5HV0A

Structural analysis of cofactor binding of a prolyl 4-hydroxylase from the pathogenic bacterium bacillus anthracis
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
212
structure length
206
Chain Sequence
NQIKEQTIFDHKGNVIKTEDREIQIISKFEEPLIVVLGNVLSDEECDELIELSKSKLARSKVGSSNDIRTSSGAFLDDNELTAKIEKRISSIMNVPASHGEGLHILNYEVDQQYKAHYDYFAEHSRSAANNRISTLVMYLNDVEEGGETFFPKLNLSVHPRKGMAVYFEYFYQDQSLNELTLHGGAPVTKGEKWIATQWVRRGTYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prolyl 4-Hydroxylase
publication title Structural analysis of cofactor binding for a prolyl 4-hydroxylase from the pathogenic bacterium Bacillus anthracis.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Oxidoreductase
total genus 59
structure length 206
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 5hv0A01
5LASA 5ERLA 3GJAA 2HBUA 5LA9A 4BQXA 3MGUA 4Q5OA 2OPWA 3W21A 3NNLA 2A1XA 3GZEA 4XCAA 4MHUA 2Y34A 4ZONA 2RG4A 5C5UA 5DAVA 2V4AA 2RDSA 2RDQA 5DAQA 3NNFA 2FCTA 3NNMA 5LBBA 4IW3A 4NHYA 5IATA 3BVCA 5C5TA 3NNJA 3OUIA 4XAAA 3OUJA 5LB6A 5DAWA 4ZPIA 5IAXA 5EPAA 3DKQA 5EP9A 5DAXA 5M0TA 4NHMA 4Y5SA 2RDRA 2Y33A 3KT4A 4UWDA 4BQYA 5LBEA 2FCUA 2RDNA 5HV4A 3GJBA 4KBZA 4NHKA 4NMIA 5LATA 5HV0A 5L9VA 4MHRA 3KT7A 4JZRA 2G1MA 3HQRA 3EMRA 3KT1A 4J25A 3HQUA 4Y5TA 4XCBA 3OUHA 5DAPA 4XACA 2HBTA 4BQWA 5A3UA 2G19A 4XC9A 5IAVA 4NHXA 3W20A 3OBZA 3PL0A 2JIJA 4NHLA 4XABA 4NAOA 5EQUA 2JIGA 3ITQA 5LBCA 5L9BA 5L9RA 5LBFA 2FCVA
chains in the Genus database with same CATH superfamily
3IDEA 2E26A 4CEWC 2Z42A 3H50A 4B7EA 4TSVA 1LRHA 4Q4Y2 4JAAA 4A2UA 1G9CA 1G9BA 1HRV3 2F4LA 4GD4A 3OYWA 4MGYE 1C1FA 2YFZA 4LMFA 5A3OA 2AH2A 2ETEA 2RMU1 4ES9A 1LEDA 1ND3B 5DZFA 2R041 4UAPA 1UPSA 1LULA 3I8TA 5C4WB 1M4WA 2ES3A 2FHRA 3IIAA 1C8M1 1AXKA 1ZRDA 5F9TA 5KHHA 1OOPC 3VZJA 1X50A 2A70A 1CONA 2VMFA 2RDSA 2Y6KA 1UF2C 2L9LA 1CPMA 4OUMA 4P9XA 1MEC1 1R1ZA 1OMIA 2P34A 3DYMA 4HPKB 4XIOA 4UW3A 4W8JA 5A7WA 4BJ0A 2FCTA 1ZZ6A 3NNMA 5ACA1 1QF3A 3ZSMA 1LHNA 4GWIA 4LKSA 4O7XA 4ZZ5A 1S2EA 4LO5B 5CNAA 2JDYA 1AJOA 1HKDA 4XAAA 2R49A 3O12A 1XNAA 4CP9A 2BBAA 2VH9A 1RMU3 1JW6A 3CKHA 1MS8A 3ZMNA 5FP9A 3R4DB 2XB6C 1GKBA 4UFIA 5A6QA 1RUD1 2DVBA 4N7UA 1Q8OA 2W39A 2VCMA 3HN3A 3JZVA 5A6ZA 4P14A 2VW0A 4X6QB 5JCTA 1ND2C 2VOVA 4WBBA 2H0BA 1P8JA 2H0VA 2RMU2 2HWD2 1W3VA 3WDWA 3GBGA 2R042 4NRMA 1V00A 4RA0A 1PIV1 1XXNA 2BYVE 1N3PA 3AMQA 5FBZA 5J48A 3RZZA 4QPGA 1Q43A 4YRDA 3NQHA 1STMA 4CRQA 1RUC1 2EAKA 3OPWA 2PA7A 4LLOA 1G6NA 1CZVA 1W0NA 4HVOA 5L9VA 2E31A 5C8CC 3KVAA 1MEC2 3N7LA 1KQRA 4K40A 1QGLA 1AJKA 2P4EA 3C3VA 1MS9A 2RS13 4A4AA 4CCOA 1EV13 2Q4SA 3F95A 3N9PA 1IS6A 3HQRA 4MSVA 1X82A 2PLV3 5FZKA 3WW1A 4AYUA 4J25A 3WF2A 3W5NA 1NLQA 4M4PA 3HQUA 3THPA 4OI2A 5JPNB 3WF3A 1VPHA 4LPLA 5FPZA 5IVCA 3SQOA 4XFAA 3QCWA 5CAZA 1VRBA 4V1PA 2E33A 3ZFEB 1RUD2 4QPIC 2DUPA 5IAVA 2JE9A 5T5JA 3BI3A 1OKQA 2YV8A 2R0FA 3ES4A 3IDAA 1W3XA 3T09A 4DZGA 1PNGA 3WDVA 1HV0A 1WBLA 2P5BA 1BLZA 1LKNA 1ZA7A 1W8NA 2YHJA 4M0HA 4MLOA 1OQDA 1VAVA 2A6ZA 1RUC2 1HV1A 3CZJA 4RGAA 4K6BA 2HWE3 1UPIA 1A6CA 3THTA 4QKFA 1VBA3 4Q29A 5FK8A 3U07A 3O1OA 1W05A 2CDOA 3ZDSA 3N9QA 3E6DA 5DPNA 5L9BA 3EQEA 3E6BA 4LKDA 4NRQA 4PDWB 1QH6A 3KB5A 1CAVA 1W9YA 1AR82 1BYHA 1TMF1 2O14A 5KHKA 5CIRA 3ACGA 5ERLA 1AL23 3ZXLA 1D7PM 4CXWA 2YBKA 5C3QA 5LEJA 4CEYC 3AVSA 4KG0A 4PF5A 5T52A 1K45A 4A6SA 4IE7A 2P37A 2Q5TA 3OGGA 5HXMA 3PIJA 5L36A 2AYHA 3H1YA 3THCA 3UJQA 3MIEA 3K3NA 1RTVA 4P9GA 1VLNA 3HBKA 4QX2A 3V0AB 1HQNA 2RG4A 1HIXA 4DO0A 1AR63 1YNAA 3PUQA 3MIBA 2WQ4A 4IE5A 2YGMA 2BGOA 4E4HA 5A6YA 5CADA 1NA1A 4OVEA 4QPYA 2RR11 1UMHA 4NHYA 3VBFA 2CWMA 1LOGA 1HXS1 2XBO1 4FOVA 4XEZA 2DCTA 2VZSA 3OTFA 3VL9A 1RUNA 1OURA 3IAPA 1FNZA 1SLTA 1TZOA 2NLRA 2W1QA 4Q1PA 3ZR6A 1HX6A 5HPOA 5J09A 4OCTA 2VC9A 4AAXA 3I59A 3B02A 4NPMA 2WNUA 1VRH1 2X5IA 4XJZA 2FMYA 1EPWA 3CJXA 4TWTA 2PQSA 2ZGPA 2QQNA 2D43A 3PVBB 4N53B 4UFHA 4D7SA 2BVVA 4JQTA 2AREA 2EIDA 2J42A 2LW8A 1DQ2A 2C9AA 3I49A 1NQDA 3QOPA 4QAWA 5IHRA 3KZ4C 3KVBA 3M7AA 4OUSA 4UBGA 5DQ0A 3VBSC 1IPKA 4FPYA 4N43B 4B4RA 5AFEA 4AI3A 1MQTB 1YRZA 4HSLA 3NV1A 5BNNA 4FO9A 1AXZA 1LCLA 1S0FA 2NPIA 3PMSA 4XMIA 4YNIA 5D1IA 4CUBA 1CQ9A 3K48A 3PJQA 5FAXA 1UU4A 4XF0A 3AMNA 4Q0VA 5F7UA 1DP0A 3VKNA 3ZN4A 3LZZA 1F4AA 5H9RA 1E5IA 2RR12 4P00B 1S0EA 4QX5A 2C1FA 4DRVA 5F1RA 4AQ6A 2X09A 3OSDA 2VNVA 2XBO2 3M3CA 4EV0A 1RUF1 3ECQA 2VNOA 3ZPYA 1YIFA 2PHXA 4XDOA 4XYXA 4LJHA 2OZ6A 3R0RA 2JDNA 5G05L 2AR6A 2BWCA 3V65A 5LZ6A 5ISLA 4YM3A 1DZQA 5BYNA 1HRV1 1N1TA 1QH7A 1VRH2 2GH8A 2IXLA 3ATGA 3AP5A 4XCBA 4CSWA 3J26N 1AVBA 3WP3A 3B93A 5FZOB 4DUWA 1DLCA 2F6BA 5CZKA 1I9RA 2ORZA 2Y60A 3QLQA 2IXKA 2GAUA 2WT0A 4ATEA 4XQDA 2W0XA 3HWJA 3QH6A 2O1QA 1XBFA 1W9WA 4RD7A 5B4XA 1O5LA 3QH7A 4K7JA 4QU1A 4XFBA 3BTXA 1LOEA 2RS53 4OYUA 1OC1A 4IV3C 1RB8G 4LK6A 2YXSA 3ALQA 3DKWA 1G9AA 2D98A 4LO4B 3WCRA 1O3RA 1HRI3 2HWF3 3H8XA 2VVEA 3M3EA 3TB0A 2CGPA 3DF0A 4NROA 2HLEA 4MGKE 3BN6A 3OG2A 2HWC3 2BERA 3HBZA 2C26A 3RVHA 3H7JA 4PBOA 5GZCA 3PUIA 1LTEA 4M3CA 3B69A 1SEFA 3Q8BA 4GH4B 3O7OA 5T5LA 5TSWA 3KGLA 1LAJA 4L99A 1VMFA 1VBE2 2A3YA 1RUF2 4IUGA 5KHGA 4MG2A 1IHMA 1SLAA 2EA7A 2BFUS 4BWOA 3TEWA 1IPJA 1HRV2 3NVCA 4LBQA 2VMEA 4LA3A 4LBKA 2WS93 4AEDC 4GALA 5C3SA 3BTYA 1N1VA 2ARXA 4E4DX 1POV0 1UY4A 3VGIA 1GYKA 2C24A 5CFCA 2NP0A 2D6NA 4BXSV 2JDMA 1WW6A 4AG4A 3IMNA 4IESA 2WJSA 3VD3A 1OBNA 2VTXJ 3VN4A 4DEVA 2VCAA 4CEWB 4Y1VA 3T0BA 5K7PA 1JTZX 1CGPA 2WNVA 3H42B 3OBAA 2AEYA 4Q4V3 2RS11 1LR5A 5EJZB 3RQ0A 1C4RA 1EV11 4YM0A 4OZXA 5GZGA 1XSQA 2EIBA 3EBRA 1LNSA 3OUJA 3VBOC 2FZ1A 1NCQA 4HN0A 4IE6A 2PLV1 1VBC2 3WEZA 1OD3A 5A7QA 2XG3A 2QQVA 1W04A 5DAXA 1RMU2 3LWCA 4NHMA 4XHBA 1OOPB 3IPVA 4B29A 1IQAA 2A6VA 3INAA 4CCEA 2VUDA 2DUQA 1QXRA 2DWRA 3ZYFA 3UKNA 3LFIA 3WG3A 1SLCA 3H3UA 5JR2A 2W1WA 2N7GA 2OT7A 4WVWA 4NVPA 4UW5A 2Y0OA 1PMHX 3ZFFA 2VOKA 2XJVA 2E7QA 4Y22B 5KWRA 3WUDA 2HWE1 4BLJA 1AL0G 3AXDA 4IEXA 3MICA 1VBA1 4JGYA 4XZUG 4BQ2A 1B35A 1X8EA 2BNMA 3S7EA 1WCDJ 1S2KA 1PK6B 4P9YA 2TBVA 4LEJA 1UWWA 1W6OA 5C8CA 4CU9A 2VR4A 3GHNA 4GZ9A 3VKOA 1ND2B 2C0ZA 5BY5A 4NIDA 4LR4A 2JG8C 4CP0A 3BALA 4MADA 4DEQA 2PLV2 1S0JA 5EFUA 1VALA 2ZEYA 3J9SA 1A34A 4XBQA 3BIWE 4BQ5A 4NPLA 5F37A 2G19A 4YW4A 4XC9A 1D2SA 4XDQA 3ST7A 4NHXA 1VE0A 1GV9A 1NOVA 1X9TA 2DVDA 3DXUA 4U2AA 4FAHA 4AGVA 2GDFA 3AZZA 5LY2A 1BK0A 1UY0A 5LA0A 3C7HA 1ASJ1 1AR61 4RSUA 5JI9A 2W52A 1ND3A 2RM23 5EQUA 4HG6B 2WFPA 3I3BA 3MLJA 1VJ2A 2WA3A 2C9KA 5C4WA 1XE7A 1DF0A 5A6XA 2D6KA 1H30A 1QMJA 4CPBD 5BXXA 2HWE2 5FWEA 4H3WA 1V6OA 1LOAA 4QPIB 4C90A 4HPKA 5FMBA 1V9U3 3ZKYA 3M2MA 5C7GA 3OY8B 1UOFA 4LULA 4JRLA 1LODA 2OYZA 1JYCA 3N9LA 1F5JA 1KEXA 1AL22 4ZKTB 4QX7A 5C3OA 3H9AA 4FXKB 5IW0A 3RZHA 2GMMA 2D3SA 3IDCB 4PJYA 1QDCA 4EWDA 3NNLA 4Y20B 4OHZA 4AFBA 4FSJA 3T4VA 4BPZA 3GXUA 1ZRCA 2GU9A 1R093 1SACA 2P3KA 4RL7A 2Y34A 2J1RA 5FZLA 4PHZA 5A3NA 1K3IA 5IT6A 4S2GA 3DYPA 4LNVA 3POJA 2W47A 4Q26A 3A21A 3UYJA 4HBNA 4ZU4A 2MHFA 1AR62 4OLLA 2H6CA 3PTYA 5L7OC 4OMDA 1MPXA 1RC6A 3FLTA 3FN9A 4MX3A 3GHMA 4XE9A 3NMBA 2VW1A 4RFT0 1XOYA 1IZ3A 2GN3A 4CEYB 3RJ2X 3WDXA 1OKOA 2QQLA 2H6BA 2XWJB 3H8OA 5I8SA 4A3XA 3NAPC 2BVBA 1XU1A 2HEVF 3POGA 3IWZA 4EN8B 4J6GA 4AVCA 2JB4A 2F17A 1YFWA 2BTVC 4MXVA 2ZMKA 1ZVFA 3CIHA 3K3OA 4A6OA 5JWPA 5GZFA 2XXZA 4QGLA 5GM0A 3GJBA 2D93A 2W87A 2WDBA 1QQP3 2C6SA 4KL1A 1QJU3 4QM9A 1FOD3 1VB2A 3WG1A 2Y6GA 2RS51 4AFCA 2DVAA 1GUIA 1PM7A 4XTMA 1YFXA 1MR5A 3VZLA 3LSEA 2XGXA 5AFBA 4COWA 1UXXX 2WABA 2HWF1 4IXLA 4N90A 1UN1A 3KT7A 4P9WA 2D40A 5JVVA 1T2XA 4KI5M 1O4YA 1W2AX 2QQUA 4BA6A 2HWC1 2VOWA 3WW4A 5JMOA 3I97A 5FZEA 5ANQA 2GMPA 4O9GA 5EHDA 3POYA 2A6WA 3CJIB 5FRAA 1XE8A 2BGPA 4QDQA 3AKPA 5EZWA 4Y5TA 3W5MA 1Z0HA 2FQPA 3TEXA 3VBSB 4ARXA 5IK7A 3ZOIA 2X05A 4R4ZA 5DAPA 2GC1A 1OF3A 2HEYF 2WC2A 3MV01 1PO13 2B42B 4PDWA 3WP4A 3O1MA 3SXWA 5LRSA 4QQLA 1GQGA 2XL7A 3KCYA 4GAZA 3W20A 4D0QA 3B00A 3O5SA 4FPJA 5FZFA 3LD8A 4FP3A 2JIJA 5AVPA 1JH5A 4UW6A 3U78A 3AYDA 2YUEA 5A1FA 2RS52 1RXGA 2WWUA 2W68A 1UMZA 1I3HA 5A3TA 1I5PA 1W6PB 1XNDA 1GMMA 4RYDA 1HRI2 1LGCA 2HWF2 1US2A 3ACHA 2LRPA 3V0AA 3LA2A 1CESA 4XUOA 5APAA 5GZDA 1C57A 1POQA 4BMEA 4CUAA 5FZ3A 4JVAA 2G9ZA 1S0IA 1U5IA 2HWC2 4H55A 4EQVA 1R082 1UIKA 1U5YA 2ZBJA 4DS0A 3ZSLA 2FDGA 1H9WA 1RITA 5DZEA 3S0MA 1D4M3 2UWCA 4KWKA 5A3MA 3ZSKA 1NXMA 1ULDA 3LGRA 3OGRA 4Q5OA 2WYFA 4IV3B 1PMJX 4FPHA 1WUVA 4QB1A 3W21A 3A0KA 4LKEA 4AI9A 1SBEA 2VBDA 5FYIA 2GP3A 4LITA 5IYYA 2WS92 2VU9A 5CVRA 1ENQA 4PF1A 2RHPA 2VAUA 2GMEA 2WWSA 3I3EA 2CTVA 4LBLA 2HEWF 2JDUA 3ZX7A 4N53A 1A8DA 1MS3A 1Q56A 2EXHA 4I3PA 4IEWA 2WLQA 4OI4A 1JHNA 1KFUL 4XDPA 2BUKA 2G9FA 2RDQA 1AR83 2X53S 4TXWA 4CVUA 1CAUB 3JU9A 3IZOA 1TNRA 2XDVA 4QPWA 3CNAA 5JPMB 2WNEA 2ATFA 5FY4A 2JX9A 3BIEA 3ZXKA 5J96B 3RGBA 4N43A 1MQTA 1RUI3 3FLPA 3NNJA 4NAMA 4Q4V2 2I07B 1PO23 5FZBA 3VV1A 5I91A 3GYDA 5FR3A 1AR71 1Y4WA 5F3IA 3VDDC 1OVSA 4BLIA 3O1SA 3J7LA 4AEDB 5LWBA 4H14A 1VBB3 2R073 1NAEA 1YXWA 3RRDA 3AZXA 1CAXB 5D8AC 2A75A 3LCPA 3CF6E 4UT5A 3I2FA 4BQ1A 5F32A 2KXLA 4YSFA 1W8FA 2WA4A 3WDTA 4AW7A 2A3XA 2LALA 3I54A 5LATA 3ILFA 4FXGB 1U5XA 4KH9A 2PHRA 5C9AC 1TG7A 4AVTA 5KR7A 1CR7A 3ZXEA 2QQWA 4N43C 3KS7A 3BU7A 1GP5A 5FZOA 3VBOB 3BU0A 2RM21 3EB7A 4ITCA 5JXJA 4K8FA 4KBBA 3FHAA 3Q8EA 4UYBA 5DUXA 4RS5C 4PBPA 3B94A 3LFMA 3POIA 3K75B 4MOAA 1ULPA 1K5MC 2ZGKA 1QNWA 3GZTB 3FE5A 3TOJA 4YZ5A 2PHTA 1BBT1 1RL3A 2YPDA 1AYM3 2VJXA 3MLKA 4D8MA 5KHIA 1OH3A 1V9U1 1ZX5A 4JDOA 2C5DA 4OI0A 1IKPA 2UURA 1GZWB 2VQUA 3X29B 5DDJ3 2AEZA 1CX4A 3ACLA 4XFGA 4NR1A 2MEV3 1BJQA 1WLDA 3FFZA 2BGCA 4GH4A 4LLFA 2ZHMA 3P5BA 3TBDA 1R091 3AYEA 4KWLA 3WQ0A 4Z1VA 3BCWA 5A70A 5FDBA 5A7PA 5FUIA 4HZFA 4XFFA 4GB31 1YI9A 2WO3A 1F2NA 4GMP3 2ZGUA 3AB0A 1XYOA 4R52A 1ZA4A 1MS1A 3UGGA 3VBHC 3PVOA 4CYDA 3LA3A 4E27A 2JG8B 3H3ZA 1L7LA 4IEOA 5F5IA 1BXHA 1MZEA 4I01A 4Q4Y1 3TWIA 1YQ5A 1BKZA 4KU8A 4Q0PA 3BTAA 2QQPA 4JRAA 1AR93 1RXFA 2ZHLA 4M01A 2BOIA 4XPVA 3DYOA 3ZN6B 1JZ8A 1ZNPA 4EZ4A 4PLMA 4CEWA 1MS4A 5L73A 1V9U2 4YVSC 3MGUA 5FP4A 1XQNA 3NV2A 5H9SA 2ZZQA 1W6QB 2ZGSA 4A3ZA 3R4UA 4L92A 3S57A 2QTWB 4WM8C 4H7MA 1UMIA 4IDZA 2DCKA 2W95A 4QKNA 4DXRA 1S0BA 3WZ1A 1OA2A 3POSA 4QWNA 4ZONA 5E89A 3OJBA 1J58A 2K9ZA 1FOD1 4SBVA 1PZ9A 1CWPA 1OOPA 2QKDA 3MEPA 1Q5OA 4A41A 1IOAA 4YZ3A 2R16A 3ELNA 4FTEA 4ATFA 3U1XA 2W3JA 2YG0A 5FY9A 1R1A3 2EIGA 2PYTA 1GWMA 3ACFA 1DBNA 3RYRA 1YFYA 1DZRA 5FYVA 3KLSA 3E5UA 3MFCA 2CAUA 3PURA 3H3LA 5LRRA 1H2KA 3RZKA 5FYBA 4BH9A 2HWD1 2WWJA 4XFIA 4MO3M 2P3IA 4Y22A 3IBMA 1FX5A 5CFDB 4Y26A 1TNFA 1PK6A 4Y3OA 1UYYA 4MUVA 4QQPA 5F5CA 4INDA 4YW3A 2QZ2A 3B7MA 3JUUA 3DN7A 4P08A 1ND2A 4Y33A 5L7OB 4CP1A 5D2AA 2FDKA 5FJHA 4KBZA 1W9FA 1GOHA 5HV0A 2FDFA 4K3UA 1JODA 4HKLA 4LKFA 1QQP2 1QJU2 1VMHA 1DIWA 1FOD2 1OUSA 4Q8LA 1ODMA 1M06G 2W92A 1V6NA 3EYPA 3VLBB 1VBC3 3MUZ1 3UGHA 2VL4A 2J1EA 3NAPB 3D82A 2PHLA 2D6LX 1PHMA 4FOQA 1NQJA 2OPKA 1O6UA 1Y9MA 3DXTA 4L97A 1D4VB 3RFRA 5J98B 1VAMA 2W46A 2VZVA 3S30A 1PK6C 2WZR3 1Y43B 5HI0A 1JXNA 4X8NA 2NZ9A 2VTFA 2CSGA 3MF9A 5SV5A 3K77A 3AM2A 4Z92B 1D4M1 2HWB3 4Y5Z0 4YW6A 4XACA 2JENA 2JECA 1EPZA 2HBTA 2K46A 3FBYA 2WT2A 3JBG2 1EAH3 4W50A 3SHRA 1EP0A 1ULEA 1FMD2 2WYSA 1AZDA 3WNMA 1NLRA 4QPIA 4IE4A 5CBLA 3VBRC 1PO12 1YLLA 3JQXA 3N7KA 3OY8A 4DY3A 4FOWA 3ZXFA 3WHUA 1JYNA 5FPBA 5IFPA 5LW9A 2A7AA 4OULA 4V2WA 5FZ7A 4AVSA 3RG0A 1PNFA 1ODNA 3ZDVA 1CIYA 2MPFA 2PXJA 3M1HA 2DVGA 2VUJA 1J3PA 5FZGA 4Y20A 2HYKA 3T3YA 1JMUB 1AR81 4YM1A 3ZMOA 4OHWA 3KHCA 4LE3A 3ZYRA 3TYJA 2XONA 2P6CA 4CE8A 2R1DA 1GICA 1ULGA 5HCBA 5FZIA 5FIXA 1MZFA 4YVWC 1ZZ7A 1PO21 2W5FA 2Q8EA 5DMYA 3NKTA 2Y0IA 3PUHA 4LORA 4Z2AA 3SCFA 1BHGA 4Y1ZA 1XE0A 3FC0A 3GJAA 4P9LA 3WG2A 1ZBA3 2ZCWA 3B01A 4FPKA 3W58A 2QFEA 1GP6A 5FZMA 1WCKA 2JKBA 1D4M2 4O65A 4ONUA 5JSOA 3ZFGC 3K4ZA 4CEYA 2IVJA 3QD6A 3V0BB 2AZ5A 3AFKA 3OGJA 4FFFA 3D0JA 2UY9A 3IT8A 2LM3A 1W03A 3WQBA 2VXRA 2ZEWA 1SMVA 1XYNA 3P6BA 2ENRA 1Z7S3 1O4ZA 1JI6A 1UW8A 1XB9A 4KMQA 2IUWA 1O91A 4IEQA 5LA1A 2JXAA 2XR4A 2QVSB 4QX8A 5BNQA 3E5QA 4HKWA 3A4UA 1FYUA 3BYWA 3IM0A 1GWLA 2WINB 4OUEA 4A7YA 4KWJA 1JZ4A 4IL7A 1PZ7A 4M0NA 2DTWA 3EO6A 5H9QA 1H2LA 1ONAA 3OPZA 5LY1A 4XJ9A 1LOBA 1RUI2 1RYYA 3SC7X 1SFPA 4YG6A 1PO22 2V4VA 1DGWX 3AP6A 2RV9A 1IG0A 5EP9A 4ES8A 2B4KA 4EN6B 5T3NA 3NWKA 4DQAA 1H4GA 3O1VA 1VBB2 2R072 3KV5A 4FT8A 4BHPA 1G8WA 5E16A 4COYA 3FWEA 4CU6A 3KT4A 2DBNA 3HEIA 1S4CA 2MEV1 4HETA 2CWSA 4XFCA 2VY0A 3NNGA 2V5YA 3CJIA 3N9NA 3W9AA 3D4KA 3VBSA 2W2IA 1O3QA 4PT6A 4AWDA 1XU2A 2WKKA 1GZTA 2WQZC 4GMP1 4UXAA 3UKTA 2P3YA 1NG0A 3VDDB 4O61A 1H8TC 5FLJA 2GN7A 2D6PA 2PQQA 2YROA 4IEVA 1EY2A 4Q0QA 5JSPA 1WD4A 1WZXA 2RS32 1N1SA 4E4SA 3NJYA 2DVFA 2VMIA 5D8AB 5FQ0B 1AR91 2P6HA 3MPBA 3AXEA 2OW4A 2WQ8A 3ZYPA 4AEJA 1AYM2 3CJIC 1W6PA 3J7MA 5AC93 3HOBA 4HVQA 1O7FA 2AC1A 5GALA 2K0GA 2XKOA 5C9AB 2OUJA 3ZXJA 2YC4A 4CP2A 1SLBA 4CXXA 4JCKA 5JOYA 1PGSA 5DDJ2 5FY5A 5KHJA 2JDPA 1W99A 3H7YA 2VBBA 1J1TA 4A42A 4RS5B 2MEV2 1XRUA 4CCCA 2VUAA 4FPCA 1NUKA 4IQPA 3J8F2 1K5MB 3FUQA 5EJ3A 2WSUA 2QQOA 1EUUA 2DUOA 2O8OA 4IV3A 2R0HA 3WP5A 2ZEXA 5FPUA 3B9IA 4N8MA 1R1A1 3CMGA 1VBE1 3AKQA 2YYOA 4QHZA 2VQAA 2ZGLA 3JQWA 1HN1A 3D6EA 3ZYIB 4AI8A 3E6CC 1BEV2 4RN5A 3LEGA 1ZZ8A 3ILNA 2EALA 2DCZA 1WMEA 1AR92 4N9IA 4A45A 1CAUA 1QJX3 3KCXA 2JE8A 3MZHA 3CQOA 4BXFA 3VL8A 3UK9A 1UYPA 1COV3 4HN1A 3EHKA 3IMMA 4H2AA 1WW5A 2W08A 3VBHB 4B8EA 2XL9A 1U5ZA 2ID4A 3KCCA 4MHUA 4AEDA 1Q8QA 4CDQC 5JMCA 3SLIA 5JZGC 4CCMA 2VW2A 1CAXA 4XUTA 1N3OA 4AVBA 3LIGA 3OGVA 4YW2A 1H2MA 4B1MA 1H1AA 1H1IA 3B3QE 2I74A 4MH0E 1OLME 1SZBA 2J1TA 2NM1A 2VE1A 1R083 4LOSA 5F2WA 1VBC1 2XUEA 3VHOA 2PAMA 4AHXA 4XAEA 2Q8CA 3RSJA 5FJKA 3RNSA 1R1A2 1RMU1 2X10A 2ZGNA 3RJRA 4YVSB 4MGZE 4AFAA 1JUIA 3PUAA 3N35A 1OF4A 2VZRA 2QNKA 3OUIA 5D21A 3VBOA 1VP6A 5A33B 3VZNA 4MGQA 3IAQA 1LGBA 4WM8B 3I3QA 1JZ2A 2WLPA 1LHUA 3HNYM 3DV8A 4FPOB 5FTTC 5FXXA 2PELA 2OKXA 3ZSEA 4NWWA 3ABZA 1WLCA 4Y5SA 5K8SA 2ZGRA 3H8UA 2TNFA 1QHDA 1OSGA 1T6BX 4AI2A 4QHOA 4D6QA 1TQ5A 4N7IA 2OIIA 2VMGA 4AHWA 2B7YA 5T5PA 4L0PA 4O9EA 2XLFA 1GZWA 1NX9A 2Y38A 4OQ9A 2YGLA 1RVF2 2RJ2A 2JJ6A 3ON7A 2XKPA 2CGNA 4Y1YA 4E2GA 2XJSA 3D3AA 4LBQD 3T08A 1IG3A 3D0SA 5LCWL 4WZFA 1YJKA 3O1TA 4R8HA 4ZHNA 3HT2A 3VBUC 2QE3A 5GLVA 1E5SA 3N9OA 3HT1A 2BQPA 1YYNA 3PDQA 5DUWA 2Q8DA 3ZXGA 3ZR5A 5FZDA 5IVVA 2PMWB 3KT1A 1DQ4A 1OUXA 1UL9A 2WZR2 2JG8A 4NPRA 1KDMA 1Z78A 4GWMA 3ZKUA 3MIHA 4J1XA 1ZBA1 2B5HA 4XXPA 1YIPA 1F5FA 4TZDA 4FI9A 2HWB2 1DGLA 1DQ0A 3KF5A 3ZLIA 3MHZA 3HAGA 4GJZA 3KD4A 1POV3 3AP4A 3N4MA 3ZN6A 1EAH2 5JR7B 2OXBA 4XF1A 4RGKA 1GSLA 1OLQA 4KWUA 2EICA 3ZYGA 3AZWA 1REDA 4YARA 1Z7S1 2X29A 5BV6A 1KD7A 2XVLA 2ZACA 5CKNA 2GNTA 1W6QA 3I2GA 4JHZA 1MS5A 3LOBA 3U11A 1SDDB 3MW2A 4HK8A 4QXKA 1AL21 3VUOA 5L9RA 1ZZ9A 3AYCA 3PU3A 5A7SA 5FXWA 2VCBA 2CV6A 2ZTNA 4E2SA 1JZ3A 4X6RB 4QT6A 2SLIA 4XTPA 4WM7C 1PVXA 4XUQA 1PVC3 2FBEA 5CYYA 3VBRB 4BK5A 4YPJA 3BTZA 5I0DA 1UQXA 3U37A 1E5HA 1DG6A 1Q8PA 2Z79A 1ZBA2 1RJ7A 2J7MA 4QX0A 5AVAA 3GDBA 2XWBB 3POWA 2JEMA 2EVXA 5DUUA 4ZZ8A 3HPNA 2Q8OA 1JN2P 2JDHA 1VMJA 3THDA 3T30A 1GLHA 3LE0A 1D0GA 1GR3A 5CFDA 5IVJA 1X7NA 4XQ4A 5A7NA 2BDRA 2FMDA 2V4AA 4YGBA 4YVWB 3WDUA 4CPBA 1Z7S2 4BMBA 2WZ8A 3GF6A 5JSRA 3I2IA 4TLGA 4YM2A 2Y6FA 1YCIA 5L7OA 1OPOA 3BVCA 4CDXC 5B4NA 2XHNA 5C71A 4FPFA 1TEIA 4I09A 2ZKLA 3NW4A 5FXVA 5HCAA 1SG3A 1WMDA 2LS6A 3C7EA 2VCCA 3USUB 3ZFGB 3B5LB 5K0UC 2WO2A 3HN1A 1CJPA 1L7RA 3IN9A 2DFCA 1VR3A 1Q8SA 1ZRRA 3AKRA 1D0HA 4NO4A 1OXCA 3NAPA 2YBPA 4XXAA 2ZXQA 4CDUC 1CZTA 3POFA 2ZX2A 4JQRA 3T4HB 3N7JA 3PVNA 5CFDC 1OVPA 5FYHA 1HB1A 1LOFC 2VGDA 4AEKA 4GWJA 4C91A 1NCRB 1TME3 1OA3A 1YQCA 4XETA 5FYYA 1BVVA 1C5HA 1OQ1A 3GNEA 3AP7A 3SEEA 5CISA 1G7YA 4QX3A 1GP4A 2DDUA 4ASMB 1QJY3 2WSVA 3Q9OA 4Q4X3 3AC0A 1CJDA 2BW8A 5B2GB 4IGOA 1NE6A 2ILMA 3S5QA 4PLOA 4DRRA 5FYUA 5BNPC 1XNKA 5EWSA 3KWVA 4BU2A 1RUJ2 1QJEA 4JDNA 1A8MA 1GQPA 3HQXA 5EYYA 2G1MA 1QKQA 4K9SA 4XURA 1FI2A 3ZXDA 1V6MA 2E63A 2VOTA 2R6QA 2WBKA 4P02B 5FO9B 4EWAA 3KMHA 2ZMLA 4AAPA 5AC92 1BMV1 2Z5WA 3AVRA 3O1RA 3NO8A 4IEUA 1WCSA 2OQ6A 1L3JA 3AMHA 2BBVA 2IXIA 1H8TB 2Y6HA 4AOCA 3HIFA 2ZA9A 1HRI1 2EF6A 1YEWA 4YGCA 3AX4A 5JLVA 2JD4A 2VULA 2UY8A 3VKLA 3V0BA 4G4FA 1MVQA 3UV9A 3OBTA 1R081 4M4RA 4XF9A 4RHV3 2VECA 3AMPA 3N7MA 1W8OA 2VZUA 2XJUA 1PZ8A 3GCWA 3ZYHA 1LJ7A 3WSOA 1RINA 2V09A 5JI7A 4QD2A 2VUCA 4Y1XA 2VZQA 1LESA 3JBG3 2LTNA 5A3WA 2IXHA 4META 1RHI2 1XJAA 4JKLA 2ARBA 1RUF3 4N9HA 2XPJA 1FMD3 4R4XA 3SCGA 4RQPC 2WS91 4AHZA 2ORXA 2XUMA 3K4DA 1DDLA 3CZUA 1MVEA 1DQ6A 1JS9A 1QJX2 1F35A 3KV4A 3VD4A 5SV8A 2LROA 4QKDA 1Q8VA 4A7ZA 3NV4A 3JB8A 1COV2 5IVBA 1BMV2 4XCAA 5DUVA 4X8PA 1I6XA 3WUCA 1WW4A 5FPXA 4QB6A 5GJ6A 4CDWC 4YW1A 1S0DA 5FZCA 1HDKA 2ZOEB 4Q4V1 1CD3G 2VBPA 1W8TA 2EXJA 1ZRIA 3PTRB 4AK3A 4YFWA 5DAQA 3LDKA 3S5AA 2ET7A 4HL0A 5F5QA 3ACIA 2QQJA 2D5FA 1CZSA 3OF1A 5HXVA 4BQ4A 5EYXA 3S7IA 3A0NA 4URTA 5BNOC 2PHDA 4ZS2A 4OI1A 5FY7A 2NN8A 2ZJCA 5ACA3 1ALYA 1FAYA 3CDZB 2D7FA 1J1LA 1C1LA 1W0OA 1UZZA 2VG9A 4OMCA 3VDDA 2ARCA 2XQRA 4TN7A 3RYPA 4CDQB 3PNAA 2NQYA 2EXIA 3NL1A 5J1XA 5JZGB 1QXJA 5FQ0A 4LBOA 2Y8KA 5D8AA 4XBLA 5T54A 3BOPA 3NV3A 4IV1C 1UYXA 3NSTA 1QIQA 3FFQA 5DN2A 5IJRA 5A7OA 4NIAA 3RI8A 3RYKA 4DNYA 2UWAA 1GOGA 2E32A 4NRPA 2XVKA 1W2UA 3VKMA 1GOFA 4R9DA 1W6NB 1WCUA 4COZA 5C9AA 5FY1A 1PIV3 3V56A 1YQ8A 3H0OA 2WZEA 3AZYA 2UWBA 2IZWA 4CCLA 3ROUA 2W9XA 1UX6A 1YO8A 4RS5A 2UYAA 2VZ1A 2R32A 4BIOA 2CNAA 1KGYA 2ADEA 4ZXKA 1K5MA 3VDAA 5T50A 2FDJA 5FZ0A 3P3NA 2EXKA 4I0AA 2Q1ZB 3UL2A 1H0BA 4QXHA 1QXPA 1AYN3 3ETPA 1AHSA 2CYFA 1PVC1 1CAWB 3MW4A 4JTNA 4E9KA 5FBJA 3OUHA 5KC6A 1KFXL 1V6LA 4RR3C 4ASLA 4R9AA 1UXZA 3AL6A 3WNPA 4R9BA 4DY5A 1GFF2 2B45X 2PTMA 1ENSA 2Z69A 3KGZA 4JKMA 3P1IA 2RS33 2C4XA 4FFIA 4P9JA 1W0PA 3VBUB 3PU8A 3A22A 3OEAA 5GLUA 5FKBA 5GLWA 4BDVB 5C6CA 4W6XA 1G9DA 3E97A 3VBHA 4FFHA 2ZMNA 3T2PA 1U0AA 4I02A 1DQ1A 4FPEA 4UF0B 4AR2A 4DXTA 5FZ9A 2GNBA 4GMP0 5LBCA 1C3HA 1K5JA 2VM9A 3UETA 5ABJB 5IVFA 1D2QA 4PIXA 3I2JA 1IQDC 4JGZA 4LK7A 5FPLA 4E8DA 2Y6LA 3J7HA 3BPZA 4D6RA 2A5ZA 3AFGA 1DU3D 5CKQA 2OQ7A 2B39A 1PVC2 1MZ5A 3J8F3 5JOZA 1VBD3 3WT3A 4GA9A 4YVSA 4AI1A 1QOTA 2OPWA 4XF4A 1W8UA 4IEPA 3VD5A 3DL3A 1QU0A 3N3HA 1NT0A 5A33A 4WM8A 4BQ3A 2E53A 5GZEA 2WZPP 2IVIB 5F2SA 4NIIA 1QJY1 1OI6A 1IS3A 1KJLA 1DYOA 2J1VA 1BEV3 3RPQA 3WY6A 5F3GA 2KD7A 1DYKA 1SFNA 3DPRC 4HSJA 2J22A 4JGZC 1W90A 3OEBA 4WM7B 4DUXA 4NUBA 3LIHA 3K4AA 3IB3A 2XQXA 3OD0A 4XBNA 1XNCA 1H2NA 5FYSA 2OA2A 3R4SA 4DIQA 1R64A 2AGSA 1FPN3 1NKGA 2BOJA 2XMLA 4XJ8A 5T5OA 1NZCA 2JDZA 2R063 1J83A 3FUOA 5IAXA 2VZ3A 2PAEA 1PMIA 5I0SA 4PLNA 1UY3A 3WF0A 3DCQA 2B9VA 4HKOA 2WAOA 4PQQA 3LA7A 2TEPA 3O0XA 2WN3A 5FZ8A 3RMYA 5FY8A 1QQP1 1UZ0A 5A80A 1QJU1 3TN92 3M3IA 5LBEA 4XJUA 1GZCA 2RDNA 5G04L 2ZKNA 3D8CA 4KGGA 4QDSA 1TME2 1S1AA 4XIKA 4DPNA 1H9PA 5JIUA 1RUE3 2RVAA 3EXUA 4Y24A 4C1XA 4CDXB 1FATA 3L2HA 1JZ5A 1QJY2 4BOWA 3IKWA 3VZMA 4BZ4A 4CZSA 1RUH3 1PGW1 4Q4X2 5K0UB 1UNBA 3FHQA 1WA4A 4RHV1 1ZBE3 5DABA 3ETQA 4AFMA 4R9CA 1CVNA 5FFOC 2R1BA 2VZOA 4CDUB 3K46A 5FYCA 1SPPB 1V0AA 4EROA 3JBG1 1HN0A 4LQRA 4W6WA 3WNOA 2JICA 4UOJA 2BV4A 1UX7A 1YI7A 3FL7A 3RMXA 1FMD1 2QQKA 3FMGA 1OLRA 1PO11 2QDRA 1ZZCA 2XLGA 2ET1A 3WHTA 1U12A 4BIFA 5CU1A 4B1LA 3U0ZA 1JYXA 3MPPG 1RVF3 3OBRA 4BQWA 4XQWA 3RI9A 2WFF2 2JKXA 3GZUC 3RWNA 2WUHA 3SISA 1DCSA 1ULFA 3SCHA 2ZPXA 2OX0A 3BB6A 4PI0A 3BOWA 3VBRA 5FMOL 2D3PA 4L11A 2ADDA 2VPVA 1J59A 5BNPB 4D6SA 3HJRA 3VDBA 2Q0AA 3M3QA 5FPAA 1F31A 5A3LA 2FDHA 5F3CA 4NAOA 1JYVA 4JTOA 1LHWA 2VOXA 5KXCA 1W2TA 1W8ZA 2UYBA 3LOIA 2W1SA 2JIGA 3ZVXA 1JU4A 1PGW2 1IS4A 4Q4W3 4RHV2 3ITQA 3QACA 2W94A 1UZYA 4Y1UA 2YU1A 4OHVA 2RE9A 4UW4A 4LO7A 3MIGA 1J3QA 2YY1A 1GANA 4YVWA 4YW5A 2JDAA 4FBFA 4NIHA 4V2VA 3O14A 4DUVA 3U10A 1GNYA 3WXPA 3FHIB 3J4UH 3DECA 3SH4A 5CKMA 1FXZA 1UY2A 4B3NA 1RUG3 3USUA 4COVA 3ZFGA 4AL9A 3T0DA 1V6KA 4DXZA 3FBMA 1LB2A 1YWKA 1UD1A 3GZEA 3T2OA 3LF7A 5DZGA 3C7GA 2DU0A 1E57A 4E2QA 2ZGOA 2YC2A 5JDBA 5C5UA 4KQ7A 1YFUA 4YFZA 2DFBA 1H8VA 2A71A 1LGNA 3NRUA 5FUPA 2XJTA 3M3OA 1RUI1 4HLTA 1NCRA 2CL2A 4K20A 2YZ4A 4K8RB 5KXDA 3NNFA 5LBBA 1JOPA 1UOBA 4FOYA 4ZY9A 4EJRA 1C8M2 1G86A 4RQPB 3AK0A 2VZTA 3KHBA 3HR9A 3E1F1 4QHBA 1VBB1 2R071 3RZJA 1W6MB 3GBFA 2RJLA 1UIJA 5DAWA 5FKCA 4FPGA 1AYN1 5ACA2 1WBFA 3N9MA 3WQ7A 5EPAA 3TNQA 4LOTA 1GNHA 4F3JA 5HCHA 1XC6A 4CCDA 4I2OA 1NY71 1SLIA 2W1UA 4XOGA 4F8AA 4CDWB 2UU8A 3C7OA 1ST8A 3AMMA 4UWDA 2DF7A 2E7TA 4ARYA 1O3SA 4MGIE 2DCJA 2WL1A 1NCRC 1X8MA 2QZ3A 4QPGC 4LHNA 2X8KA 5LA2A 1KXGA 4QX1A 4WZCA 5FY0A 4MXWB 2G4IA 1ZZBA 2RS31 5BNOB 4JV4A 5FCCA 3WW3A 1QJZA 4HXCA 2DYCA 3KQRA 3I2DA 4TLFA 1YQ2A 3LPFA 1YQ6A 1PIV2 1QOSA 1VAKA 4MHRA 4MVTA 1K12A 1AYM1 1H8TA 2ZGTA 4YGEA 2ZX1A 3VDCA 4LUKA 3WF4A 1WLTA 2HJIA 5FYZA 3KV6A 1O5UA 1C28A 4FQZA 3RZGA 1LHOA 3J7NA 4WVVA 4XZPA 1C8NA 2YMZA 3WNLA 5LEKA 3U75A 4IV1B 2I45A 5DDJ1 2YPJA 3SH5A 2B9UA 2JWPA 3WCSA 2NYYA 3WD5A 3VHPA 1AYN2 4QXBA 3WG4A 3J8F1 1VBD1 4ZU5A 2FZ2A 1NY72 4M00A 5FLHA 3JD73 2HYXA 3NJZA 4EN0A 1I1EA 2ZGMA 1RUOA 4QM8A 3PL0A 4XJAA 2B8MA 2E7AA 2HKXA 4IEYA 3ORJA 4NHLA 3POBA 1RUJ3 4LUMA 2OS2A 2P17A 1BEV1 2JG9B 2D5HA 3TRSB 4B4PA 2XJRA 3ASIA 4EZHA 4MGSA 3TEZA 2P2KA 1FT9A 1IS5A 5FREA 1ASJ3 3FLRA 4B7KA 2IXCA 2WRAA 3URFA 4HOOA 2PHUA 4Y4YA 5J36A 2NMOA 4FTBA 1BQPA 2JDKA 2V5DA 1FPN1 5K9YA 3NKGA 1ZYBA 1HW5A 1CN1A 4RR3B 2R061 4RGGA 3AJZA 4ZS3A 5DG1A 5FP3A 1BZWA 5C70A 3H1MA 4WVZA 5FXZA 3LEIA 4DINB 2D97A 1SBDA 4CTEA 1BCXA 2E6VA 1PGL1 4I3GA 3ZYJB 1JU3A 4BQXA 3SKVA 4YLZA 2R30A 3O1PA 1YJLA 2J1SA 1VBD2 1W2OA 3GBWA 3AL5A 1TMF2 2YB7A 2A1XA 4LHLA 4OFGA 4QQOA 3R6SA 1H4HA 1IGOA 4MV2A 5FK7A 2BNNA 4CDQA 3JXSA 5DG2A 1RUE1 3LQCA 3VHRA 1H6YA 3IIIA 4XHXA 4BK4A 1W2NA 4LBMA 5JZGA 1K42A 3AKTA 2VO5A 1RHI3 3WP6A 1GQHA 1OH4A 1NA1C 1RUH1 2WN2A 4FVVA 4PI2A 1ZBE1 3VBFC 2VQTA 3UNPA 3D5OA 4AEMA 4DOUA 4NJ4A 4XJWA 2IFWA 2Z4FA 1J84A 3MF6A 1RIRA 4WV8A 4ZXEA 3VHNA 5A1AA 1W6NA 4JDMA 3T1LA 5FMCA 1ZM1A 1GWKA 1QJFA 2Q1MA 2WNUC 1DGRA 3PUSA 4LA2A 4P9IA 4CCKA 2WT1A 2XOMA 1FPN2 2VNGA 2X5IC 3CEWA 5FLIA 5KXEA 1SLLA 2IWGB 2R062 1HXS2 4S2HA 5GLZA 1UZVA 3SNMA 2PN5A 1PGL2 1UU6A 3A23A 1RVF1 5IK4A 5CA6A 4YG0A 2CU5A 1W39A 3DPRB 3FZ3A 3ZXAC 4BQYA 4JGZB 4P5HA 1CX1A 4NN0A 3EJKA 2BRTA 3ME2A 4NHKA 4NMIA 4Z2WA 4D3WA 1CAWA 1SBFA 3I2HA 4KG8A 5BNNC 2DURA 1F15A 4IGPA 3WR0A 1JOBA 1KS5A 5BUVA 1DLLA 2DU1A 3SH3A 1RUE2 4LBJA 4QU2A 4C0BA 3GM8A 4K1YA 1Q3EA 2WZR1 3PJYA 5FWJA 3BKZA 1RUH2 4QB2A 4Q4W1 4GKXA 4AQSA 5IK8A 1ZBE2 4KNCA 1UY1A 4HONA 2EAAA 3MYXA 5A1LA 3HVDA 1NLSA 2HWB1 3VBUA 3G6JB 1N3QA 2AENA 2ZX3A 5KC5A 3EMRA 2CGOA 1ULCA 2Y6JA 3M4FA 5FP8A 1EAH1 4RFRB 5ANNA 1DYPA 4ORFA 5EV7A 1WCQA 5E6HA 5HBAA 4UF0A 1NE4A 4QGNA 5ABJA 1RUG1 5A3UA 1V70A 4AQTA 5I8TA 3LDBA 1H6XA 3LEKA 1GNZA 2GC2A 1DZTA 1W8WA 3JB4C 1QDOA 3USSA 3WVJA 2QDNA 3UGFA 2D6OX 5J7MA 3BODA 4JHTA 4GULA 5FO8B 1WA6X 2ZABA 1OA4A 1NXD1 2BWAA 2XH6A 1UAIA 4BM8A 4Q1RA 4I0BA 1JHJA 4NOTA 3SMHA 3F2ZA 4GQ7A 1GBGA 3MFAA 4WVMB 4Q4W2 4C0HA 1B09A 1O8PA 1T6GC 1URXA 3GGLA 1Y7BA 3HD8B 1HB2A 3PIGA 5ABJC 3E5XA 1GU3A 4XUPA 1LEMA 2PHWA 3GCXA 3IDBB 1OT5A 2HBUA 3HNBM 4WM7A 5LASA 1WMFA 1KRIA 1OHFA 2IC1A 2WO1A 2AUYA 2ERFA 2QCSB 5A32B 2MNGA 1NZIA 3ILRA 4W6YA 2GALA 3DEMA 3UKVA 4ZU7A 4QGMA 2GC3A 2ZHNA 3CO2A 4AVVA 2CDPA 2WR9A 3N36A 3RS6A 3DGTA 4OHYA 4BCUA 1RUG2 1WGPA 4FAGA 5CFCC 3I2KA 5DXDA 1FV3A 2D6MA 3MW3A 2A6XA 3AP9A 1O3TA 1S0CA 5FZAA 4JC1A 5FMOS 4A7KA 5GKAC 1JYWA 4AXOA 2KA3A 5CEHA 4IGQA 5C3RA 4Z07A 3ZIXA 5C8WA 2WNVC 4HFSA 2SBAA 4MGTA 3I3DA 4GKYA 3OYWB 1UOJA 2V73A 4BE3A 1LU2A 4Q0SA 2KM2A 5J3UA 4CDXA 3H1WA 4NE9A 1NCQC 1JUHA 1UO9A 2D44A 3S6PA 2ARAA 4G9SB 4AFDA 1PM4A 2GSYA 4EYUA 1WWYA 1BVP1 3I3MA 4L9BA 5K0UA 2A73B 1FNYA 5C33A 3CL1A 3VB9A 4LBNA 5FZHA 3T2TA 2RS12 2TUNA 3VD9A 1F9KA 4EWEA 1EV12 3HMYA 2Q1FA 2AACA 1AR73 2BP6A 2JE7A 4CDUA 5LK7B 2YBSA 3WNNA 2RDRA 1SPPA 1REEA 1LOCA 2QQMA 2YC0A 1UYZA 2Y33A 3JD71 3MI8A 3TAYA 3SEPA 1LOFA 4YGDA 5A7WB 3B9CA 1TVGA 1OPMA 5JXHA 3KSCA 1XPWA 3OGSA 3ZFFC 4E4ZA 1RUJ1 3C7FA 3I7DA 3MBWA 1ZRFA 4NIGA 3PMEA 2VTXA 4QQ2A 3TNPB 2CY6A 4CP9B 2BNOA 2BU9A 1LU1A 4JGYC 1S55A 5FZ6A 3U4SA 1DGWA 1B35C 3NJXA 1JZ7A 3CU7A 1QEXA 3CBNA 1AX1A 2G9GA 1IKQA 1AF9A 1E5RA 2PFWA 2VXJA 5BNPA 2VNRA 3BPSA 4QKBA 1VB4A 4UBHA 5AC91 5I0RA 2WAAA 1I5ZA 4IEZA 4K21A 5GLTA 1WD3A 3RDIA 3TN93 1NYWA 3MUY1 4L2NA 1WW7A 4OZOA 3WNKA 1SDWA 2XHKA 4Y4RA 1VBA2 3OD4A 5C3PA 4QPGB 4YZ2A 1BBT3 4KU7A 1YUDA 2BEOA 3V64A 2RJKA 3RZLA 4UFKA 4D69A 3GZAA 5KBFA 4XVHA 3JD72 4OHXA 3G7DA 3VZOA 2E9QA 3VKFC 2F4PA 3PHMA 2XVGA 3AZVA 1HQLA 4HMZA 1WMXA 1O59A 5FYMA 4HVRA 1ND3C 1W9SA 5I0TA 5IVEA 1RHI1 3MDPA 5C4WC 1HB3A 4CA9A 2IXJA 3WW2A 4ASKA 1LENA 4GB33 4PQ9A 5EXOA 4QDRA 5FP7A 4BISA 5IK5A 1SHWB 2VMCA 2PAKA 4SLIA 5JOXA 1ASJ2 4Z8BA 4HT1T 2WNOA 1QJX1 3CLPA 5LBFA 2ZX4A 1HQWA 1DQ5A 2HH9A 3RWKX 4AGGA 5JXGA 2WFF3 4Q4Y3 4XF3A 4LIVA 1COV1 1OQEA 2VZPA 1QWRA 4LHKA 1A3KA 2VD7A 2YFUA 4RQPA 1CIWA 2JD9A 3W59A 4H7LA 1F8VA 3FJSA 3ENRA 2GNDA 5FOBB 1W6MA 4W4ZA 5JUVA 5HCFA 3H8RA 1O4TA 3M8LA 1HJFA 4M3CF 3O0VA 3SITA 1TE1B 1WLWA 1Y9GA 4AHYA 1Y9QA 4D94A 5E1RA 3CHXA 2ZEZA 4EN9B 1HLCA 2A6YA 2YU2A 4LTAA 4XFHA 4CDWA 3QBQA 1CAVB 2DV9A 4UFJA 1W9TA 1N47A 3ZIWA 5CG8A 1DGRN 2OVUA 4LXLA 2P3JA 5IATA 4IERA 3ZFEA 4GXLA 4CCJA 4MXWA 5C5TA 5J37A 2QQIA 3WF1A 5BNOA 3PVEA 1DFQA 5CG9A 2DBIA 3AJYA 1L7QA 1H1MA 2QJVA 2IFRA 3A7QA 2J1AA 4CUGA 4PCRA 4J1WA 2O0OA 1X9PA 2RMU3 2HWD3 3ZYBA 3ES1A 4AQ2A 2R043 5F8PA 3I4IA 2FD8A 2VQ0A 4S2DA 1NA1B 1QOOA 4IV1A 1XYPA 1W28A 5F6LB 2XLAA 1J3RA 1US3A 4XW3A 4YW7A 3VBFB 1C8M3 1EYBA 4CU8A 1XSRA 4KGQA 2EIEA 1QY4A 2KR2A 3BGAA 5CB7A 1IPSA 4BB3A 4S2FA 4CXYA 3ZFEC 1W8HA 1BK1A 1XNTA 3KV9A 4FP2A 3O1UA 2GH2A 1MEC3 1JOJA 1ULOA 3I59B 2WNUB 2GC0A 2ZX0A 4IETA 5JOWA 4NWVA 4UFMA 2X5IB 2OZJA 1LHVA 4IE0A 4CU7A 2R7EB 3VD7A 3I2OA 4LO6B 3T0AA 4EN7B 1HJGA 5JXIA 2PHFA 4YZ1A 2JG9A 4PIZA 5E88A 4CCNA 4Q8KA 1KJRA 2O8QA 3MIDA 1JYIA 4URAA 1W06A 2LUWA 5E8AA 1UCXA 1POV1 1RJ8A 4FFGA 1RUD3 3LEMA 4GWNA 4QQHA 5BNNB 4AI0A 4AGRA 4PDWC 3SKJE 3U14A 4P5YA 1SCRA 3DUIA 1APNA 4RR3A 2DTYA 5IFTA 1X36A 4YZ4A 3KF3A 1OFSA 5LK5A 4XUNA 3LB9A 5JAXA 1ENXA 4Q2FA 3WQ1A 4D7TA 2J1UA 4MYEA 3M70A 2XJQA 1RUC3 1ACCA 3FX3A 4UFLA 1ENRA 4XABA 4I30A 3VZKA 4AZZA 1A78A 1V6JA 2JG9C 4CUCA 4C1WA 2Z2SB 5FUNA 4ISQA 3WNXA 3WLUA 1SFYA 2QBXA 2OUHA 3OB8A 4QMAA 3ZSJA 4FCAA 5KXBA 4JX0A 1PX4A 1JBCA 2XJPA 2Y64A 3OCPA 4YG3A 5F39A 4COUA 1S0GA 2D3RA 2FCVA 3HNMA 3LPGA 4GIQA 4LO8A 3WINE 1FV2A 1S2BA 1KITA 5LA9A 1DHKB 2B46X 3Q8FA 4HANA 1Y3TA 2ZS6B 2VMDA 2BJSA 1OD5A 4GJYA 5I8YA 4Q27A 4L8QA 1MS0A 4JKKA 1G9FA 2GP5A 4C8DA 1ZREA 3UJOA 2ZGQA 2CHHA 2W91A 5FPVA 3T2QA 4OQ8A 2BPA2 1MZ6A 5IWFA 5BPXA 4A44A 4DB5A 3ZN5A 2GNMA 4N53C 4U36A 3WV6A 4G3YC 2GZWA 5DAVA 4M3CB 1C5IA 3RZMA 5L19A 2BZDA 4PIYA 2P1BA 1OFNA 1OLMA 2WO7A 3DPRA 2Y26A 3KQ4B 3JCIA 4FPLA 1UZWA 4M3CE 4IW3A 3C8XA 4AVAA 4LHSA 3POEA 1MQTC 1AX0A 3T1MA 3ZPOA 4LBQB 3C2UA 1SQ4A 5LB6A 4EE2A 5FO7B 3LDRA 4QXCA 5FV3A 4ZPIA 1PX3A 3TN91 1TMF3 3DKQA 5EIYB 1F4HA 3GALA 1TME1 5CFCB 5M0TA 1KDKA 3MLLA 3K2OA 5FMDA 5EJ1B 1AX2A 1AR72 3PLQA 5FZ4A 3MO4A 5FOJB 3OPTA 3L2YA 4BYYA 5FZ1A 4Q4X1 5F5AA 2FCUA 2WNVB 3Q8AA 3APBA 5HV4A 2Q30A 4LE4A 4YYOA 4TTGA 4E8CA 5IVYA 2V72A 3WX5A 2DCYA 1HB4A 3O0WA 4AE2A 1WKYA 5I0UA 4LIUA 1AXYA 1REFA 2VVFA 2ZAHA 3UT0A 5A3PA 1NCQB 2I2SA 3R05A 1UOGA 3KM5A 1JYTA 1RGSA 2RR13 4LT5A 3AKSA 2NMNA 5FYTA 4K1ZA 1EUTA 2XBO3 1HXS3 1V6IA 2YDEA 3IPVB 5JIAA 4DXSA 1QNYA 4JZRA 5F6KA 2VMHA 2E51A 2RM22 4FTSA 4TYSA 3AYAA 2FDIA 2WFF1 3NJVA 4Q0UA 3MV11 5T55A 3TEYA 3ZO0B 1VRH3 2BFUL 4B4QA 4F7ZA 4XMAA 1UU5A 3OOXA 3Q8CA 1GZ9A 2VVDA 3LAGA 5F3EA 4HK9A 3ZFFB 4WVMA 1BBT2 3WOGA 2ZHKA 2JB8A 5K4LA 4GH4C 4MZUA 1KS4A 1UKGA 1X33A 2ZZJA 4JGYB 3OBZA 4AF9A 4DMIA 4F83A 1B35B 1LECA 1N1YA 2CAVA 4UI9L 4W65A 3BUCA 1XNBA 3ZM8A 5I93A 4YWAA 1W6OB 1CPNA 5C8CB 2WIIB 3LKJA 3MIFA 5A32A 4ET7A 1VIWB 4Z82A 4FQ4A 4ISRA 3U4XA 1R092 4XILA 5IUQA 4D7YA 2A3WA 3L9JT 5H9PA 1AUYA 4I0WB 4GB32 1JZ6A 1UKRA 1YHFA 2QUOA 1MACA 2ZAAA 1O8SA 3UESA 3P3PA 4DFSA 3K51A 3LSDA 3WDYA 1YC61 2K2SA 1VBE3 1SCSA
chains in the Genus database with same CATH topology
5LASA 5ERLA 3GJAA 2HBUA 5LA9A 4BQXA 3MGUA 4Q5OA 2OPWA 3W21A 3NNLA 2A1XA 3GZEA 4XCAA 4MHUA 2Y34A 4ZONA 2RG4A 5C5UA 5DAVA 2V4AA 2RDSA 2RDQA 5DAQA 3NNFA 2FCTA 3NNMA 5LBBA 4IW3A 4NHYA 5IATA 3BVCA 5C5TA 3NNJA 3OUIA 4XAAA 3OUJA 5LB6A 5DAWA 4ZPIA 5IAXA 5EPAA 3DKQA 5EP9A 5DAXA 5M0TA 4NHMA 4Y5SA 2RDRA 2Y33A 3KT4A 4UWDA 4BQYA 5LBEA 2FCUA 2RDNA 5HV4A 3GJBA 4KBZA 4NHKA 4NMIA 5LATA 5HV0A 5L9VA 4MHRA 3KT7A 4JZRA 2G1MA 3HQRA 3EMRA 3KT1A 4J25A 3HQUA 4Y5TA 4XCBA 3OUHA 5DAPA 4XACA 2HBTA 4BQWA 5A3UA 2G19A 4XC9A 5IAVA 4NHXA 3W20A 3OBZA 3PL0A 2JIJA 4NHLA 4XABA 4NAOA 5EQUA 2JIGA 3ITQA 5LBCA 5L9BA 5L9RA 5LBFA 2FCVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LAS A;  5ERL A;  3GJA A;  2HBU A;  5LA9 A;  4BQX A;  3MGU A;  4Q5O A;  2OPW A;  3W21 A;  3NNL A;  2A1X A;  3GZE A;  4XCA A;  4MHU A;  2Y34 A;  4ZON A;  2RG4 A;  5C5U A;  5DAV A;  2V4A A;  2RDS A;  2RDQ A;  5DAQ A;  3NNF A;  2FCT A;  3NNM A;  5LBB A;  4IW3 A;  4NHY A;  5IAT A;  3BVC A;  5C5T A;  3NNJ A;  3OUI A;  4XAA A;  3OUJ A;  5LB6 A;  5DAW A;  4ZPI A;  5IAX A;  5EPA A;  3DKQ A;  5EP9 A;  5DAX A;  5M0T A;  4NHM A;  4Y5S A;  2RDR A;  2Y33 A;  3KT4 A;  4UWD A;  4BQY A;  5LBE A;  2FCU A;  2RDN A;  5HV4 A;  3GJB A;  4KBZ A;  4NHK A;  4NMI A;  5LAT A;  5HV0 A;  5L9V A;  4MHR A;  3KT7 A;  4JZR A;  2G1M A;  3HQR A;  3EMR A;  3KT1 A;  4J25 A;  3HQU A;  4Y5T A;  4XCB A;  3OUH A;  5DAP A;  4XAC A;  2HBT A;  4BQW A;  5A3U A;  2G19 A;  4XC9 A;  5IAV A;  4NHX A;  3W20 A;  3OBZ A;  3PL0 A;  2JIJ A;  4NHL A;  4XAB A;  4NAO A;  5EQU A;  2JIG A;  3ITQ A;  5LBC A;  5L9B A;  5L9R A;  5LBF A;  2FCV A; 
#chains in the Genus database with same CATH topology
 3IDE A;  2E26 A;  4CEW C;  2Z42 A;  3H50 A;  4B7E A;  4TSV A;  1LRH A;  4Q4Y 2;  4JAA A;  4A2U A;  1G9C A;  1G9B A;  1HRV 3;  2F4L A;  4GD4 A;  3OYW A;  4MGY E;  1C1F A;  2YFZ A;  4LMF A;  5A3O A;  2AH2 A;  2ETE A;  2RMU 1;  4ES9 A;  1LED A;  1ND3 B;  5DZF A;  2R04 1;  4UAP A;  1UPS A;  1LUL A;  3I8T A;  5C4W B;  1M4W A;  2ES3 A;  2FHR A;  3IIA A;  1C8M 1;  1AXK A;  1ZRD A;  5F9T A;  5KHH A;  1OOP C;  3VZJ A;  1X50 A;  2A70 A;  1CON A;  2VMF A;  2RDS A;  2Y6K A;  1UF2 C;  2L9L A;  1CPM A;  4OUM A;  4P9X A;  1MEC 1;  1R1Z A;  1OMI A;  2P34 A;  3DYM A;  4HPK B;  4XIO A;  4UW3 A;  4W8J A;  5A7W A;  4BJ0 A;  2FCT A;  1ZZ6 A;  3NNM A;  5ACA 1;  1QF3 A;  3ZSM A;  1LHN A;  4GWI A;  4LKS A;  4O7X A;  4ZZ5 A;  1S2E A;  4LO5 B;  5CNA A;  2JDY A;  1AJO A;  1HKD A;  4XAA A;  2R49 A;  3O12 A;  1XNA A;  4CP9 A;  2BBA A;  2VH9 A;  1RMU 3;  1JW6 A;  3CKH A;  1MS8 A;  3ZMN A;  5FP9 A;  3R4D B;  2XB6 C;  1GKB A;  4UFI A;  5A6Q A;  1RUD 1;  2DVB A;  4N7U A;  1Q8O A;  2W39 A;  2VCM A;  3HN3 A;  3JZV A;  5A6Z A;  4P14 A;  2VW0 A;  4X6Q B;  5JCT A;  1ND2 C;  2VOV A;  4WBB A;  2H0B A;  1P8J A;  2H0V A;  2RMU 2;  2HWD 2;  1W3V A;  3WDW A;  3GBG A;  2R04 2;  4NRM A;  1V00 A;  4RA0 A;  1PIV 1;  1XXN A;  2BYV E;  1N3P A;  3AMQ A;  5FBZ A;  5J48 A;  3RZZ A;  4QPG A;  1Q43 A;  4YRD A;  3NQH A;  1STM A;  4CRQ A;  1RUC 1;  2EAK A;  3OPW A;  2PA7 A;  4LLO A;  1G6N A;  1CZV A;  1W0N A;  4HVO A;  5L9V A;  2E31 A;  5C8C C;  3KVA A;  1MEC 2;  3N7L A;  1KQR A;  4K40 A;  1QGL A;  1AJK A;  2P4E A;  3C3V A;  1MS9 A;  2RS1 3;  4A4A A;  4CCO A;  1EV1 3;  2Q4S A;  3F95 A;  3N9P A;  1IS6 A;  3HQR A;  4MSV A;  1X82 A;  2PLV 3;  5FZK A;  3WW1 A;  4AYU A;  4J25 A;  3WF2 A;  3W5N A;  1NLQ A;  4M4P A;  3HQU A;  3THP A;  4OI2 A;  5JPN B;  3WF3 A;  1VPH A;  4LPL A;  5FPZ A;  5IVC A;  3SQO A;  4XFA A;  3QCW A;  5CAZ A;  1VRB A;  4V1P A;  2E33 A;  3ZFE B;  1RUD 2;  4QPI C;  2DUP A;  5IAV A;  2JE9 A;  5T5J A;  3BI3 A;  1OKQ A;  2YV8 A;  2R0F A;  3ES4 A;  3IDA A;  1W3X A;  3T09 A;  4DZG A;  1PNG A;  3WDV A;  1HV0 A;  1WBL A;  2P5B A;  1BLZ A;  1LKN A;  1ZA7 A;  1W8N A;  2YHJ A;  4M0H A;  4MLO A;  1OQD A;  1VAV A;  2A6Z A;  1RUC 2;  1HV1 A;  3CZJ A;  4RGA A;  4K6B A;  2HWE 3;  1UPI A;  1A6C A;  3THT A;  4QKF A;  1VBA 3;  4Q29 A;  5FK8 A;  3U07 A;  3O1O A;  1W05 A;  2CDO A;  3ZDS A;  3N9Q A;  3E6D A;  5DPN A;  5L9B A;  3EQE A;  3E6B A;  4LKD A;  4NRQ A;  4PDW B;  1QH6 A;  3KB5 A;  1CAV A;  1W9Y A;  1AR8 2;  1BYH A;  1TMF 1;  2O14 A;  5KHK A;  5CIR A;  3ACG A;  5ERL A;  1AL2 3;  3ZXL A;  1D7P M;  4CXW A;  2YBK A;  5C3Q A;  5LEJ A;  4CEY C;  3AVS A;  4KG0 A;  4PF5 A;  5T52 A;  1K45 A;  4A6S A;  4IE7 A;  2P37 A;  2Q5T A;  3OGG A;  5HXM A;  3PIJ A;  5L36 A;  2AYH A;  3H1Y A;  3THC A;  3UJQ A;  3MIE A;  3K3N A;  1RTV A;  4P9G A;  1VLN A;  3HBK A;  4QX2 A;  3V0A B;  1HQN A;  2RG4 A;  1HIX A;  4DO0 A;  1AR6 3;  1YNA A;  3PUQ A;  3MIB A;  2WQ4 A;  4IE5 A;  2YGM A;  2BGO A;  4E4H A;  5A6Y A;  5CAD A;  1NA1 A;  4OVE A;  4QPY A;  2RR1 1;  1UMH A;  4NHY A;  3VBF A;  2CWM A;  1LOG A;  1HXS 1;  2XBO 1;  4FOV A;  4XEZ A;  2DCT A;  2VZS A;  3OTF A;  3VL9 A;  1RUN A;  1OUR A;  3IAP A;  1FNZ A;  1SLT A;  1TZO A;  2NLR A;  2W1Q A;  4Q1P A;  3ZR6 A;  1HX6 A;  5HPO A;  5J09 A;  4OCT A;  2VC9 A;  4AAX A;  3I59 A;  3B02 A;  4NPM A;  2WNU A;  1VRH 1;  2X5I A;  4XJZ A;  2FMY A;  1EPW A;  3CJX A;  4TWT A;  2PQS A;  2ZGP A;  2QQN A;  2D43 A;  3PVB B;  4N53 B;  4UFH A;  4D7S A;  2BVV A;  4JQT A;  2ARE A;  2EID A;  2J42 A;  2LW8 A;  1DQ2 A;  2C9A A;  3I49 A;  1NQD A;  3QOP A;  4QAW A;  5IHR A;  3KZ4 C;  3KVB A;  3M7A A;  4OUS A;  4UBG A;  5DQ0 A;  3VBS C;  1IPK A;  4FPY A;  4N43 B;  4B4R A;  5AFE A;  4AI3 A;  1MQT B;  1YRZ A;  4HSL A;  3NV1 A;  5BNN A;  4FO9 A;  1AXZ A;  1LCL A;  1S0F A;  2NPI A;  3PMS A;  4XMI A;  4YNI A;  5D1I A;  4CUB A;  1CQ9 A;  3K48 A;  3PJQ A;  5FAX A;  1UU4 A;  4XF0 A;  3AMN A;  4Q0V A;  5F7U A;  1DP0 A;  3VKN A;  3ZN4 A;  3LZZ A;  1F4A A;  5H9R A;  1E5I A;  2RR1 2;  4P00 B;  1S0E A;  4QX5 A;  2C1F A;  4DRV A;  5F1R A;  4AQ6 A;  2X09 A;  3OSD A;  2VNV A;  2XBO 2;  3M3C A;  4EV0 A;  1RUF 1;  3ECQ A;  2VNO A;  3ZPY A;  1YIF A;  2PHX A;  4XDO A;  4XYX A;  4LJH A;  2OZ6 A;  3R0R A;  2JDN A;  5G05 L;  2AR6 A;  2BWC A;  3V65 A;  5LZ6 A;  5ISL A;  4YM3 A;  1DZQ A;  5BYN A;  1HRV 1;  1N1T A;  1QH7 A;  1VRH 2;  2GH8 A;  2IXL A;  3ATG A;  3AP5 A;  4XCB A;  4CSW A;  3J26 N;  1AVB A;  3WP3 A;  3B93 A;  5FZO B;  4DUW A;  1DLC A;  2F6B A;  5CZK A;  1I9R A;  2ORZ A;  2Y60 A;  3QLQ A;  2IXK A;  2GAU A;  2WT0 A;  4ATE A;  4XQD A;  2W0X A;  3HWJ A;  3QH6 A;  2O1Q A;  1XBF A;  1W9W A;  4RD7 A;  5B4X A;  1O5L A;  3QH7 A;  4K7J A;  4QU1 A;  4XFB A;  3BTX A;  1LOE A;  2RS5 3;  4OYU A;  1OC1 A;  4IV3 C;  1RB8 G;  4LK6 A;  2YXS A;  3ALQ A;  3DKW A;  1G9A A;  2D98 A;  4LO4 B;  3WCR A;  1O3R A;  1HRI 3;  2HWF 3;  3H8X A;  2VVE A;  3M3E A;  3TB0 A;  2CGP A;  3DF0 A;  4NRO A;  2HLE A;  4MGK E;  3BN6 A;  3OG2 A;  2HWC 3;  2BER A;  3HBZ A;  2C26 A;  3RVH A;  3H7J A;  4PBO A;  5GZC A;  3PUI A;  1LTE A;  4M3C A;  3B69 A;  1SEF A;  3Q8B A;  4GH4 B;  3O7O A;  5T5L A;  5TSW A;  3KGL A;  1LAJ A;  4L99 A;  1VMF A;  1VBE 2;  2A3Y A;  1RUF 2;  4IUG A;  5KHG A;  4MG2 A;  1IHM A;  1SLA A;  2EA7 A;  2BFU S;  4BWO A;  3TEW A;  1IPJ A;  1HRV 2;  3NVC A;  4LBQ A;  2VME A;  4LA3 A;  4LBK A;  2WS9 3;  4AED C;  4GAL A;  5C3S A;  3BTY A;  1N1V A;  2ARX A;  4E4D X;  1POV 0;  1UY4 A;  3VGI A;  1GYK A;  2C24 A;  5CFC A;  2NP0 A;  2D6N A;  4BXS V;  2JDM A;  1WW6 A;  4AG4 A;  3IMN A;  4IES A;  2WJS A;  3VD3 A;  1OBN A;  2VTX J;  3VN4 A;  4DEV A;  2VCA A;  4CEW B;  4Y1V A;  3T0B A;  5K7P A;  1JTZ X;  1CGP A;  2WNV A;  3H42 B;  3OBA A;  2AEY A;  4Q4V 3;  2RS1 1;  1LR5 A;  5EJZ B;  3RQ0 A;  1C4R A;  1EV1 1;  4YM0 A;  4OZX A;  5GZG A;  1XSQ A;  2EIB A;  3EBR A;  1LNS A;  3OUJ A;  3VBO C;  2FZ1 A;  1NCQ A;  4HN0 A;  4IE6 A;  2PLV 1;  1VBC 2;  3WEZ A;  1OD3 A;  5A7Q A;  2XG3 A;  2QQV A;  1W04 A;  5DAX A;  1RMU 2;  3LWC A;  4NHM A;  4XHB A;  1OOP B;  3IPV A;  4B29 A;  1IQA A;  2A6V A;  3INA A;  4CCE A;  2VUD A;  2DUQ A;  1QXR A;  2DWR A;  3ZYF A;  3UKN A;  3LFI A;  3WG3 A;  1SLC A;  3H3U A;  5JR2 A;  2W1W A;  2N7G A;  2OT7 A;  4WVW A;  4NVP A;  4UW5 A;  2Y0O A;  1PMH X;  3ZFF A;  2VOK A;  2XJV A;  2E7Q A;  4Y22 B;  5KWR A;  3WUD A;  2HWE 1;  4BLJ A;  1AL0 G;  3AXD A;  4IEX A;  3MIC A;  1VBA 1;  4JGY A;  4XZU G;  4BQ2 A;  1B35 A;  1X8E A;  2BNM A;  3S7E A;  1WCD J;  1S2K A;  1PK6 B;  4P9Y A;  2TBV A;  4LEJ A;  1UWW A;  1W6O A;  5C8C A;  4CU9 A;  2VR4 A;  3GHN A;  4GZ9 A;  3VKO A;  1ND2 B;  2C0Z A;  5BY5 A;  4NID A;  4LR4 A;  2JG8 C;  4CP0 A;  3BAL A;  4MAD A;  4DEQ A;  2PLV 2;  1S0J A;  5EFU A;  1VAL A;  2ZEY A;  3J9S A;  1A34 A;  4XBQ A;  3BIW E;  4BQ5 A;  4NPL A;  5F37 A;  2G19 A;  4YW4 A;  4XC9 A;  1D2S A;  4XDQ A;  3ST7 A;  4NHX A;  1VE0 A;  1GV9 A;  1NOV A;  1X9T A;  2DVD A;  3DXU A;  4U2A A;  4FAH A;  4AGV A;  2GDF A;  3AZZ A;  5LY2 A;  1BK0 A;  1UY0 A;  5LA0 A;  3C7H A;  1ASJ 1;  1AR6 1;  4RSU A;  5JI9 A;  2W52 A;  1ND3 A;  2RM2 3;  5EQU A;  4HG6 B;  2WFP A;  3I3B A;  3MLJ A;  1VJ2 A;  2WA3 A;  2C9K A;  5C4W A;  1XE7 A;  1DF0 A;  5A6X A;  2D6K A;  1H30 A;  1QMJ A;  4CPB D;  5BXX A;  2HWE 2;  5FWE A;  4H3W A;  1V6O A;  1LOA A;  4QPI B;  4C90 A;  4HPK A;  5FMB A;  1V9U 3;  3ZKY A;  3M2M A;  5C7G A;  3OY8 B;  1UOF A;  4LUL A;  4JRL A;  1LOD A;  2OYZ A;  1JYC A;  3N9L A;  1F5J A;  1KEX A;  1AL2 2;  4ZKT B;  4QX7 A;  5C3O A;  3H9A A;  4FXK B;  5IW0 A;  3RZH A;  2GMM A;  2D3S A;  3IDC B;  4PJY A;  1QDC A;  4EWD A;  3NNL A;  4Y20 B;  4OHZ A;  4AFB A;  4FSJ A;  3T4V A;  4BPZ A;  3GXU A;  1ZRC A;  2GU9 A;  1R09 3;  1SAC A;  2P3K A;  4RL7 A;  2Y34 A;  2J1R A;  5FZL A;  4PHZ A;  5A3N A;  1K3I A;  5IT6 A;  4S2G A;  3DYP A;  4LNV A;  3POJ A;  2W47 A;  4Q26 A;  3A21 A;  3UYJ A;  4HBN A;  4ZU4 A;  2MHF A;  1AR6 2;  4OLL A;  2H6C A;  3PTY A;  5L7O C;  4OMD A;  1MPX A;  1RC6 A;  3FLT A;  3FN9 A;  4MX3 A;  3GHM A;  4XE9 A;  3NMB A;  2VW1 A;  4RFT 0;  1XOY A;  1IZ3 A;  2GN3 A;  4CEY B;  3RJ2 X;  3WDX A;  1OKO A;  2QQL A;  2H6B A;  2XWJ B;  3H8O A;  5I8S A;  4A3X A;  3NAP C;  2BVB A;  1XU1 A;  2HEV F;  3POG A;  3IWZ A;  4EN8 B;  4J6G A;  4AVC A;  2JB4 A;  2F17 A;  1YFW A;  2BTV C;  4MXV A;  2ZMK A;  1ZVF A;  3CIH A;  3K3O A;  4A6O A;  5JWP A;  5GZF A;  2XXZ A;  4QGL A;  5GM0 A;  3GJB A;  2D93 A;  2W87 A;  2WDB A;  1QQP 3;  2C6S A;  4KL1 A;  1QJU 3;  4QM9 A;  1FOD 3;  1VB2 A;  3WG1 A;  2Y6G A;  2RS5 1;  4AFC A;  2DVA A;  1GUI A;  1PM7 A;  4XTM A;  1YFX A;  1MR5 A;  3VZL A;  3LSE A;  2XGX A;  5AFB A;  4COW A;  1UXX X;  2WAB A;  2HWF 1;  4IXL A;  4N90 A;  1UN1 A;  3KT7 A;  4P9W A;  2D40 A;  5JVV A;  1T2X A;  4KI5 M;  1O4Y A;  1W2A X;  2QQU A;  4BA6 A;  2HWC 1;  2VOW A;  3WW4 A;  5JMO A;  3I97 A;  5FZE A;  5ANQ A;  2GMP A;  4O9G A;  5EHD A;  3POY A;  2A6W A;  3CJI B;  5FRA A;  1XE8 A;  2BGP A;  4QDQ A;  3AKP A;  5EZW A;  4Y5T A;  3W5M A;  1Z0H A;  2FQP A;  3TEX A;  3VBS B;  4ARX A;  5IK7 A;  3ZOI A;  2X05 A;  4R4Z A;  5DAP A;  2GC1 A;  1OF3 A;  2HEY F;  2WC2 A;  3MV0 1;  1PO1 3;  2B42 B;  4PDW A;  3WP4 A;  3O1M A;  3SXW A;  5LRS A;  4QQL A;  1GQG A;  2XL7 A;  3KCY A;  4GAZ A;  3W20 A;  4D0Q A;  3B00 A;  3O5S A;  4FPJ A;  5FZF A;  3LD8 A;  4FP3 A;  2JIJ A;  5AVP A;  1JH5 A;  4UW6 A;  3U78 A;  3AYD A;  2YUE A;  5A1F A;  2RS5 2;  1RXG A;  2WWU A;  2W68 A;  1UMZ A;  1I3H A;  5A3T A;  1I5P A;  1W6P B;  1XND A;  1GMM A;  4RYD A;  1HRI 2;  1LGC A;  2HWF 2;  1US2 A;  3ACH A;  2LRP A;  3V0A A;  3LA2 A;  1CES A;  4XUO A;  5APA A;  5GZD A;  1C57 A;  1POQ A;  4BME A;  4CUA A;  5FZ3 A;  4JVA A;  2G9Z A;  1S0I A;  1U5I A;  2HWC 2;  4H55 A;  4EQV A;  1R08 2;  1UIK A;  1U5Y A;  2ZBJ A;  4DS0 A;  3ZSL A;  2FDG A;  1H9W A;  1RIT A;  5DZE A;  3S0M A;  1D4M 3;  2UWC A;  4KWK A;  5A3M A;  3ZSK A;  1NXM A;  1ULD A;  3LGR A;  3OGR A;  4Q5O A;  2WYF A;  4IV3 B;  1PMJ X;  4FPH A;  1WUV A;  4QB1 A;  3W21 A;  3A0K A;  4LKE A;  4AI9 A;  1SBE A;  2VBD A;  5FYI A;  2GP3 A;  4LIT A;  5IYY A;  2WS9 2;  2VU9 A;  5CVR A;  1ENQ A;  4PF1 A;  2RHP A;  2VAU A;  2GME A;  2WWS A;  3I3E A;  2CTV A;  4LBL A;  2HEW F;  2JDU A;  3ZX7 A;  4N53 A;  1A8D A;  1MS3 A;  1Q56 A;  2EXH A;  4I3P A;  4IEW A;  2WLQ A;  4OI4 A;  1JHN A;  1KFU L;  4XDP A;  2BUK A;  2G9F A;  2RDQ A;  1AR8 3;  2X53 S;  4TXW A;  4CVU A;  1CAU B;  3JU9 A;  3IZO A;  1TNR A;  2XDV A;  4QPW A;  3CNA A;  5JPM B;  2WNE A;  2ATF A;  5FY4 A;  2JX9 A;  3BIE A;  3ZXK A;  5J96 B;  3RGB A;  4N43 A;  1MQT A;  1RUI 3;  3FLP A;  3NNJ A;  4NAM A;  4Q4V 2;  2I07 B;  1PO2 3;  5FZB A;  3VV1 A;  5I91 A;  3GYD A;  5FR3 A;  1AR7 1;  1Y4W A;  5F3I A;  3VDD C;  1OVS A;  4BLI A;  3O1S A;  3J7L A;  4AED B;  5LWB A;  4H14 A;  1VBB 3;  2R07 3;  1NAE A;  1YXW A;  3RRD A;  3AZX A;  1CAX B;  5D8A C;  2A75 A;  3LCP A;  3CF6 E;  4UT5 A;  3I2F A;  4BQ1 A;  5F32 A;  2KXL A;  4YSF A;  1W8F A;  2WA4 A;  3WDT A;  4AW7 A;  2A3X A;  2LAL A;  3I54 A;  5LAT A;  3ILF A;  4FXG B;  1U5X A;  4KH9 A;  2PHR A;  5C9A C;  1TG7 A;  4AVT A;  5KR7 A;  1CR7 A;  3ZXE A;  2QQW A;  4N43 C;  3KS7 A;  3BU7 A;  1GP5 A;  5FZO A;  3VBO B;  3BU0 A;  2RM2 1;  3EB7 A;  4ITC A;  5JXJ A;  4K8F A;  4KBB A;  3FHA A;  3Q8E A;  4UYB A;  5DUX A;  4RS5 C;  4PBP A;  3B94 A;  3LFM A;  3POI A;  3K75 B;  4MOA A;  1ULP A;  1K5M C;  2ZGK A;  1QNW A;  3GZT B;  3FE5 A;  3TOJ A;  4YZ5 A;  2PHT A;  1BBT 1;  1RL3 A;  2YPD A;  1AYM 3;  2VJX A;  3MLK A;  4D8M A;  5KHI A;  1OH3 A;  1V9U 1;  1ZX5 A;  4JDO A;  2C5D A;  4OI0 A;  1IKP A;  2UUR A;  1GZW B;  2VQU A;  3X29 B;  5DDJ 3;  2AEZ A;  1CX4 A;  3ACL A;  4XFG A;  4NR1 A;  2MEV 3;  1BJQ A;  1WLD A;  3FFZ A;  2BGC A;  4GH4 A;  4LLF A;  2ZHM A;  3P5B A;  3TBD A;  1R09 1;  3AYE A;  4KWL A;  3WQ0 A;  4Z1V A;  3BCW A;  5A70 A;  5FDB A;  5A7P A;  5FUI A;  4HZF A;  4XFF A;  4GB3 1;  1YI9 A;  2WO3 A;  1F2N A;  4GMP 3;  2ZGU A;  3AB0 A;  1XYO A;  4R52 A;  1ZA4 A;  1MS1 A;  3UGG A;  3VBH C;  3PVO A;  4CYD A;  3LA3 A;  4E27 A;  2JG8 B;  3H3Z A;  1L7L A;  4IEO A;  5F5I A;  1BXH A;  1MZE A;  4I01 A;  4Q4Y 1;  3TWI A;  1YQ5 A;  1BKZ A;  4KU8 A;  4Q0P A;  3BTA A;  2QQP A;  4JRA A;  1AR9 3;  1RXF A;  2ZHL A;  4M01 A;  2BOI A;  4XPV A;  3DYO A;  3ZN6 B;  1JZ8 A;  1ZNP A;  4EZ4 A;  4PLM A;  4CEW A;  1MS4 A;  5L73 A;  1V9U 2;  4YVS C;  3MGU A;  5FP4 A;  1XQN A;  3NV2 A;  5H9S A;  2ZZQ A;  1W6Q B;  2ZGS A;  4A3Z A;  3R4U A;  4L92 A;  3S57 A;  2QTW B;  4WM8 C;  4H7M A;  1UMI A;  4IDZ A;  2DCK A;  2W95 A;  4QKN A;  4DXR A;  1S0B A;  3WZ1 A;  1OA2 A;  3POS A;  4QWN A;  4ZON A;  5E89 A;  3OJB A;  1J58 A;  2K9Z A;  1FOD 1;  4SBV A;  1PZ9 A;  1CWP A;  1OOP A;  2QKD A;  3MEP A;  1Q5O A;  4A41 A;  1IOA A;  4YZ3 A;  2R16 A;  3ELN A;  4FTE A;  4ATF A;  3U1X A;  2W3J A;  2YG0 A;  5FY9 A;  1R1A 3;  2EIG A;  2PYT A;  1GWM A;  3ACF A;  1DBN A;  3RYR A;  1YFY A;  1DZR A;  5FYV A;  3KLS A;  3E5U A;  3MFC A;  2CAU A;  3PUR A;  3H3L A;  5LRR A;  1H2K A;  3RZK A;  5FYB A;  4BH9 A;  2HWD 1;  2WWJ A;  4XFI A;  4MO3 M;  2P3I A;  4Y22 A;  3IBM A;  1FX5 A;  5CFD B;  4Y26 A;  1TNF A;  1PK6 A;  4Y3O A;  1UYY A;  4MUV A;  4QQP A;  5F5C A;  4IND A;  4YW3 A;  2QZ2 A;  3B7M A;  3JUU A;  3DN7 A;  4P08 A;  1ND2 A;  4Y33 A;  5L7O B;  4CP1 A;  5D2A A;  2FDK A;  5FJH A;  4KBZ A;  1W9F A;  1GOH A;  5HV0 A;  2FDF A;  4K3U A;  1JOD A;  4HKL A;  4LKF A;  1QQP 2;  1QJU 2;  1VMH A;  1DIW A;  1FOD 2;  1OUS A;  4Q8L A;  1ODM A;  1M06 G;  2W92 A;  1V6N A;  3EYP A;  3VLB B;  1VBC 3;  3MUZ 1;  3UGH A;  2VL4 A;  2J1E A;  3NAP B;  3D82 A;  2PHL A;  2D6L X;  1PHM A;  4FOQ A;  1NQJ A;  2OPK A;  1O6U A;  1Y9M A;  3DXT A;  4L97 A;  1D4V B;  3RFR A;  5J98 B;  1VAM A;  2W46 A;  2VZV A;  3S30 A;  1PK6 C;  2WZR 3;  1Y43 B;  5HI0 A;  1JXN A;  4X8N A;  2NZ9 A;  2VTF A;  2CSG A;  3MF9 A;  5SV5 A;  3K77 A;  3AM2 A;  4Z92 B;  1D4M 1;  2HWB 3;  4Y5Z 0;  4YW6 A;  4XAC A;  2JEN A;  2JEC A;  1EPZ A;  2HBT A;  2K46 A;  3FBY A;  2WT2 A;  3JBG 2;  1EAH 3;  4W50 A;  3SHR A;  1EP0 A;  1ULE A;  1FMD 2;  2WYS A;  1AZD A;  3WNM A;  1NLR A;  4QPI A;  4IE4 A;  5CBL A;  3VBR C;  1PO1 2;  1YLL A;  3JQX A;  3N7K A;  3OY8 A;  4DY3 A;  4FOW A;  3ZXF A;  3WHU A;  1JYN A;  5FPB A;  5IFP A;  5LW9 A;  2A7A A;  4OUL A;  4V2W A;  5FZ7 A;  4AVS A;  3RG0 A;  1PNF A;  1ODN A;  3ZDV A;  1CIY A;  2MPF A;  2PXJ A;  3M1H A;  2DVG A;  2VUJ A;  1J3P A;  5FZG A;  4Y20 A;  2HYK A;  3T3Y A;  1JMU B;  1AR8 1;  4YM1 A;  3ZMO A;  4OHW A;  3KHC A;  4LE3 A;  3ZYR A;  3TYJ A;  2XON A;  2P6C A;  4CE8 A;  2R1D A;  1GIC A;  1ULG A;  5HCB A;  5FZI A;  5FIX A;  1MZF A;  4YVW C;  1ZZ7 A;  1PO2 1;  2W5F A;  2Q8E A;  5DMY A;  3NKT A;  2Y0I A;  3PUH A;  4LOR A;  4Z2A A;  3SCF A;  1BHG A;  4Y1Z A;  1XE0 A;  3FC0 A;  3GJA A;  4P9L A;  3WG2 A;  1ZBA 3;  2ZCW A;  3B01 A;  4FPK A;  3W58 A;  2QFE A;  1GP6 A;  5FZM A;  1WCK A;  2JKB A;  1D4M 2;  4O65 A;  4ONU A;  5JSO A;  3ZFG C;  3K4Z A;  4CEY A;  2IVJ A;  3QD6 A;  3V0B B;  2AZ5 A;  3AFK A;  3OGJ A;  4FFF A;  3D0J A;  2UY9 A;  3IT8 A;  2LM3 A;  1W03 A;  3WQB A;  2VXR A;  2ZEW A;  1SMV A;  1XYN A;  3P6B A;  2ENR A;  1Z7S 3;  1O4Z A;  1JI6 A;  1UW8 A;  1XB9 A;  4KMQ A;  2IUW A;  1O91 A;  4IEQ A;  5LA1 A;  2JXA A;  2XR4 A;  2QVS B;  4QX8 A;  5BNQ A;  3E5Q A;  4HKW A;  3A4U A;  1FYU A;  3BYW A;  3IM0 A;  1GWL A;  2WIN B;  4OUE A;  4A7Y A;  4KWJ A;  1JZ4 A;  4IL7 A;  1PZ7 A;  4M0N A;  2DTW A;  3EO6 A;  5H9Q A;  1H2L A;  1ONA A;  3OPZ A;  5LY1 A;  4XJ9 A;  1LOB A;  1RUI 2;  1RYY A;  3SC7 X;  1SFP A;  4YG6 A;  1PO2 2;  2V4V A;  1DGW X;  3AP6 A;  2RV9 A;  1IG0 A;  5EP9 A;  4ES8 A;  2B4K A;  4EN6 B;  5T3N A;  3NWK A;  4DQA A;  1H4G A;  3O1V A;  1VBB 2;  2R07 2;  3KV5 A;  4FT8 A;  4BHP A;  1G8W A;  5E16 A;  4COY A;  3FWE A;  4CU6 A;  3KT4 A;  2DBN A;  3HEI A;  1S4C A;  2MEV 1;  4HET A;  2CWS A;  4XFC A;  2VY0 A;  3NNG A;  2V5Y A;  3CJI A;  3N9N A;  3W9A A;  3D4K A;  3VBS A;  2W2I A;  1O3Q A;  4PT6 A;  4AWD A;  1XU2 A;  2WKK A;  1GZT A;  2WQZ C;  4GMP 1;  4UXA A;  3UKT A;  2P3Y A;  1NG0 A;  3VDD B;  4O61 A;  1H8T C;  5FLJ A;  2GN7 A;  2D6P A;  2PQQ A;  2YRO A;  4IEV A;  1EY2 A;  4Q0Q A;  5JSP A;  1WD4 A;  1WZX A;  2RS3 2;  1N1S A;  4E4S A;  3NJY A;  2DVF A;  2VMI A;  5D8A B;  5FQ0 B;  1AR9 1;  2P6H A;  3MPB A;  3AXE A;  2OW4 A;  2WQ8 A;  3ZYP A;  4AEJ A;  1AYM 2;  3CJI C;  1W6P A;  3J7M A;  5AC9 3;  3HOB A;  4HVQ A;  1O7F A;  2AC1 A;  5GAL A;  2K0G A;  2XKO A;  5C9A B;  2OUJ A;  3ZXJ A;  2YC4 A;  4CP2 A;  1SLB A;  4CXX A;  4JCK A;  5JOY A;  1PGS A;  5DDJ 2;  5FY5 A;  5KHJ A;  2JDP A;  1W99 A;  3H7Y A;  2VBB A;  1J1T A;  4A42 A;  4RS5 B;  2MEV 2;  1XRU A;  4CCC A;  2VUA A;  4FPC A;  1NUK A;  4IQP A;  3J8F 2;  1K5M B;  3FUQ A;  5EJ3 A;  2WSU A;  2QQO A;  1EUU A;  2DUO A;  2O8O A;  4IV3 A;  2R0H A;  3WP5 A;  2ZEX A;  5FPU A;  3B9I A;  4N8M A;  1R1A 1;  3CMG A;  1VBE 1;  3AKQ A;  2YYO A;  4QHZ A;  2VQA A;  2ZGL A;  3JQW A;  1HN1 A;  3D6E A;  3ZYI B;  4AI8 A;  3E6C C;  1BEV 2;  4RN5 A;  3LEG A;  1ZZ8 A;  3ILN A;  2EAL A;  2DCZ A;  1WME A;  1AR9 2;  4N9I A;  4A45 A;  1CAU A;  1QJX 3;  3KCX A;  2JE8 A;  3MZH A;  3CQO A;  4BXF A;  3VL8 A;  3UK9 A;  1UYP A;  1COV 3;  4HN1 A;  3EHK A;  3IMM A;  4H2A A;  1WW5 A;  2W08 A;  3VBH B;  4B8E A;  2XL9 A;  1U5Z A;  2ID4 A;  3KCC A;  4MHU A;  4AED A;  1Q8Q A;  4CDQ C;  5JMC A;  3SLI A;  5JZG C;  4CCM A;  2VW2 A;  1CAX A;  4XUT A;  1N3O A;  4AVB A;  3LIG A;  3OGV A;  4YW2 A;  1H2M A;  4B1M A;  1H1A A;  1H1I A;  3B3Q E;  2I74 A;  4MH0 E;  1OLM E;  1SZB A;  2J1T A;  2NM1 A;  2VE1 A;  1R08 3;  4LOS A;  5F2W A;  1VBC 1;  2XUE A;  3VHO A;  2PAM A;  4AHX A;  4XAE A;  2Q8C A;  3RSJ A;  5FJK A;  3RNS A;  1R1A 2;  1RMU 1;  2X10 A;  2ZGN A;  3RJR A;  4YVS B;  4MGZ E;  4AFA A;  1JUI A;  3PUA A;  3N35 A;  1OF4 A;  2VZR A;  2QNK A;  3OUI A;  5D21 A;  3VBO A;  1VP6 A;  5A33 B;  3VZN A;  4MGQ A;  3IAQ A;  1LGB A;  4WM8 B;  3I3Q A;  1JZ2 A;  2WLP A;  1LHU A;  3HNY M;  3DV8 A;  4FPO B;  5FTT C;  5FXX A;  2PEL A;  2OKX A;  3ZSE A;  4NWW A;  3ABZ A;  1WLC A;  4Y5S A;  5K8S A;  2ZGR A;  3H8U A;  2TNF A;  1QHD A;  1OSG A;  1T6B X;  4AI2 A;  4QHO A;  4D6Q A;  1TQ5 A;  4N7I A;  2OII A;  2VMG A;  4AHW A;  2B7Y A;  5T5P A;  4L0P A;  4O9E A;  2XLF A;  1GZW A;  1NX9 A;  2Y38 A;  4OQ9 A;  2YGL A;  1RVF 2;  2RJ2 A;  2JJ6 A;  3ON7 A;  2XKP A;  2CGN A;  4Y1Y A;  4E2G A;  2XJS A;  3D3A A;  4LBQ D;  3T08 A;  1IG3 A;  3D0S A;  5LCW L;  4WZF A;  1YJK A;  3O1T A;  4R8H A;  4ZHN A;  3HT2 A;  3VBU C;  2QE3 A;  5GLV A;  1E5S A;  3N9O A;  3HT1 A;  2BQP A;  1YYN A;  3PDQ A;  5DUW A;  2Q8D A;  3ZXG A;  3ZR5 A;  5FZD A;  5IVV A;  2PMW B;  3KT1 A;  1DQ4 A;  1OUX A;  1UL9 A;  2WZR 2;  2JG8 A;  4NPR A;  1KDM A;  1Z78 A;  4GWM A;  3ZKU A;  3MIH A;  4J1X A;  1ZBA 1;  2B5H A;  4XXP A;  1YIP A;  1F5F A;  4TZD A;  4FI9 A;  2HWB 2;  1DGL A;  1DQ0 A;  3KF5 A;  3ZLI A;  3MHZ A;  3HAG A;  4GJZ A;  3KD4 A;  1POV 3;  3AP4 A;  3N4M A;  3ZN6 A;  1EAH 2;  5JR7 B;  2OXB A;  4XF1 A;  4RGK A;  1GSL A;  1OLQ A;  4KWU A;  2EIC A;  3ZYG A;  3AZW A;  1RED A;  4YAR A;  1Z7S 1;  2X29 A;  5BV6 A;  1KD7 A;  2XVL A;  2ZAC A;  5CKN A;  2GNT A;  1W6Q A;  3I2G A;  4JHZ A;  1MS5 A;  3LOB A;  3U11 A;  1SDD B;  3MW2 A;  4HK8 A;  4QXK A;  1AL2 1;  3VUO A;  5L9R A;  1ZZ9 A;  3AYC A;  3PU3 A;  5A7S A;  5FXW A;  2VCB A;  2CV6 A;  2ZTN A;  4E2S A;  1JZ3 A;  4X6R B;  4QT6 A;  2SLI A;  4XTP A;  4WM7 C;  1PVX A;  4XUQ A;  1PVC 3;  2FBE A;  5CYY A;  3VBR B;  4BK5 A;  4YPJ A;  3BTZ A;  5I0D A;  1UQX A;  3U37 A;  1E5H A;  1DG6 A;  1Q8P A;  2Z79 A;  1ZBA 2;  1RJ7 A;  2J7M A;  4QX0 A;  5AVA A;  3GDB A;  2XWB B;  3POW A;  2JEM A;  2EVX A;  5DUU A;  4ZZ8 A;  3HPN A;  2Q8O A;  1JN2 P;  2JDH A;  1VMJ A;  3THD A;  3T30 A;  1GLH A;  3LE0 A;  1D0G A;  1GR3 A;  5CFD A;  5IVJ A;  1X7N A;  4XQ4 A;  5A7N A;  2BDR A;  2FMD A;  2V4A A;  4YGB A;  4YVW B;  3WDU A;  4CPB A;  1Z7S 2;  4BMB A;  2WZ8 A;  3GF6 A;  5JSR A;  3I2I A;  4TLG A;  4YM2 A;  2Y6F A;  1YCI A;  5L7O A;  1OPO A;  3BVC A;  4CDX C;  5B4N A;  2XHN A;  5C71 A;  4FPF A;  1TEI A;  4I09 A;  2ZKL A;  3NW4 A;  5FXV A;  5HCA A;  1SG3 A;  1WMD A;  2LS6 A;  3C7E A;  2VCC A;  3USU B;  3ZFG B;  3B5L B;  5K0U C;  2WO2 A;  3HN1 A;  1CJP A;  1L7R A;  3IN9 A;  2DFC A;  1VR3 A;  1Q8S A;  1ZRR A;  3AKR A;  1D0H A;  4NO4 A;  1OXC A;  3NAP A;  2YBP A;  4XXA A;  2ZXQ A;  4CDU C;  1CZT A;  3POF A;  2ZX2 A;  4JQR A;  3T4H B;  3N7J A;  3PVN A;  5CFD C;  1OVP A;  5FYH A;  1HB1 A;  1LOF C;  2VGD A;  4AEK A;  4GWJ A;  4C91 A;  1NCR B;  1TME 3;  1OA3 A;  1YQC A;  4XET A;  5FYY A;  1BVV A;  1C5H A;  1OQ1 A;  3GNE A;  3AP7 A;  3SEE A;  5CIS A;  1G7Y A;  4QX3 A;  1GP4 A;  2DDU A;  4ASM B;  1QJY 3;  2WSV A;  3Q9O A;  4Q4X 3;  3AC0 A;  1CJD A;  2BW8 A;  5B2G B;  4IGO A;  1NE6 A;  2ILM A;  3S5Q A;  4PLO A;  4DRR A;  5FYU A;  5BNP C;  1XNK A;  5EWS A;  3KWV A;  4BU2 A;  1RUJ 2;  1QJE A;  4JDN A;  1A8M A;  1GQP A;  3HQX A;  5EYY A;  2G1M A;  1QKQ A;  4K9S A;  4XUR A;  1FI2 A;  3ZXD A;  1V6M A;  2E63 A;  2VOT A;  2R6Q A;  2WBK A;  4P02 B;  5FO9 B;  4EWA A;  3KMH A;  2ZML A;  4AAP A;  5AC9 2;  1BMV 1;  2Z5W A;  3AVR A;  3O1R A;  3NO8 A;  4IEU A;  1WCS A;  2OQ6 A;  1L3J A;  3AMH A;  2BBV A;  2IXI A;  1H8T B;  2Y6H A;  4AOC A;  3HIF A;  2ZA9 A;  1HRI 1;  2EF6 A;  1YEW A;  4YGC A;  3AX4 A;  5JLV A;  2JD4 A;  2VUL A;  2UY8 A;  3VKL A;  3V0B A;  4G4F A;  1MVQ A;  3UV9 A;  3OBT A;  1R08 1;  4M4R A;  4XF9 A;  4RHV 3;  2VEC A;  3AMP A;  3N7M A;  1W8O A;  2VZU A;  2XJU A;  1PZ8 A;  3GCW A;  3ZYH A;  1LJ7 A;  3WSO A;  1RIN A;  2V09 A;  5JI7 A;  4QD2 A;  2VUC A;  4Y1X A;  2VZQ A;  1LES A;  3JBG 3;  2LTN A;  5A3W A;  2IXH A;  4MET A;  1RHI 2;  1XJA A;  4JKL A;  2ARB A;  1RUF 3;  4N9H A;  2XPJ A;  1FMD 3;  4R4X A;  3SCG A;  4RQP C;  2WS9 1;  4AHZ A;  2ORX A;  2XUM A;  3K4D A;  1DDL A;  3CZU A;  1MVE A;  1DQ6 A;  1JS9 A;  1QJX 2;  1F35 A;  3KV4 A;  3VD4 A;  5SV8 A;  2LRO A;  4QKD A;  1Q8V A;  4A7Z A;  3NV4 A;  3JB8 A;  1COV 2;  5IVB A;  1BMV 2;  4XCA A;  5DUV A;  4X8P A;  1I6X A;  3WUC A;  1WW4 A;  5FPX A;  4QB6 A;  5GJ6 A;  4CDW C;  4YW1 A;  1S0D A;  5FZC A;  1HDK A;  2ZOE B;  4Q4V 1;  1CD3 G;  2VBP A;  1W8T A;  2EXJ A;  1ZRI A;  3PTR B;  4AK3 A;  4YFW A;  5DAQ A;  3LDK A;  3S5A A;  2ET7 A;  4HL0 A;  5F5Q A;  3ACI A;  2QQJ A;  2D5F A;  1CZS A;  3OF1 A;  5HXV A;  4BQ4 A;  5EYX A;  3S7I A;  3A0N A;  4URT A;  5BNO C;  2PHD A;  4ZS2 A;  4OI1 A;  5FY7 A;  2NN8 A;  2ZJC A;  5ACA 3;  1ALY A;  1FAY A;  3CDZ B;  2D7F A;  1J1L A;  1C1L A;  1W0O A;  1UZZ A;  2VG9 A;  4OMC A;  3VDD A;  2ARC A;  2XQR A;  4TN7 A;  3RYP A;  4CDQ B;  3PNA A;  2NQY A;  2EXI A;  3NL1 A;  5J1X A;  5JZG B;  1QXJ A;  5FQ0 A;  4LBO A;  2Y8K A;  5D8A A;  4XBL A;  5T54 A;  3BOP A;  3NV3 A;  4IV1 C;  1UYX A;  3NST A;  1QIQ A;  3FFQ A;  5DN2 A;  5IJR A;  5A7O A;  4NIA A;  3RI8 A;  3RYK A;  4DNY A;  2UWA A;  1GOG A;  2E32 A;  4NRP A;  2XVK A;  1W2U A;  3VKM A;  1GOF A;  4R9D A;  1W6N B;  1WCU A;  4COZ A;  5C9A A;  5FY1 A;  1PIV 3;  3V56 A;  1YQ8 A;  3H0O A;  2WZE A;  3AZY A;  2UWB A;  2IZW A;  4CCL A;  3ROU A;  2W9X A;  1UX6 A;  1YO8 A;  4RS5 A;  2UYA A;  2VZ1 A;  2R32 A;  4BIO A;  2CNA A;  1KGY A;  2ADE A;  4ZXK A;  1K5M A;  3VDA A;  5T50 A;  2FDJ A;  5FZ0 A;  3P3N A;  2EXK A;  4I0A A;  2Q1Z B;  3UL2 A;  1H0B A;  4QXH A;  1QXP A;  1AYN 3;  3ETP A;  1AHS A;  2CYF A;  1PVC 1;  1CAW B;  3MW4 A;  4JTN A;  4E9K A;  5FBJ A;  3OUH A;  5KC6 A;  1KFX L;  1V6L A;  4RR3 C;  4ASL A;  4R9A A;  1UXZ A;  3AL6 A;  3WNP A;  4R9B A;  4DY5 A;  1GFF 2;  2B45 X;  2PTM A;  1ENS A;  2Z69 A;  3KGZ A;  4JKM A;  3P1I A;  2RS3 3;  2C4X A;  4FFI A;  4P9J A;  1W0P A;  3VBU B;  3PU8 A;  3A22 A;  3OEA A;  5GLU A;  5FKB A;  5GLW A;  4BDV B;  5C6C A;  4W6X A;  1G9D A;  3E97 A;  3VBH A;  4FFH A;  2ZMN A;  3T2P A;  1U0A A;  4I02 A;  1DQ1 A;  4FPE A;  4UF0 B;  4AR2 A;  4DXT A;  5FZ9 A;  2GNB A;  4GMP 0;  5LBC A;  1C3H A;  1K5J A;  2VM9 A;  3UET A;  5ABJ B;  5IVF A;  1D2Q A;  4PIX A;  3I2J A;  1IQD C;  4JGZ A;  4LK7 A;  5FPL A;  4E8D A;  2Y6L A;  3J7H A;  3BPZ A;  4D6R A;  2A5Z A;  3AFG A;  1DU3 D;  5CKQ A;  2OQ7 A;  2B39 A;  1PVC 2;  1MZ5 A;  3J8F 3;  5JOZ A;  1VBD 3;  3WT3 A;  4GA9 A;  4YVS A;  4AI1 A;  1QOT A;  2OPW A;  4XF4 A;  1W8U A;  4IEP A;  3VD5 A;  3DL3 A;  1QU0 A;  3N3H A;  1NT0 A;  5A33 A;  4WM8 A;  4BQ3 A;  2E53 A;  5GZE A;  2WZP P;  2IVI B;  5F2S A;  4NII A;  1QJY 1;  1OI6 A;  1IS3 A;  1KJL A;  1DYO A;  2J1V A;  1BEV 3;  3RPQ A;  3WY6 A;  5F3G A;  2KD7 A;  1DYK A;  1SFN A;  3DPR C;  4HSJ A;  2J22 A;  4JGZ C;  1W90 A;  3OEB A;  4WM7 B;  4DUX A;  4NUB A;  3LIH A;  3K4A A;  3IB3 A;  2XQX A;  3OD0 A;  4XBN A;  1XNC A;  1H2N A;  5FYS A;  2OA2 A;  3R4S A;  4DIQ A;  1R64 A;  2AGS A;  1FPN 3;  1NKG A;  2BOJ A;  2XML A;  4XJ8 A;  5T5O A;  1NZC A;  2JDZ A;  2R06 3;  1J83 A;  3FUO A;  5IAX A;  2VZ3 A;  2PAE A;  1PMI A;  5I0S A;  4PLN A;  1UY3 A;  3WF0 A;  3DCQ A;  2B9V A;  4HKO A;  2WAO A;  4PQQ A;  3LA7 A;  2TEP A;  3O0X A;  2WN3 A;  5FZ8 A;  3RMY A;  5FY8 A;  1QQP 1;  1UZ0 A;  5A80 A;  1QJU 1;  3TN9 2;  3M3I A;  5LBE A;  4XJU A;  1GZC A;  2RDN A;  5G04 L;  2ZKN A;  3D8C A;  4KGG A;  4QDS A;  1TME 2;  1S1A A;  4XIK A;  4DPN A;  1H9P A;  5JIU A;  1RUE 3;  2RVA A;  3EXU A;  4Y24 A;  4C1X A;  4CDX B;  1FAT A;  3L2H A;  1JZ5 A;  1QJY 2;  4BOW A;  3IKW A;  3VZM A;  4BZ4 A;  4CZS A;  1RUH 3;  1PGW 1;  4Q4X 2;  5K0U B;  1UNB A;  3FHQ A;  1WA4 A;  4RHV 1;  1ZBE 3;  5DAB A;  3ETQ A;  4AFM A;  4R9C A;  1CVN A;  5FFO C;  2R1B A;  2VZO A;  4CDU B;  3K46 A;  5FYC A;  1SPP B;  1V0A A;  4ERO A;  3JBG 1;  1HN0 A;  4LQR A;  4W6W A;  3WNO A;  2JIC A;  4UOJ A;  2BV4 A;  1UX7 A;  1YI7 A;  3FL7 A;  3RMX A;  1FMD 1;  2QQK A;  3FMG A;  1OLR A;  1PO1 1;  2QDR A;  1ZZC A;  2XLG A;  2ET1 A;  3WHT A;  1U12 A;  4BIF A;  5CU1 A;  4B1L A;  3U0Z A;  1JYX A;  3MPP G;  1RVF 3;  3OBR A;  4BQW A;  4XQW A;  3RI9 A;  2WFF 2;  2JKX A;  3GZU C;  3RWN A;  2WUH A;  3SIS A;  1DCS A;  1ULF A;  3SCH A;  2ZPX A;  2OX0 A;  3BB6 A;  4PI0 A;  3BOW A;  3VBR A;  5FMO L;  2D3P A;  4L11 A;  2ADD A;  2VPV A;  1J59 A;  5BNP B;  4D6S A;  3HJR A;  3VDB A;  2Q0A A;  3M3Q A;  5FPA A;  1F31 A;  5A3L A;  2FDH A;  5F3C A;  4NAO A;  1JYV A;  4JTO A;  1LHW A;  2VOX A;  5KXC A;  1W2T A;  1W8Z A;  2UYB A;  3LOI A;  2W1S A;  2JIG A;  3ZVX A;  1JU4 A;  1PGW 2;  1IS4 A;  4Q4W 3;  4RHV 2;  3ITQ A;  3QAC A;  2W94 A;  1UZY A;  4Y1U A;  2YU1 A;  4OHV A;  2RE9 A;  4UW4 A;  4LO7 A;  3MIG A;  1J3Q A;  2YY1 A;  1GAN A;  4YVW A;  4YW5 A;  2JDA A;  4FBF A;  4NIH A;  4V2V A;  3O14 A;  4DUV A;  3U10 A;  1GNY A;  3WXP A;  3FHI B;  3J4U H;  3DEC A;  3SH4 A;  5CKM A;  1FXZ A;  1UY2 A;  4B3N A;  1RUG 3;  3USU A;  4COV A;  3ZFG A;  4AL9 A;  3T0D A;  1V6K A;  4DXZ A;  3FBM A;  1LB2 A;  1YWK A;  1UD1 A;  3GZE A;  3T2O A;  3LF7 A;  5DZG A;  3C7G A;  2DU0 A;  1E57 A;  4E2Q A;  2ZGO A;  2YC2 A;  5JDB A;  5C5U A;  4KQ7 A;  1YFU A;  4YFZ A;  2DFB A;  1H8V A;  2A71 A;  1LGN A;  3NRU A;  5FUP A;  2XJT A;  3M3O A;  1RUI 1;  4HLT A;  1NCR A;  2CL2 A;  4K20 A;  2YZ4 A;  4K8R B;  5KXD A;  3NNF A;  5LBB A;  1JOP A;  1UOB A;  4FOY A;  4ZY9 A;  4EJR A;  1C8M 2;  1G86 A;  4RQP B;  3AK0 A;  2VZT A;  3KHB A;  3HR9 A;  3E1F 1;  4QHB A;  1VBB 1;  2R07 1;  3RZJ A;  1W6M B;  3GBF A;  2RJL A;  1UIJ A;  5DAW A;  5FKC A;  4FPG A;  1AYN 1;  5ACA 2;  1WBF A;  3N9M A;  3WQ7 A;  5EPA A;  3TNQ A;  4LOT A;  1GNH A;  4F3J A;  5HCH A;  1XC6 A;  4CCD A;  4I2O A;  1NY7 1;  1SLI A;  2W1U A;  4XOG A;  4F8A A;  4CDW B;  2UU8 A;  3C7O A;  1ST8 A;  3AMM A;  4UWD A;  2DF7 A;  2E7T A;  4ARY A;  1O3S A;  4MGI E;  2DCJ A;  2WL1 A;  1NCR C;  1X8M A;  2QZ3 A;  4QPG C;  4LHN A;  2X8K A;  5LA2 A;  1KXG A;  4QX1 A;  4WZC A;  5FY0 A;  4MXW B;  2G4I A;  1ZZB A;  2RS3 1;  5BNO B;  4JV4 A;  5FCC A;  3WW3 A;  1QJZ A;  4HXC A;  2DYC A;  3KQR A;  3I2D A;  4TLF A;  1YQ2 A;  3LPF A;  1YQ6 A;  1PIV 2;  1QOS A;  1VAK A;  4MHR A;  4MVT A;  1K12 A;  1AYM 1;  1H8T A;  2ZGT A;  4YGE A;  2ZX1 A;  3VDC A;  4LUK A;  3WF4 A;  1WLT A;  2HJI A;  5FYZ A;  3KV6 A;  1O5U A;  1C28 A;  4FQZ A;  3RZG A;  1LHO A;  3J7N A;  4WVV A;  4XZP A;  1C8N A;  2YMZ A;  3WNL A;  5LEK A;  3U75 A;  4IV1 B;  2I45 A;  5DDJ 1;  2YPJ A;  3SH5 A;  2B9U A;  2JWP A;  3WCS A;  2NYY A;  3WD5 A;  3VHP A;  1AYN 2;  4QXB A;  3WG4 A;  3J8F 1;  1VBD 1;  4ZU5 A;  2FZ2 A;  1NY7 2;  4M00 A;  5FLH A;  3JD7 3;  2HYX A;  3NJZ A;  4EN0 A;  1I1E A;  2ZGM A;  1RUO A;  4QM8 A;  3PL0 A;  4XJA A;  2B8M A;  2E7A A;  2HKX A;  4IEY A;  3ORJ A;  4NHL A;  3POB A;  1RUJ 3;  4LUM A;  2OS2 A;  2P17 A;  1BEV 1;  2JG9 B;  2D5H A;  3TRS B;  4B4P A;  2XJR A;  3ASI A;  4EZH A;  4MGS A;  3TEZ A;  2P2K A;  1FT9 A;  1IS5 A;  5FRE A;  1ASJ 3;  3FLR A;  4B7K A;  2IXC A;  2WRA A;  3URF A;  4HOO A;  2PHU A;  4Y4Y A;  5J36 A;  2NMO A;  4FTB A;  1BQP A;  2JDK A;  2V5D A;  1FPN 1;  5K9Y A;  3NKG A;  1ZYB A;  1HW5 A;  1CN1 A;  4RR3 B;  2R06 1;  4RGG A;  3AJZ A;  4ZS3 A;  5DG1 A;  5FP3 A;  1BZW A;  5C70 A;  3H1M A;  4WVZ A;  5FXZ A;  3LEI A;  4DIN B;  2D97 A;  1SBD A;  4CTE A;  1BCX A;  2E6V A;  1PGL 1;  4I3G A;  3ZYJ B;  1JU3 A;  4BQX A;  3SKV A;  4YLZ A;  2R30 A;  3O1P A;  1YJL A;  2J1S A;  1VBD 2;  1W2O A;  3GBW A;  3AL5 A;  1TMF 2;  2YB7 A;  2A1X A;  4LHL A;  4OFG A;  4QQO A;  3R6S A;  1H4H A;  1IGO A;  4MV2 A;  5FK7 A;  2BNN A;  4CDQ A;  3JXS A;  5DG2 A;  1RUE 1;  3LQC A;  3VHR A;  1H6Y A;  3III A;  4XHX A;  4BK4 A;  1W2N A;  4LBM A;  5JZG A;  1K42 A;  3AKT A;  2VO5 A;  1RHI 3;  3WP6 A;  1GQH A;  1OH4 A;  1NA1 C;  1RUH 1;  2WN2 A;  4FVV A;  4PI2 A;  1ZBE 1;  3VBF C;  2VQT A;  3UNP A;  3D5O A;  4AEM A;  4DOU A;  4NJ4 A;  4XJW A;  2IFW A;  2Z4F A;  1J84 A;  3MF6 A;  1RIR A;  4WV8 A;  4ZXE A;  3VHN A;  5A1A A;  1W6N A;  4JDM A;  3T1L A;  5FMC A;  1ZM1 A;  1GWK A;  1QJF A;  2Q1M A;  2WNU C;  1DGR A;  3PUS A;  4LA2 A;  4P9I A;  4CCK A;  2WT1 A;  2XOM A;  1FPN 2;  2VNG A;  2X5I C;  3CEW A;  5FLI A;  5KXE A;  1SLL A;  2IWG B;  2R06 2;  1HXS 2;  4S2H A;  5GLZ A;  1UZV A;  3SNM A;  2PN5 A;  1PGL 2;  1UU6 A;  3A23 A;  1RVF 1;  5IK4 A;  5CA6 A;  4YG0 A;  2CU5 A;  1W39 A;  3DPR B;  3FZ3 A;  3ZXA C;  4BQY A;  4JGZ B;  4P5H A;  1CX1 A;  4NN0 A;  3EJK A;  2BRT A;  3ME2 A;  4NHK A;  4NMI A;  4Z2W A;  4D3W A;  1CAW A;  1SBF A;  3I2H A;  4KG8 A;  5BNN C;  2DUR A;  1F15 A;  4IGP A;  3WR0 A;  1JOB A;  1KS5 A;  5BUV A;  1DLL A;  2DU1 A;  3SH3 A;  1RUE 2;  4LBJ A;  4QU2 A;  4C0B A;  3GM8 A;  4K1Y A;  1Q3E A;  2WZR 1;  3PJY A;  5FWJ A;  3BKZ A;  1RUH 2;  4QB2 A;  4Q4W 1;  4GKX A;  4AQS A;  5IK8 A;  1ZBE 2;  4KNC A;  1UY1 A;  4HON A;  2EAA A;  3MYX A;  5A1L A;  3HVD A;  1NLS A;  2HWB 1;  3VBU A;  3G6J B;  1N3Q A;  2AEN A;  2ZX3 A;  5KC5 A;  3EMR A;  2CGO A;  1ULC A;  2Y6J A;  3M4F A;  5FP8 A;  1EAH 1;  4RFR B;  5ANN A;  1DYP A;  4ORF A;  5EV7 A;  1WCQ A;  5E6H A;  5HBA A;  4UF0 A;  1NE4 A;  4QGN A;  5ABJ A;  1RUG 1;  5A3U A;  1V70 A;  4AQT A;  5I8T A;  3LDB A;  1H6X A;  3LEK A;  1GNZ A;  2GC2 A;  1DZT A;  1W8W A;  3JB4 C;  1QDO A;  3USS A;  3WVJ A;  2QDN A;  3UGF A;  2D6O X;  5J7M A;  3BOD A;  4JHT A;  4GUL A;  5FO8 B;  1WA6 X;  2ZAB A;  1OA4 A;  1NXD 1;  2BWA A;  2XH6 A;  1UAI A;  4BM8 A;  4Q1R A;  4I0B A;  1JHJ A;  4NOT A;  3SMH A;  3F2Z A;  4GQ7 A;  1GBG A;  3MFA A;  4WVM B;  4Q4W 2;  4C0H A;  1B09 A;  1O8P A;  1T6G C;  1URX A;  3GGL A;  1Y7B A;  3HD8 B;  1HB2 A;  3PIG A;  5ABJ C;  3E5X A;  1GU3 A;  4XUP A;  1LEM A;  2PHW A;  3GCX A;  3IDB B;  1OT5 A;  2HBU A;  3HNB M;  4WM7 A;  5LAS A;  1WMF A;  1KRI A;  1OHF A;  2IC1 A;  2WO1 A;  2AUY A;  2ERF A;  2QCS B;  5A32 B;  2MNG A;  1NZI A;  3ILR A;  4W6Y A;  2GAL A;  3DEM A;  3UKV A;  4ZU7 A;  4QGM A;  2GC3 A;  2ZHN A;  3CO2 A;  4AVV A;  2CDP A;  2WR9 A;  3N36 A;  3RS6 A;  3DGT A;  4OHY A;  4BCU A;  1RUG 2;  1WGP A;  4FAG A;  5CFC C;  3I2K A;  5DXD A;  1FV3 A;  2D6M A;  3MW3 A;  2A6X A;  3AP9 A;  1O3T A;  1S0C A;  5FZA A;  4JC1 A;  5FMO S;  4A7K A;  5GKA C;  1JYW A;  4AXO A;  2KA3 A;  5CEH A;  4IGQ A;  5C3R A;  4Z07 A;  3ZIX A;  5C8W A;  2WNV C;  4HFS A;  2SBA A;  4MGT A;  3I3D A;  4GKY A;  3OYW B;  1UOJ A;  2V73 A;  4BE3 A;  1LU2 A;  4Q0S A;  2KM2 A;  5J3U A;  4CDX A;  3H1W A;  4NE9 A;  1NCQ C;  1JUH A;  1UO9 A;  2D44 A;  3S6P A;  2ARA A;  4G9S B;  4AFD A;  1PM4 A;  2GSY A;  4EYU A;  1WWY A;  1BVP 1;  3I3M A;  4L9B A;  5K0U A;  2A73 B;  1FNY A;  5C33 A;  3CL1 A;  3VB9 A;  4LBN A;  5FZH A;  3T2T A;  2RS1 2;  2TUN A;  3VD9 A;  1F9K A;  4EWE A;  1EV1 2;  3HMY A;  2Q1F A;  2AAC A;  1AR7 3;  2BP6 A;  2JE7 A;  4CDU A;  5LK7 B;  2YBS A;  3WNN A;  2RDR A;  1SPP A;  1REE A;  1LOC A;  2QQM A;  2YC0 A;  1UYZ A;  2Y33 A;  3JD7 1;  3MI8 A;  3TAY A;  3SEP A;  1LOF A;  4YGD A;  5A7W B;  3B9C A;  1TVG A;  1OPM A;  5JXH A;  3KSC A;  1XPW A;  3OGS A;  3ZFF C;  4E4Z A;  1RUJ 1;  3C7F A;  3I7D A;  3MBW A;  1ZRF A;  4NIG A;  3PME A;  2VTX A;  4QQ2 A;  3TNP B;  2CY6 A;  4CP9 B;  2BNO A;  2BU9 A;  1LU1 A;  4JGY C;  1S55 A;  5FZ6 A;  3U4S A;  1DGW A;  1B35 C;  3NJX A;  1JZ7 A;  3CU7 A;  1QEX A;  3CBN A;  1AX1 A;  2G9G A;  1IKQ A;  1AF9 A;  1E5R A;  2PFW A;  2VXJ A;  5BNP A;  2VNR A;  3BPS A;  4QKB A;  1VB4 A;  4UBH A;  5AC9 1;  5I0R A;  2WAA A;  1I5Z A;  4IEZ A;  4K21 A;  5GLT A;  1WD3 A;  3RDI A;  3TN9 3;  1NYW A;  3MUY 1;  4L2N A;  1WW7 A;  4OZO A;  3WNK A;  1SDW A;  2XHK A;  4Y4R A;  1VBA 2;  3OD4 A;  5C3P A;  4QPG B;  4YZ2 A;  1BBT 3;  4KU7 A;  1YUD A;  2BEO A;  3V64 A;  2RJK A;  3RZL A;  4UFK A;  4D69 A;  3GZA A;  5KBF A;  4XVH A;  3JD7 2;  4OHX A;  3G7D A;  3VZO A;  2E9Q A;  3VKF C;  2F4P A;  3PHM A;  2XVG A;  3AZV A;  1HQL A;  4HMZ A;  1WMX A;  1O59 A;  5FYM A;  4HVR A;  1ND3 C;  1W9S A;  5I0T A;  5IVE A;  1RHI 1;  3MDP A;  5C4W C;  1HB3 A;  4CA9 A;  2IXJ A;  3WW2 A;  4ASK A;  1LEN A;  4GB3 3;  4PQ9 A;  5EXO A;  4QDR A;  5FP7 A;  4BIS A;  5IK5 A;  1SHW B;  2VMC A;  2PAK A;  4SLI A;  5JOX A;  1ASJ 2;  4Z8B A;  4HT1 T;  2WNO A;  1QJX 1;  3CLP A;  5LBF A;  2ZX4 A;  1HQW A;  1DQ5 A;  2HH9 A;  3RWK X;  4AGG A;  5JXG A;  2WFF 3;  4Q4Y 3;  4XF3 A;  4LIV A;  1COV 1;  1OQE A;  2VZP A;  1QWR A;  4LHK A;  1A3K A;  2VD7 A;  2YFU A;  4RQP A;  1CIW A;  2JD9 A;  3W59 A;  4H7L A;  1F8V A;  3FJS A;  3ENR A;  2GND A;  5FOB B;  1W6M A;  4W4Z A;  5JUV A;  5HCF A;  3H8R A;  1O4T A;  3M8L A;  1HJF A;  4M3C F;  3O0V A;  3SIT A;  1TE1 B;  1WLW A;  1Y9G A;  4AHY A;  1Y9Q A;  4D94 A;  5E1R A;  3CHX A;  2ZEZ A;  4EN9 B;  1HLC A;  2A6Y A;  2YU2 A;  4LTA A;  4XFH A;  4CDW A;  3QBQ A;  1CAV B;  2DV9 A;  4UFJ A;  1W9T A;  1N47 A;  3ZIW A;  5CG8 A;  1DGR N;  2OVU A;  4LXL A;  2P3J A;  5IAT A;  4IER A;  3ZFE A;  4GXL A;  4CCJ A;  4MXW A;  5C5T A;  5J37 A;  2QQI A;  3WF1 A;  5BNO A;  3PVE A;  1DFQ A;  5CG9 A;  2DBI A;  3AJY A;  1L7Q A;  1H1M A;  2QJV A;  2IFR A;  3A7Q A;  2J1A A;  4CUG A;  4PCR A;  4J1W A;  2O0O A;  1X9P A;  2RMU 3;  2HWD 3;  3ZYB A;  3ES1 A;  4AQ2 A;  2R04 3;  5F8P A;  3I4I A;  2FD8 A;  2VQ0 A;  4S2D A;  1NA1 B;  1QOO A;  4IV1 A;  1XYP A;  1W28 A;  5F6L B;  2XLA A;  1J3R A;  1US3 A;  4XW3 A;  4YW7 A;  3VBF B;  1C8M 3;  1EYB A;  4CU8 A;  1XSR A;  4KGQ A;  2EIE A;  1QY4 A;  2KR2 A;  3BGA A;  5CB7 A;  1IPS A;  4BB3 A;  4S2F A;  4CXY A;  3ZFE C;  1W8H A;  1BK1 A;  1XNT A;  3KV9 A;  4FP2 A;  3O1U A;  2GH2 A;  1MEC 3;  1JOJ A;  1ULO A;  3I59 B;  2WNU B;  2GC0 A;  2ZX0 A;  4IET A;  5JOW A;  4NWV A;  4UFM A;  2X5I B;  2OZJ A;  1LHV A;  4IE0 A;  4CU7 A;  2R7E B;  3VD7 A;  3I2O A;  4LO6 B;  3T0A A;  4EN7 B;  1HJG A;  5JXI A;  2PHF A;  4YZ1 A;  2JG9 A;  4PIZ A;  5E88 A;  4CCN A;  4Q8K A;  1KJR A;  2O8Q A;  3MID A;  1JYI A;  4URA A;  1W06 A;  2LUW A;  5E8A A;  1UCX A;  1POV 1;  1RJ8 A;  4FFG A;  1RUD 3;  3LEM A;  4GWN A;  4QQH A;  5BNN B;  4AI0 A;  4AGR A;  4PDW C;  3SKJ E;  3U14 A;  4P5Y A;  1SCR A;  3DUI A;  1APN A;  4RR3 A;  2DTY A;  5IFT A;  1X36 A;  4YZ4 A;  3KF3 A;  1OFS A;  5LK5 A;  4XUN A;  3LB9 A;  5JAX A;  1ENX A;  4Q2F A;  3WQ1 A;  4D7T A;  2J1U A;  4MYE A;  3M70 A;  2XJQ A;  1RUC 3;  1ACC A;  3FX3 A;  4UFL A;  1ENR A;  4XAB A;  4I30 A;  3VZK A;  4AZZ A;  1A78 A;  1V6J A;  2JG9 C;  4CUC A;  4C1W A;  2Z2S B;  5FUN A;  4ISQ A;  3WNX A;  3WLU A;  1SFY A;  2QBX A;  2OUH A;  3OB8 A;  4QMA A;  3ZSJ A;  4FCA A;  5KXB A;  4JX0 A;  1PX4 A;  1JBC A;  2XJP A;  2Y64 A;  3OCP A;  4YG3 A;  5F39 A;  4COU A;  1S0G A;  2D3R A;  2FCV A;  3HNM A;  3LPG A;  4GIQ A;  4LO8 A;  3WIN E;  1FV2 A;  1S2B A;  1KIT A;  5LA9 A;  1DHK B;  2B46 X;  3Q8F A;  4HAN A;  1Y3T A;  2ZS6 B;  2VMD A;  2BJS A;  1OD5 A;  4GJY A;  5I8Y A;  4Q27 A;  4L8Q A;  1MS0 A;  4JKK A;  1G9F A;  2GP5 A;  4C8D A;  1ZRE A;  3UJO A;  2ZGQ A;  2CHH A;  2W91 A;  5FPV A;  3T2Q A;  4OQ8 A;  2BPA 2;  1MZ6 A;  5IWF A;  5BPX A;  4A44 A;  4DB5 A;  3ZN5 A;  2GNM A;  4N53 C;  4U36 A;  3WV6 A;  4G3Y C;  2GZW A;  5DAV A;  4M3C B;  1C5I A;  3RZM A;  5L19 A;  2BZD A;  4PIY A;  2P1B A;  1OFN A;  1OLM A;  2WO7 A;  3DPR A;  2Y26 A;  3KQ4 B;  3JCI A;  4FPL A;  1UZW A;  4M3C E;  4IW3 A;  3C8X A;  4AVA A;  4LHS A;  3POE A;  1MQT C;  1AX0 A;  3T1M A;  3ZPO A;  4LBQ B;  3C2U A;  1SQ4 A;  5LB6 A;  4EE2 A;  5FO7 B;  3LDR A;  4QXC A;  5FV3 A;  4ZPI A;  1PX3 A;  3TN9 1;  1TMF 3;  3DKQ A;  5EIY B;  1F4H A;  3GAL A;  1TME 1;  5CFC B;  5M0T A;  1KDK A;  3MLL A;  3K2O A;  5FMD A;  5EJ1 B;  1AX2 A;  1AR7 2;  3PLQ A;  5FZ4 A;  3MO4 A;  5FOJ B;  3OPT A;  3L2Y A;  4BYY A;  5FZ1 A;  4Q4X 1;  5F5A A;  2FCU A;  2WNV B;  3Q8A A;  3APB A;  5HV4 A;  2Q30 A;  4LE4 A;  4YYO A;  4TTG A;  4E8C A;  5IVY A;  2V72 A;  3WX5 A;  2DCY A;  1HB4 A;  3O0W A;  4AE2 A;  1WKY A;  5I0U A;  4LIU A;  1AXY A;  1REF A;  2VVF A;  2ZAH A;  3UT0 A;  5A3P A;  1NCQ B;  2I2S A;  3R05 A;  1UOG A;  3KM5 A;  1JYT A;  1RGS A;  2RR1 3;  4LT5 A;  3AKS A;  2NMN A;  5FYT A;  4K1Z A;  1EUT A;  2XBO 3;  1HXS 3;  1V6I A;  2YDE A;  3IPV B;  5JIA A;  4DXS A;  1QNY A;  4JZR A;  5F6K A;  2VMH A;  2E51 A;  2RM2 2;  4FTS A;  4TYS A;  3AYA A;  2FDI A;  2WFF 1;  3NJV A;  4Q0U A;  3MV1 1;  5T55 A;  3TEY A;  3ZO0 B;  1VRH 3;  2BFU L;  4B4Q A;  4F7Z A;  4XMA A;  1UU5 A;  3OOX A;  3Q8C A;  1GZ9 A;  2VVD A;  3LAG A;  5F3E A;  4HK9 A;  3ZFF B;  4WVM A;  1BBT 2;  3WOG A;  2ZHK A;  2JB8 A;  5K4L A;  4GH4 C;  4MZU A;  1KS4 A;  1UKG A;  1X33 A;  2ZZJ A;  4JGY B;  3OBZ A;  4AF9 A;  4DMI A;  4F83 A;  1B35 B;  1LEC A;  1N1Y A;  2CAV A;  4UI9 L;  4W65 A;  3BUC A;  1XNB A;  3ZM8 A;  5I93 A;  4YWA A;  1W6O B;  1CPN A;  5C8C B;  2WII B;  3LKJ A;  3MIF A;  5A32 A;  4ET7 A;  1VIW B;  4Z82 A;  4FQ4 A;  4ISR A;  3U4X A;  1R09 2;  4XIL A;  5IUQ A;  4D7Y A;  2A3W A;  3L9J T;  5H9P A;  1AUY A;  4I0W B;  4GB3 2;  1JZ6 A;  1UKR A;  1YHF A;  2QUO A;  1MAC A;  2ZAA A;  1O8S A;  3UES A;  3P3P A;  4DFS A;  3K51 A;  3LSD A;  3WDY A;  1YC6 1;  2K2S A;  1VBE 3;  1SCS A; 
#chains in the Genus database with same CATH homology
 5LAS A;  5ERL A;  3GJA A;  2HBU A;  5LA9 A;  4BQX A;  3MGU A;  4Q5O A;  2OPW A;  3W21 A;  3NNL A;  2A1X A;  3GZE A;  4XCA A;  4MHU A;  2Y34 A;  4ZON A;  2RG4 A;  5C5U A;  5DAV A;  2V4A A;  2RDS A;  2RDQ A;  5DAQ A;  3NNF A;  2FCT A;  3NNM A;  5LBB A;  4IW3 A;  4NHY A;  5IAT A;  3BVC A;  5C5T A;  3NNJ A;  3OUI A;  4XAA A;  3OUJ A;  5LB6 A;  5DAW A;  4ZPI A;  5IAX A;  5EPA A;  3DKQ A;  5EP9 A;  5DAX A;  5M0T A;  4NHM A;  4Y5S A;  2RDR A;  2Y33 A;  3KT4 A;  4UWD A;  4BQY A;  5LBE A;  2FCU A;  2RDN A;  5HV4 A;  3GJB A;  4KBZ A;  4NHK A;  4NMI A;  5LAT A;  5HV0 A;  5L9V A;  4MHR A;  3KT7 A;  4JZR A;  2G1M A;  3HQR A;  3EMR A;  3KT1 A;  4J25 A;  3HQU A;  4Y5T A;  4XCB A;  3OUH A;  5DAP A;  4XAC A;  2HBT A;  4BQW A;  5A3U A;  2G19 A;  4XC9 A;  5IAV A;  4NHX A;  3W20 A;  3OBZ A;  3PL0 A;  2JIJ A;  4NHL A;  4XAB A;  4NAO A;  5EQU A;  2JIG A;  3ITQ A;  5LBC A;  5L9B A;  5L9R A;  5LBF A;  2FCV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...