3RDIA

Domain-domain flexibility leads to allostery within the camp receptor protein (crp)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILFYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catabolite gene activator
publication title Domain-Domain Flexibility Leads to Allostery within the Cam Receptor Protein (Crp)
rcsb
source organism Escherichia coli
molecule tags Transcription regulator
total genus 62
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rdiA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3rdiA01
4ENNA 3VOEA 3SZTA 4HW0A 1K79A 3FX3A 1IF1A 4Q29A 2D45A 4PGHA 4ZYGA 3CEWA 2DAOA 3ZMUA 5BV6A 2X4HA 2YX7A 4IEUA 3IWFA 1SFNA 4XFCA 1F5TA 1HW1A 2XLAA 5K5QA 3LA2A 5BQTA 3RNSA 1FBQA 1J59A 2IRFG 1BIAA 3BPXA 3FXQA 2YU3A 2OA4A 5J48A 3BPZA 2UZKA 3K69A 4I98B 3BB6A 3LA7A 4PIXA 3RKWA 5I0TA 1CAXB 4CDGA 1KGSA 4GO1A 3FHIB 3F8NA 2IA2A 1ZGAA 1U78A 4KYWA 2LDUA 1DPRA 1HKQA 2ZXJA 1Z91A 3QU6A 4MGIE 1QGPA 2K27A 4IEPA 1ZG5A 5K8SA 5ILSA 1JE8A 3S2WA 4EMSA 2VT2A 3I54A 3T8RA 1Y9QA 4ZH4F 2EVXA 2XLFA 4ENKA 4HDVA 1U12A 3EDPA 2P5KA 1ZAOA 1R1UA 1YQAA 3BDDA 4OIQF 4QGMA 4RB1A 2IVMA 3QAHA 2Q4SA 1ODDA 4HVRA 2FNPA 4TLFA 2DQLA 1BI0A 5J6XA 4YIIA 4KU8A 3LOIA 3NSTA 2UY9A 5CVVA 3BJOA 1V3FA 3KP3A 4LA2A 4MNUA 3OOPA 1I5ZA 4B29A 1FX7A 3I5UA 3FFQA 1ZH5A 4HN1A 1J3QA 4EJOA 1IXRC 2JPCA 4META 4YNIA 3H1WA 1SD6A 5I0RA 1IN4A 3O3KA 2K9ZA 3ECOA 5ICFA 5DCMA 3J80Z 3KLNA 4YSFA 4IETA 2KRFA 3FM5A 2K86A 4RGRA 4HMZA 3U2RA 2VT3A 4ASNA 4A0ZA 3ETQA 3GO5A 2DQRA 1MJBA 4HOBA 3KZYA 5JSOA 3CF6E 5E18F 2UY8A 2P5VA 1EH7A 3E3VA 1ZRRA 1J75A 1K78B 5E1ZB 3EETA 4ZU7A 1CAXA 4R1HA 3DEUA 5E20A 3JSOA 5K1YA 3C7JA 2JRTA 4UXNA 4ENJA 3H92A 1G6NA 4DINB 1MJ9A 1HBXG 2IP2A 1JXSA 3DPLC 1R5GA 1YFXA 2M8EA 2PAMA 2UYBA 4HX7A 2PJPA 1OFNA 2D5FA 3LSTA 3SXWA 5T3NA 1I1GA 5ILUA 2DPUA 3ZMTA 4BHCA 5FPXA 5L3BA 4RB2C 3JAMK 4LJZF 3T5XA 3T0YA 4M9ZA 2XV4S 2MLGA 2GAUA 1S8NA 1W7PD 4UVCA 3U11A 2RC4A 5FO5A 2MH2A 1QXJA 2PHDA 2XAGA 1P2FA 1IPKA 4M9SA 4RGXA 5J3UA 1EYBA 2IXLA 4QGNA 3ZDSA 3MPBA 2ZNZA 3HHGA 1PDNC 2ET1A 2WWYA 4MGZE 4Q47A 4QLCU 1GVJA 4HX4A 3L00A 3N97A 2UXNA 1OYIA 2GC3A 2AXLA 3F8MA 1JUHA 2RN7A 3GYDA 1FSHA 1B1BA 2QZ8A 4P5OA 2VE9A 1RI7A 5FCCA 4AIKA 2A6EF 1R5HA 2IXCA 1FBUA 1B9NA 2DU9A 1VTNC 3BROA 4KIFA 1UPIA 2IXJA 3TOAA 4RGSA 3GFLA 2L54A 2OA2A 4YRDA 3H1MA 3ZP5A 5HLGA 4MUVA 1X8EA 3I59B 1FYMA 4EWDA 4HSLA 2QBYB 1CX4A 3HQXA 4I0BA 4ETSA 5FDBA 1ZRDA 1Z1DA 4B8XA 5BXXA 2B9UA 1TBXA 1O7FA 4X6QB 4GULA 2PYTA 4L5JA 4IJAA 1L3JA 3GW2A 5EEHA 3GX4X 3P9IA 2XKPA 5F1RA 3I7DA 3ST7A 2BE5F 3KMHA 1XCVA 2P6SA 3KP4A 2TDXA 3SHFA 2EFWA 1ULYA 3M8FA 4RAZA 2GC0A 2A6HF 5HS8A 2Z99A 2V1XA 4OMZA 5HDNA 1LNWA 2XASA 4WXDA 1NHAA 3ZMSA 2VBZA 3R6SA 4KFCA 1U5TB 1EH6A 4HQEA 2NYXA 1PM7A 1YIOA 5I8SA 5AIPA 1RUNA 2W57A 1D8KA 3KEQA 4XBFA 5BMZA 4M73A 3S7EA 2NAZA 2A68F 3MZHA 2NRAC 1FC3A 4H0EA 5JCTA 5EEGA 5FGMA 4HF0A 1KU9A 5FB2A 4A6EA 4AD9A 2XRNA 3SQNA 3DN7A 4LA3A 3DKWA 4LB6B 2FBIA 2AS5F 1Q43A 3P9KA 3L2HA 3BPVA 4CZZA 3EHKA 3LAPA 4L5IA 3J7AO 3FXUA 1CAVA 2HQNA 2BBYA 2O8QA 3KCCA 5FLHA 2DW4A 2L4MA 4AVCA 2IA1A 4XF1A 3H1YA 3PNAA 5ICEA 2R7FA 4FT8A 3CO7C 2QWWA 1GXPA 1G4DA 3JZVA 5HDGA 4U88A 3CUQB 2HS5A 2FBHA 3FHZA 3C3VA 2GXGA 4IEYA 1IXCA 1PP8F 3QP5A 4OIRF 2K7LA 4R8HA 5D4SA 3SCHA 5DD4A 1ZZ9A 3LZZA 2KJCA 4ESBA 2M30A 5I8YA 1RIOH 2LF7A 4ZZDA 4PZJA 1NZCA 3I4PA 3MWMA 3ULQB 1ZZ6A 4CICA 2QVOA 2HEOA 1WKMA 4HVQA 2F2EA 1XGMA 2XAQA 1AOYA 2MLKA 3WODF 5I8TA 5FLXK 2WV0A 2LKPA 3U1DA 1DZTA 2ZMEA 1F1ZA 3HT1A 2JSCA 4PJYA 2IT0A 3RZZA 2A07F 2RKHA 5E1XA 1CAUB 3KLOA 3C18A 2DK5A 5D6FA 1XGOA 4HA8A 2VONA 4WF2A 4GGGA 2W84A 4MZUA 5CJ9A 4HSJA 3HOTA 3R60A 3TQNA 4R52A 1J3PA 4L9TA 1SFXA 2OD5A 3JTHA 5C6CA 4XFGA 5J8CA 4ONUA 1O3RA 1LVAA 1J9IA 1TNTA 4Q5SF 5JR7B 2YPRA 1STZA 3TDUC 4QM8A 1U5TC 2EB7A 2E9QA 3I64A 2M45A 1AWCA 2IXIA 3HSEA 2V1UA 3S0MA 3CUOA 3ML6A 3USSA 3Q9VA 5C8WA 5JSRA 1S7OA 5FPZA 5LHHA 1J1LA 3HRTA 5BS6A 5TRDA 2CSOA 2Q1ZB 4Q4ZF 1RZ4A 2D40A 4LGWA 1T6SA 3KSCA 1UIKA 1EY2A 3RJPA 2GIVA 4LLGF 3CLOA 1DP7P 1J58A 4H7LA 2K4JA 1J7KA 3F22A 2HYGD 2VC0A 2PFWA 2HZTA 1WWXA 4KUMA 4EM1A 3WGHA 2XAFA 2P7CB 4XFIA 4XF4A 3LQRA 5D8KB 3D0JA 1ON1A 1V4RA 4UNOA 4JTNA 2HKOA 3IKTA 1ZHFA 2B5HA 3M3IA 4M72A 3CUQC 3E5XA 2VC1A 3I58A 1X7NA 4JBAA 2OAZA 1Q3EA 1R22A 4J1WA 4GCVA 1XE7A 2KIFA 4BHPA 2QQBA 2JT1A 3HT2A 4AIHA 3QPTA 2BGCA 2HR3A 4EJTA 2KIUA 2PMHA 1OR7A 4G94A 3ZMDA 5FQ0A 4XFFA 3CO6C 1UFMA 3ZN0A 2O6GE 2XVCA 4U7DA 4PCQA 4EJWA 3AAFA 5LRSA 3GWZA 4PIZA 4EM2A 4XSXF 3WU0A 1Y0UA 3HTUA 4F7ZA 3HSFA 1KU3A 5DCMB 1FY7A 1SAXA 4WK8F 2O03A 4XETA 3GUDA 2HOEA 2GA1A 4HLTA 3CJNA 2ZFWA 3IRRA 1MDMA 3F3XA 4N0BA 2OZUA 4B09A 3TKYA 2QNKA 4IERA 2OPKA 1Q5OA 3FM3A 3WTVC 4M6YA 5JSPA 2RQPA 4Y13A 4G9YA 3QOPA 4LG0A 4Q48A 3IRQA 2XKOA 3FMQA 2MA3A 1DZRA 2IPQX 3E6CC 3C3WA 1JHHA 1LEAA 1UD1A 3G3ZA 1XB4A 1QO0D 5E8GA 2CO5A 3ZN1A 5D4RA 4I02A 4AQ2A 4PGGA 1BJAA 2QLZA 4MQVA 4WVZA 2FBKA 2V79A 1BI3A 3EBRA 1I6XA 2H0VA 1VJ2A 4YYOA 1NXMA 3BU7A 3DQVC 3OTFA 1LJ9A 1LQ1A 4P96A 2QJVA 2ADUA 2FEZA 4FX0A 3KP7A 1XSXA 1QZZA 1FXZA 3U0ZA 1MJAA 3D5LA 5DYMA 1LDDA 1ZX5A 5KBFA 2XAJA 3RTRA 2Q8KA 1H9TA 1HKSA 2GZWA 1NE6A 3ELNA 3MCZA 3HSRA 1IZ1A 1QNTA 1FBSA 3KGLA 1R1TA 4I2OA 4NVPA 1FWZA 2RV8A 2VXZA 2ATFA 1G3YA 2O3FA 3LQQA 1HW2A 2MNGA 1WA4A 3H50A 5HLHA 2MHFA 2PAEA 3MDPA 1HSTA 4KWJA 2QCSB 2D1VA 3HRUA 2L4AA 3KGZA 4IEVA 3GYHX 2G9WA 3DL3A 1L0OC 2Z9OA 4HN0A 4YARA 5CU1A 4Z82A 1YFUA 2EWNA 4A0XA 2Z33A 2QQAA 1DPUA 1YLFA 3V7RA 2IXHA 3IWZA 1DUXC 3MFKA 1F4KA 1O5LA 4IPAA 2D1HA 3V4GA 4YFKF 1SMYF 3RDIA 2H27A 1HKTA 3LAJA 4M9XA 4AVAA 3TO6A 3VHRA 3W6KB 4HBLA 3KE2A 3GVAA 5H6RA 1S29A 5HS7A 4HZFA 3TNPB 5LEKA 2F5CA 3WW4A 4AWXB 3WTTC 2CFXA 1BN5A 2W25A 4Q0PA 1ZYRF 4WWCA 1YW9A 1SFUA 1LB2A 2DK8A 3NQOA 4LLLA 5A2QK 4LULA 4A5MA 3WW3A 4KIBA 1D8JA 1QPMA 3DF8A 4FAHA 4IRHA 1T98A 2EK5A 2BYVE 1SD7A 3WTUC 3PVBB 1XMAA 2EV0A 4A0YA 1FNNA 3EO6A 2UXXA 4IEZA 4IESA 2G7UA 1TW3A 5HS9A 3FE5A 1MKMA 2V6CA 3RYRA 4MH0E 5LGNA 1EH8A 5H6QA 4P9UA 1U8RA 2QQ9A 5IT9K 2W24A 2OZJA 3F72A 3F6OA 3FJSA 1W5TA 3DFGA 4CHUA 3TO9A 3COAC 1YFWA 3IHUA 2PHLA 1J2XA 3PFIA 1YW7A 3WE3A 1TW2A 5D5WB 1WLTA 1Y3TA 2PAKA 2PI0A 3RYPA 1G3SA 4PIYA 3BZ6A 3FZVA 4RS8A 1XGNA 4LK0F 2KJBA 3G73A 4L9VA 5F6FA 2UWMA 1BIBA 3PLQA 2Q30A 4MTEA 5EZWA 4KT5C 1QWRA 4O5VA 3T8TA 2JTVA 2P6TA 3H7JA 3TO7A 3QRFF 5JVTA 4E2QA 2ETEA 3SZPA 1XCBA 5E16A 3H3UA 1ZZBA 5CVJA 1FP1D 1O7LA 3EQEA 1CAVB 1Z6RA 4U7BA 3LWCA 5AIQA 3FF5A 4EJUA 4Z2YA 3B02A 4DQ2A 4LLNA 1BBYA 4WCGA 4KN4X 2MBFA 1TQPA 1IN5A 2Q0OA 3WE2A 4ZZLA 4HV5A 4XSZF 2IJLA 1GQGA 1XE8A 1E17A 2CAUA 2H94A 1USTA 5FLIA 1UHWA 2COMA 4JV4A 4P9FA 4IRIA 2ZBKA 5EFUA 2OU2A 1HQCA 4UV8A 1ZRFA 4KMFA 2F5EA 3ERED 1BI1A 3MEXA 4MTDA 3IKVA 5JR3A 4QGLA 1Q1HA 3REOA 3H7YA 3D0SA 6PAXA 3EJKA 4QX5A 4MHGA 2HYFA 5J7MA 2V1DA 1FT9A 2FE3A 2PQQA 1SEFA 2P7VB 1IN8A 4IHSA 5JHUA 5AVPA 1UB9A 3WW1A 4FAGA 2MPFA 2EFQA 2A3SA 4XEZA 4HYEA 4XF0A 1YFYA 1O3TA 4EGYA 5CVRA 2P8TA 1ZZCA 3SMHA 5LHIA 1G3TA 3G7DA 2ZMEB 2XGXA 5KVRA 2JZYA 4MEXF 1QY4A 1XRUA 1TQ5A 2M5WA 5DEQA 2WC2A 4UVAA 4JQFA 2FQPA 1LDJA 4LLOA 5L3DA 3RPUA 3JAMZ 4FX4A 4BH9A 5CYVA 2ZCWA 5LHGA 2O8XA 1H0MA 3UKVA 3I71A 3VEPA 5CVIA 1ZNPA 5H20A 2CV6A 1Z7UA 2VBWA 2CWEA 3BY6A 2B8MA 1E2XA 4GYIA 3ZMVA 2FA5A 2BV6A 4ZYEA 5LLQA 3TGNA 4K8FA 4EWEA 4XF3A 1GXQA 4S05A 3U9GA 5E1WA 1D3YA 5L3GA 1S6LA 3SCFA 3ABUA 4XRFA 2EJRA 3I53A 3KEOA 3Q9SA 3M70A 4IEOA 2DBBA 1H1MA 3DV8A 5BOXA 2F4PA 2QYOA 5BPDA 3GF2A 4JVAA 3E5QA 1P6RA 5D5UB 3ABTA 3LWFA 3CDHA 5IT3A 1W5SA 2LF8A 2QENA 3LAGA 3PQJA 4K2EA 1XDSA 3ISPA 5ILVA 4E2SA 5L3EA 2A5YB 2C0ZA 5HOOA 4AVPA 1LEBA 4CYDA 1YO5C 5E1RA 4HDUA 3K9TA 1RTVA 1LKNA 3RPQA 1TQIA 3CTAA 3KP6A 2GH2A 1T2KA 3U10A 3HYIA 4KDPA 1ON2A 1R00A 4KWLA 3RKYA 2PN6A 2NNNA 1PMIA 4MV2A 4YG2F 5D5VB 4QWQA 1EV7A 1X3UA 4XFAA 4TV7A 4EJVA 3LA3A 4OMYA 3WU1B 3LFKA 4KU7A 4BXUA 1ZGJA 2J5PA 4IRGA 3KP2A 4MGRA 2ESHA 5CVUA 1IRFA 1R36A 4HBNA 1IUYA 3FMRA 1FI2A 1MD0A 5FQ0B 4HLXA 2L01A 4XLPF 4MGKE 4I09A 3IDCB 1O3SA 3NVCA 2D2WA 2ET7A 1FLIA 3RI4A 3GXOA 1KU2A 4KA4A 4XF9A 4L9NA 5ICGA 4OIPF 2IW5A 4UV9A 2DO7A 1CF7B 4UUVA 3HRMA 1QBJA 1FPQA 4IXAA 4IEWA 1ZZ7A 1MDMB 1T39A 1IAWA 4RB3C 2CYYA 1O5UA 1KYWA 4HV6A 4Y15A 2XIGA 5KHKA 2J5OA 4NHJA 1SMTA 1OI6A 2N7GA 1O57A 3M8EA 4LG0B 4E70A 4L0ZB 2ISYA 3MAJA 5LGUA 2YR2A 2YX4A 1LR5A 4OINF 2O1QA 1KQ0A 4BNCA 4OLLA 2K0GA 4KICA 2XL7A 4AIJA 4M71A 2BNOA 3IBMA 5KHHA 1TQMA 5CLSA 4HAMA 1IRGA 4LTAA 2GWRA 2HTSA 4JK1X 4RAYA 2V9VA 3J80K 4P55A 2V09A 3KFWX 4U0WA 1QXRA 4KMUX 2RGVA 1ZVFA 4KN7X 2Z69A 1YYVA 3FMSA 4YFXF 2PTMA 1ZLKA 4G7OF 3PQKA 4S04A 3EUHA 1RGSA 4G6DA 3K1PA 5D5XB 1Z05A 2QVSB 3B73A 1L3LA 1V70A 2L3DA 3BWGA 1ZG1A 3QP6A 3KZZA 1CAWA 1RL3A 1LRHA 2H6BA 2HJIA 3SHRA 2QUFA 4ESFA 1KYZA 2OBPA 3GZ5A 3V8LA 1Z6TA 4LB5A 4EM0B 3J81Z 5ED4A 2Z5UA 3IC7A 2DTRA 2OYZA 2O0YA 3L9FA 3NRVA 2PG4A 1CF7A 1DGRA 1IN7A 1X8MA 1S7AA 2XAHA 5FLXZ 2ZKLA 1XD7A 1ZG3A 3FWEA 3WG9A 5K5RA 1ZREA 3E6DA 2BNNA 3O6BB 1J3RA 1TTYA 1BM9A 2O61A 1PUEE 4XFHA 2ACJA 2VECA 1W7PA 2EV5A 1EP0A 2P17A 1YUDA 2KIMA 1U6GA 1I27A 2JPBA 5HVQC 2PQ8A 1KQ9A 2W85A 2F5FA 1T38A 1R1VA 2E1CA 1RC6A 4ZU5A 4WXHA 3GFIA 2G7HA 2GQQA 3P7NA 2NS0A 4G7ZF 2PA7A 3WTZA 3WGIA 1SQ4A 2R3SA 3V8JA 3FXRA 2CAVA 1OKRA 3KP5A 1I1SA 4MEYF 1NE4A 1ONVA 3P9CA 3M7GA 3NW4A 4WBBA 4RGUA 5LBQA 1FYLA 2FQ3A 3ZPLA 1G3WA 5BY5A 3OD0A 3DXJF 4R79A 1F9NA 3R61A 3WW2A 5AONA 4HQMA 1YW8A 4J1XA 1XDUA 3GLXA 3TDZC 1FP2A 4F8AA 1KQ8A 1BC8C 1UHMA 2FF4A 1ZARA 2ELHA 4L2NA 1BOAA 1W4MA 1R58A 2VPVA 5JAXA 2OQGA 5DDGA 1JGSA 5D8LB 3ELKA 3IL2A 2CG4A 5E8IA 1U2WA 2FOKA 4MQ9F 1YS7A 1FYKA 1NYWA 4A5NA 2FXAA 1D5VA 2VODA 3T1BA 5J8FA 3W6JB 2FRHA 1K7AA 4BHBA 4O6JA 4I0AA 3E6BA 5L3FA 3SXYA 4OOIA 2ZKZA 2HFHA 1OPCA 2ZO4A 3GEZA 2RNJA 2P5LC 4CO8A 2HDCA 4ESJA 2B0LA 2A61A 2MH9A 4E2GA 1R23A 3WTXC 5KHIA 3MYXA 3L7WA 2MC3A 2RDPA 1J0RA 3F8CA 3M9AA 5KHGA 2K02A 1B6AA 3HHHA 1YWKA 1DDNA 2PFBA 5I0SA 2PBIA 2FNAA 2EV6A 2K4BA 1YTYA 1YLLA 1IPJA 4ORFA 3F8BA 5I0UA 5HDKA 1XSDA 4L18B 4ZU4A 3GBFA 3NEUA 4Q0VA 3TNQA 2LSOA 4OU0A 4IHTA 4CXFA 2DT5A 5FD6A 2CQKA 4AXOA 4EROA 5DUKA 4DNCA 4N9IA 1P92A 4G8XA 4YIFA 4P9GA 4A12A 4I01A 1WSUA 3VFZA 4D0PA 2C6YA 2EFPA 2XHKA 2M1BA 2DCTA 2Y48A 1IW7F 2ZNYA 5ICCA 1XN7A 3CO2A 1R7JA 1FOKA 4QM9A 2VBYA 3V7CA 1YG2A 1DGWA 4N9HA 4IVNA 3GFJA 5FLJA 4X6RB 5ERIA 3BJAA 3E97A 5DV5A 2EFNA 2ETHA 5KK1A 1A04A 2Y75A 2Z3YA 1RNLA 2R7DA 4EWAA 1UCXA 3ZQ7A 4LEJA 3OV8A 1UIJA 3TOBA 2IC1A 3ROUA 3MQ0A 4NB5A 2BEOA 3O2PE 2EA4A 3F8FA 3HUGA 4BIFA 2FMLA 4Q0SA 5LGTA 2I45A 1GHCA 3ECHA 3OF1A 3D82A 1QZYA 2F5DA 2VE8A 4XFBA 1Z9CA 2RVCA 3K1MA 1K78A 4I7HA 2DLLA 4UBGA 1ZN2A 1UW8A 1H1IA 2EAAA 1WRJA 3F23A 4L0YB 3R0AA 4U0YA 4A2UA 3H8UA 5FFZA 5DCFA 2KXLA 3WTWC 4A6DA 3R4KA 3O14A 2L02A 3BJ6A 3BALA 1HSJA 2UYAA 4HVOA 4BQAA 4EQQA 1ZLJA 3BP8A 1OD5A 4I3PA 4XLNF 4IEQA 2HQRA 4MGYE 2VN2A 4UBHA 2WFPA 1P4XA 1VP6A 4HF2A 3GFMA 2H6CA 2EA7A 2DFIA 4L9JA 4QMAA 3S7IA 4ENMA 3L09A 3FZ3A 2H09A 5KHJA 4LUKA 3I0TA 2OQRA 4EVIA 2VOPA 3UKTA 2D5HA 3ACLA 5LEJA 3SCGA 2D93A 3NJZA 3GZ6A 2GA2A 3VB2A 5CADA 4RB0A 2A69F 1OYWA 2ZJ2A 1REPC 5A2QZ 4OFGA 1UCRA 3NL1A 3K0LA 1S3JA 3WGGA 2M87A 4AVBA 3JW4A 2XUBA 4KWKA 4ON0A 2PLYA 4IEXA 3E6MA 2GC1A 3K1NA 2Q2EA 2OZ6A 4D7TA 2XROA 1B9MA 4CGZA 1O3QA 3EYIA 2QDRA 1SD4A 5IT9Z 2XL9A 3N4MA 2E7WA 3MZYA 4KNYA 3JSPA 4L11A 5I93A 3EYYA 4M74A 4UHTA 1JHFA 3WTSC 3HOSA 3I59A 5BPIA 3VODA 3NKTA 2QBYA 1FSEA 1FZPB 2E7XA 1H9GA 3ES1A 5F64A 2ISZA 4GXOA 5DD8A 2HTJA 3R0JA 4M6XA 1USSA 3HIFA 3V8KA 1WI9A 1P4WA 2EFOA 2VBXA 3ZMZA 4HF1A 3HTSB 4BAYA 3DPTA 3H9AA 1XSVA 4IF4A 2KKOA 1T0FA 2DI3A 2X0LA 5HI0A 3OCPA 5BUVA 4D7SA 2GXBA 1ZZ8A 3E5UA 2BNMA 2EA2A 1RUOA 1QQIA 3L2CA 4O9GA 3IIAA 5I91A 1KA8A 5FD5A 2STTA 4WZCA 2CGPA 1U5TA 4LK1F 3RKXA 4MX3A 3J81K 4Q0QA 2P4WA 5HLIA 5JFRA 5LRRA 2MD5A 1EPZA 3UKNA 4WX9A 3Q5FA 2ESNA 4EV0A 2Q0AA 1VR3A 1BI2A 2HWVA 4OIOF 4WXCA 4O9EA 4ZYHA 3WTYC 1WGPA 4BYYA 1J5YA 1OYYA 3C1DA 2FU4A 1P4AA 2FMYA 4G6QA 4JTOA 2LNBA 5BPXA 4KIGA 4LFUA 1CAWB 3M1EA 4NQWA 1XGSA 1O4TA 2Y0OA 5E17F 3JTGA 2NNYA 3EQLF 2YSRA 4UVBA 4YFNF 1MZBA 5D1IA 2CW0F 1BC7C 1C0WA 4O3MA 1X82A 4PDKA 3QU3A 3DP7A 1MGTA 4HX8A 5DUIA 3CL1A 4ZYDA 2PEXA 2E1NA 3CUQA 3OGJA 1B4AA 4LUMA 3IDBB 3F6VA 4U0VA 5D6EA 3ES4A 1IXSB 2GC2A 4Z07A 1B59A 3BCWA 2HKXA 1W7PB 2Z2SB 3HRSA 2STWA 4RD7A 3QACA 4FBFA 4Y17A 2HGCA 1HW5A 4EGZA 1GQHA 2XLGA 5K5OA 4Q0UA 3BOQA 1OMIA 4GYGA 2VQAA 2FSWA 5TJJA 4LD5A 4HLYA 1ZRCA 1U3EM 2VOOA 1SD5A 4G7HF 3RYKA 5FFXA 2IA0A 2WTEA 1KU7A 3V7SA 1TLHB 1PP7U 1YHFA 3CJXA 1HXDA 3RIRA 4FHTA 1LDKB 5JI6A 3KETA 1WQ2A 2PMUA 1K6OA 3SFZA 1TNSA 4LMYA 3QPHA 1CAUA 2DPDA 3F21A 1YS6A 1XMKA 1CGPA 1YFHA 2QM3A 4AQ6A 1SFEA 4QXKA 3CLPA 2IXKA 2GU9A 3H3ZA 2Y0MA 4KL1A 4UXAA 1IN6A 3K2ZA 5L3CA
chains in the Genus database with same CATH superfamily
1QJX1 4ENNA 3SZTA 1K79A 4RLFA 3OEBA 5EGOB 1SDDB 1R6RA 3U4XA 4A41A 5GM0A 4BQ5A 4QX2A 3WXPA 2WN2A 5FZGA 3B69A 4YGEA 5A33B 3DEMA 2L7MP 1C57A 2WFF1 3RNSA 5K5QA 2K9QA 5A1LA 2YU3A 2TRTA 4B7EA 3G6EI 1H6YA 1FJLA 1PK6C 2OTLI 2UZKA 4I98B 3KQ4B 3RKWA 1MZ5A 5I0TA 2E5ZA 1VBD3 2RE9A 2K40A 3DYOA 4N7UA 2VCCA 2DA1A 3V0BB 3A23A 2ZGUA 1CPNA 1DPRA 5M5WJ 2ZXJA 1GLHA 3FLPA 3HNBM 1SG3A 5FY9A 2K27A 1LFBA 5K8SA 2HWC1 4XLFA 2ZAHA 3RG0A 3APBA 1APNA 2WZR3 2Y31A 5FMOL 2EVXA 4ZH4F 5A70A 3BZCA 5C3SA 2L9LA 2BRTA 1IDZA 1ZAOA 1ULDA 3BDDA 2VW0A 2IVMA 3WT3A 5AFEA 5L9BA 2GSYA 4TLFA 2OKXA 4YIIA 1LNSA 2X05A 2BHYA 1GYKA 4Y1YA 5FZ7A 5FY7A 1OPOA 2J7MA 5CVVA 3BJOA 3KP3A 2CU7A 4MNUA 3WINE 2DFBA 5K7FA 1FX7A 3I5UA 3SKJE 1J3QA 4Q27A 1WGXA 2HWE1 3H1WA 2O14A 4BDYA 4KI5M 2K9ZA 3O3KA 3ECOA 3DECA 5ICFA 1YJ9I 3J80Z 3HUGB 3KLNA 3FM5A 2K86A 1NY71 3PM1A 4XN0A 2ELJA 2JA8J 4R9DA 4KBBA 3C7HA 1YNAA 2DOFA 1VQNI 1JTYA 3WG3A 5E20A 4QX7A 3JSOA 1OF4A 4BJTA 2JRTA 2BJSA 2DVGA 2XDVA 2YXSA 1MJ9A 3DPLC 1K45A 4YZ3A 1UY3A 2PQSA 1Z7S2 2UYBA 1I1EA 2PJPA 3MI8A 2D5FA 1CJPA 1I1GA 4WM7C 3ZMTA 3ZRGA 3OYJA 2BXZA 3AP6A 4RB2C 2FDKA 1AZDA 5CKNA 3JAMK 2DA4A 2ID4A 3T5XA 1LHWA 2P34A 4P5YA 5CQGA 2XV4S 1RUE3 4D6RA 1S8NA 1W7PD 3FKIJ 3U11A 4XOTA 4P9WA 1VQPI 2RC4A 2A5ZA 5FO5A 2MH2A 3K10A 2XAGA 4M9SA 2TUNA 1DIWA 3ONQA 1DGRN 3MLKA 4PJMA 1AHSA 1MQTA 3A0NA 3AKPA 3C7FA 4G3YC 5CFCB 1F5JA 4Q47A 3N35A 1R71A 3RFRA 2XJUA 1WMDA 3L00A 2OUMA 3N97A 2UXNA 1OYIA 1NX9A 4ISQA 5IVCA 5LASA 2AXLA 3FFZA 4XNFA 1DFQA 1COV3 2TCTA 4AHXA 3GYDA 4OI2A 5J36A 4P5OA 4ASMB 2ZJPF 4YM1A 5FCCA 2A6EF 1FBUA 3BROA 2ZMLA 1E3PA 4BXSV 3JUUA 4F83A 3GFLA 4TSVA 1ZQ3P 3T3YA 2IGMA 3AB0A 1PX4A 4DBRA 1NCQB 4E7SA 4A3DJ 2VD7A 4P9YA 3WV6A 1FYMA 1W6MA 4CYCB 1AR63 2WZR2 4EWDA 5J40A 2QBYB 2Y6KA 1Z3YA 5FDBA 2XQRA 2Y60A 1TBXA 4YW2A 1O7FA 4GULA 1IDYA 1HB1A 2I5UA 2K85A 3GX4X 4AL9A 2XKPA 4J6GA 3WZ1A 3CJRB 1SDWA 2BE5F 3KMHA 1DQ2A 4NIDA 4E8CA 3LKJA 4UF0B 5IVEA 4RAZA 3CZ6A 5HS8A 3ENRA 2WZEA 4GH4C 4EN8B 1ND3A 2WA4A 4WXDA 1NHAA 3ETPA 3B6CA 1EH6A 5FKCA 4AEDA 2DA7A 4HQEA 1XNCA 3VDDC 3QYEA 3ZN4A 4P9IA 3CCLI 2W1QA 4A69C 1W39A 1X1BA 5J4VA 5KR7A 4E7JA 4RA2A 1H9WA 2B45X 3DPRC 1Y43B 3A0BC 3KS7A 1S4CA 5E3NA 4CXXA 5IP6A 4AD9A 4JDOA 4GA9A 4P9JA 1UN1A 3FUOA 2DCZA 3JRFA 4LA3A 1I6HJ 5E3LA 4FPKA 1Q43A 4IDZA 2LBFB 4P5HA 2XJRA 4W6WA 4XPVA 2Y2ZA 3FXUA 1CAVA 2HQNA 4Y3OA 5A3NA 3ZYPA 3FLTA 3CJIA 4AEKA 1JYWA 4UFKA 2L4MA 3C7EA 4AFDA 3FBIB 1Q1VA 4XF1A 3K4NA 3OYNA 2LD5A 3LSKA 5C9AB 2XC7A 3T2PA 5FREA 1JI6A 2IWGB 2ZJRF 1RRJA 1IXCA 1DQ6A 1PP8F 3WQ7A 1E5RA 4YFZA 3OGGA 4R8HA 5DD4A 4GKYA 4BE0A 2KJCA 3KIOA 1C5HA 1TWCJ 5F5QA 3O0WA 1QU0A 3E1SA 1C3HA 4ZZDA 1FATA 2JIJA 3AP4A 3I4PA 3MWMA 3ULQB 2QVOA 3TN91 4HVQA 1NQJA 1DCSA 1S0IA 1IG0A 3JB4C 3JCIA 3U1DA 4XM3A 1GWKA 5T54A 3HT1A 1IRZA 2VTXJ 4NRMA 3RZZA 4DRVA 2X5IA 5DAVA 1XU1A 3HOXJ 3VN4A 4A4AA 1TEIA 2DK5A 1Z3XA 5D6FA 3K4KA 1EAH1 2RM21 1AR62 5FY4A 5JXIA 1CZVA 2KQRA 5CJ9A 1J3PA 2EQRA 2OD5A 4NIHA 4Q4X3 1YI9A 4XFGA 3TP3A 5J8CA 5IVVA 1O3RA 1ULFA 2VCBA 2HXIA 4QDQA 1RHI1 1STZA 4UB6C 1LHVA 3A1YA 1W3XA 4QM8A 3Q0WA 5IOZA 4YEJA 3KV4A 3GMEA 1YX5A 1QGLA 1J83A 2FCVA 2P0WA 2IXIA 1DP3A 3S0MA 3HAGA 3CUOA 2E35A 2CL2A 3Q9VA 1G2HA 5C8WA 5JSRA 1S7OA 1J1LA 1N1TA 3HRTA 1Q8VA 2Q1ZB 4Q4ZF 2VMIA 1RZ4A 1T6SA 4Y20A 1UIKA 3PSFA 1EY2A 1HB4A 3MFAA 2GIVA 3IZOA 1OHFA 2R16A 4ZHNA 3F22A 1D1CA 3VBFB 4LO7A 3HGGA 2JICA 1FTTA 2OC6A 2KFDA 3H5AA 2P7CB 1Q8OA 4XW3A 3LQRA 4COZA 5D8KB 1XU2A 3HL2A 1YO8A 2R063 4S2DA 3AYEA 2K9SA 4UNOA 3WF2A 4JTNA 3HNYM 3CHXA 1VQMI 2ZKNA 2E33A 3CUQC 4UW6A 4FVVA 4C9YA 5JOXA 1UWWA 5F3GA 3KX2A 3MF6A 2P6CA 2W48A 4AVVA 2BGCA 2HR3A 4EJTA 2KIUA 2PMHA 3LDKA 2RS33 1RVF1 1ASJ3 4FISA 1US3A 4XFFA 3CO6C 3VUOA 3SDBA 1PIV3 1CZTA 4HOOA 2O6GE 3W20A 4EJWA 5EZHA 3HOYJ 4CCEA 1UJ8A 2X85A 4YELA 1Y0UA 1VLNA 1WD3A 4F7ZA 5GLVA 2O03A 1GZ9A 2E1MC 4XHBA 3BR0A 3AMPA 3VYSB 3FN9A 3B9IA 4B09A 1HDPA 3GTLJ 4XUPA 5DXDA 3S2DJ 1ACCA 4M6YA 1OSGA 4OWRB 5JXHA 2RQPA 4G9YA 1LULA 4IV1B 4RHV3 1QJX3 1RUI1 1JHHA 2KRHA 3MFCA 2CO5A 1AYN1 1T8IA 3I56I 4I02A 4BBRJ 4AQ2A 4PGGA 1NG6A 1ZM1A 3OGSA 2FBKA 1G86A 1QOOA 1LENA 4YYOA 4NRQA 2YDEA 3V42A 3O0VA 1LJ9A 2WFF3 2VQGA 4WM8C 4BU2A 2QJVA 2FEZA 4MIMA 4FX0A 4LE4A 3U0ZA 2C4XA 3SLIA 1FOD1 3CQOA 1LDDA 1ZX5A 4X6AJ 2EALA 4Q4X2 2QQVA 2KHMA 1NE6A 3HOUJ 3ELNA 1AHDP 1JTZX 1IZ1A 1QNTA 3Q0VA 4I2OA 2KA3A 1FIAA 1RC9A 2ATFA 1DGRM 3OYLA 2A6YA 3ZFFA 4XDQA 4IQ4A 4KWJA 1PVC1 3HBZA 2M7AA 4Y4RA 2HWC3 4HN0A 1PGSA 3KB5A 4Z82A 3HPNA 4I76A 2CV2A 1W9YA 4CXWA 3WR0A 2Z33A 4BBSJ 5C3QA 4OCTA 1C5IA 4XRMA 3K4DA 3IWZA 1DUXC 4HK8A 3U75A 3MFKA 3NV4A 2BFUS 1SMYF 2K5CA 3TOJA 4WVWA 2H27A 3SNMA 3VDDB 1HKTA 4B43A 4FFHA 2R062 1CJDA 4HZFA 5LEKA 3GZTB 2F5CA 3G4SI 2B42B 3VPRA 1U5ZA 3VBOC 1BN5A 1XC5A 4Q0PA 2L7FP 4IZZA 1VAMA 3DPRB 1BXHA 3JD71 2NVYJ 2HWE3 4LULA 2VH9A 5FZMA 1LE8B 3FMGA 1ETYA 4KIBA 2E7TA 1QPMA 3DF8A 4FAHA 4NBQA 1G8XA 3WTUC 3PVBB 2GOMA 2XJQA 1CR7A 3EO6A 1YJLA 2UXXA 4F92B 4B3NA 3CDIA 2XPJA 4IESA 5B2GB 1TW3A 3FHNA 3FE5A 2RS32 4MH0E 2GIZA 3AFKA 3FJSA 1W5TA 4CHUA 2KT0A 1YFWA 1VBC1 4OHVA 2CNAA 2HWF2 3TBIA 2QQLA 3WHUA 3PFIA 1YW7A 2BV4A 1TW2A 2HOTA 1I39A 1IKPA 2BW3B 1G3SA 5BNPA 5EV7A 1XGNA 1KFUL 4L9VA 5F6FA 2UWMA 1UX6A 3LL7A 2VB6A 4NIAA 4LLFA 3T8TA 1NG7A 2JTVA 1JUSA 3TO7A 5JVTA 2W4SA 4RHV2 3PUHA 4E2QA 4CEWB 5FKOA 3TYJA 2WLPA 4DZGA 3HN3A 1QJX2 3SISA 1KD7A 1BJQA 1EJ9A 4KH9A 4JZRA 1B35A 3EQEA 2CTVA 3HMYA 3UETA 4EJUA 4E9KA 4UY8I 4KBZA 1HLCA 3ZOIA 4WCGA 1GP6A 5DM7F 3WE2A 4XSZF 1GQGA 1XE8A 1E17A 2CAUA 4XC9A 1UHWA 4Y22B 3BTLA 3N7MA 5EFUA 3H9GA 4UV8A 4KMFA 3DLAA 5FMOS 5HNHA 1BI1A 3AVSA 3S93A 3AXEA 2X29A 1HKDA 5HV4A 4QGLA 4N8MA 2GP3A 1TWGJ 5FZ9A 4QX5A 2EZKA 2VOKA 2HYFA 3VZNA 4NIGA 2B39A 2HWC2 2KDOA 3WF3A 4X0GA 1XQNA 1LOGA 5CKTA 2EFQA 2WBMA 1UZ0A 3INAA 2DMQA 3FK6A 4OHXA 4HYEA 3ECQA 4XF0A 4EGYA 5C7GA 2CJJA 4YW5A 1ZZCA 1G3TA 2JB8A 2ZMEB 1GT0C 5IPAA 3NNJA 3GTJJ 1SVMA 3THPA 2O7OA 3NO8A 5JVGF 2M5WA 2QA4I 1NK2P 1X1AA 4FPHA 5L3DA 3BIEA 1AYM3 1WFXA 4FX4A 3RI8A 1UAIA 1H0MA 1BQPA 3IIIA 3VEPA 2VIXA 2HWE2 5HCFA 2CV6A 2VZOA 2VZUA 4BGDA 3ZIWA 2B8MA 4F52A 4AR2A 4GYIA 3VBUB 3JRAA 2JKXA 4AU7A 2BV6A 4K8FA 3TGNA 4FTBA 3GCMA 1GXQA 1MNDA 4KNCA 5F37A 5L3GA 4XJ9A 1LU1A 3CJTB 4XRFA 2EJRA 3PO3J 3PVOA 3WNPA 2E51A 4BQXA 1H1MA 3DV8A 3CDLA 4JVAA 4RGAA 1PO21 3BTAA 3UR3C 1JI8A 1X1PA 1P6RA 2ZSIB 1W06A 1OCZH 3LAGA 2KL4A 5HPOA 3S14J 5LA9A 4ZDLA 4K2EA 4L0PA 4UFJA 4UW4A 2QQUA 4QPGA 1ULGA 2X53S 2ZPXA 2C0ZA 1QZEA 2E1MB 2HPIA 1CD3G 2IEKA 5F1JA 4D5FA 2VOVA 5E1RA 4ANJA 4HDUA 2R1DA 3ZYJB 3RPQA 1TQIA 3KP6A 3ZCOA 2GH2A 3OY8B 4NPLA 2CV1A 5F39A 2R30A 3GTPJ 4KDPA 3RKYA 2NS8A 5K0UC 5FZ3A 5D5VB 3JQWA 1WMXA 4EJRA 4TLGA 2XRLA 3LA3A 4OMYA 3WU1B 2W00A 3LFKA 5FPLA 1OF3A 5F08A 3W59A 1OT5A 2W9XA 3OIPA 4XYXA 1R36A 3HOVJ 2EIMH 4XORA 3FBYA 3FMRA 3TN93 2HEVF 4Z92B 1F8VA 5IFTA 2E2JJ 4SLIA 1LODA 2VGDA 3GXOA 1JXNA 3POGA 2W7NA 2AQEA 4OIPF 4A44A 4NHYA 1NZIA 4M0HA 4G9SB 5HCAA 1CF7B 2R041 5FYUA 4XBQA 2AO9A 3J7AY 4UUVA 3I4NJ 1FPQA 1DQ4A 1U0AA 2WNVB 1T39A 2JK3A 2CYYA 1O5UA 1YITI 4DW6A 4ITVA 2XIGA 4NHJA 5BNGA 1OI6A 1BW5A 2VJIA 1BOBA 1EAH3 2RM23 3POEA 1W05A 5BNOC 3M8EA 4LG0B 3S16J 1MVQA 4YVSA 1TL8A 1OH4A 3L2YA 3O5SA 1W36D 1AX0A 2YX4A 1W9TA 1SFPA 1VMHA 4RGGA 1PNGA 2W0XA 2EIEA 1RHI3 3R4DB 1SLLA 3ZXJA 4KICA 2GNDA 2LS6A 1GBGA 2BP6A 3BTIA 3J80K 1N3QA 2WAQN 3VHOA 4U0WA 3H0GJ 5B66C 4KN7X 1ENSA 3FHAA 2OUHA 5M3MJ 1DGWY 1W5CC 2XB0X 3VBOB 2W3JA 4G6DA 3K1PA 5D5XB 1PK6A 3B73A 2J1RA 1L3LA 1SBEA 1V70A 2E53A 3MD2A 3QP6A 2R071 2YROA 1LOFC 4NJ4A 4F91B 2H8WA 1GLNA 1JTXA 2WQ8A 3SHRA 4ESFA 1KYZA 1WPKA 5GLTA 5ED4A 2Z5UA 2OYZA 2O0YA 5F5IA 3Q0UA 2XAHA 5FLXZ 5IY5H 1YIFA 3CCMI 4IV3C 3MEPA 3WNLA 1V6NA 4UI9L 4DYRA 5FBJA 1BKZA 3O6BB 4HG2A 3THTA 2Q8OA 5E79C 5FP8A 4AHYA 1BR1A 1RVF3 5EWSA 1W7PA 2RS12 1D4VB 1OBNA 3WY6A 2JKBA 2YHJA 1OR7C 3ABKH 1UELB 3K4MA 1B09A 1T38A 1R1VA 4CDQA 3RMXA 3WGIA 2R3SA 1C1LA 3VKFC 4FI9A 4DS0A 1ONVA 3NW4A 4RGUA 5LBQA 1FYLA 3ZPLA 5BY5A 3OD0A 4R79A 2Y26A 2L9RA 4XMYA 3WW2A 2VJ4A 2PMZN 1G59A 4J1XA 4DYCA 1FP2A 4F8AA 1W9FA 1KQ8A 1BC8C 2HDWA 1RUI3 4PJLA 1GZCA 4IKFA 1NCRA 1AYN3 1BK0A 2VPVA 5KNLA 1MZFA 2OQGA 1JGSA 1MW7A 1POQA 3VBHB 2PHTA 3W2AA 1UU5A 1D0HA 3W58A 5E8IA 1U2WA 2FOKA 4MQ9F 1FYKA 3OJBA 3K4BA 1D5VA 3T1BA 2VR4A 3W6JB 1CWPA 3BUCA 4BHBA 1EAH2 2VOWA 4WM7A 3TW7A 1RUF2 2RNJA 3OSGA 3SZGA 1FOD3 4ESJA 2CQNA 4TTGA 2MYSA 4FPEA 5IVJA 1R23A 1R091 5KHIA 2PLV3 3MYXA 5IYYA 2E26A 1RHI2 2R5YA 3TRSB 4YIRX 1WCQA 3WUDA 5A7QA 1Y1WJ 3ZYHA 4NWVA 4PCRA 1PVC3 1PJRA 2FNAA 2EV6A 1YTYA 1YLLA 4K7JA 2QZ3A 4HNTA 4M3EA 4ORFA 5HDKA 1KDKA 2QF7A 1K42A 3PNYA 4L18B 3Q3SA 4NRPA 2D6NA 1QKQA 1B8IA 4CTEA 1OOPC 3KT1A 1SFKA 3BCBA 2Y0SA 4FPOB 1TT5B 3ITQA 4Y5SA 1W8TA 1WLCA 4YIFA 4I30A 4Q4V1 2BY2A 4A12A 3K51A 2CGNA 3AZXA 4D0PA 1URXA 1QOSA 2IS1A 4IE0A 4OAZA 1C4RA 3CC4I 1HJGA 1IW7F 2ZNYA 1T6BX 3HNMA 1OLME 1XN7A 3CO2A 5GZDA 1P9QC 3JD73 4AI3A 3C8XA 4IVNA 3QH6A 4CPBD 3GFJA 3S32A 5FLJA 4X6RB 5ERIA 4LG3A 5F0HA 1NTCA 1WW7A 1T56A 5DV5A 4H55A 4LIUA 3ZQ7A 4LEJA 1GDTA 3TOBA 4JX0A 3MQ0A 1RVF2 3O2PE 3OEAA 2Y34A 1X9TA 5A7OA 1TZOA 4CDWC 1M1EB 5IP9J 2QTWB 2RJKA 2VQCA 1M4WA 4GH4A 1GHCA 1SEUA 1VBC3 2BY0A 1YHQI 4LO8A 1FAYA 5FO9B 1Z9CA 5CKQA 5K0UB 3DPUA 2HQ5A 5DABA 1UOFA 1JJ6C 1V6IA 4CCLA 4UBGA 4IOCF 4KJZA 1IHMA 4XVHA 5JIUA 4L0YB 4P14A 4A2UA 2WB1N 5FFZA 2C24A 3PNVA 3JBG2 2KXLA 3PUBA 2A1XA 4A6DA 3R4KA 3O14A 1GV5A 4HVOA 2A3YA 3H5NA 2A7AA 1AYN2 1XYOA 3D1NI 3IMNA 3BP8A 4I3PA 2JDNA 2D43A 4LBQD 2HQRA 3JRCA 1WH5A 1BHGA 4UBHA 1RKWA 2WFPA 1VP6A 2YYOA 4BK5A 2EA7A 2H6CA 3ACHA 4HFSA 2JRMA 4P02B 4CE8A 2M0CA 1FEXA 3Q8BA 4E8DA 3I0TA 3ACGA 3R4SA 4HT1T 2VOPA 3ACLA 2D93A 1ODNA 4RR3C 2O9LA 1MMNA 4V2FA 2A69F 1KONA 2IGNA 2ZJ2A 1REPC 5A2QZ 3K0LA 1ENRA 3K4LA 3N9LA 2YBSA 4KWKA 3L2VA 4ON0A 3RQIA 2VOXA 2Q2EA 2OZ6A 1BBT1 2V26A 4Q5OA 2XWBB 3OYGA 3HOBA 1A36A 4QU1A 2GMMA 1WJ5A 2QCOA 3CCRI 3V0AA 2L0KA 4C0HA 5K7HA 4EN9B 3CCYA 3ACIA 2L9VA 1ZBE2 4AVTA 2Y38A 3MZYA 5DAQA 4RQPC 3POYA 2WY7Q 4L11A 4FP3A 3EYYA 3TB0A 1QVUA 3ZXFA 1REEA 5BPIA 1N3OA 3NKTA 1XC6A 2IVJA 2Y6GA 5EF6A 4QIWN 3R0JA 4Z8BA 3AG3H 3DBLB 1ZKGA 1USSA 3HIFA 1HQLA 3MIBA 4P9XA 4OUEA 2DYSH 2BXYA 2VBXA 4XLAA 4DFSA 3HTSB 2ARBA 1TME1 1XSRA 3AZYA 3H9AA 1XSVA 1RESA 3JU9A 5HI0A 4L92A 2GXBA 1A34A 5JLWA 3HQRA 1ZZ8A 3E5UA 2BNMA 2EA2A 2VMHA 3GM8A 2WO2A 2D44A 4O9GA 3IIAA 3BT9A 5DPNA 4IV3B 5CFDB 3HXLA 3KYLA 4R9BA 5JOZA 1A35A 1RUD1 3J81K 3L2UA 1GOFA 5JFRA 3CZJA 1AF9A 5FKBA 3Q5FA 3WLUA 4XQFA 2Q0AA 5JZGB 1FX5A 1PO23 4O9EA 1PUFB 2FD8A 4MHRA 3C1DA 1P4AA 2QQWA 2LY9A 2FMYA 4G6QA 1R083 4JTOA 2FDGA 1QHHD 3M1EA 2V4AA 4BQ2A 2VKVA 3OUHA 1O4TA 2Y0OA 3MUY1 3DKXA 3CQZJ 3JTGA 2NNYA 1TVGA 2ZAAA 1D2SA 2LREA 1T0FC 4YFNF 2O0OA 3X29B 2CW0F 4BMBA 3AC0A 2PMZA 3ZFGC 4GRIA 1OXCA 2IUWA 4C0BA 3CCJI 1FYUA 3ZPYA 5FROA 3ZFEC 2VTXA 4URAA 3P1IA 3CL1A 2RR12 4NIIA 4RL7A 3CUQA 2XF7A 2EIJH 4XRSA 4LUMA 1PHMA 2ES3A 4BB3A 2F4OB 3PUAA 4HNVA 1SLCA 2LKXA 2CY6A 4HPKA 4ZONA 4L9BA 4OQ8A 1X50A 1CZSA 2XPVA 1S5LC 1GNZA 5DAXA 4Y17A 1H2MA 2HGCA 1N1SA 3AK0A 5K5OA 3BOQA 1OMIA 4CRQA 5TJJA 2R043 4LD5A 4HLYA 1ZRCA 1SBDA 1SD5A 2X6YA 4G7HF 3RYKA 2IA0A 1MZ6A 5F5CA 2NMOA 3CJXA 4ATFA 5C4WC 2QE3A 4B1RA 3OD4A 5JI6A 1WQ2A 1HV0A 1TNSA 2VNGA 5TGTA 2DCEA 5FYIA 1YS6A 1AR92 2WZ8A 2ZJCA 1YFHA 1MBJA 2HLEA 4QXKA 3CJQB 3ZO0B 1XPWA 1E3HA 2R1BA 4QQOA 3VHNA 1OOPB 3K2ZA 3VFZA 4CSWA 4FSJA 3ZXSA 1YI7A 2VG9A 3KV6A 5LA2A 1YQ5A 5JPMB 1UYYA 4Q29A 2D45A 3AMHA 3A4CA 3CEWA 3HWJA 1GZTA 5FUIA 5BV6A 2X4HA 5JLXA 4IEUA 4FQGA 3FXMA 4F93B 5LD2C 1SFNA 2LLKA 2H0BA 1UXXX 3LA2A 4LHKA 4M00A 3H8OA 2ZGLA 5FY0A 5DQ0A 3BPXA 2R073 4ITCA 2DTZA 4ZC3A 1UZWA 4DXRA 1MS5A 2WSVA 2VI6A 3BPZA 5JMCA 4RS5C 3LA7A 2WADA 3JRIA 5KCMA 5GAGJ 4GO1A 3FHIB 3OGVA 2IA2A 3WDUA 3FK7A 4BUPA 3PJYA 1PO22 3FKJA 1MH3A 4UFMA 3PIGA 2DJIA 1Z91A 3ZPOA 1QGPA 2J1UA 2LOOA 3VBSA 4IEPA 4GWMA 2LRDA 4B4CA 3C2UA 3VD3A 1JE8A 3S2WA 4Z6YA 1Y9QA 3NAPA 3CDZB 2JG8A 3EDPA 2VXRA 5FZBA 4H4KC 1WMEA 1YQAA 3T4HB 1DHKB 4RB1A 2Q4SA 1ODDA 2WQZC 2FNPA 1E0EA 1BI0A 4NPRA 1LEDA 4HSTA 1NQDA 3MGUA 2UY9A 4RA0A 1WCKA 3CBNA 4D69A 3U14A 4LA2A 1IGNA 5A3LA 1KRIA 1WJDA 4B29A 2NOJB 1MMAA 5SV8A 1BZWA 4EJOA 4META 3I3BA 5FYHA 2LW8A 5DCMA 3NWTA 2KRFA 3ZIXA 2A6ZA 4ASNA 4A0ZA 1OD3A 4QX0A 2E71A 2DQRA 1MJBA 4HOBA 4PF1A 3PMSA 3IP4B 5E18F 5APAA 4MGQA 4H3WA 3ZSKA 3DWLE 1J75A 1MBFA 3FXOA 3OBRA 3S5QA 2YC4A 4CUBA 4R1HA 3LPFA 2A6TA 2L9SA 3G1LA 4ENJA 1G6NA 4Y5Z0 4DINB 1D2QA 4Y4YA 2R5ZB 4DRRA 4K3UA 4GFBA 5SV5A 2MGQA 5T3NA 3WCSA 2DPUA 1R093 1FTZA 3PFYA 2EIBA 4LJZF 4M0NA 1NLRA 2VNOA 1MBHA 2VMDA 2VUCA 4RQPB 2EXHA 1TMF1 3KYCB 4LQRA 3J8F2 1P2FA 5FJ8J 1GUUA 1IPKA 4RGXA 2C9KA 4EZHA 3GTGJ 2ZNZA 3PIJA 3OYWB 4NN0A 1HQWA 2HZDA 4LJHA 1H88C 4DY5A 3ZSMA 5DG2A 4D6QA 4JKMA 5FZ4A 4E7KA 4QHBA 2WRAA 1OQYA 1SANA 5M0TA 4A3LJ 4Q4V3 4CP0A 4BQ4A 5FZHA 1FSHA 5FZEA 1RI7A 4AIKA 3VD5A 1R5HA 1B9NA 1VTNC 4KIFA 3WG1A 2W92A 4PDWC 1SBFA 4NC8A 2WAEA 2R6QA 5BNQA 2OA2A 4FOWA 1IUFA 2ECBA 1X8EA 3I59B 2VKDA 3C7OA 5C44J 2ERFA 5LBCA 1JT6A 1WHUA 1MQTC 5FZ8A 3VBRB 5BXXA 2WO3A 4Q4Y1 4X6QB 5EEHA 1VMFA 3AZWA 3VKMA 5F1RA 4BLIA 1WI3A 2L7ZA 1XCVA 1VQLI 2ORXA 2DMUA 2XBO2 2WS92 3LQCA 3BTJA 4XLHA 2GC0A 2M0MA 3IAM2 2LALA 2KM2A 3NV2A 3F9KA 3D4KA 2X09A 4YZ1A 5HDNA 5GZEA 4LO5B 4B1MA 2WABA 3CP2A 1LNWA 2XASA 2WR9A 3FIWA 2EXIA 2VBZA 3R6SA 4KFCA 1U5TB 1CIWA 2K2SA 3DEEA 2NYXA 1POV0 2QKLB 1POV1 4UAPA 2R92J 2NAZA 2A68F 4LKSA 4LNVA 1FC3A 2WT2A 3GCXA 5D2AA 5EEGA 5FGMA 5FB2A 1UOJA 2G9FA 4DY3A 3JR9A 1XMXA 2XRNA 2O8KA 3DKWA 4NQWB 4LB6B 2FBIA 3P9KA 3L2HA 4BJ5C 3BPVA 2XAUA 2HVSA 2C1FA 3EHKA 3LAPA 4L5IA 4GIQA 3ZR5A 4QB2A 2BBYA 3ZKYA 2HYXA 2DW4A 4C3IJ 2D98A 1R092 4QAWA 5C4WB 3M4FA 1W2NA 1ND3C 3BQYA 5ICEA 2R7FA 3CO7C 3JZVA 1WA6X 1K5MB 3WOGA 1SLIA 4U88A 1E3OC 2HS5A 3FDYA 3FHZA 3IPVA 3K70C 3GDBA 1YIJI 1BBT3 3ZX7A 2TBVA 3QP5A 4OIRF 2A6WA 4BJ0A 4LO4B 1X33A 1RIOH 5HCHA 4OMCA 2LF7A 4PZJA 5GPAA 1GR3A 1DQUA 4XJUA 4CICA 2ICWG 2JD4A 4L8QA 2HEOA 3VDAA 1H89C 3AKTA 2WUHA 2F2EA 1UZZA 1XGMA 3L9JT 2XAQA 2MLKA 3WODF 4Q4V2 1TP4A 1DYPA 3T0AA 2X6WA 1W28A 5FLXK 2QSFX 1SACA 2JSCA 1W03A 1V6OA 3K2OA 1DU6A 3PUQA 1WMFA 1TME3 3F0CA 3KLOA 4B44A 3I2IA 4XDPA 1IS5A 5BNOA 4XTMA 2GMPA 5L19A 3LSIA 1N3PA 2VONA 1G8WA 3B7MA 4MZUA 2LC2A 3IT8A 3UL2A 2BHZA 3HOTA 4YGBA 2D6MA 4L9TA 1SFXA 1LCLA 3NJYA 1WLWA 1LVAA 1RUD3 1J9IA 2JN6A 5KAFC 1TNTA 4Q5SF 2VQ0A 1SLBA 3I3QA 4RBOA 1W0PA 1V54H 2YPRA 4LIVA 1N77A 2RDSA 1MS1A 4LBKA 3RZDJ 4RM3A 3T30A 3DKYA 1AWCA 3PU8A 3GALA 3N3HA 3OS1A 1X3WB 3HSEA 3DF0A 1UMHA 3PIPF 1LPQA 2ZGQA 1UHSA 1EV12 3ML6A 2EIGA 1GSLA 4BDZA 3RSJA 5BS6A 4QWNA 3RZGA 2D40A 2X5IC 3FXLA 2F48A 3ON7A 1RXGA 3K4CA 1D0GA 2XMLA 2X9DA 3LNQA 2PFWA 4L5EA 2R7OA 4PLNA 3WGHA 3LSPA 4XF4A 3GHNA 5E3OA 5LB6A 5GAEJ 3D0JA 2XXZA 2AQFA 4EN0A 2B63J 4AQSA 5H9PA 4M4PA 1IQDC 2F6CA 3KT7A 3M3IA 1D0XA 4ZYAA 3E5XA 2VC1A 3D6EA 4JP0A 2V73A 2OAZA 1Q3EA 4D94A 3H8XA 2HYKA 4GCVA 4BHPA 2QQBA 1G9CA 4CCKA 3HT2A 4HL0A 1H2NA 1OR7A 5GADJ 4G94A 3ALQA 2AH2A 3WNKA 3ZN0A 1QJY2 3LGRA 1A78A 2XVCA 4PCQA 2UURA 1E57A 1BBT2 1RUH2 4XSXF 1FY7A 4HNUA 3GUDA 2DBNA 2HOEA 1AUYA 4PLMA 2ZHMA 4FOVA 2OCCH 1X4OA 4IQJA 3CJNA 3BG7A 3IRRA 5A7WA 1VBB1 2OZUA 1WJCA 4IERA 4Y13A 1AJKA 4GWIA 2Y6LA 3S3OA 4K1YA 2WNUC 2Y69H 4QKBA 1QXPA 4Q48A 2MA3A 3N7KA 2IPQX 1VZ0A 4Z2WA 3K48A 4RLQA 5IVFA 2GLOA 3DKQA 1HX6A 4EYUA 2JECA 3KT4A 4FPCA 2V79A 3EBRA 4DEVA 5ANQA 3FLRA 5E88A 1MNMC 4W6YA 4TXWA 3LFUA 1NXMA 3MV01 3P6BA 5F3EA 4CPBA 4EN6B 1LQ1A 2G9ZA 2ADUA 3HN1A 1XXNA 3D5LA 5FOBB 2R7XA 1LGBA 1MIJA 1H9TA 1LESA 1RUD2 3MCZA 1DGLA 3MKWB 1FBSA 5GJ6A 4FFIA 2RV8A 2VXZA 1G3YA 1HW2A 1GNYA 1MQTB 2MNGA 1WA4A 1HSTA 4D1QA 3WF0A 2D1VA 3H5RA 2L4AA 3WU2C 3RKQA 2A3XA 4IEVA 2IS6A 1MZEA 2G9WA 3MLJA 3ZKUA 2WO1A 3U37A 5ACA2 1LAJA 4A0XA 3AZVA 3MZ8A 3LDBA 1YLFA 5F32A 3IKWA 3S6PA 1KEXA 3N05A 4E4SA 3JRDA 3CC2I 1CONA 2E63A 3TEYA 4W65A 4LBQA 5F3CA 1AKHA 4IL6C 3MICA 2KZGA 3KE2A 1A3KA 4AWDA 1EKEA 3BR2A 5HS7A 1KZHA 4AWXB 3WTTC 2CFXA 4K40A 1JJ8C 2W25A 4WWCA 1YW9A 2WY8Q 1SFUA 2DK8A 1WCMJ 3MW3A 4I6ZA 4OQ9A 4LLLA 3CCUI 4OYUA 3M3QA 5A2QK 4YG6A 4A5MA 1WJAA 1S0DA 3WW3A 4PFOA 2BOLA 2EK5A 3QQAA 2RG4A 1XMAA 2EV0A 4LITA 3S3NA 3ASNH 1A8DA 2ARAA 4IEZA 4BWOA 4Y24A 4CDWA 5HS9A 2V6CA 3T2OA 2ZHLA 1RMU1 1EH8A 2CWMA 1PNFA 2XVKA 3ILFA 2ZHNA 3F6OA 2OQ7A 4P08A 3DFGA 2BU9A 4AEDB 3VDBA 3BI3A 1Y9MA 4N7IA 1J2XA 2GOXB 5D5WB 2EPFA 4PIYA 3BZ6A 3OYDA 1HQNA 4RS8A 2YUEA 4LK0F 5FWJA 4ZTFA 3KPHA 4XDOA 5IATA 5EZWA 4QPWA 1XOYA 2WAAA 4PSWA 1JZ2A 1DQ5A 1QJFA 4V19K 3PJRA 3SZPA 2J1VA 4PI0A 1XCBA 3HVDA 1TMF3 2BW8A 1NG0A 3ZSEA 3VZLA 2CQ7A 4L99A 1DBNA 1CAVB 3HJEA 3BU0A 4NHMA 1O4XA 2OUJA 3CJIB 3IAQA 4FQZA 3K4ZA 1HDDC 1FMWA 2MBFA 3ACFA 2Q0OA 1HIXA 4HV5A 4JX5A 2IJLA 4RR3A 4D5CA 4R4XA 5FLIA 2COMA 4YZ2A 2ZOEB 1R4MB 3FISA 3SITA 2WWJA 1QIQA 2F5EA 1ENHA 2R7WA 3ERED 4XIKA 1AXYA 3CMEI 3IKVA 5JR3A 1CX1A 2KR2A 1N1YA 2AGSA 1JHJA 3EJKA 1F36A 5J7MA 1OLRA 2K3PA 4FE4A 1PYVA 4EEFG 2CUZA 5JHUA 3RJ2X 4HKOA 1UB9A 1JKQC 2VXJA 3WW1A 4FASD 2MPFA 2R7VA 5BNNC 2I8DA 1B35C 1YFYA 2Y0IA 4TYSA 3SYTA 4AI0A 2VE1A 1MBGA 2I74A 1W0TA 5FPUA 3A7QA 4GAZA 4Q4Y3 1JYIA 3G7DA 2XGXA 3KCYA 1P8JA 1S2KA 5GZFA 3NAUA 3HEFA 1QY4A 2GALA 2X5IB 2J1TA 1XRUA 4PHZA 1D7PM 5DEQA 2W1OA 4CEWA 2BY1A 3O8HA 1LDJA 4LLOA 5CYYA 5L36A 2H1LA 1LKXA 2N8GA 1VNDA 4BH9A 2ZCWA 1Z7LA 4UYBA 3I71A 1BK1A 5H20A 5C5UA 4Y1ZA 1VBE1 5K9YA 1SCSA 4AI8A 2CWEA 1POV3 5FZOA 1V5FA 2QQ8A 4NUBA 4ZYEA 5F6KA 4EWEA 4XF3A 1D3YA 4EE2A 4RFRB 3ABUA 2F5VA 3K4AA 4QX3A 1U5XA 4CCDA 4SBVA 5BOXA 4O61A 3FUQA 2VUAA 4YVWA 2JA7J 4DXTA 4Y20B 3E5QA 5FRMA 3LPGA 5D5UB 5CQEA 5GTHC 3M3EA 3CKHA 3CDHA 5L73A 4P9LA 5IT3A 1RKTA 2LF8A 2J1EA 2ENRA 2JX9A 1IZ3A 4QPOA 4NHXA 1GZWA 1V9U1 1R5ID 5ILVA 4A93J 3OYKA 4E2SA 2D7FA 5L3EA 1IV6A 2A5YB 1JZ4A 2LTNA 2A6XA 3ZFGA 2VBDA 1LEBA 3GZNB 1GFF2 4FE7A 1UX7A 2XSJC 1U0JA 3ZFEA 2VW1A 4MVTA 1OJLA 1S0JA 3HYIA 5CA6A 3SC7X 4MV2A 4YG2F 5FR3A 3M2MA 4DOZA 4KU7A 4BXUA 4IRGA 3HBLA 4MGRA 2K46A 5J1YA 3OYBA 4A3IJ 3D3AA 3LSEA 4Q4W2 2GH8A 1IUYA 1E5SA 4GZ9A 3ILRA 1OH3A 1RR7A 3B01A 5L7OA 1T6GC 1Y7BA 1W9SA 4XLPF 5DUVA 4HKWA 4MGKE 3AMNA 3NVCA 1P7IA 2KZVA 4FPYA 4QPIC 1FOYA 1FLIA 2FCUA 2VKHA 1D5YA 4GDFA 4OI1A 4KA4A 4XICA 4CUCA 3DXUA 4L9NA 5ICGA 2VVFA 2DA6A 2DO7A 4UV9A 4A3JJ 4QPGC 1FMD2 1VRH1 4E4ZA 2YU9J 3OYEA 2JDAA 1ZZ7A 2CQXA 2WO7A 1KYWA 2ZEXA 3J7ZI 3M1CA 2PN5A 3SKVA 1X36A 2N7GA 2KP6A 1O57A 3N7LA 4E70A 5E3MA 3ZN6A 3DU5A 2R7RA 4L0ZB 4Q4Y2 2KDZA 2ISYA 4QKFA 2BFUL 2YR2A 1MACA 2ECCA 1LR5A 1NT0A 3HPHA 2K0GA 5L9RA 3P3NA 3ORJA 3DYMA 1TQMA 5CLSA 4LTAA 3H9QA 2MW8A 4A6OA 4RAYA 4XJ8A 2V09A 4MSVA 1JZ6A 4KISA 3TAYA 1QXRA 4AF9A 2YFZA 1I3QJ 2AXTC 4CCCA 3VHPA 4QXHA 2HWF1 2BOIA 4YFXF 2OPWA 2PTMA 4GWJA 3EUHA 1UMQA 2QVSB 2ZABA 2DYCA 4JHTA 4RS5A 3ZFFB 3I2KA 2WNOA 2G9GA 4YVSC 4BL0B 2QUFA 1JT0A 2BUKA 2WT1A 2M34A 2G4IA 1OLQA 3GTKJ 1AX2A 3IC7A 2DTRA 3VZKA 1CF7A 2ZGMA 3RZHA 2WNVA 3ZQIA 4JRLA 1W6QA 4X8PA 1PGL2 1ZREA 5FPAA 3IM0A 2Y6JA 2DODA 4DUXA 3SH5A 1PUEE 2CGOA 1ZBA1 2EV5A 2P17A 2VAUA 3LSGA 4ZTJA 1I27A 3B6AA 2JPBA 4OZOA 5CKMA 2AZ5A 1NA1A 1RC6A 4WXHA 1O4ZA 1CESA 4DB5A 5F7UA 2CRGA 2GQQA 3K46A 4G7ZF 4C2TA 1BYHA 4OUMA 3QBQA 3WTZA 2PJRA 1C1FA 3FXRA 4NE9A 1I1SA 3P9CA 3M7GA 1VBB3 4WBBA 1VQ6I 4P1WA 1SLTA 1G3WA 1I5PA 4M3CA 3A0HC 3DXJF 2W68A 3DTKA 5J09A 3NNFA 3P5JA 2YFUA 4QDRA 3NJVA 1YW8A 1XDUA 3A03A 3EB7A 1WWYA 2ZEWA 1YJKA 4CEYA 1MMDA 2LK2A 3V64A 5GLUA 5DDGA 5LY2A 1HXS2 5BNPB 1AR71 3ELKA 2R7SA 2P5BA 2ID6A 2K3FA 1YS7A 1NYWA 4A5NA 2FXAA 5J8FA 3POWA 3QYBA 5JR2A 1K7AA 4O6JA 2PELA 1TT0A 1OPCA 4LKEA 2XGDA 4CU7A 5DS9A 4CDQC 5FKKA 4CO8A 1GANA 2B0LA 3S1RJ 4B4PA 1VQ9I 2MC3A 1IJWC 5KHGA 2K02A 5IYBJ 1WW6A 2I07B 4R9AA 1ZTRA 2PBIA 1A5JA 2LKSA 5C5TA 3ZQQA 2VMEA 1T33A 4E6KG 1XSDA 1K12A 1GV2A 1NCRC 3D8CA 2W52A 1XYPA 3JQXA 4OULA 1RUC1 5LBBA 1XJAA 4CU6A 3TNQA 3SFIA 5KXDA 4MXWA 5FD6A 2YZ4A 4AXOA 4I99C 2KRCA 4E7HA 2A73B 2E36A 1NK3P 2NZ9A 1GUIA 3N9OA 1BCXA 4C1XA 1JMUB 3IDAA 4PDWA 2XR4A 2XF5A 1ULCA 1LGCA 1JKRC 1JZ3A 2M1BA 2QKDA 4XKVA 1NUKA 2HEWF 1ST8A 3R4UA 2WZPP 4CUAA 1AL21 3G1MA 4JDMA 3OL4A 2D3RA 3BJAA 2I2SA 3ABLH 1XTAA 1K61A 3Q9OA 4GKXA 2ZA9A 3MHZA 4XILA 2Z3YA 2R7DA 4EWAA 1UCXA 3BVCA 4FTSA 3EYPA 4HK9A 5G05L 3HEIA 1PVEA 2AUYA 2BEOA 2ZXQA 1RMU3 2L5QA 2DU1A 5FK8A 5B4XA 1IS4A 3ABMH 2FMLA 2ORZA 5GKAC 5FBZA 1VRBA 2G0EA 4CDXC 3QPLA 3ZMOA 2P6HA 4Y1VA 2D97A 4YG3A 4XFBA 1K78A 1VBB2 2DLLA 1ZN2A 2EAAA 1WRJA 3F23A 3L2RA 3H8UA 5DCFA 3K3OA 2Q8CA 1VQ7I 3PDQA 2MSYA 3BALA 2UYAA 4IEJA 4MGTA 5T5OA 1H8TA 1WJEA 1B72A 3TEXA 3GGLA 5FMBA 4MGYE 2VPLA 3GFMA 2DFIA 2LMDA 1W2UA 2YBPA 1PZ8A 4QMAA 3MO4A 2NYYA 2H09A 1XX5A 1O4YA 2P37A 3VKNA 1UYXA 2OQRA 3TEZA 2D5HA 5A32A 4XR6A 2W1UA 2GA2A 3CMYA 5LATA 3AKZA 3G71I 1UCRA 4N4OB 3WGGA 4BLJA 4CZSA 3AYCA 3JW4A 2B7YA 2PLYA 2YC0A 4IEXA 3T0BA 2FD5A 3E6MA 3K1NA 3EMRA 4LK7A 3HD8B 4XQ4A 4BM8A 4PJNA 2XROA 1IS6A 4CCOA 5K7PA 3EYIA 2QDRA 2IBDA 5IT9Z 2XL9A 1F15A 1RETA 2Z4FA 1ZK8A 4BXFA 4RYDA 5I93A 4G4FA 2E32A 2MD0A 4UHTA 3VYRB 3HOSA 4Y52J 3OYIA 4F55A 3VODA 3AFGA 4XLCA 2MABA 3EUAA 2E7XA 2CMPA 5F64A 3ZN5A 3PTRB 4EN7B 2HTJA 4W8JA 5FOJB 2RS11 3G1OA 3SH3A 1WI9A 1P4WA 5H9QA 3ZDVA 3ZMZA 4BAYA 3DPTA 5B1AH 2HWB2 1VBE3 5IP7J 1RJ7A 3A01A 2C9AA 1H4HA 3KV5A 1OQ1A 1RITA 1ND2C 1Z78A 4WVMA 3TEWA 1JKOC 4LK6A 1TWAJ 1QQP1 4WZCA 1LOBA 2VVEA 4LKDA 3OOUA 3S8PA 2AREA 3RKXA 5AVAA 1RMU2 4MX3A 5HLIA 1JUMA 5DTDA 2HBUA 3KHCA 1Q8SA 2HWVA 3GZUC 3RQ4A 2Z1DA 4WXCA 4ZYHA 3WTYC 4BYYA 4LBNA 1GWLA 4IE6A 1PK6B 2FU4A 3N7JA 5BPXA 4LFUA 1V9U3 4DXSA 1H2KA 2OX0A 2VZTA 4Y1UA 1V00A 2P1BA 4DUVA 4FTEA 5LCWL 1IRXA 5ERLA 1IC8A 5EYYA 1RUF1 5LZ6A 3HR9A 4NC7A 3K4JA 1BC7C 2Y8KA 1REDA 2ZBJA 2V5DA 1X1DA 1QOTA 4HX8A 2BOJA 3BKZA 5JPNB 2E1NA 3I2FA 1W6NA 3ZLIA 3WDYA 4CDUC 3RPUD 1JU3A 5FKNA 3T2TA 4E7LA 4QQLA 3IDBB 5CBLA 4LKFA 5C70A 1QF3A 4PT6A 3LD8A 3ES4A 1IXSB 1AR81 3PIOF 1W7PB 3SEEA 1VIWB 1VMJA 3QACA 5A6XA 4EGZA 1GQHA 4XKWA 1CQ9A 2BVMA 4Q0UA 1CN1A 4JGYC 1DDLA 2X48A 4CDQB 4GYGA 1UYZA 5CFDA 1WCSA 1OISA 1VRH3 1U3EM 4QX1A 5FFXA 2ZX2A 4MXVA 3RZMA 2NVUB 1EPWA 1HXDA 3RIRA 5FP9A 1G9BA 4WVVA 4ZJZA 3K7AJ 3OYCA 2PMUA 1K6OA 4LMYA 1CAUA 1OVSA 1DQ1A 4Q8KA 3V65A 2WNUA 5B1BH 4DNYA 4AQ6A 2QM3A 2M8GX 1WW5A 3CLPA 2MFZA 3H3ZA 2XG3A 3OY9A 5IYCJ 4PK4A 1IN6A 2VQTA 3WNMA 2WNEA 5L3CA 3WF1A 5ABJA 1SHWB 5FKLA 4HW0A 1L7RA 3HM5A 3BODA 1JHNA 2VO5A 2DCKA 4DIQA 2HWD2 4WM7B 3RZJA 2C26A 4PGHA 1LU2A 3C2GA 3VB9A 4A45A 2DAOA 2YX7A 4A7KA 1MS9A 3IWFA 2ZGKA 4BQ3A 2HWF3 2QUOA 1VBE2 5IW0A 2R5YB 1HW1A 5BQTA 2JE7A 2R7ZJ 5J1RA 1J59A 2IRFG 1BIAA 3LEGA 3LDRA 3FXQA 4BQNA 2YGMA 3BG9A 2I10A 1QNWA 4XUNA 3BB6A 1QPIA 3OS2A 3JBG1 1WD4A 2V5YA 2RQQA 3X2QH 1CAXB 4CDGA 1PMJX 4LMFA 5CAZA 1KGSA 3F8NA 1RPWA 2NVQJ 2RJ2A 4ES9A 1ZGAA 1U78A 1B8IB 3S3MA 4KYWA 5GZCA 4QDSA 5FAXA 1HKQA 3QU6A 2GXAA 4MGIE 4OMDA 3Q8EA 3ZM8A 1C8NA 3RGBA 1V9U2 4XTPA 2IGKA 2XLFA 4Y33A 4ENKA 1U12A 3M07A 1W1WE 3DBHB 2VJ5A 3BG5A 2AEYA 1ZBA3 2BPA2 5J96B 3QAHA 3I3DA 3BR5A 1R1ZA 3A21A 4HVRA 1WZXA 5IK7A 3NNLA 5J6XA 3LOIA 1HV1A 3NSTA 1V3FA 4IGOA 3O1VA 1MNEA 1STMA 2XJTA 1ZH5A 4BACA 4HN1A 1IXRC 4YNIA 4JGZA 2ID3A 1SD6A 1QJEA 2AACA 1IN4A 2V4JC 1V6LA 4XKCA 3C2BA 3UNPA 4IETA 4RGRA 4HMZA 3VBSC 1ZBE1 2VT3A 3PNTA 1RR8C 2DCJA 5A7SA 2WA3A 4GH4B 3F95A 1LOEA 4IE5A 5JSOA 1ERDA 4H2AA 4CU8A 2WYFA 3NAPC 2JG8C 2P5VA 1EH7A 1VRH2 1ZRRA 4A3BJ 5C8CC 1WJBA 5E1ZB 1YJNI 3MBWA 2Y30A 5K1YA 1YEWA 3UESA 1X4PA 1GVDA 3CZUA 1SFOJ 2IP2A 1R5GA 2M8EA 5FUPA 2PAMA 4HX7A 1S9HA 3LSTA 3SXWA 5ILUA 3PL0A 1A6IA 5LBEA 4F3QA 4LR4A 2VNVA 2LROA 2GAUA 3GF6A 1BEV2 4FPGA 2GNTA 2ME6A 2X10A 4IGPA 5J3UA 1EYBA 5FO7B 3O0XA 3ZDSA 2RDNA 1RUC3 3EXUA 1PDNC 5M5YJ 2DUQA 5LK5A 4QLCU 4BISA 4D6SA 2WINB 1TC3C 2DU0A 4HX4A 2CSGA 2KMUA 1TE1B 5FZ6A 2GC3A 4UOJA 3F8MA 1JUHA 2RN7A 2Q2EB 5F6LB 3ZYRA 4HXCA 1B1BA 2VE9A 4OHZA 2W5FA 2IXCA 2BBAA 3LEMA 3V0AB 2DU9A 2W47A 1DF0A 1UPIA 1MBKA 2IXJA 4RGSA 2L54A 3CD6I 5BNNA 1VAVA 3H1MA 4IHYA 2RR11 2ZSHB 3ZP5A 1AL23 4HKLA 4A42A 4N53A 2JA6J 2VZPA 3CCEI 4HSLA 3CCSI 1CX4A 1AXZA 1GOGA 1W04A 3MLLA 4RGKA 3CLQA 4I0BA 4B3AA 3OG2A 4H7MA 4B8XA 3WHBA 3T09A 2DUOA 4PBPA 3J7LA 5E6HA 2Q1FA 4YWAA 2PYTA 4L5JA 1ZBA2 4IJAA 4MO7A 3CMMA 2V72A 5JXGA 4KG8A 5F2SA 2F4MB 3ZVXA 3ST7A 5JI9A 2W95A 2EZHA 4XURA 2EFWA 2R7TA 2QKMB 1ULYA 3M8FA 4D7NA 3AYAA 1P7JA 2M7BA 4QXCA 4K21A 3B93A 2W2IA 3QH7A 2W91A 2Z99A 2Y64A 4YG0A 3RWKX 1QH7A 4OMZA 1GWMA 1XS9A 1RUJ2 4XJZA 4CCJA 1W99A 1SC7A 1T95A 5F9TA 4NO4A 4COUA 1BJZA 1IO2A 1YIOA 4BA6A 1R49A 1H4GA 1RUNA 1SVOA 3DTEA 2W57A 4I3GA 4M73A 4XBNA 3H36A 1AR91 1UF2C 4PJ0C 4Z1VA 2NRAC 5JCTA 1K83J 4HF0A 4C1WA 1AR72 1W8NA 3QWLA 2BZDA 3WDVA 4IHWA 3FHQA 3SQNA 4YW7A 3DN7A 3HKZN 5DZGA 2AS5F 2JEMA 1PO12 3BTYA 1UOBA 3J7AO 3W2WA 2O8QA 3KCCA 4EQVA 1O6UA 4PQQA 2Y0SN 4AVCA 2EIDA 4Q1RA 2DFHA 3VD9A 4ZDPA 2ZGSA 4FT8A 1G4DA 2QWWA 1DG6A 3M7AA 5A3OA 1OCPA 2DFEA 5HDGA 5E8AA 3CUQB 1WJFA 2RMU1 4ZXEA 1SLAA 5CFCC 3LSJA 3UYJA 4XBLA 4XXPA 2GXGA 4JX6A 3PURA 1NH3A 2K7LA 2EZLA 4PI2A 5D4SA 4HPKB 3LZZA 1ZZ9A 4J25A 3FXJA 5LA0A 1RUC2 2XVGA 4ESBA 2M30A 2RHPA 1X3ZB 5J37A 1VAKA 2VC9A 2WAFA 1TZLA 5AC91 3F2ZA 1ZZ6A 3NV3A 4PJJA 2HVRA 2OV7A 4QPIA 1GP4A 1WKMA 2C5DA 1W6OA 2WQ4A 3I97A 4XKBA 4HG6B 4FETA 1FV3A 2L2OA 5FYCA 2NN8A 5I8TA 4MFEA 4ZDOA 4Q8LA 1JZ8A 2LKPA 1W36C 4FP2A 2RS13 2BBVA 2YU1A 4PJYA 3ZOBA 1ENXA 1JYTA 2IT0A 4ATEA 4A7ZA 5F0CA 3AFHA 2RKHA 5E1XA 2R7QA 2UWCA 3A2KA 4P00B 1AL22 4HA8A 5DAPA 1DU3D 2JXAA 3CC7I 3CIHA 2W84A 5DDJ1 4HSJA 4ZZ5A 3TQNA 4R52A 3JTHA 1JODA 1QQP3 2ME0A 3M4OJ 5EPAA 3VDCA 4ONUA 2R7EB 5JR7B 5EDNA 3OMYA 2CW8A 5JHFA 3GJBA 1UL9A 4WM8B 1K5MA 2E9QA 3T1LA 2M45A 4AOCA 4BE2A 3WP6A 2VLAA 5A80A 2XSDC 1JZ5A 2JG9A 3USSA 2UWBA 3DEWA 2CSOA 2K9NA 3KSCA 3AXDA 4LLGF 3KF3A 1J58A 2CV0A 1RUF3 2R32A 1J7KA 2P3YA 1FOXA 2HYGD 4BY7J 1ZRIA 2VC0A 1QH6A 5A7PA 2HZTA 3HB9A 4KUMA 2JDUA 2IXSA 2WLQA 2Z5WA 1HRV1 1X19A 3N36A 1D4M2 3MV11 4XFIA 1X9PA 3VBSB 4BOWA 4XAEA 5IT6A 2JVGA 3ME2A 4AGVA 4Y5TA 3NAPB 5GLWA 2JG8B 2XHNA 2HKOA 2WL1A 1FMVA 3J8F1 1ZHFA 3BGAA 4AM3A 4M72A 3NKGA 3W2VA 5HNFA 3A22A 1AR83 5C9AC 1X7NA 1XNBA 1R64A 1D1BA 4HANA 4O7XA 3LSDA 1R22A 2GN7A 1Z0XA 2DJNA 4AIHA 2VCMA 3ZMDA 2ZB9A 4YM0A 1LUJB 1GKBA 5T5LA 5FQ0A 2RS51 1GQPA 1C28A 3KV9A 4U7DA 3KHBA 4S2GA 5FP7A 1LTEA 2ZGOA 5A3WA 3GWZA 5FWEA 4EM2A 3NARA 2AC1A 2PMWB 1OLTA 3H0DA 3NNMA 3WU0A 2JIGA 4X8NA 1KU3A 5EEAA 5DCMB 3ZYBA 1XNTA 2JWPA 2YS9A 1YCIA 4XETA 3DGTA 1V0AA 4DQAA 4HLTA 2BTVC 1MDMA 2LH9A 2QNKA 2VTFA 4AHWA 1Q5OA 1MH4A 3WTVC 5FJHA 5JSPA 3S17J 1H0BA 4H14A 4V2VA 3USUA 3BR3A 1MS8A 2XKOA 4R9CA 3C3WA 1LEAA 1UD1A 1YXWA 1XB4A 1QO0D 4W50A 5E8GA 2P4EA 3ZN1A 2CUEA 1WBFA 1VF9A 2UWAA 5C33A 1BJAA 2QLZA 4MQVA 1GNHA 2NM1A 4WVZA 1VJ2A 5C3OA 2XBO1 2WS91 3RVHA 3B9CA 3OTFA 3IH2A 1H6XA 3OL3A 1N78A 2A71A 2VQLA 1QZZA 1FXZA 1MJAA 2JDPA 4XZPA 5KBFA 2XAJA 3RTRA 1QQP2 2Q8KA 1HKSA 2YU2A 4GQ7A 3KGLA 5EJCA 1R1TA 3JBG3 4NVPA 1FWZA 1IV8A 1ZR2A 3WP4A 5HLHA 2MHFA 4AK3A 4CH7A 4UW3A 3DUIA 3HRUA 4YFWA 4YGCA 2ILMA 4FOQA 3KGZA 3VBFC 3DL3A 4Z2AA 2Z9OA 5CU1A 5FRAA 1S2EA 4L97A 2L9NA 1YFUA 4DEQA 2EWNA 3VD4A 1BW6A 2W87A 3IN9A 2QQAA 2A6VA 1CPMA 3V7RA 1Y8QB 3SH4A 1JUPA 5I0DA 1UG0A 1O5LA 3V4GA 3MKLA 3GNEA 4M9XA 2KPMA 3VHRA 4HBLA 1S29A 2DT6A 3QYFA 4J19A 4W4ZA 3HC7A 3ZXDA 3A02A 4K8RB 1ZYRF 2QBXA 2D3SA 4FO9A 3NQOA 1SFYA 1AR82 3HKZA 1W6PA 4QD2A 1KGYA 1T98A 2BYVE 1E5IA 1ZBE3 5HBAA 4A0YA 1FNNA 1HB3A 1HN1A 3KM5A 1U5YA 4BE1A 1MKMA 2LVSA 4UT5A 3QD6A 4YLZA 1H8AC 4KITB 3RYRA 1U8RA 2QQ9A 2R0FA 5IT9K 2W24A 2GDFA 4QB1A 4CDXA 3VSKA 2ZEZA 1UO9A 2XOMA 3COAC 1FV2A 3IHUA 2PHLA 3B5LB 3RS6A 3WE3A 1WLTA 4IV1C 3IMMA 2PI0A 3RYPA 3OPZA 2W82A 4M3DA 4DGWB 3M3CA 3I4IA 2Y9ZA 3LF7A 5FP3A 4FCYA 3LE0A 1BIBA 2JDMA 2YY1A 4M3GA 3U21A 4KT5C 1QWRA 2M2EA 4O5VA 5M3FJ 2D6KA 4QB6A 1QRYA 4XXAA 3H7JA 5IOYA 3MW2A 1VBD2 3KYDB 2ETEA 3GTMJ 2JVHA 3VZJA 2JWTA 1K6YA 5E16A 3BCAA 3H3UA 2XF6A 4M6VA 1FP1D 1N1VA 3FL7A 4DMIA 2NXNB 3OGRA 5AIQA 3H0OA 4LHNA 3FF5A 3TBDA 3VDXA 5LFAA 4DQ2A 1A8MA 4UFHA 3WHCA 5A3TA 4O65A 1EV11 3VKLA 3WHTA 5CISA 4JDNA 1USTA 4P9FA 2ZBKA 3IPVB 2OU2A 3MEXA 1UY1A 4MTDA 3ZQGA 2FDIA 1DP0A 3ZXLA 2HU9A 5KXEA 5CNAA 1AYM1 5EG0B 1Q1HA 3REOA 4LXLA 4CCNA 2C6SA 5CB7A 4A3XA 2FE3A 2PQQA 4M4RA 4OZXA 1SEFA 2P7VB 2RR13 3KQRA 1IN8A 4IHSA 4AYBA 5FJKA 2DXIA 1VQ4I 1LHNA 4XEZA 5EHDA 3DU6A 2QEXI 4CU9A 2VY0A 3T2QA 4N43A 3LEKA 5KVRA 2AYHA 5FZ1A 4BQQA 1VB4A 1KS5A 4IX7A 5BNOB 3BG6A