3RDIA

Domain-domain flexibility leads to allostery within the camp receptor protein (crp)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILFYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Domain-Domain Flexibility Leads to Allostery within the Cam Receptor Protein (Crp)
rcsb
source organism Escherichia coli
molecule tags Transcription regulator
molecule keywords Catabolite gene activator
total genus 62
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rdiA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3rdiA01
3EETA 1IN5A 1CAVB 2EJRA 2O3FA 1IPKA 1Q1HA 4WCGA 1TQMA 1OYYA 2GA1A 1LQ1A 2GC3A 2VBXA 1NZCA 3O14A 4IERA 4BIFA 3GUDA 5TRDA 2HDCA 3RNSA 4I0BA 4G7ZF 4LEJA 2GQQA 1XE8A 5D4RA 5HVQC 1XGSA 1ZZ8A 4IEZA 2QBYB 3U10A 4AWXB 2O1QA 5HS7A 3RZZA 4YFNF 5JVTA 4OIPF 2Z33A 2FBKA 3GX4X 3KGLA 4Q0PA 1PMIA 4JK1X 3CO7C 2IXLA 1VR3A 3UKVA 1PP7U 3U2RA 1O4TA 3JTHA 1ZZBA 1T0FA 1X82A 4I09A 2HOEA 4IEWA 3ROUA 4M71A 3V8KA 3B02A 4IEUA 3QP5A 1XB4A 4MEXF 1G3YA 5FLXZ 1ZHFA 4GCVA 4HN1A 2GIVA 1RTVA 4MTDA 2HKOA 3R61A 5HDGA 3CJNA 4U0YA 5DUIA 5HOOA 1BJAA 2V09A 3BY6A 3NVCA 4QX5A 4MQVA 2H27A 2DAOA 1QXRA 4LMYA 5IT9K 3RPUA 3BU7A 1HBXG 1WKMA 2M5WA 1SD7A 1DP7P 1R23A 1T39A 3E6CC 1D8KA 1Y3TA 1WI9A 2VODA 3WW1A 1R7JA 4A5MA 3ECOA 2EV6A 4HX7A 4M6YA 6PAXA 2DK8A 1OR7A 4IF4A 3FHZA 2L4MA 5FGMA 1RNLA 1UCRA 3CO6C 4IEQA 2OA4A 4RGUA 3J80Z 1W7PA 1I6XA 5K5RA 2Q4SA 2UXNA 3FX3A 4O9EA 2O8QA 3TDZC 2NNYA 5D6EA 4Y17A 3GWZA 3MWMA 3L09A 3C18A 1YWKA 2PQQA 2VC1A 4CGZA 1G4DA 3U0ZA 2HYFA 1YO5C 2O61A 3HSFA 4I2OA 3Q9VA 3H50A 3QU6A 5L3GA 4IPAA 3KP4A 2WTEA 2VE8A 1WQ2A 4PCQA 3VOEA 5KHKA 3I54A 4R8HA 5JSPA 4QGMA 2FOKA 4XF0A 2DW4A 5EEGA 3SZPA 5J6XA 4XF3A 1U2WA 3IKTA 1SFXA 2GAUA 4A2UA 2FMLA 5J48A 2L02A 3DPTA 2QNKA 5DDGA 2QYOA 2NNNA 3RTRA 1J0RA 4K2EA 2VONA 4PDKA 4WBBA 5I8TA 4I98B 2XRNA 5FCCA 2B5HA 4YG2F 3F23A 3GEZA 4G6QA 3MDPA 5HLHA 2XROA 4P9FA 3HTSB 1B4AA 1TW3A 4Q0QA 2E9QA 1L0OC 3RYPA 1S6LA 4A12A 3RI4A 4YARA 4OMZA 4KMFA 1IN8A 2CAUA 3KEOA 1PP8F 3FWEA 3CUQB 1ZZ9A 1F9NA 3HUGA 1R22A 1KU9A 3K0LA 1TNSA 2XGXA 3CJXA 1YQAA 4QLCU 3H1WA 1SFNA 3I64A 1U3EM 2KXLA 3D0SA 3I71A 2PTMA 3OCPA 4KT5C 2BYVE 3TDUC 2UY9A 3KLOA 2V1DA 4YIIA 1ZYRF 4MV2A 5AVPA 3M1EA 1SQ4A 2Z2SB 5DCMA 2YX7A 2JPCA 2Q30A 4HF1A 4Q29A 2DT5A 4IRHA 1LRHA 2HQRA 4FAGA 5FB2A 1USSA 3JZVA 3MZHA 4AIHA 3QU3A 2QLZA 3ZDSA 2NYXA 1EYBA 1BIAA 3I59A 4YSFA 3PQJA 4X6RB 1TBXA 2F5DA 1FI2A 4KWKA 3KP3A 3EQEA 1X3UA 1XD7A 1H1MA 2HYGD 4ZU7A 1U78A 4IHTA 1G3TA 2D5HA 3KCCA 2PHLA 2F5FA 2E7WA 4RAYA 4CHUA 2IRFG 5ILUA 5C6CA 4L11A 4XLPF 1SMTA 2NAZA 2RNJA 2XVCA 1MDMA 2GC1A 5LHIA 4L2NA 1KU2A 1SMYF 4EJTA 5KHJA 3H8UA 3ZQ7A 1QY4A 1F1ZA 4QGNA 1R1UA 4RB0A 2QZ8A 5DV5A 2Q1ZB 3FJSA 1UFMA 4JV4A 3I58A 2QWWA 5LGUA 1L3JA 2CV6A 2IA1A 4KWJA 2GXBA 3G73A 2YPRA 1FP2A 5I0TA 2W84A 3IRRA 1QWRA 1ZZ7A 2FBHA 1U5TC 2PQ8A 1J75A 2XLAA 3U11A 1HKQA 4EMSA 4UVBA 2FNAA 3HOTA 3HT2A 3LQQA 4G8XA 2GC0A 2QBYA 1HKSA 5DCFA 5A2QZ 4IJAA 4U7DA 1H9TA 3ACLA 3EBRA 1YS7A 4G94A 2D5FA 1HW1A 4EM2A 4LD5A 1R58A 5BXXA 3LZZA 5ED4A 4XF9A 4RB2C 4XF1A 2M87A 2ZMEA 3EYIA 5FDBA 2JSCA 3D82A 4HLXA 1WA4A 1Q43A 3O2PE 1ZG3A 5D5VB 2PAEA 2VT2A 1EPZA 1J2XA 3L9FA 3DEUA 3FXQA 3IRQA 1KA8A 2HR3A 3IIAA 3TOBA 5J3UA 3K69A 4UNOA 3TQNA 4XFBA 4UUVA 3EJKA 4GYGA 2V79A 5JR3A 1RUNA 5L3DA 3TKYA 5FPZA 1O3TA 2W24A 2PHDA 2K02A 2CYYA 4ONUA 3JW4A 4LGWA 3DQVC 1XSVA 2XAFA 2VE9A 4JQFA 4LUKA 3GFMA 1VJ2A 1UPIA 2W57A 1LJ9A 2GA2A 1CAWA 1ZGAA 1FNNA 1YS6A 2HKXA 1FC3A 1SAXA 4UBGA 3E3VA 3ZMZA 1DGRA 2BEOA 4KN7X 3DL3A 2P4WA 3HHHA 3LA2A 4WWCA 1PUEE 1FSEA 2CO5A 2OPKA 3KE2A 4HAMA 3KP5A 3WGIA 2Z69A 1J59A 4HX8A 3OD0A 1RL3A 4MH0E 4ZH4F 4KDPA 1D8JA 4OLLA 2HJIA 5E16A 2K7LA 2CSOA 1Y9QA 1UCXA 2Q0OA 1XE7A 3SFZA 5BUVA 4LLNA 1E2XA 5BV6A 3GFLA 5DYMA 2LSOA 4JBAA 5EEHA 2VECA 3P9KA 4IVNA 3ERED 1J3RA 4H0EA 3ZMDA 2IW5A 3SHRA 3H3ZA 4PIZA 2WFPA 3LSTA 1P4XA 4J1XA 1YFHA 3CO2A 1ZLJA 2P5LC 1IAWA 1I1SA 3IKVA 2L01A 2XUBA 2YSRA 2QUFA 3IBMA 2ZJ2A 4F7ZA 1OD5A 1B9NA 3I4PA 2FNPA 4OU0A 5JAXA 3ML6A 4XBFA 2D45A 3GO5A 3SXYA 1BOAA 3ELNA 4ZYHA 4L9JA 1P4AA 4O3MA 4WK8F 3FXUA 5E17F 5KBFA 4BHCA 2Y0OA 4HBLA 4A6DA 3NW4A 2BE5F 3RKWA 3WTXC 4WVZA 3KMHA 5H6QA 1D5VA 5F1RA 3PFIA 3F8MA 5BMZA 4E2QA 4EWEA 2K0GA 2FE3A 1J1LA 1ZAOA 1VTNC 3BJOA 4DQ2A 3M9AA 3U1DA 4DNCA 1LB2A 2D40A 1WSUA 5BS6A 4AIKA 3QPTA 4B29A 2HTSA 1Q5OA 3GZ5A 2ATFA 5BPDA 2WC2A 3TO6A 1BBYA 5D5UB 1YFYA 3SQNA 1QPMA 5CU1A 4LG0A 4BAYA 1EH8A 4YRDA 3CTAA 3E6BA 3T0YA 2PFWA 3CEWA 4EWDA 2WV0A 2VPVA 4K8FA 3E6DA 3M70A 1O3SA 2F5EA 4LK1F 2JTVA 1STZA 3TO7A 2HS5A 4M72A 1IPJA 4M9XA 3L7WA 4HVOA 4FX0A 3EUHA 5E1XA 1YFWA 4XFIA 2AS5F 4UXAA 2DCTA 3AAFA 2BNMA 4L5IA 2A5YB 3ZMTA 3MFKA 2IXJA 3G7DA 5I0RA 1RGSA 1ZVFA 3P9IA 4HLYA 2IXHA 4YNIA 4FHTA 4AD9A 5I0SA 5FQ0B 2PN6A 3HRTA 3LFKA 4EJOA 1ZH5A 3D5LA 1Z91A 2ETHA 3BPVA 1U5TA 3E5UA 2YR2A 2QQBA 2RDPA 3S0MA 2PAKA 3OV8A 5LRSA 2ZCWA 4IEPA 4AXOA 3E6MA 5L3BA 3FMSA 2H6CA 2M1BA 4OINF 2ZNZA 5AIPA 5LHGA 2K4JA 4OIOF 2MHFA 5KVRA 4YYOA 4BYYA 2D1HA 4HBNA 4HZFA 2IA2A 2E1CA 1IN4A 2PAMA 3BDDA 3SXWA 1JHHA 3F3XA 3HSEA 1YYVA 3FMRA 5I8YA 1NYWA 4P9GA 4Q0SA 1QGPA 3LQRA 1H1IA 5FLHA 3CUQC 4KICA 1CGPA 2O03A 4BNCA 2VBZA 1DGWA 1FWZA 3FZ3A 1OYWA 2IP2A 3H1YA 4B8XA 1BI3A 4B09A 4HV5A 5CVUA 2L4AA 4O5VA 1GQGA 3FM5A 1NHAA 3V7RA 4HOBA 4XF4A 2C6YA 4AVAA 3S7EA 4WF2A 5E20A 2Z9OA 1ULYA 1T98A 3TOAA 1G6NA 3DKWA 3TGNA 1XGNA 4Q0UA 1JE8A 4QM9A 3KEQA 4PJYA 4KIFA 4E70A 1XCVA 2P6TA 1CAVA 1R36A 1FYKA 5KHIA 2PG4A 3ZP5A 3F6VA 3L2HA 1XRUA 3JSOA 1CAUA 3NRVA 4BQAA 1ZNPA 4XEZA 5CVIA 3GVAA 1YHFA 4M9SA 1QQIA 4RB3C 1DPUA 2BNOA 2GXGA 1C0WA 3C1DA 2FEZA 3F6OA 5BOXA 3WGGA 4ETSA 1UB9A 2KJBA 3WU0A 2FA5A 2M30A 4L9NA 3HYIA 3DV8A 2M45A 1SEFA 4ENMA 1YLLA 2PJPA 5FD6A 1KU3A 1J3PA 2IXCA 3C7JA 3SCFA 1K7AA 1CAUB 4O9GA 2A61A 3H7YA 2J5PA 2XKPA 4E2SA 3H7JA 3DF8A 2FQPA 4IRGA 1ZZ6A 5DUKA 3J81K 3I7DA 4LB5A 1JXSA 5LGNA 3R60A 4QWQA 5JSRA 4IEXA 3W6KB 3IDBB 2Y0MA 5E1WA 2ET7A 3RDIA 2DQLA 4RGRA 2ADUA 2CW0F 3ELKA 2KIFA 5HDNA 4FBFA 4XLNF 3H9AA 1TTYA 1UHMA 5CADA 4CZZA 1FYMA 3WW3A 3KETA 2O6GE 4EM1A 2P5KA 3UKNA 1ZG5A 4QM8A 2QQ9A 5D5WB 2RGVA 3EYYA 3R6SA 4HF2A 2PEXA 3L00A 3S7IA 2A6EF 1YUDA 1Z1DA 2HWVA 2MA3A 4Z07A 4MUVA 3WTSC 3ZMUA 4OMYA 4D7SA 2IJLA 3HRMA 3PNAA 4MEYF 1DZTA 4R79A 2L54A 1E17A 2XAQA 2DQRA 4WZCA 5K5OA 1WWXA 3U9GA 2D93A 4UVCA 3WTVC 2P7VB 1BN5A 2DBBA 4ON0A 2FXAA 3RKXA 2A69F 4M74A 4YIFA 1RUOA 4I0AA 3LAGA 1QNTA 2VN2A 5LRRA 1MGTA 1W7PB 5JFRA 2ZXJA 2JRTA 4CYDA 4EQQA 5F6FA 3ECHA 4KIGA 4MGZE 2Y75A 1FZPB 1S7AA 2EFOA 4M6XA 3WTTC 3HRSA 3BB6A 3M8FA 1I5ZA 2QCSB 1TQIA 1YIOA 5HS9A 1HXDA 1ZARA 3R0AA 4HSJA 3IHUA 2FU4A 4LUMA 2XHKA 3T8RA 4RGSA 4D7TA 3GFIA 5CVJA 2K27A 4P55A 4KN4X 3SZTA 2GH2A 4QGLA 4KIBA 2RQPA 1XN7A 3I5UA 2DI3A 3GW2A 1GXQA 2MC3A 3T5XA 5FO5A 2RN7A 2PMHA 4AQ6A 2EFPA 3RIRA 4U7BA 4Q48A 2UZKA 1ON1A 4I7HA 4KA4A 1R5HA 1S8NA 4HF0A 1FY7A 1IW7F 2BV6A 1CF7A 3TNQA 4GULA 4P9UA 1Q3EA 1FT9A 3KP6A 1IXRC 5HLGA 2XL7A 5DCMB 2CGPA 3QRFF 1NE6A 3BPXA 3SCHA 2W25A 3EO6A 4IEVA 1KU7A 1FBQA 1HSTA 1HQCA 5L3EA 3WTUC 1YW8A 2IPQX 5L3FA 3M7GA 3WODF 3BALA 1KQ0A 2K9ZA 3CUOA 1FP1D 4HYEA 4MZUA 5BY5A 2OQGA 2EVXA 3D0JA 3IC7A 1G3WA 3I53A 3QPHA 4GYIA 5ICGA 2OZ6A 3QAHA 4HSLA 2CAVA 3CDHA 4FX4A 1ZZCA 1WLTA 2A07F 5FLIA 4UBHA 1FYLA 1GVJA 4FT8A 2I45A 1O3QA 1KYZA 1BC7C 2P17A 5JI6A 5L3CA 4XSXF 3VEPA 4F8AA 2O8XA 1QZYA 2K4BA 2GWRA 2OZJA 4PIXA 4XSZF 1S29A 1R1TA 3O3KA 4D0PA 2XAGA 2HZTA 1ZRCA 2KKOA 4MGKE 2IXIA 3KGZA 4PGHA 1CF7B 1B9MA 1XGMA 2OA2A 2RV8A 2RC4A 4YFKF 2HEOA 2DPDA 2STWA 4MNUA 1MJBA 4LA3A 3NKTA 3C3VA 2X0LA 2EWNA 2H94A 3QOPA 2ISZA 1FLIA 5T3NA 2IVMA 1LVAA 1IN6A 4BXUA 3HRUA 4LJZF 2LF7A 3BROA 4ZZDA 5F64A 3MYXA 4IESA 2P8TA 2H09A 4YFXF 3E5XA 4KU8A 2UWMA 5K5QA 3NL1A 3LA3A 3J7AO 4LB6B 4ZU4A 4NB5A 2QVSB 5CVVA 2PYTA 1SFUA 1MD0A 5CVRA 1H9GA 1U8RA 2PMUA 3K9TA 4AIJA 3FF5A 2E1NA 1W4MA 3GBFA 3KZZA 3E5QA 5E8GA 3ZMVA 2XIGA 1I27A 3PVBB 1IZ1A 3F21A 4WXCA 3HT1A 4L9VA 5DD8A 1U12A 1QO0D 2QVOA 1QXJA 1HW5A 3HSRA 2RKHA 3I59B 4EV0A 3BJAA 2DK5A 2ZMEB 1UIJA 3F22A 1XSDA 3NSTA 2RVCA 3R0JA 4LFUA 1P4WA 2B0LA 1IXCA 3HHGA 3F8CA 4GXOA 3BPZA 5AIQA 4O6JA 3TNPB 4ORFA 1LEAA 4MTEA 4Z2YA 4HMZA 3WU1B 1IRGA 4A0ZA 4KYWA 5KHGA 1NE4A 4RS8A 4HQMA 5JSOA 3FFQA 5CLSA 3R4KA 1KGSA 4LULA 2QQAA 1DZRA 1BI1A 2MD5A 3W6JB 4JTNA 3ZN1A 4HVQA 4HV6A 1SFEA 1XDSA 3BOQA 5LEKA 1YLFA 1LKNA 4NVPA 2O0YA 3QP6A 4I3PA 2Q2EA 5H20A 3EQLF 3V8JA 4L0YB 2JZYA 4A0YA 4P96A 2MLGA 4UV9A 4UV8A 5KHHA 1S7OA 2HQNA 3RYKA 4EJVA 5JR7B 1ZX5A 5HLIA 1JGSA 4GO1A 3NQOA 3J80K 1DPRA 4G7HF 2EA7A 5IT9Z 3SCGA 4ENNA 1YTYA 5C8WA 2UXXA 3JAMZ 3C3WA 3RYRA 1UIKA 3FXRA 5J8CA 3CL1A 5I0UA 1T6SA 1IXSB 4ESFA 3L2CA 3PQKA 1ZG1A 1YFXA 1F5TA 1YW9A 2KIUA 5KK1A 2PFBA 2K86A 1B1BA 4G9YA 4AQ2A 4BH9A 4AVPA 3WW2A 4UHTA 4MQ9F 3KLNA 4BHPA 1O57A 3HIFA 3RPQA 2EFQA 3EHKA 2F5CA 3CF6E 1LEBA 1MDMB 2A68F 4KMUX 4TV7A 1KYWA 4PIYA 5FPXA 3JTGA 2ELHA 4ENJA 4BHBA 3FHIB 2LNBA 2FF4A 1J58A 3LAPA 1XSXA 2XV4S 3H3UA 5FFXA 2P5VA 2CG4A 1HKTA 1TNTA 4LLLA 4J1WA 5HS8A 4JVAA 1TLHB 3REOA 2TDXA 4NQWA 3VODA 3GFJA 4HDVA 1GQHA 1LNWA 1F4KA 4EGZA 5BPXA 4I01A 4G7OF 1OKRA 5K8SA 5I91A 2HGCA 4HN0A 2BBYA 2G7UA 2P7CB 4LTAA 1LDDA 1OYIA 1AWCA 4EJUA 3HTUA 4EVIA 2MNGA 2VT3A 5I93A 2D2WA 4JTOA 4LLGF 1K79A 4UXNA 1HW2A 1RZ4A 4MX3A 2ZO4A 1PDNC 2DPUA 3IDCB 3LWCA 1V4RA 4L9TA 1QBJA 2Y48A 1TQPA 1LDKB 1K78A 1MJAA 3LAJA 1J7KA 4RAZA 4Y13A 5CYVA 4MGYE 2PI0A 2V6CA 4A5NA 3B73A 3JAMK 4TLFA 2QDRA 3KZYA 1MZBA 2LDUA 2ISYA 2OU2A 1ODDA 4R1HA 2C0ZA 3F8BA 5JCTA 1RC6A 3F72A 2B9UA 1PM7A 4HVRA 4IEOA 5ICCA 1Y0UA 2HTJA 2JPBA 3V4GA 4CDGA 5A2QK 3GZ6A 4UVAA 1X8EA 3LA7A 3DXJF 5ICEA 2R7FA 2UY8A 3H1MA 2EB7A 4AVBA 1ZRDA 4LG0B 4XFCA 3OF1A 1V70A 2QJVA 4EM0B 4ZU5A 3V8LA 3MQ0A 3V7CA 4G6DA 3USSA 3ES4A 4PZJA 2ETEA 4IXAA 3BZ6A 5LEJA 4X6QB 4MGIE 5E8IA 2XASA 2V1UA 4A0XA 3ZN0A 4LLOA 3MEXA 3KFWX 3WTZA 1QZZA 2HFHA 1XMKA 1ONVA 4IHSA 3Q9SA 5E1RA 3KP7A 4H7LA 4RGXA 4EWAA 1Z9CA 1IF1A 2LF8A 4XFHA 4XFGA 3P9CA 3WTYC 3UKTA 4XRFA 1O7LA 1T38A 4XETA 2N7GA 3S2WA 2P6SA 5JHUA 2Z99A 1XCBA 3PLQA 3K1PA 4HA8A 1USTA 1FSHA 1LR5A 1Z05A 5ERIA 5D8KB 3OOPA 2YX4A 2XLGA 2FQ3A 3MPBA 3F8NA 2W85A 2G7HA 1A04A 2BGCA 3I0TA 1FXZA 4XFFA 2V1XA 1RIOH 4Q5SF 1D3YA 1CX4A 3Q5FA 1OI6A 3BCWA 1O5UA 5LLQA 3G3ZA 3F8FA 2EFNA 1DUXC 2J5OA 1ZN2A 4CICA 1SD6A 5TJJA 3WGHA 2ZFWA 3K2ZA 3WW4A 1K6OA 1G3SA 4S05A 2VQAA 1S3JA 5E18F 2ZKLA 3K1NA 4LA2A 5J7MA 3CLPA 1FPQA 1EP0A 1OMIA 1LDJA 3MZYA 4AVCA 4ZZLA 1ZRRA 2FMYA 3E97A 3WE2A 4IEYA 2A6HF 1IN7A 2EV0A 5LGTA 1X8MA 1VP6A 1Z6RA 2XL9A 4HX4A 5I8SA 1YFUA 2MH2A 1REPC 1EH6A 3LOIA 5LHHA 1NXMA 3COAC 3IL2A 5D1IA 2EK5A 4R52A 4N9HA 3M3IA 2FBIA 1ZRFA 2MH9A 2PBIA 2IC1A 5FFZA 2XKOA 1P2FA 1BIBA 4CXFA 2ACJA 3T1BA 1BM9A 1TQ5A 4A6EA 1FBSA 1P92A 3O6BB 3RKYA 1L3LA 2MPFA 4EJWA 5CJ9A 2LKPA 3GF2A 3ST7A 4GGGA 1P6RA 3DFGA 5ILSA 2UYAA 1V3FA 4Q0VA 1KQ8A 2CWEA 4IETA 1W7PD 2VXZA 5BPIA 4IRIA 4QMAA 4U88A 1U6GA 3FM3A 1R00A 3ABUA 3OGJA 5BQTA 1UD1A 1ZGJA 1XGOA 4EROA 4ASNA 2L3DA 5HDKA 4META 4U0VA 4HW0A 2PA7A 2STTA 2MLKA 2FSWA 1O5LA 3DN7A 2NRAC 1WRJA 2A3SA 1EH7A 1DDNA 5H6RA 4P5OA 4WX9A 1GHCA 4HQEA 3OTFA 2FRHA 5LBQA 1UHWA 5D8LB 2H6BA 3ETQA 4M73A 1T2KA 4NHJA 1BI2A 4I02A 3ABTA 4PGGA 5ILVA 2BNNA 1FBUA 4L0ZB 3MCZA 1WGPA 1B6AA 4L18B 2VOOA 4S04A 2ET1A 3IWFA 3J81Z 4MGRA 3ULQB 5IT3A 1JUHA 3QACA 3RJPA 3DP7A 4ESBA 2M8EA 2EA4A 4ZYGA 4Z82A 2X4HA 4KU7A 3IWZA 3V7SA 2DU9A 2CFXA 5FD5A 4L5JA 1MKMA 1XMAA 2R3SA 3GLXA 4WXHA 2OYZA 2R7DA 1HSJA 3CLOA 4LK0F 1K78B 1Z7UA 2KJCA 2Z5UA 4ZYDA 4Q47A 1KQ9A 4KFCA 2EA2A 5FLJA 2Q8KA 5FLXK 4XFAA 3SMHA 5EZWA 2V9VA 4U0WA 1YG2A 1AOYA 1ON2A 4Q4ZF 3BJ6A 4ENKA 2IT0A 3BP8A 3MAJA 2B8MA 2ESHA 1J9IA 3ISPA 2IXKA 1I1GA 2VOPA 3TO9A 2D1VA 2EV5A 2OD5A 4ZYEA 2OZUA 4OFGA 2G9WA 1TW2A 1IRFA 1BC8C 2XAJA 2VBYA 1SD4A 3VFZA 2XLFA 2OAZA 2EFWA 3T8TA 1GXPA 1EY2A 2EAAA 4OIQF 2QENA 3HOSA 4OIRF 3ES1A 1FX7A 2ZNYA 3JSPA 3LWFA 4KWLA 1H0MA 2Q0AA 2UYBA 1R1VA 1XDUA 2MBFA 2GC2A 2F4PA 4EGYA 1JHFA 3NEUA 1MJ9A 4N0BA 5DD4A 3ZMSA 1BI0A 5E1ZB 1O3RA 2JT1A 3N4MA 3P7NA 2DFIA 4E2GA 4DINB 3CUQA 2VBWA 3K1MA 1OPCA 2DTRA 2OBPA 1X7NA 4CO8A 5EFUA 2PLYA 4KNYA 3SHFA 3FE5A 3FMQA 2H0VA 2VC0A 2OQRA 2ESNA 5FQ0A 2COMA 3DPLC 4RD7A 2ZKZA 2F2EA 2DLLA 1O7FA 3HQXA 2DO7A 4Y15A 1CAXB 5DEQA 3N97A 3WG9A 5D6FA 4KL1A 2KIMA 1J3QA 4FAHA 3KSCA 2WWYA 3VHRA 5AONA 1B59A 4M9ZA 1J5YA 1Z6TA 4WXDA 3M8EA 1SD5A 3WE3A 1W5SA 1IUYA 3ZPLA 2E7XA 1RI7A 1YW7A 3BWGA 3VB2A 3KP2A 5J8FA 2CQKA 3NJZA 2GZWA 2KRFA 4HLTA 4KUMA 4RB1A 5D5XB 1UW8A 1FOKA 1R5GA 3WTWC 2GU9A 5D4SA 1ZLKA 2QM3A 4MHGA 5HI0A 5ICFA 4OOIA 3GYHX 1EV7A 2AXLA 1CAXA 1OFNA 2NS0A 1CAWB 3EDPA 4HDUA 1W5TA 3H92A 2Z3YA 2XAHA 2ZBKA 4N9IA 1U5TB 4QXKA 2IA0A 3GXOA 4ESJA 3GYDA 3FZVA 5K1YA 2YU3A 1ZREA
chains in the Genus database with same CATH superfamily
3EETA 1KFUL 2EJRA 4MADA 2KFDA 1RUI3 4LO6B 1UYYA 1Q1HA 4UI9L 4N4NB 4CDXB 2JG9B 1KXGA 1OFSA 4CU8A 1JZ3A 1LJ7A 2GA1A 1ZKGA 1IG0A 1XOYA 4IERA 3A02A 4I0BA 3ZO0B 2GQQA 1XE8A 4UUTA 5D4RA 4BQYA 1X1CA 2JIGA 3NNFA 1YI9A 3Q8AA 4FPEA 3JBG2 3U10A 1HRV2 5HS7A 2YZ4A 3DKYA 4RGGA 4XDOA 2E1OA 3UJOA 5JVTA 3TP3A 2Z33A 1BK0A 3N7LA 4Q0PA 3VYUB 4JZRA 3T1MA 3JTHA 1GT0C 2JDPA 2NOGA 2WABA 1T0FA 3WG4A 5CFDB 1Q1VA 2HOEA 1WW6A 5BNNA 3QBQA 4IEUA 3QP5A 4MEXF 1AF9A 2GIVA 3F2ZA 5FYIA 3FUQA 5HDGA 3I2DA 5DUIA 2XPVA 3ZPYA 1YC61 1NX9A 3ZSEA 3BY6A 4NPLA 1UHSA 1WZ2A 4QX5A 1JU3A 4MVTA 4C91A 2H27A 4UT5A 2DAOA 3FHNA 4LMYA 1JHNA 4KT6A 2LFBA 4YM1A 5FYZA 3BU7A 3FLTA 2M5WA 5KXCA 4LBQD 1DP7P 1ACIA 1T39A 2BU9A 3OEAA 1Y3TA 1RIRA 3MW3A 1K83J 2XRLA 5BNPC 2ME6A 2R073 3WDTA 5D8AC 1H2KA 4XL9A 2DK8A 2WFF3 4XURA 4C2TA 3FHZA 3OIQA 4GALA 1NCQC 2QFEA 1RR8C 4IEQA 2OA4A 4RGUA 1AYM2 1W7PA 4V2FA 2ICWG 3FX3A 2X5IA 4BBRJ 3NNLA 3MWMA 1B72B 1YWKA 1C8NA 2G4IA 2F48A 4BB3A 4I2OA 1AX0A 5CIRA 3FK6A 2Y6KA 5L3GA 2HOTA 1GV5A 2WTEA 4MLOA 3OR2C 1JYWA 5C8CA 4PCQA 2CHHA 5KHKA 2DCKA 1KZHA 3I54A 5JSPA 1TWFJ 4QGMA 5H9SA 2DW4A 3SZPA 2OX0A 1CZVA 2IVIB 5IVYA 1V9U3 1U2WA 2GAUA 3BQZA 2HYXA 1MS9A 1H89C 1JTZX 3AJZA 2ZMNA 1QJU1 2O8OA 2VIXA 2QYOA 4HG2A 3AJYA 3RTRA 5C7GA 3QD6A 4K2EA 1WJDA 3HOWJ 3ASOH 1ENSA 4OI0A 1VQKI 4WVMB 2OTLI 3GEZA 1RUI2 4B4QA 4G6QA 2XROA 3ACFA 1B4AA 2WT1A 1L0OC 2ZX4A 3HKZA 5LWBA 3VBFB 1CN1A 1UN1A 4A12A 1DQ1A 5M5WJ 4YARA 5DUWA 5GLUA 2VZUA 5F27A 1ST8A 2YDEA 1QJY1 1IDZA 4M3CB 1DBNA 1ZZ9A 3OSDA 2FDIA 1KU9A 3K0LA 1C57A 4LK7A 1V6LA 1JZ6A 2VU9A 4F3QA 3WX5A 4IE5A 3VBFC 3ZXFA 2UWCA 2YX7A 4HF1A 1O6UA 1ND3C 3CMAI 5FWJA 3CMEI 1D0HA 3FXLA 3IAS2 4IRHA 2HQRA 1F31A 3MZHA 1QNYA 3IMNA 1IDYA 2QLZA 1U8BA 5TGTA 3I59A 4YSFA 3BVCA 1XC6A 2F5DA 3SH5A 4MIMA 2QKLB 1XD7A 1JYVA 4W50A 1U78A 4IHTA 2YU2A 4NHMA 3UJQA 1H6XA 4RAYA 1VQ4I 2WT2A 4MHUA 5HCHA 2C24A 3FBYA 5ILUA 4YELA 3KV6A 3KYDB 3S57A 1C1FA 4P08A 3DYOA 3FK7A 3KV4A 4DZPA 4IV3A 2KA3A 3HD8B 1JI8A 4CCOA 3T30A 4AI2A 4QGNA 2QZ8A 4E7SA 1UFMA 4JV4A 4Q4Y2 2IA1A 4ZZ5A 2YPRA 3IH3A 5FZLA 1C4RA 4NC7A 1J84A 3M07A 2DCEA 1IO2A 1EV11 1PK6A 5FO9B 1ZZ7A 3K4CA 2HVRA 2PQ8A 2JA2A 2GC0A 3AL5A 5ACA3 3A0HC 5A2QZ 1RUI1 3ACLA 3PHMA 2ZEZA 4G94A 3W2WA 3JRAA 1HW1A 1NCRA 2ZXWH 3J8F1 1R58A 1MS0A 1TME3 4XJ9A 3DECA 3EYIA 5FDBA 4LKEA 5IK8A 3ENRA 1FV3A 4HLXA 3PVOA 4AEDC 1Q43A 3UNPA 3HUGB 1ZG3A 2PAEA 2VT2A 1J2XA 3RZHA 3L9FA 5EZGA 3P6BA 5LA2A 2OPWA 3J4UH 1YRZA 2G0EA 2ZXQA 4UUVA 4YW6A 2WWJA 1LOFA 3HNYM 4DYQA 1S0FA 1O3TA 2W24A 4DUWA 3A0KA 4AQSA 1SBDA 2XC7A 1D4VB 2ARXA 3DQVC 3V42A 3IPVA 2VE9A 2DA3A 3KX2A 2IS6A 1VJ2A 1PIV3 1X1PA 5E89A 4IHVA 2W52A 3UKGA 5FR3A 5DUXA 1LJ9A 1CAWA 1FNNA 2HKXA 4OQ8A 1W6NB 1JJ8C 4RGKA 5CFCA 1Z7S2 1EAH1 2BEOA 3ESWB 5CEHA 3HHHA 3LA2A 4WWCA 1WUVA 2CU5A 4XMYA 1HRI3 2VQUA 1W04A 1FSEA 5KC5A 4HAMA 4RFT0 3KP5A 3WGIA 2Z69A 1HA8A 1J59A 1RL3A 1D8JA 4NIDA 4CDXC 4GH4C 2X6OA 3MV01 1R1ZA 3KQ4B 2Q0OA 2P34A 2DA6A 4LLNA 4WM7C 4FETA 4D69A 2WFF1 3U14A 4GB32 2LSOA 4JBAA 5EEHA 3ERED 4BMBA 1ZBA1 2IW5A 1TP4A 5DAQA 3H3ZA 1UMIA 1DHKB 1TEIA 5K0UB 1I1SA 1W05A 4DB5A 2D43A 2YSRA 3IBMA 1CPMA 2DDUA 5LK7B 1OD5A 1WLDA 2JK3A 1US3A 2PMZN 2CDOA 1WW4A 3U21A 1OCPA 2JUGA 4RLFA 3WHTA 3ELNA 1POV1 1ULOA 5E17F 4A6DA 4J25A 1I1EA 3TB0A 5APAA 4QPQA 3KMHA 2W1QA 5F1RA 3PFIA 4XJ8A 3SEPA 1QHGA 4D7MA 4E2QA 1MS4A 2ZEXA 1RUD3 1QJU3 3BJOA 3MVPA 1X2NA 4DQ2A 3M9AA 3U1DA 1RMU2 3MIFA 1WSUA 4A4AA 1H8TC 5C70A 1BBYA 1YFYA 3ZYIB 3JRFA 1YE9A 2LMDA 3BPSA 5IK7A 4LG0A 3TN92 4YRDA 2VOTA 3IH2A 3ALQA 3E6BA 4EWDA 2R5ZB 2WAQA 3VKLA 4ZDLA 2BJSA 3E6DA 2F5EA 4M3BA 3HBLA 4LE3A 3IP4B 3TO7A 4RL7A 1IPJA 4M9XA 4HVOA 4YM2A 3EUHA 5E1XA 1YFWA 2PJRA 3THTA 1YJ9I 2FDHA 2LALA 3O1MA 3M4FA 4JRAA 3RQ4A 5J96B 1SFOJ 3ZR8X 4HNTA 4MG2A 2E34A 3P9IA 3ZOBA 3I2FA 2LUWA 2XQXA 1OA3A 4FHTA 3JRBA 3RJRA 1U0JA 4AD9A 3T3YA 3UNGC 3S5QA 3BLYA 1U5TA 3JB4C 1GUIA 4BY7J 3VYRB 2RDRA 2YY1A 2QQBA 1ETOA 4AEMA 5DS9A 3W6VA 2YC4A 3HPNA 4XJUA 3FMSA 2BBVA 1QVTA 5AIPA 5LHGA 3LIGA 5FZ1A 4HBNA 2EZHA 3HGGA 2ZGUA 4Q2FA 2YROA 2IA2A 1RXFA 3OY9A 2PAMA 1Y56A 3BDDA 4JDOA 3LMMA 5C9AC 3F3XA 1VBB3 3POGA 5FLHA 2K9MA 2Y33A 4UFJA 1CGPA 2O03A 1D0ZA 1S4CA 3FZ3A 1HQWA 3H1YA 3LDKA 4B8XA 5JVGF 2EIDA 4O5VA 2IVJA 3FM5A 2CQXA 2VVEA 5A33B 3B94A 3V7RA 1EV13 4HOBA 4XN0A 2WNUC 4AVAA 1LKXA 2WO2A 1OKQA 2Y6LA 5E20A 3A22A 2ELJA 1T98A 3TOAA 4H55A 3DKWA 1RUJ2 5G05L 2VOWA 3CP8A 3J8F3 1ASJ3 1ACCA 1X4OA 3KEQA 3O0WA 4A42A 1FYKA 3ZP5A 5DDJ3 4JGYB 1CAUA 4BQAA 4XEZA 1YHFA 2UUZA 4M9SA 3T2QA 3TN93 4QAWA 5FXWA 2BNOA 4FQGA 5AFBA 5T55A 4Q4V1 1JOJA 1LHOA 4BM8A 5EPAA 3WU0A 3K2AA 1RJ8A 1CJDA 4L9NA 2AQFA 4RGAA 3S1QJ 1IKQA 2Y34A 1YLLA 2HWB1 1WJ5A 2XWBB 4RS5B 4UFMA 3ZFGC 1ETVA 2E51A 5IPAA 2HPIA 3LOCA 3X2QH 1PVEA 3H7JA 3DF8A 4IRGA 1ZZ6A 4PF5A 1VE0A 5LGNA 2V4VA 3VBRC 4ZXEA 3VBSB 3IDBB 5JWPA 2Y0MA 5E1WA 3RDIA 1MEC3 4LIVA 1REEA 5T50A 4CXWA 1W9WA 4CCMA 2RV9A 1RHI1 2Y9YA 5HDNA 1T0FC 4FTSA 1OISA 3ZSKA 1BEV2 3KETA 2CH0A 2P5KA 1Z67A 1RINA 1ZG5A 4QM8A 5FZ4A 3EMRA 2RGVA 4W65A 3ZKYA 5LBBA 2P81A 5KCMA 1MNMC 4K8RB 3L00A 3V0AB 2A6EF 1XXNA 4Z07A 4MUVA 3ZMUA 2BDRA 2HVQA 5HCAA 4L9BA 1WWXA 1SBEA 2VE1A 3WTVC 1HB4A 4OQ9A 1X4PA 3BTZA 4M74A 1RUOA 2RS53 2WV1A 1QNTA 1UAAA 4KBBA 4NMIA 4W4ZA 1W28A 5JFRA 3ZXJA 3P5JA 3ECHA 2IEKA 4B1MA 1S7AA 1POV3 1WH5A 3N35A 2VKVA 4M3FA 3M8FA 4YFZA 3ZQIA 2JG8B 1WI3A 4A3CJ 1AL22 2QCSB 1EPWA 2XJPA 4L99A 1ZA7A 1HXDA 3TMOA 1ZARA 1PIV2 3D4KA 4HSJA 3NAUA 2HYJA 4LUMA 3T8RA 4D7TA 4LBLA 3I49A 3GFIA 5CVJA 2VUJA 4QGLA 3GCXA 5C3PA 4Q4X3 3I5UA 1Y4WA 1FPN2 2VUCA 4DEVA 2ADDA 2MC3A 4PCRA 1U5XA 5FO5A 1NCQA 2QQJA 3M3OA 2EFPA 4Y4RA 3M7AA 4D0QA 3GZAA 2WO1A 4I7HA 3BGAA 2ORXA 4RYDA 1R5HA 2J1TA 3C7HA 2EXHA 2BP6A 4DNYA 4GULA 1GOGA 4PDWA 3UESA 3WNLA 3HEFA 1D4M3 5DCMB 2HWF3 5CG9A 2CGPA 1QH7A 3QRFF 1NE6A 3BPXA 3CCRI 2ZTNA 3J7HA 1X2MA 2PMWB 1UO9A 3EO6A 3HN3A 4IEVA 4OZOA 5CFDC 2VD7A 5L3EA 2X09A 1JZ5A 1DGLA 3CUOA 4W6WA 4CZCA 1QU0A 3BG3A 3B9IA 1KFXL 3IC7A 4PJ0C 4GYIA 4Y3OA 1PMHX 3CDHA 4TZDA 1BEV1 3HQRA 4ATEA 2B9SA 1R5ID 5FLIA 2FDGA 2WSUA 1B8IA 5LCWL 3BG5A 2WZR1 1AR92 1DQ0A 4NHYA 4AFDA 4PIXA 2ZJRF 3SEQA 4IV1A 1WW7A 1R1TA 2HXOA 2DOAA 3V0BA 3ZFEC 1S2KA 3PUSA 1ZRCA 2VB6A 3ZOIA 4AGVA 1B9MA 2RJ2A 1UMZA 1NK2P 3LSKA 2LY9A 2ID3A 2R5YA 2YFUA 2IS4A 3APBA 5BNPB 2ARAA 5FZDA 5F37A 5T3NA 1WPKA 1MH4A 3BZKA 5JLWA 4DOUA 3BROA 2P3IA 3O1RA 2H09A 4YFXF 2LH9A 2BFUS 5K5QA 1YOVB 1AXZA 1V6OA 4CZSA 3HOUJ 3OS0A 3RVHA 1H9GA 4W1UA 5IW0A 5FZCA 3K9TA 4AIJA 2W87A 3PSIA 3GBFA 3KZZA 5IWFA 1JS9A 4XN3A 1QHHD 5BNNC 5GPAA 5HLTA 4F83A 3RZLA 3HT1A 3S1RJ 3JB8A 3ZN6A 3GNEA 1W6PB 5DDJ1 4BS9A 2QVOA 1HW5A 3B3QE 2ZGQA 2VUMJ 4JAAA 3I59B 4EV0A 2DK5A 2ZMEB 2K2SA 5CQEA 3NSTA 4C9YA 3WDUA 4AI9A 2X1EA 4I99C 1TE1B 3HHGA 1MBGA 2E1MB 5IAXA 3F8CA 4GXOA 1PNFA 1RUF1 3DYMA 1GBGA 1XQNA 4TWTA 5AIQA 4O6JA 4MFDA 1LEAA 3H42B 2VJIA 2A73B 5D2AA 2XBO2 4PJNA 5KHGA 2ILMA 4RS8A 3MFAA 2IS1A 1MR5A 2NVYJ 1C8M2 1IOAA 2Y60A 3BU0A 5FP7A 4HV6A 1LECA 3BOQA 4M3CA 1MEC1 1YLFA 4NVPA 4I3PA 1JYXA 5FYSA 1YCIA 1PX4A 1MBKA 3O1TA 5KHHA 1S7OA 3RYKA 1AYM3 3GTKJ 2NVTJ 4GO1A 4BQ2A 3ORJA 1WCKA 4NQWB 2HEWF 4JGYA 3CC2I 4AYBN 4G7HF 2EA7A 5FMOL 3SCGA 3H1CA 4FE4A 2HYKA 1KITA 1O91A 4RS5A 4QWNA 2DMQA 3CL1A 1NCRC 1Q8PA 4NUBA 4ESFA 4XLAA 5J37A 1OLMA 3PQKA 4N53A 1Z3XA 1F5TA 1TVGA 1VZ0A 4YZ4A 4G9YA 4AVPA 2RS51 1OA2A 4UHTA 3J26N 2JB4A 3VWBA 3KLNA 4BHPA 1ND2B 1BK1A 2OUJA 3NJYA 1OQDA 3BR1A 5F6LB 3AYCA 3ZFEA 3RPQA 2RS12 1SBFA 2F5CA 4YGBA 2JE7A 4IV1C 3OYFA 3RWKX 1NY71 2RAEA 3WQ0A 4BDYA 3P1IA 4ITCA 1ZBE1 2JD4A 2ELHA 4LKFA 5FMDA 1A35A 2W9XA 2Z5WA 4DEQA 4G4FA 2BXZA 2LNBA 1RKTA 1FOD1 1J58A 4EJRA 4RR3B 2CSGA 4Y1VA 2QQ8A 2CG4A 1HKTA 1W3XA 3N9PA 2P6CA 1MQTC 3S2HJ 2EIJH 3THPA 4QHZA 4NQWA 1QJZA 2DDAA 2BW3B 2WAAA 1DQ6A 4ARYA 4HDVA 1RUD2 4FCYA 2W4SA 2JX9A 2QKMB 2BBYA 2P7CB 3OYCA 1B72A 4CDUA 1AWCA 5CFDA 3SFIA 4EVIA 1NAEA 1BJZA 1CZTA 2MNGA 2VT3A 5I93A 4GDFA 1KS4A 3VD5A 2ZPXA 2FDKA 4INDA 1RZ4A 3ASIA 2VH9A 3EXUA 3JRIA 4MX3A 4CCEA 1PDNC 1V6IA 2DPUA 3T4HB 4RA0A 1MBEA 1JN2P 2ZABA 1Q8OA 1J7KA 3LAJA 4RAZA 4CCJA 4Y13A 5CYVA 4MGYE 2L7KA 4M4PA 2YC2A 2LTPA 1JBCA 4TLFA 2QDRA 3B6CA 1YQCA 4QX3A 5FY5A 1MZBA 4CUBA 2EIMH 4XR6A 3LL7A 3HVDA 4XDQA 4PI0A 2ISYA 4MOAA 4ZDPA 1ODDA 4R1HA 5FKBA 3ZFFA 3HG9A 3WG2A 4QPGB 5JCTA 4RM2A 4O61A 3FFZA 2B9UA 1PM7A 1W1WE 2VJ4A 1X19A 1MS8A 3BQYA 1BYHA 4BY1J 2VNRA 5IT6A 1WBLA 1UOBA 5EYXA 2MC4A 3BT9A 4G3YC 1TG7A 5IVJA 2Z1DA 3CKHA 3DXJF 2VCBA 3VBUA 1VBB2 3WD5A 1IS5A 1X36A 3H1MA 2GNDA 5IVFA 4A45A 4GWIA 4CYCA 2YUSA 1ZRDA 2X85A 3OF1A 2QJVA 3V7CA 1NOVA 2L2OA 1MVQA 1SACA 4A3ZA 4I30A 3ZN0A 1JZ2A 2ZGNA 5F2WA 4FFIA 4L92A 2BW8A 3H5RA 3AYEA 2R072 3AMNA 4IHSA 1NLSA 3Q9SA 1UG2A 4RGXA 1HF0A 4XMIA 4DRRA 4XRFA 1T38A 4Y20B 1USTA 2DXIA 2M9HA 4UWDA 5ERIA 3F0CA 3OOPA 3JD73 1AR93 2D6MA 4Q4V3 2A6YA 2DN0A 1TL8A 3F8NA 4M3CE 2VCMA 5CNAA 1S0BA 2XSJC 2BGCA 3LSPA 3OBRA 4Z2WA 1RIOH 1H8TA 1VQ7I 4Q8LA 4N4OB 1APLC 3AP9A 3G3ZA 3CMYA 1LEDA 1BHGA 1WD4A 4DZJA 1WFXA 2J5OA 1ZN2A 1SD6A 1G2HA 2ZFWA 4QKDA 3WW4A 3TEWA 2VQAA 1URXA 5E18F 2ES3A 2ZKLA 3K1NA 5J7MA 5L9RA 3S93A 1VNDA 2WQZC 2QZ3A 4AVCA 5DQ0A 3WE2A 4IEYA 4RDUA 2A6HF 5IFTA 4YG3A 1X8MA 1VP6A 1AU7A 2MSYA 3IL2A 5D1IA 1XBFA 2K40A 4LHSA 4R52A 1Q8QA 2HEYF 3M3IA 1ZRFA 3S5AA 1NQJA 1S2BA 1UOFA 2IC1A 4OVEA 4UW4A 2DA7A 5FZIA 3JQWA 4AIDA 1IRZA 4A6EA 3HOZJ 1V6MA 2NP0A 1LCLA 2WAOA 1FBSA 2E7TA 2E33A 3M1HA 2QQLA 4YVSA 3WY6A 3K10A 2MPFA 4RSUA 4EJWA 1BLZA 2LKPA 3GF2A 2HNHA 1Z78A 1P6RA 5FFOC 4AEJA 1KQ8A 5HV4A 4XDPA 3GTMJ 2YUEA 5E79C 1RUE1 4U88A 5FYMA 3FM3A 3WP4A 3RZDJ 1Z77A 1XNCA 3OGJA 4QSHA 4ZTFA 1UKRA 3DUIA 2FCUA 3DU5A 4META 1S9HA 4U0VA 3POIA 2MLKA 5F39A 2FSWA 2HBUA 3MD2A 3DN7A 1YRNB 3INAA 1WRJA 3TEYA 2A3SA 1Y0NA 1HRV1 4CDUC 5J09A 1V9U1 2RS52 3B69A 2OTJI 2Q8CA 4N90A 4MO7A 1T2KA 1BI2A 1TZOA 2NZ9A 2JDHA 1UAIA 3NO8A 2EZIA 1W8FA 2JDMA 4L18B 2ET1A 2RVAA 4Z2AA 2R93J 5FO8B 2MFZA 3A0NA 1B35A 4XE9A 5CBLA 1DU6A 3RJPA 3AG2H 2LBFB 1HIXA 4Z82A 3NWTA 4KU7A 2D6PA 5ERLA 2DU9A 2QSFX 3K75B 1BMV2 2R7DA 1HSJA 1AR63 5FZOA 4BZ4A 1VQ8I 2Z5UA 2A7AA 2Q8KA 4XFAA 3A23A 5EZWA 5CG8A 1PGSA 2UV1A 1AOYA 1ON2A 5HCFA 3WNXA 4ENKA 1GYKA 2C4XA 2ESHA 2VW2A 2OVUA 2O9LA 3Q8BA 1GUUA 4MGTA 2EV5A 2NMNA 1XPXA 5DAVA 5A6YA 5GZGA 2F5VA 3S8PA 2JG8C 1JZ4A 1SD4A 4BQQA 3T8TA 1Y6IA 3VBSA 5GAEJ 4OIQF 3IZOA 1D5YA 4WVMA 4OIRF 3BR6A 3H9QA 4QPGA 2YBSA 3ES1A 4CE8A 2G9ZA 4LITA 3L2VA 2Q0AA 5JMCA 1FYUA 2CNAA 2BOLA 2JN6A 2F4PA 2XUMA 2EXJA 5DD4A 2XPUA 1UU6A 1O3RA 1LGNA 2JT1A 3MF6A 2Y6GA 2J1VA 3AZZA 5FV3A 1QDOA 3GTPJ 4YZ1A 1VB2A 1PO22 1OPCA 1UY2A 3LSGA 4N53B 4GH4B 1XTAA 2IGNA 4KNYA 3OGRA 1UZ0A 2VW0A 2IFWA 5L36A 1TWCJ 3RRDA 2DLLA 3CMMA 4GRIA 4P9LA 3N97A 5D6FA 2B63J 4FAHA 1VBD1 1OCOH 3GMEA 3MKWB 5A3TA 3RZJA 2FCTA 1RVF3 4I76A 1Z6TA 5J4YA 2DMTA 1XC5A 4C0HA 2W3JA 1S72I 3HJEA 1LFPA 1E57A 3IDEA 3KYCB 3ZYFA 3AZYA 1IUYA 1YW7A 1RHI2 4AI1A 1Y9MA 3NJZA 3K70D 5EG0A 4HLTA 1UW8A 3WF4A 1DU0A 2L7MP 2R49A 5DG2A 1FOKA 1AR71 3WTWC 2SBAA 3NKGA 5FPAA 5F04A 5ICFA 5E3NA 4OOIA 3CZ6A 1OFNA 3J9SA 1BJQA 3LSJA 3NMBA 4HDUA 5T54A 1DZQA 4DBQA 2XAHA 4BDZA 5DAXA 4N9IA 1U5TB 4CUAA 1FMD1 1UYZA 3GXOA 2XF6A 1P7JA 3DKXA 1HQCA 1D2QA 1ZREA 5FO7B 4AFMA 2CMPA 4FI9A 4KG8A 3AKQA 4IQJA 4WCGA 2VBXA 2RDSA 5ANQA 2QBXA 3ABLH 2ARBA 3NAPB 3RNSA 4NE9A 3WLUA 2GP5A 4HXCA 4PJLA 5HVQC 4IHXA 5LY2A 1IS4A 2EH3A 2O1QA 5BNGA 3RZZA 2JXAA 2UURA 4OIPF 4PLOA 2FBKA 4AVZA 3KGLA 3LSRA 2VUDA 2WN3A 2DYSH 1MMAA 4JK1X 1H2LA 4E7ZA 1PP7U 3U2RA 4OI4A 1O4TA 3HKZN 4W97A 1QEXA 5DZGA 5DM7F 3N36A 2P3KA 2DURA 1X82A 4YVSC 2TEPA 5FP9A 2E5NA 5FPLA 3O5SA 4M71A 2FZ1A 1E3OC 1FJLA 4AWDA 1G3YA 4GCVA 4DJAA 4E7LA 1LULA 1HLVA 3FLPA 3Q8EA 4U0YA 2RR11 1LGCA 3SKVA 1BJAA 2V09A 4CXXA 3K48A 1RUH3 2C1FA 3NVCA 1NKGA 2GXAA 5E8AA 2W1WA 1RUG2 1YNAA 4AGGA 1UMHA 4CPBD 4XTMA 3AP5A 3QYEA 1BVVA 2P1BA 3VZNA 3LD8A 3E6CC 4AR2A 1GP4A 1RITA 3ZM8A 1WI9A 2VODA 3WW1A 3ERMA 6PAXA 1H4HA 5LA0A 1QKQA 1RNLA 3IN9A 3CO6C 2M7AA 4B7EA 4O9EA 2NNYA 1LOEA 1OCRH 5D6EA 4KMQA 4E4HA 4CEWC 2EINH 4BPZA 3C18A 2PQQA 3JRDA 3U0ZA 3WHCA 2XB6C 2O61A 3JXSA 4NHKA 3AG1H 4J6GA 1EF4A 2MEV3 4YVSB 5FXZA 1AR61 3WP6A 4BE3A 2RNGA 5EEGA 4XF3A 3ZX7A 1DGRN 1C5HA 5EDNA 4A2UA 5J48A 2MG4A 3HZJA 1MMSA 4CU7A 1WMXA 4OAYA 2L02A 3AFGA 3DPTA 1LFBA 4A7KA 4YVWC 1AZDA 1NXD1 2EIGA 3OB8A 3GTQJ 1A6IA 2VMCA 4FOQA 4PDKA 4NWVA 2FCVA 3M3EA 2XRNA 1U9NA 5FCCA 2CV0A 4IL7A 1OLRA 2JRMA 1MBHA 3MDPA 4P9FA 1W2TA 3OBZA 3CCEI 2BVMA 1ETYA 4XQWA 1FPN3 4YZ3A 3RI4A 2DVFA 2V9PA 4OMZA 3THDA 4PBPA 2M34A 1ENQA 4KMFA 1IN8A 2R1BA 2JDYA 5K7FA 3KEOA 1PP8F 1AJOA 3FWEA 3CUQB 2KM2A 2W1SA 5FPBA 3HUGA 5BNOB 4HT1T 1TNSA 1O4YA 2XGXA 1DYOA 1M1EB 4QLCU 2BY1A 1U3EM 1H2NA 4RFRB 2R92J 5H9PA 5CAZA 2N8GA 2BYVE 3TDUC 2UY9A 3BR2A 1LENA 1P8JA 1ZYRF 5GPCA 3CCUI 5AVPA 5IATA 5IP6A 3DPRC 1SQ4A 5DCMA 1ZELA 4AYBA 2DODA 2KRCA 1W6OA 5ISLA 3NV3A 4XLCA 2VUAA 2VMIA 4AIHA 2R30A 1BBT3 3ABMH 1DFQA 2NYXA 2BTVC 1KDKA 3PQJA 2RREA 5F5QA 2GNMA 1NK3P 5EXOA 3U4XA 1QPIA 2ZS6B 1X3UA 1I3QJ 2E35A 2Z16A 1VQOI 4ZU7A 2D7FA 1G3TA 1WW5A 3IDAA 1PK6B 3JR9A 3POWA 2IRFG 4EN8B 1ASJ1 1GZTA 5FK7A 1X50A 5GLVA 3GTOJ 5JOWA 2A3XA 3N9OA 1VQPI 5KAFC 3ZXAC 3MN2A 2WNOA 5LHIA 4BISA 1SMYF 5FLMJ 4EJTA 3SISA 5KHJA 1QY4A 1R1UA 4RB0A 3PO3J 2DOEA 1BW5A 3OEBA 4IE4A 4C0BA 4KWJA 3G73A 5F8PA 1R49A 2C26A 3MIEA 2JJ7A 2W84A 1IJWC 2FBHA 1PIV1 3U11A 1HKDA 5C4WB 2YXSA 3HT2A 3HOTA 3KQRA 3LQQA 2B39A 2QBYA 3H5NA 1U5IA 2TUNA 2B4KA 3P3NA 3MIGA 1X1BA 5DCFA 2BY3A 2EZKA 4S2FA 3ECQA 5B1BH 2DA2A 4F91B 1YJWI 5L73A 5BXXA 2BPA2 5C44J 4XF1A 3V56A 2UWAA 2X6XA 1TT0A 2BWCA 4FXKB 3UR3C 5FZ0A 3JU9A 3KYLA 3O2PE 5C3OA 2Y26A 3LDRA 3DEUA 1KA8A 3IIAA 1I5PA 5J3UA 3K69A 1N1VA 4L8QA 1RUNA 4G6TB 4XRMA 4Q4X2 4L97A 2HWD2 4BE1A 3MHZA 2NN8A 4DXSA 4GB33 4BQOA 5F08A 4LUKA 4DS0A 2WNVA 1JU4A 2AEYA 1ZGAA 5TSWA 1GKBA 4A6OA 5A70A 2EXIA 4BJTA 4XJZA 4LE4A 1NUKA 2M0CA 2OPKA 3KE2A 4YZ5A 5F0HA 2GN3A 1GDTA 1AUYA 3HBKA 4JGZC 4RLQA 4O7XA 4KDPA 4OLLA 2HJIA 5E16A 2V26A 2A6ZA 1Y9QA 3N7KA 1WA6X 3AXDA 1R091 4GMP0 1XE7A 4BCUA 2WL1A 2QQKA 4J00A 1E2XA 2PELA 5FZ3A 2RG4A 5FPUA 2VM9A 4QKBA 2K3PA 3IB3A 3LSMA 5GZEA 2EIKH 4DXTA 2VECA 2ADEA 5B66C 2DCJA 1QDCA 5LK5A 4Q4X1 3VD9A 1VBC2 3PL0A 2HXIA 1WMDA 2XDVA 3LSTA 4J1XA 1HXS1 4JQTA 1ZLJA 2P5LC 4UAPA 2XUBA 4LIUA 4UOJA 2QUFA 1VIWB 2ZJ2A 3DBLB 1COV1 1B9NA 3I4PA 3USUA 4LMFA 1CPNA 5FZFA 3POEA 4OI2A 1SANA 4ES9A 2WLQA 1HB3A 2MEV1 1D1AA 5ANNA 1P4AA 4WK8F 4AC0A 2DVAA 2LRDA 1T33A 2Q8EA 1HCRA 5KBFA 4BHCA 2Y0OA 3RSJA 2BE5F 2DVGA 3DF0A 5H6QA 3F8MA 5BMZA 2QQIA 1JTYA 4EWEA 3ZQGA 2K0GA 5CFCC 2FE3A 1J1LA 1PVXA 1VTNC 2ZGLA 4JC1A 1T2XA 1JUIA 5JPNB 4D6SA 4M3DA 4AIKA 3QPTA 1DDLA 1AL0G 3PL8A 2BY2A 2ATFA 2GMMA 5BPDA 5J36A 5D5UB 2TCTA 4Y5TA 3GCMA 1XJAA 2LLKA 1EH8A 1XYPA 4QXHA 1F43A 3K4MA 2XGCA 2WV0A 1V6KA 1SVMA 1ZYBA 1MZEA 2HS5A 4M72A 3CNAA 4FX0A 2XVGA 4IDZA 3AX4A 4UXAA 4UYBA 2EALA 2DCTA 2ZSIB 1H9PA 4GMP3 3ZMTA 1UG0A 1N3QA 4RQPC 4YW3A 1SLAA 3G7DA 5BNNB 5I0RA 1R6RA 4M3GA 3AMPA 4GXLA 4HLYA 5A6ZA 2DA5A 4A69C 4IL6C 3HWJA 2WSVA 5I0SA 2PN6A 3LFKA 4EJOA 1ZH5A 2E2IJ 2VASA 1Z91A 1XYNA 4XJAA 4JHZA 2LC2A 3C2BA 5B4NA 1LOBA 4I6ZA 2RDPA 3BTIA 4BBSJ 4ZC3A 2ZCWA 2M4KA 1WCQA 4Q5OA 5L3BA 1C28A 1R1A1 3VD3A 2JA5J 2M1BA 4OINF 4LBNA 5KVRA 4BYYA 3WG3A 1STMA 3VDDC 4QX1A 1G9AA 1IN4A 3SXWA 4Y5Z0 2YGLA 2PMZA 3FMRA 3CCSI 2VAUA 3FL7A 1GLNA 4XHBA 4Q0SA 2TRTA 2VC9A 1SAUA 1ZK8A 3AYDA 3ZXEA 3CUQC 1UU5A 2VBZA 1FWZA 1MS1A 3MEPA 4ATFA 1BI3A 2AYHA 4QTRA 1Y9GA 2VBPA 1NHAA 1RUF3 1K6YA 1SVLA 1BOBA 2C6YA 2VCCA 3NJXA 4X8NA 2E2HJ 1FEXA 4WF2A 3UK9A 2Z9OA 1Z21A 4R4XA 1ULYA 2DT7B 2E63A 3H35A 1G6NA 4L5EA 1AX2A 1VFCA 2QTWB 1R64A 2GSYA 2KDOA 3WT3A 4Q0UA 1WMFA 1TC3C 3KB5A 5FK8A 1XCVA 1R083 2A6WA 2R7TA 3WHUA 2PG4A 4COVA 5FZOB 3L2HA 3JSOA 4NOTA 2FUG2 1OH4A 1SDDB 1ZNPA 4KQ7A 3KHBA 4ISQA 1RUE2 1H30A 4RB3C 1LE8A 2OKXA 3LF7A 3ZMNA 1DPUA 4PJJA 3R0RA 3K3OA 3C1DA 2JQ7A 4M01A 1UZVA 2NVUB 4XPVA 4ETSA 1OUXA 1A34A 4FOYA 2WNUA 3BG7A 1QOOA 3GJAA 2CUJA 1QJX2 3G6EI 3HYIA 4NWWA 4N8MA 4ZKTB 4CEWB 2M45A 2KP6A 4GB31 3KPHA 4ENMA 1MPXA 4Z92B 3EUKL 5FD6A 1J3PA 2L9SA 5T5LA 3C7JA 2KLOA 1K7AA 2J5PA 1DIWA 1VPHA 4NROA 3Q0WA 3AMMA 2XSDC 5DUKA 3J81K 3I7DA 1YQ2A 1JXSA 2CTVA 5JSRA 2WT0A 4S2GA 3W6KB 2PHTA 3EUHC 1VRH3 1K61A 4CDWC 3ELKA 4BIOA 2AC1A 4PDWB 1AR62 3I2KA 4FBFA 4XLNF 3H9AA 1TTYA 4XKBA 3WW3A 3TN91 4EM1A 5T5PA 3VSLA 1W06A 3UKNA 5D5WB 5FBZA 3EYYA 2JMWA 1FOD3 3S7IA 4CRQA 4NN0A 5E3MA 3W3CA 2R32A 3PNAA 2HEVF 4MEYF 2Y6FA 4R79A 3FKJA 2C6SA 2XAQA 2DQRA 3U9GA 4N7UA 2DBBA 4ON0A 2JIJA 2FXAA 3RKXA 3VDDB 5LRRA 3S3MA 4OHWA 1IS3A 1MGTA 1HRI1 2W94A 2B9VA 3RMYA 3M8JA 2E7QA 2A5WA 4KIGA 4M6VA 4URTA 2Y75A 3E7LA 1FZPB 2CV1A 4M6XA 3QLQA 1N1SA 4SLIA 4B47A 3HRSA 1XSQA 3O0XA 3BB6A 1I5ZA 1TQIA 1UWWA 5HS9A 1AX1A 3R0AA 1FIPA 2W47A 2CU7A 3VBOC 1SDWA 2XHKA 1CESA 2M3AA 2IGOA 3K46A 4LXLA 1QIQA 2GALA 3GALA 2VLAA 2GH2A 2WNEA 1ZBA3 2BZDA 2RQPA 2DI3A 1MIJA 1O8SA 3GW2A 1LTEA 1GXQA 1GU3A 5JXGA 1REFA 1FPN1 4XHXA 3K3NA 2RN7A 2PMHA 4XQFA 1G9FA 3VBUB 3ZGKA 3RIRA 4COYA 1PUFB 1ON1A 4KA4A 3ZXDA 1GICA 1S8NA 2ZZJA 4HF0A 4EN7B 1LEMA 5F1JA 3U1KA 3DWLE 4OCTA 5HNHA 4C8DA 1X9TA 4P9UA 1Q3EA 1FT9A 3KP6A 1F4HA 1M06G 2W25A 5DM6F 1CD3G 1F9KA 4NPMA 1HSTA 4R9CA 3ILRA 1PX3A 5FP3A 5M3MJ 1ERDA 5L3FA 3M7GA 1OCTC 3BALA 3PVNA 1G8WA 5IK5A 4MZUA 1T08B 2HVSA 2V5YA 2JDNA 4EZHA 1A5JA 2OQGA 3D0JA 3ITQA 1F2NA 3V0AA 2G9FA 3AP6A 2OZ6A 2R4GA 5LBFA 3FISA 4QDRA 4FX4A 5IHRA 2DFHA 5LATA 5DMYA 2RS32 3OPZA 5FZ8A 3O1VA 5J47A 1KYZA 4YW7A 2P17A 2X8KA 3VEPA 2W95A 2A3YA 3T2TA 2ZXIA 2O8XA 1QZYA 1S29A 1UXZA 1IV8A 2VOVA 4MHRA 3AB0A 2H0BA 5HNFA 5A33A 5D21A 1CF7B 4IGOA 3Q8FA 3W9AA 4OHVA 4MNUA 1GNHA 1HDKA 1I50J 1OXCA 3NKTA 3C3VA 2X0LA 3VBFA 3BR3A 2ISZA 1IG3A 1FLIA 2DF7A 2R042 2IVMA 1MMDA 2EXKA 4BXUA 1JGGA 3HRUA 4QX0A 3HN1A 4LJZF 2HWB2 3MYXA 4IESA 5A3NA 2AUYA 4YZ2A 1AR82 4MGSA 5J1RA 3WDWA 1O8PA 3NL1A 4XUOA 3LA3A 4M3CF 1GOFA 1ODNA 2PHUA 4ZU4A 3A03A 2YC0A 1T95A 5FLVA 1MD0A 5CVRA 2CQ7A 1U8RA 2PMUA 3FF5A 5FBJA 1ZR2A 1QOSA 3E5QA 5FZHA 5E8GA 3WG7H 3LNQA 4II2A 1VBB1 3KVBA 3PVBB 3F21A 4L9VA 3F9KA 1U12A 3LSEA 3I3LA 2XG3A 1QO0D 1R1A2 1QXJA 2RKHA 4GA9A 4NIHA 1GNYA 3PFYA 5FYVA 2QSGX 3F22A 1XSDA 1X1AA 2VQ0A 4IGPA 4LFUA 1QHDA 3SLIA 4G12A 2B0LA 3FBNB 3QYFA 3QODA 1UOGA 2RJKA 1IXCA 2BUKA 1OVSA 1HQLA 4QXBA 1VI0A 2ZGSA 4AFAA 2AR6A 4MTEA 3WU2C 1O59A 4CP2A 4KYWA 2H8WA 1NE4A 1FTZA 1IS6A 4XVHA 4HQMA 1KGSA 4LULA 1BI1A 4BJ0A 4LK6A 2DFEA 3DTIA 5ABJB 1DYKA 3W6JB 5JXIA 3J7AY 4CDUB 4HVQA 2RE9A 1XDSA 4X1EA 3WR0A 4BQ1A 4B1RA 2WNVB 1MMNA 3W2AA 3ZR5A 2O0YA 4NO4A 1UL9A 1ULEA 2Q2EA 4ITVA 3EQLF 4L0YB 2WIIB 1H2MA 2X6YA 1MS5A 4UV9A 2HWE2 3WHBA 2E7AA 2HQNA 1XYOA 2WNVC 2BOJA 4XIDA 4UW5A 1E3PA 4HFSA 2R5ZA 3ZSMA 4KGGA 1DPRA 4A3FJ 1VAKA 1OLTA 1YTYA 1OOPA 1W6QB 5C8WA 2UXXA 3M4OJ 3C3WA 2ZGTA 5I0UA 1IXSB 3L2CA 1W6MB 1H0BA 5CZKA 4FP2A 5KK1A 2RS11 1REDA 3G2BA 2K86A 4AQ2A 5FOJB 3WW2A 3W5MA 4MQ9F 2FZ2A 4JCKA 4LOCA 2LY1A 3BTLA 1Y7BA 2PXJA 5FMCA 4A3LJ 5FZBA 1MDMB 3HBZA 2A68F 3FXJA 4KMUX 4LBJA 1KYWA 1RUJ1 2A6VA 1RC9A 4ENJA 4CDQA 1GSLA 4BHBA 3DLAA 2FF4A 1TWGJ 2YHJA 3LAPA 1XSXA 2XV4S 3T2PA 2P5VA 5CKMA 3TEDA 1VQ6I 5J3LA 4R4ZA 4CA0A 3DEMA 3REOA 2TDXA 3VODA 1BR1A 3BOWA 3SDBA 4XNFA 1GQHA 3AXEA 5C4WA 4P02B 4YLZA 1F4KA 3D5OA 4E4SA 2QQNA 5K8SA 5I91A 1TWAJ 5K7PA 1OYIA 2D6LX 1WH7A 3HTUA 3CF5F 1HDDC 1PUFA 4O65A 1H4GA 2CS3A 3AL6A 4E7KA 1K79A 2JSPA 5CPRB 2JD9A 2DVDA 4K9SA 3E1SA 1HW2A 2L9VA 2I74A 2DYRH 2ZGMA 3EB7A 4IE0A 5F3GA 1YJLA 4LBQA 2DMPA 1ZBA2 2XHNA 4AE2A 2QUOA 1W8ZA 4U2AA 3JAMK 4ZHNA 2MGQA 1BXHA 5FY0A 3RJ2X 4RN5A 1NA1A 2A3WA 5FXVA 4P9YA 2OU2A 3AKRA 3CP2A 3AFHA 1VBD3 3S2DJ 2VQGA 1S0GA 4WVWA 3L2WA 2JPBA 2R062 3V4GA 3HC7A 5GTIC 4NHXA 4NC8A 5A2QK 2J1EA 2E36A 1ZTRA 1ENRA 2HZDA 3S16J 2RS31 4MXVA 2R7FA 2W1OA 2EB7A 2VCAA 3MKZA 1POQA 3ONQA 3SH4A 1V70A 3K77A 2GNBA 3UGGA 2B46X 5EJ3A 3ES4A 3FMGA 4IXAA 2Q5TA 1JZ8A 4CCKA 5LEJA 2B42B 5E8IA 1BEV3 4BACA 2QA4I 3I3EA 3MEXA 4AGRA 4A3JJ 1QZZA 3OIPA 2HFHA 2D3SA 1JUPA 5EQUA 4AI0A 5E1RA 3OYLA 4OUEA 1SFKA 2XAUA 1IF1A 3CIHA 2QZ2A 2LF8A 3C7FA 3P9CA 4KNCA 2RM22 2N7GA 2P6SA 3MW4A 1W8TA 1FATA 3ACHA 2Z99A 1XCBA 2J1UA 2AEZA 1B8IB 1A36A 2LVSA 2QGUA 2XLGA 2DWRA 3AZXA 5KHDA 2W85A 1A04A 3I0TA 3CCMI 2JKXA 2ZMKA 3AL0C 1DGWX 1NTCA 4CEWA 4WZFA 3S1NJ 2MW8A 1CX4A 1G59A 1O5UA 4H2AA 2Y31A 4BXFA 5FKKA 2EFNA 1KGYA 1DUXC 2YV8A 5E6HA 5TJJA 4P5HA 3M2MA 1G3SA 1IRXA 1BVP1 4Y26A 2WS92 2G1MA 4LA2A 1U0AA 1EP0A 3L1PA 3OL4A 3OYWB 2RHPA 5F32A 1ETXA 1TMF2 4HPKA 1ZRRA 2ZAHA 2FMYA 3MZ8A 5CKQA 5LGTA 2XL9A 5I8SA 1YFUA 2MH2A 5FPVA 4Q1RA 1NXMA 4YEJA 4GWJA 3JRGA 2FBIA 4B3XA 2PBIA 3OUJA 1FX5A 2ZAAA 3HL2A 4C3JJ 4C1WA 2ACJA 1QU3A 5FMOS 5C4WC 5C4JJ 2VPLA 5LA1A 2ZFUA 3WDVA 1AXKA 3VSKA 3RKYA 1SLBA 1L3LA 2WAQN 5CJ9A 3CQZJ 2XJTA 4PT6A 1X9PA 5ILSA 4K40A 1K5MC 1I9RA 2ZXHA 1V3FA 4Q0VA 3U4SA 4QPOA 4UB8C 4IETA 4XACA 4XLEA 1DQ4A 2I10A 1UD1A 1ZGJA 3OYDA 5F3CA 3H8RA 2L3DA 3ZIXA 1EKEA 5HDKA 5C8CB 4HW0A 1APNA 2EICA 2KMUA 1E3HA 3CCVI 2AGSA 2C9KA 1EH7A 5H6RA 2WB1N 4N7IA 1GHCA 4HQEA 3POBA 3OTFA 1S7EA 4XOPA 4IHYA 5D8LB 2H6BA 3CLQA 4SBVA 5FZ9A 2VR4A 3MBWA 4MGQA 4KH9A 3JRHA 4ARXA 3CDZB 3ABTA 1K12A 4NRPA 4L0ZB 2ZHLA 1WGPA 1JJ6C 1W2AX 4BE0A 3ULQB 3KZIC 5IT3A 2J7MA 1PVC1 3QACA 4JOMA 3W5NA 1IPSA 2DMNA 3DP7A 1UMQA 1HC8A 2M8EA 4KG0A 2A75A 2X4HA 3FHAA 3DEEA 1DQ5A 2B45X 3P5BA 3V7SA 2QCOA 1SVOA 2RDNA 3G1LA 2WN2A 4LR4A 1MKMA 3TBDA 1ZRIA 3CCQI 4CTEA 4ZYDA 1MMGA 2GNTA 4KFCA 2HLEA 5FUPA 1I3HA 4FE7A 2V9VA 4ZZ8A 4U0WA 2R7SA 3PU8A 4Q4ZF 3ABKH 1C8M1 2JWPA 5GZDA 2IT0A 3BP8A 2B8MA 5T52A 1J9IA 5IVVA 1Q56A 5H2FC 1RMU3 2IXKA 3D5SC 3K4BA 1I1GA 4CP1A 2VOPA 3VKFC 2D1VA 4FSJA 2L9LA 4ZYEA 4WM8B 2CYFA 3ZYBA 2DCZA 1UKGA 2WLPA 1RESA 3MIBA 2JE8A 2Q8DA 5FY8A 2OAZA 1MSEC 1GXPA 3MW2A 5I0DA 4UW3A 2RJLA 2Q8OA 4PHZA 3R4SA 1LFUP 1KD7A 3DPRB 2ZNYA 1GZCA 2VJ5A 4Z8BA 1H0MA 4JKLA 2UYBA 4ZS2A 1XDUA 2GC2A 3DPUA 4JRLA 4EGYA 3ZIWA 4Y5SA 1JHFA 3NEUA 2KDZA 3ZMSA 5E1ZB 2RS33 2BQPA 1DQ2A 3P7NA 2DFIA 3FC0A 1WBFA 1OJLA 1WJBA 3K1MA 2FD5A 3TEZA 3NV4A 4AG4A 1X7NA 5JDBA 5FY1A 1RUC1 4PBOA 4NIGA 1VBE3 2COMA 4PDWC 2KQRA 3VZJA 3W2VA 2W82A 3WQBA 2DO7A 1AYN2 3ZYPA 2KIMA 1J3QA 2EILH 3VHRA 5AONA 3C2GA 1B59A 3GTLJ 1J5YA 4WXDA 3C8XA 2IBDA 1VLNA 2PHRA 3WE3A 1Z7S3 5KXBA 2GOMA 3A01A 1VBD2 2CQKA 3TOJA 5ABJC 1LU2A 2KRFA 4KUMA 3B7MA 3GBWA 5D5XB 3RGBA 1OCZH 2HWC3 1HXS2 1PVC2 5LW9A 2NS0A 1OQYA 3O8GA 1CAWB 5CKTA 1W5TA 2OPTA 3H92A 3BG6A 2Z3YA 3J7LA 2IA0A 1W6PA 4XUNA 2DMUA 3GYDA 1I3AA 1IG7A 3K2ZA 1JODA 4NJ4A 1IN5A 5ACA1 1XB9A 2ZHKA 2BVBA 2L9NA 3DEWA 3RI9A 4YGEA 1TQMA 5EF6A 4D3WA 1RJ7A 1OYYA 1LQ1A 1D7PM 2DU0A 2VBBA 3MUY1 2XVLA 3O14A 4BIFA 2YFZA 2PN5A 4G7ZF 3TEXA 1I39A 3TRSB 1W6OB 4KISA 1XGSA 1ZZ8A 4IEZA 2QBYB 4AWXB 4EE2A 3NAPC 1VAVA 5JIAA 4IO9F 5FJKA 1PMJX 3GX4X 1OLQA 4HONA 2XJQA 1PMIA 3AZWA 4PUSA 1VR3A 2DA1A 2CGOA 1XS9A 4AHXA 4KJZA 4I09A 3HXLA 2YU9J 2GM4A 2WA0A 4IEWA 3ROUA 5IVEA 1FMD3 1BQPA 3V8KA 4LBKA 4YRVA 1XB4A 5FLXZ 1ZHFA 4HN1A 2GDFA 3AKPA 2HWB3 2HKOA 1GNZA 3BIEA 3CJNA 3K4AA 3ZXKA 1RKWA 3TL4X 2RS13 1OF4A 4M0NA 1EAH3 5CQGA 4AHZA 4ANJA 1SMVA 2LM3A 3ZR6A 3IKWA 1RETA 4MQVA 4QB1A 2D3RA 1VRH2 3RZMA 1M4WA 5IT9K 3RPUA 3FXMA 1N1TA 1HBXG 4GD4A 1WKMA 1CONA 4JP0A 1HN0A 3PNVA 4P5YA 4DO0A 5J1XA 4B1LA 1D8KA 4TYSA 2JVGA 2XB5A 2ERFA 1R7JA 4A5MA 2YG0A 4NC6A 4HX7A 4QB6A 4M6YA 1RUH2 1N3PA 1OR7A 2HOAA 2KHMA 2X9DA 4IF4A 3M3CA 2L4MA 1HV1A 1UCRA 2YB7A 1WJEA 3J80Z 2Y0IA 1I6XA 4BEHA 2Q4SA 2UXNA 2OQ7A 3W59A 3TYJA 5FROA 3KF5A 3GWZA 3L09A 2VC1A 1LNSA 4CGZA 1G4DA 4Y20A 3HSFA 2JG8A 3Q9VA 3H50A 5L9VA 1RUE3 2KZVA 3QU6A 4Q26A 2VE8A 2F4MB 4UY8I 3RZGA 4R8HA 3CQOA 4AI8A 3CHXA 2DBIA 3S14J 1V6JA 4XF0A 4D94A 5J6XA 4RA2A 4UFIA 2I5UA 1HRV3 4BEHB 3IKTA 2XBO3 1SFXA 2WR9A 2NQYA 4IHWA 2R7VA 3LGRA 1SZBA 3MV11 3S1MJ 1C1LA 1FAYA 2QNKA 3UYJA 1K45A 4OZXA 5DDGA 2CW7A 2NNNA 5AC92 4XCBA 1AKHB 2VXJA 2WO7A 4MO3M 1UX6A 4WBBA 2D6OX 2AQEA 5I8TA 1BBT1 4I98B 4QDQA 4XBLA 2B5HA 3KCYA 1S0EA 3F23A 4C30A 3VBHA 4QX2A 2R7ZJ 3HPHA 3RYPA 4BQ4A 1S6LA 1VBC1 3T4VA 3I4IA 3V65A 1E5HA 2CAUA 3PMSA 2D5VA 3SKJE 1YEWA 3K2OA 4KI5M 1ZBE2 3CJXA 1YQAA 3BCBA 1QJFA 1SFNA 1MZ6A 4XQ4A 3I71A 1WCMJ 3ZFFB 3WF2A 4YG0A 3OSGA 2PTMA 3OCPA 3P3PA 5KWRA 4M3EA 1CIYA 1UZCA 4MV2A 3M1EA 2R061 4XILA 1SCRA 2JPCA 4P9JA 4Q29A 4Q4W1 3C2HA 2MABA 5C3SA 4WVVA 2WQ8A 3OOUA 2RMU3 5FB2A 4S0HB 3H0DA 1USSA 3JZVA 3QU3A 3ZDSA 1W36C 4UUSA 1LAJA 1MNEA 1K4TA 2AXTC 4X6RB 4AF9A 1TBXA 2JJ6A 5H9QA 1OUSA 4KWKA 3EQEA 1H1MA 4RBOA 5A7SA 2D5HA 3CC7I 1POGA 4L11A 4XLPF 4RAGA 4LHKA 1SMTA 2IZWA 1QQP1 1R081 2XVCA 1MDMA 1ND2A 3OYMA 4E7HA 3H8UA 3ZQ7A 1FV2A 4PLMA 2JDZA 9ANTA 3BG9A 2Q1ZB 5TISC 3FJSA 3VZOA 3I58A 1L3JA 4PI2A 2K9NA 2F4LA 4V2GA 2V7FA 1JKPC 4XIOA 3N9NA 3IRRA 3MLKA 3HAGA 1QWRA 4NIAA 2XLAA 2MD0A 1HKQA 3UGFA 4A3EJ 4EMSA 3HEIA 3VBOB 5F0CA 1QJU2 3T0AA 2HWE1 4GWMA 3SQOA 4UFHA 1HKSA 3FIWA 4IJAA 4U7DA 2OJED 1WJCA 2X51A 1YS7A 5FZ6A 2D5FA 4EM2A 5GZFA 2CUZA 4LD5A 3BYWA 3LZZA 4XF9A 4RB2C 4D6RA 4ASMB 2WJSA 4NRMA 2JVHA 2HDDA 3IV5A 2JSCA 1YYNA 1WA4A 4RAFA 4HETA 1VQLI 3PO2J 5D5VB 4K20A 1EPZA 5A7WB 3EUAA 2ID4A 2ZGKA 3FXQA 4DOZA 3IRQA 2HR3A 3SEEA 5EHDA 1W2OA 3TOBA 4UNOA 2CUEA 3TQNA 4K6BA 1JTXA 4WM8A 4FOWA 4YVWA 4E27A 3EJKA 4GYGA 4QPWA 2V79A 5L3DA 5BNOC 4A44A 2BWAA 3LOBA 2W2IA 2K02A 2CYYA 3LSIA 3JW4A 1EJ9A 3GTJJ 4CVUA 4A6SA 5C3RA 5EG0B 4JQFA 4XONA 3HNMA 3GFMA 5IUQA 4QX8A 5T5OA 1HXS3 1W8UA 3I56I 1WGXA 2DTWA 2LYCA 1LOFC 1IZ3A 3TP0A 2R7EB 1YS6A 2H8RA 1FC3A 2XF5A 1SAXA 4UBGA 1TWHJ 3AZVA 3ZMZA 2W1UA 1DGRA 5M5YJ 4KN7X 1U5ZA 2P4WA 3OUHA 3H0GJ 1IGOA 5CB7A 2P3YA 3VUOA 1OH3A 2L0KA 4HX8A 3OD0A 1QJEA 1OFCX 2J1RA 4MH0E 2NPIA 3LFUA 2K7LA 2CSOA 4BKXA 2R7QA 1UCXA 4D6QA 3SFZA 4A3KJ 1K42A 1DLLA 1VAMA 3VDAA 3GFLA 1KONA 4CXYA 4BK4A 4L0PA 5DAWA 1MNDA 5B3SH 3H3VK 3P9KA 4IVNA 4YW5A 3QYBA 3ZMDA 5EGOA 4WV8A 3SHRA 4CCDA 2CJJA 2FOWA 4X6AJ 4UF0B 1YFHA 3CO2A 3OYJA 2WAEA 2RR13 3O1PA 3VBOA 2E19A 1US2A 3J7NA 3I9V2 2VZVA 1CQTA 4F7ZA 2JENA 3CCYA 3OOXA 4UFKA 4JX0A 3OYEA 1MEC2 1MW7A 4DIQA 2PLV1 2D45A 3OIOA 4FOVA 1G9CA 1UX7A 4BQWA 3FXUA 3I2HA 3O1SA 4XABA 3F95A 3E1F1 3ACIA 3RKWA 3WTXC 4WVZA 5E3OA 1QMJA 2ZEYA 3I55I 4PQ9A 4QPGC 2ZA9A 3WF1A 1NH3A 2GMPA 3SC7X 1ZAOA 3I2JA 4Y22B 3WP3A 1R093 4DNCA 4EQVA 2D40A 1A3KA 2X6WA 5BS6A 4XUTA 3N05A 4B29A 5FUIA 2WS93 1Q5OA 3GZ5A 1DYPA 3OWTA 2WC2A 3TO6A 3SQNA 1QPMA 2L7FP 4LLFA 4BAYA 2JKBA 5A1FA 5CFCB 3CTAA 3T0YA 4XUPA 2PFWA 4A3IJ 2VPVA 4IXLA 1HDPA 1VBA3 4A3GJ 3RSNA 1O3SA 4ASKA 1STZA 3DXUA 3PVEA 1NQDA 1MQTA 5JZGC 4XFIA 2HWF1 4H4KC 1S2EA 2IXJA 4Q8KA 1MH3A 3FBMA 1RGSA 4W6XA 1ZVFA 1V00A 4XCAA 1TNFA 3LFIA 4TN7A 1AYN1 3LEMA 4IUGA 4RHV3 3VBRB 4GZ9A 2XF7A 2RMU1 3D5LA 2RR12 1JKQC 5FZMA 2YR2A 3S0MA 2PAKA 4HK9A 1JUSA 3WINE 3ZKUA 3WXPA 2H6CA 2XH6A 2CY6A 3VKNA 2AZ5A 2C5DA 4OIOF 1QF3A 3VV1A 2D1HA 3OYKA 1L7QA 2BVVA 1HN1A 4HZFA 2E1CA 4K1ZA 2VZOA 4XW3A 2Q1FA 3K4LA 1PGW1 1DF0A 2VKHA 5GKAC 5DTDA 1ND2C 1JHHA 4GJZA 4XBQA 4IKFA 2V6EA 1GP6A 2YYOA 1OBNA 3L9JT 3ZN4A 5DG1A 5I8YA 1NYWA 4P9GA 3ZFFC 5FYYA 4C90A 2DTZA 1H1IA 2VMHA 4KICA 5C33A 2VQLA 3WUDA 1DGWA 1BR4A 1YI2I 1GQGA 3FUOA 3MIDA 1NA1B 1VBE2 4XF4A 3ON7A 4AVTA 4CDQB 3ZXSA 1WHUA 4ZONA 1CIWA 4QT6A 3KT7A 2W00A 3BR5A 2WNUB 1LHNA 2NLRA 3KS7A 1R1A3 1VF9A 1S0DA 2P4EA 4R9AA 1RUG1 4QM9A 4BQNA 4PJYA 1X58A 4KIFA 3U37A 5GM0A 2P6TA 1CAVA 1AL21 5KHIA 4JX5A 1XRUA 1ULGA 5FJ8J 1J83A 3IMMA 2I2SA 1YJNI 1D0XA 2FEZA 2V5DA 3F6OA 4Y1UA 1DGRM 5BOXA 3HMYA 4BOWA 1UB9A 2LRPA 1DLCA 2FA5A 1KQRA 4GKYA 3O0VA 3VBRA 1Y8QB 1Y43B 1SEFA 1LODA 1AA7A 1N1YA 4IOCF 3ZYHA 4IZZA 5CKNA 1H1AA 5F6KA 3IAM2 2PJPA 1KU3A 1XNDA 2CW8A 5J98B 2K5CA 4PJMA 2JWTA 4C2MJ 2A61A 3H7YA 3M1CA 4YPJA 2DV9A 4DMIA 2Y8KA 4LB5A 2Z42A 3R60A 4QWQA 1NZIA 4KGQA 2ET7A 1BR2A 5K4LA 3A0BC 2DQLA 1VB4A 3GDBA 1JUMA 4RGRA 2ADUA 5B4XA 5LFAA 2KIFA 2AACA 3K6GA 5JOXA 2VZPA 3RZKA 4AFCA 1R4NB 1GVDA 3CBNA 2KIQA 5CADA 4IGQA 3J8F2 4I3GA 5HXVA 1QOTA 1FYMA 2O6GE 1RUJ3 4CPBA 2A05A 1HLCA 4HEA2 2XPJA 5EJZB 3OYAA 3R6SA 5FKMA 4HF2A 5F2SA 2PEXA 4XXAA 3PIGA 4AFBA 4AM3A 3VZLA 2HWVA 2LREA 2MA3A 2VG9A 1OC1A 5F9TA 5C3EJ 3BKZA 1DZTA 2BHZA 2L54A 1E17A 4FPYA 4HNUA 2FX0A 3G1MA 5K5OA 1V5FA 4RM3A 5E3LA 2BW3A 2ZC2A 2P7VB 3K70C 1UZYA 1BN5A 2ID6A 1UU4A 2K85A 4UFLA 2A69F 2YBPA 4I0AA 4QB2A 1W7PB 2F6CA 2ZXJA 2CWMA 4CYDA 1ETKA 2QF7A 5GAHJ 1O4ZA 3GTGJ 1FNZA 4MGZE 5FYHA 1TMF1 1JMUB 2X10A 4C3HJ 5GTHC 5M5XJ 1YIOA 1UJ8A 1ZBE3 1CVNA 2VTFA