5HV0A

Structural analysis of cofactor binding of a prolyl 4-hydroxylase from the pathogenic bacterium bacillus anthracis
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
212
structure length
206
Chain Sequence
NQIKEQTIFDHKGNVIKTEDREIQIISKFEEPLIVVLGNVLSDEECDELIELSKSKLARSKVGSSNDIRTSSGAFLDDNELTAKIEKRISSIMNVPASHGEGLHILNYEVDQQYKAHYDYFAEHSRSAANNRISTLVMYLNDVEEGGETFFPKLNLSVHPRKGMAVYFEYFYQDQSLNELTLHGGAPVTKGEKWIATQWVRRGTYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of cofactor binding for a prolyl 4-hydroxylase from the pathogenic bacterium Bacillus anthracis.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Oxidoreductase
molecule keywords Prolyl 4-Hydroxylase
total genus 59
structure length 206
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 5hv0A01
5DAWA 4BQXA 5LBCA 2G19A 5DAXA 2RDRA 2JIGA 2V4AA 5LASA 3HQRA 5EP9A 4J25A 3OUJA 3EMRA 5M0TA 3NNJA 2HBUA 5EPAA 5HV4A 4Y5TA 3GJBA 5DAQA 3OUIA 3NNLA 4ZONA 4NHLA 5LB6A 3HQUA 2OPWA 2RG4A 2RDQA 5IAVA 5L9BA 2Y33A 4NHYA 3KT1A 2A1XA 4XABA 2FCVA 5C5UA 4NAOA 4NHMA 2FCUA 2G1MA 3GJAA 2JIJA 3NNMA 3PL0A 5DAVA 5ERLA 4BQWA 4MHUA 4XACA 5DAPA 4JZRA 5LBBA 3W20A 3KT7A 5IAXA 3OUHA 4NHXA 3OBZA 3ITQA 5L9VA 4MHRA 4UWDA 4ZPIA 5IATA 2FCTA 3GZEA 4XCBA 4Y5SA 4XCAA 3KT4A 4KBZA 4XAAA 4XC9A 5L9RA 2Y34A 5LBEA 5LATA 4IW3A 5LBFA 2RDNA 4Q5OA 5C5TA 5EQUA 2RDSA 3NNFA 5LA9A 5HV0A 3W21A 2HBTA 4BQYA 3BVCA 5A3UA 3MGUA 3DKQA 4NHKA 4NMIA
chains in the Genus database with same CATH superfamily
2D6LX 3J7MA 3JB8A 1AF9A 3B02A 4RGKA 4BQXA 4CDWC 5BNOC 4Z2AA 1S1AA 4LO5B 2BW8A 1PNFA 4DY5A 1SFNA 5J36A 3GALA 4YLZA 1Y9GA 4JX0A 1HIXA 2HH9A 5DG1A 1ENRA 4XF4A 5JSOA 3O5SA 3ZYRA 4COUA 1W8FA 3VBOC 3NJYA 5FQ0B 3NJVA 4PBPA 1FPN1 3RNSA 3OGVA 1AX2A 4PCRA 2PYTA 2E7AA 2HBUA 2C26A 1ENQA 2WAAA 1E57A 5F5IA 2CAUA 3H8XA 4CP9A 3BIWE 3MW2A 2V09A 4AK3A 1JZ8A 1AUYA 3FBYA 4AHXA 3ZN4A 3AZWA 4CUBA 3LSEA 4ZONA 4AHYA 5LB6A 1S4CA 4D7TA 4DUWA 4K8FA 2XUEA 5IVBA 1AR93 4HVOA 3CIHA 4LIVA 2A6YA 1W9YA 4CXXA 1WCSA 3I59A 5IYYA 3O0WA 3SHRA 1QJEA 1REEA 3AKTA 4INDA 4CEYB 2LM3A 3JBG3 4JV4A 5C71A 5HXVA 1CVNA 1GNHA 2BRTA 1IGOA 3MPPG 4WM8A 4AEJA 1C1LA 3E5UA 2LUWA 1GANA 1RUE2 3WG4A 2UY9A 4AVVA 3M3IA 1FMD1 3BN6A 2AEZA 5BNOA 4CUCA 1QDOA 3ZDSA 1RUC3 3V0BB 2Q8CA 5IW0A 2R062 3K3NA 2PAMA 2XHNA 5FPUA 2BNMA 2QZ3A 5DAVA 1HLCA 3RZGA 3VDBA 4RS5B 3USUA 2DBNA 2R1DA 3VBRA 4IV1B 3IDBB 1XYNA 1OLMA 5LBBA 3W20A 1DGRN 1UYZA 3OF1A 3ZN5A 3CO2A 1FPN3 1Q56A 1SLCA 4ORFA 2VY0A 2JEMA 1U12A 4UFJA 3VDDA 5CFDC 3GGLA 2AREA 1QGLA 1BQPA 2VL4A 2XL7A 4WBBA 5ANNA 3W9AA 1JZ3A 1V0AA 1I5PA 4QX2A 4HSLA 1DZRA 1WW7A 3BOPA 3WF4A 1PO13 1S0JA 2XLGA 2HKXA 2P37A 1JZ7A 2FZ2A 4OI2A 4B1LA 2VUCA 2YG0A 4A7ZA 5JOZA 3PUQA 4XCBA 4O9GA 4ES8A 2B5HA 2Y64A 2PN5A 2YB7A 5ISLA 3VBOB 5KXCA 3HVDA 3ALQA 2HWE2 1OURA 4Q4X1 3ME2A 5JOWA 1F8VA 4HFSA 1PIV3 1ENXA 4MXWB 3LPGA 3LZZA 2WFPA 4ARXA 1TNRA 4QQ2A 5J3UA 2J42A 3D3AA 3UKVA 4JGZA 3CZUA 4OCTA 4XBQA 4A45A 4AWDA 4XFIA 5HCBA 4XETA 3J9SA 4LBQB 5LY1A 4LKDA 1HXS3 4QT6A 1LJ7A 2R043 3AVRA 2VTFA 3OPWA 3T0AA 4KMQA 1XRUA 5KC6A 2Y6KA 1S0BA 2O8OA 1HW5A 3B9IA 3J7LA 5C9AB 3VDDB 4UF0A 5F3CA 1CAVB 3ZSJA 1HQWA 1W6NB 2PHRA 1JMUB 2CGNA 3UGHA 2DUPA 4JGZC 4NVPA 2A73B 1B09A 1GZWA 4L2NA 3CNAA 4NIGA 5CKNA 4CPBD 4MG2A 4UAPA 4N53A 1J58A 5FIXA 5IHRA 1RGSA 4BYYA 4B1MA 5BXXA 1V9U2 1O8PA 4CP2A 2VZTA 4ZXEA 3KCYA 2CYFA 2XMLA 1S2KA 3AP6A 3ON7A 1ND2C 2YU1A 4GH4A 1SQ4A 3ZFFB 1K42A 2NN8A 5LASA 3DPRC 3VV1A 5ACA1 4CVUA 4M0NA 2OZ6A 4CCEA 5IVVA 4QKFA 3WF3A 1UPIA 2JG9C 3MF9A 1H2LA 2RS33 3ES1A 3I2IA 1PVC2 5FO7B 2Z2SB 2ZTNA 3ASIA 3OOXA 4K8RB 5A3NA 3GJBA 1A8DA 1VMHA 1OPOA 3FC0A 2JG8A 5H9PA 2XJSA 2GP5A 2BQPA 2ENRA 4MGZE 5J96B 1MZFA 5IK5A 4P9WA 4YZ4A 2BU9A 3AZVA 2PXJA 5FZOA 4UBGA 3RYKA 1OD3A 3C2UA 2A6VA 3MIEA 4M01A 2ZHMA 1AYM2 2B4KA 3NAPB 1ZBE1 3UYJA 3IPVB 5C9AA 4ZXKA 5CVRA 4FXKB 2NP0A 2IXHA 3SCFA 4PLMA 1RUD1 2FDIA 1UZWA 3ZPYA 1W99A 5F37A 2QQMA 3ILFA 2GC3A 3M2MA 5A7WB 4NAOA 1YQCA 3JCIA 4D94A 4MGYE 1COV1 1J1TA 4YWAA 2W92A 2OT7A 4QU1A 5FRAA 4GMP3 5F5CA 3W59A 1VBB2 1ND2A 1WKYA 1BJQA 4ZY9A 4QHBA 4EN6B 2VD7A 1AJOA 5FYVA 3M70A 4L99A 3ZYIB 1YYNA 4P02B 4PT6A 4W6XA 3N9LA 3POGA 1RVF3 1SPPA 4N53C 4DXSA 4FPLA 1EPWA 4B4QA 4P9JA 3RI8A 3GHMA 1MVQA 4QQPA 4YW3A 3WCSA 4XFAA 2JJ6A 5EFUA 4PIXA 3U1XA 4AI2A 4V1PA 4YG0A 2J1TA 4K1ZA 1FV2A 4JHTA 2W9XA 2JDKA 4MH0E 1KJLA 3U07A 1BVP1 2NYYA 4WM7A 2AUYA 3OYWB 4XUNA 5A33A 5CBLA 1AXZA 2YBSA 3RMXA 3ZFEB 1C5IA 1LGNA 5FYSA 1WCKA 2FQPA 2ZX4A 5FMCA 1SBDA 3KT4A 3VGIA 5C3SA 1YWKA 2E26A 2Q5TA 4N7UA 4IGPA 1PM7A 3N9MA 4Q4W2 1FI2A 1AHSA 1SMVA 1CX4A 1RHI2 4CCCA 1X8MA 1ZA4A 1XNAA 3P1IA 4YGDA 5J37A 1K45A 3VUOA 2WO7A 3GZTB 4ATEA 3A0NA 3E6BA 2C0ZA 1L7LA 3KF5A 2EALA 3OG2A 1W03A 4XHBA 1UZ0A 1XNBA 4IV1A 4A4AA 5IVFA 4RGAA 1CPMA 1RUE3 2VCCA 4UW5A 5GALA 2VMFA 3POIA 2D5FA 2JE8A 4QX0A 3WNMA 5A6YA 3N7JA 4BDVB 2VZOA 3LD8A 3TAYA 5FV3A 3WZ1A 3HNBM 4JKLA 2DCKA 1F31A 2R063 3DPRA 3AKSA 2W47A 3OD0A 4CDUC 4RR3C 3E1F1 4WVVA 3BTXA 3M1HA 4WVZA 5KC5A 4QHOA 1EUTA 3KWVA 3E6DA 4TXWA 5GZDA 4CP9B 3P5BA 3J8F1 4QX1A 5HCHA 1UX6A 5D2AA 2XLFA 3GF6A 4QXCA 4LUMA 4FOQA 1X8EA 4XURA 1JOBA 2GN7A 3LA2A 1J3PA 3NNGA 4QPIB 2WABA 2BWCA 2VQUA 2Y6FA 5HV4A 3T09A 1RJ8A 1GP6A 5CEHA 3HMYA 1PGL1 5I93A 4XAEA 4FQZA 4GA9A 4XJ8A 4BISA 2ZOEB 4MYEA 1ZBA1 2WRAA 2VAUA 4CCJA 2VZPA 1W9TA 1XNKA 4AVCA 3LAGA 3VDDC 1QJZA 3KD4A 3ZN6B 5GZEA 1EAH1 4XBLA 5FZKA 1LGCA 1BCXA 1EV13 3Q8EA 5FP7A 4D3WA 3J7NA 4AFDA 3O1MA 4FPYA 2HWC3 2XUMA 5C5UA 5JLVA 4AXOA 1NZCA 4CDXB 3O1RA 4Q0PA 3R4SA 4M4RA 4XJWA 4D7YA 1H2NA 3C7EA 1M4WA 4NRPA 2MHFA 4DO0A 3CF6E 3QD6A 5DDJ2 2ZHKA 1RXGA 3NNMA 3PL0A 1MEC1 4KQ7A 4QPYA 2PMWB 5ACA2 1NE6A 1P8JA 2JG9A 4QKBA 5L9VA 3RZMA 3OBTA 4LOTA 3ILNA 1MQTB 4XACA 3KMHA 1PVC1 2V5DA 3H7YA 5A7PA 1AVBA 3PNAA 3KM5A 5J98B 4B3NA 1ND3B 1RVF2 1GYKA 1W0PA 3OBZA 4KU8A 5L73A 3ROUA 2QTWB 4YZ1A 4NPLA 4PQ9A 1FX5A 2YYOA 4AHWA 5C70A 3I2JA 3MIBA 4FFGA 4KGQA 3AJYA 1TME3 1ZYBA 5JOYA 2TUNA 4QDRA 3M7AA 1VMFA 4I01A 3LQCA 1JZ6A 1DQ5A 1C4RA 1FOD3 4XFCA 1KFUL 5ABJB 3VDAA 1J84A 3PDQA 5EYYA 2X05A 2CGPA 1CAXA 1JODA 4ZHNA 2P34A 1VBE1 1TEIA 1APNA 1CAUA 3VHRA 5CFCC 3L2YA 3ZSEA 3RZLA 4IDZA 3VZKA 3NWKA 5LBFA 1O4YA 2BPA2 1KITA 2E31A 2FZ1A 4I0AA 1TQ5A 2XKPA 5DUXA 1ZZCA 1C8M2 4YZ3A 4IEOA 3TNPB 2HEYF 4Z07A 3ZSLA 1W06A 2H6BA 2JE7A 1JUIA 1OF4A 3JBG1 1ZX5A 2I45A 4Q8LA 1WBFA 3O7OA 1XNDA 5CADA 2ETEA 2WL1A 2Y8KA 3WP4A 3SKJE 2XOMA 2NMOA 3ZXJA 4XE9A 4CEYC 2QKDA 3J26N 1RUD2 1G9FA 3JZVA 4Q4Y2 4YW6A 1EV11 4OVEA 4LBNA 1DCSA 4BWOA 1KQRA 2HWD3 4XXPA 4Y26A 4PLOA 5KBFA 4TLFA 2XBO3 5SV8A 2JDAA 4L11A 1JU3A 2Q8DA 4YW4A 1A6CA 4PF5A 1PM4A 2G19A 3LFIA 1PK6B 2PTMA 2CGOA 1HQNA 2W0XA 3BPZA 3HQXA 4XOGA 3V64A 1VAVA 2BJSA 2YBKA 1WCQA 3J7HA 4D8MA 1POV1 4RFT0 2VZSA 4IE4A 4XTMA 4AEDC 1QJX3 2VQTA 1ONAA 3I2FA 1UOBA 4CSWA 2EIBA 2LW8A 2RM23 3KV6A 3NNJA 4BHPA 1AL0G 1HQLA 5FZCA 2QFEA 2Y0OA 4Y5TA 2VCBA 2XJRA 2ZGKA 3H7JA 4QX3A 3SH5A 2XWBB 4L97A 5JZGA 5JDBA 1RJ7A 3IBMA 1GWKA 1OOPC 4HKLA 3B01A 1NCQB 4IEVA 4IEQA 5E8AA 1R1A3 3PIGA 1XE0A 1VBA2 4I3GA 1W2NA 3CHXA 1EPZA 4XDOA 1W04A 4QMAA 4I0BA 2OW4A 5JR2A 4AGGA 4QPGB 2GC1A 2V72A 2V73A 4UFKA 4AR2A 3WF2A 1H8TA 2G4IA 1C1FA 4JDOA 1UU6A 3ZVXA 4NIHA 2MNGA 2YPJA 2R6QA 3ZDVA 4AOCA 3KVBA 4BOWA 2LTNA 2PQSA 4DMIA 1IQAA 4Y20A 5FZ6A 2R041 2R073 3ZSKA 2RS11 5L7OA 1RUI2 2WN3A 3WQ0A 2JIJA 5DPNA 4AI0A 2D6OX 3T0DA 2L9LA 3JXSA 5ERLA 2BTVC 2WNVB 2X8KA 4RR3A 1SCSA 5A3WA 5DAPA 4QQOA 4YG3A 4E8CA 1BXHA 4FPCA 4COZA 4E8DA 1SFPA 1UCXA 2GDFA 2RS31 1H4HA 1YQ8A 2AR6A 2EF6A 3FHQA 3KLSA 3Q9OA 1TVGA 2XJVA 4MV2A 2R16A 1RUG2 4YW2A 4OHYA 4RHV2 5FZ0A 1ZREA 1VLNA 3ZXDA 5IATA 1COV2 5E16A 1GQPA 1F15A 4C91A 5I0DA 2W1UA 3JD73 4EZ4A 3BIEA 3MW4A 3GZEA 4XTPA 4GALA 4WVMA 4NIIA 4IE5A 2ZGQA 2NMNA 3K3OA 3UJOA 5BY5A 4LBOA 4EV0A 1N1SA 2C5DA 4CCMA 4IESA 1N3OA 1S0GA 3JD71 2D6NA 1CIWA 2JXAA 2XVKA 3BGAA 5BNNB 3AZXA 4Q0SA 4XQ4A 4RN5A 4Q5OA 4CUGA 2RS52 1GZWB 5HI0A 1GQHA 3E5XA 2Y6HA 5FUIA 4Q4Y3 5LY2A 5DDJ1 3N4MA 4XW3A 2ERFA 4ET7A 1POQA 1LAJA 1DG6A 1V9U3 5D21A 2A6WA 2WBKA 1LGBA 5A3MA 5K0UC 4PDWB 4RL7A 5F5AA 3EXUA 2VZ3A 5F3IA 5DZFA 4YYOA 2QBXA 3ZXKA 4EN9B 3ZXGA 2DYCA 2RHPA 2RS13 2WNEA 4MGQA 3W5NA 4N90A 5E6HA 3WNLA 4MXWA 2RM22 4TYSA 4BIFA 1LECA 4DUXA 2JB8A 3T1MA 2W52A 2P3YA 2R0FA 5DAXA 1WUVA 1XPWA 1K5MC 2RDRA 4XVHA 3ZYPA 2SBAA 2JD4A 1AZDA 2TBVA 4U36A 4AFMA 1J1LA 1J83A 1OVPA 2XXZA 4QU2A 4HL0A 3OUJA 1UWWA 1W05A 2QQPA 1PO12 5CA6A 5T50A 2WZPP 3PMEA 1HRI2 4OUMA 1MACA 1J3RA 3AKRA 3VHOA 3V65A 1UKGA 1UOGA 3FJSA 3ZN6A 5GZGA 3FZ3A 5FPVA 5DAQA 3OUIA 2K46A 3THDA 3HNYM 5I0RA 1C8M1 1NA1B 5IVJA 1U5ZA 2BVVA 4A2UA 4JRAA 2BFUS 3TEYA 1OSGA 3SQOA 2WZR3 5L36A 3S0MA 2XVLA 5IFPA 1O3TA 1H2MA 3TN93 2JDZA 3I2KA 2AC1A 1W2UA 1D0GA 4HONA 1UAIA 1GLHA 3H3LA 1W6OA 4IQPA 3N7LA 2YMZA 1QKQA 1DLCA 1NT0A 1AL21 2A75A 1KRIA 4AFBA 1XC6A 3MYXA 1RUI3 1LHNA 3INAA 1QJY1 4HKOA 2Y6LA 1Q5OA 2F4LA 3AB0A 3FE5A 3I8TA 2TNFA 3ZKYA 2ZGPA 2Y6JA 3I7DA 4YFWA 1CJPA 4DY3A 3ZO0B 3THCA 3D0JA 2VNRA 2XWJB 1CAXB 1IG0A 2IFRA 2LRPA 5DMYA 1DYPA 4SLIA 3VBUC 5LK7B 1V9U1 2LALA 1MS4A 4C1WA 3LB9A 3I3DA 3RWKX 3MIGA 1UOJA 2VBDA 1F2NA 2VZRA 4Q4Y1 5CIRA 3HAGA 4Z1VA 1QDCA 2EXIA 3C7OA 3HJRA 3OEBA 1R1ZA 3S57A 3B94A 1REFA 4LE4A 3DYMA 3WNKA 5FXZA 3BKZA 2I2SA 1S0EA 1B35B 3OD4A 4NWVA 4BPZA 5KHGA 4ZU5A 1QEXA 4N7IA 3H42B 2IUWA 5FMOS 1ZZ7A 3ZPOA 5K7PA 4Q8KA 3AM2A 2GMPA 3LA3A 1XE7A 4D69A 1W8TA 2WWUA 2YU2A 1F4AA 2HWB1 2ZX2A 3CMGA 5FYIA 4NWWA 4K6BA 4BU2A 5FY0A 1Y9QA 4ISQA 1X36A 3IB3A 2RJKA 3MO4A 4Q0QA 2A6ZA 5FZMA 3WOGA 4JKKA 2B9UA 4HT1T 2P3JA 2WAOA 3MDPA 2VUJA 4WVWA 4ZU7A 2WJSA 4CTEA 4CP0A 3WXPA 3IAQA 1AR61 5A3UA 2XG3A 5GJ6A 1QJFA 1AL23 4G9SB 2I07B 2ADEA 2YFZA 4BK4A 3OTFA 4W4ZA 4BZ4A 3RZJA 5TSWA 1YJKA 2ZGUA 3IIIA 1GOGA 3J4UH 5CU1A 4K9SA 1Y4WA 3WF0A 3P6BA 2RS12 3BTAA 4R9DA 2ATFA 3NV2A 1R091 4AEMA 1MS9A 3NKTA 3MFAA 4M3CB 4NE9A 4PQQA 1VJ2A 1VRH1 2ZHNA 3OPTA 4XUPA 3B3QE 3ZMOA 1J59A 1F4HA 2DTYA 1Z0HA 1V6IA 3PHMA 2H0VA 1F9KA 1ULCA 3WW2A 2VH9A 1OC1A 1NCRC 1OQDA 5EPAA 4CDQA 1OBNA 4BCUA 2GNBA 2WKKA 4P5HA 4AVAA 1Y9MA 5JXJA 3NV4A 4FPKA 3LOBA 3N36A 5T5JA 4Q29A 3KZ4C 4NAMA 4Z82A 1SZBA 4DXTA 1PZ8A 4JDMA 5FPBA 4PDWC 4OHWA 4LA2A 3A0KA 4IEUA 2DVDA 2BZDA 2BOIA 2IFWA 1D0HA 3BYWA 1V70A 5F2SA 3BU0A 2UU8A 1WBLA 4GMP0 3LWCA 1BKZA 4YZ5A 3GYDA 3KCXA 1ALYA 1NY71 3ABZA 1QJU3 1N3QA 5FZAA 3ZFGB 1MQTA 4ATFA 2ZGOA 3KV4A 4CDWB 1BMV1 1R083 5SV5A 1AR81 4NOTA 2X29A 1QQP3 2FBEA 1OHFA 2J1RA 3P3PA 2YC0A 3DN7A 1K5MB 5JR7B 4UW6A 5JXIA 2IXKA 2HWC1 4XFFA 2ORZA 1BYHA 1C57A 4GWIA 1D2SA 5FZ9A 2G9GA 2YBPA 2SLIA 1FAYA 4FP2A 1ACCA 1S0CA 4W8JA 4XFHA 3K2OA 1PO11 2ZX3A 3K75B 4QPIC 5EYXA 3KT7A 5BNNA 1FNYA 4AG4A 1HRI1 3WG3A 4M4PA 5FKBA 3LE0A 4OMDA 3AP9A 3H50A 3JUUA 3MV11 4X8PA 5FP3A 1LNSA 2ZEZA 1OF3A 4HOOA 3RVHA 2QQIA 2VMGA 1OMIA 1RUF2 4QB6A 3WDYA 1T2XA 1X9PA 2JDYA 3VKNA 3WW3A 4BQ2A 4CA9A 4PDWA 2WA4A 3I3MA 1ND2B 1PK6C 1TMF1 4XJZA 2UYAA 4YFZA 1VPHA 1PNGA 1CX1A 1VRBA 1S0DA 3CJIC 4P08A 4UFLA 3E5QA 3IN9A 5FYTA 4EN0A 3VDCA 2ET7A 4RFRB 2XONA 1DF0A 2VPVA 2QQWA 5GKAC 1K5MA 3GZAA 2RS32 2Z79A 3HT1A 5C3RA 1UMZA 5AVPA 5FZGA 3AP7A 5EQUA 1OOPB 2GC2A 4R4XA 4A3XA 2IVIB 2BDRA 2BVBA 1H1AA 2P17A 1YIFA 3PJYA 2XJPA 3IAPA 2A3WA 2DUOA 5C8CB 1V6KA 5J48A 4OUSA 2W3JA 3WLUA 3WNNA 1YCIA 4ONUA 1LTEA 3TB0A 1UW8A 4D6RA 4GAZA 5BNPA 4XJUA 3JQXA 1HN1A 2XH6A 4UF0B 1V6NA 1ST8A 3IDCB 1O4TA 3POBA 1S2BA 1D2QA 2JDMA 3AK0A 2VW0A 5BV6A 5C3OA 3FLRA 2Q1FA 5IWFA 3G6JB 2WLPA 4QM8A 1GSLA 2J1AA 1RUNA 1D7PM 1KFXL 3FUQA 4YVWB 4GH4B 1H8TB 4XMAA 1NKGA 2XVGA 1JHNA 1JH5A 2O1QA 4ES9A 1XSQA 4P9LA 3DCQA 1OQ1A 1QY4A 2GC0A 3LPFA 4F8AA 3WUDA 1DYKA 1AR73 2ZEXA 4YM3A 4IETA 2R49A 2OX0A 1LOBA 5CKQA 3T4HB 1CN1A 2ADDA 4KG0A 2VNVA 1QXRA 1RUH3 2OXBA 1JUHA 2VZUA 3ZOIA 2BOJA 2OQ7A 5FY9A 3MLKA 1H0BA 4BIOA 3MIFA 4LORA 1KJRA 1H30A 1NE4A 4HKWA 4WM8C 3ILRA 2IVJA 4O65A 4BA6A 4PBOA 5AC91 2CY6A 1X33A 1LHOA 2RDQA 1RHI3 3ZYGA 4BXSV 1AX1A 5A3TA 4BLJA 3IIAA 4OFGA 1AR62 1W6PA 5T5OA 1OT5A 3ES4A 3VBFC 3B9CA 5A80A 2PLV1 3ETQA 3RI9A 3AMHA 2HWB2 3J8F3 2RVAA 5FY8A 4QWNA 3WG2A 3ZXEA 4BM8A 3ACFA 1RITA 1IG3A 4AQSA 2KA3A 1Z78A 5A7NA 5JOXA 4CEWA 3HD8B 4ASLA 2WO3A 1LOAA 2UWCA 1ODMA 2NLRA 1X9TA 4EYUA 1RUJ1 2DDUA 3VL9A 1WA4A 4AQTA 4Z92B 4QDSA 4TTGA 5FMOL 1SPPB 1Q8PA 3AVSA 2EAAA 1LEDA 2ZXQA 3PVEA 5T5PA 2VUAA 1GMMA 4NPMA 4W50A 4F3JA 1LENA 2PHUA 4CDUB 5J09A 5A1AA 3M3OA 1W6QB 3K4DA 1QJY2 5G05L 4D6QA 1W0NA 2E9QA 3FHAA 3HPNA 3LIHA 1VBD3 3WDWA 4WV8A 1SLTA 2W68A 3H3ZA 4LK6A 1U5YA 3DXUA 3GCXA 4GH4C 5HXMA 2WZ8A 1CZTA 2W1WA 1BBT2 1WMXA 2HEVF 5EXOA 4CE8A 5AFBA 4MGKE 1QHDA 3DECA 2NPIA 2D3SA 4JKMA 1W8UA 2BERA 2Y0IA 1BMV2 1E5IA 4FO9A 2W5FA 2WS92 2B45X 4XJ9A 1CESA 5C4WC 2RMU2 3JB4C 1CZVA 2YY1A 3UK9A 4EJRA 3SH3A 1JYIA 1GOHA 1OD5A 1RL3A 4DXZA 1UL9A 3AMPA 5FZIA 2VZQA 1GZ9A 2HWC2 3BODA 1KS5A 3I3EA 4UW3A 4OI1A 3ST7A 4FAGA 5JPNB 4XZUG 1QXPA 3VBRB 3LKJA 1X82A 4Y1XA 2O8QA 3WR0A 4ASMB 1ASJ1 4BQYA 3D5OA 1PMJX 4LBQD 5LA0A 1RUG3 2ZPXA 5FK7A 4LLFA 4LR4A 3SEPA 2WNOA 1HB3A 2K2SA 3BOWA 4LJHA 4R52A 3Q8CA 4M3CA 1ULPA 3ACLA 2JDUA 4JVAA 3T30A 3NSTA 1TG7A 3MGUA 4BE3A 5A7SA 4CCKA 3A7QA 4YSFA 4NMIA 3N7KA 2BGPA 5JAXA 1GNYA 3RYRA 2BGOA 1AR82 3KCCA 4HVQA 2CV6A 1AR72 2C6SA 4URTA 5G04L 4CUAA 4XHXA 2B7YA 2PHDA 1RUJ3 4ZU4A 5C3QA 5KWRA 1KS4A 1XYPA 4QGMA 1QJU1 4HN1A 4JGYC 2D3RA 2HWF2 1UX7A 2ZJCA 5AVAA 3ZKUA 4LBMA 1GNZA 3CJIA 2WSUA 3MV01 4YGBA 2RS53 1MPXA 1RUH2 1UMIA 2QCSB 2WZR2 3RSJA 2XQXA 4GQ7A 2ES3A 1QNWA 5FP9A 5HCFA 2VMCA 2VC9A 5JMOA 2A5ZA 2EIGA 3H1YA 1JBCA 1YFYA 5J1XA 4YVSB 2PHFA 4UYBA 1FT9A 3JQWA 1O91A 3V0AA 1W9SA 1ZZ6A 1JYVA 4Q4X2 5CG9A 3O1PA 2D93A 4COYA 5FPXA 2HWB3 3J8F2 2N7GA 3DKWA 1WCDJ 3BU7A 5CISA 1NLRA 2LROA 1GZTA 4I0WB 1CD3G 2XQRA 1F35A 5LRRA 5F6LB 4IEWA 5A32A 3OBAA 2DUQA 4L0PA 4A42A 4F83A 3ZYJB 2ZMLA 4LLOA 4QQLA 3PJQA 4H55A 4A6SA 2WFF3 4AI1A 5C33A 1YNAA 1JYXA 4FI9A 4JAAA 2YC4A 1D4M3 3Q8BA 4CEYA 3W5MA 2E53A 3I4IA 1NQJA 4JQRA 4L92A 4OHVA 1LEMA 3DYOA 1OH4A 4QX8A 4K21A 1NOVA 2I74A 2F17A 4K1YA 4JZRA 3I54A 1IZ3A 3QLQA 4FTSA 4HETA 1BLZA 2V4VA 3OUHA 1EAH2 4QX5A 5C7GA 1RUC2 3GHNA 5FZHA 5A1LA 1MZ5A 5DDJ3 3V0BA 4FOYA 5JI9A 2RJ2A 1MZEA 4LBLA 4Y22B 2VXJA 2H0BA 4Q4W1 4V2WA 5KHJA 4TN7A 1F5JA 1HB4A 1QOOA 2BP6A 5FYCA 1W6PB 4PF1A 1EP0A 1HB1A 1CZSA 3F2ZA 2WINB 5H9SA 4DRVA 2W46A 2O0OA 1ZBA3 1WA6X 2D44A 1QOSA 1WMDA 5EJ3A 3UKTA 2CNAA 2WNVA 3V56A 1PGW2 5A32B 3ZR6A 2RR12 1SLIA 3B69A 4FT8A 3TNQA 1Q3EA 1TME2 5EWSA 4NN0A 1G9CA 5FTTC 3NMBA 3LCPA 4CEWB 4FAHA 1IS6A 1UF2C 2C4XA 1ZBE2 3AKPA 2IXLA 3U14A 2UURA 1OUXA 2DVAA 4YVSC 5JVVA 2RDSA 2GAUA 2E6VA 2OUJA 2X10A 3LEMA 3VBOA 3OY8A 5KHHA 3VBSA 5T54A 3I2DA 1E5RA 4S2DA 3NAPC 4DB5A 4QPGC 1XSRA 2HWF3 1VBB1 4QHZA 2QDNA 3BB6A 4QX7A 2PA7A 2WSVA 1Y3TA 3ACGA 2JDPA 3URFA 1PVXA 2ZEWA 2ZAAA 4PI0A 4KWLA 3VHPA 3CL1A 4R9AA 4BMEA 3KV9A 3OGJA 5FMBA 2ZHLA 1V6OA 1O4ZA 3ATGA 2V4AA 4FFIA 3AYDA 5F1RA 2G9FA 5EP9A 3QOPA 1O6UA 2QNKA 3GM8A 3FHIB 2EXHA 2WNVC 4D6SA 5AFEA 2YDEA 5IK8A 1AYN2 1X7NA 2VUDA 4R4ZA 4XPVA 3POYA 2XBO2 4MUVA 5FJHA 5C4WB 3LDRA 4P9YA 5FLHA 3HN3A 3RYPA 4Q4X3 2CDPA 1UKRA 2ZGMA 4KBBA 5F8PA 3T2PA 3KB5A 1MS3A 5FMDA 1TMF3 1AYM3 4YPJA 3RMYA 1O3RA 1POV0 1YRZA 1NCRA 3M3CA 3ZM8A 2RG4A 3OPZA 5FFOC 4J1WA 1YHFA 1ASJ2 2B42B 1UOFA 4GB31 2RMU3 4H14A 3RS6A 4YG6A 1GV9A 4MGTA 1JU4A 2XB6C 3TYJA 3WDVA 3FUOA 3ZYHA 4BXFA 2A1XA 1VAMA 2YGLA 3WNXA 5IK7A 1UY1A 1UIJA 1WZXA 2DCJA 1ZRDA 5GZCA 4KG8A 3WV6A 2JDNA 1LULA 1QNYA 1X50A 3DF0A 4AEDA 2RMU1 5BNNC 2AYHA 2W94A 3ZFFA 1AYM1 4XDQA 1HXS1 3MI8A 4NHMA 4QB2A 2HWD1 5FXVA 2EAKA 3UL2A 1SHWB 4UT5A 5BNQA 5LWBA 5LRSA 4A7YA 2D5HA 2X53S 1ZZ9A 2ZS6B 1JN2P 3POEA 4LXLA 1JOPA 1W6QA 2YV8A 3IDEA 1OLME 2GMEA 1ZVFA 3F95A 3PUIA 4UI9L 4XF9A 2QZ2A 2X5IC 4YW1A 1T6GC 1I3HA 2W2IA 5C4WA 3MFCA 3O1UA 3ETPA 1WLWA 1SCRA 2EIDA 1UZYA 1UY0A 1UQXA 1SLAA 1R092 5A3PA 1W8WA 1VBE2 3T2TA 1UY4A 3ZMNA 3APBA 3ZIWA 4Y5Z0 1G9AA 3ZR5A 3AZZA 1ODNA 3EB7A 4YGCA 3T1LA 2BEOA 3BI3A 4XCAA 2VQ0A 4EE2A 1OKOA 1UY3A 1O5UA 4I2OA 5JSPA 2J1UA 5DZEA 5LZ6A 4GB33 2EXKA 2XDVA 3WW4A 4NRQA 3RG0A 4B29A 1W8OA 3NVCA 5LATA 4AGRA 2ZKNA 3K48A 4LQRA 3PTRB 1DFQA 3IKWA 3MW3A 2ZABA 1JZ4A 2VVFA 2DVGA 3FX3A 3PU8A 1VB2A 4DUVA 1OA3A 2ID4A 1IKQA 5B4XA 1GU3A 4NPRA 4JCKA 3GBGA 3VD7A 2AENA 2JKXA 1WW4A 4FPFA 4URAA 4CXWA 1N1TA 4XUTA 1CIYA 3KHBA 4FOWA 2WNUA 1ULEA 1DGRA 2FHRA 4Y1UA 3H8RA 1BBT1 1EYBA 2DV9A 3OCPA 4Y22A 3WNPA 4FQ4A 3K4AA 3TN92 2R071 1VP6A 2D7FA 2XGXA 1WW6A 5DAWA 4ZZ5A 3BPSA 3VZLA 3ZFEC 1E5HA 1I6XA 1U5XA 3DEMA 4YM2A 4OHZA 4LKSA 5E88A 3AMQA 2JIGA 5DUVA 5T5LA 5CKMA 5KXDA 2FDGA 1ULGA 3TWIA 4LULA 3ZYBA 1O8SA 2X09A 4DEQA 1US3A 1DHKB 1WMFA 3EMRA 3VD4A 1KD7A 2BNNA 1IS3A 1UXZA 4PI2A 3RDIA 1RUF3 4GD4A 2X5IB 1VBC3 1Z7S2 2BV4A 3M4FA 4HK9A 4CPBA 4TZDA 3AXDA 5I91A 1NG0A 2HLEA 3VHNA 1LCLA 5ANQA 5GM0A 3NNLA 1UU4A 4LPLA 3THPA 3UJQA 1PO23 1ULFA 4NHLA 2FDFA 2D6MA 4COVA 4HMZA 3POFA 4FTBA 4MSVA 3AL5A 3IMMA 4O7XA 4AQ2A 5C6CA 1B35C 4K20A 3D8CA 5FZ1A 4YGEA 4E4SA 2KM2A 2OKXA 3O1TA 1RMU1 4N43C 1KDKA 4E2GA 4N9IA 1C8M3 4YVWA 3I2HA 4JGYA 5JIAA 4FXGB 3X29B 3EYPA 1NQDA 4QKDA 4XABA 4HSJA 1PGW1 2PAKA 3KS7A 4MOAA 3WQBA 2FCVA 2WLQA 2YPDA 1DGWA 3OGRA 1NAEA 3VZOA 5DZGA 5L7OC 3LEIA 4A41A 2MEV1 4HXCA 1BEV2 1H6XA 2R7EB 2EVXA 4P5YA 4AFAA 2VU9A 4LHKA 5IFTA 2ARCA 4META 4KU7A 1O59A 2A3YA 2PHLA 3N3HA 4IEYA 4AQ6A 3I3BA 2PQQA 2QQLA 3BUCA 1PGSA 4HPKB 1AXYA 1W90A 1ZNPA 4RQPC 4D7SA 3U0ZA 2XKOA 1UYPA 4UBHA 4W65A 3OSDA 4E4HA 2P6CA 1ZRIA 2ARAA 2AEYA 4H7MA 2OIIA 3B7MA 3WHUA 2HWE1 4AI3A 4HANA 4TSVA 2HWE3 2XHKA 4OZXA 3TEXA 3ZFGA 1AL22 3ZIXA 5FZ7A 2FDJA 1AR63 1MS1A 1BHGA 4HLTA 5A6ZA 2VBBA 3FL7A 3M8LA 3THTA 4BB3A 1AYN3 4CU7A 4IERA 3WY6A 4QAWA 4DRRA 4W6WA 1H2KA 2JECA 5FO8B 3PVBB 4GB32 4Y5SA 3U78A 3WDUA 4JGYB 3PVNA 2P1BA 1CR7A 4YARA 4WZFA 3NV1A 1UZZA 4LNVA 5IVYA 4AEDB 2YUEA 3BTZA 1S2EA 2A7AA 3VKMA 1JYTA 4AI9A 2DTWA 4GWNA 1AR92 3SISA 2E33A 4Y20B 1ASJ3 4GWMA 4YZ2A 5FZDA 1GKBA 3I59B 1HXS2 5FYUA 3K51A 1G9BA 2CSGA 3NO8A 5LA9A 4OULA 1TZOA 2A71A 1LOFC 5FYZA 2XJUA 2WYSA 2VCMA 5H9RA 5IJRA 4GJYA 4IEZA 3VZNA 1AXKA 1SLBA 3VN4A 1JHJA 1QXJA 5F32A 2WT0A 2R042 3FN9A 3WUCA 5FR3A 4I02A 4EQVA 1SEFA 2E63A 4AHZA 1VR3A 1CQ9A 3KHCA 3ZFGC 4LTAA 3RGBA 2OA2A 3HIFA 5DUUA 4Q0VA 4Q4V1 3AXEA 3UKNA 3H1WA 5BPXA 3KF3A 1HB2A 1US2A 2DF7A 3MIDA 2F6BA 2HWD2 2NZ9A 2XLAA 3WX5A 1QJX2 1R082 2P3KA 1SACA 4P00B 2ZMKA 4GZ9A 1RUD3 2F4PA 5B2GB 1VRH3 5EV7A 2WYFA 2WWJA 1RUG1 4S2HA 5FZOB 5KXBA 1QJY3 5E89A 1OLRA 2D6KA 2WQ4A 3N9QA 2DCTA 2DFBA 2GH8A 4CCDA 4QXHA 1JXNA 3SC7X 3GDBA 3QCWA 3UESA 5JZGC 1DQ0A 2AGSA 2CU5A 2WN2A 5F6KA 2O14A 4PIZA 3KGZA 1YXWA 2BGCA 3NRUA 2JE9A 1NXMA 5LW9A 1OFNA 4FFFA 4IV3C 2ZZQA 2DURA 5IAVA 2WS93 2Q1MA 4DQAA 1G9DA 3VZMA 4XILA 5KXEA 4FBFA 2Q0AA 5CNAA 5FPZA 2VOKA 2Y33A 4JGZB 1UIKA 1I9RA 1MS8A 2PELA 5A6XA 4AAPA 2WWSA 1C28A 2W08A 3CJIB 1OH3A 2R072 1HDKA 1VBD1 1VBA1 4XQWA 3WQ7A 5EIYB 4CDWA 4JTOA 5E1RA 4QB1A 3CKHA 5J7MA 1LHWA 1UYXA 3SEEA 4Y24A 3ZFFC 4CYDA 3R05A 4KH9A 1XNCA 2W1SA 4RSUA 1MEC3 4YVSA 3SNMA 3U4SA 1DP0A 3IM0A 1YFXA 4XXAA 5FPAA 3S5QA 1CJDA 3GCWA 5T52A 5JCTA 3R0RA 5KHKA 1LHUA 1NYWA 2IXIA 1SFYA 2PHTA 2X5IA 5IK4A 4BQ3A 4OZOA 1N47A 2GMMA 3WQ1A 1L7RA 5F3GA 4NHXA 1XBFA 5GLTA 1H1IA 3LGRA 5FYYA 5FWEA 5FY4A 2VO5A 2HWF1 5GZFA 1LOGA 1W9WA 1LRHA 3HOBA 3VZJA 2WT1A 2YC2A 3D82A 3WW1A 4Q4V3 1YFWA 2WC2A 1R64A 4UXAA 1C8NA 3TBDA 4OLLA 4LUKA 5FXWA 2JD9A 1DZTA 2W39A 3BTYA 2C9AA 2JG8B 5L9RA 1QQP2 4E2QA 5LEKA 2J1EA 2BWAA 1ZZ8A 2IZWA 1RB8G 3ACHA 4EWEA 1M06G 3HR9A 5L7OB 3SITA 1JI6A 2Y6GA 4FPGA 5C5TA 3CQOA 4AYUA 2WO2A 4N9HA 2A6XA 1GQGA 4IE6A 2FD8A 4C0BA 3AYAA 4B4RA 1YC61 1XU2A 4M0HA 4JQTA 4DXRA 5C8CA 2B8MA 3OEAA 4X6RB 4XFGA 3WDTA 5CFDA 2QQNA 4YM1A 3O1OA 3NJZA 1W6MB 4Y1YA 1D4M2 1S0IA 3DKQA 3WSOA 4AVBA 2ZAHA 3PU3A 2QQJA 4DZGA 2ZGLA 3LEGA 3S7EA 5FBZA 3C3VA 5GLUA 3UT0A 1ZZBA 4IGOA 5LBCA 1JOJA 1BEV1 5EJZB 1STMA 5JI7A 2DCYA 5HCAA 5IVCA 2PHWA 2GH2A 2WIIB 1HRI3 2VZVA 4EZHA 1K3IA 4S2FA 2Z69A 1RUE1 3OYWA 1Y7BA 3EBRA 1W2OA 3GBFA 1FMD2 1AR91 2Y38A 1ND3C 3B00A 5FZ3A 3SKVA 1O7FA 1JZ2A 1CAWA 5FCCA 3IZOA 4WM7C 2Z4FA 5HPOA 5JUVA 3IT8A 3HN1A 2OPWA 5FAXA 5JIUA 1UZVA 2ARXA 1KXGA 1VB4A 5LA1A 1RHI1 2CL2A 1W0OA 4R9CA 5FO9B 1TME1 1XE8A 4AVSA 3VBHB 3S7IA 1RUOA 4LE3A 2AH2A 2Y60A 2R32A 4JHZA 4LEJA 4AL9A 4DNYA 2GNDA 3D0SA 1MEC2 5D1IA 5ACA3 4X6QB 4DINB 2D6PA 2R1BA 4IGQA 4B7EA 1OI6A 4RR3B 2J1VA 2OQ6A 3KGLA 3O12A 4AF9A 3RQ0A 4HPKA 1NXD1 5A7OA 1ND3A 2P3IA 4RQPA 4IE7A 2B46X 3DV8A 2VOVA 3T0BA 5D8AA 1QMJA 1V6JA 4YVWC 1S55A 3CDZB 4JRLA 2Q8OA 4UFMA 3VBFA 1LESA 3HEIA 3A23A 2J1SA 2VECA 1PO21 1OLQA 2KR2A 5FWJA 3SH4A 3N7MA 2VOTA 2ZA9A 1OPMA 3GNEA 1MS5A 4AW7A 1ZRRA 3TEZA 2OS2A 5EHDA 3R6SA 4ZS2A 3WNOA 5B4NA 2R30A 4E27A 2ET1A 4JDNA 4QQHA 5FLIA 1NA1C 4CDUA 2VCAA 5BUVA 1IKPA 1GP5A 1CAUB 2ZGNA 5FZ8A 4CZSA 3I97A 1EY2A 2WDBA 1W3VA 2K9ZA 1ULDA 1YQ2A 1AYN1 1PIV1 4QPWA 2MEV2 3H1MA 3PUSA 5BYNA 3R4UA 2E7TA 1QIQA 4GJZA 1AX0A 3FWEA 3AYCA 2GNTA 2MPFA 3AJZA 4KBZA 1WLTA 4CRQA 5A6QA 5A3LA 1BZWA 3O1SA 2VR4A 1FOD2 3OGGA 2DCZA 2EICA 4DOUA 1NCRB 4IV3A 1DQ1A 1VBD2 1W3XA 5FUPA 2VTXA 1MR5A 1YEWA 1E5SA 1HJFA 1NUKA 3KVAA 4GKYA 3AP5A 4XYXA 4ZKTB 3ZSMA 4KL1A 3K4ZA 4ZZ8A 5A70A 2Z5WA 1NY72 3S30A 5HV0A 3W21A 1DIWA 2JWPA 2ZCWA 3OGSA 3QH7A 5AC93 3T08A 3BVCA 3O14A 1IPKA 1CPNA 5FPLA 5K4LA 4DS0A 2ZX0A 2FMYA 4Q2FA 3VL8A 3H9AA 2CAVA 3DL3A 2A3XA 1JS9A 3HWJA 2PHXA 3LEKA 1NZIA 1OQEA 4UOJA 4KGGA 1CWPA 1B35A 4AVTA 3RRDA 1GR3A 1RVF1 3NQHA 3VD3A 1GUIA 4GXLA 4OUEA 2VJXA 1YIPA 4KWJA 4XUQA 3MIHA 5FKCA 2BNOA 5LK5A 1V6MA 3POJA 3M3QA 1FNZA 4NR1A 1JZ5A 2VTXJ 4HK8A 3U11A 2VMIA 4PIYA 3I49A 4QGLA 2D40A 3O1VA 2QQOA 1QQP1 3MLJA 4N8MA 3WD5A 4BQ1A 5M0TA 5CFCB 1AR83 1MS0A 1RUF1 3ZXLA 1WGPA 3CEWA 1R1A2 2EIEA 5C3PA 5CZKA 1KGYA 3FMGA 3HQUA 5FZ4A 4SBVA 5FJKA 2E32A 1DZQA 1LU2A 2YGMA 3GXUA 5GLWA 3IPVA 2CHHA 1A34A 2J7MA 1C5HA 4RGGA 2OPKA 3CLPA 1QJU2 4ZS3A 2VVEA 4AE2A 3N35A 5C9AC 4CDQB 2V5YA 5K9YA 1DQ2A 4K7JA 5D8AC 5FYHA 1GICA 4WVMB 5ABJA 1I5ZA 3AL6A 4LO4B 1SG3A 1NA1A 4LHLA 3M3EA 3WP5A 4V2VA 1RUJ2 1XYOA 1DYOA 1ZBA2 4Y4RA 2WZR1 3LDKA 3A22A 5FLJA 3NV3A 2DU1A 1FATA 1UNBA 2R0HA 2VGDA 3VKOA 2BBVA 2G1MA 4RYDA 5FYBA 4LA3A 4FP3A 1OFSA 3C7GA 3E97A 1UMHA 2HJIA 4I3PA 4R8HA 4CU6A 1XU1A 5C8CC 2Q30A 4MHUA 3SMHA 5FY7A 4AGVA 1Y43B 2UWBA 2K0GA 1DGWX 1LOCA 2WNUC 2ZZJA 5GLZA 1CAWB 2VNOA 2OYZA 3ORJA 5FQ0A 1SLLA 3OJBA 3ITQA 3PURA 4GIQA 4IE0A 4WM7B 2BBAA 4QXBA 4TLGA 3VLBB 5A33B 5L19A 4MHRA 1GFF2 1UPSA 3ZLIA 1H6YA 1N3PA 4WZCA 5FY5A 5FZFA 3QBQA 2LS6A 5DN2A 2RS51 5EJ1B 2P5BA 1K5JA 2IWGB 1LR5A 3T2OA 4N43B 1H8TC 1LOEA 5APAA 1OVSA 3RZHA 1H8VA 4XC9A 1ZA7A 3WT3A 2Y26A 4IUGA 3K77A 4RA0A 3SXWA 5HBAA 1VBB3 4D0QA 4XMIA 4OQ8A 1BEV3 1OKQA 2WT2A 4GWJA 1ZRCA 1XOYA 5LBEA 5AC92 1ENSA 1TE1B 1PMIA 2FDKA 4LO8A 2RDNA 4KNCA 1QF3A 2C9KA 2KXLA 2VXRA 3POWA 1DBNA 5K8SA 4LO7A 5FOBB 3UNPA 1W6MA 4QPGA 5JZGB 4BLIA 2WO1A 2QE3A 4MXVA 2D97A 3LF7A 1WCUA 3NNFA 5IUQA 3AC0A 1EAH3 4EROA 2WFF1 4H2AA 4RD7A 2VQAA 3VD5A 4Q1RA 3L2HA 3VKLA 2BYVE 4B4PA 3VD9A 2EA7A 5BNPC 3H0OA 4I30A 2WQZC 1FYUA 1VAKA 4XIOA 4C0HA 1W8NA 1W39A 2BFUL 4LIUA 3USUB 3PUAA 2WR9A 4NHKA 5GLVA 1RUH1 1XB9A 3KV5A 1PHMA 2NM1A 3JBG2 4XDPA 5LA2A 3EQEA 1PX3A 2RV9A 3MEPA 3MHZA 4LKFA 3NAPA 2Q4SA 1PZ7A 1YQ6A 2WUHA 1H4GA 3U75A 3ZX7A 3P3NA 4W6YA 4COWA 4Q4W3 2VMDA 1R093 4DPNA 2P6HA 4P9XA 3AKQA 2XL9A 4E9KA 2DU0A 3DYPA 4A44A 2QQKA 2IXCA 1SDDB 4P9IA 3MZHA 4AI8A 1FXZA 1MQTC 4OI4A 3RWNA 1COV3 4I09A 1OA2A 4K40A 1UU5A 4CEWC 1J3QA 4P9GA 4LHSA 3IDAA 4BH9A 1HKDA 3LSDA 3SLIA 2WNUB 4AEKA 5A7QA 2RJLA 3T3YA 1OOPA 5JXHA 2OZJA 1D4M1 1YFUA 2VW2A 1BBT3 4M00A 4MZUA 4QD2A 1CONA 1YJLA 1LHVA 2D3PA 1RXFA 3LFMA 4E4DX 5A1FA 3G7DA 4M3CF 1WWYA 4O61A 5K0UB 1O3QA 3OB8A 1VBE3 4CU9A 4NUBA 3CU7A 5I8TA 4GULA 3CBNA 5L9BA 4NJ4A 4K3UA 2GZWA 1IS4A 3MUY1 1TNFA 4E4ZA 2VOXA 4ITCA 5JXGA 5KR7A 5I8SA 4A6OA 2P2KA 3ZXFA 5JWPA 4NRMA 4XEZA 1MVEA 2VBPA 2YXSA 3I2GA 2WZEA 1ZM1A 4Y1VA 2B9VA 3SCGA 2ARBA 3GJAA 5FZLA 5FZEA 4CP1A 2XPJA 4BQ4A 2PLV2 4R9BA 1DQ4A 2GP3A 4HVRA 2AZ5A 2RM21 1RTVA 1XQNA 3BCWA 4Q4V2 5FUNA 4A7KA 4OHXA 1LB2A 5F3EA 1A8MA 3HT2A 1NLQA 1POV3 3PMSA 3WHTA 5JPMB 3E6CC 2C24A 1QJX1 2GNMA 5F39A 1WLCA 1A78A 1YUDA 1RC6A 4WM8B 2RR11 4LBQA 1BK1A 2QQUA 3FFQA 2Q8EA 3VBSC 5JSRA 2VMEA 1W8HA 4RS5A 1VMJA 2ZBJA 2JB4A 4IV3B 1VBC2 1Z7S3 2VVDA 3MF6A 1G8WA 3AYEA 3UGFA 1U0AA 3RZKA 3PIJA 4IEXA 4MADA 4CDQC 3NL1A 5CG8A 1PO22 3BALA 4L9BA 2GSYA 1W2TA 1UO9A 5F7UA 1IPSA 2Z42A 4CDXC 4RHV1 5FYMA 3OBRA 1WD3A 1QWRA 2UY8A 4KWKA 4GMP1 4Y4YA 1H9WA 3KQ4B 4IW3A 5FZBA 1R1A1 2W95A 4OYUA 3VBUA 3S5AA 4YM0A 3D6EA 3CZJA 4MLOA 3S6PA 2VMHA 3DXTA 1QOTA 4XF1A 5CAZA 1PZ9A 3AFKA 4X8NA 5A7WA 4B8EA 3MUZ1 4RS5C 1W6OB 4BJ0A 1FPN2 1OXCA 2VW1A 3N9NA 3PLQA 4MGIE 1UXXX 1L7QA 1PIV2 2YROA 1C3HA 1RYYA 2JDHA 1KDMA 2PFWA 1VBA3 4O9EA 4EN8B 4NIDA 4UFHA 5DG2A 4MO3M 1FOD1 2ILMA 3A21A 3D4KA 2IC1A 4HZFA 2CDOA 3FLTA 2VOWA 4C8DA 1O5LA 2DVBA 4LK7A 1PX4A 4Q1PA 2XBO1 3O0XA 1JYCA 1HX6A 1HV1A 4IEPA 3VBHA 3PUHA 4CCNA 1WMEA 2G9ZA 1GWLA 3EO6A 4C90A 4AAXA 5I8YA 5LEJA 2GALA 1H1MA 1O3SA 4LT5A 5ABJC 3HQRA 3DUIA 5FK8A 1RUC1 3TEWA 4JC1A 2JG8C 3A4UA 3LIGA 3TOJA 2E51A 1S0FA 1IHMA 1OUSA 1D4VB 1RMU3 1W9FA 4PHZA 4N53B 2XJQA 2FDHA 1WD4A 3RPQA 4RQPB 4NIAA 1AR71 4JTNA 1LU1A 3PVOA 3WDXA 3N9OA 1CAVA 1W6NA 4MVTA 4CCLA 4OMCA 3AFGA 4FPJA 1UN1A 1YQ5A 4Y1ZA 3VBSB 3VBRC 5IT6A 2B39A 1T6BX 1IOAA 1HRV2 1Q43A 4IXLA 2VNGA 1HN0A 1K12A 1V00A 2D98A 4RHV3 3R4DB 2W1QA 3WEZA 4FTEA 3NW4A 4J1XA 1JYWA 1YLLA 3ELNA 4GKXA 4XFBA 4KI5M 2UWAA 2ZKLA 3KQRA 3OY8B 4LMFA 3TRSB 5DXDA 1QU0A 4XQDA 3RZZA 3C7HA 4LBJA 4FOVA 1HJGA 1Z7S1 1GBGA 1A3KA 2D43A 3WP3A 4PJYA 1W8ZA 1WLDA 1REDA 2P4EA 5A3OA 3UETA 4AFCA 3FBMA 4N43A 2PAEA 3DPRB 4M3CE 4UW4A 5I0UA 2JX9A 1YO8A 3H3UA 2ZX1A 3FLPA 5DABA 5FBJA 2WFF2 2QDRA 3LA7A 3JD72 4L8QA 4KWUA 1W2AX 2HYKA 4HG6B 2DVFA 3QACA 2CTVA 1I1EA 1GWMA 4J6GA 3RJRA 1DU3D 2JKBA 1G6NA 3AZYA 2DFCA 2GN3A 3NKGA 1JW6A 1NCQC 3EHKA 4Q0UA 4YRDA 3USSA 4CCOA 3NJXA 1LOFA 4ZPIA 1SBEA 2XJTA 5BNOB 1BVVA 3LOIA 4XUOA 2FCTA 3MLLA 3RFRA 3VKFC 5FDBA 4LOSA 3H8UA 5JMCA 1PGL2 2TEPA 2A70A 3WINE 2YHJA 3H8OA 1MZ6A 2GU9A 4XAAA 2H6CA 2Q1ZB 4QDQA 2ORXA 1Q8OA 1VE0A 2JICA 4Q27A 5CYYA 2QUOA 3UGGA 3O0VA 1ZBE3 1Q8VA 4UFIA 5EZWA 1VIWB 2WQ8A 2YZ4A 1GZCA 3N9PA 2RR13 1VALA 2QQVA 5CB7A 1URXA 2KD7A 1G86A 4P14A 3SCHA 4XBNA 4AZZA 3AMMA 4FSJA 4OI0A 2ZMNA 4FFHA 1XJAA 3ZFEA 3POSA 2QVSB 4PLNA 5FOJB 2RE9A 3ZYFA 3AP4A 5D8AB 2AACA 1F5FA 3IWZA 4ARYA 2PLV3 1NCQA 2MEV3 1QH6A 4MGSA 5CFCA 1HV0A 2FMDA 5T55A 2HYXA 1WW5A 2E7QA 3IMNA 3VB9A 3WF1A 1LODA 4LO6B 3U37A 2J22A 5FREA 2R061 3Q8FA 2EXJA 2JENA 5F5QA 2DWRA 3HBKA 4CU8A 1N1YA 1U5IA 4J25A 3U10A 3V0AB 4MX3A 4CDXA 1L3JA 2C1FA 4LITA 2ZACA 5F9TA 5K0UA 3VBUB 3MPBA 1EUUA 4XZPA 4B7KA 1RMU2 1IS5A 1TMF2 3Q8AA 4G4FA 3ZXAC 4OQ9A 2IXJA 3L9JT 4Y33A 4BK5A 2VM9A 4QM9A 1VRH2 4BMBA 3CJXA 4S2GA 1RIRA 4CXYA 3QH6A 1VBC1 5T3NA 2DBIA 3HNMA 4FCAA 1QH7A 4EWDA 3KSCA 1XXNA 3ACIA 3WP6A 3MBWA 1V6LA 4FVVA 5FXXA 4DEVA 1HRV3 1RINA 4NHYA 2UYBA 3KT1A 5F2WA 4EN7B 1XNTA 1Q8QA 2W91A 2ZGRA 3WVJA 4XIKA 1PMHX 1OA4A 2VE1A 4YW5A 4QPIA 3AMNA 1IPJA 2YFUA 4XJAA 3I2OA 4IL7A 2FCUA 4ISRA 4TWTA 1GP4A 2OUHA 3DGTA 3LDBA 1EV12 5DUWA 3W58A 5I0SA 1NX9A 1UD1A 4HN0A 3WG1A 1DQ6A 2CWMA 4Q26A 2NQYA 4QGNA 1SDWA 3TN91 4LBKA 3FFZA 3PTYA 4BQWA 5DQ0A 2OVUA 5FY1A 4FPEA 5IAXA 5FP8A 4E2SA 5BNPB 4Z2WA 2ZGTA 1UYYA 4QKNA 2W87A 1N1VA 4HBNA 3EJKA 5H9QA 1ZRFA 4Z8BA 4YNIA 4FPOB 5LCWL 1JTZX 4UWDA 1PVC3 2WS91 4ASKA 1BK0A 4C1XA 4G3YC 1FMD3 1IQDC 3AX4A 4NO4A 3GBWA 3GZUC 1Q8SA 2ZGSA 1CGPA 4U2AA 5IVEA 1SBFA 3VBFB 3JU9A 4H7LA 5FP4A 2CWSA 3MICA 4NROA 3B5LB 4F7ZA 2JG9B 1ULOA 3HBZA 3C8XA 2VZ1A 1JYNA 4XF0A 2WA3A 2Y34A 2BUKA 1UY2A 1G7YA 2XR4A 3T2QA 3WCRA 2ZEYA 1AJKA 4LHNA 3T4VA 1PK6A 1NLSA 3B93A 5KHIA 1KEXA 1DLLA 2HEWF 3K46A 4LKEA 3C7FA 1GOFA 4YW7A 3UV9A 4FPHA 4BQ5A 5C8WA 1HRV1 3U4XA 1FV3A 1YI9A 2HBTA 4IV1C 4DIQA 1DGLA 1YI7A 4Y3OA 3VBHC 4XF3A 1R081 3ECQA 5I0TA 1RUI1 1DDLA 4EWAA 4A3ZA 5CFDB 1LKNA 3ENRA 4DFSA 1W28A 2VULA 1H9PA 4H3WA 3RJ2X 4QXKA 2VG9A 3I3QA 2QJVA
chains in the Genus database with same CATH topology
5DAWA 4BQXA 5LBCA 2G19A 5DAXA 2RDRA 2JIGA 2V4AA 5LASA 3HQRA 5EP9A 4J25A 3OUJA 3EMRA 5M0TA 3NNJA 2HBUA 5EPAA 5HV4A 4Y5TA 3GJBA 5DAQA 3OUIA 3NNLA 4ZONA 4NHLA 5LB6A 3HQUA 2OPWA 2RG4A 2RDQA 5IAVA 5L9BA 2Y33A 4NHYA 3KT1A 2A1XA 4XABA 2FCVA 5C5UA 4NAOA 4NHMA 2FCUA 2G1MA 3GJAA 2JIJA 3NNMA 3PL0A 5DAVA 5ERLA 4BQWA 4MHUA 4XACA 5DAPA 4JZRA 5LBBA 3W20A 3KT7A 5IAXA 3OUHA 4NHXA 3OBZA 3ITQA 5L9VA 4MHRA 4UWDA 4ZPIA 5IATA 2FCTA 3GZEA 4XCBA 4Y5SA 4XCAA 3KT4A 4KBZA 4XAAA 4XC9A 5L9RA 2Y34A 5LBEA 5LATA 4IW3A 5LBFA 2RDNA 4Q5OA 5C5TA 5EQUA 2RDSA 3NNFA 5LA9A 5HV0A 3W21A 2HBTA 4BQYA 3BVCA 5A3UA 3MGUA 3DKQA 4NHKA 4NMIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DAW A;  4BQX A;  5LBC A;  2G19 A;  5DAX A;  2RDR A;  2JIG A;  2V4A A;  5LAS A;  3HQR A;  5EP9 A;  4J25 A;  3OUJ A;  3EMR A;  5M0T A;  3NNJ A;  2HBU A;  5EPA A;  5HV4 A;  4Y5T A;  3GJB A;  5DAQ A;  3OUI A;  3NNL A;  4ZON A;  4NHL A;  5LB6 A;  3HQU A;  2OPW A;  2RG4 A;  2RDQ A;  5IAV A;  5L9B A;  2Y33 A;  4NHY A;  3KT1 A;  2A1X A;  4XAB A;  2FCV A;  5C5U A;  4NAO A;  4NHM A;  2FCU A;  2G1M A;  3GJA A;  2JIJ A;  3NNM A;  3PL0 A;  5DAV A;  5ERL A;  4BQW A;  4MHU A;  4XAC A;  5DAP A;  4JZR A;  5LBB A;  3W20 A;  3KT7 A;  5IAX A;  3OUH A;  4NHX A;  3OBZ A;  3ITQ A;  5L9V A;  4MHR A;  4UWD A;  4ZPI A;  5IAT A;  2FCT A;  3GZE A;  4XCB A;  4Y5S A;  4XCA A;  3KT4 A;  4KBZ A;  4XAA A;  4XC9 A;  5L9R A;  2Y34 A;  5LBE A;  5LAT A;  4IW3 A;  5LBF A;  2RDN A;  4Q5O A;  5C5T A;  5EQU A;  2RDS A;  3NNF A;  5LA9 A;  5HV0 A;  3W21 A;  2HBT A;  4BQY A;  3BVC A;  5A3U A;  3MGU A;  3DKQ A;  4NHK A;  4NMI A; 
#chains in the Genus database with same CATH topology
 2D6L X;  3J7M A;  3JB8 A;  1AF9 A;  3B02 A;  4RGK A;  4BQX A;  4CDW C;  5BNO C;  4Z2A A;  1S1A A;  4LO5 B;  2BW8 A;  1PNF A;  4DY5 A;  1SFN A;  5J36 A;  3GAL A;  4YLZ A;  1Y9G A;  4JX0 A;  1HIX A;  2HH9 A;  5DG1 A;  1ENR A;  4XF4 A;  5JSO A;  3O5S A;  3ZYR A;  4COU A;  1W8F A;  3VBO C;  3NJY A;  5FQ0 B;  3NJV A;  4PBP A;  1FPN 1;  3RNS A;  3OGV A;  1AX2 A;  4PCR A;  2PYT A;  2E7A A;  2HBU A;  2C26 A;  1ENQ A;  2WAA A;  1E57 A;  5F5I A;  2CAU A;  3H8X A;  4CP9 A;  3BIW E;  3MW2 A;  2V09 A;  4AK3 A;  1JZ8 A;  1AUY A;  3FBY A;  4AHX A;  3ZN4 A;  3AZW A;  4CUB A;  3LSE A;  4ZON A;  4AHY A;  5LB6 A;  1S4C A;  4D7T A;  4DUW A;  4K8F A;  2XUE A;  5IVB A;  1AR9 3;  4HVO A;  3CIH A;  4LIV A;  2A6Y A;  1W9Y A;  4CXX A;  1WCS A;  3I59 A;  5IYY A;  3O0W A;  3SHR A;  1QJE A;  1REE A;  3AKT A;  4IND A;  4CEY B;  2LM3 A;  3JBG 3;  4JV4 A;  5C71 A;  5HXV A;  1CVN A;  1GNH A;  2BRT A;  1IGO A;  3MPP G;  4WM8 A;  4AEJ A;  1C1L A;  3E5U A;  2LUW A;  1GAN A;  1RUE 2;  3WG4 A;  2UY9 A;  4AVV A;  3M3I A;  1FMD 1;  3BN6 A;  2AEZ A;  5BNO A;  4CUC A;  1QDO A;  3ZDS A;  1RUC 3;  3V0B B;  2Q8C A;  5IW0 A;  2R06 2;  3K3N A;  2PAM A;  2XHN A;  5FPU A;  2BNM A;  2QZ3 A;  5DAV A;  1HLC A;  3RZG A;  3VDB A;  4RS5 B;  3USU A;  2DBN A;  2R1D A;  3VBR A;  4IV1 B;  3IDB B;  1XYN A;  1OLM A;  5LBB A;  3W20 A;  1DGR N;  1UYZ A;  3OF1 A;  3ZN5 A;  3CO2 A;  1FPN 3;  1Q56 A;  1SLC A;  4ORF A;  2VY0 A;  2JEM A;  1U12 A;  4UFJ A;  3VDD A;  5CFD C;  3GGL A;  2ARE A;  1QGL A;  1BQP A;  2VL4 A;  2XL7 A;  4WBB A;  5ANN A;  3W9A A;  1JZ3 A;  1V0A A;  1I5P A;  4QX2 A;  4HSL A;  1DZR A;  1WW7 A;  3BOP A;  3WF4 A;  1PO1 3;  1S0J A;  2XLG A;  2HKX A;  2P37 A;  1JZ7 A;  2FZ2 A;  4OI2 A;  4B1L A;  2VUC A;  2YG0 A;  4A7Z A;  5JOZ A;  3PUQ A;  4XCB A;  4O9G A;  4ES8 A;  2B5H A;  2Y64 A;  2PN5 A;  2YB7 A;  5ISL A;  3VBO B;  5KXC A;  3HVD A;  3ALQ A;  2HWE 2;  1OUR A;  4Q4X 1;  3ME2 A;  5JOW A;  1F8V A;  4HFS A;  1PIV 3;  1ENX A;  4MXW B;  3LPG A;  3LZZ A;  2WFP A;  4ARX A;  1TNR A;  4QQ2 A;  5J3U A;  2J42 A;  3D3A A;  3UKV A;  4JGZ A;  3CZU A;  4OCT A;  4XBQ A;  4A45 A;  4AWD A;  4XFI A;  5HCB A;  4XET A;  3J9S A;  4LBQ B;  5LY1 A;  4LKD A;  1HXS 3;  4QT6 A;  1LJ7 A;  2R04 3;  3AVR A;  2VTF A;  3OPW A;  3T0A A;  4KMQ A;  1XRU A;  5KC6 A;  2Y6K A;  1S0B A;  2O8O A;  1HW5 A;  3B9I A;  3J7L A;  5C9A B;  3VDD B;  4UF0 A;  5F3C A;  1CAV B;  3ZSJ A;  1HQW A;  1W6N B;  2PHR A;  1JMU B;  2CGN A;  3UGH A;  2DUP A;  4JGZ C;  4NVP A;  2A73 B;  1B09 A;  1GZW A;  4L2N A;  3CNA A;  4NIG A;  5CKN A;  4CPB D;  4MG2 A;  4UAP A;  4N53 A;  1J58 A;  5FIX A;  5IHR A;  1RGS A;  4BYY A;  4B1M A;  5BXX A;  1V9U 2;  1O8P A;  4CP2 A;  2VZT A;  4ZXE A;  3KCY A;  2CYF A;  2XML A;  1S2K A;  3AP6 A;  3ON7 A;  1ND2 C;  2YU1 A;  4GH4 A;  1SQ4 A;  3ZFF B;  1K42 A;  2NN8 A;  5LAS A;  3DPR C;  3VV1 A;  5ACA 1;  4CVU A;  4M0N A;  2OZ6 A;  4CCE A;  5IVV A;  4QKF A;  3WF3 A;  1UPI A;  2JG9 C;  3MF9 A;  1H2L A;  2RS3 3;  3ES1 A;  3I2I A;  1PVC 2;  5FO7 B;  2Z2S B;  2ZTN A;  3ASI A;  3OOX A;  4K8R B;  5A3N A;  3GJB A;  1A8D A;  1VMH A;  1OPO A;  3FC0 A;  2JG8 A;  5H9P A;  2XJS A;  2GP5 A;  2BQP A;  2ENR A;  4MGZ E;  5J96 B;  1MZF A;  5IK5 A;  4P9W A;  4YZ4 A;  2BU9 A;  3AZV A;  2PXJ A;  5FZO A;  4UBG A;  3RYK A;  1OD3 A;  3C2U A;  2A6V A;  3MIE A;  4M01 A;  2ZHM A;  1AYM 2;  2B4K A;  3NAP B;  1ZBE 1;  3UYJ A;  3IPV B;  5C9A A;  4ZXK A;  5CVR A;  4FXK B;  2NP0 A;  2IXH A;  3SCF A;  4PLM A;  1RUD 1;  2FDI A;  1UZW A;  3ZPY A;  1W99 A;  5F37 A;  2QQM A;  3ILF A;  2GC3 A;  3M2M A;  5A7W B;  4NAO A;  1YQC A;  3JCI A;  4D94 A;  4MGY E;  1COV 1;  1J1T A;  4YWA A;  2W92 A;  2OT7 A;  4QU1 A;  5FRA A;  4GMP 3;  5F5C A;  3W59 A;  1VBB 2;  1ND2 A;  1WKY A;  1BJQ A;  4ZY9 A;  4QHB A;  4EN6 B;  2VD7 A;  1AJO A;  5FYV A;  3M70 A;  4L99 A;  3ZYI B;  1YYN A;  4P02 B;  4PT6 A;  4W6X A;  3N9L A;  3POG A;  1RVF 3;  1SPP A;  4N53 C;  4DXS A;  4FPL A;  1EPW A;  4B4Q A;  4P9J A;  3RI8 A;  3GHM A;  1MVQ A;  4QQP A;  4YW3 A;  3WCS A;  4XFA A;  2JJ6 A;  5EFU A;  4PIX A;  3U1X A;  4AI2 A;  4V1P A;  4YG0 A;  2J1T A;  4K1Z A;  1FV2 A;  4JHT A;  2W9X A;  2JDK A;  4MH0 E;  1KJL A;  3U07 A;  1BVP 1;  2NYY A;  4WM7 A;  2AUY A;  3OYW B;  4XUN A;  5A33 A;  5CBL A;  1AXZ A;  2YBS A;  3RMX A;  3ZFE B;  1C5I A;  1LGN A;  5FYS A;  1WCK A;  2FQP A;  2ZX4 A;  5FMC A;  1SBD A;  3KT4 A;  3VGI A;  5C3S A;  1YWK A;  2E26 A;  2Q5T A;  4N7U A;  4IGP A;  1PM7 A;  3N9M A;  4Q4W 2;  1FI2 A;  1AHS A;  1SMV A;  1CX4 A;  1RHI 2;  4CCC A;  1X8M A;  1ZA4 A;  1XNA A;  3P1I A;  4YGD A;  5J37 A;  1K45 A;  3VUO A;  2WO7 A;  3GZT B;  4ATE A;  3A0N A;  3E6B A;  2C0Z A;  1L7L A;  3KF5 A;  2EAL A;  3OG2 A;  1W03 A;  4XHB A;  1UZ0 A;  1XNB A;  4IV1 A;  4A4A A;  5IVF A;  4RGA A;  1CPM A;  1RUE 3;  2VCC A;  4UW5 A;  5GAL A;  2VMF A;  3POI A;  2D5F A;  2JE8 A;  4QX0 A;  3WNM A;  5A6Y A;  3N7J A;  4BDV B;  2VZO A;  3LD8 A;  3TAY A;  5FV3 A;  3WZ1 A;  3HNB M;  4JKL A;  2DCK A;  1F31 A;  2R06 3;  3DPR A;  3AKS A;  2W47 A;  3OD0 A;  4CDU C;  4RR3 C;  3E1F 1;  4WVV A;  3BTX A;  3M1H A;  4WVZ A;  5KC5 A;  4QHO A;  1EUT A;  3KWV A;  3E6D A;  4TXW A;  5GZD A;  4CP9 B;  3P5B A;  3J8F 1;  4QX1 A;  5HCH A;  1UX6 A;  5D2A A;  2XLF A;  3GF6 A;  4QXC A;  4LUM A;  4FOQ A;  1X8E A;  4XUR A;  1JOB A;  2GN7 A;  3LA2 A;  1J3P A;  3NNG A;  4QPI B;  2WAB A;  2BWC A;  2VQU A;  2Y6F A;  5HV4 A;  3T09 A;  1RJ8 A;  1GP6 A;  5CEH A;  3HMY A;  1PGL 1;  5I93 A;  4XAE A;  4FQZ A;  4GA9 A;  4XJ8 A;  4BIS A;  2ZOE B;  4MYE A;  1ZBA 1;  2WRA A;  2VAU A;  4CCJ A;  2VZP A;  1W9T A;  1XNK A;  4AVC A;  3LAG A;  3VDD C;  1QJZ A;  3KD4 A;  3ZN6 B;  5GZE A;  1EAH 1;  4XBL A;  5FZK A;  1LGC A;  1BCX A;  1EV1 3;  3Q8E A;  5FP7 A;  4D3W A;  3J7N A;  4AFD A;  3O1M A;  4FPY A;  2HWC 3;  2XUM A;  5C5U A;  5JLV A;  4AXO A;  1NZC A;  4CDX B;  3O1R A;  4Q0P A;  3R4S A;  4M4R A;  4XJW A;  4D7Y A;  1H2N A;  3C7E A;  1M4W A;  4NRP A;  2MHF A;  4DO0 A;  3CF6 E;  3QD6 A;  5DDJ 2;  2ZHK A;  1RXG A;  3NNM A;  3PL0 A;  1MEC 1;  4KQ7 A;  4QPY A;  2PMW B;  5ACA 2;  1NE6 A;  1P8J A;  2JG9 A;  4QKB A;  5L9V A;  3RZM A;  3OBT A;  4LOT A;  3ILN A;  1MQT B;  4XAC A;  3KMH A;  1PVC 1;  2V5D A;  3H7Y A;  5A7P A;  1AVB A;  3PNA A;  3KM5 A;  5J98 B;  4B3N A;  1ND3 B;  1RVF 2;  1GYK A;  1W0P A;  3OBZ A;  4KU8 A;  5L73 A;  3ROU A;  2QTW B;  4YZ1 A;  4NPL A;  4PQ9 A;  1FX5 A;  2YYO A;  4AHW A;  5C70 A;  3I2J A;  3MIB A;  4FFG A;  4KGQ A;  3AJY A;  1TME 3;  1ZYB A;  5JOY A;  2TUN A;  4QDR A;  3M7A A;  1VMF A;  4I01 A;  3LQC A;  1JZ6 A;  1DQ5 A;  1C4R A;  1FOD 3;  4XFC A;  1KFU L;  5ABJ B;  3VDA A;  1J84 A;  3PDQ A;  5EYY A;  2X05 A;  2CGP A;  1CAX A;  1JOD A;  4ZHN A;  2P34 A;  1VBE 1;  1TEI A;  1APN A;  1CAU A;  3VHR A;  5CFC C;  3L2Y A;  3ZSE A;  3RZL A;  4IDZ A;  3VZK A;  3NWK A;  5LBF A;  1O4Y A;  2BPA 2;  1KIT A;  2E31 A;  2FZ1 A;  4I0A A;  1TQ5 A;  2XKP A;  5DUX A;  1ZZC A;  1C8M 2;  4YZ3 A;  4IEO A;  3TNP B;  2HEY F;  4Z07 A;  3ZSL A;  1W06 A;  2H6B A;  2JE7 A;  1JUI A;  1OF4 A;  3JBG 1;  1ZX5 A;  2I45 A;  4Q8L A;  1WBF A;  3O7O A;  1XND A;  5CAD A;  2ETE A;  2WL1 A;  2Y8K A;  3WP4 A;  3SKJ E;  2XOM A;  2NMO A;  3ZXJ A;  4XE9 A;  4CEY C;  2QKD A;  3J26 N;  1RUD 2;  1G9F A;  3JZV A;  4Q4Y 2;  4YW6 A;  1EV1 1;  4OVE A;  4LBN A;  1DCS A;  4BWO A;  1KQR A;  2HWD 3;  4XXP A;  4Y26 A;  4PLO A;  5KBF A;  4TLF A;  2XBO 3;  5SV8 A;  2JDA A;  4L11 A;  1JU3 A;  2Q8D A;  4YW4 A;  1A6C A;  4PF5 A;  1PM4 A;  2G19 A;  3LFI A;  1PK6 B;  2PTM A;  2CGO A;  1HQN A;  2W0X A;  3BPZ A;  3HQX A;  4XOG A;  3V64 A;  1VAV A;  2BJS A;  2YBK A;  1WCQ A;  3J7H A;  4D8M A;  1POV 1;  4RFT 0;  2VZS A;  4IE4 A;  4XTM A;  4AED C;  1QJX 3;  2VQT A;  1ONA A;  3I2F A;  1UOB A;  4CSW A;  2EIB A;  2LW8 A;  2RM2 3;  3KV6 A;  3NNJ A;  4BHP A;  1AL0 G;  1HQL A;  5FZC A;  2QFE A;  2Y0O A;  4Y5T A;  2VCB A;  2XJR A;  2ZGK A;  3H7J A;  4QX3 A;  3SH5 A;  2XWB B;  4L97 A;  5JZG A;  5JDB A;  1RJ7 A;  3IBM A;  1GWK A;  1OOP C;  4HKL A;  3B01 A;  1NCQ B;  4IEV A;  4IEQ A;  5E8A A;  1R1A 3;  3PIG A;  1XE0 A;  1VBA 2;  4I3G A;  1W2N A;  3CHX A;  1EPZ A;  4XDO A;  1W04 A;  4QMA A;  4I0B A;  2OW4 A;  5JR2 A;  4AGG A;  4QPG B;  2GC1 A;  2V72 A;  2V73 A;  4UFK A;  4AR2 A;  3WF2 A;  1H8T A;  2G4I A;  1C1F A;  4JDO A;  1UU6 A;  3ZVX A;  4NIH A;  2MNG A;  2YPJ A;  2R6Q A;  3ZDV A;  4AOC A;  3KVB A;  4BOW A;  2LTN A;  2PQS A;  4DMI A;  1IQA A;  4Y20 A;  5FZ6 A;  2R04 1;  2R07 3;  3ZSK A;  2RS1 1;  5L7O A;  1RUI 2;  2WN3 A;  3WQ0 A;  2JIJ A;  5DPN A;  4AI0 A;  2D6O X;  3T0D A;  2L9L A;  3JXS A;  5ERL A;  2BTV C;  2WNV B;  2X8K A;  4RR3 A;  1SCS A;  5A3W A;  5DAP A;  4QQO A;  4YG3 A;  4E8C A;  1BXH A;  4FPC A;  4COZ A;  4E8D A;  1SFP A;  1UCX A;  2GDF A;  2RS3 1;  1H4H A;  1YQ8 A;  2AR6 A;  2EF6 A;  3FHQ A;  3KLS A;  3Q9O A;  1TVG A;  2XJV A;  4MV2 A;  2R16 A;  1RUG 2;  4YW2 A;  4OHY A;  4RHV 2;  5FZ0 A;  1ZRE A;  1VLN A;  3ZXD A;  5IAT A;  1COV 2;  5E16 A;  1GQP A;  1F15 A;  4C91 A;  5I0D A;  2W1U A;  3JD7 3;  4EZ4 A;  3BIE A;  3MW4 A;  3GZE A;  4XTP A;  4GAL A;  4WVM A;  4NII A;  4IE5 A;  2ZGQ A;  2NMN A;  3K3O A;  3UJO A;  5BY5 A;  4LBO A;  4EV0 A;  1N1S A;  2C5D A;  4CCM A;  4IES A;  1N3O A;  1S0G A;  3JD7 1;  2D6N A;  1CIW A;  2JXA A;  2XVK A;  3BGA A;  5BNN B;  3AZX A;  4Q0S A;  4XQ4 A;  4RN5 A;  4Q5O A;  4CUG A;  2RS5 2;  1GZW B;  5HI0 A;  1GQH A;  3E5X A;  2Y6H A;  5FUI A;  4Q4Y 3;  5LY2 A;  5DDJ 1;  3N4M A;  4XW3 A;  2ERF A;  4ET7 A;  1POQ A;  1LAJ A;  1DG6 A;  1V9U 3;  5D21 A;  2A6W A;  2WBK A;  1LGB A;  5A3M A;  5K0U C;  4PDW B;  4RL7 A;  5F5A A;  3EXU A;  2VZ3 A;  5F3I A;  5DZF A;  4YYO A;  2QBX A;  3ZXK A;  4EN9 B;  3ZXG A;  2DYC A;  2RHP A;  2RS1 3;  2WNE A;  4MGQ A;  3W5N A;  4N90 A;  5E6H A;  3WNL A;  4MXW A;  2RM2 2;  4TYS A;  4BIF A;  1LEC A;  4DUX A;  2JB8 A;  3T1M A;  2W52 A;  2P3Y A;  2R0F A;  5DAX A;  1WUV A;  1XPW A;  1K5M C;  2RDR A;  4XVH A;  3ZYP A;  2SBA A;  2JD4 A;  1AZD A;  2TBV A;  4U36 A;  4AFM A;  1J1L A;  1J83 A;  1OVP A;  2XXZ A;  4QU2 A;  4HL0 A;  3OUJ A;  1UWW A;  1W05 A;  2QQP A;  1PO1 2;  5CA6 A;  5T50 A;  2WZP P;  3PME A;  1HRI 2;  4OUM A;  1MAC A;  1J3R A;  3AKR A;  3VHO A;  3V65 A;  1UKG A;  1UOG A;  3FJS A;  3ZN6 A;  5GZG A;  3FZ3 A;  5FPV A;  5DAQ A;  3OUI A;  2K46 A;  3THD A;  3HNY M;  5I0R A;  1C8M 1;  1NA1 B;  5IVJ A;  1U5Z A;  2BVV A;  4A2U A;  4JRA A;  2BFU S;  3TEY A;  1OSG A;  3SQO A;  2WZR 3;  5L36 A;  3S0M A;  2XVL A;  5IFP A;  1O3T A;  1H2M A;  3TN9 3;  2JDZ A;  3I2K A;  2AC1 A;  1W2U A;  1D0G A;  4HON A;  1UAI A;  1GLH A;  3H3L A;  1W6O A;  4IQP A;  3N7L A;  2YMZ A;  1QKQ A;  1DLC A;  1NT0 A;  1AL2 1;  2A75 A;  1KRI A;  4AFB A;  1XC6 A;  3MYX A;  1RUI 3;  1LHN A;  3INA A;  1QJY 1;  4HKO A;  2Y6L A;  1Q5O A;  2F4L A;  3AB0 A;  3FE5 A;  3I8T A;  2TNF A;  3ZKY A;  2ZGP A;  2Y6J A;  3I7D A;  4YFW A;  1CJP A;  4DY3 A;  3ZO0 B;  3THC A;  3D0J A;  2VNR A;  2XWJ B;  1CAX B;  1IG0 A;  2IFR A;  2LRP A;  5DMY A;  1DYP A;  4SLI A;  3VBU C;  5LK7 B;  1V9U 1;  2LAL A;  1MS4 A;  4C1W A;  3LB9 A;  3I3D A;  3RWK X;  3MIG A;  1UOJ A;  2VBD A;  1F2N A;  2VZR A;  4Q4Y 1;  5CIR A;  3HAG A;  4Z1V A;  1QDC A;  2EXI A;  3C7O A;  3HJR A;  3OEB A;  1R1Z A;  3S57 A;  3B94 A;  1REF A;  4LE4 A;  3DYM A;  3WNK A;  5FXZ A;  3BKZ A;  2I2S A;  1S0E A;  1B35 B;  3OD4 A;  4NWV A;  4BPZ A;  5KHG A;  4ZU5 A;  1QEX A;  4N7I A;  3H42 B;  2IUW A;  5FMO S;  1ZZ7 A;  3ZPO A;  5K7P A;  4Q8K A;  3AM2 A;  2GMP A;  3LA3 A;  1XE7 A;  4D69 A;  1W8T A;  2WWU A;  2YU2 A;  1F4A A;  2HWB 1;  2ZX2 A;  3CMG A;  5FYI A;  4NWW A;  4K6B A;  4BU2 A;  5FY0 A;  1Y9Q A;  4ISQ A;  1X36 A;  3IB3 A;  2RJK A;  3MO4 A;  4Q0Q A;  2A6Z A;  5FZM A;  3WOG A;  4JKK A;  2B9U A;  4HT1 T;  2P3J A;  2WAO A;  3MDP A;  2VUJ A;  4WVW A;  4ZU7 A;  2WJS A;  4CTE A;  4CP0 A;  3WXP A;  3IAQ A;  1AR6 1;  5A3U A;  2XG3 A;  5GJ6 A;  1QJF A;  1AL2 3;  4G9S B;  2I07 B;  2ADE A;  2YFZ A;  4BK4 A;  3OTF A;  4W4Z A;  4BZ4 A;  3RZJ A;  5TSW A;  1YJK A;  2ZGU A;  3III A;  1GOG A;  3J4U H;  5CU1 A;  4K9S A;  1Y4W A;  3WF0 A;  3P6B A;  2RS1 2;  3BTA A;  4R9D A;  2ATF A;  3NV2 A;  1R09 1;  4AEM A;  1MS9 A;  3NKT A;  3MFA A;  4M3C B;  4NE9 A;  4PQQ A;  1VJ2 A;  1VRH 1;  2ZHN A;  3OPT A;  4XUP A;  3B3Q E;  3ZMO A;  1J59 A;  1F4H A;  2DTY A;  1Z0H A;  1V6I A;  3PHM A;  2H0V A;  1F9K A;  1ULC A;  3WW2 A;  2VH9 A;  1OC1 A;  1NCR C;  1OQD A;  5EPA A;  4CDQ A;  1OBN A;  4BCU A;  2GNB A;  2WKK A;  4P5H A;  4AVA A;  1Y9M A;  5JXJ A;  3NV4 A;  4FPK A;  3LOB A;  3N36 A;  5T5J A;  4Q29 A;  3KZ4 C;  4NAM A;  4Z82 A;  1SZB A;  4DXT A;  1PZ8 A;  4JDM A;  5FPB A;  4PDW C;  4OHW A;  4LA2 A;  3A0K A;  4IEU A;  2DVD A;  2BZD A;  2BOI A;  2IFW A;  1D0H A;  3BYW A;  1V70 A;  5F2S A;  3BU0 A;  2UU8 A;  1WBL A;  4GMP 0;  3LWC A;  1BKZ A;  4YZ5 A;  3GYD A;  3KCX A;  1ALY A;  1NY7 1;  3ABZ A;  1QJU 3;  1N3Q A;  5FZA A;  3ZFG B;  1MQT A;  4ATF A;  2ZGO A;  3KV4 A;  4CDW B;  1BMV 1;  1R08 3;  5SV5 A;  1AR8 1;  4NOT A;  2X29 A;  1QQP 3;  2FBE A;  1OHF A;  2J1R A;  3P3P A;  2YC0 A;  3DN7 A;  1K5M B;  5JR7 B;  4UW6 A;  5JXI A;  2IXK A;  2HWC 1;  4XFF A;  2ORZ A;  1BYH A;  1C57 A;  4GWI A;  1D2S A;  5FZ9 A;  2G9G A;  2YBP A;  2SLI A;  1FAY A;  4FP2 A;  1ACC A;  1S0C A;  4W8J A;  4XFH A;  3K2O A;  1PO1 1;  2ZX3 A;  3K75 B;  4QPI C;  5EYX A;  3KT7 A;  5BNN A;  1FNY A;  4AG4 A;  1HRI 1;  3WG3 A;  4M4P A;  5FKB A;  3LE0 A;  4OMD A;  3AP9 A;  3H50 A;  3JUU A;  3MV1 1;  4X8P A;  5FP3 A;  1LNS A;  2ZEZ A;  1OF3 A;  4HOO A;  3RVH A;  2QQI A;  2VMG A;  1OMI A;  1RUF 2;  4QB6 A;  3WDY A;  1T2X A;  1X9P A;  2JDY A;  3VKN A;  3WW3 A;  4BQ2 A;  4CA9 A;  4PDW A;  2WA4 A;  3I3M A;  1ND2 B;  1PK6 C;  1TMF 1;  4XJZ A;  2UYA A;  4YFZ A;  1VPH A;  1PNG A;  1CX1 A;  1VRB A;  1S0D A;  3CJI C;  4P08 A;  4UFL A;  3E5Q A;  3IN9 A;  5FYT A;  4EN0 A;  3VDC A;  2ET7 A;  4RFR B;  2XON A;  1DF0 A;  2VPV A;  2QQW A;  5GKA C;  1K5M A;  3GZA A;  2RS3 2;  2Z79 A;  3HT1 A;  5C3R A;  1UMZ A;  5AVP A;  5FZG A;  3AP7 A;  5EQU A;  1OOP B;  2GC2 A;  4R4X A;  4A3X A;  2IVI B;  2BDR A;  2BVB A;  1H1A A;  2P17 A;  1YIF A;  3PJY A;  2XJP A;  3IAP A;  2A3W A;  2DUO A;  5C8C B;  1V6K A;  5J48 A;  4OUS A;  2W3J A;  3WLU A;  3WNN A;  1YCI A;  4ONU A;  1LTE A;  3TB0 A;  1UW8 A;  4D6R A;  4GAZ A;  5BNP A;  4XJU A;  3JQX A;  1HN1 A;  2XH6 A;  4UF0 B;  1V6N A;  1ST8 A;  3IDC B;  1O4T A;  3POB A;  1S2B A;  1D2Q A;  2JDM A;  3AK0 A;  2VW0 A;  5BV6 A;  5C3O A;  3FLR A;  2Q1F A;  5IWF A;  3G6J B;  2WLP A;  4QM8 A;  1GSL A;  2J1A A;  1RUN A;  1D7P M;  1KFX L;  3FUQ A;  4YVW B;  4GH4 B;  1H8T B;  4XMA A;  1NKG A;  2XVG A;  1JHN A;  1JH5 A;  2O1Q A;  4ES9 A;  1XSQ A;  4P9L A;  3DCQ A;  1OQ1 A;  1QY4 A;  2GC0 A;  3LPF A;  4F8A A;  3WUD A;  1DYK A;  1AR7 3;  2ZEX A;  4YM3 A;  4IET A;  2R49 A;  2OX0 A;  1LOB A;  5CKQ A;  3T4H B;  1CN1 A;  2ADD A;  4KG0 A;  2VNV A;  1QXR A;  1RUH 3;  2OXB A;  1JUH A;  2VZU A;  3ZOI A;  2BOJ A;  2OQ7 A;  5FY9 A;  3MLK A;  1H0B A;  4BIO A;  3MIF A;  4LOR A;  1KJR A;  1H30 A;  1NE4 A;  4HKW A;  4WM8 C;  3ILR A;  2IVJ A;  4O65 A;  4BA6 A;  4PBO A;  5AC9 1;  2CY6 A;  1X33 A;  1LHO A;  2RDQ A;  1RHI 3;  3ZYG A;  4BXS V;  1AX1 A;  5A3T A;  4BLJ A;  3IIA A;  4OFG A;  1AR6 2;  1W6P A;  5T5O A;  1OT5 A;  3ES4 A;  3VBF C;  3B9C A;  5A80 A;  2PLV 1;  3ETQ A;  3RI9 A;  3AMH A;  2HWB 2;  3J8F 3;  2RVA A;  5FY8 A;  4QWN A;  3WG2 A;  3ZXE A;  4BM8 A;  3ACF A;  1RIT A;  1IG3 A;  4AQS A;  2KA3 A;  1Z78 A;  5A7N A;  5JOX A;  4CEW A;  3HD8 B;  4ASL A;  2WO3 A;  1LOA A;  2UWC A;  1ODM A;  2NLR A;  1X9T A;  4EYU A;  1RUJ 1;  2DDU A;  3VL9 A;  1WA4 A;  4AQT A;  4Z92 B;  4QDS A;  4TTG A;  5FMO L;  1SPP B;  1Q8P A;  3AVS A;  2EAA A;  1LED A;  2ZXQ A;  3PVE A;  5T5P A;  2VUA A;  1GMM A;  4NPM A;  4W50 A;  4F3J A;  1LEN A;  2PHU A;  4CDU B;  5J09 A;  5A1A A;  3M3O A;  1W6Q B;  3K4D A;  1QJY 2;  5G05 L;  4D6Q A;  1W0N A;  2E9Q A;  3FHA A;  3HPN A;  3LIH A;  1VBD 3;  3WDW A;  4WV8 A;  1SLT A;  2W68 A;  3H3Z A;  4LK6 A;  1U5Y A;  3DXU A;  3GCX A;  4GH4 C;  5HXM A;  2WZ8 A;  1CZT A;  2W1W A;  1BBT 2;  1WMX A;  2HEV F;  5EXO A;  4CE8 A;  5AFB A;  4MGK E;  1QHD A;  3DEC A;  2NPI A;  2D3S A;  4JKM A;  1W8U A;  2BER A;  2Y0I A;  1BMV 2;  1E5I A;  4FO9 A;  2W5F A;  2WS9 2;  2B45 X;  4XJ9 A;  1CES A;  5C4W C;  2RMU 2;  3JB4 C;  1CZV A;  2YY1 A;  3UK9 A;  4EJR A;  3SH3 A;  1JYI A;  1GOH A;  1OD5 A;  1RL3 A;  4DXZ A;  1UL9 A;  3AMP A;  5FZI A;  2VZQ A;  1GZ9 A;  2HWC 2;  3BOD A;  1KS5 A;  3I3E A;  4UW3 A;  4OI1 A;  3ST7 A;  4FAG A;  5JPN B;  4XZU G;  1QXP A;  3VBR B;  3LKJ A;  1X82 A;  4Y1X A;  2O8Q A;  3WR0 A;  4ASM B;  1ASJ 1;  4BQY A;  3D5O A;  1PMJ X;  4LBQ D;  5LA0 A;  1RUG 3;  2ZPX A;  5FK7 A;  4LLF A;  4LR4 A;  3SEP A;  2WNO A;  1HB3 A;  2K2S A;  3BOW A;  4LJH A;  4R52 A;  3Q8C A;  4M3C A;  1ULP A;  3ACL A;  2JDU A;  4JVA A;  3T30 A;  3NST A;  1TG7 A;  3MGU A;  4BE3 A;  5A7S A;  4CCK A;  3A7Q A;  4YSF A;  4NMI A;  3N7K A;  2BGP A;  5JAX A;  1GNY A;  3RYR A;  2BGO A;  1AR8 2;  3KCC A;  4HVQ A;  2CV6 A;  1AR7 2;  2C6S A;  4URT A;  5G04 L;  4CUA A;  4XHX A;  2B7Y A;  2PHD A;  1RUJ 3;  4ZU4 A;  5C3Q A;  5KWR A;  1KS4 A;  1XYP A;  4QGM A;  1QJU 1;  4HN1 A;  4JGY C;  2D3R A;  2HWF 2;  1UX7 A;  2ZJC A;  5AVA A;  3ZKU A;  4LBM A;  1GNZ A;  3CJI A;  2WSU A;  3MV0 1;  4YGB A;  2RS5 3;  1MPX A;  1RUH 2;  1UMI A;  2QCS B;  2WZR 2;  3RSJ A;  2XQX A;  4GQ7 A;  2ES3 A;  1QNW A;  5FP9 A;  5HCF A;  2VMC A;  2VC9 A;  5JMO A;  2A5Z A;  2EIG A;  3H1Y A;  1JBC A;  1YFY A;  5J1X A;  4YVS B;  2PHF A;  4UYB A;  1FT9 A;  3JQW A;  1O91 A;  3V0A A;  1W9S A;  1ZZ6 A;  1JYV A;  4Q4X 2;  5CG9 A;  3O1P A;  2D93 A;  4COY A;  5FPX A;  2HWB 3;  3J8F 2;  2N7G A;  3DKW A;  1WCD J;  3BU7 A;  5CIS A;  1NLR A;  2LRO A;  1GZT A;  4I0W B;  1CD3 G;  2XQR A;  1F35 A;  5LRR A;  5F6L B;  4IEW A;  5A32 A;  3OBA A;  2DUQ A;  4L0P A;  4A42 A;  4F83 A;  3ZYJ B;  2ZML A;  4LLO A;  4QQL A;  3PJQ A;  4H55 A;  4A6S A;  2WFF 3;  4AI1 A;  5C33 A;  1YNA A;  1JYX A;  4FI9 A;  4JAA A;  2YC4 A;  1D4M 3;  3Q8B A;  4CEY A;  3W5M A;  2E53 A;  3I4I A;  1NQJ A;  4JQR A;  4L92 A;  4OHV A;  1LEM A;  3DYO A;  1OH4 A;  4QX8 A;  4K21 A;  1NOV A;  2I74 A;  2F17 A;  4K1Y A;  4JZR A;  3I54 A;  1IZ3 A;  3QLQ A;  4FTS A;  4HET A;  1BLZ A;  2V4V A;  3OUH A;  1EAH 2;  4QX5 A;  5C7G A;  1RUC 2;  3GHN A;  5FZH A;  5A1L A;  1MZ5 A;  5DDJ 3;  3V0B A;  4FOY A;  5JI9 A;  2RJ2 A;  1MZE A;  4LBL A;  4Y22 B;  2VXJ A;  2H0B A;  4Q4W 1;  4V2W A;  5KHJ A;  4TN7 A;  1F5J A;  1HB4 A;  1QOO A;  2BP6 A;  5FYC A;  1W6P B;  4PF1 A;  1EP0 A;  1HB1 A;  1CZS A;  3F2Z A;  2WIN B;  5H9S A;  4DRV A;  2W46 A;  2O0O A;  1ZBA 3;  1WA6 X;  2D44 A;  1QOS A;  1WMD A;  5EJ3 A;  3UKT A;  2CNA A;  2WNV A;  3V56 A;  1PGW 2;  5A32 B;  3ZR6 A;  2RR1 2;  1SLI A;  3B69 A;  4FT8 A;  3TNQ A;  1Q3E A;  1TME 2;  5EWS A;  4NN0 A;  1G9C A;  5FTT C;  3NMB A;  3LCP A;  4CEW B;  4FAH A;  1IS6 A;  1UF2 C;  2C4X A;  1ZBE 2;  3AKP A;  2IXL A;  3U14 A;  2UUR A;  1OUX A;  2DVA A;  4YVS C;  5JVV A;  2RDS A;  2GAU A;  2E6V A;  2OUJ A;  2X10 A;  3LEM A;  3VBO A;  3OY8 A;  5KHH A;  3VBS A;  5T54 A;  3I2D A;  1E5R A;  4S2D A;  3NAP C;  4DB5 A;  4QPG C;  1XSR A;  2HWF 3;  1VBB 1;  4QHZ A;  2QDN A;  3BB6 A;  4QX7 A;  2PA7 A;  2WSV A;  1Y3T A;  3ACG A;  2JDP A;  3URF A;  1PVX A;  2ZEW A;  2ZAA A;  4PI0 A;  4KWL A;  3VHP A;  3CL1 A;  4R9A A;  4BME A;  3KV9 A;  3OGJ A;  5FMB A;  2ZHL A;  1V6O A;  1O4Z A;  3ATG A;  2V4A A;  4FFI A;  3AYD A;  5F1R A;  2G9F A;  5EP9 A;  3QOP A;  1O6U A;  2QNK A;  3GM8 A;  3FHI B;  2EXH A;  2WNV C;  4D6S A;  5AFE A;  2YDE A;  5IK8 A;  1AYN 2;  1X7N A;  2VUD A;  4R4Z A;  4XPV A;  3POY A;  2XBO 2;  4MUV A;  5FJH A;  5C4W B;  3LDR A;  4P9Y A;  5FLH A;  3HN3 A;  3RYP A;  4Q4X 3;  2CDP A;  1UKR A;  2ZGM A;  4KBB A;  5F8P A;  3T2P A;  3KB5 A;  1MS3 A;  5FMD A;  1TMF 3;  1AYM 3;  4YPJ A;  3RMY A;  1O3R A;  1POV 0;  1YRZ A;  1NCR A;  3M3C A;  3ZM8 A;  2RG4 A;  3OPZ A;  5FFO C;  4J1W A;  1YHF A;  1ASJ 2;  2B42 B;  1UOF A;  4GB3 1;  2RMU 3;  4H14 A;  3RS6 A;  4YG6 A;  1GV9 A;  4MGT A;  1JU4 A;  2XB6 C;  3TYJ A;  3WDV A;  3FUO A;  3ZYH A;  4BXF A;  2A1X A;  1VAM A;  2YGL A;  3WNX A;  5IK7 A;  1UY1 A;  1UIJ A;  1WZX A;  2DCJ A;  1ZRD A;  5GZC A;  4KG8 A;  3WV6 A;  2JDN A;  1LUL A;  1QNY A;  1X50 A;  3DF0 A;  4AED A;  2RMU 1;  5BNN C;  2AYH A;  2W94 A;  3ZFF A;  1AYM 1;  4XDQ A;  1HXS 1;  3MI8 A;  4NHM A;  4QB2 A;  2HWD 1;  5FXV A;  2EAK A;  3UL2 A;  1SHW B;  4UT5 A;  5BNQ A;  5LWB A;  5LRS A;  4A7Y A;  2D5H A;  2X53 S;  1ZZ9 A;  2ZS6 B;  1JN2 P;  3POE A;  4LXL A;  1JOP A;  1W6Q A;  2YV8 A;  3IDE A;  1OLM E;  2GME A;  1ZVF A;  3F95 A;  3PUI A;  4UI9 L;  4XF9 A;  2QZ2 A;  2X5I C;  4YW1 A;  1T6G C;  1I3H A;  2W2I A;  5C4W A;  3MFC A;  3O1U A;  3ETP A;  1WLW A;  1SCR A;  2EID A;  1UZY A;  1UY0 A;  1UQX A;  1SLA A;  1R09 2;  5A3P A;  1W8W A;  1VBE 2;  3T2T A;  1UY4 A;  3ZMN A;  3APB A;  3ZIW A;  4Y5Z 0;  1G9A A;  3ZR5 A;  3AZZ A;  1ODN A;  3EB7 A;  4YGC A;  3T1L A;  2BEO A;  3BI3 A;  4XCA A;  2VQ0 A;  4EE2 A;  1OKO A;  1UY3 A;  1O5U A;  4I2O A;  5JSP A;  2J1U A;  5DZE A;  5LZ6 A;  4GB3 3;  2EXK A;  2XDV A;  3WW4 A;  4NRQ A;  3RG0 A;  4B29 A;  1W8O A;  3NVC A;  5LAT A;  4AGR A;  2ZKN A;  3K48 A;  4LQR A;  3PTR B;  1DFQ A;  3IKW A;  3MW3 A;  2ZAB A;  1JZ4 A;  2VVF A;  2DVG A;  3FX3 A;  3PU8 A;  1VB2 A;  4DUV A;  1OA3 A;  2ID4 A;  1IKQ A;  5B4X A;  1GU3 A;  4NPR A;  4JCK A;  3GBG A;  3VD7 A;  2AEN A;  2JKX A;  1WW4 A;  4FPF A;  4URA A;  4CXW A;  1N1T A;  4XUT A;  1CIY A;  3KHB A;  4FOW A;  2WNU A;  1ULE A;  1DGR A;  2FHR A;  4Y1U A;  3H8R A;  1BBT 1;  1EYB A;  2DV9 A;  3OCP A;  4Y22 A;  3WNP A;  4FQ4 A;  3K4A A;  3TN9 2;  2R07 1;  1VP6 A;  2D7F A;  2XGX A;  1WW6 A;  5DAW A;  4ZZ5 A;  3BPS A;  3VZL A;  3ZFE C;  1E5H A;  1I6X A;  1U5X A;  3DEM A;  4YM2 A;  4OHZ A;  4LKS A;  5E88 A;  3AMQ A;  2JIG A;  5DUV A;  5T5L A;  5CKM A;  5KXD A;  2FDG A;  1ULG A;  3TWI A;  4LUL A;  3ZYB A;  1O8S A;  2X09 A;  4DEQ A;  1US3 A;  1DHK B;  1WMF A;  3EMR A;  3VD4 A;  1KD7 A;  2BNN A;  1IS3 A;  1UXZ A;  4PI2 A;  3RDI A;  1RUF 3;  4GD4 A;  2X5I B;  1VBC 3;  1Z7S 2;  2BV4 A;  3M4F A;  4HK9 A;  4CPB A;  4TZD A;  3AXD A;  5I91 A;  1NG0 A;  2HLE A;  3VHN A;  1LCL A;  5ANQ A;  5GM0 A;  3NNL A;  1UU4 A;  4LPL A;  3THP A;  3UJQ A;  1PO2 3;  1ULF A;  4NHL A;  2FDF A;  2D6M A;  4COV A;  4HMZ A;  3POF A;  4FTB A;  4MSV A;  3AL5 A;  3IMM A;  4O7X A;  4AQ2 A;  5C6C A;  1B35 C;  4K20 A;  3D8C A;  5FZ1 A;  4YGE A;  4E4S A;  2KM2 A;  2OKX A;  3O1T A;  1RMU 1;  4N43 C;  1KDK A;  4E2G A;  4N9I A;  1C8M 3;  4YVW A;  3I2H A;  4JGY A;  5JIA A;  4FXG B;  3X29 B;  3EYP A;  1NQD A;  4QKD A;  4XAB A;  4HSJ A;  1PGW 1;  2PAK A;  3KS7 A;  4MOA A;  3WQB A;  2FCV A;  2WLQ A;  2YPD A;  1DGW A;  3OGR A;  1NAE A;  3VZO A;  5DZG A;  5L7O C;  3LEI A;  4A41 A;  2MEV 1;  4HXC A;  1BEV 2;  1H6X A;  2R7E B;  2EVX A;  4P5Y A;  4AFA A;  2VU9 A;  4LHK A;  5IFT A;  2ARC A;  4MET A;  4KU7 A;  1O59 A;  2A3Y A;  2PHL A;  3N3H A;  4IEY A;  4AQ6 A;  3I3B A;  2PQQ A;  2QQL A;  3BUC A;  1PGS A;  4HPK B;  1AXY A;  1W90 A;  1ZNP A;  4RQP C;  4D7S A;  3U0Z A;  2XKO A;  1UYP A;  4UBH A;  4W65 A;  3OSD A;  4E4H A;  2P6C A;  1ZRI A;  2ARA A;  2AEY A;  4H7M A;  2OII A;  3B7M A;  3WHU A;  2HWE 1;  4AI3 A;  4HAN A;  4TSV A;  2HWE 3;  2XHK A;  4OZX A;  3TEX A;  3ZFG A;  1AL2 2;  3ZIX A;  5FZ7 A;  2FDJ A;  1AR6 3;  1MS1 A;  1BHG A;  4HLT A;  5A6Z A;  2VBB A;  3FL7 A;  3M8L A;  3THT A;  4BB3 A;  1AYN 3;  4CU7 A;  4IER A;  3WY6 A;  4QAW A;  4DRR A;  4W6W A;  1H2K A;  2JEC A;  5FO8 B;  3PVB B;  4GB3 2;  4Y5S A;  3U78 A;  3WDU A;  4JGY B;  3PVN A;  2P1B A;  1CR7 A;  4YAR A;  4WZF A;  3NV1 A;  1UZZ A;  4LNV A;  5IVY A;  4AED B;  2YUE A;  3BTZ A;  1S2E A;  2A7A A;  3VKM A;  1JYT A;  4AI9 A;  2DTW A;  4GWN A;  1AR9 2;  3SIS A;  2E33 A;  4Y20 B;  1ASJ 3;  4GWM A;  4YZ2 A;  5FZD A;  1GKB A;  3I59 B;  1HXS 2;  5FYU A;  3K51 A;  1G9B A;  2CSG A;  3NO8 A;  5LA9 A;  4OUL A;  1TZO A;  2A71 A;  1LOF C;  5FYZ A;  2XJU A;  2WYS A;  2VCM A;  5H9R A;  5IJR A;  4GJY A;  4IEZ A;  3VZN A;  1AXK A;  1SLB A;  3VN4 A;  1JHJ A;  1QXJ A;  5F32 A;  2WT0 A;  2R04 2;  3FN9 A;  3WUC A;  5FR3 A;  4I02 A;  4EQV A;  1SEF A;  2E63 A;  4AHZ A;  1VR3 A;  1CQ9 A;  3KHC A;  3ZFG C;  4LTA A;  3RGB A;  2OA2 A;  3HIF A;  5DUU A;  4Q0V A;  4Q4V 1;  3AXE A;  3UKN A;  3H1W A;  5BPX A;  3KF3 A;  1HB2 A;  1US2 A;  2DF7 A;  3MID A;  2F6B A;  2HWD 2;  2NZ9 A;  2XLA A;  3WX5 A;  1QJX 2;  1R08 2;  2P3K A;  1SAC A;  4P00 B;  2ZMK A;  4GZ9 A;  1RUD 3;  2F4P A;  5B2G B;  1VRH 3;  5EV7 A;  2WYF A;  2WWJ A;  1RUG 1;  4S2H A;  5FZO B;  5KXB A;  1QJY 3;  5E89 A;  1OLR A;  2D6K A;  2WQ4 A;  3N9Q A;  2DCT A;  2DFB A;  2GH8 A;  4CCD A;  4QXH A;  1JXN A;  3SC7 X;  3GDB A;  3QCW A;  3UES A;  5JZG C;  1DQ0 A;  2AGS A;  2CU5 A;  2WN2 A;  5F6K A;  2O14 A;  4PIZ A;  3KGZ A;  1YXW A;  2BGC A;  3NRU A;  2JE9 A;  1NXM A;  5LW9 A;  1OFN A;  4FFF A;  4IV3 C;  2ZZQ A;  2DUR A;  5IAV A;  2WS9 3;  2Q1M A;  4DQA A;  1G9D A;  3VZM A;  4XIL A;  5KXE A;  4FBF A;  2Q0A A;  5CNA A;  5FPZ A;  2VOK A;  2Y33 A;  4JGZ B;  1UIK A;  1I9R A;  1MS8 A;  2PEL A;  5A6X A;  4AAP A;  2WWS A;  1C28 A;  2W08 A;  3CJI B;  1OH3 A;  2R07 2;  1HDK A;  1VBD 1;  1VBA 1;  4XQW A;  3WQ7 A;  5EIY B;  4CDW A;  4JTO A;  5E1R A;  4QB1 A;  3CKH A;  5J7M A;  1LHW A;  1UYX A;  3SEE A;  4Y24 A;  3ZFF C;  4CYD A;  3R05 A;  4KH9 A;  1XNC A;  2W1S A;  4RSU A;  1MEC 3;  4YVS A;  3SNM A;  3U4S A;  1DP0 A;  3IM0 A;  1YFX A;  4XXA A;  5FPA A;  3S5Q A;  1CJD A;  3GCW A;  5T52 A;  5JCT A;  3R0R A;  5KHK A;  1LHU A;  1NYW A;  2IXI A;  1SFY A;  2PHT A;  2X5I A;  5IK4 A;  4BQ3 A;  4OZO A;  1N47 A;  2GMM A;  3WQ1 A;  1L7R A;  5F3G A;  4NHX A;  1XBF A;  5GLT A;  1H1I A;  3LGR A;  5FYY A;  5FWE A;  5FY4 A;  2VO5 A;  2HWF 1;  5GZF A;  1LOG A;  1W9W A;  1LRH A;  3HOB A;  3VZJ A;  2WT1 A;  2YC2 A;  3D82 A;  3WW1 A;  4Q4V 3;  1YFW A;  2WC2 A;  1R64 A;  4UXA A;  1C8N A;  3TBD A;  4OLL A;  4LUK A;  5FXW A;  2JD9 A;  1DZT A;  2W39 A;  3BTY A;  2C9A A;  2JG8 B;  5L9R A;  1QQP 2;  4E2Q A;  5LEK A;  2J1E A;  2BWA A;  1ZZ8 A;  2IZW A;  1RB8 G;  3ACH A;  4EWE A;  1M06 G;  3HR9 A;  5L7O B;  3SIT A;  1JI6 A;  2Y6G A;  4FPG A;  5C5T A;  3CQO A;  4AYU A;  2WO2 A;  4N9H A;  2A6X A;  1GQG A;  4IE6 A;  2FD8 A;  4C0B A;  3AYA A;  4B4R A;  1YC6 1;  1XU2 A;  4M0H A;  4JQT A;  4DXR A;  5C8C A;  2B8M A;  3OEA A;  4X6R B;  4XFG A;  3WDT A;  5CFD A;  2QQN A;  4YM1 A;  3O1O A;  3NJZ A;  1W6M B;  4Y1Y A;  1D4M 2;  1S0I A;  3DKQ A;  3WSO A;  4AVB A;  2ZAH A;  3PU3 A;  2QQJ A;  4DZG A;  2ZGL A;  3LEG A;  3S7E A;  5FBZ A;  3C3V A;  5GLU A;  3UT0 A;  1ZZB A;  4IGO A;  5LBC A;  1JOJ A;  1BEV 1;  5EJZ B;  1STM A;  5JI7 A;  2DCY A;  5HCA A;  5IVC A;  2PHW A;  2GH2 A;  2WII B;  1HRI 3;  2VZV A;  4EZH A;  1K3I A;  4S2F A;  2Z69 A;  1RUE 1;  3OYW A;  1Y7B A;  3EBR A;  1W2O A;  3GBF A;  1FMD 2;  1AR9 1;  2Y38 A;  1ND3 C;  3B00 A;  5FZ3 A;  3SKV A;  1O7F A;  1JZ2 A;  1CAW A;  5FCC A;  3IZO A;  4WM7 C;  2Z4F A;  5HPO A;  5JUV A;  3IT8 A;  3HN1 A;  2OPW A;  5FAX A;  5JIU A;  1UZV A;  2ARX A;  1KXG A;  1VB4 A;  5LA1 A;  1RHI 1;  2CL2 A;  1W0O A;  4R9C A;  5FO9 B;  1TME 1;  1XE8 A;  4AVS A;  3VBH B;  3S7I A;  1RUO A;  4LE3 A;  2AH2 A;  2Y60 A;  2R32 A;  4JHZ A;  4LEJ A;  4AL9 A;  4DNY A;  2GND A;  3D0S A;  1MEC 2;  5D1I A;  5ACA 3;  4X6Q B;  4DIN B;  2D6P A;  2R1B A;  4IGQ A;  4B7E A;  1OI6 A;  4RR3 B;  2J1V A;  2OQ6 A;  3KGL A;  3O12 A;  4AF9 A;  3RQ0 A;  4HPK A;  1NXD 1;  5A7O A;  1ND3 A;  2P3I A;  4RQP A;  4IE7 A;  2B46 X;  3DV8 A;  2VOV A;  3T0B A;  5D8A A;  1QMJ A;  1V6J A;  4YVW C;  1S55 A;  3CDZ B;  4JRL A;  2Q8O A;  4UFM A;  3VBF A;  1LES A;  3HEI A;  3A23 A;  2J1S A;  2VEC A;  1PO2 1;  1OLQ A;  2KR2 A;  5FWJ A;  3SH4 A;  3N7M A;  2VOT A;  2ZA9 A;  1OPM A;  3GNE A;  1MS5 A;  4AW7 A;  1ZRR A;  3TEZ A;  2OS2 A;  5EHD A;  3R6S A;  4ZS2 A;  3WNO A;  5B4N A;  2R30 A;  4E27 A;  2ET1 A;  4JDN A;  4QQH A;  5FLI A;  1NA1 C;  4CDU A;  2VCA A;  5BUV A;  1IKP A;  1GP5 A;  1CAU B;  2ZGN A;  5FZ8 A;  4CZS A;  3I97 A;  1EY2 A;  2WDB A;  1W3V A;  2K9Z A;  1ULD A;  1YQ2 A;  1AYN 1;  1PIV 1;  4QPW A;  2MEV 2;  3H1M A;  3PUS A;  5BYN A;  3R4U A;  2E7T A;  1QIQ A;  4GJZ A;  1AX0 A;  3FWE A;  3AYC A;  2GNT A;  2MPF A;  3AJZ A;  4KBZ A;  1WLT A;  4CRQ A;  5A6Q A;  5A3L A;  1BZW A;  3O1S A;  2VR4 A;  1FOD 2;  3OGG A;  2DCZ A;  2EIC A;  4DOU A;  1NCR B;  4IV3 A;  1DQ1 A;  1VBD 2;  1W3X A;  5FUP A;  2VTX A;  1MR5 A;  1YEW A;  1E5S A;  1HJF A;  1NUK A;  3KVA A;  4GKY A;  3AP5 A;  4XYX A;  4ZKT B;  3ZSM A;  4KL1 A;  3K4Z A;  4ZZ8 A;  5A70 A;  2Z5W A;  1NY7 2;  3S30 A;  5HV0 A;  3W21 A;  1DIW A;  2JWP A;  2ZCW A;  3OGS A;  3QH7 A;  5AC9 3;  3T08 A;  3BVC A;  3O14 A;  1IPK A;  1CPN A;  5FPL A;  5K4L A;  4DS0 A;  2ZX0 A;  2FMY A;  4Q2F A;  3VL8 A;  3H9A A;  2CAV A;  3DL3 A;  2A3X A;  1JS9 A;  3HWJ A;  2PHX A;  3LEK A;  1NZI A;  1OQE A;  4UOJ A;  4KGG A;  1CWP A;  1B35 A;  4AVT A;  3RRD A;  1GR3 A;  1RVF 1;  3NQH A;  3VD3 A;  1GUI A;  4GXL A;  4OUE A;  2VJX A;  1YIP A;  4KWJ A;  4XUQ A;  3MIH A;  5FKC A;  2BNO A;  5LK5 A;  1V6M A;  3POJ A;  3M3Q A;  1FNZ A;  4NR1 A;  1JZ5 A;  2VTX J;  4HK8 A;  3U11 A;  2VMI A;  4PIY A;  3I49 A;  4QGL A;  2D40 A;  3O1V A;  2QQO A;  1QQP 1;  3MLJ A;  4N8M A;  3WD5 A;  4BQ1 A;  5M0T A;  5CFC B;  1AR8 3;  1MS0 A;  1RUF 1;  3ZXL A;  1WGP A;  3CEW A;  1R1A 2;  2EIE A;  5C3P A;  5CZK A;  1KGY A;  3FMG A;  3HQU A;  5FZ4 A;  4SBV A;  5FJK A;  2E32 A;  1DZQ A;  1LU2 A;  2YGM A;  3GXU A;  5GLW A;  3IPV A;  2CHH A;  1A34 A;  2J7M A;  1C5H A;  4RGG A;  2OPK A;  3CLP A;  1QJU 2;  4ZS3 A;  2VVE A;  4AE2 A;  3N35 A;  5C9A C;  4CDQ B;  2V5Y A;  5K9Y A;  1DQ2 A;  4K7J A;  5D8A C;  5FYH A;  1GIC A;  4WVM B;  5ABJ A;  1I5Z A;  3AL6 A;  4LO4 B;  1SG3 A;  1NA1 A;  4LHL A;  3M3E A;  3WP5 A;  4V2V A;  1RUJ 2;  1XYO A;  1DYO A;  1ZBA 2;  4Y4R A;  2WZR 1;  3LDK A;  3A22 A;  5FLJ A;  3NV3 A;  2DU1 A;  1FAT A;  1UNB A;  2R0H A;  2VGD A;  3VKO A;  2BBV A;  2G1M A;  4RYD A;  5FYB A;  4LA3 A;  4FP3 A;  1OFS A;  3C7G A;  3E97 A;  1UMH A;  2HJI A;  4I3P A;  4R8H A;  4CU6 A;  1XU1 A;  5C8C C;  2Q30 A;  4MHU A;  3SMH A;  5FY7 A;  4AGV A;  1Y43 B;  2UWB A;  2K0G A;  1DGW X;  1LOC A;  2WNU C;  2ZZJ A;  5GLZ A;  1CAW B;  2VNO A;  2OYZ A;  3ORJ A;  5FQ0 A;  1SLL A;  3OJB A;  3ITQ A;  3PUR A;  4GIQ A;  4IE0 A;  4WM7 B;  2BBA A;  4QXB A;  4TLG A;  3VLB B;  5A33 B;  5L19 A;  4MHR A;  1GFF 2;  1UPS A;  3ZLI A;  1H6Y A;  1N3P A;  4WZC A;  5FY5 A;  5FZF A;  3QBQ A;  2LS6 A;  5DN2 A;  2RS5 1;  5EJ1 B;  2P5B A;  1K5J A;  2IWG B;  1LR5 A;  3T2O A;  4N43 B;  1H8T C;  1LOE A;  5APA A;  1OVS A;  3RZH A;  1H8V A;  4XC9 A;  1ZA7 A;  3WT3 A;  2Y26 A;  4IUG A;  3K77 A;  4RA0 A;  3SXW A;  5HBA A;  1VBB 3;  4D0Q A;  4XMI A;  4OQ8 A;  1BEV 3;  1OKQ A;  2WT2 A;  4GWJ A;  1ZRC A;  1XOY A;  5LBE A;  5AC9 2;  1ENS A;  1TE1 B;  1PMI A;  2FDK A;  4LO8 A;  2RDN A;  4KNC A;  1QF3 A;  2C9K A;  2KXL A;  2VXR A;  3POW A;  1DBN A;  5K8S A;  4LO7 A;  5FOB B;  3UNP A;  1W6M A;  4QPG A;  5JZG B;  4BLI A;  2WO1 A;  2QE3 A;  4MXV A;  2D97 A;  3LF7 A;  1WCU A;  3NNF A;  5IUQ A;  3AC0 A;  1EAH 3;  4ERO A;  2WFF 1;  4H2A A;  4RD7 A;  2VQA A;  3VD5 A;  4Q1R A;  3L2H A;  3VKL A;  2BYV E;  4B4P A;  3VD9 A;  2EA7 A;  5BNP C;  3H0O A;  4I30 A;  2WQZ C;  1FYU A;  1VAK A;  4XIO A;  4C0H A;  1W8N A;  1W39 A;  2BFU L;  4LIU A;  3USU B;  3PUA A;  2WR9 A;  4NHK A;  5GLV A;  1RUH 1;  1XB9 A;  3KV5 A;  1PHM A;  2NM1 A;  3JBG 2;  4XDP A;  5LA2 A;  3EQE A;  1PX3 A;  2RV9 A;  3MEP A;  3MHZ A;  4LKF A;  3NAP A;  2Q4S A;  1PZ7 A;  1YQ6 A;  2WUH A;  1H4G A;  3U75 A;  3ZX7 A;  3P3N A;  4W6Y A;  4COW A;  4Q4W 3;  2VMD A;  1R09 3;  4DPN A;  2P6H A;  4P9X A;  3AKQ A;  2XL9 A;  4E9K A;  2DU0 A;  3DYP A;  4A44 A;  2QQK A;  2IXC A;  1SDD B;  4P9I A;  3MZH A;  4AI8 A;  1FXZ A;  1MQT C;  4OI4 A;  3RWN A;  1COV 3;  4I09 A;  1OA2 A;  4K40 A;  1UU5 A;  4CEW C;  1J3Q A;  4P9G A;  4LHS A;  3IDA A;  4BH9 A;  1HKD A;  3LSD A;  3SLI A;  2WNU B;  4AEK A;  5A7Q A;  2RJL A;  3T3Y A;  1OOP A;  5JXH A;  2OZJ A;  1D4M 1;  1YFU A;  2VW2 A;  1BBT 3;  4M00 A;  4MZU A;  4QD2 A;  1CON A;  1YJL A;  1LHV A;  2D3P A;  1RXF A;  3LFM A;  4E4D X;  5A1F A;  3G7D A;  4M3C F;  1WWY A;  4O61 A;  5K0U B;  1O3Q A;  3OB8 A;  1VBE 3;  4CU9 A;  4NUB A;  3CU7 A;  5I8T A;  4GUL A;  3CBN A;  5L9B A;  4NJ4 A;  4K3U A;  2GZW A;  1IS4 A;  3MUY 1;  1TNF A;  4E4Z A;  2VOX A;  4ITC A;  5JXG A;  5KR7 A;  5I8S A;  4A6O A;  2P2K A;  3ZXF A;  5JWP A;  4NRM A;  4XEZ A;  1MVE A;  2VBP A;  2YXS A;  3I2G A;  2WZE A;  1ZM1 A;  4Y1V A;  2B9V A;  3SCG A;  2ARB A;  3GJA A;  5FZL A;  5FZE A;  4CP1 A;  2XPJ A;  4BQ4 A;  2PLV 2;  4R9B A;  1DQ4 A;  2GP3 A;  4HVR A;  2AZ5 A;  2RM2 1;  1RTV A;  1XQN A;  3BCW A;  4Q4V 2;  5FUN A;  4A7K A;  4OHX A;  1LB2 A;  5F3E A;  1A8M A;  3HT2 A;  1NLQ A;  1POV 3;  3PMS A;  3WHT A;  5JPM B;  3E6C C;  2C24 A;  1QJX 1;  2GNM A;  5F39 A;  1WLC A;  1A78 A;  1YUD A;  1RC6 A;  4WM8 B;  2RR1 1;  4LBQ A;  1BK1 A;  2QQU A;  3FFQ A;  2Q8E A;  3VBS C;  5JSR A;  2VME A;  1W8H A;  4RS5 A;  1VMJ A;  2ZBJ A;  2JB4 A;  4IV3 B;  1VBC 2;  1Z7S 3;  2VVD A;  3MF6 A;  1G8W A;  3AYE A;  3UGF A;  1U0A A;  3RZK A;  3PIJ A;  4IEX A;  4MAD A;  4CDQ C;  3NL1 A;  5CG8 A;  1PO2 2;  3BAL A;  4L9B A;  2GSY A;  1W2T A;  1UO9 A;  5F7U A;  1IPS A;  2Z42 A;  4CDX C;  4RHV 1;  5FYM A;  3OBR A;  1WD3 A;  1QWR A;  2UY8 A;  4KWK A;  4GMP 1;  4Y4Y A;  1H9W A;  3KQ4 B;  4IW3 A;  5FZB A;  1R1A 1;  2W95 A;  4OYU A;  3VBU A;  3S5A A;  4YM0 A;  3D6E A;  3CZJ A;  4MLO A;  3S6P A;  2VMH A;  3DXT A;  1QOT A;  4XF1 A;  5CAZ A;  1PZ9 A;  3AFK A;  4X8N A;  5A7W A;  4B8E A;  3MUZ 1;  4RS5 C;  1W6O B;  4BJ0 A;  1FPN 2;  1OXC A;  2VW1 A;  3N9N A;  3PLQ A;  4MGI E;  1UXX X;  1L7Q A;  1PIV 2;  2YRO A;  1C3H A;  1RYY A;  2JDH A;  1KDM A;  2PFW A;  1VBA 3;  4O9E A;  4EN8 B;  4NID A;  4UFH A;  5DG2 A;  4MO3 M;  1FOD 1;  2ILM A;  3A21 A;  3D4K A;  2IC1 A;  4HZF A;  2CDO A;  3FLT A;  2VOW A;  4C8D A;  1O5L A;  2DVB A;  4LK7 A;  1PX4 A;  4Q1P A;  2XBO 1;  3O0X A;  1JYC A;  1HX6 A;  1HV1 A;  4IEP A;  3VBH A;  3PUH A;  4CCN A;  1WME A;  2G9Z A;  1GWL A;  3EO6 A;  4C90 A;  4AAX A;  5I8Y A;  5LEJ A;  2GAL A;  1H1M A;  1O3S A;  4LT5 A;  5ABJ C;  3HQR A;  3DUI A;  5FK8 A;  1RUC 1;  3TEW A;  4JC1 A;  2JG8 C;  3A4U A;  3LIG A;  3TOJ A;  2E51 A;  1S0F A;  1IHM A;  1OUS A;  1D4V B;  1RMU 3;  1W9F A;  4PHZ A;  4N53 B;  2XJQ A;  2FDH A;  1WD4 A;  3RPQ A;  4RQP B;  4NIA A;  1AR7 1;  4JTN A;  1LU1 A;  3PVO A;  3WDX A;  3N9O A;  1CAV A;  1W6N A;  4MVT A;  4CCL A;  4OMC A;  3AFG A;  4FPJ A;  1UN1 A;  1YQ5 A;  4Y1Z A;  3VBS B;  3VBR C;  5IT6 A;  2B39 A;  1T6B X;  1IOA A;  1HRV 2;  1Q43 A;  4IXL A;  2VNG A;  1HN0 A;  1K12 A;  1V00 A;  2D98 A;  4RHV 3;  3R4D B;  2W1Q A;  3WEZ A;  4FTE A;  3NW4 A;  4J1X A;  1JYW A;  1YLL A;  3ELN A;  4GKX A;  4XFB A;  4KI5 M;  2UWA A;  2ZKL A;  3KQR A;  3OY8 B;  4LMF A;  3TRS B;  5DXD A;  1QU0 A;  4XQD A;  3RZZ A;  3C7H A;  4LBJ A;  4FOV A;  1HJG A;  1Z7S 1;  1GBG A;  1A3K A;  2D43 A;  3WP3 A;  4PJY A;  1W8Z A;  1WLD A;  1RED A;  2P4E A;  5A3O A;  3UET A;  4AFC A;  3FBM A;  4N43 A;  2PAE A;  3DPR B;  4M3C E;  4UW4 A;  5I0U A;  2JX9 A;  1YO8 A;  3H3U A;  2ZX1 A;  3FLP A;  5DAB A;  5FBJ A;  2WFF 2;  2QDR A;  3LA7 A;  3JD7 2;  4L8Q A;  4KWU A;  1W2A X;  2HYK A;  4HG6 B;  2DVF A;  3QAC A;  2CTV A;  1I1E A;  1GWM A;  4J6G A;  3RJR A;  1DU3 D;  2JKB A;  1G6N A;  3AZY A;  2DFC A;  2GN3 A;  3NKG A;  1JW6 A;  1NCQ C;  3EHK A;  4Q0U A;  4YRD A;  3USS A;  4CCO A;  3NJX A;  1LOF A;  4ZPI A;  1SBE A;  2XJT A;  5BNO B;  1BVV A;  3LOI A;  4XUO A;  2FCT A;  3MLL A;  3RFR A;  3VKF C;  5FDB A;  4LOS A;  3H8U A;  5JMC A;  1PGL 2;  2TEP A;  2A70 A;  3WIN E;  2YHJ A;  3H8O A;  1MZ6 A;  2GU9 A;  4XAA A;  2H6C A;  2Q1Z B;  4QDQ A;  2ORX A;  1Q8O A;  1VE0 A;  2JIC A;  4Q27 A;  5CYY A;  2QUO A;  3UGG A;  3O0V A;  1ZBE 3;  1Q8V A;  4UFI A;  5EZW A;  1VIW B;  2WQ8 A;  2YZ4 A;  1GZC A;  3N9P A;  2RR1 3;  1VAL A;  2QQV A;  5CB7 A;  1URX A;  2KD7 A;  1G86 A;  4P14 A;  3SCH A;  4XBN A;  4AZZ A;  3AMM A;  4FSJ A;  4OI0 A;  2ZMN A;  4FFH A;  1XJA A;  3ZFE A;  3POS A;  2QVS B;  4PLN A;  5FOJ B;  2RE9 A;  3ZYF A;  3AP4 A;  5D8A B;  2AAC A;  1F5F A;  3IWZ A;  4ARY A;  2PLV 3;  1NCQ A;  2MEV 3;  1QH6 A;  4MGS A;  5CFC A;  1HV0 A;  2FMD A;  5T55 A;  2HYX A;  1WW5 A;  2E7Q A;  3IMN A;  3VB9 A;  3WF1 A;  1LOD A;  4LO6 B;  3U37 A;  2J22 A;  5FRE A;  2R06 1;  3Q8F A;  2EXJ A;  2JEN A;  5F5Q A;  2DWR A;  3HBK A;  4CU8 A;  1N1Y A;  1U5I A;  4J25 A;  3U10 A;  3V0A B;  4MX3 A;  4CDX A;  1L3J A;  2C1F A;  4LIT A;  2ZAC A;  5F9T A;  5K0U A;  3VBU B;  3MPB A;  1EUU A;  4XZP A;  4B7K A;  1RMU 2;  1IS5 A;  1TMF 2;  3Q8A A;  4G4F A;  3ZXA C;  4OQ9 A;  2IXJ A;  3L9J T;  4Y33 A;  4BK5 A;  2VM9 A;  4QM9 A;  1VRH 2;  4BMB A;  3CJX A;  4S2G A;  1RIR A;  4CXY A;  3QH6 A;  1VBC 1;  5T3N A;  2DBI A;  3HNM A;  4FCA A;  1QH7 A;  4EWD A;  3KSC A;  1XXN A;  3ACI A;  3WP6 A;  3MBW A;  1V6L A;  4FVV A;  5FXX A;  4DEV A;  1HRV 3;  1RIN A;  4NHY A;  2UYB A;  3KT1 A;  5F2W A;  4EN7 B;  1XNT A;  1Q8Q A;  2W91 A;  2ZGR A;  3WVJ A;  4XIK A;  1PMH X;  1OA4 A;  2VE1 A;  4YW5 A;  4QPI A;  3AMN A;  1IPJ A;  2YFU A;  4XJA A;  3I2O A;  4IL7 A;  2FCU A;  4ISR A;  4TWT A;  1GP4 A;  2OUH A;  3DGT A;  3LDB A;  1EV1 2;  5DUW A;  3W58 A;  5I0S A;  1NX9 A;  1UD1 A;  4HN0 A;  3WG1 A;  1DQ6 A;  2CWM A;  4Q26 A;  2NQY A;  4QGN A;  1SDW A;  3TN9 1;  4LBK A;  3FFZ A;  3PTY A;  4BQW A;  5DQ0 A;  2OVU A;  5FY1 A;  4FPE A;  5IAX A;  5FP8 A;  4E2S A;  5BNP B;  4Z2W A;  2ZGT A;  1UYY A;  4QKN A;  2W87 A;  1N1V A;  4HBN A;  3EJK A;  5H9Q A;  1ZRF A;  4Z8B A;  4YNI A;  4FPO B;  5LCW L;  1JTZ X;  4UWD A;  1PVC 3;  2WS9 1;  4ASK A;  1BK0 A;  4C1X A;  4G3Y C;  1FMD 3;  1IQD C;  3AX4 A;  4NO4 A;  3GBW A;  3GZU C;  1Q8S A;  2ZGS A;  1CGP A;  4U2A A;  5IVE A;  1SBF A;  3VBF B;  3JU9 A;  4H7L A;  5FP4 A;  2CWS A;  3MIC A;  4NRO A;  3B5L B;  4F7Z A;  2JG9 B;  1ULO A;  3HBZ A;  3C8X A;  2VZ1 A;  1JYN A;  4XF0 A;  2WA3 A;  2Y34 A;  2BUK A;  1UY2 A;  1G7Y A;  2XR4 A;  3T2Q A;  3WCR A;  2ZEY A;  1AJK A;  4LHN A;  3T4V A;  1PK6 A;  1NLS A;  3B93 A;  5KHI A;  1KEX A;  1DLL A;  2HEW F;  3K46 A;  4LKE A;  3C7F A;  1GOF A;  4YW7 A;  3UV9 A;  4FPH A;  4BQ5 A;  5C8W A;  1HRV 1;  3U4X A;  1FV3 A;  1YI9 A;  2HBT A;  4IV1 C;  4DIQ A;  1DGL A;  1YI7 A;  4Y3O A;  3VBH C;  4XF3 A;  1R08 1;  3ECQ A;  5I0T A;  1RUI 1;  1DDL A;  4EWA A;  4A3Z A;  5CFD B;  1LKN A;  3ENR A;  4DFS A;  1W28 A;  2VUL A;  1H9P A;  4H3W A;  3RJ2 X;  4QXK A;  2VG9 A;  3I3Q A;  2QJV A; 
#chains in the Genus database with same CATH homology
 5DAW A;  4BQX A;  5LBC A;  2G19 A;  5DAX A;  2RDR A;  2JIG A;  2V4A A;  5LAS A;  3HQR A;  5EP9 A;  4J25 A;  3OUJ A;  3EMR A;  5M0T A;  3NNJ A;  2HBU A;  5EPA A;  5HV4 A;  4Y5T A;  3GJB A;  5DAQ A;  3OUI A;  3NNL A;  4ZON A;  4NHL A;  5LB6 A;  3HQU A;  2OPW A;  2RG4 A;  2RDQ A;  5IAV A;  5L9B A;  2Y33 A;  4NHY A;  3KT1 A;  2A1X A;  4XAB A;  2FCV A;  5C5U A;  4NAO A;  4NHM A;  2FCU A;  2G1M A;  3GJA A;  2JIJ A;  3NNM A;  3PL0 A;  5DAV A;  5ERL A;  4BQW A;  4MHU A;  4XAC A;  5DAP A;  4JZR A;  5LBB A;  3W20 A;  3KT7 A;  5IAX A;  3OUH A;  4NHX A;  3OBZ A;  3ITQ A;  5L9V A;  4MHR A;  4UWD A;  4ZPI A;  5IAT A;  2FCT A;  3GZE A;  4XCB A;  4Y5S A;  4XCA A;  3KT4 A;  4KBZ A;  4XAA A;  4XC9 A;  5L9R A;  2Y34 A;  5LBE A;  5LAT A;  4IW3 A;  5LBF A;  2RDN A;  4Q5O A;  5C5T A;  5EQU A;  2RDS A;  3NNF A;  5LA9 A;  5HV0 A;  3W21 A;  2HBT A;  4BQY A;  3BVC A;  5A3U A;  3MGU A;  3DKQ A;  4NHK A;  4NMI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...