1JHNA

Crystal structure of the lumenal domain of calnexin
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
398
structure length
380
Chain Sequence
YKAPVPSGEVYFADSFDRGTLSGWILSKAKDGKWEVDEMKETKLPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGVYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSIVNSGNPVNPSREIEDPEDQKPEDWDERPKIPDPDAVKPDDWNEDAPAKIPDEEATKPDGWLDDEPEYVPDPDAEKPEDWDEDMDGEWEAPQIANPKCESAPGCGVWQRPMIDNPNYKGKWKPPMIDNPNYQGIWKPRKIPNPDFFEDLEPFKMTPFSAIGLELWSMTSDIFFDNFIVCGDRRVVDDWANDGWGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords calnexin
publication title The Structure of calnexin, an ER chaperone involved in quality control of protein folding.
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Chaperone
total genus 44
structure length 380
sequence length 398
ec nomenclature
pdb deposition date 2001-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00262 Calreticulin Calreticulin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.250.10 Mainly Beta Ribbon Calnexin lumenal domain, non-globular proline-rich hairpin domain Calreticulin/calnexin, P domain 1jhnA02
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1jhnA01
4I30A 1HDKA 5GLWA 4SLIA 4FQ4A 1AX1A 4M3CB 4XHBA 1MS4A 3M1HA 4YG0A 1S0JA 3VUOA 3MEPA 1YXWA 2WT2A 1KQRA 5DZGA 2GNDA 2D6MA 1D2SA 4XZPA 1S0GA 2CNAA 3B01A 2NN8A 3FBYA 3HR9A 2R49A 4YFWA 1WCSA 1W6PA 3AZWA 4R9BA 5DG1A 1UPSA 4K1ZA 3WCRA 2W68A 4Y1YA 4YM3A 2CYFA 2ERFA 1GICA 4BMEA 3AJYA 4DQAA 1WW4A 5EYYA 1S0FA 2NYYA 2JECA 1V6OA 1Q56A 3SH3A 3WDVA 5CBLA 1LU2A 1F31A 4YM2A 3WG3A 2A6WA 1W6PB 2UWBA 2WT0A 5CB7A 2GNMA 5GZFA 3M3QA 1CIWA 4YG3A 4YG6A 5DG2A 3AJZA 2ZGLA 3AP4A 3OYWB 4LBMA 3O5SA 2YZ4A 2PHRA 2XG3A 4LBJA 2ZHMA 4Q8KA 1APNA 2OUHA 3M3EA 2ZGPA 4BMBA 2DVDA 2ZGQA 1CPNA 1SBFA 1W6QA 1QDCA 2ZGNA 3AFKA 3MW2A 2ZBJA 1S1AA 1AVBA 2ZGRA 2AREA 1C1LA 3INAA 3O0XA 1KDMA 1MS0A 1QOOA 1OFSA 3POSA 2UURA 5HCFA 3POYA 1EPWA 3I8TA 5GLVA 2SLIA 4FPGA 3ZXLA 2JE7A 5GJ6A 4P9WA 1YRZA 2D6PA 1FV2A 2GN3A 4YM0A 1KDKA 3FLTA 1LU1A 4LBQA 2ZABA 1LGNA 3AZXA 4Q2FA 1DIWA 3SNMA 3IM0A 4XILA 4XJ8A 3V0AB 4FPLA 1KJLA 3AP9A 3FLRA 4JCKA 5JDBA 1WUVA 4LBLA 5E89A 5GLZA 4Y20A 3VKMA 2ZHLA 1JBCA 3AP6A 1JOJA 3AZZA 2GMEA 2JDZA 3AZVA 4FPJA 4PBPA 1G8WA 3MPPG 4W65A 5DZEA 2DUOA 3CNAA 1DBNA 2D6OX 3DGTA 2ZMKA 1O4ZA 3T1LA 3WDYA 1CPMA 1QKQA 2C9AA 3AX4A 3DUIA 3MW3A 4GKYA 5H9SA 1N3QA 4DS0A 3FUOA 1LOFC 1NXD1 2W08A 1GBGA 1Z0HA 4YW1A 1DYPA 1B09A 1GANA 2PHXA 2AGSA 3BTAA 1UX6A 4Y20B 1MS8A 3ATGA 1GZWB 1IKQA 3PMEA 2AENA 1JN2P 3LCPA 4GALA 4JRAA 4LBOA 5CNAA 1JXNA 5AVAA 4R9CA 4Y1UA 2Z42A 2C5DA 4FPFA 2AH2A 4Y1VA 4XDQA 5JMCA 1HKDA 3ASIA 4Q26A 4XJ9A 2W52A 1LOGA 1FNZA 3VKLA 4LBKA 1MS9A 1DZQA 3RG0A 2OW4A 4LBNA 3SITA 4YZ5A 2RHPA 3UJOA 3VKOA 1W6OB 3AYDA 4WZFA 2G4IA 2A71A 4Y24A 3OY8B 4XYXA 4LBQD 3PVNA 2A6YA 2ENRA 3WVJA 3HMYA 3WHUA 4Y22A 3ZYPA 1A8DA 1DFQA 5JVVA 5DUXA 3ZPYA 3N35A 1SLLA 4AGRA 4BPZA 1HQWA 2D3PA 1AXYA 1Q8PA 3PVOA 1WBFA 5H9PA 3VV1A 3WDXA 4ZKTB 3RRDA 1YO8A 2VUAA 2YV8A 5JLVA 2UU8A 3MW4A 5IK7A 4AWDA 4JC1A 4FP3A 3SH4A 4GXLA 5HCBA 3PVEA 1C57A 4HL0A 4XJZA 4FOYA 3GALA 4M3CE 1HLCA 3V64A 3RQ0A 3WZ1A 5DUVA 4Y22B 3WHTA 1FV3A 4YGEA 2DVAA 1ULCA 1LTEA 3ILRA 3ZSJA 3A0NA 3A0KA 2ZGSA 1SBEA 2ZHNA 5GZEA 3WV6A 4R9AA 2LALA 4FOWA 4FOVA 2R0HA 4AVSA 1BKZA 1OQ1A 3FUQA 4CRQA 4Y1ZA 1WLWA 1AJOA 1DYKA 1GNHA 3UJQA 2PELA 2ZZJA 2DUQA 1UZZA 2TEPA 2A6ZA 5GALA 1ENQA 3SISA 4YZ1A 1LENA 1G9AA 1JYIA 1C1FA 1N47A 1G9BA 1LGCA 2CWSA 4Q8LA 2JKBA 2NZ9A 2DU1A 2EAKA 3OJBA 4YGDA 1Q8SA 2V73A 1V00A 3GNEA 4XJUA 3IPVA 4RL7A 1QF3A 1BQPA 2GN7A 3U4XA 2P2KA 1S0DA 3NV1A 3PJQA 1A3KA 3V0BA 1TEIA 1DQ5A 2DU0A 5IK8A 1JUIA 3N36A 1AX2A 1WBLA 2GMMA 1WLCA 2P3JA 4PF5A 3W59A 4XJWA 1V6NA 1V6LA 5DUWA 1X50A 5SV8A 3TAYA 5T52A 2DYCA 3AP5A 1IKPA 4L8QA 2VU9A 3L2YA 1S0CA 3WDWA 2D6LX 3WG2A 3TB0A 4HANA 1AF9A 5FRAA 3ZSLA 1RINA 4ISRA 1V6MA 1WD4A 2XB6C 3A4UA 4DRVA 1N1YA 2A75A 2D3SA 3LSDA 4BM8A 4XXPA 4PQ9A 4Y26A 1H30A 1LHWA 1PZ8A 1MS5A 5KXBA 2FMDA 1UMZA 1BJQA 1N3PA 1UZYA 4YZ3A 4Q1RA 5GLTA 1GLHA 2ZACA 3B00A 1ONAA 3RMXA 4F83A 1LOAA 3UL2A 1FX5A 1W6QB 1WW7A 2D6NA 5JOZA 4NO4A 4UW6A 3AYAA 2ES3A 1IS6A 5GM0A 4TZDA 2R16A 4FPOB 1GYKA 1QNYA 1BZWA 2W39A 1GV9A 1QNWA 1WLDA 4UW3A 5EWSA 1G7YA 1JW6A 2PHUA 4XBNA 1FAYA 1S0EA 3Q9OA 5CAZA 1UKGA 2PHFA 1G9FA 1CONA 3I4IA 1IOAA 3B9CA 2D7FA 4LBQB 2CY6A 2DWRA 4NOTA 2AUYA 1QMJA 5F9TA 1K9CA 1O4YA 3O0VA 1KRIA 1ULEA 1W6MA 3ZSMA 4ASMB 3LSEA 1KJRA 5F5QA 4XTPA 2ZAAA 4GKXA 1IS5A 1BYHA 1MR5A 2ZGKA 1N1VA 3WG1A 3VKFC 3N7LA 3UK9A 1IS3A 3AYEA 1CVNA 1I1EA 5FREA 1AX0A 5T50A 4AGGA 1NLSA 1G86A 4P9YA 1Q8QA 4XJAA 3OGGA 3D6EA 4U2AA 4GA9A 1MVQA 3IMNA 3WDTA 1LHNA 4YW4A 4WVVA 3N7JA 4FPCA 2ZA9A 3N7KA 1MZ5A 4D69A 4XBLA 5DZFA 4M01A 1W6NA 1Q8VA 5T5JA 1LOEA 2EALA 4Q27A 3ZXKA 1Q8OA 2DTWA 4IQPA 4R9DA 1ULDA 4FOQA 5HCAA 4KBBA 2A6XA 3NV4A 1LGBA 5EYXA 4FQZA 4BOWA 4DRRA 1D0HA 1MS1A 5T5LA 3ZSKA 3ZXEA 2CWMA 3D4KA 4YFZA 2I2SA 3SLIA 4C1WA 1DQ2A 1W0OA 4BLJA 1RIRA 3HN1A 4AGVA 5EXOA 2WNEA 2JD4A 1SLTA 3ZXFA 1YYNA 2ZMLA 2OVUA 3NWKA 1VIWB 3H0OA 3ZVXA 4Y1XA 5GZCA 3POWA 1QGLA 3FFZA 1N1TA 2DVGA 2GALA 3WDUA 2ARBA 5T55A 5T5PA 2YY1A 2ZGUA 3D5OA 4XBQA 2NMOA 3KM5A 3V65A 1SLCA 3O0WA 1LODA 2A3YA 2DV9A 1S0IA 2D3RA 3IN9A 1VALA 1ZA4A 4YGBA 5GZDA 1MS3A 1YI7A 1UN1A 2VY0A 4RA0A 5E88A 2JJ6A 1F5FA 3R4UA 2ARXA 1LOCA 1N1SA 1GZ9A 2DVBA 3QCWA 4GWNA 4M3CA 5T54A 3VKNA 2NM1A 2E7QA 4XTMA 1XQNA 5GLUA 4Z8BA 2BQPA 2KM2A 1QOSA 1CESA 1FYUA 2EXIA 2EXJA 5E8AA 2A70A 2EXKA 2ZMNA 3BODA 1QOTA 3ZXJA 2Q5TA 1IS4A 2WLQA 3RSJA 2R0FA 2ZHKA 2A7AA 1G9DA 2OUJA 1SCRA 1V6JA 1S0BA 1LEDA 4K1YA 5DXDA 2E53A 2GNBA 4XIKA 4ATFA 4AVVA 1G9CA 1Y7BA 2VW2A 4XMIA 3AXDA 1WW6A 1DHKB 1W0PA 3AK0A 3IPVB 3M2MA 1CQ9A 5L73A 3OPZA 4C1XA 3M3OA 3V0BB 5H9RA 1LHUA 4YZ4A 1H9WA 2V5YA 4XE9A 1ZM1A 3BIWE 3OYWA 1GSLA 3B3QE 2D6KA 3JU9A 1CJPA 4ZXKA 4FPYA 2VXRA 2E6VA 4AVTA 1LESA 3APBA 4M00A 2UWAA 5KXEA 2GMPA 4FP2A 4XOGA 1U0AA 2YROA 2P3KA 2A3XA 2EIGA 1RITA 3OBTA 2HYKA 3WG4A 1LEMA 1LCLA 3NV2A 4WVWA 3ZYRA 4BQ1A 2P34A 2UWCA 1V6IA 2A6VA 4P9XA 1JHNA 5IUQA 2NP0A 3AP7A 3JUUA 5T5OA 5JOXA 3RS6A 1FNYA 4TYSA 2WKKA 1PZ9A 4AYUA 3V0AA 4YGCA 3WLUA 3OBRA 2YMZA 2PHWA 4DPNA 1H9PA 3QLQA 1GZCA 2LTNA 1UAIA 3AYCA 1VLNA 3R05A 2YXSA 4ITCA 1MVEA 4H55A 3WUDA 1PZ7A 3NV3A 4YM1A 4CZSA 1I3HA 1DGLA 2E7TA 1CR7A 2R1BA 4MYEA 4U36A 1SCSA 1FATA 3ENRA 1ENSA 4FPHA 1R1ZA 3AZYA 3IKWA 1Z78A 4UW4A 4YW3A 5GZGA 1A78A 4PCRA 4DFSA 2SBAA 2AR6A 5LK5A 1ENRA 3SH5A 1GZWA 4K21A 3WCSA 5KXCA 5JOWA 5KXDA 2EF6A 3WOGA 1QU0A 2JE9A 3M3CA 1W6MB 4OZXA 4ATEA 1OKQA 1AXZA 3USUA 2DURA 3C2UA 2AYHA 3B69A 2FHRA 4YZ2A 2NMNA 2WJSA 1HQLA 2P37A 4P14A 4XXAA 3WNXA 2DUPA 1WW5A 2PHTA 2GDFA 1SLBA 3RMYA 3O12A 5BYNA 5IK5A 4YW2A 1LOBA 1W6OA 1DQ0A 1AXKA 1LHVA 1WD3A 2VW0A 2WSVA 3ILFA 2GNTA 2VW1A 5DUUA 3N7MA 3OY8A 2ZGMA 1BXHA 5JOYA 2P3IA 2ZKNA 1AZDA 3USUB 4FPKA 1J1TA 1LOFA 1W6NB 2D44A 1V6KA 2ZGOA 4M3CF 4FVVA 2CL2A 3W58A 1F9KA 4YLZA 4CTEA 1ULGA 3KQRA 5CA6A 1URXA 4ISQA 1MACA 1N3OA 3R4SA 1KITA 2R1DA 1DQ6A 1VAVA 2WQZC 1LECA 4Q1PA 4FPEA 1GNZA 1LULA 4BLIA 1CN1A 3T1MA 3BOPA 2A5ZA 5IK4A 1UL9A 1DQ4A 1QDOA 1MZ6A 2H0BA 5H9QA 4WV8A 1SFYA 2WSUA 1DLLA 2B7YA 1GKBA 1LJ7A 2CTVA 2DTYA 1C4RA 5IT6A 3FLPA 4GWMA 1HHNA 1SACA 1LHOA 2E51A 4YW5A 3ILNA 2ZGTA 4K20A 4PBOA 4UW5A 1YIFA 2WT1A 3WUCA 3N3HA 2A3WA 1SLAA 4XIOA 1VAMA 3AXEA 2EXHA 4XHXA 1DQ1A 1JYCA 2D43A 1SLIA 4XMAA 1SBDA 2DVFA 3T2TA 1ULFA 1AJKA 2VH9A
chains in the Genus database with same CATH superfamily
1HN1A 4BYYA 1FPN2 1KS4A 2WIIB 3MF9A 3NAPB 3GDBA 2TBVA 5GLWA 4FQ4A 3VUOA 4M3CB 2WBKA 2WT2A 5A3OA 1KQRA 4DNYA 2VOTA 2X8KA 4K9SA 2NN8A 3I2OA 3HR9A 1O7FA 1TG7A 2XUEA 5FYBA 1UPSA 2HWE1 1NX9A 3H1WA 4LHLA 4M0HA 1I9RA 4ONUA 4OI1A 5J3UA 2W68A 2JDKA 2MHFA 1PHMA 5IVBA 1BVP1 1WW4A 4GH4A 4R4XA 2RS11 3VDDC 1S0FA 1OBNA 1TE1B 3SKVA 1V6OA 4UF0A 1XNTA 2WO7A 3VZKA 5JUVA 3ZX7A 4CVUA 4IGQA 5FP4A 4EQVA 4XACA 1OF4A 3M3QA 1WMEA 5GZFA 4BQWA 3OYWB 4LBMA 1DLCA 2PHRA 2RJKA 2ZHMA 2OQ6A 3AL5A 5FJKA 1APNA 1R1A1 2OUHA 2MEV3 4UWDA 4BMBA 4BQ2A 3O1VA 3PHMA 4MGSA 1CPNA 1W6QA 4EE2A 4LT5A 2ID4A 5T3NA 1PO11 2VD7A 5EP9A 4XZUG 1O3RA 2AREA 1WCUA 2XL9A 4DY3A 3O0XA 4I2OA 4P00B 1MQTB 1SEFA 5IK7A 5C9AB 1U5ZA 4DXRA 2IXHA 1QQP2 1W2UA 5JZGC 1EPWA 4CPBD 4HXCA 3LA7A 5GJ6A 1YRZA 4I0AA 5A6XA 4YM0A 4QWNA 1KDKA 2OA2A 3L2HA 2ZABA 4DUXA 3UT0A 1KEXA 3IM0A 4FPLA 4KU7A 5C71A 3I3BA 5JDBA 4LORA 1WUVA 3ACFA 3B9IA 5E89A 4EV0A 4LUKA 2ZHLA 1JBCA 2C0ZA 3AP6A 3CMGA 3LIHA 3NJVA 4W65A 1W8NA 5G05L 2W47A 3NKGA 2DFBA 2WRAA 1DG6A 3CNAA 3OBZA 1DBNA 1SDWA 4JGYA 5FZ8A 3WQ1A 5C8CC 4AFCA 3WDYA 3VZLA 1QKQA 4IGOA 2OPWA 1V0AA 5H9SA 3SQOA 1LOFC 1POV3 3HOBA 1NXD1 2HWF3 2W08A 4GAZA 1X9PA 1DYPA 3OGSA 1RMU1 2ARAA 2BFUS 3NO8A 2EA7A 5BNOC 1W06A 1JN2P 3LCPA 4JHZA 4A2UA 5AVAA 4XUNA 3HIFA 4JAAA 4MHRA 3ZYJB 4BB3A 2C5DA 4FPFA 2AH2A 3CZUA 1F35A 1PK6C 4FTBA 2PLV1 1VBA1 1YLLA 3ASIA 3UKNA 5ABJC 2OIIA 3K48A 3VKLA 4LBKA 2VMIA 2Y8KA 5FZLA 1GP4A 2RR11 2OW4A 5M0TA 4BISA 3CKHA 3KVAA 4LITA 3UJOA 1K5JA 5EQUA 3VBUB 2XR4A 1I6XA 3OY8B 3KZ4C 2ENRA 4UFJA 3UKTA 1JOPA 5C6CA 5DUXA 4AGRA 5J37A 2VVEA 1RHI3 3PVOA 4PIZA 2A1XA 3WDXA 2QQPA 1IPJA 5JLVA 2V72A 3ZFFC 2KR2A 3VBSB 2UU8A 2YPDA 3CZJA 1OOPB 4AWDA 5A6YA 4PIYA 2VMCA 2WL1A 5ERLA 3SH4A 4RR3C 1TNFA 4N53A 1VMHA 3QACA 1XNDA 3V64A 3WZ1A 1JS9A 2ZX4A 5FYIA 1FV3A 2Z4FA 3AKQA 5FYSA 1YNAA 2JDAA 2P17A 2RS33 4LOTA 3O1SA 3A0NA 4UFLA 3TNQA 1QJY3 3CL1A 4LMFA 3UETA 4AVSA 5FZ0A 4FOVA 2R0HA 2WDBA 3MIFA 3NJYA 2QQLA 2WS93 3NL1A 2W5FA 4N53B 3RZZA 2P1BA 2DUQA 3T0AA 2A6ZA 2B9UA 3BIEA 3OUHA 3K3NA 1JYIA 3ZFEC 2JENA 3HNYM 5FUIA 1LGCA 3B93A 4Q8LA 3KV9A 5FYMA 1FMD1 4S2GA 2PN5A 1UMIA 4YVWC 3HQUA 3SCFA 5FOBB 2BOJA 2W91A 4RL7A 5JAXA 2B46X 5LATA 5FZGA 2P2KA 5ACA3 3NV1A 1F5JA 3K77A 3PJQA 4BK4A 2X5IC 4P5HA 4BQYA 4DY5A 1TEIA 1DQ5A 2J1AA 3ZYBA 4DMIA 1JUIA 1QJU3 5F39A 3KT4A 4NHYA 3RNSA 3ZMNA 1ENXA 5A6ZA 5CFCA 3I59B 5FMDA 3W59A 4XJWA 4URAA 1V6NA 4A7KA 4LKEA 1X50A 5JIUA 1SPPA 3N9OA 2DBIA 2EIBA 3S5QA 4IE6A 1TME2 1J3PA 2D6LX 3ACLA 3TB0A 3LB9A 4AI3A 4NROA 5FRAA 3ZSLA 4CXYA 4ZU7A 1AYM1 1V6MA 2ORXA 2XB6C 3CJXA 3POEA 4GJYA 5FZ1A 2AC1A 2VMDA 3TOJA 1N1YA 2D3SA 4QPIC 2Y38A 4AFBA 5I91A 3OBAA 4WBBA 5FZDA 3B7MA 4QXHA 1MS5A 4L92A 2XHKA 5A1AA 1VJ2A 1N3PA 2VTFA 2VC9A 4KH9A 2R072 5GLTA 1BMV1 1GLHA 1RUG1 4AI9A 2IVIB 2EIDA 4W6WA 3RMXA 1LOAA 1UKRA 3UL2A 1FX5A 4L99A 5FMCA 5JOZA 1NZCA 1YWKA 1AUYA 4UW6A 5DAXA 3GJBA 4IEXA 4KWKA 1AR92 5GM0A 2OQ7A 1R083 4TZDA 1ZBA1 5K8SA 1DGRA 1GYKA 4WM7A 2W39A 5EWSA 4BQ4A 1G7YA 1K45A 1OHFA 2WFF1 4XBNA 4DIQA 2R041 4XQ4A 5FLIA 4JDMA 1DZRA 1CAVA 4YPJA 3O1RA 1RVF3 3W5NA 4AG4A 2Q8OA 3WW2A 1RJ7A 2DWRA 5JPMB 3CDZB 2AUYA 4XEZA 4DINB 2PAKA 1O4YA 1OKOA 3O0VA 4E8DA 5EHDA 3IAPA 1EAH3 4WM7B 4QQ2A 3CO2A 1NLRA 4K8RB 4ORFA 1H1MA 1H2NA 2B8MA 1HV0A 2PA7A 2YHJA 4C8DA 4NHLA 1GWMA 3J26N 1IS3A 3WY6A 3QH6A 1YEWA 1I1EA 5T50A 5FLJA 3ETPA 1RUOA 5FIXA 1QWRA 1J1LA 2VL4A 2Q1MA 3GCXA 4GA9A 4U2AA 5IFPA 3ZIWA 4YW4A 2XWBB 1WZXA 3N7JA 4FPCA 2ZA9A 2WN2A 3N7KA 3P6BA 4XBLA 4Q4X3 4CCJA 1DGWX 1GR3A 1Q8VA 1W6NA 4Q27A 4IGPA 2TNFA 4EWEA 2O0OA 3UGGA 5JSRA 3H50A 1E5SA 2MEV2 4FQZA 4BOWA 3ZKUA 1D0HA 4DRRA 1MS1A 4MUVA 5T5LA 3ZXEA 1PGW1 5LBBA 1CX1A 4O7XA 4JGZA 4LA3A 4NMIA 4BQ3A 2WAAA 4YRDA 4YFZA 2I2SA 1POV0 5I8TA 4LLFA 3HN1A 4AGVA 5CZKA 4CEWA 2H6CA 2JD4A 3ZXFA 1U5IA 3THTA 3F2ZA 5L7OC 1VIWB 1Y43B 3ZVXA 3FFQA 1DCSA 4YVSB 1QHDA 4QHOA 1VAKA 1QGLA 1N1TA 4H7MA 2GALA 4LE3A 3WDUA 2BU9A 3KWVA 5T5PA 3WW3A 3C8XA 4LO6B 3D5OA 4QQLA 3M3IA 4Q4V1 2A3YA 2XVKA 2D3RA 3PJYA 4CEWB 5A3UA 1Z7S3 2F4PA 1VALA 1ZA4A 2B5HA 5GZDA 5K0UC 2VY0A 1UN1A 4NN0A 5E6HA 4RA0A 1ZRCA 2QTWB 5CFDB 1F5FA 1QJX3 1WKYA 2ARXA 5AVPA 3WINE 4B1LA 1N1SA 1GZ9A 1RUC1 1AHSA 1PO21 2DVBA 2P4EA 3DN7A 5T54A 3ZYHA 2PTMA 4DOUA 4IDZA 4HK8A 4IXLA 4Z8BA 2BQPA 5EJZB 3LOBA 1MEC1 2HWF2 1CESA 3ZXAC 3DPRC 5DQ0A 4OHZA 2A70A 2ZMNA 3J4UH 3W9AA 4CDWA 4DUWA 3BODA 4OHYA 5C4WA 1BEV1 2R0FA 3LGRA 4AF9A 4JDNA 3U0ZA 2VMEA 3ELNA 3I54A 3R4DB 1H6XA 3HPNA 2J1SA 4AI2A 2WA3A 1G9CA 4XIKA 5FUPA 3C7HA 1YC61 3M2MA 1Q43A 1CQ9A 5CADA 3M3OA 4TN7A 5A7PA 3V0BB 1CAWA 4Q4Y1 3DCQA 4YZ4A 2V5YA 4Q0VA 1ZM1A 1XU2A 1MPXA 1NG0A 3PUSA 5ANQA 5BNNA 1PGSA 2D6KA 2NPIA 1EY2A 4QPGC 4FPYA 1XSRA 1LESA 2CDOA 2ZJCA 5JXGA 1H8TA 3GBGA 2GMPA 1U0AA 1RHI2 1O59A 3N9PA 1U12A 4S2HA 3ROUA 3VZNA 2X09A 4YWAA 2FZ1A 5FYTA 3WG4A 1EYBA 4NIHA 1LEMA 2X5IB 2Y6FA 3NV2A 4RGKA 4BDVB 4C90A 5FQ0A 4BQ1A 1JU3A 2UWCA 1UU4A 1JHNA 3I3EA 4EN7B 3T2OA 1XJAA 1Y3TA 1H4GA 2XBO1 3RS6A 2WNVB 2RS32 1HXS1 1ACCA 3MI8A 4IESA 3V0AA 4CCMA 2WQ8A 3VBOC 3MIHA 5FBZA 1GZCA 1ULOA 3ZYGA 2WS92 4WM8C 5FPZA 5FZ4A 5FP9A 4E9KA 1Y9GA 3HJRA 2Q1ZB 2GU9A 2FZ2A 1W9TA 4A7YA 5F5IA 3U14A 2E7TA 4QXBA 2R1BA 4U36A 3POFA 1SCSA 2FCUA 3MUY1 3TYJA 1NCRA 2VJXA 3JCIA 1ENSA 3SXWA 1R1ZA 3AZYA 1Y4WA 3JB8A 4ZU4A 1A78A 1HJFA 4PCRA 2BDRA 2AR6A 3MF6A 4NHXA 5LK5A 1GZWA 3WCSA 3DL3A 5ACA2 4BCUA 4QD2A 2EF6A 3J7HA 2VQTA 1RMU3 2VZPA 3ETQA 1W6MB 4OZXA 4Z1VA 3VBRA 3F95A 1OKQA 5FK8A 1QJU2 5FZKA 1AR81 1DZTA 1FI2A 2ILMA 4RS5C 2W1SA 1W0NA 1NCRB 3C2UA 2I07B 4YZ2A 2NMNA 2WJSA 2P37A 3AL6A 1VBA3 1J3RA 5KHGA 5L19A 1WA4A 4RQPA 1JZ8A 3O1MA 2K46A 3FN9A 2FDKA 4YW2A 2J1TA 3FL7A 2RR13 1IPSA 1O91A 1W6OA 2VMGA 1C28A 1WD3A 2XQXA 2VW0A 2WSVA 5A7SA 5A80A 3ZXGA 5I8YA 3VBHA 2XKPA 2Y0IA 2ZGMA 4LLOA 2ZOEB 2YU1A 4IV3C 2D97A 2JDPA 3GZAA 2BNOA 3LDKA 4XFCA 1COV1 5J7MA 3LPFA 1SG3A 2VTXA 3D3AA 4M3CF 2RS51 2ZGOA 2CL2A 3A22A 3RJ2X 3DYPA 2JDHA 2VOKA 1F9KA 3RI8A 2CGNA 2E9QA 4Q29A 5C33A 1URXA 3ZFGB 4NR1A 2WQZC 3NAPC 3GBWA 2YUEA 1LULA 3T1MA 4GWIA 3VD4A 1O3QA 4OI0A 2D98A 1UL9A 3Q8EA 3HD8B 1R082 5IVCA 5H9QA 1RGSA 1SFYA 4INDA 4ZZ5A 1QJEA 3I2FA 1C4RA 5CYYA 2YDEA 4GWMA 2YB7A 1FOD1 3AVSA 1LHOA 3E1F1 1D4M1 2IFWA 3ZYFA 2X53S 5F32A 2VZSA 3DKWA 3ILNA 1RVF2 2ZGTA 4K20A 4ZXEA 1JUHA 4R8HA 2BBAA 4BJ0A 2WO3A 2WT1A 4XUPA 2A3WA 3MPBA 3BCWA 4XIOA 4EZ4A 5JR7B 2YC2A 3LPGA 1XBFA 1DQ1A 3WR0A 1EAH2 4CCLA 1UYPA 5JCTA 2DVFA 5C7GA 3RZHA 1OT5A 1CAXB 3T2TA 4F8AA 4ZHNA 2VZTA 1XNKA 5A3TA 2VH9A 5J98B 4PT6A 3N4MA 1AR63 1UOFA 1FMD3 4CPBA 1LRHA 1AX1A 3MV01 4YG0A 1S0JA 2ADEA 3VD3A 3FMGA 3KGZA 5D8AB 5DZGA 2D6MA 1S0GA 2CNAA 4EZHA 3CU7A 3LFIA 4FXKB 3GZEA 3FBYA 2R49A 2OZJA 1C5IA 1S2EA 3AZWA 1JYVA 3ALQA 1PIV1 4K1ZA 4M4RA 1A34A 2Z2SB 3HQRA 4LUMA 3U11A 4Y33A 3ZN5A 2JG8A 1MQTC 4Q4X2 1W9SA 3PIGA 5DPNA 5FXWA 3WF4A 2ERFA 4DQAA 1GICA 5LY2A 4YM3A 5C9AC 3EJKA 5EYYA 4LTAA 3ACHA 3CF6E 4OQ8A 2XLFA 4AXOA 1HRV1 3SH3A 1GWLA 3WDVA 1LU2A 2YFUA 3PU3A 2QJVA 4XC9A 3W20A 2UWBA 4AQ2A 1WMXA 1S4CA 2B42B 5FY1A 3VBFA 1REDA 1PNFA 3NRUA 2XH6A 4W4ZA 3WF3A 3C3VA 3NQHA 3O5SA 2YZ4A 1QJFA 3PUAA 2IWGB 1D7PM 1ND2A 3WQ7A 5DAPA 4CXXA 1WMFA 2HWD3 2HWB3 2UY8A 2Y6HA 3M3EA 2DVDA 1OA2A 4H14A 2ZGQA 3MW2A 1QDCA 2D5HA 2ZGNA 2YFZA 4GMP1 1W05A 4D7SA 1S1AA 4MX3A 2J22A 4L9BA 1L7RA 2ZGRA 4FXGB 1DP0A 1C1LA 1GP6A 1KDMA 2J42A 1PNGA 4XURA 1Z7S2 5HCFA 2WWJA 1ZBA3 3I8TA 1RUD1 1ZZ9A 1ND2B 2SLIA 2XDVA 3CEWA 2JE7A 1XE7A 2E63A 2R061 4X8PA 5A3WA 1ZZBA 2Y6LA 4TTGA 1QJX2 2HWC1 2XHNA 4UFMA 1LU1A 1RUI3 1VBB1 2H0VA 2R043 3AC0A 4XDPA 2VBPA 3TN91 1XSQA 3SNMA 2GAUA 3VL8A 4CDUA 3FLRA 4JCKA 1UNBA 5FWJA 5A7WB 4MVTA 1UY0A 2LUWA 1YQ5A 4JKMA 4LNVA 4FPJA 5DZEA 1G8WA 1LB2A 5IVVA 2QQMA 3Q8FA 3S57A 3VBUC 5IAXA 1O4ZA 3T1LA 5FP3A 4HPKA 1CPMA 2C9AA 3DUIA 3H7JA 3MW3A 3OPTA 4OLLA 5FWEA 1CIYA 3ORJA 4LO5B 4CUGA 2NLRA 1PM4A 4B1MA 5JXHA 1Z0HA 3O1TA 2P6CA 4PDWA 1GANA 3BTAA 4GWJA 3TWIA 3ZN6A 4C0HA 3MYXA 5CVRA 4Y5SA 1DF0A 3VBSC 2AENA 5KC6A 4HBNA 4WM8B 1OOPC 4GALA 1NY71 3NNGA 4DXZA 2O1QA 4Y1UA 1JZ2A 5FZ7A 3C7EA 4Y1VA 4XUQA 3K46A 1POQA 2W95A 3PL0A 1HKDA 4Q26A 3BVCA 2W52A 4PF1A 3DKQA 1LOGA 3KCXA 1VBC1 5JMOA 1FNZA 5AFEA 4CE8A 3Q8AA 2IXLA 4D8MA 1JU4A 5AFBA 3PNAA 3VHNA 2J1VA 2XXZA 4D6RA 1VRH1 2BWAA 2A71A 2W46A 4N53C 4Q0PA 4Y24A 2QQNA 3ES1A 3M70A 5FPAA 4LBQD 2WQ4A 4MXWA 1PGL1 2ZS6B 4IV1B 1KGYA 3HMYA 4Y22A 5F3EA 1A8DA 5JVVA 1RUJ1 3N35A 3ZPYA 2XKOA 4BPZA 1ND3B 5EZWA 1HQWA 2D3PA 3NJXA 5H9PA 4ZKTB 1WBFA 3SHRA 1ZRDA 4FTSA 2F17A 2C4XA 4Z92B 3OEAA 2K9ZA 2OZ6A 4Y4RA 5FXZA 2VNRA 3JD71 1PMJX 4FP3A 4GXLA 1NCQB 3PVEA 1C57A 5HCBA 5JXJA 1V9U1 4Q4V3 4E4DX 2RM21 5EJ3A 1OH4A 1HLCA 4CP9A 3RQ0A 3IIAA 2GSYA 3Q8BA 4Y22B 1L7LA 2Y33A 2DCKA 4YGEA 2DVAA 5FZOA 1NA1B 1SFPA 1ULCA 3I2DA 1JZ4A 3ILRA 4B4RA 1B35A 2ZGSA 1SBEA 5GZEA 1OD3A 3BTYA 3ZR5A 2LALA 3H8OA 1RUC3 2FDGA 2CSGA 2XGXA 1BKZA 1OQ1A 4IE5A 4LO8A 2G1MA 5L9RA 1UOBA 1BLZA 1QH6A 2BRTA 4CRQA 1PVC1 1CJDA 1AJOA 4NPLA 3I2KA 1QH7A 4S2DA 2ZZJA 5IVYA 1UZZA 3RZLA 5GALA 1RMU2 4QX8A 2WNUA 2YC4A 1UIKA 4YZ1A 1LENA 1QXRA 3HQXA 5CFCC 5CG8A 3L9JT 1G9BA 5FYYA 1UYYA 2JKBA 2DU1A 2EAKA 3DECA 4YGDA 5IJRA 3KSCA 2V73A 5J96B 1V00A 3GNEA 3IPVA 1VBA2 5FZFA 2CGPA 2GN7A 4AK3A 1LR5A 1RUF1 2RR12 1TMF1 3DEMA 4XF4A 2DBNA 2DU0A 3A21A 3I97A 4Q4Y3 3N36A 1AX2A 1WBLA 2GMMA 5FP7A 2VNOA 4PF5A 1IHMA 1VBD1 4OI4A 3MHZA 1M06G 4CSWA 3VD9A 5DDJ1 4AEDA 5SV8A 3TAYA 5A1FA 3AP5A 3AKSA 3FWEA 4WVZA 4GH4B 3S6PA 5LA1A 3WDWA 2WZR1 3K2OA 1AF9A 4S2FA 4XCBA 1F8VA 4ISRA 4UF0B 3A4UA 2WINB 2QQVA 2ZX3A 3DYOA 5C3QA 3U75A 3MIBA 4BM8A 3AVRA 2OT7A 4PQ9A 4XXPA 3AMMA 3ZIXA 2WO2A 3BUCA 1PZ8A 1Q3EA 4AEDB 4WM7C 3LFMA 4QHBA 1UMZA 2WZ8A 3I3DA 4YZ3A 4CCKA 4L97A 2J1EA 2Q8DA 4JV4A 4XUOA 5F3CA 2XBO3 4FT8A 3JZVA 1W6QB 2WO1A 2JB8A 3OG2A 4XFHA 1MZEA 1OLQA 4NO4A 5FOJB 4LKFA 2FBEA 2ES3A 1VE0A 1GUIA 1O6UA 1C8M3 3JQWA 3S0MA 4XFFA 1RJ8A 1EV11 2PHLA 5J09A 4UW3A 5KHKA 1JW6A 2BVVA 4LJHA 4EN6B 1HW5A 3EHKA 1UKGA 2JWPA 3G7DA 1CONA 3I4IA 4YNIA 3B9CA 1AR62 1FMD2 2D7FA 3MBWA 2JDNA 4UYBA 1RUH3 4Q4W1 4CU9A 4A6SA 4R52A 1UMHA 4MHUA 4N8MA 4XTPA 2ZAAA 1IS5A 1BYHA 2ZGKA 5I0RA 5CKQA 1CWPA 4LKSA 4CA9A 3N7LA 4W50A 1QXJA 1AR83 2OX0A 2QQKA 5C8WA 4K3UA 3TNPB 2X05A 4JGYB 4P9LA 2E32A 4AFAA 4AGGA 1NLSA 4NPMA 4YVSC 2BNNA 1TQ5A 4V2VA 2XONA 1BHGA 4HG6B 1MVQA 2RMU1 4IEPA 1FPN1 1US2A 1UY1A 4JTNA 4V1PA 1WA6X 3B02A 4Y5Z0 5G04L 2XQRA 3N9LA 3LEKA 5T5JA 4B8EA 2EALA 4CEWC 3IBMA 2QUOA 3U4SA 2HBTA 2DTWA 4IQPA 4R9DA 4CP1A 1ULDA 1COV3 4FOQA 5HCAA 1VR3A 3HBZA 4KBBA 3NV4A 4XAAA 2RS53 5EYXA 5CFDC 2HWD2 2HWB2 4C91A 2GH8A 4NJ4A 1DGRN 1UD1A 2XWJB 3C7FA 2FDHA 2XL7A 2Y6JA 3OEBA 4L2NA 1DQ2A 4BLJA 5CKNA 1RIRA 2CU5A 1K5MA 4XAEA 3WP3A 2EAAA 2FDFA 3WW1A 4NIGA 2ZMLA 3ES4A 3NWKA 3H0OA 1ZBA2 3FHAA 5GZCA 5F5AA 2WN3A 2XVLA 2DVGA 4OUMA 2IXIA 1FOD3 1RUI2 2W1QA 2R042 1D4M3 1BCXA 4AE2A 2ZGUA 1X8MA 2NMOA 2IZWA 2HLEA 5FPLA 3KM5A 2BV4A 3GGLA 1HRI3 3J8F1 5HXVA 3SEEA 3ITQA 5KHIA 4N9IA 1UW8A 2WZEA 4AVBA 2PQSA 4EJRA 4CP2A 2X10A 5BNPA 3WF2A 2BFUL 3RZJA 2HEWF 4BIFA 3SKJE 3WF1A 5LBEA 3GZUC 2FCVA 4QGMA 2NM1A 5FPBA 5FO9B 1XQNA 1QQP1 4KMQA 5GLUA 4ZS3A 2KM2A 4ASKA 5HV4A 1QOSA 4CDXA 1OSGA 1UY3A 4TWTA 3OPWA 1O4TA 1GP5A 3E97A 4O65A 2EXKA 2O14A 2Q5TA 1IS4A 2WLQA 1C3HA 3T08A 2A7AA 5C3RA 4FFHA 3WEZA 2C24A 5LEJA 1V6JA 1LEDA 1UZVA 1AL0G 2E53A 2GNBA 5DXDA 3RI9A 4CDXB 1Y7BA 2VW2A 2WNVC 3EO6A 3PTRB 2VZVA 5L73A 5IVEA 1ST8A 4I01A 3OPZA 4YSFA 3POGA 1LHUA 1PGW2 4ZZ8A 2BYVE 4F7ZA 4KU8A 3BIWE 1GMMA 4X6QB 1GSLA 3S30A 4URTA 1ZRRA 2XOMA 5CFCB 4CEYA 2DCYA 2VXRA 1EP0A 3MFCA 3TEZA 2XJUA 3APBA 3H8UA 1GWKA 1SDDB 2C1FA 3VDCA 3VDBA 5I0TA 1GNYA 1W2AX 1SPPB 3CIHA 4XMIA 4XOGA 5A32A 5JI7A 3H9AA 3QOPA 2EIGA 1W8UA 4CP0A 1SQ4A 2HYKA 5FY5A 5EPAA 3H3ZA 3IT8A 3HT1A 1LCLA 5C5UA 4WVWA 3BPSA 3D0JA 2P34A 2VNGA 4COVA 4FFGA 3VDDA 4Q4V2 2ZCWA 4KWJA 4IEYA 5IUQA 2NP0A 1O5UA 4AQTA 3MIDA 5A32B 5JOXA 1YJKA 2R063 1FNYA 4A44A 2WKKA 1L7QA 3VN4A 1NCRC 1PZ9A 1H1IA 4DO0A 2HWC3 2OS2A 1RUC2 2P6HA 2PHWA 3TN93 1H2KA 1VBE3 1VLNA 4XABA 4ITCA 1MVEA 4RFT0 2V4VA 1PVXA 3WUDA 5ANNA 4YM1A 4AAXA 4NUBA 4GJZA 1K12A 1CR7A 1D0GA 3EXUA 4HLTA 4MYEA 3VHRA 4ZY9A 2XJPA 3RDIA 3ZN4A 4UI9L 4IERA 3WF0A 1YJLA 4UW4A 1IGOA 3IKWA 1Z78A 4IETA 5FPVA 5GZGA 4DFSA 5FLHA 1CAVB 1W39A 2QQIA 4I3PA 3RPQA 3SH5A 5JPNB 4K21A 5JZGA 4A42A 3G6JB 4TSVA 5LASA 3ZFGC 3WOGA 1S2BA 2D40A 2JE9A 3ZM8A 4X6RB 3M3CA 3SEPA 1W8ZA 5FYVA 5FXVA 5IVJA 4Q4Y2 1J3QA 4AOCA 5EIYB 1UPIA 1STMA 3S5AA 4YW7A 2ADDA 4XF0A 1HQLA 3BI3A 5FJHA 1ASJ3 1SLBA 1OVSA 1VBC3 2FMYA 2GDFA 2IVJA 3O12A 3BB6A 4JKLA 3BKZA 1DQ0A 1RXFA 3ILFA 5C8CA 4QXCA 1OD5A 2YBKA 2P3IA 2ZKNA 1VRH3 5CISA 2ZXQA 3LEGA 5FZ9A 4FPKA 3JB4C 3AMHA 1LOFA 3QD6A 4PLNA 1W6NB 5K4LA 5SV5A 1V6KA 2VTXJ 3W58A 5C3OA 3MZHA 1UXXX 5CA6A 5BNOA 1JZ6A 1MACA 2XBO2 5CG9A 1KITA 1VAVA 1HB4A 4QDSA 2HKXA 3LF7A 4MZUA 4XUTA 1CN1A 4JGZB 3WNKA 5D8AC 3T09A 1PK6A 5IK4A 5HCHA 1TME1 2AEZA 2WR9A 5ABJA 4FFFA 4GB31 1C8M2 2XLAA 4LXLA 2RM23 3ECQA 4WV8A 4CDQA 1DLLA 2B7YA 1CZTA 2E33A 3VD7A 2WUHA 4N43A 3ZDSA 1SACA 4NHMA 5AC91 4ASLA 2QQUA 2ZTNA 2UY9A 4EYUA 3I7DA 4KWUA 4CU6A 4AHXA 4DXSA 1KS5A 4HVOA 1VMFA 2R071 3DF0A 5FPUA 1YIFA 1RUH2 1MZFA 3HVDA 4LPLA 2EXHA 1HV1A 4XMAA 1E5HA 4QB2A 1ULFA 3POIA 4D3WA 4N43B 2JG8C 2IXJA 1AJKA 4TLFA 1AR91 2BOIA 2LROA 3CBNA 1AR82 1RUE1 4I30A 4QGNA 2HWE3 3AMPA 4RR3A 1PMHX 3M8LA 4XHBA 3M1HA 2WLPA 5E1RA 2IUWA 4UAPA 3B01A 2RS13 4XDOA 4Y3OA 4MV2A 4XQDA 2KXLA 4IE7A 2V5DA 1WCSA 4QX5A 4R9BA 5DAQA 3WCRA 4CDWB 1TMF3 5L9VA 4QX3A 5C4WB 3E5XA 2YPJA 3E6BA 4BMEA 5FY8A 3AJYA 4QAWA 3WNMA 2VO5A 1ND2C 3H7YA 1COV2 5DDJ3 2NYYA 3MICA 3AB0A 3ME2A 1SHWB 2RS52 3C7OA 2Z69A 5I0UA 2XJVA 2VG9A 4C0BA 1JZ7A 2JDMA 1F31A 2WZR3 4H2AA 2A6WA 4YM2A 1R1A3 4W6YA 5I8SA 3WG3A 3ZFEA 5CB7A 2GNMA 1HIXA 2CAVA 1CAWB 1CIWA 1BBT1 4YVWA 5IVFA 1PO13 4OUSA 5DG2A 3AJZA 2ZGLA 3AP4A 5FZ6A 4AHWA 3OF1A 4B7KA 5BNNB 5J48A 4LBJA 1JODA 2FQPA 1JMUB 2ZGPA 2QQOA 3BN6A 3KV4A 3RVHA 3U37A 1H8TB 3AFKA 1IQAA 4KI5M 1OPMA 2ZBJA 1FOD2 1D4M2 2YGMA 1YCIA 1DYOA 2C6SA 4BE3A 1OUSA 3INAA 1HRI2 2ARCA 5LA0A 1MS0A 1QOOA 3VDAA 2MEV1 3POSA 4X8NA 1GQPA 5FQ0B 1J58A 3OGJA 4OZOA 3KLSA 1OC1A 4FPGA 3NSTA 4P9WA 1EV13 1FV2A 2HYXA 2WWUA 3MUZ1 2R6QA 1BK1A 1DGWA 1W8OA 4LBQA 5JSOA 2BBVA 1LGNA 2XJRA 3AZXA 4UFKA 4QPIA 4XILA 3V0AB 3NKTA 1KJLA 3AP9A 4PDWC 5IAVA 4D6SA 4NWVA 5GLZA 3A7QA 4AEJA 4Y20A 2JDUA 3M4FA 4Q4W3 2PXJA 3AZZA 3K75B 3AZVA 4PBPA 2DCJA 3FHQA 3MPPG 5CIRA 2DUOA 3IIIA 2P3YA 3VZJA 2JIGA 3NJZA 2D6OX 4ARXA 2RDNA 2ZMKA 4GKYA 3AX4A 1UOGA 4IV1C 2PAEA 2UYBA 1ND3C 1GBGA 4YW1A 5IHRA 3RZGA 1XYOA 2YYOA 1FT9A 1XNBA 2PLV3 4LHNA 2Y64A 1H2MA 4Y20B 1UX6A 1UYZA 3ATGA 1GZWB 1IKQA 3PMEA 4OUEA 5FFOC 3ZYIB 4XFIA 2HEVF 2AACA 3H1MA 2WYFA 2RMU3 4LBOA 1JXNA 4Q0UA 3T0DA 1NCQC 2VGDA 4GZ9A 2QNKA 4E8CA 1POV1 4COYA 1IQDC 2HWF1 3VBRB 4K40A 4XDQA 2VULA 1NA1C 3QBQA 4QGLA 3PU8A 1MS9A 1DZQA 5A33A 4IEOA 4NPRA 3KHCA 4RQPB 1HX6A 3SITA 4KGGA 1FXZA 2RHPA 2PYTA 1W6OB 4WZFA 2G4IA 4FSJA 5FYHA 2WZPP 3VBHB 2GP5A 2A6YA 3WVJA 4B29A 2VBDA 3LAGA 3U07A 1DFQA 4DZGA 1U5XA 1SLLA 3PIJA 1Q8PA 4PJYA 3VV1A 2R062 2Z5WA 1UXZA 4OULA 5LB6A 3RRDA 4JZRA 3U10A 5DABA 2HWC2 3BPZA 3TN92 1RTVA 4QDRA 5BV6A 1AL21 3J7NA 1OQEA 3U1XA 4AFDA 3J8F3 1VBE2 4JHTA 1RHI1 3WSOA 3CJIA 3GALA 4FOYA 3UGFA 3TEWA 4E4HA 2FDIA 3IWZA 4BWOA 3KF3A 4N7IA 3WHTA 1K42A 4CCCA 4LO4B 5B4NA 3ZSJA 3A0KA 4AEMA 1O3SA 4KWLA 4FOWA 5KHJA 1A8MA 3HN3A 1NE4A 4GH4C 4Y1ZA 3KF5A 3VD5A 1VPHA 1WLWA 1DYKA 3THPA 1GNHA 4A3XA 2PELA 3CJIB 2RS31 1GOHA 2FD8A 3WXPA 2TEPA 1W3VA 1QJY1 4MO3M 3SISA 3RWNA 4G4FA 1REEA 1NY72 2CWSA 2BGOA 2NZ9A 3T3YA 1XC6A 4AEDC 1Q8SA 2WNOA 5KHHA 1ZX5A 1KFXL 3TBDA 3VL9A 4XJUA 3OB8A 4Z2WA 4HVQA 3ON7A 1ASJ2 1A3KA 1VBC2 2RE9A 5K0UA 4BIOA 1OLME 1UCXA 1JI6A 4MGIE 1TVGA 1UIJA 1ZA7A 1ZNPA 2YBPA 3MIEA 4V2WA 5I93A 1WLCA 3LDBA 1AYM3 1VRH2 2JX9A 1HB2A 1QXPA 1V6LA 5ACA1 5DUWA 4A41A 5LCWL 2JG8B 5T52A 2DYCA 2Q8CA 2BGPA 2VCMA 3DPRA 2VU9A 3L2YA 4HT1T 4AZZA 2DCTA 1PGL2 1F2NA 3WG2A 3JBG1 1WWYA 1RINA 5FY9A 1NLQA 5B2GB 1RUG3 2X29A 1WD4A 3MGUA 4QB6A 2OKXA 5CEHA 2VQUA 4DRVA 5LZ6A 1F4HA 3U78A 4AI1A 5I0DA 5A3LA 2VCBA 1V70A 1UO9A 4QPWA 4QX7A 5E16A 2I74A 4IE0A 2O8OA 4Y26A 1H30A 3VBFB 4H3WA 5KXBA 1T2XA 1QY4A 4WVMA 3SMHA 1BJQA 1UZYA 2RM22 4UOJA 3EB7A 2VMFA 4Q1RA 2ZACA 3USSA 2G19A 3MLJA 4XQWA 3WP4A 1ONAA 4QQPA 4CCDA 2KA3A 1JZ3A 4F83A 2PAMA 4JGYC 1WW7A 2WFF3 4QPYA 4QPGA 1UOJA 4FPOB 3N9QA 1QNYA 3N9NA 4DEQA 4P9GA 1BZWA 3WW4A 2QZ3A 1WLDA 3OOXA 4E27A 5FBJA 2PHUA 4GQ7A 4BXSV 1W99A 1S0EA 2B45X 5F2WA 3Q9OA 4CXWA 1ZZCA 2PHFA 2C26A 2ZPXA 4PQQA 1R081 3E6DA 1S55A 1IOAA 1GQGA 2HWE2 2W1WA 1AYN1 4RHV1 3E5QA 2CY6A 4JTOA 3S7IA 1QMJA 5DMYA 5F9TA 1RC6A 1K9CA 3J7MA 3LE0A 3KT1A 3ZPOA 1KRIA 4CDUB 2RS12 4ASMB 3LSEA 1KJRA 5F5QA 2YG0A 1NAEA 1MR5A 1N1VA 2DFCA 2H6BA 3MFAA 1TMF2 2F6BA 2GP3A 3UYJA 5F2SA 3VKFC 1ZBE1 3UK9A 2J1UA 3BU7A 4XCAA 3VBOA 1KD7A 2JG9A 3AYEA 1CVNA 2EVXA 3PDQA 1AX0A 1H2LA 2BJSA 4LULA 5K7PA 4HPKB 5DDJ2 1EAH1 4P9YA 2GC3A 3B94A 4XJAA 2BWCA 2VMHA 3OGGA 4HFSA 3D6EA 4E4SA 4CUCA 4Z2AA 3SCGA 2VOVA 5A3NA 1JYWA 3WDTA 1QEXA 1LHNA 2VR4A 2WZR2 4PDWB 1R1A2 3D82A 4NIIA 3ZN6B 4D69A 5FMOS 2N7GA 5DZFA 1YFYA 1PO12 1BVVA 1RL3A 5EFUA 1VMJA 4CCOA 5FP8A 4RGAA 2A6XA 5FO8B 1LGBA 1TNRA 1NQJA 1W03A 1NYWA 1W2NA 2ZX0A 3MLKA 4Q4X1 4AAPA 4E2GA 3D4KA 2VUJA 4MOAA 4LIUA 4HVRA 1E5IA 4RS5A 1UU5A 4BZ4A 1OMIA 5JIAA 4HETA 2WNEA 1CAUA 1SLTA 5FZBA 2CGOA 2ZX2A 5L9BA 2OVUA 3OUJA 4GB33 4I09A 3GHMA 4MXWB 4EWDA 1EV12 4JDOA 1W2TA 3V56A 4I3GA 3FFZA 4IUGA 5A3PA 5AC93 3X29B 2E31A 4RD7A 4XBQA 1OF3A 4JVAA 2VCCA 4IV3A 4QKBA 3WX5A 4MG2A 2P5BA 4CDXC 1W8TA 1PO23 1CAUB 2WFPA 4Q4W2 3THCA 4YGBA 1MS3A 1MEC3 1YI7A 3J7LA 4QQHA 2VZRA 5FCCA 4CP9B 4W8JA 3A23A 4AVCA 3NAPA 1XNCA 1LOCA 2VQAA 5FZOB 4M3CA 4GWNA 4XVHA 3VKNA 2VZ3A 1B35B 1BEV3 2E7QA 1RUE3 4IEUA 4L0PA 4CU8A 1T6BX 2BERA 2EXIA 2RVAA 3BU0A 2EXJA 5E8AA 2PLV2 4CCNA 3AFGA 1HB1A 2IXCA 3O1PA 4KNCA 3RSJA 2RMU2 2XJTA 5L36A 3WQ0A 1G9DA 1PM7A 2OUJA 2WNUB 3EBRA 1AR71 1WCKA 5FMOL 3E6CC 4CEYC 2PFWA 2W94A 3MLLA 5GKAC 4K1YA 1W8WA 4DXTA 3JQXA 4LEJA 4ATFA 2ZEYA 3WD5A 3I2IA 1C5HA 1UZ0A 3AK0A 4HZFA 1W0PA 1YIPA 3ACGA 3IPVB 1OA3A 4HKWA 1LKNA 1ALYA 1O8SA 4RSUA 5H9RA 1IPKA 5KWRA 2TUNA 2YBSA 4HSLA 4QX1A 1ZVFA 5F1RA 3OYWA 1OVPA 2VNVA 3ZO0B 3JU9A 1BBT3 2E7AA 2LS6A 4B3NA 2E6VA 2LW8A 2JXAA 4AI0A 3NW4A 5KXEA 2XPJA 3N9MA 2Q0AA 3IDAA 2YROA 2BVBA 3NNMA 5B4XA 3OUIA 2JB4A 2VZQA 4XF9A 2A3XA 4PI0A 2C9KA 1RITA 3OBTA 3SCHA 2G9FA 1MQTA 4MGKE 4YW6A 3POYA 5C9AA 4M0NA 3DXTA 4AFMA 1HXS3 3GBFA 4WZCA 5BPXA 2BPA2 3WNOA 1V6IA 3UKVA 3J8F2 3P3PA 2A6VA 4P9XA 4FAGA 1W8HA 2B9VA 3OD4A 2BEOA 3EYPA 2Y34A 2YC0A 3AP7A 1LNSA 3JUUA 1OURA 5F3IA 1PX4A 1T6GC 3LA3A 3URFA 4YARA 4BH9A 4XFGA 4YGCA 3WLUA 4MGQA 3RWKX 4MXVA 1P8JA 4CUAA 2LTNA 1OLRA 1SZBA 2WYSA 2YXSA 3RYPA 4IEVA 4H55A 1CZVA 1UWWA 4TLGA 3TRSB 2FDJA 2XLGA 3NV3A 4OMCA 5LA2A 1I3HA 1US3A 2Z79A 3NNJA 3VGIA 1WCQA 4IL7A 4ES8A 3LOIA 3GCWA 5J1XA 1FATA 5C3PA 2AZ5A 1A6CA 5IATA 1W9YA 1EPZA 1VB4A 2VXJA 3KMHA 3RMYA 5BY5A 4FI9A 2QDNA 1ENRA 1W8FA 5KXCA 1XB9A 5LBCA 5FPXA 4CUBA 5KXDA 1QU0A 1R091 2CV6A 4JGZC 4LIVA 1AYM2 4K6BA 2DURA 1UX7A 2FHRA 4XXAA 2Y6KA 1NOVA 1WMDA 1XOYA 1WW5A 4AR2A 2WAOA 1J83A 1RB8G 4QM8A 3RYKA 1BMV2 1LOBA 5FXXA 4J25A 4LK7A 1RUG2 1UZWA 1AXKA 1LHVA 3H8XA 1ZRFA 2GNTA 2VW1A 3KT7A 3DXUA 3N7MA 3OY8A 3VBUA 1BXHA 5F8PA 1AZDA 5JSPA 5D21A 4CCEA 4XFAA 3RZKA 4CDQC 3PUQA 4UFIA 2OXBA 5FK7A 4FVVA 3ST7A 3FBMA 1XE8A 3O7OA 4N43C 4YLZA 2CAUA 3NNLA 3KQRA 3VBSA 3ZKYA 2D93A 1UY4A 3KQ4B 1Y9MA 1N3OA 1OOPA 1Y9QA 1OH3A 2R1DA 1ZRIA 2Y0OA 4Q1PA 4FPEA 1GNZA 2VUDA 2LRPA 2WFF2 3K4AA 3BOPA 2A5ZA 1AL23 4ZS2A 5FYZA 1QDOA 2H0BA 4EWAA 2I45A 3VHOA 2J7MA 1K5MB 3VLBB 2CTVA 2DTYA 4CDWC 1L3JA 2IXKA 3FLPA 5C4WC 1HHNA 3MV11 2BP6A 3OTFA 2FCTA 2E51A 4I0BA 4TXWA 4YW5A 3W5MA 1JYTA 2HBUA 2BTVC 1R64A 1JYXA 4UW5A 5DN2A 4J1XA 4NWWA 1SLAA 2W9XA 1HJGA 3AXEA 2VZOA 3NNFA 3KB5A 3AMQA 5LWBA 1SLIA 4IEWA 1SBDA 2HEYF 5APAA 1YQ6A 3HBKA 1ULPA 4LKDA 4R9CA 5BNPB 5BNNC 2QZ2A 1HDKA 1PIV3 3FJSA 1X33A 4SLIA 4N9HA 4ES9A 1MS4A 3MEPA 1YXWA 2WA4A 4MADA 2GNDA 3R6SA 2XMLA 1H8TC 1D2SA 4XZPA 3TEYA 3KS7A 3LWCA 4YFWA 1HRV3 1W6PA 5DG1A 3I59A 3OSDA 1AR61 5IYYA 5A7NA 3RZMA 4Y1YA 2CYFA 4UFHA 5FKCA 4LOSA 1XXNA 2YGLA 1LAJA 4J1WA 2JECA 1OLMA 2QE3A 3NVCA 4NVPA 1Q56A 4HSJA 4QXKA 5CBLA 4BXFA 1YUDA 3JBG3 1W6PB 2WT0A 5A7OA 1G6NA 1X7NA 3IB3A 3KCYA 4GMP3 1XPWA 4YG3A 4YG6A 1H0BA 4QKDA 4ET7A 4RN5A 4LO7A 1I5ZA 2ZEXA 1XE0A 2V4AA 2XG3A 4R4ZA 1XYPA 5ISLA 4GB32 1Q5OA 2E26A 4CEYB 4Q8KA 4A3ZA 3ABZA 2O8QA 5JI9A 1SBFA 1D2QA 5EJ1B 1RUD3 4Z07A 4NIDA 3AKPA 2IC1A 4EN9B 5AC92 1U5YA 5HBAA 1AVBA 4Y4YA 4KG8A 3ZDVA 4Q5OA 3EQEA 1RUNA 1VBB3 2CHHA 1PO22 4W6XA 2HWD1 2HWB1 1OFSA 1VB2A 3T4HB 2UURA 4LA2A 2R32A 1NQDA 5HXMA 5GLVA 4QQOA 1W3XA 1XRUA 1MEC2 3VDDB 3ZXLA 2D6PA 1XNAA 2GN3A 3DYMA 4P02B 3VBRC 3FLTA 3I3MA 3H1YA 3IMMA 4AI8A 4NE9A 1OI6A 1DIWA 1BEV2 4Q2FA 1RUE2 4XF1A 4XJ8A 4RHV3 1E57A 1AYN3 2MNGA 4XF3A 4LBLA 2VQ0A 1NZIA 3RGBA 3VKMA 1NUKA 4M4PA 4RQPC 1JOJA 1RUI1 2GMEA 1JHJA 2JDZA 2W1UA 4J6GA 4QX2A 2RDQA 3DGTA 3VBHC 4PLOA 1ZBE3 4KQ7A 4AQSA 3ZLIA 4DS0A 2BUKA 3POBA 1N3QA 3FUOA 4XPVA 2QCSB 1C8NA 2W92A 4NAMA 4PHZA 4JQTA 4OHXA 1B09A 2PHXA 2AGSA 2ZZQA 1MS8A 1H1AA 1YQCA 3T30A 5JZGB 2ET7A 5KC5A 2ZX1A 2K2SA 5CNAA 4JRAA 4RGGA 4QDQA 4B7EA 3R0RA 1H4HA 2Z42A 1BBT2 1IG3A 5JMCA 3HNBM 1GFF2 4XJ9A 2BW8A 2GH2A 3K51A 3IDBB 2Q30A 2VOWA 1RXGA 3RG0A 4AVAA 1H6YA 2PMWB 1RUJ3 4LBNA 3WNPA 4AHYA 4YZ5A 3PMSA 3VKOA 3AYDA 4QKFA 5FZMA 3Q8CA 1HXS2 4EROA 5C8CB 3CJIC 3HAGA 4XYXA 1REFA 3JD73 3P5BA 3PVNA 4YVSA 3IAQA 5FR3A 3WHUA 4O9EA 3ZYPA 3K4ZA 1QIQA 1V9U3 4KGQA 3O1OA 4UBGA 2QBXA 1AXYA 5D1IA 1S2KA 4G3YC 4EN8B 1GOFA 4MH0E 1YO8A 2VUAA 2YV8A 1OXCA 2WABA 3M7AA 1W2OA 2B4KA 4FBFA 3MW4A 1ZZ8A 2QQWA 4ZONA 3RYRA 5BNOB 3OGRA 4AW7A 1IZ3A 3LD8A 4IEQA 4JC1A 4BK5A 5F6KA 5JWPA 3H3LA 2VM9A 3WQBA 5A70A 4HL0A 4XJZA 1YQ2A 4M3CE 1PK6B 5FZAA 3MDPA 5DUVA 5CFDA 1PVC3 3LIGA 1OA4A 4F3JA 5F5CA 1XYNA 5C3SA 3I3QA 1CX4A 3PURA 4CDQB 5ABJB 1LTEA 2Q8EA 5LEKA 3HNMA 2ZHNA 3KHBA 2JKXA 3WV6A 4R9AA 3KV6A 3IDEA 4LHSA 4Q0QA 3ZFFA 1GU3A 3FUQA 4FTEA 3BALA 1RYYA 1JZ5A 1J59A 4O61A 3H3UA 4LHKA 2ZEZA 3UJQA 4BA6A 4DB5A 4HMZA 1D4VB 2JEMA 3ZR6A 3UNPA 2ZKLA 1ENQA 2EICA 5LRRA 1G9AA 1C1FA 1N47A 4EN0A 1NXMA 1RUF3 2G9ZA 1JH5A 3VBFC 3OJBA 1AR73 5FZHA 3ZFFB 5FDBA 4I02A 3ZOIA 5TSWA 1VBD3 1QF3A 1BQPA 3P3NA 4IE4A 4OQ9A 4RR3B 5JR2A 1S0DA 3U4XA 3V0BA 4D7TA 2HJIA 2G9GA 3JXSA 4P9JA 1YQ8A 3GF6A 4PLMA 2YU2A 5C70A 5IK8A 2A73B 4NAOA 2P3JA 3OD0A 4KL1A 5FYCA 2WC2A 4E2QA 5EV7A 2RV9A 2VECA 3H42B 3LEIA 1UY2A 3FZ3A 4NRPA 3WP6A 1IKPA 4L8QA 1S0CA 4QX0A 1HQNA 3THDA 1UF2C 5JXIA 4HANA 3NMBA 4L11A 3I2JA 2X5IA 2B39A 1TZOA 2OPKA 2PHDA 4COWA 2Q4SA 4FFIA 2A75A 5LBFA 3LSDA 3ZFEB 4NRMA 3T0BA 5A6QA 1AL22 4HKLA 2J1RA 4CDUC 1LHWA 3KD4A 4AL9A 4YVWB 2JE8A 5HV0A 2FMDA 3UESA 2W0XA 4QM9A 1OPOA 4META 2WNVA 4RFRB 5A3MA 5BUVA 3B00A 3PVBB 5A1LA 2VPVA 5FZEA 4AEKA 3RFRA 3LQCA 1OQDA 1CGPA 1HB3A 1YHFA 2D6NA 2QFEA 5F37A 4A6OA 4O9GA 5CKMA 3AYAA 2WWSA 1IS6A 3IZOA 4COUA 2VZUA 2R16A 1YFWA 4MGZE 4JX0A 1OUXA 1GV9A 1QNWA 1QJY2 3AM2A 4GMP0 1FAYA 4D6QA 1M4WA 2JG9C 3P1IA 5CAZA 1G9FA 4OYUA 2XUMA 3H8RA 1PIV2 4KBZA 1C8M1 4LBQB 1X36A 4NOTA 5I0SA 4QPIB 2QVSB 3T2PA 5FY0A 2ORZA 5LRSA 1ULEA 1W6MA 2V09A 3ZSMA 3AMNA 1F4AA 1I5PA 1ODNA 4GKXA 4N90A 1HRV2 3VHPA 3WG1A 3PUHA 1R093 4QT6A 1FPN3 3TEXA 1NKGA 1RUH1 4QU1A 4CYDA 4UT5A 5FREA 2W3JA 4QB1A 1JYNA 3BOWA 1G86A 1Q8QA 4GIQA 3HEIA 3IMNA 3JBG2 4WVVA 5A7QA 1UYXA 2JD9A 4NIAA 1MZ5A 2JICA 1DU3D 4HOOA 5C5TA 4M01A 1WGPA 1LOEA 4B4PA 3ZXKA 1Q8OA 5FYUA 3VZOA 3LZZA 3GHNA 4UXAA 2VZ1A 5F6LB 2IFRA 4LE4A 3BTXA 4QKNA 3S7EA 3ZFGA 5FKBA 2GC0A 3ZSKA 1NT0A 1RUD2 2CWMA 1B35C 1E5RA 1GZTA 1X9TA 5FTTC 5A33B 4FAHA 5LY1A 1QJZA 3SLIA 3I49A 4C1WA 1VP6A 4OHWA 1W04A 1W0OA 1VBB2 2Y6GA 4I0WB 2CDPA 4P08A 5EXOA 2JDYA 5BNQA 1GOGA 1YYNA 4BU2A 4JRLA 4Y1XA 2Y26A 4NRQA 3POWA 4H7LA 4XFBA 2WNUC 3WNNA 2LM3A 2MPFA 4BHPA 2QDRA 2ARBA 2RDSA 2QQJA 1SMVA 2YY1A 3AKRA 2HH9A 5T55A 2UYAA 3MO4A 3QH7A 3V65A 1SLCA 4JKKA 3O0WA 3O1UA 1LODA 4RHV2 1AYN2 2DV9A 1S0IA 3RJRA 3FC0A 3IN9A 3BYWA 1QQP3 1W9WA 1CAXA 2ZEWA 5L7OA 5F3GA 1JTZX 4HKOA 3DV8A 5E88A 1ZZ6A 3FE5A 2JJ6A 4PI2A 3R4UA 4SBVA 1HRI1 3C7GA 3QCWA 1ZBE2 4OVEA 4XTMA 5D8AA 1VRBA 2WS91 4ARYA 5KBFA 3D0SA 1F15A 1CD3G 1FYUA 2L9LA 2BGCA 1OFNA 4QU2A 4DEVA 1W28A 2XJQA 1DDLA 1O3TA 5L7OB 1QOTA 1EUUA 4LQRA 3CHXA 4MGTA 3ZXJA 3O14A 4LR4A 1GQHA 2ZHKA 3BTZA 1HN0A 2ET1A 1SCRA 1PMIA 1YFXA 1S0BA 4HK9A 4A4AA 2VOXA 1ODMA 1KFUL 3J9SA 4Q0SA 1YI9A 1PX3A 4AVVA 4A7ZA 2GC1A 3AXDA 1WW6A 1DHKB 3IDCB 2VVDA 4C1XA 1QJU1 1RUJ2 5K0UB 4GULA 1H9WA 3GZTB 5FY4A 4XE9A 4BQ5A 5HPOA 3POJA 5FAXA 3B3QE 2F4LA 1W90A 1CJPA 4ZXKA 4AVTA 2PQQA 3JD72 4GD4A 2W2IA 4AQ6A 3GJAA 4M00A 2UWAA 2RDRA 4FP2A 1V9U2 5DAWA 4BQXA 3LEMA 2P3KA 5CU1A 3DPRB 2QKDA 3EMRA 2OYZA 4FCAA 5J36A 4OCTA 1H8VA 3FX3A 2JIJA 2NQYA 2Q1FA 3KCCA 3KGLA 4MLOA 2VVFA 3ZYRA 1SFNA 3WT3A 4JQRA 4NHKA 5KR7A 3E5UA 2R7EB 2R30A 2XJSA 1PVC2 4WVMB 5T5OA 4MSVA 3CQOA 2VE1A 1O5LA 4TYSA 2K0GA 4FO9A 4XW3A 4AYUA 3BGAA 2YMZA 3OBRA 5LA9A 2VUCA 4DPNA 1H9PA 3QLQA 3ZMOA 5A7WA 2ATFA 1UAIA 3AYCA 3R05A 4HN0A 4QMAA 5BXXA 3OCPA 3ZSEA 4QPGB 2ZAHA 3K3OA 5FZCA 4OMDA 1PZ7A 4CZSA 4UBHA 5IW0A 5HI0A 1DGLA 4OI2A 5FZIA 5LK7B 3VZMA 3I2GA 5IWFA 1RUF2 1RVF1 5FO7B 1IG0A 2BZDA 1VBE1 3ENRA 4P9IA 1AR72 4FPHA 4YW3A 3GXUA 3PUIA 2D5FA 1CZSA 2GZWA 2SBAA 4IEZA 1KXGA 3GYDA 1VBD2 3UGHA 2VBBA 5JOWA 3D8CA 2Y60A 3LKJA 4WM8A 3B5LB 3UV9A 3GM8A 4PIXA 5D2AA 5FY7A 4CU7A 4D94A 3WP5A 4P5YA 5FZ3A 4ATEA 5IFTA 1K3IA 4KG0A 1AXZA 1JOBA 4IW3A 2BNMA 3SC7X 4DUVA 3USUA 1J84A 4Z82A 3LA2A 2AYHA 3B69A 1K5MC 2ETEA 3HT2A 4P14A 3T2QA 3VBOB 3WNXA 1ZZ7A 2JG9B 5LW9A 2DF7A 2DUPA 2RG4A 2PHTA 2VCAA 3K4DA 4AHZA 1WLTA 2DCZA 4E4ZA 1YFUA 5BYNA 5IK5A 3T4VA 4QHZA 1O8PA 2EIEA 2VAUA 4D0QA 4Y5TA 5DUUA 5F7UA 5JOYA 4IV1A 3KVBA 3USUB 4K8FA 4K7JA 1J1TA 4OFGA 1ASJ1 1XU1A 2D44A 1ND3A 3PTYA 3OGVA 3FHIB 1TME3 4LK6A 3CLPA 1NE6A 1ULGA 1WCDJ 2AEYA 3VB9A 2KD7A 4CTEA 4D7YA 5FUNA 4ISQA 5FV3A 3WNLA 5BNPC 3R4SA 2XVGA 3W21A 1DQ6A 1ZREA 1LECA 1NCQA 4ZPIA 4B4QA 3LDRA 4MGYE 4BLIA 3ACIA 2DDUA 1DQ4A 4RS5B 1MZ6A 1W9FA 4COZA 1NA1A 2WSUA 2R073 1GKBA 1LJ7A 4YYOA 5IT6A 4HN1A 4HONA 1X8EA 1ZYBA 4RYDA 2RJLA 5DAVA 5FMBA 3MIGA 4PBOA 4E2SA 1AR93 1UU6A 3WUCA 1BK0A 1UQXA 1Z7S1 3I2HA 3N3HA 4IV3B 1EUTA 4ZU5A 3AKTA 1VAMA 2GC2A 4XHXA 4XETA 1JYCA 2D43A 3KV5A 2W87A 3ZXDA 1X82A 4G9SB 5K9YA 1QJX1 4OHVA 4A45A 2RJ2A 3HWJA 4N7UA 3PLQA 1R092
chains in the Genus database with same CATH topology
4BYYA 1FPN2 1KS4A 2WIIB 3MF9A 3NAPB 5GLWA 2TBVA 4FQ4A 3VUOA 4M3CB 2WT2A 1KQRA 4DNYA 2X8KA 4K9SA 2NN8A 3HR9A 1O7FA 1UPSA 2HWE1 4M0HA 3H1WA 4LHLA 4ONUA 1I9RA 4OI1A 5J3UA 2W68A 2MHFA 1PHMA 1BVP1 1WW4A 4GH4A 4R4XA 2RS11 3VDDC 1S0FA 1TE1B 1V6OA 3VZKA 3ZX7A 5GZFA 3M3QA 1WMEA 3OYWB 4LBMA 2PHRA 2RJKA 2ZHMA 1APNA 1R1A1 2OUHA 2MEV3 4BMBA 3PHMA 1CPNA 1W6QA 4LT5A 5T3NA 1PO11 2AREA 2XL9A 4DY3A 3O0XA 4I2OA 1MQTB 1SEFA 5C9AB 1U5ZA 2IXHA 1QQP2 1W2UA 5JZGC 1EPWA 3LA7A 5GJ6A 1YRZA 4I0AA 4YM0A 1KDKA 2OA2A 3L2HA 2ZABA 3IM0A 4FPLA 4KU7A 5JDBA 1WUVA 3B9IA 5E89A 4EV0A 4LUKA 2ZHLA 1JBCA 2C0ZA 3AP6A 4W65A 3NKGA 2DFBA 3CNAA 1DG6A 3WQ1A 1DBNA 1SDWA 4JGYA 5C8CC 4AFCA 3WDYA 3VZLA 1QKQA 5H9SA 1LOFC 1POV3 1NXD1 2HWF3 2W08A 1DYPA 1RMU1 2BFUS 3NO8A 2EA7A 5BNOC 1JN2P 3LCPA 4A2UA 5AVAA 3HIFA 4JAAA 3ZYJB 2C5DA 4FPFA 2AH2A 1PK6C 4FTBA 2PLV1 1VBA1 1YLLA 3ASIA 3UKNA 5ABJC 2OIIA 3K48A 3VKLA 4LBKA 2VMIA 2RR11 2OW4A 3UJOA 3VBUB 1I6XA 3OY8B 3KZ4C 2ENRA 3UKTA 5C6CA 5DUXA 4AGRA 5J37A 2VVEA 1RHI3 3PVOA 4PIZA 3WDXA 2QQPA 1IPJA 5JLVA 3ZFFC 3VBSB 2UU8A 1OOPB 4AWDA 4PIYA 2WL1A 3SH4A 4RR3C 1TNFA 4N53A 3QACA 1XNDA 3V64A 3WZ1A 2ZX4A 1FV3A 3AKQA 1YNAA 2P17A 2RS33 3A0NA 3TNQA 1QJY3 3CL1A 4AVSA 4FOVA 2R0HA 3MIFA 2WS93 3NL1A 4N53B 3RZZA 2DUQA 2A6ZA 2B9UA 1JYIA 3ZFEC 2JENA 1LGCA 3B93A 4Q8LA 1FMD1 4S2GA 2PN5A 4YVWC 5FOBB 3SCFA 4RL7A 5JAXA 2B46X 5ACA3 2P2KA 3NV1A 1F5JA 3PJQA 2X5IC 4P5HA 4DY5A 1TEIA 1DQ5A 4DMIA 1JUIA 1QJU3 5CFCA 3KT4A 3ZMNA 3RNSA 1ENXA 3I59B 3W59A 4XJWA 1V6NA 4A7KA 1X50A 5JIUA 1TME2 1J3PA 2D6LX 3ACLA 3TB0A 3LB9A 4AI3A 5FRAA 3ZSLA 4ZU7A 1AYM1 1V6MA 2XB6C 3CJXA 3TOJA 1N1YA 2D3SA 4QPIC 2Y38A 4AFBA 5I91A 4WBBA 3B7MA 1MS5A 4L92A 2XHKA 1BMV1 1VJ2A 1N3PA 4KH9A 2R072 5GLTA 1GLHA 1RUG1 4W6WA 3RMXA 1LOAA 1UKRA 3UL2A 1FX5A 4L99A 5JOZA 1NZCA 1YWKA 1AUYA 4UW6A 4IEXA 4KWKA 1AR92 5GM0A 1R083 4TZDA 1ZBA1 5K8SA 1DGRA 1GYKA 4WM7A 2W39A 5EWSA 1G7YA 1OHFA 2WFF1 4XBNA 2R041 4XQ4A 5FLIA 4JDMA 1DZRA 1CAVA 1RVF3 4AG4A 2Q8OA 3WW2A 1RJ7A 2DWRA 5JPMB 2AUYA 4XEZA 4DINB 2PAKA 1O4YA 3O0VA 4WM7B 1EAH3 4QQ2A 3CO2A 1NLRA 4ORFA 1H1MA 1H2NA 2B8MA 1HV0A 2PA7A 2YHJA 4NHLA 3J26N 1IS3A 3WY6A 3QH6A 1I1EA 5T50A 5FLJA 1RUOA 1QWRA 1J1LA 4U2AA 2Q1MA 4GA9A 3ZIWA 4YW4A 2XWBB 3N7JA 4FPCA 2ZA9A 3N7KA 4XBLA 4Q4X3 1DGWX 1GR3A 1Q8VA 1W6NA 4Q27A 2TNFA 4EWEA 2O0OA 5JSRA 3H50A 2MEV2 4FQZA 4BOWA 4DRRA 1D0HA 1MS1A 4MUVA 5T5LA 3ZXEA 1PGW1 4JGZA 4LA3A 4YRDA 4YFZA 2I2SA 1POV0 5I8TA 4LLFA 3HN1A 4AGVA 4CEWA 2H6CA 2JD4A 3ZXFA 1U5IA 3THTA 5L7OC 1VIWB 1Y43B 3ZVXA 3FFQA 4YVSB 1QHDA 1VAKA 1QGLA 1N1TA 4H7MA 2GALA 4LE3A 3WDUA 5T5PA 3WW3A 4LO6B 3D5OA 4QQLA 3M3IA 4Q4V1 2A3YA 2XVKA 2D3RA 3PJYA 4CEWB 1Z7S3 2F4PA 1VALA 1ZA4A 2B5HA 5GZDA 5K0UC 2VY0A 1UN1A 4NN0A 1ZRCA 4RA0A 5CFDB 1F5FA 1QJX3 5AVPA 2ARXA 3WINE 1N1SA 1GZ9A 1RUC1 1AHSA 1PO21 2DVBA 3DN7A 5T54A 2PTMA 4DOUA 4HK8A 4IXLA 4Z8BA 2BQPA 3LOBA 1MEC1 2HWF2 1CESA 3ZXAC 3DPRC 4OHZA 2A70A 2ZMNA 3J4UH 3W9AA 4CDWA 4OHYA 3BODA 5C4WA 1BEV1 2R0FA 3LGRA 4AF9A 4JDNA 3U0ZA 3I54A 3ELNA 3R4DB 4AI2A 2WA3A 1G9CA 4XIKA 3M2MA 1Q43A 1CQ9A 5CADA 3M3OA 3V0BB 1CAWA 4Q4Y1 4YZ4A 2V5YA 4Q0VA 1ZM1A 1XU2A 5BNNA 1NG0A 1PGSA 2D6KA 2NPIA 1EY2A 4QPGC 4FPYA 1LESA 2ZJCA 1H8TA 3GBGA 2GMPA 1U0AA 1RHI2 1U12A 4S2HA 3ROUA 3VZNA 2FZ1A 3WG4A 1EYBA 1LEMA 2X5IB 3NV2A 4C90A 5FQ0A 4BQ1A 2UWCA 1UU4A 1JHNA 4EN7B 1Y3TA 1H4GA 2XBO1 3RS6A 2WNVB 2RS32 1HXS1 3MI8A 4IESA 3V0AA 3VBOC 3MIHA 5FBZA 1GZCA 3ZYGA 2WS92 4WM8C 5FPZA 4E9KA 2Q1ZB 2GU9A 2FZ2A 4A7YA 2E7TA 2R1BA 4U36A 1SCSA 3TYJA 1NCRA 3JCIA 1ENSA 3SXWA 1R1ZA 3AZYA 4ZU4A 3JB8A 1A78A 4PCRA 2AR6A 3MF6A 5LK5A 1GZWA 3WCSA 3DL3A 5ACA2 4BCUA 4QD2A 2EF6A 1RMU3 3ETQA 1W6MB 4OZXA 4Z1VA 3VBRA 1OKQA 1QJU2 1AR81 1DZTA 1FI2A 2ILMA 4RS5C 1NCRB 3C2UA 2I07B 4YZ2A 2NMNA 2WJSA 2P37A 1VBA3 1J3RA 5KHGA 5L19A 1WA4A 4RQPA 4YW2A 2RR13 1O91A 1W6OA 2VMGA 4E2SA 1C28A 1WD3A 3ZXGA 2VW0A 2WSVA 5I8YA 3VBHA 2XKPA 2Y0IA 2ZGMA 4LLOA 2ZOEB 4IV3C 2D97A 3GZAA 2BNOA 4XFCA 1COV1 5J7MA 4M3CF 2RS51 2ZGOA 2CL2A 3RJ2X 2VOKA 1F9KA 3RI8A 2CGNA 2E9QA 4Q29A 5C33A 1URXA 3ZFGB 4NR1A 2WQZC 3NAPC 3GBWA 2YUEA 1LULA 3T1MA 1O3QA 4OI0A 2D98A 1UL9A 3HD8B 1R082 5H9QA 1RGSA 1SFYA 4INDA 1C4RA 2YDEA 4GWMA 1FOD1 1LHOA 1D4M1 2IFWA 2X53S 3DKWA 3ILNA 1RVF2 2ZGTA 4K20A 1JUHA 4R8HA 2WT1A 2A3WA 3MPBA 3BCWA 4XIOA 5JR7B 1DQ1A 3WR0A 1EAH2 5JCTA 2DVFA 3T2TA 1CAXB 4F8AA 1XNKA 2VH9A 5J98B 3N4MA 1AR63 1FMD3 1LRHA 1AX1A 4YG0A 1S0JA 3FMGA 3KGZA 5D8AB 5DZGA 2D6MA 1S0GA 2CNAA 3CU7A 4FXKB 3FBYA 2R49A 2OZJA 1C5IA 3AZWA 3ALQA 1PIV1 4K1ZA 2Z2SB 4LUMA 3U11A 3ZN5A 4AEKA 2JG8A 1MQTC 4Q4X2 4YM3A 5C9AC 2ERFA 4DQAA 1GICA 3EJKA 5EYYA 4LTAA 3CF6E 2XLFA 4AXOA 1HRV1 3SH3A 3WDVA 1LU2A 2QJVA 4AQ2A 2UWBA 2B42B 3VBFA 1REDA 1PNFA 2XH6A 3C3VA 3O5SA 2YZ4A 2IWGB 1ND2A 3WQ7A 1WMFA 2HWD3 2HWB3 2UY8A 3M3EA 2DVDA 1OA2A 4H14A 2ZGQA 3MW2A 1QDCA 2D5HA 2ZGNA 4GMP1 4D7SA 1S1AA 4MX3A 4L9BA 2ZGRA 4FXGB 1C1LA 1KDMA 1PNGA 1Z7S2 5HCFA 1ZBA3 3I8TA 1RUD1 1ZZ9A 1ND2B 2SLIA 3CEWA 3POYA 2JE7A 1XE7A 2E63A 2R061 4X8PA 1ZZBA 1QJX2 2HWC1 1LU1A 1RUI3 1VBB1 2H0VA 2R043 3TN91 3SNMA 2GAUA 3VL8A 4CDUA 3FLRA 4JCKA 4MVTA 2LUWA 4LNVA 4FPJA 5DZEA 1G8WA 1LB2A 3VBUC 1O4ZA 3T1LA 4HPKA 1CPMA 2C9AA 3DUIA 3H7JA 3MW3A 4OLLA 4LO5B 2NLRA 1Z0HA 4PDWA 1GANA 3BTAA 3TWIA 3ZN6A 4C0HA 3MYXA 5CVRA 1DF0A 3VBSC 2AENA 5KC6A 4HBNA 4WM8B 1OOPC 4GALA 1NY71 4DXZA 2O1QA 4Y1UA 4Y1VA 1HKDA 4Q26A 2W52A 1LOGA 3KCXA 1VBC1 1FNZA 5AFEA 2IXLA 5AFBA 3PNAA 3VHNA 1VRH1 2BWAA 2A71A 4N53C 4Q0PA 4Y24A 3ES1A 3M70A 4LBQD 2WQ4A 4MXWA 1PGL1 2ZS6B 4IV1B 3HMYA 4Y22A 1A8DA 5JVVA 1RUJ1 3N35A 3ZPYA 2XKOA 4BPZA 1ND3B 5EZWA 1HQWA 2D3PA 5H9PA 4ZKTB 1ZRDA 1WBFA 3SHRA 4FTSA 4Z92B 2K9ZA 2OZ6A 2VNRA 3JD71 4FP3A 4GXLA 1NCQB 3PVEA 1C57A 5HCBA 1V9U1 4Q4V3 4E4DX 2RM21 5EJ3A 1HLCA 3RQ0A 3IIAA 2GSYA 4Y22B 4YGEA 2DCKA 2DVAA 1NA1B 1ULCA 3I2DA 3ILRA 4B4RA 1B35A 2ZGSA 1SBEA 5GZEA 2LALA 1RUC3 2XGXA 1BKZA 1OQ1A 4LO8A 1QH6A 4CRQA 1PVC1 1CJDA 1AJOA 1QH7A 4S2DA 2ZZJA 1UZZA 5GALA 1RMU2 2WNUA 4YZ1A 1UIKA 5CFCC 1LENA 1QXRA 3HQXA 5CG8A 3L9JT 1G9BA 2JKBA 2DU1A 2EAKA 4YGDA 3KSCA 2V73A 5J96B 1V00A 3GNEA 3IPVA 1VBA2 2CGPA 2GN7A 4AK3A 1LR5A 1RUF1 2RR12 1TMF1 4XF4A 2DU0A 4Q4Y3 3N36A 1AX2A 1WBLA 2GMMA 2VNOA 4PF5A 1IHMA 1VBD1 4OI4A 1M06G 5DDJ1 4AEDA 5SV8A 3TAYA 3AP5A 3AKSA 3FWEA 4WVZA 4GH4B 3S6PA 3WDWA 2WZR1 4S2FA 1AF9A 1F8VA 4ISRA 3A4UA 2WINB 2ZX3A 3MIBA 4BM8A 4XXPA 4PQ9A 3AMMA 3ZIXA 1PZ8A 1Q3EA 4AEDB 4WM7C 4QHBA 1UMZA 4YZ3A 4L97A 4JV4A 2XBO3 4FT8A 3JZVA 1W6QB 4XFHA 1MZEA 1OLQA 4NO4A 5FOJB 2FBEA 2ES3A 1C8M3 3JQWA 3S0MA 4XFFA 1RJ8A 1EV11 2PHLA 5J09A 4UW3A 5KHKA 1JW6A 2BVVA 4EN6B 1HW5A 3EHKA 1UKGA 3G7DA 1CONA 3I4IA 4YNIA 3B9CA 1AR62 1FMD2 2D7FA 1RUH3 4Q4W1 4R52A 4XTPA 2ZAAA 1IS5A 1BYHA 2ZGKA 5I0RA 3N7LA 1QXJA 1AR83 5C8WA 4K3UA 3TNPB 4JGYB 4P9LA 4AFAA 4AGGA 1NLSA 4YVSC 2BNNA 1TQ5A 1MVQA 2RMU1 4IEPA 1FPN1 4JTNA 4V1PA 3B02A 4Y5Z0 4B8EA 5T5JA 4CEWC 2EALA 3IBMA 2QUOA 4CP1A 2DTWA 4IQPA 4R9DA 1ULDA 1COV3 4FOQA 5HCAA 1VR3A 3HBZA 4KBBA 3NV4A 5EYXA 2RS53 5CFDC 2HWD2 2HWB2 4C91A 2GH8A 1DGRN 1UD1A 2XWJB 2XL7A 4L2NA 1DQ2A 4BLJA 1RIRA 1K5MA 3WP3A 2EAAA 3WW1A 2ZMLA 3ES4A 3NWKA 3H0OA 1ZBA2 5GZCA 2XVLA 2DVGA 4OUMA 2IXIA 1FOD3 1RUI2 2R042 1D4M3 1BCXA 4AE2A 2ZGUA 1X8MA 2NMOA 2IZWA 3MZHA 3KM5A 1HRI3 3J8F1 5HXVA 5KHIA 4N9IA 1UW8A 4AVBA 4EJRA 4CP2A 5BNPA 2BFUL 2HEWF 4BIFA 3GZUC 4QGMA 2NM1A 5FO9B 1XQNA 1QQP1 5GLUA 2KM2A 1QOSA 4CDXA 1OSGA 4TWTA 1O4TA 3E97A 2EXKA 2Q5TA 1IS4A 2WLQA 1C3HA 2A7AA 5LEJA 1V6JA 1LEDA 1AL0G 2E53A 2GNBA 5DXDA 3RI9A 4CDXB 1Y7BA 2VW2A 2WNVC 3EO6A 5L73A 4I01A 3OPZA 4YSFA 1LHUA 1PGW2 2BYVE 4F7ZA 4KU8A 3BIWE 4X6QB 1GSLA 3S30A 4URTA 1ZRRA 5CFCB 4CEYA 2DCYA 2VXRA 1EP0A 3MFCA 2XJUA 3APBA 3H8UA 2C1FA 5I0TA