1JHNA

Crystal structure of the lumenal domain of calnexin
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
398
structure length
380
Chain Sequence
YKAPVPSGEVYFADSFDRGTLSGWILSKAKDGKWEVDEMKETKLPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGVYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSIVNSGNPVNPSREIEDPEDQKPEDWDERPKIPDPDAVKPDDWNEDAPAKIPDEEATKPDGWLDDEPEYVPDPDAEKPEDWDEDMDGEWEAPQIANPKCESAPGCGVWQRPMIDNPNYKGKWKPPMIDNPNYQGIWKPRKIPNPDFFEDLEPFKMTPFSAIGLELWSMTSDIFFDNFIVCGDRRVVDDWANDGWGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords calnexin
publication title The Structure of calnexin, an ER chaperone involved in quality control of protein folding.
pubmed doi rcsb
source organism Canis lupus familiaris
total genus 44
structure length 380
sequence length 398
ec nomenclature
pdb deposition date 2001-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00262 Calreticulin Calreticulin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.250.10 Mainly Beta Ribbon Calnexin lumenal domain, non-globular proline-rich hairpin domain Calreticulin/calnexin, P domain 1jhnA02
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1jhnA01
3O5SA 1CJPA 3GNEA 1SFYA 4PBPA 1MS0A 5GALA 4LBOA 1G7YA 4BLJA 3AK0A 2AREA 2P3IA 3IPVB 1GV9A 2DVFA 1W6QA 1DQ1A 3FUOA 4L8QA 4Y26A 3UJOA 3AZWA 1CPNA 1LEDA 4GALA 1UZZA 2ZGSA 3SH3A 1HLCA 1UZYA 3ZXJA 2DURA 1WD4A 3FLPA 3WDVA 2UWAA 3A0NA 3KQRA 3AXEA 4U36A 5T55A 3SH5A 4Y1VA 4Z8BA 4XILA 3ZXKA 1NLSA 1LENA 2JECA 3ZYRA 1AXKA 2Q5TA 4M01A 4YGEA 1MS8A 2OVUA 3OY8B 1BXHA 1Y7BA 3LCPA 1LOCA 1N3OA 1W6PB 2ZHMA 2SLIA 5BYNA 3U4XA 1MVQA 5IK7A 1A8DA 2DYCA 2ZGNA 1FX5A 4FPGA 4XJAA 2JJ6A 3KM5A 4Y1XA 3FLRA 2ZHNA 2WT0A 3R4SA 5T5PA 5IK5A 4P9WA 3UK9A 4Q26A 1OQ1A 1QDOA 1R1ZA 2A3XA 1S0DA 2C5DA 3B9CA 1SBEA 3VKNA 2WKKA 1ENSA 3WZ1A 2GDFA 3IKWA 4K21A 4LBJA 1AX0A 1IS5A 2A7AA 5DUXA 1GKBA 4NOTA 2AR6A 1Q8VA 4K20A 4DFSA 3AP4A 3O12A 5GZEA 4Q8KA 4YZ3A 3M3QA 1V6OA 2ZGMA 2D43A 2PELA 2YROA 1AXYA 1CESA 2D6MA 3WG2A 4M3CB 1I1EA 3BOPA 1Q8SA 2GMEA 1H9PA 1CIWA 2GMPA 3ILRA 3AFKA 1W0OA 3R05A 3IPVA 3AX4A 1MS5A 4RA0A 2WSVA 2DTWA 5DZGA 1UN1A 4FPOB 3D4KA 3ZSMA 2E6VA 2GN3A 5H9RA 3AZXA 2A3WA 1JUIA 5FREA 3SISA 3PJQA 1DQ0A 1JN2P 1BYHA 3WUCA 2JKBA 3POWA 2UU8A 2EXKA 4ASMB 2KM2A 1JYIA 2A6XA 4XMAA 4YG3A 4Y22B 1AX1A 1ULGA 4UW5A 3ZPYA 3OY8A 4YW5A 3AP6A 4XXPA 3VV1A 3N7KA 1W6PA 1AJKA 2ZGQA 1CR7A 2DUPA 3OJBA 3PVNA 4YW4A 4GWNA 2NZ9A 1A78A 1UL9A 5E88A 1MZ5A 4K1ZA 5T52A 3FFZA 3WDXA 1LHUA 1URXA 2UWBA 4YM1A 1BQPA 4YZ5A 1HKDA 1HHNA 1AXZA 2D6KA 4FPLA 2LALA 4XJWA 1A3KA 1PZ7A 1ZM1A 1UKGA 2VH9A 5JLVA 1XQNA 5DXDA 1GYKA 3APBA 3CNAA 3LSDA 4U2AA 3L2YA 3ENRA 2ZGOA 2SBAA 2P3JA 3WHTA 3OYWA 2DVDA 4M3CA 2R49A 3V65A 5KXEA 1WLDA 2W39A 3VKOA 4LBQB 4W65A 1J1TA 5GZDA 1LOAA 2PHFA 3ZSKA 1C4RA 1UX6A 2WT1A 3ILFA 4TYSA 5CBLA 3M1HA 1G9CA 4AVVA 2AYHA 3R4UA 5IK8A 1UMZA 4XIKA 2OUJA 1O4ZA 1DYKA 4TZDA 2BQPA 1LGNA 1V00A 5GZFA 1FAYA 1LESA 1S0GA 4YZ2A 5KXBA 1N1YA 1F5FA 1QKQA 3POYA 1BKZA 3QCWA 5CAZA 1ULFA 1GLHA 2E7QA 3WDYA 2NM1A 2ZKNA 4DPNA 1LOFC 2UURA 4Y1ZA 4Y22A 1V6IA 1WLWA 2GMMA 4LBQD 3VKFC 1W6MB 3WCSA 3WV6A 2EXIA 5HCFA 1LEMA 3AYEA 5SV8A 3HMYA 3SITA 1G9DA 1BJQA 2V73A 4XXAA 2CNAA 3NV3A 4FQ4A 1X50A 1YI7A 2DVAA 5H9PA 1IS6A 1N1SA 3B69A 5H9SA 2ZZJA 1W6OB 1WW6A 2WJSA 4FOQA 4XJZA 3W58A 2D6NA 2FHRA 3V0BA 4IQPA 4Q2FA 4PBOA 1MS4A 1APNA 3NV4A 4YW2A 1FYUA 4ISRA 4XE9A 5EWSA 5JOWA 2A71A 4XHXA 2ARXA 1SLCA 5F9TA 3V0AB 1GZWB 2YV8A 1GNHA 1AZDA 1IS3A 5DZEA 4YW3A 4DRRA 1DYPA 1KITA 1SLLA 3SH4A 2XB6C 4XJ8A 3N7LA 3WDWA 1BZWA 4XZPA 2TEPA 2ZMKA 3OPZA 1LOGA 4MYEA 1KRIA 3WHUA 1LHWA 1N1TA 2GALA 2ZGRA 2VW2A 4DQAA 2GNBA 4LBQA 1F9KA 2E51A 2A3YA 1FNZA 4DS0A 1AF9A 2GNTA 5DG2A 1LTEA 2D7FA 3MPPG 3VUOA 3PMEA 1JHNA 3USUB 3DUIA 5L73A 3WNXA 2A6WA 4YFWA 1KQRA 1LGCA 4PQ9A 1D0HA 3AYDA 5H9QA 5T5OA 3VKMA 2EIGA 4P9XA 1DHKB 1LHOA 2DVBA 4XTPA 1W6MA 3HN1A 4FOWA 4BQ1A 4AWDA 3OYWB 2ZA9A 3RMXA 1N3QA 2PHWA 1HQWA 1NXD1 4CTEA 1FNYA 2A70A 3TB0A 4BMBA 2WNEA 4GKXA 1W6NB 2NN8A 2OUHA 3WOGA 3JUUA 1W6OA 2DUOA 2D6LX 4FOYA 1ONAA 2ZHKA 4FOVA 5CB7A 1FV3A 4C1WA 1VAMA 1LHVA 2JE9A 1DQ5A 3WLUA 1S0EA 1S0JA 5CA6A 1CONA 2EXHA 3HR9A 2PHTA 3V0AA 1GZWA 4PF5A 3O0XA 1W0PA 4YGDA 1MR5A 1ULEA 1WBFA 1N3PA 3NV1A 4FP3A 1JOJA 2ZGPA 2ERFA 1CQ9A 5EYXA 4AVSA 5LK5A 2DV9A 3T2TA 2GN7A 3AJYA 1V6MA 1QNWA 2FMDA 2P2KA 3T1LA 4WV8A 3POSA 1OFSA 4Y24A 2R16A 1SCSA 1Q8QA 2WSUA 4ATEA 3MW4A 3BODA 2ARBA 1QNYA 5KXDA 4Q8LA 3Q9OA 4XHBA 4Y20B 1SLBA 2A6VA 3N35A 1LOEA 2LTNA 4FPCA 3V0BB 1JBCA 1LHNA 3AZZA 1CVNA 1Q56A 3USUA 3AJZA 3VKLA 5JOZA 1KJLA 1HDKA 1YXWA 3LSEA 4JRAA 4XBQA 1GSLA 5DUVA 2R0FA 5GJ6A 3I4IA 2JDZA 1G9AA 2CTVA 3RSJA 2A75A 1WBLA 1WW7A 2PHXA 2VW1A 1CPMA 2D6OX 2DU1A 2PHRA 2AGSA 3RQ0A 2EALA 3IM0A 3N7JA 3A0KA 4AGGA 1SLIA 1Q8OA 3WG1A 3N3HA 3IN9A 2ES3A 1GZCA 1VLNA 4BM8A 2D3PA 4XOGA 1I3HA 4C1XA 4ATFA 5DG1A 1QOSA 3WUDA 4WZFA 3I8TA 2WQZC 1W6NA 5EYYA 3ZXLA 5HCBA 5EXOA 2H0BA 4P14A 4XMIA 3BIWE 4JC1A 3AP7A 5IT6A 1AVBA 1LU2A 4M3CF 1GNZA 4JCKA 5F5QA 1H9WA 3B01A 3D6EA 1IS4A 4FP2A 1FV2A 3PVEA 4XTMA 3UJQA 1KDMA 1WW4A 4GA9A 1CN1A 1DQ6A 3MEPA 4YW1A 3ILNA 5CNAA 1LJ7A 4FQZA 1Q8PA 4GKYA 4H55A 4NO4A 1RINA 4YM0A 2ZAAA 2W08A 4YZ1A 1MS9A 4P9YA 3UL2A 3OBRA 4XBLA 4M3CE 1JXNA 2ZMLA 2ZHLA 1S0FA 2CY6A 1C57A 1DQ2A 5IUQA 1LECA 1PZ8A 3AYCA 3INAA 3N7MA 4Y20A 4AYUA 4F83A 1GICA 1N47A 1DLLA 3RS6A 2Z42A 3SNMA 4Y1UA 4YGCA 1AJOA 2AENA 2CL2A 1GZ9A 3M3EA 5T5LA 5GM0A 3ASIA 4CZSA 4CRQA 1V6KA 3WG3A 2JE7A 4FPJA 1QDCA 2P34A 3B3QE 3IMNA 1UAIA 1N1VA 2DUQA 1LOBA 2GNDA 4Q27A 4BOWA 2CWSA 3WCRA 4PCRA 5KXCA 4YG6A 1LULA 5GZGA 2W68A 1IKPA 3ATGA 3DGTA 1QU0A 4FPYA 1LODA 2D3RA 5DUUA 4BLIA 5GLWA 2V5YA 2R1DA 4LBNA 3A4UA 4FPHA 2EXJA 5GLZA 2ZGTA 4HL0A 5AVAA 2UWCA 4YM3A 2DWRA 2HYKA 3SLIA 3ZVXA 3QLQA 4LBKA 1ENQA 1Z0HA 4YM2A 5GZCA 4BPZA 1G86A 4FPEA 3V64A 2I2SA 4FPKA 2EAKA 4XBNA 3ZSLA 3ZYPA 2GNMA 3D5OA 1SCRA 3ZSJA 1S0CA 2OW4A 2ZGKA 1SLTA 1UPSA 2D6PA 2ZGUA 1G9BA 1V6NA 3C2UA 2RHPA 2VXRA 1DZQA 1Z78A 2D44A 2EF6A 4FVVA 3AYAA 1K9CA 2PHUA 3TAYA 5JDBA 1HQLA 5E89A 2P37A 1G8WA 1PZ9A 1MZ6A 1QMJA 4BMEA 5T5JA 1S0BA 2ZACA 2G4IA 4ZKTB 1JYCA 2WT2A 3NWKA 1DIWA 1YYNA 4YGBA 3O0VA 2B7YA 4AGVA 1DFQA 1O4YA 5JMCA 5JOYA 1WW5A 2YMZA 3MW2A 2DVGA 4YZ4A 1JW6A 5DZFA 4DRVA 4ISQA 1LOFA 1ZA4A 2DTYA 2ZABA 3O0WA 4XDQA 1SBFA 2ZGLA 2VU9A 3PVOA 1LU1A 4YLZA 3ZXEA 4Q1PA 1G9FA 1OKQA 5T50A 3M2MA 4LBMA 4R9AA 2R0HA 2W52A 3M3CA 3NV2A 3RMYA 3RRDA 4I30A 4AGRA 2AH2A 1LCLA 1TEIA 3WDUA 2YXSA 3AP5A 1RITA 4YG0A 4XJ9A 3WG4A 1F31A 1VALA 4SLIA 5HCAA 2DU0A 1FATA 1D2SA 1WD3A 1DGLA 4AVTA 1MACA 2VUAA 2D3SA 4KBBA 1SACA 2NMOA 3AZYA 3FBYA 1YRZA 1YO8A 4GWMA 4UW3A 1MS3A 4ZXKA 3AXDA 1U0AA 4OZXA 4XIOA 5GLVA 3ZXFA 4R9BA 2NP0A 4FPFA 4ITCA 1B09A 3H0OA 2E53A 4Y1YA 3B00A 1AX2A 1V6LA 2R1BA 3AP9A 1C1FA 3AZVA 1SBDA 5T54A 1V6JA 3OBTA 5FRAA 1QOTA 4XYXA 2NMNA 2CYFA 4R9DA 2A6YA 4WVVA 1W6QB 3JU9A 2YZ4A 4WVWA 2CWMA 1ULCA 5GLUA 1VIWB 2JD4A 3BTAA 2XG3A 1KJRA 4K1YA 1MS1A 5DUWA 5E8AA 2ZBJA 2A5ZA 2VW0A 1DBNA 1C1LA 5JVVA 1WCSA 1SLAA 3WDTA 2WLQA 1ULDA 2ZMNA 2E7TA 1ENRA 1WUVA 4GXLA 2NYYA 3RG0A 1YIFA 1QGLA 3FLTA 4R9CA 3T1MA 4HANA 1EPWA 2A6ZA 3WVJA 4LBLA 2C9AA 1QOOA 4UW6A 3MW3A 4YFZA 1KDKA 2YY1A 3OGGA 3N36A 4UW4A 1RIRA 2ENRA 2P3KA 1IKQA 5JOXA 4RL7A 1LGBA 4XJUA 2VY0A 3FUQA 2AUYA 1WLCA 1H30A 4M00A 5GLTA 1DQ4A 1VAVA 1GBGA 1S0IA 1QF3A 3W59A 1GANA 5IK4A 1MVEA 3M3OA 3GALA 4Q1RA 4D69A 1S1AA 1IOAA
chains in the Genus database with same CATH superfamily
1G6NA 2XVLA 1M06G 1SFYA 4NAMA 4PBPA 1J84A 5GALA 2VNGA 3A21A 1T6BX 2XWBB 3EJKA 3ZLIA 4AAXA 5LASA 2WA3A 1CX1A 2MEV2 2RR11 2DVFA 1DQ1A 3FUOA 3PTYA 3ZXAC 4XFIA 1LEDA 4RYDA 1K3IA 1HLCA 4E2GA 1VRH3 3ZXJA 2DURA 5FP3A 1VBC3 1XOYA 2YG0A 5BNNC 1M4WA 5T55A 3KQRA 2VMFA 3AXEA 3CJIC 4KMQA 4U36A 3ZN6A 4FTEA 4YPJA 5E16A 1NLSA 1LENA 3RJ2X 3ZYRA 3ZXKA 1AXKA 2Q5TA 4YGEA 3ZSEA 5A6QA 5DAVA 1MS8A 2OVUA 5F3CA 3WY6A 3LCPA 1UKRA 1LOCA 2QCSB 3VBSB 5B4NA 2VL4A 1W2UA 3K4ZA 4XW3A 5D1IA 3U75A 4EN9B 3MI8A 1MVQA 4IW3A 1RUC3 3UYJA 4AFAA 2WABA 4UI9L 4DEVA 1FX5A 4XJAA 1UU6A 3EXUA 5HXMA 2CGPA 4UFHA 3KM5A 2JICA 3FLRA 3VHPA 4DXRA 5IK5A 1QJU3 3UK9A 1SFNA 1QDOA 1R1ZA 3B9CA 2A3XA 1HJGA 5KHIA 5FZLA 3AKSA 2Q8DA 4CDUB 4CP0A 5KWRA 4EWAA 3HBKA 3NJVA 4TN7A 4AQ2A 4NOTA 3SMHA 3K75B 3TN93 3J7LA 4K20A 4DFSA 3AP4A 2VMCA 1ZRFA 3M3QA 4OZOA 3ZX7A 4GB31 5IHRA 2JG8A 1AXYA 2D6MA 1O7FA 1UU5A 1ZNPA 3GCXA 4Q4X1 5CIRA 3BOPA 4XAAA 4XFHA 3WG2A 1I1EA 4PLOA 1DF0A 1CIWA 2VQAA 5FZKA 4LKDA 4FFFA 2E33A 4COYA 1MS5A 1XE8A 3QH7A 1MQTB 2HJIA 3MYXA 4KWJA 4NRPA 1UN1A 3IB3A 1KEXA 3GBGA 3LDRA 3BTXA 1RVF2 3BVCA 4C8DA 1S2EA 3ZFEC 4CDQB 4AEDC 5L7OB 3B5LB 1O3TA 1CAWA 1TVGA 1UF2C 4BWOA 5FR3A 1BYHA 3HIFA 3P6BA 1ULPA 1AR81 2VQTA 3POWA 4I0AA 4UF0A 2EXKA 4CUBA 1VP6A 4CVUA 3UGHA 5CFCB 1ZBE2 3ZPYA 3HJRA 1QXJA 3OY8A 3VV1A 4BA6A 5A3UA 1AJKA 2Y6KA 3LD8A 3OB8A 1CR7A 4RFT0 4CP9A 3VDBA 5L9RA 4XQDA 2DFCA 3HD8B 4GWNA 3WW3A 4QQOA 2VM9A 1MZ5A 5FYCA 1AR71 2JG9B 3WDXA 5F3GA 4LO4B 1URXA 3N9QA 1D4M3 3LEIA 4LOTA 4YM1A 1HV1A 4YZ5A 3PIJA 1BBT3 1AXZA 4NAOA 1NAEA 1FPN2 1UYXA 2L9LA 4HT1T 3S6PA 3MFCA 2LALA 2R043 4LK7A 4XJWA 1PZ7A 1ZM1A 4OCTA 3HT2A 4URTA 5F5CA 4OHZA 1NA1B 5FQ0A 3LSDA 2VAUA 1VBB2 1W0NA 1CAUB 1F15A 1VBE3 3ENRA 1E5SA 3K2OA 3T4VA 2P3JA 3AM2A 3UESA 3JB8A 4LITA 1AUYA 4F8AA 1S4CA 3V65A 4A7YA 4JQRA 1YC61 3KT1A 5FOJB 4MGTA 4KH9A 5L19A 2HWE2 4C90A 1J1TA 5GZDA 3VZLA 2JIGA 1C4RA 1UX6A 5FZGA 5IVYA 3I3MA 5I0UA 2JB8A 2QUOA 5FXXA 2AYHA 1OLMA 4XIKA 1O4ZA 1KGYA 5DPNA 4TZDA 1YNAA 4FFGA 1LGNA 2R062 1J83A 4P02B 4JGYA 1UY2A 1NY72 5AC91 3QCWA 1KFXL 1ULFA 2E7QA 2VZUA 4V2WA 3SQOA 2OIIA 2WZPP 4Y1ZA 4Y4YA 1V6IA 4LBQD 4N9HA 1YFWA 2EXIA 1LEMA 4QQLA 1ACCA 3VDAA 1G9DA 4GH4A 2V73A 3MGUA 2RMU2 4CEWC 4FQ4A 5FKCA 5DDJ3 3AC0A 3VBOB 1PIV1 3K48A 3VD5A 1N1SA 4GMP3 2E31A 2HYXA 4FXKB 4PHZA 2XUEA 2YHJA 3BN6A 3JXSA 3S7IA 1VPHA 2WJSA 1QQP2 2P17A 4XF0A 2D6NA 3BTYA 2ZPXA 3OGVA 1XPWA 3VZMA 1QY4A 5FZ6A 1IHMA 1OLME 4QGNA 4CDWA 4Z07A 5EWSA 4XHXA 1DLCA 2ARXA 4FFHA 1J3QA 1SLCA 3MF6A 5C4WA 5FUPA 2BZDA 2XB6C 4NIGA 1JI6A 2O14A 5LA0A 2XUMA 1UPIA 2ZX4A 3POGA 3K3OA 5CISA 1ZZ9A 3WXPA 5JXGA 1ZYBA 3WHUA 1W04A 2GALA 3WF3A 1XRUA 2FDIA 2KD7A 4Y5TA 2E51A 4W6WA 1FNZA 2WR9A 1ZX5A 3LKJA 2MNGA 2GNTA 1BCXA 5DG2A 4Q4V1 1H4GA 5FJHA 1UXXX 3JBG1 2JDUA 3PMEA 3USUB 3DUIA 4FI9A 3VHOA 5L73A 2W1QA 5BNPC 2A6WA 5I91A 1KQRA 1LGCA 4PQ9A 1D0HA 3ORJA 5T5OA 2VUCA 2WNUB 4C0HA 2EIGA 1FOD3 4LEJA 4KGQA 3E1F1 4CU6A 4S2DA 3VD4A 1VBD2 4P9XA 3LOBA 4XFAA 1XU2A 2RS53 1LHOA 2WNVA 1MEC3 1W6MA 1OF3A 4RQPB 3HN1A 1YCIA 3MPBA 4FOWA 5FYIA 2VG9A 2ZA9A 1NCQC 4JDMA 5ABJB 2JXAA 2XJRA 1JYNA 4QB1A 1NZCA 2X53S 3ZDSA 5FP4A 2HEYF 4GKXA 1W6NB 2OUHA 2VE1A 3WP3A 2WC2A 4CDXB 4QU1A 1W6OA 4FOYA 1RHI1 2BOIA 4BZ4A 2VNRA 4FOVA 5LEJA 1H6YA 2X29A 3M70A 4J1WA 5HXVA 4C1WA 2V5DA 1RUJ1 2JE9A 3VBRC 2Q0AA 2RS13 3RYKA 3VBFA 3EMRA 5B2GB 2EXHA 3HR9A 2VBPA 5FP8A 1BVP1 4D7TA 4PF5A 3O0XA 5FY0A 5CADA 1W0PA 4B1LA 1ULEA 1TMF2 4IERA 1NCRB 1ENXA 4QWNA 1S55A 2OS2A 5EYXA 5C71A 5LK5A 2DV9A 4GJZA 3T2TA 2GN7A 1QNWA 2FMDA 5FZ1A 1OD5A 3H7JA 2WLPA 1OH3A 3TEXA 1SZBA 1TE1B 2QQUA 3LGRA 2ARBA 1OKOA 2WFF3 2VZVA 3PU3A 2CHHA 3Q9OA 4Q8LA 1ASJ1 3BALA 1H4HA 2LTNA 1LHNA 5A3OA 3WNPA 2YDEA 1R081 3AJZA 4JVAA 2V72A 5FYHA 4GQ7A 5JOZA 1KJLA 1JOBA 3B7MA 1NQDA 1BVVA 3FWEA 3LSEA 3MV11 4M0NA 1SPPB 4NWWA 2JDHA 3I4IA 1G9AA 3RSJA 1BK0A 2A75A 1UOBA 1CPMA 2D6OX 2DCJA 1K5MC 1I9RA 2DU1A 2VW1A 3RQ0A 3CJIA 4A44A 5BNNA 1QXPA 5HV4A 4PI2A 3I2OA 1QEXA 2XOMA 3GCWA 1H1AA 2W95A 2XJSA 4ORFA 1GZCA 1AYM2 1HJFA 1VLNA 2CDPA 4RSUA 1MPXA 3FFQA 1HB4A 4XQWA 4ATFA 1OBNA 3A22A 4HVRA 5FZ9A 4LUKA 4LPLA 4WZFA 3ON7A 3PMSA 3DXUA 5EYYA 4COZA 3KV5A 3VD9A 3KZ4C 2YC2A 1GQHA 3H1YA 5IT6A 2AEYA 1LU2A 2CAVA 3B01A 3D6EA 1IS4A 2VR4A 5BPXA 4FP2A 4IUGA 3RNSA 3PVEA 4HN1A 5FIXA 3P3NA 1HV0A 4GA9A 1CN1A 2Y26A 3I3DA 3I2DA 2VOVA 3PL0A 4K8RB 2R6QA 4NO4A 2TBVA 1PX4A 4RS5B 2DBNA 1OPOA 3VDCA 2ZAAA 3OF1A 5JUVA 3L9JT 1ZBA1 4XABA 2XLAA 1JXNA 5KR7A 3K46A 2WWUA 5IFTA 4P9JA 5IW0A 4NJ4A 2XL7A 3INAA 5FCCA 4XFFA 2JWPA 2OX0A 3NAPA 5FO9B 4AVCA 1YIPA 3RS6A 1GZ9A 3M3EA 2HWF2 5HBAA 5T5LA 3WNMA 3ZFEA 5IVVA 5J7MA 2ADEA 5GM0A 4P00B 3WG3A 3S5AA 3ZIXA 4CEYA 2P34A 1ZVFA 3B3QE 2X5IC 1EV12 2FBEA 2VOXA 4IE5A 1PNGA 4QGMA 4BYYA 2GNDA 3J8F3 2CWSA 3WCRA 1PGL1 3IZOA 4OI4A 1JODA 2XDVA 2HWB2 3VDDB 4I2OA 4W8JA 2W68A 1IKPA 3DGTA 3KS7A 3MIFA 4LHKA 2LW8A 5DUUA 1GWMA 1NUKA 5GLWA 3S30A 1ND3B 3H50A 2RDQA 3IBMA 3IDCB 4Q4W1 5AVAA 2UWCA 2WYSA 4A42A 4PIZA 2HYKA 3SLIA 2R32A 3ZO0B 2J1TA 3QLQA 4LBKA 3TNPB 3IAQA 1JYWA 2WAOA 1E5IA 3OG2A 4FPEA 3V64A 3JD71 4OI2A 4DUXA 2FZ2A 2JDKA 2EAKA 2VUJA 1D0GA 3FN9A 4ASKA 4DINB 2GNMA 2W3JA 5FYZA 3ZSJA 4EQVA 2OW4A 1VB4A 1VBA3 2RJKA 1VAKA 5A32A 3C2UA 3DCQA 2PHDA 5KC5A 4FVVA 5IFPA 2PHUA 4L2NA 2BTVC 1C5HA 2PYTA 1PO23 4RR3B 4QPIB 2RS31 1X7NA 3LPFA 3R0RA 5C9AB 1W9YA 2WZR2 3S5QA 2BFUS 5FPXA 1JYCA 2WT2A 3GHNA 5KHJA 1YYNA 1C5IA 3O0VA 4AGVA 1OQEA 5JMCA 1KXGA 5ACA1 4QHZA 2VZOA 3EHKA 2WRAA 2GC2A 1POV0 1ALYA 2PLV3 3SCHA 2ZX2A 1WMFA 3MFAA 4OUSA 3O1SA 3UKTA 2ATFA 1RMU3 1ZA4A 2DTYA 3OEAA 4XDQA 3PVOA 2VU9A 4I02A 2QJVA 2QKDA 2VO5A 5FY8A 4Y5Z0 5FPVA 3E5UA 4LBMA 2IZWA 3TN91 2VGDA 2AH2A 2ARAA 2YXSA 5FXWA 3RZKA 4XJ9A 1NLRA 1WCKA 2X10A 5SV5A 2XJTA 1BEV2 2GP3A 3GZAA 4GWMA 1YRZA 5EPAA 4LR4A 1MS3A 2TNFA 4XIOA 4AOCA 1RUF3 4NWVA 4R9BA 3H3UA 5GLVA 3UGGA 4ITCA 4Q4Y2 1QJX3 2ZZQA 2V4VA 5JZGB 2WZEA 3ALQA 1R64A 2R1BA 3VLBB 3IDEA 1W6QB 3JU9A 3ABZA 2CWMA 4M0HA 5GLUA 1JZ3A 2RR12 2X8KA 1K5JA 3BTAA 3HOBA 3ACHA 4K1YA 3AVSA 1AR93 2A5ZA 2VW0A 1DBNA 1C1LA 1DGWX 5ABJA 1RUG1 4DXSA 3PURA 5FPZA 4IV1C 1XU1A 2JEMA 5C8CB 2JG8C 3VB9A 2JDYA 2Q8OA 3QACA 3X29B 2O8QA 1WUVA 1BBT1 2WWSA 2RVAA 4IE0A 4N43C 5FBZA 3FLTA 4JGZC 1ZREA 2XVGA 3CU7A 1AYN3 4HANA 4HONA 4NVPA 3WVJA 1NT0A 2F4PA 4LBLA 2C9AA 1H6XA 2ARCA 4UW6A 1KDKA 1XNAA 2QFEA 2YU1A 1MQTA 2YY1A 4HPKB 4IEXA 4TWTA 5IVBA 2FD8A 1V9U3 1W8ZA 3HN3A 1VBE1 3IIAA 3OCPA 2W91A 2B5HA 4M4RA 5EFUA 3AMNA 4XFGA 5FZOB 1FMD2 1PVC3 1WLCA 3LDBA 2WQ4A 3S7EA 4COVA 1UX7A 3WP6A 3KCCA 2LM3A 1GBGA 1QF3A 3VBRA 3W59A 5CFCA 3NJYA 1GANA 5FZDA 1MVEA 3M3OA 4Q1RA 2DFBA 2D98A 1R091 2CY6A 2BNNA 1IOAA 3O5SA 4GWJA 1W8HA 4IEOA 4UFLA 4Y3OA 1PGW1 3ZDVA 3OPWA 4FTSA 1GP5A 2PHLA 3AK0A 3OSDA 2P3IA 3IPVB 1ZA7A 5JIUA 4Y26A 3UJOA 4O61A 1CPNA 1ZZCA 1UZZA 2ZGSA 4MV2A 4YW6A 5ANQA 4B4RA 1UZYA 4JRLA 4B4PA 1O3QA 2RV9A 2VVDA 2UWAA 3A0NA 5DDJ1 4Y1VA 4XILA 1NA1A 2ILMA 1WCUA 2AZ5A 1AR82 3H42B 4H7LA 5HCHA 1RXFA 1T2XA 3AL6A 4XUOA 3VHNA 1Y7BA 2BVBA 1SDWA 2HEWF 4Q0SA 4WM7A 4A45A 4QKNA 2ZHMA 3RGBA 3AFGA 2HBTA 1HXS3 1STMA 3ZXGA 3H7YA 3ZPOA 2DYCA 3MF9A 2YBPA 1GQPA 4Y1XA 1CJDA 3E97A 4KWLA 1WMEA 3RPQA 2FDJA 2W47A 4YRDA 1QIQA 5K0UA 2OT7A 1HB1A 1OPMA 4CCCA 1AR72 1HRI1 5C33A 2MEV3 2Z69A 3AMPA 4JGYC 1KFUL 1S0DA 3ZIWA 2Z4FA 1SBEA 3CZJA 2WKKA 3VKNA 3WSOA 4DOUA 2VOTA 5CG9A 2RDNA 1AX0A 1IS5A 1F4AA 2A7AA 3E5XA 1YFYA 2I74A 2XQXA 5EP9A 2AR6A 2ZGMA 1WCDJ 3RZZA 1CESA 5JXIA 5C5TA 3WD5A 5A7SA 1ZRCA 4B1MA 2ZX3A 1H9PA 1GOGA 2OZJA 1POV1 1QH6A 3R05A 2ET1A 1XB9A 3D8CA 5J37A 1NX9A 1FOD1 4V2VA 2DTWA 5DZGA 3ZSMA 4FPOB 2VVFA 3AZXA 2A3WA 1JUIA 5EIYB 1ZRRA 5KHKA 5C4WC 1JN2P 3WUCA 3WQ7A 2JKBA 1EY2A 5F3IA 2OKXA 2KM2A 2DBIA 4A4AA 1VB2A 2A6XA 4XMAA 4YG3A 4UW5A 4IEPA 3VHRA 5AC92 1Y43B 1SEFA 4XXPA 3MICA 4IEQA 3N7KA 5A80A 1SG3A 1W6PA 1NQJA 1PK6B 2BU9A 3H8OA 2BGOA 4QQPA 5A7WB 4QMAA 3GJAA 4YW4A 5F5AA 1E57A 3KQ4B 1OOPA 3DN7A 1UL9A 5E88A 4MG2A 4I0BA 4K1ZA 1PIV2 4MGIE 5JR2A 3N4MA 4LO6B 4JDNA 5F37A 1OLRA 5I0SA 2ZJCA 3PJYA 1NE6A 1PHMA 3K77A 2QQOA 3KHCA 5C8WA 2WUHA 3DF0A 1OH4A 2VH9A 1W8FA 1RVF3 5DXDA 1EUTA 3APBA 3MLKA 4MUVA 4NMIA 4U2AA 2WFF1 2N7GA 2VULA 4QKBA 1CAXA 3WHTA 2DVDA 1XNCA 1ZBE3 2R49A 4M3CA 5KXEA 3D82A 1WLDA 3VKOA 3VD7A 4IEYA 3KVAA 2WO1A 3GDBA 4KWUA 1L3JA 3VZOA 3ILFA 2WT1A 1HRV1 5FXZA 1G9CA 3FX3A 2PAMA 2PQSA 2OUJA 1C8M1 1DGRN 3U37A 1RUI1 2RJLA 3VBFC 4ES8A 1JU3A 4X8NA 3WX5A 3JBG2 4YSFA 5KXBA 3J7HA 1DDLA 2QQJA 5FFOC 1QKQA 4B7KA 3POYA 1FPN3 1CZVA 1OVSA 2WAAA 4AE2A 4DPNA 2WS91 2BERA 1LOFC 3POFA 1RUH1 4Y22A 1WLWA 2GMMA 4YW7A 3VKFC 4AZZA 3UGFA 2AEZA 1UZWA 4META 1XNKA 1I5ZA 2HWD2 2Z79A 3FHIB 1AR62 4XXAA 1VBB3 1LNSA 2CNAA 4ZXEA 1ND2B 4K7JA 3LA2A 4CXWA 1GU3A 2XJPA 3EO6A 4HZFA 3T08A 4E2QA 2ORXA 2VCCA 5H9SA 3W58A 1WW6A 1IG3A 4FOQA 1H2NA 2HWE3 2OYZA 1ZRIA 3LQCA 3N9PA 4IQPA 4LO7A 5A6ZA 4PBOA 4S2HA 4WBBA 4YW2A 1H2KA 4ISRA 4QT6A 4A7ZA 5JOWA 2A71A 4CP2A 1O59A 4DMIA 4EJRA 5LW9A 4ZHNA 5F9TA 2V4AA 1SMVA 1GZWB 2YV8A 1W8TA 1XSQA 2CV6A 2QQMA 4TXWA 1QH7A 2R063 1SLLA 5CFDB 4QX8A 3OPZA 1NG0A 5F39A 3C7GA 5I0TA 5LCWL 2OQ7A 2Y6HA 4Y4RA 4OFGA 2WYFA 1N1TA 1HN0A 4JTNA 4DQAA 2GNBA 4LBQA 2A3YA 3HQXA 4AI8A 1QJZA 2RMU3 4XUQA 4AW7A 4DS0A 5LEKA 1B35A 3ZOIA 1AF9A 5LA2A 2C0ZA 3RYPA 5BUVA 3OGRA 4EROA 4NUBA 4W50A 1MZEA 2VBDA 5BXXA 5A3LA 2ADDA 1ASJ2 1XYPA 3DL3A 2KA3A 3R6SA 1QQP3 1OT5A 3ZN5A 2ZCWA 3WQ0A 3EBRA 1YFXA 3J8F1 4PLMA 4E4ZA 5BNOB 3AYDA 5H9QA 1W8WA 2HWC1 3VKMA 3KD4A 4C0BA 3KGLA 2XJQA 3I7DA 4OUMA 2YPDA 4OVEA 4EN8B 4IV1A 2OPWA 4D6QA 3RMXA 4NHLA 2PHWA 4CPBA 1UY4A 1W2TA 3AKQA 3UETA 1NXD1 3A7QA 1TME1 4OQ9A 1FNYA 4N43A 3N9MA 4JGZA 5FOBB 1JS9A 1LKNA 1UYPA 2NN8A 2BGCA 2QDRA 2VZQA 2WNEA 5EJ1B 3SKJE 5A6XA 4HSLA 3IIIA 4WVZA 3NAPC 4B3NA 5A1LA 3ZR5A 3B9IA 1D2QA 5CB7A 1PMJX 1VAMA 4A41A 3JB4C 1RUD2 1T6GC 2VQ0A 2IXCA 3WLUA 5CA6A 1S0JA 1CONA 3OOXA 3EB7A 1NYWA 4Q0UA 5FY5A 5A6YA 2EAAA 4CEYC 1RGSA 5FTTC 1N3PA 4CU8A 2AACA 3RI8A 2YU2A 4Q29A 2ZGPA 5FP7A 2EA7A 1PO21 1ODMA 4RFRB 3WF0A 3PHMA 2D97A 1VBD3 2Q30A 4AVBA 3CIHA 1NCQB 1UOJA 2QE3A 5FY4A 1W8NA 4INDA 1Q8QA 1PO11 4J1XA 3CDZB 4O9EA 3VDDA 4N7UA 5E1RA 5A7PA 4QPYA 3ZYGA 1GOFA 1SLBA 4Y20B 4FPCA 1LOEA 4M4PA 1H0BA 4CCLA 2ZX1A 4BU2A 1E5HA 1JU4A 1RMU1 1PMIA 5C3QA 3ITQA 4X6QB 1HDKA 1YXWA 3WF4A 2BGPA 3LZZA 2YC0A 2F17A 2GH2A 2JDZA 3MZHA 2PHXA 2HLEA 4OULA 4DY5A 1JZ6A 4GD4A 2PHRA 2XBO1 2AGSA 3H8RA 3ZKYA 3A0KA 3ROUA 1Q8OA 1W9WA 1VMJA 3THDA 1TMF3 3GHMA 3ZFFC 4C1XA 3Q8EA 4EV0A 4PT6A 2R071 2WQZC 1PGL2 2EVXA 3AKTA 4KGGA 3SCFA 1RUF1 2Y6GA 4WVMA 3AP7A 3K3NA 4M3CF 2Z5WA 5A33B 1QJX1 2VD7A 3WNOA 4QPGC 2ID4A 4UOJA 4FBFA 1SDDB 2VZSA 4LKSA 4Q4W2 2ZAHA 3HNYM 4XTMA 1RJ7A 1ST8A 2VCMA 3WW2A 1WW4A 2PQQA 4QGLA 1DQ6A 1W28A 4YW1A 5CNAA 2ZTNA 1K5MB 1YWKA 4UT5A 4H55A 4GKYA 3PNAA 4XDPA 2VUDA 3JD72 3PUIA 4ZU5A 4GJYA 1AR91 4YZ1A 4R52A 3S57A 5FZ0A 5DAWA 2QQKA 3M8LA 1TG7A 1S0FA 1AYM3 3TYJA 1LECA 3UNPA 3DKWA 4F83A 1N47A 1DLLA 2LROA 2Z42A 3SNMA 1UY0A 4YGCA 1AJOA 2CL2A 5I8SA 2XXZA 2IXIA 4XURA 2RS32 3TEWA 2MPFA 3I59A 4AI2A 4P5YA 3HEIA 4IGOA 5FZ8A 4CPBD 5LBBA 2VMIA 3A23A 2W1SA 5IATA 2NQYA 4R4XA 5ACA2 5JZGA 1X8EA 2PN5A 2VZPA 3I2FA 1UAIA 1N1VA 3IMNA 1ZZ7A 4YWAA 4DUWA 2ETEA 2FCVA 5TSWA 1QHDA 5KXCA 3BCWA 1W8OA 4YG6A 2GC3A 3CBNA 4IL7A 3ACIA 1LODA 4BLIA 3T0DA 1X33A 2R1DA 1QJY2 3ZFGA 2EXJA 5GLZA 2GZWA 1CX4A 4HL0A 2BYVE 1DGWA 4YM3A 5ABJC 2DWRA 4LUMA 2VBBA 3I2GA 3OBAA 3ZVXA 1ENQA 3BYWA 4YM2A 1PGSA 4L92A 4BPZA 2HWF3 2W9XA 4FPKA 4AFDA 2ZXQA 3D5OA 2E7AA 2XONA 2X5IB 2ZGUA 2VTFA 2VCAA 3ECQA 2K0GA 4CU7A 5M0TA 2RHPA 1MQTC 1EV13 2VXRA 4XUTA 2EF6A 2F6BA 4WM8A 3AYAA 1HQLA 3U11A 2ZEZA 4PI0A 2YC4A 1G8WA 1XE7A 5L7OC 2HWB3 4IDZA 2VQUA 4BMEA 4IV3B 5BV6A 5FZOA 4PDWA 4MXWA 2ZACA 4LTAA 1SFPA 5CFCC 1QXRA 1UOGA 2RM21 2FDHA 5EZWA 3T0AA 2JX9A 1DIWA 4JQTA 4YGBA 1WLTA 3NNFA 4QX5A 1H8TB 1O4YA 4FXGB 5JOYA 1IZ3A 1YI9A 2ORZA 2YMZA 4K3UA 2DVGA 1JW6A 1RUG2 1LRHA 1OA3A 2WL1A 4EN0A 4RGKA 4GAZA 4ISQA 5FY7A 1LOFA 1COV1 1QJEA 2MEV1 3H9AA 4LXLA 2IXJA 5I0RA 5FPBA 4KU7A 1XNBA 1OKQA 3LA7A 2BW8A 5T50A 1RUE1 4R9AA 3NRUA 2ET7A 3F95A 3M3CA 4CUCA 5JCTA 4AGRA 2E9QA 1RITA 3WG4A 1F31A 4SLIA 1OXCA 1FATA 4HG6B 1D2SA 1WD3A 3WF2A 1NA1C 3I49A 1MACA 1XXNA 4KBBA 4NPMA 1OA4A 2WZR3 1F35A 3AZYA 1YO8A 4MVTA 4O7XA 3THTA 4AQTA 1JZ4A 4WM7C 2PTMA 3AXDA 1U0AA 3Q8FA 2Q8CA 5FYUA 2P6HA 1O3SA 4MGYE 3POEA 4LA2A 1R092 3KT4A 3AP9A 1C1FA 5K9YA 5T54A 2IXKA 2C4XA 3I97A 1W06A 1O6UA 2A6YA 2LS6A 1PGW2 5K0UC 4JHTA 4R4ZA 1VR3A 1ULCA 1W8UA 1K12A 5FKBA 4G9SB 1VIWB 1UYYA 2JD4A 4FFIA 2UY8A 5A3MA 5JI9A 4EYUA 1KJRA 3ETQA 2Q1MA 3VBUA 4MSVA 1UU4A 3ZN6B 3BKZA 1CAVA 4E9KA 3CZUA 5JVVA 2CDOA 2Y64A 3KCYA 1SLAA 5ANNA 4AAPA 1NKGA 1D4VB 1ULDA 1BEV3 2E7TA 1ENRA 3DYMA 3LFMA 2JD9A 5DAQA 1R1A3 4ZZ8A 5FZMA 4G4FA 1JUHA 2BRTA 2VPVA 4HN0A 2D93A 2BBAA 4Q4Y3 4DUVA 1US2A 2HH9A 3DECA 4PIYA 1HIXA 4UW4A 2Y60A 4N7IA 1IKQA 1EAH2 5LA9A 4YNIA 4G3YC 5JOXA 3URFA 2PMWB 3SHRA 1FXZA 2P6CA 1ZBE1 3FUQA 1AL22 1HRI2 4N90A 1KS4A 4TLFA 1NLQA 1DQ4A 4A6SA 1CD3G 1Z7S1 4F7ZA 5BNQA 5IK4A 4KU8A 4NRQA 4XF1A 2G4IA 1W9FA 4QDRA 4ES9A 4NHXA 3VBHA 3GF6A 1CJPA 3I2JA 3VGIA 2FDGA 2CU5A 1MS0A 3HNMA 4FSJA 1PMHX 1PK6A 2KXLA 1A34A 5A7WA 4BXFA 5D8AA 1OOPC 3NSTA 3U0ZA 1GQGA 4IXLA 4UXAA 4BLJA 4FO9A 1GNYA 1GV9A 3VZJA 4L8QA 4LLOA 4BQ4A 2CAUA 1NXMA 3C7FA 4GALA 3THPA 3VL8A 4D8MA 1UCXA 5J48A 3SH3A 2BWAA 4CUAA 4GMP0 3Q8CA 3EQEA 4QDSA 3I2HA 4K8FA 3LAGA 3E6DA 4D6SA 1CAWB 1H1IA 3FLPA 3WDVA 4LMFA 4DO0A 1YUDA 1WGPA 2JECA 3IWZA 3TOJA 1FMD3 4QKFA 5CZKA 4B4QA 4M01A 1X9PA 3N9LA 3OY8B 2WDBA 1BXHA 4AHYA 2JIJA 4YVWB 2WNOA 1N3OA 3ZR6A 2ZS6B 3B94A 4CP9B 4ZS2A 4XEZA 1VRH1 5IK7A 3LPGA 5EJZB 2IWGB 4CDXC 1VBC1 4GZ9A 2JJ6A 3NNGA 1PX3A 4IGQA 3ZFFA 4I0WB 3D0SA 3KHBA 1X8MA 2WT0A 3R4SA 5FV3A 2ZX0A 3PUSA 5T5PA 3LWCA 4P9WA 1NY71 3QD6A 3WG1A 5KHHA 2C5DA 4LKEA 1ENSA 4BISA 2GDFA 3IKWA 4QKDA 4LBJA 1PM7A 4JAAA 1O8SA 1NCRC 4QXKA 1RUC1 4QPGA 4LA3A 1Q8VA 4N53A 4AFCA 2WA4A 4YZ3A 3DPRA 4HKOA 4Q8KA 1REEA 2D43A 2PELA 3NJXA 4RHV2 2A1XA 4HK8A 4D0QA 3THCA 4N8MA 4JTOA 5CKMA 1QJU1 1AR83 3NNLA 1JYVA 1ND2A 5JPMB 1TQ5A 3DYOA 4CCDA 3AFKA 4ZZ5A 1W0OA 3RZGA 5A7NA 1YEWA 3AX4A 4PLNA 4KWKA 4Q5OA 4RA0A 3LE0A 5HI0A 1BMV1 4KL1A 1LR5A 2BEOA 2DF7A 3D4KA 1HRV2 5H9RA 5LA1A 5CU1A 5DMYA 3OD0A 5FREA 3RI9A 1C8M2 4DEQA 1RUI2 1AR73 3LIHA 4Z2AA 5C3PA 1WCQA 3NNJA 4ASMB 4UWDA 1RUNA 2BDRA 1JYIA 2VECA 2V09A 2XKPA 2Q1ZB 3AP6A 2WS92 4GH4B 4UAPA 2VNVA 1RUH2 3T2PA 3VBSA 2ZGQA 1O4TA 4O65A 3OJBA 3CJXA 4QD2A 1B35C 2EIDA 3NVCA 4QXBA 3W20A 4E2SA 3MIHA 1LHUA 3OGSA 4UFIA 5FMDA 1BQPA 1HKDA 1HHNA 4CDWB 4P9GA 3BPSA 2IFWA 4FPLA 3KB5A 5FAXA 3P1IA 4FAGA 5JLVA 4CDUA 1VBD1 1PM4A 2W87A 1XQNA 4LJHA 4YVSB 3T4HB 3CNAA 1QJFA 4DB5A 4MHRA 4DIQA 2ZGOA 2SBAA 3WW4A 1D4M1 2BPA2 4QM8A 3ZXDA 5AC93 4I3GA 2QQIA 4XCAA 5EV7A 3O7OA 3CHXA 2W39A 4W65A 2R041 4QXCA 2VZRA 2Y8KA 1LOAA 2PHFA 1OFNA 1F8VA 4TYSA 2UY9A 1OLQA 1YJLA 5CBLA 1Q5OA 2OA2A 4AVVA 3R4UA 5IK8A 2XR4A 4LE4A 1DYKA 3HPNA 4EZHA 2DCTA 3J7MA 3ZN4A 3SKVA 4XC9A 1J1LA 1V00A 1PIV3 1FAYA 3KF5A 1S0GA 5GZFA 4CDQA 5L7OA 2VMGA 4QXHA 1F5FA 2P5BA 3NW4A 1BKZA 2YBKA 5T3NA 1UZ0A 1GLHA 3CEWA 2NM1A 4K9SA 4NN0A 3ST7A 3E6CC 2JKXA 3J8F2 3MLLA 5FZHA 3LEKA 3F2ZA 2WNVB 4FCAA 2HWC2 1W6MB 4QAWA 4ZONA 4QM9A 4LHLA 3AYEA 5EQUA 4UFMA 3Q8BA 5HCFA 5SV8A 3SITA 3WR0A 4COUA 3NV3A 3VDDC 4XFCA 3CO2A 1IPKA 3GM8A 1S2BA 1YI7A 2DVAA 4GB32 5GKAC 5H9PA 3NL1A 1UIJA 4Q4X2 2JDNA 3LIGA 2FMYA 3N9NA 3B69A 2JG9A 2WWJA 1W6OB 2ZZJA 1TME2 3MO4A 4XJZA 5C70A 1Q43A 1J3PA 5J09A 1APNA 3NV4A 1FYUA 4SBVA 1XE0A 3WINE 1DZTA 3VBFB 2MHFA 5DZEA 3SEEA 1GNHA 1IS3A 4AQ6A 4YW3A 1KITA 2WN2A 1EYBA 3JBG3 1JZ2A 4NPLA 4GMP1 2YUEA 3N7LA 3QOPA 3WDWA 1BZWA 1FT9A 2VTXA 4AI9A 5IVFA 1W90A 1CAUA 2TEPA 2ZMKA 1LOGA 4MYEA 4EWDA 1KRIA 2Y38A 1L7RA 2R30A 3CL1A 2ZGRA 2VW2A 3ES1A 4AHWA 1F9KA 1AR63 2HWD3 2XWJB 3G7DA 4BXSV 4H14A 3JQWA 5C9AC 2NLRA 1PO12 3TWIA 4C91A 3MPPG 1JHNA 4UYBA 5FYBA 5D2AA 4E8CA 3WNXA 5A33A 5JIAA 5FPLA 4QX3A 3GZEA 3CKHA 3ACGA 5DABA 2Y33A 3LDKA 5LY1A 2G1MA 5A3PA 3OUHA 3W21A 5I8YA 5BNNB 1U5IA 2BFUL 3CJIB 4BQWA 3U07A 4D7SA 1DHKB 4XTPA 4QX7A 1NE4A 3T2QA 4PIXA 1S2KA 1GR3A 2XBO2 3OYWB 4AG4A 4EN6B 4H3WA 3PUQA 5FZ7A 3VBOA 2HBUA 2OXBA 3HNBM 2CSGA 5F1RA 3JUUA 3BTZA 1W9TA 2D6LX 2HWF1 3JZVA 2R072 4BQ2A 1ONAA 3NJZA 4IEWA 4MXVA 5J3UA 2RS51 1LHVA 1MEC1 2VCBA 1U5XA 5LZ6A 1DQ5A 1S0EA 1MZFA 1ASJ3 1WWYA 1EV11 3IT8A 2XMLA 4QU2A 1GZTA 1MR5A 1JOPA 1WBFA 3NV1A 1GUIA 4FP3A 5JZGC 3C7OA 3W5NA 2ERFA 3OEBA 4P08A 1CQ9A 4AVSA 3O1RA 1IQAA 1UXZA 2J7MA 4PJYA 5JR7B 2P2KA 2VC9A 4CCEA 4D7YA 4MX3A 3H1MA 4IEUA 1REDA 1U5ZA 2BNOA 3POSA 4CCKA 4UBGA 4Y24A 4QHOA 2R16A 2Y6FA 2WSUA 3AMMA 2BV4A 2RS11 4ATEA 3MW4A 3BODA 4Q0VA 5IVCA 5ISLA 4HVOA 3ZFGC 1W2OA 3W9AA 4XHBA 2A6VA 3N35A 3V0BB 4FAHA 1YLLA 4XF9A 1JBCA 5F6KA 1ZZ8A 3AZZA 3C7EA 1CVNA 3USUA 4NIHA 3WF1A 3IMMA 3O1UA 4Z82A 1UNBA 4QQHA 3ACFA 3ZFEB 3HT1A 4XBQA 5FY1A 4AF9A 2GC1A 2J1SA 4AEDB 4CCOA 4CYDA 3HWJA 4L9BA 1WW7A 2WNUA 1RUD3 3POIA 4CEYB 2EALA 4AGGA 1XNDA 4RQPA 2O8OA 4NHYA 2P4EA 4Q0QA 2ES3A 5IVEA 1WA6X 2D3PA 4XOGA 2QQNA 4WM8C 3OUJA 5DG1A 2VJXA 5JAXA 1V70A 5C3RA 2R7EB 3I8TA 4IGPA 3BIEA 1W6NA 2WZR1 3PDQA 5LRRA 5HCBA 3ZXLA 4CDXA 5EXOA 4D94A 3HAGA 3O14A 4PDWC 4IV3A 4K40A 3I3EA 4A3XA 5FP9A 1HB2A 3RVHA 3RYRA 2PA7A 1OVPA 3J7NA 3MUY1 1GNZA 4JCKA 1H2LA 5EHDA 1H9WA 1OHFA 3GJBA 4Q4V2 5L9BA 3PU8A 4QHBA 3ZYHA 4TTGA 5BY5A 1XYOA 4NHKA 2K2SA 3UJQA 1KDMA 3MEPA 1NCRA 3DYPA 3OD4A 1Q8PA 1RINA 4QDQA 2BNMA 2W08A 4LO8A 5A32B 4P9YA 3UL2A 2XJVA 4XBLA 1UMHA 4M3CE 5FPAA 2ZMLA 4AHZA 4NIDA 2ZHLA 1HB3A 2WBKA 2D40A 4MZUA 1DQ2A 4N9IA 3RFRA 3OUIA 3PUHA 4CCNA 3GGLA 3RZMA 4A7KA 2H0VA 2VMDA 3MIEA 1R1A1 1RHI2 1SPPA 2JB4A 4Q4Y1 3MDPA 3WT3A 1RUJ2 2QQLA 2RM22 3KCXA 2RDRA 3MIGA 1V6KA 3WNLA 4CRQA 1OSGA 3MLJA 3C3VA 2JE7A 3POBA 4Q4W3 3NQHA 1WMXA 1RYYA 2DUQA 1LOBA 1W2AX 4PCRA 4CXXA 1GWLA 1OQDA 5L36A 4B7EA 3FBMA 1COV2 3I3BA 3I2IA 3JD73 3WEZA 4CEWB 1LULA 2CGOA 3GBFA 4P9IA 2WIIB 4FPYA 2O0OA 5I8TA 3T30A 2B9UA 1RUE2 2V5YA 3AB0A 4NROA 4FPHA 4LIVA 3CQOA 3VBUC 4AFBA 2WQ8A 3GXUA 2ZGTA 4BH9A 5CKNA 1K45A 2EIBA 4PF1A 2RE9A 3KLSA 2ZKLA 4LO5B 2Y0IA 1Z0HA 5FZBA 1R082 2XGXA 2QQWA 4KI5M 1G86A 2J1RA 1W9SA 2J22A 5LY2A 3WQBA 2RS33 4MLOA 4HKLA 4XBNA 5FZCA 4AI3A 5JXHA 5JSOA 3ZYPA 4RS5A 3OTFA 3OGJA 5LWBA 4OHWA 1JZ5A 3ACLA 3VL9A 2ZGKA 2BUKA 4HOOA 1SLTA 2RG4A 3P3PA 2YBSA 2OZ6A 2GAUA 5ACA3 2VZTA 1DZQA 1Z78A 1OURA 2D44A 4KG0A 5FLIA 2W1UA 4XCBA 1FMD1 5E89A 4LT5A 1YHFA 3D0JA 4Q0PA 4H2AA 5T5JA 4OI1A 3U78A 1S0BA 4IESA 2QQVA 2JENA 5BNPB 4MH0E 4Z1VA 1QJY3 4ZKTB 2DCKA 2K46A 3NWKA 5DN2A 5EJ3A 3ES4A 1VBA1 4RD7A 5DAXA 2G9ZA 3O1OA 2C9KA 1DFQA 3MHZA 4YYOA 5CYYA 3VBHC 4YARA 4V1PA 1F2NA 3C8XA 3MW2A 4YZ4A 5DZFA 1PK6C 4XPVA 4ZY9A 2QBXA 4DRVA 2WO2A 3RWNA 5D8AC 5FYYA 2ZABA 1O5UA 4YLZA 1SBFA 2ZGLA 5DQ0A 3GZUC 2J1VA 5FMOS 5FO8B 1OC1A 4IE7A 2XLGA 4ASLA 2FZ1A 2R0HA 3RRDA 4AEJA 4XQ4A 4BB3A 2K9ZA 4HVQA 1TEIA 1ZBA2 4LE3A 1U12A 2F4LA 2C1FA 4YG0A 1ND3A 1H1MA 2PLV1 4KG8A 4XAEA 5G05L 5HCAA 1XNTA 1DGLA 3EYPA 4AVTA 2WZ8A 4BCUA 3ZYBA 3VBRB 4HETA 3WQ1A 2NMOA 4CA9A 3MIDA 4UW3A 2Y6LA 4ZXKA 1UMIA 1I6XA 4OZXA 5B4XA 1Z7S2 4YVWA 4FPFA 1B09A 2E53A 4IEZA 4Y1YA 1AX2A 1V6LA 3VZKA 1RUG3 3WP4A 1WMDA 1V6JA 1CZSA 3OBTA 3M4FA 5FRAA 1J59A 1XYNA 4XYXA 2NMNA 4R9DA 4ONUA 3DXTA 4L97A 2YZ4A 4WVWA 1ZZ6A 1L7LA 1JHJA 2BP6A 5JSRA 1AHSA 3POJA 4RR3A 4J25A 3CF6E 3ELNA 5I0DA 1Y9MA 3MV01 4QPIA 4HSJA 5C9AA 4N53C 1W99A 3DPRC 1WCSA 4XUNA 2FDFA 4LULA 2WLQA 3J26N 4DXZA 4BK4A 5HPOA 5JWPA 1W3VA 4WM7B 1ND2C 2NYYA 5A70A 5A3NA 3RG0A 1QGLA 5JI7A 4I01A 4GWIA 4R9CA 4E4DX 1EPWA 3O1MA 1AL0G 1C3HA 4LHNA 1QOOA 1R093 3MW3A 1VRH2 4YFZA 1RIRA 2E26A 5K0UB 1VBC2 4UFJA 4QB2A 3BGAA 3T0BA 2QZ2A 3V0AB 3NO8A 1J58A 3U10A 2W2IA 4JZRA 2XVKA 5GLTA 2IC1A 1VAVA 4D6RA 5ERLA 5CFDC 1S0IA 1AYN1 3GALA 1X9TA 1XC6A 2X09A 1S1AA 4OI0A 3VBSC 5C5UA 1RUC2 2W92A 3GNEA 4QPWA 5FPUA 1J3RA 1V9U1 2WINB 4LBOA 1G7YA 4AHXA 2ZEXA 4IEVA 3RZJA 1ULOA 5J96B 1QJU2 1PVC1 1PVXA 2AREA 5F3EA 3W5MA 3I54A 3B93A 1FI2A 1W6QA 4HBNA 1RC6A 4E8DA 3AZWA 2VNOA 3S0MA 1C8NA 1GWKA 5BNOC 3LOIA 4CDUC 5HV0A 4MOAA 1H8VA 1WD4A 5FLJA 3TN92 1BMV2 1EAH3 2ZEYA 1O5LA 5JXJA 3SH5A 4FTBA 4GULA 4YVSA 1WKYA 4Z8BA 4LNVA 4JKMA 2Q1FA 2FDKA 1AL23 1CWPA 1HRI3 5C8CA 5KHGA 5JPNB 4MHUA 1W6PB 1KS5A 3B02A 5A3WA 3ETPA 2SLIA 3MBWA 5K4LA 4JKKA 5FZ4A 5BYNA 1DP0A 3U4XA 1A8DA 3I3QA 4UBHA 4FPGA 2ZGNA 1OOPB 2RDSA 1OA2A 3BPZA 3PUAA 1DU3D 2ZHNA 4HPKA 1P8JA 4Z92B 2CGNA 5A7QA 4CDQC 4Q26A 4BIFA 1OQ1A 4L11A 2XHNA 3WZ1A 3AL5A 5A7OA 1POV3 4K21A 4JKLA 5FZEA 1HQNA 2QDNA 1E5RA 3QH6A 5DUXA 4XZUG 1GKBA 1HXS1 1NOVA 1AR61 2HWD1 3J9SA 1Y9QA 1JMUB 3O12A 1DYOA 2YFZA 4L99A 5GZEA 3VN4A 1V6OA 5AFBA 1Y4WA 2YROA 3FHQA 1CAXB 4DZGA 3FJSA 1Y9GA 4M3CB 1IQDC 3DEMA 1Q8SA 2VOKA 2GMEA 5K7PA 1D4M2 3LEMA 2DCYA 2GMPA 3ILRA 4XF3A 4DY3A 5JSPA 2JG9C 1BBT2 4OHYA 4RGGA 5FXVA 3IPVA 5FMOL 3O1VA 1ODNA 5FYSA 2R042 2WSVA 2WO3A 1EP0A 5IYYA 2A73B 4PQQA 1YQ6A 2E6VA 2GN3A 2GU9A 3KGZA 3DKQA 3SISA 2QVSB 2TUNA 3IDBB 4XACA 2G9GA 3ZKUA 1UY3A 3PJQA 1DQ0A 1VBE2 1YQ8A 2UU8A 2W0XA 2IXHA 2I07B 4Y22B 1AX1A 1ULGA 4IETA 5FWJA 4E27A 4W6XA 4YW5A 2XQRA 2I45A 1W39A 3BB6A 4LIUA 1VMHA 4EE2A 4JHZA 2DUPA 3PVNA 1YFUA 2WN3A 4A3ZA 4RHV3 4ARXA 3FC0A 2NZ9A 1A78A 3HBZA 2OQ6A 1W05A 2YB7A 3SXWA 5T52A 3FFZA 4AQSA 5LRSA 3LA3A 2UWBA 2G19A 3RDIA 4QX0A 2D6KA 4E4SA 3TEZA 2J42A 2BBVA 3FZ3A 3HVDA 2VVEA 1A3KA 2Y34A 1UKGA 1HRV3 5G04L 4HFSA 1GYKA 2C24A 3SCGA 1C8M3 1RUI3 3L2YA 5DDJ2 3U4SA 2RJ2A 5F6LB 1YQ5A 3OYWA 3GBWA 5IAVA 3VBOC 3MIBA 1REFA 1NZIA 4LBQB 2WS93 4RN5A 1K42A 2B46X 3ZSKA 1RUH3 5A3TA 1B35B 1RVF1 3H8UA 3M1HA 4NE9A 4OMCA 4OMDA 4JV4A 5LBFA 1RUD1 1UMZA 1UY1A 4A6OA 1O3RA 1OF4A 2JE8A 2BQPA 1V0AA 4CCMA 3BUCA 4KBZA 1LESA 4OHXA 3G6JB 5F2WA 4YZ2A 1N1YA 2PXJA 2VZ1A 2RR13 5CAZA 1JYXA 3TEYA 2XHKA 1D7PM 3WDYA 2ZKNA 1US3A 4LLFA 4AXOA 2VXJA 1UO9A 4XVHA 2UURA 4CSWA 4IV1B 3WCSA 3WV6A 2KR2A 2JG8B 3HMYA 2JDPA 3I2KA 2OPKA 3BU0A 1BJQA 5CKQA 4S2GA 1X50A 3O1TA 1HW5A 4N43B 4JGZB 1IS6A 3KF3A 4KQ7A 2B8MA 2Q8EA 4LOSA 1FPN1 4MO3M 2FHRA 3V0BA 1EPZA 4Q2FA 2B39A 1MS4A 4HKWA 3H1WA 3PLQA 2HEVF 5F32A 1CGPA 3FL7A 4XE9A 1FOD2 4Y33A 5CEHA 4BDVB 4AEDA 1TNRA 4UF0B 1VBB1 2WNUC 5FUIA 2RS52 4ARYA 1AZDA 1MEC2 2VZ3A 3T3YA 3JQXA 4DRRA 1DYPA 2B9VA 3SH4A 4XJ8A 3AKPA 4RQPC 2XL9A 4XZPA 3TBDA 1IPSA 4WZCA 2IFRA 5FYMA 2HWE1 5J98B 2BVVA 1LHWA 2BWCA 3E6BA 2HWC3 3NKTA 5DAPA 1OI6A 4CXYA 1RB8G 2YYOA 3IDAA 4IV3C 1GFF2 1RTVA 4GB33 2R061 4W4ZA 3RWKX 1LTEA 2RS12 2D7FA 4Q4X3 4AEMA 3VUOA 3ME2A 1U5YA 1GP4A 4D3WA 2B4KA 3FE5A 1TME3 1UYZA 2YPJA 1H8TC 4YFWA 1UZVA 3AMQA 4QB6A 1OMIA 1OUSA 1GMMA 5FQ0B 2RMU1 3ZYJB 2YFUA 4DXTA 2DVBA 1O91A 2LUWA 3FHAA 4BQ1A 4AWDA 1BK1A 3J4UH 1DZRA 1N3QA 2WFF2 1JYTA 1HQWA 5LB6A 2QZ3A 4AK3A 4CTEA 1QQP1 1VE0A 1A6CA 5E6HA 2A70A 3TB0A 4BMBA 1BHGA 3E5QA 3WOGA 4K6BA 2DUOA 3UV9A 2D5FA 2ZHKA 4WVMB 3CMGA 1FV3A 2H6CA 3LF7A 4HK9A 4JDOA 3ZMOA 1XBFA 2PAKA 2WFPA 3U14A 1PO13 3CLPA 1ZRDA 4JGYB 4R8HA 3AKRA 2PHTA 3V0AA 1GZWA 2VTXJ 5AVPA 3TNQA 4Z2WA 4YGDA 2UYBA 3ZM8A 5CFDA 1JZ8A 1JOJA 4XDOA 4RGAA 1C28A 3AJYA 1V6MA 1L7QA 4URAA 5C7GA 2O1QA 3T1LA 4BE3A 5F7UA 4WV8A 5L9VA 5IVJA 1OFSA 4B29A 1SCSA 1QJY1 3MUZ1 4NHMA 3T09A 2XBO3 4CEWA 4TSVA 5C3OA 1QNYA 4L0PA 5APAA 4AI0A 4XUPA 4CU9A 5LBCA 3UT0A 5KXDA 4OQ8A 1POQA 5KC6A 1VRBA 4JX0A 4BIOA 4MGZE 4EWEA 1Q56A 4KNCA 3VKLA 1YQ2A 1DG6A 5IJRA 3N9OA 4OYUA 4JRAA 4HXCA 3QBQA 2R073 5BNOA 1GSLA 3I59B 2R0FA 5DUVA 5GJ6A 2XJUA 2CTVA 5C4WB 1R1A2 1WBLA 5FJKA 2QQPA 4RS5C 3IM0A 3N7JA 1W03A 1SLIA 1UW8A 3M7AA 4ZS3A 1DCSA 3BU7A 3ZYFA 4ZU7A 3N3HA 3OPTA 3FMGA 1CZTA 3IN9A 3USSA 3VZNA 5D21A 4BM8A 1TZOA 3ZMNA 1I3HA 4S2FA 4QX1A 1QOSA 3WUDA 2HKXA 2Z2SB 3VD3A 4AEKA 5FMCA 2E32A 2VMEA 4LORA 1CIYA 2H0BA 3HQUA 4XF4A 1JZ7A 3ZFGB 4P14A 4XMIA 3BIWE 4JC1A 4E4HA 3GYDA 1AVBA 4P5HA 2BJSA 5F5QA 5BNPA 3LEGA 4AR2A 4F3JA 1TMF1 2D5HA 5FYVA 4B8EA 1FV2A 4ET7A 2XKOA 4CP1A 5JMOA 4AL9A 3SC7X 1SQ4A 2LRPA 2UYAA 4OHVA 4NIIA 2W5FA 3ILNA 4I3PA 3WNNA 1LJ7A 1UD1A 2P3YA 4FQZA 4YM0A 1WA4A 1MS9A 3K4AA 4CE8A 1LB2A 4QX2A 1NCQA 5I93A 3OBRA 3KV6A 4WM8B 4IE6A 4Y5SA 1C57A 3LFIA 5IUQA 3AYCA 1ND3C 1PZ8A 3AVRA 3N7MA 4Y20A 1OD3A 4AYUA 4GIQA 1GICA 3JCIA 4CCJA 1A8MA 1SHWB 4PDWB 4MXWB 4HLTA 4CUGA 4Y1UA 1O8PA 4DNYA 2AENA 5FUNA 5FZFA 1XJAA 1DGRA 2W46A 2Y6JA 3WNKA 2B42B 3ASIA 5J1XA 4YVWC 4CZSA 4Q4V3 5FZAA 1GOHA 1VBA2 1AYM1 4FPJA 1QDCA 5FY9A 3BOWA 2NPIA 5FYTA 4Q27A 4BOWA 2PAEA 5FMBA 1PO22 4X6RB 5GZGA 3ATGA 4EN7B 1QU0A 4RR3C 2D3RA 2JDMA 2AC1A 2IVJA 2IXLA 2JDAA 3KV4A 4LBNA 4QPIC 3A4UA 5F5IA 5F2SA 5LK7B 2YGMA 1X82A 4LK6A 2IUWA 3AMHA 1XSRA 4QQ2A 2VOWA 2PLV2 2PFWA 2GP5A 2GSYA 5GZCA 1VMFA 1UQXA 1RMU2 1BLZA 3M3IA 1RHI3 1H2MA 2I2SA 5FK7A 4MGSA 4BQ5A 4BJ0A 3BI3A 1EUUA 1K5MA 2J1AA 3ZSLA 1RUJ3 5FDBA 2RM23 2ZOEB 1SCRA 3KV9A 5IWFA 1S0CA 3RJRA 1UPSA 2D6PA 1EAH1 1G9BA 5A1FA 1V6NA 1IGOA 3LB9A 1YJKA 3RZLA 3KMHA 3KWVA 4BK5A 5JDBA 5FLHA 3TAYA 1K9CA 3KSCA 3NMBA 4COWA 1AL21 2P37A 1PZ9A 3Q8AA 1COV3 1I5PA 3SEPA 4BQXA 5C6CA 5FBJA 1MZ6A 1QMJA 2DDUA 3NKGA 4I09A 5FWEA 3VBUB 5IAXA 1RUOA 2B45X 2C6SA 1RUE3 4J6GA 4OUEA 1JTZX 3K51A 1RUF2 1CAVB 3IAPA 5A1AA 2X05A 5KBFA 2B7YA 1QJX2 1WW5A 1WZXA 4BQYA 4GH4C 4XFBA 3L2HA 4NRMA 3ZYIB 2IVIB 1R083 1Y3TA 3DV8A 3KT7A 2XLFA 1GP6A 1UOFA 2HWB1 3O0WA 3ZXEA 1LU1A 3TRSB 4Q1PA 1G9FA 3UKVA 2VMHA 1LAJA 3PIGA 3M2MA 3P5BA 1IPJA 2E63A 1YQCA 4IE4A 3WW1A 2W52A 1AR92 3NV2A 4ZPIA 4P9LA 3RMYA 4I30A 5FO7B 4CDWC 4NPRA 1LCLA 2YGLA 1UWWA 3WDUA 1UIKA 3AP5A 1JH5A 3H3LA 3NAPB 1VALA 4LKFA 2DCZA 2DU0A 4YVSC 5F8PA 5CVRA 2VUAA 4W6YA 2D3SA 3WP5A 5C8CC 1SACA 3NNMA 4X8PA 5C3SA 1HN1A 3FBYA 4AFMA 4TLGA 4MGKE 4MADA 4EZ4A 1X36A 2BOJA 3VBHB 3ZXFA 1AYN2 2NP0A 3H0OA 3R4DB 2C26A 3B00A 1IG0A 1VJ2A 5D8AB 1TNFA 3AZVA 4O9GA 1SBDA 2X5IA 2G9FA 3OBZA 4MGQA 3T2OA 2J1EA 1QOTA 1ZZBA 1V9U2 2CYFA 3U1XA 5LBEA 4WVVA 3GZTB 1RXGA 3H8XA 5FK8A 4NR1A 5FZ3A 5CG8A 3HQRA 4ZU4A 1PVC2 3UKNA 1PNFA 2EIEA 2XG3A 4AI1A 1MS1A 5DUWA 5E8AA 2ZBJA 4A2UA 1ZBA3 2EICA 2QNKA 3PTRB 1KD7A 2FQPA 3O1PA 2Q4SA 4LQRA 4RHV1 2W1WA 2WNVC 2WO7A 3PVBB 1OUXA 1H8TA 4HMZA 4NIAA 3WDTA 2XPJA 2H6BA 2FCTA 2GH8A 2ZMNA 1RJ8A 5FZIA 5K8SA 1Q3EA 4GXLA 3V56A 1YIFA 2J1UA 5AFEA 5J36A 4FT8A 3RZHA 1W3XA 2GC0A 3K4DA 3T1MA 1Z7S3 2A6ZA 4H7MA 5LATA 3ZFFB 2XH6A 4OLLA 1F4HA 3OGGA 3N36A 2P1BA 4AVAA 2ENRA 2P3KA 2FCUA 3KVBA 4BQ3A 1F5JA 4RL7A 1LGBA 3D3AA 1QWRA 4XJUA 2VY0A 1BEV1 2ZEWA 4XETA 4LHSA 2AUYA 1H30A 4M00A 4UFKA 3C7HA 1HX6A 3H3ZA 4QPGB 1W2NA 4N53B 4BHPA 2W94A 1RL3A 4D69A 3DPRB 2Y0OA 2QTWB 1HXS2
chains in the Genus database with same CATH topology
1G6NA 2XVLA 1M06G 1SFYA 4PBPA 5GALA 2VNGA 2XWBB 3EJKA 2WA3A 2MEV2 2RR11 2DVFA 1DQ1A 3FUOA 3PTYA 3ZXAC 4XFIA 1LEDA 1HLCA 4E2GA 1VRH3 3ZXJA 2DURA 1VBC3 5BNNC 1M4WA 5T55A 3KQRA 3AXEA 3CJIC 4U36A 3ZN6A 4FTEA 3ZXKA 5E16A 1NLSA 1LENA 3RJ2X 3ZYRA 1AXKA 2Q5TA 4YGEA 3ZSEA 1MS8A 2OVUA 3WY6A 3LCPA 1UKRA 1LOCA 2QCSB 3VBSB 1W2UA 4XW3A 5D1IA 4EN9B 3MI8A 1MVQA 4AFAA 1RUC3 1FX5A 4XJAA 1UU6A 3EXUA 2CGPA 3KM5A 2JICA 3FLRA 3VHPA 5IK5A 1QJU3 3UK9A 1SFNA 1QDOA 1R1ZA 3B9CA 2A3XA 5KHIA 3AKSA 4CDUB 4CP0A 5KWRA 4EWAA 4AQ2A 4NOTA 3SMHA 3TN93 4K20A 4DFSA 3AP4A 1ZRFA 3M3QA 3ZX7A 4GB31 2JG8A 1AXYA 2D6MA 1O7FA 1UU5A 1ZNPA 4Q4X1 5CIRA 3WG2A 3BOPA 4XFHA 1I1EA 4PLOA 1DF0A 1CIWA 2VQAA 4COYA 1MS5A 1XE8A 3QH7A 1MQTB 2HJIA 3MYXA 4KWJA 1UN1A 3GBGA 1RVF2 3ZFEC 4CDQB 4AEDC 5L7OB 3B5LB 1O3TA 1CAWA 1UF2C 4BWOA 1BYHA 3HIFA 4I0AA 1AR81 3POWA 2EXKA 1VP6A 5CFCB 1ZBE2 3ZPYA 1QXJA 3OY8A 3VV1A 4BA6A 1AJKA 1CR7A 4RFT0 4XQDA 2DFCA 3HD8B 4GWNA 3WW3A 4QQOA 1MZ5A 1AR71 2JG9B 3WDXA 4LO4B 1URXA 1D4M3 4YM1A 1HV1A 4YZ5A 1BBT3 1AXZA 3S6PA 1FPN2 4HT1T 3MFCA 2LALA 2R043 4XJWA 1PZ7A 1ZM1A 3HT2A 4URTA 4OHZA 1NA1B 5FQ0A 3LSDA 1VBB2 1CAUB 1VBE3 3ENRA 2P3JA 3AM2A 3JB8A 1AUYA 4F8AA 3V65A 4A7YA 4JQRA 3KT1A 5FOJB 4KH9A 5L19A 2HWE2 4C90A 1J1TA 5GZDA 3VZLA 1C4RA 1UX6A 5I0UA 2QUOA 2AYHA 4XIKA 1O4ZA 4TZDA 1YNAA 1LGNA 2R062 4JGYA 1NY72 5AC91 3QCWA 1KFXL 1ULFA 2E7QA 2OIIA 2WZPP 4Y1ZA 4Y4YA 1V6IA 4LBQD 4N9HA 1YFWA 2EXIA 1LEMA 4QQLA 1G9DA 4GH4A 2V73A 3MGUA 2RMU2 4CEWC 4FQ4A 5DDJ3 3VBOB 1PIV1 3K48A 1N1SA 4GMP3 4FXKB 2YHJA 3S7IA 2WJSA 1QQP2 2P17A 4XF0A 2D6NA 2ZPXA 3VZMA 1QY4A 1IHMA 4QGNA 4CDWA 4Z07A 5EWSA 4XHXA 2ARXA 1J3QA 1SLCA 3MF6A 5C4WA 2XB6C 2XUMA 1UPIA 2ZX4A 1ZZ9A 3WXPA 1ZYBA 3WHUA 2GALA 1XRUA 2E51A 4W6WA 1FNZA 1ZX5A 3LKJA 2MNGA 2GNTA 1BCXA 5DG2A 4Q4V1 1H4GA 3JBG1 3PMEA 3USUB 3DUIA 3VHOA 5BNPC 5L73A 2A6WA 5I91A 1KQRA 1LGCA 4PQ9A 1D0HA 5T5OA 2WNUB 2EIGA 1FOD3 4LEJA 4KGQA 3LOBA 4S2DA 1VBD2 4P9XA 4XFAA 1XU2A 2RS53 1LHOA 2WNVA 1MEC3 1W6MA 4RQPB 3HN1A 1YCIA 3MPBA 4FOWA 2VG9A 2ZA9A 1NCQC 4JDMA 2JXAA 2XJRA 1NZCA 2X53S 3ZDSA 2HEYF 4GKXA 1W6NB 2OUHA 3WP3A 2WC2A 4CDXB 1W6OA 4FOYA 1RHI1 4BZ4A 2VNRA 4FOVA 5LEJA 3M70A 2X29A 5HXVA 4J1WA 4C1WA 1RUJ1 2JE9A 3VBRC 2Q0AA 2RS13 3RYKA 3VBFA 5B2GB 2EXHA 3HR9A 1BVP1 4D7TA 4PF5A 3O0XA 5CADA 1W0PA 1ULEA 1TMF2 4IERA 1NCRB 1ENXA 1S55A 5EYXA 5LK5A 2DV9A 3T2TA 2GN7A 1QNWA 2FMDA 1OD5A 3H7JA 2WLPA 1TE1B 3LGRA 2ARBA 2WFF3 4Q8LA 3Q9OA 1ASJ1 3BALA 1H4HA 2LTNA 1LHNA 2YDEA 1R081 3AJZA 4JVAA 4GQ7A 5JOZA 1KJLA 3B7MA 1NQDA 1BVVA 3FWEA 3LSEA 4M0NA 4NWWA 3I4IA 1G9AA 3RSJA 2A75A 2VW1A 1CPMA 2D6OX 2DCJA 1K5MC 1I9RA 2DU1A 3RQ0A 4C0HA 3CJIA 5BNNA 1QXPA 1H1AA 4ORFA 2XJSA 1GZCA 1AYM2 1VLNA 4RSUA 3FFQA 4XQWA 4ATFA 4HVRA 4LUKA 4WZFA 3PMSA 5EYYA 4COZA 3KZ4C 1GQHA 3H1YA 5IT6A 1LU2A 2CAVA 3B01A 3D6EA 1IS4A 5BPXA 4FP2A 3RNSA 3PVEA 4HN1A 3P3NA 1HV0A 4GA9A 1CN1A 2Y26A 3I2DA 2VOVA 5JI9A 2R6QA 4NO4A 2TBVA 4RS5B 1OPOA 2ZAAA 3OF1A 3L9JT 1ZBA1 2XLAA 1JXNA 4P9JA 2XL7A 3INAA 5FCCA 4XFFA 3NAPA 5FO9B 4AVCA 1YIPA 3RS6A 1GZ9A 3M3EA 2HWF2 5HBAA 5T5LA 3ZFEA 5J7MA 5GM0A 3WG3A 3ZIXA 4CEYA 2P34A 1ZVFA 3B3QE 2X5IC 1EV12 2FBEA 2VOXA 4QGMA 1PNGA 4BYYA 2GNDA 3J8F3 2CWSA 3WCRA 1PGL1 4OI4A 2HWB2 3VDDB 4I2OA 2W68A 1IKPA 3DGTA 3KS7A 3MIFA 4LHKA 5DUUA 5GLWA 3S30A 1ND3B 3H50A 4Q4W1 3IBMA 3IDCB 5AVAA 2UWCA 4PIZA 2HYKA 3SLIA 2R32A 3ZO0B 3QLQA 4LBKA 3TNPB 4FPEA 3V64A 3JD71 4OI2A 2FZ2A 2EAKA 2VUJA 1D0GA 4DINB 2GNMA 3ZSJA 2OW4A 1VB4A 1VBA3 2RJKA 1VAKA 5A32A 3C2UA 2PHDA 5KC5A 4FVVA 2PHUA 4L2NA 2BTVC 1C5HA 2PYTA 1PO23 4RR3B 4QPIB 2RS31 1X7NA 3R0RA 5C9AB 2WZR2 2BFUS 5FPXA 2WT2A 1JYCA 3GHNA 5KHJA 1YYNA 1C5IA 3O0VA 4AGVA 1OQEA 5JMCA 1KXGA 5ACA1 3EHKA 2GC2A 1POV0 1ALYA 2PLV3 3SCHA 2ZX2A 1WMFA 3MFAA 4OUSA 3UKTA 2ATFA 1RMU3 1ZA4A 2DTYA 4XDQA 3PVOA 2VU9A 4I02A 2QJVA 2QKDA 4Y5Z0 3E5UA 4LBMA 2IZWA 3TN91 2VGDA 2AH2A 2YXSA 4XJ9A 1NLRA 1WCKA 5SV5A 2XJTA 1BEV2 3GZAA 4GWMA 1YRZA 4LR4A 1MS3A 2TNFA 4XIOA 1RUF3 4NWVA 4R9BA 3H3UA 5GLVA 4ITCA 4Q4Y2 1QJX3 2ZZQA 5JZGB 3ALQA 2R1BA 3VLBB 3IDEA 1W6QB 3JU9A 2CWMA 4M0HA 5GLUA 2RR12 2X8KA 3BTAA 4K1YA 1AR93 2A5ZA 2VW0A 1DBNA 1C1LA 1DGWX 5ABJA 1RUG1 5FPZA 4IV1C 1XU1A 2JEMA 5C8CB 2JG8C 2Q8OA 3QACA 3X29B 2O8QA 1WUVA 1BBT1 2WWSA 5FBZA 4N43C 3FLTA 4JGZC 1ZREA 2XVGA 3CU7A 1AYN3 4HANA 4NVPA 3WVJA 2F4PA 4LBLA 2C9AA 4UW6A 1KDKA 2QFEA 2YY1A 4HPKB 1MQTA 4IEXA 4TWTA 1V9U3 3OCPA 1VBE1 3IIAA 5EFUA 3VL9A 2B5HA 3AMNA 4XFGA 1FMD2 1PVC3 1WLCA 3S7EA 2WQ4A 4COVA 3WP6A 3KCCA 2LM3A 1GBGA 1QF3A 3VBRA 3W59A 5CFCA 1GANA 1MVEA 3M3OA 4Q1RA 2DFBA 2D98A 1R091 2CY6A 2BNNA 1IOAA 3O5SA 4IEOA 1PGW1 4FTSA 2PHLA 3AK0A 2P3IA 3IPVB 5JIUA 4Y26A 3UJOA 1CPNA 1ZZCA 1UZZA 2ZGSA 4MV2A 4B4RA 1UZYA 4JRLA 4B4PA 1O3QA 2VVDA 2UWAA 3A0NA 5DDJ1 4Y1VA 4XILA 1NA1A 2ILMA 2AZ5A 1AR82 4H7LA 3VHNA 1Y7BA 2BVBA 1SDWA 2HEWF 4Q0SA 4WM7A 2ZHMA 3AFGA 1HXS3 3ZXGA 3H7YA 2DYCA 3MF9A 4Y1XA 1CJDA 3E97A 4KWLA 1WMEA 3RPQA 4YRDA 5K0UA 5C33A 1OPMA 1AR72 1HRI1 2MEV3 2Z69A 3AMPA 4JGYC 1KFUL 1S0DA 3ZIWA 1SBEA 3VKNA 2WKKA 5CG9A 4DOUA 1AX0A 1IS5A 2A7AA 3E5XA 1YFYA 2I74A 2AR6A 2ZGMA 1WCDJ 3RZZA 1CESA 3WD5A 1ZRCA 2ZX3A 1H9PA 2OZJA 1POV1 1QH6A 3R05A 2ET1A 3D8CA 5J37A 1FOD1 2DTWA 5DZGA 3ZSMA 4FPOB 2VVFA 3AZXA 2A3WA 1JUIA 1ZRRA 5KHKA 5C4WC 1JN2P 3WUCA 3WQ7A 2JKBA 1EY2A 2KM2A 1VB2A 2A6XA 4XMAA 4YG3A 4UW5A 4IEPA 3VHRA 5AC92 1Y43B 1SEFA 4XXPA 3MICA 4IEQA 3N7KA 1W6PA 1NQJA 1PK6B 4QQPA 4QMAA 4YW4A 1E57A 1OOPA 3DN7A 1UL9A 5E88A 4I0BA 4K1ZA 1PIV2 4MGIE 3N4MA 4LO6B 4JDNA 5I0SA 1OLRA 2ZJCA 3PJYA 1NE6A 1PHMA 5C8WA 3DF0A 2VH9A 1RVF3 5DXDA 3APBA 3MLKA 4MUVA 4U2AA 2WFF1 2N7GA 2VULA 1CAXA 3WHTA 2DVDA 1XNCA 1ZBE3 2R49A 4M3CA 5KXEA 3D82A 1WLDA 3VKOA 4IEYA 1L3JA 3VZOA 3ILFA 2WT1A 1HRV1 1G9CA 3FX3A 2PAMA 2OUJA 1C8M1 1DGRN 1RUI1 2RJLA 3VBFC 4ES8A 4X8NA 3WX5A 3JBG2 4YSFA 5KXBA 1DDLA 5FFOC 1QKQA 4B7KA 3POYA 1FPN3 4DPNA 4AE2A 2WS91 1LOFC 1RUH1 4Y22A 1WLWA 2GMMA 3VKFC 4META 1AR62 1XNKA 1I5ZA 2HWD2 2Z79A 3FHIB 4XXAA 1VBB3 2CNAA 1ND2B 4K7JA 3LA2A 2XJPA 3EO6A 4HZFA 4E2QA 5H9SA 3W58A 1WW6A 4FOQA 1H2NA 2HWE3 2OYZA 4IQPA 4LO7A 4PBOA 4S2HA 4WBBA 4YW2A 1H2KA 4ISRA 4QT6A 4A7ZA 5JOWA 2A71A 4CP2A 4DMIA 4EJRA 5F9TA 3V0AB 1SMVA 1GZWB 2YV8A 2CV6A 1QH7A 2R063 1SLLA 5CFDB 3OPZA 1NG0A 5I0TA 4OFGA 1N1TA 4JTNA 4DQAA 2GNBA 4LBQA 2A3YA 3HQXA 4AI8A 1QJZA 2RMU3 4AW7A 4DS0A 5LEKA 1B35A 1AF9A 3RYPA 2C0ZA 5BUVA 4EROA 1MZEA 5BXXA 5A3LA 1ASJ2 1XYPA 3DL3A 2KA3A 3R6SA 1QQP3 3ZN5A 2ZCWA 3WQ0A 3EBRA 1YFXA 3J8F1 4PLMA 4E4ZA 5BNOB 3AYDA 5H9QA 2HWC1 3VKMA 3KD4A 4C0BA 3KGLA 2XJQA 3I7DA 4OUMA 4OVEA 4EN8B 4IV1A 3RMXA 4NHLA 2PHWA 3AKQA 1NXD1 5FOBB 1TME1 1FNYA 4N43A 4JGZA 1LKNA 2QDRA 2NN8A 2BGCA 2WNEA 4HSLA 4WVZA 4B3NA 3NAPC 3B9IA 1D2QA 5CB7A 1VAMA 3JB4C 1RUD2 1T6GC 2VQ0A 2IXCA 3WLUA 5CA6A 1S0JA 1CONA 1NYWA 4Q0UA 2EAAA 4CEYC 1RGSA 5FTTC 1N3PA 3RI8A 4Q29A 2ZGPA 2EA7A 1PO21 3PHMA 2D97A 1VBD3 2Q30A 4AVBA 1NCQB 2QE3A 4J1XA 4INDA 1Q8QA 1PO11 4O9EA 3VDDA 4N7UA 5E1RA 4QPYA 3ZYGA 4Y20B 1SLBA 4FPCA 1LOEA 1H0BA 2ZX1A 1RMU1 1PMIA 4X6QB 1HDKA 1YXWA 3LZZA 2YC0A 2GH2A 2JDZA 3MZHA 2PHXA 4OULA 4DY5A 2PHRA 2XBO1 2AGSA 3A0KA 3ROUA 1Q8OA 1TMF3 3GHMA 3ZFFC 4C1XA 4EV0A 2R071 2WQZC 1PGL2 2EVXA 3AKTA 4KGGA 3SCFA 1RUF1 4WVMA 3AP7A 4M3CF 2Z5WA 5A33B 1QJX1 4QPGC 4FBFA 4Q4W2 2ZAHA 4XTMA 1RJ7A 3WW2A 1WW4A 2PQQA 4QGLA 1DQ6A 4YW1A 5CNAA 2ZTNA 1K5MB 1YWKA 4H55A 4GKYA 3PNAA 4ZU5A 3JD72 4YZ1A 1AR91 4R52A 3M8LA 1S0FA 1AYM3 3TYJA 1LECA 3DKWA 4F83A 1N47A 1DLLA 2Z42A 3SNMA 4YGCA 5I8SA 1AJOA 2CL2A 2IXIA 2RS32 2MPFA 3I59A 4AI2A 2VMIA 2NQYA 4R4XA 5ACA2 5JZGA 2PN5A 1X8EA 3IMNA 1UAIA 1N1VA 1ZZ7A 2ETEA 5KXCA 5TSWA 1QHDA 3BCWA 4YG6A 2GC3A 4IL7A 1LODA 4BLIA 1X33A 2R1DA 1QJY2 3ZFGA 2EXJA 5GLZA 2GZWA