3RDIA

Domain-domain flexibility leads to allostery within the camp receptor protein (crp)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILFYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catabolite gene activator
publication title Domain-Domain Flexibility Leads to Allostery within the Cam Receptor Protein (Crp)
rcsb
source organism Escherichia coli
molecule tags Transcription regulator
total genus 62
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rdiA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3rdiA01
3DQVC 5LGUA 2PBIA 4UVCA 3L00A 2UXNA 4A12A 2D40A 2L3DA 3SCGA 2K27A 4DNCA 3CF6E 4ENMA 2BNOA 4G7HF 4HBNA 5CVRA 4UUVA 3ZDSA 1B4AA 1OKRA 2CGPA 3TDUC 2DTRA 2XAGA 1ZRRA 4EV0A 1CF7B 3GBFA 2QZ8A 3I54A 5CVJA 2XLAA 3Q5FA 3J80Z 3EHKA 1QO0D 4FHTA 3HTSB 1T98A 2EA4A 4A0XA 4CXFA 1HKTA 3ERED 1SD7A 1ZG5A 1SFXA 4R52A 2A69F 1SMTA 1IAWA 3ZPLA 5EEHA 3GO5A 3F8NA 1U5TC 4HA8A 2P4WA 1HW5A 2BBYA 2VOOA 2FRHA 1SD6A 1J5YA 1RL3A 1FX7A 3VFZA 1TQPA 1BIAA 5FFZA 3MZHA 3CO6C 3ES1A 3IHUA 3ETQA 3OD0A 3JTGA 1U3EM 2V9VA 3ISPA 2XHKA 1IN6A 3S0MA 2HJIA 1ZVFA 4QMAA 3FMSA 1V70A 1X8MA 2PAEA 3P9CA 5L3BA 3IKTA 2X4HA 1DPRA 2XAQA 1K78A 3H7YA 1J58A 4MGZE 1SQ4A 2O8XA 3FMQA 4PDKA 2FXAA 3RKWA 2HTJA 3M9AA 4Q5SF 1J3PA 5LHHA 1JHHA 5J8FA 4J1XA 5BPIA 3FZVA 2M5WA 3F22A 1DGRA 1QWRA 5HLGA 2XROA 3ROUA 1CAWB 3SZTA 1QZYA 2KIMA 1CAXB 2IXHA 3K2ZA 1H1IA 4LA3A 3CUOA 2YX4A 3VB2A 2CG4A 2NS0A 2WFPA 2NNNA 2P7VB 1WGPA 4EJTA 3F8MA 3RDIA 1XN7A 3Q9VA 4HX8A 1BI3A 2CYYA 3V8LA 4UBGA 3LQRA 2VE8A 4L9TA 1HQCA 2KKOA 3V8KA 1YIOA 5CJ9A 3MWMA 2D5HA 2JRTA 2ETEA 3FF5A 4HBLA 5I0SA 3ES4A 5JFRA 1U6GA 1UHWA 2HFHA 1X7NA 1ZLJA 5FLXK 1OD5A 3Q9SA 3MYXA 3PQJA 4ZYHA 1BJAA 2EV6A 2D5FA 1XD7A 4IRGA 2HYFA 3KLNA 1OFNA 1Q3EA 2DPDA 4HX7A 1FBSA 1TQIA 4HVQA 2C6YA 2K4BA 1ZGJA 5E1ZB 3FM5A 3C1DA 4HV6A 1USTA 3U9GA 5L3DA 2IJLA 3DPLC 2PJPA 1FSEA 5CVUA 2QVSB 1SD4A 1P92A 5CVVA 2YU3A 1BC8C 3RPQA 1R7JA 1DP7P 4RS8A 4AWXB 4RGUA 3IWFA 2Q2EA 3RIRA 5ILVA 2CFXA 4HVRA 5KK1A 3FZ3A 2EFOA 2NYXA 2P5VA 4UNOA 5JSPA 2AXLA 1U5TA 4NHJA 2G7UA 3BPZA 5FQ0B 3QU6A 1X3UA 3IIAA 5AIQA 3H8UA 2JT1A 5H20A 4RGSA 1YFXA 3WW4A 2FOKA 4KFCA 1W5TA 5DCFA 4ESBA 2H6CA 1ZN2A 2P5KA 3J80K 1T38A 1T6SA 5E1WA 4M9ZA 3DKWA 1B6AA 3G73A 2VOPA 3BZ6A 2WV0A 1CAWA 4EROA 3I5UA 2BNMA 3KP3A 5L3CA 3JZVA 3HQXA 2P6SA 4Q0QA 1BI1A 5FLHA 3KP4A 3RKYA 3ELKA 4KN4X 1ON2A 4AVBA 3I4PA 4MTDA 1OPCA 2CW0F 3DL3A 1IRFA 3EDPA 4EJVA 3BPVA 3FFQA 3JSPA 3U0ZA 2ISYA 4G8XA 3K69A 4RB3C 3WE2A 2FE3A 2PLYA 4M6XA 2AS5F 1FSHA 3KE2A 2ESHA 2F5FA 1GQGA 3UKTA 1L0OC 4JVAA 3GW2A 2CSOA 1STZA 3I59B 1XB4A 4UV9A 2QBYA 3D82A 2DQLA 1R5GA 4XSXF 4LLGF 4CZZA 3BB6A 3FJSA 3SQNA 3C3VA 2B5HA 1FLIA 2PAMA 4MGKE 1G3SA 1NYWA 1AOYA 4UBHA 4ZU4A 3ZN0A 4XFCA 4Q0SA 2P17A 4U0YA 4FAHA 3HHHA 4I2OA 4G94A 1LRHA 2MH2A 5CADA 2GC3A 3TO6A 2W25A 2MPFA 1ZZ6A 4YYOA 2OZ6A 5DV5A 1YYVA 2VECA 3ZMVA 3G7DA 3FXRA 2MA3A 2CAVA 4X6QB 3ZMSA 5KHKA 3E5QA 3EQLF 3QPHA 1LDDA 2Y0MA 5LLQA 5DD4A 5LRSA 4N9HA 1FNNA 3AAFA 4QX5A 1HW2A 3BOQA 4I3PA 1O7FA 4EM1A 4AQ2A 3H1WA 1FPQA 4PJYA 3QAHA 2QVOA 2L54A 4I0AA 2Q0AA 4ESJA 2ADUA 5D5VB 5I0UA 4L9JA 2Y48A 3IBMA 2VBXA 4KIFA 2KIUA 4EM0B 1AWCA 4ZZDA 4RGRA 4MGIE 3PNAA 3WTYC 1RUNA 5HVQC 1ZYRF 2KJBA 1YQAA 3D5LA 2DLLA 2IXLA 4GYIA 1YS7A 3P9IA 1W7PD 2LSOA 5K5OA 2J5OA 3T1BA 4K8FA 2F2EA 2CV6A 1RI7A 2F5EA 2G9WA 1BIBA 4AVPA 5JHUA 3NJZA 4PIXA 1F5TA 1ZZCA 2JZYA 3IC7A 1S29A 2A61A 2M45A 4Q0VA 3V4GA 5T3NA 2FBIA 3UKVA 3GFLA 4E2SA 4KT5C 2FA5A 1CX4A 4FX4A 4LG0B 4EWDA 2OZUA 4L2NA 5CLSA 5HI0A 2E9QA 4I01A 5FGMA 2V1UA 3KSCA 4WF2A 2L02A 3KEQA 4Z2YA 3VHRA 4M72A 3RI4A 5KVRA 5DD8A 3F21A 2H6BA 3B73A 2HKOA 2Z69A 2FSWA 5LHGA 1FWZA 2XLFA 1ZZBA 4RAZA 1V4RA 2VBWA 1R36A 1OR7A 5DDGA 1QBJA 5I93A 1C0WA 3M70A 3RPUA 3K1PA 2BYVE 4HLXA 3ACLA 3C7JA 3HRSA 2ZNYA 3LSTA 1QPMA 2PMUA 1Z91A 3KP5A 1MDMA 1KQ8A 5DCMB 4LA2A 5LRRA 5HS9A 2GZWA 3K1MA 1GVJA 4L11A 1D5VA 1E17A 5ILSA 1J2XA 1LVAA 5BMZA 5J6XA 1UD1A 2XKOA 1I1GA 2D1HA 4YFKF 3DV8A 4IEZA 4B09A 4P9GA 2A3SA 1BC7C 1ODDA 3REOA 4QGMA 4HQMA 3R61A 4A6DA 1J0RA 2OBPA 4BNCA 4M9SA 3GFMA 1P2FA 1GHCA 4QGLA 4M9XA 3HRTA 4KA4A 2VC0A 5HDNA 2BGCA 5FLXZ 4D7SA 5DYMA 1KU2A 4XETA 5BPDA 4O5VA 4HOBA 3P9KA 4RB2C 1ZH5A 2FNAA 1XGOA 2VBYA 1O5UA 4EQQA 3GEZA 2Y0OA 4OFGA 1CAVB 1J59A 3NSTA 3N97A 2D2WA 1TQ5A 1CAUA 2GWRA 2DAOA 2BV6A 5IT3A 5KHIA 1UHMA 4XF0A 2ZO4A 3LAPA 3HOTA 4EMSA 4HF2A 4G6DA 2O8QA 4WXHA 2DFIA 2P5LC 3WTZA 3GLXA 4QGNA 1OYIA 3L2CA 3EUHA 3WGGA 3M1EA 2RQPA 2R3SA 1X8EA 5CYVA 4G6QA 1YW9A 4JQFA 4WXCA 2FQ3A 3H92A 2STTA 4XF9A 3H9AA 4JBAA 1OYYA 2ZMEB 3DPTA 1TW3A 3MQ0A 1WA4A 3EETA 4MQ9F 4CYDA 1U12A 4ENJA 3ML6A 5LEJA 3T5XA 3WGHA 2VT3A 1EP0A 2MHFA 2B0LA 3N4MA 3L2HA 4IRHA 3PQKA 1IXCA 4ZZLA 1TNSA 1LQ1A 3C3WA 4ESFA 1NXMA 4EJUA 2IVMA 4S04A 4BYYA 1YLLA 3L09A 3RNSA 5KBFA 3CLOA 1D3YA 3HHGA 2XLGA 2V1XA 4IEWA 3RYRA 1LDJA 4L9NA 3B02A 4U88A 2B9UA 4YRDA 2EA7A 5JR7B 3LA3A 1UFMA 4EJOA 4MGYE 2R7DA 2O0YA 1K6OA 4XFFA 4YSFA 2VODA 5FLJA 2PN6A 4OIQF 1EH8A 2GXGA 1XRUA 4Y15A 4MEXF 3WTVC 3QP5A 2IP2A 4J1WA 5E16A 2OA2A 3QRFF 5EFUA 3NL1A 1G3WA 5D5UB 1WWXA 5E17F 1LB2A 4HW0A 1GXPA 1MGTA 5ICEA 1XDSA 2EFNA 2ZNZA 2KIFA 3LWFA 2HOEA 4KICA 4F8AA 1H9TA 2DK8A 4BIFA 5H6RA 2E1NA 3KP2A 1R22A 4L9VA 4BH9A 2MNGA 4GXOA 2DI3A 4P9FA 3O14A 2IPQX 3KFWX 1VP6A 3LA7A 3NQOA 4MHGA 4Z82A 4KWKA 4IHTA 1CF7A 1DZRA 2Z3YA 2WTEA 1KA8A 4O9EA 1ZRCA 2UY8A 5D5WB 4KUMA 1RGSA 3L7WA 2IC1A 3F6VA 1BBYA 3H50A 2W24A 3MDPA 1MJAA 4L0ZB 1J3QA 4O9GA 4FX0A 1BOAA 5I0TA 3FX3A 3PFIA 5K5RA 1ZZ7A 1HKQA 3WTSC 3F8CA 4HAMA 2A5YB 3WE3A 2RV8A 3V7SA 3M8EA 1V3FA 5I8YA 2YX7A 1WSUA 5I0RA 2XV4S 4HQEA 3RZZA 2FU4A 2DQRA 4UV8A 4IETA 5HS8A 3I0TA 3GVAA 1QY4A 5HS7A 5J7MA 2CO5A 4Q0UA 2FF4A 5FO5A 1P4WA 3LA2A 1IXRC 3K9TA 3BJ6A 1LNWA 2K7LA 4I02A 3QACA 1ZARA 4A2UA 1MD0A 1E2XA 2JPBA 3ELNA 3NVCA 1FXZA 3I58A 2OYZA 2QCSB 1B9MA 1YLFA 1L3LA 2BEOA 2QQ9A 3ZQ7A 5AONA 2Z2SB 2PQQA 1FYLA 3KETA 1SEFA 5E1RA 2ZFWA 2W85A 3BWGA 1O7LA 4M74A 5E18F 3M7GA 3KZZA 4AIJA 2MBFA 1XGMA 1L3JA 4R1HA 1DPUA 2OAZA 1JGSA 4BXUA 1ZREA 4ONUA 1XGNA 2XVCA 2QWWA 2GQQA 3I53A 1CAXA 2CQKA 3WW3A 2QJVA 1EYBA 4OIPF 1BI2A 3RYPA 2GH2A 2QYOA 5F1RA 4LB5A 2A6HF 4RB0A 3UKNA 4IEQA 4XBFA 5J48A 4Q4ZF 1KQ0A 2RVCA 1GQHA 3W6JB 3EYIA 2XL9A 1NE4A 3H3UA 3CUQC 2ET1A 2M1BA 1OI6A 2HDCA 4A6EA 3FMRA 3FXUA 1ZGAA 1Y9QA 2VQAA 1S7AA 3K0LA 1DZTA 3QP6A 3SCFA 4DINB 2WWYA 5BQTA 2ZBKA 1Q1HA 1FOKA 4PIZA 1XSVA 2HQRA 1LKNA 5JR3A 1T39A 3WGIA 2EV0A 2GA2A 2IA0A 4G9YA 4IJAA 4AVCA 4MQVA 4PGGA 2YR2A 3LAJA 2G7HA 1HBXG 2L4MA 1KYWA 2V6CA 4CGZA 1U78A 3HRUA 4BHPA 4AIKA 3CL1A 2EA2A 4IEXA 1O4TA 3JSOA 1I5ZA 4LGWA 3CUQB 4X6RB 4HLTA 4U7DA 3C18A 4ZYGA 3MPBA 5D4SA 1I6XA 4UVBA 2MH9A 5BPXA 3OCPA 5FQ0A 3V7CA 1SAXA 1T0FA 4IXAA 4HVOA 1RTVA 1ZRFA 3PVBB 1R1TA 3V8JA 3G3ZA 1RC6A 2UY9A 3OOPA 4MGRA 1QQIA 1S6LA 2VE9A 3F6OA 3LOIA 4D7TA 2K4JA 4IEUA 5FB2A 4LJZF 3WTXC 3GYHX 1ULYA 5HLIA 4RGXA 3LZZA 1SFNA 3O3KA 4ON0A 3TQNA 5CU1A 2E7WA 5KHHA 2EWNA 1FP1D 3KGZA 2NRAC 3NRVA 4AIHA 3SMHA 3WTTC 1JXSA 2VPVA 1RNLA 5D6EA 3TGNA 1PDNC 1JUHA 4XF1A 1FP2A 4LB6B 4Y17A 2IXKA 4LTAA 2RGVA 3MCZA 5ED4A 1H0MA 1T2KA 1EY2A 3E6BA 1KU7A 3JAMZ 1PMIA 3R0AA 4ENKA 4XF3A 5BXXA 2VC1A 4LFUA 3GWZA 4OU0A 4UXAA 3I59A 3GXOA 3VEPA 1IF1A 2R7FA 1YS6A 1HXDA 3GZ5A 2IXIA 2FBHA 5D4RA 1YFHA 3NEUA 5D1IA 5I91A 4IESA 1SFEA 1U2WA 4HF1A 1TW2A 1W7PB 2P7CB 5F64A 3CLPA 2M30A 3HSFA 4KU8A 3MZYA 4Q29A 1QNTA 1REPC 4FT8A 1XE8A 2N7GA 1TBXA 3ZMUA 4YIIA 3RKXA 1J1LA 4IEVA 5FPZA 3HOSA 3ST7A 3R0JA 3CUQA 2HR3A 3R4KA 3CJNA 3ZN1A 1Q5OA 4HN0A 5ERIA 1B9NA 4ZU5A 5L3FA 1ZX5A 2RNJA 2V09A 2LNBA 1JHFA 5EZWA 1XDUA 2HKXA 2EFWA 4PIYA 1IUYA 2JPCA 3D0JA 2OA4A 5I8SA 4YG2F 5LEKA 3LAGA 3GX4X 3GUDA 1IPKA 1F1ZA 3T8RA 2ESNA 4JTOA 4OINF 5CVIA 1IZ1A 1UPIA 1R5HA 1WQ2A 2GU9A 1FZPB 4KU7A 4Z07A 2H09A 4U7BA 3FXQA 4WZCA 1IN8A 3SHRA 1YW7A 1HSJA 1VTNC 4XSZF 2NNYA 1JE8A 2BNNA 4HN1A 2K02A 5L3GA 1U8RA 3PLQA 1W4MA 3O6BB 1YFYA 2XASA 3NKTA 1IW7F 2FMYA 2Z99A 3HIFA 2IT0A 4NVPA 2GC2A 4P9UA 3FHZA 3WG9A 3F72A 1USSA 3DF8A 4XFHA 2OPKA 4UXNA 4XEZA 3H1YA 2K0GA 5E1XA 2A68F 4ETSA 2PYTA 4L18B 5BOXA 3EYYA 2RN7A 1PP7U 2FQPA 1ON1A 3U10A 4LULA 1KGSA 1IPJA 4WBBA 5JSRA 2LF8A 1P6RA 2DU9A 1R1UA 4KWJA 2J5PA 2LF7A 4MEYF 4WXDA 1X82A 4LG0A 1LEBA 2P8TA 4EJWA 1YHFA 4TLFA 2ZKLA 1MKMA 4CICA 3WTUC 2QNKA 4HLYA 1IN7A 4OLLA 5E8GA 4GGGA 1TTYA 1R23A 3MAJA 4GULA 5K8SA 1FT9A 4L0YB 4FAGA 4XF4A 2PHLA 3SZPA 1Y3TA 1XMKA 4UVAA 1F4KA 1ZZ8A 4PZJA 4WX9A 3KP6A 1IRGA 2PG4A 3QPTA 4AD9A 5FD5A 3KLOA 2ZCWA 1TLHB 2KRFA 2EK5A 4HMZA 4R8HA 5AVPA 2X0LA 5ILUA 2MLGA 4G7OF 1QGPA 1PM7A 1B1BA 1BM9A 3WW2A 3TOAA 4XRFA 5DCMA 4EWEA 3L9FA 4ENNA 2V79A 2IW5A 2IXJA 2PHDA 4Q0PA 2Q0OA 1QZZA 3COAC 2JTVA 1YFUA 1BI0A 2Y75A 5LHIA 5BS6A 1R00A 4EVIA 3EJKA 5JSOA 1G6NA 3R60A 4LLLA 3JAMK 4BHBA 4YNIA 4WCGA 4LUKA 2V1DA 3K1NA 1XMAA 1ZG3A 5E8IA 5D8KB 4ZU7A 2DBBA 1UIJA 2IA2A 5JCTA 3T0YA 1FYKA 5BY5A 2XUBA 3U11A 2OD5A 4A0YA 2I45A 4HDVA 1HW1A 4ZYDA 1ZG1A 1Z1DA 2UXXA 5A2QZ 5K5QA 2XRNA 5KHJA 2JSCA 1CAVA 1LR5A 4WWCA 2A07F 1NZCA 4KYWA 3E6MA 1ZHFA 3M8FA 2XAHA 1I1SA 5DUIA 4DQ2A 3E6DA 4UHTA 5AIPA 2GC0A 2F5CA 5DEQA 4XFAA 2D1VA 3ECOA 4HZFA 4LLOA 2QUFA 4I7HA 3DFGA 3EBRA 2W84A 2UYBA 2E1CA 2Q30A 2QQBA 5C6CA 4MUVA 3WODF 1ZRDA 4A0ZA 3IKVA 3CO7C 1UCRA 3S7IA 1U5TB 4O6JA 5D8LB 4R79A 2TDXA 1UIKA 2F4PA 4I0BA 4EGZA 1ZNPA 1O3SA 3F23A 4CO8A 3ABUA 3HYIA 1WKMA 2ZMEA 1P4AA 3EO6A 2HTSA 5F6FA 3TDZC 3QU3A 2IXCA 3I7DA 5C8WA 2VBZA 5I8TA 5JI6A 4XFIA 3ECHA 1NE6A 2RKHA 5FD6A 4TV7A 5ICCA 2NAZA 3NW4A 1UW8A 3FE5A 1HKSA 4M6YA 3BDDA 3SCHA 1Z05A 1PUEE 2EVXA 2D93A 2HZTA 4MNUA 5LBQA 1VR3A 1S3JA 4Y13A 3MFKA 2H94A 2O6GE 3HTUA 1J9IA 4EM2A 3H3ZA 4LMYA 4LEJA 2YPRA 4LLNA 2C0ZA 4XFGA 2VXZA 5FPXA 4NQWA 1DDNA 1W5SA 1OYWA 5HOOA 1RZ4A 2HEOA 3J81Z 2L01A 2Z33A 4XFBA 1G3TA 3KP7A 2EAAA 3H1MA 1WRJA 1HSTA 2OU2A 2IRFG 4PCQA 1Z6TA 1KYZA 4KN7X 4BHCA 3T8TA 5D6FA 1Y0UA 1I27A 1G3YA 2QM3A 2QBYB 1XCVA 4EWAA 4I98B 4KNYA 2QENA 4K2EA 3LFKA 4KMFA 3E5XA 2ETHA 4N0BA 3VODA 4NB5A 1XSDA 3HSEA 5FLIA 5LGTA 1LEAA 2PMHA 3MEXA 1J75A 4CDGA 3ZP5A 1B59A 3BJOA 2QDRA 4B29A 3FWEA 4P55A 1D8KA 4M73A 3H7JA 5JAXA 1YG2A 2PFBA 3ZMDA 3BROA 4ORFA 2FNPA 1NHAA 1LDKB 1RIOH 3DN7A 3IRQA 2IA1A 3ABTA 3SHFA 3BALA 4IHSA 1O3RA 2WC2A 2PAKA 1KQ9A 2XAJA 5LGNA 1J3RA 3IDCB 3KGLA 3M3IA 3S2WA 3U1DA 4YFXF 3DXJF 6PAXA 4MX3A 2DK5A 2K86A 2Q1ZB 3SFZA 1F9NA 2PA7A 2UZKA 4P5OA 4QLCU 4HDUA 1YFWA 2FEZA 4WVZA 2MLKA 4JV4A 2HYGD 2GIVA 4MTEA 2ELHA 2DCTA 2KJCA 3IWZA 4U0VA 3FHIB 2OZJA 4HX4A 2FBKA 3D0SA 4BAYA 4IERA 1VJ2A 3OGJA 1J7KA 1FC3A 4OMYA 4QXKA 3IRRA 4BQAA 2OQGA 2EFPA 5IT9Z 3QOPA 1EPZA 1FYMA 2PI0A 3HT2A 1S8NA 1YW8A 3ULQB 2ZXJA 4FBFA 1MJBA 4HF0A 1IXSB 5A2QK 3OV8A 1QXJA 2UYAA 2Z5UA 5HDGA 2ISZA 3WU1B 2KXLA 4RD7A 2EFQA 3J7AO 4O3MA 4META 1IN5A 5DUKA 2HQNA 1OMIA 4AXOA 3GFJA 3TKYA 4IEOA 2QQAA 4P96A 5HDKA 4A5MA 4IVNA 1FY7A 4ZH4F 4WK8F 4G7ZF 3JW4A 1K79A 4XLPF 2GAUA 1O5LA 4HYEA 4IEYA 4MH0E 1G4DA 1MZBA 3W6KB 4A5NA 3BJAA 2ACJA 3LWCA 4U0WA 2P6TA 3F8FA 3F3XA 2QLZA 1P4XA 3KCCA 1ZZ9A 4I09A 1EH6A 1PP8F 5E20A 2L4AA 3TOBA 2XKPA 1TNTA 4YFNF 1Z9CA 2H27A 1TQMA 4D0PA 4KWLA 4E2QA 3SXYA 1EH7A 2PTMA 4JK1X 3E3VA 3RYKA 5BUVA 2Z9OA 5JVTA 1DUXC 3FM3A 1QXRA 1YTYA 2M87A 1R1VA 5ICFA 4GCVA 1SD5A 5HLHA 2O61A 4CHUA 3VOEA 1XCBA 1MDMB 3TO7A 2COMA 4LK0F 2D45A 2VONA 4Q48A 2Q8KA 2DPUA 2OQRA 1MJ9A 5BV6A 2VT2A 4EGYA 3EQEA 2STWA 3WW1A 1EV7A 3J81K 3I64A 3TO9A 2O3FA 2F5DA 1S7OA 3BU7A 5D5XB 2PEXA 4F7ZA 5K1YA 1FI2A 2BE5F 4JTNA 4MZUA 5ICGA 4YIFA 2DW4A 1XSXA 3IL2A 2EJRA 4M71A 3E97A 3KEOA 3GZ6A 2Q4SA 3HUGA 5J8CA 4KDPA 1XGSA 4H7LA 5J3UA 1UCXA 2XGXA 2LKPA 2CWEA 4KIGA 4AQ6A 3OF1A 4E2GA 4PGHA 2GXBA 1RUOA 5FFXA 3BY6A 4OIRF 2ET7A 3KZYA 3TNQA 2RDPA 4AVAA 3E6CC 3GYDA 3USSA 4IPAA 2ZKZA 4RAYA 2B8MA 1A04A 4IEPA 1CAUB 1Q43A 4OOIA 1WLTA 1YUDA 3CDHA 2MD5A 4MV2A 1YWKA 4OMZA 3CO2A 1UB9A 3TNPB 2HS5A 3F8BA 2XIGA 4E70A 1H9GA 1KU3A 2E7XA 3RTRA 1IN4A 3RJPA 1H1MA 3KMHA 1SMYF 1O57A 2YSRA 1ZLKA 1LJ9A 3HRMA 4KIBA 5FDBA 2PFWA 1D8JA 1DGWA 1R58A 5EEGA 5FCCA 3P7NA 3BP8A 4KMUX 1YO5C 3GF2A 2O1QA 1ONVA 3O2PE 1O3TA 5TRDA 4QM9A 1KU9A 3ZMZA 3SXWA 3OTFA 5IT9K 3E5UA 2VN2A 4N9IA 5L3EA 2K9ZA 2M8EA 3CEWA 3JTHA 4RB1A 2W57A 1K7AA 3HSRA 3GFIA 2RC4A 3WU0A 1SFUA 3CTAA 4OIOF 3ZMTA 4S05A 4LD5A 3BPXA 2GC1A 1BN5A 1Z6RA 2ATFA 2EB7A 4HV5A 4LUMA 3CJXA 2PQ8A 2DO7A 4Q47A 5KHGA 2XAFA 4IRIA 4H0EA 3BCWA 3DP7A 4HSJA 4L5JA 4GO1A 3U2RA 2DT5A 4QM8A 2CAUA 3IDBB 4LK1F 1W7PA 2EV5A 2ZJ2A 4IF4A 3I71A 2O03A 3HT1A 4L5IA 1CGPA 2A6EF 4ZYEA 4XLNF 1WI9A 4GYGA 4B8XA 3LQQA 1FBUA 4ASNA 3S7EA 3V7RA 4KL1A 1K78B 1ZAOA 3DEUA 3WTWC 2XL7A 5H6QA 2FMLA 4QWQA 2MC3A 2LDUA 4YARA 2UWMA 1Z7UA 2H0VA 5TJJA 2HWVA 1FBQA 1XE7A 2HGCA 3R6SA 4HSLA 1GXQA 1O3QA 2GA1A
chains in the Genus database with same CATH superfamily
3SDBA 1KITA 4UVCA 1RUG1 3G4SI 4IL7A 3FL7A 3ZGKA 2Y64A 1S0BA 1NH3A 2Y6LA 1B4AA 1ND3C 2DCZA 1OKRA 4KQ7A 1R092 4PJ0C 1F2NA 2QZ8A 3I54A 3O1PA 3Q5FA 2R5ZA 2DOFA 3PTYA 4R4ZA 4PSWA 4SBVA 5A70A 1K5MB 1JOJA 3HTSB 1HJFA 1T98A 5FXXA 1W2OA 4A0XA 2WKKA 1SD7A 1LHWA 1ZG5A 3KEYA 4R52A 2YUEA 4BB3A 3GTJJ 1PNGA 5L7OC 1B8IB 3DEEA 3J7NA 1H8VA 1R6RA 4W6WA 4JDNA 1SD6A 1XYPA 5FY8A 1U0AA 5APAA 1RL3A 1H4GA 4P08A 1AU7A 3VFZA 1TQPA 5HXMA 1ST8A 2KPMA 3ETQA 4FISA 1HX6A 2V9VA 3ISPA 2LRPA 3M8LA 1JKOC 4W65A 4BY7J 4QMAA 3CHXA 1X8MA 2EF6A 4AI9A 3P9CA 3MLLA 4AFMA 1GSLA 4Z2AA 1DPRA 2HBTA 3H7YA 1OLRA 1YJNI 3IPVA 2FDIA 3DECA 3ABZA 2RM23 1PIV1 2R1DA 1ODNA 1YC61 2F17A 3C7OA 4D3WA 1F43A 1JHHA 5BPIA 1N3QA 1RC9A 1QWRA 3TP3A 1VAVA 3WG3A 4FE7A 1HXS1 3U78A 1CAWB 1NY72 1UYYA 1RUE1 4Y5SA 2ZTNA 4CDXC 3Q0VA 4XIKA 3CUOA 2LRDA 2AC1A 1JOPA 4XABA 1WGPA 3MI8A 3SEEA 4GH4C 3RZJA 4EJTA 4DJAA 1MS4A 1UYXA 2L7FP 1D0XA 2CGOA 3V8LA 5K7HA 1R082 3CCYA 4UBGA 5A7QA 3LQRA 2VE8A 5FBJA 1HQCA 1MMNA 2D5HA 3RZLA 4IW3A 1UHWA 1NX9A 1NLQA 2HFHA 4BIOA 4BDVB 4JQTA 1V6OA 5JZGB 2QQPA 2BW8A 3Q9SA 3MYXA 3PQJA 2JK3A 1HB3A 1S0FA 3VB9A 1XSQA 4LHSA 3CDLA 4XORA 2HEYF 4QPIA 4UFKA 2G19A 5FAXA 4TXWA 1Q3EA 1FBSA 1LUJB 1NCQA 2AO9A 3PSIA 2JA6J 1AR93 2IJLA 4KH9A 2PJPA 4CDQB 1FSEA 2XUMA 1SD4A 4Q4Y3 1P92A 2F6BA 2J1EA 5TISC 2YU3A 1BC8C 4AWXB 1BQPA 3NWKA 5FFOC 5ILVA 4N7UA 2O5RA 4QQPA 4HVRA 3QCWA 5L19A 3FZ3A 2XJTA 5ANNA 3FBYA 4QHOA 4JYKA 3HVDA 2AXLA 3IP4B 4NHJA 3QU6A 5AIQA 1HDPA 2JT1A 3GNEA 4CU6A 5H20A 2FDJA 1YFXA 3WW4A 2V5YA 2KM2A 4KFCA 4DBQA 1MQTA 2M0CA 1MMGA 1XNBA 3NV1A 3DKWA 1JZ5A 3G73A 1H1AA 3RI9A 1LJ7A 4F93B 1EA3A 3MVPA 4UF0B 3JZVA 2P2KA 2JA2A 1Q8QA 5IUQA 3HB9A 2P6SA 1QJU3 3MIBA 2EXIA 3KP4A 1W03A 3RKYA 2F4LA 5FOBB 2DOEA 2IVJA 1W6NA 2G4IA 4AVBA 1IRFA 5F3EA 2HWD1 5LA0A 1WJEA 4GA9A 3K69A 2FE3A 3LEMA 2VMHA 4IE7A 1X1BA 1FSHA 4B8EA 3TP0A 3GTMJ 4E7HA 5FYIA 3M3YJ 5ERLA 2XSDC 2CSOA 4XIOA 1STZA 3I59B 3BIEA 3W2VA 4UV9A 2JVHA 4Z1VA 2VMCA 5F5AA 1R5GA 4LE4A 1NKGA 1DQ1A 1TT0A 1ZBE1 4QU2A 3C3VA 2ZSIB 1FLIA 4XR6A 1ASJ1 1X1CA 2YZ4A 4UBHA 3ZN0A 2QQ8A 1VQPI 2EQRA 4Q0SA 1AR71 4G94A 1LRHA 4E7JA 2GC3A 5DV5A 1RJ8A 3W6VA 3G7DA 5KHKA 2B42B 3ZMSA 3E5QA 3EQLF 3I2KA 2K9QA 3HDDA 2ZMKA 1LHUA 2YC4A 4LIVA 2EZHA 1W0UA 4R9AA 1H6XA 1U9OA 5LRSA 4C1WA 1OA3A 3TBDA 3AAFA 2E2HJ 5ABJA 1RR8C 1KDKA 3BOQA 2WAEA 3A01B 2YFZA 1VQ4I 3H1WA 4NIGA 4B3AA 2HOSA 4CCLA 2ZKNA 5D5VB 2VBXA 5EQUA 3I2HA 1GZCA 4ZZDA 4D0QA 4RGRA 1F9KA 2K3FA 2LTPA 4BJ0A 4OHXA 2HWC2 1YS7A 2XJUA 3INAA 4Y4RA 2DA5A 5SV5A 2ELJA 2J5OA 3UETA 5GLVA 3OUJA 5GPAA 2O14A 2CV6A 2X6WA 5C3SA 5FZDA 3FBNB 3NJZA 5K0UA 2GN7A 1RXGA 1RUG3 3I2FA 2WZ8A 4E2SA 2FA5A 4UW3A 1BLZA 4HNUA 2E9QA 5HI0A 3KSCA 1S5LC 2VZOA 3RI4A 5DD8A 1UMQA 4BZ4A 5C4WC 2NOGA 3EYPA 3IN9A 1U0JA 3HPHA 3W21A 1LOAA 1BCXA 2A3XA 4SLIA 3GZTB 1VAKA 1V4RA 1OR7A 2V73A 3BR2A 1NA1B 2VCCA 3K1PA 4HLXA 2E51A 1QPMA 1KQ8A 4Q8LA 4COUA 2VXDA 4BQ1A 2Y6FA 1DLLA 4AZZA 5HS9A 2HVRA 4M3CE 2RREA 2WNVB 1RHI2 2YG0A 4LKDA 1RUF2 3D6EA 4CPBD 1QIQA 2PHRA 1FMD2 1V6IA 2D1HA 4D7MA 1R64A 4IEZA 4AUXA 4IEJA 1NG0A 1ODDA 1LAJA 1JYNA 4HQMA 3R61A 1J0RA 1VBC2 2MABA 4DUWA 2VG9A 3HRTA 5HDNA 2BGCA 2RS31 5C33A 2PMZN 2X8KA 1YYNA 4TLGA 5LBCA 1PIV3 5CISA 3SEPA 1AR62 2VBYA 1O5UA 2XB6C 4DZPA 3KZ4C 3NSTA 2D97A 1K5MC 2OT7A 1A6QA 1DU6A 1CAUA 2DFHA 4FFHA 2DFBA 3WZ1A 2BV6A 5IT3A 4YEJA 1HXS3 2PELA 1RUE3 1CWPA 4TWTA 2EPFA 4JZRA 2P5LC 3GBGA 1WZXA 3GLXA 5FK7A 1QNYA 3WGGA 3LEKA 2WN3A 4B1MA 4GJZA 2RQPA 2R3SA 1I3HA 4G6QA 5F5CA 2K9SA 4AEMA 3USUB 4WXCA 1Q56A 1BBT2 5E3LA 5GLZA 3KQRA 2ZMEB 4I6ZA 2VZRA 4BE1A 2P81A 4RGKA 2XB5A 3FIWA 1PZ9A 3EETA 5LY1A 5FZEA 4MQ9F 4IE4A 4CYDA 4P9LA 2E34A 4EJRA 4ENJA 2W5FA 4LHLA 4E4HA 3VDDA 1MS3A 3ZOBA 2VT3A 2B0LA 3I3DA 4LBNA 2JUGA 1LE8B 3PQKA 1ETXA 4ZZLA 3UKGA 1MMDA 5DMYA 1AJKA 2DF7A 4EJUA 4NQWB 1W9SA 4XNFA 3RNSA 1WW5A 3EXUA 2XLGA 4BQYA 4B7EA 3O0VA 3B02A 2VW2A 3CESA 1UFMA 4R4XA 3KV6A 3P3PA 4XFFA 1CVNA 3HNYM 4F92B 2PN6A 1EH8A 2L9NA 2DMUA 1XRUA 2Q1MA 5EGOB 3QRFF 4ZKTB 4CA0A 1G3WA 3CCLI 2R32A 1RUI2 1WWXA 4BQXA 2PMZA 4RA2A 2JX9A 2EFNA 4BQ5A 3OS1A 5FZBA 5EYXA 4FPOB 5JZGC 3IKWA 3ZR6A 3WVJA 4RA0A 3RMYA 2XPVA 2DI3A 4UFMA 1A3KA 3N7JA 1TMF2 2OF7A 3LMMA 3VBUA 4XBNA 1KS4A 5J47A 3B94A 2HWD3 2YB7A 1ZTRA 3KB5A 4KWKA 4CDWA 2JDMA 1GZWB 1DZRA 2Z3YA 1W90A 2WTEA 1KA8A 3TYJA 1ZRCA 1POQA 2F6CA 2VPRA 1D5YA 4KUMA 1L7QA 1DQUA 2IC1A 5ISLA 1HRV1 3VBRA 3H50A 1F5JA 4BS9A 1MJAA 4O9GA 3NNMA 3NRUA 3HNBM 2CUFA 1X4OA 3WTSC 3F8CA 2A5YB 1UY2A 1GUIA 3AYCA 5KXDA 1V3FA 4WVVA 1ZBE3 4UB6C 3N36A 2HU9A 4RS5B 5I0RA 2XV4S 4WVMA 1ASJ3 3K3NA 3GVAA 1ZR2A 3OB8A 3QODA 3U1KA 3DBHB 4Y20A 1AR73 2IAIA 2F4IA 2FF4A 2MSYA 5FO5A 2P37A 4CXXA 1P4WA 3LA2A 4AQSA 4QDQA 2NM1A 3K9TA 1KDMA 4LOSA 1QDCA 1D0ZA 1MD0A 3OYHA 2JPBA 1JKRC 2VUJA 2LS6A 3QYEA 3NVCA 2DJNA 2CU7A 1OLMA 2QCSB 1G9CA 5IP9J 4DUXA 1MZ5A 3ZQ7A 4OAZA 1DP0A 4Q26A 5JXIA 4AHWA 4QXCA 4BDZA 4AEKA 4XMAA 4ISRA 3BWGA 1F36A 5E18F 1EAH1 4AIJA 3ABMH 1XGMA 2KLOA 4BBSJ 1DPUA 1D4VB 4AGVA 4ZDLA 5DZGA 4C3JJ 3I53A 2CS3A 2Q8DA 1LFBA 4OIPF 2WA0A 3V0AB 3KIOA 2VB6A 4ZTJA 1AYM2 4Q4ZF 1OLQA 3EYIA 2XL9A 1NG6A 4B4CA 3VWBA 2WYSA 4XDQA 1JW6A 4AEDC 2HDCA 5FZ3A 5EZHA 1NQDA 2VQAA 2FD8A 5JR2A 2RHPA 2HWB2 5BQTA 2ZBKA 1WMXA 1U5YA 1YO8A 1LKNA 1DLCA 2ZXQA 5JR3A 2JDHA 1W9FA 1YX5A 5M5WJ 2L9LA 3HUGB 4PGGA 4XHBA 3LAJA 5FZKA 1CIWA 1ND2A 3IAM2 2XQXA 3T0BA 1QHDA 4CGZA 1U78A 2BY2A 4JX0A 1AX0A 4LK6A 2V7FA 4WM7A 1S0IA 2XJPA 1I5ZA 4GB31 3DCQA 5K7ZA 1VBB2 2W9XA 5T5PA 1WI3A 2E7TA 3IH4A 4QX8A 1T0FA 4HNVA 3RJ2X 3P6BA 4Q5OA 4DS0A 2VI6A 4N43A 3V8JA 3DKYA 3WLUA 1RC6A 5IVEA 2KDZA 4XLCA 3F6OA 3DLAA 3LOIA 3HN1A 5EG0A 4JGYB 3WTXC 3UK9A 5HODA 5HLIA 4RGXA 2C26A 3PUBA 3B6AA 3JBG1 4ON0A 2VKDA 2ERFA 1UQXA 3HN3A 1O8SA 2EWNA 3OIPA 3MICA 3OYDA 4AC0A 2RS33 4HK8A 4XE9A 3KGZA 2V72A 2BXZA 2BZTA 2X6OA 3HOUJ 2E36A 3HGYA 4M3CB 5D21A 4AI3A 3H5RA 3TGNA 5D6EA 1C1LA 2RM22 1FP2A 4LB6B 4Y17A 5G04L 3JRBA 4GQ7A 2RGVA 1JU3A 1NA1C 1S9HA 3KCXA 1PMIA 3T2OA 5BXXA 1ULEA 2VC1A 3GWZA 1RUJ2 3GCXA 4E4DX 3VEPA 5FY7A 4QKDA 1YX3A 4HKLA 5BNNA 5KWRA 1W28A 3GZ5A 1OOPA 1W0TA 1YFHA 1BOBA 3NEUA 5D1IA 1SFEA 1O8PA 1V6MA 4FPFA 1W7PB 2P0WA 2P7CB 2WNVC 5F64A 3RVHA 3HSFA 1Y43B 4KU8A 4MGSA 1K5JA 3V64A 1TBXA 5F7UA 3ZMUA 4PI2A 3CUQA 3LL7A 3R4KA 4XQDA 3CJNA 1Q5OA 2JRMA 2GH8A 1C4RA 2DUOA 5ERIA 3TEDA 1B9NA 4CRQA 4INDA 4A41A 2VM9A 4NDLA 1CIYA 1W6QB 3PJQA 5FZ9A 1IUYA 4RQPB 3D0JA 1GOHA 3BVCA 4S2GA 2M3AA 2W87A 2KQRA 3S3MA 2FZ1A 3LAGA 3T8RA 2GNMA 2UU8A 5B3SH 1R5HA 4BQ4A 1WQ2A 3N9LA 5IVVA 1FZPB 3OYWA 5JI7A 3QD6A 4C3IJ 3BTLA 4U7BA 4D1QA 4WZCA 2R5ZB 3ETPA 1YW7A 1HSJA 4MVTA 4UAPA 4MLOA 5L3GA 2XASA 2RE9A 3RZDJ 3FHZA 1JODA 1VMHA 3AL6A 1Y9GA 5LB6A 3VZKA 4UXNA 4XEZA 4DRRA 3H1YA 2XOMA 2I8DA 2EICA 1BK0A 1TP4A 2H1KA 5BOXA 2RN7A 2FQPA 1ONAA 3DXUA 4CU8A 2ZMEC 1ETYA 3OYNA 1R1ZA 3HOZJ 1WJCA 2DU9A 1R1UA 4MEYF 4WXDA 3BC8A 1DYPA 1W99A 1IG7A 3HG9A 1QJU2 1MKMA 5FZFA 3O8GA 4XRMA 2GOMA 5FWEA 1ETQA 3ZKUA 3NV4A 1IN7A 5GPCA 5E88A 2WR9A 2BVLA 1RVF1 2VOXA 4GULA 1OQ1A 5TSWA 2JA8J 1FT9A 1W6PA 3IPVB 3WT3A 3BYWA 3VYRB 4XF4A 1CQ9A 3LPGA 4LLFA 2XVGA 1E5RA 1ZZ8A 1HRV3 3KP6A 2PG4A 5JOWA 3NAPA 3GXUA 5CB7A 4R8HA 1GOGA 1PM7A 3VDAA 4EWEA 1FV3A 1WD4A 2V79A 1RIRA 5FP4A 1XXNA 2IXJA 2PHDA 4AG4A 1LU2A 3S1RJ 4J6GA 2JDYA 1HB1A 3I49A 3VGIA 5LHIA 2FCVA 5FY1A 1AA7A 4I3GA 4LLLA 4YIRX 1L7LA 4YNIA 4Y26A 2JIGA 3K1NA 4QDRA 3MW4A 5C9AA 1OA4A 3UR3C 1OA2A 1MR5A 3H3LA 2CQXA 4CPBA 1HKDA 2YXSA 1BR4A 5A7SA 4HDVA 5HV0A 4AR2A 5CFCA 1ETOA 1ZG1A 4II2A 2LR8A 4QPIB 4HKWA 2AR6A 5KHJA 3HJRA 1CAVA 1Y8QB 3DXTA 1EAH3 1IRZA 2XBO1 4KGQA 3ENRA 5DUXA 3SDGA 3BZCA 4CU9A 1IC8A 3G1LA 4KG0A 5FP3A 2D1VA 4QB2A 3ECOA 2IFRA 5KXBA 1W6OA 2Q1FA 2D6PA 5IK8A 3WODF 1ZRDA 3CO7C 1UCRA 4X8NA 2W39A 3NAUA 4OYUA 2F4PA 1D1AA 4I0BA 4CO8A 1D1BA 1MQTB 2AACA 4QPGC 4MADA 4XRSA 5BYNA 2IXCA 3TL4X 5I8TA 5CKNA 3QBQA 2RKHA 2NAZA 1G2HA 1HKSA 2GMMA 4M6YA 2ZEXA 4EN6B 3ZQQA 4MO3M 2HZTA 2IZWA 3MFKA 3CCJI 4DXSA 3BG5A 3OMYA 1UX6A 3U4XA 4AEJA 4JKKA 1XNDA 3KM5A 4AW7A 2E7QA 4LEJA 4NHMA 4M00A 4LLNA 2C0ZA 4XOTA 2VW0A 3B01A 5CKQA 1DDNA 4Y5Z0 1QHHD 1H2KA 2HBUA 2HEOA 1UY0A 3ZQCA 4XFBA 1HDDC 1T6BX 3KP7A 4D9JA 3H1MA 4MIMA 1G59A 1WRJA 2RJLA 2LW8A 1HSTA 3SJMA 2OU2A 4GB33 1PUFA 1H9WA 1XU1A 4MG2A 2CV0A 4BHCA 1I27A 3T4HB 2QM3A 3B5LB 2A5ZA 3RJRA 4KNYA 3UGGA 3DF0A 3E5XA 2YPDA 4H7MA 5FYHA 4A42A 3AXEA 1LEAA 3DUIA 1WLCA 2C9AA 4CDGA 1GP6A 3CF5F 3BJOA 3HM5A 2QDRA 4NO4A 3O1SA 1CZSA 3FWEA 4XJ9A 3T2TA 4P55A 4HT1T 3ZMDA 1PO22 2LP0A 2Q8CA 3JBG3 3DN7A 2IA1A 3ABTA 4IHSA 2D6MA 3Q8BA 1KQ9A 1GV5A 3KGLA 3M3IA 4JGZA 5JIAA 5LY2A 2BVVA 5L7OA 4XRSG 2XUEA 1GWMA 2E6VA 2Q1ZB 4Y4YA 2PA7A 2VQLA 4P5OA 5DAQA 4B1RA 1PZ7A 4GWNA 2FEZA 3RWNA 4LQRA 1SMVA 5ABJB 3ZN4A 3S14J 5E3MA 1IRXA 1MEC1 2VUAA 1AHDP 3BCBA 2E31A 2FBKA 4BAYA 4QSHA 1HXS2 3KF5A 1ITYA 5FO7B 4CEYA 4OMYA 1RUE2 2OQGA 2QZ3A 4XKBA 3OY8B 1PGL1 1AJOA 1FNYA 4PFOA 4GALA 1HA8A 3U4SA 3M8JA 1ZYBA 3ZFGA 4FBFA 5A2QK 4HF0A 1IXSB 1E5SA 3T0AA 5HDGA 4A3FJ 3WU1B 4RD7A 3K10A 4XYXA 1CJPA 4O3MA 1IN5A 4UUSB 3CD6I 2HQNA 3QWLA 2DN0A 4L9BA 2EXJA 3OOUA 3WG4A 4IEOA 5HDKA 1C5HA 4DB5A 4E7IA 2YGLA 2BXYA 3AMMA 1VBA1 2GAUA 2BOJA 2AYHA 2KT0A 4A5NA 4OMDA 2JKBA 2P6TA 3NMBA 4I09A 2UV1A 1OCCH 1TQMA 4KWLA 3JRGA 1EH7A 4JK1X 5F9TA 2ID6A 3ASIA 2VJIA 1DQ4A 5FYZA 3FM3A 1QXRA 4LPLA 2BFUL 5JXHA 5ICFA 3W2WA 1SD5A 2BPA2 2O61A 2OW4A 3ZYGA 2DCYA 1YRNA 3P3NA 3VOEA 4IE0A 3TO7A 2ZXWH 3SFIA 3ZXAC 1X9PA 3ZXSA 4MO7A 3RG0A 4M3EA 3S2DJ 1UY1A 3N7LA 2CSGA 1WCDJ 2DPUA 5CA6A 2VT2A 2XWJB 3WW1A 1XYNA 3F2ZA 1QVUA 1ULDA 2J1UA 3TO9A 2F5DA 3AP9A 3S2HJ 3CU7A 4F7ZA 1TEIA 2BE5F 2LYCA 4MFEA 3WHCA 2DW4A 1XSXA 3IL2A 1JTYA 3E97A 1JYWA 3KEOA 3IZOA 3FUOA 2ZMNA 5B5EC 5J8CA 1K3IA 2V4VA 2E53A 1RVF3 2Y31A 1UCXA 3HMYA 4FOWA 2ZMLA 5FMOS 1AXKA 4E2GA 3L2RA 4PGHA 2GXBA 3KZYA 4XCBA 3TNQA 2R7XA 1PHMA 4E7ZA 4CP2A 2RDPA 3E6CC 5FPVA 2B8MA 4IEPA 1CAUB 2WO1A 4OOIA 1B35A 2MD5A 3VDCA 4AL9A 5J40A 1GOFA 1VBE1 2Y6GA 2D6NA 1NUKA 2PJRA 1ZBE2 4B3XA 1KU3A 3RTRA 3RJPA 3KMHA 1ZRIA 3MW2A 1Y1VJ 3WNNA 3HRMA 2QSFX 1O4XA 2PFWA 2QSGX 4DEQA 2JUCA 4PFPA 1AR72 3VN4A 2EBIA 1AR82 1UPSA 1W0PA 5FCCA 3PVEA 2ZXHA 2J1RA 4AHZA 3GF2A 4CDUB 2DT6A 1KU9A 1MW7A 2P4EA 1RMU1 2C1FA 3E5UA 1RUH2 3B69A 5L3EA 2X9DA 5B1AH 2VOKA 1A36A 3NARA 4I0WB 5FYVA 3JTHA 3VDDB 1Z21A 1FOD1 2B45X 2RC4A 1J09A 4C3HJ 4OIOF 3GTLJ 4LD5A 4Z2WA 2XBO3 4AK3A 2V5DA 2ATFA 4LUMA 4AWDA 4Q47A 4IRIA 3PJRA 4FPJA 5CZKA 1XC5A 3KD4A 4KGGA 3K75B 2CAUA 2P34A 2ZC2A 4MFDA 3FLTA 1BK1A 2IGNA 3WNXA 4K7JA 2O8KA 1CGPA 4XLNF 1QJX2 3BODA 5CKTA 4GKYA 4F3JA 2JWPA 3S7EA 1RB8G 5DAVA 5DZFA 1K78B 3H3VK 2JIJA 4LBMA 2FMLA 2ZB9A 4QWQA 1Z7UA 2HGCA 3RSJA 3E1F1 2KIQA 2GA1A 5LGUA 4AFAA 4COZA 2PBIA 1HDKA 2KZVA 3K2OA 4LBQB 2VVDA 2FDKA 4BXFA 2LC2A 4QPIC 3CMYA 1ZKGA 4LE3A 5IYBJ 4ENMA 4G7HF 3PMSA 3VBUB 5SV8A 1F5FA 4CDWB 3BG9A 2VXRA 3GBFA 1R081 3V56A 5E89A 2VJJA 3JRHA 4D5FA 1QO0D 4XTMA 3WF2A 4A3LJ 4B4RA 3VBRB 2EA4A 3C7FA 3CBNA 4YPJA 1NT0A 3OYFA 4IE6A 4OAYA 3RS6A 2A69F 5IJRA 1OF4A 3BPSA 3RSNA 4BQNA 2LD5A 5FY5A 2P4WA 4G3YC 1HW5A 2IVIB 4WVMB 1C3HA 1MQTC 3PIGA 3FXOA 4FPKA 2A6ZA 3ZXKA 2ZX1A 2IGOA 1P8JA 1KQRA 2HH9A 4Z6YA 4RN5A 2HVQA 2DTWA 4Y20B 1BIAA 4QT6A 3CO6C 3IAPA 2EZKA 4FI9A 2WZPP 3FMGA 3OD0A 5T52A 3NWSA 2IUWA 1Y39A 2R7EB 1JZ4A 1IN6A 3S0MA 5J3LA 2CUJA 2XG3A 3OYMA 4FE4A 1A35A 1ZVFA 2QQIA 1X2MA 2IS1A 3FMSA 3T0DA 2PAEA 4FTSA 2E1MB 4QXBA 1G9FA 3IKTA 2X4HA 2RS32 4EATA 1S0EA 3BKZA 4QQ2A 1XQNA 4K1ZA 4QKNA 2O8XA 3FMQA 2JVGA 4PDKA 1XBFA 2GNBA 2WLPA 1A6CA 1UKGA 4K6BA 3RKWA 2HTJA 1LOCA 3M9AA 3OYCA 1FJLA 2GMPA 4GXLA 4AHXA 5LHHA 1MEC3 5J8FA 4J1XA 3FKIJ 1IPSA 4FQ4A 4QPOA 2M5WA 3F22A 1GWLA 3Q8EA 4CXWA 2GN3A 3JD71 4XC9A 3ROUA 1W8WA 3SZTA 2XXZA 4P9IA 1XMXA 1ULOA 4BK4A 2IXHA 3O5SA 2VKEA 5GAEJ 1IV8A 1XNKA 3T1MA 2NYYA 2GP3A 3MMYB 3PUAA 4UYBA 3WF4A 3OEBA 4KJZA 5FMCA 3URFA 2GNTA 1U5ZA 2VKVA 4L9TA 3V8KA 2JDZA 4OUSA 1YIOA 3MWMA 1W9YA 2JRTA 4XOGA 3ES4A 1X7NA 1VBA3 2PMWB 1WKYA 3OYEA 2V9PA 1BVVA 4BXXJ 1OD5A 1OCPA 2R30A 1BJAA 2KHMA 2D5FA 3AFHA 1FOWA 3APBA 1OFNA 2DPDA 1TQIA 5A32A 2C6YA 2K4BA 5ABJC 1O4YA 5E1ZB 4HV6A 5F2SA 3U9GA 1W2AX 5LBEA 1Y1WJ 3AL0B 2BVMA 4RGUA 4WM7B 2DMNA 1GICA 2ARXA 2Q2EA 1GV2A 2L7MP 1UXZA 3G71I 1LOGA 5BNPB 4UNOA 1JZ7A 3AG1H 2ZABA 1U5TA 3BPZA 4JRLA 3H8UA 2PXJA 2QQKA 2FOKA 1W5TA 4YGCA 5DCFA 1A5JA 2DU1A 4N43B 5IFTA 2QKMB 3DTKA 2DUQA 3J80K 4IQ4A 2DA6A 4M9ZA 4XMYA 2VOPA 4JP0A 5EG0B 3DTEA 1CAWA 3IIIA 2BNMA 5L3CA 3HQXA 1X19A 2VULA 2QTWB 2HWC1 2WJSA 4RFRB 3ZDVA 2XR4A 2Y9ZA 2PN5A 2CW0F 4AVZA 3GTKJ 3EDPA 1UN1A 3ILRA 3VBHA 5JHFA 3JSPA 1MBEA 3AM2A 4GFBA 4RB3C 3WE2A 2W4SA 1STMA 2ZGQA 4M6XA 5C5TA 2HVSA 1OR7C 3LNQA 1ZGWA 1HRV2 1L0OC 4JVAA 4XM3A 4RGAA 5F32A 5JOXA 3VYUB 4PI0A 2CDPA 3VD3A 3CC7I 3AB0A 4DOZA 1XB4A 2QBXA 4DRVA 2DDAA 1VBE3 4FOVA 4QPYA 5A3TA 3POFA 2P1BA 2DQLA 4LLGF 4CZZA 3BB6A 1RKWA 3BR6A 3UJQA 4M01A 2WABA 4MGKE 4CDQA 2R5YA 2YPJA 4XFCA 4W8JA 3LPFA 3MGUA 5A7PA 1T8IA 1V6KA 2MH2A 5CADA 2RV9A 1ZZ6A 4YYOA 3I2GA 1YYVA 2EIJH 1OPOA 2XGEA 2VECA 4LOCA 3FXRA 4X6QB 4C0BA 3K4CA 2ZJCA 1RMU3 1WFXA 3QPHA 4ET7A 5FROA 4XLFA 1RHI1 2OQ7A 2BVBA 3KWVA 5DD4A 4FXGB 3JCUC 4N9HA 3O0WA 1FOD3 1FMD1 2VZPA 1WD3A 4LMFA 1HW2A 4I3PA 4EM1A 1N3PA 1EAH2 3OYWB 3D4KA 1K6YA 2QVOA 5H9PA 2L54A 5M5YJ 4NJ4A 1VBC1 1JH5A 3IBMA 2W48A 4CZCA 2DCKA 5LK7B 4EM0B 2BOLA 5FYYA 2KR2A 2VL8A 2B7EA 1IKQA 2VJ4A 4MGIE 2CW8A 2JKXA 5HVQC 4NN0A 1AR61 3PM1A 4GYIA 1LHVA 2QQNA 4FETA 3KLSA 1W7PD 2XF5A 3NV2A 5K5OA 5C5UA 1K61A 4K8FA 3MIFA 3D8CA 2F5EA 4YZ2A 2ME6A 1F5TA 4CDUC 2JZYA 3S5QA 2A61A 5FIXA 2IS6A 5CPRB 5IVBA 4Q0VA 3H36A 3V4GA 4L97A 5AC92 3UKVA 2VTXA 1LGBA 4NPRA 4KT5C 3MIDA 2OZUA 5CLSA 2AGSA 2RAEA 5FGMA 3VDDC 4WF2A 2WL1A 3DBRB 4M72A 2D7FA 5KVRA 1H6YA 3PUQA 3FHQA 1R083 1W6PB 3SLIA 2Z69A 4UW6A 2VH9A 5LHGA 1FWZA 2XLFA 4R9BA 4R9DA 2X09A 1PMJX 3C2GA 3M1CA 5DDGA 1KJRA 1W36C 4YRVA 5I93A 2QKDA 3K70D 3NAPB 3U1XA 1WLDA 4BBRJ 3C7JA 4LORA 2ZNYA 3LSTA 2PMUA 3KP5A 4JCKA 1SBDA 2WO7A 4OI2A 3G1MA 4NRPA 1UMZA 1POGA 4JHZA 1URXA 4LA2A 5A33A 3FBMA 1GVJA 1D5VA 3TWIA 5ILSA 3A01A 3TRSB 1LVAA 4L99A 1A8DA 4D94A 1W8HA 3Q3SA 1IOAA 1ULPA 4OHYA 1UD1A 3CQZJ 1X9TA 4B09A 1BC7C 2CJJA 3VKMA 2M34A 3REOA 4QGMA 5BNGA 3MW3A 3AL5A 3FXJA 3T1LA 5C9AB 3OYKA 4BNCA 1V6NA 3JBG2 3SISA 4M9SA 3GFMA 5KCMA 4AI1A 5CIRA 2VZUA 3VBUC 4BGDA 4KA4A 4AVVA 2VC0A 1RUI1 4CDWC 1JUPA 3ZPOA 1VI0A 1FPN2 4HOBA 1ZH5A 1XGOA 4EQQA 1D4M2 1CAVB 1J59A 3ZO0B 2G0EA 2FHRA 2A73B 3VBRC 1TQ5A 3IDEA 1XNAA 1OLTA 2GWRA 1JYVA 2A70A 3JD73 1POV1 1LECA 1SPPA 2RR11 3LAPA 1YQ2A 1TMF1 5FV3A 3POSA 4WXHA 2DFIA 3WTZA 4XL9A 1W05A 1W6OB 4NNJA 3L2CA 3EUHA 2O8OA 1E3HA 3M1EA 4MGQA 3UNGC 1NQJA 5CYVA 2WSVA 1C1FA 1YW9A 4JQFA 3OGVA 4DYQA 1NA1A 1PVXA 2FQ3A 1XSRA 3J4UH 2ZHKA 4Q4X2 4AFDA 2AXTC 3H9AA 4PUSA 2Y33A 4A3BJ 1CESA 4XVHA 1UOGA 5FZ4A 1Z3YA 1TZOA 4XILA 3DPTA 1TW3A 1MBGA 1WMFA 4II3A 4LOTA 2E1MC 2YYOA 1ZBA1 5JOYA 3TEXA 3NV3A 5IW0A 2WNVA 3ZCOA 2WA3A 1V54H 2N8GA 4WM8B 4N4OB 4G9SB 1TZLA 3WGHA 3PIOF 2LREA 1OH4A 2ECBA 1SLTA 2X05A 1TNSA 3C3WA 4NROA 2GXAA 3C2UA 4S04A 3PUHA 5FY9A 1YLLA 1H88C 1SFKA 4GIQA 2EIMH 1D3YA 3HHGA 4IEWA 1BEV1 4D7NA 5J1RA 3SH3A 2EA7A 1RETA 1PUFB 3L9JT 4CCNA 2W47A 4MGYE 2R7DA 2O0YA 1O4ZA 3WDYA 5DXDA 3WTVC 3QP5A 2FDFA 3NL1A 2LMDA 3CZ6A 1FATA 2FCUA 1KGYA 4D6QA 3ZQGA 1HCRA 1LODA 5E17F 1LB2A 2WINB 3BT9A 5ICEA 1QF3A 1BMV1 2ZNZA 1XDSA 4KICA 4F8AA 3G6EI 2DK8A 4B1LA 5EJ3A 5H6RA 4P9FA 1AYM1 2HWC3 3KV5A 2IS2A 2I07B 4JGZB 3LA7A 2CW7A 3USUA 4MHGA 1RVF2 4Z82A 3BGAA 1P7JA 4IO9F 2G1MA 3B3QE 3M7AA 4O9EA 1MZFA 3VPRA 5D5WB 2VZQA 4XURA 3LDBA 4OUMA 4WM7C 3F6VA 2HWB1 2XH6A 5J96B 1RUC2 4MHUA 3LEIA 1BOAA 3FX3A 4AM3A 1ZZ7A 5BNPC 4UWDA 1VIWB 4CEYB 3M8EA 1OJLA 1K83J 1RESA 1T0FC 2VAUA 4NWVA 1T08B 4HQEA 2FU4A 2DQRA 4UV8A 3OSFA 2A1XA 4N43C 3ZFGB 5HS8A 5JLWA 3N35A 3I0TA 1JMUB 5HS7A 4X6AJ 4QPWA 1YJWI 5EJZB 2VL4A 1DF0A 4Q0UA 3R05A 2WBKA 2VY0A 1VBB1 4EN0A 3ZYPA 2JWTA 3KHBA 2CWSA 4A44A 4I02A 1ZARA 4ABZA 4FQZA 4YW1A 4A2UA 5FZ7A 4GKXA 1FXZA 3WHTA 3PIPF 3GLLA 1RHI3 5AONA 1FMD3 3KETA 5E1RA 4E4SA 2XVLA 4JX5A 2MG4A 3MV11 1VNDA 2NMNA 1O7LA 3A4UA 4K8RB 4S2HA 1VBC3 2NQYA 4R1HA 2DUPA 4BXUA 1ZREA 5BNNC 1MS9A 2JJ6A 2XGCA 1ORKA 2R061 4G4FA 2XVCA 4ONUA 3PVOA 2QWWA 2GQQA 1CAXA 3PNVA 3WW3A 1OOPC 1QJEA 3UESA 1EYBA 3GF6A 3RYPA 4Y1YA 1GZWA 5F1RA 3LSRA 1AR63 5F27A 3ZYIB 4RB0A 4W97A 1FIPA 3UKNA 1ULCA 1YRZA 5J48A 1GQHA 3W6JB 1NE4A 3GALA 4BM8A 3CUQC 2ET1A 2M1BA 1RUJ1 5J98B 1OI6A 4XDPA 4A6EA 3FXUA 1Y9QA 4LKFA 2CL2A 3SCFA 2V4JC 3PURA 4RS5A 4PIZA 1JUSA 2CUEA 1J1TA 2VZ3A 1T39A 5JVVA 5LWBA 1I39A 3BOPA 2EV0A 2GA2A 2IA0A 4G9YA 4MQVA 2LLKA 1HBXG 1SVLA 1GBGA 3HAGA 2DODA 2V6CA 3ONQA 3ORJA 4GZ9A 2VMEA 3HRUA 1VQOI 2Z16A 4AIKA 2XPWA 3CL1A 3VBSB 3SQOA 3A0BC 4FSJA 3MKYB 4HLTA 2KA3A 1B35B 2VQUA 1AL21 1E3PA 5BPXA 5B4NA 5FQ0A 1SAXA 2PJRB 4IXAA 4HVOA 1XPXA 3IV5A 2JA7J 1ZRFA 3PVBB 3AKRA 1R1TA 3BUCA 2UY9A 1QQIA 2VE9A 3SNMA 2K4JA 5FB2A 2CV1A 2IS4A 4LJZF 2ZGLA 1H8TB 4FQGA 3N05A 3O3KA 2DDUA 3VKOA 2NVXJ 5KHHA 1CX1A 1HN0A 1MVQA 1FP1D 1RUI3 2JSPA 1FTTA 3NRVA 4HG2A 3RQ4A 2X6YA 4FVVA 2E63A 1PDNC 1JUHA 1N77A 3H1CA 2IXKA 1LKXA 4BQOA 5ED4A 3WQ7A 1H0MA 3E6BA 2PX9A 9ANTA 2DMPA 3JAMZ 4UFHA 4A3ZA 3VBOB 4JX4A 2ZZQA 3NAPC 4XF3A 1MEC2 1UJ8A 4OU0A 1H89C 1POV3 1SCSA 2RR13 3MHZA 4XJZA 4B43A 1IF1A 1TMF3 3C2HA 3ZFEA 1IDYA 5JMCA 1N25A 1H4HA 2FBHA 5D4RA 1OISA 1U2WA 1PGL2 4HF1A 1TW2A 2DFCA 2BY3A 1V5EA 2YU2A 3SC7X 1YHQI 1AX1A 3JCIA 1VQKI 4DUVA 5DPNA 3L2QA 1W2TA 3VHNA 2G9FA 3VUOA 2A6TA 1OUSA 2QQUA 3OBTA 4YIIA 3RKXA 2QUOA 4IEVA 4YGBA 4XZPA 1W3XA 2JECA 5CQEA 2R49A 2EIEA 4HN0A 1YEWA 1JI8A 5C9AC 4YLZA 5G05L 3CDIA 1ZX5A 2RNJA 3ZMOA 3BTCA 1JHFA 5C3PA 1ZBA3 5EZWA 1XDUA 3B9IA 3LEGA 2BY1A 1VBA2 3SITA 2C6SA 2XVKA 2OA4A 4YG2F 3AKSA 2W91A 5CKMA 1KFUL 3MKWB 1IPKA 4JGYA 2WFF2 2A6XA 5CVIA 2FCTA 3VZLA 1WCUA 1REDA 1UU4A 4DZGA 2K40A 1BEV3 3AYAA 2IEKA 4OUEA 4XSZF 1A78A 2B9VA 2NNYA 1JE8A 4HN1A 2ZXIA 1U8RA 2OXBA 3O6BB 1YFYA 1IW7F 2Z99A 2IT0A 5GZDA 2GC2A 5DAWA 3VZOA 2ARAA 1LESA 3P1IA 1USSA 1W36D 3DF8A 5FPUA 3JU9A 4E7KA 4XFHA 3J7HA 4NHXA 1PP7U 3SKVA 4OHZA 4EN9B 2DYSH 1GR3A 3WCRA 2MD0A 1KGSA 4FFIA 1IPJA 4WBBA 5JSRA 4MXVA 5F8PA 2LF8A 1TG7A 3MO4A 1P6RA 3HGGA 2VNOA 4OZOA 5LBBA 2BBAA 2LF7A 5GP9A 5CBLA 5FBZA 3HL2A 3JB8A 1AYM3 2ZKLA 3LSHA 1VRH1 4OLLA 1TTYA 1I5PA 4C9YA 4LBQD 2GP5A 3SZPA 1GV9A 5A3UA 1NAEA 5IYYA 1F4KA 3OG2A 2JEMA 2ICWG 2HWB3 1IRGA 3TEWA 3QPTA 1W6QA 2OQ6A 3KLOA 5B4XA 2WADA 1TLHB 1Y9MA 4RQPA 3LQCA 5ILUA 4G7OF 1B1BA 4TN7A 1VBE2 1FOYA 5DCMA 3CIHA 1JTZX 1AHSA 5IK5A 2IW5A 3TMOA 2Q0OA 5JWPA 3J8F1 4CSWA 5L36A 4EVIA 3EJKA 5JSOA 1G6NA 3I2DA 4BHBA 3GTGJ 4WCGA 4OVEA 4W6YA 2UWBA 3POGA 2FDHA 1XMAA 1VBB3 1ZG3A 1UIJA 3WU2C 2IA2A 3TAYA 1TME1 2WNEA 5BY5A 4E8CA 2TEPA 4JGZC 3U11A 2FQ4A 4A0YA 1RITA 1LGCA 4CE8A 1RMU2 2I45A 4XK4A 2UXXA 3M3OA 4L92A 4DQAA 1X1AA 5FWJA 5K5QA 2XRNA 1RUD1 5A32B 2VOTA 1FOD2 3KT4A 2A07F 4LJHA 2EH3A 1NZCA 5A3NA 5FPLA 2Z5WA 1OCRH 1PO21 4GJYA 3V42A 4TTGA 1I1SA 1DFQA 4QD2A 4OCTA 2R063 5C3OA 1YI2I 1KS5A 4CEYC 2YBKA 3I3BA 4PDWA 2GOXB 2Q2EB 2RS12 4B7KA 4V2VA 2W84A 2E1CA 1CQTA 5C6CA 3AJZA 2VKHA 4XJAA 2M9HA 4XLHA 1WW6A 3ZFGC 3I55I 3IKVA 1U5TB 2TDXA 4C2MJ 3WEZA 3IDAA 3HOVJ 1UY3A 3F23A 1RUJ3 1G9BA 1JN2P 4IOCF 3HYIA 2FUG2 1IQAA 4BLIA 4QB6A 2IBDA 4GD4A 3BR3A 4NIIA 4YM0A 5C8WA 5LASA 5JI6A 4IV3A 5F08A 3ECHA 2X5IA 4UOJA 3J7YJ 3AZVA 4YM2A 5FZMA 1LGNA 3BDDA 5FYBA 1PUEE 2EVXA 4MNUA 2LFBA 2VNRA 2JJ7A 2QKLB 1S3JA 1Q1VA 4IV1A 3ZYBA 2H94A 3HTUA 1J9IA 2YC2A 4EM2A 1SDWA 4UW5A 1X33A 3ACHA 3VBHB 2VXZA 2VGDA 5FPXA 4DZJA 2VUMJ 4L8QA 1W5SA 2L01A 2OTJI 2EAAA 3K4DA 4UFIA 1Z67A 3WXPA 3QYFA 2OUHA 3S1NJ 2OV7A 4PCQA 3AZXA 1KYZA 2V6EA 4BJ5C 1AL23 3DWLE 3FHAA 1Y0UA 1SBEA 2E1OA 1ACCA 1XCVA 4PQ9A 3WY6A 2GSYA 1YCIA 2QENA 1DQ2A 4ES9A 3LFKA 4P1WA 5KHDA 2ETHA 4N8MA 5FLIA 3D1NI 5LGTA 3IMNA 5FMBA 3MEXA 5FO8B 1DZQA 4ISQA 2R5YB 2JMWA 3MBWA 3PUIA 1UHSA 5KXCA 4B29A 2L0KA 1QHGA 1D8KA 1W1WE 3MIEA 2OC6A 2I2SA 1LENA 1CN1A 4JHTA 2X1EA 1O3RA 4B48A 1WJ5A 1J3RA 3IDCB 3AMHA 3S2WA 3U1DA 4YFXF 4ATFA 5CEHA 6PAXA 2DK5A 4F3QA 3T08A 2EAKA 2Y6HA 2A71A 5FZ1A 4HDUA 4JV4A 3A4CA 2GIVA 5EPAA 4URAA 3BG6A 2ELHA 4DYCA 2DCTA 2WNOA 3IWZA 3FHIB 2OZJA 4CEWA 1MBKA 1B35C 3X2QH 4HX4A 5JLXA 3JD72 4IQJA 3ZKYA 4IERA 1VJ2A 3OGJA 5LCWL 5IPAA 1PMHX 4QX2A 4M3FA 1HLVA 3MEPA 3CZUA 4BQAA 4F55A 2EIKH 2ZXJA 2LBFA 1MJBA 3ASOH 5LATA 3A23A 2Z5UA 1AXZA 2EFQA 5FZLA 5FXWA 5A6XA 3WUCA 4E6KG 3TKYA 1NLSA 3LE0A 1HC8A 2NS8A 2QQAA 3I9V2 4P96A 2AZ5A 2B9SA 4EEFG 4IVNA 4B44A 1FY7A 4ZH4F 4BXSV 5FYUA 4FPCA 4LXLA 1K79A 5BNOA 4XLPF 3FXLA 2DTZA 2PLV2 3QOEA 5E8AA 3W6KB 4A6OA 4IHVA 5DQ0A 4N4NB 3S5AA 1EH6A 5E20A 2ZFUA 3ILFA 3PFYA 3GGLA 1YXWA 1AR81 5BUVA 2Z9OA 2OCEA 3WG2A 1SEUA 3Q8FA 2W94A 1YTYA 4UFLA 5FUIA 3POIA 4GCVA 1RUH1 1WJBA 3A1YA 2D45A 3HD8B 5A33B 2VONA 2YMZA 3AFKA 2J7MA 1OQEA 4PT6A 4Q48A 2BWCA 2OQRA 1MJ9A 1LHOA 4EGYA 3ZSMA 2STWA 1DG6A 5DUUA 1EV7A 3J81K 2VMGA 1QMJA 3GBWA 1PJRA 3OR2C 4BQQA 1UF2C 3DPRA 3BU7A 3T2QA 2PEXA 4KNCA 4JTNA 4FASD 1D1CA 5ICGA 3SKJE 2DT7B 1ZR4A 3OY8A 2EJRA 1QZEA 1NK2P 4B4QA 5F1JA 2NVYJ 2M4KA 4WZFA 5IK4A 1O91A 1VRH3 1IG0A 1QJX1 4KDPA 1XGSA 1NCRA 4E8DA 1N78A 2XGXA 4UUSA 2CWEA 2LTNA 3KT1A 1OURA 2HDWA 5FFXA 3BY6A 2ET7A 3V65A 1PX3A 5F37A 4D7YA 4BK5A 3VHPA 2NN8A 3USSA 2OUJA 4IPAA 2ZKZA 3VLBB 3UJOA 2P3KA 2L2OA 1SPPB 3DTIA 4MV2A 5EJ1B 4YW3A 1FOXA 3U21A 4OMZA 4R9CA 3ZXGA 3ILNA 3HJEA 5LFAA 5FKCA 3TNPB 5CG8A 3F8BA 4IL6C 4KG8A 2ZAAA 4PLMA 3S3NA 3WDUA 3Q8AA 3J8F3 2BTVC 3IUOA 5FZ0A 1SMYF 1G8XA 4ZDOA 1ZLKA 4OULA 3KX2A 5B2GB 1D8JA 3ZXFA 2HEWF 1DGWA 2BOIA 3ERMA 4XQ4A 4OQ8A 1R58A 5EEGA 3RRDA 4CXYA 1TME3 3I3QA 5A7NA 4Q4V2 2HDDA 4I76A 1ONVA 3AG3H 5TRDA 1UU6A 1A34A 3EB7A 1NK3P 5IT9K 1OFSA 2Y0SN 2VN2A 5HNFA 3DYPA 2K9ZA 1SG3A 2M8EA 3AMNA 3CEWA 1RUD3 2W57A 1K7AA 4DO0A 4FTBA 2Y2ZA 3WU0A 3CTAA 2CH0A 2XSJC 2X1CA 3WP5A 5GAGJ 1PO23 2GC1A 3A21A 1BN5A 2XJRA 1K42A 1Z6RA 2DYCA 1YQ5A 2DO7A 2XAFA 1VE0A 4H0EA 3DP7A 3U2RA 2DT5A 4QM8A 2XQRA 1SDDB 3PNYA 3BTZA 4CUCA 4OI0A 2D6OX 4OI4A 1WCQA 2VQHA 1SCRA 3K6GA 4FTHA 3VBFA 3HT1A 4ZYEA 1QJY1 3DU5A 1WI9A 4RM2A 2P6CA 4B8XA 3LQQA 1FBUA 4ASNA 1FNZA 1LOEA 2VQ0A 1UU5A 4FOQA 3TN91 4KL1A 3RZHA 3DEUA 3WTWC 2SLIA 4AGGA 2HXIA 5DS9A 3AG4H 1Q8SA 1QJZA 3EMRA 1O6UA 1S1AA 1XE7A 3R6SA 1GXQA 1O3QA 4BU2A 4ZS3A 1EF4A 3L00A 5FZGA 2UXNA 5TGTA 2AUYA 4Y1ZA 3ZQHA 5K9YA 3SCGA 2K27A 5GZGA 2GMEA 3CF6E 3AKZA 3AP4A 1R9TJ 1XYOA 3ZDSA 4BKXA 2CGPA 2XAGA 2ID3A 5GLTA 3CJIA 4XAAA 5A1LA 1F4HA 4EV0A 2RJKA 1RYYA 2CV2A 5T50A 4FP3A 3EHKA 2EXKA 4Q27A 2H0BA 4AI8A 4AF9A 4CDUA 1DP3A 2JDNA 1UZCA 1N1TA 4CP9A 3WQ0A 3S57A 1AF9A 4CXFA 2AEYA 2C4XA 1R4NB 4QX1A 1IAWA 5FYCA 3ZPLA 3F8NA 1U5TC 2JXAA 4YFWA 2CQ7A 3S8PA 2BBYA 2VOOA 2FRHA 1DU3D 2ZEWA 1T56A 2DVDA 5GZFA 5DTDA 1QDOA 2VU9A 5L73A 4Y3OA 5IVYA 1IV6A 3MZHA 3IHUA 4XJUA 4NPMA 2VMFA 4Q4W2 1PVEA 3I2JA 1W5CC 3GHNA 4PCRA 1JYXA 3DKQA 2L5QA 2BHZA 2NS7A 3G2BA 5K7FA 3VSLA 1LFUP 1ENXA 1K78A 1X3WB 3VBHC 3MN2A 1VQMI 1V0AA 1XB9A 5J36A 3ZMNA 1AZDA 2Y6KA 5I0DA 4PJNA 1J3PA 3K4KA 2E35A 5EDNA 4LHNA 4Q2FA 4LBQA 2QSHX 1ULGA 2RR12 2XROA 3ZSJA 1WCSA 4YW2A 5HV4A 1QZYA 2KIMA 1CAXB 4KWUA 2K9NA 1H1IA 1Z7LA 4LA3A 2VVFA 2YX4A 2EIGA 1S0JA 2CG4A 4CDQC 4YVWB 3QPLA 2R041 3K7AJ 3FUQA 1MNEA 3F8MA 3RDIA 3Q9VA 1RPWA 1BI3A 1D7PM 5FRAA 2HYJA 5FO9B 1L7RA 3W20A 4Z8BA 2KKOA 2E7AA 2W2IA 2ETEA 1UYZA 1U6GA 3B93A 4NHKA 1ZBA2 1ZLJA 4UUTA 2ZEZA 4K21A 3NWTA 4ZYHA 2E5NA 1XD7A 5AFBA 2IFWA 3LIGA 3L2YA 4A6SA 4HX7A 4HVQA 4D69A 3RZMA 1WW7A 3JRCA 4P02B 3VD7A 1NG7A 3MF9A 2R93J 4Y52J 3FM5A 1AR83 5L3DA 4Y7NJ 1MNMC 5CVUA 2QVSB 4W1UA 5CVVA 1R7JA 1UG2A 1BEV2 3ZN5A 4RS8A 3S15J 1JZ6A 2CFXA 1RUH3 2UUZA 1JHNA 1YJKA 5KK1A 5L9BA 4XACA 2P5VA 4X8PA 1GVDA 1DHKB 4EZ4A 3HR9A 2AQEA 1Y6IA 5FQ0B 2W08A 1X3UA 3IIAA 3AYEA 2YBSA 3ZSEA 4RGSA 3RQIA 1UAIA 1J84A 5F0HA 2JDPA 4DEVA 2P5KA 1ZN2A 5H9SA 1T38A 1T6SA 1B6AA 1BMV2 2RDRA 3BZ6A 4PF1A 1HQLA 4ZXEA 2ARCA 4MHRA 2WN2A 2DXIA 2X85A 1W8TA 2DBIA 3RQ0A 4LR4A 1DIWA 4S2FA 1MPXA 3ELKA 1QJX3 1WHUA 1ON2A 1ETVA 5K4LA 3DL3A 3U75A 1OPCA 2HZDA 2NVTJ 3BPVA 3FFQA 2ISYA 4G8XA 4RHV2 3O1MA 2PLYA 2FD5A 4TYSA 2AS5F 2ZPXA 3WG7H 2VBBA 2ESHA 3K48A 1GQGA 3ZSLA 1W2NA 1Y4WA 1IS4A 5AC91 3GW2A 2QQJA 3M3QA 4XKVA 4QIWN 4ZPIA 4PSXA 3HQRA 1GFF2 4X1EA 4EE2A 2QBYA 1YIPA 2YU1A 3ZFEB 3D82A 4NIDA 3BU0A 1E5IA 4XSXF 5GZEA 4U36A 2PHFA 3FJSA 3SQNA 3OBAA 3VL8A 1Z7S2 3CJRB 1JOBA 2CUZA 2B5HA 1JYIA 2PAMA 1NYWA 3A7QA 3RKQA 4LO5B 2E60A 5LK5A 4OHVA 3BTXA 2GNDA 4F52A 4U0YA 2LY1A 4FAHA 3AX4A 3A22A 4BMBA 1T33A 2W25A 4JKMA 2OZ6A 3W9AA 5BNPA 3ZMVA 1YI9A 4COWA 2MA3A 2CAVA 2PHWA 2LALA 2R16A 3O1UA 5FR3A 2BBVA 2RMU2 2L9RA 2EIBA 2LM3A 3LSKA 1VLNA 2X53S 3GTOJ 3ZRGA 2CDOA 3PJYA 1FNNA 2K85A 1APNA 4QX5A 1HQNA 4GMP1 4EQVA 5IVCA 2X51A 2K3PA 1O7FA 1Z0XA 3RI8A 1FPQA 3QAHA 4I0AA 1EJ9A 5FKBA 2ZHNA 1OKOA 5JLVA 4L9JA 4IHXA 2Y48A 2R062 5C8CA 2WZEA 5JIUA 3FFZA 1H2MA 1JT6A 4KIFA 2KIUA 1AWCA 3ZX7A 2BJSA 3S30A 2VBDA 2DA2A 1FPN1 2A5WA 3BZKA 2HXOA 1JJ6C 1RUNA 3EUHC 3WF1A 4CU7A 1YQAA 1QJY3 3D5LA 2DLLA 2TBVA 2IXLA 1D4M1 4U2AA 1N47A 3TN93 3CMMA 1HV1A 4KMQA 3T1BA 1RI7A 3POEA 3NO8A 5F5QA 1BIBA 5GKAC 5JHUA 5KAIC 2D3SA 3CC4I 4PIXA 2VZTA 4BL0B 1OUXA 3IC7A 1OSGA 2K2SA 1ENRA 2FBIA 3GFLA 4EWDA 4FX4A 4L2NA 4GMP0 1NXD1 3ON7A 1S2BA 2VBPA 3VHRA 3ZOIA 3OBRA 3F21A 1HF0A 4BQ2A 4ZZ8A 3B73A 2HKOA 4Q4X1 1W8ZA 2FSWA 1ZZBA 4ATEA 2CMPA 4RAZA 2ZGUA 5DUWA 1FAYA 2VBWA 1R36A 1QBJA 1QXPA 3M70A 3HOYJ 3ACLA 3OEAA 5DG1A 1VB2A 2ZJQF 1AL22 2LK2A 1TNRA 5DCMB 5LRRA 2GZWA 1V9U1 2EXHA 4DXRA 4L11A 1YE9A 1YIJI 3K4AA 3L2WA 2CFOA 5BMZA 4CZSA 2A6VA 4IGPA 2XKOA 3H42B 1I1GA 4NC8A 4YFKF 3DV8A 4P9GA 2VOVA 2A3SA 1IGOA 1FYUA 1JHJA 3ZN6A 5IAXA 4A6DA 2OBPA 4PBOA 4ZS2A 4AGRA 4QGLA 5HCFA 4M9XA 3WD5A 2VNVA 1KU2A 1FV2A 4XETA 2W1SA 3HBKA 4JX6A 3P9KA 3ZQIA 2FNAA 3CDZB 3GEZA 4OFGA 1P9QC 4BOWA 1OQYA 4CCDA 1ETKA 1DYOA 3KVAA 4XDOA 2BGPA 2C5DA 3FLRA 2ZGSA 5JDBA 4A4AA 5KHIA 3AP5A 4NIHA 3LCPA 2ZO4A 2WT1A 4XF0A 1JT0A 2E19A 4EMSA 4HF2A 4PDWB 4G6DA 4IGOA 3KYLA 2KP6A 1VBD2 3M4FA 4QGNA 4QX3A 2W00A 4FPLA 1GZ9A 2R043 4XUOA 1X8EA 3J7ZI 4MYEA 2PHXA 1XG1A 4BY1J 2ZBJA 3H92A 4XF9A 2ZHMA 1RUC1 2DMQA 3N3HA 3MQ0A 1WA4A 2VUDA 2R7WA 4IV3B 5IVFA 1Z3XA 2X5IB 2WWUA 1CZTA 3CNAA 2ZA9A 2QQWA 3LFMA 3ML6A 2LOOA 3GJBA 2L7ZA 4DYRA 4YW6A 2RDNA 4V2FA 4A3CJ 4IV1B 1W6MA 1SVMA 1EP0A 3N4MA 4IRHA 2ZJPF 1AUYA 5EV7A 3N9PA 3LSEA 1FMWA 1LQ1A 2IVMA 3DKXA 3BQZA 3C7GA 1E0EA 1Q8VA 5KBFA 3K4NA 1BVP1 1MS5A 1B09A 4L9NA 1WJAA 5LA1A 5JR7B 4YRDA 3LA3A 3GZEA 5LA9A 2YY1A 4MXWB 2VQCA 4YSFA 5FLJA 2ZX4A 1IKPA 2IXSA 1W2UA 4Z92B 4MEXF 1WCMJ 2IP2A 4J1WA 4YVWC 3J9SA 5EFUA 4M3GA 1LCLA 4BEHA 1MS1A 3A0HC 5D5UB 3WR0A 5J1XA 4HW0A 4NRQA 3D5OA 2KD7A 1GXPA 2KL4A 4WV8A 2MYSA 3OYAA 1H9TA 4RS5C 3ZXEA 2E1NA 1R22A 2MNGA 4NC6A 3HPGA 3O14A 2IPQX 4YG6A 1VP6A 1W9WA 1VRH2 3NQOA 2SBAA 4IUGA 2WQ4A 3K4ZA 1WWYA 5JXJA 1E3OC 4CCMA 1JYCA 4YGEA 2VNGA 3LDKA 1CF7A 4XQWA 1WJDA 5FTTC 3I2OA 4BE2A 3AKQA 1OQDA 2WZR2 2R7OA 1K4TA 2XB0X 3ALQA 1JYTA 3L7WA 5D8AB 5DZEA 5CFDA 5AC93 3AP6A 5DG2A 1ACIA 4C30A 2WQ8A 3MDPA 4CEWB 4Q1RA 4FX0A 4WM8A 1LEDA 4HONA 5K5RA 1HKQA 3VD4A 4HAMA 4K1YA 2RV8A 5IATA 3CMGA 4NC7A 3ZVXA 3OSGA 3BQYA 1W8OA 3S6PA 4G6TB 3HNMA 4IETA 2LBFB 3WV6A 2OVUA 2JD9A 4NOTA 3J8F2 1QY4A 5IY5H 3ZYFA 2CO5A 4IQPA 3GJAA 1ENSA 3WCSA 1DGRM 1V5GA 1WLWA 4CCCA 3PDQA 5J4VA 4QXHA 3OPZA 2R072 1LNWA 1TME2 1UOJA 3DEWA 2UURA 1E2XA 1Q8PA 4RFT0 3H0GJ 2TRTA 2OYZA 5BNOB 2LUWA 1L3LA 2BEOA 2QQ9A 4QDSA 2Z2SB 3W2AA 4YW7A 3OIOA 1RUD2 4GMP3 2KDOA 2P3YA 2W85A 4J00A 4YVSB 4M74A 1Z0HA 3JRDA 1W8FA 3M7GA 4PJLA 1L3JA 4XIDA 1M06G 1JGSA 1XGNA 3EPZA 3ZFEC 1W0NA 2DJIA 2XAUA 2AEZA 4JDMA 1PNFA 5JPMB 2XDVA 4HXCA 1FPN3 4K20A 2GH2A 2HWE1 3BTYA 5CQGA 4LB5A 2WB1N 3HBZA 5C70A 2AREA 5GLWA 1D4M3 4XBFA 5F6KA 5DUVA 2QA4I 2RVCA 4IZZA 3H3UA 3H9GA 2J1SA 1S55A 3FMRA 3VD5A 1ZGAA 3CZJA 3DPRB 3QP6A 4DINB 2L9SA 1G86A 1CJDA 4TZDA 2WWYA 4C90A 1F35A 2HWF1 1Q1HA 1UNBA 1FOKA 2CGNA 5A3OA 3I3MA 1UZVA 4V19K 5IVJA 2HQRA 2I5UA 5E79C 3IAQA 1JGGA 3KV4A 5EYRA 4IJAA 2GBYA 1NCRB 2YR2A 2G7HA 4JGYC 1BJQA 2Z79A 1KYWA 4Q4X3 3L2UA 3CQOA 1GYKA 3W59A 1PO12 1TE1B 3K77A 3VV1A 2EA2A 4IEXA 5J1YA 1O4TA 3I97A 1EKEA 2VCMA 4CTEA 3JSOA 4X6RB 5IOYA 4U7DA 1N1YA 4AEDB 3L1PA 2R7ZJ 5EHDA 1VQ5I 3I3EA 2K9MA 4JRAA 3T09A 5D4SA 2M8GX 1I6XA 3C8XA 1V9U3 1U9NA 5F6LB 4X0GA 3OCPA 3N9QA 4ZY9A 3AZWA 3WDWA 2WFF1 2WS92 3H8RA