1UXZA

Carbohydrate binding module (cbm6cm-2) from cellvibrio mixtus lichenase 5a
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
131
structure length
131
Chain Sequence
MVIATIQAEDHSQQSGTQQETTTDTGGGKNVGYIDAGDWLSYAGTPVNIPSSGSYLIEYRVASQNGGGSLTFEEAGGAPVHGTIAIPATGGWQTWTTIQHTVNLSAGSHQFGIKANAGGWNLNWIRINKTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the Family 6 Carbohydrate Binding Module from Cellvibrio Mixtus Endoglucanase 5A in Complex with Oligosaccharides Reveals Two Distinct Binding Sites with Different Ligand Specificities
pubmed doi rcsb
source organism Cellvibrio mixtus
molecule tags Carbohydrate binding module
molecule keywords CELLULASE B
total genus 30
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1uxzA00
1UY3A 5JUVA 1WKYA 1HN1A 4QAWA 3GDBA 3OGSA 1PMHX 4FI9A 2JKXA 3VDCA 2W9XA 3P1IA 4PT6A 2W46A 2J1EA 2RVAA 5G04L 2VCAA 3I2GA 1OH4A 4XUTA 4OUEA 2VZVA 3W5MA 3GXUA 3EB7A 2W1SA 2VQUA 5F7UA 1JZ8A 4QDQA 5JXJA 2VC9A 3HNBM 3I2JA 1TG7A 2W1UA 4ZZ8A 2WO3A 2RV9A 4BK5A 3OGRA 3UESA 4M4PA 3I3BA 4LKSA 1JU3A 2WO1A 2CDPA 4QB2A 4P02B 1JZ2A 4XURA 4CUCA 3WNKA 1JZ7A 1K45A 1GNYA 3HPNA 3WNMA 4XVHA 4DEQA 2YC4A 4AG4A 1BHGA 1F4HA 1O8SA 3ACIA 4BDVB 1GMMA 3OBAA 1UX7A 3HNMA 2EIDA 3ACHA 3SKVA 2C9KA 4ZXEA 1R64A 2J1SA 2VR4A 2X05A 4QPWA 2XQXA 2VMCA 3GGLA 1K42A 4QDRA 5DMYA 3MUY1 2J1RA 3CZUA 1UY4A 2E26A 3LE0A 1LNSA 2J7MA 3A21A 2YFZA 3A7QA 2V5DA 2QQNA 5FUIA 1DP0A 1L7QA 4LQRA 2PQSA 2ORZA 4YPJA 1SG3A 2VM9A 5JXGA 3LPGA 1W8OA 4MGSA 4DEVA 2W94A 5IHRA 3CQOA 1NKGA 4KMQA 3I3EA 3T0BA 3HN3A 4PF1A 2C4XA 2W5FA 4W8JA 1NX9A 2ZEYA 3WNLA 3SEPA 3GM8A 3T2OA 3THDA 1SHWB 4JKMA 4UOJA 3LPFA 3WSOA 4CU9A 4UAPA 4KWUA 3F2ZA 2WQ8A 3VD5A 2VOTA 2J1VA 1GUIA 3MV11 3E1F1 3C8XA 2J1TA 3OEAA 1KGYA 2W1WA 2VZ3A 1RYYA 3PUIA 4IUGA 3W5NA 5A1AA 1W9SA 3T0AA 2WAOA 3VDBA 2Y6LA 2VZTA 3ECQA 3IAPA 1CZVA 1JYWA 3CDZB 1W9TA 4MGQA 2J1AA 3WF1A 2DDUA 1O59A 4A45A 1W0NA 2L9LA 5IYYA 1UYZA 5DN2A 4DXRA 2YB7A 4XUQA 2BBAA 3IB3A 4XUOA 2WN2A 3FHAA 4CUBA 1JZ3A 4P08A 2VCBA 4CU6A 1UXXX 2R7EB 3T09A 1GOGA 4XUNA 2WUHA 1OD3A 2W47A 5B4NA 2B4KA 1H6XA 4QX2A 5LCWL 1I5PA 1CX1A 3UETA 2DCJA 4DXSA 2E33A 2BERA 3MV01 1UY2A 3HEIA 4DUWA 2EIBA 4RN5A 1JHJA 5JR2A 2J22A 3OGVA 4BJ0A 1US3A 4DUXA 3MUZ1 1OT5A 4ZY9A 1JZ6A 5EIYB 3MBWA 1NUKA 1K3IA 3SKJE 3VD3A 5JXHA 3T0DA 4E8DA 2BGOA 3K46A 3T2PA 2QQJA 3J7HA 4OMCA 4A6OA 4P00B 3WF0A 2C26A 1D7PM 2JE8A 4A41A 2Y6GA 2E31A 2W1QA 3WNNA 3C7EA 4UI9L 4D8MA 3LEKA 2QQMA 4TXWA 3VDAA 3A23A 4Z2AA 3UNPA 5G05L 2LS6A 1ULPA 2Y64A 3HOBA 1W9WA 4PQQA 1IQDC 1YQ2A 2V4VA 4JHZA 1PMJX 4M4RA 3FL7A 3MO4A 5IFPA 1JZ4A 2HYXA 2W92A 3K4DA 2QQLA 5C70A 2VMEA 2CDOA 3NRUA 1GOHA 4GWJA 3T08A 4MADA 1W8NA 2WZEA 3DYMA 4BXSV 1EUUA 2W3JA 2J1UA 3WNPA 4CVUA 3OG2A 4QB6A 4L0PA 2ZEXA 3NJXA 4CU7A 3PUHA 1GOFA 4ARXA 3CKHA 3WEZA 3WF3A 3SEEA 4P5YA 2VZQA 4MO3M 5B4XA 1UY1A 3CIHA 3I3DA 3NNGA 2V72A 1UWWA 1UXZA 2ZEZA 2W95A 2X09A 3BGAA 1DYOA 4QX0A 5EJ1B 2Y8KA 1EUTA 3C7GA 1W99A 4W50A 1WCQA 2VMDA 3LEIA 2VZRA 1JYVA 2E32A 2EICA 5LA0A 1CIYA 1O8PA 2VTFA 4A42A 4BK4A 1TVGA 3IAQA 1OF3A 4A4AA 1J83A 2XHNA 2ID4A 5DQ0A 3LQCA 1J84A 3CZJA 4DXTA 3CMGA 3D3AA 2EIEA 2XOMA 4OMDA 2VCCA 5J1XA 1NAEA 3ABZA 2Y6HA 5LA1A 1JYXA 3DYPA 2QQIA 4LHSA 4OYUA 5CYYA 4ZZ5A 2XONA 2VMFA 2ZXQA 1PX3A 1ULOA 5HXMA 5C7GA 4HG6B 2ZEWA 4JX0A 4JKLA 2QQKA 1K12A 4XZUG 2QBXA 1XNAA 3A22A 3AC0A 3THCA 2DCKA 1XC6A 2ORXA 3BN6A 2YC2A 5IFTA 1H6YA 4D0QA 3NJVA 4XUPA 5EJZB 1P8JA 3P6BA 2HLEA 2JDAA 4LPLA 5C71A 3WF4A 5DPNA 1F4AA 3C7HA 1UYXA 4A44A 5I0DA 3FN9A 5IJRA 2Y6KA 4MOAA 1T2XA 3FHQA 1PX4A 2BZDA 4QDSA 4KI5M 4GWIA 3VD4A 3WF2A 2WN3A 4E8CA 1DLCA 1KEXA 1CZSA 1JZ5A 4QX3A 2VO5A 3VD9A 4W4ZA 3ACFA 2QQOA 1UMHA 3WNOA 4AAXA 3K4ZA 3NQHA 5LA2A 2RJ2A 3T2QA 3I2HA 2WZ8A 2WABA 2YG0A 1OF4A 2KD7A 4QB1A 3OEBA 2BGPA 4DUVA 4ARYA 4JKKA 2Z4FA 2VL4A 4CU8A 4GZ9A 3U37A 3HNYM 3JXSA 1US2A 2VZPA 3HJRA 2WO2A 5JMOA 2VQTA 2VZOA 2W87A 1CZTA 3IDAA 5CZKA 4CUAA 1GQPA 1UZ0A 3DYOA 2YFUA 1UMIA 2W91A 3I97A 2WAAA 1UY0A 1MPXA 3K77A 3C7FA 5JXIA 3IIIA 3I2KA 3ACGA 1JU4A 2VZSA 5HPOA 1XNTA 3OB8A 1JI6A 3WQBA 3DECA 3K75B 2OKXA 3EYPA 3VD7A 2JD9A 4TTGA 1JYNA 2B9VA 1SDDB 2X10A 3ZM8A 1UYYA 1XPWA 3K4AA 4A3ZA 4ET7A 3I2FA 4QX1A 2VZ1A 1GU3A 2Y6JA 2LW8A 3ETPA 3LEGA 2WYSA 1L7RA 4OZOA 4RYDA 2VZUA 3I2IA 2VJXA 3C7OA 2WBKA 2WDBA
chains in the Genus database with same CATH superfamily
1BJQA 2VTXJ 4FOQA 1PGL1 1WKYA 2X8KA 1HN1A 1ZBE3 3CJIC 4CDXB 1V6OA 1LJ7A 3AP6A 2ZA9A 1MQTB 3QLQA 1HRI2 4O65A 2P17A 4R4ZA 2ZJCA 1EV11 2VCAA 3KQ4B 1MS4A 5G04L 5FP7A 4NPRA 5I0RA 4DINB 1YLLA 3O0WA 4OUEA 4Q4V2 4OQ9A 2MNGA 1VBD1 4J1WA 4LLOA 5GLZA 3VBSC 4BQ2A 5A33A 2CGOA 3GXUA 5L9BA 5E16A 2D7FA 4PLMA 2QDRA 3BTAA 2W1SA 1W6MA 4HL0A 4UW6A 1LOEA 2TEPA 4LBQA 4AK3A 1YJKA 4CEWA 5BNPB 1WMXA 1DU3D 3PLQA 1CPMA 4FOWA 4ZZ8A 2RV9A 1AR91 1HRV2 1K5JA 1V6NA 3MFAA 4D6SA 5JAXA 1KXGA 3U10A 4Y1VA 1X9TA 4ITCA 3WX5A 1TZOA 1FPN1 3PURA 3TWIA 4AEJA 1RVF1 4E4ZA 1YFXA 1ZVFA 3H8OA 1OQEA 2OZ6A 2P6HA 1W8HA 1ODNA 3PU8A 1BBT3 1DGLA 4XURA 1AR83 1WW4A 2ENRA 3LSEA 1QKQA 1K45A 2EXKA 3WNKA 1GNYA 1KQRA 1WLCA 3WNMA 1JZ7A 4YW5A 5FZCA 1VBA3 1ZBA2 2E7QA 3VN4A 1ULEA 4AEDA 3ACIA 1RHI3 3HNMA 3RZGA 5J09A 1ASJ2 4OI1A 4YFZA 2WRAA 3ACHA 3HQRA 3SKVA 2A6WA 2WO7A 3WP3A 4ZXEA 4XFAA 5AC93 1QOTA 3OUHA 2VR4A 1ULFA 2VUDA 4ZU5A 1K42A 4L97A 3RGBA 1J1TA 2JDUA 5FYSA 4CP2A 1W03A 2GMMA 3VBHC 1DIWA 3W58A 4Q8LA 5DZFA 1H2LA 2A6ZA 5KHHA 2JIGA 5JZGB 4IEWA 2J7MA 4N8MA 5IAVA 1Y9QA 3A7QA 4X8PA 1LEMA 2D93A 2XMLA 2Q8DA 2QQNA 1UPIA 3VZNA 4YVSA 1CVNA 1LOCA 1V6IA 2PHWA 3KQRA 3ZN4A 4FXKB 1SZBA 5FUIA 1OKOA 1DP0A 2A71A 4CDWC 3W9AA 4RR3C 3T4HB 5DDJ2 2WJSA 1S0FA 3AP9A 3QACA 3WVJA 5JOWA 3Q8FA 1W8OA 5A7OA 2ZHMA 2R041 3CQOA 3QCWA 1ND2C 3VBSB 4P9LA 3I3EA 1CQ9A 4QD2A 3CHXA 3HN3A 4WV8A 5DUXA 2JDZA 1H30A 4Q29A 2C4XA 3PU3A 1NCRB 1W9YA 4W8JA 3RYKA 4OHYA 1NX9A 1DZTA 3GZUC 3IZOA 3SEPA 2OQ6A 3ENRA 3KVAA 1ZX5A 3GCXA 3GM8A 1RMU1 1VB2A 4QKBA 2PXJA 3UGHA 2A3XA 4HN1A 4XQWA 2BBVA 2WKKA 4DRVA 4A3XA 1TEIA 3AYCA 3CJIB 2K2SA 2HWC3 4WZCA 4CDXC 4CU9A 3V0AA 4HZFA 1EAH3 3AZYA 3WT3A 1OXCA 3ZIWA 2IVJA 1QIQA 3MGUA 1YCIA 4DS0A 3C8XA 3JBG3 2J1TA 2R30A 3ILNA 4KWLA 4Q1RA 2RR12 3L2HA 3TOJA 1QQP1 2W1WA 5IVVA 2VOVA 2VZ3A 4HOOA 5FO7B 4CRQA 1RB8G 1C5HA 5FZIA 2RMU2 4RS5C 2ATFA 3ZKUA 3DPRC 1W9SA 4ATEA 3APBA 2WAOA 3VDBA 3TB0A 1W0PA 2VZTA 3UK9A 2BFUL 1LHNA 5F2WA 1QH7A 5FZ1A 1MZFA 4GALA 1W9TA 2D6MA 4DRRA 4NAMA 4MGQA 5FBZA 4DFSA 2SBAA 4FTEA 1A78A 2MHFA 3NAPC 1F5FA 2L9LA 5FQ0A 1GV9A 5A80A 4COWA 5IVCA 4UFJA 3DN7A 4DXRA 1UKGA 4XUQA 2ET7A 3IB3A 5JSOA 4K21A 3RMYA 4UYBA 4P08A 2YGLA 2I74A 2Q1FA 3J7LA 4M3CF 4YWAA 3TN93 5JOYA 1UXXX 2R7EB 2XJRA 1SACA 4XIKA 4BA6A 5GZCA 2F4PA 1OLQA 1OLMA 1GOGA 4XUNA 4YVSB 4G3YC 3BCWA 2IXJA 4Q0PA 2W47A 5CA6A 1AR72 4M0HA 4Q4Y3 3AP7A 1SBDA 1I5PA 1NOVA 1TNRA 2FCVA 4OZXA 5LZ6A 3MIBA 1HX6A 4NHLA 2C5DA 3O1PA 5LBBA 1HDKA 1C1FA 2BERA 4XBNA 3MV01 5J98B 4YM3A 3ITQA 4DNYA 4RQPC 4Q4W3 2PN5A 4Q4X2 4RSUA 4DUWA 5C3SA 2VXJA 3WUDA 3OUIA 3AL5A 1XE8A 2WC2A 3OGVA 1CX4A 5FKBA 4PI0A 4DUXA 1BVP1 1VBC3 4CPBA 4IW3A 4QWNA 4YM0A 1OT5A 4ZY9A 5CVRA 3GALA 4KGGA 5EIYB 3VDDC 4YG3A 1NUKA 1MS3A 1DGWA 3SKJE 3VD3A 4WVMA 3B69A 4YNIA 4Y4YA 5SV8A 4QHOA 2HWF1 4IEQA 4NWVA 2RS13 4A6OA 1JBCA 1RUE2 1DG6A 2DYCA 2WLPA 3FLTA 1OVPA 4AZZA 4CP1A 4NIGA 1D7PM 1ZZ7A 2HWD2 1YI9A 2ZCWA 4A41A 4MGZE 2P6CA 4A7KA 3WNNA 4CDUB 4X6RB 1DQ4A 2G1MA 3V0BA 1CJDA 1DGRA 1HKDA 2QQMA 4TXWA 4XYXA 1Q8PA 4NRQA 5FYVA 5DAQA 5F8PA 4A7ZA 4MG2A 1ULPA 2H6CA 4GD4A 3HOBA 1KFXL 2F6BA 5AFEA 1VBD3 3U4XA 1PVC2 3VHPA 3AYDA 3RJRA 1D0GA 3ZSMA 1JMUB 3PIJA 3WCRA 1HV0A 1LEDA 4XETA 3TNQA 3VBUC 3WUCA 4AHZA 1YRZA 4Q4Y1 3RWNA 4BQXA 5JIUA 1XNDA 2P37A 4P5HA 2QZ2A 5C70A 1MS0A 3AYAA 3RRDA 1F5JA 3NRUA 3S7IA 1IZ3A 3AMPA 1IS5A 1W6NB 2WZEA 3ZFGB 3KV4A 4LBQB 3PVEA 3W59A 1QJY1 5A3UA 3ZXGA 2W3JA 2GNTA 4FPLA 1ALYA 3WINE 4CVUA 5F9TA 1IHMA 3OBTA 1X9PA 5KXBA 5FFOC 1H8TB 1GOFA 4OI4A 4JVAA 3ZYHA 1E57A 1UZZA 3RVHA 2DWRA 2XJQA 3VDDA 3WF3A 1PK6A 4P5YA 2XGXA 1WD3A 1YJLA 2GMEA 4MO3M 1OPMA 2RS11 3B93A 1D2SA 4QPIC 4XABA 1MQTA 3OGGA 4GWNA 4LXLA 4NPMA 4CP9A 5IATA 2WL1A 5FUPA 5CADA 5D8AB 1FI2A 1UNBA 4FPEA 3RZZA 2VXRA 4CE8A 3FWEA 5FZFA 3R6SA 5FOBB 1UXZA 3MIGA 2VNRA 1ZZ8A 3S5AA 3VBFB 4XDQA 3BGAA 2OQ7A 5BYNA 2CNAA 4Y20B 3I7DA 1JUHA 2DV9A 3ATGA 3GF6A 1DYOA 5FY8A 1AXYA 1GBGA 4ES8A 2OVUA 4NPLA 3VL9A 4XF0A 5AFBA 1U5ZA 4HFSA 3VZJA 1AR73 3WW3A 1W99A 1AR63 1YQ8A 2GH2A 2VAUA 4QM8A 2FDGA 5A1LA 5IWFA 2VMDA 4NRMA 2BVBA 2W39A 3LEIA 1ZRIA 4NHYA 5A7SA 1C57A 4HXCA 3IKWA 2XJVA 3MEPA 2CGNA 2HWB1 2RJKA 3PHMA 1FOD3 1EPWA 2EICA 3KV9A 1VRH3 4LE3A 1IQAA 2VTFA 4QGMA 3VKMA 4A42A 3B01A 4RGKA 5AC91 4DY3A 3SLIA 4BK4A 1Q5OA 4Z8BA 2AENA 1HQLA 1O4YA 2LALA 2XLFA 1TME3 1OF3A 1KD7A 5I8SA 4CCMA 5HCHA 3DUIA 3ZMOA 1GYKA 2ID4A 2C1FA 2QVSB 3LQCA 1J84A 5DQ0A 3O12A 2WNUB 1K5MB 1UZYA 4MXWB 4MLOA 4PQ9A 5J1XA 3ABZA 3WDWA 1YO8A 2VBDA 1JYXA 4YZ1A 2OPKA 4LHSA 4HETA 3RZLA 3I8TA 2XWJB 1EYBA 5CYYA 4I30A 5ACA1 2XONA 3ZPOA 1LR5A 3MPBA 1JUIA 5A3TA 4WM7B 3FC0A 4HG6B 5LB6A 2FDFA 5EJ3A 1Y3TA 1VP6A 2IVIB 2ZABA 4QPGA 4Q1PA 4RHV1 1Y9GA 5FP9A 2RR13 2QBXA 3IBMA 3KHBA 3N9OA 4XZUG 5F5QA 4CA9A 4IESA 1XNAA 4Y5SA 3I54A 4LOTA 3VGIA 3A22A 1WLTA 2HBUA 1LHUA 2GZWA 3DL3A 2A3WA 1RHI2 2ORXA 2BNMA 2XBO3 2XWBB 4NHMA 2VG9A 3BN6A 3RYRA 2BDRA 3M4FA 1FV3A 5FYIA 1JTZX 3VHNA 1XNKA 1H6YA 1F15A 1QDCA 5FZHA 3KCCA 2XJSA 3MHZA 2XLGA 1SLIA 4Q8KA 4B4QA 2QFEA 1GZ9A 2Q30A 5FJHA 4EWDA 2B42B 3UJOA 2UY8A 3ACLA 3NSTA 1QDOA 4R8HA 3JD71 4EZHA 1K5MC 1QJZA 3OSDA 4Y22A 3NNFA 4XJ8A 4W6YA 1W6MB 3MPPG 4CEYB 2FBEA 1YFYA 3KWVA 4LO5B 5E88A 3ZFFB 4WBBA 3FE5A 4YW2A 3WDTA 5I0DA 4CDQB 3L2YA 4XDOA 4CP0A 4MGIE 1PX4A 5FK8A 2ZBJA 4FFFA 3S30A 1F35A 3PUQA 3JUUA 1POV1 4QQPA 3D82A 4N53C 4AR2A 1RVF3 4E8CA 1XJAA 4OLLA 2VO5A 3POWA 3WD5A 4EN7B 1W05A 4RHV3 1AL21 3ACFA 2QQOA 1XQNA 4Q0SA 3WNOA 1GR3A 2UWCA 4AVVA 5M0TA 5EXOA 2DVBA 3NQHA 4ASMB 3I2HA 2B45X 2WZ8A 2ZGQA 2YG0A 4GH4A 4QB1A 3NV2A 3M3QA 5J37A 2VW2A 1RUD2 5FZMA 3J8F3 1H0BA 1J1LA 3LDKA 3U11A 4P9WA 1O4ZA 4XJUA 4JKKA 4DZGA 2VL4A 2V09A 4I3GA 1UL9A 2WQ4A 4QPIB 3VBUB 3LEMA 3HNYM 2CV6A 3BALA 3E97A 4NHKA 4Q4W1 3K51A 3TYJA 1RUF3 2DUPA 2KA3A 2F4LA 5DABA 2HWC1 1STMA 2E51A 1IOAA 3M70A 1ZBE1 3NV4A 3OD4A 4BXFA 4E4SA 4EN9B 3J8F1 4WM7A 5FPAA 4BQ4A 2AREA 1LGNA 1ND2B 2VQTA 1S0EA 2GC0A 2VZOA 3EMRA 1AR81 2CY6A 2EXHA 4JGZC 4RGGA 5I0TA 1EPZA 4BQWA 3BU0A 3ZPYA 2C9AA 1QMJA 2NYYA 5K9YA 2ZZJA 2EXJA 1UMIA 4INDA 4K9SA 3NV3A 2PHFA 2WA4A 3JB8A 2XR4A 2VPVA 3MDPA 1E5IA 5CKNA 3LAGA 4DXZA 1RUJ3 1QXPA 2Q8OA 5JZGC 5AVPA 4DOUA 3AVSA 5L7OB 3HQXA 5AVAA 2NP0A 5C8CA 5CNAA 1POV0 5EFUA 1BLZA 5IVJA 5JOZA 4K8FA 1JI6A 1TMF1 2A5ZA 2WZPP 1ZREA 3TEWA 5CAZA 3MF6A 2A7AA 3ZDSA 3VD7A 1IS3A 1DQ1A 1VBB1 3E5UA 4N43A 5FZEA 3UGGA 2B9VA 2ZGSA 3BODA 4CUGA 5K0UB 5L36A 1PZ9A 1G6NA 4CDUC 5J48A 2MEV1 4ET7A 2RM23 4NRPA 1AR71 2Y6JA 1PO13 2GP5A 4XILA 3WNXA 4OZOA 3OGJA 2BVVA 3WW2A 4CEYC 2JDYA 2DVDA 3I2IA 2VJXA 5DZEA 5EWSA 3SH3A 1QJY3 3FLRA 4WM8B 4XCBA 3VDDB 2QQVA 3ZYRA 2WDBA 5L73A 4P9IA 3ZSLA 1CAXA 3H7JA 2B46X 2BYVE 3GDBA 1PMHX 1SCRA 4UT5A 2R061 5D8AA 5HV0A 4I02A 1UU5A 4EYUA 3H42B 2W46A 3G7DA 2J1EA 2XL9A 2HWD3 4R9BA 1W8ZA 5LK5A 4BLJA 1FOD1 3I2GA 1W04A 4K1ZA 3ZN6B 4KH9A 3O1MA 2VZVA 1H8TA 1OUSA 5I8YA 5DAWA 1CAUB 1YI7A 1GZCA 5JR7B 1QWRA 4FXGB 1I9RA 3DKWA 4YVSC 5ACA3 3IMMA 2BGCA 5F7UA 1F9KA 1REFA 1XSRA 2ZTNA 2VC9A 2DVAA 2YU1A 3HNBM 5C8CC 5ABJA 1CD3G 5T50A 1WZXA 1VBC2 2CTVA 4IGPA 2ZACA 3AMNA 4S2DA 4WM7C 2W1UA 2E6VA 4AI1A 3UESA 2UWBA 1H2KA 2WA3A 4NWWA 2Q1MA 2EALA 2KXLA 1YC61 1PNFA 5GALA 1I3HA 2P5BA 2PFWA 5DUUA 2A73B 3ZR5A 2B7YA 1BMV2 1BZWA 5CFCB 1XU2A 4P02B 2R071 1JZ2A 2WNUC 2RS32 4N43B 3HPNA 5LBFA 2D3SA 1DQ2A 4AI2A 3VBOA 1PM4A 1O8SA 1WLDA 2PHLA 4LBMA 1GMMA 1YEWA 2ZAAA 2QUOA 3OBAA 4EV0A 4YLZA 5T54A 1G8WA 3IN9A 5ABJC 1W2NA 4V2VA 3ASIA 1E5RA 3SCHA 2C9KA 4H2AA 1R64A 2J1SA 3WOGA 2BJSA 3VUOA 5FZKA 4QPWA 3GGLA 1COV1 5DMYA 5F5CA 5FZDA 3AFKA 1B35B 4N90A 2BPA2 3MUY1 1FATA 4JQRA 4YG6A 4EROA 4XE9A 2P3IA 2RDSA 2Q8EA 2IXCA 5IVBA 1W2UA 3GHNA 1SCSA 5FZ3A 3UKVA 2Q4SA 5LA9A 3RWKX 2D98A 2WS93 3NKGA 3KB5A 2V5DA 3KGLA 4IE6A 2R0HA 3UL2A 5T5LA 3V0BB 1OUXA 3I49A 4YM1A 4LO4B 1KITA 4LQRA 1VBC1 2JEMA 1SG3A 4S2GA 5JXGA 5T5OA 1WCDJ 3UKTA 3V65A 1W6PA 1NKGA 3HD8B 4KMQA 3M1HA 2XBO1 3T0BA 5BNQA 4MX3A 4MXVA 2XJUA 3ORJA 4H7LA 2W5FA 5F39A 4BQ5A 2X53S 1FOD2 4S2FA 1HB1A 2GMPA 3WNLA 2HWC2 1C4RA 4LNVA 3MICA 3T2OA 4W6XA 3THDA 2RDQA 3FMGA 1H8TC 1DFQA 3H1WA 3JCIA 4JKMA 3RZJA 5FAXA 3FZ3A 3S7EA 3LPFA 1E5SA 4QQHA 1YQ6A 5LY2A 3U1XA 2JG9C 5C3PA 1R091 1BMV1 3N7LA 2DTWA 3VBHB 3VD5A 3I2OA 3IDBB 4IEYA 4Q0QA 3USUA 1GUIA 2YBSA 4KGQA 4MGKE 4Q0UA 3WDXA 2XH6A 4HN0A 2UURA 4WVZA 1UX6A 4FFHA 3WQ0A 1NE6A 4YSFA 5JCTA 4QXCA 4Y1UA 1V9U2 1FNYA 1XE0A 2NZ9A 3WDYA 4A7YA 3LA3A 4AGVA 5FR3A 1RGSA 5FYYA 4FPCA 1NA1B 4JV4A 1POV3 4JGYA 2Y6LA 3B7MA 2Y60A 2ZHNA 2RHPA 3KV5A 4IE5A 1UQXA 5ANNA 3K48A 4CXWA 3CDZB 3HN1A 1FPN3 1JYWA 4LE4A 5I0UA 1G9FA 2CHHA 3PVBB 3WF1A 4XDPA 1LODA 3OJBA 3WP5A 2Y0OA 1WW5A 4IV1A 1XNBA 5LK7B 1TE1B 3KVBA 1AJOA 5IT6A 5DDJ3 5IK7A 4FAGA 4P9GA 2VMIA 2YB7A 4Z2WA 5C9AB 4CTEA 1HB3A 2BBAA 3RSJA 2N7GA 4N43C 3FHAA 1MS9A 2OXBA 5FZBA 2VCBA 5LY1A 5H9RA 1PGL2 2WFPA 3R05A 4JRLA 5K8SA 2WNEA 5A3WA 4B1MA 1I6XA 4B7KA 1LHVA 5FBJA 2IWGB 1QJEA 2Y38A 3KCYA 5FWEA 1AR82 2W08A 5B4NA 4QX2A 4LIVA 2DVGA 1LTEA 1CX1A 4RQPB 5IVYA 2DCJA 4DXSA 2HWB3 4QU2A 5C8CB 2FDKA 1ONAA 1VAVA 3HEIA 4NAOA 1KDMA 5A6YA 3RZKA 4RN5A 3FUQA 5JR2A 4X8NA 3B9CA 2NMNA 3RFRA 2BV4A 4BJ0A 1LGBA 4D6RA 3VV1A 1US3A 4FBFA 1YQ5A 2R0FA 1BKZA 1ZZBA 3MUZ1 1QGLA 5DAXA 1JZ6A 3RZHA 1R1A1 2AH2A 5FK7A 5K0UA 3VBUA 3J7NA 2JD4A 1EAH1 1T6GC 4QKDA 2XKOA 3T0DA 1LESA 4E8DA 4YGEA 5DG1A 2VW1A 2YBKA 3K46A 3SCFA 4M0NA 2QQJA 4OMCA 1WCKA 4I0BA 1UOGA 2GC2A 4GMP0 2EAKA 2IXHA 4P00B 2W1QA 5CKMA 3PMEA 3ZYPA 4CEWC 2B8MA 3L9JT 2VCMA 4IV3C 3VDAA 4BLIA 3ZFEA 5GLUA 3UNPA 1NLSA 2Y64A 3O1UA 5LATA 4YZ3A 2B39A 4XXAA 2YPJA 3EO6A 3ZR6A 1L3JA 4XJAA 4JHZA 4Y22B 1Z7S1 3ZSKA 1UOJA 3HQUA 3H7YA 1PK6C 3S6PA 4Q4V3 2O8OA 3AMHA 4HVRA 1JZ4A 1Q8OA 3I59B 2FZ2A 2JKBA 5B2GB 2HYXA 3H9AA 2FQPA 5I93A 1HRI3 1VRBA 2R073 2WZR3 4XQDA 2W92A 3E6CC 3V64A 3K4DA 2QQLA 1RUNA 1GLHA 2CDOA 1UU4A 2JE9A 4KG8A 1QJX1 1GOHA 3T08A 4MADA 3JQWA 3DYMA 2K46A 4BE3A 4I3PA 1ND3C 2DUOA 1EUUA 1QJX2 2IFRA 2VULA 2ILMA 4GQ7A 4QPGC 3SISA 5KHGA 2VW0A 1O3QA 1GZTA 2WFF2 4L0PA 2ZEXA 3AZZA 2VVEA 3WP4A 3LIHA 5D1IA 1C8M3 4ARXA 3CKHA 1LAJA 1QJU3 3W21A 2ZGNA 1AL22 4PF5A 4NMIA 2VZQA 1SDWA 1SPPB 2C0ZA 3HMYA 4QXBA 5E8AA 4D94A 1UY1A 3ROUA 1JOBA 3VHOA 2HYKA 5FYCA 2VVDA 4JAAA 2HEWF 1S2KA 5IVFA 4NHXA 1QXRA 3JU9A 2V72A 3VBRA 3O7OA 2ZGLA 5FLHA 2ZEZA 4CDWB 1V9U3 1HJFA 4O9GA 3R4DB 1YYNA 4C1WA 3MLJA 4OHWA 2VGDA 2WSUA 2D6KA 1AR93 1OBNA 2JECA 5FPXA 5CISA 1G7YA 1W8WA 1G9CA 1EAH2 5EJ1B 4OI2A 5HBAA 1RINA 2AYHA 2QQUA 3C7GA 3J7MA 3ZDVA 4BB3A 1OA4A 3DV8A 1PNGA 1LECA 4W50A 1PIV3 4XJZA 4TZDA 1J3PA 1ENQA 4GB31 3E6BA 2ADEA 1SMVA 3LDRA 3QBQA 3MLLA 1QNWA 4LOSA 4N53A 4Q4X3 5FYTA 4V2WA 1N1TA 1ENXA 4XCAA 1O5LA 5FZOB 1VPHA 1W06A 4BWOA 1L7LA 1OOPC 3IAQA 4A6SA 5EPAA 2FDHA 2ZX3A 1RUF2 2X5IC 4AEMA 3USSA 4C0BA 4DXTA 2XUEA 2EIEA 4RHV2 2XOMA 2IXIA 4SBVA 2RE9A 1FAYA 3AVRA 2HWD1 2XB6C 4URTA 3AKRA 4CDQC 1XYNA 4URAA 3OPZA 3N4MA 1W6PB 4YARA 4QKNA 2ZZQA 2EXIA 3P5BA 2VMFA 5A7QA 2D43A 4IGOA 5HXMA 1SPPA 3H0OA 3O1RA 5C7GA 4FTBA 5JI7A 4JX0A 1JYCA 4RA0A 1QU0A 2WINB 3VLBB 1X50A 2QQKA 2VUAA 4QGNA 1CPNA 2YMZA 3T1MA 1CJPA 3VBRB 2HWE1 5KR7A 1J58A 2WT0A 1IPKA 3VZOA 3USUB 3A4UA 1GWLA 2YC2A 3FFZA 3KV6A 4IQPA 3M2MA 4E2GA 3O5SA 1MQTC 3POJA 1PVXA 4LJHA 1H4HA 1S2EA 1GQHA 3WV6A 4META 2WFF1 3O1OA 4MHRA 1ULDA 3ILRA 4B8EA 4QHZA 4B7EA 1A6CA 3NJVA 4HT1T 1QNYA 4C1XA 3OBZA 1O3SA 2FCUA 4ZS2A 2D40A 4L99A 3PL0A 2JDAA 1W3XA 4LPLA 3LIGA 2OX0A 3B5LB 5DPNA 1F4AA 5CU1A 2OW4A 3MLKA 1LOFA 3URFA 2FMDA 2GNBA 1NCQC 3Q9OA 4FTSA 2JG8B 4OQ8A 1ZA7A 3ZVXA 3FHQA 5LW9A 2BZDA 1NE4A 1TMF3 1BEV1 4JRAA 4Y1YA 4NJ4A 4R9DA 3WG4A 1J59A 5F5IA 2PHUA 4KI5M 3OPWA 1QJFA 2B5HA 4HMZA 4R4XA 2ET1A 3VB9A 2QQPA 1JZ3A 1JZ5A 1UZWA 4QX3A 1PMIA 4C91A 2PAKA 5FMOS 2R6QA 4QM9A 2BOJA 1WUVA 5F3GA 4FAHA 4LKDA 5KXDA 1LOBA 2AUYA 1W6NA 3D5OA 2NLRA 2WZR1 2RMU1 2JDKA 4JDNA 4LO8A 3ZIXA 1S1AA 5EP9A 5A7WB 5LA2A 3PDQA 2HBTA 1NY72 2RJ2A 3FX3A 4N7UA 3T2QA 2GH8A 3RPQA 4WVVA 2TNFA 2KD7A 1LGCA 5BUVA 4L8QA 1QJY2 3VHRA 2B9UA 1KFUL 1PZ8A 3AJYA 1GANA 3N9MA 5GKAC 3T4VA 3BPSA 1MS5A 1R092 3CU7A 4ARYA 4CDQA 1ZRCA 4COVA 4XF3A 3UT0A 3U37A 4IDZA 1R1A3 2GN7A 3JXSA 2OT7A 3ON7A 5DUWA 1RMU2 2XG3A 1U5XA 1F31A 3ZFGA 3BOPA 4NIHA 4OFGA 5C3QA 4J25A 4U2AA 2GDFA 2K9ZA 3HJRA 1PVC1 3BUCA 4XMAA 2WO2A 2GC1A 3NMBA 1ENSA 1CZTA 2FMYA 4ZKTB 1R1ZA 3IDAA 2R49A 5T52A 5LRRA 5BNOB 5F3EA 1IS4A 3AB0A 2ZX1A 1W2OA 1UZ0A 3CO2A 3LF7A 3OCPA 4WM8C 1NLRA 5GZDA 4MUVA 1ULGA 2W91A 3I97A 2XUMA 4QPIA 1HIXA 4YW4A 2WAAA 3LDBA 3H1MA 3BOWA 1MPXA 3ELNA 1PVC3 2Z79A 2JXAA 3K77A 4LBLA 4O7XA 4ZONA 2O14A 3BPZA 4SLIA 4YVWA 3TEXA 4FPJA 4Y3OA 3QH7A 4I0WB 1XXNA 2VZSA 1D4VB 2JDNA 4LBJA 4BHPA 5APAA 3N3HA 1N1YA 2YDEA 3WQBA 1YWKA 3F95A 2CWSA 4GH4C 1VMFA 4JGZA 1HB4A 1LHOA 1AXZA 1PGW1 5JSRA 4XTMA 4UFLA 1GQGA 4XFIA 1XOYA 2P34A 1RMU3 1REDA 4MXWA 4ATFA 3WW1A 5KBFA 1IS6A 2YC0A 1SBEA 1RUI2 1GFF2 2BUKA 4LORA 4QX1A 2VZ1A 2R062 3ETPA 5JPNB 3DXUA 5CBLA 3CL1A 2RR11 2RS31 1A8MA 4RYDA 2BRTA 1YQCA 1WMEA 3I59A 3KGZA 3VKOA 3NNJA 4IEPA 5FXXA 3X29B 1S0BA 4MV2A 2WSVA 1DBNA 4FQ4A 4QAWA 1YIPA 3OGSA 3O1TA 2A75A 3HIFA 4L9BA 2JKXA 4XACA 5FTTC 3LB9A 3VDCA 1DYPA 1Z0HA 4FOYA 4YGCA 5H9QA 4AFAA 4EN6B 4WZFA 1CAWA 5C5TA 2RVAA 3DF0A 4LR4A 1MS1A 1JN2P 2Y34A 1M06G 1SFYA 4XUTA 1OH4A 2D6LX 1MZ5A 5GM0A 5JMCA 4TSVA 1IG3A 1RJ7A 1FX5A 1X33A 1VBD2 1TMF2 1S0JA 3CJXA 4K1YA 1SEFA 3CLPA 3EB7A 3KM5A 5C33A 1JZ8A 4JC1A 4LKFA 1ENRA 4Q0VA 5JXJA 2IZWA 5KHKA 1HN0A 2MPFA 1EV12 3MFCA 4HANA 3POIA 3ILFA 1N47A 1FNZA 2WO3A 2ZGMA 3OGRA 2VUJA 3EJKA 1NYWA 3GBWA 2WR9A 3I3BA 1JS9A 1QQP2 1WCUA 3MW4A 1RC6A 3N7MA 5L19A 1S0CA 3N35A 4ORFA 5GZGA 5D2AA 1AYM3 4JZRA 4QB2A 3U14A 2XVLA 1W28A 2XLAA 5K7PA 4AQSA 4XFCA 2V73A 4N53B 3D4KA 4LT5A 4XVHA 2BWCA 4FPKA 4AG4A 1BHGA 1JW6A 1F4HA 3J8F2 2D3RA 2NM1A 4BDVB 2MEV2 3DXTA 5CFCA 2DTYA 2EIDA 2ZPXA 3NAPA 3POGA 4J6GA 5A3PA 2GNMA 2FHRA 3AYEA 3OTFA 3ZFFC 3SCGA 1MVQA 1S0IA 4YW6A 2XQXA 3D8CA 3M3EA 4IETA 4QDRA 4D3WA 4G4FA 1EY2A 2J1RA 3KHCA 5EYXA 3OD0A 4I0AA 1UY4A 3LE0A 3EBRA 4JGYC 2A70A 2P4EA 4N7IA 1LNSA 3VBOB 3AZWA 5C3OA 4XIOA 5A3NA 3A21A 1DQ6A 2YFZA 4E2SA 1NY71 4UW5A 3T2TA 3MF9A 1MACA 4KBZA 3IDCB 3R0RA 1MR5A 1FMD2 4GMP1 1L7QA 5DUVA 1F2NA 1FV2A 4YPJA 3PIGA 3K2OA 1LB2A 5J96B 2JB8A 3POFA 2NPIA 3LCPA 2DUQA 4H14A 2H0BA 3LPGA 1VIWB 4MGSA 1O7FA 3MW2A 2OYZA 1GSLA 5FREA 4EN0A 1Z78A 2JDMA 3OPTA 5IHRA 3VZMA 2SLIA 4Y4RA 5ISLA 3BIWE 3AMQA 1AZDA 4XF9A 1BEV2 2ZEYA 3RI8A 3LFMA 4NUBA 3KSCA 4YW1A 5CG9A 5JOXA 4AQ2A 1SHWB 4GJYA 4MYEA 4AQTA 4UOJA 1H2MA 4AHYA 2BWAA 1UU6A 3B00A 2Q1ZB 1SQ4A 3OUJA 4LEJA 4UAPA 1QJU1 4KWUA 3WSOA 1JODA 2JDHA 1S4CA 2EA7A 2ARAA 1AUYA 2WQ8A 3J26N 3JD72 1PM7A 2VOTA 3KMHA 2J1VA 1RUD1 3N9PA 1ULCA 4COZA 2VQAA 3NVCA 3MV11 4QXHA 2XJPA 4PJYA 3MZHA 1CAVA 1W6QB 3S0MA 2DCZA 2A6YA 3AXDA 1VRH2 2VMHA 1EP0A 4AVCA 3T30A 4IV3A 2ADDA 5FPLA 3ES4A 4UF0A 4LHNA 3PUAA 2E7TA 1GKBA 4IUGA 1POQA 4XFHA 1URXA 4CYDA 1W2TA 3T0AA 5FJKA 4C90A 1VALA 5FIXA 3IAPA 1CZVA 4UW3A 1WMDA 3BIEA 1LU1A 4OUSA 4AF9A 3VBFA 1DGRN 3V56A 5FDBA 1Z7S3 2DCYA 5JSPA 1JXNA 2J1AA 2VNVA 3WDUA 2RJLA 4RR3A 4Y26A 4MVTA 1N3OA 1O59A 1W0NA 1YHFA 4YW7A 2H6BA 4QHBA 5IYYA 1KJRA 1VMJA 4TN7A 3ZXJA 4FO9A 5DN2A 3AZVA 2ARBA 1A8DA 4LITA 5A33B 2E63A 2OUHA 2PLV3 4NIIA 4COUA 4GXLA 5ACA2 1ASJ3 5I91A 1UMZA 4M3CA 2XJTA 4HK9A 1O3TA 3AL6A 4LK7A 5FYHA 1CONA 5FY5A 4XMIA 3RS6A 3HBZA 3OOXA 3T09A 2BEOA 4HSLA 1DQ0A 1YXWA 5BNOC 4IE4A 3WHTA 1OD3A 2QE3A 4UF0B 3BTXA 1H9WA 2RM22 3RI9A 3SH5A 2B4KA 5LCWL 1AXKA 2GALA 2P3JA 1VE0A 3HR9A 4AVTA 4BU2A 4B4RA 4BQ3A 2G9FA 4CCJA 3UETA 1ZBE2 5BNPC 1VAMA 2ZMKA 4YZ4A 3KCXA 1OC1A 2EIBA 4TLFA 2JICA 4DIQA 4KBBA 4XHBA 2J22A 1W8TA 3ZYFA 5TSWA 2VECA 1CESA 3IM0A 1AYN3 5E6HA 2Z42A 3J9SA 3KZ4C 3ZXAC 2WWSA 5DAPA 1M4WA 2CU5A 3H8UA 2DFBA 3M3OA 5J36A 1OPOA 3S5QA 3JQXA 1K3IA 1VAKA 1WD4A 3GBFA 3KLSA 4OULA 2LUWA 3O14A 5BNOA 1ZNPA 1OD5A 3T2PA 2R1DA 2UYBA 2V4AA 3WF0A 4KQ7A 2JE8A 5C4WA 1UO9A 1OURA 2E31A 3BYWA 1C8M1 3ZXFA 4N9HA 4OVEA 4D8MA 3U07A 5H9PA 4JTOA 3M3CA 2QQWA 1LOAA 4XC9A 3AKQA 3LEKA 3A23A 2WQZC 4LA3A 5G05L 3GBGA 2PYTA 4PQQA 1YQ2A 5T5JA 1MS8A 3E5XA 1HXS3 1RUH3 1SLBA 2V4VA 4EN8B 3NJZA 3MO4A 4QKFA 5IFPA 2H0VA 5H9SA 4Z1VA 3WDVA 2AEZA 1D0HA 5LEJA 2EIGA 2OS2A 3FBYA 4Q2FA 4UFIA 1AL0G 4WVWA 3GZAA 2NN8A 4XFFA 2PTMA 2VMEA 1CGPA 5J7MA 1XBFA 2WFF3 5GLTA 4GJZA 1PO21 4GWJA 5FY0A 4CCKA 5CFCC 1BQPA 2EF6A 1W8NA 3EQEA 2XDVA 5KC6A 5KHIA 2G4IA 4RQPA 2JG8A 1ZYBA 5FZLA 1YUDA 1DQ5A 4QX8A 4D7SA 1MEC2 4YFWA 1SLLA 1REEA 2CAUA 1BBT1 4QB6A 3ZFFA 4BCUA 4E4HA 3NJXA 3PUHA 1RUC3 1Y9MA 4LO7A 1WW6A 2XQRA 3WEZA 2RS51 2Y0IA 1RHI1 2PAEA 3U75A 1Z7S2 1OH3A 5C6CA 4R52A 4XHXA 4BM8A 5B4XA 1H1IA 1QOSA 3LWCA 3WP6A 2G19A 5JVVA 4W65A 1OI6A 2YPDA 2D5HA 5FYMA 1MZ6A 2JJ6A 2XKPA 3AM2A 3H3ZA 3NNGA 3ZXKA 4PDWC 5JWPA 3EHKA 2W52A 3FJSA 2E53A 2PHRA 1NXD1 1RUE1 1J3RA 2W95A 2X09A 1DYKA 3MIEA 2WIIB 2OIIA 5JIAA 3S57A 2HWF2 4FFIA 2FDIA 1NCQA 4BMEA 2P1BA 2KM2A 4QX0A 4AFDA 2QCSB 4BIFA 2PAMA 1XU1A 3NAPB 4NIDA 2BP6A 1R1A2 2JENA 2PA7A 2DBIA 2UY9A 4AQ6A 4B4PA 3OYWB 1XNCA 1XSQA 5L9RA 5LWBA 1HQNA 2W0XA 4AL9A 2RMU3 2D44A 4FP3A 4CDXA 1RTVA 1V0AA 1NQDA 1JHNA 4FPHA 1JYVA 2E32A 1OOPB 3TEZA 4L11A 1CIYA 2W68A 1O8PA 5FY4A 2GN3A 1D4M2 1ND3A 3RYPA 4QXKA 2HWB2 3ES1A 2LROA 5C4WB 3ZFEC 3D6EA 2KR2A 2XHNA 4XOGA 1YFUA 1IG0A 4BMBA 5FO9B 2C24A 2GU9A 5A32B 3D3AA 2HEVF 2PMWB 1Y43B 3DPRA 5FZOA 4CCCA 4UFMA 5A6XA 1NA1C 1RUOA 1DLLA 1UW8A 5FMCA 2Y6HA 1W6OB 3FLPA 3TEYA 3KF3A 1RUD3 1T6BX 2QQIA 3DYPA 3H3LA 1BCXA 4PIXA 4OYUA 4ZZ5A 3MIFA 4JQTA 5F32A 4EE2A 3ZN6A 1ULOA 1O91A 4YZ5A 1ODMA 1C3HA 1O4TA 2ZEWA 4IEXA 2BW8A 4Q27A 4C0HA 2GNDA 3PMSA 4O9EA 1NCRC 1UPSA 3CF6E 4O61A 4PDWA 4YVWB 4JKLA 3ZYGA 1WWYA 1GWKA 2JG9B 3MYXA 5E89A 1XYPA 2VMGA 5C8WA 1VMHA 1S55A 4V1PA 1FMD3 3CBNA 1WMFA 2DBNA 4IEUA 3M7AA 2XHKA 2VY0A 2DCKA 3THCA 1Q56A 2MEV3 3RG0A 5FYBA 4F8AA 4RR3B 5FZAA 4YYOA 1GP4A 2Y26A 5JPMB 2D6PA 1C5IA 3WZ1A 4AI8A 4I2OA 3D0JA 3VKNA 1I1EA 5FP8A 1V9U1 1AR62 1MVEA 3ZYJB 5EQUA 4HPKA 4EZ4A 2WBKA 2YUEA 2CYFA 3PVOA 4OHXA 4YG0A 2A6XA 2ERFA 5DZGA 4XJ9A 1P8JA 1ST8A 1ND3B 4Z07A 5HV4A 1ZZ6A 4OUMA 1G86A 4LUMA 1CWPA 3EXUA 4HKWA 5GZEA 4QPYA 1UN1A 4Q26A 2AGSA 5IK5A 1V6LA 3SHRA 5BV6A 3ZFEB 1XYOA 1Y4WA 3M3IA 3OYWA 4GB33 1KS4A 1GNZA 2W2IA 3PTYA 2DURA 5CFDA 2RS33 3I4IA 4KNCA 3P3PA 4UXAA 1HB2A 4XAEA 4Y24A 5KWRA 1PK6B 4QDSA 4IGQA 1B35C 3BB6A 1HW5A 2XBO2 5FMOL 4YGBA 1GP5A 1UD1A 2IFWA 2WN3A 2XVKA 4YW3A 1KEXA 3SH4A 1W9FA 1CZSA 1AL23 3PNAA 1G9BA 1IPSA 5FP4A 4XQ4A 4P14A 4DY5A 1RUJ1 5KXEA 3VD9A 5ABJB 4KWKA 5FZ6A 2EVXA 1NCRA 4K6BA 3RJ2X 2A1XA 2QTWB 2YBPA 4AAXA 4ISRA 4TLGA 3LGRA 1MEC3 1XE7A 2PHTA 1MEC1 5IW0A 4IE7A 4YRDA 4AYUA 2QJVA 4K40A 4GA9A 3AXEA 5LASA 1NZIA 3LSDA 4NVPA 4XFBA 4N9IA 1PO12 1COV2 2Z4FA 2XXZA 3BU7A 1RUC1 1PZ7A 1JOJA 5CB7A 4C8DA 4CU8A 4E4DX 3ZXEA 1O5UA 3ST7A 2P2KA 4ZS3A 4D7TA 4QQOA 2VH9A 2JG9A 4AFMA 4BIOA 2JIJA 2ZMLA 5FPZA 3E5QA 3UJQA 2D6OX 2HWF3 4AAPA 1SLCA 5JMOA 1LOFC 4KU8A 4PLNA 1BK1A 1LKNA 4P9YA 2R042 5A7PA 1PIV1 2R063 3N9NA 1HLCA 2R072 5CFDC 2XL7A 4CUAA 1GQPA 1RUI3 2I45A 1RL3A 1H4GA 2WWJA 2UWAA 3JB4C 4LK6A 4RS5A 4RL7A 2ZGOA 5DDJ1 1DGWX 2RDRA 2YFUA 1XRUA 2JB4A 5FZGA 4B1LA 1OA2A 4CPBD 4F83A 3POYA 5FZ7A 3GJAA 1DF0A 3JZVA 1HXS1 1RUH1 3QOPA 4DO0A 1AR92 1HRV1 3C7FA 3VBOC 1Q8SA 2P3KA 5CG8A 2WT2A 2BNOA 4IERA 3I2KA 2IUWA 4MH0E 4KU7A 2ES3A 2GP3A 3P3NA 3N9QA 3ACGA 4AHWA 3CNAA 3POEA 2NMOA 5HPOA 3OB8A 4PCRA 5EYYA 2XVGA 4FPYA 1W2AX 3N7JA 1AX0A 1U12A 2A6VA 3ZN5A 3VL8A 1SDDB 4DMIA 2YROA 3ZM8A 1UYYA 1X8MA 2BTVC 5T5PA 1XPWA 2R1BA 3K4AA 3BTZA 4HLTA 4R9CA 2RM21 1R093 2WYSA 1V6KA 3MW3A 4AEDC 2ZX2A 3WG3A 4M3CE 3C7OA 1G9AA 2DU1A 4QX7A 4Q4W2 2FD8A 3PJQA 5F3IA 1UY3A 4XBLA 2UU8A 4HVQA 5JUVA 3MI8A 5L7OC 5E1RA 2Y6FA 1DZRA 4FI9A 5EZWA 4LHLA 5A3MA 2W9XA 3P1IA 4PT6A 3PUSA 3G6JB 1Y7BA 3THPA 1UAIA 4S2HA 1RUE3 3INAA 3ZXLA 3WG1A 4CDUA 2UYAA 3H8XA 3QD6A 4M3CB 1VBB2 3W5MA 3B9IA 2RDNA 3JBG1 3B3QE 2DCTA 2I07B 5HCBA 3U78A 2WT1A 4JDMA 1NT0A 2VQUA 1I5ZA 5GZFA 2WNVA 2ZX0A 1KDKA 4QDQA 4XJWA 1O6UA 2GSYA 1R083 1QHDA 2QZ3A 3I2JA 2E9QA 1PHMA 2G9GA 1TG7A 3ZO0B 4FPGA 4BK5A 1LULA 3POBA 1VJ2A 4IE0A 4M4PA 3IWZA 5BXXA 5K4LA 3RDIA 4AOCA 3GNEA 1RUG2 4LKSA 1JU3A 2GC3A 2PELA 2WO1A 3JD73 5A1FA 4RFT0 3C2UA 2CDPA 1TME1 1ZM1A 3N36A 2OA2A 2OUJA 5HCFA 4CUCA 2WWUA 5IVEA 4Y5TA 5A70A 4DEQA 2ETEA 4XF4A 4YZ2A 2YC4A 5F6KA 4LHKA 5JZGA 3AMMA 3WY6A 4FSJA 3R4UA 1QEXA 3OY8A 1UX7A 2VE1A 1ASJ1 1YFWA 2E7AA 2O0OA 2YZ4A 4JDOA 4LBKA 4PBPA 1QY4A 2WS91 3T3YA 2PLV2 3GHMA 1ZBA1 1ND2A 4GH4B 1HQWA 2X05A 5F3CA 5A7WA 2VMCA 5KXCA 2VNOA 2O1QA 3WCSA 1JYTA 3CZUA 1COV3 5FZ9A 2E26A 1RVF2 2HKXA 1UKRA 4EWEA 1FPN2 1UOFA 1TQ5A 3N9LA 1CIWA 3O1SA 4FFGA 4PIYA 4NIAA 4QQ2A 4X6QB 4CP9B 5FXWA 2PHDA 2WNVC 4CCOA 2VOXA 4MGYE 1NLQA 3H1YA 2PQSA 4PDWB 2ORZA 3PJYA 3WLUA 5F1RA 2VM9A 5EHDA 4AWDA 4XFGA 1NZCA 4DEVA 1IKPA 1H1AA 1SFNA 4DQAA 4XXPA 5F6LB 4D7YA 2W94A 5GLWA 3O0XA 2ZHLA 1JH5A 3JBG2 3MIHA 1OFNA 3KD4A 4HKOA 4ZPIA 4GWMA 1W3VA 2EAAA 4PF1A 5HXVA 2JDPA 2WS92 3AKPA 1LRHA 2HEYF 5FZ8A 1CN1A 3THTA 1MZEA 2CAVA 4PIZA 4UBHA 3TNPB 2V5YA 4NR1A 3POSA 2D5FA 2VOWA 3N7KA 5FCCA 1ZRDA 2CSGA 4CCEA 3ZLIA 1GP6A 2YYOA 3F2ZA 4JGYB 4L92A 1TME2 3NNLA 4QQLA 2JE7A 3C3VA 4H55A 2VNGA 3E1F1 2FDJA 3IPVA 3OEAA 1KGYA 1WBFA 2WNVB 5FPUA 5BPXA 2YXSA 1ZZCA 3ZSJA 5EV7A 5DXDA 4K3UA 4M00A 1RYYA 1EV13 1H2NA 1X36A 3PUIA 1OSGA 4CCLA 2YHJA 5A1AA 2OPWA 3LFIA 4IEVA 2Z69A 3GZTB 3W5NA 1AX1A 2YV8A 4ES9A 3KT1A 1H1MA 4NE9A 5K0UC 3ECQA 3NJYA 3AKTA 3ETQA 3I2DA 2XPJA 4TWTA 2DFCA 4FPFA 5LRSA 2QNKA 2DDUA 3DCQA 4WVMB 5BNPA 1CAVB 1W6QA 1UIKA 2X29A 4A45A 5LBEA 1GICA 2CWMA 3NKTA 1JYIA 2O8QA 3K3OA 1LOGA 1UYZA 2JG8C 4K7JA 4LTAA 4NROA 1A34A 1SBFA 1UCXA 2JX9A 4OHVA 1OMIA 1CAUA 4W6WA 3A0NA 1KJLA 1PGSA 2JWPA 2HWE3 4QT6A 4ZU4A 4XUOA 2D3PA 2LM3A 2WN2A 4OCTA 4BYYA 4CUBA 4J1XA 5F37A 1AYM1 4B3NA 2PHXA 4CU6A 2NQYA 4HSJA 1VBB3 1WGPA 4G9SB 3RZMA 1X8EA 4BZ4A 5FPBA 1PIV2 2WUHA 4BOWA 1OHFA 2DF7A 1Q3EA 4JGZB 4FVVA 1AR61 1U5YA 3SXWA 1H6XA 4CEYA 3VBFC 1UIJA 2IC1A 1H9PA 1RUI1 1KS5A 1W6OA 4BISA 1CAXB 3LA2A 5FYZA 3SQOA 4UW4A 5AC92 3HWJA 2ARXA 3M8LA 4RD7A 4OI0A 2E33A 4FCAA 3BTYA 5A32A 1UY2A 3VBRC 3H50A 5L9VA 4AGRA 1PGW2 2ARCA 2Y33A 1N3QA 1JHJA 2IXKA 1SFPA 4HKLA 2BFUS 1UYPA 4RGAA 1HJGA 3NL1A 4MHUA 1VBE3 3HAGA 5D8AC 4D69A 1IPJA 4GMP3 3O0VA 1VBA2 1ZBA3 1PO11 2WLQA 3TAYA 5C5UA 4YM2A 1OKQA 4IL7A 2ZMNA 4EWAA 5I8TA 2D6NA 3MBWA 4D6QA 1F8VA 3AP5A 4AI9A 4AXOA 5JXHA 1NXMA 5GLVA 3RNSA 3VBSA 1VR3A 2BGOA 2P3YA 1B09A 4NO4A 4RFRB 5A7NA 1HXS2 1RUH2 3J7HA 4LO6B 3TN91 1QQP3 1WA4A 3H8RA 2ZGKA 2C26A 1W8FA 3ALQA 4ZXKA 2C6SA 2ZKLA 2Y6GA 4LLFA 4M01A 4A2UA 4QMAA 5IK4A 5BNNB 3C7EA 3KF5A 4UI9L 4LA2A 1WA6X 1VBE2 1R082 4Y20A 4XZPA 4QGLA 4TYSA 5FXZA 5FY9A 4Z2AA 5JLVA 2LS6A 2X5IB 1W9WA 5IK8A 1IQDC 2J42A 5FZ0A 1S2BA 2RS12 4XF1A 1PMJX 4XPVA 4M4RA 5BNNC 1DCSA 4CCNA 3FL7A 3W20A 1D4M1 1APNA 2BOIA 5F2SA 2F17A 2FCTA 4K8RB 2ZS6B 2Q5TA 1OA3A 4BQYA 4F7ZA 4XEZA 2AACA 3V0AB 2ZX4A 2RG4A 1RUC2 4CSWA 2R043 4Y1XA 1U5IA 5FV3A 1A3KA 3IT8A 1DZQA 1C1LA 1SLTA 1ZZ9A 4BQ1A 1LHWA 1QJX3 4FQZA 1V00A 4BXSV 5A6QA 5CEHA 3ZXDA 1N3PA 3WHUA 3ZMNA 2J1UA 4Y33A 3WNPA 3OG2A 5CKQA 3KS7A 3KT7A 3TBDA 4GKYA 2VU9A 4Q4Y2 4CXXA 4DPNA 4CU7A 3D0SA 2WZR2 3SC7X 4BH9A 1AYN1 3VBHA 1YNAA 5JDBA 1NG0A 4LKEA 5FP3A 5FLJA 5GJ6A 3SEEA 1NA1A 1RUJ2 3B94A 4XAAA 2OZJA 4B29A 4BPZA 4AFCA 5CFDB 2YGMA 3IIAA 1H8VA 2ZAHA 3ZX7A 1W0OA 3WXPA 3CIHA 4AW7A 1WBLA 4QU1A 1N1SA 4UBGA 1W90A 1R081 3RQ0A 4CDWA 4QX5A 5FMBA 5FQ0B 5FPVA 1UF2C 4COYA 3HT2A 5F5AA 4GULA 3I3DA 1AYN2 3I3QA 1OLRA 1UWWA 3UV9A 3WQ7A 4CXYA 1GWMA 1K5MA 1BVVA 4AE2A 1DHKB 2X5IA 3WW4A 1ZRRA 3T1LA 1PO23 3IMNA 3NV1A 4QPGB 1LCLA 3I3MA 4AFBA 5FLIA 5BNNA 3DEMA 2ZOEB 3OBRA 3WR0A 2Z5WA 3CEWA 2Y8KA 1EUTA 1WW7A 3ZSEA 4KL1A 3LD8A 1IGOA 1RITA 1YIFA 4JCKA 1WCQA 3AP4A 1XB9A 2AC1A 1DDLA 2VQ0A 1X82A 2WYFA 2VZRA 4Q4X1 2RS53 5ERLA 4AI0A 4AHXA 1S0GA 2DVFA 3UGFA 5LA0A 4CZSA 4ASKA 3HT1A 4FOVA 4ASLA 4AGGA 3DGTA 5I0SA 1S0DA 2HWE2 3LKJA 5A3LA 4FPOB 1TVGA 4LMFA 4GIQA 4A4AA 1OQDA 1J83A 4HK8A 3NO8A 3AX4A 3CZJA 2GAUA 5FWJA 3CMGA 4E27A 2CGPA 4CEWB 4OMDA 2VCCA 2R16A 3AZXA 1NAEA 5FYUA 1ZRFA 3GCWA 1J3QA 4KWJA 3LOIA 1RXGA 4RS5B 2Q8CA 5LA1A 5CIRA 5SV5A 4DB5A 4P9JA 1BEV3 3TN92 2A3YA 4P9XA 2IXLA 1UZVA 3SMHA 2VOKA 4U36A 3RMXA 2ZXQA 1PX3A 3LA7A 3Q8BA 1BK0A 4IV1C 4EQVA 2K0GA 3VKLA 4AVBA 1CAWB 1FXZA 4KG0A 5KC5A 1VBA1 4LBOA 1K12A 5HI0A 4MGTA 2FZ1A 4HONA 1NQJA 4LUKA 1RUF1 2CL2A 3FUOA 5FZ4A 2ZGRA 4ZU7A 3AC0A 3AJZA 5FRAA 1XC6A 1OLME 2PQQA 4OHZA 3ZKYA 5DAVA 1IKQA 2RS52 2VBBA 3UKNA 3Q8EA 3O1VA 2QDNA 2BQPA 1B35A 4L2NA 1OFSA 5LBCA 4ONUA 4GAZA 5IFTA 1AJKA 3LOBA 1O3RA 3IDEA 1OQ1A 1U0AA 4GB32 1BBT2 4LBQD 4ZHNA 3H3UA 5T55A 1BYHA 3SITA 2Q0AA 4D0QA 2VD7A 2AEYA 4XUPA 5EJZB 3VZLA 4YVWC 2HLEA 3P6BA 3LZZA 3ZFGC 3QH6A 5C71A 1OOPA 4CCDA 1PO22 3BI3A 3WF4A 4AVSA 4Y1ZA 2ZGUA 1V6JA 1HRV3 3C7HA 5FKCA 1UYXA 4A44A 3A0KA 3HBKA 4PHZA 1HV1A 2Z2SB 2QKDA 5C9AC 3BVCA 1KRIA 1ZA4A 3FN9A 5FXVA 5IJRA 1AHSA 3OF1A 2VBPA 3PTRB 5DG2A 2Y6KA 4MOAA 1T2XA 3Q8AA 4MZUA 3B02A 4H3WA 4IEOA 2HH9A 1RIRA 3ZYBA 3AFGA 3HVDA 4HPKB 3GJBA 1JOPA 1X7NA 5LEKA 3UYJA 4GWIA 3VD4A 3WF2A 2HJIA 4GKXA 1DLCA 3Q8CA 1VBE1 2LTNA 4FP2A 5C4WC 3KT4A 1FYUA 3AKSA 3GYDA 4W4ZA 1AVBA 3WG2A 3WQ1A 4Z92B 1C8M2 3BKZA 4HBNA 1N1VA 1UMHA 1VLNA 3NNMA 3DKQA 1OVSA 3K4ZA 4LBNA 2TBVA 3R4SA 4I01A 1Q8VA 4LIUA 4UWDA 4F3JA 3CJIA 2BU9A 1QH6A 4NOTA 1VRH1 2WABA 1OF4A 4AVAA 4JHTA 3ZOIA 1Q8QA 2ZHKA 3OEBA 2TUNA 4PBOA 1LU2A 3MIDA 1AF9A 2BGPA 4XW3A 4DUVA 5T3NA 1QJU2 5JI9A 5KHJA 5D21A 4R9AA 5FO8B 5HCAA 2AR6A 4GZ9A 3NWKA 1C8NA 1E5HA 2PLV1 1US2A 2VVFA 2YY1A 3AK0A 2VZPA 4YGDA 1QOOA 1CR7A 1VB4A 1UOBA 1GZWB 5BY5A 1V70A 2ZKNA 1D4M3 4AI3A 3ME2A 5L7OA 2VUCA 1AX2A 1GNHA 3K3NA 2G9ZA 2W87A 4EJRA 5CZKA 2YU2A 5J3UA 1V6MA 1LENA 5C3RA 5A6ZA 1WCSA 1C28A 3PVNA 3TRSB 3OY8B 3NW4A 1D2QA 3DYOA 1BXHA 4IV1B 3ZYIB 4Y5Z0 4IXLA 4AEDB 1FMD1 1AYM2 1QXJA 1RUG1 2WNUA 1UY0A 4K20A 4UFHA 2R32A 1RUG3 1QF3A 2D97A 5FMDA 2VTXA 3FBMA 1RXFA 5JXIA 5ANQA 2LRPA 3IIIA 5FOJB 5A3OA 3SNMA 4PI2A 4XBQA 4E2QA 5FY1A 1JU4A 3VKFC 1W8UA 4Z82A 1XNTA 4FT8A 4IEZA 3GZEA 5C9AA 3DECA 4XTPA 4MSVA 3K75B 4IV3B 1FT9A 2OKXA 3EYPA 4I09A 4Q4V1 2JD9A 5IAXA 1TNFA 2ZGPA 3IPVB 4LULA 4UFKA 1JYNA 4TTGA 1SLAA 2X10A 2I2SA 2WNOA 3VZKA 4Q5OA 4ISQA 3DPRB 4H7MA 4WM8A 4E9KA 1HRI1 2AZ5A 4A3ZA 3U0ZA 4HVOA 5FY7A 4NN0A 2DU0A 2ZGTA 3FFQA 1GU3A 1NCQB 2LW8A 1W39A 3I2FA 3J4UH 2BNNA 3LEGA 1L7RA 5FUNA 4AEKA 1RJ8A 1G9DA 3FHIB 2VZUA 1ACCA 4JTNA 5IUQA 3U4SA 4PLOA 1GZWA 1Q43A 1WLWA 3E6DA
chains in the Genus database with same CATH topology
1UY3A 5JUVA 1WKYA 1HN1A 4QAWA 3GDBA 3OGSA 1PMHX 4FI9A 2JKXA 3VDCA 2W9XA 3P1IA 4PT6A 2W46A 2J1EA 2RVAA 5G04L 2VCAA 3I2GA 1OH4A 4XUTA 4OUEA 2VZVA 3W5MA 3GXUA 3EB7A 2W1SA 2VQUA 5F7UA 1JZ8A 4QDQA 5JXJA 2VC9A 3HNBM 3I2JA 1TG7A 2W1UA 4ZZ8A 2WO3A 2RV9A 4BK5A 3OGRA 3UESA 4M4PA 3I3BA 4LKSA 1JU3A 2WO1A 2CDPA 4QB2A 4P02B 1JZ2A 4XURA 4CUCA 3WNKA 1JZ7A 1K45A 1GNYA 3HPNA 3WNMA 4XVHA 4DEQA 2YC4A 4AG4A 1BHGA 1F4HA 1O8SA 3ACIA 4BDVB 1GMMA 3OBAA 1UX7A 3HNMA 2EIDA 3ACHA 3SKVA 2C9KA 4ZXEA 1R64A 2J1SA 2VR4A 2X05A 4QPWA 2XQXA 2VMCA 3GGLA 1K42A 4QDRA 5DMYA 3MUY1 2J1RA 3CZUA 1UY4A 2E26A 3LE0A 1LNSA 2J7MA 3A21A 2YFZA 3A7QA 2V5DA 2QQNA 5FUIA 1DP0A 1L7QA 4LQRA 2PQSA 2ORZA 4YPJA 1SG3A 2VM9A 5JXGA 3LPGA 1W8OA 4MGSA 4DEVA 2W94A 5IHRA 3CQOA 1NKGA 4KMQA 3I3EA 3T0BA 3HN3A 4PF1A 2C4XA 2W5FA 4W8JA 1NX9A 2ZEYA 3WNLA 3SEPA 3GM8A 3T2OA 3THDA 1SHWB 4JKMA 4UOJA 3LPFA 3WSOA 4CU9A 4UAPA 4KWUA 3F2ZA 2WQ8A 3VD5A 2VOTA 2J1VA 1GUIA 3MV11 3E1F1 3C8XA 2J1TA 3OEAA 1KGYA 2W1WA 2VZ3A 1RYYA 3PUIA 4IUGA 3W5NA 5A1AA 1W9SA 3T0AA 2WAOA 3VDBA 2Y6LA 2VZTA 3ECQA 3IAPA 1CZVA 1JYWA 3CDZB 1W9TA 4MGQA 2J1AA 3WF1A 2DDUA 1O59A 4A45A 1W0NA 2L9LA 5IYYA 1UYZA 5DN2A 4DXRA 2YB7A 4XUQA 2BBAA 3IB3A 4XUOA 2WN2A 3FHAA 4CUBA 1JZ3A 4P08A 2VCBA 4CU6A 1UXXX 2R7EB 3T09A 1GOGA 4XUNA 2WUHA 1OD3A 2W47A 5B4NA 2B4KA 1H6XA 4QX2A 5LCWL 1I5PA 1CX1A 3UETA 2DCJA 4DXSA 2E33A 2BERA 3MV01 1UY2A 3HEIA 4DUWA 2EIBA 4RN5A 1JHJA 5JR2A 2J22A 3OGVA 4BJ0A 1US3A 4DUXA 3MUZ1 1OT5A 4ZY9A 1JZ6A 5EIYB 3MBWA 1NUKA 1K3IA 3SKJE 3VD3A 5JXHA 3T0DA 4E8DA 2BGOA 3K46A 3T2PA 2QQJA 3J7HA 4OMCA 4A6OA 4P00B 3WF0A 2C26A 1D7PM 2JE8A 4A41A 2Y6GA 2E31A 2W1QA 3WNNA 3C7EA 4UI9L 4D8MA 3LEKA 2QQMA 4TXWA 3VDAA 3A23A 4Z2AA 3UNPA 5G05L 2LS6A 1ULPA 2Y64A 3HOBA 1W9WA 4PQQA 1IQDC 1YQ2A 2V4VA 4JHZA 1PMJX 4M4RA 3FL7A 3MO4A 5IFPA 1JZ4A 2HYXA 2W92A 3K4DA 2QQLA 5C70A 2VMEA 2CDOA 3NRUA 1GOHA 4GWJA 3T08A 4MADA 1W8NA 2WZEA 3DYMA 4BXSV 1EUUA 2W3JA 2J1UA 3WNPA 4CVUA 3OG2A 4QB6A 4L0PA 2ZEXA 3NJXA 4CU7A 3PUHA 1GOFA 4ARXA 3CKHA 3WEZA 3WF3A 3SEEA 4P5YA 2VZQA 4MO3M 5B4XA 1UY1A 3CIHA 3I3DA 3NNGA 2V72A 1UWWA 1UXZA 2ZEZA 2W95A 2X09A 3BGAA 1DYOA 4QX0A 5EJ1B 2Y8KA 1EUTA 3C7GA 1W99A 4W50A 1WCQA 2VMDA 3LEIA 2VZRA 1JYVA 2E32A 2EICA 5LA0A 1CIYA 1O8PA 2VTFA 4A42A 4BK4A 1TVGA 3IAQA 1OF3A 4A4AA 1J83A 2XHNA 2ID4A 5DQ0A 3LQCA 1J84A 3CZJA 4DXTA 3CMGA 3D3AA 2EIEA 2XOMA 4OMDA 2VCCA 5J1XA 1NAEA 3ABZA 2Y6HA 5LA1A 1JYXA 3DYPA 2QQIA 4LHSA 4OYUA 5CYYA 4ZZ5A 2XONA 2VMFA 2ZXQA 1PX3A 1ULOA 5HXMA 5C7GA 4HG6B 2ZEWA 4JX0A 4JKLA 2QQKA 1K12A 4XZUG 2QBXA 1XNAA 3A22A 3AC0A 3THCA 2DCKA 1XC6A 2ORXA 3BN6A 2YC2A 5IFTA 1H6YA 4D0QA 3NJVA 4XUPA 5EJZB 1P8JA 3P6BA 2HLEA 2JDAA 4LPLA 5C71A 3WF4A 5DPNA 1F4AA 3C7HA 1UYXA 4A44A 5I0DA 3FN9A 5IJRA 2Y6KA 4MOAA 1T2XA 3FHQA 1PX4A 2BZDA 4QDSA 4KI5M 4GWIA 3VD4A 3WF2A 2WN3A 4E8CA 1DLCA 1KEXA 1CZSA 1JZ5A 4QX3A 2VO5A 3VD9A 4W4ZA 3ACFA 2QQOA 1UMHA 3WNOA 4AAXA 3K4ZA 3NQHA 5LA2A 2RJ2A 3T2QA 3I2HA 2WZ8A 2WABA 2YG0A 1OF4A 2KD7A 4QB1A 3OEBA 2BGPA 4DUVA 4ARYA 4JKKA 2Z4FA 2VL4A 4CU8A 4GZ9A 3U37A 3HNYM 3JXSA 1US2A 2VZPA 3HJRA 2WO2A 5JMOA 2VQTA 2VZOA 2W87A 1CZTA 3IDAA 5CZKA 4CUAA 1GQPA 1UZ0A 3DYOA 2YFUA 1UMIA 2W91A 3I97A 2WAAA 1UY0A 1MPXA 3K77A 3C7FA 5JXIA 3IIIA 3I2KA 3ACGA 1JU4A 2VZSA 5HPOA 1XNTA 3OB8A 1JI6A 3WQBA 3DECA 3K75B 2OKXA 3EYPA 3VD7A 2JD9A 4TTGA 1JYNA 2B9VA 1SDDB 2X10A 3ZM8A 1UYYA 1XPWA 3K4AA 4A3ZA 4ET7A 3I2FA 4QX1A 2VZ1A 1GU3A 2Y6JA 2LW8A 3ETPA 3LEGA 2WYSA 1L7RA 4OZOA 4RYDA 2VZUA 3I2IA 2VJXA 3C7OA 2WBKA 2WDBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UY3 A;  5JUV A;  1WKY A;  1HN1 A;  4QAW A;  3GDB A;  3OGS A;  1PMH X;  4FI9 A;  2JKX A;  3VDC A;  2W9X A;  3P1I A;  4PT6 A;  2W46 A;  2J1E A;  2RVA A;  5G04 L;  2VCA A;  3I2G A;  1OH4 A;  4XUT A;  4OUE A;  2VZV A;  3W5M A;  3GXU A;  3EB7 A;  2W1S A;  2VQU A;  5F7U A;  1JZ8 A;  4QDQ A;  5JXJ A;  2VC9 A;  3HNB M;  3I2J A;  1TG7 A;  2W1U A;  4ZZ8 A;  2WO3 A;  2RV9 A;  4BK5 A;  3OGR A;  3UES A;  4M4P A;  3I3B A;  4LKS A;  1JU3 A;  2WO1 A;  2CDP A;  4QB2 A;  4P02 B;  1JZ2 A;  4XUR A;  4CUC A;  3WNK A;  1JZ7 A;  1K45 A;  1GNY A;  3HPN A;  3WNM A;  4XVH A;  4DEQ A;  2YC4 A;  4AG4 A;  1BHG A;  1F4H A;  1O8S A;  3ACI A;  4BDV B;  1GMM A;  3OBA A;  1UX7 A;  3HNM A;  2EID A;  3ACH A;  3SKV A;  2C9K A;  4ZXE A;  1R64 A;  2J1S A;  2VR4 A;  2X05 A;  4QPW A;  2XQX A;  2VMC A;  3GGL A;  1K42 A;  4QDR A;  5DMY A;  3MUY 1;  2J1R A;  3CZU A;  1UY4 A;  2E26 A;  3LE0 A;  1LNS A;  2J7M A;  3A21 A;  2YFZ A;  3A7Q A;  2V5D A;  2QQN A;  5FUI A;  1DP0 A;  1L7Q A;  4LQR A;  2PQS A;  2ORZ A;  4YPJ A;  1SG3 A;  2VM9 A;  5JXG A;  3LPG A;  1W8O A;  4MGS A;  4DEV A;  2W94 A;  5IHR A;  3CQO A;  1NKG A;  4KMQ A;  3I3E A;  3T0B A;  3HN3 A;  4PF1 A;  2C4X A;  2W5F A;  4W8J A;  1NX9 A;  2ZEY A;  3WNL A;  3SEP A;  3GM8 A;  3T2O A;  3THD A;  1SHW B;  4JKM A;  4UOJ A;  3LPF A;  3WSO A;  4CU9 A;  4UAP A;  4KWU A;  3F2Z A;  2WQ8 A;  3VD5 A;  2VOT A;  2J1V A;  1GUI A;  3MV1 1;  3E1F 1;  3C8X A;  2J1T A;  3OEA A;  1KGY A;  2W1W A;  2VZ3 A;  1RYY A;  3PUI A;  4IUG A;  3W5N A;  5A1A A;  1W9S A;  3T0A A;  2WAO A;  3VDB A;  2Y6L A;  2VZT A;  3ECQ A;  3IAP A;  1CZV A;  1JYW A;  3CDZ B;  1W9T A;  4MGQ A;  2J1A A;  3WF1 A;  2DDU A;  1O59 A;  4A45 A;  1W0N A;  2L9L A;  5IYY A;  1UYZ A;  5DN2 A;  4DXR A;  2YB7 A;  4XUQ A;  2BBA A;  3IB3 A;  4XUO A;  2WN2 A;  3FHA A;  4CUB A;  1JZ3 A;  4P08 A;  2VCB A;  4CU6 A;  1UXX X;  2R7E B;  3T09 A;  1GOG A;  4XUN A;  2WUH A;  1OD3 A;  2W47 A;  5B4N A;  2B4K A;  1H6X A;  4QX2 A;  5LCW L;  1I5P A;  1CX1 A;  3UET A;  2DCJ A;  4DXS A;  2E33 A;  2BER A;  3MV0 1;  1UY2 A;  3HEI A;  4DUW A;  2EIB A;  4RN5 A;  1JHJ A;  5JR2 A;  2J22 A;  3OGV A;  4BJ0 A;  1US3 A;  4DUX A;  3MUZ 1;  1OT5 A;  4ZY9 A;  1JZ6 A;  5EIY B;  3MBW A;  1NUK A;  1K3I A;  3SKJ E;  3VD3 A;  5JXH A;  3T0D A;  4E8D A;  2BGO A;  3K46 A;  3T2P A;  2QQJ A;  3J7H A;  4OMC A;  4A6O A;  4P00 B;  3WF0 A;  2C26 A;  1D7P M;  2JE8 A;  4A41 A;  2Y6G A;  2E31 A;  2W1Q A;  3WNN A;  3C7E A;  4UI9 L;  4D8M A;  3LEK A;  2QQM A;  4TXW A;  3VDA A;  3A23 A;  4Z2A A;  3UNP A;  5G05 L;  2LS6 A;  1ULP A;  2Y64 A;  3HOB A;  1W9W A;  4PQQ A;  1IQD C;  1YQ2 A;  2V4V A;  4JHZ A;  1PMJ X;  4M4R A;  3FL7 A;  3MO4 A;  5IFP A;  1JZ4 A;  2HYX A;  2W92 A;  3K4D A;  2QQL A;  5C70 A;  2VME A;  2CDO A;  3NRU A;  1GOH A;  4GWJ A;  3T08 A;  4MAD A;  1W8N A;  2WZE A;  3DYM A;  4BXS V;  1EUU A;  2W3J A;  2J1U A;  3WNP A;  4CVU A;  3OG2 A;  4QB6 A;  4L0P A;  2ZEX A;  3NJX A;  4CU7 A;  3PUH A;  1GOF A;  4ARX A;  3CKH A;  3WEZ A;  3WF3 A;  3SEE A;  4P5Y A;  2VZQ A;  4MO3 M;  5B4X A;  1UY1 A;  3CIH A;  3I3D A;  3NNG A;  2V72 A;  1UWW A;  1UXZ A;  2ZEZ A;  2W95 A;  2X09 A;  3BGA A;  1DYO A;  4QX0 A;  5EJ1 B;  2Y8K A;  1EUT A;  3C7G A;  1W99 A;  4W50 A;  1WCQ A;  2VMD A;  3LEI A;  2VZR A;  1JYV A;  2E32 A;  2EIC A;  5LA0 A;  1CIY A;  1O8P A;  2VTF A;  4A42 A;  4BK4 A;  1TVG A;  3IAQ A;  1OF3 A;  4A4A A;  1J83 A;  2XHN A;  2ID4 A;  5DQ0 A;  3LQC A;  1J84 A;  3CZJ A;  4DXT A;  3CMG A;  3D3A A;  2EIE A;  2XOM A;  4OMD A;  2VCC A;  5J1X A;  1NAE A;  3ABZ A;  2Y6H A;  5LA1 A;  1JYX A;  3DYP A;  2QQI A;  4LHS A;  4OYU A;  5CYY A;  4ZZ5 A;  2XON A;  2VMF A;  2ZXQ A;  1PX3 A;  1ULO A;  5HXM A;  5C7G A;  4HG6 B;  2ZEW A;  4JX0 A;  4JKL A;  2QQK A;  1K12 A;  4XZU G;  2QBX A;  1XNA A;  3A22 A;  3AC0 A;  3THC A;  2DCK A;  1XC6 A;  2ORX A;  3BN6 A;  2YC2 A;  5IFT A;  1H6Y A;  4D0Q A;  3NJV A;  4XUP A;  5EJZ B;  1P8J A;  3P6B A;  2HLE A;  2JDA A;  4LPL A;  5C71 A;  3WF4 A;  5DPN A;  1F4A A;  3C7H A;  1UYX A;  4A44 A;  5I0D A;  3FN9 A;  5IJR A;  2Y6K A;  4MOA A;  1T2X A;  3FHQ A;  1PX4 A;  2BZD A;  4QDS A;  4KI5 M;  4GWI A;  3VD4 A;  3WF2 A;  2WN3 A;  4E8C A;  1DLC A;  1KEX A;  1CZS A;  1JZ5 A;  4QX3 A;  2VO5 A;  3VD9 A;  4W4Z A;  3ACF A;  2QQO A;  1UMH A;  3WNO A;  4AAX A;  3K4Z A;  3NQH A;  5LA2 A;  2RJ2 A;  3T2Q A;  3I2H A;  2WZ8 A;  2WAB A;  2YG0 A;  1OF4 A;  2KD7 A;  4QB1 A;  3OEB A;  2BGP A;  4DUV A;  4ARY A;  4JKK A;  2Z4F A;  2VL4 A;  4CU8 A;  4GZ9 A;  3U37 A;  3HNY M;  3JXS A;  1US2 A;  2VZP A;  3HJR A;  2WO2 A;  5JMO A;  2VQT A;  2VZO A;  2W87 A;  1CZT A;  3IDA A;  5CZK A;  4CUA A;  1GQP A;  1UZ0 A;  3DYO A;  2YFU A;  1UMI A;  2W91 A;  3I97 A;  2WAA A;  1UY0 A;  1MPX A;  3K77 A;  3C7F A;  5JXI A;  3III A;  3I2K A;  3ACG A;  1JU4 A;  2VZS A;  5HPO A;  1XNT A;  3OB8 A;  1JI6 A;  3WQB A;  3DEC A;  3K75 B;  2OKX A;  3EYP A;  3VD7 A;  2JD9 A;  4TTG A;  1JYN A;  2B9V A;  1SDD B;  2X10 A;  3ZM8 A;  1UYY A;  1XPW A;  3K4A A;  4A3Z A;  4ET7 A;  3I2F A;  4QX1 A;  2VZ1 A;  1GU3 A;  2Y6J A;  2LW8 A;  3ETP A;  3LEG A;  2WYS A;  1L7R A;  4OZO A;  4RYD A;  2VZU A;  3I2I A;  2VJX A;  3C7O A;  2WBK A;  2WDB A; 
#chains in the Genus database with same CATH topology
 1BJQ A;  2VTX J;  4FOQ A;  1PGL 1;  1WKY A;  2X8K A;  1HN1 A;  1ZBE 3;  3CJI C;  4CDX B;  1V6O A;  1LJ7 A;  3AP6 A;  2ZA9 A;  1MQT B;  3QLQ A;  1HRI 2;  4O65 A;  2P17 A;  4R4Z A;  2ZJC A;  1EV1 1;  2VCA A;  3KQ4 B;  1MS4 A;  5G04 L;  5FP7 A;  4NPR A;  5I0R A;  4DIN B;  1YLL A;  3O0W A;  4OUE A;  4Q4V 2;  4OQ9 A;  2MNG A;  1VBD 1;  4J1W A;  4LLO A;  5GLZ A;  3VBS C;  4BQ2 A;  5A33 A;  2CGO A;  3GXU A;  5L9B A;  5E16 A;  2D7F A;  4PLM A;  2QDR A;  3BTA A;  2W1S A;  1W6M A;  4HL0 A;  4UW6 A;  1LOE A;  2TEP A;  4LBQ A;  4AK3 A;  1YJK A;  4CEW A;  5BNP B;  1WMX A;  1DU3 D;  3PLQ A;  1CPM A;  4FOW A;  4ZZ8 A;  2RV9 A;  1AR9 1;  1HRV 2;  1K5J A;  1V6N A;  3MFA A;  4D6S A;  5JAX A;  1KXG A;  3U10 A;  4Y1V A;  1X9T A;  4ITC A;  3WX5 A;  1TZO A;  1FPN 1;  3PUR A;  3TWI A;  4AEJ A;  1RVF 1;  4E4Z A;  1YFX A;  1ZVF A;  3H8O A;  1OQE A;  2OZ6 A;  2P6H A;  1W8H A;  1ODN A;  3PU8 A;  1BBT 3;  1DGL A;  4XUR A;  1AR8 3;  1WW4 A;  2ENR A;  3LSE A;  1QKQ A;  1K45 A;  2EXK A;  3WNK A;  1GNY A;  1KQR A;  1WLC A;  3WNM A;  1JZ7 A;  4YW5 A;  5FZC A;  1VBA 3;  1ZBA 2;  2E7Q A;  3VN4 A;  1ULE A;  4AED A;  3ACI A;  1RHI 3;  3HNM A;  3RZG A;  5J09 A;  1ASJ 2;  4OI1 A;  4YFZ A;  2WRA A;  3ACH A;  3HQR A;  3SKV A;  2A6W A;  2WO7 A;  3WP3 A;  4ZXE A;  4XFA A;  5AC9 3;  1QOT A;  3OUH A;  2VR4 A;  1ULF A;  2VUD A;  4ZU5 A;  1K42 A;  4L97 A;  3RGB A;  1J1T A;  2JDU A;  5FYS A;  4CP2 A;  1W03 A;  2GMM A;  3VBH C;  1DIW A;  3W58 A;  4Q8L A;  5DZF A;  1H2L A;  2A6Z A;  5KHH A;  2JIG A;  5JZG B;  4IEW A;  2J7M A;  4N8M A;  5IAV A;  1Y9Q A;  3A7Q A;  4X8P A;  1LEM A;  2D93 A;  2XML A;  2Q8D A;  2QQN A;  1UPI A;  3VZN A;  4YVS A;  1CVN A;  1LOC A;  1V6I A;  2PHW A;  3KQR A;  3ZN4 A;  4FXK B;  1SZB A;  5FUI A;  1OKO A;  1DP0 A;  2A71 A;  4CDW C;  3W9A A;  4RR3 C;  3T4H B;  5DDJ 2;  2WJS A;  1S0F A;  3AP9 A;  3QAC A;  3WVJ A;  5JOW A;  3Q8F A;  1W8O A;  5A7O A;  2ZHM A;  2R04 1;  3CQO A;  3QCW A;  1ND2 C;  3VBS B;  4P9L A;  3I3E A;  1CQ9 A;  4QD2 A;  3CHX A;  3HN3 A;  4WV8 A;  5DUX A;  2JDZ A;  1H30 A;  4Q29 A;  2C4X A;  3PU3 A;  1NCR B;  1W9Y A;  4W8J A;  3RYK A;  4OHY A;  1NX9 A;  1DZT A;  3GZU C;  3IZO A;  3SEP A;  2OQ6 A;  3ENR A;  3KVA A;  1ZX5 A;  3GCX A;  3GM8 A;  1RMU 1;  1VB2 A;  4QKB A;  2PXJ A;  3UGH A;  2A3X A;  4HN1 A;  4XQW A;  2BBV A;  2WKK A;  4DRV A;  4A3X A;  1TEI A;  3AYC A;  3CJI B;  2K2S A;  2HWC 3;  4WZC A;  4CDX C;  4CU9 A;  3V0A A;  4HZF A;  1EAH 3;  3AZY A;  3WT3 A;  1OXC A;  3ZIW A;  2IVJ A;  1QIQ A;  3MGU A;  1YCI A;  4DS0 A;  3C8X A;  3JBG 3;  2J1T A;  2R30 A;  3ILN A;  4KWL A;  4Q1R A;  2RR1 2;  3L2H A;  3TOJ A;  1QQP 1;  2W1W A;  5IVV A;  2VOV A;  2VZ3 A;  4HOO A;  5FO7 B;  4CRQ A;  1RB8 G;  1C5H A;  5FZI A;  2RMU 2;  4RS5 C;  2ATF A;  3ZKU A;  3DPR C;  1W9S A;  4ATE A;  3APB A;  2WAO A;  3VDB A;  3TB0 A;  1W0P A;  2VZT A;  3UK9 A;  2BFU L;  1LHN A;  5F2W A;  1QH7 A;  5FZ1 A;  1MZF A;  4GAL A;  1W9T A;  2D6M A;  4DRR A;  4NAM A;  4MGQ A;  5FBZ A;  4DFS A;  2SBA A;  4FTE A;  1A78 A;  2MHF A;  3NAP C;  1F5F A;  2L9L A;  5FQ0 A;  1GV9 A;  5A80 A;  4COW A;  5IVC A;  4UFJ A;  3DN7 A;  4DXR A;  1UKG A;  4XUQ A;  2ET7 A;  3IB3 A;  5JSO A;  4K21 A;  3RMY A;  4UYB A;  4P08 A;  2YGL A;  2I74 A;  2Q1F A;  3J7L A;  4M3C F;  4YWA A;  3TN9 3;  5JOY A;  1UXX X;  2R7E B;  2XJR A;  1SAC A;  4XIK A;  4BA6 A;  5GZC A;  2F4P A;  1OLQ A;  1OLM A;  1GOG A;  4XUN A;  4YVS B;  4G3Y C;  3BCW A;  2IXJ A;  4Q0P A;  2W47 A;  5CA6 A;  1AR7 2;  4M0H A;  4Q4Y 3;  3AP7 A;  1SBD A;  1I5P A;  1NOV A;  1TNR A;  2FCV A;  4OZX A;  5LZ6 A;  3MIB A;  1HX6 A;  4NHL A;  2C5D A;  3O1P A;  5LBB A;  1HDK A;  1C1F A;  2BER A;  4XBN A;  3MV0 1;  5J98 B;  4YM3 A;  3ITQ A;  4DNY A;  4RQP C;  4Q4W 3;  2PN5 A;  4Q4X 2;  4RSU A;  4DUW A;  5C3S A;  2VXJ A;  3WUD A;  3OUI A;  3AL5 A;  1XE8 A;  2WC2 A;  3OGV A;  1CX4 A;  5FKB A;  4PI0 A;  4DUX A;  1BVP 1;  1VBC 3;  4CPB A;  4IW3 A;  4QWN A;  4YM0 A;  1OT5 A;  4ZY9 A;  5CVR A;  3GAL A;  4KGG A;  5EIY B;  3VDD C;  4YG3 A;  1NUK A;  1MS3 A;  1DGW A;  3SKJ E;  3VD3 A;  4WVM A;  3B69 A;  4YNI A;  4Y4Y A;  5SV8 A;  4QHO A;  2HWF 1;  4IEQ A;  4NWV A;  2RS1 3;  4A6O A;  1JBC A;  1RUE 2;  1DG6 A;  2DYC A;  2WLP A;  3FLT A;  1OVP A;  4AZZ A;  4CP1 A;  4NIG A;  1D7P M;  1ZZ7 A;  2HWD 2;  1YI9 A;  2ZCW A;  4A41 A;  4MGZ E;  2P6C A;  4A7K A;  3WNN A;  4CDU B;  4X6R B;  1DQ4 A;  2G1M A;  3V0B A;  1CJD A;  1DGR A;  1HKD A;  2QQM A;  4TXW A;  4XYX A;  1Q8P A;  4NRQ A;  5FYV A;  5DAQ A;  5F8P A;  4A7Z A;  4MG2 A;  1ULP A;  2H6C A;  4GD4 A;  3HOB A;  1KFX L;  2F6B A;  5AFE A;  1VBD 3;  3U4X A;  1PVC 2;  3VHP A;  3AYD A;  3RJR A;  1D0G A;  3ZSM A;  1JMU B;  3PIJ A;  3WCR A;  1HV0 A;  1LED A;  4XET A;  3TNQ A;  3VBU C;  3WUC A;  4AHZ A;  1YRZ A;  4Q4Y 1;  3RWN A;  4BQX A;  5JIU A;  1XND A;  2P37 A;  4P5H A;  2QZ2 A;  5C70 A;  1MS0 A;  3AYA A;  3RRD A;  1F5J A;  3NRU A;  3S7I A;  1IZ3 A;  3AMP A;  1IS5 A;  1W6N B;  2WZE A;  3ZFG B;  3KV4 A;  4LBQ B;  3PVE A;  3W59 A;  1QJY 1;  5A3U A;  3ZXG A;  2W3J A;  2GNT A;  4FPL A;  1ALY A;  3WIN E;  4CVU A;  5F9T A;  1IHM A;  3OBT A;  1X9P A;  5KXB A;  5FFO C;  1H8T B;  1GOF A;  4OI4 A;  4JVA A;  3ZYH A;  1E57 A;  1UZZ A;  3RVH A;  2DWR A;  2XJQ A;  3VDD A;  3WF3 A;  1PK6 A;  4P5Y A;  2XGX A;  1WD3 A;  1YJL A;  2GME A;  4MO3 M;  1OPM A;  2RS1 1;  3B93 A;  1D2S A;  4QPI C;  4XAB A;  1MQT A;  3OGG A;  4GWN A;  4LXL A;  4NPM A;  4CP9 A;  5IAT A;  2WL1 A;  5FUP A;  5CAD A;  5D8A B;  1FI2 A;  1UNB A;  4FPE A;  3RZZ A;  2VXR A;  4CE8 A;  3FWE A;  5FZF A;  3R6S A;  5FOB B;  1UXZ A;  3MIG A;  2VNR A;  1ZZ8 A;  3S5A A;  3VBF B;  4XDQ A;  3BGA A;  2OQ7 A;  5BYN A;  2CNA A;  4Y20 B;  3I7D A;  1JUH A;  2DV9 A;  3ATG A;  3GF6 A;  1DYO A;  5FY8 A;  1AXY A;  1GBG A;  4ES8 A;  2OVU A;  4NPL A;  3VL9 A;  4XF0 A;  5AFB A;  1U5Z A;  4HFS A;  3VZJ A;  1AR7 3;  3WW3 A;  1W99 A;  1AR6 3;  1YQ8 A;  2GH2 A;  2VAU A;  4QM8 A;  2FDG A;  5A1L A;  5IWF A;  2VMD A;  4NRM A;  2BVB A;  2W39 A;  3LEI A;  1ZRI A;  4NHY A;  5A7S A;  1C57 A;  4HXC A;  3IKW A;  2XJV A;  3MEP A;  2CGN A;  2HWB 1;  2RJK A;  3PHM A;  1FOD 3;  1EPW A;  2EIC A;  3KV9 A;  1VRH 3;  4LE3 A;  1IQA A;  2VTF A;  4QGM A;  3VKM A;  4A42 A;  3B01 A;  4RGK A;  5AC9 1;  4DY3 A;  3SLI A;  4BK4 A;  1Q5O A;  4Z8B A;  2AEN A;  1HQL A;  1O4Y A;  2LAL A;  2XLF A;  1TME 3;  1OF3 A;  1KD7 A;  5I8S A;  4CCM A;  5HCH A;  3DUI A;  3ZMO A;  1GYK A;  2ID4 A;  2C1F A;  2QVS B;  3LQC A;  1J84 A;  5DQ0 A;  3O12 A;  2WNU B;  1K5M B;  1UZY A;  4MXW B;  4MLO A;  4PQ9 A;  5J1X A;  3ABZ A;  3WDW A;  1YO8 A;  2VBD A;  1JYX A;  4YZ1 A;  2OPK A;  4LHS A;  4HET A;  3RZL A;  3I8T A;  2XWJ B;  1EYB A;  5CYY A;  4I30 A;  5ACA 1;  2XON A;  3ZPO A;  1LR5 A;  3MPB A;  1JUI A;  5A3T A;  4WM7 B;  3FC0 A;  4HG6 B;  5LB6 A;  2FDF A;  5EJ3 A;  1Y3T A;  1VP6 A;  2IVI B;  2ZAB A;  4QPG A;  4Q1P A;  4RHV 1;  1Y9G A;  5FP9 A;  2RR1 3;  2QBX A;  3IBM A;  3KHB A;  3N9O A;  4XZU G;  5F5Q A;  4CA9 A;  4IES A;  1XNA A;  4Y5S A;  3I54 A;  4LOT A;  3VGI A;  3A22 A;  1WLT A;  2HBU A;  1LHU A;  2GZW A;  3DL3 A;  2A3W A;  1RHI 2;  2ORX A;  2BNM A;  2XBO 3;  2XWB B;  4NHM A;  2VG9 A;  3BN6 A;  3RYR A;  2BDR A;  3M4F A;  1FV3 A;  5FYI A;  1JTZ X;  3VHN A;  1XNK A;  1H6Y A;  1F15 A;  1QDC A;  5FZH A;  3KCC A;  2XJS A;  3MHZ A;  2XLG A;  1SLI A;  4Q8K A;  4B4Q A;  2QFE A;  1GZ9 A;  2Q30 A;  5FJH A;  4EWD A;  2B42 B;  3UJO A;  2UY8 A;  3ACL A;  3NST A;  1QDO A;  4R8H A;  3JD7 1;  4EZH A;  1K5M C;  1QJZ A;  3OSD A;  4Y22 A;  3NNF A;  4XJ8 A;  4W6Y A;  1W6M B;  3MPP G;  4CEY B;  2FBE A;  1YFY A;  3KWV A;  4LO5 B;  5E88 A;  3ZFF B;  4WBB A;  3FE5 A;  4YW2 A;  3WDT A;  5I0D A;  4CDQ B;  3L2Y A;  4XDO A;  4CP0 A;  4MGI E;  1PX4 A;  5FK8 A;  2ZBJ A;  4FFF A;  3S30 A;  1F35 A;  3PUQ A;  3JUU A;  1POV 1;  4QQP A;  3D82 A;  4N53 C;  4AR2 A;  1RVF 3;  4E8C A;  1XJA A;  4OLL A;  2VO5 A;  3POW A;  3WD5 A;  4EN7 B;  1W05 A;  4RHV 3;  1AL2 1;  3ACF A;  2QQO A;  1XQN A;  4Q0S A;  3WNO A;  1GR3 A;  2UWC A;  4AVV A;  5M0T A;  5EXO A;  2DVB A;  3NQH A;  4ASM B;  3I2H A;  2B45 X;  2WZ8 A;  2ZGQ A;  2YG0 A;  4GH4 A;  4QB1 A;  3NV2 A;  3M3Q A;  5J37 A;  2VW2 A;  1RUD 2;  5FZM A;  3J8F 3;  1H0B A;  1J1L A;  3LDK A;  3U11 A;  4P9W A;  1O4Z A;  4XJU A;  4JKK A;  4DZG A;  2VL4 A;  2V09 A;  4I3G A;  1UL9 A;  2WQ4 A;  4QPI B;  3VBU B;  3LEM A;  3HNY M;  2CV6 A;  3BAL A;  3E97 A;  4NHK A;  4Q4W 1;  3K51 A;  3TYJ A;  1RUF 3;  2DUP A;  2KA3 A;  2F4L A;  5DAB A;  2HWC 1;  1STM A;  2E51 A;  1IOA A;  3M70 A;  1ZBE 1;  3NV4 A;  3OD4 A;  4BXF A;  4E4S A;  4EN9 B;  3J8F 1;  4WM7 A;  5FPA A;  4BQ4 A;  2ARE A;  1LGN A;  1ND2 B;  2VQT A;  1S0E A;  2GC0 A;  2VZO A;  3EMR A;  1AR8 1;  2CY6 A;  2EXH A;  4JGZ C;  4RGG A;  5I0T A;  1EPZ A;  4BQW A;  3BU0 A;  3ZPY A;  2C9A A;  1QMJ A;  2NYY A;  5K9Y A;  2ZZJ A;  2EXJ A;  1UMI A;  4IND A;  4K9S A;  3NV3 A;  2PHF A;  2WA4 A;  3JB8 A;  2XR4 A;  2VPV A;  3MDP A;  1E5I A;  5CKN A;  3LAG A;  4DXZ A;  1RUJ 3;  1QXP A;  2Q8O A;  5JZG C;  5AVP A;  4DOU A;  3AVS A;  5L7O B;  3HQX A;  5AVA A;  2NP0 A;  5C8C A;  5CNA A;  1POV 0;  5EFU A;  1BLZ A;  5IVJ A;  5JOZ A;  4K8F A;  1JI6 A;  1TMF 1;  2A5Z A;  2WZP P;  1ZRE A;  3TEW A;  5CAZ A;  3MF6 A;  2A7A A;  3ZDS A;  3VD7 A;  1IS3 A;  1DQ1 A;  1VBB 1;  3E5U A;  4N43 A;  5FZE A;  3UGG A;  2B9V A;  2ZGS A;  3BOD A;  4CUG A;  5K0U B;  5L36 A;  1PZ9 A;  1G6N A;  4CDU C;  5J48 A;  2MEV 1;  4ET7 A;  2RM2 3;  4NRP A;  1AR7 1;  2Y6J A;  1PO1 3;  2GP5 A;  4XIL A;  3WNX A;  4OZO A;  3OGJ A;  2BVV A;  3WW2 A;  4CEY C;  2JDY A;  2DVD A;  3I2I A;  2VJX A;  5DZE A;  5EWS A;  3SH3 A;  1QJY 3;  3FLR A;  4WM8 B;  4XCB A;  3VDD B;  2QQV A;  3ZYR A;  2WDB A;  5L73 A;  4P9I A;  3ZSL A;  1CAX A;  3H7J A;  2B46 X;  2BYV E;  3GDB A;  1PMH X;  1SCR A;  4UT5 A;  2R06 1;  5D8A A;  5HV0 A;  4I02 A;  1UU5 A;  4EYU A;  3H42 B;  2W46 A;  3G7D A;  2J1E A;  2XL9 A;  2HWD 3;  4R9B A;  1W8Z A;  5LK5 A;  4BLJ A;  1FOD 1;  3I2G A;  1W04 A;  4K1Z A;  3ZN6 B;  4KH9 A;  3O1M A;  2VZV A;  1H8T A;  1OUS A;  5I8Y A;  5DAW A;  1CAU B;  1YI7 A;  1GZC A;  5JR7 B;  1QWR A;  4FXG B;  1I9R A;  3DKW A;  4YVS C;  5ACA 3;  3IMM A;  2BGC A;  5F7U A;  1F9K A;  1REF A;  1XSR A;  2ZTN A;  2VC9 A;  2DVA A;  2YU1 A;  3HNB M;  5C8C C;  5ABJ A;  1CD3 G;  5T50 A;  1WZX A;  1VBC 2;  2CTV A;  4IGP A;  2ZAC A;  3AMN A;  4S2D A;  4WM7 C;  2W1U A;  2E6V A;  4AI1 A;  3UES A;  2UWB A;  1H2K A;  2WA3 A;  4NWW A;  2Q1M A;  2EAL A;  2KXL A;  1YC6 1;  1PNF A;  5GAL A;  1I3H A;  2P5B A;  2PFW A;  5DUU A;  2A73 B;  3ZR5 A;  2B7Y A;  1BMV 2;  1BZW A;  5CFC B;  1XU2 A;  4P02 B;  2R07 1;  1JZ2 A;  2WNU C;  2RS3 2;  4N43 B;  3HPN A;  5LBF A;  2D3S A;  1DQ2 A;  4AI2 A;  3VBO A;  1PM4 A;  1O8S A;  1WLD A;  2PHL A;  4LBM A;  1GMM A;  1YEW A;  2ZAA A;  2QUO A;  3OBA A;  4EV0 A;  4YLZ A;  5T54 A;  1G8W A;  3IN9 A;  5ABJ C;  1W2N A;  4V2V A;  3ASI A;  1E5R A;  3SCH A;  2C9K A;  4H2A A;  1R64 A;  2J1S A;  3WOG A;  2BJS A;  3VUO A;  5FZK A;  4QPW A;  3GGL A;  1COV 1;  5DMY A;  5F5C A;  5FZD A;  3AFK A;  1B35 B;  4N90 A;  2BPA 2;  3MUY 1;  1FAT A;  4JQR A;  4YG6 A;  4ERO A;  4XE9 A;  2P3I A;  2RDS A;  2Q8E A;  2IXC A;  5IVB A;  1W2U A;  3GHN A;  1SCS A;  5FZ3 A;  3UKV A;  2Q4S A;  5LA9 A;  3RWK X;  2D98 A;  2WS9 3;  3NKG A;  3KB5 A;  2V5D A;  3KGL A;  4IE6 A;  2R0H A;  3UL2 A;  5T5L A;  3V0B B;  1OUX A;  3I49 A;  4YM1 A;  4LO4 B;  1KIT A;  4LQR A;  1VBC 1;  2JEM A;  1SG3 A;  4S2G A;  5JXG A;  5T5O A;  1WCD J;  3UKT A;  3V65 A;  1W6P A;  1NKG A;  3HD8 B;  4KMQ A;  3M1H A;  2XBO 1;  3T0B A;  5BNQ A;  4MX3 A;  4MXV A;  2XJU A;  3ORJ A;  4H7L A;  2W5F A;  5F39 A;  4BQ5 A;  2X53 S;  1FOD 2;  4S2F A;  1HB1 A;  2GMP A;  3WNL A;  2HWC 2;  1C4R A;  4LNV A;  3MIC A;  3T2O A;  4W6X A;  3THD A;  2RDQ A;  3FMG A;  1H8T C;  1DFQ A;  3H1W A;  3JCI A;  4JKM A;  3RZJ A;  5FAX A;  3FZ3 A;  3S7E A;  3LPF A;  1E5S A;  4QQH A;  1YQ6 A;  5LY2 A;  3U1X A;  2JG9 C;  5C3P A;  1R09 1;  1BMV 1;  3N7L A;  2DTW A;  3VBH B;  3VD5 A;  3I2O A;  3IDB B;  4IEY A;  4Q0Q A;  3USU A;  1GUI A;  2YBS A;  4KGQ A;  4MGK E;  4Q0U A;  3WDX A;  2XH6 A;  4HN0 A;  2UUR A;  4WVZ A;  1UX6 A;  4FFH A;  3WQ0 A;  1NE6 A;  4YSF A;  5JCT A;  4QXC A;  4Y1U A;  1V9U 2;  1FNY A;  1XE0 A;  2NZ9 A;  3WDY A;  4A7Y A;  3LA3 A;  4AGV A;  5FR3 A;  1RGS A;  5FYY A;  4FPC A;  1NA1 B;  4JV4 A;  1POV 3;  4JGY A;  2Y6L A;  3B7M A;  2Y60 A;  2ZHN A;  2RHP A;  3KV5 A;  4IE5 A;  1UQX A;  5ANN A;  3K48 A;  4CXW A;  3CDZ B;  3HN1 A;  1FPN 3;  1JYW A;  4LE4 A;  5I0U A;  1G9F A;  2CHH A;  3PVB B;  3WF1 A;  4XDP A;  1LOD A;  3OJB A;  3WP5 A;  2Y0O A;  1WW5 A;  4IV1 A;  1XNB A;  5LK7 B;  1TE1 B;  3KVB A;  1AJO A;  5IT6 A;  5DDJ 3;  5IK7 A;  4FAG A;  4P9G A;  2VMI A;  2YB7 A;  4Z2W A;  5C9A B;  4CTE A;  1HB3 A;  2BBA A;  3RSJ A;  2N7G A;  4N43 C;  3FHA A;  1MS9 A;  2OXB A;  5FZB A;  2VCB A;  5LY1 A;  5H9R A;  1PGL 2;  2WFP A;  3R05 A;  4JRL A;  5K8S A;  2WNE A;  5A3W A;  4B1M A;  1I6X A;  4B7K A;  1LHV A;  5FBJ A;  2IWG B;  1QJE A;  2Y38 A;  3KCY A;  5FWE A;  1AR8 2;  2W08 A;  5B4N A;  4QX2 A;  4LIV A;  2DVG A;  1LTE A;  1CX1 A;  4RQP B;  5IVY A;  2DCJ A;  4DXS A;  2HWB 3;  4QU2 A;  5C8C B;  2FDK A;  1ONA A;  1VAV A;  3HEI A;  4NAO A;  1KDM A;  5A6Y A;  3RZK A;  4RN5 A;  3FUQ A;  5JR2 A;  4X8N A;  3B9C A;  2NMN A;  3RFR A;  2BV4 A;  4BJ0 A;  1LGB A;  4D6R A;  3VV1 A;  1US3 A;  4FBF A;  1YQ5 A;  2R0F A;  1BKZ A;  1ZZB A;  3MUZ 1;  1QGL A;  5DAX A;  1JZ6 A;  3RZH A;  1R1A 1;  2AH2 A;  5FK7 A;  5K0U A;  3VBU A;  3J7N A;  2JD4 A;  1EAH 1;  1T6G C;  4QKD A;  2XKO A;  3T0D A;  1LES A;  4E8D A;  4YGE A;  5DG1 A;  2VW1 A;  2YBK A;  3K46 A;  3SCF A;  4M0N A;  2QQJ A;  4OMC A;  1WCK A;  4I0B A;  1UOG A;  2GC2 A;  4GMP 0;  2EAK A;  2IXH A;  4P00 B;  2W1Q A;  5CKM A;  3PME A;  3ZYP A;  4CEW C;  2B8M A;  3L9J T;  2VCM A;  4IV3 C;  3VDA A;  4BLI A;  3ZFE A;  5GLU A;  3UNP A;  1NLS A;  2Y64 A;  3O1U A;  5LAT A;  4YZ3 A;  2B39 A;  4XXA A;  2YPJ A;  3EO6 A;  3ZR6 A;  1L3J A;  4XJA A;  4JHZ A;  4Y22 B;  1Z7S 1;  3ZSK A;  1UOJ A;  3HQU A;  3H7Y A;  1PK6 C;  3S6P A;  4Q4V 3;  2O8O A;  3AMH A;  4HVR A;  1JZ4 A;  1Q8O A;  3I59 B;  2FZ2 A;  2JKB A;  5B2G B;  2HYX A;  3H9A A;  2FQP A;  5I93 A;  1HRI 3;  1VRB A;  2R07 3;  2WZR 3;  4XQD A;  2W92 A;  3E6C C;  3V64 A;  3K4D A;  2QQL A;  1RUN A;  1GLH A;  2CDO A;  1UU4 A;  2JE9 A;  4KG8 A;  1QJX 1;  1GOH A;  3T08 A;  4MAD A;  3JQW A;  3DYM A;  2K46 A;  4BE3 A;  4I3P A;  1ND3 C;  2DUO A;  1EUU A;  1QJX 2;  2IFR A;  2VUL A;  2ILM A;  4GQ7 A;  4QPG C;  3SIS A;  5KHG A;  2VW0 A;  1O3Q A;  1GZT A;  2WFF 2;  4L0P A;  2ZEX A;  3AZZ A;  2VVE A;  3WP4 A;  3LIH A;  5D1I A;  1C8M 3;  4ARX A;  3CKH A;  1LAJ A;  1QJU 3;  3W21 A;  2ZGN A;  1AL2 2;  4PF5 A;  4NMI A;  2VZQ A;  1SDW A;  1SPP B;  2C0Z A;  3HMY A;  4QXB A;  5E8A A;  4D94 A;  1UY1 A;  3ROU A;  1JOB A;  3VHO A;  2HYK A;  5FYC A;  2VVD A;  4JAA A;  2HEW F;  1S2K A;  5IVF A;  4NHX A;  1QXR A;  3JU9 A;  2V72 A;  3VBR A;  3O7O A;  2ZGL A;  5FLH A;  2ZEZ A;  4CDW B;  1V9U 3;  1HJF A;  4O9G A;  3R4D B;  1YYN A;  4C1W A;  3MLJ A;  4OHW A;  2VGD A;  2WSU A;  2D6K A;  1AR9 3;  1OBN A;  2JEC A;  5FPX A;  5CIS A;  1G7Y A;  1W8W A;  1G9C A;  1EAH 2;  5EJ1 B;  4OI2 A;  5HBA A;  1RIN A;  2AYH A;  2QQU A;  3C7G A;  3J7M A;  3ZDV A;  4BB3 A;  1OA4 A;  3DV8 A;  1PNG A;  1LEC A;  4W50 A;  1PIV 3;  4XJZ A;  4TZD A;  1J3P A;  1ENQ A;  4GB3 1;  3E6B A;  2ADE A;  1SMV A;  3LDR A;  3QBQ A;  3MLL A;  1QNW A;  4LOS A;  4N53 A;  4Q4X 3;  5FYT A;  4V2W A;  1N1T A;  1ENX A;  4XCA A;  1O5L A;  5FZO B;  1VPH A;  1W06 A;  4BWO A;  1L7L A;  1OOP C;  3IAQ A;  4A6S A;  5EPA A;  2FDH A;  2ZX3 A;  1RUF 2;  2X5I C;  4AEM A;  3USS A;  4C0B A;  4DXT A;  2XUE A;  2EIE A;  4RHV 2;  2XOM A;  2IXI A;  4SBV A;  2RE9 A;  1FAY A;  3AVR A;  2HWD 1;  2XB6 C;  4URT A;  3AKR A;  4CDQ C;  1XYN A;  4URA A;  3OPZ A;  3N4M A;  1W6P B;  4YAR A;  4QKN A;  2ZZQ A;  2EXI A;  3P5B A;  2VMF A;  5A7Q A;  2D43 A;  4IGO A;  5HXM A;  1SPP A;  3H0O A;  3O1R A;  5C7G A;  4FTB A;  5JI7 A;  4JX0 A;  1JYC A;  4RA0 A;  1QU0 A;  2WIN B;  3VLB B;  1X50 A;  2QQK A;  2VUA A;  4QGN A;  1CPN A;  2YMZ A;  3T1M A;  1CJP A;  3VBR B;  2HWE 1;  5KR7 A;  1J58 A;  2WT0 A;  1IPK A;  3VZO A;  3USU B;  3A4U A;  1GWL A;  2YC2 A;  3FFZ A;  3KV6 A;  4IQP A;  3M2M A;  4E2G A;  3O5S A;  1MQT C;  3POJ A;  1PVX A;  4LJH A;  1H4H A;  1S2E A;  1GQH A;  3WV6 A;  4MET A;  2WFF 1;  3O1O A;  4MHR A;  1ULD A;  3ILR A;  4B8E A;  4QHZ A;  4B7E A;  1A6C A;  3NJV A;  4HT1 T;  1QNY A;  4C1X A;  3OBZ A;  1O3S A;  2FCU A;  4ZS2 A;  2D40 A;  4L99 A;  3PL0 A;  2JDA A;  1W3X A;  4LPL A;  3LIG A;  2OX0 A;  3B5L B;  5DPN A;  1F4A A;  5CU1 A;  2OW4 A;  3MLK A;  1LOF A;  3URF A;  2FMD A;  2GNB A;  1NCQ C;  3Q9O A;  4FTS A;  2JG8 B;  4OQ8 A;  1ZA7 A;  3ZVX A;  3FHQ A;  5LW9 A;  2BZD A;  1NE4 A;  1TMF 3;  1BEV 1;  4JRA A;  4Y1Y A;  4NJ4 A;  4R9D A;  3WG4 A;  1J59 A;  5F5I A;  2PHU A;  4KI5 M;  3OPW A;  1QJF A;  2B5H A;  4HMZ A;  4R4X A;  2ET1 A;  3VB9 A;  2QQP A;  1JZ3 A;  1JZ5 A;  1UZW A;  4QX3 A;  1PMI A;  4C91 A;  2PAK A;  5FMO S;  2R6Q A;  4QM9 A;  2BOJ A;  1WUV A;  5F3G A;  4FAH A;  4LKD A;  5KXD A;  1LOB A;  2AUY A;  1W6N A;  3D5O A;  2NLR A;  2WZR 1;  2RMU 1;  2JDK A;  4JDN A;  4LO8 A;  3ZIX A;  1S1A A;  5EP9 A;  5A7W B;  5LA2 A;  3PDQ A;  2HBT A;  1NY7 2;  2RJ2 A;  3FX3 A;  4N7U A;  3T2Q A;  2GH8 A;  3RPQ A;  4WVV A;  2TNF A;  2KD7 A;  1LGC A;  5BUV A;  4L8Q A;  1QJY 2;  3VHR A;  2B9U A;  1KFU L;  1PZ8 A;  3AJY A;  1GAN A;  3N9M A;  5GKA C;  3T4V A;  3BPS A;  1MS5 A;  1R09 2;  3CU7 A;  4ARY A;  4CDQ A;  1ZRC A;  4COV A;  4XF3 A;  3UT0 A;  3U37 A;  4IDZ A;  1R1A 3;  2GN7 A;  3JXS A;  2OT7 A;  3ON7 A;  5DUW A;  1RMU 2;  2XG3 A;  1U5X A;  1F31 A;  3ZFG A;  3BOP A;  4NIH A;  4OFG A;  5C3Q A;  4J25 A;  4U2A A;  2GDF A;  2K9Z A;  3HJR A;  1PVC 1;  3BUC A;  4XMA A;  2WO2 A;  2GC1 A;  3NMB A;  1ENS A;  1CZT A;  2FMY A;  4ZKT B;  1R1Z A;  3IDA A;  2R49 A;  5T52 A;  5LRR A;  5BNO B;  5F3E A;  1IS4 A;  3AB0 A;  2ZX1 A;  1W2O A;  1UZ0 A;  3CO2 A;  3LF7 A;  3OCP A;  4WM8 C;  1NLR A;  5GZD A;  4MUV A;  1ULG A;  2W91 A;  3I97 A;  2XUM A;  4QPI A;  1HIX A;  4YW4 A;  2WAA A;  3LDB A;  3H1M A;  3BOW A;  1MPX A;  3ELN A;  1PVC 3;  2Z79 A;  2JXA A;  3K77 A;  4LBL A;  4O7X A;  4ZON A;  2O14 A;  3BPZ A;  4SLI A;  4YVW A;  3TEX A;  4FPJ A;  4Y3O A;  3QH7 A;  4I0W B;  1XXN A;  2VZS A;  1D4V B;  2JDN A;  4LBJ A;  4BHP A;  5APA A;  3N3H A;  1N1Y A;  2YDE A;  3WQB A;  1YWK A;  3F95 A;  2CWS A;  4GH4 C;  1VMF A;  4JGZ A;  1HB4 A;  1LHO A;  1AXZ A;  1PGW 1;  5JSR A;  4XTM A;  4UFL A;  1GQG A;  4XFI A;  1XOY A;  2P34 A;  1RMU 3;  1RED A;  4MXW A;  4ATF A;  3WW1 A;  5KBF A;  1IS6 A;  2YC0 A;  1SBE A;  1RUI 2;  1GFF 2;  2BUK A;  4LOR A;  4QX1 A;  2VZ1 A;  2R06 2;  3ETP A;  5JPN B;  3DXU A;  5CBL A;  3CL1 A;  2RR1 1;  2RS3 1;  1A8M A;  4RYD A;  2BRT A;  1YQC A;  1WME A;  3I59 A;  3KGZ A;  3VKO A;  3NNJ A;  4IEP A;  5FXX A;  3X29 B;  1S0B A;  4MV2 A;  2WSV A;  1DBN A;  4FQ4 A;  4QAW A;  1YIP A;  3OGS A;  3O1T A;  2A75 A;  3HIF A;  4L9B A;  2JKX A;  4XAC A;  5FTT C;  3LB9 A;  3VDC A;  1DYP A;  1Z0H A;  4FOY A;  4YGC A;  5H9Q A;  4AFA A;  4EN6 B;  4WZF A;  1CAW A;  5C5T A;  2RVA A;  3DF0 A;  4LR4 A;  1MS1 A;  1JN2 P;  2Y34 A;  1M06 G;  1SFY A;  4XUT A;  1OH4 A;  2D6L X;  1MZ5 A;  5GM0 A;  5JMC A;  4TSV A;  1IG3 A;  1RJ7 A;  1FX5 A;  1X33 A;  1VBD 2;  1TMF 2;  1S0J A;  3CJX A;  4K1Y A;  1SEF A;  3CLP A;  3EB7 A;  3KM5 A;  5C33 A;  1JZ8 A;  4JC1 A;  4LKF A;  1ENR A;  4Q0V A;  5JXJ A;  2IZW A;  5KHK A;  1HN0 A;  2MPF A;  1EV1 2;  3MFC A;  4HAN A;  3POI A;  3ILF A;  1N47 A;  1FNZ A;  2WO3 A;  2ZGM A;  3OGR A;  2VUJ A;  3EJK A;  1NYW A;  3GBW A;  2WR9 A;  3I3B A;  1JS9 A;  1QQP 2;  1WCU A;  3MW4 A;  1RC6 A;  3N7M A;  5L19 A;  1S0C A;  3N35 A;  4ORF A;  5GZG A;  5D2A A;  1AYM 3;  4JZR A;  4QB2 A;  3U14 A;  2XVL A;  1W28 A;  2XLA A;  5K7P A;  4AQS A;  4XFC A;  2V73 A;  4N53 B;  3D4K A;  4LT5 A;  4XVH A;  2BWC A;  4FPK A;  4AG4 A;  1BHG A;  1JW6 A;  1F4H A;  3J8F 2;  2D3R A;  2NM1 A;  4BDV B;  2MEV 2;  3DXT A;  5CFC A;  2DTY A;  2EID A;  2ZPX A;  3NAP A;  3POG A;  4J6G A;  5A3P A;  2GNM A;  2FHR A;  3AYE A;  3OTF A;  3ZFF C;  3SCG A;  1MVQ A;  1S0I A;  4YW6 A;  2XQX A;  3D8C A;  3M3E A;  4IET A;  4QDR A;  4D3W A;  4G4F A;  1EY2 A;  2J1R A;  3KHC A;  5EYX A;  3OD0 A;  4I0A A;  1UY4 A;  3LE0 A;  3EBR A;  4JGY C;  2A70 A;  2P4E A;  4N7I A;  1LNS A;  3VBO B;  3AZW A;  5C3O A;  4XIO A;  5A3N A;  3A21 A;  1DQ6 A;  2YFZ A;  4E2S A;  1NY7 1;  4UW5 A;  3T2T A;  3MF9 A;  1MAC A;  4KBZ A;  3IDC B;  3R0R A;  1MR5 A;  1FMD 2;  4GMP 1;  1L7Q A;  5DUV A;  1F2N A;  1FV2 A;  4YPJ A;  3PIG A;  3K2O A;  1LB2 A;  5J96 B;  2JB8 A;  3POF A;  2NPI A;  3LCP A;  2DUQ A;  4H14 A;  2H0B A;  3LPG A;  1VIW B;  4MGS A;  1O7F A;  3MW2 A;  2OYZ A;  1GSL A;  5FRE A;  4EN0 A;  1Z78 A;  2JDM A;  3OPT A;  5IHR A;  3VZM A;  2SLI A;  4Y4R A;  5ISL A;  3BIW E;  3AMQ A;  1AZD A;  4XF9 A;  1BEV 2;  2ZEY A;  3RI8 A;  3LFM A;  4NUB A;  3KSC A;  4YW1 A;  5CG9 A;  5JOX A;  4AQ2 A;  1SHW B;  4GJY A;  4MYE A;  4AQT A;  4UOJ A;  1H2M A;  4AHY A;  2BWA A;  1UU6 A;  3B00 A;  2Q1Z B;  1SQ4 A;  3OUJ A;  4LEJ A;  4UAP A;  1QJU 1;  4KWU A;  3WSO A;  1JOD A;  2JDH A;  1S4C A;  2EA7 A;  2ARA A;  1AUY A;  2WQ8 A;  3J26 N;  3JD7 2;  1PM7 A;  2VOT A;  3KMH A;  2J1V A;  1RUD 1;  3N9P A;  1ULC A;  4COZ A;  2VQA A;  3NVC A;  3MV1 1;  4QXH A;  2XJP A;  4PJY A;  3MZH A;  1CAV A;  1W6Q B;  3S0M A;  2DCZ A;  2A6Y A;  3AXD A;  1VRH 2;  2VMH A;  1EP0 A;  4AVC A;  3T30 A;  4IV3 A;  2ADD A;  5FPL A;  3ES4 A;  4UF0 A;  4LHN A;  3PUA A;  2E7T A;  1GKB A;  4IUG A;  1POQ A;  4XFH A;  1URX A;  4CYD A;  1W2T A;  3T0A A;  5FJK A;  4C90 A;  1VAL A;  5FIX A;  3IAP A;  1CZV A;  4UW3 A;  1WMD A;  3BIE A;  1LU1 A;  4OUS A;  4AF9 A;  3VBF A;  1DGR N;  3V56 A;  5FDB A;  1Z7S 3;  2DCY A;  5JSP A;  1JXN A;  2J1A A;  2VNV A;  3WDU A;  2RJL A;  4RR3 A;  4Y26 A;  4MVT A;  1N3O A;  1O59 A;  1W0N A;  1YHF A;  4YW7 A;  2H6B A;  4QHB A;  5IYY A;  1KJR A;  1VMJ A;  4TN7 A;  3ZXJ A;  4FO9 A;  5DN2 A;  3AZV A;  2ARB A;  1A8D A;  4LIT A;  5A33 B;  2E63 A;  2OUH A;  2PLV 3;  4NII A;  4COU A;  4GXL A;  5ACA 2;  1ASJ 3;  5I91 A;  1UMZ A;  4M3C A;  2XJT A;  4HK9 A;  1O3T A;  3AL6 A;  4LK7 A;  5FYH A;  1CON A;  5FY5 A;  4XMI A;  3RS6 A;  3HBZ A;  3OOX A;  3T09 A;  2BEO A;  4HSL A;  1DQ0 A;  1YXW A;  5BNO C;  4IE4 A;  3WHT A;  1OD3 A;  2QE3 A;  4UF0 B;  3BTX A;  1H9W A;  2RM2 2;  3RI9 A;  3SH5 A;  2B4K A;  5LCW L;  1AXK A;  2GAL A;  2P3J A;  1VE0 A;  3HR9 A;  4AVT A;  4BU2 A;  4B4R A;  4BQ3 A;  2G9F A;  4CCJ A;  3UET A;  1ZBE 2;  5BNP C;  1VAM A;  2ZMK A;  4YZ4 A;  3KCX A;  1OC1 A;  2EIB A;  4TLF A;  2JIC A;  4DIQ A;  4KBB A;  4XHB A;  2J22 A;  1W8T A;  3ZYF A;  5TSW A;  2VEC A;  1CES A;  3IM0 A;  1AYN 3;  5E6H A;  2Z42 A;  3J9S A;  3KZ4 C;  3ZXA C;  2WWS A;  5DAP A;  1M4W A;  2CU5 A;  3H8U A;  2DFB A;  3M3O A;  5J36 A;  1OPO A;  3S5Q A;  3JQX A;  1K3I A;  1VAK A;  1WD4 A;  3GBF A;  3KLS A;  4OUL A;  2LUW A;  3O14 A;  5BNO A;  1ZNP A;  1OD5 A;  3T2P A;  2R1D A;  2UYB A;  2V4A A;  3WF0 A;  4KQ7 A;  2JE8 A;  5C4W A;  1UO9 A;  1OUR A;  2E31 A;  3BYW A;  1C8M 1;  3ZXF A;  4N9H A;  4OVE A;  4D8M A;  3U07 A;  5H9P A;  4JTO A;  3M3C A;  2QQW A;  1LOA A;  4XC9 A;  3AKQ A;  3LEK A;  3A23 A;  2WQZ C;  4LA3 A;  5G05 L;  3GBG A;  2PYT A;  4PQQ A;  1YQ2 A;  5T5J A;  1MS8 A;  3E5X A;  1HXS 3;  1RUH 3;  1SLB A;  2V4V A;  4EN8 B;  3NJZ A;  3MO4 A;  4QKF A;  5IFP A;  2H0V A;  5H9S A;  4Z1V A;  3WDV A;  2AEZ A;  1D0H A;  5LEJ A;  2EIG A;  2OS2 A;  3FBY A;  4Q2F A;  4UFI A;  1AL0 G;  4WVW A;  3GZA A;  2NN8 A;  4XFF A;  2PTM A;  2VME A;  1CGP A;  5J7M A;  1XBF A;  2WFF 3;  5GLT A;  4GJZ A;  1PO2 1;  4GWJ A;  5FY0 A;  4CCK A;  5CFC C;  1BQP A;  2EF6 A;  1W8N A;  3EQE A;  2XDV A;  5KC6 A;  5KHI A;  2G4I A;  4RQP A;  2JG8 A;  1ZYB A;  5FZL A;  1YUD A;  1DQ5 A;  4QX8 A;  4D7S A;  1MEC 2;  4YFW A;  1SLL A;  1REE A;  2CAU A;  1BBT 1;  4QB6 A;  3ZFF A;  4BCU A;  4E4H A;  3NJX A;  3PUH A;  1RUC 3;  1Y9M A;  4LO7 A;  1WW6 A;  2XQR A;  3WEZ A;  2RS5 1;  2Y0I A;  1RHI 1;  2PAE A;  3U75 A;  1Z7S 2;  1OH3 A;  5C6C A;  4R52 A;  4XHX A;  4BM8 A;  5B4X A;  1H1I A;  1QOS A;  3LWC A;  3WP6 A;  2G19 A;  5JVV A;  4W65 A;  1OI6 A;  2YPD A;  2D5H A;  5FYM A;  1MZ6 A;  2JJ6 A;  2XKP A;  3AM2 A;  3H3Z A;  3NNG A;  3ZXK A;  4PDW C;  5JWP A;  3EHK A;  2W52 A;  3FJS A;  2E53 A;  2PHR A;  1NXD 1;  1RUE 1;  1J3R A;  2W95 A;  2X09 A;  1DYK A;  3MIE A;  2WII B;  2OII A;  5JIA A;  3S57 A;  2HWF 2;  4FFI A;  2FDI A;  1NCQ A;  4BME A;  2P1B A;  2KM2 A;  4QX0 A;  4AFD A;  2QCS B;  4BIF A;  2PAM A;  1XU1 A;  3NAP B;  4NID A;  2BP6 A;  1R1A 2;  2JEN A;  2PA7 A;  2DBI A;  2UY9 A;  4AQ6 A;  4B4P A;  3OYW B;  1XNC A;  1XSQ A;  5L9R A;  5LWB A;  1HQN A;  2W0X A;  4AL9 A;  2RMU 3;  2D44 A;  4FP3 A;  4CDX A;  1RTV A;  1V0A A;  1NQD A;  1JHN A;  4FPH A;  1JYV A;  2E32 A;  1OOP B;  3TEZ A;  4L11 A;  1CIY A;  2W68 A;  1O8P A;  5FY4 A;  2GN3 A;  1D4M 2;  1ND3 A;  3RYP A;  4QXK A;  2HWB 2;  3ES1 A;  2LRO A;  5C4W B;  3ZFE C;  3D6E A;  2KR2 A;  2XHN A;  4XOG A;  1YFU A;  1IG0 A;  4BMB A;  5FO9 B;  2C24 A;  2GU9 A;  5A32 B;  3D3A A;  2HEV F;  2PMW B;  1Y43 B;  3DPR A;  5FZO A;  4CCC A;  4UFM A;  5A6X A;  1NA1 C;  1RUO A;  1DLL A;  1UW8 A;  5FMC A;  2Y6H A;  1W6O B;  3FLP A;  3TEY A;  3KF3 A;  1RUD 3;  1T6B X;  2QQI A;  3DYP A;  3H3L A;  1BCX A;  4PIX A;  4OYU A;  4ZZ5 A;  3MIF A;  4JQT A;  5F32 A;  4EE2 A;  3ZN6 A;  1ULO A;  1O91 A;  4YZ5 A;  1ODM A;  1C3H A;  1O4T A;  2ZEW A;  4IEX A;  2BW8 A;  4Q27 A;  4C0H A;  2GND A;  3PMS A;  4O9E A;  1NCR C;  1UPS A;  3CF6 E;  4O61 A;  4PDW A;  4YVW B;  4JKL A;  3ZYG A;  1WWY A;  1GWK A;  2JG9 B;  3MYX A;  5E89 A;  1XYP A;  2VMG A;  5C8W A;  1VMH A;  1S55 A;  4V1P A;  1FMD 3;  3CBN A;  1WMF A;  2DBN A;  4IEU A;  3M7A A;  2XHK A;  2VY0 A;  2DCK A;  3THC A;  1Q56 A;  2MEV 3;  3RG0 A;  5FYB A;  4F8A A;  4RR3 B;  5FZA A;  4YYO A;  1GP4 A;  2Y26 A;  5JPM B;  2D6P A;  1C5I A;  3WZ1 A;  4AI8 A;  4I2O A;  3D0J A;  3VKN A;  1I1E A;  5FP8 A;  1V9U 1;  1AR6 2;  1MVE A;  3ZYJ B;  5EQU A;  4HPK A;  4EZ4 A;  2WBK A;  2YUE A;  2CYF A;  3PVO A;  4OHX A;  4YG0 A;  2A6X A;  2ERF A;  5DZG A;  4XJ9 A;  1P8J A;  1ST8 A;  1ND3 B;  4Z07 A;  5HV4 A;  1ZZ6 A;  4OUM A;  1G86 A;  4LUM A;  1CWP A;  3EXU A;  4HKW A;  5GZE A;  4QPY A;  1UN1 A;  4Q26 A;  2AGS A;  5IK5 A;  1V6L A;  3SHR A;  5BV6 A;  3ZFE B;  1XYO A;  1Y4W A;  3M3I A;  3OYW A;  4GB3 3;  1KS4 A;  1GNZ A;  2W2I A;  3PTY A;  2DUR A;  5CFD A;  2RS3 3;  3I4I A;  4KNC A;  3P3P A;  4UXA A;  1HB2 A;  4XAE A;  4Y24 A;  5KWR A;  1PK6 B;  4QDS A;  4IGQ A;  1B35 C;  3BB6 A;  1HW5 A;  2XBO 2;  5FMO L;  4YGB A;  1GP5 A;  1UD1 A;  2IFW A;  2WN3 A;  2XVK A;  4YW3 A;  1KEX A;  3SH4 A;  1W9F A;  1CZS A;  1AL2 3;  3PNA A;  1G9B A;  1IPS A;  5FP4 A;  4XQ4 A;  4P14 A;  4DY5 A;  1RUJ 1;  5KXE A;  3VD9 A;  5ABJ B;  4KWK A;  5FZ6 A;  2EVX A;  1NCR A;  4K6B A;  3RJ2 X;  2A1X A;  2QTW B;  2YBP A;  4AAX A;  4ISR A;  4TLG A;  3LGR A;  1MEC 3;  1XE7 A;  2PHT A;  1MEC 1;  5IW0 A;  4IE7 A;  4YRD A;  4AYU A;  2QJV A;  4K40 A;  4GA9 A;  3AXE A;  5LAS A;  1NZI A;  3LSD A;  4NVP A;  4XFB A;  4N9I A;  1PO1 2;  1COV 2;  2Z4F A;  2XXZ A;  3BU7 A;  1RUC 1;  1PZ7 A;  1JOJ A;  5CB7 A;  4C8D A;  4CU8 A;  4E4D X;  3ZXE A;  1O5U A;  3ST7 A;  2P2K A;  4ZS3 A;  4D7T A;  4QQO A;  2VH9 A;  2JG9 A;  4AFM A;  4BIO A;  2JIJ A;  2ZML A;  5FPZ A;  3E5Q A;  3UJQ A;  2D6O X;  2HWF 3;  4AAP A;  1SLC A;  5JMO A;  1LOF C;  4KU8 A;  4PLN A;  1BK1 A;  1LKN A;  4P9Y A;  2R04 2;  5A7P A;  1PIV 1;  2R06 3;  3N9N A;  1HLC A;  2R07 2;  5CFD C;  2XL7 A;  4CUA A;  1GQP A;  1RUI 3;  2I45 A;  1RL3 A;  1H4G A;  2WWJ A;  2UWA A;  3JB4 C;  4LK6 A;  4RS5 A;  4RL7 A;  2ZGO A;  5DDJ 1;  1DGW X;  2RDR A;  2YFU A;  1XRU A;  2JB4 A;  5FZG A;  4B1L A;  1OA2 A;  4CPB D;  4F83 A;  3POY A;  5FZ7 A;  3GJA A;  1DF0 A;  3JZV A;  1HXS 1;  1RUH 1;  3QOP A;  4DO0 A;  1AR9 2;  1HRV 1;  3C7F A;  3VBO C;  1Q8S A;  2P3K A;  5CG8 A;  2WT2 A;  2BNO A;  4IER A;  3I2K A;  2IUW A;  4MH0 E;  4KU7 A;  2ES3 A;  2GP3 A;  3P3N A;  3N9Q A;  3ACG A;  4AHW A;  3CNA A;  3POE A;  2NMO A;  5HPO A;  3OB8 A;  4PCR A;  5EYY A;  2XVG A;  4FPY A;  1W2A X;  3N7J A;  1AX0 A;  1U12 A;  2A6V A;  3ZN5 A;  3VL8 A;  1SDD B;  4DMI A;  2YRO A;  3ZM8 A;  1UYY A;  1X8M A;  2BTV C;  5T5P A;  1XPW A;  2R1B A;  3K4A A;  3BTZ A;  4HLT A;  4R9C A;  2RM2 1;  1R09 3;  2WYS A;  1V6K A;  3MW3 A;  4AED C;  2ZX2 A;  3WG3 A;  4M3C E;  3C7O A;  1G9A A;  2DU1 A;  4QX7 A;  4Q4W 2;  2FD8 A;  3PJQ A;  5F3I A;  1UY3 A;  4XBL A;  2UU8 A;  4HVQ A;  5JUV A;  3MI8 A;  5L7O C;  5E1R A;  2Y6F A;  1DZR A;  4FI9 A;  5EZW A;  4LHL A;  5A3M A;  2W9X A;  3P1I A;  4PT6 A;  3PUS A;  3G6J B;  1Y7B A;  3THP A;  1UAI A;  4S2H A;  1RUE 3;  3INA A;  3ZXL A;  3WG1 A;  4CDU A;  2UYA A;  3H8X A;  3QD6 A;  4M3C B;  1VBB 2;  3W5M A;  3B9I A;  2RDN A;  3JBG 1;  3B3Q E;  2DCT A;  2I07 B;  5HCB A;  3U78 A;  2WT1 A;  4JDM A;  1NT0 A;  2VQU A;  1I5Z A;  5GZF A;  2WNV A;  2ZX0 A;  1KDK A;  4QDQ A;  4XJW A;  1O6U A;  2GSY A;  1R08 3;  1QHD A;  2QZ3 A;  3I2J A;  2E9Q A;  1PHM A;  2G9G A;  1TG7 A;  3ZO0 B;  4FPG A;  4BK5 A;  1LUL A;  3POB A;  1VJ2 A;  4IE0 A;  4M4P A;  3IWZ A;  5BXX A;  5K4L A;  3RDI A;  4AOC A;  3GNE A;  1RUG 2;  4LKS A;  1JU3 A;  2GC3 A;  2PEL A;  2WO1 A;  3JD7 3;  5A1F A;  4RFT 0;  3C2U A;  2CDP A;  1TME 1;  1ZM1 A;  3N36 A;  2OA2 A;  2OUJ A;  5HCF A;  4CUC A;  2WWU A;  5IVE A;  4Y5T A;  5A70 A;  4DEQ A;  2ETE A;  4XF4 A;  4YZ2 A;  2YC4 A;  5F6K A;  4LHK A;  5JZG A;  3AMM A;  3WY6 A;  4FSJ A;  3R4U A;  1QEX A;  3OY8 A;  1UX7 A;  2VE1 A;  1ASJ 1;  1YFW A;  2E7A A;  2O0O A;  2YZ4 A;  4JDO A;  4LBK A;  4PBP A;  1QY4 A;  2WS9 1;  3T3Y A;  2PLV 2;  3GHM A;  1ZBA 1;  1ND2 A;  4GH4 B;  1HQW A;  2X05 A;  5F3C A;  5A7W A;  2VMC A;  5KXC A;  2VNO A;  2O1Q A;  3WCS A;  1JYT A;  3CZU A;  1COV 3;  5FZ9 A;  2E26 A;  1RVF 2;  2HKX A;  1UKR A;  4EWE A;  1FPN 2;  1UOF A;  1TQ5 A;  3N9L A;  1CIW A;  3O1S A;  4FFG A;  4PIY A;  4NIA A;  4QQ2 A;  4X6Q B;  4CP9 B;  5FXW A;  2PHD A;  2WNV C;  4CCO A;  2VOX A;  4MGY E;  1NLQ A;  3H1Y A;  2PQS A;  4PDW B;  2ORZ A;  3PJY A;  3WLU A;  5F1R A;  2VM9 A;  5EHD A;  4AWD A;  4XFG A;  1NZC A;  4DEV A;  1IKP A;  1H1A A;  1SFN A;  4DQA A;  4XXP A;  5F6L B;  4D7Y A;  2W94 A;  5GLW A;  3O0X A;  2ZHL A;  1JH5 A;  3JBG 2;  3MIH A;  1OFN A;  3KD4 A;  4HKO A;  4ZPI A;  4GWM A;  1W3V A;  2EAA A;  4PF1 A;  5HXV A;  2JDP A;  2WS9 2;  3AKP A;  1LRH A;  2HEY F;  5FZ8 A;  1CN1 A;  3THT A;  1MZE A;  2CAV A;  4PIZ A;  4UBH A;  3TNP B;  2V5Y A;  4NR1 A;  3POS A;  2D5F A;  2VOW A;  3N7K A;  5FCC A;  1ZRD A;  2CSG A;  4CCE A;  3ZLI A;  1GP6 A;  2YYO A;  3F2Z A;  4JGY B;  4L92 A;  1TME 2;  3NNL A;  4QQL A;  2JE7 A;  3C3V A;  4H55 A;  2VNG A;  3E1F 1;  2FDJ A;  3IPV A;  3OEA A;  1KGY A;  1WBF A;  2WNV B;  5FPU A;  5BPX A;  2YXS A;  1ZZC A;  3ZSJ A;  5EV7 A;  5DXD A;  4K3U A;  4M00 A;  1RYY A;  1EV1 3;  1H2N A;  1X36 A;  3PUI A;  1OSG A;  4CCL A;  2YHJ A;  5A1A A;  2OPW A;  3LFI A;  4IEV A;  2Z69 A;  3GZT B;  3W5N A;  1AX1 A;  2YV8 A;  4ES9 A;  3KT1 A;  1H1M A;  4NE9 A;  5K0U C;  3ECQ A;  3NJY A;  3AKT A;  3ETQ A;  3I2D A;  2XPJ A;  4TWT A;  2DFC A;  4FPF A;  5LRS A;  2QNK A;  2DDU A;  3DCQ A;  4WVM B;  5BNP A;  1CAV B;  1W6Q A;  1UIK A;  2X29 A;  4A45 A;  5LBE A;  1GIC A;  2CWM A;  3NKT A;  1JYI A;  2O8Q A;  3K3O A;  1LOG A;  1UYZ A;  2JG8 C;  4K7J A;  4LTA A;  4NRO A;  1A34 A;  1SBF A;  1UCX A;  2JX9 A;  4OHV A;  1OMI A;  1CAU A;  4W6W A;  3A0N A;  1KJL A;  1PGS A;  2JWP A;  2HWE 3;  4QT6 A;  4ZU4 A;  4XUO A;  2D3P A;  2LM3 A;  2WN2 A;  4OCT A;  4BYY A;  4CUB A;  4J1X A;  5F37 A;  1AYM 1;  4B3N A;  2PHX A;  4CU6 A;  2NQY A;  4HSJ A;  1VBB 3;  1WGP A;  4G9S B;  3RZM A;  1X8E A;  4BZ4 A;  5FPB A;  1PIV 2;  2WUH A;  4BOW A;  1OHF A;  2DF7 A;  1Q3E A;  4JGZ B;  4FVV A;  1AR6 1;  1U5Y A;  3SXW A;  1H6X A;  4CEY A;  3VBF C;  1UIJ A;  2IC1 A;  1H9P A;  1RUI 1;  1KS5 A;  1W6O A;  4BIS A;  1CAX B;  3LA2 A;  5FYZ A;  3SQO A;  4UW4 A;  5AC9 2;  3HWJ A;  2ARX A;  3M8L A;  4RD7 A;  4OI0 A;  2E33 A;  4FCA A;  3BTY A;  5A32 A;  1UY2 A;  3VBR C;  3H50 A;  5L9V A;  4AGR A;  1PGW 2;  2ARC A;  2Y33 A;  1N3Q A;  1JHJ A;  2IXK A;  1SFP A;  4HKL A;  2BFU S;  1UYP A;  4RGA A;  1HJG A;  3NL1 A;  4MHU A;  1VBE 3;  3HAG A;  5D8A C;  4D69 A;  1IPJ A;  4GMP 3;  3O0V A;  1VBA 2;  1ZBA 3;  1PO1 1;  2WLQ A;  3TAY A;  5C5U A;  4YM2 A;  1OKQ A;  4IL7 A;  2ZMN A;  4EWA A;  5I8T A;  2D6N A;  3MBW A;  4D6Q A;  1F8V A;  3AP5 A;  4AI9 A;  4AXO A;  5JXH A;  1NXM A;  5GLV A;  3RNS A;  3VBS A;  1VR3 A;  2BGO A;  2P3Y A;  1B09 A;  4NO4 A;  4RFR B;  5A7N A;  1HXS 2;  1RUH 2;  3J7H A;  4LO6 B;  3TN9 1;  1QQP 3;  1WA4 A;  3H8R A;  2ZGK A;  2C26 A;  1W8F A;  3ALQ A;  4ZXK A;  2C6S A;  2ZKL A;  2Y6G A;  4LLF A;  4M01 A;  4A2U A;  4QMA A;  5IK4 A;  5BNN B;  3C7E A;  3KF5 A;  4UI9 L;  4LA2 A;  1WA6 X;  1VBE 2;  1R08 2;  4Y20 A;  4XZP A;  4QGL A;  4TYS A;  5FXZ A;  5FY9 A;  4Z2A A;  5JLV A;  2LS6 A;  2X5I B;  1W9W A;  5IK8 A;  1IQD C;  2J42 A;  5FZ0 A;  1S2B A;  2RS1 2;  4XF1 A;  1PMJ X;  4XPV A;  4M4R A;  5BNN C;  1DCS A;  4CCN A;  3FL7 A;  3W20 A;  1D4M 1;  1APN A;  2BOI A;  5F2S A;  2F17 A;  2FCT A;  4K8R B;  2ZS6 B;  2Q5T A;  1OA3 A;  4BQY A;  4F7Z A;  4XEZ A;  2AAC A;  3V0A B;  2ZX4 A;  2RG4 A;  1RUC 2;  4CSW A;  2R04 3;  4Y1X A;  1U5I A;  5FV3 A;  1A3K A;  3IT8 A;  1DZQ A;  1C1L A;  1SLT A;  1ZZ9 A;  4BQ1 A;  1LHW A;  1QJX 3;  4FQZ A;  1V00 A;  4BXS V;  5A6Q A;  5CEH A;  3ZXD A;  1N3P A;  3WHU A;  3ZMN A;  2J1U A;  4Y33 A;  3WNP A;  3OG2 A;  5CKQ A;  3KS7 A;  3KT7 A;  3TBD A;  4GKY A;  2VU9 A;  4Q4Y 2;  4CXX A;  4DPN A;  4CU7 A;  3D0S A;  2WZR 2;  3SC7 X;  4BH9 A;  1AYN 1;  3VBH A;  1YNA A;  5JDB A;  1NG0 A;  4LKE A;  5FP3 A;  5FLJ A;  5GJ6 A;  3SEE A;  1NA1 A;  1RUJ 2;  3B94 A;  4XAA A;  2OZJ A;  4B29 A;  4BPZ A;  4AFC A;  5CFD B;  2YGM A;  3IIA A;  1H8V A;  2ZAH A;  3ZX7 A;  1W0O A;  3WXP A;  3CIH A;  4AW7 A;  1WBL A;  4QU1 A;  1N1S A;  4UBG A;  1W90 A;  1R08 1;  3RQ0 A;  4CDW A;  4QX5 A;  5FMB A;  5FQ0 B;  5FPV A;  1UF2 C;  4COY A;  3HT2 A;  5F5A A;  4GUL A;  3I3D A;  1AYN 2;  3I3Q A;  1OLR A;  1UWW A;  3UV9 A;  3WQ7 A;  4CXY A;  1GWM A;  1K5M A;  1BVV A;  4AE2 A;  1DHK B;  2X5I A;  3WW4 A;  1ZRR A;  3T1L A;  1PO2 3;  3IMN A;  3NV1 A;  4QPG B;  1LCL A;  3I3M A;  4AFB A;  5FLI A;  5BNN A;  3DEM A;  2ZOE B;  3OBR A;  3WR0 A;  2Z5W A;  3CEW A;  2Y8K A;  1EUT A;  1WW7 A;  3ZSE A;  4KL1 A;  3LD8 A;  1IGO A;  1RIT A;  1YIF A;  4JCK A;  1WCQ A;  3AP4 A;  1XB9 A;  2AC1 A;  1DDL A;  2VQ0 A;  1X82 A;  2WYF A;  2VZR A;  4Q4X 1;  2RS5 3;  5ERL A;  4AI0 A;  4AHX A;  1S0G A;  2DVF A;  3UGF A;  5LA0 A;  4CZS A;  4ASK A;  3HT1 A;  4FOV A;  4ASL A;  4AGG A;  3DGT A;  5I0S A;  1S0D A;  2HWE 2;  3LKJ A;  5A3L A;  4FPO B;  1TVG A;  4LMF A;  4GIQ A;  4A4A A;  1OQD A;  1J83 A;  4HK8 A;  3NO8 A;  3AX4 A;  3CZJ A;  2GAU A;  5FWJ A;  3CMG A;  4E27 A;  2CGP A;  4CEW B;  4OMD A;  2VCC A;  2R16 A;  3AZX A;  1NAE A;  5FYU A;  1ZRF A;  3GCW A;  1J3Q A;  4KWJ A;  3LOI A;  1RXG A;  4RS5 B;  2Q8C A;  5LA1 A;  5CIR A;  5SV5 A;  4DB5 A;  4P9J A;  1BEV 3;  3TN9 2;  2A3Y A;  4P9X A;  2IXL A;  1UZV A;  3SMH A;  2VOK A;  4U36 A;  3RMX A;  2ZXQ A;  1PX3 A;  3LA7 A;  3Q8B A;  1BK0 A;  4IV1 C;  4EQV A;  2K0G A;  3VKL A;  4AVB A;  1CAW B;  1FXZ A;  4KG0 A;  5KC5 A;  1VBA 1;  4LBO A;  1K12 A;  5HI0 A;  4MGT A;  2FZ1 A;  4HON A;  1NQJ A;  4LUK A;  1RUF 1;  2CL2 A;  3FUO A;  5FZ4 A;  2ZGR A;  4ZU7 A;  3AC0 A;  3AJZ A;  5FRA A;  1XC6 A;  1OLM E;  2PQQ A;  4OHZ A;  3ZKY A;  5DAV A;  1IKQ A;  2RS5 2;  2VBB A;  3UKN A;  3Q8E A;  3O1V A;  2QDN A;  2BQP A;  1B35 A;  4L2N A;  1OFS A;  5LBC A;  4ONU A;  4GAZ A;  5IFT A;  1AJK A;  3LOB A;  1O3R A;  3IDE A;  1OQ1 A;  1U0A A;  4GB3 2;  1BBT 2;  4LBQ D;  4ZHN A;  3H3U A;  5T55 A;  1BYH A;  3SIT A;  2Q0A A;  4D0Q A;  2VD7 A;  2AEY A;  4XUP A;  5EJZ B;  3VZL A;  4YVW C;  2HLE A;  3P6B A;  3LZZ A;  3ZFG C;  3QH6 A;  5C71 A;  1OOP A;  4CCD A;  1PO2 2;  3BI3 A;  3WF4 A;  4AVS A;  4Y1Z A;  2ZGU A;  1V6J A;  1HRV 3;  3C7H A;  5FKC A;  1UYX A;  4A44 A;  3A0K A;  3HBK A;  4PHZ A;  1HV1 A;  2Z2S B;  2QKD A;  5C9A C;  3BVC A;  1KRI A;  1ZA4 A;  3FN9 A;  5FXV A;  5IJR A;  1AHS A;  3OF1 A;  2VBP A;  3PTR B;  5DG2 A;  2Y6K A;  4MOA A;  1T2X A;  3Q8A A;  4MZU A;  3B02 A;  4H3W A;  4IEO A;  2HH9 A;  1RIR A;  3ZYB A;  3AFG A;  3HVD A;  4HPK B;  3GJB A;  1JOP A;  1X7N A;  5LEK A;  3UYJ A;  4GWI A;  3VD4 A;  3WF2 A;  2HJI A;  4GKX A;  1DLC A;  3Q8C A;  1VBE 1;  2LTN A;  4FP2 A;  5C4W C;  3KT4 A;  1FYU A;  3AKS A;  3GYD A;  4W4Z A;  1AVB A;  3WG2 A;  3WQ1 A;  4Z92 B;  1C8M 2;  3BKZ A;  4HBN A;  1N1V A;  1UMH A;  1VLN A;  3NNM A;  3DKQ A;  1OVS A;  3K4Z A;  4LBN A;  2TBV A;  3R4S A;  4I01 A;  1Q8V A;  4LIU A;  4UWD A;  4F3J A;  3CJI A;  2BU9 A;  1QH6 A;  4NOT A;  1VRH 1;  2WAB A;  1OF4 A;  4AVA A;  4JHT A;  3ZOI A;  1Q8Q A;  2ZHK A;  3OEB A;  2TUN A;  4PBO A;  1LU2 A;  3MID A;  1AF9 A;  2BGP A;  4XW3 A;  4DUV A;  5T3N A;  1QJU 2;  5JI9 A;  5KHJ A;  5D21 A;  4R9A A;  5FO8 B;  5HCA A;  2AR6 A;  4GZ9 A;  3NWK A;  1C8N A;  1E5H A;  2PLV 1;  1US2 A;  2VVF A;  2YY1 A;  3AK0 A;  2VZP A;  4YGD A;  1QOO A;  1CR7 A;  1VB4 A;  1UOB A;  1GZW B;  5BY5 A;  1V70 A;  2ZKN A;  1D4M 3;  4AI3 A;  3ME2 A;  5L7O A;  2VUC A;  1AX2 A;  1GNH A;  3K3N A;  2G9Z A;  2W87 A;  4EJR A;  5CZK A;  2YU2 A;  5J3U A;  1V6M A;  1LEN A;  5C3R A;  5A6Z A;  1WCS A;  1C28 A;  3PVN A;  3TRS B;  3OY8 B;  3NW4 A;  1D2Q A;  3DYO A;  1BXH A;  4IV1 B;  3ZYI B;  4Y5Z 0;  4IXL A;  4AED B;  1FMD 1;  1AYM 2;  1QXJ A;  1RUG 1;  2WNU A;  1UY0 A;  4K20 A;  4UFH A;  2R32 A;  1RUG 3;  1QF3 A;  2D97 A;  5FMD A;  2VTX A;  3FBM A;  1RXF A;  5JXI A;  5ANQ A;  2LRP A;  3III A;  5FOJ B;  5A3O A;  3SNM A;  4PI2 A;  4XBQ A;  4E2Q A;  5FY1 A;  1JU4 A;  3VKF C;  1W8U A;  4Z82 A;  1XNT A;  4FT8 A;  4IEZ A;  3GZE A;  5C9A A;  3DEC A;  4XTP A;  4MSV A;  3K75 B;  4IV3 B;  1FT9 A;  2OKX A;  3EYP A;  4I09 A;  4Q4V 1;  2JD9 A;  5IAX A;  1TNF A;  2ZGP A;  3IPV B;  4LUL A;  4UFK A;  1JYN A;  4TTG A;  1SLA A;  2X10 A;  2I2S A;  2WNO A;  3VZK A;  4Q5O A;  4ISQ A;  3DPR B;  4H7M A;  4WM8 A;  4E9K A;  1HRI 1;  2AZ5 A;  4A3Z A;  3U0Z A;  4HVO A;  5FY7 A;  4NN0 A;  2DU0 A;  2ZGT A;  3FFQ A;  1GU3 A;  1NCQ B;  2LW8 A;  1W39 A;  3I2F A;  3J4U H;  2BNN A;  3LEG A;  1L7R A;  5FUN A;  4AEK A;  1RJ8 A;  1G9D A;  3FHI B;  2VZU A;  1ACC A;  4JTN A;  5IUQ A;  3U4S A;  4PLO A;  1GZW A;  1Q43 A;  1WLW A;  3E6D A; 
#chains in the Genus database with same CATH homology
 1UY3 A;  5JUV A;  1WKY A;  1HN1 A;  4QAW A;  3GDB A;  3OGS A;  1PMH X;  4FI9 A;  2JKX A;  3VDC A;  2W9X A;  3P1I A;  4PT6 A;  2W46 A;  2J1E A;  2RVA A;  5G04 L;  2VCA A;  3I2G A;  1OH4 A;  4XUT A;  4OUE A;  2VZV A;  3W5M A;  3GXU A;  3EB7 A;  2W1S A;  2VQU A;  5F7U A;  1JZ8 A;  4QDQ A;  5JXJ A;  2VC9 A;  3HNB M;  3I2J A;  1TG7 A;  2W1U A;  4ZZ8 A;  2WO3 A;  2RV9 A;  4BK5 A;  3OGR A;  3UES A;  4M4P A;  3I3B A;  4LKS A;  1JU3 A;  2WO1 A;  2CDP A;  4QB2 A;  4P02 B;  1JZ2 A;  4XUR A;  4CUC A;  3WNK A;  1JZ7 A;  1K45 A;  1GNY A;  3HPN A;  3WNM A;  4XVH A;  4DEQ A;  2YC4 A;  4AG4 A;  1BHG A;  1F4H A;  1O8S A;  3ACI A;  4BDV B;  1GMM A;  3OBA A;  1UX7 A;  3HNM A;  2EID A;  3ACH A;  3SKV A;  2C9K A;  4ZXE A;  1R64 A;  2J1S A;  2VR4 A;  2X05 A;  4QPW A;  2XQX A;  2VMC A;  3GGL A;  1K42 A;  4QDR A;  5DMY A;  3MUY 1;  2J1R A;  3CZU A;  1UY4 A;  2E26 A;  3LE0 A;  1LNS A;  2J7M A;  3A21 A;  2YFZ A;  3A7Q A;  2V5D A;  2QQN A;  5FUI A;  1DP0 A;  1L7Q A;  4LQR A;  2PQS A;  2ORZ A;  4YPJ A;  1SG3 A;  2VM9 A;  5JXG A;  3LPG A;  1W8O A;  4MGS A;  4DEV A;  2W94 A;  5IHR A;  3CQO A;  1NKG A;  4KMQ A;  3I3E A;  3T0B A;  3HN3 A;  4PF1 A;  2C4X A;  2W5F A;  4W8J A;  1NX9 A;  2ZEY A;  3WNL A;  3SEP A;  3GM8 A;  3T2O A;  3THD A;  1SHW B;  4JKM A;  4UOJ A;  3LPF A;  3WSO A;  4CU9 A;  4UAP A;  4KWU A;  3F2Z A;  2WQ8 A;  3VD5 A;  2VOT A;  2J1V A;  1GUI A;  3MV1 1;  3E1F 1;  3C8X A;  2J1T A;  3OEA A;  1KGY A;  2W1W A;  2VZ3 A;  1RYY A;  3PUI A;  4IUG A;  3W5N A;  5A1A A;  1W9S A;  3T0A A;  2WAO A;  3VDB A;  2Y6L A;  2VZT A;  3ECQ A;  3IAP A;  1CZV A;  1JYW A;  3CDZ B;  1W9T A;  4MGQ A;  2J1A A;  3WF1 A;  2DDU A;  1O59 A;  4A45 A;  1W0N A;  2L9L A;  5IYY A;  1UYZ A;  5DN2 A;  4DXR A;  2YB7 A;  4XUQ A;  2BBA A;  3IB3 A;  4XUO A;  2WN2 A;  3FHA A;  4CUB A;  1JZ3 A;  4P08 A;  2VCB A;  4CU6 A;  1UXX X;  2R7E B;  3T09 A;  1GOG A;  4XUN A;  2WUH A;  1OD3 A;  2W47 A;  5B4N A;  2B4K A;  1H6X A;  4QX2 A;  5LCW L;  1I5P A;  1CX1 A;  3UET A;  2DCJ A;  4DXS A;  2E33 A;  2BER A;  3MV0 1;  1UY2 A;  3HEI A;  4DUW A;  2EIB A;  4RN5 A;  1JHJ A;  5JR2 A;  2J22 A;  3OGV A;  4BJ0 A;  1US3 A;  4DUX A;  3MUZ 1;  1OT5 A;  4ZY9 A;  1JZ6 A;  5EIY B;  3MBW A;  1NUK A;  1K3I A;  3SKJ E;  3VD3 A;  5JXH A;  3T0D A;  4E8D A;  2BGO A;  3K46 A;  3T2P A;  2QQJ A;  3J7H A;  4OMC A;  4A6O A;  4P00 B;  3WF0 A;  2C26 A;  1D7P M;  2JE8 A;  4A41 A;  2Y6G A;  2E31 A;  2W1Q A;  3WNN A;  3C7E A;  4UI9 L;  4D8M A;  3LEK A;  2QQM A;  4TXW A;  3VDA A;  3A23 A;  4Z2A A;  3UNP A;  5G05 L;  2LS6 A;  1ULP A;  2Y64 A;  3HOB A;  1W9W A;  4PQQ A;  1IQD C;  1YQ2 A;  2V4V A;  4JHZ A;  1PMJ X;  4M4R A;  3FL7 A;  3MO4 A;  5IFP A;  1JZ4 A;  2HYX A;  2W92 A;  3K4D A;  2QQL A;  5C70 A;  2VME A;  2CDO A;  3NRU A;  1GOH A;  4GWJ A;  3T08 A;  4MAD A;  1W8N A;  2WZE A;  3DYM A;  4BXS V;  1EUU A;  2W3J A;  2J1U A;  3WNP A;  4CVU A;  3OG2 A;  4QB6 A;  4L0P A;  2ZEX A;  3NJX A;  4CU7 A;  3PUH A;  1GOF A;  4ARX A;  3CKH A;  3WEZ A;  3WF3 A;  3SEE A;  4P5Y A;  2VZQ A;  4MO3 M;  5B4X A;  1UY1 A;  3CIH A;  3I3D A;  3NNG A;  2V72 A;  1UWW A;  1UXZ A;  2ZEZ A;  2W95 A;  2X09 A;  3BGA A;  1DYO A;  4QX0 A;  5EJ1 B;  2Y8K A;  1EUT A;  3C7G A;  1W99 A;  4W50 A;  1WCQ A;  2VMD A;  3LEI A;  2VZR A;  1JYV A;  2E32 A;  2EIC A;  5LA0 A;  1CIY A;  1O8P A;  2VTF A;  4A42 A;  4BK4 A;  1TVG A;  3IAQ A;  1OF3 A;  4A4A A;  1J83 A;  2XHN A;  2ID4 A;  5DQ0 A;  3LQC A;  1J84 A;  3CZJ A;  4DXT A;  3CMG A;  3D3A A;  2EIE A;  2XOM A;  4OMD A;  2VCC A;  5J1X A;  1NAE A;  3ABZ A;  2Y6H A;  5LA1 A;  1JYX A;  3DYP A;  2QQI A;  4LHS A;  4OYU A;  5CYY A;  4ZZ5 A;  2XON A;  2VMF A;  2ZXQ A;  1PX3 A;  1ULO A;  5HXM A;  5C7G A;  4HG6 B;  2ZEW A;  4JX0 A;  4JKL A;  2QQK A;  1K12 A;  4XZU G;  2QBX A;  1XNA A;  3A22 A;  3AC0 A;  3THC A;  2DCK A;  1XC6 A;  2ORX A;  3BN6 A;  2YC2 A;  5IFT A;  1H6Y A;  4D0Q A;  3NJV A;  4XUP A;  5EJZ B;  1P8J A;  3P6B A;  2HLE A;  2JDA A;  4LPL A;  5C71 A;  3WF4 A;  5DPN A;  1F4A A;  3C7H A;  1UYX A;  4A44 A;  5I0D A;  3FN9 A;  5IJR A;  2Y6K A;  4MOA A;  1T2X A;  3FHQ A;  1PX4 A;  2BZD A;  4QDS A;  4KI5 M;  4GWI A;  3VD4 A;  3WF2 A;  2WN3 A;  4E8C A;  1DLC A;  1KEX A;  1CZS A;  1JZ5 A;  4QX3 A;  2VO5 A;  3VD9 A;  4W4Z A;  3ACF A;  2QQO A;  1UMH A;  3WNO A;  4AAX A;  3K4Z A;  3NQH A;  5LA2 A;  2RJ2 A;  3T2Q A;  3I2H A;  2WZ8 A;  2WAB A;  2YG0 A;  1OF4 A;  2KD7 A;  4QB1 A;  3OEB A;  2BGP A;  4DUV A;  4ARY A;  4JKK A;  2Z4F A;  2VL4 A;  4CU8 A;  4GZ9 A;  3U37 A;  3HNY M;  3JXS A;  1US2 A;  2VZP A;  3HJR A;  2WO2 A;  5JMO A;  2VQT A;  2VZO A;  2W87 A;  1CZT A;  3IDA A;  5CZK A;  4CUA A;  1GQP A;  1UZ0 A;  3DYO A;  2YFU A;  1UMI A;  2W91 A;  3I97 A;  2WAA A;  1UY0 A;  1MPX A;  3K77 A;  3C7F A;  5JXI A;  3III A;  3I2K A;  3ACG A;  1JU4 A;  2VZS A;  5HPO A;  1XNT A;  3OB8 A;  1JI6 A;  3WQB A;  3DEC A;  3K75 B;  2OKX A;  3EYP A;  3VD7 A;  2JD9 A;  4TTG A;  1JYN A;  2B9V A;  1SDD B;  2X10 A;  3ZM8 A;  1UYY A;  1XPW A;  3K4A A;  4A3Z A;  4ET7 A;  3I2F A;  4QX1 A;  2VZ1 A;  1GU3 A;  2Y6J A;  2LW8 A;  3ETP A;  3LEG A;  2WYS A;  1L7R A;  4OZO A;  4RYD A;  2VZU A;  3I2I A;  2VJX A;  3C7O A;  2WBK A;  2WDB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...