 2XSJC 4JC1A 3RIRA 2HOEA 1OCCH 2WYFA 3E5QA 1KU7A 4IRGA 4AI1A 1I39A 4Z6YA 1U0JA 3CJXA 2CH0A 3QYBA 2QQ9A 1D8JA 1GMMA 2XSDC 3OJBA 2YROA 5FZFA 4FPLA 1PNFA 1PNGA 1OFSA 3R60A 4AVAA 2C6SA 1GANA 2EXKA 1W04A 3FF5A 4DBQA 2D6OX 1QHDA 4P96A 2W39A 4QKBA 2X85A 1EV11 3FZ3A 3W2WA 3K4JA 1RXFA 5F6LB 1V6NA 4V2FA 3WTUC 1YLFA 3OV8A 5JXJA 1IS3A 3KWVA 2BNMA 1ZGJA 2P6SA 1TEIA 4BQOA 2RC4A 3D8CA 4XM3A 5IUQA 3FXUA 4XICA 1ZELA 4XOPA 3OGVA 4XOGA 2JKXA 5J1RA 3EDPA 1XSRA 3ABMH 3ULQB 4CZZA 4JGZC 4QB6A 1ULEA 3S1NJ 5FKLA 4LXLA 3AP6A 3HBZA 2EILH 1PVC1 1ZRFA 2GMEA 4XBNA 3NKGA 2VMGA 1DQ5A 3O3KA 4AGVA 2D1HA 3SLIA 2Y0IA 3TWIA 1IAWA 3MIHA 2DWRA 1OCOH 2L4AA 3MQ0A 1R1UA 4ESJA 1W06A 2QKLB 4MHUA 4YW5A 1XYPA 1ZZ7A 4IKFA 4Y22A 4KI5M 1W3XA 5FKBA 2LDUA 2AXLA 4V2GA 1RUH2 2PA7A 4XBLA 2RDQA 5I0RA 3A1YA 5E1ZB 1RJ7A 3KCYA 5ERLA 3SH3A 4F8AA 2RE9A 3MVPA 4Y4RA 3H42B 2O3FA 3UGFA 2JMWA 1U8BA 2WWYA 4ZKTB 5F2WA 1A6CA 1OH3A 2XPWA 4Q1PA 1VBC1 2FE3A 2E1MB 2DCEA 1SFNA 5FZHA 1EUTA 4Y15A 2IGOA 1IQAA 5G05L 3BDDA 4GH4B 2XAGA 4CDUB 1S0EA 3IN9A 4OOIA 3M1EA 5IVEA 3L2HA 3IDEA 3NV1A 3FMGA 3AFHA 5GADJ 4FPFA 2R0QC 4HV5A 2EV6A 4ZYHA 4BJ5C 4GB32 4E2QA 1X19A 4GWNA 5FY1A 3V0BB 2WWJA 4YWAA 2CU7A 3GGLA 1QEXA 4GYGA 2VBWA 4EM0B 1HRV1 5KHKA 1E3PA 4MHGA 1HF0A 5E3NA 5CVRA 1VQ8I 5A6ZA 3CP2A 3M9AA 2DUQA 4PLMA 1F4HA 3OR1C 2VE9A 3AM2A 4AL9A 2A6VA 5DV5A 2D6MA 1BHGA 1HRV2 2ZOEB 3RKWA 1D1BA 3T1MA 5J8CA 1C28A 2YXSA 1X33A 5LBEA 1KGYA 1YJLA 5ABJC 1KZHA 4YFZA 1PHMA 3IRQA 2DQRA 3SQOA 3S5QA 4DFSA 4Y20A 4DQ2A 2KHMA 2VLAA 3S15J 4Z1VA 3HRSA 5DN2A 4MQVA 1WJBA 4QPIB 2ECCA 5DM6F 2JUGA 3MV11 3V8LA 3AXDA 4HSRA 5FMDA 1STZA 3LOCA 5HLIA 2LY9A 2MYSA 1S0CA 3U10A 2DDBA 3M7AA 2ZABA 2WAEA 3NJZA 4QU2A 1WMXA 4DO0A 2KIMA 1PZ8A 1B6AA 1W7PD 3J9SA 1TWHJ 2VC9A 3KLNA 4N7UA 2LOOA 4XDOA 1W9FA 2IXJA 5EV7A 2VOVA 5HDKA 2ZACA 1ETXA 2IVIB 3B6AA 2FRHA 1GT0C 1E5SA 5J4YA 4COWA 2WTEA 3QACA 2DT6A 2Z2SB 3FBMA 5FZ9A 3NSTA 3OF1A 4AG4A 5F7UA 5K5OA 2WBMA 3ABTA 1GQHA 2WR9A 4N43A 3FLPA 3RGBA 3TOAA 2MSYA 3FHZA 2Q8OA 1GKBA 3THPA 2IW5A 4AWDA 2N7GA 1WGPA 1H8TB 4RGAA 4CA9A 2PTMA 2R0FA 2VULA 2A6HF 2EA7A 1SMYF 1MS9A 2V9PA 4CEYB 2B7EA 2CQQA 2XV4S 4HVOA 1MBFA 4LBOA 1ONVA 3SZPA 3LOBA 4QM9A 2KZGA 1D2SA 4XILA 4YIIA 2P37A 2L4MA 5CG8A 1KS5A 3OYWA 3FXJA 1CAUA 3CUOA 2BXZA 3KGLA 4D5CA 4MOAA 1RINA 3L2CA 1Z6RA 3NEUA 5DZFA 1DZTA 3BTXA 2RS11 4RYDA 4FSJA 2YGLA 2G1MA 1K6YA 4PJYA 3IMMA 5C9AA 2LFBA 3IWZA 3KE2A 4F3QA 3EYIA 3OIOA 2JUCA 2I07B 2IAIA 2W92A 3M3IA 3E97A 1E57A 3AFKA 2YSRA 2PHFA 5FPUA 2BFUS 2RS12 2R5ZA 5JDBA 4UAPA 2F6BA 4M3DA 4A6EA 2BY2A 4N90A 4MADA 1UFMA 3RWNA 4N53A 3MW3A 3BR0A 4EM2A 2VODA 1MMGA 3ZYFA 1O3RA 1MS3A 4B4QA 1QQIA 5D5UB 3CP8A 2KM2A 3QLQA 3BLYA 4OQ9A 3IMNA 2DMPA 2E2HJ 2JB8A 2FJ1A 1LDDA 4PDWC 3RMXA 3ZIXA 1RXGA 3ACFA 5BNNA 5CQEA 2UZKA 4QGMA 4JDMA 2PAEA 1BW5A 2CQKA 3MKZA 3AJYA 3H1MA 3T4VA 2QTWB 4MGSA 3ETPA 4CXYA 2JQ7A 4XDQA 5EJCA 3ILFA 2LR8A 3CZJA 4X8NA 5D5XB 3MKYB 1IDZA 4YARA 4QPQA 3BTIA 1K42A 2JDNA 3FXKA 1LVAA 2CUFA 2BNOA 3V8JA 4A3GJ 1L7QA 2JG9B 2W1WA 3POSA 1IGOA 1UNBA 2JE7A 2VGDA 2RHPA 1GP6A 4KN7X 3H7JA 4RGSA 1H9GA 3JSPA 1SBEA 2IS2A 4CYDA 1X1BA 1WKMA 2QQWA 4PIXA 5FIXA 2VBDA 4NROA 2GXAA 4QX2A 4XLPF 2VZQA 3PVEA 3IKTA 2V9VA 3BJAA 5FJKA 1TME2 2QQKA 2LS6A 2Q1FA 2RJ2A 1JOBA 2Z33A 3WEZA 4JCKA 3EQLF 4TLGA 1VQLI 4URAA 5FR3A 2X48A 5LD2C 1LDJA 2V5YA 4BY1J 3K3OA 1UY1A 2QKMB 2HDDA 5GLTA 1YS6A 2ZKLA 4XF1A 2ZBKA 3AZWA 1PGW1 2JWPA 2QQIA 5JHUA 2LRDA 1NCRB 3CF6E 5IAVA 3TEZA 1PIV1 2IA2A 1N1SA 2B8MA 1XDUA 4HANA 2LLKA 1D0YA 1BL0A 2JTVA 1KITA 1PGW2 2E5NA 2Q1MA 3WNPA 2E7QA 1PIV2 3M4OJ 1N78A 2P7VB 1IXCA 2VONA 1JOJA 2K7LA 4ISRA 4NE9A 2G0EA 3G1MA 4YFNF 4LBQB 5F9TA 5BNOB 4BEHA 4O6JA 2KMUA 1HDDC 4XAAA 1MD0A 3Q3SA 5ICCA 4XZPA 2W1QA 3B02A 3ZFEA 5L7OC 3WNMA 3G1OA 1LCLA 3JTGA 5K9YA 3WTSC 2ZMEA 2ZSIB 1O91A 2XIGA 4XEZA 1EPZA 2RG4A 2PAKA 3S5AA 2PHWA 4QPWA 5FBJA 1B8IA 4I76A 1UWWA 1JJ6C 4B3NA 3MFAA 1W36D 2XPVA 1PK6B 2DBIA 4EE2A 3MLKA 1T6BX 1ZX5A 3GF2A 3ZYBA 1AR63 4BPZA 5KXEA 4MNUA 4GWJA 4XURA 4CGZA 2E7AA 2X8KA 4CP9B 1C5IA 3MW4A 4FFHA 3ZSJA 5AC93 1DQ1A 1OYIA 4XSZF 2W48A 4PHZA 3HD8B 2NRAC 5JWPA 3PQKA 2QQVA 2YU3A 1O8SA 2E19A 2VT3A 5CYVA 4JV4A 4IE4A 5F8PA 5F5CA 4HKOA 4MH0E 1DBNA 3AMNA 2YU2A 1E5RA 1VLNA 5CKQA 2D45A 3B6CA 2Y60A 1OF4A 3N7JA 3OY9A 4ZPIA 5FZMA 1IXRC 4IOAF 1QOOA 2K40A 4I0WB 5DMYA 1I3HA 2OYZA 2B4KA 3U75A 2FCUA 3NJYA 4HMZA 3DN7A 1UZZA 1W8WA 2Z5UA 1XGSA 1CAXA 2EVXA 1USTA 5AONA 1ETOA 2ZEYA 3PUAA 1U5TB 3ZXGA 2VQTA 3ILRA 1DP0A 2ILMA 1FP1D 1CX4A 3HRTA 4QX7A 4CP1A 2CQNA 4LUKA 1M06G 4XL9A 2WV0A 1K45A 2ZGKA 5TISC 4MGZE 5CKMA 3SEPA 3C7FA 3CJNA 4AVZA 5DG1A 2PYTA 1R58A 4IEXA 4DUXA 4YGBA 3SCHA 3PUBA 2FXAA 4BMBA 1MKMA 3OY8B 3DKQA 3WD5A 1CAVA 2HDCA 1P6RA 5D6EA 5CIRA 3HNBM 1PUFA 4QSHA 2C24A 2KJBA 1QHHD 1LR5A 4L18B 4L92A 1Z0HA 2ZGRA 3DV8A 1FNNA 1FPQA 2FQ4A 2RVAA 2FBIA 3FMQA 3WCSA 3T0DA 1YQAA 3DYOA 1DZRA 3GZ6A 4BCUA 4F3JA 2JE9A 2ZGNA 1PZ9A 4BISA 2IVMA 3ZQHA 4B47A 5EEGA 3WNKA 4MQ9F 2K4BA 2CSOA 1KEXA 4C1WA 4IEVA 1RR7A 1AR61 2DVAA 2WADA 1Y43B 2CV0A 1UHMA 1MMDA 3M1HA 4DXSA 5IATA 5DYMA 4YPJA 3AL5A 2DCZA 1XMAA 2WRAA 3POFA 1UMZA 1IDYA 5EXOA 3U1KA 5AC91 1RIOH 4BQNA 3HB9A 3FJSA 4QIWN 2ZXIA 4QPGA 4C1XA 1AR62 3R0RA 1AHDP 2UWMA 3D3AA 2XLGA 3VHPA 2V6CA 4BA6A 2L9VA 4NHKA 3MMYB 3O1SA 3T3YA 2CFOA 4YSFA 1YRNB 2RVCA 3HM5A 4NC7A 1JYXA 1K5JA 3VKNA 1GHCA 2Q8DA 2JDHA 5IOZA 4D7SA 4RAZA 4H3WA 5FYTA 1VQPI 2P3YA 2ZGMA 1W8NA 4WVMA 1W2AX 3PFYA 5FZDA 3BI3A 4HX4A 3AK0A 4UUTA 1X82A 2HQNA 2BERA 4KQ7A 4RHV2 2W08A 3WTWC 1SLAA 5KHJA 2FUG2 1F9NA 2JA8J 1PP8F 3J81Z 1QJU1 2M1BA 1MZFA 2LC2A 1QVUA 4IETA 2VBXA 5JCTA 2QA4I 1NCQA 3W59A 1CQ9A 5CYYA 1F4AA 3QWLA 3JUUA 4IHWA 4LHKA 1W8OA 3KYDB 3EYYA 2X9DA 2W95A 1CZTA 4ONUA 2WN3A 2ZEZA 1S0IA 1QJU2 4U0WA 2A6ZA 5C8CA 1K61A 4YW6A 2Y6KA 2ELKA 5JI7A 3AVSA 2E51A 3CF5F 5FUIA 3IT8A 1SG3A 5JUVA 1XJAA 1BBT3 3C2GA 1R23A 1QPIA 1GR3A 4N43C 4YG0A 1BK0A 2OW4A 3CNAA 5I0TA 2WNVB 1DU6A 2LF8A 2WNOA 5LA2A 1JYNA 1UPIA 4I3PA 4AYUA 2DUOA 2ZJRF 3F2ZA 2VG9A 5IT3A 5C5UA 4H55A 4LK0F 2C4XA 3FXQA 4BQ1A 4Q0QA 2EFWA 1SEUA 2EAKA 1TW2A 3FHNA 5FXXA 1D0HA 4HNUA 1ENRA 4K8FA 2PBIA 5HDGA 4LK7A 3MIEA 1D2QA 5L36A 3OOPA 4ZY9A 1K4TA 4INDA 2AUYA 2OT7A 3P3NA 2VD7A 2VU9A 1FV3A 4JGZB 2MGQA 3K70C 3TOJA 5DUUA 4NN0A 4B44A 4AFAA 1P4XA 3ZFGA 1PYVA 4FTHA 2KIQA 2XGXA 1U0AA 4PBPA 1OPOA 3AMHA 4E4ZA 1YJ9I 5C9AC 1HLVA 4M3BA 2BPA2 3O0WA 2XPUA 1IS6A 1OA3A 4V2WA 2COBA 5LB6A 1Z7S2 3HMYA 1SC7A 1JKRC 3H3ZA 1FJLA 4BQ3A 1MNDA 5FMCA 3U1XA 2E34A 2LY1A 4N53C 4J00A 1ULCA 4XLNF 4QKNA 2DCYA 3NJVA 3GTGJ 4CCDA 2OPWA 2HEOA 5FZOA 4LKEA 4CCNA 3S2DJ 3WQ1A 5EPAA 5A2QK 2W4SA 4CEWC 4I02A 3ZN4A 4IEQA 4L9TA 3PNTA 4UW4A 2K46A 1OOPA 1BJQA 3WR0A 2EFOA 4UV9A 5BNNC 4XFCA 3OL4A 4NHYA 3IDCB 1DFQA 1VBD3 1BBT1 4A6OA 3USSA 5A7NA 1KDKA 4FXKB 4E9KA 3IWFA 1H2KA 3UK9A 3KP3A 2Z9OA 3LKJA 4ZS3A 4U0VA 6PAXA 2DYCA 3DPRA 2HVQA 2F4IA 2K02A 2LBFA 3UYJA 2WZEA 3JRCA 1BBT2 4XF0A 2RS33 3G7DA 3RWKX 5JVVA 5JSRA 2JEMA 1DQ2A 1O3SA 1LECA 4DJAA 1MBJA 3GTKJ 4YZ5A 2M8GX 4MLOA 5HS9A 3GDBA 1X36A 3ZN5A 5FMOL 3LF7A 1W0PA 5C5TA 3KVBA 3TN93 4FHTA 1R5GA 3RCOA 3JRAA 1RHI1 4XUTA 4CHUA 3VSKA 4U88A 5A6YA 3GVAA 1SFUA 2XXZA 4JK1X 1RB8G 5FZCA 1D0ZA 4LHSA 1SFXA 5FYMA 2W82A 3ZCOA 4MGTA 1XYNA 3PSFA 4FI9A 5C3QA 4UUVA 1RHI2 3FM3A 2WO7A 1ZZ6A 2HYGD 2P5LC 3JRGA 3MN2A 3VDDA 3HHHA 3N3HA 1LEMA 1LNWA 3VBHB 5M0TA 4BMEA 1V00A 1XSDA 1DHKB 4BQAA 3AL6A 3ZSEA 2R4GA 3VYSB 3VKMA 1W05A 4NQWB 1JI8A 3I3DA 5JOXA 3DP7A 4MXWB 5KXBA 1WKYA 4BXUA 4CCLA 2FDKA 3I2HA 2WA0A 3GEZA 4LBNA 2ZGUA 2OBPA 1MDMB 2R062 2XBO1 4XQDA 2J1EA 1YJNI 2HQAA 4XHBA 2VMIA 3GXOA 5CISA 4A3CJ 3OYFA 3OYEA 5IVVA 3DQVC 3SEEA 1Q1HA 1QJFA 3BIWE 4BQ4A 1OPCA 2BW3B 3IRRA 1SPPB 4DB5A 4L9JA 3IZOA 3IP4B 2Q5TA 2F4PA 3QODA 5BOXA 3UGHA 1VBD1 4LITA 2XBO2 2DCJA 1O5LA 3ZFEC 4YVSB 4RR3A 2WT1A 1CWPA 3E3VA 2ZMEC 5LY2A 1RUOA 4FQ4A 5JI6A 5K7PA 5FUPA 4PF5A 2L7ZA 3WW2A 4RB0A 2ZMNA 3Q9OA 2RS31 3QAHA 3O1VA 4L0YB 3IB3A 3RZOJ 2H09A 3QPHA 1IQDC 2CUZA 2VZOA 3JU9A 5EQUA 4S04A 2X10A 1R1A2 1HJFA 3LAJA 2QWWA 2FEZA 2XASA 3WNXA 1MEC2 1BQPA 2HQRA 4HDVA 1G6NA 2VMDA 1D1CA 2BVMA 3WX5A 3KETA 4GGGA 2ZJCA 1KU3A 3C7EA 5HDNA 5SV8A 4OI4A 5A6QA 2VJXA 5JPMB 2Z69A 1K78B 1S8NA 3KP4A 1WZXA 4Z8BA 5SV5A 2E1CA 4AI9A 4TTGA 5F39A 4FTEA 3P9KA 3AKRA 5FLHA 1YNAA 3PU8A 2FNAA 5DUIA 1I50J 2K9SA 1JZ8A 2WKKA 1RESA 4EZ4A 3JXSA 5D8LB 1CQTA 2PFBA 1Y9QA 4A0YA 3RQ4A 4DUWA 5A7QA 2JB4A 4HRIA 5FLVA 3V8KA 5HCBA 4WCGA 3LPGA 5J6XA 2ARXA 2VQCA 3CDHA 2YFUA 4A2UA 4ARYA 3PIOF 3T09A 5F2SA 5F6KA 4G8XA 2STTA 2W5FA 3NKTA 1POV0 2I45A 4BQ2A 4Q4X2 2WT2A 4K20A 3TB0A 3FHAA 2X1DA 5JSOA 4R9CA 4HX8A 2R5YB 5FB2A 2HWE3 1X3WB 5FZAA 1BZWA 1MS8A 2ZA9A 3OGSA 1HKSA 4XLFA 2PLV3 1X1PA 4B7EA 3FX3A 5DDJ1 2EA2A 4DRVA 2CWEA 1MBGA 2A6WA 4LBLA 1F36A 4JVAA 4ATEA 3GZ5A 1CN1A 3WDVA 2BZDA 3LSTA 5BS6A 1SAXA 4LQRA 1RRJA 1X8MA 4QX8A 5A7SA 4IEZA 1R093 5DDJ2 3ZSKA 3MIBA 1H1IA 3UKNA 3WDUA 5HODA 1MH3A 3GBGA 3F8BA 1VBE1 4S2DA 2FBKA 4R9DA 2VBYA 4GO1A 2WLQA 4ISQA 3UKVA 2A5YB 1XSQA 4D9JA 3FC0A 1C3HA 3HOXJ 2R7XA 1TE1B 2WC2A 4FE4A 1VBE2 4IF4A 4PLOA 2HGCA 4B3AA 4YNIA 3I54A 1LOCA 2CW7A 2FMLA 3U0ZA 1W0UA 1QXJA 4XQFA 4XLHA 3LL7A 1XD7A 3WGGA 2R30A 1QJY2 1W9SA 4QPGC 2FQPA 3VYRB 1JI6A 1W8TA 1DLLA 1EPWA 3OBTA 3HIFA 2GLOA 3H0DA 3DF8A 2X1EA 1JUHA 4OUMA 2GN7A 5IYDJ 3I55I 3RPUD 2H6CA 1J09A 1DGWY 2KRFA 2BGCA 1GWLA 3U21A 3ZOIA 1W2OA 2VIXA 1HSTA 1Y9GA 1ZM1A 2ZX2A 4MGQA 1FMVA 2O8QA 4QXBA 4DQAA 2VJ4A 2VQ0A 1QQP3 1SBDA 1ASJ3 4FQGA 3CDZB 5CQGA 4P5HA 1S0BA 2WFPA 3AKPA 4AUXA 5JI9A 4M01A 4RAGA 4CU9A 5LCWL 2MC3A 1BLZA 2DUPA 2HWE1 4GH4A 1OCZH 4CDUA 2YV8A 5A3UA 2PLV1 3KF3A 5D4RA 2KP6A 3BPZA 1NCQC 1HW5A 5IW0A 1AYN2 2YC4A 5CKTA 4J1XA 1RKTA 3E0JB 5L7OB 1LGNA 5DUVA 1GUUA 3CTAA 3GLXA 4E8CA 1G2HA 1UHWA 3BROA 5C8CC 3DLAA 1FMD1 1HLCA 1FOWA 3PSIA 5LHGA 5B2GB 3V0BA 3GFIA 4GZ9A 5GM0A 1QJEA 1QOSA 1TMF3 2BVVA 1RGSA 1R091 2LUWA 5ILUA 1S0FA 4NIGA 1GXPA 2LRPA 1XGMA 1I6HJ 3QYFA 2VW1A 3E1SA 3GBFA 2E32A 4HV6A 4XW3A 2E2JJ 4M73A 1FMD2 1OSGA 4E7IA 2ERFA 3RTRA 3VUOA 4AHZA 4JX0A 3VYUB 3A0KA 2CDPA 5I0UA 3GTOJ 3VDBA 1PUEE 3R4SA 2ARAA 3M07A 2OS2A 1NK3P 1WH7A 1YWKA 4IGPA 3T1BA 3Q9VA 4UOJA 5F3IA 2XVCA 4JKMA 1JTZX 1WUVA 4QPIA 3D5OA 3L2YA 3O8HA 3WZ1A 1A36A 5FRMA 3ZQQA 4Q8KA 3NRVA 2NZ9A 4JP0A 3AP5A 3VKFC 1YQ5A 3S6PA 4IE6A 4GCVA 3KV4A 4M72A 2AO9A 3ZDSA 1Z3YA 4AFBA 2VCMA 3B9CA 3I4IA 4RFT0 1UCRA 1V6JA 2RR13 1W8HA 1XE7A 2P34A 4WM7B 2XJUA 1QQP1 1URXA 1O4XA 4IHVA 1UXXX 5CBLA 1BJZA 1GZTA 4CCEA 4OFGA 2DQLA 2FDIA 5FFXA 1VPHA 2K0GA 3CIHA 4BLJA 2MPFA 1VAVA 1Y8QB 4NBQA 1JW6A 2X6WA 2ZJ2A 5HCHA 1QQP2 2WAOA 3TP0A 2EQRA 4KNCA 4H7LA 5BYNA 2XVKA 1H8TA 1QZZA 4UYBA 1SLLA 5IAXA 3F3XA 3QP6A 1Y3TA 2M34A 1UKGA 2K9LA 4EMSA 2YGMA 1YYNA 4ZONA 2VNOA 2VCBA 1OOPC 3RMYA 5LHHA 4A7KA 3LQRA 2JJ6A 4CEYA 4ANJA 1O59A 2M0CA 3DGTA 4RM3A 5CKNA 4CUGA 1TMF1 4KGQA 3ZYPA 4A0XA 2ZZQA 4Y5Z0 2LP0A 2PHUA 3VWBA 1G9AA 5HOOA 2KXLA 5IP9J 4QX3A 1R4MB 1WCSA 2PMUA 1ST8A 1JHFA 1Y8RB 3H3LA 4N9HA 3DPRC 2NVQJ 1Q5OA 1W9WA 5D2AA 3PUQA 4XCBA 2X1CA 2RMU1 3IH2A 4KT5C 4XJ9A 1XSXA 1YRZA 4Y1VA 2I5UA 2GWRA 1EH7A 2DMNA 1YW9A 2BOLA 2CO5A 1W8ZA 1POGA 2D5VA 1QJX2 4YGEA 4KMUX 3NWKA 2RMU2 5GP9A 4M3CF 2HWF1 1AR83 1OUXA 4IRHA 3KT1A 5ILSA 1F15A 3H35A 1ZG1A 4YW7A 5FWEA 4NDLA 5C3PA 4FOVA 1MMNA 2D5FA 1IPSA 2ZNZA 4B4RA 2HWF2 1F43A 3BR5A 4DUVA 4Y20B 3T08A 5IVYA 3UKTA 2QDNA 2XAFA 2Q0AA 2RR11 3LE0A 5K7HA 2H1KA 2LW8A 2H0BA 5KR7A 3U14A 2GNDA 3VDDC 4EJRA 5L3DA 4PGGA 1GOFA 5F5QA 5C4WB 5EIYB 3ZX7A 2RQPA 3M3EA 1VR3A 4GQ7A 5HI0A 4AD9A 5DAVA 3LMMA 2YC0A 5A33B 1QZEA 1X9TA 2PMWB 2P6CA 1K5MB 3WOGA 4CDXC 3J4UH 3HNYM 1JT6A 1HA8A 2FZ2A 4HK8A 2A3XA 3MLLA 3OB8A 4YZ4A 1AA7A 1JZ2A 2YPJA 1CX1A 2ZGTA 2BWCA 3KQ4B 2ZGOA 1NZCA 4AI0A 1UN1A 2AH2A 1UYXA 1WVRA 1W9YA 1ZBA2 2JG9A 1WJCA 3C1DA 1LULA 2ZC2A 3BZ6A 2QQNA 1GUIA 3I3QA 2B9SA 4AWXB 4HQEA 4RR3C 1H2NA 2XPJA 4MZUA 3E6BA 2WA4A 3R0AA 2A1XA 1OJLA 1WJFA 5JOZA 2RM23 1MGTA 4F91B 2Y8KA 1TQIA 3VOEA 3H1YA 3S1RJ 1JXNA 1W6QB 2BGOA 5A70A 3KZYA 3OYLA 3HJEA 4DNCA 1RUI1 5HLGA 1HKQA 4NRQA 5LW9A 5JR3A 4UW3A 3LSRA 3OYWB 4LJZF 1YCIA 1XNCA 2BDRA 5LLQA 3PNVA 4CXXA 4U7DA 2M4KA 4PI0A 2MBFA 3JB4C 2DVFA 1F2NA 1RUI2 1MSFC 3V65A 1NCRA 3CDLA 3CCSI 1RVF3 4YM0A 2ID3A 3V7SA 4XBQA 2VMCA 3OUHA 3JCUC 4E2SA 4BBRJ 1BEV3 2P8TA 3UETA 1B35B 5C9AB 2W9XA 3WP5A 2QUOA 2XJVA 3H1WA 2FQ3A 2NS8A 1T95A 1FBUA 2ZMKA 3WSOA 3I3MA 5J09A 3E6CC 4M71A 2Y6FA 3MPBA 5C3SA 1V55H 4BB3A 5A80A 1H9WA 4COVA 1DZQA 3CEWA 4NC6A 3I2IA 4LBQA 3B00A 3PL8A 2Y9ZA 3MYXA 4GFBA 4U87A 2MA3A 5HS7A 3B01A 2ET7A 2RDNA 2XGCA 4R9AA 4CU7A 5F0CA 2RV9A 3UGGA 2HWC3 5J47A 1GZCA 3V64A 2FHRA 4CEWB 3CCEI 4BKXA 1V9U2 1W2TA 4LPLA 2XUEA 2WAFA 2WQ4A 1T6GC 4JAAA 1EH8A 2P4WA 4Y1XA 2ME0A 2Y30A 5HCFA 4PSWA 3ST7A 1UY3A 1B72B 1WCQA 3ONQA 5GAHJ 1PK6A 2OIIA 3LNQA 1R22A 1WW4A 4CH7A 5LEKA 1CPNA 1DGLA 2VQUA 4ES9A 3WHTA 1OLMA 2F17A 4D7NA 4S2GA 3W20A 4IV3B 1DIWA 3S2WA 2HS5A 3OPWA 1A6QA 3W5NA 1ZLJA 2VXZA 3E6DA 3P6BA 2ZBJA 2SBAA 1IZ1A 4RGKA 4CP9A 2KFDA 1Z1DA 1PM4A 2OVUA 4YG2F 4LLNA 2RM21 1DGRN 3BPVA 4LO5B 3IKVA 4JRLA 1YXWA 1QBJA 2ZHLA 4FETA 4ZHNA 4AHXA 3CDIA 2UWAA 5TSWA 2X6XA 5BV6A 4Y33A 2RM22 2JPBA 2QFEA 4CU6A 4S05A 1UIJA 4HOOA 1HW2A 4ENNA 2A7AA 3SH4A 5TJJA 2VMHA 3HTUA 2ID4A 3R05A 4XZUG 1ODNA 3BTLA 4LA3A 5FMOS 4F7ZA 1RVF1 4A42A 3QBQA 1NX9A 1U5TA 1MZ5A 2YBSA 4DXRA 4E4HA 1BEV1 2F5CA 1B9NA 1N3OA 2R043 2KPMA 3ZR6A 5FO7B 4YGCA 5EDNA 3OYAA 1K3IA 4P00B 1C57A 2UY9A 3ZMNA 4R8HA 1QY4A 4KIGA 1V6LA 5FO5A 1AWCA 4FPGA 2KIUA 5LA1A 2E53A 4Q4Y3 3LFMA 3LOIA 4N0BA 3OY8A 3R6SA 3DXJF 1XU2A 3MUZ1 2CGNA 2D3RA 2E71A 3SNMA 3PNAA 3F22A 4P9YA 4FFGA 2HWC1 4CZSA 3AZVA 3RQIA 1QVTA 2RNJA 2E1MC 3LSHA 5FMBA 3BTZA 4XIOA 2YB7A 4QGNA 3KHCA 1C8M2 5K5RA 4GH4C 3HR9A 4CDUC 4P9UA 1XXNA 2OZJA 5ACA3 3VBFB 3GTLJ 2Q4SA 3ZXSA 2GC0A 2PHLA 1IKPA 1UOGA 2ETHA 4XKBA 1QNWA 2CJJA 4NUBA 4HLXA 1IW7F 3N4MA 2WQZC 2ZMEB 3CMMA 4Q4V2 2DBBA 4D6RA 1RI7A 1NY72 1CIYA 3J8F2 4S2FA 2HH9A 1XX5A 3BPSA 5J3LA 1OKQA 1HB4A 3DEEA 3H8OA 4NHJA 1H6XA 1RUF3 3KX2A 2M2EA 1O6UA 3JD72 3I2FA 3KF5A 3HEIA 1RUJ2 1YRNA 4XXPA 2BOJA 1YEWA 3SQNA 4G3YC 4R1HA 3LQQA 1YE9A 3AX4A 1ZRCA 4A3DJ 3WTYC 1D5YA 4H2AA 1AL23 1GXQA 3FL7A 4FOWA 2QCSB 3TEWA 3A01B 4OULA 2MC4A 1X1CA 4TYSA 1CPMA 2A6TA 5DEQA 1G9BA 3J7ZI 1RUC2 3T1LA 4QPIC 2D93A 4OHVA 2ZX0A 3CL1A 3K4KA 1COV3 3LIGA 2R041 1DYKA 2VTFA 3V0AB 3CMEI 5JOYA 5FPLA 1DYOA 4XF4A 1CF7B 3NO8A 4JX4A 2BW8A 3CCQI 1OFNA 1ZQ3P 4KG0A 1YITI 3KM5A 5DABA 2PMZN 3VL9A 5L9VA 5DD8A 2MH2A 4Q4Y1 3JAMZ 3SZGA 4BS9A 5E6HA 4FXGB 1W03A 2PQQA 4HEA2 1UD1A 4FPKA 2XMLA 3IIIA 5EZHA 1GOHA 3HN1A 1OYYA 2ZXHA 4BQ5A 2SLIA 4CP2A 1Y1WJ 1A3KA 1W0TA 3WTVC 1UYYA 1HXS3 3FLRA 1NKGA 4JYKA 3JR9A 3JW4A 5ACA1 2PJRB 4Q27A 2V1NA 4OMCA 2WNVA 3BN6A 4DNYA 2HDWA 1NA1B 3GYHX 1H8TC 2R7TA 3H7YA 3OS1A 4XK4A 2ETEA 1OCTC 3WDYA 1R9TJ 2VNVA 2AREA 3S30A 4V19K 4BH9A 4FASD 5ACA2 3SCFA 1G8XA 3A03A 5FZ3A 2HZTA 3OYMA 3I8TA 3I5UA 2CUJA 1RUF1 4JKKA 2VOOA 4X8PA 4JGZA 3OYNA 4QKFA 1HBXG 1SFYA 4AC0A 2JK3A 4XR6A 4HFSA 4E4SA 1LPQA 3OOUA 3GHMA 2LKXA 1AUYA 3KP6A 2QQLA 2B0LA 1NOVA 4GIQA 3U4XA 3HOZJ 5LBQA 4FPOB 3WF0A 1BXHA 2CGOA 3HOTA 3MF9A 1AL21 2DFBA 2R6QA 2FD5A 2V4AA 2XB6C 3PVNA 3VZJA 4OI1A 1XNDA 2VVFA 3W2AA 2XOMA 3MFCA 4KN4X 4CDQB 1UZCA 2XF5A 4C3JJ 2VZ3A 1COV1 1FATA 5FYVA 2LMDA 1W6MB 3S16J 1JUIA