3RDIA

Domain-domain flexibility leads to allostery within the camp receptor protein (crp)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
200
structure length
200
Chain Sequence
b'DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILFYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catabolite gene activator
publication title Domain-Domain Flexibility Leads to Allostery within the Cam Receptor Protein (Crp)
rcsb
source organism Escherichia coli
molecule tags Transcription regulator
total genus 62
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rdiA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3rdiA01
4I01A 2DI3A 3OV8A 3LZZA 3KP2A 1YW8A 2YPRA 5K8SA 1KU3A 4WXCA 4O9GA 2HKOA 4GGGA 3ES1A 5BPIA 3S7EA 4HX7A 2KJBA 4EWEA 1T2KA 5CVUA 4WVZA 1TNSA 3LA7A 4XFCA 1KYWA 4M9ZA 3D0SA 1QY4A 5TJJA 2XLFA 1SD4A 3RKXA 4U0VA 3F8NA 3SCFA 1X82A 1ZN2A 3JTGA 2ESNA 3LQQA 1PUEE 1WGPA 4IETA 1O3QA 1PMIA 3WTVC 3H1MA 3JTHA 2D2WA 3F8FA 4HDVA 1PP8F 5HDGA 1JHHA 1LDDA 5I8YA 2P5LC 4QGMA 2FA5A 4XF9A 4XFIA 3MPBA 4XFHA 4NQWA 1YIOA 3RNSA 1L3JA 2Q0OA 1NZCA 1WRJA 4E2GA 4HF0A 5EEHA 4IEYA 4ZU7A 5E1RA 4AWXB 1MD0A 3IDBB 1Z91A 4ON0A 3DPTA 4XFBA 3M8EA 4RS8A 5IT9K 4WZCA 1G4DA 1BIAA 2WC2A 4RGUA 1UIJA 2VBZA 4N9IA 2L3DA 2IP2A 1TTYA 2OZUA 4ONUA 2IXIA 1FWZA 1FLIA 4J1WA 1G3SA 1Y0UA 2RNJA 1FP1D 3IKVA 2UY8A 4I7HA 2EA2A 3HOTA 2MBFA 3R61A 2PQQA 3KFWX 5FFZA 1ZHFA 4IVNA 3EYIA 4KU8A 3ECHA 1JUHA 1TBXA 5I0SA 2QENA 3DKWA 3O2PE 4LG0A 1KGSA 1S7OA 2FNPA 1ON2A 2D1HA 1RZ4A 1P92A 4E2SA 3B73A 5E8GA 2ETHA 1DP7P 5HLGA 2EJRA 3RIRA 2PTMA 2YX7A 1YLFA 3GVAA 5F1RA 4L11A 4G8XA 4IEOA 1XCVA 5D5VB 1E2XA 1S8NA 4IEXA 5HLHA 5ICCA 3J7AO 4LMYA 2W25A 1OD5A 1AOYA 2K4JA 1R5GA 1BIBA 3L2CA 4LFUA 5EEGA 3JW4A 2YR2A 5JSPA 5LLQA 1OYIA 2QQBA 4LGWA 3S2WA 2DPUA 4HVRA 4F7ZA 2FBIA 4ZU4A 1O7LA 5K5RA 2D5FA 3ROUA 2V1UA 4UVBA 4HVOA 3M8FA 2HEOA 2HWVA 2WFPA 2O8XA 2Z3YA 3EDPA 4P9FA 4HMZA 3LWCA 1QPMA 4IPAA 4UHTA 2BYVE 5LRRA 2HTJA 4KDPA 1HKTA 3SXWA 4IESA 3S0MA 2CV6A 3UKTA 3I54A 4Q0UA 3KSCA 2AXLA 3OF1A 4JQFA 3TO9A 2F5CA 3BJOA 2ZFWA 2OPKA 1CAXB 4UBGA 5I0RA 3BPXA 4N0BA 1ZAOA 1J5YA 2BE5F 1JGSA 5D5UB 3H8UA 5CADA 4Z82A 1ZYRF 3ZMVA 2UY9A 2VECA 1J0RA 4KU7A 3RDIA 4MX3A 2HTSA 3CUQA 1CAWA 5JR7B 1TQ5A 3U11A 4KN4X 1U8RA 2OD5A 4U0WA 1FZPB 2HQRA 2NAZA 1YYVA 3FWEA 1P4XA 1TW3A 3F8MA 4IEPA 4PCQA 2BEOA 3J80Z 2M87A 2XVCA 1YW7A 3N4MA 2GIVA 1H9GA 5FFXA 2K86A 1VR3A 2P17A 1FSHA 1FYLA 2QVSB 5D1IA 4OIPF 1Q3EA 3KGLA 3BPZA 3ST7A 3H1WA 1OPCA 4CGZA 1MJBA 1OYYA 2P4WA 2VC1A 3GLXA 1LRHA 3WW1A 3F21A 4EWDA 5HS9A 2QJVA 3GFLA 4HQEA 1LB2A 5E1WA 4U7BA 3C18A 2CAUA 4G9YA 1ODDA 4JTNA 4L9VA 2EVXA 4HZFA 1QO0D 1K7AA 1KU7A 2IC1A 1QZZA 4XFAA 3O6BB 3ELNA 4RAZA 5HS7A 3J81Z 2XV4S 1G6NA 4P9UA 2W24A 2RV8A 2FBHA 4PGHA 1RI7A 1B1BA 3CO6C 4HDUA 4EJUA 4Q48A 5I0UA 4YFKF 3F8CA 1YFYA 3FXUA 3DQVC 3DL3A 2JRTA 4A0XA 5FLIA 5BY5A 2J5PA 3FZ3A 3H7YA 2BNOA 4LA3A 2CG4A 5BMZA 4BHBA 2XRNA 5HOOA 4ENNA 4Q0QA 4BNCA 1J3QA 3NVCA 1JHFA 3NSTA 2GA1A 3F22A 5LHIA 2MH2A 3WW4A 1TQMA 1YS7A 1T6SA 1ZG5A 2LSOA 1BJAA 1XN7A 3HRUA 4EM1A 2DK8A 1STZA 5HLIA 5LGNA 2XAGA 1BC7C 2Y75A 1NXMA 2GA2A 1OKRA 5AIPA 2Y48A 3TKYA 2XL7A 1XRUA 3SXYA 3H92A 5CVIA 3KZYA 1Z6RA 2RDPA 2BGCA 3VEPA 2L01A 3RKWA 3FFQA 1FP2A 2Z5UA 2V09A 1P4WA 3I71A 1YLLA 4LB6B 3M3IA 2LNBA 4EMSA 5L3EA 2M30A 1FC3A 2Z99A 4KICA 5JHUA 2BBYA 2ZO4A 2PMUA 2CAVA 1SD5A 1H1MA 3ZMSA 1YFHA 2H6CA 4UXAA 3GBFA 4O3MA 2IVMA 4Y13A 4CZZA 5E1XA 4ENKA 3R0JA 3CUQC 4OFGA 2PEXA 3G3ZA 3IWFA 4M72A 3MEXA 5AONA 1YTYA 3U9GA 1ZGAA 2KIUA 3CLOA 3I4PA 4HBLA 4IHTA 1IXCA 2MA3A 2GAUA 5A2QK 3TGNA 1CAXA 2QBYB 5FCCA 2LF7A 4MGRA 4FT8A 4BYYA 3CL1A 3CF6E 3O14A 4HF1A 4EQQA 2MLGA 2RC4A 2JPCA 2PG4A 3BDDA 1L0OC 4HX8A 1FBUA 5J8CA 3ML6A 4MTEA 4RB3C 2ISYA 2LF8A 2BNNA 1XGMA 1YQAA 2VQAA 3V8JA 3BROA 4NVPA 2A6EF 4JTOA 2Y0OA 4EROA 4D7TA 4G7OF 2YSRA 1BI2A 4HVQA 3ACLA 2FQPA 2FBKA 3GO5A 1H0MA 3ZMZA 5DUIA 4LG0B 3I5UA 4MQ9F 5JVTA 3REOA 2N7GA 2IXCA 4MQVA 5ICEA 3LFKA 3PQJA 5ED4A 5DUKA 3WU0A 5CYVA 4OINF 3KP3A 3I59B 3VOEA 4XFFA 2P6TA 4XFGA 2K02A 3FMQA 2IA0A 1RTVA 2Q4SA 2NNYA 3K1PA 1DZRA 3R4KA 1XE7A 1LEBA 4J1XA 1VTNC 1KQ8A 3RKYA 3M70A 1O57A 5D8LB 4Q0SA 4ZZDA 1RGSA 2ET7A 5L3GA 1ZZ7A 1HSTA 1R00A 2QZ8A 4UV8A 3MYXA 4LB5A 3F6OA 4D7SA 3CO2A 5E1ZB 2Z2SB 4B29A 3RPQA 3K1MA 5ILSA 4ENJA 4OLLA 4I3PA 2OQRA 5KBFA 3IL2A 3FF5A 4XLPF 2CSOA 4UVCA 4JVAA 4UVAA 3QP5A 4PJYA 1IW7F 4LULA 2PQ8A 3EJKA 2PLYA 3LAPA 1UIKA 3GF2A 5KHHA 1MJAA 2KJCA 1USTA 3TO7A 4ASNA 3KETA 2FE3A 2CGPA 2XAFA 2H0VA 4HN1A 1YUDA 3CUQB 3U1DA 1CAWB 2EFNA 3WTWC 2ZXJA 5BPXA 3KEOA 1S6LA 2L4AA 4U88A 3WGIA 2F4PA 2CQKA 2M1BA 2D45A 3CUOA 2A6HF 5BPDA 1NHAA 1RUNA 2EK5A 2I45A 4HLXA 3LAJA 2HJIA 4CXFA 2STWA 3QAHA 2XLGA 1O5LA 1B59A 3ZN1A 5FD6A 4PIYA 4JBAA 2UYBA 4EV0A 3TOAA 3R6SA 2RN7A 1QBJA 4OIRF 2XLAA 1BN5A 3JAMK 1WWXA 1MZBA 4HAMA 4KMFA 1W7PD 5I0TA 5K5OA 4WF2A 2DW4A 5J7MA 3AAFA 1J75A 1I1SA 2UXNA 1ZH5A 1B9NA 1ULYA 2BNMA 3FXRA 4YIIA 2FMYA 1HSJA 1U12A 1XGOA 2O6GE 3ISPA 1Z05A 3Q9SA 2DFIA 1FI2A 1B9MA 3UKVA 5FLJA 2P8TA 5E18F 3B02A 4Z2YA 4IEUA 5CJ9A 5C8WA 3MWMA 1ZZ6A 2F5EA 3VODA 3ZMTA 2QBYA 2VE8A 3FJSA 4FX0A 4PIZA 2Q1ZB 3HTSB 4EJOA 1WKMA 3BP8A 1TQIA 2W85A 3WGHA 5KHKA 2V9VA 3SQNA 4PGGA 4HOBA 1UFMA 5JSRA 2DU9A 2XUBA 3HQXA 2XKPA 4OIOF 2EV0A 1UPIA 1D8JA 4X6QB 4IRGA 4BHCA 1B4AA 3K2ZA 1ZX5A 1IF1A 2PJPA 2Z69A 1UW8A 5E16A 2EFOA 1LDKB 2VBYA 3BJAA 1QGPA 5I93A 1IRFA 1MDMB 2STTA 1YFUA 1GXQA 1CAVA 2Z33A 3DPLC 2O0YA 3H3ZA 6PAXA 3BOQA 3C1DA 4IRHA 4QXKA 2FF4A 2L54A 2ZNYA 2P7CB 1SD7A 1TW2A 1BC8C 4OMYA 1HQCA 1K79A 1XGSA 5CVJA 3ES4A 3K0LA 1YHFA 2EFPA 1QZYA 2MNGA 3BB6A 1FYMA 3D82A 1REPC 1R1VA 1Z6TA 2EA4A 1TNTA 3I59A 4GYIA 4L9NA 1JE8A 2HGCA 1SEFA 4Q0PA 2EV5A 2KRFA 2COMA 4XETA 2VOOA 1FXZA 3FM3A 3L00A 4OMZA 3VHRA 3LAGA 4ESFA 4IJAA 4G7HF 1DPUA 4G7ZF 2EFQA 5L3CA 1G3TA 1XDUA 4GCVA 2IXKA 4HLYA 4YFXF 4JK1X 2OZJA 4MHGA 3PQKA 3ZMDA 4LD5A 4L5IA 4WWCA 2P7VB 3SHFA 5DD4A 4HSJA 3RJPA 4L0YB 2F2EA 4ESBA 4HA8A 5BUVA 5I91A 1U6GA 5DCMB 1LVAA 5JFRA 3USSA 3L9FA 4GULA 2F5FA 4RGSA 3GFMA 1J9IA 4FHTA 5LBQA 1SQ4A 5JI6A 4YNIA 3BCWA 1NYWA 4L9TA 3P9IA 2G7UA 2OZ6A 3ABTA 2YX4A 3M9AA 3E5UA 1IRGA 4ZYGA 4HN0A 3PVBB 2FOKA 1F1ZA 2GC0A 3D0JA 4FBFA 4LLLA 2MHFA 3IRRA 4KMUX 4AIKA 3F23A 4I2OA 4IEQA 1LNWA 1U3EM 1QXRA 3GW2A 2KXLA 3ZQ7A 2C0ZA 2O61A 5DYMA 1RNLA 2IW5A 1WQ2A 3T8RA 4LJZF 1B6AA 1GXPA 4WXHA 2A68F 3IWZA 4PZJA 1HBXG 1IAWA 4R79A 2GC2A 4KFCA 4A6DA 4KL1A 4ZYEA 5D5XB 2E1CA 2M45A 5KHIA 2LDUA 3HHHA 2R3SA 1V4RA 4TLFA 2NYXA 4RB1A 4KYWA 1IZ1A 1J7KA 4A12A 2DCTA 1BOAA 1X8EA 2DTRA 4WK8F 1J1LA 3WTUC 4RB0A 4B09A 3NRVA 5KHJA 3OOPA 1QNTA 3G73A 3WG9A 4P96A 1ZVFA 4L5JA 5CVRA 5D8KB 2DO7A 3QOPA 4QMAA 1IN6A 3H7JA 2GH2A 3RYPA 1O3RA 3C3WA 3QU3A 2QCSB 3I7DA 5C6CA 3MZHA 4LUMA 2DAOA 3HSFA 2VC0A 5AVPA 1ZZBA 3P9CA 3FMSA 1QQIA 2XAJA 2B0LA 2FNAA 2PAKA 3QACA 4L18B 1FSEA 3BU7A 2QYOA 1HW1A 1O7FA 3IRQA 1MDMA 4E70A 1MKMA 2X0LA 4Q5SF 3BPVA 3W6KB 2P5VA 1O4TA 1SFNA 2OYZA 3NW4A 3NKTA 1IN5A 2VBXA 2QWWA 2HYFA 2WV0A 3T1BA 1F9NA 2VONA 4A2UA 2MC3A 4XRFA 1SFXA 5F6FA 1X7NA 3HRTA 1F5TA 1W5SA 4AVPA 2M8EA 5FB2A 2IXJA 2GXGA 2ZNZA 1O3SA 4KWJA 1EH7A 4K8FA 4IHSA 4Q29A 4AIJA 5CU1A 2VOPA 1ZLKA 4MUVA 3R60A 3VFZA 2OAZA 1DUXC 3N97A 2Q0AA 3IKTA 1O3TA 3MDPA 5D5WB 3IDCB 3WTYC 3OCPA 4GXOA 2IJLA 3WW3A 1R36A 4HSLA 3E6DA 4HX4A 1OYWA 2QVOA 1Z9CA 1FT9A 5H6QA 3L7WA 2K9ZA 2PAEA 4I0BA 3K9TA 4P5OA 4RGRA 4HV5A 4I02A 4YFNF 4AXOA 1R1UA 3HOSA 3OD0A 5DCMA 1RL3A 1SFEA 4RAYA 2E9QA 2EV6A 3KP4A 4BXUA 3H50A 2RVCA 1BI0A 1L3LA 2QQAA 1O5UA 2O3FA 1WSUA 4PIXA 1YW9A 2F5DA 4YG2F 2FU4A 4YARA 5IT9Z 1ZZCA 1VP6A 1EV7A 4MTDA 4Z07A 5DCFA 4WX9A 4CYDA 4L9JA 3J80K 2G9WA 1OMIA 3NJZA 4RB2C 5LEJA 3M1EA 1GHCA 1P6RA 3DF8A 4FAGA 5JR3A 1CAVB 3WE2A 3F8BA 4R8HA 4EVIA 1XB4A 5E8IA 2JTVA 3H9AA 2IPQX 2ELHA 1ZNPA 3FM5A 5I8SA 3LQRA 4S04A 2UXXA 1IPJA 4M6YA 1KQ9A 5FPXA 1WLTA 4KWLA 3MQ0A 3BJ6A 4G94A 4ENMA 3DP7A 1J3PA 4MGZE 1R7JA 4M73A 5T3NA 3IIAA 1R58A 4ZU5A 2WWYA 2QLZA 2HOEA 2M5WA 1XSXA 3ZP5A 4FX4A 3E5XA 1TQPA 5EZWA 2DLLA 1T98A 3J81K 2MLKA 3GEZA 1FNNA 4MZUA 4XBFA 4XF0A 2VT3A 4EJVA 3JSPA 4LLOA 2XAHA 2R7DA 1Z7UA 4U7DA 1GQHA 4YRDA 5F64A 1HW2A 1ZLJA 3M7GA 3K69A 3QU6A 4AQ2A 3CLPA 2J5OA 2EB7A 4AD9A 4MV2A 3MZYA 5DD8A 2G7HA 3L2HA 4XF1A 3PNAA 4EJWA 4MH0E 3LA2A 2HR3A 2IA2A 3LWFA 4R52A 1W5TA 2JZYA 3P7NA 1BI1A 1OFNA 4F8AA 4LK0F 2KKOA 4X6RB 2XKOA 3E6CC 2ETEA 2HFHA 1CF7B 5EFUA 4KNYA 4AVAA 4KIBA 3IHUA 3ERED 1W7PB 4K2EA 3EQEA 3FE5A 1EH6A 3TDZC 3C7JA 1YS6A 1QWRA 1F4KA 5CLSA 3SHRA 2EAAA 1KU9A 1T0FA 4YYOA 2ZBKA 4EGYA 2DK5A 3UKNA 1C0WA 1XMKA 4DQ2A 5D4SA 3C3VA 1YG2A 3SZTA 4EM0B 3LA3A 3SZPA 1KQ0A 2V6CA 5LRSA 1RC6A 1EY2A 1JXSA 1Z1DA 2TDXA 5FLHA 2PHDA 2PBIA 3ZMUA 4XEZA 5DEQA 3DXJF 1ZRDA 3ULQB 1QXJA 1FBQA 1MGTA 1KU2A 1FYKA 2XAQA 4WBBA 2BV6A 3F72A 4G6DA 2L4MA 1XCBA 2HS5A 1S29A 1Y9QA 2DBBA 2HYGD 2P5KA 4CDGA 5FQ0B 1ZARA 4M6XA 1SFUA 2Q30A 4M9SA 1CGPA 4Q4ZF 1LDJA 5H6RA 1ZRFA 3EQLF 2ATFA 4MEXF 1K78A 1XMAA 1FBSA 2XASA 1J2XA 4XF3A 3V4GA 1LJ9A 3WGGA 4FAHA 3V7SA 1HKSA 5LGTA 1ZREA 1J58A 3GXOA 4KA4A 4IXAA 3WTXC 5FDBA 1YFWA 3CJXA 1IXSB 2OA4A 4CHUA 1J59A 4IEZA 5E20A 3Q9VA 5BOXA 3KE2A 4KT5C 3WTTC 5K5QA 3HSRA 1J3RA 2QDRA 3IBMA 5BV6A 4IERA 4HQMA 4I09A 2PAMA 1XE8A 3ETQA 2O1QA 2H09A 5BS6A 1DGRA 1LKNA 4MGIE 2W84A 1YWKA 1FOKA 3SCHA 2K27A 2FRHA 3DV8A 3BALA 4RGXA 1SD6A 2ZMEB 3BZ6A 4MGKE 3U2RA 2A61A 3E6MA 3O3KA 4E2QA 1Y3TA 5ICFA 2D40A 2QM3A 1NE6A 1R23A 3HYIA 4BH9A 4HBNA 2WTEA 3T8TA 2IRFG 1V70A 2VT2A 2B5HA 5D6FA 3RZZA 4META 2ZKZA 3I58A 2IA1A 1YFXA 2NS0A 4OOIA 3U10A 1FX7A 1W4MA 1HW5A 4LLGF 3IC7A 5DDGA 4LUKA 4IEWA 2K4BA 4Y17A 4Q0VA 4AQ6A 4AVCA 3FHIB 3CJNA 3QP6A 4LK1F 3HRSA 1CAUB 2D5HA 4LA2A 2PI0A 3ZPLA 3EYYA 2EA7A 1T38A 4R1HA 3WODF 2GZWA 1OR7A 2OA2A 4XSXF 3W6JB 4PDKA 2W57A 4O5VA 3FHZA 1T39A 4BIFA 5JAXA 3KMHA 1MJ9A 1IN7A 2PA7A 3KLNA 5KK1A 1XGNA 3V8KA 2Q8KA 1HXDA 3I53A 4GYGA 3FMRA 3GUDA 1ON1A 1G3YA 1DZTA 3S7IA 1HKQA 4H7LA 3KP7A 2VN2A 4L2NA 1S7AA 2XGXA 2A07F 2PHLA 4ZZLA 1FPQA 4O6JA 2VE9A 3G7DA 4NB5A 3ELKA 1EPZA 3NQOA 3RPUA 2Q2EA 1R5HA 2VBWA 1U5TA 1CF7A 2IT0A 3NL1A 3SCGA 3HT2A 1P4AA 1OI6A 4ZYDA 2OQGA 1W7PA 3BWGA 3ZDSA 3F3XA 5A2QZ 2V1XA 1P2FA 4KIGA 3CEWA 2Z9OA 5JCTA 1UD1A 3F6VA 3U0ZA 4HF2A 2UZKA 1IXRC 5KVRA 3PFIA 3HUGA 1UHMA 4ESJA 2QNKA 5FO5A 3KZZA 3KP6A 2FQ3A 4XF4A 3ECOA 2MPFA 1I27A 4BAYA 3QRFF 2D1VA 2OBPA 2KIMA 1K6OA 1X3UA 1Q1HA 4A0ZA 3HHGA 4S05A 2IXHA 4OIQF 2A69F 2ISZA 4AVBA 5ERIA 4IEVA 3KLOA 3CTAA 2QUFA 1UCXA 2DT5A 2OU2A 2UWMA 4QLCU 4BQAA 4KWKA 5J8FA 3BY6A 3LOIA 1PDNC 5FQ0A 2L02A 2LKPA 4U0YA 2DQLA 4A0YA 5LHGA 4QGNA 3T0YA 3TQNA 1ZRCA 1KA8A 2A3SA 5DV5A 1EH8A 2K0GA 1CX4A 3GZ5A 3QPTA 2XL9A 3TNQA 4WCGA 3EETA 2XHKA 2V1DA 5J48A 4EGZA 2E7WA 1LEAA 1X8MA 4EWAA 4RD7A 1ZZ8A 4UUVA 2E7XA 1EYBA 1LR5A 3VB2A 5KHGA 2B9UA 1USSA 5TRDA 1FY7A 5LHHA 2NNNA 4D0PA 3KEQA 2O8QA 2XIGA 4MEYF 2ZKLA 3D5LA 3TO6A 4QWQA 5D4RA 3RYRA 2JPBA 2H27A 2YU3A 3NEUA 4QM8A 3KCCA 1ZGJA 4IRIA 5BXXA 4QGLA 1R1TA 3EO6A 5LGUA 3COAC 1IUYA 5JSOA 3GYHX 2ZMEA 4LLNA 2E1NA 2GXBA 2Y0MA 1ZRRA 4QX5A 3E6BA 1Q5OA 2RGVA 2DQRA 3T5XA 5BQTA 3WW2A 5ILVA 4P55A 5FLXZ 1UCRA 3TOBA 3CO7C 4UBHA 3H3UA 4AIHA 2ZJ2A 4TV7A 2JSCA 3E3VA 5HS8A 2FEZA 5L3FA 4L0ZB 4Q47A 5CVVA 1SMTA 3WE3A 2GC3A 1YO5C 3I64A 1GQGA 1ZZ9A 4NHJA 3MCZA 1G3WA 1XD7A 1CAUA 1RIOH 2HKXA 2H6BA 1D5VA 3TNPB 4LEJA 4ZH4F 3GX4X 4KIFA 2IXLA 1ZG3A 5FPZA 2PN6A 2CYYA 5ILUA 4ETSA 5J3UA 1I5ZA 1RUOA 1TLHB 1U5TC 3GFIA 3JZVA 1U78A 5I8TA 1ZG1A 3DFGA 3WTZA 3JAMZ 3E5QA 1LQ1A 5HDNA 2A5YB 3HRMA 3L09A 4HV6A 1K78B 4A5MA 4B8XA 4A5NA 2JT1A 3CDHA 3V7RA 2PFBA 3R0AA 1BBYA 2MH9A 2XROA 1PM7A 5K1YA 2QQ9A 4DINB 2ESHA 1IN8A 2VXZA 2D93A 4EM2A 3MFKA 3WU1B 1V3FA 1S3JA 2PMHA 4YSFA 5IT3A 4LTAA 3PLQA 2P6SA 5ICGA 4H0EA 2R7FA 2V79A 4OU0A 1I1GA 3JSOA 2VPVA 4G6QA 3Q5FA 5FD5A 1BI3A 3EUHA 2GC1A 1DDNA 4UNOA 2C6YA 2GQQA 1ONVA 2GWRA 3FX3A 3WTSC 3TDUC 1H9TA 3I0TA 2HDCA 4KN7X 4GO1A 3RTRA 4M9XA 2FXAA 3MAJA 2X4HA 3V7CA 3LSTA 4N9HA 1R22A 3FXQA 1KYZA 4WXDA 2CWEA 2O03A 2CO5A 1UHWA 2B8MA 2EFWA 1H1IA 4ZYHA 3GZ6A 1XDSA 3K1NA 4P9GA 3QPHA 2KIFA 3HSEA 5LEKA 1IN4A 3GFJA 4KUMA 2ADUA 4HLTA 1VJ2A 4M71A 5J6XA 1UB9A 4MNUA 4DNCA 3OGJA 4JV4A 4BHPA 1AWCA 1BM9A 3HT1A 2MD5A 1Q43A 2HQNA 1SMYF 3GYDA 2RQPA 1DPRA 4O9EA 4CICA 1D8KA 3EHKA 5D6EA 2RKHA 2AS5F 5FGMA 2UYAA 3ABUA 2FSWA 3KGZA 4ORFA 2HZTA 4I0AA 4XLNF 3RI4A 2VODA 3HIFA 1WI9A 2PYTA 1DGWA 1PP7U 4EJTA 2PFWA 5HDKA 5HI0A 2CFXA 1XSVA 3HTUA 4M74A 1EP0A 1U5TB 4A6EA 2FMLA 3V8LA 1NE4A 1U2WA 4Y15A 3DN7A 4CO8A 3RYKA 4IF4A 4UXNA 3P9KA 5L3BA 2GU9A 2NRAC 4YIFA 3EBRA 2EWNA 4UV9A 1WA4A 1A04A 5HVQC 5L3DA 1D3YA 1XSDA 2DPDA 2K7LA 2H94A 3GWZA 3SMHA 4HW0A 4I98B 4XSZF 5FLXK 1GVJA 3ZN0A 4MGYE 4HYEA 1SAXA 3SFZA 2ACJA 2CW0F 3E97A 5AIQA 3FZVA 5E17F 3OTFA 2ZCWA 5H20A 3DEUA 1IPKA 1I6XA 4QM9A 3KP5A 2ET1A 1E17A 3H1YA
chains in the Genus database with same CATH superfamily
3THPA 2DI3A 1NG0A 5KC6A 2OTLI 3LZZA 1FMWA 3J7LA 2YPRA 2VLAA 5K8SA 1KU3A 2YROA 3V0BA 4MFDA 4QB2A 1QJU3 3S7EA 3GTJJ 2Y33A 1NUKA 1RUC3 5CVUA 4WVZA 1US3A 1LTEA 4QX7A 4MHUA 3OUHA 4XN3A 1QY4A 2MGQA 3S5QA 1EV12 1TME3 2R93J 4U0VA 1O4XA 3GTGJ 5H9PA 4N7IA 4DUXA 1ZN2A 2ESNA 3LQQA 1LU2A 1O3QA 2DOFA 2JVHA 2ZGRA 4LBMA 2P3KA 2YY1A 2WBMA 3O1OA 1OISA 1JTXA 4XF9A 5CYYA 4XFIA 3MPBA 5A3NA 4NQWA 4XDPA 2K2SA 2Q0OA 4HF0A 2BHYA 3N7KA 2WB1N 2Y6FA 1LHNA 5F6KA 4UB8C 3L2UA 2O8OA 2GIZA 4C9YA 3IDBB 4PLOA 3K51A 1Z91A 4DOZA 1V9U2 3DPTA 4CDXB 4GB33 4Q4X2 4CCLA 4IQPA 3N9NA 1FAYA 4WZCA 3W6VA 1BIAA 2VI6A 3AMHA 3SKVA 3W2VA 5GZGA 1LJ7A 1VMJA 5A32A 4XPVA 1Y0UA 2AUYA 1NK3P 3IKVA 1TMF2 2UY8A 4I7HA 3CCEI 1OLTA 3JUUA 2XJQA 1OF4A 1G7YA 2X5IB 3EXUA 5H9RA 3U1KA 2DN0A 1S4CA 3A22A 4XUNA 3RZKA 3SQOA 4X6AJ 1TBXA 2QENA 2CQNA 2FNPA 1ON2A 2LYCA 4GMP0 3L2VA 1VRH1 1IPSA 1RZ4A 1P92A 4E2SA 1BW5A 1K4TA 1DP7P 4M4RA 1PGSA 3ZSKA 4KNCA 5ANNA 5F9TA 1POGA 4QPIB 4QD2A 3VZLA 3ZMNA 2P37A 2F4IA 5F1RA 5AC93 5D5VB 5FPUA 2V26A 5HLHA 1MEC1 4D3WA 4LMYA 2DMUA 3EYPA 4GWMA 3ENRA 5A7WA 1G59A 2JDKA 3L2CA 4XL9A 2YR2A 4JAAA 1VZ0A 5DABA 3GCXA 2HWVA 2OUJA 3FIWA 5ABJC 1U8BA 4ITCA 3IAPA 4IPAA 5LRRA 5T5LA 4XLHA 2HTJA 4PI0A 4KDPA 3SXWA 4L8QA 3KSCA 2AXLA 1OA3A 3BJOA 3FUOA 2NVTJ 2QBXA 5L7OA 4Y20B 1Z7S3 2WSUA 1ZAOA 3R4UA 4C91A 5CADA 1MS8A 1GOGA 3ZFFA 1ZYRF 3FXKA 4HK9A 2UY9A 2VECA 1J0RA 3VZMA 5JR7B 4MGQA 4KN4X 3O8HA 4LHNA 5FYBA 1YRNB 1DBNA 3FWEA 1P4XA 4IEPA 4PCQA 1COV1 3K4AA 1YW7A 3NV3A 2DFHA 4BMBA 5T54A 1LOFA 1Q3EA 3HKZN 4BE2A 3KGLA 4IGQA 3VL8A 3LIHA 5DAWA 4D6RA 1MJBA 1OYYA 2XGEA 1LRHA 4CCJA 5LK5A 2HWB1 2BPA2 2QJVA 3WU2C 2XQXA 4NO4A 3GFLA 2AHQA 1R71A 1XMXA 5E1WA 3C18A 4XABA 4OHXA 1F8VA 1QO0D 4B4PA 3O6BB 1HRV3 3ELNA 3VD3A 3HOZJ 4Y52J 1CONA 1AR61 5IVYA 1P7IA 2W39A 1TL8A 5EHDA 5F0CA 3HWJA 5SV5A 4DUVA 3CO6C 2KT0A 4QPGB 2QSHX 2SLIA 4EJUA 5FPLA 5I0UA 1QEXA 3VKMA 4NIHA 2K9MA 4AGVA 3DL3A 1S0CA 2CUZA 2DUOA 5T5PA 4D0QA 4AW7A 4LA3A 3OPTA 4FPEA 5DN2A 1POV1 1VQOI 4ENNA 1VBB3 1E5IA 4R9CA 4BNCA 1J3QA 3NVCA 1HXS2 3NSTA 4CCNA 5FYVA 1R083 3FC0A 3NV1A 1POQA 4XKCA 1GNZA 4E7IA 1STZA 3CP2A 5HLIA 1D2SA 5LGNA 2HYKA 1K5MB 4LKDA 3OS2A 4PQ9A 5AIPA 3TKYA 2W3JA 2Y6JA 5J1YA 1K12A 2ZGQA 2GXAA 5GPAA 5CVIA 4B44A 1QDCA 3K2OA 4BQ1A 1D1AA 3KZYA 1WLWA 1P7JA 2RDPA 1KJLA 2VKDA 3VEPA 1SMVA 1S7EA 4Q4W1 3TBDA 4UF0B 2PELA 2Z5UA 4P14A 4K6BA 5IHRA 4W4ZA 1YLLA 2LNBA 1Q8OA 1SCRA 2F4OB 2DA3A 1UZCA 1FC3A 4CEWB 2VW0A 3TN93 1XNCA 5FZHA 2J1EA 2PMUA 1PVXA 5L7OC 4LK6A 1JZ6A 1HRI2 4C3HJ 2Q5TA 4AGGA 1CD3G 5FP9A 1POV0 3ZFFC 4O3MA 1VFCA 1E5RA 3FXJA 1ZA4A 4YVWB 3WG4A 3I4MJ 2LLKA 1AA7A 1XU2A 3O1PA 5E1XA 4OFGA 3MEXA 1Q8VA 1ZGAA 3U9GA 4HBLA 1RVF1 3I2FA 3NWTA 1IXCA 1JYVA 2MA3A 2LTPA 5A2QK 5HLTA 1CAXA 2ZTNA 3O14A 4XMIA 2MLGA 1LOFC 3BDDA 3BYWA 1MS1A 5L9RA 1FBUA 3I3EA 3K3NA 3TEDA 3SLIA 4MFEA 4MTEA 1FOWA 1FMD2 3G1OA 3KS7A 3VDAA 4YM0A 3VZKA 1ZBE2 2Y0OA 3WHBA 3ILNA 2OT7A 5ERLA 1W5CC 2XWBB 1FNZA 5M3MJ 4XRSA 1P8JA 2LALA 2UWCA 1W2AX 2FBKA 3GO5A 4NBQA 4XBNA 3ZMZA 2W08A 5F5QA 4LG0B 2DU0A 2DDBA 3BQYA 1MBGA 5EG0B 4MQVA 3CIHA 1JH5A 5FP3A 4EZHA 4BQXA 3PQJA 2MEV1 1DGWY 4COWA 1K3IA 3FL7A 5DUKA 1OCOH 5CYVA 3KP3A 3I59B 4XFFA 4TSVA 3LPGA 3BZCA 3GXUA 3X29B 2Q4SA 2GP5A 4AAXA 1G8XA 4G4FA 2IXSA 1XE7A 1LEBA 3LSMA 4KBZA 4H3WA 2X8KA 1URXA 3RKYA 4XUPA 5L19A 1UY3A 3OYDA 2VVEA 4QQPA 2ET7A 1NLSA 1O8SA 3VV1A 5E1ZB 1NTCA 1BK1A 2D3PA 3RWKX 2VCMA 5ILSA 2XUMA 4ENJA 3OG2A 5KBFA 3IL2A 3VYTB 3FF5A 4XLPF 1C4RA 4AE2A 4UVCA 5E8AA 3QP5A 1IW7F 3WDWA 4RS5A 4LULA 1AYN1 3EJKA 2YGMA 1YI7A 3RGBA 3GF2A 4D69A 5GLVA 4XHXA 2EQRA 2IS4A 3KETA 3NJYA 4CXWA 5F32A 3ZGKA 1JXNA 1Q8PA 2QKDA 3DYMA 1TWHJ 2F4PA 2WJSA 3JR9A 3CUOA 2A6HF 5BPDA 2C5DA 2DYSH 2QE3A 1Z78A 1P9QC 3LAJA 4K3UA 1ASJ2 1MEC3 1AX2A 2A6YA 2HPIA 3BU0A 2STWA 2ID4A 2XLGA 1B59A 4B47A 1D4M1 3RQ0A 2JN6A 4YEJA 4JBAA 3RPUD 2RDRA 2UYBA 3BT9A 1CJDA 2W9XA 1XC5A 1FOYA 4IV3A 1R1A2 2YU1A 2ZEWA 1B8IB 2XLAA 1TC3C 4AC0A 3K7AJ 3ZIWA 4FQ4A 2DTZA 4S2DA 4AFAA 2YHJA 2OQ6A 4LBNA 5GAHJ 2X48A 1OURA 2CFOA 1ULYA 2JQ7A 5APAA 3D5RC 2FMYA 2P2KA 3S8PA 1XGOA 1Z05A 1WBFA 2DFIA 4ASKA 1Y8QB 3B02A 3JBG2 5EZHA 4IEUA 3FHNA 5CJ9A 1AXZA 4TN7A 1KDKA 2JA7J 3VODA 4FX0A 2EINH 2Q1ZB 2X53S 1TQIA 2W85A 1UX6A 3PUAA 3N05A 3JRDA 4YLZA 4FP3A 1COV3 4RLQA 4PGGA 3D1NI 4GH4A 1XG1A 2WAOA 5A6QA 2XUBA 1JUPA 1RITA 1UPIA 1D8JA 4XLFA 2E60A 1FTTA 1ZX5A 4RHV3 2PJPA 5T50A 1UW8A 5E16A 1LDKB 2VTXJ 3B7MA 2STTA 2E2IJ 1LGCA 2W92A 2HWB3 3RCOA 3CCUI 3S1QJ 5E3NA 5A6YA 2O0YA 5FWJA 3H3ZA 3C8XA 3C1DA 1ETVA 1RR8C 3ACGA 2JE7A 2C24A 3L2QA 2CYFA 2ZNYA 5FZIA 1SD7A 1NX9A 1HQCA 5EJCA 4M3FA 3BB6A 1QZYA 2L9SA 1REPC 1AR63 1VQ7I 3M3OA 1TNTA 1RKWA 4XYXA 3OBTA 1JE8A 1SEFA 2LY1A 1WGXA 3WQ1A 5B4NA 3DF0A 3O1TA 2VOOA 1FXZA 1Y8RB 4OMZA 4QQOA 4ESFA 3AP7A 1DPUA 2ARAA 2C4XA 4RS5C 1AR92 2EFQA 5L3CA 5FR3A 4GCVA 2OZJA 2VULA 3PQKA 4LD5A 1EAH2 3R05A 1POV3 5DD4A 2WINB 3OY8B 3S16J 2Z1DA 3E0JB 4L0YB 1OLQA 3PVNA 5ACA1 5DZEA 4ESBA 3HBLA 4HA8A 5BUVA 1U6GA 4CUGA 5IY5H 5JFRA 4BQOA 1VQ9I 2F5FA 2WN3A 4PF1A 4FHTA 5LBQA 1SQ4A 5KXCA 2NOJB 2WNUA 3BCWA 3ZXJA 2R4GA 3ASOH 2OZ6A 5A3MA 2VMFA 2YFUA 4ZYGA 4HN0A 4IV3C 2FOKA 3D0JA 1YIJI 2ZFUA 1W6NA 3PDQA 3NNJA 4RBOA 4HKOA 4GALA 5CFDB 3F23A 4QHBA 3QCWA 1W0UA 5CKTA 3ZSLA 4PFPA 4JYKA 1LPQA 3GLLA 1J84A 2C0ZA 3POYA 2M34A 5DYMA 1RNLA 2XVLA 2JG8A 3T8RA 5IW0A 1EUTA 3BTLA 1GXPA 3IWZA 5GZDA 3KCYA 3WCRA 2LD5A 4Z2WA 3B3QE 4QU1A 5LBBA 2JB8A 5KHIA 1KS5A 1V4RA 4TLFA 4UW3A 1T2XA 4NIAA 4CPBD 2ZGKA 1RVF3 1RR7A 4Y1ZA 1BOAA 1X8EA 4GWNA 4GH4C 3WTUC 3ZSMA 2W46A 4XM3A 4B09A 3NRVA 3SEQA 4NAMA 1YQ8A 3G73A 4L5JA 3FUQA 1UAIA 2E5ZA 2WYSA 4GKXA 1R093 1N47A 4QMAA 5FZBA 5F0FA 3H7JA 3WR0A 3IIIA 1NCRA 1Z3XA 3CQZJ 2GNDA 2COBA 3CD6I 4LUMA 2GOMA 2DAOA 3HSFA 3S15J 3R0RA 4YW4A 4HKWA 3FMSA 4CYCA 2FDIA 2WKKA 2PAKA 3RS6A 1HW1A 1O7FA 3IRQA 3GALA 1MKMA 2JD9A 2F4LA 3UNPA 2MEV3 2OKXA 3NKTA 2H8WA 2WWUA 2RS12 1IN5A 2LREA 4TWTA 4QPOA 4LR4A 5SV8A 4CU9A 3B94A 4A2UA 4YFWA 5F6FA 3A0HC 1X7NA 1F5TA 1HC8A 3RRDA 3S3MA 1W5SA 1WZXA 2QSFX 4KWJA 4L0PA 4IHSA 1QNYA 1W1WE 5FKMA 3SEEA 3A2KA 3VFZA 2L7KA 3N9QA 3IKTA 1DQ1A 5D5WB 4JX4A 3WTYC 3OCPA 5C4WA 5JR2A 5FXWA 3WW3A 1NH3A 4CCEA 2G9GA 1GR3A 1QOSA 3SH3A 2WNUC 3KEYA 3K4CA 1OYWA 1C8M1 1S2BA 4BGDA 3ZVXA 1STMA 3FN9A 3QYBA 4GWIA 3K9TA 1RHI1 1N75A 2KD7A 1AYN3 4E4ZA 4XZPA 4RYDA 1QDOA 2WIIB 2Z5WA 4D1QA 4ES8A 4C2UA 1HX6A 4XXAA 1Y56A 3OD0A 5DCMA 3C7FA 1SFEA 3KT4A 2WZR2 2E9QA 2OF7A 2AACA 2CSGA 3AP5A 4HPKB 1H4HA 4C3IJ 3RJRA 1EF4A 2I10A 2XWJB 2FU4A 1YHQI 2VMIA 4YARA 2JG8C 3WF3A 1ZZCA 1EV7A 3BG9A 4MTDA 4H7MA 1BBT1 5DCFA 1AL21 1LODA 1W8HA 2NYYA 2RM22 1V5GA 4FPCA 2G9WA 3NJZA 4PT6A 2WNEA 4XNFA 4FAGA 5JR3A 4COUA 1CAVB 2OC6A 4R8HA 4Y4YA 1XB4A 1IGOA 3WNOA 2RS32 1E3HA 3HB9A 5C8CB 3JU9A 2M3AA 4A3GJ 1XNTA 1GBGA 1WJBA 4C2MJ 3ZYGA 3HD8B 2UXXA 3MIDA 1IPJA 1SVMA 1KQ9A 4F92B 1V6KA 4P9JA 5JI7A 2BQPA 1R7JA 3CCLI 3IIAA 1OC1A 4L97A 4AYUA 4LBOA 3WG1A 2H1KA 4QX3A 1DGWX 1NCRC 1W06A 3EUAA 3E5XA 5EZWA 1ETWA 1OUXA 4FPJA 3DBHB 1T98A 2MLKA 2Z79A 1VQMI 3M3CA 4YGCA 1WCKA 3W2AA 4XF0A 1ND2B 2QZ3A 4EJVA 3JSPA 2Y0SA 1VQ5I 1Z7UA 4U7DA 5EGOA 3MO4A 4Z92B 1EUUA 2W4SA 3K4BA 1WW4A 5CIRA 5BNPA 4KBBA 5FMCA 1OQEA 4L92A 1W2UA 3BG6A 3MZYA 4XONA 5DD8A 2VOTA 1S5LC 3ABMH 3L2HA 5FUPA 3PNAA 4EJWA 1JW6A 2BWAA 4GAZA 2ADDA 2X09A 4R52A 3HGYA 2HOSA 4XDOA 4F8AA 4LK0F 1ONAA 4X6RB 4I6ZA 1NG6A 4QB1A 2E5NA 4FXGB 1RUI1 4KIBA 3IH4A 1W7PB 2VQCA 4MGTA 2P0WA 1WFXA 2Z16A 3FE5A 3C7JA 1WWYA 5CLSA 3RSNA 5C4WC 1EAH1 1YJ9I 2VPLA 1XMKA 5D4SA 2B9VA 3VSLA 3OSFA 1KQ0A 1OJLA 1RC6A 3J7NA 1EY2A 2WQ4A 4ES9A 3C2HA 5FLHA 2PHDA 4XEZA 4K1YA 2QFEA 5K7PA 1MGTA 4J19A 5FKKA 2VOVA 3F72A 1FIPA 2DBBA 2W94A 2KZVA 4AEJA 4N43B 5J4YA 5ACA3 1RUJ3 4S2FA 3MV11 4M3CF 2GMPA 1UXZA 1C8NA 1ZRFA 3IAS2 3KB5A 5FLMJ 1K78A 4AWDA 1RXGA 3C7HA 4EQVA 2P3IA 3RFRA 4XF3A 3IUOA 1QOOA 2CWSA 4BU2A 4BM8A 1JOBA 1QQP1 5DM6F 1ZREA 3GXOA 4IXAA 1YFWA 4IEZA 2LY2A 5E20A 3Q9VA 1AL0G 5BOXA 3KE2A 5K5QA 4B48A 2JENA 4IERA 5C9AB 2L9LA 2D7FA 1HV0A 2QQUA 5DZFA 2IS1A 2FRHA 4C0HA 1SBFA 2PMZN 4OI2A 2ARBA 4CP0A 1SG3A 4RGXA 3BZ6A 2HEVF 5FZ6A 2A61A 1G2HA 4B1RA 4E2QA 1Y3TA 2WLPA 4UWDA 2E1MB 1HLCA 3POGA 3OPWA 4HBNA 2SBAA 1V70A 3MLLA 3VD4A 4XCBA 2B5HA 5D6FA 2YG0A 2NS0A 1HW5A 4DZJA 3BTJA 3VDDA 5GZEA 5FRNA 4JKKA 4BDZA 2DOAA 3P3NA 4AQ6A 5BNPC 3FHIB 3LEKA 2XSDC 2P34A 3I2IA 4NJ4A 2AENA 1CAUB 3OUIA 3G1LA 3ZPLA 2QQLA 4OVEA 4O61A 3V64A 5B1BH 4QHZA 4FE4A 1BZWA 2E2HJ 4Y22A 4ATEA 3SISA 1AJOA 3VBUB 3W6JB 4PDKA 3FHZA 1IG3A 2KISA 1T39A 4DY5A 4BIFA 5JAXA 3RZHA 4M0NA 3KMHA 1IN7A 4V2VA 1FOD2 4CEYA 5KK1A 2ZSIB 3V8KA 2Q8KA 4GYGA 3AG1H 3PJQA 3GBGA 1ON1A 1F5JA 5KWRA 2R061 2YFZA 5A6ZA 2VN2A 4L2NA 4UUSB 5F2WA 1FPQA 3ORJA 3NQOA 4QXHA 3VBRA 2Q2EA 1U5TA 5FY7A 1JU4A 2XRLA 5DMYA 1WJCA 2R7TA 4A3KJ 5T5JA 3IAM2 1QIQA 2JA8J 2OQGA 3F3XA 1ALYA 1P2FA 5ANQA 2Z9OA 3IT8A 3AG2H 3F6VA 5J3LA 2VCAA 2GM4A 1IXRC 2XR4A 4AU7A 2WO7A 1WH5A 4XF4A 5EYXA 4V2GA 5FO7B 1T6BX 3GTQJ 1MZ5A 2B42B 3MVPA 4BAYA 3ZDVA 1KFXL 5FZKA 2D1VA 2WFF2 2OBPA 3GHNA 1X3UA 1Q1HA 4F55A 5J1XA 4I30A 1UPSA 2LKSA 2VZSA 2A69F 4AVBA 5ERIA 1WMDA 2LW8A 4M01A 3WG3A 1X1CA 5IPAA 2QUFA 1C8M3 1UCXA 1YC61 2DT5A 4BQAA 1AJKA 1RHI3 5FPBA 1UY0A 4FOYA 4JKMA 5J96B 1QJX1 1OXCA 2D5VA 2VQTA 5LHGA 4BQ3A 1ZRCA 1GANA 2VGDA 1RMU1 2IVIB 1VBD1 1JYCA 3J9SA 4RQPB 3TNQA 4WCGA 5C4XJ 3ILRA 2V1DA 5J48A 4HANA 2CV0A 1I1EA 1PZ9A 4BWOA 1ZZ8A 5IVFA 1BBT3 1AL23 3VB2A 1USSA 3PNYA 3KEQA 3VBSB 2O8QA 4MEYF 2ZKLA 2QQPA 4S2HA 1PK6C 4LBQB 3CJRB 4E7ZA 4WV8A 3RYRA 2JPBA 1SLCA 5C5TA 3HG9A 4DUWA 1V5FA 5GADJ 3VDDC 1ZGJA 4NHKA 1HQLA 5BXXA 3ZCOA 2DU1A 3OIPA 1IUYA 3B00A 3WF0A 3GYHX 2E1NA 4A42A 3AL0C 2A3WA 3ZXKA 1Y1VJ 3E6BA 4M3CB 1Q5OA 2HQ5A 4ZDPA 5BQTA 3WNXA 5ILVA 2EXHA 4P55A 4YPJA 4N4NB 1H2MA 4HG6B 2X5IA 4UBHA 5JOWA 4AIHA 1JTZX 1PGW2 2ZJ2A 4XOPA 3TW6A 5B66C 2FEZA 2JDUA 1SMTA 4CEYC 1B72B 3WE3A 4QQ2A 1GQGA 1ZZ9A 3ILFA 3ZR8X 2HKXA 3CDLA 2NVXJ 5IWFA 2ERFA 3L2WA 1KJRA 1DYOA 3FBYA 3AKSA 4LNVA 5J3UA 3VBRC 1N78A 1AR71 1U5TC 3DBLB 4MXVA 1ZG1A 1PHMA 3E5QA 2A5YB 1AXYA 3IH3A 3KYDB 2IZWA 2WAQA 1OQDA 3CDHA 1LCLA 1XPWA 3ZQGA 1PM7A 5M5YJ 2QQ9A 2FDJA 4FPGA 1IRZA 2D93A 4EM2A 4LO5B 4OUMA 3WU1B 2CY6A 2EXJA 2NLRA 3WNNA 3B9IA 5IT3A 3GM8A 3K4JA 2BOIA 5ICGA 2VR4A 2R7FA 4JQRA 2OX0A 2IUWA 2BY0A 1I1GA 2VPVA 4PCRA 4BXFA 3Q5FA 5KXBA 3Q8CA 2GQQA 3PIJA 3LOCA 2XJSA 3FX3A 4W97A 3TDUC 1SFOJ 3PUSA 5A32B 2YBSA 3RTRA 2XF7A 3ZXLA 2PXJA 5JXJA 5A1FA 3MAJA 2X4HA 2ZMNA 3V7CA 1JKQC 3LSPA 3FXQA 1KYZA 4RFT0 1HKDA 3WQBA 1X3ZB 4XMYA 1A6QA 4HFSA 2UUZA 1AR82 3GZ6A 1VB4A 4P9GA 1PYVA 1HB4A 4R9DA 3DKQA 5GM0A 1V00A 1IN4A 5BNGA 2HWC1 3J8F2 2VVFA 3UGFA 1QQP3 3MF9A 4MNUA 2Z42A 2NQYA 4JV4A 4P5YA 1BM9A 3HT1A 1IDYA 5J47A 1MSFC 4NRPA 3K48A 2Y2ZA 4MHRA 1D8KA 1ZR4A 2W1OA 4UOJA 3S57A 4G9SB 2R7SA 1OSGA 3H5NA 5HXMA 2JJ6A 2JDMA 1NK2P 1XYNA 3KGZA 1VQ8I 3HIFA 2XF6A 2X5IC 1PP7U 3W20A 2PFWA 3OYAA 2RMU1 3LSHA 4E7HA 4H55A 1GKBA 4LOTA 4B7EA 2WT1A 2EALA 3V8LA 1NE4A 1U2WA 5B5EC 2JXAA 4EEFG 4CO8A 3RYKA 4UXNA 2GALA 5K9YA 2PLV2 2FBEA 1ODNA 4TZDA 5L7OB 5IAXA 5L3DA 1XSDA 2ZX0A 4IL7A 1D0XA 2K7LA 1H0BA 4QPIC 5C71A 4U87A 1SAXA 2C9KA 3OYEA 2ACJA 2DA1A 4BY1J 3OTFA 3WQ7A 1IPKA 1K5MA 1OA2A 4QM9A 2ET1A 3I2GA 1AHDP 3U4XA 4UFKA 1MNMC 1OCTC 3TEXA 4WXCA 1GUIA 4YZ5A 4FPKA 4AEDA 1TT0A 1W39A 1TWGJ 2CUJA 3ABLH 1FV2A 5CNAA 4YM3A 2D6KA 3OPZA 3ZXEA 3PIPF 4FCYA 3D0SA 2XLFA 1SD4A 2R063 3A01B 2EIGA 4A3CJ 5GLTA 4FOQA 1F43A 3SCFA 1PUEE 1WGPA 3Q0WA 1EA3A 3WG7H 1PVC1 3DYOA 3WDVA 4CEWA 2EXIA 5FZEA 1CPNA 2EXKA 3LDRA 3F8FA 4HDVA 5I8YA 1ULGA 2P5LC 3OYBA 4XR6A 1S72I 1O6UA 4XFHA 5IP6A 4QIWN 1NZCA 2VW1A 1YNAA 5EEHA 4ZU7A 1U5YA 4YVWA 4AWXB 4D7MA 4XFBA 2WB1A 1LEDA 4RS8A 3ABKH 2Y60A 3AM2A 1B35B 4R9AA 1UIJA 3I2JA 3JXSA 4N9IA 3ZYFA 4IX7A 2OZUA 2FCTA 2W87A 2E34A 4SLIA 4UFHA 1W9SA 3B6CA 1FLIA 2ZZJA 3OUJA 1G3SA 4AUXA 1O4ZA 1W36D 1OD3A 2X1DA 1RUE1 1BMV2 3HOTA 1OCRH 3PJYA 4K9SA 3R61A 2PQQA 3KFWX 5LBEA 5FFZA 3RZDJ 3IP4B 2YZ4A 3ECHA 4AI9A 1QJX3 4V19K 1DGLA 3K6GA 2ZJCA 1G9FA 4PSXA 2RR12 3THTA 1RMU3 4LG0A 2MFZA 2Y30A 5CPRB 1VBD3 5EXOA 3CKHA 4ZC3A 3CCYA 5E8GA 2VZQA 5A3OA 4NC8A 4QPGC 4Z1VA 1X36A 2W2IA 1DU3D 3LB9A 1BEV1 3H3VK 1SVLA 2RS51 3RIRA 2YX7A 4FVVA 3IMNA 3EUKL 3BN6A 1XXNA 1E2XA 3H0OA 5J36A 4DBRA 1T08B 4YELA 4IHVA 2ZGMA 2W25A 2K4JA 4GWJA 1R5GA 2ZX4A 1OCPA 4Y24A 3VKFC 1FPN2 3ACFA 3G71I 2OPWA 4LJHA 3DCQA 1V6JA 3M8FA 2HEOA 3H9QA 4A7ZA 2O8XA 2Z3YA 3EDPA 4RN5A 2NVQJ 1J83A 4UHTA 1K5MC 1R6RA 2EH3A 2OCEA 4CE8A 4IESA 3OEBA 4IKFA 4Q0UA 3SZGA 2F5CA 2ZFWA 2OPKA 1CAXB 2VCBA 4XN0A 3G6EI 4MO7A 3BPXA 3Q3SA 4AEDC 3Q0UA 2O0OA 1MPXA 1VBE1 1J5YA 2BE5F 2R5ZA 5D5UB 4E7KA 3VB9A 4Z82A 4GDFA 5H9QA 1TWAJ 5JXHA 3ZQQA 3TP0A 3VUOA 3BC8A 4YW5A 2OD5A 4E4DX 3HL2A 3QYFA 4PF5A 3F8MA 5HODA 3CNAA 1REDA 3J80Z 4CEWC 3ERMA 3LEIA 1GT0C 1FYLA 2QVSB 5D1IA 3GTOJ 2EIKH 4AVZA 1W0PA 3T2PA 3ST7A 2D44A 2VL4A 3H1WA 1PUFB 4LOCA 2QCOA 4YVWC 3MD2A 2A3YA 4QX8A 2ZOEB 2JD4A 3F95A 4EWDA 4YW6A 4IQJA 3M7AA 2ZC2A 3BTCA 3NAUA 3GTMJ 2VUJA 2RE9A 2BVBA 2ZGNA 3ZIXA 1IC8A 4HZFA 1K7AA 2L7ZA 1OFSA 1QZZA 4XFAA 2BZDA 2VOXA 4NE9A 5KAFC 3MICA 2XV4S 4EATA 2AREA 1KD7A 2XOMA 4P9UA 2BHZA 2EIJH 2RV8A 2FBHA 1B09A 2WABA 3UGHA 5IFTA 1RI7A 3GTPJ 2R0FA 1Z77A 3FLRA 3SYTA 2VC9A 3F8CA 1YFYA 4INDA 1V9U3 4JGZB 4A0XA 5DDJ2 2J5PA 2BBAA 3FZ3A 4A3LJ 4C3JJ 2XRNA 3LSGA 2WAAA 2VKEA 4RS5B 2BY2A 2E7QA 3KV4A 2R7VA 1R4MB 1TG7A 1NZIA 4OCTA 4OHWA 3WD5A 4LQRA 1YS7A 1LGBA 1BJAA 1OOPB 2DK8A 3RG0A 3JRIA 3W59A 5KC5A 4OMDA 3O1VA 2Y75A 2GA2A 2HWC3 5GZCA 5FZ3A 1OKRA 2RV9A 1RUC2 5C7GA 1XRUA 2JECA 3SXYA 3MLJA 4DJAA 4M3EA 4AHXA 5EJZB 5F04A 1FP2A 3Q9OA 3TRSB 3CMEI 2RNGA 4Y1XA 3HZJA 4IV3B 5ISLA 4EMSA 5CA6A 5L3EA 2OXBA 1IDZA 5GAEJ 3PVOA 3AP9A 5JHUA 2RMU3 2Y6KA 3KZIC 2DWRA 4X1EA 5E89A 2ZO4A 2YXSA 4GA9A 3OR2C 3WF2A 5FXZA 2E7AA 4BQNA 4GB32 1ACCA 4NIGA 4UXAA 1GUUA 3GBFA 4B4CA 4CA0A 2DMNA 4CZZA 2FCVA 3JRBA 5K0UB 2WT2A 1RPWA 2E53A 2PEXA 3G3ZA 3IWFA 5AONA 1YTYA 1PM4A 4IHTA 3I4PA 4Q4Y1 1IG7A 4R4XA 1S0BA 5FZOB 2V9KA 3ZQCA 5FCCA 4MGRA 3CF6E 4HF1A 4EQQA 4HNVA 3A23A 2JPCA 3WF4A 4XBQA 4GH4B 2Q1FA 1YQ6A 1JU3A 3LSDA 3DCFA 1YO8A 1OCCH 2VG9A 2BNNA 2KZGA 3O5SA 2P1BA 4QKFA 1GICA 3BROA 4YM1A 4EYUA 2A75A 5CFDA 3ZYHA 3ACLA 4GKYA 5CQGA 1H0MA 3AVRA 4JX6A 5F3GA 5M0TA 3I5UA 2UU8A 1N25A 1UOFA 3OYMA 2IXCA 3NO8A 3FHAA 5FPAA 3WDYA 2J42A 5ED4A 4E6KG 1OQ1A 2IBDA 1ENHA 3T0AA 1JYIA 2VKHA 2YS9A 2IA0A 1RTVA 1DZRA 3HPGA 3N9PA 1CX1A 2HVQA 5FP7A 2PN5A 3ZYRA 5CKNA 1O57A 5JIUA 4NHYA 4ZZDA 2W5FA 1RGSA 5B4XA 1BR2A 4BDVB 4UV8A 2VOKA 5DUUA 3RPQA 3K1MA 3VGIA 1TZLA 1VMHA 1L7RA 1RUE3 2JIJA 1Z7S2 4PLMA 2OQRA 1PO21 1SLAA 4P02B 3DPRA 3FBMA 1PJRA 3GJAA 1ND3B 1G9CA 3LAPA 1UIKA 5J4VA 5KHHA 2KJCA 3I55I 1USTA 4ASNA 3AZYA 5J1RA 5M3FJ 2CGPA 2XAFA 2YU2A 3C7OA 3FDYA 5FKCA 1RUG1 4DBQA 1YUDA 1CAWB 5JOZA 3WTWC 5BPXA 5E3LA 1BEV3 2L4AA 2LKXA 3QWLA 4U88A 3WGIA 2GP3A 2RS53 2MC4A 4I99C 2EPFA 1W6NB 2XBO1 2M1BA 2D45A 3M8LA 4LO7A 4NHXA 3POSA 3VDBA 1YOVB 3PNTA 3H36A 4MOAA 4Q27A 4AAPA 1DQ0A 2ZXIA 2HJIA 3QAHA 2E33A 3MFAA 4NROA 1ITYA 4YW1A 2RN7A 1IS4A 4EN6B 5A3UA 3SITA 1BN5A 1WWXA 1HRV2 2QTWB 4HKLA 1MZBA 4HAMA 2J1VA 1W7PD 4RA0A 4WF2A 2XVGA 4F93B 1J75A 2HH9A 1KXGA 2VJXA 1LHWA 4E7JA 3ZXFA 1FMVA 1XQNA 1ULCA 3FXRA 3DECA 4FFFA 3DU5A 4RM2A 1H8TB 1GP4A 1MH3A 2O6GE 3DKYA 1VBE3 1JN2P 1B9MA 2P8TA 5E18F 4HRIA 4EN0A 3MWMA 5CFDC 2F5EA 3ZMTA 1VBB2 4UAPA 2VE8A 3FJSA 4JZRA 3AKPA 4BDYA 4HPKA 1MQTB 2JDHA 3BP8A 3WGHA 5FYSA 1R082 5B2GB 1LESA 1JBCA 3CCRI 3HQXA 1D2QA 4OIOF 4X6QB 5CBLA 1B4AA 3K2ZA 4A7KA 1X1BA 5IVJA 1IF1A 4AZZA 3VHPA 4MSVA 2EFOA 1QF3A 2I2SA 4W6WA 2HXIA 1YFUA 3POWA 3FLPA 1CAVA 1VI0A 1FMD3 2Z33A 1PNGA 3QH7A 4CDUA 1ETYA 3H35A 5DS9A 2XONA 3GTKJ 2FF4A 2JE8A 2ORZA 4GFBA 3E1F1 1TW2A 4A3MJ 1BC8C 4OMYA 2X10A 1K79A 3ES4A 3DKXA 3K0LA 1VF9A 1NKGA 5FV3A 1R1VA 1Z6TA 3H8OA 3TN92 2RJ2A 4FTEA 3ZLIA 2XPJA 1G86A 3AYAA 2VD7A 2COMA 4XETA 5I0DA 4BJ5C 3ZXDA 2JUGA 1W2TA 3DPRC 1W8ZA 4GJZA 3JCIA 1KGYA 1W05A 4G7ZF 3H8XA 1U0AA 3BTYA 3OYGA 2DMQA 2DV9A 2DJIA 3OOUA 1TZOA 5F5IA 1ND2A 3KIOA 1MMGA 3B69A 5LA0A 1XNDA 1LGNA 1QJU1 2KQRA 2E26A 3TL4X 2HYXA 4WWCA 2QF7A 5KNLA 1W9FA 2J1SA 1NLRA 3FBIB 5C3QA 3A0BC 1D5YA 1TME1 1LOGA 5DCMB 1LVAA 2Y9YA 4BQ5A 4Y5TA 4LIUA 5IK5A 4YNIA 2BGOA 2VAUA 3IMMA 1NYWA 4MO3M 1X1AA 1AYM1 2YX4A 4D8MA 5F2SA 1IO2A 3E5UA 2CL2A 3PVBB 1F1ZA 2J1AA 1X9TA 3ZQLA 3K4MA 2DT7B 4YW2A 3IB3A 1ULDA 1SPPB 1LNWA 1JZ8A 2JWTA 1U3EM 3GW2A 2KXLA 3ZQ7A 1DP3A 1OA4A 1NY71 5D8AA 2K85A 4Y7NJ 2EZIA 2A68F 4FP2A 4PZJA 3I3DA 2YPDA 3FHQA 1HBXG 1IAWA 2WLQA 4R79A 1WVRA 4E4HA 5B3SH 5J40A 4KL1A 4ZYEA 3HMYA 3NAPB 2LDUA 3HHHA 4N43A 4XURA 4Z8BA 1OFCX 2NYXA 2HWF1 1K4SA 4KYWA 4Q4Y3 4A12A 2R30A 3I3BA 2DTRA 4ATFA 5IYCJ 4QDSA 1V6OA 3WNPA 1MVQA 4XVHA 4XQWA 1H89C 5C3EJ 2DO7A 3VYRB 4DY3A 4JOMA 4OYUA 3VYUB 5FJHA 1SCSA 5BNPB 2Z4FA 5AC91 5LY1A 3AB0A 1O3RA 2H1LA 5F8PA 2QCSB 5C6CA 3JRAA 2IS2A 4CDUC 4W1UA 3PHMA 5C9AA 3GJBA 1VRH2 4JX0A 2B0LA 4BBSJ 2FNAA 3BU7A 4LG3A 1G9BA 1I6HJ 4E70A 3BPVA 2OTJI 4K7JA 1SFNA 1MEC2 1DLCA 3NW4A 4AI2A 3CMAI 2VBXA 3ZKYA 2QWWA 2WQ8A 1NA1B 1OUSA 3MHZA 4XDQA 2XC7A 2MC3A 1ND2C 2B7EA 3HRTA 1XU1A 2M0MA 1KRIA 4DZPA 2IXJA 3THCA 1NXD1 2GXGA 1JHNA 4LBQD 5IP9J 1UX7A 2R071 4Q29A 5FRAA 3UESA 4AIJA 2XJRA 5CU1A 3R60A 1TNRA 5C44J 1DUXC 2W1QA 3MDPA 4DXRA 2X29A 1JZ3A 1YXWA 5FY0A 1NLQA 1RUH3 4CP9B 3LL7A 1S55A 4ZXKA 3E6DA 5HXVA 1LU1A 1PMJX 3ZOIA 1RINA 3LFUA 5LA1A 5H6QA 3L7WA 4XKVA 1W8NA 4OWRB 4RL7A 1VMFA 2F4MB 2VM9A 4CP1A 3TW7A 4URAA 3URFA 3OIOA 4I02A 4O7XA 3S3OA 3CDIA 2JDAA 1RL3A 4K8RB 4NPLA 3PSFA 2VE1A 3KP4A 1COV2 3O0WA 4BXUA 1RUF1 1RUG3 2TUNA 1L3LA 5T5OA 1Z3YA 3MN2A 4PIXA 1YW9A 4ASLA 3PTRB 5D8AC 2XBO3 5H9SA 2WZPP 5IT9Z 2QQNA 4F52A 1AVBA 5FZ9A 1VP6A 5JXIA 4Z07A 2HWB2 4WX9A 2VUDA 3BR2A 4IOAF 4QPQA 1BLZA 3RZGA 4L9JA 2FD8A 3J80K 3EB7A 4NDLA 1OMIA 2JEMA 3HN1A 3DLAA 1P6RA 3DF8A 1V6MA 3OSDA 4N43C 4QB6A 5A3LA 1V5EA 5GKAC 4Q2FA 4GXLA 4BBRJ 2VZUA 2CU7A 4JDOA 1SLIA 1AR62 2LVSA 1QJY1 1HF0A 3BUCA 2UWBA 5KXDA 4PLNA 4YM2A 3RI9A 5A6XA 4G94A 4ENMA 2DA7A 3DP7A 1J3PA 1H6XA 1R58A 2WWYA 4LKEA 5FWEA 2M5WA 1XSXA 3AL0B 2ZXHA 1Z67A 1TQPA 2WO3A 2H0BA 4D7NA 4NWWA 4AI8A 3UGGA 3AMMA 5C9AC 4XLCA 4OZXA 4XBFA 4YWAA 4RQPA 1AX0A 4K20A 2VT3A 4CCCA 4ASMB 1MBEA 4LLOA 2R7DA 3VD5A 3BLYA 3JQWA 5F64A 1HW2A 2ZMLA 4CEYB 1XC6A 4IZZA 4AQ2A 2J5OA 2EB7A 2HWD1 4AD9A 5G05L 5FZLA 5A80A 4BLJA 4MH0E 2DT6A 3VBSA 2RHPA 5LW9A 2XUEA 3BGAA 5J09A 2IA2A 3LWFA 4K1ZA 2ZGSA 4XUTA 3CCJI 4XXPA 1OFNA 1WCUA 4AI0A 2KKOA 2Q2EB 5H2FC 4Q4W2 1ST8A 2E32A 3RZMA 4KNYA 3LDBA 1YQ5A 1VBC1 1UYZA 3IHUA 4L99A 4UT5A 3VBOB 4M3CA 1R4NB 1W2NA 3HXLA 2L0KA 3I2KA 2HDWA 3S1NJ 5FZFA 4FTBA 3FKIJ 3M1HA 1OLME 4YYOA 4EGYA 2DK5A 3UKNA 1A8MA 5GLZA 3AZZA 3SZTA 4N4OB 2LBFB 3VD9A 4LT5A 2R16A 1Z1DA 2KA3A 1B72A 2PBIA 3ZMUA 1QH6A 1VAMA 4NIIA 3DXJF 1YCIA 1QXJA 4XAAA 5F5CA 5JUVA 3ZR5A 1RVF2 3IDAA 4P08A 3J7AY 2L4MA 4Z2AA 2HS5A 1S29A 1Y9QA 1SDWA 4M6XA 2VUCA 3BOWA 1H9PA 4M9SA 3WUCA 2JUCA 2F5VA 1JUMA 2ATFA 3AFHA 1BHGA 3WNLA 4MEXF 1FBSA 5GAGJ 2XASA 1N1TA 1RUD3 2LTNA 2DMTA 5F08A 4XRMA 1W8WA 4NRMA 1JUSA 1ETOA 3T4VA 2R7QA 3V7SA 1GDTA 1AYM3 2ICWG 2OVUA 1YRZA 2VBPA 2MG4A 4KA4A 1QKQA 2OA4A 4FOVA 4V1PA 2WZR3 4KT5C 3WTTC 3HSRA 1IZ3A 5BV6A 4I09A 4XILA 3ETQA 2HQAA 1LKNA 2W84A 2Y64A 3SCHA 3PVEA 2JA6J 2MEV2 3HOXJ 3GGLA 3GBWA 2DUPA 2WYFA 4N53B 4K40A 5LASA 5HNFA 1SD6A 3E6MA 2RM23 2OQ7A 4XIKA 4R9BA 2PMZA 1W90A 2D40A 2QM3A 4LXLA 1N77A 2R7WA 2VT2A 1X2NA 4RQPC 3RZZA 4CZCA 4H4KC 3U10A 1U5XA 2HWF3 5BNNA 5E3MA 1FATA 3WNMA 2J1RA 3A0NA 3DBRB 4M0HA 4MLOA 2VZOA 4LORA 2B63J 2D5HA 5GZFA 3VBSC 4R1HA 3ZO0B 2RG4A 2NMOA 1OR7A 1D4VB 4HK8A 1AYN2 2XJTA 4S2GA 2W57A 2EIMH 4JX5A 3M3YJ 3ETPA 1U5IA 1W6PB 2XHNA 1MJ9A 2PA7A 1IS5A 3MEPA 2Q1MA 1SANA 2CNAA 4E27A 1WD4A 3FMRA 3GUDA 1XNKA 5F3CA 1DZTA 5JOYA 3S7IA 4H7LA 1UJ8A 5JDBA 2D6LX 3H0DA 4ZS2A 1V6IA 2GBYA 3AYDA 1SAUA 4DMIA 2VE9A 3S30A 4NB5A 3AFKA 1K83J 2OCCH 1EPZA 5FRMA 2L9NA 2VBWA 2BXZA 3GZAA 1CF7A 3OEAA 3BZKA 1D4M2 3BTZA 3HT2A 1XYPA 1US2A 1LEMA 1HB3A 2XPWA 4MIMA 3CLQA 3U0ZA 3QOEA 3C7GA 4OUEA 5E6HA 2R073 1YQCA 4ESJA 5FO5A 3KP6A 2FQ3A 3OYIA 3ECOA 2IEKA 4BE0A 3B01A 3QRFF 2QEXI 4FSJA 2ES3A 1X1PA 3HHGA 3NWSA 5IYDJ 2IXHA 2PHWA 2ISZA 3OY9A 2EICA 3KLOA 4AI3A 3RVHA 1X4PA 4EN8B 4OQ8A 4QLCU 4RHV1 4DO0A 4KWKA 2BXYA 5J8FA 1REFA 1PDNC 4FPYA 5FQ0A 3WDXA 3NRUA 3A01A 2L02A 1W6OA 2VOWA 3WP5A 2HOTA 1UKRA 4I0WB 4D7YA 2DQLA 3TQNA 2A3SA 2XB6C 4OQ9A 1EH8A 2K0GA 3GZ5A 3QPTA 1RUF3 2XL9A 1WCMJ 1A5JA 3EETA 3MLKA 5GTIC 4EGZA 2E7WA 4AQSA 4H14A 1QMJA 4UUVA 2G9ZA 1W0TA 2LY9A 3OYKA 3K70C 2B9UA 2W68A 5TRDA 3W5MA 5LHHA 4D0PA 2K9QA 3B9CA 2LRPA 2E2JJ 3D5LA 3CMMA 4P5HA 1B35A 3FLTA 3IKWA 5JVGF 3VWBA 5LBCA 5BNNC 1RJ7A 1ENSA 4QGLA 1OHFA 5T55A 1C28A 1DIWA 2VKVA 4LLNA 4GRIA 1QJY3 2GXBA 4UFIA 1ZRRA 4QX5A 1BVP1 2BDRA 5FLXZ 4ISQA 1OR7C 4C30A 1F15A 4XLAA 2JSCA 4CA9A 2YV8A 2DVGA 2DMPA 5L3FA 2TCTA 3OB8A 5CVVA 1DF0A 5FXVA 3RJ2X 1RRJA 3KV9A 4LK7A 1BCXA 4NHJA 3JREA 5DUXA 1HB1A 2VZVA 1Y0NA 3KT7A 4AEDB 5ACA2 4XJAA 4EZ4A 2WBKA 1ZG3A 4BJTA 3A21A 5FPZA 2HWD3 3OOXA 2DF7A 2B45X 3AXEA 1RUOA 1TLHB 2RQQA 9ANTA 1RXFA 4CP2A 3IAQA 4A3FJ 1H30A 3JAMZ 3DYPA 2WS93 3L09A 5F3IA 5FUNA 1NQDA 4L5EA 2K40A 2B4KA 4E4SA 2M8GX 2G4IA 2PFBA 4XIOA 1YE9A 1MNEA 4KWUA 2NVYJ 2ESHA 3V0AA 1VBC3 1I3HA 2ZS6B 3K10A 3MFKA 4EJRA 3PUBA 4P9YA 1S3JA 2PMHA 3PO3J 2P6SA 3RZJA 1SBDA 2V79A 4DYQA 2HXOA 2Y31A 3JSOA 4HXCA 2DOEA 2DDUA 3IH2A 1M06G 1W9WA 2ME0A 1VIWB 3BR0A 1MS5A 5TISC 1BI3A 3M3QA 4RR3B 5FREA 2GC1A 4UNOA 4UI9L 4DPNA 1VLNA 4CH7A 1R5ID 3S93A 1R091 1H9TA 3TEWA 2NM1A 1UZVA 2HDCA 4F3QA 4XJWA 2FXAA 4YFZA 2X6YA 1LFUP 4N9HA 1YJWI 1X58A 1LULA 3TP3A 5A7NA 3CCMI 4WXDA 2JICA 1VQNI 5DAXA 2CO5A 4N8MA 3VYSB 1F2NA 3GMEA 4M6VA 2EFWA 4EN9B 1PUFA 3K1NA 2C1FA 2P5BA 2BVLA 5IUQA 4CU6A 1KEXA 3WCSA 4HLTA 2W00A 1O91A 5J6XA 1UB9A 4DNCA 1HDPA 3ZRGA 1B35C 3S5AA 1Q43A 2HQNA 1SMYF 4RA2A 3GYDA 4Z6YA 2RQPA 3KZ4C 4O9EA 4CICA 1N3PA 2JDYA 5D6EA 1UMIA 2ORXA 5FGMA 1YEWA 3ABUA 4WM7B 2FSWA 3J4UH 1YIFA 2V9PA 4ZJZA 3VBFB 2AQEA 4ORFA 3UJQA 4XLNF 1V55H 3HDDA 3RI4A 4K21A 5EQUA 5FYHA 2NN8A 1DGWA 4EJTA 5HI0A 1XSVA 3HTUA 3WHUA 4FFGA 1EP0A 1RC9A 4JGZA 2FMLA 3SC7X 1QJZA 1CR7A 1ULOA 1E5SA 4IF4A 3P9KA 2NRAC 4YIFA 2FDKA 1WA4A 4YG3A 1HDDC 3WHTA 3BR6A 5HVQC 1D3YA 2DA6A 2DPDA 2TEPA 3ZKUA 3KYCB 4I98B 1GNHA 2R5ZB 2A1XA 5FMOL 1OOPA 3UYJA 4CDQB 5F0HA 3E97A 3OIQA 3FZVA 2ZCWA 5H20A 1GQPA 1I6XA 1UELB 2GDFA 1C8M2 2LP0A 3H1YA 4I01A 3ON7A 1PIV3 2RDNA 3OV8A 2QQKA 3OYLA 1MSEC 1RHI2 3KP2A 1YW8A 1VNDA 4A93J 2VB6A 1MBFA 5BPIA 4HX7A 2XJUA 4A3JJ 3I56I 1SHWB 1O59A 4XAEA 2KJBA 3T09A 1TNSA 3H0GJ 3LA7A 3HNYM 4DW6A 5F5AA 3Q8FA 4XOTA 4HNUA 2XVKA 3UV9A 3RKXA 2IGMA 2W82A 1A6IA 1A3KA 3S6PA 1YI9A 3JTGA 4IETA 1PMIA 3CJIA 5FYTA 3PURA 3WTVC 5HDGA 1BBT2 2X6WA 1LDDA 2MYSA 1AL22 3AX4A 2D6MA 4QGMA 2FA5A 5A33B 1GU3A 4QTRA 4I3GA 1ZBA1 3NJVA 1YIOA 3RNSA 1L3JA 3JD71 4KISA 1WRJA 3Q8AA 1W6QA 1JOJA 1R1ZA 4PJJA 4PDWA 1AF9A 5K0UA 4ON0A 5LD2C 4KMQA 5FKBA 3M8EA 5FZOA 5IT9K 2TRTA 4J01A 2YPJA 1UWWA 2EZKA 4HEA2 4RGAA 4M3BA 3NQHA 2KIQA 4Y1YA 4RGUA 1WPKA 1GZWB 2L3DA 2IP2A 3OYHA 1ENXA 1TTYA 1MS9A 4FQZA 4Q1PA 4J1WA 3APBA 2AXTC 1UZZA 1S2KA 5FYCA 1FP1D 1WLCA 2W1SA 5CZKA 5FYYA 1JOPA 2EA2A 2MBFA 3LSKA 1PGL1 4XQFA 1MMSA 2YC0A 1ZHFA 4A45A 3MKWB 5FLVA 2YUEA 3EYIA 2XG3A 3WQ0A 3HNMA 4M3GA 2IWGB 4QSHA 2CU5A 1BR1A 5T52A 1AXKA 3O2PE 2HOAA 1KGSA 3K4LA 5DUWA 3NMBA 3OWTA 3MKZA 3I9V2 3B73A 2ETHA 4D9JA 3DTKA 5IVVA 1YX3A 4YZ4A 4COVA 2EJRA 3BG3A 3AG3H 1YLFA 4QQLA 4TLGA 1JKRC 2AEYA 5AVAA 4CCKA 3A4CA 4IEOA 4BJ6C 1S8NA 4JGZC 4IEXA 4FISA 3J8F3 2ARCA 1OD5A 3ZFGB 3MUZ1 3H9GA 1RUI2 3HJRA 3JW4A 5FZ4A 2QQBA 4LGWA 3S2WA 4QKBA 4AYBA 3CHXA 4LO8A 4MADA 3LSIA 4ZU4A 1O7LA 1LE8A 2D5FA 3ROUA 2V1UA 3CC4I 4B4RA 4UVBA 1OT5A 1OOPC 2WFPA 4BKXA 1WD3A 1UY2A 1WA6X 3AJYA 1BK0A 2HBUA 1QPMA 4UW6A 3U07A 1HKTA 1WMXA 1RUJ1 3S0MA 3UKTA 2VTXA 3I4NJ 4YGEA 4DQAA 1ND3A 5I0RA 2F17A 5BNOB 1OPMA 2LRDA 1WW7A 4PUSA 4N0BA 3ZN4A 2VU9A 1KZHA 4A6OA 3H8UA 2PLV3 1MZ6A 4KU7A 2AQFA 1DQUA 3RDIA 2HTSA 3ZYPA 1CAWA 1TQ5A 1U8RA 3VKNA 4U0WA 2HQRA 4LBJA 1YYVA 4BS9A 3U21A 2A6WA 1TW3A 3CJIC 4AL9A 2BEOA 1TEIA 4ZZ5A 3J7HA 4QPWA 2GIVA 3OGGA 2K86A 3VKLA 1VR3A 3BI3A 3OGSA 1Q8QA 2O9LA 4Y5SA 1OPCA 1QQP2 3L2RA 4CGZA 3ZXAC 1CJPA 1BJZA 2VC1A 3GLXA 4PDWC 5K0UC 3F21A 3K4NA 4RDUA 1GMMA 2CQQA 5DUVA 3FBNB 2BVMA 4IE7A 4XUQA 1CIYA 1HV1A 2CAUA 3LPFA 5IOZA 4L9VA 3LGRA 5M5WJ 3M4OJ 1KU7A 2IC1A 2XMLA 1NT0A 3K77A 3M2MA 4RAZA 5HS7A 3LQCA 2R7ZJ 1H9WA 3J81Z 1ULFA 4AK3A 4JC1A 1Z0XA 2M2EA 2VL8A 3H5AA 1C5HA 1EPWA 1H8TA 5FKNA 4XCAA 4XQ4A 4PI2A 2KPMA 4HDUA 4LO4B 1A35A 4CU8A 1JI6A 1GZTA 4Q48A 4YFKF 5JMOA 1F31A 1YQ2A 5CKQA 3DQVC 3QQAA 1MQTA 5FLIA 1WCQA 3BQZA 3H7YA 2CQ7A 2KL4A 2BNOA 2CG4A 3DPRB 5BMZA 4KI5M 4V2WA 3I2DA 5AFBA 4Q0QA 1JHFA 3K2AA 3TEYA 5LHIA 2MH2A 3WW4A 1TQMA 3D3AA 1T6SA 2LSOA 3DXUA 4EM1A 2ECBA 5IAVA 3AVSA 3E1SA 4TYSA 1BC7C 1NXMA 2QDNA 4FETA 2CRGA 4JDMA 3HOVJ 2Y48A 4NPMA 2XL7A 4UW5A 2R062 2YC4A 2DBNA 2RR13 2BGCA 3RKWA 5DM7F 3FFZA 2V09A 4II2A 3WOGA 1P4WA 3OYCA 3I71A 4LB6B 2JKBA 3S17J 4DYRA 4ZYAA 2M30A 2VIXA 2ZZQA 2CGOA 3MKYB 4KICA 3MIFA 1UAAA 2BBYA 1GP6A 1ND3C 3ZMSA 1YFHA 1RIRA 2D3RA 1GNYA 3LF7A 2H6CA 3ATGA 1XNBA 2VXRA 2WRAA 4AEMA 4Y13A 2XGDA 4BQ2A 4E8CA 4QT6A 3RQ4A 4DB5A 5EF6A 1A31A 1HQWA 3CLOA 1G9AA 3TGNA 4P9LA 3T2TA 1C57A 2LF7A 4FT8A 1IKPA 3CL1A 3P5JA 3UETA 2NPIA 2RC4A 5DAQA 2PG4A 2V5YA 3ME2A 2DXIA 4HX8A 1ODMA 3ZM8A 5J8CA 2NS8A 4R4ZA 5EV7A 4RB3C 1QJX2 2ISYA 3AG4H 1XGMA 3EMRA 1YQAA 4KG8A 2HBTA 1RMU2 4JTOA 4EROA 1VBD2 4D7TA 1DG6A 1SPPA 3CBNA 5J98B 4G7OF 1BI2A 5C3RA 2ZHMA 3WNKA 4UFLA 3T0BA 3AKRA 5DUIA 2NVUB 4CDUB 4IE6A 1H8TC 2N7GA 3ZQIA 3J7ZI 4OAZA 1ZBA3 3LFKA 3JD73 3WU0A 4OINF 3SDBA 2P6TA 3MF6A 3NAPA 4JGYB 2K02A 1MQTC 3FMQA 5JOXA 2NNYA 1TWCJ 3R4KA 5FZ0A 4J00A 1VTNC 3I2OA 1QGLA 4JHTA 1NAEA 1QZEA 2JB4A 3KQ4B 3KWVA 4FASD 2Y6GA 4CUBA 2VMGA 3IDEA 5L3GA 2WA3A 1HSTA 1R00A 3MYXA 5CAZA 4LB5A 1VBA1 3CO2A 2Z2SB 3AYCA 2DFFA 4A3BJ 2P4EA 3JRGA 4ABZA 3DEEA 1EKEA 4OHZA 4E9KA 2DFBA 3A03A 1REEA 1G9DA 2CSOA 3F2ZA 4PJYA 1ZRIA 4XC9A 2DVDA 1K61A 2ZMKA 2PLYA 3LFMA 5F27A 3V56A 1MJAA 2DFCA 4GQ7A 3HJEA 3TO7A 1JYNA 2OIIA 3DTIA 4HN1A 3CQOA 3CUQB 4P00B 3O12A 3AFGA 4PK4A 1AR72 4F83A 2ZXJA 2B46X 3SH5A 3NV2A 3KEOA 3JRFA 4DRRA 3KV5A 2CQKA 4QAWA 4NC7A 1NA1A 2I45A 2VW2A 2GLOA 3PNVA 2XAUA 3OR1C 1V6NA 1JT6A 5HCFA 1LNSA 5D8AB 5FD6A 4LHLA 4PIYA 2JMWA 1DQ4A 3Q8BA 4EV0A 2VJJA 3TOAA 3R6SA 3GZEA 1QBJA 4D5CA 2E63A 5A7QA 1JTYA 1SFPA 3JAMK 2R6QA 4YZ3A 2ZGPA 3H1CA 4GMP1 2DW4A 4CP9A 3AAFA 3G1MA 4PJMA 3H42B 3POJA 1DDLA 2BNMA 1VAKA 5DAPA 1XPXA 1HSJA 4AG4A 5IK4A 3OYNA 3ISPA 3Q9SA 2L7FP 1DU6A 4NAOA 3UKVA 3POEA 4Z2YA 2UURA 1QA6A 2JDPA 1ZZ6A 2QBYA 3ZFEB 4Y4RA 3ZYIB 4WVWA 2IS6A 1WW5A 1WKMA 3MIGA 2HWE1 4IV1A 1UOGA 2V9VA 2BP6A 3SQNA 2HPMA 5JSRA 2DU9A 3N9LA 4QX2A 2W47A 2EV0A 3MIEA 4BHCA 1Q56A 3VZOA 2EILH 2HWC2 4PJ0C 1S2EA 2QQOA 2Z69A 3TEZA 1F4AA 2BFUS 2Q8OA 1QGPA 5I93A 4XKBA 4JRLA 1IRFA 5FP8A 3NAPC 3ITQA 3ZR6A 4WM8A 5K7FA 3BR3A 1W8UA 1QJEA 2YGLA 1X33A 6PAXA 4MGSA 2P3JA 4QXKA 1UG0A 4LPLA 2OW4A 2P7CB 3I97A 2Y38A 4IHWA 2HNHA 5LA2A 3UL2A 2VZRA 2OUMA 1DGRM 2EFPA 3D82A 1H4GA 2EA4A 4C90A 4GYIA 3HQUA 4L9NA 2RMU2 2HGCA 4Q0PA 1VB2A 2KRFA 1HLVA 2LUWA 2GSYA 1X1DA 3FM3A 3OYFA 4BIOA 2OPTA 4YGDA 4B43A 3VHRA 4G7HF 4IJAA 5IATA 1TT5B 3A1YA 2A05A 1JS9A 5C70A 1XDUA 4LO6B 4BZ4A 2D6OX 4YFXF 4JK1X 3FXOA 4Q4V1 4MHGA 4JDNA 3ZMDA 1OBNA 1SZBA 1GOFA 1YITI 2P7VB 3V42A 4BL0B 5C5UA 3P6BA 2JX9A 2ZJPF 4XE9A 1SBEA 2F2EA 5FZMA 4RGGA 3KF5A 5DAVA 5HV4A 4FFHA 3USSA 4GULA 2R041 1NA1C 4A41A 2W52A 4RGSA 3GFMA 1J9IA 2KLOA 1OLRA 3ZXGA 5HV0A 4AEKA 2XGCA 2A5WA 4L9TA 3P9IA 3O8GA 1WH7A 4FOWA 3FXMA 2VVDA 2BZTA 3FMGA 3VBOA 4FBFA 4QQHA 1FEXA 3IZOA 1UU4A 1S0GA 2MHFA 1NOVA 3IRRA 4KMUX 1PVC2 3HOUJ 2ZEYA 3LEMA 3C2GA 2VCCA 1Z0HA 5F3EA 2CW7A 2WZ8A 2BTVC 1AKHA 4IL6C 2LBFA 3VLBB 1WQ2A 5GLUA 1IKQA 3UR3C 4LJZF 4CCDA 4UYBA 1B6AA 2IVJA 1LOEA 4WXHA 3VN4A 3KCXA 2HDDA 1CESA 1FX5A 2QQWA 3ZPOA 3MGUA 4OAYA 1D1CA 5JPNB 1DZQA 5D5XB 4HSRA 2WADA 3PL0A 5IVBA 2R3SA 1Q1VA 1JI8A 2WNVB 4BLIA 4IV1C 5AFEA 4RB1A 4DYCA 2DCTA 5FTTC 2CHHA 4BY7J 1J1LA 1YJLA 2FUG2 4LE3A 2JIGA 3QD6A 1X3WB 4CCOA 5KHJA 3I3MA 1ORKA 3WG9A 4P96A 1RUE2 4DGWB 4UUTA 3GZUC 5CVRA 3QOPA 2DJNA 1PO11 3OBRA 1IN6A 2GH2A 1O8PA 4I76A 2ZA9A 3VPRA 4WM8C 1ZELA 1CIWA 3QU3A 1NCQB