1UXZA

Carbohydrate binding module (cbm6cm-2) from cellvibrio mixtus lichenase 5a
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
131
structure length
131
Chain Sequence
b'MVIATIQAEDHSQQSGTQQETTTDTGGGKNVGYIDAGDWLSYAGTPVNIPSSGSYLIEYRVASQNGGGSLTFEEAGGAPVHGTIAIPATGGWQTWTTIQHTVNLSAGSHQFGIKANAGGWNLNWIRINKTH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULASE B
publication title The Crystal Structure of the Family 6 Carbohydrate Binding Module from Cellvibrio Mixtus Endoglucanase 5A in Complex with Oligosaccharides Reveals Two Distinct Binding Sites with Different Ligand Specificities
pubmed doi rcsb
source organism Cellvibrio mixtus
molecule tags Carbohydrate binding module
total genus 30
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1uxzA00
1SHWB 3HNBM 2X10A 3T0BA 4CU8A 1UWWA 3C7OA 2YFZA 3I2IA 3UNPA 2VZ3A 4JHZA 3LQCA 3ACIA 4DUXA 3WSOA 2W1QA 2J7MA 1F4HA 1UZ0A 3CIHA 3HOBA 2BGOA 2R7EB 2W94A 5EJ1B 4CU7A 2ZEYA 3HN3A 2VZQA 3OEAA 1K42A 1WCQA 4P08A 3VDBA 4L0PA 3K46A 4DXTA 2J1TA 2J22A 2W47A 4DEQA 5B4NA 4W4ZA 1XPWA 3VDAA 2JKXA 1JYXA 4XUTA 2WYSA 4BXSV 4E8DA 1MPXA 1WKYA 2E33A 4W8JA 5DMYA 3FL7A 2LS6A 4QX3A 1W9SA 2EICA 5DN2A 5LA0A 3K75B 1US3A 2V4VA 1PX4A 3K4ZA 2WDBA 4M4RA 1GU3A 3C7FA 5HPOA 3WF1A 3J7HA 3EB7A 2WAAA 2W9XA 3ETPA 3SKVA 2VMCA 1J83A 3LPFA 1JZ6A 1O59A 3LE0A 3SEEA 3DYPA 2J1RA 2CDOA 4W50A 4JKMA 2ZEXA 1TVGA 3I2HA 1W8NA 4QDRA 2B4KA 3SKJE 1P8JA 3MUY1 1UXZA 4TXWA 2VZTA 2J1UA 3I3BA 1GOGA 5EJZB 3WNKA 5B4XA 4XUPA 1CZSA 5JMOA 1J84A 5C71A 4ZZ5A 1H6XA 4LQRA 1JI6A 4D0QA 4ZZ8A 1H6YA 2WZ8A 3THDA 2Y64A 4DXRA 3ABZA 5LA2A 2VM9A 2QQOA 4LPLA 2VQTA 2XONA 3EYPA 1RYYA 2E32A 4PT6A 2ID4A 5DPNA 2WO2A 3LEKA 2WN2A 2W91A 4QAWA 3WNLA 2WUHA 2VZ1A 5CZKA 2VZRA 2VMFA 4QB2A 4CUAA 2HLEA 3NJVA 1W9TA 2VOTA 3C7EA 3CQOA 1DLCA 2L9LA 1GOFA 1W0NA 3UESA 1GOHA 4ET7A 3K4DA 5LCWL 2DCKA 2PQSA 3IDAA 3T2QA 5C70A 4GWJA 4ZY9A 3F2ZA 4BK4A 5IYYA 2QQMA 1OD3A 5DQ0A 4Z2AA 2VR4A 4LKSA 4P02B 4JKLA 3HJRA 4RYDA 4MGQA 4AG4A 2J1AA 4XUNA 2X09A 1EUUA 2ZEWA 1UY0A 3PUHA 3T0DA 4UAPA 1D7PM 1UY2A 2OKXA 3IB3A 3I97A 3U37A 4OYUA 1CIYA 4CU9A 1JZ5A 1GMMA 2BERA 4P5YA 2VC9A 4ZXEA 2B9VA 4OZOA 1JU3A 2XOMA 4PQQA 4PF1A 1UY4A 1CZTA 2ZXQA 2QQNA 4JX0A 4XVHA 3FHQA 3WF3A 5F7UA 3BN6A 4QDSA 4UI9L 5FUIA 2VCAA 2Y6JA 3WNMA 5HXMA 4LHSA 3DYMA 1GQPA 1W8OA 1O8SA 1I5PA 2VQUA 4CU6A 3CMGA 3K4AA 2YB7A 3NRUA 3C8XA 1GUIA 3NQHA 2CDPA 4IUGA 5JXJA 4TTGA 3HPNA 5JR2A 2WAOA 2VMDA 3CDZB 3T08A 3WF2A 3OB8A 1F4AA 4A41A 4DUVA 4DEVA 3OEBA 1UYYA 4ARXA 1JZ2A 4CUCA 1US2A 1UYZA 3DYOA 3T0AA 2C26A 2W95A 1UMIA 3LEIA 4KI5M 2W87A 3THCA 2RVAA 4OUEA 1SDDB 1K12A 1DYOA 2ORZA 2W3JA 2DDUA 2JDAA 1SG3A 1OF3A 1ULOA 4QPWA 3IAQA 4KWUA 3MV11 1GNYA 1JZ4A 3OBAA 3VD5A 5G05L 5IHRA 4MOAA 2E31A 3MUZ1 4A44A 2WBKA 3WF4A 2E26A 1JU4A 4A45A 2KD7A 3HNYM 1TG7A 3ZM8A 1JZ7A 5JXIA 1ULPA 3C7GA 4A3ZA 2WZEA 3E1F1 4OMDA 4XUOA 3JXSA 4AAXA 4MGSA 3WNNA 2VZSA 2JE8A 1PMHX 2W1WA 1NX9A 4GZ9A 5EIYB 3A23A 2Y6HA 4MO3M 2W1UA 1XNTA 3FN9A 4FI9A 3A7QA 2QBXA 2Y6GA 3VD9A 2W46A 3ACHA 3I2GA 4MADA 5LA1A 3K77A 3WQBA 1NKGA 4XUQA 3NNGA 3VD7A 2W1SA 1YQ2A 3OGVA 1LNSA 4RN5A 3PUIA 3I2KA 3CZUA 3P1IA 3A21A 4BJ0A 1NAEA 3WEZA 2ZEZA 2VZVA 1JYWA 2BBAA 3BGAA 2YFUA 4ARYA 2C4XA 2VO5A 2QQLA 5G04L 1UYXA 4CUBA 4BDVB 1CX1A 1EUTA 1UY3A 1UXXX 2VZPA 4XURA 2V72A 4QDQA 1OF4A 1OT5A 3OGSA 2J1SA 1JYVA 4D8MA 3ACFA 3VD4A 3T2PA 4CVUA 2DCJA 1CZVA 5CYYA 5C7GA 5IJRA 2WO1A 2Z4FA 5I0DA 1O8PA 2VMEA 1UY1A 3MV01 1OH4A 3MBWA 1K45A 1W9WA 4M4PA 3I2JA 2VZUA 1K3IA 3I3DA 4A4AA 4GWIA 2LW8A 1PX3A 2HYXA 2RJ2A 3SEPA 2VZOA 3D3AA 3WF0A 3A22A 3P6BA 3VD3A 2ORXA 5IFPA 3WNOA 2Y6KA 4QX1A 2V5DA 5JUVA 3W5MA 3GXUA 4DUWA 3GM8A 1R64A 4QB1A 5JXGA 3HNMA 2WO3A 1DP0A 1UX7A 2VJXA 3CKHA 2Y6LA 3NJXA 2W5FA 1UMHA 2EIEA 2VTFA 2VCCA 3I2FA 3VDCA 2WQ8A 4YPJA 1JHJA 4OMCA 1BHGA 1XNAA 4UOJA 1HN1A 2EIBA 2XHNA 3GGLA 4HG6B 4E8CA 2BZDA 3ECQA 2EIDA 4A6OA 2C9KA 3FHAA 1JZ8A 1KEXA 4QX0A 3IAPA 2VCBA 2X05A 1T2XA 3WNPA 1KGYA 3LEGA 2YG0A 3LPGA 3MO4A 1L7RA 2VL4A 2Y8KA 5JXHA 3GDBA 2YC2A 1IQDC 2RV9A 4QB6A 2QQKA 1JYNA 4XZUG 3HEIA 4A42A 1L7QA 2XQXA 2W92A 3AC0A 2BGPA 1XC6A 3DECA 3ACGA 3UETA 5A1AA 2JD9A 4JKKA 2J1VA 3IIIA 4QX2A 3OG2A 3W5NA 2YC4A 2WN3A 5J1XA 1W99A 2WABA 3I3EA 4KMQA 1JZ3A 3T2OA 2QQJA 1NUKA 3OGRA 2QQIA 4DXSA 5IFTA 3T09A 2J1EA 4BK5A 3C7HA 3CZJA 4P00B 1PMJX
chains in the Genus database with same CATH superfamily
4KG0A 1PHMA 2EXHA 3USUB 3WCRA 4CU8A 3NJYA 1DZTA 1UWWA 1X8EA 3C7OA 1VBD3 1N1VA 2OYZA 2WLPA 4FPEA 2K2SA 4N90A 1Y3TA 1C3HA 4YVSC 3KGLA 2QQVA 5L9RA 1HN0A 1AYN3 1CQ9A 3ACIA 4P9GA 3WSOA 1UYPA 2KR2A 2QQPA 3ATGA 3NAPC 4J25A 3CIHA 1VRBA 1CAWA 1GZ9A 2R7EB 1S0JA 3KD4A 4GALA 3HN3A 1VR3A 1AL0G 2UY9A 4RHV1 4XJUA 4BPZA 3L2HA 4IV3C 4FOVA 4AR2A 1WCQA 2V73A 1CAVB 4GWMA 1HRI2 4K8FA 4L0PA 1UKRA 2ZMNA 4LXLA 4BU2A 1VJ2A 1I9RA 2Q1FA 2QQWA 2VOXA 1BMV1 3LEMA 3PTYA 3AFKA 3JD71 4DINB 3Q8EA 1H8VA 2W52A 1LB2A 3BPZA 1NYWA 3U11A 2NPIA 1S0FA 1W6OA 5ANQA 5F5QA 1GNZA 1AL21 1COV3 3B01A 2RG4A 1PO21 3POYA 5TSWA 2CTVA 1W03A 4RR3C 5FZOB 5I0SA 2R1BA 2R1DA 1JYXA 3JQXA 2WYSA 4E8DA 2BBVA 2IC1A 3AXEA 1WKYA 4YVWA 1OOPC 1CESA 1NLSA 4AVCA 5FLIA 4I0BA 1WCSA 3T4HB 1DQ2A 5FBJA 1XU1A 1PGSA 5ISLA 1F31A 1TNFA 4FOQA 4QKBA 3WDXA 3RG0A 2B5HA 1W9SA 4IDZA 3KS7A 4CCEA 4CCJA 5CFDC 4B1LA 4OLLA 2WNOA 4I3GA 3K75B 5FPLA 4HVOA 2JXAA 1V6LA 1VBB2 2V4VA 1Q8OA 2VY0A 2HWB2 3APBA 4OFGA 4OHXA 5FYIA 4M4RA 1OSGA 1W2UA 5A7QA 4CA9A 3VV1A 5ACA1 1CN1A 1HV0A 4ASLA 5JCTA 2WT2A 1H9PA 4NVPA 4AZZA 3ZIWA 3GHMA 3JBG2 2ZKNA 2ZGQA 3EB7A 1K5MB 3ETPA 1C57A 3O0WA 5FREA 4EROA 3LSDA 4OVEA 1TQ5A 4HZFA 1ZA7A 3I3QA 4XF0A 3LPFA 1CAUB 3MIEA 1JZ6A 1JHNA 5LASA 2X5IA 4LK6A 4META 5AC93 2J1RA 5JOXA 2XLGA 4W50A 1S2KA 1Z7S2 3ZSJA 4F83A 1HW5A 3O0XA 3NNJA 1J58A 4WZFA 4YZ4A 1TVGA 4Z82A 3C2UA 5BNPB 3SKJE 3IMMA 1NA1C 4LKEA 1D4M2 4L11A 4QKFA 2VTXA 1ZZ6A 2VD7A 2BW8A 5AFEA 2GNMA 1IQAA 4Q27A 5E89A 5EJZB 1UW8A 4P9JA 1JTZX 1S1AA 4UFMA 1EPWA 1QHDA 3SCGA 3I49A 1YXWA 5J7MA 2RS51 2RDSA 1RTVA 1CWPA 1W8WA 2G9ZA 1W04A 4FPCA 4HPKB 1U5ZA 4DY5A 4Y1VA 4PIYA 1KFUL 3AMNA 3NNLA 2CHHA 4OQ9A 1H6XA 3GYDA 4I3PA 3J8F3 2UU8A 3J9SA 4YM2A 4NIGA 1H6YA 1C1FA 1UNBA 3H1YA 4CDQC 4YFZA 4YVSB 5GALA 1V6NA 3QLQA 3SNMA 1N1YA 4QGLA 2WR9A 2WRAA 3WP5A 3NW4A 5IVVA 3NAPB 5FRAA 3MLKA 5FPBA 3OPTA 5IAXA 3GJAA 1RINA 3UGFA 4AE2A 2Y0OA 4IV3B 4DNYA 4Y4YA 4NIDA 1DZQA 5DPNA 2JICA 1BYHA 5DAVA 2W91A 1SLTA 3WNLA 3IN9A 4JDMA 5CZKA 2EIGA 2VMFA 3N9OA 3CHXA 3WDVA 3RYPA 1SBDA 4E2SA 2ZZJA 1PM7A 1W9TA 1GOFA 1SPPA 2P37A 3WDYA 4ET7A 1DDLA 4XJ8A 5FYCA 2XVGA 3O5SA 3R6SA 1OOPB 3B00A 5J96B 2DCKA 4NROA 3IDAA 1LOBA 4J6GA 2XB6C 3ZXAC 1T6GC 4LA2A 3F2ZA 4S2GA 4OQ8A 4MXVA 4YGDA 4HN0A 3MPBA 4BK4A 1XE0A 2MEV2 3DUIA 3UGGA 2CWMA 3M3QA 3W21A 3V65A 4Z1VA 4P02B 3MW2A 5CFDB 5FY5A 5EXOA 3R4DB 4EQVA 1M4WA 2KA3A 4H55A 5FXXA 3VBRC 4QHOA 4XPVA 2J1AA 3FE5A 5GLTA 1REEA 3PU3A 3T2TA 4XUNA 4XETA 5FP7A 1G9CA 2AR6A 4C0HA 1EUUA 2IWGB 1GR3A 4HSLA 3K51A 3PUHA 4FAGA 2ZAHA 4NRPA 3T0DA 3SQOA 1GZWA 4UAPA 2A7AA 2OKXA 4LOTA 5F5AA 4YGCA 5FY9A 2FDIA 3MIHA 1VBE2 3U37A 2LRPA 3B5LB 4IE7A 4OYUA 3KT1A 4QM9A 1QOSA 1SMVA 4LBQA 1IG0A 1GMMA 1SFPA 4YLZA 3JCIA 4ZXEA 1MQTC 1NQDA 2DCYA 4ZKTB 1M06G 1ZRFA 1JU3A 1U5IA 2VVFA 2VECA 4RFT0 4XAEA 5FPZA 3H1MA 1YO8A 3WLUA 1AR73 2ZXQA 4NPMA 4XVHA 3FHQA 2FDJA 2RS32 3ZR6A 3BN6A 4QDSA 3AL5A 2VOKA 1UOBA 4UI9L 4XC9A 4ZONA 5FUIA 3SLIA 2XJQA 4S2HA 5DDJ2 4E2GA 3U4XA 5FXWA 1MS4A 1K5JA 3AVRA 1I5ZA 5LBCA 2PQQA 2XHKA 1ZZBA 3ASIA 2AZ5A 3RNSA 3I3MA 1R082 2P4EA 3TBDA 2VQUA 3CMGA 4HXCA 4CE8A 2OUJA 2PXJA 3M70A 2HWC1 1GUIA 4PI0A 4RS5C 3N4MA 4I30A 3NQHA 1C5HA 3AZWA 2P17A 3N9NA 4MGIE 2JIJA 1VBA3 4XXPA 1SBEA 5FZ4A 5GLZA 2HEYF 3HPNA 4N53B 2ZPXA 4AAPA 3WF2A 2CGNA 1RJ7A 3N7KA 4FPKA 5FMOS 2BVBA 1OC1A 3ZOIA 3BTZA 2HWF3 1PVC2 1RUE1 4OHWA 3MHZA 2ZTNA 1QJY2 2YXSA 1AUYA 2BUKA 3DYOA 1HDKA 3T0AA 2RDRA 2GDFA 2WZR1 3KQ4B 2NM1A 3THCA 2C1FA 1RUJ1 1Z78A 4EN9B 1O3SA 2BDRA 3EHKA 1SDDB 1YYNA 1RUI2 3DKQA 2CAUA 1OI6A 3H3ZA 4LBOA 2ILMA 4CDWC 5CFCB 1JS9A 4C1XA 4FP2A 1LGCA 3VKOA 2P3JA 4CCNA 1UN1A 1LGBA 2XPJA 1GSLA 4QPWA 3IAQA 1RUC1 3H3LA 4I0AA 4KWUA 4A3XA 4Y20A 1GNYA 3NNMA 3OBAA 3VD5A 5FR3A 5DG2A 5HCHA 1CPNA 2WIIB 3MGUA 5G05L 1ND3C 1A6CA 1Q8VA 1UU6A 3BOWA 3MUZ1 4NRMA 4QXHA 3WV6A 2O8QA 3N9QA 3H8OA 1ENXA 1H30A 4F3JA 5C8CC 1JZ7A 3BOPA 1PZ8A 4LNVA 2WT1A 1ULPA 3LDKA 5K0UB 5LBFA 3MDPA 4A3ZA 3D0SA 1CJDA 4QQHA 1RHI2 1ZBA2 3LSEA 4MGSA 4XTMA 3O1OA 2VZSA 2JE8A 4EWAA 3DEMA 4GZ9A 1W39A 2D6PA 4S2DA 4B4RA 2WWSA 2Y6HA 1QNWA 4MO3M 1OKQA 2PHTA 2WNEA 2FCUA 3FN9A 3NV2A 5LB6A 3S6PA 1PNGA 5BPXA 5FPXA 1WMXA 1OFNA 3A7QA 5BNNA 1W6NA 1ZNPA 2I2SA 1AYM1 5FYVA 4ZU4A 1IS3A 3ILFA 3MZHA 1QJFA 2JECA 1NE6A 3KV5A 1XYNA 4LO5B 5JI9A 3VBSC 2OZJA 2XG3A 5IK7A 5IUQA 1G9DA 3I2GA 3VLBB 1W28A 4MADA 1MQTB 3LIHA 1R093 3MYXA 1H4HA 2PTMA 3K77A 4M3CA 4M01A 4XUQA 1POQA 1G8WA 1LEMA 1VAKA 2QTWB 2OW4A 2VUJA 3OJBA 2WYFA 1QXRA 1CIWA 2IVJA 2D3PA 4FXKB 1E5IA 4W6YA 4AVTA 5A32A 1HJFA 3J7MA 1GNHA 1FXZA 4AI1A 4Q0SA 5FZLA 3DPRA 5EYYA 4BJ0A 2PLV2 1NAEA 3OPZA 2HBUA 4UBHA 3AK0A 1W6PA 2VVEA 4E9KA 4LHKA 4UW4A 2DVGA 4XJAA 3LKJA 2ZEZA 2Q8CA 1MEC1 1OKOA 2VZVA 1ULEA 3BGAA 3E5XA 3U14A 4ARYA 3PNAA 4JTNA 4RS5B 3K3NA 4NHKA 1AJKA 2Q8DA 1JXNA 3UKNA 1WMEA 3VBFA 2NQYA 1ENRA 1WMFA 1AR92 1EUTA 1UY3A 2HWD1 2I74A 5FYHA 1UXXX 5KBFA 4XURA 5L73A 1WCKA 4FAHA 1HB3A 3R05A 4O9EA 2CU5A 2OX0A 2GP5A 4MZUA 1OHFA 2D6MA 5KC5A 1JYVA 1FPN1 3VZJA 4CVUA 5F3CA 3PUAA 1U5XA 5C9AB 1CZVA 2TBVA 3WG1A 4NRQA 4PQ9A 4OHYA 4Y5SA 5FLHA 3PVBB 3TN92 5IJRA 3KHCA 3U1XA 5T3NA 4YNIA 1PIV1 1OA4A 5J48A 1UY1A 3E6BA 2NP0A 5IATA 5FMOL 3QH6A 2VBPA 5JOZA 2JG9C 3WP6A 4HBNA 1K3IA 3EQEA 3N9PA 3T1LA 4A4AA 1WCDJ 3VL8A 4ONUA 2LW8A 1PX3A 3AJYA 4GH4C 4DOUA 4TZDA 2GALA 4EYUA 4JGYC 5LA9A 3A22A 3P6BA 3VBUA 1TMF1 2ORXA 4RSUA 1B35A 2P6CA 1O5UA 3GBWA 3WG3A 3LIGA 3POJA 4AEJA 1PMIA 1W05A 2AACA 5JUVA 4I2OA 5T5OA 3W5MA 4B7EA 2QZ2A 3ELNA 1W6QA 2EALA 2UY8A 4OI4A 1HQWA 3ZYFA 1PVXA 1UX7A 2VJXA 1X33A 2Q5TA 4LUMA 1IOAA 2Y6LA 1PZ9A 3NJXA 3T1MA 5C3SA 2OQ6A 3CJXA 5FMDA 2W5FA 3J7NA 1UMHA 1ZRRA 4KNCA 2GN7A 1EV12 1IS4A 1NY72 2XJVA 2EVXA 2RHPA 4LBMA 4IQPA 4UFKA 4CPBA 2LROA 3FJSA 1JYTA 4P9LA 1A8DA 3LA3A 4JC1A 4ATEA 2GMEA 3HT1A 4OUSA 3RRDA 1QXPA 5H9QA 4AHYA 2AH2A 4FPGA 4UOJA 4Q4W3 2EIBA 2ET1A 2XXZA 2PHUA 3LOIA 4K6BA 3O0VA 4ORFA 5EP9A 1H0BA 4HG6B 4E8CA 4BQ2A 3CJIA 2FBEA 3FHAA 3VBSB 5T5JA 1O4TA 1RUF1 1RUE3 2D6KA 3OY8A 5L7OB 4FPYA 5FOBB 3ZPYA 3IAPA 5GLWA 2VCBA 2X05A 5LRSA 1T2XA 3WNPA 3TNQA 3M7AA 4AFBA 3D82A 1NE4A 5F37A 1FMD1 2EXIA 1EP0A 1UCXA 2HBTA 4N43A 5IVCA 1RB8G 5I91A 4B8EA 3LPGA 2JB8A 3MO4A 4M0NA 4QGNA 1RUJ3 4LIUA 1L7RA 4AFMA 2Y8KA 2SLIA 1VMHA 4LBKA 1YCIA 5A3MA 3GDBA 2V4AA 4UW5A 1VE0A 3ZXGA 4XFFA 4XHBA 1H8TB 4Q4V2 1BK1A 1UU5A 5H9PA 1OH3A 4FPHA 1VBD1 2W92A 4QU2A 1NLQA 3ZXFA 1XC6A 2VAUA 3O12A 4J1XA 2WA4A 4QM8A 1AYN1 3VHRA 4EN7B 1C8M2 3I54A 3PIGA 4Q0VA 4YGEA 5DUVA 4AHZA 5FWJA 4N9HA 5A7OA 4JKKA 4QX2A 2J1VA 1XNDA 2PAMA 3IIIA 3W5NA 2PAKA 4QQ2A 2Y38A 4AWDA 4JQTA 4BQXA 3M8LA 3RMXA 4CXYA 1W99A 5KHHA 5FYYA 1W0OA 1ENQA 4LO6B 4MGZE 4E2QA 3POWA 5BNOA 1JZ3A 1LESA 2QQJA 2IXKA 3A0KA 3OGRA 5E88A 2QQIA 2WQ4A 1JYIA 3USUA 4ISRA 3D4KA 3WG2A 1JMUB 2VTXJ 3HQXA 3OCPA 3QH7A 3THPA 5JSOA 1O5LA 1COV1 1A3KA 2JG9B 5FZCA 1ZREA 2XUEA 4K9SA 2E51A 2Q4SA 2WNVA 3AKQA 4NE9A 2VZ3A 2Z2SB 4XHXA 5JIAA 2R072 3SXWA 4QPGC 4GH4B 4W6WA 4WM8B 4P14A 4LA3A 2J7MA 1F4HA 3PIJA 4JGYB 2Q8OA 1HRI3 5EJ1B 5IVJA 4CU7A 1ACCA 1LECA 2ZEYA 1OUXA 2DTYA 4C1WA 4FXGB 4NIAA 2ZBJA 3VDBA 3ZSEA 2XJSA 3K46A 3SH4A 4DXTA 4AI8A 2JG8B 2J1TA 1C28A 2W47A 1PK6A 1IPKA 1YQ8A 1WCUA 4D3WA 4CDXC 1XE7A 2MHFA 1MZFA 1V6KA 5ANNA 5A3LA 1MEC3 4GIQA 4XIKA 2JKXA 1E5RA 3GZTB 3KV4A 2BFUS 1JOPA 5LK5A 5DAPA 3RYKA 1J3RA 5CNAA 5DMYA 1H4GA 2ARBA 3ZYHA 3O1PA 1QJU1 4NHXA 2XR4A 5C8WA 1CAXA 4ASKA 4BIFA 1ZRDA 4F8AA 4XQDA 1J59A 1DGWA 3FLTA 1YJLA 1ZBE1 1VBB3 4UXAA 5GLVA 1AR81 1F9KA 2HWB3 2VOWA 2RDNA 3URFA 2ZCWA 2OS2A 5IVEA 1IGOA 4LT5A 2DUOA 1US3A 2DUPA 4YW2A 3K4ZA 2R042 3S0MA 2WDBA 1YHFA 1PGW2 3C7FA 1R1A2 3K48A 3BU0A 5FKCA 2JDHA 2B7YA 1TZOA 2JX9A 1K5MA 4Y24A 3PMEA 4GJZA 2RE9A 2TNFA 1HQLA 3V0BB 3ZX7A 4MUVA 5CADA 3SKVA 4XXAA 5FYBA 1WBLA 2TEPA 3ZKYA 4XQWA 1J83A 4XEZA 4DFSA 3LFIA 2CV6A 2YV8A 4MVTA 3VBHB 2QFEA 1ASJ2 2XL7A 3UJOA 4AVVA 2XVLA 4FTBA 1MS5A 2XBO1 2Z69A 3NNFA 4Y1XA 2Q8EA 1TMF3 4WBBA 3J8F1 3KZ4C 2RDQA 4NPLA 4HFSA 4M0HA 4QPIC 1TNRA 4JKMA 3RJ2X 2Q1ZB 3AMQA 4QKDA 2DUQA 1H2NA 1VMFA 1X9PA 2ZEXA 3AP5A 3I2HA 1UOFA 3SISA 3DXUA 5CB7A 5KHGA 1MZ5A 5F6KA 3MUY1 4NN0A 4SBVA 3ZYBA 2Z79A 1BZWA 5LBEA 2QVSB 4TYSA 2AC1A 4EZ4A 4AEDA 1Z0HA 3WNKA 2MNGA 3MLJA 2G9FA 3WDWA 3FFZA 1QKQA 5DXDA 4IV1B 3ZFGC 4LE3A 5LBBA 4KWLA 4XFGA 2HWC2 1W2TA 2XJRA 3VHPA 3FHIB 4RL7A 1APNA 1UQXA 5JI7A 4ZZ5A 4LQRA 2R062 4N7IA 3CBNA 2VBBA 4FPJA 1VBC1 4MX3A 5D2AA 5FXVA 3MPPG 3THDA 5JIUA 2A3YA 4QPGB 5DZEA 2E7QA 2WNUA 3NAPA 3WDTA 2VQTA 4EZHA 2Y33A 1WMDA 1BVP1 2XONA 3OBRA 1N1TA 4IEUA 3B02A 4O61A 5ERLA 5A6YA 1LODA 3EJKA 2ZGOA 1RYYA 2E32A 2ID4A 1Y43B 2XUMA 3LEKA 4TLGA 2WS92 3AL6A 2WN2A 1JOJA 4AGVA 4JTOA 2ZMLA 1EYBA 3WUDA 2RMU2 1HRV2 2VZ1A 4M00A 3QCWA 2VZRA 3AM2A 4QXCA 4A7YA 1I1EA 1H2KA 4CUAA 1RMU2 4LR4A 2WC2A 1ONAA 4RR3A 3OPWA 2BOIA 3RQ0A 4XZPA 2ETEA 3N7LA 4AI0A 4UFHA 2L9LA 1RUC2 2TUNA 4AK3A 4CCLA 4BHPA 5A6QA 3UESA 1UMZA 5FP4A 1HIXA 1UIJA 5LCWL 2PQSA 5D8AA 3T2QA 1NLRA 3ZDSA 1J1TA 2MEV3 2ZGLA 1ODMA 2CY6A 1ODNA 4R4XA 5AFBA 4PLOA 4CP9B 1WUVA 4OI1A 3VZLA 4FTEA 3FFQA 2GC3A 1NCQA 1YI7A 1ZX5A 3WQ0A 3B7MA 3LCPA 3WW4A 4Y1ZA 1AR71 3VDDA 4JKLA 4QQLA 3PMSA 1GWLA 1STMA 2GSYA 3KLSA 4MGQA 2ZX3A 3CLPA 3VZMA 4AHXA 3T4VA 1UPSA 4IXLA 4X8NA 1DG6A 5IVBA 5FO7B 4ASMB 1KDKA 2A75A 4TLFA 1G9AA 3NMBA 4NAMA 1VBE3 3K2OA 1OLME 1LAJA 2BOJA 1SLBA 5LWBA 3PDQA 1O4YA 2CGOA 3IB3A 4L99A 3ZYGA 1EAH1 2IFWA 3I97A 5FY7A 4Y4RA 5A3OA 3H50A 2JB4A 5F5CA 4N7UA 1JZ5A 2GN3A 2HWE2 4P5YA 1AX1A 2VC9A 1CX4A 2B9VA 4OZOA 3VKMA 3WHUA 1VBA1 1YQ5A 1LOFA 1W8HA 1L7LA 5A3PA 2QCSB 2C24A 1UY4A 5C6CA 1CZTA 2RM22 1BBT1 2ZA9A 2D5HA 2QQNA 4QPIB 4U36A 5DDJ3 1WW5A 4Q1RA 2ZX0A 4LBJA 2HWF1 1WW4A 4LBQD 1NA1A 4MXWA 4WVMB 4AW7A 1O3TA 5FQ0B 1YFXA 5HCBA 3VBOC 1R083 2PYTA 2Y6JA 3AYDA 5FY0A 3WNMA 3FC0A 1LR5A 3DYMA 4EJRA 1W3XA 4YG0A 1Q56A 4CRQA 1GQPA 1W8OA 2KXLA 2NYYA 2IXHA 1I5PA 1QQP2 2DTWA 4CU6A 1JYCA 2YB7A 3K4AA 4Y5TA 5FYSA 4BB3A 1F8VA 1RL3A 5CKQA 4IESA 5EWSA 3ZFGB 3ZPOA 3DGTA 3PHMA 1CGPA 4A2UA 1QJU3 4IUGA 3MF9A 1ST8A 4LHNA 1PVC3 2C0ZA 2F6BA 2Q1MA 2WAOA 2Y0IA 2ZZQA 3MF6A 3CDZB 1VP6A 4KU7A 5FZ6A 3OB8A 3T08A 1V00A 1ZBE3 1QJY3 2XLFA 3HR9A 1AR83 4A41A 4DUVA 5D1IA 3AYAA 2JDMA 1LCLA 1Y9GA 1CPMA 4OHZA 4AQTA 4D69A 4CUCA 4KWJA 1AR62 1US2A 4L9BA 2IZWA 3ALQA 4AQ2A 1FOD2 2C26A 1RUI3 4HANA 1UX6A 2P34A 2W87A 2XH6A 2XJUA 5BV6A 5C33A 2RVAA 3ZN6A 4OUEA 2VE1A 1FT9A 1RUH2 5KXDA 4YSFA 1RUD2 4X6QB 2DDUA 2X8KA 4YVWC 4DXZA 4PDWB 4PJYA 1W8ZA 5GZEA 3GALA 2WSUA 3SMHA 5E8AA 2XBO3 3X29B 4N53C 2IVIB 3VL9A 5F9TA 5GZCA 3PVOA 5L9VA 5BNQA 3H8UA 1W0PA 1RUNA 1R091 3FX3A 1ZBA3 3ZM8A 1KJRA 3OGGA 5JXIA 2P3IA 2DV9A 1NXD1 2WT0A 1NQJA 3E1F1 4OMDA 3JXSA 1DYKA 4R52A 1RXFA 3VBRA 2H0BA 5FPAA 3WNNA 2FCTA 3BB6A 1GV9A 2QUOA 5C3PA 2DYCA 3IMNA 5K8SA 5EIYB 2BYVE 3KV6A 4ES8A 1QY4A 4WM7A 5DUXA 4NIIA 5C4WC 3LAGA 1WD3A 4TN7A 5J3UA 3B9CA 5CFCC 4CEWB 1TME2 3SCHA 5J98B 1QOTA 3RI9A 4Z8BA 3ZXKA 1UU4A 4Y1YA 1REDA 2X5IC 2Y6GA 1VBC3 3VD9A 4XIOA 2D3SA 3IT8A 4FFGA 4JVAA 5FK7A 3WP4A 3ZKUA 3FBYA 3FZ3A 1O3QA 1SLIA 5GLUA 2VW1A 1W6MA 4BYYA 2VULA 1Y4WA 2XDVA 2RS12 3ACLA 4SLIA 3BTXA 4XCAA 4XF9A 2P1BA 3NNGA 3VD7A 4LMFA 1G6NA 1LU2A 5C3RA 1OXCA 4GB32 4LOSA 3OGVA 3VHOA 4RN5A 3ZMOA 1WWYA 4CP2A 5K0UC 2P6HA 3AYCA 4ZHNA 1AXKA 5CG9A 3PUIA 3OF1A 4N9IA 3I2KA 3ZSKA 2LM3A 3P1IA 3ZFFA 1H9WA 4YW5A 4L92A 1SLLA 3VBOB 5C3OA 4Q4Y2 3HWJA 3V64A 2DBNA 1RVF2 1RUG1 1ALYA 4LO4B 4G9SB 5I0UA 1QH6A 2BBAA 4KGQA 1OPMA 4RS5A 2YFUA 5LRRA 1JYWA 4QHBA 1AR93 2W0XA 2IXIA 2C4XA 1ULDA 2ZHLA 2JD4A 1FV3A 1UKGA 5G04L 3MW4A 2YZ4A 4Y3OA 5FK8A 5GKAC 3WR0A 4BLJA 2PHRA 1CX1A 5LATA 3PLQA 1QJX3 2QDNA 3M3IA 5FV3A 1CAWB 4KG8A 4QDQA 3OUJA 5F2SA 5IW0A 4PCRA 4BQ5A 5FOJB 2VUAA 3LA7A 4D8MA 1MS3A 3TN93 4CCMA 3T2PA 1GP5A 1V6IA 5SV5A 3RYRA 5I8YA 2WFPA 5JZGA 1C5IA 2G9GA 1BQPA 2UYBA 5C7GA 4H3WA 2WO1A 5FPVA 1W9FA 4UWDA 1W6OB 3KT7A 1W8UA 3MBWA 4CDWA 5A1LA 2B9UA 1YI9A 1XJAA 1WZXA 3VB9A 1JODA 1BEV2 1D4VB 4K21A 3BUCA 1EAH3 2YU1A 3J4UH 3ZSLA 2W68A 4GWIA 4YVWB 4Q0QA 2K46A 1WD4A 4HT1T 2RJ2A 3U0ZA 4C90A 2VZOA 1VAVA 1F35A 3IPVA 4Z07A 4UW6A 2ET7A 3D3AA 4K20A 1SBFA 5FUNA 4IEPA 3U10A 3TB0A 3R4UA 5FYUA 4YZ1A 1ND3A 1HLCA 4Q4W1 2DURA 4XDOA 3USSA 4AEMA 2Y6KA 1BLZA 2VUCA 5JR7B 1BBT3 1DGWX 4FQ4A 4QX1A 4WVWA 4QQOA 4XBQA 3VN4A 1CJPA 5C8CA 1RXGA 3GM8A 3N7MA 2VMIA 4QB1A 5F8PA 5JXGA 5C9AC 5CKNA 4R4ZA 2WO3A 4X8PA 1EV13 1ULFA 2DCZA 3A4UA 3ITQA 4BQYA 3BTYA 4YG6A 5KHKA 4JGZA 3VUOA 5IK8A 5GZGA 2ZX1A 1V9U2 2B46X 3LF7A 3ZXEA 3NKGA 5C4WB 2VCCA 4O65A 4H7LA 2D5FA 4AHWA 3I2FA 3I59A 1NCRA 1HXS1 1TE1B 4GMP1 2ZKLA 1BHGA 2IXLA 3SH3A 3N7JA 4MV2A 2X5IB 4DS0A 3VBSA 4BLIA 4CPBD 1A8MA 4XW3A 5I8TA 3KQRA 2C9KA 4AVSA 3MW3A 4NWWA 3ZFEA 1JZ8A 5AC92 3V0AB 5C3QA 4YW4A 2BWAA 2WFF1 4AI2A 1F2NA 1HX6A 4FFHA 4CP1A 1KGYA 1PO11 5KWRA 2YU2A 2Z42A 3AJZA 1YEWA 5CVRA 4EE2A 1PGL2 4R9AA 3MLLA 4OZXA 4E4SA 4PBOA 4B4QA 1ZRIA 4K3UA 5BXXA 2WWUA 4Q4V3 1VIWB 3ST7A 5FZ3A 3LDRA 4DMIA 4AQ6A 4QB6A 2XJPA 5F39A 1W3VA 1PM4A 2O8OA 3IM0A 3QD6A 3IDEA 4MLOA 3HEIA 3JZVA 4XF3A 4A42A 2NMOA 3H7JA 1IG3A 2XJTA 3AC0A 3PJYA 2Y34A 2GC1A 4HONA 1JUHA 1LJ7A 3J8F2 3H42B 1SACA 4H14A 4TSVA 1XE8A 3ENRA 4COWA 1X8MA 3UETA 2VG9A 3JU9A 5A3WA 1HRI1 5L7OC 1SFNA 4XFBA 3LWCA 3VBHA 2XKPA 5JOWA 1LTEA 3S7IA 3KB5A 4COUA 5J1XA 4CP0A 3O1TA 2DVAA 2WABA 4ES9A 3ZN4A 4KMQA 3KVBA 3T2OA 1FYUA 1NUKA 3OSDA 4XF4A 3O1VA 4Y22A 4YZ2A 3DV8A 5IFTA 3OD4A 1OLQA 3T09A 1J3QA 2RV9A 1OQDA 1SHWB 4CYDA 3LOBA 5B2GB 1KDMA 3T0BA 4XJZA 4LLOA 5LEKA 1H8TC 1SPPB 2YFZA 3I2IA 4MHRA 3UNPA 1Q8SA 3E97A 2GH8A 4JHZA 3WCSA 2YPJA 4CXWA 5CIRA 5JLVA 5A6XA 3MIDA 3P3PA 2OPWA 1VRH2 2R0HA 1XBFA 3RZMA 4IE6A 1UZVA 1FNYA 2W94A 3ZO0B 1DYPA 2FDHA 1OLMA 2W08A 1ZVFA 2VZQA 3OUIA 1VBB1 4BIOA 2HWB1 3OEAA 5CKMA 1K42A 4P08A 4URAA 2E7TA 3JUUA 5A33A 3H7YA 1YFUA 1WLTA 2BNMA 2EAAA 4LHLA 2LUWA 3WOGA 2J22A 1UZWA 2ARAA 2RR12 3OYWB 4XBLA 4HN1A 4AVBA 3JBG1 4FPLA 4W4ZA 4Q26A 1PNFA 2YHJA 3PUSA 4K1ZA 5HV4A 2OA2A 4IEZA 1XPWA 1RUG3 5IWFA 3KHBA 1YRZA 2GAUA 1GZWB 2VW2A 5BNNC 4BXSV 1MS9A 5T52A 5E6HA 3PVNA 4QHZA 2E33A 4XFHA 1GYKA 1MS0A 1LENA 1XRUA 3BTAA 3WW2A 2EA7A 4LBQB 4LORA 3WXPA 2BJSA 3FL7A 5JSRA 2VMGA 3E6DA 2LS6A 4WM8C 2FCVA 2XWBB 1Z7S1 2OT7A 5L19A 2R043 5E16A 5JAXA 3RFRA 5KXCA 2EICA 4FTSA 4RHV2 1Q8PA 4NR1A 1D4M1 3S7EA 3RZKA 2IFRA 4HOOA 4MGKE 1PX4A 4Q4X3 3DPRC 4KGGA 3F95A 2JG8C 3KCXA 2R32A 2WZPP 5HPOA 2YDEA 3HVDA 1BMV2 2JDPA 4HVRA 2VQAA 3JD72 2R16A 3V0BA 4FFIA 2ES3A 2WWJA 2WAAA 1NT0A 1W06A 1N47A 1ASJ3 2W9XA 1AL22 4FVVA 1PO22 3WD5A 4CEYC 1R1ZA 2QJVA 3POGA 5CA6A 1OMIA 2YGLA 3IBMA 4XABA 3TAYA 2PHFA 3WQ1A 3GZEA 3D8CA 5FZ9A 3TRSB 2D6NA 3LE0A 3SEEA 1FV2A 2DFCA 2CDOA 1DQ4A 2A70A 4JCKA 2GMPA 3MIFA 2WSVA 3ZN5A 4GULA 3ZXLA 4QDRA 1ND2C 2B4KA 1AX0A 5FZIA 3KT4A 1LOGA 2PHDA 1UXZA 5H9RA 4MG2A 1C4RA 1G7YA 3DXTA 1VAMA 2J1UA 2VZTA 4JZRA 3I3BA 3TEYA 1GOGA 1DQ5A 1UOGA 1F5FA 3RGBA 3WG4A 5ACA2 2FDKA 1JW6A 3UYJA 1YC61 1LOEA 2V09A 2VU9A 4YFWA 1UZZA 5FZ7A 4BISA 4GD4A 1AVBA 4XUPA 4UF0B 1AZDA 5FO8B 2DWRA 1OD5A 1CZSA 2QZ3A 4GMP3 1HXS3 2A3XA 5C71A 4AFAA 5GJ6A 4NPRA 4Y20B 2B39A 2PHWA 1WLWA 1W9YA 4ZZ8A 4D0QA 3VBUC 4UBGA 3WNXA 1XSRA 1G86A 1YNAA 2WZ8A 5C5TA 1LHOA 3AMPA 3N9LA 5T54A 5FY1A 4CCKA 5T50A 3MIBA 2VM9A 2H0VA 5ABJC 1ZYBA 2HEWF 2MEV1 2OIIA 2YYOA 3AMMA 3EYPA 5A7NA 1KS5A 2WS93 5DAQA 2BV4A 2WFF3 3U75A 3O14A 1D0HA 3RZLA 4TWTA 4GJYA 4XOGA 1SFYA 1PO13 1HRV3 1YUDA 2BTVC 4LKFA 2IXCA 2YGMA 3LDBA 3CNAA 1RMU3 3QACA 1YQCA 1XB9A 2VQ0A 3JQWA 4QAWA 4CDXA 4DRRA 3BIEA 5FZHA 1O7FA 5FZGA 3DCQA 4IV1C 4P9XA 2HLEA 1XYPA 1VBE1 2K0GA 2RS52 2VOTA 1DLCA 3AKRA 2ZABA 3CQOA 2GNBA 3HIFA 5BNNB 2N7GA 4YWAA 2OZ6A 1LEDA 3K4DA 1UPIA 4UW3A 5C70A 4NO4A 2CGPA 4CP9A 4L97A 1F5JA 4ZY9A 3AP9A 1XOYA 3JB4C 3B94A 4M3CB 3PJQA 3SC7X 3M3CA 1S0GA 1OD3A 2FDFA 2VR4A 3MFAA 1CAVA 1AX2A 4W6XA 5DDJ1 4M3CE 5A32B 4Q29A 4R8HA 3DPRB 1XYOA 3POEA 5FMCA 3CU7A 4AG4A 5HCAA 2ZGSA 1R081 5C5UA 1POV1 1YLLA 1QH7A 1UY0A 3QBQA 4FO9A 5FZOA 1D7PM 1UY2A 2XGXA 2BWCA 2HWE3 5EHDA 1IKQA 2JDZA 1SLCA 2GC0A 5FAXA 4HMZA 1OQ1A 2WQZC 4CEYB 2X29A 2HEVF 4C8DA 1O6UA 2YBKA 3WP3A 3VBFB 5LY2A 5A7WB 2RM23 2FZ2A 4JRAA 5DABA 3TOJA 1BVVA 1SZBA 1AXYA 1LRHA 1PVC1 3KM5A 4J1WA 4QPIA 4RQPC 4K7JA 2FD8A 2VXJA 1QJY1 4JX0A 1VB2A 2ZS6B 4NUBA 4WVMA 4Y33A 1DQ6A 3WF3A 1FX5A 4FBFA 5F7UA 3M2MA 2F4PA 3RSJA 1ND2B 2VCAA 3J26N 2YBPA 1D0GA 1QQP3 1URXA 4C91A 4LHSA 3JBG3 4YGBA 4G4FA 3HAGA 1RUI1 2JWPA 3ON7A 1NOVA 1W8TA 2Q30A 1HQNA 2DVBA 1EY2A 3ZFGA 3C8XA 3HBZA 2YPDA 4LTAA 1XSQA 2DU0A 5JDBA 3OBTA 3AP6A 5BUVA 2CDPA 2Y6FA 3H0OA 1UO9A 1CAUA 4TTGA 2A6WA 4XE9A 5JR2A 4IGQA 5T5PA 3VBUB 1Z7S3 2D98A 1B35B 2NLRA 1QF3A 2JENA 4BE3A 1AXZA 4BXFA 1FOD3 4BQ4A 3H8RA 1D4M3 3FUQA 2G19A 3IDCB 1RIRA 3LZZA 5BNPA 5ABJB 1JZ2A 1UYZA 2WLQA 4PIZA 4JDNA 1Y9MA 1PK6C 3U07A 1O3RA 1RHI1 4L2NA 1ZBA1 2W95A 2GU9A 3I2DA 3LEIA 2JDUA 5FP8A 1JUIA 5IK4A 1NXMA 1XNKA 4HK8A 5FJKA 5F3EA 1A78A 1L3JA 3GCXA 2G4IA 1LHUA 4JHTA 2OQ7A 2W3JA 2D6LX 1SG3A 3AMHA 5CBLA 4OUMA 4HPKA 5A70A 3MV11 4QT6A 2VVDA 3D6EA 3MIGA 1ZZ8A 4GWNA 4LO7A 2E63A 1S4CA 1H1IA 4EN8B 4MOAA 4IW3A 2E31A 4YVSA 3J7LA 1FNZA 3TYJA 4QXKA 2WBKA 3Q8AA 2E26A 3TWIA 2CYFA 3OY8B 2KD7A 5IAVA 3HNYM 2FQPA 1TG7A 4JAAA 1RUE2 4GAZA 4IE0A 4MYEA 3W59A 3N3HA 3ES1A 4IV3A 1LOCA 2FDGA 2WZEA 4D6QA 4N43B 1SCSA 2VGDA 2GH2A 4XUOA 1E5HA 1QJEA 4AAXA 4E27A 3TEWA 2E7AA 3WINE 4INDA 2WZR2 1N1SA 2W1WA 1W90A 2V5YA 1KJLA 4NOTA 2CAVA 3A23A 1RUJ2 1DU3D 4YG3A 2W1UA 3ETQA 5FBZA 3I4IA 2XWJB 4PIXA 1KRIA 5F2WA 1JOBA 2ZX2A 1S2BA 2VNRA 2WINB 3B3QE 3KWVA 1KITA 4PDWC 5FYZA 4CDUC 1FI2A 2QBXA 2ZGRA 1BCXA 5LEJA 3IIAA 3O1MA 3ZYJB 3MICA 2RS13 1AR91 1OOPA 2OUHA 2W46A 2EF6A 4U2AA 3AX4A 4FT8A 1LGNA 1Q8QA 4ZS2A 4GB33 3NVCA 1H1MA 3MEPA 3WQBA 1NKGA 1QJX1 3RZJA 3U78A 4RQPB 1X9TA 1YQ2A 4IE5A 4XCBA 1GZTA 2O14A 5CFDA 1X50A 1LNSA 5FCCA 2ENRA 4AGRA 1HB4A 4KH9A 3TN91 4BQ1A 1LHNA 2BFUL 3AZXA 5BNOB 4BQ3A 2AENA 1X82A 1QDOA 4CXXA 2VPVA 4Q2FA 1GWMA 1ZZCA 4FP3A 4F7ZA 2QE3A 4BM8A 4CEWC 1OA2A 3UL2A 4BWOA 1QOOA 4JDOA 2BNOA 1ENSA 2WNVB 3HMYA 1H2MA 3MI8A 2QQLA 4COYA 1AYM2 1UYXA 1SQ4A 2BEOA 2WNUC 5FZ0A 4CSWA 2QNKA 4ZXKA 4COZA 3ZXJA 5FPUA 2ERFA 2VZPA 2V72A 4B4PA 1OF4A 1OT5A 3OGSA 2RS33 2LTNA 2VXRA 2ATFA 3OD0A 3VGIA 3ACFA 1IPSA 4PBPA 2PHLA 4CCDA 1HKDA 3VD4A 3O1RA 2D93A 1IS5A 5FZBA 5FZ8A 3OTFA 2CWSA 1IKPA 1PK6B 2JEMA 2BPA2 3ZYRA 4E4ZA 5I0DA 2B8MA 1BEV3 1POV3 2YBSA 3NKTA 3POIA 3B69A 4YW3A 4EN6B 1EV11 1NY71 1OH4A 1NG0A 4YZ5A 3FLPA 4IEVA 4BA6A 4XACA 2A5ZA 3H9AA 3WVJA 5CG8A 3I2JA 5M0TA 1MEC2 3I3DA 4ZU7A 1Y7BA 2ZHMA 1DQ0A 4HETA 4XYXA 5D8AC 3SEPA 2K9ZA 1KS4A 5K7PA 4URTA 4IE4A 2E53A 4Q8LA 1CAXB 3OOXA 3RI8A 4N53A 1S0BA 3DL3A 1GQGA 5F6LB 1JN2P 3KGZA 1YFYA 1NCQC 1D2QA 1BJQA 2HWD2 3AZYA 3VZNA 3WNOA 4P5HA 4IGOA 4ZU5A 3VDDC 4C0BA 1QJZA 4YARA 3NL1A 4DUWA 1FPN2 1DBNA 1R64A 1UF2C 2BU9A 3HNMA 3LFMA 1V9U3 1BK0A 4WV8A 4XFCA 3BCWA 2ZGTA 4H7MA 3C3VA 3PL0A 4MH0E 5C4WA 1PIV2 1QXJA 2JJ6A 3ZXDA 4EWEA 2VTFA 1S0IA 5CFCA 3T3YA 4Q0UA 4LLFA 1H1AA 3VHNA 4Q4V1 1W2NA 3FBMA 2WQ8A 4MGYE 1JHJA 4LITA 5I8SA 3NJZA 4OMCA 4CDUB 4E4DX 1HN1A 3PTRB 3T30A 3V56A 1LOFC 3GGLA 5F1RA 3V0AA 1MR5A 2R49A 3GZAA 1C8M1 2EIDA 3ECQA 5D21A 1I6XA 2H6CA 1TMF2 3POSA 4XDQA 3BALA 3LB9A 5JPNB 1KEXA 5IVFA 1TEIA 3ME2A 5JWPA 4D7TA 2BRTA 1RHI3 4DO0A 1X36A 5K0UA 2QKDA 3O1SA 3KMHA 2YG0A 2OPKA 4XJ9A 5FZKA 3RS6A 4AEDB 3N9MA 4V2WA 5LZ6A 5J37A 4DRVA 2NMNA 2AUYA 3S57A 5FFOC 4GKXA 3BYWA 4P9WA 1QIQA 2D3RA 2F4LA 2KM2A 2XL9A 3LA2A 2EAKA 4DPNA 2QQKA 2R071 1JYNA 4XZUG 1ZZ9A 2VOVA 1YFWA 2BGPA 5A3UA 4WVZA 1W8FA 5L9BA 4ITCA 3WW3A 4XAAA 1WGPA 3B9IA 2WNUB 3DECA 1MQTA 3ACGA 3SH5A 3W9AA 4LKDA 3GCWA 3HT2A 1RUF2 5F5IA 4OI0A 3ZR5A 2FHRA 4L8QA 4UFJA 4D6RA 2BVVA 2PLV3 2WN3A 5EZWA 4KBZA 3ILRA 3I3EA 3HQRA 3SITA 1FMD2 1GP6A 4JRLA 4QKNA 1Q3EA 1EPZA 1MS8A 1V6MA 2J1EA 3E6CC 2ZGKA 1PMJX 4OCTA 4RR3B 3HNBM 3EO6A 2X10A 3ZMNA 1A34A 1CVNA 2LALA 5FZDA 1DFQA 1GZCA 2FMYA 3AXDA 5JVVA 1VRH3 3UKTA 1WLDA 1E57A 2A1XA 4IGPA 2R0FA 2BGCA 4AOCA 4BQWA 3OUHA 2OXBA 3LQCA 5D8AB 2ADDA 3BVCA 3EXUA 4QX5A 4DUXA 1VBD2 3AVSA 3BI3A 2W1QA 3BODA 2GNDA 1D2SA 1UZ0A 1S0EA 4I01A 3HOBA 2BGOA 5A7SA 1GWKA 5FZAA 4K40A 4QX7A 2BQPA 1AYN2 1DLLA 1NCQB 2PN5A 3WX5A 1ZRCA 2RR13 2R041 5DUWA 3I2OA 5I0TA 3VDDB 1PGW1 3N35A 1R1A1 4UT5A 3OYWA 4XILA 5C9AA 4DEQA 4Q4X1 1OBNA 4WM7C 3WY6A 3R4SA 4LBLA 5B4NA 3NV4A 1JH5A 1T6BX 3CL1A 4EV0A 1W2AX 3A0NA 5FZMA 3WUCA 3IZOA 3VKLA 3VDAA 4DZGA 3KCCA 5KR7A 3UKVA 4I09A 4FPFA 2D40A 4XUTA 3M3OA 4COVA 1MPXA 5FO9B 1ASJ1 3EBRA 1COV2 1U5YA 4W8JA 2ZGUA 3B93A 3AB0A 3AKSA 4QXBA 3VKNA 4S2FA 5JMCA 3D5OA 4QWNA 4QX3A 4RHV3 4UYBA 5L36A 1RGSA 1UIKA 3NV1A 5DN2A 1XNCA 2PELA 5LA0A 4MXWB 4W65A 1NA1B 3WW1A 4D7SA 4DB5A 3JD73 4CCOA 5A3TA 5J36A 3AP4A 3ZFFC 1GU3A 4WZCA 2R30A 2ZACA 5HCFA 2A6YA 4IEYA 4Z92B 5HV0A 1AL23 4AXOA 1GP4A 2D97A 1PO23 4LJHA 5A80A 2P5BA 3WF1A 2YROA 1XQNA 1HJGA 3J7HA 4FCAA 3TEZA 2J42A 4GA9A 2VMCA 5GM0A 4D94A 5EQUA 4BMBA 4V2VA 2R061 4FOWA 3CO2A 5FY8A 5EJ3A 1O59A 4BH9A 2WA3A 1GKBA 1QJU2 4ZS3A 4CDQB 4PLNA 3DYPA 4IERA 4CTEA 5FYMA 3GBGA 1DQ1A 3AKTA 2ZX4A 1ZBE2 3ROUA 1AR82 4GKYA 1QWRA 4QD2A 5L7OA 2ZGNA 1CR7A 1W8NA 2DCTA 3VKFC 5JZGC 1P8JA 5FUPA 5ACA3 4NWVA 2WS91 4R9DA 4TXWA 4YZ3A 5EYXA 2GZWA 2A6ZA 4PF5A 2VUDA 4MSVA 2RMU1 1DGLA 1HRV1 1DGRA 4QQPA 3ZN6B 2NN8A 1RMU1 5F32A 4AGGA 5B4XA 4UF0A 5I0RA 3Q9OA 2SBAA 4GXLA 3HD8B 5A7PA 5DZGA 4BOWA 4HSJA 4NHMA 5JMOA 4CU9A 1H8TA 1ZM1A 1J84A 3VZOA 2UWBA 4D6SA 1XNBA 2ZGPA 2VBDA 1JI6A 1WA6X 1OFSA 1ZA4A 2QDRA 3H3UA 4IETA 2BP6A 5DZFA 1OQEA 5CAZA 1V70A 2Y64A 2XBO2 4DXRA 3UV9A 3ABZA 5LA2A 1C8M3 1OA3A 2HYKA 5JPMB 4LPLA 2QQOA 4Q8KA 5DAWA 4DIQA 4NMIA 3NO8A 1YQ6A 3U4SA 4V1PA 1OVSA 1U12A 5FMBA 3GNEA 4PT6A 1AJOA 1IS6A 1GBGA 2WO2A 4BZ4A 4OULA 4HVQA 3HBKA 4JGZC 5GZFA 3VBRB 4JV4A 3DN7A 2WUHA 2QQUA 2RS53 3BPSA 2WL1A 4NHYA 4WM7B 3SHRA 3DKWA 4KWKA 5SV8A 1S2EA 4QB2A 5GZDA 1NZCA 1NCRC 3DF0A 3NJVA 4B7KA 3FMGA 5BY5A 2D6OX 1N3PA 1UD1A 3C7EA 4FPOB 1DIWA 2JG9A 4OHVA 4AYUA 1W0NA 2R073 1RUOA 2DVFA 1GOHA 5KC6A 2HWE1 4CZSA 5AVPA 5IVYA 5DAXA 4O9GA 3KF3A 1LOAA 3NSTA 4GH4A 1VBC2 1VB4A 4UFLA 4WM8A 3ZFEC 1W6MB 1MACA 1GANA 4GWJA 4LUKA 2H6BA 4JGYA 2RM21 2UURA 4AI9A 4XFIA 3L2YA 5IYYA 3M4FA 2QQMA 3OGJA 4I0WB 2O0OA 2GP3A 1IZ3A 3P5BA 4K1YA 4LKSA 1UOJA 2GNTA 5DQ0A 4Z2AA 5A3NA 3RJRA 2OVUA 3HJRA 4RYDA 3IKWA 2JDKA 2JG8A 3WDUA 5DUUA 1XXNA 5HXVA 3ZFFB 5A6ZA 1BXHA 1VLNA 1KXGA 3AZVA 4LULA 4Q1PA 1N3OA 2X09A 1J3PA 1QQP1 5KHJA 1HB1A 2ZEWA 1AHSA 2P2KA 1E5SA 3ZVXA 4DQAA 4NHLA 4CEYA 1VPHA 1ZZ7A 1B09A 3GHNA 2BNNA 2RJLA 5A1FA 1ULGA 1RC6A 1WW6A 1CIYA 1S0CA 4R9CA 4O7XA 5A7WA 2UYAA 2I45A 3K3OA 4GMP0 4P9YA 3UJQA 2BERA 1O91A 1QNYA 3D0JA 5LK7B 4Q5OA 2F17A 4QPYA 3RZGA 4YW1A 3THTA 3AZZA 1MZ6A 4NIHA 2XOMA 4PQQA 4PF1A 1QJX2 4ATFA 3VBHC 3RZHA 1FAYA 1AR61 4B3NA 1ND2A 2W39A 1NZIA 1FOD1 2VNGA 1R1A3 5JZGB 1AR72 2ZOEB 2A73B 1DGRN 5HXMA 3VZKA 3ZYIB 5FZEA 1AF9A 2Y60A 1MS1A 2E6VA 5LW9A 1RUH1 4KQ7A 1O8SA 4CDWB 1RUD1 1QU0A 5FXZA 3S30A 3AP7A 3NRUA 1REFA 3G7DA 4XQ4A 2AEZA 3I8TA 4M3CF 2EXJA 3P3NA 3L9JT 4QX8A 4LE4A 3M1HA 1EAH2 5KHIA 4RGGA 2DF7A 3IPVB 5JXJA 4HL0A 5FYTA 3VBFC 3WT3A 1N3QA 2VMDA 3WZ1A 1ND3B 1F4AA 1Y9QA 3TNPB 5BYNA 1DF0A 1UAIA 1WLCA 2PA7A 1V0AA 2NZ9A 1VBA2 2ZHKA 4DEVA 1HB2A 3SCFA 5ABJA 4IEWA 3AKPA 2ARCA 1H2LA 3OEBA 2RJKA 5C8CB 2VW0A 1BBT2 1UYYA 4ARXA 1YWKA 5APAA 4LBNA 2HWF2 1JBCA 1OVPA 2JDYA 1UMIA 3BU7A 2O1QA 3EMRA 4KI5M 1SCRA 1U0AA 4AEKA 1W2OA 3W58A 4JGZB 2XKOA 2IXJA 3O7OA 5FTTC 2HWC3 1K12A 1DYOA 1QEXA 2ORZA 1TME1 3H1WA 3ORJA 4R9BA 2IUWA 4AFDA 4IV1A 4B29A 4YM3A 2FMDA 2AYHA 1DCSA 2JDAA 5CU1A 3CEWA 1OF3A 1G9FA 3CF6E 3WHTA 3I59B 1NCRB 1ULOA 2R063 4BMEA 2Q0AA 5IK5A 4HKOA 4QGMA 4CUGA 2YMZA 3RVHA 4D7YA 1JZ4A 3M3EA 2P3KA 3POBA 3ZIXA 5HI0A 1KD7A 4AFCA 5IHRA 2RS11 4QPGA 5I93A 1B35C 4A44A 2YY1A 2ZMKA 3WF4A 3ZFEB 1JU4A 4A45A 3RPQA 5EPAA 3ILNA 3AYEA 4Y26A 1GICA 3ZLIA 4GB31 1YJKA 4LK7A 3RDIA 5FY4A 2WZR3 3C7GA 4OI2A 2CSGA 2RMU3 2DBIA 3G6JB 4PHZA 1UL9A 3Q8CA 1IPJA 1PMHX 1S0DA 4Q4Y1 4CDQA 3IDBB 1NX9A 5T5LA 4YM1A 3BKZA 3H8XA 1RVF1 1XU2A 2E9QA 2XLAA 2HJIA 4KBBA 4YW6A 1XNTA 1RUC3 1WBFA 1WA4A 4A7ZA 5JOYA 3MFCA 4WVVA 4FI9A 1IHMA 1LULA 4B1MA 4I02A 1LHVA 3RWKX 4XTPA 1W6NB 4XFAA 2AGSA 4RGAA 3ACHA 2AREA 5LA1A 2ADEA 3CJIC 3JB8A 4XJWA 1DHKB 4RQPA 3UT0A 1J1LA 5J09A 4A6SA 1C8NA 4RD7A 2D43A 2W1SA 2PHXA 1GFF2 2FZ1A 3FWEA 3Q8FA 2W2IA 4LEJA 1R092 1CONA 2RS31 1YIPA 2YUEA 5FWEA 2PMWB 3BIWE 2WJSA 3GJBA 4GQ7A 4KU8A 4N43C 4Y5Z0 3CZUA 3A21A 2G1MA 2XQRA 4Y22B 1KFXL 1BKZA 3KSCA 3WEZA 2ZAAA 3GF6A 4HKWA 4YRDA 3GZUC 1W6PB 2A6XA 1BEV1 4IEOA 4XMAA 5FKBA 3POFA 4IL7A 1AYM3 5E1RA 1V6OA 1LKNA 4YW7A 3ZSMA 2VO5A 2WO7A 2P3YA 2DFBA 3RWNA 4QMAA 3WQ7A 4CUBA 5IT6A 4BDVB 4AF9A 3PUQA 2CNAA 2A3WA 1QDCA 5FIXA 4EN0A 1MZEA 4HLTA 3TEXA 5K4LA 3OBZA 2J1SA 5K9YA 3KF5A 5EFUA 4BCUA 2CL2A 3LD8A 2C6SA 3AFGA 4FFFA 3W20A 5A33B 2DCJA 2HH9A 3GBFA 3ZYPA 2JDNA 5FQ0A 1GLHA 5FP9A 3KCYA 2GC2A 5CYYA 4UFIA 3S5QA 3KVAA 1KQRA 5BNOC 1MVQA 2Z4FA 5FDBA 1V9U1 1O8PA 2PAEA 1RITA 2VMEA 3MV01 4N8MA 3RMYA 4JQRA 1LU1A 5LY1A 1K45A 1RJ8A 1W9WA 2ZGMA 3INAA 1Q5OA 4IEQA 4RFRB 4M4PA 1Q43A 2MPFA 1RUG2 1SLAA 2VZUA 5FLJA 4Z2WA 4NAOA 4ZPIA 4Q0PA 1C1LA 2WNVC 3R0RA 4PLMA 2HYXA 2HWD3 1QGLA 3FLRA 3WF0A 1SEFA 2D44A 3ZDVA 1G9BA 3VD3A 5F3IA 1V6JA 5IFPA 4Y1UA 5KXEA 5AC91 4YYOA 1FATA 1FPN3 4MGTA 5FP3A 5DG1A 1QMJA 2GMMA 1AR63 2V5DA 4G3YC 4K8RB 3GXUA 5FZ1A 5HBAA 3PVEA 4FOYA 4E4HA 1W6QB 1PIV3 2R6QA 4Q4X2 1PGL1 1DP0A 2XMLA 4IEXA 3HQUA 4X6RB 4MHUA 1RUH3 2WKKA 3CKHA 4XDPA 1VMJA 4LIVA 4NJ4A 4PI2A 4AVAA 3IWZA 4HK9A 1RUD3 1OPOA 3LGRA 2JE7A 3E5QA 4A7KA 2EIEA 2EXKA 1OURA 2Z5WA 3ES4A 4XBNA 1GQHA 2I07B 2ARXA 3VDCA 4PDWA 4YPJA 3UK9A 4CDUA 3NWKA 1XNAA 2A6VA 1LHWA 4YM0A 5EV7A 1X7NA 3S5AA 1VALA 4H2AA 2XHNA 2AEYA 3UGHA 2BZDA 4AL9A 3Q8BA 5FZFA 4A6OA 3FUOA 1PZ7A 1YIFA 2DU1A 2UWAA 2ZHNA 3QOPA 4Q4W2 2B42B 3CJIB 4ISQA 4AQSA 4DY3A 2VNVA 4QX0A 4RA0A 5CEHA 5F3GA 4LO8A 1OUSA 2VH9A 3LEGA 5CISA 2DVDA 4FSJA 2YC0A 4CCCA 2X53S 2PLV1 5AVAA 4RGKA 3NV3A 2VL4A 1SDWA 2PFWA 3KV9A 4P9IA 1UZYA 1K5MC 2D7FA 4KL1A 5JXHA 1TME3 1WW7A 2B45X 2VCMA 2YC2A 2VMHA 1POV0 1S55A 4CEWA 1IQDC 2XVKA 5JSPA 4HKLA 1I3HA 1HXS2 2C9AA 4EWDA 1L7QA 2XQXA 4QU1A 3RZZA 1VRH1 2HKXA 4XF1A 1RUF3 3PURA 1F15A 3PU8A 5H9SA 1CD3G 2JE9A 4FQZA 5BNPC 1MVEA 2A71A 1HV1A 5A1AA 1FMD3 2JIGA 2JD9A 1DZRA 3HN1A 5T55A 3OG2A 5FJHA 2WFF2 2YC4A 3N36A 4AI3A 2RR11 4XMIA 1PO12 2JKBA 5KXBA 3VBOA 2VNOA 2ZJCA 4Q4Y3 4CDXB 4AEDC 3O1UA 2C5DA 1RVF3 3E5UA 4DXSA 1ULCA 2Y26A 1O4ZA 1OLRA 2UWCA 4BK5A 3C7HA 3I7DA 3CZJA 4P00B
chains in the Genus database with same CATH topology
1SHWB 3HNBM 2X10A 3T0BA 4CU8A 1UWWA 3C7OA 2YFZA 3I2IA 3UNPA 2VZ3A 4JHZA 3LQCA 3ACIA 4DUXA 3WSOA 2W1QA 2J7MA 1F4HA 1UZ0A 3CIHA 3HOBA 2BGOA 2R7EB 2W94A 5EJ1B 4CU7A 2ZEYA 3HN3A 2VZQA 3OEAA 1K42A 1WCQA 4P08A 3VDBA 4L0PA 3K46A 4DXTA 2J1TA 2J22A 2W47A 4DEQA 5B4NA 4W4ZA 1XPWA 3VDAA 2JKXA 1JYXA 4XUTA 2WYSA 4BXSV 4E8DA 1MPXA 1WKYA 2E33A 4W8JA 5DMYA 3FL7A 2LS6A 4QX3A 1W9SA 2EICA 5DN2A 5LA0A 3K75B 1US3A 2V4VA 1PX4A 3K4ZA 2WDBA 4M4RA 1GU3A 3C7FA 5HPOA 3WF1A 3J7HA 3EB7A 2WAAA 2W9XA 3ETPA 3SKVA 2VMCA 1J83A 3LPFA 1JZ6A 1O59A 3LE0A 3SEEA 3DYPA 2J1RA 2CDOA 4W50A 4JKMA 2ZEXA 1TVGA 3I2HA 1W8NA 4QDRA 2B4KA 3SKJE 1P8JA 3MUY1 1UXZA 4TXWA 2VZTA 2J1UA 3I3BA 1GOGA 5EJZB 3WNKA 5B4XA 4XUPA 1CZSA 5JMOA 1J84A 5C71A 4ZZ5A 1H6XA 4LQRA 1JI6A 4D0QA 4ZZ8A 1H6YA 2WZ8A 3THDA 2Y64A 4DXRA 3ABZA 5LA2A 2VM9A 2QQOA 4LPLA 2VQTA 2XONA 3EYPA 1RYYA 2E32A 4PT6A 2ID4A 5DPNA 2WO2A 3LEKA 2WN2A 2W91A 4QAWA 3WNLA 2WUHA 2VZ1A 5CZKA 2VZRA 2VMFA 4QB2A 4CUAA 2HLEA 3NJVA 1W9TA 2VOTA 3C7EA 3CQOA 1DLCA 2L9LA 1GOFA 1W0NA 3UESA 1GOHA 4ET7A 3K4DA 5LCWL 2DCKA 2PQSA 3IDAA 3T2QA 5C70A 4GWJA 4ZY9A 3F2ZA 4BK4A 5IYYA 2QQMA 1OD3A 5DQ0A 4Z2AA 2VR4A 4LKSA 4P02B 4JKLA 3HJRA 4RYDA 4MGQA 4AG4A 2J1AA 4XUNA 2X09A 1EUUA 2ZEWA 1UY0A 3PUHA 3T0DA 4UAPA 1D7PM 1UY2A 2OKXA 3IB3A 3I97A 3U37A 4OYUA 1CIYA 4CU9A 1JZ5A 1GMMA 2BERA 4P5YA 2VC9A 4ZXEA 2B9VA 4OZOA 1JU3A 2XOMA 4PQQA 4PF1A 1UY4A 1CZTA 2ZXQA 2QQNA 4JX0A 4XVHA 3FHQA 3WF3A 5F7UA 3BN6A 4QDSA 4UI9L 5FUIA 2VCAA 2Y6JA 3WNMA 5HXMA 4LHSA 3DYMA 1GQPA 1W8OA 1O8SA 1I5PA 2VQUA 4CU6A 3CMGA 3K4AA 2YB7A 3NRUA 3C8XA 1GUIA 3NQHA 2CDPA 4IUGA 5JXJA 4TTGA 3HPNA 5JR2A 2WAOA 2VMDA 3CDZB 3T08A 3WF2A 3OB8A 1F4AA 4A41A 4DUVA 4DEVA 3OEBA 1UYYA 4ARXA 1JZ2A 4CUCA 1US2A 1UYZA 3DYOA 3T0AA 2C26A 2W95A 1UMIA 3LEIA 4KI5M 2W87A 3THCA 2RVAA 4OUEA 1SDDB 1K12A 1DYOA 2ORZA 2W3JA 2DDUA 2JDAA 1SG3A 1OF3A 1ULOA 4QPWA 3IAQA 4KWUA 3MV11 1GNYA 1JZ4A 3OBAA 3VD5A 5G05L 5IHRA 4MOAA 2E31A 3MUZ1 4A44A 2WBKA 3WF4A 2E26A 1JU4A 4A45A 2KD7A 3HNYM 1TG7A 3ZM8A 1JZ7A 5JXIA 1ULPA 3C7GA 4A3ZA 2WZEA 3E1F1 4OMDA 4XUOA 3JXSA 4AAXA 4MGSA 3WNNA 2VZSA 2JE8A 1PMHX 2W1WA 1NX9A 4GZ9A 5EIYB 3A23A 2Y6HA 4MO3M 2W1UA 1XNTA 3FN9A 4FI9A 3A7QA 2QBXA 2Y6GA 3VD9A 2W46A 3ACHA 3I2GA 4MADA 5LA1A 3K77A 3WQBA 1NKGA 4XUQA 3NNGA 3VD7A 2W1SA 1YQ2A 3OGVA 1LNSA 4RN5A 3PUIA 3I2KA 3CZUA 3P1IA 3A21A 4BJ0A 1NAEA 3WEZA 2ZEZA 2VZVA 1JYWA 2BBAA 3BGAA 2YFUA 4ARYA 2C4XA 2VO5A 2QQLA 5G04L 1UYXA 4CUBA 4BDVB 1CX1A 1EUTA 1UY3A 1UXXX 2VZPA 4XURA 2V72A 4QDQA 1OF4A 1OT5A 3OGSA 2J1SA 1JYVA 4D8MA 3ACFA 3VD4A 3T2PA 4CVUA 2DCJA 1CZVA 5CYYA 5C7GA 5IJRA 2WO1A 2Z4FA 5I0DA 1O8PA 2VMEA 1UY1A 3MV01 1OH4A 3MBWA 1K45A 1W9WA 4M4PA 3I2JA 2VZUA 1K3IA 3I3DA 4A4AA 4GWIA 2LW8A 1PX3A 2HYXA 2RJ2A 3SEPA 2VZOA 3D3AA 3WF0A 3A22A 3P6BA 3VD3A 2ORXA 5IFPA 3WNOA 2Y6KA 4QX1A 2V5DA 5JUVA 3W5MA 3GXUA 4DUWA 3GM8A 1R64A 4QB1A 5JXGA 3HNMA 2WO3A 1DP0A 1UX7A 2VJXA 3CKHA 2Y6LA 3NJXA 2W5FA 1UMHA 2EIEA 2VTFA 2VCCA 3I2FA 3VDCA 2WQ8A 4YPJA 1JHJA 4OMCA 1BHGA 1XNAA 4UOJA 1HN1A 2EIBA 2XHNA 3GGLA 4HG6B 4E8CA 2BZDA 3ECQA 2EIDA 4A6OA 2C9KA 3FHAA 1JZ8A 1KEXA 4QX0A 3IAPA 2VCBA 2X05A 1T2XA 3WNPA 1KGYA 3LEGA 2YG0A 3LPGA 3MO4A 1L7RA 2VL4A 2Y8KA 5JXHA 3GDBA 2YC2A 1IQDC 2RV9A 4QB6A 2QQKA 1JYNA 4XZUG 3HEIA 4A42A 1L7QA 2XQXA 2W92A 3AC0A 2BGPA 1XC6A 3DECA 3ACGA 3UETA 5A1AA 2JD9A 4JKKA 2J1VA 3IIIA 4QX2A 3OG2A 3W5NA 2YC4A 2WN3A 5J1XA 1W99A 2WABA 3I3EA 4KMQA 1JZ3A 3T2OA 2QQJA 1NUKA 3OGRA 2QQIA 4DXSA 5IFTA 3T09A 2J1EA 4BK5A 3C7HA 3CZJA 4P00B 1PMJX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SHW B;  3HNB M;  2X10 A;  3T0B A;  4CU8 A;  1UWW A;  3C7O A;  2YFZ A;  3I2I A;  3UNP A;  2VZ3 A;  4JHZ A;  3LQC A;  3ACI A;  4DUX A;  3WSO A;  2W1Q A;  2J7M A;  1F4H A;  1UZ0 A;  3CIH A;  3HOB A;  2BGO A;  2R7E B;  2W94 A;  5EJ1 B;  4CU7 A;  2ZEY A;  3HN3 A;  2VZQ A;  3OEA A;  1K42 A;  1WCQ A;  4P08 A;  3VDB A;  4L0P A;  3K46 A;  4DXT A;  2J1T A;  2J22 A;  2W47 A;  4DEQ A;  5B4N A;  4W4Z A;  1XPW A;  3VDA A;  2JKX A;  1JYX A;  4XUT A;  2WYS A;  4BXS V;  4E8D A;  1MPX A;  1WKY A;  2E33 A;  4W8J A;  5DMY A;  3FL7 A;  2LS6 A;  4QX3 A;  1W9S A;  2EIC A;  5DN2 A;  5LA0 A;  3K75 B;  1US3 A;  2V4V A;  1PX4 A;  3K4Z A;  2WDB A;  4M4R A;  1GU3 A;  3C7F A;  5HPO A;  3WF1 A;  3J7H A;  3EB7 A;  2WAA A;  2W9X A;  3ETP A;  3SKV A;  2VMC A;  1J83 A;  3LPF A;  1JZ6 A;  1O59 A;  3LE0 A;  3SEE A;  3DYP A;  2J1R A;  2CDO A;  4W50 A;  4JKM A;  2ZEX A;  1TVG A;  3I2H A;  1W8N A;  4QDR A;  2B4K A;  3SKJ E;  1P8J A;  3MUY 1;  1UXZ A;  4TXW A;  2VZT A;  2J1U A;  3I3B A;  1GOG A;  5EJZ B;  3WNK A;  5B4X A;  4XUP A;  1CZS A;  5JMO A;  1J84 A;  5C71 A;  4ZZ5 A;  1H6X A;  4LQR A;  1JI6 A;  4D0Q A;  4ZZ8 A;  1H6Y A;  2WZ8 A;  3THD A;  2Y64 A;  4DXR A;  3ABZ A;  5LA2 A;  2VM9 A;  2QQO A;  4LPL A;  2VQT A;  2XON A;  3EYP A;  1RYY A;  2E32 A;  4PT6 A;  2ID4 A;  5DPN A;  2WO2 A;  3LEK A;  2WN2 A;  2W91 A;  4QAW A;  3WNL A;  2WUH A;  2VZ1 A;  5CZK A;  2VZR A;  2VMF A;  4QB2 A;  4CUA A;  2HLE A;  3NJV A;  1W9T A;  2VOT A;  3C7E A;  3CQO A;  1DLC A;  2L9L A;  1GOF A;  1W0N A;  3UES A;  1GOH A;  4ET7 A;  3K4D A;  5LCW L;  2DCK A;  2PQS A;  3IDA A;  3T2Q A;  5C70 A;  4GWJ A;  4ZY9 A;  3F2Z A;  4BK4 A;  5IYY A;  2QQM A;  1OD3 A;  5DQ0 A;  4Z2A A;  2VR4 A;  4LKS A;  4P02 B;  4JKL A;  3HJR A;  4RYD A;  4MGQ A;  4AG4 A;  2J1A A;  4XUN A;  2X09 A;  1EUU A;  2ZEW A;  1UY0 A;  3PUH A;  3T0D A;  4UAP A;  1D7P M;  1UY2 A;  2OKX A;  3IB3 A;  3I97 A;  3U37 A;  4OYU A;  1CIY A;  4CU9 A;  1JZ5 A;  1GMM A;  2BER A;  4P5Y A;  2VC9 A;  4ZXE A;  2B9V A;  4OZO A;  1JU3 A;  2XOM A;  4PQQ A;  4PF1 A;  1UY4 A;  1CZT A;  2ZXQ A;  2QQN A;  4JX0 A;  4XVH A;  3FHQ A;  3WF3 A;  5F7U A;  3BN6 A;  4QDS A;  4UI9 L;  5FUI A;  2VCA A;  2Y6J A;  3WNM A;  5HXM A;  4LHS A;  3DYM A;  1GQP A;  1W8O A;  1O8S A;  1I5P A;  2VQU A;  4CU6 A;  3CMG A;  3K4A A;  2YB7 A;  3NRU A;  3C8X A;  1GUI A;  3NQH A;  2CDP A;  4IUG A;  5JXJ A;  4TTG A;  3HPN A;  5JR2 A;  2WAO A;  2VMD A;  3CDZ B;  3T08 A;  3WF2 A;  3OB8 A;  1F4A A;  4A41 A;  4DUV A;  4DEV A;  3OEB A;  1UYY A;  4ARX A;  1JZ2 A;  4CUC A;  1US2 A;  1UYZ A;  3DYO A;  3T0A A;  2C26 A;  2W95 A;  1UMI A;  3LEI A;  4KI5 M;  2W87 A;  3THC A;  2RVA A;  4OUE A;  1SDD B;  1K12 A;  1DYO A;  2ORZ A;  2W3J A;  2DDU A;  2JDA A;  1SG3 A;  1OF3 A;  1ULO A;  4QPW A;  3IAQ A;  4KWU A;  3MV1 1;  1GNY A;  1JZ4 A;  3OBA A;  3VD5 A;  5G05 L;  5IHR A;  4MOA A;  2E31 A;  3MUZ 1;  4A44 A;  2WBK A;  3WF4 A;  2E26 A;  1JU4 A;  4A45 A;  2KD7 A;  3HNY M;  1TG7 A;  3ZM8 A;  1JZ7 A;  5JXI A;  1ULP A;  3C7G A;  4A3Z A;  2WZE A;  3E1F 1;  4OMD A;  4XUO A;  3JXS A;  4AAX A;  4MGS A;  3WNN A;  2VZS A;  2JE8 A;  1PMH X;  2W1W A;  1NX9 A;  4GZ9 A;  5EIY B;  3A23 A;  2Y6H A;  4MO3 M;  2W1U A;  1XNT A;  3FN9 A;  4FI9 A;  3A7Q A;  2QBX A;  2Y6G A;  3VD9 A;  2W46 A;  3ACH A;  3I2G A;  4MAD A;  5LA1 A;  3K77 A;  3WQB A;  1NKG A;  4XUQ A;  3NNG A;  3VD7 A;  2W1S A;  1YQ2 A;  3OGV A;  1LNS A;  4RN5 A;  3PUI A;  3I2K A;  3CZU A;  3P1I A;  3A21 A;  4BJ0 A;  1NAE A;  3WEZ A;  2ZEZ A;  2VZV A;  1JYW A;  2BBA A;  3BGA A;  2YFU A;  4ARY A;  2C4X A;  2VO5 A;  2QQL A;  5G04 L;  1UYX A;  4CUB A;  4BDV B;  1CX1 A;  1EUT A;  1UY3 A;  1UXX X;  2VZP A;  4XUR A;  2V72 A;  4QDQ A;  1OF4 A;  1OT5 A;  3OGS A;  2J1S A;  1JYV A;  4D8M A;  3ACF A;  3VD4 A;  3T2P A;  4CVU A;  2DCJ A;  1CZV A;  5CYY A;  5C7G A;  5IJR A;  2WO1 A;  2Z4F A;  5I0D A;  1O8P A;  2VME A;  1UY1 A;  3MV0 1;  1OH4 A;  3MBW A;  1K45 A;  1W9W A;  4M4P A;  3I2J A;  2VZU A;  1K3I A;  3I3D A;  4A4A A;  4GWI A;  2LW8 A;  1PX3 A;  2HYX A;  2RJ2 A;  3SEP A;  2VZO A;  3D3A A;  3WF0 A;  3A22 A;  3P6B A;  3VD3 A;  2ORX A;  5IFP A;  3WNO A;  2Y6K A;  4QX1 A;  2V5D A;  5JUV A;  3W5M A;  3GXU A;  4DUW A;  3GM8 A;  1R64 A;  4QB1 A;  5JXG A;  3HNM A;  2WO3 A;  1DP0 A;  1UX7 A;  2VJX A;  3CKH A;  2Y6L A;  3NJX A;  2W5F A;  1UMH A;  2EIE A;  2VTF A;  2VCC A;  3I2F A;  3VDC A;  2WQ8 A;  4YPJ A;  1JHJ A;  4OMC A;  1BHG A;  1XNA A;  4UOJ A;  1HN1 A;  2EIB A;  2XHN A;  3GGL A;  4HG6 B;  4E8C A;  2BZD A;  3ECQ A;  2EID A;  4A6O A;  2C9K A;  3FHA A;  1JZ8 A;  1KEX A;  4QX0 A;  3IAP A;  2VCB A;  2X05 A;  1T2X A;  3WNP A;  1KGY A;  3LEG A;  2YG0 A;  3LPG A;  3MO4 A;  1L7R A;  2VL4 A;  2Y8K A;  5JXH A;  3GDB A;  2YC2 A;  1IQD C;  2RV9 A;  4QB6 A;  2QQK A;  1JYN A;  4XZU G;  3HEI A;  4A42 A;  1L7Q A;  2XQX A;  2W92 A;  3AC0 A;  2BGP A;  1XC6 A;  3DEC A;  3ACG A;  3UET A;  5A1A A;  2JD9 A;  4JKK A;  2J1V A;  3III A;  4QX2 A;  3OG2 A;  3W5N A;  2YC4 A;  2WN3 A;  5J1X A;  1W99 A;  2WAB A;  3I3E A;  4KMQ A;  1JZ3 A;  3T2O A;  2QQJ A;  1NUK A;  3OGR A;  2QQI A;  4DXS A;  5IFT A;  3T09 A;  2J1E A;  4BK5 A;  3C7H A;  3CZJ A;  4P00 B;  1PMJ X; 
#chains in the Genus database with same CATH topology
 4KG0 A;  1PHM A;  2EXH A;  3USU B;  3WCR A;  4CU8 A;  3NJY A;  1DZT A;  1UWW A;  1X8E A;  3C7O A;  1VBD 3;  1N1V A;  2OYZ A;  2WLP A;  4FPE A;  2K2S A;  4N90 A;  1Y3T A;  1C3H A;  4YVS C;  3KGL A;  2QQV A;  5L9R A;  1HN0 A;  1AYN 3;  1CQ9 A;  3ACI A;  4P9G A;  3WSO A;  1UYP A;  2KR2 A;  2QQP A;  3ATG A;  3NAP C;  4J25 A;  3CIH A;  1VRB A;  1CAW A;  1GZ9 A;  2R7E B;  1S0J A;  3KD4 A;  4GAL A;  3HN3 A;  1VR3 A;  1AL0 G;  2UY9 A;  4RHV 1;  4XJU A;  4BPZ A;  3L2H A;  4IV3 C;  4FOV A;  4AR2 A;  1WCQ A;  2V73 A;  1CAV B;  4GWM A;  1HRI 2;  4K8F A;  4L0P A;  1UKR A;  2ZMN A;  4LXL A;  4BU2 A;  1VJ2 A;  1I9R A;  2Q1F A;  2QQW A;  2VOX A;  1BMV 1;  3LEM A;  3PTY A;  3AFK A;  3JD7 1;  4DIN B;  3Q8E A;  1H8V A;  2W52 A;  1LB2 A;  3BPZ A;  1NYW A;  3U11 A;  2NPI A;  1S0F A;  1W6O A;  5ANQ A;  5F5Q A;  1GNZ A;  1AL2 1;  1COV 3;  3B01 A;  2RG4 A;  1PO2 1;  3POY A;  5TSW A;  2CTV A;  1W03 A;  4RR3 C;  5FZO B;  5I0S A;  2R1B A;  2R1D A;  1JYX A;  3JQX A;  2WYS A;  4E8D A;  2BBV A;  2IC1 A;  3AXE A;  1WKY A;  4YVW A;  1OOP C;  1CES A;  1NLS A;  4AVC A;  5FLI A;  4I0B A;  1WCS A;  3T4H B;  1DQ2 A;  5FBJ A;  1XU1 A;  1PGS A;  5ISL A;  1F31 A;  1TNF A;  4FOQ A;  4QKB A;  3WDX A;  3RG0 A;  2B5H A;  1W9S A;  4IDZ A;  3KS7 A;  4CCE A;  4CCJ A;  5CFD C;  4B1L A;  4OLL A;  2WNO A;  4I3G A;  3K75 B;  5FPL A;  4HVO A;  2JXA A;  1V6L A;  1VBB 2;  2V4V A;  1Q8O A;  2VY0 A;  2HWB 2;  3APB A;  4OFG A;  4OHX A;  5FYI A;  4M4R A;  1OSG A;  1W2U A;  5A7Q A;  4CA9 A;  3VV1 A;  5ACA 1;  1CN1 A;  1HV0 A;  4ASL A;  5JCT A;  2WT2 A;  1H9P A;  4NVP A;  4AZZ A;  3ZIW A;  3GHM A;  3JBG 2;  2ZKN A;  2ZGQ A;  3EB7 A;  1K5M B;  3ETP A;  1C57 A;  3O0W A;  5FRE A;  4ERO A;  3LSD A;  4OVE A;  1TQ5 A;  4HZF A;  1ZA7 A;  3I3Q A;  4XF0 A;  3LPF A;  1CAU B;  3MIE A;  1JZ6 A;  1JHN A;  5LAS A;  2X5I A;  4LK6 A;  4MET A;  5AC9 3;  2J1R A;  5JOX A;  2XLG A;  4W50 A;  1S2K A;  1Z7S 2;  3ZSJ A;  4F83 A;  1HW5 A;  3O0X A;  3NNJ A;  1J58 A;  4WZF A;  4YZ4 A;  1TVG A;  4Z82 A;  3C2U A;  5BNP B;  3SKJ E;  3IMM A;  1NA1 C;  4LKE A;  1D4M 2;  4L11 A;  4QKF A;  2VTX A;  1ZZ6 A;  2VD7 A;  2BW8 A;  5AFE A;  2GNM A;  1IQA A;  4Q27 A;  5E89 A;  5EJZ B;  1UW8 A;  4P9J A;  1JTZ X;  1S1A A;  4UFM A;  1EPW A;  1QHD A;  3SCG A;  3I49 A;  1YXW A;  5J7M A;  2RS5 1;  2RDS A;  1RTV A;  1CWP A;  1W8W A;  2G9Z A;  1W04 A;  4FPC A;  4HPK B;  1U5Z A;  4DY5 A;  4Y1V A;  4PIY A;  1KFU L;  3AMN A;  3NNL A;  2CHH A;  4OQ9 A;  1H6X A;  3GYD A;  4I3P A;  3J8F 3;  2UU8 A;  3J9S A;  4YM2 A;  4NIG A;  1H6Y A;  1C1F A;  1UNB A;  3H1Y A;  4CDQ C;  4YFZ A;  4YVS B;  5GAL A;  1V6N A;  3QLQ A;  3SNM A;  1N1Y A;  4QGL A;  2WR9 A;  2WRA A;  3WP5 A;  3NW4 A;  5IVV A;  3NAP B;  5FRA A;  3MLK A;  5FPB A;  3OPT A;  5IAX A;  3GJA A;  1RIN A;  3UGF A;  4AE2 A;  2Y0O A;  4IV3 B;  4DNY A;  4Y4Y A;  4NID A;  1DZQ A;  5DPN A;  2JIC A;  1BYH A;  5DAV A;  2W91 A;  1SLT A;  3WNL A;  3IN9 A;  4JDM A;  5CZK A;  2EIG A;  2VMF A;  3N9O A;  3CHX A;  3WDV A;  3RYP A;  1SBD A;  4E2S A;  2ZZJ A;  1PM7 A;  1W9T A;  1GOF A;  1SPP A;  2P37 A;  3WDY A;  4ET7 A;  1DDL A;  4XJ8 A;  5FYC A;  2XVG A;  3O5S A;  3R6S A;  1OOP B;  3B00 A;  5J96 B;  2DCK A;  4NRO A;  3IDA A;  1LOB A;  4J6G A;  2XB6 C;  3ZXA C;  1T6G C;  4LA2 A;  3F2Z A;  4S2G A;  4OQ8 A;  4MXV A;  4YGD A;  4HN0 A;  3MPB A;  4BK4 A;  1XE0 A;  2MEV 2;  3DUI A;  3UGG A;  2CWM A;  3M3Q A;  3W21 A;  3V65 A;  4Z1V A;  4P02 B;  3MW2 A;  5CFD B;  5FY5 A;  5EXO A;  3R4D B;  4EQV A;  1M4W A;  2KA3 A;  4H55 A;  5FXX A;  3VBR C;  4QHO A;  4XPV A;  2J1A A;  3FE5 A;  5GLT A;  1REE A;  3PU3 A;  3T2T A;  4XUN A;  4XET A;  5FP7 A;  1G9C A;  2AR6 A;  4C0H A;  1EUU A;  2IWG B;  1GR3 A;  4HSL A;  3K51 A;  3PUH A;  4FAG A;  2ZAH A;  4NRP A;  3T0D A;  3SQO A;  1GZW A;  4UAP A;  2A7A A;  2OKX A;  4LOT A;  5F5A A;  4YGC A;  5FY9 A;  2FDI A;  3MIH A;  1VBE 2;  3U37 A;  2LRP A;  3B5L B;  4IE7 A;  4OYU A;  3KT1 A;  4QM9 A;  1QOS A;  1SMV A;  4LBQ A;  1IG0 A;  1GMM A;  1SFP A;  4YLZ A;  3JCI A;  4ZXE A;  1MQT C;  1NQD A;  2DCY A;  4ZKT B;  1M06 G;  1ZRF A;  1JU3 A;  1U5I A;  2VVF A;  2VEC A;  4RFT 0;  4XAE A;  5FPZ A;  3H1M A;  1YO8 A;  3WLU A;  1AR7 3;  2ZXQ A;  4NPM A;  4XVH A;  3FHQ A;  2FDJ A;  2RS3 2;  3ZR6 A;  3BN6 A;  4QDS A;  3AL5 A;  2VOK A;  1UOB A;  4UI9 L;  4XC9 A;  4ZON A;  5FUI A;  3SLI A;  2XJQ A;  4S2H A;  5DDJ 2;  4E2G A;  3U4X A;  5FXW A;  1MS4 A;  1K5J A;  3AVR A;  1I5Z A;  5LBC A;  2PQQ A;  2XHK A;  1ZZB A;  3ASI A;  2AZ5 A;  3RNS A;  3I3M A;  1R08 2;  2P4E A;  3TBD A;  2VQU A;  3CMG A;  4HXC A;  4CE8 A;  2OUJ A;  2PXJ A;  3M70 A;  2HWC 1;  1GUI A;  4PI0 A;  4RS5 C;  3N4M A;  4I30 A;  3NQH A;  1C5H A;  3AZW A;  2P17 A;  3N9N A;  4MGI E;  2JIJ A;  1VBA 3;  4XXP A;  1SBE A;  5FZ4 A;  5GLZ A;  2HEY F;  3HPN A;  4N53 B;  2ZPX A;  4AAP A;  3WF2 A;  2CGN A;  1RJ7 A;  3N7K A;  4FPK A;  5FMO S;  2BVB A;  1OC1 A;  3ZOI A;  3BTZ A;  2HWF 3;  1PVC 2;  1RUE 1;  4OHW A;  3MHZ A;  2ZTN A;  1QJY 2;  2YXS A;  1AUY A;  2BUK A;  3DYO A;  1HDK A;  3T0A A;  2RDR A;  2GDF A;  2WZR 1;  3KQ4 B;  2NM1 A;  3THC A;  2C1F A;  1RUJ 1;  1Z78 A;  4EN9 B;  1O3S A;  2BDR A;  3EHK A;  1SDD B;  1YYN A;  1RUI 2;  3DKQ A;  2CAU A;  1OI6 A;  3H3Z A;  4LBO A;  2ILM A;  4CDW C;  5CFC B;  1JS9 A;  4C1X A;  4FP2 A;  1LGC A;  3VKO A;  2P3J A;  4CCN A;  1UN1 A;  1LGB A;  2XPJ A;  1GSL A;  4QPW A;  3IAQ A;  1RUC 1;  3H3L A;  4I0A A;  4KWU A;  4A3X A;  4Y20 A;  1GNY A;  3NNM A;  3OBA A;  3VD5 A;  5FR3 A;  5DG2 A;  5HCH A;  1CPN A;  2WII B;  3MGU A;  5G05 L;  1ND3 C;  1A6C A;  1Q8V A;  1UU6 A;  3BOW A;  3MUZ 1;  4NRM A;  4QXH A;  3WV6 A;  2O8Q A;  3N9Q A;  3H8O A;  1ENX A;  1H30 A;  4F3J A;  5C8C C;  1JZ7 A;  3BOP A;  1PZ8 A;  4LNV A;  2WT1 A;  1ULP A;  3LDK A;  5K0U B;  5LBF A;  3MDP A;  4A3Z A;  3D0S A;  1CJD A;  4QQH A;  1RHI 2;  1ZBA 2;  3LSE A;  4MGS A;  4XTM A;  3O1O A;  2VZS A;  2JE8 A;  4EWA A;  3DEM A;  4GZ9 A;  1W39 A;  2D6P A;  4S2D A;  4B4R A;  2WWS A;  2Y6H A;  1QNW A;  4MO3 M;  1OKQ A;  2PHT A;  2WNE A;  2FCU A;  3FN9 A;  3NV2 A;  5LB6 A;  3S6P A;  1PNG A;  5BPX A;  5FPX A;  1WMX A;  1OFN A;  3A7Q A;  5BNN A;  1W6N A;  1ZNP A;  2I2S A;  1AYM 1;  5FYV A;  4ZU4 A;  1IS3 A;  3ILF A;  3MZH A;  1QJF A;  2JEC A;  1NE6 A;  3KV5 A;  1XYN A;  4LO5 B;  5JI9 A;  3VBS C;  2OZJ A;  2XG3 A;  5IK7 A;  5IUQ A;  1G9D A;  3I2G A;  3VLB B;  1W28 A;  4MAD A;  1MQT B;  3LIH A;  1R09 3;  3MYX A;  1H4H A;  2PTM A;  3K77 A;  4M3C A;  4M01 A;  4XUQ A;  1POQ A;  1G8W A;  1LEM A;  1VAK A;  2QTW B;  2OW4 A;  2VUJ A;  3OJB A;  2WYF A;  1QXR A;  1CIW A;  2IVJ A;  2D3P A;  4FXK B;  1E5I A;  4W6Y A;  4AVT A;  5A32 A;  1HJF A;  3J7M A;  1GNH A;  1FXZ A;  4AI1 A;  4Q0S A;  5FZL A;  3DPR A;  5EYY A;  4BJ0 A;  2PLV 2;  1NAE A;  3OPZ A;  2HBU A;  4UBH A;  3AK0 A;  1W6P A;  2VVE A;  4E9K A;  4LHK A;  4UW4 A;  2DVG A;  4XJA A;  3LKJ A;  2ZEZ A;  2Q8C A;  1MEC 1;  1OKO A;  2VZV A;  1ULE A;  3BGA A;  3E5X A;  3U14 A;  4ARY A;  3PNA A;  4JTN A;  4RS5 B;  3K3N A;  4NHK A;  1AJK A;  2Q8D A;  1JXN A;  3UKN A;  1WME A;  3VBF A;  2NQY A;  1ENR A;  1WMF A;  1AR9 2;  1EUT A;  1UY3 A;  2HWD 1;  2I74 A;  5FYH A;  1UXX X;  5KBF A;  4XUR A;  5L73 A;  1WCK A;  4FAH A;  1HB3 A;  3R05 A;  4O9E A;  2CU5 A;  2OX0 A;  2GP5 A;  4MZU A;  1OHF A;  2D6M A;  5KC5 A;  1JYV A;  1FPN 1;  3VZJ A;  4CVU A;  5F3C A;  3PUA A;  1U5X A;  5C9A B;  1CZV A;  2TBV A;  3WG1 A;  4NRQ A;  4PQ9 A;  4OHY A;  4Y5S A;  5FLH A;  3PVB B;  3TN9 2;  5IJR A;  3KHC A;  3U1X A;  5T3N A;  4YNI A;  1PIV 1;  1OA4 A;  5J48 A;  1UY1 A;  3E6B A;  2NP0 A;  5IAT A;  5FMO L;  3QH6 A;  2VBP A;  5JOZ A;  2JG9 C;  3WP6 A;  4HBN A;  1K3I A;  3EQE A;  3N9P A;  3T1L A;  4A4A A;  1WCD J;  3VL8 A;  4ONU A;  2LW8 A;  1PX3 A;  3AJY A;  4GH4 C;  4DOU A;  4TZD A;  2GAL A;  4EYU A;  4JGY C;  5LA9 A;  3A22 A;  3P6B A;  3VBU A;  1TMF 1;  2ORX A;  4RSU A;  1B35 A;  2P6C A;  1O5U A;  3GBW A;  3WG3 A;  3LIG A;  3POJ A;  4AEJ A;  1PMI A;  1W05 A;  2AAC A;  5JUV A;  4I2O A;  5T5O A;  3W5M A;  4B7E A;  2QZ2 A;  3ELN A;  1W6Q A;  2EAL A;  2UY8 A;  4OI4 A;  1HQW A;  3ZYF A;  1PVX A;  1UX7 A;  2VJX A;  1X33 A;  2Q5T A;  4LUM A;  1IOA A;  2Y6L A;  1PZ9 A;  3NJX A;  3T1M A;  5C3S A;  2OQ6 A;  3CJX A;  5FMD A;  2W5F A;  3J7N A;  1UMH A;  1ZRR A;  4KNC A;  2GN7 A;  1EV1 2;  1IS4 A;  1NY7 2;  2XJV A;  2EVX A;  2RHP A;  4LBM A;  4IQP A;  4UFK A;  4CPB A;  2LRO A;  3FJS A;  1JYT A;  4P9L A;  1A8D A;  3LA3 A;  4JC1 A;  4ATE A;  2GME A;  3HT1 A;  4OUS A;  3RRD A;  1QXP A;  5H9Q A;  4AHY A;  2AH2 A;  4FPG A;  4UOJ A;  4Q4W 3;  2EIB A;  2ET1 A;  2XXZ A;  2PHU A;  3LOI A;  4K6B A;  3O0V A;  4ORF A;  5EP9 A;  1H0B A;  4HG6 B;  4E8C A;  4BQ2 A;  3CJI A;  2FBE A;  3FHA A;  3VBS B;  5T5J A;  1O4T A;  1RUF 1;  1RUE 3;  2D6K A;  3OY8 A;  5L7O B;  4FPY A;  5FOB B;  3ZPY A;  3IAP A;  5GLW A;  2VCB A;  2X05 A;  5LRS A;  1T2X A;  3WNP A;  3TNQ A;  3M7A A;  4AFB A;  3D82 A;  1NE4 A;  5F37 A;  1FMD 1;  2EXI A;  1EP0 A;  1UCX A;  2HBT A;  4N43 A;  5IVC A;  1RB8 G;  5I91 A;  4B8E A;  3LPG A;  2JB8 A;  3MO4 A;  4M0N A;  4QGN A;  1RUJ 3;  4LIU A;  1L7R A;  4AFM A;  2Y8K A;  2SLI A;  1VMH A;  4LBK A;  1YCI A;  5A3M A;  3GDB A;  2V4A A;  4UW5 A;  1VE0 A;  3ZXG A;  4XFF A;  4XHB A;  1H8T B;  4Q4V 2;  1BK1 A;  1UU5 A;  5H9P A;  1OH3 A;  4FPH A;  1VBD 1;  2W92 A;  4QU2 A;  1NLQ A;  3ZXF A;  1XC6 A;  2VAU A;  3O12 A;  4J1X A;  2WA4 A;  4QM8 A;  1AYN 1;  3VHR A;  4EN7 B;  1C8M 2;  3I54 A;  3PIG A;  4Q0V A;  4YGE A;  5DUV A;  4AHZ A;  5FWJ A;  4N9H A;  5A7O A;  4JKK A;  4QX2 A;  2J1V A;  1XND A;  2PAM A;  3III A;  3W5N A;  2PAK A;  4QQ2 A;  2Y38 A;  4AWD A;  4JQT A;  4BQX A;  3M8L A;  3RMX A;  4CXY A;  1W99 A;  5KHH A;  5FYY A;  1W0O A;  1ENQ A;  4LO6 B;  4MGZ E;  4E2Q A;  3POW A;  5BNO A;  1JZ3 A;  1LES A;  2QQJ A;  2IXK A;  3A0K A;  3OGR A;  5E88 A;  2QQI A;  2WQ4 A;  1JYI A;  3USU A;  4ISR A;  3D4K A;  3WG2 A;  1JMU B;  2VTX J;  3HQX A;  3OCP A;  3QH7 A;  3THP A;  5JSO A;  1O5L A;  1COV 1;  1A3K A;  2JG9 B;  5FZC A;  1ZRE A;  2XUE A;  4K9S A;  2E51 A;  2Q4S A;  2WNV A;  3AKQ A;  4NE9 A;  2VZ3 A;  2Z2S B;  4XHX A;  5JIA A;  2R07 2;  3SXW A;  4QPG C;  4GH4 B;  4W6W A;  4WM8 B;  4P14 A;  4LA3 A;  2J7M A;  1F4H A;  3PIJ A;  4JGY B;  2Q8O A;  1HRI 3;  5EJ1 B;  5IVJ A;  4CU7 A;  1ACC A;  1LEC A;  2ZEY A;  1OUX A;  2DTY A;  4C1W A;  4FXG B;  4NIA A;  2ZBJ A;  3VDB A;  3ZSE A;  2XJS A;  3K46 A;  3SH4 A;  4DXT A;  4AI8 A;  2JG8 B;  2J1T A;  1C28 A;  2W47 A;  1PK6 A;  1IPK A;  1YQ8 A;  1WCU A;  4D3W A;  4CDX C;  1XE7 A;  2MHF A;  1MZF A;  1V6K A;  5ANN A;  5A3L A;  1MEC 3;  4GIQ A;  4XIK A;  2JKX A;  1E5R A;  3GZT B;  3KV4 A;  2BFU S;  1JOP A;  5LK5 A;  5DAP A;  3RYK A;  1J3R A;  5CNA A;  5DMY A;  1H4G A;  2ARB A;  3ZYH A;  3O1P A;  1QJU 1;  4NHX A;  2XR4 A;  5C8W A;  1CAX A;  4ASK A;  4BIF A;  1ZRD A;  4F8A A;  4XQD A;  1J59 A;  1DGW A;  3FLT A;  1YJL A;  1ZBE 1;  1VBB 3;  4UXA A;  5GLV A;  1AR8 1;  1F9K A;  2HWB 3;  2VOW A;  2RDN A;  3URF A;  2ZCW A;  2OS2 A;  5IVE A;  1IGO A;  4LT5 A;  2DUO A;  1US3 A;  2DUP A;  4YW2 A;  3K4Z A;  2R04 2;  3S0M A;  2WDB A;  1YHF A;  1PGW 2;  3C7F A;  1R1A 2;  3K48 A;  3BU0 A;  5FKC A;  2JDH A;  2B7Y A;  1TZO A;  2JX9 A;  1K5M A;  4Y24 A;  3PME A;  4GJZ A;  2RE9 A;  2TNF A;  1HQL A;  3V0B B;  3ZX7 A;  4MUV A;  5CAD A;  3SKV A;  4XXA A;  5FYB A;  1WBL A;  2TEP A;  3ZKY A;  4XQW A;  1J83 A;  4XEZ A;  4DFS A;  3LFI A;  2CV6 A;  2YV8 A;  4MVT A;  3VBH B;  2QFE A;  1ASJ 2;  2XL7 A;  3UJO A;  4AVV A;  2XVL A;  4FTB A;  1MS5 A;  2XBO 1;  2Z69 A;  3NNF A;  4Y1X A;  2Q8E A;  1TMF 3;  4WBB A;  3J8F 1;  3KZ4 C;  2RDQ A;  4NPL A;  4HFS A;  4M0H A;  4QPI C;  1TNR A;  4JKM A;  3RJ2 X;  2Q1Z B;  3AMQ A;  4QKD A;  2DUQ A;  1H2N A;  1VMF A;  1X9P A;  2ZEX A;  3AP5 A;  3I2H A;  1UOF A;  3SIS A;  3DXU A;  5CB7 A;  5KHG A;  1MZ5 A;  5F6K A;  3MUY 1;  4NN0 A;  4SBV A;  3ZYB A;  2Z79 A;  1BZW A;  5LBE A;  2QVS B;  4TYS A;  2AC1 A;  4EZ4 A;  4AED A;  1Z0H A;  3WNK A;  2MNG A;  3MLJ A;  2G9F A;  3WDW A;  3FFZ A;  1QKQ A;  5DXD A;  4IV1 B;  3ZFG C;  4LE3 A;  5LBB A;  4KWL A;  4XFG A;  2HWC 2;  1W2T A;  2XJR A;  3VHP A;  3FHI B;  4RL7 A;  1APN A;  1UQX A;  5JI7 A;  4ZZ5 A;  4LQR A;  2R06 2;  4N7I A;  3CBN A;  2VBB A;  4FPJ A;  1VBC 1;  4MX3 A;  5D2A A;  5FXV A;  3MPP G;  3THD A;  5JIU A;  2A3Y A;  4QPG B;  5DZE A;  2E7Q A;  2WNU A;  3NAP A;  3WDT A;  2VQT A;  4EZH A;  2Y33 A;  1WMD A;  1BVP 1;  2XON A;  3OBR A;  1N1T A;  4IEU A;  3B02 A;  4O61 A;  5ERL A;  5A6Y A;  1LOD A;  3EJK A;  2ZGO A;  1RYY A;  2E32 A;  2ID4 A;  1Y43 B;  2XUM A;  3LEK A;  4TLG A;  2WS9 2;  3AL6 A;  2WN2 A;  1JOJ A;  4AGV A;  4JTO A;  2ZML A;  1EYB A;  3WUD A;  2RMU 2;  1HRV 2;  2VZ1 A;  4M00 A;  3QCW A;  2VZR A;  3AM2 A;  4QXC A;  4A7Y A;  1I1E A;  1H2K A;  4CUA A;  1RMU 2;  4LR4 A;  2WC2 A;  1ONA A;  4RR3 A;  3OPW A;  2BOI A;  3RQ0 A;  4XZP A;  2ETE A;  3N7L A;  4AI0 A;  4UFH A;  2L9L A;  1RUC 2;  2TUN A;  4AK3 A;  4CCL A;  4BHP A;  5A6Q A;  3UES A;  1UMZ A;  5FP4 A;  1HIX A;  1UIJ A;  5LCW L;  2PQS A;  5D8A A;  3T2Q A;  1NLR A;  3ZDS A;  1J1T A;  2MEV 3;  2ZGL A;  1ODM A;  2CY6 A;  1ODN A;  4R4X A;  5AFB A;  4PLO A;  4CP9 B;  1WUV A;  4OI1 A;  3VZL A;  4FTE A;  3FFQ A;  2GC3 A;  1NCQ A;  1YI7 A;  1ZX5 A;  3WQ0 A;  3B7M A;  3LCP A;  3WW4 A;  4Y1Z A;  1AR7 1;  3VDD A;  4JKL A;  4QQL A;  3PMS A;  1GWL A;  1STM A;  2GSY A;  3KLS A;  4MGQ A;  2ZX3 A;  3CLP A;  3VZM A;  4AHX A;  3T4V A;  1UPS A;  4IXL A;  4X8N A;  1DG6 A;  5IVB A;  5FO7 B;  4ASM B;  1KDK A;  2A75 A;  4TLF A;  1G9A A;  3NMB A;  4NAM A;  1VBE 3;  3K2O A;  1OLM E;  1LAJ A;  2BOJ A;  1SLB A;  5LWB A;  3PDQ A;  1O4Y A;  2CGO A;  3IB3 A;  4L99 A;  3ZYG A;  1EAH 1;  2IFW A;  3I97 A;  5FY7 A;  4Y4R A;  5A3O A;  3H50 A;  2JB4 A;  5F5C A;  4N7U A;  1JZ5 A;  2GN3 A;  2HWE 2;  4P5Y A;  1AX1 A;  2VC9 A;  1CX4 A;  2B9V A;  4OZO A;  3VKM A;  3WHU A;  1VBA 1;  1YQ5 A;  1LOF A;  1W8H A;  1L7L A;  5A3P A;  2QCS B;  2C24 A;  1UY4 A;  5C6C A;  1CZT A;  2RM2 2;  1BBT 1;  2ZA9 A;  2D5H A;  2QQN A;  4QPI B;  4U36 A;  5DDJ 3;  1WW5 A;  4Q1R A;  2ZX0 A;  4LBJ A;  2HWF 1;  1WW4 A;  4LBQ D;  1NA1 A;  4MXW A;  4WVM B;  4AW7 A;  1O3T A;  5FQ0 B;  1YFX A;  5HCB A;  3VBO C;  1R08 3;  2PYT A;  2Y6J A;  3AYD A;  5FY0 A;  3WNM A;  3FC0 A;  1LR5 A;  3DYM A;  4EJR A;  1W3X A;  4YG0 A;  1Q56 A;  4CRQ A;  1GQP A;  1W8O A;  2KXL A;  2NYY A;  2IXH A;  1I5P A;  1QQP 2;  2DTW A;  4CU6 A;  1JYC A;  2YB7 A;  3K4A A;  4Y5T A;  5FYS A;  4BB3 A;  1F8V A;  1RL3 A;  5CKQ A;  4IES A;  5EWS A;  3ZFG B;  3ZPO A;  3DGT A;  3PHM A;  1CGP A;  4A2U A;  1QJU 3;  4IUG A;  3MF9 A;  1ST8 A;  4LHN A;  1PVC 3;  2C0Z A;  2F6B A;  2Q1M A;  2WAO A;  2Y0I A;  2ZZQ A;  3MF6 A;  3CDZ B;  1VP6 A;  4KU7 A;  5FZ6 A;  3OB8 A;  3T08 A;  1V00 A;  1ZBE 3;  1QJY 3;  2XLF A;  3HR9 A;  1AR8 3;  4A41 A;  4DUV A;  5D1I A;  3AYA A;  2JDM A;  1LCL A;  1Y9G A;  1CPM A;  4OHZ A;  4AQT A;  4D69 A;  4CUC A;  4KWJ A;  1AR6 2;  1US2 A;  4L9B A;  2IZW A;  3ALQ A;  4AQ2 A;  1FOD 2;  2C26 A;  1RUI 3;  4HAN A;  1UX6 A;  2P34 A;  2W87 A;  2XH6 A;  2XJU A;  5BV6 A;  5C33 A;  2RVA A;  3ZN6 A;  4OUE A;  2VE1 A;  1FT9 A;  1RUH 2;  5KXD A;  4YSF A;  1RUD 2;  4X6Q B;  2DDU A;  2X8K A;  4YVW C;  4DXZ A;  4PDW B;  4PJY A;  1W8Z A;  5GZE A;  3GAL A;  2WSU A;  3SMH A;  5E8A A;  2XBO 3;  3X29 B;  4N53 C;  2IVI B;  3VL9 A;  5F9T A;  5GZC A;  3PVO A;  5L9V A;  5BNQ A;  3H8U A;  1W0P A;  1RUN A;  1R09 1;  3FX3 A;  1ZBA 3;  3ZM8 A;  1KJR A;  3OGG A;  5JXI A;  2P3I A;  2DV9 A;  1NXD 1;  2WT0 A;  1NQJ A;  3E1F 1;  4OMD A;  3JXS A;  1DYK A;  4R52 A;  1RXF A;  3VBR A;  2H0B A;  5FPA A;  3WNN A;  2FCT A;  3BB6 A;  1GV9 A;  2QUO A;  5C3P A;  2DYC A;  3IMN A;  5K8S A;  5EIY B;  2BYV E;  3KV6 A;  4ES8 A;  1QY4 A;  4WM7 A;  5DUX A;  4NII A;  5C4W C;  3LAG A;  1WD3 A;  4TN7 A;  5J3U A;  3B9C A;  5CFC C;  4CEW B;  1TME 2;  3SCH A;  5J98 B;  1QOT A;  3RI9 A;  4Z8B A;  3ZXK A;  1UU4 A;  4Y1Y A;  1RED A;  2X5I C;  2Y6G A;  1VBC 3;  3VD9 A;  4XIO A;  2D3S A;  3IT8 A;  4FFG A;  4JVA A;  5FK7 A;  3WP4 A;  3ZKU A;  3FBY A;  3FZ3 A;  1O3Q A;  1SLI A;  5GLU A;  2VW1 A;  1W6M A;  4BYY A;  2VUL A;  1Y4W A;  2XDV A;  2RS1 2;  3ACL A;  4SLI A;  3BTX A;  4XCA A;  4XF9 A;  2P1B A;  3NNG A;  3VD7 A;  4LMF A;  1G6N A;  1LU2 A;  5C3R A;  1OXC A;  4GB3 2;  4LOS A;  3OGV A;  3VHO A;  4RN5 A;  3ZMO A;  1WWY A;  4CP2 A;  5K0U C;  2P6H A;  3AYC A;  4ZHN A;  1AXK A;  5CG9 A;  3PUI A;  3OF1 A;  4N9I A;  3I2K A;  3ZSK A;  2LM3 A;  3P1I A;  3ZFF A;  1H9W A;  4YW5 A;  4L92 A;  1SLL A;  3VBO B;  5C3O A;  4Q4Y 2;  3HWJ A;  3V64 A;  2DBN A;  1RVF 2;  1RUG 1;  1ALY A;  4LO4 B;  4G9S B;  5I0U A;  1QH6 A;  2BBA A;  4KGQ A;  1OPM A;  4RS5 A;  2YFU A;  5LRR A;  1JYW A;  4QHB A;  1AR9 3;  2W0X A;  2IXI A;  2C4X A;  1ULD A;  2ZHL A;  2JD4 A;  1FV3 A;  1UKG A;  5G04 L;  3MW4 A;  2YZ4 A;  4Y3O A;  5FK8 A;  5GKA C;  3WR0 A;  4BLJ A;  2PHR A;  1CX1 A;  5LAT A;  3PLQ A;  1QJX 3;  2QDN A;  3M3I A;  5FV3 A;  1CAW B;  4KG8 A;  4QDQ A;  3OUJ A;  5F2S A;  5IW0 A;  4PCR A;  4BQ5 A;  5FOJ B;  2VUA A;  3LA7 A;  4D8M A;  1MS3 A;  3TN9 3;  4CCM A;  3T2P A;  1GP5 A;  1V6I A;  5SV5 A;  3RYR A;  5I8Y A;  2WFP A;  5JZG A;  1C5I A;  2G9G A;  1BQP A;  2UYB A;  5C7G A;  4H3W A;  2WO1 A;  5FPV A;  1W9F A;  4UWD A;  1W6O B;  3KT7 A;  1W8U A;  3MBW A;  4CDW A;  5A1L A;  2B9U A;  1YI9 A;  1XJA A;  1WZX A;  3VB9 A;  1JOD A;  1BEV 2;  1D4V B;  4K21 A;  3BUC A;  1EAH 3;  2YU1 A;  3J4U H;  3ZSL A;  2W68 A;  4GWI A;  4YVW B;  4Q0Q A;  2K46 A;  1WD4 A;  4HT1 T;  2RJ2 A;  3U0Z A;  4C90 A;  2VZO A;  1VAV A;  1F35 A;  3IPV A;  4Z07 A;  4UW6 A;  2ET7 A;  3D3A A;  4K20 A;  1SBF A;  5FUN A;  4IEP A;  3U10 A;  3TB0 A;  3R4U A;  5FYU A;  4YZ1 A;  1ND3 A;  1HLC A;  4Q4W 1;  2DUR A;  4XDO A;  3USS A;  4AEM A;  2Y6K A;  1BLZ A;  2VUC A;  5JR7 B;  1BBT 3;  1DGW X;  4FQ4 A;  4QX1 A;  4WVW A;  4QQO A;  4XBQ A;  3VN4 A;  1CJP A;  5C8C A;  1RXG A;  3GM8 A;  3N7M A;  2VMI A;  4QB1 A;  5F8P A;  5JXG A;  5C9A C;  5CKN A;  4R4Z A;  2WO3 A;  4X8P A;  1EV1 3;  1ULF A;  2DCZ A;  3A4U A;  3ITQ A;  4BQY A;  3BTY A;  4YG6 A;  5KHK A;  4JGZ A;  3VUO A;  5IK8 A;  5GZG A;  2ZX1 A;  1V9U 2;  2B46 X;  3LF7 A;  3ZXE A;  3NKG A;  5C4W B;  2VCC A;  4O65 A;  4H7L A;  2D5F A;  4AHW A;  3I2F A;  3I59 A;  1NCR A;  1HXS 1;  1TE1 B;  4GMP 1;  2ZKL A;  1BHG A;  2IXL A;  3SH3 A;  3N7J A;  4MV2 A;  2X5I B;  4DS0 A;  3VBS A;  4BLI A;  4CPB D;  1A8M A;  4XW3 A;  5I8T A;  3KQR A;  2C9K A;  4AVS A;  3MW3 A;  4NWW A;  3ZFE A;  1JZ8 A;  5AC9 2;  3V0A B;  5C3Q A;  4YW4 A;  2BWA A;  2WFF 1;  4AI2 A;  1F2N A;  1HX6 A;  4FFH A;  4CP1 A;  1KGY A;  1PO1 1;  5KWR A;  2YU2 A;  2Z42 A;  3AJZ A;  1YEW A;  5CVR A;  4EE2 A;  1PGL 2;  4R9A A;  3MLL A;  4OZX A;  4E4S A;  4PBO A;  4B4Q A;  1ZRI A;  4K3U A;  5BXX A;  2WWU A;  4Q4V 3;  1VIW B;  3ST7 A;  5FZ3 A;  3LDR A;  4DMI A;  4AQ6 A;  4QB6 A;  2XJP A;  5F39 A;  1W3V A;  1PM4 A;  2O8O A;  3IM0 A;  3QD6 A;  3IDE A;  4MLO A;  3HEI A;  3JZV A;  4XF3 A;  4A42 A;  2NMO A;  3H7J A;  1IG3 A;  2XJT A;  3AC0 A;  3PJY A;  2Y34 A;  2GC1 A;  4HON A;  1JUH A;  1LJ7 A;  3J8F 2;  3H42 B;  1SAC A;  4H14 A;  4TSV A;  1XE8 A;  3ENR A;  4COW A;  1X8M A;  3UET A;  2VG9 A;  3JU9 A;  5A3W A;  1HRI 1;  5L7O C;  1SFN A;  4XFB A;  3LWC A;  3VBH A;  2XKP A;  5JOW A;  1LTE A;  3S7I A;  3KB5 A;  4COU A;  5J1X A;  4CP0 A;  3O1T A;  2DVA A;  2WAB A;  4ES9 A;  3ZN4 A;  4KMQ A;  3KVB A;  3T2O A;  1FYU A;  1NUK A;  3OSD A;  4XF4 A;  3O1V A;  4Y22 A;  4YZ2 A;  3DV8 A;  5IFT A;  3OD4 A;  1OLQ A;  3T09 A;  1J3Q A;  2RV9 A;  1OQD A;  1SHW B;  4CYD A;  3LOB A;  5B2G B;  1KDM A;  3T0B A;  4XJZ A;  4LLO A;  5LEK A;  1H8T C;  1SPP B;  2YFZ A;  3I2I A;  4MHR A;  3UNP A;  1Q8S A;  3E97 A;  2GH8 A;  4JHZ A;  3WCS A;  2YPJ A;  4CXW A;  5CIR A;  5JLV A;  5A6X A;  3MID A;  3P3P A;  2OPW A;  1VRH 2;  2R0H A;  1XBF A;  3RZM A;  4IE6 A;  1UZV A;  1FNY A;  2W94 A;  3ZO0 B;  1DYP A;  2FDH A;  1OLM A;  2W08 A;  1ZVF A;  2VZQ A;  3OUI A;  1VBB 1;  4BIO A;  2HWB 1;  3OEA A;  5CKM A;  1K42 A;  4P08 A;  4URA A;  2E7T A;  3JUU A;  5A33 A;  3H7Y A;  1YFU A;  1WLT A;  2BNM A;  2EAA A;  4LHL A;  2LUW A;  3WOG A;  2J22 A;  1UZW A;  2ARA A;  2RR1 2;  3OYW B;  4XBL A;  4HN1 A;  4AVB A;  3JBG 1;  4FPL A;  4W4Z A;  4Q26 A;  1PNF A;  2YHJ A;  3PUS A;  4K1Z A;  5HV4 A;  2OA2 A;  4IEZ A;  1XPW A;  1RUG 3;  5IWF A;  3KHB A;  1YRZ A;  2GAU A;  1GZW B;  2VW2 A;  5BNN C;  4BXS V;  1MS9 A;  5T52 A;  5E6H A;  3PVN A;  4QHZ A;  2E33 A;  4XFH A;  1GYK A;  1MS0 A;  1LEN A;  1XRU A;  3BTA A;  3WW2 A;  2EA7 A;  4LBQ B;  4LOR A;  3WXP A;  2BJS A;  3FL7 A;  5JSR A;  2VMG A;  3E6D A;  2LS6 A;  4WM8 C;  2FCV A;  2XWB B;  1Z7S 1;  2OT7 A;  5L19 A;  2R04 3;  5E16 A;  5JAX A;  3RFR A;  5KXC A;  2EIC A;  4FTS A;  4RHV 2;  1Q8P A;  4NR1 A;  1D4M 1;  3S7E A;  3RZK A;  2IFR A;  4HOO A;  4MGK E;  1PX4 A;  4Q4X 3;  3DPR C;  4KGG A;  3F95 A;  2JG8 C;  3KCX A;  2R32 A;  2WZP P;  5HPO A;  2YDE A;  3HVD A;  1BMV 2;  2JDP A;  4HVR A;  2VQA A;  3JD7 2;  2R16 A;  3V0B A;  4FFI A;  2ES3 A;  2WWJ A;  2WAA A;  1NT0 A;  1W06 A;  1N47 A;  1ASJ 3;  2W9X A;  1AL2 2;  4FVV A;  1PO2 2;  3WD5 A;  4CEY C;  1R1Z A;  2QJV A;  3POG A;  5CA6 A;  1OMI A;  2YGL A;  3IBM A;  4XAB A;  3TAY A;  2PHF A;  3WQ1 A;  3GZE A;  3D8C A;  5FZ9 A;  3TRS B;  2D6N A;  3LE0 A;  3SEE A;  1FV2 A;  2DFC A;  2CDO A;  1DQ4 A;  2A70 A;  4JCK A;  2GMP A;  3MIF A;  2WSV A;  3ZN5 A;  4GUL A;  3ZXL A;  4QDR A;  1ND2 C;  2B4K A;  1AX0 A;  5FZI A;  3KT4 A;  1LOG A;  2PHD A;  1UXZ A;  5H9R A;  4MG2 A;  1C4R A;  1G7Y A;  3DXT A;  1VAM A;  2J1U A;  2VZT A;  4JZR A;  3I3B A;  3TEY A;  1GOG A;  1DQ5 A;  1UOG A;  1F5F A;  3RGB A;  3WG4 A;  5ACA 2;  2FDK A;  1JW6 A;  3UYJ A;  1YC6 1;  1LOE A;  2V09 A;  2VU9 A;  4YFW A;  1UZZ A;  5FZ7 A;  4BIS A;  4GD4 A;  1AVB A;  4XUP A;  4UF0 B;  1AZD A;  5FO8 B;  2DWR A;  1OD5 A;  1CZS A;  2QZ3 A;  4GMP 3;  1HXS 3;  2A3X A;  5C71 A;  4AFA A;  5GJ6 A;  4NPR A;  4Y20 B;  2B39 A;  2PHW A;  1WLW A;  1W9Y A;  4ZZ8 A;  4D0Q A;  3VBU C;  4UBG A;  3WNX A;  1XSR A;  1G86 A;  1YNA A;  2WZ8 A;  5C5T A;  1LHO A;  3AMP A;  3N9L A;  5T54 A;  5FY1 A;  4CCK A;  5T50 A;  3MIB A;  2VM9 A;  2H0V A;  5ABJ C;  1ZYB A;  2HEW F;  2MEV 1;  2OII A;  2YYO A;  3AMM A;  3EYP A;  5A7N A;  1KS5 A;  2WS9 3;  5DAQ A;  2BV4 A;  2WFF 3;  3U75 A;  3O14 A;  1D0H A;  3RZL A;  4TWT A;  4GJY A;  4XOG A;  1SFY A;  1PO1 3;  1HRV 3;  1YUD A;  2BTV C;  4LKF A;  2IXC A;  2YGM A;  3LDB A;  3CNA A;  1RMU 3;  3QAC A;  1YQC A;  1XB9 A;  2VQ0 A;  3JQW A;  4QAW A;  4CDX A;  4DRR A;  3BIE A;  5FZH A;  1O7F A;  5FZG A;  3DCQ A;  4IV1 C;  4P9X A;  2HLE A;  1XYP A;  1VBE 1;  2K0G A;  2RS5 2;  2VOT A;  1DLC A;  3AKR A;  2ZAB A;  3CQO A;  2GNB A;  3HIF A;  5BNN B;  2N7G A;  4YWA A;  2OZ6 A;  1LED A;  3K4D A;  1UPI A;  4UW3 A;  5C70 A;  4NO4 A;  2CGP A;  4CP9 A;  4L97 A;  1F5J A;  4ZY9 A;  3AP9 A;  1XOY A;  3JB4 C;  3B94 A;  4M3C B;  3PJQ A;  3SC7 X;  3M3C A;  1S0G A;  1OD3 A;  2FDF A;  2VR4 A;  3MFA A;  1CAV A;  1AX2 A;  4W6X A;  5DDJ 1;  4M3C E;  5A32 B;  4Q29 A;  4R8H A;  3DPR B;  1XYO A;  3POE A;  5FMC A;  3CU7 A;  4AG4 A;  5HCA A;  2ZGS A;  1R08 1;  5C5U A;  1POV 1;  1YLL A;  1QH7 A;  1UY0 A;  3QBQ A;  4FO9 A;  5FZO A;  1D7P M;  1UY2 A;  2XGX A;  2BWC A;  2HWE 3;  5EHD A;  1IKQ A;  2JDZ A;  1SLC A;  2GC0 A;  5FAX A;  4HMZ A;  1OQ1 A;  2WQZ C;  4CEY B;  2X29 A;  2HEV F;  4C8D A;  1O6U A;  2YBK A;  3WP3 A;  3VBF B;  5LY2 A;  5A7W B;  2RM2 3;  2FZ2 A;  4JRA A;  5DAB A;  3TOJ A;  1BVV A;  1SZB A;  1AXY A;  1LRH A;  1PVC 1;  3KM5 A;  4J1W A;  4QPI A;  4RQP C;  4K7J A;  2FD8 A;  2VXJ A;  1QJY 1;  4JX0 A;  1VB2 A;  2ZS6 B;  4NUB A;  4WVM A;  4Y33 A;  1DQ6 A;  3WF3 A;  1FX5 A;  4FBF A;  5F7U A;  3M2M A;  2F4P A;  3RSJ A;  1ND2 B;  2VCA A;  3J26 N;  2YBP A;  1D0G A;  1QQP 3;  1URX A;  4C91 A;  4LHS A;  3JBG 3;  4YGB A;  4G4F A;  3HAG A;  1RUI 1;  2JWP A;  3ON7 A;  1NOV A;  1W8T A;  2Q30 A;  1HQN A;  2DVB A;  1EY2 A;  3ZFG A;  3C8X A;  3HBZ A;  2YPD A;  4LTA A;  1XSQ A;  2DU0 A;  5JDB A;  3OBT A;  3AP6 A;  5BUV A;  2CDP A;  2Y6F A;  3H0O A;  1UO9 A;  1CAU A;  4TTG A;  2A6W A;  4XE9 A;  5JR2 A;  4IGQ A;  5T5P A;  3VBU B;  1Z7S 3;  2D98 A;  1B35 B;  2NLR A;  1QF3 A;  2JEN A;  4BE3 A;  1AXZ A;  4BXF A;  1FOD 3;  4BQ4 A;  3H8R A;  1D4M 3;  3FUQ A;  2G19 A;  3IDC B;  1RIR A;  3LZZ A;  5BNP A;  5ABJ B;  1JZ2 A;  1UYZ A;  2WLQ A;  4PIZ A;  4JDN A;  1Y9M A;  1PK6 C;  3U07 A;  1O3R A;  1RHI 1;  4L2N A;  1ZBA 1;  2W95 A;  2GU9 A;  3I2D A;  3LEI A;  2JDU A;  5FP8 A;  1JUI A;  5IK4 A;  1NXM A;  1XNK A;  4HK8 A;  5FJK A;  5F3E A;  1A78 A;  1L3J A;  3GCX A;  2G4I A;  1LHU A;  4JHT A;  2OQ7 A;  2W3J A;  2D6L X;  1SG3 A;  3AMH A;  5CBL A;  4OUM A;  4HPK A;  5A70 A;  3MV1 1;  4QT6 A;  2VVD A;  3D6E A;  3MIG A;  1ZZ8 A;  4GWN A;  4LO7 A;  2E63 A;  1S4C A;  1H1I A;  4EN8 B;  4MOA A;  4IW3 A;  2E31 A;  4YVS A;  3J7L A;  1FNZ A;  3TYJ A;  4QXK A;  2WBK A;  3Q8A A;  2E26 A;  3TWI A;  2CYF A;  3OY8 B;  2KD7 A;  5IAV A;  3HNY M;  2FQP A;  1TG7 A;  4JAA A;  1RUE 2;  4GAZ A;  4IE0 A;  4MYE A;  3W59 A;  3N3H A;  3ES1 A;  4IV3 A;  1LOC A;  2FDG A;  2WZE A;  4D6Q A;  4N43 B;  1SCS A;  2VGD A;  2GH2 A;  4XUO A;  1E5H A;  1QJE A;  4AAX A;  4E27 A;  3TEW A;  2E7A A;  3WIN E;  4IND A;  2WZR 2;  1N1S A;  2W1W A;  1W90 A;  2V5Y A;  1KJL A;  4NOT A;  2CAV A;  3A23 A;  1RUJ 2;  1DU3 D;  4YG3 A;  2W1U A;  3ETQ A;  5FBZ A;  3I4I A;  2XWJ B;  4PIX A;  1KRI A;  5F2W A;  1JOB A;  2ZX2 A;  1S2B A;  2VNR A;  2WIN B;  3B3Q E;  3KWV A;  1KIT A;  4PDW C;  5FYZ A;  4CDU C;  1FI2 A;  2QBX A;  2ZGR A;  1BCX A;  5LEJ A;  3IIA A;  3O1M A;  3ZYJ B;  3MIC A;  2RS1 3;  1AR9 1;  1OOP A;  2OUH A;  2W46 A;  2EF6 A;  4U2A A;  3AX4 A;  4FT8 A;  1LGN A;  1Q8Q A;  4ZS2 A;  4GB3 3;  3NVC A;  1H1M A;  3MEP A;  3WQB A;  1NKG A;  1QJX 1;  3RZJ A;  3U78 A;  4RQP B;  1X9T A;  1YQ2 A;  4IE5 A;  4XCB A;  1GZT A;  2O14 A;  5CFD A;  1X50 A;  1LNS A;  5FCC A;  2ENR A;  4AGR A;  1HB4 A;  4KH9 A;  3TN9 1;  4BQ1 A;  1LHN A;  2BFU L;  3AZX A;  5BNO B;  4BQ3 A;  2AEN A;  1X82 A;  1QDO A;  4CXX A;  2VPV A;  4Q2F A;  1GWM A;  1ZZC A;  4FP3 A;  4F7Z A;  2QE3 A;  4BM8 A;  4CEW C;  1OA2 A;  3UL2 A;  4BWO A;  1QOO A;  4JDO A;  2BNO A;  1ENS A;  2WNV B;  3HMY A;  1H2M A;  3MI8 A;  2QQL A;  4COY A;  1AYM 2;  1UYX A;  1SQ4 A;  2BEO A;  2WNU C;  5FZ0 A;  4CSW A;  2QNK A;  4ZXK A;  4COZ A;  3ZXJ A;  5FPU A;  2ERF A;  2VZP A;  2V72 A;  4B4P A;  1OF4 A;  1OT5 A;  3OGS A;  2RS3 3;  2LTN A;  2VXR A;  2ATF A;  3OD0 A;  3VGI A;  3ACF A;  1IPS A;  4PBP A;  2PHL A;  4CCD A;  1HKD A;  3VD4 A;  3O1R A;  2D93 A;  1IS5 A;  5FZB A;  5FZ8 A;  3OTF A;  2CWS A;  1IKP A;  1PK6 B;  2JEM A;  2BPA 2;  3ZYR A;  4E4Z A;  5I0D A;  2B8M A;  1BEV 3;  1POV 3;  2YBS A;  3NKT A;  3POI A;  3B69 A;  4YW3 A;  4EN6 B;  1EV1 1;  1NY7 1;  1OH4 A;  1NG0 A;  4YZ5 A;  3FLP A;  4IEV A;  4BA6 A;  4XAC A;  2A5Z A;  3H9A A;  3WVJ A;  5CG8 A;  3I2J A;  5M0T A;  1MEC 2;  3I3D A;  4ZU7 A;  1Y7B A;  2ZHM A;  1DQ0 A;  4HET A;  4XYX A;  5D8A C;  3SEP A;  2K9Z A;  1KS4 A;  5K7P A;  4URT A;  4IE4 A;  2E53 A;  4Q8L A;  1CAX B;  3OOX A;  3RI8 A;  4N53 A;  1S0B A;  3DL3 A;  1GQG A;  5F6L B;  1JN2 P;  3KGZ A;  1YFY A;  1NCQ C;  1D2Q A;  1BJQ A;  2HWD 2;  3AZY A;  3VZN A;  3WNO A;  4P5H A;  4IGO A;  4ZU5 A;  3VDD C;  4C0B A;  1QJZ A;  4YAR A;  3NL1 A;  4DUW A;  1FPN 2;  1DBN A;  1R64 A;  1UF2 C;  2BU9 A;  3HNM A;  3LFM A;  1V9U 3;  1BK0 A;  4WV8 A;  4XFC A;  3BCW A;  2ZGT A;  4H7M A;  3C3V A;  3PL0 A;  4MH0 E;  5C4W A;  1PIV 2;  1QXJ A;  2JJ6 A;  3ZXD A;  4EWE A;  2VTF A;  1S0I A;  5CFC A;  3T3Y A;  4Q0U A;  4LLF A;  1H1A A;  3VHN A;  4Q4V 1;  1W2N A;  3FBM A;  2WQ8 A;  4MGY E;  1JHJ A;  4LIT A;  5I8S A;  3NJZ A;  4OMC A;  4CDU B;  4E4D X;  1HN1 A;  3PTR B;  3T30 A;  3V56 A;  1LOF C;  3GGL A;  5F1R A;  3V0A A;  1MR5 A;  2R49 A;  3GZA A;  1C8M 1;  2EID A;  3ECQ A;  5D21 A;  1I6X A;  2H6C A;  1TMF 2;  3POS A;  4XDQ A;  3BAL A;  3LB9 A;  5JPN B;  1KEX A;  5IVF A;  1TEI A;  3ME2 A;  5JWP A;  4D7T A;  2BRT A;  1RHI 3;  4DO0 A;  1X36 A;  5K0U A;  2QKD A;  3O1S A;  3KMH A;  2YG0 A;  2OPK A;  4XJ9 A;  5FZK A;  3RS6 A;  4AED B;  3N9M A;  4V2W A;  5LZ6 A;  5J37 A;  4DRV A;  2NMN A;  2AUY A;  3S57 A;  5FFO C;  4GKX A;  3BYW A;  4P9W A;  1QIQ A;  2D3R A;  2F4L A;  2KM2 A;  2XL9 A;  3LA2 A;  2EAK A;  4DPN A;  2QQK A;  2R07 1;  1JYN A;  4XZU G;  1ZZ9 A;  2VOV A;  1YFW A;  2BGP A;  5A3U A;  4WVZ A;  1W8F A;  5L9B A;  4ITC A;  3WW3 A;  4XAA A;  1WGP A;  3B9I A;  2WNU B;  3DEC A;  1MQT A;  3ACG A;  3SH5 A;  3W9A A;  4LKD A;  3GCW A;  3HT2 A;  1RUF 2;  5F5I A;  4OI0 A;  3ZR5 A;  2FHR A;  4L8Q A;  4UFJ A;  4D6R A;  2BVV A;  2PLV 3;  2WN3 A;  5EZW A;  4KBZ A;  3ILR A;  3I3E A;  3HQR A;  3SIT A;  1FMD 2;  1GP6 A;  4JRL A;  4QKN A;  1Q3E A;  1EPZ A;  1MS8 A;  1V6M A;  2J1E A;  3E6C C;  2ZGK A;  1PMJ X;  4OCT A;  4RR3 B;  3HNB M;  3EO6 A;  2X10 A;  3ZMN A;  1A34 A;  1CVN A;  2LAL A;  5FZD A;  1DFQ A;  1GZC A;  2FMY A;  3AXD A;  5JVV A;  1VRH 3;  3UKT A;  1WLD A;  1E57 A;  2A1X A;  4IGP A;  2R0F A;  2BGC A;  4AOC A;  4BQW A;  3OUH A;  2OXB A;  3LQC A;  5D8A B;  2ADD A;  3BVC A;  3EXU A;  4QX5 A;  4DUX A;  1VBD 2;  3AVS A;  3BI3 A;  2W1Q A;  3BOD A;  2GND A;  1D2S A;  1UZ0 A;  1S0E A;  4I01 A;  3HOB A;  2BGO A;  5A7S A;  1GWK A;  5FZA A;  4K40 A;  4QX7 A;  2BQP A;  1AYN 2;  1DLL A;  1NCQ B;  2PN5 A;  3WX5 A;  1ZRC A;  2RR1 3;  2R04 1;  5DUW A;  3I2O A;  5I0T A;  3VDD B;  1PGW 1;  3N35 A;  1R1A 1;  4UT5 A;  3OYW A;  4XIL A;  5C9A A;  4DEQ A;  4Q4X 1;  1OBN A;  4WM7 C;  3WY6 A;  3R4S A;  4LBL A;  5B4N A;  3NV4 A;  1JH5 A;  1T6B X;  3CL1 A;  4EV0 A;  1W2A X;  3A0N A;  5FZM A;  3WUC A;  3IZO A;  3VKL A;  3VDA A;  4DZG A;  3KCC A;  5KR7 A;  3UKV A;  4I09 A;  4FPF A;  2D40 A;  4XUT A;  3M3O A;  4COV A;  1MPX A;  5FO9 B;  1ASJ 1;  3EBR A;  1COV 2;  1U5Y A;  4W8J A;  2ZGU A;  3B93 A;  3AB0 A;  3AKS A;  4QXB A;  3VKN A;  4S2F A;  5JMC A;  3D5O A;  4QWN A;  4QX3 A;  4RHV 3;  4UYB A;  5L36 A;  1RGS A;  1UIK A;  3NV1 A;  5DN2 A;  1XNC A;  2PEL A;  5LA0 A;  4MXW B;  4W65 A;  1NA1 B;  3WW1 A;  4D7S A;  4DB5 A;  3JD7 3;  4CCO A;  5A3T A;  5J36 A;  3AP4 A;  3ZFF C;  1GU3 A;  4WZC A;  2R30 A;  2ZAC A;  5HCF A;  2A6Y A;  4IEY A;  4Z92 B;  5HV0 A;  1AL2 3;  4AXO A;  1GP4 A;  2D97 A;  1PO2 3;  4LJH A;  5A80 A;  2P5B A;  3WF1 A;  2YRO A;  1XQN A;  1HJG A;  3J7H A;  4FCA A;  3TEZ A;  2J42 A;  4GA9 A;  2VMC A;  5GM0 A;  4D94 A;  5EQU A;  4BMB A;  4V2V A;  2R06 1;  4FOW A;  3CO2 A;  5FY8 A;  5EJ3 A;  1O59 A;  4BH9 A;  2WA3 A;  1GKB A;  1QJU 2;  4ZS3 A;  4CDQ B;  4PLN A;  3DYP A;  4IER A;  4CTE A;  5FYM A;  3GBG A;  1DQ1 A;  3AKT A;  2ZX4 A;  1ZBE 2;  3ROU A;  1AR8 2;  4GKY A;  1QWR A;  4QD2 A;  5L7O A;  2ZGN A;  1CR7 A;  1W8N A;  2DCT A;  3VKF C;  5JZG C;  1P8J A;  5FUP A;  5ACA 3;  4NWV A;  2WS9 1;  4R9D A;  4TXW A;  4YZ3 A;  5EYX A;  2GZW A;  2A6Z A;  4PF5 A;  2VUD A;  4MSV A;  2RMU 1;  1DGL A;  1HRV 1;  1DGR A;  4QQP A;  3ZN6 B;  2NN8 A;  1RMU 1;  5F32 A;  4AGG A;  5B4X A;  4UF0 A;  5I0R A;  3Q9O A;  2SBA A;  4GXL A;  3HD8 B;  5A7P A;  5DZG A;  4BOW A;  4HSJ A;  4NHM A;  5JMO A;  4CU9 A;  1H8T A;  1ZM1 A;  1J84 A;  3VZO A;  2UWB A;  4D6S A;  1XNB A;  2ZGP A;  2VBD A;  1JI6 A;  1WA6 X;  1OFS A;  1ZA4 A;  2QDR A;  3H3U A;  4IET A;  2BP6 A;  5DZF A;  1OQE A;  5CAZ A;  1V70 A;  2Y64 A;  2XBO 2;  4DXR A;  3UV9 A;  3ABZ A;  5LA2 A;  1C8M 3;  1OA3 A;  2HYK A;  5JPM B;  4LPL A;  2QQO A;  4Q8K A;  5DAW A;  4DIQ A;  4NMI A;  3NO8 A;  1YQ6 A;  3U4S A;  4V1P A;  1OVS A;  1U12 A;  5FMB A;  3GNE A;  4PT6 A;  1AJO A;  1IS6 A;  1GBG A;  2WO2 A;  4BZ4 A;  4OUL A;  4HVQ A;  3HBK A;  4JGZ C;  5GZF A;  3VBR B;  4JV4 A;  3DN7 A;  2WUH A;  2QQU A;  2RS5 3;  3BPS A;  2WL1 A;  4NHY A;  4WM7 B;  3SHR A;  3DKW A;  4KWK A;  5SV8 A;  1S2E A;  4QB2 A;  5GZD A;  1NZC A;  1NCR C;  3DF0 A;  3NJV A;  4B7K A;  3FMG A;  5BY5 A;  2D6O X;  1N3P A;  1UD1 A;  3C7E A;  4FPO B;  1DIW A;  2JG9 A;  4OHV A;  4AYU A;  1W0N A;  2R07 3;  1RUO A;  2DVF A;  1GOH A;  5KC6 A;  2HWE 1;  4CZS A;  5AVP A;  5IVY A;  5DAX A;  4O9G A;  3KF3 A;  1LOA A;  3NST A;  4GH4 A;  1VBC 2;  1VB4 A;  4UFL A;  4WM8 A;  3ZFE C;  1W6M B;  1MAC A;  1GAN A;  4GWJ A;  4LUK A;  2H6B A;  4JGY A;  2RM2 1;  2UUR A;  4AI9 A;  4XFI A;  3L2Y A;  5IYY A;  3M4F A;  2QQM A;  3OGJ A;  4I0W B;  2O0O A;  2GP3 A;  1IZ3 A;  3P5B A;  4K1Y A;  4LKS A;  1UOJ A;  2GNT A;  5DQ0 A;  4Z2A A;  5A3N A;  3RJR A;  2OVU A;  3HJR A;  4RYD A;  3IKW A;  2JDK A;  2JG8 A;  3WDU A;  5DUU A;  1XXN A;  5HXV A;  3ZFF B;  5A6Z A;  1BXH A;  1VLN A;  1KXG A;  3AZV A;  4LUL A;  4Q1P A;  1N3O A;  2X09 A;  1J3P A;  1QQP 1;  5KHJ A;  1HB1 A;  2ZEW A;  1AHS A;  2P2K A;  1E5S A;  3ZVX A;  4DQA A;  4NHL A;  4CEY A;  1VPH A;  1ZZ7 A;  1B09 A;  3GHN A;  2BNN A;  2RJL A;  5A1F A;  1ULG A;  1RC6 A;  1WW6 A;  1CIY A;  1S0C A;  4R9C A;  4O7X A;  5A7W A;  2UYA A;  2I45 A;  3K3O A;  4GMP 0;  4P9Y A;  3UJQ A;  2BER A;  1O91 A;  1QNY A;  3D0J A;  5LK7 B;  4Q5O A;  2F17 A;  4QPY A;  3RZG A;  4YW1 A;  3THT A;  3AZZ A;  1MZ6 A;  4NIH A;  2XOM A;  4PQQ A;  4PF1 A;  1QJX 2;  4ATF A;  3VBH C;  3RZH A;  1FAY A;  1AR6 1;  4B3N A;  1ND2 A;  2W39 A;  1NZI A;  1FOD 1;  2VNG A;  1R1A 3;  5JZG B;  1AR7 2;  2ZOE B;  2A73 B;  1DGR N;  5HXM A;  3VZK A;  3ZYI B;  5FZE A;  1AF9 A;  2Y60 A;  1MS1 A;  2E6V A;  5LW9 A;  1RUH 1;  4KQ7 A;  1O8S A;  4CDW B;  1RUD 1;  1QU0 A;  5FXZ A;  3S30 A;  3AP7 A;  3NRU A;  1REF A;  3G7D A;  4XQ4 A;  2AEZ A;  3I8T A;  4M3C F;  2EXJ A;  3P3N A;  3L9J T;  4QX8 A;  4LE4 A;  3M1H A;  1EAH 2;  5KHI A;  4RGG A;  2DF7 A;  3IPV B;  5JXJ A;  4HL0 A;  5FYT A;  3VBF C;  3WT3 A;  1N3Q A;  2VMD A;  3WZ1 A;  1ND3 B;  1F4A A;  1Y9Q A;  3TNP B;  5BYN A;  1DF0 A;  1UAI A;  1WLC A;  2PA7 A;  1V0A A;  2NZ9 A;  1VBA 2;  2ZHK A;  4DEV A;  1HB2 A;  3SCF A;  5ABJ A;  4IEW A;  3AKP A;  2ARC A;  1H2L A;  3OEB A;  2RJK A;  5C8C B;  2VW0 A;  1BBT 2;  1UYY A;  4ARX A;  1YWK A;  5APA A;  4LBN A;  2HWF 2;  1JBC A;  1OVP A;  2JDY A;  1UMI A;  3BU7 A;  2O1Q A;  3EMR A;  4KI5 M;  1SCR A;  1U0A A;  4AEK A;  1W2O A;  3W58 A;  4JGZ B;  2XKO A;  2IXJ A;  3O7O A;  5FTT C;  2HWC 3;  1K12 A;  1DYO A;  1QEX A;  2ORZ A;  1TME 1;  3H1W A;  3ORJ A;  4R9B A;  2IUW A;  4AFD A;  4IV1 A;  4B29 A;  4YM3 A;  2FMD A;  2AYH A;  1DCS A;  2JDA A;  5CU1 A;  3CEW A;  1OF3 A;  1G9F A;  3CF6 E;  3WHT A;  3I59 B;  1NCR B;  1ULO A;  2R06 3;  4BME A;  2Q0A A;  5IK5 A;  4HKO A;  4QGM A;  4CUG A;  2YMZ A;  3RVH A;  4D7Y A;  1JZ4 A;  3M3E A;  2P3K A;  3POB A;  3ZIX A;  5HI0 A;  1KD7 A;  4AFC A;  5IHR A;  2RS1 1;  4QPG A;  5I93 A;  1B35 C;  4A44 A;  2YY1 A;  2ZMK A;  3WF4 A;  3ZFE B;  1JU4 A;  4A45 A;  3RPQ A;  5EPA A;  3ILN A;  3AYE A;  4Y26 A;  1GIC A;  3ZLI A;  4GB3 1;  1YJK A;  4LK7 A;  3RDI A;  5FY4 A;  2WZR 3;  3C7G A;  4OI2 A;  2CSG A;  2RMU 3;  2DBI A;  3G6J B;  4PHZ A;  1UL9 A;  3Q8C A;  1IPJ A;  1PMH X;  1S0D A;  4Q4Y 1;  4CDQ A;  3IDB B;  1NX9 A;  5T5L A;  4YM1 A;  3BKZ A;  3H8X A;  1RVF 1;  1XU2 A;  2E9Q A;  2XLA A;  2HJI A;  4KBB A;  4YW6 A;  1XNT A;  1RUC 3;  1WBF A;  1WA4 A;  4A7Z A;  5JOY A;  3MFC A;  4WVV A;  4FI9 A;  1IHM A;  1LUL A;  4B1M A;  4I02 A;  1LHV A;  3RWK X;  4XTP A;  1W6N B;  4XFA A;  2AGS A;  4RGA A;  3ACH A;  2ARE A;  5LA1 A;  2ADE A;  3CJI C;  3JB8 A;  4XJW A;  1DHK B;  4RQP A;  3UT0 A;  1J1L A;  5J09 A;  4A6S A;  1C8N A;  4RD7 A;  2D43 A;  2W1S A;  2PHX A;  1GFF 2;  2FZ1 A;  3FWE A;  3Q8F A;  2W2I A;  4LEJ A;  1R09 2;  1CON A;  2RS3 1;  1YIP A;  2YUE A;  5FWE A;  2PMW B;  3BIW E;  2WJS A;  3GJB A;  4GQ7 A;  4KU8 A;  4N43 C;  4Y5Z 0;  3CZU A;  3A21 A;  2G1M A;  2XQR A;  4Y22 B;  1KFX L;  1BKZ A;  3KSC A;  3WEZ A;  2ZAA A;  3GF6 A;  4HKW A;  4YRD A;  3GZU C;  1W6P B;  2A6X A;  1BEV 1;  4IEO A;  4XMA A;  5FKB A;  3POF A;  4IL7 A;  1AYM 3;  5E1R A;  1V6O A;  1LKN A;  4YW7 A;  3ZSM A;  2VO5 A;  2WO7 A;  2P3Y A;  2DFB A;  3RWN A;  4QMA A;  3WQ7 A;  4CUB A;  5IT6 A;  4BDV B;  4AF9 A;  3PUQ A;  2CNA A;  2A3W A;  1QDC A;  5FIX A;  4EN0 A;  1MZE A;  4HLT A;  3TEX A;  5K4L A;  3OBZ A;  2J1S A;  5K9Y A;  3KF5 A;  5EFU A;  4BCU A;  2CL2 A;  3LD8 A;  2C6S A;  3AFG A;  4FFF A;  3W20 A;  5A33 B;  2DCJ A;  2HH9 A;  3GBF A;  3ZYP A;  2JDN A;  5FQ0 A;  1GLH A;  5FP9 A;  3KCY A;  2GC2 A;  5CYY A;  4UFI A;  3S5Q A;  3KVA A;  1KQR A;  5BNO C;  1MVQ A;  2Z4F A;  5FDB A;  1V9U 1;  1O8P A;  2PAE A;  1RIT A;  2VME A;  3MV0 1;  4N8M A;  3RMY A;  4JQR A;  1LU1 A;  5LY1 A;  1K45 A;  1RJ8 A;  1W9W A;  2ZGM A;  3INA A;  1Q5O A;  4IEQ A;  4RFR B;  4M4P A;  1Q43 A;  2MPF A;  1RUG 2;  1SLA A;  2VZU A;  5FLJ A;  4Z2W A;  4NAO A;  4ZPI A;  4Q0P A;  1C1L A;  2WNV C;  3R0R A;  4PLM A;  2HYX A;  2HWD 3;  1QGL A;  3FLR A;  3WF0 A;  1SEF A;  2D44 A;  3ZDV A;  1G9B A;  3VD3 A;  5F3I A;  1V6J A;  5IFP A;  4Y1U A;  5KXE A;  5AC9 1;  4YYO A;  1FAT A;  1FPN 3;  4MGT A;  5FP3 A;  5DG1 A;  1QMJ A;  2GMM A;  1AR6 3;  2V5D A;  4G3Y C;  4K8R B;  3GXU A;  5FZ1 A;  5HBA A;  3PVE A;  4FOY A;  4E4H A;  1W6Q B;  1PIV 3;  2R6Q A;  4Q4X 2;  1PGL 1;  1DP0 A;  2XML A;  4IEX A;  3HQU A;  4X6R B;  4MHU A;  1RUH 3;  2WKK A;  3CKH A;  4XDP A;  1VMJ A;  4LIV A;  4NJ4 A;  4PI2 A;  4AVA A;  3IWZ A;  4HK9 A;  1RUD 3;  1OPO A;  3LGR A;  2JE7 A;  3E5Q A;  4A7K A;  2EIE A;  2EXK A;  1OUR A;  2Z5W A;  3ES4 A;  4XBN A;  1GQH A;  2I07 B;  2ARX A;  3VDC A;  4PDW A;  4YPJ A;  3UK9 A;  4CDU A;  3NWK A;  1XNA A;  2A6V A;  1LHW A;  4YM0 A;  5EV7 A;  1X7N A;  3S5A A;  1VAL A;  4H2A A;  2XHN A;  2AEY A;  3UGH A;  2BZD A;  4AL9 A;  3Q8B A;  5FZF A;  4A6O A;  3FUO A;  1PZ7 A;  1YIF A;  2DU1 A;  2UWA A;  2ZHN A;  3QOP A;  4Q4W 2;  2B42 B;  3CJI B;  4ISQ A;  4AQS A;  4DY3 A;  2VNV A;  4QX0 A;  4RA0 A;  5CEH A;  5F3G A;  4LO8 A;  1OUS A;  2VH9 A;  3LEG A;  5CIS A;  2DVD A;  4FSJ A;  2YC0 A;  4CCC A;  2X53 S;  2PLV 1;  5AVA A;  4RGK A;  3NV3 A;  2VL4 A;  1SDW A;  2PFW A;  3KV9 A;  4P9I A;  1UZY A;  1K5M C;  2D7F A;  4KL1 A;  5JXH A;  1TME 3;  1WW7 A;  2B45 X;  2VCM A;  2YC2 A;  2VMH A;  1POV 0;  1S55 A;  4CEW A;  1IQD C;  2XVK A;  5JSP A;  4HKL A;  1I3H A;  1HXS 2;  2C9A A;  4EWD A;  1L7Q A;  2XQX A;  4QU1 A;  3RZZ A;  1VRH 1;  2HKX A;  4XF1 A;  1RUF 3;  3PUR A;  1F15 A;  3PU8 A;  5H9S A;  1CD3 G;  2JE9 A;  4FQZ A;  5BNP C;  1MVE A;  2A71 A;  1HV1 A;  5A1A A;  1FMD 3;  2JIG A;  2JD9 A;  1DZR A;  3HN1 A;  5T55 A;  3OG2 A;  5FJH A;  2WFF 2;  2YC4 A;  3N36 A;  4AI3 A;  2RR1 1;  4XMI A;  1PO1 2;  2JKB A;  5KXB A;  3VBO A;  2VNO A;  2ZJC A;  4Q4Y 3;  4CDX B;  4AED C;  3O1U A;  2C5D A;  1RVF 3;  3E5U A;  4DXS A;  1ULC A;  2Y26 A;  1O4Z A;  1OLR A;  2UWC A;  4BK5 A;  3C7H A;  3I7D A;  3CZJ A;  4P00 B; 
#chains in the Genus database with same CATH homology
 1SHW B;  3HNB M;  2X10 A;  3T0B A;  4CU8 A;  1UWW A;  3C7O A;  2YFZ A;  3I2I A;  3UNP A;  2VZ3 A;  4JHZ A;  3LQC A;  3ACI A;  4DUX A;  3WSO A;  2W1Q A;  2J7M A;  1F4H A;  1UZ0 A;  3CIH A;  3HOB A;  2BGO A;  2R7E B;  2W94 A;  5EJ1 B;  4CU7 A;  2ZEY A;  3HN3 A;  2VZQ A;  3OEA A;  1K42 A;  1WCQ A;  4P08 A;  3VDB A;  4L0P A;  3K46 A;  4DXT A;  2J1T A;  2J22 A;  2W47 A;  4DEQ A;  5B4N A;  4W4Z A;  1XPW A;  3VDA A;  2JKX A;  1JYX A;  4XUT A;  2WYS A;  4BXS V;  4E8D A;  1MPX A;  1WKY A;  2E33 A;  4W8J A;  5DMY A;  3FL7 A;  2LS6 A;  4QX3 A;  1W9S A;  2EIC A;  5DN2 A;  5LA0 A;  3K75 B;  1US3 A;  2V4V A;  1PX4 A;  3K4Z A;  2WDB A;  4M4R A;  1GU3 A;  3C7F A;  5HPO A;  3WF1 A;  3J7H A;  3EB7 A;  2WAA A;  2W9X A;  3ETP A;  3SKV A;  2VMC A;  1J83 A;  3LPF A;  1JZ6 A;  1O59 A;  3LE0 A;  3SEE A;  3DYP A;  2J1R A;  2CDO A;  4W50 A;  4JKM A;  2ZEX A;  1TVG A;  3I2H A;  1W8N A;  4QDR A;  2B4K A;  3SKJ E;  1P8J A;  3MUY 1;  1UXZ A;  4TXW A;  2VZT A;  2J1U A;  3I3B A;  1GOG A;  5EJZ B;  3WNK A;  5B4X A;  4XUP A;  1CZS A;  5JMO A;  1J84 A;  5C71 A;  4ZZ5 A;  1H6X A;  4LQR A;  1JI6 A;  4D0Q A;  4ZZ8 A;  1H6Y A;  2WZ8 A;  3THD A;  2Y64 A;  4DXR A;  3ABZ A;  5LA2 A;  2VM9 A;  2QQO A;  4LPL A;  2VQT A;  2XON A;  3EYP A;  1RYY A;  2E32 A;  4PT6 A;  2ID4 A;  5DPN A;  2WO2 A;  3LEK A;  2WN2 A;  2W91 A;  4QAW A;  3WNL A;  2WUH A;  2VZ1 A;  5CZK A;  2VZR A;  2VMF A;  4QB2 A;  4CUA A;  2HLE A;  3NJV A;  1W9T A;  2VOT A;  3C7E A;  3CQO A;  1DLC A;  2L9L A;  1GOF A;  1W0N A;  3UES A;  1GOH A;  4ET7 A;  3K4D A;  5LCW L;  2DCK A;  2PQS A;  3IDA A;  3T2Q A;  5C70 A;  4GWJ A;  4ZY9 A;  3F2Z A;  4BK4 A;  5IYY A;  2QQM A;  1OD3 A;  5DQ0 A;  4Z2A A;  2VR4 A;  4LKS A;  4P02 B;  4JKL A;  3HJR A;  4RYD A;  4MGQ A;  4AG4 A;  2J1A A;  4XUN A;  2X09 A;  1EUU A;  2ZEW A;  1UY0 A;  3PUH A;  3T0D A;  4UAP A;  1D7P M;  1UY2 A;  2OKX A;  3IB3 A;  3I97 A;  3U37 A;  4OYU A;  1CIY A;  4CU9 A;  1JZ5 A;  1GMM A;  2BER A;  4P5Y A;  2VC9 A;  4ZXE A;  2B9V A;  4OZO A;  1JU3 A;  2XOM A;  4PQQ A;  4PF1 A;  1UY4 A;  1CZT A;  2ZXQ A;  2QQN A;  4JX0 A;  4XVH A;  3FHQ A;  3WF3 A;  5F7U A;  3BN6 A;  4QDS A;  4UI9 L;  5FUI A;  2VCA A;  2Y6J A;  3WNM A;  5HXM A;  4LHS A;  3DYM A;  1GQP A;  1W8O A;  1O8S A;  1I5P A;  2VQU A;  4CU6 A;  3CMG A;  3K4A A;  2YB7 A;  3NRU A;  3C8X A;  1GUI A;  3NQH A;  2CDP A;  4IUG A;  5JXJ A;  4TTG A;  3HPN A;  5JR2 A;  2WAO A;  2VMD A;  3CDZ B;  3T08 A;  3WF2 A;  3OB8 A;  1F4A A;  4A41 A;  4DUV A;  4DEV A;  3OEB A;  1UYY A;  4ARX A;  1JZ2 A;  4CUC A;  1US2 A;  1UYZ A;  3DYO A;  3T0A A;  2C26 A;  2W95 A;  1UMI A;  3LEI A;  4KI5 M;  2W87 A;  3THC A;  2RVA A;  4OUE A;  1SDD B;  1K12 A;  1DYO A;  2ORZ A;  2W3J A;  2DDU A;  2JDA A;  1SG3 A;  1OF3 A;  1ULO A;  4QPW A;  3IAQ A;  4KWU A;  3MV1 1;  1GNY A;  1JZ4 A;  3OBA A;  3VD5 A;  5G05 L;  5IHR A;  4MOA A;  2E31 A;  3MUZ 1;  4A44 A;  2WBK A;  3WF4 A;  2E26 A;  1JU4 A;  4A45 A;  2KD7 A;  3HNY M;  1TG7 A;  3ZM8 A;  1JZ7 A;  5JXI A;  1ULP A;  3C7G A;  4A3Z A;  2WZE A;  3E1F 1;  4OMD A;  4XUO A;  3JXS A;  4AAX A;  4MGS A;  3WNN A;  2VZS A;  2JE8 A;  1PMH X;  2W1W A;  1NX9 A;  4GZ9 A;  5EIY B;  3A23 A;  2Y6H A;  4MO3 M;  2W1U A;  1XNT A;  3FN9 A;  4FI9 A;  3A7Q A;  2QBX A;  2Y6G A;  3VD9 A;  2W46 A;  3ACH A;  3I2G A;  4MAD A;  5LA1 A;  3K77 A;  3WQB A;  1NKG A;  4XUQ A;  3NNG A;  3VD7 A;  2W1S A;  1YQ2 A;  3OGV A;  1LNS A;  4RN5 A;  3PUI A;  3I2K A;  3CZU A;  3P1I A;  3A21 A;  4BJ0 A;  1NAE A;  3WEZ A;  2ZEZ A;  2VZV A;  1JYW A;  2BBA A;  3BGA A;  2YFU A;  4ARY A;  2C4X A;  2VO5 A;  2QQL A;  5G04 L;  1UYX A;  4CUB A;  4BDV B;  1CX1 A;  1EUT A;  1UY3 A;  1UXX X;  2VZP A;  4XUR A;  2V72 A;  4QDQ A;  1OF4 A;  1OT5 A;  3OGS A;  2J1S A;  1JYV A;  4D8M A;  3ACF A;  3VD4 A;  3T2P A;  4CVU A;  2DCJ A;  1CZV A;  5CYY A;  5C7G A;  5IJR A;  2WO1 A;  2Z4F A;  5I0D A;  1O8P A;  2VME A;  1UY1 A;  3MV0 1;  1OH4 A;  3MBW A;  1K45 A;  1W9W A;  4M4P A;  3I2J A;  2VZU A;  1K3I A;  3I3D A;  4A4A A;  4GWI A;  2LW8 A;  1PX3 A;  2HYX A;  2RJ2 A;  3SEP A;  2VZO A;  3D3A A;  3WF0 A;  3A22 A;  3P6B A;  3VD3 A;  2ORX A;  5IFP A;  3WNO A;  2Y6K A;  4QX1 A;  2V5D A;  5JUV A;  3W5M A;  3GXU A;  4DUW A;  3GM8 A;  1R64 A;  4QB1 A;  5JXG A;  3HNM A;  2WO3 A;  1DP0 A;  1UX7 A;  2VJX A;  3CKH A;  2Y6L A;  3NJX A;  2W5F A;  1UMH A;  2EIE A;  2VTF A;  2VCC A;  3I2F A;  3VDC A;  2WQ8 A;  4YPJ A;  1JHJ A;  4OMC A;  1BHG A;  1XNA A;  4UOJ A;  1HN1 A;  2EIB A;  2XHN A;  3GGL A;  4HG6 B;  4E8C A;  2BZD A;  3ECQ A;  2EID A;  4A6O A;  2C9K A;  3FHA A;  1JZ8 A;  1KEX A;  4QX0 A;  3IAP A;  2VCB A;  2X05 A;  1T2X A;  3WNP A;  1KGY A;  3LEG A;  2YG0 A;  3LPG A;  3MO4 A;  1L7R A;  2VL4 A;  2Y8K A;  5JXH A;  3GDB A;  2YC2 A;  1IQD C;  2RV9 A;  4QB6 A;  2QQK A;  1JYN A;  4XZU G;  3HEI A;  4A42 A;  1L7Q A;  2XQX A;  2W92 A;  3AC0 A;  2BGP A;  1XC6 A;  3DEC A;  3ACG A;  3UET A;  5A1A A;  2JD9 A;  4JKK A;  2J1V A;  3III A;  4QX2 A;  3OG2 A;  3W5N A;  2YC4 A;  2WN3 A;  5J1X A;  1W99 A;  2WAB A;  3I3E A;  4KMQ A;  1JZ3 A;  3T2O A;  2QQJ A;  1NUK A;  3OGR A;  2QQI A;  4DXS A;  5IFT A;  3T09 A;  2J1E A;  4BK5 A;  3C7H A;  3CZJ A;  4P00 B;  1PMJ X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...