1UXZA

Carbohydrate binding module (cbm6cm-2) from cellvibrio mixtus lichenase 5a
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
131
structure length
131
Chain Sequence
MVIATIQAEDHSQQSGTQQETTTDTGGGKNVGYIDAGDWLSYAGTPVNIPSSGSYLIEYRVASQNGGGSLTFEEAGGAPVHGTIAIPATGGWQTWTTIQHTVNLSAGSHQFGIKANAGGWNLNWIRINKTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULASE B
publication title The Crystal Structure of the Family 6 Carbohydrate Binding Module from Cellvibrio Mixtus Endoglucanase 5A in Complex with Oligosaccharides Reveals Two Distinct Binding Sites with Different Ligand Specificities
pubmed doi rcsb
source organism Cellvibrio mixtus
molecule tags Carbohydrate binding module
total genus 30
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1uxzA00
4CUCA 2ZEYA 1W0NA 2VCAA 2YC2A 5DN2A 3CDZB 2ZEZA 3I2KA 2YFZA 1PX4A 3THDA 2JDAA 3ACIA 2W46A 2WAOA 3OGVA 3E1F1 1JZ6A 2L9LA 3ABZA 3C7EA 4CU8A 3DYOA 4P02B 1K3IA 3T2PA 5JUVA 3IIIA 1P8JA 2ORXA 3A22A 1UY1A 4IUGA 4MADA 3K4ZA 4GWJA 3OEAA 1NUKA 2WO1A 2Y64A 1XPWA 3CZUA 1YQ2A 4FI9A 4BK4A 1DLCA 1GMMA 4LPLA 1UXXX 3WF3A 1UY2A 1EUUA 1UYYA 4LKSA 4PF1A 4MGQA 2QQJA 3W5MA 1W8NA 3T0BA 1PMHX 2ID4A 4CU7A 1K42A 3SKVA 2RJ2A 4DXTA 5F7UA 4KMQA 3HNBM 3CQOA 2W91A 1HN1A 1KGYA 2VZOA 1W9WA 1O59A 4XURA 2WZ8A 2BGOA 2W47A 4QDSA 2J1RA 3HEIA 5EJZB 4ZZ8A 2VZUA 3T0AA 2HLEA 2XHNA 2YC4A 4L0PA 2XONA 1T2XA 2V72A 1GOFA 3GDBA 4MOAA 1J83A 2HYXA 1MPXA 2WABA 2V5DA 4XUPA 5LCWL 1JYWA 3LPGA 1UY0A 2QQOA 1UX7A 4UI9L 3C7OA 4W4ZA 4YPJA 3SEEA 3WSOA 2EIEA 4OZOA 3W5NA 4D0QA 1JI6A 5JXHA 2VCBA 3NJVA 3OBAA 2DCKA 3A23A 4AG4A 1GOHA 2WO3A 3DYPA 4KI5M 2J1AA 3MV11 2QQLA 2Y6KA 4A3ZA 1JHJA 2BBAA 2WUHA 3WNPA 2QQIA 4TTGA 4E8CA 4D8MA 5FUIA 2X10A 2W5FA 2VC9A 3FN9A 3LPFA 1PMJX 3T2OA 4GZ9A 4KWUA 1JZ8A 2VZPA 5JMOA 3NNGA 3ZM8A 1OH4A 2EICA 4RYDA 1RYYA 3SEPA 5B4NA 3P6BA 5LA2A 1JU4A 4HG6B 4QDRA 3LQCA 4E8DA 3NQHA 1F4HA 4PQQA 4DUVA 2QQMA 3P1IA 2E32A 2W1UA 1NX9A 1W99A 1UWWA 5J1XA 3I2GA 2VZVA 3LEIA 5IFPA 4TXWA 2VL4A 3T08A 2DDUA 2ZEXA 4BDVB 4DUWA 1F4AA 3IAPA 4BJ0A 3HNMA 1JZ4A 5DQ0A 2VJXA 3JXSA 5HPOA 3D3AA 4PT6A 4P08A 3C7FA 3I3BA 4QPWA 1JYXA 3GXUA 1CZSA 1UZ0A 4LHSA 4W8JA 1NKGA 2JE8A 2EIDA 2J7MA 3WEZA 2Y6JA 5IFTA 3K4DA 3SKJE 1OT5A 3WNNA 2YFUA 4M4RA 1BHGA 1JU3A 4QB1A 4Z2AA 3BGAA 1UY4A 2WYSA 3MO4A 3FHQA 1W9TA 2QQKA 3CKHA 5EIYB 3K46A 1IQDC 2Z4FA 1OF4A 4GWIA 3VDBA 1SHWB 3GM8A 5HXMA 2VZ3A 4P00B 2VMCA 1L7QA 2C9KA 2LW8A 2ZEWA 3HOBA 1W9SA 4XUQA 3J7HA 5DMYA 1JZ3A 4QDQA 2VZTA 2VMEA 1I5PA 2Y6GA 4RN5A 2Y8KA 4ZXEA 4XUNA 1GNYA 3HJRA 3THCA 1R64A 3LEKA 3PUHA 1UXZA 3WNOA 1OF3A 5A1AA 2VMFA 3IB3A 3WQBA 2VQUA 1US2A 1SDDB 3ECQA 4QB6A 3CZJA 4JKKA 1GU3A 4ARYA 2EIBA 3C7HA 3MV01 4XUTA 4QB2A 4OUEA 3I3DA 2VZRA 1CIYA 2VMDA 4A45A 4CUBA 2WN3A 1D7PM 3NRUA 1UY3A 3K77A 2VQTA 2C26A 2XQXA 4ARXA 2CDOA 1DP0A 2VO5A 1JYNA 4MGSA 1PX3A 2VZ1A 3WNKA 3FL7A 3OGSA 2OKXA 2V4VA 2J1UA 3K4AA 3C7GA 2W94A 3IAQA 5CYYA 4A41A 1J84A 2B4KA 2W1WA 3VD5A 4OMCA 3ACGA 3VDAA 5EJ1B 5B4XA 5G04L 3WF0A 3VD9A 1GQPA 1JYVA 1WKYA 5DPNA 2VTFA 2WO2A 5CZKA 5JXJA 2E33A 4BXSV 2ORZA 5IHRA 4P5YA 3MUZ1 4ZZ5A 1CX1A 2RV9A 3HNYM 2J1EA 5IYYA 2LS6A 3I3EA 2J1TA 3GGLA 3I2HA 2YG0A 1UYZA 4W50A 1CZVA 4A4AA 1UYXA 1H6XA 1LNSA 1O8SA 1TG7A 1JZ7A 3C8XA 2C4XA 4MO3M 3U37A 4AAXA 1OD3A 2VZSA 1ULPA 1H6YA 4CU6A 3DECA 2JKXA 4JKLA 2Y6HA 5G05L 1XNAA 3DYMA 2XOMA 3HN3A 2VM9A 3WNMA 1XNTA 3CMGA 5C7GA 3EYPA 5I0DA 2BZDA 3IDAA 3MUY1 1SG3A 2QQNA 4A42A 4BK5A 2W3JA 2VZQA 5JXIA 3F2ZA 3ACFA 1W8OA 3BN6A 4OMDA 4DXRA 2E26A 1WCQA 1JZ5A 1UMIA 4UOJA 3VDCA 4OYUA 1US3A 3I2IA 2W9XA 1O8PA 4QX2A 4JHZA 4XVHA 2W92A 3UESA 1DYOA 2ZXQA 3UETA 3CIHA 3I97A 3A21A 1TVGA 3T09A 2WBKA 4DXSA 4M4PA 4ZY9A 4DEQA 1NAEA 4CVUA 5JXGA 2R7EB 2KD7A 3NJXA 3UNPA 5C70A 3A7QA 1GUIA 5LA0A 1EUTA 2W1QA 4DUXA 2W95A 2YB7A 1CZTA 4CUAA 2X05A 4QX3A 3ACHA 2WN2A 1K45A 4JX0A 3K75B 3OGRA 2J22A 3AC0A 5LA1A 3OG2A 1UMHA 2DCJA 3VD3A 1KEXA 2E31A 2WAAA 2VR4A 3HPNA 2JD9A 2BGPA 3WNLA 4LQRA 2WQ8A 2QBXA 3VD4A 2X09A 4XZUG 3OEBA 5IJRA 1ULOA 2J1VA 3I2JA 4QX0A 2RVAA 2CDPA 4DEVA 4JKMA 2WZEA 4QX1A 3LEGA 3ETPA 1JZ2A 2VCCA 2PQSA 4QAWA 1XC6A 4A44A 4CU9A 2VOTA 2B9VA 3PUIA 3FHAA 2Y6LA 1L7RA 3OB8A 2W1SA 3WF1A 3T0DA 3MBWA 3T2QA 4XUOA 3WF4A 2J1SA 3I2FA 2W87A 4UAPA 4A6OA 5C71A 3WF2A 1K12A 3LE0A 3VD7A 4ET7A 1GOGA 5JR2A 2WDBA 2BERA 3EB7A
chains in the Genus database with same CATH superfamily
2ZJCA 1ASJ3 1YYNA 5L7OA 3ZPOA 4Y1YA 3VUOA 5FZBA 4YGDA 1W0NA 4MHUA 5CFCB 2O0OA 4C1WA 3MFAA 4LO8A 3TEWA 3IMNA 5M0TA 3B3QE 3H1MA 4FXGB 4AEKA 2YFZA 2HEWF 4HFSA 3THDA 4ZKTB 2JDPA 3ZYFA 3LOBA 1SMVA 4XE9A 2WAOA 3IBMA 4I02A 3E1F1 3AL5A 3N36A 4IGPA 4S2GA 4XDPA 5LA9A 3ABZA 2F6BA 4XF3A 4V2WA 4CU8A 1K3IA 2UWCA 3BYWA 5FZ1A 2ZMNA 1FOD1 3GBFA 4E2GA 5JUVA 5IK8A 2ORXA 4YM1A 1OHFA 1ZBE2 1A34A 4LKDA 1RUE3 1RUF1 4GWJA 5BY5A 1IGOA 5CVRA 3D5OA 1G9AA 3ZXJA 2D6KA 4JGZB 3PDQA 5JDBA 4AW7A 1DLCA 4Y1XA 4YGEA 2XVKA 4WM8C 3VBUB 4CDUC 5JAXA 3EHKA 3INAA 3JZVA 1UY2A 5FZGA 3FE5A 3A0NA 4MLOA 2FHRA 1D4M2 5CBLA 3M7AA 4CU7A 2ZZQA 1NLQA 3H50A 3UGHA 2RM23 1GWMA 3NV3A 4DXTA 1VRH3 1N1SA 2H6BA 4O61A 4KMQA 4X6RB 2W91A 1KDKA 1WMDA 5C8CA 5T3NA 5I8TA 3VL9A 4XURA 2WZ8A 3GJAA 1A3KA 2BGOA 1XE7A 1S0GA 2D7FA 4LKEA 2FCUA 3LSDA 4RS5C 1YQ5A 5APAA 5FZIA 1V6KA 2PQQA 2CTVA 2GZWA 1BBT1 2Z2SB 5LBFA 4B4QA 4CDQA 4AVTA 1NCRA 2JKBA 4MXWA 2P3JA 1L7LA 3MW2A 1QQP3 1EV13 2V72A 3RZJA 2ARXA 2YU2A 4MOAA 2GSYA 4D94A 1DU3D 2OPKA 2WABA 1Q43A 1JYWA 3SXWA 5HCAA 1UX7A 1WCUA 3RQ0A 3HMYA 3ZMNA 5A3MA 4HVOA 1OBNA 2WNUA 3QH7A 1WA4A 1ZZ7A 2VPVA 2XJQA 2R16A 4MXVA 4JCKA 3URFA 5ABJC 4ZHNA 1K5JA 2EIEA 4OZOA 4D0QA 1WZXA 1LECA 1VAKA 4M3CB 5AVAA 1XRUA 1VIWB 3NJVA 5C3QA 1D2QA 2DCKA 2BNOA 1MZEA 4K20A 4DZGA 1FPN1 2VG9A 1YJKA 4BPZA 3ZN6A 3RI9A 2Z79A 4KI5M 4CP9A 3ZXAC 1HRI3 4LUMA 4HONA 5L19A 1WMFA 4NHKA 4A3ZA 4YARA 1IPJA 2BBAA 3JQWA 4Y4YA 1AYN3 2WL1A 4Y26A 3LA7A 4OHXA 4AVSA 4C0BA 5F8PA 3FLPA 5KHHA 2YBKA 4J25A 4Q8LA 5ANQA 5J36A 1VBA1 2ZHNA 5FUIA 3ZKYA 1RUI1 2DVBA 3FN9A 3LPFA 4LA2A 4WVZA 3SCHA 3OBRA 1PM4A 1R091 5F2WA 4Y1UA 3DUIA 3AP5A 4I2OA 4KWUA 4EWAA 1AL23 1RUJ2 2Y60A 3B93A 4FTEA 1CAXA 2I74A 4IQPA 3SQOA 1H1MA 1PO23 2E7QA 2GC2A 2OYZA 1SZBA 1OH4A 2RHPA 1KQRA 2EICA 3HBZA 4RYDA 2QFEA 3HWJA 1RYYA 1W8HA 2WRAA 4EZ4A 5B4NA 3P6BA 5KHGA 4HG6B 4QDRA 2FCTA 4H3WA 1UN1A 4YSFA 3MICA 3AKTA 4AEDC 2ZGRA 1O3SA 1UKGA 2NYYA 2XUEA 3GYDA 4DUVA 1HRV1 3MPBA 4LOTA 3WVJA 2UWAA 1QJX3 1RINA 4LIUA 4Q2FA 4BQ4A 3O1MA 1UWWA 1XNCA 3T08A 2DDUA 2ETEA 2ZEXA 4GD4A 5FMOL 5FYMA 4FCAA 5ACA1 1LGNA 1JYTA 5JR7B 2VJXA 3JXSA 4E4DX 1IG3A 3CJXA 5HV4A 1W8UA 3D3AA 4PT6A 3NNLA 3LDBA 5C8CB 4XBNA 4ZS2A 4N43A 2XJPA 5C9AA 4BB3A 1OPOA 4Y33A 5LBBA 4CCJA 4FBFA 2R32A 4LHSA 1W6OA 3ZDSA 1LEDA 3KV9A 1NKGA 4LHLA 4W8JA 2EIDA 2J7MA 2PN5A 3M1HA 5AVPA 5FYBA 5LWBA 1FMD1 2Y6JA 2AACA 2VNVA 2BJSA 4Q4V3 1NCRB 4MXWB 4A7ZA 3SKJE 4CDQB 2AH2A 3WD5A 1H2NA 5C5TA 5IFTA 3WNNA 1J59A 1BKZA 2VOXA 1ND3C 3TB0A 4E4HA 4UFIA 1RUC2 3AFGA 3WW4A 3ZYHA 4GJZA 2YPDA 3VN4A 1Z78A 4IL7A 5A7OA 4UW4A 2PFWA 1UIKA 3OBZA 1RJ7A 2IXHA 3ST7A 3BGAA 4XXPA 1UY4A 1U5XA 3ZX7A 3D82A 2QDRA 4BWOA 1W9TA 4BISA 4CCMA 2MNGA 4GWMA 5FZMA 1XOYA 2VECA 4Y20A 1IQDC 1H4GA 3OTFA 4Z8BA 1LEMA 1OF4A 2ZMLA 1HKDA 3NAPA 4XMAA 4AI0A 5FYYA 4E2QA 4IXLA 2LM3A 2ZZJA 1L7QA 3NL1A 5CKNA 3WDXA 1UIJA 2YMZA 2ZEWA 1WLDA 2RS11 1YQ6A 1HXS1 2BQPA 2BPA2 4JDOA 1RMU3 2D93A 2OUHA 3J7HA 1I6XA 3IZOA 3KV6A 1N47A 2VZTA 1KFXL 4PIZA 2VMEA 2Y6GA 4MH0E 3O1RA 3AYDA 3OYWB 3TEXA 1W8WA 4N53C 4JGYC 4CEWC 5KHIA 1CAVA 2FDHA 3MFCA 4LO6B 4PLMA 1WBLA 2VQ0A 5FDBA 2QDNA 1FOD3 2XJUA 3UYJA 4FPCA 5IVEA 3SHRA 5KBFA 4A2UA 4CE8A 3LEKA 5FQ0A 2B9UA 1APNA 3ZIWA 3ZIXA 1D0HA 1H4HA 5I0TA 1PNGA 3LFMA 4NO4A 1SFPA 1NXD1 3IB3A 3T1MA 3WDVA 3WQBA 5K7PA 4HMZA 3TN92 3U4XA 4BIOA 3OJBA 2OZJA 4QB6A 5FZEA 2TEPA 1EYBA 2P2KA 4IW3A 4JKKA 1GU3A 1UZWA 4Q4X2 2MEV3 4ARYA 2D3RA 3C7HA 4XFFA 1TEIA 2QCSB 1GKBA 3ZFEC 4QB2A 2J42A 4G3YC 4OUEA 3ZYBA 2VZRA 1CIYA 4EWDA 2BNNA 4GULA 2JG8A 4IV3C 4YW3A 1QJEA 4COWA 1UY3A 2ZX2A 1O4TA 2VQTA 2A71A 3FLRA 1NZCA 2C26A 1H2LA 2A3XA 5FZ3A 3WNXA 5C3OA 3WR0A 1S2EA 2BRTA 2HH9A 3AXDA 3LOIA 4BH9A 3O1OA 2VO5A 4I09A 1JYNA 2VZ1A 3E6DA 1CAUB 1OFSA 1ODNA 2VH9A 2R0HA 4QHBA 3FL7A 3OGSA 1BBT3 1RUG1 1DQ1A 4GJYA 4CTEA 3AP9A 1BVP1 2VBBA 3FJSA 5IK7A 3WQ1A 3UJQA 2W94A 1ND2B 4N43B 5C9AB 5CYYA 5FWJA 4JAAA 1CJPA 4A41A 1IG0A 2P34A 4LT5A 1C8M2 1CIWA 1PZ8A 2W1WA 5CIRA 2BUKA 4V1PA 3ACGA 5C3PA 4LUKA 5EJ1B 5G04L 2CU5A 1O3TA 2GMPA 1NLSA 2D98A 3OPWA 3OUIA 1QJZA 5FZDA 4GALA 2BU9A 4JZRA 1VBC1 1WLTA 2PAKA 1JYVA 4QQLA 5LB6A 1LODA 3BCWA 1WKYA 3QH6A 3CL1A 2OW4A 1UKRA 2DTWA 3AKQA 1YXWA 1FPN3 4Y5SA 3ZSJA 4BZ4A 1A6CA 1CX1A 2AEZA 3OD0A 4AQ2A 3CF6E 3CJIA 3WG2A 3FMGA 2R071 3MIEA 4Y22A 3NAPB 3MEPA 1K5MC 2JIJA 2BEOA 1HB3A 2C9AA 4UFMA 4Y1VA 4FXKB 1OQEA 4LE3A 3P3PA 5FBZA 4QGNA 3ELNA 2ERFA 1VBA3 1W6PB 4IE6A 4ISQA 4QT6A 4DINB 4FPEA 2JB8A 2E7TA 3ZOIA 1LNSA 1O8SA 1JZ7A 1LRHA 3KD4A 3C8XA 4XBQA 1ZYBA 4NHYA 3KGLA 1OD3A 1R093 1Y7BA 2RJLA 3QLQA 3ZYIB 4FO9A 1H8VA 1Y9GA 2WWSA 5A7SA 4FAHA 3U10A 3SISA 2XOMA 4NIIA 2BOIA 1CAVB 1ZBA2 4GMP1 5C3SA 4CEYA 1XNTA 5FY1A 5H9SA 3PJYA 4NAOA 2RG4A 5FQ0B 5IVBA 2ZS6B 4BQ5A 1TME1 4DY3A 3O0VA 5F5CA 1AVBA 3OPTA 4LR4A 5FTTC 1AX0A 1ZA7A 2V5YA 3IDAA 1F5JA 1OOPC 4L8QA 1WW5A 1HRV3 1S4CA 2ZAAA 3EJKA 4KGQA 4ORFA 2VZQA 3OUJA 3G7DA 4K7JA 4YWAA 3BN6A 1NY72 3NWKA 1RUD2 4DXRA 4FT8A 3E6CC 1WCQA 3KVBA 1TMF2 4Z07A 4UOJA 1JZ5A 1HB4A 4Y5TA 2BVVA 3BPZA 4GWNA 4LMFA 2DU0A 1COV1 4QX2A 3VDCA 5ACA3 5K9YA 2GMMA 4M00A 4BQXA 1AXYA 1KDMA 3E5UA 1UX6A 1OSGA 3LAGA 3R0RA 4Q4Y3 4GB31 5DUWA 3H1YA 3I59A 3ZMOA 2ZXQA 4R4ZA 3RJ2X 3W58A 1EP0A 4WVWA 5FZLA 3A21A 1V70A 1BEV3 1TVGA 2R062 2XJSA 2XBO1 3KV4A 5FP9A 3N4MA 1VP6A 4Q1RA 4CVUA 5BNOA 5SV8A 1PZ9A 3KZ4C 1CJDA 1F31A 1WLCA 4NIDA 2R7EB 2KD7A 1KXGA 4LBLA 2DVGA 4Y5Z0 4BU2A 4YVSC 3DEMA 1YIPA 1FV3A 4PIXA 4F8AA 1QWRA 1MEC1 2B39A 4I0BA 2Q8DA 5LA0A 2HBUA 4YG6A 1B35C 5EV7A 3NKTA 2JEMA 4YGCA 1ENQA 2X05A 2HKXA 3RRDA 3ACHA 2WO7A 4WM7B 1PMIA 5FLJA 2B46X 3M4FA 3HAGA 1PO11 2BV4A 2H0BA 4XFAA 1OKOA 4BM8A 1VBB2 1XU2A 5LASA 3ALQA 4NMIA 1V6JA 1SPPA 5LA1A 1OKQA 2IXKA 5FMCA 2DCJA 1OUSA 1OD5A 4BQ2A 4FP2A 4FP3A 1KEXA 1Q5OA 4OUSA 3KCXA 1QIQA 5KC5A 1C28A 4LJHA 3HPNA 4WVVA 4XYXA 1DYKA 3U07A 3WV6A 4LQRA 2WQ8A 3V56A 2BP6A 3VD4A 2X09A 3C2UA 4LBQB 5EQUA 2ADEA 4COZA 2XLGA 2X53S 4X8PA 2B5HA 4RHV3 1VB2A 5IK5A 2WFF1 4QX0A 2ET7A 2OZ6A 1ZNPA 1UL9A 2JDMA 4K3UA 3AB0A 2IVJA 2RS13 2RVAA 4AHYA 1HXS3 4Y22B 5FZFA 3ZFGC 1QNWA 3VBFC 2VBPA 4XF1A 1R1A2 1W06A 2NPIA 3BPSA 3ETPA 4BQ3A 2VCCA 2YYOA 3VBSA 2XWBB 3SLIA 5FZ9A 4CU9A 3ILNA 4IEOA 4ZU4A 1LB2A 3RG0A 4PF5A 3L2YA 2VXJA 3ZXGA 3WG3A 3IM0A 3J26N 2IXLA 1QJY1 2Y6LA 5FYVA 2JG9C 4FFIA 3OB8A 2O1QA 2R0FA 3VBHC 4EWEA 2ZCWA 1DHKB 2OIIA 2AYHA 5JI7A 5I0RA 3FHIB 3MBWA 3ZXDA 4XJ9A 1V6MA 1TNRA 1DCSA 3LGRA 2IVIB 4CSWA 2Y33A 4CPBA 4HXCA 3WDYA 4KG8A 1RVF2 1YEWA 3D6EA 2W87A 1V6LA 5A3OA 3WW2A 2AENA 5KXEA 1H30A 1OXCA 4JTOA 5K8SA 3KQ4B 3ILFA 3UKNA 1CVNA 4Q4W2 1VMJA 1YQ8A 1ZZCA 1C5HA 2WDBA 4CDWA 1D4M1 1PHMA 1Z7S2 4O65A 5DAXA 4OHWA 4BLIA 4KBZA 3EMRA 4F7ZA 3CNAA 1Y9QA 3VDDB 3JU9A 5JOXA 1ZA4A 2TBVA 1W04A 5LRSA 1MQTA 4XETA 5FP8A 5JZGA 3AMHA 2VXRA 4HOOA 5FOBB 3W59A 1VBD1 2AC1A 5GZEA 4R9BA 4ASMB 1RUG3 2RMU3 2JDAA 2R042 3ACIA 2FMYA 3GCWA 4CXWA 2IFWA 4R9CA 1ST8A 1TNFA 1O5UA 1Q3EA 1W6MB 3WZ1A 5FY7A 2L9LA 2XB6C 3C7EA 2P5BA 3J8F1 2PHTA 5A32A 4FFHA 1NA1C 2G9ZA 4RR3A 5BNOB 1LR5A 1UY1A 5FV3A 3SC7X 2CSGA 4FPOB 4YVWA 1GICA 3JBG2 1WCSA 5CFDA 2Y64A 4TZDA 1XPWA 3CZUA 4LULA 5AC92 4BK4A 1DGLA 4UT5A 4IEVA 4Y24A 3G6JB 4MX3A 2VUJA 1M4WA 1UXXX 2BNMA 4N9HA 3RI8A 3DPRB 1OMIA 1VBC3 3VKNA 3WF3A 2JWPA 1QJU2 2VMGA 3J7MA 5FXXA 2XJTA 3KMHA 2ZX3A 4KNCA 1CESA 2JDUA 3EO6A 4NHXA 4MGQA 2QQJA 1RC6A 5AFEA 1PMHX 2ID4A 1W03A 3GJBA 4R9DA 1K42A 2CY6A 3SKVA 2RJ2A 2A1XA 4HPKA 4XJZA 3CQOA 3GBWA 3BTAA 1KGYA 1W9WA 2WZR3 1XNBA 1O59A 2DCZA 2Y34A 5F1RA 2KR2A 2WFPA 5FO7B 2WNVA 4K8RB 4JDNA 4LITA 1LGBA 1Y4WA 3PURA 5FXZA 3WG1A 5ABJA 3MHZA 1W2TA 2PHUA 5E88A 3T0AA 2YC4A 5EJ3A 1REDA 1IQAA 2PTMA 5C5UA 1T2XA 3KSCA 1VBE3 4BE3A 4ZU7A 1L3JA 2D6PA 4XAAA 4NJ4A 5F3IA 1MPXA 2V5DA 3AZZA 3GZEA 4XUPA 3LPGA 2G9FA 3VZOA 4HVQA 1UY0A 1DF0A 1RUH1 1UO9A 2GP5A 2QQOA 1QXRA 1JTZX 4IEZA 1RHI2 1W6NA 2BFUL 3C7OA 1RUJ1 4FPHA 3RS6A 4CP1A 4YPJA 4B7EA 2ADDA 1IKQA 1LTEA 3R4UA 1QDCA 1TME3 4C91A 1SFYA 1JI6A 1W2AX 3VGIA 1YIFA 1HB2A 2AZ5A 5KR7A 3A23A 4JV4A 4QKBA 4DB5A 5BNPC 2Z5WA 4R8HA 4RA0A 4EYUA 3DYPA 2IXJA 4P9WA 3MV11 5FY8A 3R4DB 4MVTA 1JHJA 2YU1A 2PYTA 3B94A 3JD72 1GQHA 3O0WA 4CCOA 5C4WB 4EN6B 3RZMA 1VAVA 2WUHA 4GB33 2QQIA 3WNPA 1NCQC 5F3EA 1ACCA 1OI6A 1O6UA 5IVJA 2XL9A 1LOGA 4D8MA 3PTYA 4QPGA 1XSQA 1MQTB 3VBRC 5JZGB 5DABA 5KHKA 1W3XA 2E6VA 4QXKA 1CONA 1PMJX 1G9FA 4HKOA 4HK8A 1NXMA 3RGBA 4EV0A 4G9SB 5FOJB 2RE9A 2VTXA 3U78A 3FWEA 3I3MA 2B7YA 4F3JA 2VNGA 3VZJA 5I91A 1JZ8A 2ZGLA 2FDIA 4QPIB 5E6HA 1PGW2 1A78A 1ULCA 5HBAA 1I1EA 5E16A 1MEC3 2B8MA 4ASKA 4Q26A 1REFA 2HWE2 1XXNA 5A32B 2P3KA 3K48A 1FV2A 4IV1A 1IS3A 4IV1C 4K6BA 4QQ2A 4XCAA 4RR3B 2DCYA 3H3UA 3SEPA 3FUOA 5LA2A 4LBMA 3WCSA 1JU4A 1LULA 1PVC2 5IK4A 4CXXA 3LQCA 1N3OA 3SITA 3S0MA 4URAA 4LBOA 1JODA 1S2KA 2XLAA 3N9NA 3NQHA 1TE1B 5EYYA 2VMIA 3UKTA 3DCQA 4AWDA 4WZCA 1AF9A 2D43A 2ZACA 4AFCA 3IDEA 4LHNA 3U4SA 4COYA 3B9IA 3KB5A 1W99A 3MI8A 3I2GA 4JTNA 2VZVA 2QZ3A 3S57A 4OI1A 1W6QB 4DUWA 5I8YA 4ES9A 5D21A 4AEJA 4BJ0A 2ZGKA 4UW3A 4PBOA 1OH3A 3WXPA 5FPXA 4RGGA 1ASJ2 3DV8A 4NWWA 5GALA 3V0BA 2WFF3 1H8TC 1H8TA 2H0VA 3ENRA 4XHXA 5HPOA 1UU6A 1YLLA 4HPKB 1VMFA 4ZONA 4B3NA 4AI3A 4YM2A 1LENA 1XYNA 4AYUA 3KWVA 4QPWA 4RGAA 1JYXA 4OHVA 4YW5A 4Q1PA 1F9KA 1UZ0A 2WNVB 3BOPA 5JCTA 1XBFA 1S0FA 1AL0G 2QQUA 4H55A 5DG1A 1X9TA 4D6QA 2JE8A 4NHMA 3WEZA 4AR2A 1QF3A 3WDUA 2PHFA 4QKDA 3TNQA 1OT5A 1QJY3 3VHOA 2WS93 1ZM1A 2GC0A 3B02A 3RMYA 2DVFA 4M4RA 4D7TA 2XG3A 4WM8A 2VVEA 4CDUA 4BQWA 1BHGA 1DQ4A 1RUE2 4QB1A 4CUBA 2IC1A 5HXVA 3N3HA 3WY6A 4AK3A 4OI2A 3UT0A 1V9U2 5B2GB 3B5LB 2WYSA 3S30A 3LCPA 3HT1A 4CA9A 2E63A 4GH4C 4MZUA 1LHWA 5A1LA 1REEA 5A7NA 1S0CA 1Q8QA 3TN91 4YZ5A 4CP2A 3AJZA 3T30A 3PJQA 2Z4FA 4CYDA 3Q9OA 1W8ZA 4Q4X1 2NN8A 2YY1A 1DQ2A 5F3CA 1D4M3 3GM8A 5HXMA 1WUVA 5J48A 1ZZBA 2RM22 4LK6A 4RS5A 1VRH2 4H2AA 2C9KA 5H9RA 1W8TA 2IFRA 2LW8A 3AP4A 3MIBA 4KGGA 4WVMB 1KFUL 3O1VA 1O3QA 2VVDA 1ZREA 2K0GA 2C0ZA 5DG2A 1Y43B 3TRSB 4NRQA 2ZKLA 1VBD3 2YXSA 3O14A 4LKFA 1CPMA 1LOFC 5FJKA 4M3CF 3ZKUA 2XL7A 1RL3A 5EWSA 2TUNA 2Y8KA 2ZGTA 4TN7A 2D40A 2YUEA 1I9RA 1EV12 1W2OA 4GA9A 5EHDA 4QPGB 3AYAA 5A7PA 4B1LA 3P5BA 1JUHA 3J8F3 2X5IB 2ZAHA 3Q8FA 3KT7A 4COUA 3HJRA 1O7FA 4PLNA 3POEA 4SBVA 5GLTA 5LZ6A 3DF0A 1IPSA 1F35A 5T52A 2O14A 1C8M1 5A3UA 1AR62 1A8DA 1QXJA 1RXFA 2VMFA 3FFQA 4AHWA 4XF9A 5DZGA 1US2A 3PTRB 1ALYA 1KJRA 2A3WA 3ECQA 1IS4A 5FLIA 1ONAA 1CAWA 3O12A 1C1LA 4GKXA 4KQ7A 3VBOC 3W21A 4L92A 3WDWA 1XE0A 2EIBA 3AMNA 3AP7A 3VL8A 1X8EA 3RJRA 3VHRA 4AQTA 5BUVA 3I3DA 5A33A 1DFQA 1EAH2 1GZWA 1WMEA 4LBQD 3SH3A 5DAPA 4A45A 4AF9A 5GKAC 1HX6A 1D7PM 2WN3A 1GLHA 5IVYA 3IMMA 2D97A 2FZ1A 1CGPA 3KCYA 2XQXA 3WUCA 1DDLA 1OVPA 5A3TA 1G9BA 1RB8G 4PJYA 3AZYA 5L7OB 3LA3A 2K9ZA 1JOJA 4RQPC 2CDOA 4N90A 3BTZA 1AYN2 1CQ9A 2OUJA 2HWB2 4N8MA 5FZHA 2HEVF 3ZSEA 4CCEA 1Q8OA 3VHNA 1FT9A 5LY1A 4MGIE 2XGXA 4C0HA 1MACA 3V0BB 2JICA 3E5QA 4XTMA 2RJKA 5GLWA 2P4EA 2J1UA 3B01A 3FBYA 4FPGA 4QKFA 1UU5A 2ZBJA 5A6ZA 1DGWX 4S2DA 5DDJ1 5FP7A 3RWKX 2Q1FA 4IE7A 5DZEA 1XSRA 1G6NA 1AL22 1X36A 2VW2A 1RUH3 5A7QA 4Q0QA 5J7MA 3LDRA 4XMIA 3H3ZA 5BPXA 3LIHA 1RUJ3 2WA3A 4AEDA 3L9JT 4YW4A 3RZLA 5F37A 4KH9A 1AR93 3VD9A 2LRPA 4WM8B 1JYCA 1ZBA1 5A1FA 3J4UH 3PVEA 4YZ3A 3WP4A 4KU8A 1GQPA 3WQ0A 2GN3A 1H0BA 4XCBA 1HN0A 4CCKA 2PELA 4BXSV 4EN9B 1OPMA 4XF0A 4BXFA 4DOUA 1GZCA 1JUIA 1GFF2 4P5YA 3M3EA 4MV2A 1QJX2 4W6WA 2AUYA 2J1EA 4KWJA 2LS6A 3LZZA 4XJ8A 3KV5A 4L9BA 1TZOA 1NY71 1TMF1 3MYXA 5FYHA 2RDRA 4KBBA 1ZZ9A 1W28A 3UKVA 3I3EA 3O5SA 4UW5A 1AXKA 2DFBA 2YG0A 3H8OA 5JSOA 1UYZA 4R4XA 1JHNA 3O0XA 2WQ4A 1SBDA 4UYBA 1XU1A 4XXAA 5HCFA 5IAVA 4A4AA 1UYXA 4XC9A 1H6XA 1TG7A 1E5HA 1RUNA 1ND3A 2R061 3H7JA 4LTAA 3GHNA 3U37A 4AAXA 2VZSA 3IT8A 1YFWA 2D6MA 2XKOA 2VVFA 4LO4B 4QU2A 1C4RA 1EPWA 1BMV2 2CNAA 4F83A 1H9PA 5DAQA 4YFWA 5G05L 1XNAA 3DYMA 4B8EA 5KC6A 2HWD3 2OPWA 4FPJA 3N7MA 2ZOEB 4CRQA 1WD4A 2WNUB 3CMGA 1SCSA 4M0HA 1WCDJ 4UW6A 1DZRA 3QACA 1JYIA 4BLJA 3N9MA 1POV1 1VBB1 4P9IA 4PIYA 3MUY1 2CGNA 4A42A 2WWJA 3BVCA 1CX4A 2W3JA 3ZN6B 5JLVA 1W8OA 3ZYRA 5FPZA 3UGGA 4CP9B 2E26A 1LHVA 3E6BA 2GNTA 1UZZA 4OYUA 2W9XA 3ZXKA 1S55A 5GLVA 4XVHA 1R081 5A3PA 2W92A 2G4IA 4N7UA 4UBHA 1DQ5A 4QPYA 3WLUA 3FX3A 5FAXA 2GU9A 1ENSA 3CIHA 2EAKA 2DBNA 1RMU2 4IE5A 4N53A 4JGYA 3T09A 5E1RA 5FJHA 4OLLA 1UOGA 1E57A 4B4RA 4CEWA 3RWNA 1GYKA 2D44A 1HV0A 1MS4A 1NAEA 1R1A1 1S0IA 4YRDA 4ZY9A 4DIQA 5FO8B 1RUF3 2B45X 4IEQA 5C70A 3HBKA 3AZVA 3NJYA 1J1LA 2XMLA 4JVAA 1CAXB 4H7MA 1LESA 1EUTA 1FOD2 2DTYA 2RDSA 3ZFFC 3ZFFA 4RFRB 1STMA 4JX0A 3K75B 4XAEA 5D8AC 1PVXA 1AX2A 2IZWA 2J22A 3AC0A 3ZFEA 3BIEA 4M01A 5CG9A 4KWKA 4JC1A 1N1YA 2I2SA 4XJUA 2XVLA 4PI2A 3UGFA 4PDWC 4IV3A 2GNBA 4AEDB 4CCNA 4Q8KA 2MEV2 5F39A 1RXGA 3WHUA 4Q4X3 2VR4A 2HWC2 4Z82A 5T5JA 5CISA 2F4PA 4KG0A 5H9QA 3WNLA 5JMCA 3UV9A 1XYPA 3ES1A 2QBXA 4Q4W1 1QHDA 1AR81 4A7YA 4QX8A 1O4YA 1Z7S1 2WIIB 4W6YA 5CADA 1AXZA 4AVBA 2CAUA 2PLV1 5FZ0A 4DEVA 2BGCA 3ZSKA 2HYKA 1QEXA 5GJ6A 1JZ2A 1HDKA 1G86A 1HLCA 4NE9A 1BBT2 4E9KA 3N9OA 4GAZA 1W6OB 2E51A 1LAJA 1GWKA 4YW6A 2A6ZA 2VOTA 4AHXA 4KWLA 3PUIA 5I0UA 2R041 2ET1A 4R52A 1WCKA 1MS9A 3U1XA 1MS0A 1PIV2 1ND3B 2W1SA 3WF1A 4OHYA 5FY4A 1S0DA 5KXBA 3J9SA 3USSA 4AFMA 4KU7A 4P9LA 3AX4A 4FQZA 1J3QA 3BODA 2EAAA 4OULA 4GKYA 5L73A 3JBG1 1BCXA 1PNFA 5CNAA 3O1UA 2H6CA 3VKFC 4IDZA 1CWPA 3AM2A 3D0SA 3IKWA 3RYPA 5FPAA 3WF2A 4WM7C 4XQDA 5AC91 1K12A 1AHSA 5GZCA 2IUWA 3LD8A 1SFNA 4Y20B 4ET7A 3F95A 1GOGA 4B4PA 5DZFA 5IUQA 1QJU1 4EQVA 2PHLA 2XPJA 1K5MA 5JWPA 5LK5A 3SMHA 1GNZA 1WW7A 3FC0A 1QY4A 4DXZA 2I45A 4CUCA 2ZGQA 4MUVA 2FD8A 1JW6A 4MGZE 1RUI3 2VCAA 5FZ6A 4AFAA 4Z1VA 2YC2A 4CDXA 4CDXC 1PGL2 2O8OA 1FNYA 2NM1A 3CDZB 2ZEZA 3I2KA 5DN2A 1J1TA 3THPA 4YZ2A 2EXIA 1AUYA 3MIHA 1PX4A 1VBA2 5DUUA 3RZKA 4QM9A 1ZRRA 4RSUA 1PK6C 3OGVA 1MVEA 4JRLA 4QKNA 4N53B 1Y9MA 3ZXEA 1JS9A 3DYOA 5DDJ3 4P02B 3VZLA 4AFBA 5IVFA 1SLIA 4QM8A 3AKPA 3WG4A 3A22A 4KL1A 1OC1A 1U5IA 4MADA 3K4ZA 1LKNA 4N7IA 1NUKA 1RITA 5GZDA 3POFA 2WO1A 3FLTA 3KVAA 4YZ1A 1YQ2A 2DV9A 1X50A 4AQ6A 1RHI1 1OOPA 4HK9A 4LPLA 5FMOS 1DG6A 1ZBA3 5F2SA 4P9GA 4AL9A 1EUUA 4UFJA 4XPVA 5BNNC 4QMAA 3HVDA 4NUBA 4XILA 3W5MA 1W8NA 3GZTB 1HRV2 2DUPA 2JG8B 2ZHMA 2YZ4A 2LTNA 3UL2A 1AZDA 2GNMA 4QXCA 3S7EA 4S2FA 3SCFA 5F7UA 4P9XA 2K2SA 1HN1A 3OUHA 3M8LA 1LCLA 5ACA2 2ZHLA 4LORA 3T4VA 2W47A 4Q4Y2 4C90A 3WP6A 3JD71 4HN0A 2HJIA 2J1RA 5EJZB 4FOQA 3GBGA 3VDDC 4ZZ8A 4NVPA 2HLEA 2VU9A 1E5SA 2VW0A 4L0PA 1FMD3 2ENRA 1BEV2 1OQDA 1GZ9A 4YVSA 1AR72 4L11A 2RS32 1QMJA 1GOFA 1N3PA 1QDOA 5FO9B 1B35A 1I3HA 2R063 5AFBA 3I54A 3DL3A 1J83A 5F5IA 3O7OA 3VLBB 2Q1MA 3WT3A 3S5QA 3PU3A 4BHPA 5LCWL 5DUXA 3PUQA 5EPAA 1C3HA 2WT2A 4TLGA 2A6XA 2W52A 1PGW1 2VMHA 2PHWA 3VV1A 5JIUA 2PHRA 4XZPA 4HL0A 4NAMA 2FDJA 3BTYA 2HWE1 1UNBA 2GH2A 3AFKA 3POIA 3WSOA 2Y26A 1UF2C 4IERA 3BALA 2VE1A 3NVCA 5JOWA 2XVGA 4QU1A 1NYWA 1POV3 1PVC1 1VBB3 1ZVFA 5JXHA 4XBLA 1IHMA 2YHJA 4XW3A 4INDA 4CXYA 3AMPA 3ILRA 2C6SA 3BI3A 2P6CA 2V09A 3DPRC 3IWZA 4ONUA 1POQA 1YJLA 2ARBA 3GZAA 1LOCA 2J1AA 3CJIB 3GALA 3MW4A 1VJ2A 2DVDA 2P3YA 2QQLA 3KHBA 3ZFGA 3ZYPA 3VBFA 4FOVA 1K5MB 2JDZA 4RHV2 1R083 4EN7B 3D8CA 5KXCA 4XFBA 1VMHA 1NG0A 2QE3A 1ASJ1 1Q8SA 1UPSA 1X82A 5IT6A 2OQ7A 1ZZ6A 1J3PA 2UY8A 2X10A 3GF6A 1MR5A 2VC9A 4K8FA 3ZN5A 3BTXA 5C33A 2JG9A 4DO0A 1ODMA 3VBHA 3M3QA 1BVVA 2F17A 3T2OA 2Y38A 1UD1A 2Q0AA 2VZPA 3H7YA 5L9VA 5F6KA 4HANA 1ZBE1 2TNFA 1HV1A 1ULFA 1WGPA 2XH6A 2ZA9A 4ATFA 1U0AA 4PHZA 4AGRA 2VQAA 3N9QA 5F6LB 4AQSA 1CN1A 2WLPA 2UY9A 4CEYB 4I01A 3WUDA 3AYCA 1RUE1 1HQLA 1UCXA 2UU8A 5K0UC 2WINB 4E8DA 1V9U1 4NPMA 4SLIA 4P9YA 5CEHA 3Q8BA 3IIAA 2R6QA 4L99A 5F3GA 1OOPB 4RD7A 1BYHA 2RDQA 2WKKA 5FLHA 4CCDA 4NROA 3B69A 2QQMA 2P17A 3P1IA 2W1UA 1NX9A 1UOBA 3OD4A 4LLFA 5FXVA 3KM5A 2NZ9A 1OQ1A 1VE0A 3LEIA 3R4SA 3BIWE 3ROUA 5J1XA 2VL4A 3AMQA 3MF9A 1AR83 4IEWA 3IAPA 4DRRA 1JZ4A 1F2NA 5DQ0A 3S5AA 4Z92B 3H1WA 2RM21 1JBCA 2VULA 2YGMA 1VRH1 2UYBA 3I59B 4IEYA 3ZVXA 5J37A 2PLV3 5FREA 4B1MA 3A0KA 3C7FA 1GWLA 4HLTA 2R1BA 3NV4A 4P08A 1JN2P 3GXUA 3ZLIA 2WR9A 3HD8B 2DVAA 4IETA 4NRMA 1O3RA 1NA1A 2RMU2 3PMEA 4D7SA 2WWUA 3HQUA 3VKOA 4Y3OA 5EYXA 1R1ZA 4Q0SA 4YVSB 1W0PA 2VNRA 2BWCA 3NV1A 1G9CA 5J09A 4J6GA 5FYIA 1JU3A 2FBEA 2W39A 3ON7A 5T5LA 2FDFA 2XHKA 4EROA 3PL0A 4NHLA 3ZYGA 2I07B 1FATA 3JBG3 3MPPG 4LBJA 1AR61 4Q0PA 1SPPB 3MO4A 5FYCA 3FHQA 1H2MA 1VBC2 3CKHA 1VPHA 1JOPA 2A6YA 2AREA 4UWDA 2RS52 1DGRA 4XIOA 5ANNA 2R073 1QJU3 4FVVA 4K9SA 4LE4A 3VDBA 3JB4C 2A6WA 3LWCA 5GZFA 1EAH1 4XTPA 3QCWA 4P00B 2R1DA 3JB8A 1V6NA 2E53A 4HKLA 2WZR2 3HOBA 5ERLA 1S1AA 2UYAA 5EZWA 4C1XA 1W9SA 1DIWA 3ZFGB 1HW5A 5CFCA 5CFCC 3SCGA 3VBFB 4L97A 4XUQA 2JE9A 4LLOA 3HQXA 5DMYA 2HWB1 3VB9A 1JZ3A 3FUQA 3VBSB 3DXUA 5BNQA 1I5PA 1ZRFA 4YM0A 2OXBA 3LFIA 4FFGA 2BW8A 2HWF2 4NWVA 2ZGOA 1VBE2 1SLCA 3APBA 3CO2A 5HCBA 3WP5A 4XUNA 4GMP3 3J7LA 2JG9B 1GNYA 3THCA 4EE2A 4FOWA 3MLLA 4NN0A 1R64A 3KS7A 4YW2A 4XFHA 4I0WB 5LEJA 3M70A 5LRRA 1OF3A 1AL21 5A1AA 2EVXA 4JGZA 1S0EA 4JGZC 4TLFA 4XJWA 3OGJA 2LUWA 3NV2A 3VBUA 3VBUC 1SDDB 3LB9A 1RJ8A 2D6NA 3CZJA 3ZSMA 3POGA 3KF5A 3NNFA 5BNPA 1TME2 3NNJA 1GANA 3MV01 2BWAA 2DBIA 5A3WA 5BXXA 1UMZA 2D6LX 2VMDA 1COV3 4CDWB 4BIFA 2Q8OA 3U11A 2HEYF 3K77A 4BQ1A 2CWSA 1SLAA 4HZFA 3WINE 1NCQA 1IS6A 4IGQA 1VLNA 4U36A 3W20A 1SBEA 3JUUA 2VCMA 2XR4A 1D4VB 2GC1A 3AYEA 5L9RA 1HQWA 1LU2A 4ITCA 2XBO3 3VBRA 1SLBA 4O9GA 1PX3A 4EJRA 4GB32 3AP6A 1AYM2 2LALA 1WD3A 1AJKA 4HETA 1W3VA 1W2NA 1E5IA 1I5ZA 2OKXA 4OCTA 2V4VA 4UXAA 2BOJA 3WDTA 1GNHA 4IEPA 4AFDA 1KD7A 1MVQA 3DXTA 3C7GA 1QNYA 3IAQA 5IWFA 2ZABA 1AJOA 2EALA 4D69A 1RUC1 2AR6A 1PO13 4AVVA 2P3IA 3I4IA 4HVRA 3VD5A 1ENRA 1MEC2 1VALA 4YVWB 2R30A 1UOJA 5LW9A 1QOTA 2RR12 1BMV1 2X5IC 3VDAA 5CFDB 1NQJA 4MSVA 2OVUA 3O1PA 4MGTA 4WBBA 2Y0OA 3K51A 4UFHA 4DQAA 1QH7A 4AI1A 3B7MA 4LOSA 3TBDA 3PUSA 4RL7A 4ZU5A 5DPNA 2WO2A 3ZPYA 1PVC3 4XOGA 5CZKA 3OGGA 3POYA 1GSLA 2FQPA 2FCVA 4UFKA 3NO8A 4ZZ5A 2KA3A 2X8KA 2RV9A 2Q8CA 3HNYM 3BOWA 5IYYA 2JDYA 4FPLA 4NPRA 2VUAA 4AGVA 5C3RA 2UWBA 4PI0A 4P9JA 5DAWA 1Q8VA 5H9PA 2CV6A 2WFF2 4AE2A 4DY5A 2J1TA 3I2HA 4XABA 5ABJB 5FPBA 5L7OC 2GN7A 4FQ4A 2DWRA 2ZGPA 4Q27A 1LOAA 5CKMA 3ASIA 4XF4A 1OUXA 1RMU1 4MO3M 2E7AA 4LA3A 1V00A 4YG3A 3M3CA 1OFNA 2F4LA 1ULPA 2VOWA 1G9DA 4CU6A 3DECA 1ZBE3 4JKLA 4URTA 1QJY2 4YGBA 2Y6HA 4FSJA 4AVAA 2WS92 3KQRA 1W6NB 1RTVA 1DBNA 5F9TA 4XJAA 4GH4A 5I93A 1T6BX 4AGGA 2CWMA 3WNMA 3PIJA 5FZ8A 4I30A 5FZCA 1IS5A 3QD6A 5A6XA 3IPVA 1OA2A 5HV0A 5D2AA 5FWEA 4P5HA 5FPLA 3KCCA 3RYKA 4CP0A 4LO5B 2KXLA 1V9U3 5I0DA 1GQGA 3K3NA 4IE4A 4YZ4A 3Q8EA 1SG3A 5LATA 4BK5A 4FTBA 1LHUA 1UU4A 1UZYA 3MW3A 1OLMA 3H0OA 2MEV1 5BNPB 4LHKA 3I2DA 1WWYA 1UMIA 3L2HA 1OLQA 1US3A 1FI2A 2HWC1 1O8PA 3I2IA 3WQ7A 1ULGA 2YDEA 2XUMA 3LF7A 1QU0A 3EXUA 4DS0A 1YHFA 3HQRA 5F32A 2NQYA 5FZKA 4FOYA 4AOCA 1LHNA 1LOFA 3ORJA 4M0NA 1DYOA 1GV9A 1NCQB 1QQP2 5C8CC 3I97A 5LY2A 5FPVA 3VBRB 4OFGA 1ULEA 1VBD2 2QVSB 4DXSA 2KM2A 2C5DA 3ES4A 3KT1A 4QXBA 2D3PA 2VUCA 5FPUA 3AVRA 1QH6A 1CPNA 5BYNA 1V6OA 4K40A 5C6CA 5JXGA 3UNPA 1BZWA 4CDQC 1NCRC 4GIQA 3J8F2 4L2NA 1E5RA 3WW3A 5JSRA 1QOSA 3V0AA 2YB7A 1CZTA 4X6QB 3VBOA 4CUAA 2IXIA 1PIV1 4IV1B 1K45A 4LK7A 5T5OA 4HSLA 2XQRA 1GR3A 1VB4A 2BBVA 1J58A 4U2AA 5FY9A 1AR63 4IEUA 3CHXA 3X29B 3OG2A 1UMHA 3KHCA 1U12A 4XFCA 3VD3A 5HCHA 3DN7A 2WNUC 4OVEA 5SV5A 4CCLA 4LNVA 1HRI2 3HT2A 4O7XA 1NZIA 2DYCA 2JD9A 2BGPA 4RQPA 2A70A 5T55A 1XJAA 2AGSA 1IOAA 1ZRDA 5J98B 1EAH3 3OEBA 2QZ2A 2QNKA 3C3VA 4BMBA 1H1AA 2Z42A 3V65A 4Q0UA 5IJRA 2WSVA 3I2JA 1H8TB 1IPKA 1FXZA 5EXOA 3T2TA 4JKMA 4AI2A 1X7NA 2BDRA 2LROA 2BFUS 2XJRA 2HWB3 2PQSA 1PGL1 4FPKA 2AEYA 4A44A 4EN0A 5A3LA 3ZR6A 4BA6A 1O91A 3P3NA 5J96B 3MIDA 4QHZA 3OYWA 2B9VA 4TSVA 3VZMA 1X9PA 3N9PA 1BLZA 4GXLA 4LO7A 2VUDA 3N7JA 1PO22 3FHAA 3PLQA 2CHHA 1L7RA 1W05A 4LBNA 4MG2A 3T0DA 1S0BA 4CDUB 4YG0A 1RUH2 1OLRA 4XUOA 4OI0A 2G19A 3WF4A 4XFGA 2J1SA 5FY0A 1AR92 4UAPA 4A6OA 4GH4B 4ZPIA 4DFSA 2Q30A 4BOWA 3H42B 1DYPA 2G1MA 2P6HA 2K46A 2Q1ZB 3LSEA 1XNKA 3VD7A 3POBA 3IPVB 4NIAA 1XQNA 3VZNA 1RUD1 2VNOA 1DQ0A 1CR7A 1YFUA 5FBJA 4B7KA 1MS3A 3E5XA 3LA2A 4RS5B 1MS1A 4H7LA 3FZ3A 1HJFA 1AX1A 1WLWA 4WV8A 5LK7B 5DUVA 4B29A 2BVBA 3OSDA 2ZEYA 2PAEA 3LDKA 1W0OA 2UURA 4XACA 1CAUA 1ULDA 4PQ9A 1KS4A 3VKLA 4Q4Y1 2XWJB 4Q4V2 2EA7A 2W46A 1O5LA 4FAGA 1JZ6A 3OPZA 1BEV1 4N43C 1ND2A 1ND2C 1AR71 5C9AC 2P37A 1YFYA 5I8SA 2RS31 2ZGSA 1POV0 2ZGMA 3T2PA 2A3YA 3IIIA 1RUC3 2ES3A 3PNAA 1P8JA 2OA2A 3WP3A 5ISLA 4IUGA 2JDNA 1YQCA 3EBRA 1PZ7A 3OEAA 2HWD2 2NP0A 1UQXA 4HKWA 5E89A 5FIXA 4FI9A 1GMMA 3V0AB 3M3OA 3VBOB 1CAWB 2W68A 2X29A 2EIGA 4WZFA 1UYYA 1KRIA 1BXHA 2CL2A 4E4SA 4LKSA 4PF1A 5A33B 4AEMA 3UJOA 1GZWB 1W9FA 3IDBB 3T0BA 1RUOA 1GP5A 4A3XA 3ZSLA 2YV8A 3M2MA 5CA6A 3ZDVA 2VW1A 3HNBM 3BU7A 5KHJA 1C1FA 2VZOA 2Y0IA 1C5IA 3NAPC 4RQPB 4HSJA 2JX9A 5FK7A 2PA7A 3AJYA 3DKQA 3AL6A 4IE0A 4QDSA 3AKRA 3HEIA 3MF6A 5D1IA 2VZUA 3RZZA 4RHV1 2ATFA 2XHNA 1W6PA 3RPQA 2W08A 2XONA 4LBKA 1VR3A 3QOPA 3Q8AA 4IESA 4W65A 4Y4RA 3DGTA 2PMWB 3E97A 2Z69A 3GDBA 1MZFA 2HYXA 2PHXA 2DURA 1DGRN 1RUF2 1MZ5A 1V0AA 5D8AA 5FKBA 3QBQA 5GM0A 4AI8A 4CPBD 2ZPXA 1SEFA 4UI9L 1T6GC 4W4ZA 4PDWA 4QQHA 4JQRA 3V64A 1NQDA 1RVF1 4YYOA 4FFFA 4I3GA 2MPFA 3TN93 3NNMA 3SEEA 5IAXA 3OBTA 3UK9A 3OY8A 3W5NA 4D6RA 4RFT0 2GDFA 2VCBA 1HIXA 5FYUA 1Q8PA 3OBAA 5CAZA 3A4UA 3KF3A 1GP6A 1QGLA 4W6XA 4AG4A 5IVVA 1GOHA 2WO3A 2ILMA 5I0SA 3D4KA 4ATEA 5C8WA 2HWC3 2Y6KA 1J3RA 1X8MA 1GZTA 2JG8C 4TYSA 1ZRCA 2JJ6A 4XHBA 4XQWA 4TTGA 4E8CA 2YC0A 2VOVA 2WQZC 5A80A 1PM7A 2WT0A 1HQNA 1LU1A 1UAIA 3TEYA 4D3WA 2W5FA 3VZKA 1GBGA 2JDKA 3CU7A 2JECA 3AK0A 1URXA 4QX7A 3N7KA 2OS2A 2RMU1 4GZ9A 1C8M3 5A7WA 4YM3A 1LOEA 5JMOA 2WLQA 3T3YA 3N35A 3NNGA 3R05A 4ZS3A 3ZM8A 1PIV3 4WM7A 3PMSA 1MZ6A 3WHTA 5FP4A 4AVCA 1KITA 3ACLA 2QQPA 2ZGNA 3AVSA 3PUAA 3N9LA 4NR1A 4Q0VA 1GP4A 5FP3A 2XDVA 3VKMA 3H8XA 2XKPA 1FPN2 1F4HA 2OX0A 3B9CA 3R6SA 2ARCA 5L9BA 4PQQA 5IVCA 1DZQA 3I7DA 3KLSA 4BYYA 1BK0A 4YW1A 2XLFA 4PLOA 3ZYJB 1OVSA 2E32A 3NMBA 1IZ3A 4DPNA 5FR3A 1DZTA 2OQ6A 2JENA 2QKDA 2RS51 2YBSA 2ZX0A 4TXWA 5TSWA 1S2BA 4LBQA 4BDVB 4DMIA 5IFPA 5JPMB 1F4AA 1ZRIA 2WA4A 3HNMA 5FFOC 1UYPA 1YRZA 4GMP0 4D7YA 1D2SA 4OZXA 4NRPA 4COVA 4M3CE 1F15A 3CJIC 1PK6A 1RUI2 2JXAA 3I3BA 4DRVA 4MGKE 2WZR1 1W9YA 2VAUA 3BB6A 3JCIA 4JGYB 4CEWB 1CZSA 1DGWA 1R092 1W2UA 4QX5A 2JIGA 4I3PA 4ZXKA 3T1LA 2C1FA 3JQXA 3NW4A 5FYTA 4S2HA 4P14A 2V73A 5IW0A 2VTXJ 3K2OA 1A8MA 1WMXA 3KT4A 3K4DA 2JD4A 2HWF1 5DDJ2 3J7NA 1VBE1 2YFUA 3OCPA 4MGYE 5F5QA 4XDQA 3FFZA 1OA3A 1F8VA 2ZGUA 2CYFA 5FZ7A 3ZFFB 4Z2WA 2WT1A 3I3QA 4NIGA 5BNNA 4Z2AA 3H3LA 5D8AB 1V6IA 3ZFEB 3ZXFA 2PAMA 5CG8A 4QGMA 2QUOA 1QXPA 4PDWB 4IV3B 2QQKA 1YNAA 3IN9A 4CEYC 4AI9A 5EIYB 3AXEA 2IWGB 3K46A 2PXJA 3AMMA 4MHRA 3S6PA 1YI7A 3NKGA 5HI0A 2JB4A 3OY8B 4GWIA 3MGUA 4QWNA 1RUD3 5F5AA 5L36A 1SHWB 1TMF3 4CCCA 1WW4A 2NMNA 5LBEA 1JOBA 1SLTA 1W90A 2VZ3A 3EQEA 1RIRA 3O1TA 4N9IA 1YO8A 2VMCA 4E27A 3T4HB 5FUPA 3VDDA 3H8UA 4E4ZA 2OT7A 3H9AA 2VD7A 4K21A 5FMDA 3U14A 2PHDA 4CZSA 1FNZA 4UBGA 4I0AA 1OLME 1UOFA 4A7KA 2RDNA 4RGKA 4QDQA 1YWKA 1FMD2 1AYM1 3LIGA 3RMXA 2DU1A 3NSTA 4RN5A 2ZHKA 4XEZA 1NOVA 1W6MA 1B09A 4GQ7A 4ZXEA 3O1SA 2FDGA 1KJLA 5JOZA 1AR73 1CD3G 2RS33 1EY2A 3PVOA 1PGSA 5A3NA 2MHFA 1C8NA 5BNOC 1VAMA 4QHOA 5J3UA 4JHTA 4OHZA 3PUHA 1UXZA 5FUNA 3WNOA 2DFCA 1HJGA 3TWIA 1SDWA 5A7WB 4LXLA 5FXWA 5JSPA 2Y6FA 2O8QA 3RZGA 2WC2A 2VQUA 2RR11 4AXOA 1LJ7A 1Y3TA 4LEJA 3DPRA 2DUOA 2WNEA 4ISRA 4J1WA 4EZHA 5K4LA 4HN1A 4R9AA 4XUTA 1LGCA 3THTA 3ZO0B 3FBMA 2EXHA 2Q8EA 4MYEA 3NRUA 2WNOA 4DNYA 4NOTA 1C57A 5T54A 1H9WA 4UF0A 5FKCA 1H2KA 3ZXLA 4ARXA 2RS12 3AZWA 1HXS2 2ZMKA 3RVHA 2BYVE 3OOXA 1DP0A 2FZ2A 1R082 4MGSA 4CDXB 4FPYA 1S0JA 3CEWA 1R1A3 3WNKA 2VGDA 2D5HA 4PBPA 1PK6B 3S7IA 1YC61 1LOBA 3K4AA 4QGLA 4AHZA 3U75A 5DXDA 2WYFA 2CGOA 3VBSC 1FYUA 1J84A 2B4KA 3POSA 2Q4SA 4OMCA 1XE8A 5K0UA 5B4XA 1N1VA 2GMEA 1RVF3 2WS91 4X8NA 4YLZA 5FRAA 3WF0A 1WBFA 1SLLA 5JIAA 2E9QA 1YCIA 2HBTA 2DF7A 2NLRA 4EN8B 1BJQA 5BNNB 2C24A 2N7GA 3PHMA 2VTFA 1U5ZA 3SH5A 3TAYA 4D6SA 4Q4W3 2E33A 5JXJA 2YGLA 4C8DA 1YI9A 2NMOA 2ORZA 5FZAA 1DQ6A 5IHRA 1Z7S3 2EF6A 2SBAA 2Q5TA 3MUZ1 2FMDA 3TNPB 4CUGA 5DAVA 1XNDA 5FYSA 5LBCA 3OF1A 2CAVA 3CLPA 5CKQA 2WZPP 1IKPA 1JXNA 2JE7A 1AR82 1XB9A 2YROA 2GH8A 3WW1A 4CDWC 2DCTA 5C4WA 2ZX1A 4AZZA 5C4WC 5LEKA 3PVNA 2QQWA 5FZOA 2QQVA 1RUG2 3I8TA 3GGLA 3BUCA 5KWRA 2PLV2 4W50A 1CZVA 1MQTC 1SCRA 2ARAA 2R043 3D0JA 5JZGC 2YPJA 1QQP1 1M06G 1EV11 3AZXA 2D3SA 4O9EA 5FY5A 2A6VA 2D6OX 1B35B 2C4XA 5BV6A 1BQPA 3USUA 2ZX4A 4LIVA 2XJVA 3NJZA 4XFIA 4BMEA 1H6YA 2WJSA 1D0GA 4QPIC 4QPIA 2ZKNA 2JKXA 3VHPA 3M3IA 2A75A 3PU8A 5EFUA 4IEXA 4YW7A 1MS5A 3HN3A 5A6QA 2VM9A 5AC93 4OQ8A 3PIGA 3IDCB 4RR3C 3ZN4A 3ME2A 4YVWC 5C7GA 2JDHA 3EYPA 4K1YA 5CFDC 5JPNB 2BZDA 3BKZA 2DUQA 3DKWA 5FCCA 3TOJA 2QQNA 1OA4A 5JXIA 1QOOA 2GALA 2G9GA 1OURA 2R072 3ACFA 3F2ZA 3HIFA 4OMDA 5CB7A 4FPFA 3HR9A 1JH5A 5IATA 2RS53 1HRI1 2P1BA 1W6QA 2A7AA 4YFZA 4ASLA 1NT0A 3ATGA 2QJVA 4JHZA 1AYN1 5GZGA 4QD2A 4H14A 2BTVC 4Q29A 4UFLA 1WA6X 4UF0B 5T50A 3UESA 3ZR5A 3UETA 3MZHA 2WSUA 3GCXA 3U0ZA 3TEZA 4HT1T 3RDIA 5FK8A 3ITQA 3MIFA 4YNIA 2WBKA 2WNVC 3BU0A 2XXZA 5GLUA 3TYJA 4ES8A 4M4PA 3VBHB 1KS5A 4DEQA 4NIHA 4QQPA 2YBPA 1NE6A 2QTWB 2W2IA 3LKJA 3NJXA 1UZVA 4QQOA 2GAUA 3RZHA 1F5FA 1FX5A 1SQ4A 3A7QA 2HWF3 1BK1A 1GUIA 3CBNA 3WCRA 4DUXA 2W1QA 1RHI3 3LEMA 5GLZA 1PO21 2W95A 1HB1A 4HBNA 4QX3A 3RNSA 2D5FA 2WN2A 2ZTNA 5T5PA 3GZUC 4PCRA 3WOGA 5JVVA 5A70A 3OGRA 4IGOA 4OQ9A 3MIGA 1NLRA 4BCUA 2A73B 5K0UB 5FZ4A 3H8RA 1LHOA 4JQTA 1W8FA 2E31A 1AR91 2WAAA 4QXHA 1Q56A 4OI4A 1QJX1 2SLIA 2VY0A 1ZZ8A 3PVBB 1COV2 3MLKA 2IXCA 4TWTA 1QKQA 5E8AA 4XZUG 3GHMA 3JD73 2EXKA 5KXDA 3MLJA 1U5YA 1ULOA 2J1VA 4NPLA 3MDPA 3POJA 4WVMA 4BQYA 4Q5OA 2XBO2 1SACA 4XIKA 4V2VA 3I2OA 2CDPA 4AAPA 2WZEA 4QX1A 2VOKA 4A6SA 5JI9A 3LEGA 4FTSA 2GP3A 5FZOB 1RGSA 1DLLA 1YFXA 1NA1B 4QAWA 4XQ4A 1XC6A 1AYM3 3WX5A 1ENXA 1WW6A 2R49A 4J1XA 1NE4A 4QPGC 1FAYA 3GNEA 1QJFA 4Q4V1 5EP9A 2X5IA 1UPIA 3SNMA 1MS8A 3N7LA 2HWE3 1PO12 3USUB 2CGPA 1O4ZA 3RSJA 4K1ZA 2FDKA 3K3OA 1W39A 1N3QA 2GC3A 2W0XA 3ETQA 5FYZA 1TQ5A 5FMBA 3T2QA 2A5ZA 1XYOA 1H1IA 4G4FA 2EXJA 4META 4M3CA 3SH4A 3I2FA 2HWD1 1UW8A 2RR13 4Y1ZA 1G7YA 2GNDA 3HN1A 5C71A 3Q8CA 3I49A 1VRBA 1YUDA 1Z0HA 4E2SA 1EPZA 2B42B 1N1TA 4JDMA 1ZX5A 3LE0A 2V4AA 1JMUB 3KGZA 4XDOA 3RFRA 5A6YA 5JOYA 1G8WA 3RYRA 3POWA 5JR2A 3AKSA 5CU1A 4OUMA 2VBDA 1X33A 2BERA 4JRAA 3EB7A 3B00A 1SBFA 3W9AA
chains in the Genus database with same CATH topology
4CUCA 2ZEYA 1W0NA 2VCAA 2YC2A 5DN2A 3CDZB 2ZEZA 3I2KA 2YFZA 1PX4A 3THDA 2JDAA 3ACIA 2W46A 2WAOA 3OGVA 3E1F1 1JZ6A 2L9LA 3ABZA 3C7EA 4CU8A 3DYOA 4P02B 1K3IA 3T2PA 5JUVA 3IIIA 1P8JA 2ORXA 3A22A 1UY1A 4IUGA 4MADA 3K4ZA 4GWJA 3OEAA 1NUKA 2WO1A 2Y64A 1XPWA 3CZUA 1YQ2A 4FI9A 4BK4A 1DLCA 1GMMA 4LPLA 1UXXX 3WF3A 1UY2A 1EUUA 1UYYA 4LKSA 4PF1A 4MGQA 2QQJA 3W5MA 1W8NA 3T0BA 1PMHX 2ID4A 4CU7A 1K42A 3SKVA 2RJ2A 4DXTA 5F7UA 4KMQA 3HNBM 3CQOA 2W91A 1HN1A 1KGYA 2VZOA 1W9WA 1O59A 4XURA 2WZ8A 2BGOA 2W47A 4QDSA 2J1RA 3HEIA 5EJZB 4ZZ8A 2VZUA 3T0AA 2HLEA 2XHNA 2YC4A 4L0PA 2XONA 1T2XA 2V72A 1GOFA 3GDBA 4MOAA 1J83A 2HYXA 1MPXA 2WABA 2V5DA 4XUPA 5LCWL 1JYWA 3LPGA 1UY0A 2QQOA 1UX7A 4UI9L 3C7OA 4W4ZA 4YPJA 3SEEA 3WSOA 2EIEA 4OZOA 3W5NA 4D0QA 1JI6A 5JXHA 2VCBA 3NJVA 3OBAA 2DCKA 3A23A 4AG4A 1GOHA 2WO3A 3DYPA 4KI5M 2J1AA 3MV11 2QQLA 2Y6KA 4A3ZA 1JHJA 2BBAA 2WUHA 3WNPA 2QQIA 4TTGA 4E8CA 4D8MA 5FUIA 2X10A 2W5FA 2VC9A 3FN9A 3LPFA 1PMJX 3T2OA 4GZ9A 4KWUA 1JZ8A 2VZPA 5JMOA 3NNGA 3ZM8A 1OH4A 2EICA 4RYDA 1RYYA 3SEPA 5B4NA 3P6BA 5LA2A 1JU4A 4HG6B 4QDRA 3LQCA 4E8DA 3NQHA 1F4HA 4PQQA 4DUVA 2QQMA 3P1IA 2E32A 2W1UA 1NX9A 1W99A 1UWWA 5J1XA 3I2GA 2VZVA 3LEIA 5IFPA 4TXWA 2VL4A 3T08A 2DDUA 2ZEXA 4BDVB 4DUWA 1F4AA 3IAPA 4BJ0A 3HNMA 1JZ4A 5DQ0A 2VJXA 3JXSA 5HPOA 3D3AA 4PT6A 4P08A 3C7FA 3I3BA 4QPWA 1JYXA 3GXUA 1CZSA 1UZ0A 4LHSA 4W8JA 1NKGA 2JE8A 2EIDA 2J7MA 3WEZA 2Y6JA 5IFTA 3K4DA 3SKJE 1OT5A 3WNNA 2YFUA 4M4RA 1BHGA 1JU3A 4QB1A 4Z2AA 3BGAA 1UY4A 2WYSA 3MO4A 3FHQA 1W9TA 2QQKA 3CKHA 5EIYB 3K46A 1IQDC 2Z4FA 1OF4A 4GWIA 3VDBA 1SHWB 3GM8A 5HXMA 2VZ3A 4P00B 2VMCA 1L7QA 2C9KA 2LW8A 2ZEWA 3HOBA 1W9SA 4XUQA 3J7HA 5DMYA 1JZ3A 4QDQA 2VZTA 2VMEA 1I5PA 2Y6GA 4RN5A 2Y8KA 4ZXEA 4XUNA 1GNYA 3HJRA 3THCA 1R64A 3LEKA 3PUHA 1UXZA 3WNOA 1OF3A 5A1AA 2VMFA 3IB3A 3WQBA 2VQUA 1US2A 1SDDB 3ECQA 4QB6A 3CZJA 4JKKA 1GU3A 4ARYA 2EIBA 3C7HA 3MV01 4XUTA 4QB2A 4OUEA 3I3DA 2VZRA 1CIYA 2VMDA 4A45A 4CUBA 2WN3A 1D7PM 3NRUA 1UY3A 3K77A 2VQTA 2C26A 2XQXA 4ARXA 2CDOA 1DP0A 2VO5A 1JYNA 4MGSA 1PX3A 2VZ1A 3WNKA 3FL7A 3OGSA 2OKXA 2V4VA 2J1UA 3K4AA 3C7GA 2W94A 3IAQA 5CYYA 4A41A 1J84A 2B4KA 2W1WA 3VD5A 4OMCA 3ACGA 3VDAA 5EJ1B 5B4XA 5G04L 3WF0A 3VD9A 1GQPA 1JYVA 1WKYA 5DPNA 2VTFA 2WO2A 5CZKA 5JXJA 2E33A 4BXSV 2ORZA 5IHRA 4P5YA 3MUZ1 4ZZ5A 1CX1A 2RV9A 3HNYM 2J1EA 5IYYA 2LS6A 3I3EA 2J1TA 3GGLA 3I2HA 2YG0A 1UYZA 4W50A 1CZVA 4A4AA 1UYXA 1H6XA 1LNSA 1O8SA 1TG7A 1JZ7A 3C8XA 2C4XA 4MO3M 3U37A 4AAXA 1OD3A 2VZSA 1ULPA 1H6YA 4CU6A 3DECA 2JKXA 4JKLA 2Y6HA 5G05L 1XNAA 3DYMA 2XOMA 3HN3A 2VM9A 3WNMA 1XNTA 3CMGA 5C7GA 3EYPA 5I0DA 2BZDA 3IDAA 3MUY1 1SG3A 2QQNA 4A42A 4BK5A 2W3JA 2VZQA 5JXIA 3F2ZA 3ACFA 1W8OA 3BN6A 4OMDA 4DXRA 2E26A 1WCQA 1JZ5A 1UMIA 4UOJA 3VDCA 4OYUA 1US3A 3I2IA 2W9XA 1O8PA 4QX2A 4JHZA 4XVHA 2W92A 3UESA 1DYOA 2ZXQA 3UETA 3CIHA 3I97A 3A21A 1TVGA 3T09A 2WBKA 4DXSA 4M4PA 4ZY9A 4DEQA 1NAEA 4CVUA 5JXGA 2R7EB 2KD7A 3NJXA 3UNPA 5C70A 3A7QA 1GUIA 5LA0A 1EUTA 2W1QA 4DUXA 2W95A 2YB7A 1CZTA 4CUAA 2X05A 4QX3A 3ACHA 2WN2A 1K45A 4JX0A 3K75B 3OGRA 2J22A 3AC0A 5LA1A 3OG2A 1UMHA 2DCJA 3VD3A 1KEXA 2E31A 2WAAA 2VR4A 3HPNA 2JD9A 2BGPA 3WNLA 4LQRA 2WQ8A 2QBXA 3VD4A 2X09A 4XZUG 3OEBA 5IJRA 1ULOA 2J1VA 3I2JA 4QX0A 2RVAA 2CDPA 4DEVA 4JKMA 2WZEA 4QX1A 3LEGA 3ETPA 1JZ2A 2VCCA 2PQSA 4QAWA 1XC6A 4A44A 4CU9A 2VOTA 2B9VA 3PUIA 3FHAA 2Y6LA 1L7RA 3OB8A 2W1SA 3WF1A 3T0DA 3MBWA 3T2QA 4XUOA 3WF4A 2J1SA 3I2FA 2W87A 4UAPA 4A6OA 5C71A 3WF2A 1K12A 3LE0A 3VD7A 4ET7A 1GOGA 5JR2A 2WDBA 2BERA 3EB7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CUC A;  2ZEY A;  1W0N A;  2VCA A;  2YC2 A;  5DN2 A;  3CDZ B;  2ZEZ A;  3I2K A;  2YFZ A;  1PX4 A;  3THD A;  2JDA A;  3ACI A;  2W46 A;  2WAO A;  3OGV A;  3E1F 1;  1JZ6 A;  2L9L A;  3ABZ A;  3C7E A;  4CU8 A;  3DYO A;  4P02 B;  1K3I A;  3T2P A;  5JUV A;  3III A;  1P8J A;  2ORX A;  3A22 A;  1UY1 A;  4IUG A;  4MAD A;  3K4Z A;  4GWJ A;  3OEA A;  1NUK A;  2WO1 A;  2Y64 A;  1XPW A;  3CZU A;  1YQ2 A;  4FI9 A;  4BK4 A;  1DLC A;  1GMM A;  4LPL A;  1UXX X;  3WF3 A;  1UY2 A;  1EUU A;  1UYY A;  4LKS A;  4PF1 A;  4MGQ A;  2QQJ A;  3W5M A;  1W8N A;  3T0B A;  1PMH X;  2ID4 A;  4CU7 A;  1K42 A;  3SKV A;  2RJ2 A;  4DXT A;  5F7U A;  4KMQ A;  3HNB M;  3CQO A;  2W91 A;  1HN1 A;  1KGY A;  2VZO A;  1W9W A;  1O59 A;  4XUR A;  2WZ8 A;  2BGO A;  2W47 A;  4QDS A;  2J1R A;  3HEI A;  5EJZ B;  4ZZ8 A;  2VZU A;  3T0A A;  2HLE A;  2XHN A;  2YC4 A;  4L0P A;  2XON A;  1T2X A;  2V72 A;  1GOF A;  3GDB A;  4MOA A;  1J83 A;  2HYX A;  1MPX A;  2WAB A;  2V5D A;  4XUP A;  5LCW L;  1JYW A;  3LPG A;  1UY0 A;  2QQO A;  1UX7 A;  4UI9 L;  3C7O A;  4W4Z A;  4YPJ A;  3SEE A;  3WSO A;  2EIE A;  4OZO A;  3W5N A;  4D0Q A;  1JI6 A;  5JXH A;  2VCB A;  3NJV A;  3OBA A;  2DCK A;  3A23 A;  4AG4 A;  1GOH A;  2WO3 A;  3DYP A;  4KI5 M;  2J1A A;  3MV1 1;  2QQL A;  2Y6K A;  4A3Z A;  1JHJ A;  2BBA A;  2WUH A;  3WNP A;  2QQI A;  4TTG A;  4E8C A;  4D8M A;  5FUI A;  2X10 A;  2W5F A;  2VC9 A;  3FN9 A;  3LPF A;  1PMJ X;  3T2O A;  4GZ9 A;  4KWU A;  1JZ8 A;  2VZP A;  5JMO A;  3NNG A;  3ZM8 A;  1OH4 A;  2EIC A;  4RYD A;  1RYY A;  3SEP A;  5B4N A;  3P6B A;  5LA2 A;  1JU4 A;  4HG6 B;  4QDR A;  3LQC A;  4E8D A;  3NQH A;  1F4H A;  4PQQ A;  4DUV A;  2QQM A;  3P1I A;  2E32 A;  2W1U A;  1NX9 A;  1W99 A;  1UWW A;  5J1X A;  3I2G A;  2VZV A;  3LEI A;  5IFP A;  4TXW A;  2VL4 A;  3T08 A;  2DDU A;  2ZEX A;  4BDV B;  4DUW A;  1F4A A;  3IAP A;  4BJ0 A;  3HNM A;  1JZ4 A;  5DQ0 A;  2VJX A;  3JXS A;  5HPO A;  3D3A A;  4PT6 A;  4P08 A;  3C7F A;  3I3B A;  4QPW A;  1JYX A;  3GXU A;  1CZS A;  1UZ0 A;  4LHS A;  4W8J A;  1NKG A;  2JE8 A;  2EID A;  2J7M A;  3WEZ A;  2Y6J A;  5IFT A;  3K4D A;  3SKJ E;  1OT5 A;  3WNN A;  2YFU A;  4M4R A;  1BHG A;  1JU3 A;  4QB1 A;  4Z2A A;  3BGA A;  1UY4 A;  2WYS A;  3MO4 A;  3FHQ A;  1W9T A;  2QQK A;  3CKH A;  5EIY B;  3K46 A;  1IQD C;  2Z4F A;  1OF4 A;  4GWI A;  3VDB A;  1SHW B;  3GM8 A;  5HXM A;  2VZ3 A;  4P00 B;  2VMC A;  1L7Q A;  2C9K A;  2LW8 A;  2ZEW A;  3HOB A;  1W9S A;  4XUQ A;  3J7H A;  5DMY A;  1JZ3 A;  4QDQ A;  2VZT A;  2VME A;  1I5P A;  2Y6G A;  4RN5 A;  2Y8K A;  4ZXE A;  4XUN A;  1GNY A;  3HJR A;  3THC A;  1R64 A;  3LEK A;  3PUH A;  1UXZ A;  3WNO A;  1OF3 A;  5A1A A;  2VMF A;  3IB3 A;  3WQB A;  2VQU A;  1US2 A;  1SDD B;  3ECQ A;  4QB6 A;  3CZJ A;  4JKK A;  1GU3 A;  4ARY A;  2EIB A;  3C7H A;  3MV0 1;  4XUT A;  4QB2 A;  4OUE A;  3I3D A;  2VZR A;  1CIY A;  2VMD A;  4A45 A;  4CUB A;  2WN3 A;  1D7P M;  3NRU A;  1UY3 A;  3K77 A;  2VQT A;  2C26 A;  2XQX A;  4ARX A;  2CDO A;  1DP0 A;  2VO5 A;  1JYN A;  4MGS A;  1PX3 A;  2VZ1 A;  3WNK A;  3FL7 A;  3OGS A;  2OKX A;  2V4V A;  2J1U A;  3K4A A;  3C7G A;  2W94 A;  3IAQ A;  5CYY A;  4A41 A;  1J84 A;  2B4K A;  2W1W A;  3VD5 A;  4OMC A;  3ACG A;  3VDA A;  5EJ1 B;  5B4X A;  5G04 L;  3WF0 A;  3VD9 A;  1GQP A;  1JYV A;  1WKY A;  5DPN A;  2VTF A;  2WO2 A;  5CZK A;  5JXJ A;  2E33 A;  4BXS V;  2ORZ A;  5IHR A;  4P5Y A;  3MUZ 1;  4ZZ5 A;  1CX1 A;  2RV9 A;  3HNY M;  2J1E A;  5IYY A;  2LS6 A;  3I3E A;  2J1T A;  3GGL A;  3I2H A;  2YG0 A;  1UYZ A;  4W50 A;  1CZV A;  4A4A A;  1UYX A;  1H6X A;  1LNS A;  1O8S A;  1TG7 A;  1JZ7 A;  3C8X A;  2C4X A;  4MO3 M;  3U37 A;  4AAX A;  1OD3 A;  2VZS A;  1ULP A;  1H6Y A;  4CU6 A;  3DEC A;  2JKX A;  4JKL A;  2Y6H A;  5G05 L;  1XNA A;  3DYM A;  2XOM A;  3HN3 A;  2VM9 A;  3WNM A;  1XNT A;  3CMG A;  5C7G A;  3EYP A;  5I0D A;  2BZD A;  3IDA A;  3MUY 1;  1SG3 A;  2QQN A;  4A42 A;  4BK5 A;  2W3J A;  2VZQ A;  5JXI A;  3F2Z A;  3ACF A;  1W8O A;  3BN6 A;  4OMD A;  4DXR A;  2E26 A;  1WCQ A;  1JZ5 A;  1UMI A;  4UOJ A;  3VDC A;  4OYU A;  1US3 A;  3I2I A;  2W9X A;  1O8P A;  4QX2 A;  4JHZ A;  4XVH A;  2W92 A;  3UES A;  1DYO A;  2ZXQ A;  3UET A;  3CIH A;  3I97 A;  3A21 A;  1TVG A;  3T09 A;  2WBK A;  4DXS A;  4M4P A;  4ZY9 A;  4DEQ A;  1NAE A;  4CVU A;  5JXG A;  2R7E B;  2KD7 A;  3NJX A;  3UNP A;  5C70 A;  3A7Q A;  1GUI A;  5LA0 A;  1EUT A;  2W1Q A;  4DUX A;  2W95 A;  2YB7 A;  1CZT A;  4CUA A;  2X05 A;  4QX3 A;  3ACH A;  2WN2 A;  1K45 A;  4JX0 A;  3K75 B;  3OGR A;  2J22 A;  3AC0 A;  5LA1 A;  3OG2 A;  1UMH A;  2DCJ A;  3VD3 A;  1KEX A;  2E31 A;  2WAA A;  2VR4 A;  3HPN A;  2JD9 A;  2BGP A;  3WNL A;  4LQR A;  2WQ8 A;  2QBX A;  3VD4 A;  2X09 A;  4XZU G;  3OEB A;  5IJR A;  1ULO A;  2J1V A;  3I2J A;  4QX0 A;  2RVA A;  2CDP A;  4DEV A;  4JKM A;  2WZE A;  4QX1 A;  3LEG A;  3ETP A;  1JZ2 A;  2VCC A;  2PQS A;  4QAW A;  1XC6 A;  4A44 A;  4CU9 A;  2VOT A;  2B9V A;  3PUI A;  3FHA A;  2Y6L A;  1L7R A;  3OB8 A;  2W1S A;  3WF1 A;  3T0D A;  3MBW A;  3T2Q A;  4XUO A;  3WF4 A;  2J1S A;  3I2F A;  2W87 A;  4UAP A;  4A6O A;  5C71 A;  3WF2 A;  1K12 A;  3LE0 A;  3VD7 A;  4ET7 A;  1GOG A;  5JR2 A;  2WDB A;  2BER A;  3EB7 A; 
#chains in the Genus database with same CATH topology
 2ZJC A;  1ASJ 3;  1YYN A;  5L7O A;  3ZPO A;  4Y1Y A;  3VUO A;  5FZB A;  4YGD A;  1W0N A;  4MHU A;  5CFC B;  2O0O A;  4C1W A;  3MFA A;  4LO8 A;  3TEW A;  3IMN A;  5M0T A;  3B3Q E;  3H1M A;  4FXG B;  4AEK A;  2YFZ A;  2HEW F;  4HFS A;  3THD A;  4ZKT B;  2JDP A;  3ZYF A;  3LOB A;  1SMV A;  4XE9 A;  2WAO A;  3IBM A;  4I02 A;  3E1F 1;  3AL5 A;  3N36 A;  4IGP A;  4S2G A;  4XDP A;  5LA9 A;  3ABZ A;  2F6B A;  4XF3 A;  4V2W A;  4CU8 A;  1K3I A;  2UWC A;  3BYW A;  5FZ1 A;  2ZMN A;  1FOD 1;  3GBF A;  4E2G A;  5JUV A;  5IK8 A;  2ORX A;  4YM1 A;  1OHF A;  1ZBE 2;  1A34 A;  4LKD A;  1RUE 3;  1RUF 1;  4GWJ A;  5BY5 A;  1IGO A;  5CVR A;  3D5O A;  1G9A A;  3ZXJ A;  2D6K A;  4JGZ B;  3PDQ A;  5JDB A;  4AW7 A;  1DLC A;  4Y1X A;  4YGE A;  2XVK A;  4WM8 C;  3VBU B;  4CDU C;  5JAX A;  3EHK A;  3INA A;  3JZV A;  1UY2 A;  5FZG A;  3FE5 A;  3A0N A;  4MLO A;  2FHR A;  1D4M 2;  5CBL A;  3M7A A;  4CU7 A;  2ZZQ A;  1NLQ A;  3H50 A;  3UGH A;  2RM2 3;  1GWM A;  3NV3 A;  4DXT A;  1VRH 3;  1N1S A;  2H6B A;  4O61 A;  4KMQ A;  4X6R B;  2W91 A;  1KDK A;  1WMD A;  5C8C A;  5T3N A;  5I8T A;  3VL9 A;  4XUR A;  2WZ8 A;  3GJA A;  1A3K A;  2BGO A;  1XE7 A;  1S0G A;  2D7F A;  4LKE A;  2FCU A;  3LSD A;  4RS5 C;  1YQ5 A;  5APA A;  5FZI A;  1V6K A;  2PQQ A;  2CTV A;  2GZW A;  1BBT 1;  2Z2S B;  5LBF A;  4B4Q A;  4CDQ A;  4AVT A;  1NCR A;  2JKB A;  4MXW A;  2P3J A;  1L7L A;  3MW2 A;  1QQP 3;  1EV1 3;  2V72 A;  3RZJ A;  2ARX A;  2YU2 A;  4MOA A;  2GSY A;  4D94 A;  1DU3 D;  2OPK A;  2WAB A;  1Q43 A;  1JYW A;  3SXW A;  5HCA A;  1UX7 A;  1WCU A;  3RQ0 A;  3HMY A;  3ZMN A;  5A3M A;  4HVO A;  1OBN A;  2WNU A;  3QH7 A;  1WA4 A;  1ZZ7 A;  2VPV A;  2XJQ A;  2R16 A;  4MXV A;  4JCK A;  3URF A;  5ABJ C;  4ZHN A;  1K5J A;  2EIE A;  4OZO A;  4D0Q A;  1WZX A;  1LEC A;  1VAK A;  4M3C B;  5AVA A;  1XRU A;  1VIW B;  3NJV A;  5C3Q A;  1D2Q A;  2DCK A;  2BNO A;  1MZE A;  4K20 A;  4DZG A;  1FPN 1;  2VG9 A;  1YJK A;  4BPZ A;  3ZN6 A;  3RI9 A;  2Z79 A;  4KI5 M;  4CP9 A;  3ZXA C;  1HRI 3;  4LUM A;  4HON A;  5L19 A;  1WMF A;  4NHK A;  4A3Z A;  4YAR A;  1IPJ A;  2BBA A;  3JQW A;  4Y4Y A;  1AYN 3;  2WL1 A;  4Y26 A;  3LA7 A;  4OHX A;  4AVS A;  4C0B A;  5F8P A;  3FLP A;  5KHH A;  2YBK A;  4J25 A;  4Q8L A;  5ANQ A;  5J36 A;  1VBA 1;  2ZHN A;  5FUI A;  3ZKY A;  1RUI 1;  2DVB A;  3FN9 A;  3LPF A;  4LA2 A;  4WVZ A;  3SCH A;  3OBR A;  1PM4 A;  1R09 1;  5F2W A;  4Y1U A;  3DUI A;  3AP5 A;  4I2O A;  4KWU A;  4EWA A;  1AL2 3;  1RUJ 2;  2Y60 A;  3B93 A;  4FTE A;  1CAX A;  2I74 A;  4IQP A;  3SQO A;  1H1M A;  1PO2 3;  2E7Q A;  2GC2 A;  2OYZ A;  1SZB A;  1OH4 A;  2RHP A;  1KQR A;  2EIC A;  3HBZ A;  4RYD A;  2QFE A;  3HWJ A;  1RYY A;  1W8H A;  2WRA A;  4EZ4 A;  5B4N A;  3P6B A;  5KHG A;  4HG6 B;  4QDR A;  2FCT A;  4H3W A;  1UN1 A;  4YSF A;  3MIC A;  3AKT A;  4AED C;  2ZGR A;  1O3S A;  1UKG A;  2NYY A;  2XUE A;  3GYD A;  4DUV A;  1HRV 1;  3MPB A;  4LOT A;  3WVJ A;  2UWA A;  1QJX 3;  1RIN A;  4LIU A;  4Q2F A;  4BQ4 A;  3O1M A;  1UWW A;  1XNC A;  3T08 A;  2DDU A;  2ETE A;  2ZEX A;  4GD4 A;  5FMO L;  5FYM A;  4FCA A;  5ACA 1;  1LGN A;  1JYT A;  5JR7 B;  2VJX A;  3JXS A;  4E4D X;  1IG3 A;  3CJX A;  5HV4 A;  1W8U A;  3D3A A;  4PT6 A;  3NNL A;  3LDB A;  5C8C B;  4XBN A;  4ZS2 A;  4N43 A;  2XJP A;  5C9A A;  4BB3 A;  1OPO A;  4Y33 A;  5LBB A;  4CCJ A;  4FBF A;  2R32 A;  4LHS A;  1W6O A;  3ZDS A;  1LED A;  3KV9 A;  1NKG A;  4LHL A;  4W8J A;  2EID A;  2J7M A;  2PN5 A;  3M1H A;  5AVP A;  5FYB A;  5LWB A;  1FMD 1;  2Y6J A;  2AAC A;  2VNV A;  2BJS A;  4Q4V 3;  1NCR B;  4MXW B;  4A7Z A;  3SKJ E;  4CDQ B;  2AH2 A;  3WD5 A;  1H2N A;  5C5T A;  5IFT A;  3WNN A;  1J59 A;  1BKZ A;  2VOX A;  1ND3 C;  3TB0 A;  4E4H A;  4UFI A;  1RUC 2;  3AFG A;  3WW4 A;  3ZYH A;  4GJZ A;  2YPD A;  3VN4 A;  1Z78 A;  4IL7 A;  5A7O A;  4UW4 A;  2PFW A;  1UIK A;  3OBZ A;  1RJ7 A;  2IXH A;  3ST7 A;  3BGA A;  4XXP A;  1UY4 A;  1U5X A;  3ZX7 A;  3D82 A;  2QDR A;  4BWO A;  1W9T A;  4BIS A;  4CCM A;  2MNG A;  4GWM A;  5FZM A;  1XOY A;  2VEC A;  4Y20 A;  1IQD C;  1H4G A;  3OTF A;  4Z8B A;  1LEM A;  1OF4 A;  2ZML A;  1HKD A;  3NAP A;  4XMA A;  4AI0 A;  5FYY A;  4E2Q A;  4IXL A;  2LM3 A;  2ZZJ A;  1L7Q A;  3NL1 A;  5CKN A;  3WDX A;  1UIJ A;  2YMZ A;  2ZEW A;  1WLD A;  2RS1 1;  1YQ6 A;  1HXS 1;  2BQP A;  2BPA 2;  4JDO A;  1RMU 3;  2D93 A;  2OUH A;  3J7H A;  1I6X A;  3IZO A;  3KV6 A;  1N47 A;  2VZT A;  1KFX L;  4PIZ A;  2VME A;  2Y6G A;  4MH0 E;  3O1R A;  3AYD A;  3OYW B;  3TEX A;  1W8W A;  4N53 C;  4JGY C;  4CEW C;  5KHI A;  1CAV A;  2FDH A;  3MFC A;  4LO6 B;  4PLM A;  1WBL A;  2VQ0 A;  5FDB A;  2QDN A;  1FOD 3;  2XJU A;  3UYJ A;  4FPC A;  5IVE A;  3SHR A;  5KBF A;  4A2U A;  4CE8 A;  3LEK A;  5FQ0 A;  2B9U A;  1APN A;  3ZIW A;  3ZIX A;  1D0H A;  1H4H A;  5I0T A;  1PNG A;  3LFM A;  4NO4 A;  1SFP A;  1NXD 1;  3IB3 A;  3T1M A;  3WDV A;  3WQB A;  5K7P A;  4HMZ A;  3TN9 2;  3U4X A;  4BIO A;  3OJB A;  2OZJ A;  4QB6 A;  5FZE A;  2TEP A;  1EYB A;  2P2K A;  4IW3 A;  4JKK A;  1GU3 A;  1UZW A;  4Q4X 2;  2MEV 3;  4ARY A;  2D3R A;  3C7H A;  4XFF A;  1TEI A;  2QCS B;  1GKB A;  3ZFE C;  4QB2 A;  2J42 A;  4G3Y C;  4OUE A;  3ZYB A;  2VZR A;  1CIY A;  4EWD A;  2BNN A;  4GUL A;  2JG8 A;  4IV3 C;  4YW3 A;  1QJE A;  4COW A;  1UY3 A;  2ZX2 A;  1O4T A;  2VQT A;  2A71 A;  3FLR A;  1NZC A;  2C26 A;  1H2L A;  2A3X A;  5FZ3 A;  3WNX A;  5C3O A;  3WR0 A;  1S2E A;  2BRT A;  2HH9 A;  3AXD A;  3LOI A;  4BH9 A;  3O1O A;  2VO5 A;  4I09 A;  1JYN A;  2VZ1 A;  3E6D A;  1CAU B;  1OFS A;  1ODN A;  2VH9 A;  2R0H A;  4QHB A;  3FL7 A;  3OGS A;  1BBT 3;  1RUG 1;  1DQ1 A;  4GJY A;  4CTE A;  3AP9 A;  1BVP 1;  2VBB A;  3FJS A;  5IK7 A;  3WQ1 A;  3UJQ A;  2W94 A;  1ND2 B;  4N43 B;  5C9A B;  5CYY A;  5FWJ A;  4JAA A;  1CJP A;  4A41 A;  1IG0 A;  2P34 A;  4LT5 A;  1C8M 2;  1CIW A;  1PZ8 A;  2W1W A;  5CIR A;  2BUK A;  4V1P A;  3ACG A;  5C3P A;  4LUK A;  5EJ1 B;  5G04 L;  2CU5 A;  1O3T A;  2GMP A;  1NLS A;  2D98 A;  3OPW A;  3OUI A;  1QJZ A;  5FZD A;  4GAL A;  2BU9 A;  4JZR A;  1VBC 1;  1WLT A;  2PAK A;  1JYV A;  4QQL A;  5LB6 A;  1LOD A;  3BCW A;  1WKY A;  3QH6 A;  3CL1 A;  2OW4 A;  1UKR A;  2DTW A;  3AKQ A;  1YXW A;  1FPN 3;  4Y5S A;  3ZSJ A;  4BZ4 A;  1A6C A;  1CX1 A;  2AEZ A;  3OD0 A;  4AQ2 A;  3CF6 E;  3CJI A;  3WG2 A;  3FMG A;  2R07 1;  3MIE A;  4Y22 A;  3NAP B;  3MEP A;  1K5M C;  2JIJ A;  2BEO A;  1HB3 A;  2C9A A;  4UFM A;  4Y1V A;  4FXK B;  1OQE A;  4LE3 A;  3P3P A;  5FBZ A;  4QGN A;  3ELN A;  2ERF A;  1VBA 3;  1W6P B;  4IE6 A;  4ISQ A;  4QT6 A;  4DIN B;  4FPE A;  2JB8 A;  2E7T A;  3ZOI A;  1LNS A;  1O8S A;  1JZ7 A;  1LRH A;  3KD4 A;  3C8X A;  4XBQ A;  1ZYB A;  4NHY A;  3KGL A;  1OD3 A;  1R09 3;  1Y7B A;  2RJL A;  3QLQ A;  3ZYI B;  4FO9 A;  1H8V A;  1Y9G A;  2WWS A;  5A7S A;  4FAH A;  3U10 A;  3SIS A;  2XOM A;  4NII A;  2BOI A;  1CAV B;  1ZBA 2;  4GMP 1;  5C3S A;  4CEY A;  1XNT A;  5FY1 A;  5H9S A;  3PJY A;  4NAO A;  2RG4 A;  5FQ0 B;  5IVB A;  2ZS6 B;  4BQ5 A;  1TME 1;  4DY3 A;  3O0V A;  5F5C A;  1AVB A;  3OPT A;  4LR4 A;  5FTT C;  1AX0 A;  1ZA7 A;  2V5Y A;  3IDA A;  1F5J A;  1OOP C;  4L8Q A;  1WW5 A;  1HRV 3;  1S4C A;  2ZAA A;  3EJK A;  4KGQ A;  4ORF A;  2VZQ A;  3OUJ A;  3G7D A;  4K7J A;  4YWA A;  3BN6 A;  1NY7 2;  3NWK A;  1RUD 2;  4DXR A;  4FT8 A;  3E6C C;  1WCQ A;  3KVB A;  1TMF 2;  4Z07 A;  4UOJ A;  1JZ5 A;  1HB4 A;  4Y5T A;  2BVV A;  3BPZ A;  4GWN A;  4LMF A;  2DU0 A;  1COV 1;  4QX2 A;  3VDC A;  5ACA 3;  5K9Y A;  2GMM A;  4M00 A;  4BQX A;  1AXY A;  1KDM A;  3E5U A;  1UX6 A;  1OSG A;  3LAG A;  3R0R A;  4Q4Y 3;  4GB3 1;  5DUW A;  3H1Y A;  3I59 A;  3ZMO A;  2ZXQ A;  4R4Z A;  3RJ2 X;  3W58 A;  1EP0 A;  4WVW A;  5FZL A;  3A21 A;  1V70 A;  1BEV 3;  1TVG A;  2R06 2;  2XJS A;  2XBO 1;  3KV4 A;  5FP9 A;  3N4M A;  1VP6 A;  4Q1R A;  4CVU A;  5BNO A;  5SV8 A;  1PZ9 A;  3KZ4 C;  1CJD A;  1F31 A;  1WLC A;  4NID A;  2R7E B;  2KD7 A;  1KXG A;  4LBL A;  2DVG A;  4Y5Z 0;  4BU2 A;  4YVS C;  3DEM A;  1YIP A;  1FV3 A;  4PIX A;  4F8A A;  1QWR A;  1MEC 1;  2B39 A;  4I0B A;  2Q8D A;  5LA0 A;  2HBU A;  4YG6 A;  1B35 C;  5EV7 A;  3NKT A;  2JEM A;  4YGC A;  1ENQ A;  2X05 A;  2HKX A;  3RRD A;  3ACH A;  2WO7 A;  4WM7 B;  1PMI A;  5FLJ A;  2B46 X;  3M4F A;  3HAG A;  1PO1 1;  2BV4 A;  2H0B A;  4XFA A;  1OKO A;  4BM8 A;  1VBB 2;  1XU2 A;  5LAS A;  3ALQ A;  4NMI A;  1V6J A;  1SPP A;  5LA1 A;  1OKQ A;  2IXK A;  5FMC A;  2DCJ A;  1OUS A;  1OD5 A;  4BQ2 A;  4FP2 A;  4FP3 A;  1KEX A;  1Q5O A;  4OUS A;  3KCX A;  1QIQ A;  5KC5 A;  1C28 A;  4LJH A;  3HPN A;  4WVV A;  4XYX A;  1DYK A;  3U07 A;  3WV6 A;  4LQR A;  2WQ8 A;  3V56 A;  2BP6 A;  3VD4 A;  2X09 A;  3C2U A;  4LBQ B;  5EQU A;  2ADE A;  4COZ A;  2XLG A;  2X53 S;  4X8P A;  2B5H A;  4RHV 3;  1VB2 A;  5IK5 A;  2WFF 1;  4QX0 A;  2ET7 A;  2OZ6 A;  1ZNP A;  1UL9 A;  2JDM A;  4K3U A;  3AB0 A;  2IVJ A;  2RS1 3;  2RVA A;  4AHY A;  1HXS 3;  4Y22 B;  5FZF A;  3ZFG C;  1QNW A;  3VBF C;  2VBP A;  4XF1 A;  1R1A 2;  1W06 A;  2NPI A;  3BPS A;  3ETP A;  4BQ3 A;  2VCC A;  2YYO A;  3VBS A;  2XWB B;  3SLI A;  5FZ9 A;  4CU9 A;  3ILN A;  4IEO A;  4ZU4 A;  1LB2 A;  3RG0 A;  4PF5 A;  3L2Y A;  2VXJ A;  3ZXG A;  3WG3 A;  3IM0 A;  3J26 N;  2IXL A;  1QJY 1;  2Y6L A;  5FYV A;  2JG9 C;  4FFI A;  3OB8 A;  2O1Q A;  2R0F A;  3VBH C;  4EWE A;  2ZCW A;  1DHK B;  2OII A;  2AYH A;  5JI7 A;  5I0R A;  3FHI B;  3MBW A;  3ZXD A;  4XJ9 A;  1V6M A;  1TNR A;  1DCS A;  3LGR A;  2IVI B;  4CSW A;  2Y33 A;  4CPB A;  4HXC A;  3WDY A;  4KG8 A;  1RVF 2;  1YEW A;  3D6E A;  2W87 A;  1V6L A;  5A3O A;  3WW2 A;  2AEN A;  5KXE A;  1H30 A;  1OXC A;  4JTO A;  5K8S A;  3KQ4 B;  3ILF A;  3UKN A;  1CVN A;  4Q4W 2;  1VMJ A;  1YQ8 A;  1ZZC A;  1C5H A;  2WDB A;  4CDW A;  1D4M 1;  1PHM A;  1Z7S 2;  4O65 A;  5DAX A;  4OHW A;  4BLI A;  4KBZ A;  3EMR A;  4F7Z A;  3CNA A;  1Y9Q A;  3VDD B;  3JU9 A;  5JOX A;  1ZA4 A;  2TBV A;  1W04 A;  5LRS A;  1MQT A;  4XET A;  5FP8 A;  5JZG A;  3AMH A;  2VXR A;  4HOO A;  5FOB B;  3W59 A;  1VBD 1;  2AC1 A;  5GZE A;  4R9B A;  4ASM B;  1RUG 3;  2RMU 3;  2JDA A;  2R04 2;  3ACI A;  2FMY A;  3GCW A;  4CXW A;  2IFW A;  4R9C A;  1ST8 A;  1TNF A;  1O5U A;  1Q3E A;  1W6M B;  3WZ1 A;  5FY7 A;  2L9L A;  2XB6 C;  3C7E A;  2P5B A;  3J8F 1;  2PHT A;  5A32 A;  4FFH A;  1NA1 C;  2G9Z A;  4RR3 A;  5BNO B;  1LR5 A;  1UY1 A;  5FV3 A;  3SC7 X;  2CSG A;  4FPO B;  4YVW A;  1GIC A;  3JBG 2;  1WCS A;  5CFD A;  2Y64 A;  4TZD A;  1XPW A;  3CZU A;  4LUL A;  5AC9 2;  4BK4 A;  1DGL A;  4UT5 A;  4IEV A;  4Y24 A;  3G6J B;  4MX3 A;  2VUJ A;  1M4W A;  1UXX X;  2BNM A;  4N9H A;  3RI8 A;  3DPR B;  1OMI A;  1VBC 3;  3VKN A;  3WF3 A;  2JWP A;  1QJU 2;  2VMG A;  3J7M A;  5FXX A;  2XJT A;  3KMH A;  2ZX3 A;  4KNC A;  1CES A;  2JDU A;  3EO6 A;  4NHX A;  4MGQ A;  2QQJ A;  1RC6 A;  5AFE A;  1PMH X;  2ID4 A;  1W03 A;  3GJB A;  4R9D A;  1K42 A;  2CY6 A;  3SKV A;  2RJ2 A;  2A1X A;  4HPK A;  4XJZ A;  3CQO A;  3GBW A;  3BTA A;  1KGY A;  1W9W A;  2WZR 3;  1XNB A;  1O59 A;  2DCZ A;  2Y34 A;  5F1R A;  2KR2 A;  2WFP A;  5FO7 B;  2WNV A;  4K8R B;  4JDN A;  4LIT A;  1LGB A;  1Y4W A;  3PUR A;  5FXZ A;  3WG1 A;  5ABJ A;  3MHZ A;  1W2T A;  2PHU A;  5E88 A;  3T0A A;  2YC4 A;  5EJ3 A;  1RED A;  1IQA A;  2PTM A;  5C5U A;  1T2X A;  3KSC A;  1VBE 3;  4BE3 A;  4ZU7 A;  1L3J A;  2D6P A;  4XAA A;  4NJ4 A;  5F3I A;  1MPX A;  2V5D A;  3AZZ A;  3GZE A;  4XUP A;  3LPG A;  2G9F A;  3VZO A;  4HVQ A;  1UY0 A;  1DF0 A;  1RUH 1;  1UO9 A;  2GP5 A;  2QQO A;  1QXR A;  1JTZ X;  4IEZ A;  1RHI 2;  1W6N A;  2BFU L;  3C7O A;  1RUJ 1;  4FPH A;  3RS6 A;  4CP1 A;  4YPJ A;  4B7E A;  2ADD A;  1IKQ A;  1LTE A;  3R4U A;  1QDC A;  1TME 3;  4C91 A;  1SFY A;  1JI6 A;  1W2A X;  3VGI A;  1YIF A;  1HB2 A;  2AZ5 A;  5KR7 A;  3A23 A;  4JV4 A;  4QKB A;  4DB5 A;  5BNP C;  2Z5W A;  4R8H A;  4RA0 A;  4EYU A;  3DYP A;  2IXJ A;  4P9W A;  3MV1 1;  5FY8 A;  3R4D B;  4MVT A;  1JHJ A;  2YU1 A;  2PYT A;  3B94 A;  3JD7 2;  1GQH A;  3O0W A;  4CCO A;  5C4W B;  4EN6 B;  3RZM A;  1VAV A;  2WUH A;  4GB3 3;  2QQI A;  3WNP A;  1NCQ C;  5F3E A;  1ACC A;  1OI6 A;  1O6U A;  5IVJ A;  2XL9 A;  1LOG A;  4D8M A;  3PTY A;  4QPG A;  1XSQ A;  1MQT B;  3VBR C;  5JZG B;  5DAB A;  5KHK A;  1W3X A;  2E6V A;  4QXK A;  1CON A;  1PMJ X;  1G9F A;  4HKO A;  4HK8 A;  1NXM A;  3RGB A;  4EV0 A;  4G9S B;  5FOJ B;  2RE9 A;  2VTX A;  3U78 A;  3FWE A;  3I3M A;  2B7Y A;  4F3J A;  2VNG A;  3VZJ A;  5I91 A;  1JZ8 A;  2ZGL A;  2FDI A;  4QPI B;  5E6H A;  1PGW 2;  1A78 A;  1ULC A;  5HBA A;  1I1E A;  5E16 A;  1MEC 3;  2B8M A;  4ASK A;  4Q26 A;  1REF A;  2HWE 2;  1XXN A;  5A32 B;  2P3K A;  3K48 A;  1FV2 A;  4IV1 A;  1IS3 A;  4IV1 C;  4K6B A;  4QQ2 A;  4XCA A;  4RR3 B;  2DCY A;  3H3U A;  3SEP A;  3FUO A;  5LA2 A;  4LBM A;  3WCS A;  1JU4 A;  1LUL A;  1PVC 2;  5IK4 A;  4CXX A;  3LQC A;  1N3O A;  3SIT A;  3S0M A;  4URA A;  4LBO A;  1JOD A;  1S2K A;  2XLA A;  3N9N A;  3NQH A;  1TE1 B;  5EYY A;  2VMI A;  3UKT A;  3DCQ A;  4AWD A;  4WZC A;  1AF9 A;  2D43 A;  2ZAC A;  4AFC A;  3IDE A;  4LHN A;  3U4S A;  4COY A;  3B9I A;  3KB5 A;  1W99 A;  3MI8 A;  3I2G A;  4JTN A;  2VZV A;  2QZ3 A;  3S57 A;  4OI1 A;  1W6Q B;  4DUW A;  5I8Y A;  4ES9 A;  5D21 A;  4AEJ A;  4BJ0 A;  2ZGK A;  4UW3 A;  4PBO A;  1OH3 A;  3WXP A;  5FPX A;  4RGG A;  1ASJ 2;  3DV8 A;  4NWW A;  5GAL A;  3V0B A;  2WFF 3;  1H8T C;  1H8T A;  2H0V A;  3ENR A;  4XHX A;  5HPO A;  1UU6 A;  1YLL A;  4HPK B;  1VMF A;  4ZON A;  4B3N A;  4AI3 A;  4YM2 A;  1LEN A;  1XYN A;  4AYU A;  3KWV A;  4QPW A;  4RGA A;  1JYX A;  4OHV A;  4YW5 A;  4Q1P A;  1F9K A;  1UZ0 A;  2WNV B;  3BOP A;  5JCT A;  1XBF A;  1S0F A;  1AL0 G;  2QQU A;  4H55 A;  5DG1 A;  1X9T A;  4D6Q A;  2JE8 A;  4NHM A;  3WEZ A;  4AR2 A;  1QF3 A;  3WDU A;  2PHF A;  4QKD A;  3TNQ A;  1OT5 A;  1QJY 3;  3VHO A;  2WS9 3;  1ZM1 A;  2GC0 A;  3B02 A;  3RMY A;  2DVF A;  4M4R A;  4D7T A;  2XG3 A;  4WM8 A;  2VVE A;  4CDU A;  4BQW A;  1BHG A;  1DQ4 A;  1RUE 2;  4QB1 A;  4CUB A;  2IC1 A;  5HXV A;  3N3H A;  3WY6 A;  4AK3 A;  4OI2 A;  3UT0 A;  1V9U 2;  5B2G B;  3B5L B;  2WYS A;  3S30 A;  3LCP A;  3HT1 A;  4CA9 A;  2E63 A;  4GH4 C;  4MZU A;  1LHW A;  5A1L A;  1REE A;  5A7N A;  1S0C A;  1Q8Q A;  3TN9 1;  4YZ5 A;  4CP2 A;  3AJZ A;  3T30 A;  3PJQ A;  2Z4F A;  4CYD A;  3Q9O A;  1W8Z A;  4Q4X 1;  2NN8 A;  2YY1 A;  1DQ2 A;  5F3C A;  1D4M 3;  3GM8 A;  5HXM A;  1WUV A;  5J48 A;  1ZZB A;  2RM2 2;  4LK6 A;  4RS5 A;  1VRH 2;  4H2A A;  2C9K A;  5H9R A;  1W8T A;  2IFR A;  2LW8 A;  3AP4 A;  3MIB A;  4KGG A;  4WVM B;  1KFU L;  3O1V A;  1O3Q A;  2VVD A;  1ZRE A;  2K0G A;  2C0Z A;  5DG2 A;  1Y43 B;  3TRS B;  4NRQ A;  2ZKL A;  1VBD 3;  2YXS A;  3O14 A;  4LKF A;  1CPM A;  1LOF C;  5FJK A;  4M3C F;  3ZKU A;  2XL7 A;  1RL3 A;  5EWS A;  2TUN A;  2Y8K A;  2ZGT A;  4TN7 A;  2D40 A;  2YUE A;  1I9R A;  1EV1 2;  1W2O A;  4GA9 A;  5EHD A;  4QPG B;  3AYA A;  5A7P A;  4B1L A;  3P5B A;  1JUH A;  3J8F 3;  2X5I B;  2ZAH A;  3Q8F A;  3KT7 A;  4COU A;  3HJR A;  1O7F A;  4PLN A;  3POE A;  4SBV A;  5GLT A;  5LZ6 A;  3DF0 A;  1IPS A;  1F35 A;  5T52 A;  2O14 A;  1C8M 1;  5A3U A;  1AR6 2;  1A8D A;  1QXJ A;  1RXF A;  2VMF A;  3FFQ A;  4AHW A;  4XF9 A;  5DZG A;  1US2 A;  3PTR B;  1ALY A;  1KJR A;  2A3W A;  3ECQ A;  1IS4 A;  5FLI A;  1ONA A;  1CAW A;  3O12 A;  1C1L A;  4GKX A;  4KQ7 A;  3VBO C;  3W21 A;  4L92 A;  3WDW A;  1XE0 A;  2EIB A;  3AMN A;  3AP7 A;  3VL8 A;  1X8E A;  3RJR A;  3VHR A;  4AQT A;  5BUV A;  3I3D A;  5A33 A;  1DFQ A;  1EAH 2;  1GZW A;  1WME A;  4LBQ D;  3SH3 A;  5DAP A;  4A45 A;  4AF9 A;  5GKA C;  1HX6 A;  1D7P M;  2WN3 A;  1GLH A;  5IVY A;  3IMM A;  2D97 A;  2FZ1 A;  1CGP A;  3KCY A;  2XQX A;  3WUC A;  1DDL A;  1OVP A;  5A3T A;  1G9B A;  1RB8 G;  4PJY A;  3AZY A;  5L7O B;  3LA3 A;  2K9Z A;  1JOJ A;  4RQP C;  2CDO A;  4N90 A;  3BTZ A;  1AYN 2;  1CQ9 A;  2OUJ A;  2HWB 2;  4N8M A;  5FZH A;  2HEV F;  3ZSE A;  4CCE A;  1Q8O A;  3VHN A;  1FT9 A;  5LY1 A;  4MGI E;  2XGX A;  4C0H A;  1MAC A;  3V0B B;  2JIC A;  3E5Q A;  4XTM A;  2RJK A;  5GLW A;  2P4E A;  2J1U A;  3B01 A;  3FBY A;  4FPG A;  4QKF A;  1UU5 A;  2ZBJ A;  5A6Z A;  1DGW X;  4S2D A;  5DDJ 1;  5FP7 A;  3RWK X;  2Q1F A;  4IE7 A;  5DZE A;  1XSR A;  1G6N A;  1AL2 2;  1X36 A;  2VW2 A;  1RUH 3;  5A7Q A;  4Q0Q A;  5J7M A;  3LDR A;  4XMI A;  3H3Z A;  5BPX A;  3LIH A;  1RUJ 3;  2WA3 A;  4AED A;  3L9J T;  4YW4 A;  3RZL A;  5F37 A;  4KH9 A;  1AR9 3;  3VD9 A;  2LRP A;  4WM8 B;  1JYC A;  1ZBA 1;  5A1F A;  3J4U H;  3PVE A;  4YZ3 A;  3WP4 A;  4KU8 A;  1GQP A;  3WQ0 A;  2GN3 A;  1H0B A;  4XCB A;  1HN0 A;  4CCK A;  2PEL A;  4BXS V;  4EN9 B;  1OPM A;  4XF0 A;  4BXF A;  4DOU A;  1GZC A;  1JUI A;  1GFF 2;  4P5Y A;  3M3E A;  4MV2 A;  1QJX 2;  4W6W A;  2AUY A;  2J1E A;  4KWJ A;  2LS6 A;  3LZZ A;  4XJ8 A;  3KV5 A;  4L9B A;  1TZO A;  1NY7 1;  1TMF 1;  3MYX A;  5FYH A;  2RDR A;  4KBB A;  1ZZ9 A;  1W28 A;  3UKV A;  3I3E A;  3O5S A;  4UW5 A;  1AXK A;  2DFB A;  2YG0 A;  3H8O A;  5JSO A;  1UYZ A;  4R4X A;  1JHN A;  3O0X A;  2WQ4 A;  1SBD A;  4UYB A;  1XU1 A;  4XXA A;  5HCF A;  5IAV A;  4A4A A;  1UYX A;  4XC9 A;  1H6X A;  1TG7 A;  1E5H A;  1RUN A;  1ND3 A;  2R06 1;  3H7J A;  4LTA A;  3GHN A;  3U37 A;  4AAX A;  2VZS A;  3IT8 A;  1YFW A;  2D6M A;  2XKO A;  2VVF A;  4LO4 B;  4QU2 A;  1C4R A;  1EPW A;  1BMV 2;  2CNA A;  4F83 A;  1H9P A;  5DAQ A;  4YFW A;  5G05 L;  1XNA A;  3DYM A;  4B8E A;  5KC6 A;  2HWD 3;  2OPW A;  4FPJ A;  3N7M A;  2ZOE B;  4CRQ A;  1WD4 A;  2WNU B;  3CMG A;  1SCS A;  4M0H A;  1WCD J;  4UW6 A;  1DZR A;  3QAC A;  1JYI A;  4BLJ A;  3N9M A;  1POV 1;  1VBB 1;  4P9I A;  4PIY A;  3MUY 1;  2CGN A;  4A42 A;  2WWJ A;  3BVC A;  1CX4 A;  2W3J A;  3ZN6 B;  5JLV A;  1W8O A;  3ZYR A;  5FPZ A;  3UGG A;  4CP9 B;  2E26 A;  1LHV A;  3E6B A;  2GNT A;  1UZZ A;  4OYU A;  2W9X A;  3ZXK A;  1S55 A;  5GLV A;  4XVH A;  1R08 1;  5A3P A;  2W92 A;  2G4I A;  4N7U A;  4UBH A;  1DQ5 A;  4QPY A;  3WLU A;  3FX3 A;  5FAX A;  2GU9 A;  1ENS A;  3CIH A;  2EAK A;  2DBN A;  1RMU 2;  4IE5 A;  4N53 A;  4JGY A;  3T09 A;  5E1R A;  5FJH A;  4OLL A;  1UOG A;  1E57 A;  4B4R A;  4CEW A;  3RWN A;  1GYK A;  2D44 A;  1HV0 A;  1MS4 A;  1NAE A;  1R1A 1;  1S0I A;  4YRD A;  4ZY9 A;  4DIQ A;  5FO8 B;  1RUF 3;  2B45 X;  4IEQ A;  5C70 A;  3HBK A;  3AZV A;  3NJY A;  1J1L A;  2XML A;  4JVA A;  1CAX B;  4H7M A;  1LES A;  1EUT A;  1FOD 2;  2DTY A;  2RDS A;  3ZFF C;  3ZFF A;  4RFR B;  1STM A;  4JX0 A;  3K75 B;  4XAE A;  5D8A C;  1PVX A;  1AX2 A;  2IZW A;  2J22 A;  3AC0 A;  3ZFE A;  3BIE A;  4M01 A;  5CG9 A;  4KWK A;  4JC1 A;  1N1Y A;  2I2S A;  4XJU A;  2XVL A;  4PI2 A;  3UGF A;  4PDW C;  4IV3 A;  2GNB A;  4AED B;  4CCN A;  4Q8K A;  2MEV 2;  5F39 A;  1RXG A;  3WHU A;  4Q4X 3;  2VR4 A;  2HWC 2;  4Z82 A;  5T5J A;  5CIS A;  2F4P A;  4KG0 A;  5H9Q A;  3WNL A;  5JMC A;  3UV9 A;  1XYP A;  3ES1 A;  2QBX A;  4Q4W 1;  1QHD A;  1AR8 1;  4A7Y A;  4QX8 A;  1O4Y A;  1Z7S 1;  2WII B;  4W6Y A;  5CAD A;  1AXZ A;  4AVB A;  2CAU A;  2PLV 1;  5FZ0 A;  4DEV A;  2BGC A;  3ZSK A;  2HYK A;  1QEX A;  5GJ6 A;  1JZ2 A;  1HDK A;  1G86 A;  1HLC A;  4NE9 A;  1BBT 2;  4E9K A;  3N9O A;  4GAZ A;  1W6O B;  2E51 A;  1LAJ A;  1GWK A;  4YW6 A;  2A6Z A;  2VOT A;  4AHX A;  4KWL A;  3PUI A;  5I0U A;  2R04 1;  2ET1 A;  4R52 A;  1WCK A;  1MS9 A;  3U1X A;  1MS0 A;  1PIV 2;  1ND3 B;  2W1S A;  3WF1 A;  4OHY A;  5FY4 A;  1S0D A;  5KXB A;  3J9S A;  3USS A;  4AFM A;  4KU7 A;  4P9L A;  3AX4 A;  4FQZ A;  1J3Q A;  3BOD A;  2EAA A;  4OUL A;  4GKY A;  5L73 A;  3JBG 1;  1BCX A;  1PNF A;  5CNA A;  3O1U A;  2H6C A;  3VKF C;  4IDZ A;  1CWP A;  3AM2 A;  3D0S A;  3IKW A;  3RYP A;  5FPA A;  3WF2 A;  4WM7 C;  4XQD A;  5AC9 1;  1K12 A;  1AHS A;  5GZC A;  2IUW A;  3LD8 A;  1SFN A;  4Y20 B;  4ET7 A;  3F95 A;  1GOG A;  4B4P A;  5DZF A;  5IUQ A;  1QJU 1;  4EQV A;  2PHL A;  2XPJ A;  1K5M A;  5JWP A;  5LK5 A;  3SMH A;  1GNZ A;  1WW7 A;  3FC0 A;  1QY4 A;  4DXZ A;  2I45 A;  4CUC A;  2ZGQ A;  4MUV A;  2FD8 A;  1JW6 A;  4MGZ E;  1RUI 3;  2VCA A;  5FZ6 A;  4AFA A;  4Z1V A;  2YC2 A;  4CDX A;  4CDX C;  1PGL 2;  2O8O A;  1FNY A;  2NM1 A;  3CDZ B;  2ZEZ A;  3I2K A;  5DN2 A;  1J1T A;  3THP A;  4YZ2 A;  2EXI A;  1AUY A;  3MIH A;  1PX4 A;  1VBA 2;  5DUU A;  3RZK A;  4QM9 A;  1ZRR A;  4RSU A;  1PK6 C;  3OGV A;  1MVE A;  4JRL A;  4QKN A;  4N53 B;  1Y9M A;  3ZXE A;  1JS9 A;  3DYO A;  5DDJ 3;  4P02 B;  3VZL A;  4AFB A;  5IVF A;  1SLI A;  4QM8 A;  3AKP A;  3WG4 A;  3A22 A;  4KL1 A;  1OC1 A;  1U5I A;  4MAD A;  3K4Z A;  1LKN A;  4N7I A;  1NUK A;  1RIT A;  5GZD A;  3POF A;  2WO1 A;  3FLT A;  3KVA A;  4YZ1 A;  1YQ2 A;  2DV9 A;  1X50 A;  4AQ6 A;  1RHI 1;  1OOP A;  4HK9 A;  4LPL A;  5FMO S;  1DG6 A;  1ZBA 3;  5F2S A;  4P9G A;  4AL9 A;  1EUU A;  4UFJ A;  4XPV A;  5BNN C;  4QMA A;  3HVD A;  4NUB A;  4XIL A;  3W5M A;  1W8N A;  3GZT B;  1HRV 2;  2DUP A;  2JG8 B;  2ZHM A;  2YZ4 A;  2LTN A;  3UL2 A;  1AZD A;  2GNM A;  4QXC A;  3S7E A;  4S2F A;  3SCF A;  5F7U A;  4P9X A;  2K2S A;  1HN1 A;  3OUH A;  3M8L A;  1LCL A;  5ACA 2;  2ZHL A;  4LOR A;  3T4V A;  2W47 A;  4Q4Y 2;  4C90 A;  3WP6 A;  3JD7 1;  4HN0 A;  2HJI A;  2J1R A;  5EJZ B;  4FOQ A;  3GBG A;  3VDD C;  4ZZ8 A;  4NVP A;  2HLE A;  2VU9 A;  1E5S A;  2VW0 A;  4L0P A;  1FMD 3;  2ENR A;  1BEV 2;  1OQD A;  1GZ9 A;  4YVS A;  1AR7 2;  4L11 A;  2RS3 2;  1QMJ A;  1GOF A;  1N3P A;  1QDO A;  5FO9 B;  1B35 A;  1I3H A;  2R06 3;  5AFB A;  3I54 A;  3DL3 A;  1J83 A;  5F5I A;  3O7O A;  3VLB B;  2Q1M A;  3WT3 A;  3S5Q A;  3PU3 A;  4BHP A;  5LCW L;  5DUX A;  3PUQ A;  5EPA A;  1C3H A;  2WT2 A;  4TLG A;  2A6X A;  2W52 A;  1PGW 1;  2VMH A;  2PHW A;  3VV1 A;  5JIU A;  2PHR A;  4XZP A;  4HL0 A;  4NAM A;  2FDJ A;  3BTY A;  2HWE 1;  1UNB A;  2GH2 A;  3AFK A;  3POI A;  3WSO A;  2Y26 A;  1UF2 C;  4IER A;  3BAL A;  2VE1 A;  3NVC A;  5JOW A;  2XVG A;  4QU1 A;  1NYW A;  1POV 3;  1PVC 1;  1VBB 3;  1ZVF A;  5JXH A;  4XBL A;  1IHM A;  2YHJ A;  4XW3 A;  4IND A;  4CXY A;  3AMP A;  3ILR A;  2C6S A;  3BI3 A;  2P6C A;  2V09 A;  3DPR C;  3IWZ A;  4ONU A;  1POQ A;  1YJL A;  2ARB A;  3GZA A;  1LOC A;  2J1A A;  3CJI B;  3GAL A;  3MW4 A;  1VJ2 A;  2DVD A;  2P3Y A;  2QQL A;  3KHB A;  3ZFG A;  3ZYP A;  3VBF A;  4FOV A;  1K5M B;  2JDZ A;  4RHV 2;  1R08 3;  4EN7 B;  3D8C A;  5KXC A;  4XFB A;  1VMH A;  1NG0 A;  2QE3 A;  1ASJ 1;  1Q8S A;  1UPS A;  1X82 A;  5IT6 A;  2OQ7 A;  1ZZ6 A;  1J3P A;  2UY8 A;  2X10 A;  3GF6 A;  1MR5 A;  2VC9 A;  4K8F A;  3ZN5 A;  3BTX A;  5C33 A;  2JG9 A;  4DO0 A;  1ODM A;  3VBH A;  3M3Q A;  1BVV A;  2F17 A;  3T2O A;  2Y38 A;  1UD1 A;  2Q0A A;  2VZP A;  3H7Y A;  5L9V A;  5F6K A;  4HAN A;  1ZBE 1;  2TNF A;  1HV1 A;  1ULF A;  1WGP A;  2XH6 A;  2ZA9 A;  4ATF A;  1U0A A;  4PHZ A;  4AGR A;  2VQA A;  3N9Q A;  5F6L B;  4AQS A;  1CN1 A;  2WLP A;  2UY9 A;  4CEY B;  4I01 A;  3WUD A;  3AYC A;  1RUE 1;  1HQL A;  1UCX A;  2UU8 A;  5K0U C;  2WIN B;  4E8D A;  1V9U 1;  4NPM A;  4SLI A;  4P9Y A;  5CEH A;  3Q8B A;  3IIA A;  2R6Q A;  4L99 A;  5F3G A;  1OOP B;  4RD7 A;  1BYH A;  2RDQ A;  2WKK A;  5FLH A;  4CCD A;  4NRO A;  3B69 A;  2QQM A;  2P17 A;  3P1I A;  2W1U A;  1NX9 A;  1UOB A;  3OD4 A;  4LLF A;  5FXV A;  3KM5 A;  2NZ9 A;  1OQ1 A;  1VE0 A;  3LEI A;  3R4S A;  3BIW E;  3ROU A;  5J1X A;  2VL4 A;  3AMQ A;  3MF9 A;  1AR8 3;  4IEW A;  3IAP A;  4DRR A;  1JZ4 A;  1F2N A;  5DQ0 A;  3S5A A;  4Z92 B;  3H1W A;  2RM2 1;  1JBC A;  2VUL A;  2YGM A;  1VRH 1;  2UYB A;  3I59 B;  4IEY A;  3ZVX A;  5J37 A;  2PLV 3;  5FRE A;  4B1M A;  3A0K A;  3C7F A;  1GWL A;  4HLT A;  2R1B A;  3NV4 A;  4P08 A;  1JN2 P;  3GXU A;  3ZLI A;  2WR9 A;  3HD8 B;  2DVA A;  4IET A;  4NRM A;  1O3R A;  1NA1 A;  2RMU 2;  3PME A;  4D7S A;  2WWU A;  3HQU A;  3VKO A;  4Y3O A;  5EYX A;  1R1Z A;  4Q0S A;  4YVS B;  1W0P A;  2VNR A;  2BWC A;  3NV1 A;  1G9C A;  5J09 A;  4J6G A;  5FYI A;  1JU3 A;  2FBE A;  2W39 A;  3ON7 A;  5T5L A;  2FDF A;  2XHK A;  4ERO A;  3PL0 A;  4NHL A;  3ZYG A;  2I07 B;  1FAT A;  3JBG 3;  3MPP G;  4LBJ A;  1AR6 1;  4Q0P A;  1SPP B;  3MO4 A;  5FYC A;  3FHQ A;  1H2M A;  1VBC 2;  3CKH A;  1VPH A;  1JOP A;  2A6Y A;  2ARE A;  4UWD A;  2RS5 2;  1DGR A;  4XIO A;  5ANN A;  2R07 3;  1QJU 3;  4FVV A;  4K9S A;  4LE4 A;  3VDB A;  3JB4 C;  2A6W A;  3LWC A;  5GZF A;  1EAH 1;  4XTP A;  3QCW A;  4P00 B;  2R1D A;  3JB8 A;  1V6N A;  2E53 A;  4HKL A;  2WZR 2;  3HOB A;  5ERL A;  1S1A A;  2UYA A;  5EZW A;  4C1X A;  1W9S A;  1DIW A;  3ZFG B;  1HW5 A;  5CFC A;  5CFC C;  3SCG A;  3VBF B;  4L97 A;  4XUQ A;  2JE9 A;  4LLO A;  3HQX A;  5DMY A;  2HWB 1;  3VB9 A;  1JZ3 A;  3FUQ A;  3VBS B;  3DXU A;  5BNQ A;  1I5P A;  1ZRF A;  4YM0 A;  2OXB A;  3LFI A;  4FFG A;  2BW8 A;  2HWF 2;  4NWV A;  2ZGO A;  1VBE 2;  1SLC A;  3APB A;  3CO2 A;  5HCB A;  3WP5 A;  4XUN A;  4GMP 3;  3J7L A;  2JG9 B;  1GNY A;  3THC A;  4EE2 A;  4FOW A;  3MLL A;  4NN0 A;  1R64 A;  3KS7 A;  4YW2 A;  4XFH A;  4I0W B;  5LEJ A;  3M70 A;  5LRR A;  1OF3 A;  1AL2 1;  5A1A A;  2EVX A;  4JGZ A;  1S0E A;  4JGZ C;  4TLF A;  4XJW A;  3OGJ A;  2LUW A;  3NV2 A;  3VBU A;  3VBU C;  1SDD B;  3LB9 A;  1RJ8 A;  2D6N A;  3CZJ A;  3ZSM A;  3POG A;  3KF5 A;  3NNF A;  5BNP A;  1TME 2;  3NNJ A;  1GAN A;  3MV0 1;  2BWA A;  2DBI A;  5A3W A;  5BXX A;  1UMZ A;  2D6L X;  2VMD A;  1COV 3;  4CDW B;  4BIF A;  2Q8O A;  3U11 A;  2HEY F;  3K77 A;  4BQ1 A;  2CWS A;  1SLA A;  4HZF A;  3WIN E;  1NCQ A;  1IS6 A;  4IGQ A;  1VLN A;  4U36 A;  3W20 A;  1SBE A;  3JUU A;  2VCM A;  2XR4 A;  1D4V B;  2GC1 A;  3AYE A;  5L9R A;  1HQW A;  1LU2 A;  4ITC A;  2XBO 3;  3VBR A;  1SLB A;  4O9G A;  1PX3 A;  4EJR A;  4GB3 2;  3AP6 A;  1AYM 2;  2LAL A;  1WD3 A;  1AJK A;  4HET A;  1W3V A;  1W2N A;  1E5I A;  1I5Z A;  2OKX A;  4OCT A;  2V4V A;  4UXA A;  2BOJ A;  3WDT A;  1GNH A;  4IEP A;  4AFD A;  1KD7 A;  1MVQ A;  3DXT A;  3C7G A;  1QNY A;  3IAQ A;  5IWF A;  2ZAB A;  1AJO A;  2EAL A;  4D69 A;  1RUC 1;  2AR6 A;  1PO1 3;  4AVV A;  2P3I A;  3I4I A;  4HVR A;  3VD5 A;  1ENR A;  1MEC 2;  1VAL A;  4YVW B;  2R30 A;  1UOJ A;  5LW9 A;  1QOT A;  2RR1 2;  1BMV 1;  2X5I C;  3VDA A;  5CFD B;  1NQJ A;  4MSV A;  2OVU A;  3O1P A;  4MGT A;  4WBB A;  2Y0O A;  3K51 A;  4UFH A;  4DQA A;  1QH7 A;  4AI1 A;  3B7M A;  4LOS A;  3TBD A;  3PUS A;  4RL7 A;  4ZU5 A;  5DPN A;  2WO2 A;  3ZPY A;  1PVC 3;  4XOG A;  5CZK A;  3OGG A;  3POY A;  1GSL A;  2FQP A;  2FCV A;  4UFK A;  3NO8 A;  4ZZ5 A;  2KA3 A;  2X8K A;  2RV9 A;  2Q8C A;  3HNY M;  3BOW A;  5IYY A;  2JDY A;  4FPL A;  4NPR A;  2VUA A;  4AGV A;  5C3R A;  2UWB A;  4PI0 A;  4P9J A;  5DAW A;  1Q8V A;  5H9P A;  2CV6 A;  2WFF 2;  4AE2 A;  4DY5 A;  2J1T A;  3I2H A;  4XAB A;  5ABJ B;  5FPB A;  5L7O C;  2GN7 A;  4FQ4 A;  2DWR A;  2ZGP A;  4Q27 A;  1LOA A;  5CKM A;  3ASI A;  4XF4 A;  1OUX A;  1RMU 1;  4MO3 M;  2E7A A;  4LA3 A;  1V00 A;  4YG3 A;  3M3C A;  1OFN A;  2F4L A;  1ULP A;  2VOW A;  1G9D A;  4CU6 A;  3DEC A;  1ZBE 3;  4JKL A;  4URT A;  1QJY 2;  4YGB A;  2Y6H A;  4FSJ A;  4AVA A;  2WS9 2;  3KQR A;  1W6N B;  1RTV A;  1DBN A;  5F9T A;  4XJA A;  4GH4 A;  5I93 A;  1T6B X;  4AGG A;  2CWM A;  3WNM A;  3PIJ A;  5FZ8 A;  4I30 A;  5FZC A;  1IS5 A;  3QD6 A;  5A6X A;  3IPV A;  1OA2 A;  5HV0 A;  5D2A A;  5FWE A;  4P5H A;  5FPL A;  3KCC A;  3RYK A;  4CP0 A;  4LO5 B;  2KXL A;  1V9U 3;  5I0D A;  1GQG A;  3K3N A;  4IE4 A;  4YZ4 A;  3Q8E A;  1SG3 A;  5LAT A;  4BK5 A;  4FTB A;  1LHU A;  1UU4 A;  1UZY A;  3MW3 A;  1OLM A;  3H0O A;  2MEV 1;  5BNP B;  4LHK A;  3I2D A;  1WWY A;  1UMI A;  3L2H A;  1OLQ A;  1US3 A;  1FI2 A;  2HWC 1;  1O8P A;  3I2I A;  3WQ7 A;  1ULG A;  2YDE A;  2XUM A;  3LF7 A;  1QU0 A;  3EXU A;  4DS0 A;  1YHF A;  3HQR A;  5F32 A;  2NQY A;  5FZK A;  4FOY A;  4AOC A;  1LHN A;  1LOF A;  3ORJ A;  4M0N A;  1DYO A;  1GV9 A;  1NCQ B;  1QQP 2;  5C8C C;  3I97 A;  5LY2 A;  5FPV A;  3VBR B;  4OFG A;  1ULE A;  1VBD 2;  2QVS B;  4DXS A;  2KM2 A;  2C5D A;  3ES4 A;  3KT1 A;  4QXB A;  2D3P A;  2VUC A;  5FPU A;  3AVR A;  1QH6 A;  1CPN A;  5BYN A;  1V6O A;  4K40 A;  5C6C A;  5JXG A;  3UNP A;  1BZW A;  4CDQ C;  1NCR C;  4GIQ A;  3J8F 2;  4L2N A;  1E5R A;  3WW3 A;  5JSR A;  1QOS A;  3V0A A;  2YB7 A;  1CZT A;  4X6Q B;  3VBO A;  4CUA A;  2IXI A;  1PIV 1;  4IV1 B;  1K45 A;  4LK7 A;  5T5O A;  4HSL A;  2XQR A;  1GR3 A;  1VB4 A;  2BBV A;  1J58 A;  4U2A A;  5FY9 A;  1AR6 3;  4IEU A;  3CHX A;  3X29 B;  3OG2 A;  1UMH A;  3KHC A;  1U12 A;  4XFC A;  3VD3 A;  5HCH A;  3DN7 A;  2WNU C;  4OVE A;  5SV5 A;  4CCL A;  4LNV A;  1HRI 2;  3HT2 A;  4O7X A;  1NZI A;  2DYC A;  2JD9 A;  2BGP A;  4RQP A;  2A70 A;  5T55 A;  1XJA A;  2AGS A;  1IOA A;  1ZRD A;  5J98 B;  1EAH 3;  3OEB A;  2QZ2 A;  2QNK A;  3C3V A;  4BMB A;  1H1A A;  2Z42 A;  3V65 A;  4Q0U A;  5IJR A;  2WSV A;  3I2J A;  1H8T B;  1IPK A;  1FXZ A;  5EXO A;  3T2T A;  4JKM A;  4AI2 A;  1X7N A;  2BDR A;  2LRO A;  2BFU S;  2XJR A;  2HWB 3;  2PQS A;  1PGL 1;  4FPK A;  2AEY A;  4A44 A;  4EN0 A;  5A3L A;  3ZR6 A;  4BA6 A;  1O91 A;  3P3N A;  5J96 B;  3MID A;  4QHZ A;  3OYW A;  2B9V A;  4TSV A;  3VZM A;  1X9P A;  3N9P A;  1BLZ A;  4GXL A;  4LO7 A;  2VUD A;  3N7J A;  1PO2 2;  3FHA A;  3PLQ A;  2CHH A;  1L7R A;  1W05 A;  4LBN A;  4MG2 A;  3T0D A;  1S0B A;  4CDU B;  4YG0 A;  1RUH 2;  1OLR A;  4XUO A;  4OI0 A;  2G19 A;  3WF4 A;  4XFG A;  2J1S A;  5FY0 A;  1AR9 2;  4UAP A;  4A6O A;  4GH4 B;  4ZPI A;  4DFS A;  2Q30 A;  4BOW A;  3H42 B;  1DYP A;  2G1M A;  2P6H A;  2K46 A;  2Q1Z B;  3LSE A;  1XNK A;  3VD7 A;  3POB A;  3IPV B;  4NIA A;  1XQN A;  3VZN A;  1RUD 1;  2VNO A;  1DQ0 A;  1CR7 A;  1YFU A;  5FBJ A;  4B7K A;  1MS3 A;  3E5X A;  3LA2 A;  4RS5 B;  1MS1 A;  4H7L A;  3FZ3 A;  1HJF A;  1AX1 A;  1WLW A;  4WV8 A;  5LK7 B;  5DUV A;  4B29 A;  2BVB A;  3OSD A;  2ZEY A;  2PAE A;  3LDK A;  1W0O A;  2UUR A;  4XAC A;  1CAU A;  1ULD A;  4PQ9 A;  1KS4 A;  3VKL A;  4Q4Y 1;  2XWJ B;  4Q4V 2;  2EA7 A;  2W46 A;  1O5L A;  4FAG A;  1JZ6 A;  3OPZ A;  1BEV 1;  4N43 C;  1ND2 A;  1ND2 C;  1AR7 1;  5C9A C;  2P37 A;  1YFY A;  5I8S A;  2RS3 1;  2ZGS A;  1POV 0;  2ZGM A;  3T2P A;  2A3Y A;  3III A;  1RUC 3;  2ES3 A;  3PNA A;  1P8J A;  2OA2 A;  3WP3 A;  5ISL A;  4IUG A;  2JDN A;  1YQC A;  3EBR A;  1PZ7 A;  3OEA A;  2HWD 2;  2NP0 A;  1UQX A;  4HKW A;  5E89 A;  5FIX A;  4FI9 A;  1GMM A;  3V0A B;  3M3O A;  3VBO B;  1CAW B;  2W68 A;  2X29 A;  2EIG A;  4WZF A;  1UYY A;  1KRI A;  1BXH A;  2CL2 A;  4E4S A;  4LKS A;  4PF1 A;  5A33 B;  4AEM A;  3UJO A;  1GZW B;  1W9F A;  3IDB B;  3T0B A;  1RUO A;  1GP5 A;  4A3X A;  3ZSL A;  2YV8 A;  3M2M A;  5CA6 A;  3ZDV A;  2VW1 A;  3HNB M;  3BU7 A;  5KHJ A;  1C1F A;  2VZO A;  2Y0I A;  1C5I A;  3NAP C;  4RQP B;  4HSJ A;  2JX9 A;  5FK7 A;  2PA7 A;  3AJY A;  3DKQ A;  3AL6 A;  4IE0 A;  4QDS A;  3AKR A;  3HEI A;  3MF6 A;  5D1I A;  2VZU A;  3RZZ A;  4RHV 1;  2ATF A;  2XHN A;  1W6P A;  3RPQ A;  2W08 A;  2XON A;  4LBK A;  1VR3 A;  3QOP A;  3Q8A A;  4IES A;  4W65 A;  4Y4R A;  3DGT A;  2PMW B;  3E97 A;  2Z69 A;  3GDB A;  1MZF A;  2HYX A;  2PHX A;  2DUR A;  1DGR N;  1RUF 2;  1MZ5 A;  1V0A A;  5D8A A;  5FKB A;  3QBQ A;  5GM0 A;  4AI8 A;  4CPB D;  2ZPX A;  1SEF A;  4UI9 L;  1T6G C;  4W4Z A;  4PDW A;  4QQH A;  4JQR A;  3V64 A;  1NQD A;  1RVF 1;  4YYO A;  4FFF A;  4I3G A;  2MPF A;  3TN9 3;  3NNM A;  3SEE A;  5IAX A;  3OBT A;  3UK9 A;  3OY8 A;  3W5N A;  4D6R A;  4RFT 0;  2GDF A;  2VCB A;  1HIX A;  5FYU A;  1Q8P A;  3OBA A;  5CAZ A;  3A4U A;  3KF3 A;  1GP6 A;  1QGL A;  4W6X A;  4AG4 A;  5IVV A;  1GOH A;  2WO3 A;  2ILM A;  5I0S A;  3D4K A;  4ATE A;  5C8W A;  2HWC 3;  2Y6K A;  1J3R A;  1X8M A;  1GZT A;  2JG8 C;  4TYS A;  1ZRC A;  2JJ6 A;  4XHB A;  4XQW A;  4TTG A;  4E8C A;  2YC0 A;  2VOV A;  2WQZ C;  5A80 A;  1PM7 A;  2WT0 A;  1HQN A;  1LU1 A;  1UAI A;  3TEY A;  4D3W A;  2W5F A;  3VZK A;  1GBG A;  2JDK A;  3CU7 A;  2JEC A;  3AK0 A;  1URX A;  4QX7 A;  3N7K A;  2OS2 A;  2RMU 1;  4GZ9 A;  1C8M 3;  5A7W A;  4YM3 A;  1LOE A;  5JMO A;  2WLQ A;  3T3Y A;  3N35 A;  3NNG A;  3R05 A;  4ZS3 A;  3ZM8 A;  1PIV 3;  4WM7 A;  3PMS A;  1MZ6 A;  3WHT A;  5FP4 A;  4AVC A;  1KIT A;  3ACL A;  2QQP A;  2ZGN A;  3AVS A;  3PUA A;  3N9L A;  4NR1 A;  4Q0V A;  1GP4 A;  5FP3 A;  2XDV A;  3VKM A;  3H8X A;  2XKP A;  1FPN 2;  1F4H A;  2OX0 A;  3B9C A;  3R6S A;  2ARC A;  5L9B A;  4PQQ A;  5IVC A;  1DZQ A;  3I7D A;  3KLS A;  4BYY A;  1BK0 A;  4YW1 A;  2XLF A;  4PLO A;  3ZYJ B;  1OVS A;  2E32 A;  3NMB A;  1IZ3 A;  4DPN A;  5FR3 A;  1DZT A;  2OQ6 A;  2JEN A;  2QKD A;  2RS5 1;  2YBS A;  2ZX0 A;  4TXW A;  5TSW A;  1S2B A;  4LBQ A;  4BDV B;  4DMI A;  5IFP A;  5JPM B;  1F4A A;  1ZRI A;  2WA4 A;  3HNM A;  5FFO C;  1UYP A;  1YRZ A;  4GMP 0;  4D7Y A;  1D2S A;  4OZX A;  4NRP A;  4COV A;  4M3C E;  1F15 A;  3CJI C;  1PK6 A;  1RUI 2;  2JXA A;  3I3B A;  4DRV A;  4MGK E;  2WZR 1;  1W9Y A;  2VAU A;  3BB6 A;  3JCI A;  4JGY B;  4CEW B;  1CZS A;  1DGW A;  1R09 2;  1W2U A;  4QX5 A;  2JIG A;  4I3P A;  4ZXK A;  3T1L A;  2C1F A;  3JQX A;  3NW4 A;  5FYT A;  4S2H A;  4P14 A;  2V73 A;  5IW0 A;  2VTX J;  3K2O A;  1A8M A;  1WMX A;  3KT4 A;  3K4D A;  2JD4 A;  2HWF 1;  5DDJ 2;  3J7N A;  1VBE 1;  2YFU A;  3OCP A;  4MGY E;  5F5Q A;  4XDQ A;  3FFZ A;  1OA3 A;  1F8V A;  2ZGU A;  2CYF A;  5FZ7 A;  3ZFF B;  4Z2W A;  2WT1 A;  3I3Q A;  4NIG A;  5BNN A;  4Z2A A;  3H3L A;  5D8A B;  1V6I A;  3ZFE B;  3ZXF A;  2PAM A;  5CG8 A;  4QGM A;  2QUO A;  1QXP A;  4PDW B;  4IV3 B;  2QQK A;  1YNA A;  3IN9 A;  4CEY C;  4AI9 A;  5EIY B;  3AXE A;  2IWG B;  3K46 A;  2PXJ A;  3AMM A;  4MHR A;  3S6P A;  1YI7 A;  3NKG A;  5HI0 A;  2JB4 A;  3OY8 B;  4GWI A;  3MGU A;  4QWN A;  1RUD 3;  5F5A A;  5L36 A;  1SHW B;  1TMF 3;  4CCC A;  1WW4 A;  2NMN A;  5LBE A;  1JOB A;  1SLT A;  1W90 A;  2VZ3 A;  3EQE A;  1RIR A;  3O1T A;  4N9I A;  1YO8 A;  2VMC A;  4E27 A;  3T4H B;  5FUP A;  3VDD A;  3H8U A;  4E4Z A;  2OT7 A;  3H9A A;  2VD7 A;  4K21 A;  5FMD A;  3U14 A;  2PHD A;  4CZS A;  1FNZ A;  4UBG A;  4I0A A;  1OLM E;  1UOF A;  4A7K A;  2RDN A;  4RGK A;  4QDQ A;  1YWK A;  1FMD 2;  1AYM 1;  3LIG A;  3RMX A;  2DU1 A;  3NST A;  4RN5 A;  2ZHK A;  4XEZ A;  1NOV A;  1W6M A;  1B09 A;  4GQ7 A;  4ZXE A;  3O1S A;  2FDG A;  1KJL A;  5JOZ A;  1AR7 3;  1CD3 G;  2RS3 3;  1EY2 A;  3PVO A;  1PGS A;  5A3N A;  2MHF A;  1C8N A;  5BNO C;  1VAM A;  4QHO A;  5J3U A;  4JHT A;  4OHZ A;  3PUH A;  1UXZ A;  5FUN A;  3WNO A;  2DFC A;  1HJG A;  3TWI A;  1SDW A;  5A7W B;  4LXL A;  5FXW A;  5JSP A;  2Y6F A;  2O8Q A;  3RZG A;  2WC2 A;  2VQU A;  2RR1 1;  4AXO A;  1LJ7 A;  1Y3T A;  4LEJ A;  3DPR A;  2DUO A;  2WNE A;  4ISR A;  4J1W A;  4EZH A;  5K4L A;  4HN1 A;  4R9A A;  4XUT A;  1LGC A;  3THT A;  3ZO0 B;  3FBM A;  2EXH A;  2Q8E A;  4MYE A;  3NRU A;  2WNO A;  4DNY A;  4NOT A;  1C57 A;  5T54 A;  1H9W A;  4UF0 A;  5FKC A;  1H2K A;  3ZXL A;  4ARX A;  2RS1 2;  3AZW A;  1HXS 2;  2ZMK A;  3RVH A;  2BYV E;  3OOX A;  1DP0 A;  2FZ2 A;  1R08 2;  4MGS A;  4CDX B;  4FPY A;  1S0J A;  3CEW A;  1R1A 3;  3WNK A;  2VGD A;  2D5H A;  4PBP A;  1PK6 B;  3S7I A;  1YC6 1;  1LOB A;  3K4A A;  4QGL A;  4AHZ A;  3U75 A;  5DXD A;  2WYF A;  2CGO A;  3VBS C;  1FYU A;  1J84 A;  2B4K A;  3POS A;  2Q4S A;  4OMC A;  1XE8 A;  5K0U A;  5B4X A;  1N1V A;  2GME A;  1RVF 3;  2WS9 1;  4X8N A;  4YLZ A;  5FRA A;  3WF0 A;  1WBF A;  1SLL A;  5JIA A;  2E9Q A;  1YCI A;  2HBT A;  2DF7 A;  2NLR A;  4EN8 B;  1BJQ A;  5BNN B;  2C24 A;  2N7G A;  3PHM A;  2VTF A;  1U5Z A;  3SH5 A;  3TAY A;  4D6S A;  4Q4W 3;  2E33 A;  5JXJ A;  2YGL A;  4C8D A;  1YI9 A;  2NMO A;  2ORZ A;  5FZA A;  1DQ6 A;  5IHR A;  1Z7S 3;  2EF6 A;  2SBA A;  2Q5T A;  3MUZ 1;  2FMD A;  3TNP B;  4CUG A;  5DAV A;  1XND A;  5FYS A;  5LBC A;  3OF1 A;  2CAV A;  3CLP A;  5CKQ A;  2WZP P;  1IKP A;  1JXN A;  2JE7 A;  1AR8 2;  1XB9 A;  2YRO A;  2GH8 A;  3WW1 A;  4CDW C;  2DCT A;  5C4W A;  2ZX1 A;  4AZZ A;  5C4W C;  5LEK A;  3PVN A;  2QQW A;  5FZO A;  2QQV A;  1RUG 2;  3I8T A;  3GGL A;  3BUC A;  5KWR A;  2PLV 2;  4W50 A;  1CZV A;  1MQT C;  1SCR A;  2ARA A;  2R04 3;  3D0J A;  5JZG C;  2YPJ A;  1QQP 1;  1M06 G;  1EV1 1;  3AZX A;  2D3S A;  4O9E A;  5FY5 A;  2A6V A;  2D6O X;  1B35 B;  2C4X A;  5BV6 A;  1BQP A;  3USU A;  2ZX4 A;  4LIV A;  2XJV A;  3NJZ A;  4XFI A;  4BME A;  1H6Y A;  2WJS A;  1D0G A;  4QPI C;  4QPI A;  2ZKN A;  2JKX A;  3VHP A;  3M3I A;  2A75 A;  3PU8 A;  5EFU A;  4IEX A;  4YW7 A;  1MS5 A;  3HN3 A;  5A6Q A;  2VM9 A;  5AC9 3;  4OQ8 A;  3PIG A;  3IDC B;  4RR3 C;  3ZN4 A;  3ME2 A;  4YVW C;  5C7G A;  2JDH A;  3EYP A;  4K1Y A;  5CFD C;  5JPN B;  2BZD A;  3BKZ A;  2DUQ A;  3DKW A;  5FCC A;  3TOJ A;  2QQN A;  1OA4 A;  5JXI A;  1QOO A;  2GAL A;  2G9G A;  1OUR A;  2R07 2;  3ACF A;  3F2Z A;  3HIF A;  4OMD A;  5CB7 A;  4FPF A;  3HR9 A;  1JH5 A;  5IAT A;  2RS5 3;  1HRI 1;  2P1B A;  1W6Q A;  2A7A A;  4YFZ A;  4ASL A;  1NT0 A;  3ATG A;  2QJV A;  4JHZ A;  1AYN 1;  5GZG A;  4QD2 A;  4H14 A;  2BTV C;  4Q29 A;  4UFL A;  1WA6 X;  4UF0 B;  5T50 A;  3UES A;  3ZR5 A;  3UET A;  3MZH A;  2WSU A;  3GCX A;  3U0Z A;  3TEZ A;  4HT1 T;  3RDI A;  5FK8 A;  3ITQ A;  3MIF A;  4YNI A;  2WBK A;  2WNV C;  3BU0 A;  2XXZ A;  5GLU A;  3TYJ A;  4ES8 A;  4M4P A;  3VBH B;  1KS5 A;  4DEQ A;  4NIH A;  4QQP A;  2YBP A;  1NE6 A;  2QTW B;  2W2I A;  3LKJ A;  3NJX A;  1UZV A;  4QQO A;  2GAU A;  3RZH A;  1F5F A;  1FX5 A;  1SQ4 A;  3A7Q A;  2HWF 3;  1BK1 A;  1GUI A;  3CBN A;  3WCR A;  4DUX A;  2W1Q A;  1RHI 3;  3LEM A;  5GLZ A;  1PO2 1;  2W95 A;  1HB1 A;  4HBN A;  4QX3 A;  3RNS A;  2D5F A;  2WN2 A;  2ZTN A;  5T5P A;  3GZU C;  4PCR A;  3WOG A;  5JVV A;  5A70 A;  3OGR A;  4IGO A;  4OQ9 A;  3MIG A;  1NLR A;  4BCU A;  2A73 B;  5K0U B;  5FZ4 A;  3H8R A;  1LHO A;  4JQT A;  1W8F A;  2E31 A;  1AR9 1;  2WAA A;  4QXH A;  1Q56 A;  4OI4 A;  1QJX 1;  2SLI A;  2VY0 A;  1ZZ8 A;  3PVB B;  1COV 2;  3MLK A;  2IXC A;  4TWT A;  1QKQ A;  5E8A A;  4XZU G;  3GHM A;  3JD7 3;  2EXK A;  5KXD A;  3MLJ A;  1U5Y A;  1ULO A;  2J1V A;  4NPL A;  3MDP A;  3POJ A;  4WVM A;  4BQY A;  4Q5O A;  2XBO 2;  1SAC A;  4XIK A;  4V2V A;  3I2O A;  2CDP A;  4AAP A;  2WZE A;  4QX1 A;  2VOK A;  4A6S A;  5JI9 A;  3LEG A;  4FTS A;  2GP3 A;  5FZO B;  1RGS A;  1DLL A;  1YFX A;  1NA1 B;  4QAW A;  4XQ4 A;  1XC6 A;  1AYM 3;  3WX5 A;  1ENX A;  1WW6 A;  2R49 A;  4J1X A;  1NE4 A;  4QPG C;  1FAY A;  3GNE A;  1QJF A;  4Q4V 1;  5EP9 A;  2X5I A;  1UPI A;  3SNM A;  1MS8 A;  3N7L A;  2HWE 3;  1PO1 2;  3USU B;  2CGP A;  1O4Z A;  3RSJ A;  4K1Z A;  2FDK A;  3K3O A;  1W39 A;  1N3Q A;  2GC3 A;  2W0X A;  3ETQ A;  5FYZ A;  1TQ5 A;  5FMB A;  3T2Q A;  2A5Z A;  1XYO A;  1H1I A;  4G4F A;  2EXJ A;  4MET A;  4M3C A;  3SH4 A;  3I2F A;  2HWD 1;  1UW8 A;  2RR1 3;  4Y1Z A;  1G7Y A;  2GND A;  3HN1 A;  5C71 A;  3Q8C A;  3I49 A;  1VRB A;  1YUD A;  1Z0H A;  4E2S A;  1EPZ A;  2B42 B;  1N1T A;  4JDM A;  1ZX5 A;  3LE0 A;  2V4A A;  1JMU B;  3KGZ A;  4XDO A;  3RFR A;  5A6Y A;  5JOY A;  1G8W A;  3RYR A;  3POW A;  5JR2 A;  3AKS A;  5CU1 A;  4OUM A;  2VBD A;  1X33 A;  2BER A;  4JRA A;  3EB7 A;  3B00 A;  1SBF A;  3W9A A; 
#chains in the Genus database with same CATH homology
 4CUC A;  2ZEY A;  1W0N A;  2VCA A;  2YC2 A;  5DN2 A;  3CDZ B;  2ZEZ A;  3I2K A;  2YFZ A;  1PX4 A;  3THD A;  2JDA A;  3ACI A;  2W46 A;  2WAO A;  3OGV A;  3E1F 1;  1JZ6 A;  2L9L A;  3ABZ A;  3C7E A;  4CU8 A;  3DYO A;  4P02 B;  1K3I A;  3T2P A;  5JUV A;  3III A;  1P8J A;  2ORX A;  3A22 A;  1UY1 A;  4IUG A;  4MAD A;  3K4Z A;  4GWJ A;  3OEA A;  1NUK A;  2WO1 A;  2Y64 A;  1XPW A;  3CZU A;  1YQ2 A;  4FI9 A;  4BK4 A;  1DLC A;  1GMM A;  4LPL A;  1UXX X;  3WF3 A;  1UY2 A;  1EUU A;  1UYY A;  4LKS A;  4PF1 A;  4MGQ A;  2QQJ A;  3W5M A;  1W8N A;  3T0B A;  1PMH X;  2ID4 A;  4CU7 A;  1K42 A;  3SKV A;  2RJ2 A;  4DXT A;  5F7U A;  4KMQ A;  3HNB M;  3CQO A;  2W91 A;  1HN1 A;  1KGY A;  2VZO A;  1W9W A;  1O59 A;  4XUR A;  2WZ8 A;  2BGO A;  2W47 A;  4QDS A;  2J1R A;  3HEI A;  5EJZ B;  4ZZ8 A;  2VZU A;  3T0A A;  2HLE A;  2XHN A;  2YC4 A;  4L0P A;  2XON A;  1T2X A;  2V72 A;  1GOF A;  3GDB A;  4MOA A;  1J83 A;  2HYX A;  1MPX A;  2WAB A;  2V5D A;  4XUP A;  5LCW L;  1JYW A;  3LPG A;  1UY0 A;  2QQO A;  1UX7 A;  4UI9 L;  3C7O A;  4W4Z A;  4YPJ A;  3SEE A;  3WSO A;  2EIE A;  4OZO A;  3W5N A;  4D0Q A;  1JI6 A;  5JXH A;  2VCB A;  3NJV A;  3OBA A;  2DCK A;  3A23 A;  4AG4 A;  1GOH A;  2WO3 A;  3DYP A;  4KI5 M;  2J1A A;  3MV1 1;  2QQL A;  2Y6K A;  4A3Z A;  1JHJ A;  2BBA A;  2WUH A;  3WNP A;  2QQI A;  4TTG A;  4E8C A;  4D8M A;  5FUI A;  2X10 A;  2W5F A;  2VC9 A;  3FN9 A;  3LPF A;  1PMJ X;  3T2O A;  4GZ9 A;  4KWU A;  1JZ8 A;  2VZP A;  5JMO A;  3NNG A;  3ZM8 A;  1OH4 A;  2EIC A;  4RYD A;  1RYY A;  3SEP A;  5B4N A;  3P6B A;  5LA2 A;  1JU4 A;  4HG6 B;  4QDR A;  3LQC A;  4E8D A;  3NQH A;  1F4H A;  4PQQ A;  4DUV A;  2QQM A;  3P1I A;  2E32 A;  2W1U A;  1NX9 A;  1W99 A;  1UWW A;  5J1X A;  3I2G A;  2VZV A;  3LEI A;  5IFP A;  4TXW A;  2VL4 A;  3T08 A;  2DDU A;  2ZEX A;  4BDV B;  4DUW A;  1F4A A;  3IAP A;  4BJ0 A;  3HNM A;  1JZ4 A;  5DQ0 A;  2VJX A;  3JXS A;  5HPO A;  3D3A A;  4PT6 A;  4P08 A;  3C7F A;  3I3B A;  4QPW A;  1JYX A;  3GXU A;  1CZS A;  1UZ0 A;  4LHS A;  4W8J A;  1NKG A;  2JE8 A;  2EID A;  2J7M A;  3WEZ A;  2Y6J A;  5IFT A;  3K4D A;  3SKJ E;  1OT5 A;  3WNN A;  2YFU A;  4M4R A;  1BHG A;  1JU3 A;  4QB1 A;  4Z2A A;  3BGA A;  1UY4 A;  2WYS A;  3MO4 A;  3FHQ A;  1W9T A;  2QQK A;  3CKH A;  5EIY B;  3K46 A;  1IQD C;  2Z4F A;  1OF4 A;  4GWI A;  3VDB A;  1SHW B;  3GM8 A;  5HXM A;  2VZ3 A;  4P00 B;  2VMC A;  1L7Q A;  2C9K A;  2LW8 A;  2ZEW A;  3HOB A;  1W9S A;  4XUQ A;  3J7H A;  5DMY A;  1JZ3 A;  4QDQ A;  2VZT A;  2VME A;  1I5P A;  2Y6G A;  4RN5 A;  2Y8K A;  4ZXE A;  4XUN A;  1GNY A;  3HJR A;  3THC A;  1R64 A;  3LEK A;  3PUH A;  1UXZ A;  3WNO A;  1OF3 A;  5A1A A;  2VMF A;  3IB3 A;  3WQB A;  2VQU A;  1US2 A;  1SDD B;  3ECQ A;  4QB6 A;  3CZJ A;  4JKK A;  1GU3 A;  4ARY A;  2EIB A;  3C7H A;  3MV0 1;  4XUT A;  4QB2 A;  4OUE A;  3I3D A;  2VZR A;  1CIY A;  2VMD A;  4A45 A;  4CUB A;  2WN3 A;  1D7P M;  3NRU A;  1UY3 A;  3K77 A;  2VQT A;  2C26 A;  2XQX A;  4ARX A;  2CDO A;  1DP0 A;  2VO5 A;  1JYN A;  4MGS A;  1PX3 A;  2VZ1 A;  3WNK A;  3FL7 A;  3OGS A;  2OKX A;  2V4V A;  2J1U A;  3K4A A;  3C7G A;  2W94 A;  3IAQ A;  5CYY A;  4A41 A;  1J84 A;  2B4K A;  2W1W A;  3VD5 A;  4OMC A;  3ACG A;  3VDA A;  5EJ1 B;  5B4X A;  5G04 L;  3WF0 A;  3VD9 A;  1GQP A;  1JYV A;  1WKY A;  5DPN A;  2VTF A;  2WO2 A;  5CZK A;  5JXJ A;  2E33 A;  4BXS V;  2ORZ A;  5IHR A;  4P5Y A;  3MUZ 1;  4ZZ5 A;  1CX1 A;  2RV9 A;  3HNY M;  2J1E A;  5IYY A;  2LS6 A;  3I3E A;  2J1T A;  3GGL A;  3I2H A;  2YG0 A;  1UYZ A;  4W50 A;  1CZV A;  4A4A A;  1UYX A;  1H6X A;  1LNS A;  1O8S A;  1TG7 A;  1JZ7 A;  3C8X A;  2C4X A;  4MO3 M;  3U37 A;  4AAX A;  1OD3 A;  2VZS A;  1ULP A;  1H6Y A;  4CU6 A;  3DEC A;  2JKX A;  4JKL A;  2Y6H A;  5G05 L;  1XNA A;  3DYM A;  2XOM A;  3HN3 A;  2VM9 A;  3WNM A;  1XNT A;  3CMG A;  5C7G A;  3EYP A;  5I0D A;  2BZD A;  3IDA A;  3MUY 1;  1SG3 A;  2QQN A;  4A42 A;  4BK5 A;  2W3J A;  2VZQ A;  5JXI A;  3F2Z A;  3ACF A;  1W8O A;  3BN6 A;  4OMD A;  4DXR A;  2E26 A;  1WCQ A;  1JZ5 A;  1UMI A;  4UOJ A;  3VDC A;  4OYU A;  1US3 A;  3I2I A;  2W9X A;  1O8P A;  4QX2 A;  4JHZ A;  4XVH A;  2W92 A;  3UES A;  1DYO A;  2ZXQ A;  3UET A;  3CIH A;  3I97 A;  3A21 A;  1TVG A;  3T09 A;  2WBK A;  4DXS A;  4M4P A;  4ZY9 A;  4DEQ A;  1NAE A;  4CVU A;  5JXG A;  2R7E B;  2KD7 A;  3NJX A;  3UNP A;  5C70 A;  3A7Q A;  1GUI A;  5LA0 A;  1EUT A;  2W1Q A;  4DUX A;  2W95 A;  2YB7 A;  1CZT A;  4CUA A;  2X05 A;  4QX3 A;  3ACH A;  2WN2 A;  1K45 A;  4JX0 A;  3K75 B;  3OGR A;  2J22 A;  3AC0 A;  5LA1 A;  3OG2 A;  1UMH A;  2DCJ A;  3VD3 A;  1KEX A;  2E31 A;  2WAA A;  2VR4 A;  3HPN A;  2JD9 A;  2BGP A;  3WNL A;  4LQR A;  2WQ8 A;  2QBX A;  3VD4 A;  2X09 A;  4XZU G;  3OEB A;  5IJR A;  1ULO A;  2J1V A;  3I2J A;  4QX0 A;  2RVA A;  2CDP A;  4DEV A;  4JKM A;  2WZE A;  4QX1 A;  3LEG A;  3ETP A;  1JZ2 A;  2VCC A;  2PQS A;  4QAW A;  1XC6 A;  4A44 A;  4CU9 A;  2VOT A;  2B9V A;  3PUI A;  3FHA A;  2Y6L A;  1L7R A;  3OB8 A;  2W1S A;  3WF1 A;  3T0D A;  3MBW A;  3T2Q A;  4XUO A;  3WF4 A;  2J1S A;  3I2F A;  2W87 A;  4UAP A;  4A6O A;  5C71 A;  3WF2 A;  1K12 A;  3LE0 A;  3VD7 A;  4ET7 A;  1GOG A;  5JR2 A;  2WDB A;  2BER A;  3EB7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...