3RDIA

Domain-domain flexibility leads to allostery within the camp receptor protein (crp)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILFYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Domain-Domain Flexibility Leads to Allostery within the Cam Receptor Protein (Crp)
rcsb
source organism Escherichia coli
molecule tags Transcription regulator
molecule keywords Catabolite gene activator
total genus 62
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rdiA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3rdiA01
2DQLA 3MPBA 3VFZA 4QM8A 4KU7A 5FB2A 3GZ5A 5I8SA 3F8CA 3SXYA 4HX8A 3ISPA 4HN0A 2VONA 4AQ2A 4HF2A 4Q5SF 4XFBA 3HTSB 4K2EA 2GC1A 1YFXA 3LA7A 4G8XA 3JW4A 3KGLA 2JRTA 2D5FA 2GA1A 5KHKA 4L5IA 4WK8F 3IBMA 4GXOA 2F5CA 1SFNA 1EP0A 3MQ0A 1J3RA 1LQ1A 2VE8A 3F8NA 3LAJA 3GVAA 3QOPA 2ZNZA 4PJYA 4J1XA 2VN2A 5H6RA 1IN6A 2K4JA 4RGUA 1EH6A 3FF5A 2K02A 1CX4A 3EDPA 1ZG1A 1IPKA 4EQQA 1AOYA 3J81Z 2Z69A 4BHPA 1R58A 3MDPA 3V7CA 4XF3A 1D5VA 1XRUA 2Y0OA 3LA2A 2QCSB 1KA8A 4YIFA 1WI9A 3BP8A 5KHIA 1W4MA 3R61A 3FMSA 1YUDA 2XAGA 1JHFA 4IEOA 2P6SA 5HDGA 2ZO4A 5HI0A 4JBAA 2O61A 4U0YA 1YWKA 1FI2A 4M72A 3USSA 5AONA 4WXCA 4G7ZF 1QQIA 4IF4A 2PTMA 1DDNA 5A2QK 4IRIA 1CF7B 5JHUA 5E20A 2WV0A 3ZMDA 5HVQC 4IEVA 2RDPA 1U5TB 1F5TA 3F3XA 1PP7U 4XETA 4X6QB 2W57A 3CO2A 4KMUX 3KFWX 3D82A 1QZZA 1E2XA 4IEQA 4BHCA 4Q29A 2ZXJA 5K5QA 3C1DA 3GFLA 5LEJA 3D5LA 1FYMA 1W7PB 2V09A 2IA1A 1QPMA 5DD4A 1NE4A 3V8JA 2BNMA 3H50A 1TBXA 3IHUA 3SZPA 2GC2A 3K1MA 1Y9QA 2DO7A 5I0SA 2CO5A 2Q8KA 1KGSA 4HLXA 2WWYA 2MH2A 2CV6A 3WW3A 4AVBA 3HQXA 4YG2F 1BI1A 5CVVA 2OZJA 2ETHA 2M87A 2H09A 3L7WA 1Y0UA 4L0YB 2H94A 2KKOA 3BPVA 3GBFA 2W24A 2L4MA 4IEPA 3ZMTA 2IXHA 1SD7A 3KZYA 2Y75A 1XCBA 4LULA 3KEQA 4HX4A 3WG9A 3TOBA 2XL9A 2FMYA 3PLQA 1XGNA 2MPFA 1WA4A 2OA2A 2HS5A 3LSTA 4ZYDA 2LKPA 2O03A 1C0WA 3HSRA 4KNYA 1UFMA 2FU4A 2M45A 1NYWA 4NHJA 4RS8A 5CVUA 2X0LA 1I5ZA 4OMYA 4P5OA 2HFHA 2OZUA 2AXLA 4EM2A 3RTRA 4YSFA 1J5YA 4O6JA 3MZYA 3PVBB 2HQRA 4Q48A 3HRSA 5FLXK 2VE9A 3WU0A 2CG4A 4ESJA 1YFHA 4ZYGA 2FBKA 3QRFF 1YW7A 3RI4A 2ISYA 1D8JA 4FHTA 2JTVA 1ONVA 1IPJA 4BYYA 4WF2A 4AIKA 3HT2A 1V3FA 3QU6A 4Z82A 5FLIA 4DQ2A 3IRQA 2ZCWA 1IXCA 5D6EA 4IERA 4HZFA 2QNKA 2FEZA 5AIQA 1IW7F 1B4AA 3K69A 4LEJA 4ZU4A 3GXOA 1TTYA 3M8EA 4LG0B 3I58A 3N97A 2YX4A 3W6JB 2G9WA 3FHZA 2LDUA 4ON0A 5TRDA 3WTTC 3JAMK 4PZJA 3K1NA 1I1GA 4KFCA 3FHIB 3BWGA 1OKRA 1SEFA 1ZARA 1KU2A 2CGPA 3NQOA 4D7TA 5IT9Z 4MTDA 3GLXA 2ZBKA 4D7SA 3JSPA 2IPQX 1L0OC 3BZ6A 2EA4A 1Z9CA 3IC7A 2V1UA 1O7FA 3R6SA 3MCZA 4Y15A 3WGHA 3NEUA 5DV5A 4EWEA 2ELHA 3WTSC 5F6FA 3RKXA 3BJOA 1DZTA 5KBFA 1ZN2A 2FBIA 1MJAA 4Q0SA 1B9NA 5DUKA 3TQNA 4XLPF 2FXAA 1ZAOA 1LEBA 2IT0A 4JK1X 5LRSA 4UV9A 4PIXA 1YO5C 3FMRA 1WGPA 3HRMA 3OD0A 4LLLA 3EQEA 4M9ZA 3ZMSA 3IRRA 2Q4SA 2L01A 2EFPA 1KU9A 2KRFA 1SFUA 3DKWA 2PYTA 2EB7A 4H0EA 3O3KA 1QZYA 4MHGA 4GO1A 4U7DA 2E9QA 1ZZ6A 2ZKZA 4KIFA 2Q30A 3RYRA 3MWMA 2FNPA 3WTUC 4PIZA 1MJ9A 5K8SA 3ZPLA 4KA4A 4I01A 2ESHA 2F2EA 5JSPA 3LZZA 2Q1ZB 3QP6A 5LRRA 4Q0PA 2O8QA 1A04A 1BI3A 1Z7UA 1USTA 1EH8A 4MQVA 4GGGA 2H6CA 1W5TA 1IXSB 2L54A 3SQNA 5J6XA 2EV0A 4B09A 2HDCA 3CF6E 4WX9A 3CLPA 5E16A 2BEOA 3H3UA 1DZRA 1ZRFA 3IWFA 4P55A 3T0YA 4M6XA 2RGVA 3C3VA 1WLTA 5FFXA 3H1MA 4Q0UA 5DUIA 1OYWA 1V4RA 2P5LC 2TDXA 3B73A 1YFYA 1QGPA 4UVBA 2ACJA 1UW8A 3LAPA 1U8RA 2UY9A 3SMHA 2XKPA 3FXRA 3J7AO 3KP2A 4GCVA 1XMAA 4I0BA 4FBFA 3O2PE 3DXJF 1BOAA 2EWNA 4YFNF 3ACLA 1OMIA 1ON2A 3MAJA 2ET1A 4NQWA 3M7GA 1MD0A 4PGGA 3V7RA 4QWQA 4UXNA 3JSOA 2ZJ2A 1UPIA 3M3IA 2ESNA 2GH2A 1R22A 1P92A 4HLYA 4LTAA 4RGSA 4YRDA 2A69F 2PMUA 4AVCA 3UKTA 1UIKA 3WODF 2HEOA 3MFKA 4KWKA 2M1BA 3QP5A 4QGNA 3U0ZA 3I0TA 4N9IA 1VTNC 4KL1A 5I93A 4ORFA 1R00A 2OQGA 5K5OA 3FMQA 5DEQA 1CAWB 4KN4X 2P8TA 5JR3A 3G7DA 3I71A 2EFNA 2YPRA 2MNGA 4TV7A 3Q9SA 3ZN1A 4QMAA 2FA5A 2QQAA 4Y17A 4FX0A 2OU2A 4G6DA 1UB9A 4HQEA 1PP8F 1V70A 2XAHA 4RAYA 4QGLA 5J3UA 1ZRDA 3I7DA 3SCFA 5C6CA 5L3CA 4IEZA 2JZYA 5E17F 3TDZC 2RVCA 1S3JA 3HSEA 2HKOA 5L3FA 2QBYB 1CAVA 5L3EA 2FMLA 4META 4M9XA 4L11A 2KJBA 2P7VB 3FXQA 5JI6A 2VBWA 3K2ZA 2M30A 2PFBA 1ZZCA 3MYXA 3GZ6A 3WTYC 3WTXC 3KP7A 3E5UA 3O6BB 4HF0A 2PN6A 3D0JA 1UIJA 1MGTA 4IJAA 3E97A 4YIIA 4MGKE 4XFFA 2QVOA 2UYBA 2O6GE 1FBUA 3KP5A 3CJXA 2OD5A 1XD7A 1JGSA 2QQBA 1HBXG 2P5KA 5J7MA 2VBYA 4IXAA 4U88A 1P2FA 3T1BA 1SD5A 2V79A 4IETA 4XFIA 1XB4A 1HW2A 1SD6A 3M1EA 1TQMA 1ZYRF 2H6BA 3KETA 4U0VA 2F4PA 2MLKA 5L3DA 2XV4S 1HW1A 3HIFA 4KT5C 3LOIA 1U3EM 3R0JA 5FPZA 5H6QA 4IEUA 5BQTA 3ULQB 2DK5A 5KHJA 2EVXA 1IUYA 3P7NA 4LB6B 2IRFG 2QJVA 5FGMA 1U78A 3NKTA 1ZZ7A 1CAUA 5KVRA 4E2GA 3TO6A 4EMSA 2IVMA 1TW2A 3LA3A 4AD9A 5E8IA 3F8BA 3WW4A 1WQ2A 2IA0A 5DCFA 4AWXB 1LRHA 4EV0A 1BC8C 1F1ZA 1R1VA 3BALA 3E5XA 4LUKA 1W5SA 1XCVA 1RZ4A 3GUDA 4CZZA 1Z91A 1P6RA 3EETA 2BBYA 4HV6A 3TKYA 5FDBA 2CAUA 3R0AA 3CO7C 1H1MA 1R1UA 3CUOA 2FF4A 1YHFA 2P6TA 2QWWA 4MQ9F 4AIHA 5BPIA 1XDUA 5FO5A 2DTRA 1L3LA 1TQIA 3BCWA 5ICEA 1VP6A 4S05A 4RB2C 5KHGA 1FYKA 4MGZE 4KMFA 5ED4A 2JPCA 1U5TC 2KJCA 2K4BA 3LWFA 1BM9A 3E6DA 3RPQA 2HYFA 3E5QA 4EGZA 4MUVA 1WSUA 3OOPA 1TQPA 3TO9A 3LQQA 5E18F 5FD5A 1R5GA 3WGGA 4XFHA 1OD5A 2ATFA 1TQ5A 4UBGA 5LGTA 4QX5A 2PJPA 2XAFA 4L0ZB 1J2XA 6PAXA 1P4XA 4LD5A 5EFUA 3BY6A 3WU1B 2Q0OA 3CDHA 3CUQB 1ZX5A 5D5UB 2GXBA 4D0PA 2XLAA 2A6EF 1XSXA 2QBYA 3REOA 4A12A 1MZBA 5FQ0A 2WTEA 2Q0AA 1YLFA 4KN7X 4ZU7A 2XGXA 4R79A 4ETSA 3I59B 2EK5A 1IN8A 3GEZA 2JSCA 2ZMEA 2KIMA 2GAUA 4DNCA 4XFCA 3DEUA 2GZWA 1Q43A 3F8FA 2XAJA 5BPXA 5HDNA 2EV5A 5KHHA 2D1HA 3DFGA 1ZNPA 3ZMVA 1P4WA 4BH9A 1IN7A 2PBIA 2DCTA 1J3PA 1BIAA 2B9UA 5FLJA 3S7EA 1IRFA 2UZKA 2HGCA 1BI2A 4FX4A 5ILSA 4HQMA 4XEZA 1QO0D 5CLSA 1Y3TA 4ESFA 4N9HA 3CEWA 3OV8A 3DV8A 3V8LA 4X6RB 5J8FA 5DD8A 4BIFA 3NW4A 4OIPF 2L02A 4L9VA 4Q0QA 3KEOA 1S7AA 5CJ9A 5H20A 1XGMA 3OF1A 3P9CA 1WWXA 4PIYA 3PQKA 4WBBA 3RPUA 1U12A 2LNBA 5D8LB 5IT9K 3DP7A 2UXNA 3ROUA 5JVTA 3E6CC 2EFWA 3TOAA 2D5HA 5C8WA 3U11A 2EAAA 1REPC 3C18A 2EA7A 4ENMA 1DPUA 4HSLA 3V7SA 4YFKF 4LLOA 2DLLA 2MLGA 1H0MA 1YFWA 2D45A 1R1TA 4LLGF 1XGOA 5ERIA 1CAVB 4WCGA 3GFMA 5E1WA 1GXPA 3BJ6A 2K9ZA 3BPZA 1GQHA 2DW4A 4EM0B 3MZHA 3L2CA 2BV6A 2XUBA 5D5XB 2W84A 4A0YA 3IWZA 4AIJA 2RV8A 4PCQA 3FZVA 4LK1F 4MGIE 4HW0A 2YX7A 4L9TA 2LF7A 4JQFA 4ZYEA 5D8KB 1KQ8A 2QENA 5I0UA 2F5DA 2A5YB 3CJNA 1RUNA 4A0ZA 1DP7P 5FPXA 3SCGA 2ZNYA 1SQ4A 4IEYA 3HYIA 5JSRA 2QLZA 1E17A 1AWCA 5D5WB 2STWA 4RAZA 1IRGA 4EJWA 3HHGA 2OYZA 1BN5A 1R5HA 3ML6A 1LJ9A 2G7UA 1QXRA 4LA2A 4KU8A 4PDKA 5L3GA 2Y0MA 4P9GA 4EGYA 1O57A 5HOOA 1O3SA 1J59A 2MD5A 4IEXA 4HF1A 3ST7A 2W85A 4UBHA 3SHRA 4MH0E 4L5JA 2VT3A 2GC3A 2Z9OA 5E8GA 3P9KA 2XL7A 3G73A 3KP4A 3ERED 2Z3YA 4HLTA 4L9JA 4XRFA 1O5UA 1KU7A 2PHLA 1ZRCA 1BI0A 2Z33A 4A5NA 5JCTA 4OOIA 3KZZA 3DQVC 4G9YA 4HX7A 4ZZLA 4IHSA 2CWEA 2BYVE 1PM7A 3WW2A 2GA2A 3F22A 1F9NA 2XHKA 4LFUA 1R36A 1S6LA 4LGWA 1OYYA 1RTVA 1O3RA 1J58A 3HT1A 3FX3A 3J80K 3GFJA 2EJRA 2STTA 1ZZ8A 4E2QA 3K0LA 3L00A 3FM3A 2D40A 1KYWA 2ETEA 2LF8A 3EO6A 1R23A 3EBRA 2L4AA 5HS9A 1YFUA 1XGSA 1FP1D 2ZMEB 2J5OA 3QACA 4B29A 1HQCA 3JTHA 3P9IA 3KP6A 4F7ZA 1WRJA 1X8MA 2GIVA 2M8EA 2XIGA 1LB2A 1ZLKA 1UCRA 3WGIA 4XF1A 2V1DA 5K1YA 2O8XA 4MV2A 2QM3A 3RYKA 1L3JA 2VBZA 2I45A 3EJKA 1DGWA 5BV6A 2PLYA 3TO7A 2HTJA 2A3SA 1G3TA 2IC1A 1ULYA 1S8NA 1VR3A 1W7PD 2Z5UA 1PMIA 4UHTA 3KE2A 2HJIA 3OGJA 3HHHA 1RNLA 2VBXA 1YIOA 2DT5A 4IVNA 1T39A 2CW0F 2GWRA 1J1LA 2VOPA 1EYBA 1FPQA 1FWZA 2VECA 3J80Z 1QY4A 1FC3A 5EZWA 4WWCA 2PEXA 2NNNA 3M70A 5FCCA 2IP2A 1K78B 5E1RA 2GXGA 3LQRA 5I8YA 3K9TA 1ZRRA 1O7LA 3DN7A 3H3ZA 1B1BA 4LUMA 4XF0A 5DCMB 5LHIA 2IXIA 4HAMA 2B5HA 4IESA 2FQ3A 3LFKA 3N4MA 4MGRA 2N7GA 1MJBA 1XSDA 3QPTA 1LNWA 3I53A 5LHHA 2BE5F 2XROA 2FRHA 4AXOA 2VT2A 4IRGA 5CVJA 5LGNA 2IW5A 2R3SA 1ZGAA 4OIOF 3QPHA 2V6CA 2PA7A 1UHMA 4UNOA 3TDUC 4Q4ZF 4F8AA 4A6DA 4JV4A 4PGHA 2CQKA 2O3FA 3COAC 1T6SA 5E1ZB 3I4PA 1XE7A 4ASNA 4HBNA 4HVRA 1B59A 3UKVA 4CYDA 3ZMUA 3SFZA 1ZLJA 3VEPA 1YYVA 2KIFA 3H9AA 2KXLA 1BC7C 1Q5OA 1TNSA 5CVRA 3TNQA 3H7YA 2DBBA 1K79A 2DI3A 4HVOA 4QGMA 3H92A 2AS5F 1Q1HA 2UWMA 2VQAA 1HSJA 1G4DA 3ES4A 4FAHA 4I3PA 2K27A 5BXXA 3CTAA 2VC0A 1IF1A 2EA2A 2OPKA 4H7LA 5FLXZ 4OLLA 2P5VA 2PI0A 1HW5A 3VODA 3FZ3A 5BUVA 3RJPA 5I8TA 3U9GA 1ZHFA 4CICA 2CYYA 1STZA 3BU7A 4YNIA 2M5WA 1OR7A 4I2OA 2OA4A 2DAOA 5CYVA 1FT9A 3G3ZA 4ENJA 2R7DA 2XKOA 3RNSA 4UUVA 4UVAA 1PDNC 1O3QA 4KICA 1YS7A 1MKMA 2E1CA 1MDMA 1XMKA 4OINF 3CUQA 4LJZF 5EEHA 2D93A 4MEYF 4RB3C 4U7BA 1H9TA 2RQPA 4KWJA 4R1HA 1YS6A 4FT8A 4CHUA 2E7XA 4UVCA 1J0RA 1H9GA 3SHFA 5HDKA 5LHGA 2MHFA 5I0TA 4I09A 3BB6A 2MC3A 2NS0A 4L2NA 4BQAA 2DK8A 3EYIA 4FAGA 3CUQC 4KYWA 2VODA 4I7HA 3IKVA 4OIRF 5JFRA 1XN7A 1YG2A 1FSEA 3ECOA 4HV5A 3F21A 3KP3A 2C6YA 3FWEA 3IL2A 5LBQA 1USSA 1YW8A 3GF2A 1GXQA 4E70A 2DQRA 2XASA 1EH7A 4AVPA 4IEWA 3ZP5A 1S29A 4E2SA 4MEXF 4RB1A 2YR2A 1SMYF 3PFIA 1FZPB 3CL1A 2UXXA 4LA3A 1CAUB 2COMA 1I6XA 1U6GA 2IXJA 1FX7A 1J9IA 4IPAA 3JAMZ 1JXSA 5ICCA 2HTSA 1CAXB 1OPCA 3S2WA 1HSTA 2R7FA 1JE8A 3SXWA 4HOBA 1UCXA 1F4KA 2VXZA 1NHAA 3Q5FA 3NL1A 1ZZBA 4MNUA 4GULA 3GYDA 4MX3A 3M8FA 1FY7A 4CO8A 1UHWA 2IXCA 2RNJA 1XSVA 2Z99A 2FE3A 3IKTA 2L3DA 4O9GA 1SD4A 1YLLA 1SFEA 4I98B 1KU3A 3CLOA 2OAZA 3JZVA 2HOEA 1YW9A 1X8EA 4QXKA 2H0VA 5EEGA 3IDBB 1LDJA 4EJVA 1BJAA 3TGNA 1LKNA 1JUHA 1UD1A 3KSCA 3I59A 2WFPA 2FNAA 1LEAA 5HS8A 1B6AA 1FSHA 4Z2YA 4O9EA 1X3UA 1RC6A 5DCMA 5F1RA 3HRTA 3MEXA 3F23A 4K8FA 2CFXA 2QUFA 3NRVA 2NNYA 3J81K 5DDGA 4YARA 1CGPA 1K78A 4XFAA 3U1DA 2O1QA 3WW1A 3I64A 2P4WA 2HZTA 4ZYHA 1LDDA 3S7IA 2RKHA 1Z05A 3SZTA 3R4KA 4I02A 3RDIA 2ET7A 2B0LA 5HLGA 2E7WA 3H1WA 1HKSA 3U10A 2XVCA 2UYAA 1FBQA 5BOXA 4LMYA 2Z2SB 2OQRA 1SMTA 3T8RA 4ENKA 5JR7B 5F64A 4RGRA 2KIUA 3GO5A 1G3YA 5LLQA 1RI7A 2P17A 2A6HF 3WE3A 1WKMA 3K1PA 2FBHA 5E1XA 4J1WA 2EFOA 5T3NA 1J3QA 4NB5A 2IJLA 5AVPA 4UXAA 4QM9A 2ISZA 3EHKA 1DGRA 3FE5A 3AAFA 4KUMA 3B02A 4YYOA 1O3TA 1X82A 3IIAA 4QLCU 4WXDA 2PQQA 1G3WA 2VOOA 3H1YA 1HXDA 4KIGA 1SAXA 5FLHA 5BS6A 1ZREA 4O5VA 1HKQA 4RB0A 4MTEA 2IXLA 4GYGA 4JTNA 4HDVA 1GVJA 2A61A 1Q3EA 2QYOA 4MGYE 1TLHB 1FOKA 4KIBA 4BHBA 4ENNA 4EJTA 3H8UA 2K0GA 5IT3A 2K86A 2DPDA 3T5XA 5L3BA 3GYHX 4MZUA 2D2WA 3WTVC 2CAVA 1EPZA 3ABTA 2D1VA 5CU1A 4P9UA 3HRUA 3VHRA 1OFNA 2IA2A 1IXRC 2W25A 3HOTA 3ABUA 1G3SA 1G6NA 4HBLA 2NYXA 1YQAA 2XLFA 2HWVA 3DPTA 3BOQA 3I5UA 4OIQF 4G7HF 2FOKA 1O5LA 4OFGA 2GQQA 3ETQA 3RYPA 4HDUA 1FNNA 4CXFA 1GQGA 4M71A 2BNOA 3S0MA 2DU9A 3DPLC 3BJAA 2C0ZA 3DL3A 3IDCB 1ODDA 3BPXA 3JTGA 2G7HA 4A6EA 1VJ2A 2ZFWA 3EQLF 4O3MA 1RL3A 4BXUA 4WZCA 1D8KA 1NXMA 4XF9A 2HQNA 3VOEA 3RIRA 5CADA 3LWCA 4A0XA 3C3WA 4HMZA 4HYEA 3V4GA 4L18B 3L2HA 1K7AA 2QZ8A 3O14A 1R7JA 3ELKA 2PHDA 4OU0A 4IHTA 5FFZA 4M73A 1JHHA 1RGSA 3GWZA 5HS7A 1FP2A 1W7PA 5I91A 5TJJA 5I0RA 4Z07A 3HTUA 4B8XA 1FXZA 3VB2A 2GC0A 4EROA 4Q47A 1DUXC 4LB5A 1J75A 4ZZDA 1CAXA 2RN7A 2ZKLA 1BBYA 1DPRA 4RD7A 3GW2A 1U5TA 3NSTA 1QNTA 5K5RA 3W6KB 2B8MA 2QQ9A 3WTWC 5BMZA 1ON1A 4I0AA 1OYIA 4CGZA 1EV7A 4R8HA 4L9NA 4EJOA 3I54A 4M74A 1OI6A 2PQ8A 3GFIA 5D1IA 5JSOA 1ZG5A 4NVPA 5HLIA 3F72A 2PAMA 4N0BA 1H1IA 3Q9VA 4XFGA 1FLIA 4BAYA 4GYIA 5ILUA 2Y48A 3RKWA 5ICGA 2GU9A 1YTYA 4AQ6A 2LSOA 1Z6TA 4WXHA 3ZQ7A 1B9MA 3R60A 4DINB 2EFQA 3H7JA 2YSRA 2DFIA 2XLGA 3FJSA 3PQJA 4LLNA 4KWLA 2Q2EA 1NE6A 1LVAA 2V1XA 3UKNA 2J5PA 4R52A 1TW3A 1Z1DA 1CAWA 3SCHA 4JTOA 3ZDSA 1KQ9A 5BY5A 2F5EA 2O0YA 3L9FA 2YU3A 3HUGA 4A5MA 3HOSA 3OCPA 4LK0F 3GX4X 2WC2A 4ESBA 3OTFA 3F6OA 2BNNA 1Z6RA 3M9AA 1D3YA 2H27A 5ICFA 4LG0A 2XRNA 2DPUA 4XBFA 4A2UA 5AIPA 4EJUA 5JAXA 4KDPA 3KLOA 2A68F 4AVAA 1XDSA 3KGZA 2PG4A 4Y13A 1IN4A 4CDGA 5ILVA 1J7KA 4JVAA 1RUOA 3CO6C 1FBSA 1I27A 2HKXA 4P9FA 4XSZF 1T38A 2JT1A 2V9VA 1KYZA 4M6YA 3ES1A 2A07F 2HYGD 5D4RA 3PNAA 3QAHA 3T8TA 2OZ6A 4G94A 1SFXA 2X4HA 2E1NA 2PMHA 1MDMB 1PUEE 1S7OA 2NRAC 1IZ1A 2NAZA 3KLNA 2BGCA 5LGUA 4ONUA 2MBFA 4HA8A 1T98A 2FQPA 1T2KA 4G7OF 1X7NA 3ZMZA 1RIOH 2K7LA 1ZG3A 2HR3A 1QBJA 1BIBA 5A2QZ 1XE8A 1K6OA 3LAGA 3FM5A 3KMHA 3E3VA 4ZH4F 3RKYA 3E6BA 1GHCA 1ZVFA 2ADUA 5J8CA 3WTZA 3F6VA 2EV6A 3TNPB 2QVSB 1FYLA 4YFXF 1I1SA 3HSFA 5HLHA 3EUHA 3NVCA 5D6FA 3RZZA 4HSJA 2JPBA 5J48A 1IAWA 2PAKA 2OBPA 1TNTA 1ZH5A 2VPVA 4HN1A 4XSXF 4P96A 3F8MA 4XLNF 3E6MA 4U0WA 3ECHA 3ZN0A 2PAEA 5D5VB 5KK1A 4G6QA 4EWDA 2P7CB 5DYMA 4EVIA 4RGXA 1QXJA 1LR5A 2PFWA 2XAQA 3V8KA 2QDRA 1LDKB 4UV8A 5BPDA 1NZCA 1O4TA 2FSWA 4BNCA 3EYYA 5FQ0B 2RC4A 3C7JA 3L09A 4EWAA 4WVZA 1T0FA 5LEKA 3FFQA 1P4AA 2IXKA 3FXUA 1QWRA 1ZZ9A 2VC1A 5FD6A 3U2RA 2F5FA 2CSOA 3QU3A 3D0SA 1CF7A 4HVQA 1HKTA 3DF8A 3WE2A 3ELNA 5CVIA 4M9SA 5D4SA 3BROA 2UY8A 4TLFA 1ZGJA 1EY2A 1U2WA 4S04A 3BDDA 2MH9A 4Q0VA 3KCCA 4IRHA 4EM1A 2MA3A 3NJZA 1KQ0A 1IN5A 4OMZA 4XF4A 4ZU5A
chains in the Genus database with same CATH superfamily
2DQLA 3PVNA 2VOWA 4Q4Y3 4KU7A 4LBKA 3GZ5A 3AP5A 4QKNA 4X0GA 3ISPA 4AQTA 1IRZA 2M2EA 3OYEA 2VONA 2B9VA 3I3MA 4Q1RA 2R30A 4CVUA 1UMIA 3JW4A 3A7QA 1JUPA 2RDRA 2GLOA 5FZ9A 4L5IA 2BOLA 4WK8F 3OY9A 2F5CA 2ME6A 3MQ0A 2R043 1J3RA 1UN1A 3F8NA 1MBJA 1SPPA 1G9AA 5LBBA 4HPKB 5KC6A 3MGUA 2VKEA 4J1XA 5L19A 5H6RA 3C8XA 4V1PA 1IN6A 3WV6A 1F4AA 4QPGA 4PUSA 1ZTRA 1CIYA 3Q8FA 1ZG1A 1AOYA 3ZR5A 4CEWA 1QF3A 2Z69A 5B1BH 3DU5A 3MDPA 4XF3A 1D5VA 4YELA 3HM5A 3R4DB 3BP8A 2CUFA 5IP7J 3A2KA 5APAA 4DNYA 3VV1A 2ZO4A 4DJAA 2K3PA 4M72A 1S9HA 4WXCA 1PUFA 3F9KA 3OYFA 3TEWA 3WQ7A 1DDNA 1GNZA 3WCRA 5HVQC 4IEVA 2RDPA 1R083 5EG0B 4XETA 4X6QB 2J1SA 2DA5A 3CO2A 5C44J 1LHVA 2NVYJ 5BNPC 4BMBA 1E2XA 1SMVA 2XWJB 2ZXJA 4LHLA 1UWWA 1IG7A 1Q8OA 2X10A 5DAWA 1ST8A 5DDJ2 2L9NA 2BNMA 3IHUA 3ZXKA 2Q8CA 3JRGA 2ENRA 1WLCA 2BWAA 4QPGC 2CO5A 1YNAA 5A7QA 3NQHA 3ZLIA 5K9YA 1ASJ3 2WWYA 2MH2A 4OHWA 3WW3A 4AVBA 4LBOA 3OMYA 1BI1A 5CVVA 2ETHA 1ZR4A 3L7WA 3OOUA 1WW7A 1Y0UA 3H8RA 1B09A 2YUSA 4XQWA 1TNRA 1HRI1 3VD3A 3AB0A 4JAAA 1SD7A 3KZYA 2Y75A 4LULA 2LKSA 5IYCJ 3TOBA 1VBE1 3PLQA 3PU8A 1XGNA 1U5YA 4M00A 2OA2A 3LSTA 4XLEA 1SEUA 1WJEA 3POWA 4KNYA 2RG4A 1UFMA 4Q4X2 2M45A 1NYWA 4NHJA 5HV4A 2X0LA 1NLRA 1I5ZA 4P5OA 4NHXA 2HFHA 2OZUA 4BQNA 3DXUA 4Q48A 2XSJC 4YW7A 4HANA 1E3HA 1GICA 1HRV1 1IV6A 2VE9A 1RUI1 2CMPA 1QRYA 3CLQA 5FY7A 5F1JA 2JKXA 2V72A 3RI4A 2ISYA 1RYYA 2HI3A 1IHMA 4H3WA 4OI4A 1IPJA 4RHV1 1V3FA 3PNTA 4C3HJ 5FLIA 4FPKA 3HQUA 2ZCWA 4IERA 3VBRA 3AMHA 3AZXA 2OT7A 2ZHNA 2WL1A 3I97A 1IW7F 4OUEA 4D69A 3M8EA 2E60A 1JBCA 2JWTA 1XSQA 2G9WA 2DCYA 3JD71 2JMWA 1A78A 3LPGA 2LDUA 4ON0A 1D0HA 2OXBA 3KX2A 2NQYA 3M3QA 1SEFA 1KU2A 2CGPA 4WVMB 3BLYA 4AZZA 3ZOIA 2WZR1 3J7YJ 4D7SA 5E79C 2PHRA 2XWBB 3UETA 3BZ6A 2EA4A 4N53B 5C3PA 2WNUC 5KNLA 1O7FA 3R6SA 3MCZA 1Y9MA 3D3AA 4JP0A 3WGHA 1VRH2 3RRDA 4Y1VA 3ZQLA 3Q0UA 5F6FA 3O1TA 1QEXA 2FBIA 2W92A 4RN5A 4RAFA 3I9V2 4XLPF 1RUJ2 3OPTA 1LEBA 4JK1X 1Y1WJ 5JMCA 4DGWB 1G2HA 3BPSA 1HQLA 3IZOA 3FMRA 3HRMA 1AU7A 2ZEXA 1S2KA 3VKNA 1KU9A 2IEKA 4JX6A 5E3OA 4PBPA 3W2WA 2PYTA 4H0EA 3IKWA 1QZYA 2D3RA 2VQ0A 1GNYA 2Q30A 3HD8B 4IL7A 1MJ9A 1M1EB 3HWJA 4NR1A 3LSDA 3ZPLA 4KA4A 2ESHA 1URXA 1X33A 2Q1ZB 4FP3A 3QP6A 5IVVA 4M3CA 2FZ1A 2WBMA 4GGGA 1JOPA 3INAA 3SQNA 2MEV1 3RZGA 2ZGLA 3CF6E 5E16A 5HNFA 3H3UA 2NVQJ 4KGQA 4Y20A 1SPPB 3U07A 5HCBA 3BR1A 4M6XA 1VRBA 4GWIA 4YG0A 5DUIA 1OYWA 3OYHA 1BCXA 1O6UA 2DU0A 2TDXA 5KAIC 3PIOF 1QGPA 4UVBA 2ACJA 4LK7A 1U8RA 4MXVA 2ZGUA 3OGRA 2ZX1A 2XKPA 3RGBA 1PGW2 4YM2A 4GCVA 1XMAA 1KQRA 3O2PE 2RHPA 3S8PA 1H9WA 1FTZA 1XE0A 4LBNA 5ANQA 4QAWA 1EV11 3MAJA 2DA7A 3ZN5A 4NQWA 1QIQA 2VZQA 3M7GA 1MD0A 2CU7A 2LD5A 3GLLA 1ULCA 3CCEI 2ZJ2A 2VTFA 3M3IA 3FC0A 2GH2A 3BU0A 4HT1T 3G1MA 2DXIA 3N9QA 4LTAA 4RGSA 4YRDA 3FBIB 5M5XJ 1R093 3GGLA 4Y26A 2XBO2 1JZ3A 4DPNA 3NJXA 5F3IA 3OD4A 4CYCB 1X9PA 4AG4A 2F4IA 3QP5A 3BODA 2Q1MA 3U0ZA 3DPRC 4N9IA 1AHSA 3GTOJ 2CRGA 1NG7A 4ORFA 1R00A 4RR3C 3CC7I 2E31A 1SZBA 1MZ5A 3I71A 2ZX4A 2MNGA 1VB4A 1AR63 4JCKA 4JRLA 4XKWA 1YC61 2VR4A 2D6KA 3BQYA 2QQAA 2BP6A 1OR7C 3AVRA 1AL23 4K8RB 2OU2A 3AP7A 4HQEA 5A7WA 5GZDA 1MS5A 5J3UA 4M3CE 2YU9J 4UFKA 5C6CA 4IEZA 4N43B 3CDZB 5CB7A 3HSEA 1XMXA 5FLVA 1CAVA 5L3EA 1GKBA 3GCWA 4KI5M 1WW4A 4META 4WM7A 4BA6A 4L11A 2DYRH 4AEJA 1LAJA 1CWPA 1UMQA 1XNKA 2DA2A 2VBWA 2M30A 2PFBA 1ZZCA 1VFCA 4JHTA 3OBZA 3S32A 3E5UA 2WZ8A 2WWSA 2PN6A 3D0JA 4DXRA 3Q8CA 1YJ9I 3E97A 2OC6A 1WMDA 4MGKE 2QVOA 1AKHB 2RV9A 3CD6I 2O6GE 3NMBA 2ORZA 2OD5A 3M8JA 4MXWA 4QDQA 1XD7A 1JGSA 2QQBA 1QVUA 1QMJA 5GLTA 3CKHA 1HLVA 5J3LA 5J7MA 4XQDA 3UNPA 3O1MA 1BW5A 2ECBA 4XFIA 1CVNA 1DF0A 4EATA 2K9LA 1ND2C 2ZHLA 1XTAA 1OLMA 2JN6A 1H30A 4UW6A 2X5IA 3GCMA 3BOPA 3ULQB 1W6NA 3SDBA 1DG6A 5DABA 5FGMA 1AR71 3OOXA 3V0AB 3MIBA 2WINB 1Y39A 4E2GA 1ULOA 5L7OC 1AYM1 1UF2C 2JA8J 1TW2A 2E35A 4DOZA 1FEXA 4EN8B 3WW4A 2EIGA 4YG6A 4LBLA 2DFBA 4EV0A 2UURA 3O0WA 4F83A 3BALA 1I3HA 1Z91A 3U4SA 1P6RA 2ZMKA 5LY1A 1OXCA 3EETA 1H6XA 1V5EA 2XPWA 1R1UA 4GRIA 3CUOA 2DMNA 4RAGA 2QWWA 4CH7A 5EGOB 1A8MA 2E6VA 4AVSA 5FO5A 1TQIA 5BNNB 3BCWA 2QZ3A 3PDQA 2ZAAA 4XJUA 4S05A 4P9LA 1X2MA 4MGZE 1EAH2 3I2DA 1VQ7I 4AEDB 2QQIA 2KM2A 1U5TC 2K4BA 5K0UC 4GKXA 4QX1A 5FZOA 1OUSA 1W2OA 2E34A 1MQTC 2IGOA 2VBDA 1K6YA 3WGGA 2BERA 3MV01 2ATFA 2WQZC 1G9FA 2QE3A 2PJPA 4AF9A 1J2XA 3WU1B 3OUJA 1R71A 3CDHA 5D5UB 1DFQA 3IH3A 3OS1A 4FFFA 2A6EF 1XNBA 3SFIA 3VBFA 2D3SA 2OIIA 1MH3A 1YLFA 1ND3B 1YJWI 4ZU7A 2XGXA 4R79A 4ETSA 3I59B 1B8IB 2JSCA 2H1KA 5F5CA 3T2PA 4AUXA 4AHWA 3DEUA 2BXZA 3WEZA 3MO4A 5HDNA 5KHHA 1XQNA 3G71I 2D1HA 2Y64A 2VCBA 1YOVB 2X1DA 2VZRA 1FJLA 4OHYA 2HLEA 1P4WA 1WZ2A 2DCTA 2HU9A 4LPLA 4YGCA 1FMD2 2VOXA 3ZXGA 1QO0D 3E1SA 4RA0A 1LE8B 4MGTA 3OY8B 4COVA 4Q4V2 1P7IA 5CLSA 3ZYPA 1D0ZA 3BTIA 3FHQA 1H8TA 4CE8A 2F4LA 3NARA 3OYIA 3GZAA 4IL6C 4DXSA 4Q4W3 3ZXDA 3KEOA 3A03A 3FUQA 2LY2A 5AFBA 1XGMA 4H55A 2R49A 4PIYA 1YIFA 3PQKA 3ILRA 2LNBA 5EIYB 3FIWA 5JVTA 2NOJB 3E6CC 5IATA 2EFWA 1RHI1 4CDXB 1WZXA 5C8WA 5J1XA 1ZA7A 3C18A 2JA7J 3LPFA 4HSLA 3B3QE 2Q1FA 3M3EA 5BNPB 1XGOA 5ERIA 4CDWB 3WQ1A 1E5HA 2LUWA 2K9ZA 2CNAA 4MO3M 3MZHA 2BV6A 2ZHMA 5FP4A 2XUBA 4J00A 4II3A 4UFMA 3K4KA 5FKNA 5FY9A 3VUOA 2X6YA 2HDDA 3DKYA 4P5HA 1LNSA 2Y0SN 4E7HA 5C3EJ 3PSIA 4LK1F 4MGIE 4BLIA 1KQ8A 4FOVA 2YPDA 2YZ4A 2CDOA 3CJNA 1N47A 1RUNA 1AX1A 4UFHA 3LNQA 2WO1A 4XJAA 2ZNYA 1S0BA 5JSRA 4QD2A 5IVYA 3TW7A 1ODNA 5D21A 3VHNA 1VQPI 5A32A 1LECA 1R5HA 3ML6A 4LA2A 5DAPA 1VBA2 4Y7NJ 4P9GA 2KIQA 3K48A 1XNCA 3HOVJ 4C8DA 3CJRB 2W85A 4KJZA 2JK3A 4UBHA 3BZKA 4IZZA 2Y6HA 4B3AA 4HFSA 2VT3A 3ZQGA 1TT0A 4QKBA 2JEMA 2M0CA 2VMGA 5KCMA 4NPRA 1GZTA 2XL7A 4BQ2A 3G73A 4I6ZA 5C70A 4COZA 4J19A 2Z3YA 2LYCA 1W0PA 1D4VB 2W47A 4WVVA 1BI0A 2Z33A 5FZ4A 4A5NA 2JX9A 2JB4A 4Q4V3 1Z0XA 3DQVC 4NIGA 1HJGA 5JLXA 1W6PB 2VC9A 3WW2A 3Q0WA 2QA4I 1CJDA 2QQMA 1R36A 1UX7A 2PN5A 4BQYA 4AEKA 4XJWA 1J58A 3FX3A 2KRCA 3I2HA 3GFJA 5JVVA 2XB0X 2V4VA 1ULGA 5EZHA 4AU7A 1FTTA 1VRH3 4NE9A 1FP1D 1LOFA 2J5OA 3QACA 3K75B 4DEQA 2VOTA 2VCAA 3P9IA 4NPMA 2R7SA 3ZYRA 3KQ4B 2M8EA 1MS8A 1PO21 3MBWA 5EYRA 4XF1A 3OWTA 5JOZA 3T08A 5K1YA 1K61A 2QM3A 2DVBA 1L3JA 5FROA 2DUOA 4EN6B 1QKQA 2Y31A 5BV6A 2PLYA 3ZSEA 4XUPA 3HBKA 2HTJA 1QZEA 2OUHA 1ULYA 1C1LA 3D6EA 1BR4A 2IFRA 1HN1A 2VUJA 1YIOA 1T39A 2XHNA 3VZKA 2ME0A 4WM8A 3O7OA 2ZX3A 2VECA 1QY4A 3IN9A 5EZWA 3AX4A 5IHRA 4BOWA 4WWCA 1Y1VJ 2NNNA 2WFF3 3T1LA 3ZDVA 4BPZA 5C9AC 1NA1C 1LHNA 4XCBA 2L9SA 1VQKI 2DMTA 5FPAA 3LQRA 2R4GA 4UY8I 5I8YA 4KH9A 1DU0A 1ZRRA 3TW6A 3CCRI 4XNFA 4QPGB 3AKQA 1B1BA 2OCCH 2VMIA 4F92B 3SYTA 1N1YA 2R7UA 3ZFGA 4M4RA 3AZYA 1JTYA 4E4SA 2FQ3A 3LFKA 5HLTA 4MGRA 1BL0A 1VQ8I 1MJBA 2N7GA 1ND2B 5JIAA 3X29B 2JDAA 3FFZA 5LHHA 4FSJA 1HQWA 2RNGA 4RQPC 4RLFA 2LLKA 4IRGA 1DU6A 3TBDA 3SITA 4OIOF 3WF3A 3QPHA 2Q2EB 3ZR6A 4JYKA 3GTKJ 5FZBA 3TDUC 1JH5A 4F8AA 1N77A 2PMWB 1JS9A 4FQZA 2VPLA 1LOCA 4ASNA 4HBNA 4KITB 4CYDA 1ERDA 2HWD1 3VEPA 1OQYA 3R4UA 2WQ4A 4HKWA 3GZUC 3O8GA 4NHMA 2DF7A 3RFRA 2DBBA 5A3PA 3MPPG 1RHI2 5CKMA 1UXXX 2XGDA 3VHOA 4ATEA 4I3PA 5BXXA 3CTAA 3T4VA 4M01A 1ETVA 2V4JC 3H0OA 3VL9A 2W00A 1HW5A 2JRMA 3ITQA 3FZ3A 5BUVA 5LBEA 4YNIA 2CYYA 5EP9A 5EDNA 3BTAA 4PQ9A 3RZHA 3CCYA 3OSGA 5CYVA 1FT9A 1JKPC 3ZCOA 4FASD 1QNYA 1IS3A 3OYAA 2VNVA 4UUVA 4UVAA 1F35A 1IQDC 4CXWA 1MKMA 4GJYA 4OINF 3PUIA 4MEYF 1LOFC 4GKYA 3BI3A 1PZ7A 1YS6A 4FT8A 5C4WA 2Z79A 1J0RA 1H9GA 3SHFA 5FYTA 2M0MA 4I09A 2UV1A 3FKJA 2R92J 5FPVA 2NS0A 1P7JA 4L2NA 2XQRA 5IK4A 3FBNB 4FAGA 1R6RA 2VODA 3QLQA 4N8MA 4HV5A 4NQWB 1SCRA 5DAXA 4M3BA 3V0BA 5I0DA 1UMHA 2B7EA 3T3YA 3G4SI 5EPAA 3POJA 4BUPA 3BR6A 1D0XA 3SKVA 4Q2FA 5K0UB 1WCMJ 4JQRA 2GMEA 5FZIA 5FRAA 4AEDC 1LGNA 1QOTA 2RS32 1NA1B 1CAUB 1U6GA 1JYXA 1LHWA 4UUTA 1KITA 2IZWA 1W2AX 1R5ID 5F08A 3RQ4A 3SXWA 2P3JA 4AHZA 3T09A 2DDAA 1WCKA 3BG9A 4CDQB 2RMU2 4MNUA 4F93B 3Q0VA 1AR93 1D4M1 5LA2A 1X58A 1J83A 3GYDA 1RUH2 3BVCA 5HCAA 4FI9A 2RVAA 4LKDA 2VZSA 3O5SA 5T55A 3GF6A 2FE3A 1RUI2 2LY9A 3FLPA 2C24A 2ZA9A 5HNHA 3RWNA 1SD4A 4A41A 3WHTA 1ONAA 4I98B 4FTHA 1KU3A 5E8AA 2EZHA 4LG3A 2SBAA 4Z6YA 4OUMA 2FDFA 3O8HA 2E7AA 4YW2A 1MVEA 2BQPA 5DDJ3 2OF7A 2WY8Q 3K4BA 2MD0A 3KSCA 2VW2A 2WFPA 1OD3A 5HS8A 2C9KA 1X3ZB 1MBGA 5DCMA 1FYUA 5FJ8J 1ENHA 3HRTA 3MEXA 3F23A 3S1QJ 1GZCA 2VQGA 2QUFA 3PL8A 2M34A 3CCMI 3AYEA 2QF7A 3K2AA 3I2GA 5SV5A 1XPXA 1QJEA 3C7EA 1QJFA 2HWF1 4ZYHA 2W2IA 2DYSH 2LKXA 2HWC3 1SACA 3SZTA 5C3SA 2B0LA 4OI1A 3H1WA 1IS5A 1UG0A 3QBQA 3AP9A 3F2ZA 1TP4A 2L9RA 2LK2A 3T8RA 4ENKA 3N9MA 2A05A 5F64A 3OR1C 1E57A 3VGIA 1ACCA 2RJ2A 4N4OB 1VQ4I 1RUG2 3OYKA 4QB6A 5T52A 3K1PA 5E1XA 4J1WA 1J3QA 2IJLA 1PO13 3CJQB 4UXAA 5C3OA 1D4M2 2XOMA 3FE5A 3KF3A 5D8AA 3LD8A 4YYOA 1W90A 3VBUC 1ULFA 4UF0A 4JGZA 4WXDA 2M9HA 4ABZA 4KIGA 4PLMA 5FLHA 1ZREA 3HJEA 3PUFA 2ID6A 1PX4A 4RB0A 4XABA 1W5CC 1FOKA 1COV2 2GXAA 2OPTA 1YHQI 3DXTA 3H8UA 1YJNI 2K0GA 3MKZA 2EXJA 5A3OA 1W2NA 1UYYA 2D2WA 2BDRA 5CU1A 3ABLH 3GTMJ 3SISA 3VHRA 4XBNA 2DU1A 3KVBA 1EAH1 2NYXA 1V9U1 4CZSA 2Q5TA 1TWAJ 3LOCA 3I5UA 4PFOA 1FMVA 2W0XA 1VBD3 3J7ZI 2XQXA 4CDQC 5L9BA 4ZDPA 5G05L 4YZ2A 2FQ4A 2BNOA 2RR12 2GMMA 4LNVA 1SLTA 3DL3A 1K83J 1ODDA 2WYSA 1C8M1 4BBRJ 5CIRA 4OZOA 3LSIA 4BXUA 4P9JA 4WZCA 1NXMA 4XF9A 2ZGMA 1UL9A 1RKWA 4QPYA 2HNHA 3WUCA 3O14A 1R7JA 2Y8KA 3ELKA 2P6CA 4OU0A 1H2MA 3PTYA 5FFZA 1FP2A 4IX7A 3OIPA 5I91A 5TJJA 3DYPA 5I0RA 4Z07A 1LGCA 1XC6A 1GLNA 1UOJA 2GC0A 4EROA 2BWCA 1DUXC 5IVFA 1ZR2A 1UU6A 4FP2A 3PIPF 4YVWA 2R32A 2IVJA 2R7QA 2AREA 1W99A 1Q1VA 5EJCA 4WVWA 1QNTA 2WLPA 2B8MA 1Z3XA 2YDEA 2PQSA 2J7MA 5ERLA 1UY4A 3I54A 5LY2A 3RSJA 4IQ4A 2X1CA 5H9RA 4NVPA 1GR3A 3HL2A 1ND3C 5LFAA 3MW2A 5KR7A 3Q9VA 2HVRA 3PM1A 5ILUA 4AI0A 1ETYA 1RUF3 1ND2A 4MGSA 4D94A 2A6YA 2GU9A 4MO7A 1YTYA 4FPGA 3AFHA 2DA3A 1PX3A 4XKVA 4AQ6A 4WXHA 1ULDA 3OYWA 1SLBA 5FYMA 3H35A 1MMSA 3VPRA 3NV4A 3H7JA 2DFIA 4FETA 4LO6B 4LLNA 3PNVA 5C71A 4KWLA 4XOTA 2Q2EA 5E3MA 1NE6A 2HWE1 2WSVA 2L0KA 1TW3A 1CAWA 1XBFA 3SCHA 1YYNA 3MD2A 1KQ9A 4AFCA 5F6LB 2O0YA 1RVF3 3P5BA 1Z77A 3J7MA 1BJQA 1QQP3 2WC2A 4ESBA 1D3YA 1EA3A 2H27A 5ICFA 4A2UA 2XRNA 2DPUA 4XBFA 1R092 2BU9A 3WLUA 4KDPA 1OCOH 4AVAA 1XDSA 2PG4A 1W39A 5BNNC 3FXLA 4Y13A 2WQ8A 2ZJPF 3VD9A 2ZJRF 2HKXA 4P9FA 4DZJA 2JT1A 1QDOA 1VBD2 1IDYA 2Y6FA 4DS0A 4BJ5C 2L7KA 3ES1A 2A07F 1F31A 3T8TA 3OYMA 1BK0A 2E1NA 4BM8A 4LO4B 1U9NA 1OKQA 1HCRA 4HSRA 3L2QA 4YM3A 1IZ1A 3H9JA 1JN2P 4MYEA 5A7WB 1RITA 3RS6A 4ONUA 1WGXA 4MVTA 5C8CB 1OSGA 2FQPA 3AKTA 1X7NA 2HR3A 1LPQA 1QBJA 2XRLA 1TWHJ 1Q8QA 3LAGA 4AC0A 1JUSA 3HOXJ 1AVBA 3E6BA 2ADUA 4CZCA 4HKLA 4RFT0 4XAEA 4IOAF 2VZTA 2AQEA 3TNPB 2QVSB 1FYLA 1I1SA 1WBFA 2HOAA 3EUHA 5D6FA 4HSJA 1T0FC 4E7LA 1DGWX 2OBPA 2CL2A 1ZH5A 1APLC 3POGA 2K9MA 4U0WA 3PUQA 2LVSA 4RGXA 1Q8SA 2XR4A 1RJ7A 5FY8A 2ZACA 5FZHA 5JWPA 1WJCA 2XAQA 3V8KA 3VBHB 1SC7A 1DYPA 1O4TA 2QSHX 2LFBA 5FQ0B 3L09A 4WVZA 4IHVA 3FFQA 2NP0A 5FY0A 1ZZ9A 3HEIA 4C9YA 3I2JA 5FD6A 2JDYA 5FOJB 1OCTC 2CSOA 3I2FA 3L2RA 2E71A 3VKLA 3LSMA 4HVQA 4QXBA 5A3NA 2JIJA 1BKZA 3DF8A 3WE2A 1F5FA 4M9SA 3BROA 4TLFA 3KZIC 4R4ZA 1PK6C 3K51A 1U2WA 3LSHA 3BDDA 3S57A 4RL7A 1QH6A 4Q0VA 4CEYA 1IN5A 3FK6A 1R1A3 3JBG2 4XRSA 4ZYAA 2BHZA 1F8VA 5ACA1 5FB2A 4UF0B 4C30A 1RUD3 3LEIA 4TZDA 3JBG1 3Q8EA 4HF2A 2R061 4XFBA 5FO8B 1OF4A 4MFDA 4G8XA 3KGLA 4BJTA 2JRTA 2D5FA 4EQVA 1RUG1 1QNWA 4GXOA 1SFNA 4BZ4A 4IQPA 1LQ1A 3LAJA 3GVAA 2HWB3 2KHMA 4XJ8A 1VBB2 1XX5A 1S55A 4PJYA 2VN2A 4GMP3 5FKMA 2PLV3 4EN0A 4XJZA 1EH6A 4D3WA 1WJAA 3VB9A 4F52A 3EDPA 3CMAI 1IPKA 3J81Z 1FOD2 3HGGA 2UUZA 2IGKA 1KA8A 1TWCJ 4YIFA 1PVC1 5KHIA 2EIDA 4GB33 3R61A 3FMSA 1YUDA 3A23A 2QCOA 3AXDA 2OV7A 4EYUA 2P6SA 2WWUA 5HDGA 4JBAA 3W6VA 4N53A 5AONA 4QKFA 4GH4B 1QQIA 1N3QA 3IDEA 4CUAA 3ZOBA 5JHUA 5E20A 4M0HA 5DZGA 3WQBA 4CCDA 5A6YA 3F3XA 4L5EA 2DBIA 2TRTA 4AR2A 1VAMA 2CUEA 5FYUA 2WYFA 1NA1A 1N1SA 3KFWX 3D82A 2WZEA 2QTWB 4IEQA 4A3BJ 2W68A 3AG4H 1JTXA 4XLCA 3HUGB 2P1BA 1DGRM 3C1DA 3G1LA 3GFLA 1POV1 1A34A 5LA1A 2IVIB 1FYMA 2DFEA 3S1MJ 2IA1A 1NE4A 3U1XA 2GC2A 3K1MA 1Y9QA 1FOWA 2DO7A 3DBHB 5I0SA 3VD7A 1FX5A 4COYA 2Q8KA 1KGSA 5EQUA 2BW8A 2CV6A 2HH9A 3J8F3 2DUQA 1AYN2 1VBB1 2OZJA 1PVXA 1NQDA 2JG9C 2WO7A 3AL6A 3N9PA 3CCQI 2KKOA 2HBTA 1U5XA 4H7MA 3GBFA 5E6HA 2W24A 2L4MA 3ZMTA 4BE2A 4IHXA 5CKQA 1GP6A 2SLIA 3KEQA 1POQA 5DAVA 3WG9A 4LMFA 3PJQA 2LS6A 3GBGA 4UWDA 2MPFA 5J1UA 5DM7F 2HS5A 1K42A 4ZYDA 3ZGKA 1WUVA 2LKPA 3CDLA 1W6OA 1JZ4A 5FTTC 3HNYM 4JDOA 1QJX3 2KDZA 1X50A 3V42A 2FU4A 3K7AJ 2XGCA 3U4XA 4GD4A 2RS12 2JD4A 4EM2A 3MZYA 3PVBB 4RS5C 3IAM2 3GTGJ 2DBNA 2QFEA 4B1MA 2CDPA 3EXUA 5F5QA 4CU9A 2KRHA 3HRSA 3MIHA 2EZLA 4RM2A 4NDLA 1O8PA 3WU0A 5FZ1A 2R042 5B3SH 2VH9A 1GFF2 2BVBA 5LK5A 1YFHA 4ZYGA 4YVSB 3QRFF 1S0FA 5EJ3A 4E7ZA 4R9DA 1H8TB 1ONVA 4A4AA 1GVDA 2ZOEB 2R1BA 1WLWA 4WF2A 5C5TA 1WVRA 2O0OA 3O1PA 3QU6A 4Z82A 2KR2A 5GLWA 5C8CC 4BDVB 3IRQA 1QJU1 1N1VA 4HZFA 2Q8DA 4MIMA 2R7ZJ 2FEZA 3GZTB 1B4AA 3W5MA 4LEJA 3ZKYA 2XJRA 2Y30A 4HEA2 3I58A 5M3MJ 4KBZA 4BY1J 1YIPA 1HJFA 2IGNA 2Y33A 4RMNA 3JAMK 3B69A 5FAXA 3K1NA 4KFCA 3BWGA 1OKRA 3VSKA 1Y8RB 1UO9A 4OWRB 1W36D 4CUCA 1ZBE3 3S15J 5FV3A 4OQ9A 5GPAA 1IC8A 1BEV2 3IC7A 4YW4A 4KNCA 3WNLA 4W8JA 4LXLA 2D6PA 1ALYA 5FO9B 2ELHA 4E6KG 5F0FA 3THPA 1CZSA 1DZTA 1ZN2A 2HVQA 1JGGA 4Q0SA 1B9NA 1ZAOA 1NG0A 2OUMA 4D7NA 1YO5C 1WGPA 3OD0A 3ZVXA 4LLLA 3PL0A 3IAQA 4JX0A 4QT6A 2Q4SA 3A0BC 5IYYA 2EFPA 1SFUA 2W7NA 5F6KA 2EB7A 3ZYFA 3O3KA 2ZPXA 2BW3B 4GO1A 3ZXSA 2E9QA 2ZKZA 3S3NA 4PIZA 1X1PA 3NJVA 5BNNA 2LY1A 4ZZ8A 5JXGA 3ZMNA 1RPWA 3VZJA 2F2EA 3LZZA 3VDXA 4BQ3A 4Y52J 5LRRA 4DBRA 4Q0PA 4FXKB 2O8QA 3UESA 1BBT1 3HOYJ 4FE4A 4MQVA 3K4ZA 2H6CA 3VWBA 2HWD2 3CLPA 1CJPA 4LBQD 1ZRFA 2J1UA 5JZGA 3LDRA 3T0YA 3N9NA 3C3VA 4NWWA 5T5OA 3H1MA 1UZZA 4B48A 1V4RA 5EGOA 1CPNA 2X8KA 2R7RA 1U0AA 2NS7A 4UOJA 1GZWA 1YFYA 1UW8A 4GH4C 3MIFA 4XDPA 3TOJA 1VQMI 3SMHA 3OYCA 3FXRA 3MKYB 1KS4A 4FBFA 3DXJF 1WI3A 5EG0A 3ACLA 3S6PA 5HPOA 1OMIA 1ON2A 2JKBA 4Q8KA 1X19A 4F3JA 4QX0A 4PGGA 4PJNA 1ZGWA 4UXNA 3L1PA 1R22A 2N8GA 1RUI3 4HLYA 3GXUA 3PVOA 5LK7B 2DVFA 2A69F 5IK7A 4A3IJ 2YROA 3KT1A 2VD7A 4RHV3 2Y0SA 5FMOS 2R071 4QGNA 3FMGA 3ACIA 5FKLA 3B93A 5I93A 3VDDA 2E2IJ 5K5OA 4X8NA 1CAWB 2F4MB 2JDPA 3GTQJ 3G7DA 1XJAA 5AC91 3DTIA 3S93A 3Q9SA 4URTA 1UAAA 2ZAHA 1R9TJ 1W2TA 4GAZA 4G12A 4QGLA 1QHGA 5F32A 2QQWA 4AYUA 3BR3A 3UT0A 5FZ7A 5TSWA 1LCLA 1JMUB 5GAGJ 3HEFA 2P3YA 1SANA 2QBYB 1RETA 1LFBA 2FMLA 4M9XA 3VBUB 1OLQA 2YG0A 2P7VB 3FXQA 2ARXA 1WLDA 5B4NA 5GZGA 3GZ6A 3HNBM 3WTYC 3KYLA 1AL0G 1AX2A 1QU3A 3RZOJ 4HF0A 5DAQA 2LTPA 4IJAA 3WNXA 1BW6A 4J01A 2YBPA 3IMMA 2VMDA 2Z16A 3H42B 1LOEA 5EV7A 3CJXA 4YVSC 3FHNA 1WHUA 2D98A 1VALA 1HBXG 2P5KA 2HOTA 1W9SA 1P2FA 2XJUA 1MNEA 2V79A 1XB4A 1F4HA 3W59A 1FNYA 1SD6A 2CWSA 1V0AA 1EUUA 4YEJA 1U8BA 2RS33 2XV4S 1RMU2 5A3UA 3H9GA 1A8DA 3HIFA 2YPJA 4KT5C 3LOIA 4K1ZA 2VQHA 3H9QA 1G9BA 5FPZA 4IEUA 5BQTA 1CPMA 5D8AC 2DK5A 3T1MA 3P7NA 2MEV3 2IRFG 1GMMA 3NKTA 4YW5A 4RYDA 4S2GA 3KT4A 3K4DA 4EMSA 2B39A 4AD9A 3PU3A 1H6YA 2JDZA 3SZGA 1TWGJ 1G86A 2BZTA 4R9AA 1LRHA 2CFOA 1BC8C 3PJYA 1R1VA 4CCKA 1XCVA 1RZ4A 3GUDA 3MW3A 4DB5A 4CUBA 4HV6A 5FDBA 2PJRB 2CAUA 3R0AA 3CO7C 1T2XA 1H1MA 1JU3A 1YHFA 4U87A 2P6TA 5FXWA 4IE4A 5BPIA 2D6NA 2DTRA 4BEHA 1L3LA 3HMYA 5HXVA 3BT9A 5K7PA 3LSGA 3DWLE 2ZXQA 3OBRA 5ICEA 4N53C 1HB4A 3LKJA 4RB2C 1MBHA 2FOWA 2COBA 1R082 1FYKA 3E1F1 4KMFA 2E7QA 1NOVA 3LWFA 4MADA 2HYKA 3RPQA 4OZXA 1Y0NA 1MZEA 5JDBA 3M3CA 4KG0A 4EGZA 1WSUA 3LQQA 2HYXA 2KDOA 3TMOA 5CG8A 4NHKA 1NCQB 2GNBA 2BZDA 1US3A 4L0ZB 3WG7H 6PAXA 1K3IA 2GOMA 1GNHA 3I49A 1PNFA 4ZXKA 1ZX5A 1DYOA 1YX3A 1H4GA 3NRUA 5J36A 1XSXA 3DEMA 4ASMB 4D0QA 3K70D 2NPIA 1ITYA 4N43C 2Q0AA 1TME3 1NKGA 1NH3A 1DHKB 4KN7X 4BE1A 5A7SA 2EK5A 1H9PA 2P2KA 4H2AA 4ZY9A 2ZMEA 4II2A 2L9VA 4BISA 2GZWA 3BTJA 1RINA 2WNVC 1A3KA 4AEDA 5BPXA 2EV5A 2V5DA 1MBFA 2BVMA 3C7GA 1ZBA1 3DFGA 1OCCH 3W58A 4GA9A 2VASA 3VBOB 3MI8A 1BA5A 2B9UA 5FLJA 3RZJA 1A31A 4O65A 4AI8A 2RR11 3DPRB 4FX4A 4XEZA 2XGEA 2QBXA 4NAOA 1IKPA 1MEC2 4G9SB 1W6NB 3LIHA 3WNNA 1GV2A 1QH7A 5DXDA 4ESFA 1N3OA 4CDUA 4N9HA 3O1VA 4YG3A 3DV8A 4BB3A 3M2MA 3AZVA 1ULEA 3WHUA 1MQTB 5DD8A 4BIFA 2EIBA 3MUZ1 2L02A 1PK6B 1I3AA 3CP2A 4KGGA 4LE3A 4RR3A 3M1HA 1WWXA 1HB3A 5IT9K 2UXNA 2J42A 2XPVA 4XACA 3BCAA 4AVVA 3OIQA 5F7UA 4V2FA 3VN4A 3U11A 2EAAA 1TMF3 4AYBA 3V7SA 4S2DA 4YFKF 4OHZA 2DCKA 4ZJZA 1R1TA 4KG8A 4LLGF 3K4NA 2XF5A 3KYDB 4SLIA 1GXPA 3BJ6A 3BPZA 4NAMA 1UY2A 2ZGQA 2C4XA 3ZPYA 3L2CA 1LVKA 5CEHA 5D5XB 4QHBA 4AM3A 3VDDB 2RV8A 2XVKA 4PCQA 4DEVA 5FYSA 4MXWB 3GMEA 2G0EA 3W3CA 4PI2A 4JQFA 2QENA 5I0UA 1O4XA 1UNBA 3VL8A 2DTWA 2UWAA 1J09A 2OQ7A 4PF5A 4YFWA 5GLVA 9ANTA 1SQ4A 5A3MA 2QLZA 5C9AB 4QU1A 1W8NA 4EJWA 3WG3A 1SBEA 4EJRA 1BXHA 1AYN1 3WG1A 4KU8A 4FTEA 4ASKA 1K5MA 2B4KA 1O57A 5HOOA 1O3SA 4HXCA 3ST7A 4B1LA 1U0JA 2WNUB 4XJ9A 4XURA 4Y33A 3KLSA 5SV8A 4MFEA 2GC3A 5LBFA 5GAEJ 1W8FA 1KD7A 2R5ZB 2VJ4A 1GDTA 3WP4A 3BG7A 3WNPA 4RQPA 2TUNA 4HLTA 1LHUA 4XRFA 1O5UA 3BR2A 2FD5A 5JCTA 5BNGA 1H4HA 1E5IA 2LW8A 3ABMH 3KZZA 2EH3A 2VJJA 4G9YA 5FKOA 2K46A 4HX7A 4IHSA 2B7YA 2BYVE 1HRV2 4XIKA 3DKQA 1CQ9A 1S6LA 1TME2 2VKDA 2VI6A 2DDUA 2E63A 2EJRA 4NHYA 5DPNA 2MFZA 3RZMA 2PHWA 3L00A 2FDJA 2D40A 1KYWA 4CP2A 1DYKA 1R23A 3V64A 1OA4A 5JLVA 2ZZJA 1YFUA 1XGSA 2GMPA 1Z7S1 3IAS2 1MS0A 4B29A 3KP6A 4F7ZA 1QJU2 4YZ1A 1GOHA 2GIVA 4H14A 2XIGA 1GUIA 5JI7A 1ZLKA 1M06G 3WGIA 1JYNA 4B3XA 3PNYA 2K85A 1WW5A 3I2IA 3TAYA 2ZTNA 4C2TA 3S30A 4HSTA 2JG8C 4K3UA 2BGOA 3TP0A 2YFZA 3ZN6A 3MV11 2A73B 2CGOA 3VDCA 1S8NA 4TN7A 3GM8A 1W7PD 2Z5UA 1PMIA 2VL4A 2CHHA 3HHHA 3PIJA 4FCYA 2VBXA 1BBT2 3IT8A 3KM5A 2CW0F 3R05A 1UY0A 4DUXA 3QPSA 2A5ZA 3ZSKA 2GWRA 2WZPP 2E1OA 1J1LA 1EYBA 2GN7A 3R0RA 2WAQA 3VBSA 3VZNA 2PEXA 1RHI3 3S17J 3KEYA 2VZPA 4W50A 1QJX2 5J4YA 1XPWA 3K9TA 4XILA 1ENQA 4LUMA 2I2SA 4UB6C 5LHIA 3JQXA 2A7AA 1KONA 1YE9A 3I55I 4OI0A 1C8NA 4FFHA 4CCEA 1D2SA 2JSPA 2EAKA 3QPTA 1LNWA 4XKBA 3AK0A 2BE5F 2WADA 1EJ9A 1WD3A 2FRHA 1BEV1 4XL9A 5LGNA 2IW5A 1HXS1 1ZGAA 4AIDA 2PA7A 3KQRA 3GTLJ 1UHMA 4QPQA 5ACA2 4FPFA 2HQAA 4C3IJ 4IKFA 4DZGA 2BBAA 4YVSA 3WF0A 5IOZA 1KDKA 2O3FA 1T6SA 2XG3A 3I4PA 1C8M2 4X6AJ 3QQAA 1MBKA 3ZMUA 3SFZA 2PXJA 1ZLJA 2VZOA 1I9RA 4QX8A 3H9AA 2DVGA 2ZB9A 2D44A 3TNQA 3OY8A 4C2UA 4HNUA 5FY5A 1MMAA 2ZABA 4QB2A 4HVOA 4URAA 3QH7A 5DUWA 3JR9A 1Q1HA 1JYCA 1G4DA 3ES4A 1VAKA 5LA9A 1VBC3 1IF1A 2EA2A 2OPKA 1Y7BA 3WF1A 2PI0A 4XICA 3VODA 3RJPA 3NNFA 1MZ6A 3BU7A 4Q4V1 2M5WA 4AVTA 1P8JA 5L9RA 4IO9F 5FZAA 3MUY1 4YW6A 2I07B 2FZ2A 1JKQC 4GIQA 2XKOA 2VJ5A 1K4SA 5A33B 2V9KA 2AUYA 2XB5A 1PDNC 1S4CA 4KICA 3AFKA 2D6OX 5EEHA 2KISA 4RB3C 4U7BA 4KWJA 1JHNA 3CJIB 3KV5A 4CHUA 2M7BA 4LO8A 3N7LA 4B7KA 3JCIA 1FV2A 1W28A 5A32B 2VU9A 5L7OA 5HDKA 1X2NA 1NXD1 2B9SA 3BB6A 3MW4A 2F48A 4YZ3A 4BJ6C 5FYIA 2WFF2 4BE0A 2DK8A 5LW9A 3FN9A 4AHXA 3CCSI 3ECOA 2E7TA 1FOYA 1HRI2 4PJJA 2C1FA 4CDXA 4OHVA 2C6YA 2HVSA 3JRIA 1V6KA 4UI9L 5LBQA 1OOPA 5FYZA 3O0XA 1GXQA 4E70A 2W48A 4YRVA 3HOZJ 3JXSA 5J09A 4RB1A 2JA6J 4ZHNA 1FZPB 2X09A 2UXXA 1P9QC 3UGFA 1I6XA 1FX7A 2FDHA 1JXSA 5ICCA 5AC92 1CAXB 4KMQA 1X36A 1OPCA 4FOQA 2R7FA 2JDUA 3T0AA 4HOBA 1OQEA 5FKKA 1NHAA 3NL1A 5FP8A 1RUC1 3AFGA 3QPLA 3RG0A 2A6WA 4GULA 5FZDA 3ZSLA 3WINE 3M8FA 1FY7A 4NC8A 1PIV1 2RS11 1SLLA 1W0TA 3CC2I 3KVAA 3D5OA 5D2AA 5LD2C 1YLLA 3JRHA 1SFEA 2DFHA 3WZ1A 1DQ1A 1XU2A 3IMNA 5B2GB 3JZVA 1YW9A 1QJY3 1X8EA 4XRMA 5L7OB 1PGL2 5EEGA 3H1CA 1W8UA 1S2EA 1S0IA 3CQZJ 4KISA 1RUE1 1LKNA 3I59A 3ZSMA 1PMHX 5HODA 1ND3A 1B6AA 1XNTA 4Z2YA 4O9EA 1RC6A 4BBSJ 1T95A 5IVBA 4PSWA 2CFXA 1ETWA 3BTYA 1F43A 2WY7Q 5DDGA 4XDQA 4ZPIA 5JLWA 1K78A 4MHUA 1WKYA 2O1QA 3EPZA 4I3GA 1T56A 4V2VA 4YGBA 5FZ6A 2HZTA 1Y56A 1LDDA 4XLFA 1Z05A 2A6XA 2ET7A 4XKCA 3RDIA 2VMHA 2E7WA 1RXGA 3G6JB 1HKSA 3U10A 1UELB 1K4TA 4NMIA 2OQRA 5TGTA 1Y9GA 3AKRA 2ZHKA 2DVAA 3GO5A 5IK8A 1FMD3 2A75A 3JRDA 1IV8A 2UU8A 2P37A 4BDYA 4NB5A 1HQNA 2GNDA 4A7KA 2A3YA 5JR2A 5T5LA 5DN2A 2ISZA 3UL2A 1DGRA 3AAFA 4KUMA 5JXIA 2JG8A 4P1WA 2RS53 4D8MA 1G3WA 2VOOA 4XTPA 5GP9A 1VQNI 5BS6A 3MLLA 4O5VA 2OTJI 1SVMA 3H8XA 4NWVA 4AI9A 3ZR8X 3T2TA 2IXLA 4JTNA 5KAFC 2WNVA 4HDVA 2A61A 1Q3EA 1SFPA 5FZKA 2QYOA 4LQRA 4MGYE 1REDA 1PGW1 3TEXA 5A1AA 1A36A 3RI8A 3DEWA 5DMYA 4CYCA 2V9PA 5IT3A 2K86A 1S7EA 2VLAA 3V0AA 2XJTA 4AE2A 3ZFFA 4P00B 1NY71 2D1VA 2XUEA 1REEA 2IA2A 3ABUA 2VIXA 4B7EA 2TNFA 2HEVF 1H88C 5FZ8A 3FKIJ 4G7HF 2FOKA 3WU2C 2NZ9A 2GQQA 2WT1A 3BYWA 5FK8A 3RYPA 2IUWA 4HDUA 1COV1 4AW7A 2CUZA 3UYJA 4QQHA 1HLCA 1ENRA 4LOCA 3RI9A 1PUFB 3S0MA 2DU9A 3DPLC 4N90A 3IAPA 4CDXC 2GBYA 1VJ2A 3PO2J 2ZFWA 3CU7A 1RL3A 1D8KA 2O5RA 1W6MB 5JI9A 3LWCA 4A0XA 1LOBA 3C3WA 3FISA 2WAAA 4HMZA 1N1TA 4ISRA 2K2SA 2QZ8A 1MEC1 3GHMA 1K5MC 3WR0A 1FNZA 4RBOA 2PHDA 4IHTA 1JHHA 1PMJX 1RGSA 1W7PA 4ZKTB 2WS91 3WQ0A 3VYUB 1AR81 4ZS2A 3HTUA 4DO0A 4B8XA 3VBHC 1OC1A 4COUA 3ERMA 3VB2A 5DG2A 2WNEA 1EF4A 5DDJ1 4HG2A 3K3NA 1OQDA 4OULA 2TBVA 3O0VA 3KV9A 3GW2A 1LTEA 1NY72 3WTWC 5BMZA 1JJ6C 1ON1A 3OL3A 4I0AA 3QWLA 1CN1A 4R8HA 4EJOA 5A70A 3GFIA 5F2SA 1ZG5A 1YEWA 3TBIA 4F55A 4AWDA 4N0BA 2ES3A 4A44A 2Y0IA 4BAYA 1BVP1 3HBLA 3RKWA 3NV1A 2W1SA 3BKZA 5DM6F 3DPRA 4QX2A 2X29A 3WVJA 1VB2A 3A0NA 1A6CA 3ZQ7A 3GTPJ 2X53S 2ZZQA 4FPLA 5H9SA 3FJSA 1SG3A 2YGMA 5JVGF 4A3KJ 2NMNA 2XSDC 1NK2P 2EALA 4JTOA 3ZDSA 1NUKA 2YU3A 2OS2A 2PLV2 3OS0A 4W4ZA 2BXYA 1AYM2 3PUAA 4LK0F 4RHV2 3NAUA 1Z7S2 2JE9A 1UOGA 1Z6RA 3M9AA 1WJ5A 5M0TA 3ZRGA 5GKAC 2ELJA 1IN4A 5ILVA 1RUOA 1CX1A 3CO6C 3WG4A 4XSZF 1YITI 1T38A 1WMFA 1VZ0A 5CFCA 3KF5A 1GOFA 3BIEA 1KYZA 4M6YA 1JW6A 1RUD2 3LSPA 1IKQA 3PNAA 4LHSA 1VBE2 1S1AA 5JIUA 1MDMB 3S5AA 1S7OA 2Y26A 4C1WA 2NAZA 5LB6A 1Z21A 3CMYA 3MVPA 2MBFA 3N36A 3AVSA 3AYAA 1ZG3A 2ZKNA 1IUFA 1HDKA 3OB8A 4HK9A 3WNKA 1Z78A 1XE8A 3WF2A 3FM5A 3KMHA 1VBD1 5FUPA 4ASLA 2DCZA 1YJLA 3E3VA 4YW1A 3RKYA 1TMF2 2HYJA 2AZ5A 1KFUL 1PO22 3HSFA 3I3BA 3NVCA 4CCLA 4LK6A 4M3CF 1LKXA 2RAEA 5J48A 2VQUA 2NVUB 2VPVA 3ETPA 4HN1A 4P96A 3J4UH 3F8MA 4XLNF 4B47A 1W04A 4CDWA 2ADEA 5KK1A 4EWDA 2IXSA 2P7CB 1JYIA 3OJBA 1YX5A 1QXJA 3ZM8A 1D0GA 2YXSA 2PFWA 2B63J 2QDRA 2DDBA 4V2GA 4CP1A 5BPDA 3K4LA 4BNCA 1H2NA 1E5SA 3C7JA 4EWAA 5BNOC 2P4EA 3QCWA 2Y9ZA 1VBE3 3TYJA 2DJIA 3LFUA 1P4AA 3HGYA 2E51A 2F5FA 3QU3A 4D5FA 3D0SA 3BQZA 3UK9A 1CF7A 1D1CA 5F27A 4JX4A 5LBCA 1UZCA 5FZGA 2CW7A 1FPN1 1W6QB 3MKWB 2WB1A 2XJPA 4BGDA 2VZUA 4COWA 1XSRA 4U2AA 2HPMA 3KCCA 4EM1A 4FE7A 2MA3A 1KQ0A 1OISA 1VBA3 4OMZA 4QU2A 4LT5A 2BTVC 4CPBD 2W3JA 3N7JA 5FZMA 5JUVA 3VFZA 1RUF1 3HNMA 3BG5A 1W8OA 1OPMA 2FDIA 4HN0A 1QJY2 3I8TA 4Q5SF 5LASA 3WT3A 1JU4A 4K2EA 2GC1A 4ES8A 1W06A 2GA1A 5KHKA 2AXTC 2ZC2A 3IBMA 2WUHA 5FYCA 4ZZ5A 2HWE3 1IPSA 3JD73 2VVDA 2IS4A 4NJ4A 4JGYB 3QOPA 2WS92 2LRPA 2ZNZA 2YS9A 1RVF1 5T50A 1TL8A 1OKOA 4RGUA 1MS1A 4EQQA 3ZQQA 5EHDA 3RCOA 5LCWL 4BQWA 4BHPA 1R58A 3RZLA 3ZFFC 5C5UA 1YRNB 3KIOA 3CZ6A 2NXNB 2Y6GA 5K0UA 5FZEA 5FY4A 1WCDJ 4LO7A 2O7OA 2XAGA 4IEOA 1BOBA 4U0YA 3Q8AA 3POFA 1FI2A 4ITCA 3USSA 4KQ7A 1PO12 3THCA 4B3NA 2PTMA 1CF7B 3MN2A 5C33A 3BTXA 3ZMDA 3S3OA 4NO4A 2RM21 3VSLA 1U5TB 3W2VA 1TWFJ 1F5TA 3LCPA 4QXCA 1YCIA 1I50J 1MPXA 2W57A 3NAPA 3VZMA 2ZEWA 2X6XA 4Y24A 5LZ6A 4KMUX 3MIEA 4Y5SA 3NNLA 4BHCA 3MLKA 2WSUA 3ZKUA 4Q27A 2V09A 4QX3A 4CSWA 2LP0A 5DD4A 2HWC2 1W0NA 3H50A 1TBXA 4HNTA 2L5QA 3NAPC 5IJRA 1RIRA 4MG2A 2K9NA 4RQPB 3HQXA 5C4XJ 2M87A 1M4WA 3VYRB 2R0FA 1RXFA 5DTDA 3QYBA 1O4YA 2OTLI 2H94A 4GZ9A 1TC3C 3BPVA 1D0YA 1NLQA 2WO3A 1XCBA 4HX4A 3WNMA 3RPUD 2BRTA 4A7YA 2I74A 2FMYA 3A02A 2VULA 5G04L 2QQLA 3QYFA 3KS7A 3B94A 2VOVA 2O03A 1F36A 3HSRA 2KZVA 3UGHA 2RMU1 4ZDOA 2VUCA 4XXAA 5CVUA 3WDVA 5A1FA 2VW1A 4HRIA 2AXLA 3RTRA 4O6JA 1RUH1 2HQRA 2IFWA 2ZEYA 5J96B 5FLXK 2G1MA 2CG4A 1R1A1 2VAUA 4ESJA 1R091 2FBKA 1YW7A 2C5DA 5CA6A 1YO8A 1D8JA 3H5NA 2JTVA 4FHTA 1TEIA 2J22A 5ACA3 3U78A 4AIKA 4Q4Y1 1W8WA 4K40A 2AACA 2DT7B 3NWKA 3M07A 4F91B 2XDVA 1JODA 1RMU3 2QNKA 3K69A 1AR61 3OSFA 2EIMH 2GIZA 4LG0B 2C6SA 4XQ4A 2R041 2YX4A 1HX6A 4IV1B 3BR0A 1AL21 2HWB1 1MNDA 2LMDA 3JREA 5TRDA 4Y5TA 3WTTC 4AHYA 4QPIA 4PZJA 3FHIB 1I1GA 2PLV1 1PIV2 4OHXA 4D7TA 3SH4A 1Y4WA 2EZIA 5IT9Z 1OLME 5FJHA 3JU9A 2IPQX 3AL0B 1L0OC 1Z9CA 5IWFA 1DQ4A 4Y15A 1TVGA 4FVVA 4CP0A 1PVC3 2YU2A 4ZONA 4EWEA 3WTSC 3VDAA 4GB31 4IGQA 3VD4A 3BG3A 5BNOA 3OGVA 2E1MB 1OH3A 2AHQA 2DMPA 4AAXA 2TEPA 3TQNA 3VBSB 5LRSA 1MSFC 4FQGA 4PIXA 3ZPOA 4WZFA 1GV5A 1AZDA 2WKKA 5FBJA 4BU2A 3ZMSA 1C28A 4CA9A 1AHDP 4L8QA 2L01A 2D6LX 3VZLA 3OYJA 4AFBA 5T5JA 4MHGA 3TB0A 4U7DA 1PM4A 1L7RA 2ZGSA 1UX6A 1ZZ6A 4KIFA 2FNPA 2LRDA 4X1EA 4AI3A 2QQOA 1POV3 5IYBJ 3JQWA 4I01A 3LOBA 3WCSA 3LSKA 1H8AC 1IS4A 1UZYA 3ABZA 2A6VA 1J1TA 2E5ZA 1AXYA 3HXLA 2DCJA 1BI3A 5HCHA 1UZVA 1XU1A 1EH8A 4ZDLA 1Q8PA 1ASJ1 2D6MA 3J8F1 2GSYA 4CDUC 5J6XA 4RLQA 2EV0A 2JVHA 4B09A 2HDCA 1SLCA 1XS9A 3HKZN 1X1DA 1DZRA 1F9KA 1HRI3 3I3EA 1OT5A 3IWFA 2BGPA 3BC8A 4AQSA 4K21A 4AGVA 1NLSA 3J8F2 3H5RA 1WLTA 5FFXA 3ZXFA 3FDYA 4GJZA 2P5LC 1B72A 3B73A 1BJZA 2XC7A 5FUIA 4V19K 4R4XA 3IB3A 3KP2A 3LSEA 3FL7A 2XAUA 3OYNA 5A7OA 1OA3A 1O59A 3FLRA 3O1UA 2K5CA 2FMDA 2CJJA 3D4KA 3VBOA 3RMXA 4QWQA 3JSOA 1CIWA 3ILNA 2B42B 2ESNA 3LQCA 2F4OB 3HQRA 3WHBA 2VMEA 2JDKA 4YVWB 3OS2A 4AVCA 2R5YB 1UIKA 2FCVA 4FFGA 2PHFA 1MMNA 3MKLA 4KWKA 3OYGA 1LHOA 2XF6A 2M1BA 1WCSA 1UAIA 2KPMA 3I0TA 1WMEA 1IOAA 5K4LA 4KL1A 1GANA 5ABJA 2D97A 5A3WA 4DW6A 3FMQA 4KN4X 2WDBA 2P8TA 5JR3A 2Y2ZA 2EFNA 3J7LA 1T33A 4PLOA 5GTIC 3USUB 2YBSA 4QMAA 1ASJ2 2AR6A 1FOD3 4Z1VA 4FX0A 2VE1A 4PJ0C 3ACGA 1PGSA 4D6RA 3AKPA 4A3ZA 3DKXA 4A45A 2H0BA 4Y5Z0 1C3HA 2PELA 4AOCA 5L3CA 1GWLA 3J26N 2RVCA 4XE9A 2HKOA 5L3FA 1W36C 3URFA 3DYMA 2B46X 1D1AA 1YRZA 2HXIA 1HV1A 4AL9A 2XBO3 4L97A 2E26A 2K9SA 5JI6A 2W5FA 3QODA 1OVSA 3UV9A 4ARXA 4I99C 3WTXC 3KP7A 3O6BB 4A3JJ 4YIIA 2UYBA 1DU3D 1H8TC 1FBUA 1ZBE2 2XXZA 4XUTA 4NRPA 4XTMA 1DBNA 1CZTA 1OCZH 2BFUL 5GZFA 3TN91 2VBYA 4U88A 1W2UA 4Q4W1 4RS5B 4IETA 3H3VK 4CDUB 1HW2A 1TQMA 1OOPC 1YI9A 2W91A 1ZYRF 3KETA 3ALQA 2F4PA 5L3DA 4YGEA 1WH7A 2RJLA 1HW1A 1GV9A 1KDMA 1MR5A 3MZ8A 1BBT3 3AMMA 4M3GA 5KHJA 5A6XA 4CP9A 2YFUA 1Z0HA 3ZXJA 4LB6B 4XYXA 2P81A 1U78A 2A5WA 1ZZ7A 4A3GJ 2RDNA 1JZ6A 3C7OA 2R7OA 4QXHA 2R16A 3TO6A 3C2GA 2IVMA 5E8IA 3LA3A 3HOUJ 4GWJA 2IA0A 5DCFA 4HETA 3SEQA 2IS6A 2GH8A 4CZZA 2QKMB 2YC4A 3TKYA 1OA2A 4YFZA 1YQ5A 4XN3A 1OH4A 4PK4A 4QHOA 1ETXA 4MQ9F 4Q4X1 5FR3A 4B1RA 4AIHA 5K7FA 2FUG2 1JUMA 4D7MA 2HEWF 1W9TA 5FWJA 3C2UA 3ME2A 3ASIA 5ED4A 3CJIA 2JPCA 5FPLA 2XVGA 2KJCA 5F37A 5C8CA 4NUBA 2V5YA 2O8OA 2HYFA 2VGDA 1TT5B 1AJKA 4AGGA 3ZIXA 4ZXEA 1CR7A 4NC6A 5FK7A 4U36A 1YQ6A 1YQ2A 1P4XA 3ZN6B 4LD5A 3BY6A 1RR7A 2DOEA 1JZ5A 3HOWJ 5IAXA 2M7AA 1T08B 4LBMA 2GNTA 2D3PA 1JI8A 3JD72 1STMA 2QBYA 3ZXEA 1BK1A 3REOA 4A12A 5FQ0A 1YJKA 2WTEA 5JOXA 2W82A 4QX7A 3LB9A 4KWUA 1IN8A 5HXMA 1Q56A 5AVAA 2KIMA 5FPBA 4DNCA 4XFCA 3DCQA 2QKDA 1Q43A 3QH6A 3CF5F 2OKXA 1VRH1 3A0KA 2FBEA 1GT0C 1SFKA 2Q8EA 1TG7A 2BOJA 4CA0A 2VKHA 4BH9A 2PBIA 3POEA 1BIAA 2DA6A 1BR1A 3LSJA 3N7MA 1PO23 1BI2A 5ILSA 1FMWA 3L2VA 5JOWA 1DLLA 1Y3TA 2QQUA 3N05A 3CEWA 4XRSG 3OV8A 3ZFGB 2JUGA 5KXBA 3V8LA 4GQ7A 4X6RB 5J8FA 1WJBA 2R7TA 3AL5A 3NW4A 1DIWA 4A3FJ 4L9VA 1S7AA 5DZFA 2CYFA 3VDDC 4DY5A 3OF1A 3P9CA 5FJKA 4AFDA 4XONA 4FO9A 4WBBA 1U12A 2HXOA 3DP7A 2WNUA 1UHSA 3T30A 2RS31 3TOAA 1PJRA 1ZM1A 1CZVA 2KZGA 1REPC 5DG1A 2W1UA 3RMYA 2EA7A 4ENMA 5EYXA 1DPUA 3VBUA 4Y1XA 4XVHA 5FKCA 3H0GJ 2DLLA 1H0MA 1YFWA 3VYSB 2D45A 2ZGTA 4WCGA 4AGRA 3GFMA 5E1WA 3ZMOA 2QQJA 4EM0B 1AYM3 4IQJA 3VZOA 4AYBN 2CS3A 2W84A 4A0YA 4AIJA 2MW8A 1OHFA 3ZFEB 4QIWN 3E7LA 3WDTA 2QGUA 5F3CA 3FZVA 4L9TA 2LF7A 1F2NA 3JB4C 3I4IA 5D8KB 4IGOA 2F5DA 2A70A 2DVDA 4A0ZA 3AKZA 1REFA 1JOBA 2YYOA 2F6CA 4XORA 1V00A 2QQNA 4PQQA 1S0CA 1E17A 1AWCA 5D5WB 2STWA 4RAZA 1IRGA 2CWMA 3HHGA 4JC1A 1H2LA 2PMZA 1LJ9A 2E1MC 2G7UA 2GOXB 1QXRA 2BHYA 3VBOC 2M8GX 3KV6A 5H9PA 2AO9A 4A3DJ 2MD5A 4HF1A 1HIXA 2DODA 3DUIA 1LGBA 3SHRA 4Z2AA 4MH0E 4FCAA 1UG2A 4IV3B 1UY3A 5E8GA 4AVZA 2WV1A 3A4UA 5T5PA 5B66C 5JPNB 3P9KA 2GALA 4HOOA 5CFCC 4QPOA 1JZ8A 3ERED 1S0EA 2L2OA 3I3DA 4L9JA 2PHLA 1ZRCA 1WH5A 1GUUA 2JA2A 1T6BX 4OOIA 3JRAA 3PFYA 4ZZLA 2CWEA 1PM7A 2QEXI 1F9NA 2RQQA 5EYYA 4LFUA 4LGWA 2ZBJA 1OYYA 1O3RA 3ZN4A 3HT1A 1H89C 4UYBA 1OVPA 1UQXA 1ZZ8A 4E2QA 4QB1A 5BYNA 4BXFA 2VM9A 3RJRA 1MQTA 3T4HB 4LJHA 4Q4W2 1GYKA 3MF9A 4BCUA 2CSGA 5GPCA 2ETEA 2LF8A 4QWNA 1JT0A 3LFIA 3EBRA 2L4AA 3N9LA 2BY2A 1UZ0A