5HV0A

Structural analysis of cofactor binding of a prolyl 4-hydroxylase from the pathogenic bacterium bacillus anthracis
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
212
structure length
206
Chain Sequence
NQIKEQTIFDHKGNVIKTEDREIQIISKFEEPLIVVLGNVLSDEECDELIELSKSKLARSKVGSSNDIRTSSGAFLDDNELTAKIEKRISSIMNVPASHGEGLHILNYEVDQQYKAHYDYFAEHSRSAANNRISTLVMYLNDVEEGGETFFPKLNLSVHPRKGMAVYFEYFYQDQSLNELTLHGGAPVTKGEKWIATQWVRRGTYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Prolyl 4-Hydroxylase
publication title Structural analysis of cofactor binding for a prolyl 4-hydroxylase from the pathogenic bacterium Bacillus anthracis.
pubmed doi rcsb
source organism Bacillus anthracis
total genus 59
structure length 206
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 5hv0A01
3PL0A 4NAOA 2RDNA 5IAVA 2RDQA 4XC9A 4NHLA 4NHKA 4NHXA 4XAAA 5L9RA 5ERLA 3NNLA 5DAPA 4BQYA 5C5UA 5DAWA 5EP9A 2HBUA 2OPWA 2V4AA 4IW3A 5LBCA 4MHRA 5EPAA 4KBZA 5M0TA 5IATA 4XABA 5LASA 3ITQA 3NNFA 5LBEA 4UWDA 3OBZA 4JZRA 4NHYA 3NNMA 5C5TA 3KT7A 4ZPIA 3DKQA 3KT4A 5LBFA 2Y33A 2FCTA 5LB6A 2Y34A 4ZONA 5IAXA 3OUJA 4XCBA 5A3UA 5HV4A 4J25A 4BQWA 3GJBA 3KT1A 4BQXA 4XACA 5DAXA 3W20A 3EMRA 3HQUA 3NNJA 5LATA 4XCAA 2RDRA 5EQUA 3OUHA 4Y5SA 5DAQA 2RDSA 2G1MA 3W21A 3OUIA 3GJAA 4Y5TA 4MHUA 5LBBA 2JIGA 5L9VA 4NMIA 2HBTA 5LA9A 5DAVA 3GZEA 2G19A 4NHMA 4Q5OA 3HQRA 3MGUA 3BVCA 2A1XA 2FCVA 5L9BA 2RG4A 2JIJA 2FCUA 5HV0A
chains in the Genus database with same CATH superfamily
1ZVFA 2WNVA 4NRPA 4Y20B 2YU1A 2JICA 3ACIA 2RDQA 1BBT2 1QXJA 4MADA 1UWWA 3HD8B 3WF4A 1RUI2 4CTEA 4PIYA 3NAPB 2OQ7A 4LIVA 3T4HB 2VNGA 5C4WC 3VKOA 2P3KA 1HQNA 3OG2A 1UIJA 1JZ7A 1MZEA 1WMDA 3UV9A 3ZIWA 4FO9A 1S0BA 2VBBA 2GAUA 3B00A 2BNOA 3ZFGA 1LGBA 4E4DX 2W1WA 4H7MA 5FXZA 5C5UA 1BEV3 4QXCA 4GH4A 4X8NA 5DAWA 2D5FA 1DQ5A 1ZZ7A 1QXPA 5T5PA 3QACA 5FQ0B 1XE0A 1YFXA 1VPHA 3ELNA 1IOAA 3I2OA 4COVA 4ATFA 3CHXA 2EIBA 2PAEA 1RUD1 3QOPA 4TLGA 5I8TA 2ZEZA 1H9WA 2Y26A 3POIA 1H1MA 5J36A 2ZA9A 2GH2A 2XWJB 1UYPA 3ENRA 3BOPA 3APBA 5CYYA 2ZGOA 5CADA 1HQWA 3J7MA 2WUHA 4GAZA 4P02B 2W9XA 3R6SA 4CUGA 1O3RA 2WDBA 3BYWA 3OBZA 5AC92 3WQBA 5FBZA 1CAWB 5LA0A 2D98A 3QCWA 1QNWA 3DPRB 3H8XA 3O5SA 4Q0PA 2VZ1A 3NL1A 5JSOA 3LIGA 2G9GA 5D8AB 5BNPA 1SBEA 3RMXA 4QKNA 1BQPA 2WIIB 2PTMA 4CP9A 5C9AB 4NIGA 5A6YA 2D6OX 3R4SA 1O8PA 1V9U3 1E57A 5FZ0A 5IAXA 4QPGC 3T08A 3OUJA 5KBFA 4ZS2A 4BQ5A 4YSFA 1RUH1 5F32A 4R4XA 2DVBA 4RFT0 5A7NA 2AGSA 1COV3 2ENRA 4IGPA 2QZ2A 3AMNA 4AI8A 5JMOA 4YW4A 3N7LA 2XJRA 5FKCA 3UJQA 4CE8A 3NV1A 2O8QA 4UF0B 2LRPA 4HT1T 3BPSA 3G7DA 1UO9A 4FPYA 3HN1A 1PGW2 1QF3A 4MSVA 5A3LA 2B42B 2WNEA 2ZHLA 3ILFA 3N9LA 4ZHNA 2XXZA 3NV3A 4MGSA 1FMD1 4LMFA 3ZN6A 2FDIA 2V5DA 4KU8A 5DUUA 4YW1A 5EQUA 2RS13 1CX4A 3D4KA 1JOBA 3KB5A 2DCYA 3FLTA 2NQYA 4YNIA 3IPVA 3W5NA 1NZCA 4D6QA 2WYSA 1SBFA 4YFZA 1US2A 3USSA 2B4KA 5DDJ1 1U5ZA 4Y1XA 4W6XA 4IDZA 1XRUA 2P37A 4CDQA 1JHNA 1KFXL 4N43B 3OY8B 4X6QB 4IEZA 3LDRA 3I4IA 2PN5A 4FBFA 1MEC2 4LTAA 1R083 1IS3A 1YQ2A 2FCVA 2NMOA 3VZOA 2JG9A 4Q4Y3 1HJGA 5FK8A 3MZHA 2BERA 2I45A 4NWWA 1KD7A 2XLGA 4RS5A 1G9AA 3RYPA 3NJXA 4HK8A 1Q8VA 3HR9A 4BWOA 4BA6A 1VALA 4YM1A 1SDWA 3WSOA 5LCWL 3KV6A 2BGOA 1OOPB 3K75B 1R1A1 4AQSA 3I2DA 1WCSA 2QNKA 1HN0A 1WCDJ 4CEYB 1NCRA 5FZLA 5F5CA 1WWYA 2XKOA 1S1AA 4NHXA 1V6IA 3ZFEB 1ND2B 4I01A 1FX5A 3BU0A 1OA4A 2RS11 3H7YA 5T5LA 1SG3A 4CEWA 2BGPA 1HV1A 2XBO2 4Y1UA 5J3UA 3EXUA 3Q8CA 3B9IA 2W92A 3HNYM 4GULA 3AP7A 1HXS2 1XNDA 2HWB1 1RITA 3B7MA 3H0OA 1SLLA 2WSUA 3K4ZA 3L2HA 4F8AA 2YHJA 3B01A 5LW9A 1QKQA 5LY1A 1O91A 5ACA3 1AL23 4HKOA 5IHRA 2ZPXA 3H1WA 5CA6A 3DECA 4AWDA 3SEEA 1ZZCA 3GNEA 1QJX1 2Y6GA 2VCMA 4IL7A 4K9SA 4LO5B 1DYOA 1MVQA 2VZTA 3WUDA 4Q4Y1 3RZHA 1N3PA 3LE0A 3VBHB 2E33A 3C7OA 5IW0A 2G9FA 3U4SA 1QJFA 5CKQA 4CDWB 1AR92 4X6RB 3VBRB 4WZCA 2ZEWA 3IAPA 1S0EA 2QQUA 2HWD2 3W9AA 4ARYA 2MEV2 4IV3C 4QDQA 3RGBA 3RJRA 2O1QA 1MS3A 1SLBA 2VVEA 2W68A 1WW5A 3I2JA 3LPFA 1LOEA 1QY4A 2GC2A 3NWKA 2YROA 5JOZA 1VRH1 1IG3A 2X53S 3FHQA 3R4UA 1EPZA 4LQRA 3SCGA 4XFGA 1ZA7A 2OZJA 2R1BA 3KLSA 3SLIA 4QXBA 1H1AA 3DN7A 2FDHA 5IFTA 2OPKA 2E32A 2JG8C 3Q8AA 4FOQA 2OKXA 4KWKA 2WN3A 3AZWA 1UYZA 2HLEA 2L9LA 2FBEA 1BXHA 1CQ9A 3GHMA 3OPTA 2E53A 4XUOA 5CB7A 3VDDB 4MYEA 5A80A 4BQXA 5JSPA 3H8UA 1DDLA 3I3MA 4Z2AA 4IE0A 2KA3A 1GBGA 5I0UA 4ORFA 3I59B 1G9FA 2DUQA 2A6XA 5FPZA 1X82A 3IN9A 2JDMA 5KC6A 4META 3O1MA 1GUIA 4LHKA 3O1SA 5FPBA 2W47A 1K5MB 1MACA 4YG3A 3A0NA 1PO23 2XVGA 3ACFA 5FY8A 3DYPA 2CAUA 4XMIA 2KXLA 4R9AA 5KXEA 4UOJA 2ORXA 5FXVA 5H9RA 1UF2C 4AYUA 4OLLA 3VBOC 1XYNA 3MW2A 1W9WA 4J1XA 1MZFA 3ORJA 1HB2A 4ASMB 4J6GA 1VB4A 2D6NA 4MO3M 1NKGA 5HCAA 1EV11 1LCLA 4HVOA 5FXWA 3WF1A 2ZOEB 2GH8A 4BHPA 1DLLA 5GZFA 2UYAA 2IUWA 5J09A 2JDUA 5EZWA 4HKLA 2VMIA 1A34A 5FY7A 2JDKA 4BMEA 2XJQA 1ZRDA 1QOTA 4AK3A 1D4M1 1QOSA 5EYXA 2Y6KA 4JGZB 4YZ4A 1QU0A 3PURA 1QJY3 4XJ8A 2FDFA 1JZ8A 1B09A 2X5IC 4DS0A 1PVC2 1WGPA 2B9UA 4QQLA 5DUXA 2JEMA 4PBPA 1MS0A 3LSDA 5BNNA 1ST8A 1VBB2 4IEYA 1I5PA 4LKDA 5JOXA 3FBYA 4GWMA 4LBNA 5KWRA 2Y0OA 4FP3A 1PO21 1RUI3 4COYA 4AHWA 5JAXA 2Y6FA 1XNAA 3RSJA 1JYVA 4AG4A 1YQ6A 3T1LA 5GZGA 3DYOA 4QPIA 5FMOL 5FPLA 4IESA 4D3WA 4CDUB 2BYVE 2OIIA 1ZRRA 2DUPA 3OGVA 1RHI3 5FP9A 4UBGA 4XFIA 5A32A 1UU4A 4FOYA 4Y22A 5JI9A 1YLLA 4E8DA 1AR71 3SNMA 4DXSA 1Y7BA 4JCKA 4TSVA 1ULDA 2WNUA 2E26A 3WCSA 3O1UA 2QDRA 5LA1A 1CZTA 3SXWA 1VBC1 2EIEA 4UWDA 5FRAA 1W03A 4JZRA 4L0PA 4MGKE 3J8F2 2XJVA 4XFCA 1SPPB 4QB1A 1L3JA 3SC7X 1EAH1 2GN3A 4K20A 5JOWA 2UY8A 3MPPG 2D6MA 1IPKA 4IE4A 5FZ4A 5FWJA 3OGSA 2VNOA 3MF9A 1U12A 1O7FA 2LUWA 3M70A 1RMU3 4OUMA 5FPAA 5AC93 1KJLA 3K51A 5FZ1A 5C4WA 2R1DA 3LD8A 1BBT1 1WW7A 2XLAA 2VOKA 1RUI1 4FTBA 4JQRA 1AVBA 3ES1A 1PMJX 1O4ZA 2GU9A 2YZ4A 4XCBA 3JD72 2VTXJ 1QGLA 2R042 1WKYA 4N8MA 1J3RA 3LIHA 3CKHA 4BQWA 5LK7B 2BV4A 4UW5A 3N9NA 2IFWA 1PM4A 2YU2A 4PIZA 2ZGNA 1LENA 3KGLA 4I30A 2VOWA 2XHKA 1IKQA 4DZGA 1VMHA 1ASJ2 4LITA 5FUIA 4Q1RA 1S0IA 5HXVA 4UYBA 1LHWA 4XVHA 4YVSB 3VZMA 4XOGA 2CHHA 1O4TA 3DV8A 4PCRA 3OD4A 3JQXA 5E6HA 1WCKA 3ZXAC 1O3TA 1UKRA 3VB9A 4MV2A 3IDAA 1LAJA 2H6BA 2PQSA 4B7EA 3MLJA 2DWRA 1YIPA 4PJYA 3KZ4C 1CPNA 1MS8A 1N1SA 1ZBE2 3OOXA 2WNVC 3U10A 1DYKA 1UU6A 3N36A 4ATEA 3ON7A 1DQ0A 3VHRA 3GZEA 2XVKA 1GQPA 1GZWA 4KU7A 4E9KA 3AYCA 3MDPA 1MZ5A 1PGSA 5EHDA 1YRZA 1JN2P 2VH9A 2O0OA 2UWBA 3PHMA 3ZMNA 5L9BA 1AX0A 4QPGA 2PLV2 3A22A 1UXXX 1YYNA 3ZFGC 4HLTA 4XIOA 1RUJ1 3SKJE 1QH7A 1YNAA 2JXAA 3U11A 1W8UA 4XUPA 2ZAAA 4IERA 4GH4C 1MEC3 1FI2A 2Q1FA 1UIKA 2ZGMA 4DINB 1SBDA 3RZMA 2XMLA 1XB9A 2LTNA 4LBQD 1W6MB 4K1YA 2P5BA 1V6JA 1S55A 3J7LA 2YMZA 4NHKA 1AX1A 3WDXA 4QB2A 4FTSA 1W9FA 2ZGTA 4ISQA 4W6YA 4UFIA 1PGW1 2VC9A 2VUAA 4XJAA 2JDAA 1OKOA 5JR7B 4NPMA 3ZX7A 3VBUB 3U4XA 1LU2A 3OEAA 4LKEA 2BNMA 3VN4A 2W91A 2HJIA 2VD7A 2WLPA 4PBOA 2BU9A 4ES9A 3OPZA 1BK1A 1GMMA 1H1IA 2XBO3 3E5QA 4GA9A 4PF5A 1F9KA 1ULOA 1DYPA 3AMMA 5K4LA 3RRDA 5B4NA 1OSGA 4R9BA 5F37A 2BZDA 2Z79A 1LNSA 2G9ZA 2QTWB 4CYDA 1U0AA 5FP7A 4WM7C 3BIWE 4LBOA 4FPFA 5GZCA 5L7OB 1RUOA 4LOTA 5BNPC 5ABJC 1YQ8A 1BEV2 4PQQA 4Q0SA 2ZHNA 3IDCB 3K48A 2K9ZA 3QLQA 1RC6A 1NCQA 5APAA 3GHNA 3RFRA 4ZZ5A 4TTGA 4TWTA 5FBJA 1MEC1 4E2SA 3I3EA 1G6NA 5C70A 3EQEA 3USUA 4EE2A 2IVIB 1ZBA2 3SEPA 2QQVA 1U5YA 2UYBA 4Z1VA 5C5TA 3LOBA 5FMBA 1AR93 5FMCA 4XQWA 5CFCC 3KT4A 3AL6A 3NV2A 4EJRA 4N90A 4LA3A 4X8PA 5JDBA 3WHTA 2MEV3 2C4XA 5T50A 1LOCA 4XILA 1U5IA 3OCPA 2EIDA 4PQ9A 4NO4A 2XB6C 3VD7A 2VMFA 3FUQA 5JIUA 4YARA 5JSRA 5JR2A 1N1YA 4A7KA 2B9VA 3VZJA 3AJZA 4CSWA 4PDWC 4JV4A 4YG0A 4Q4W3 5F6KA 1VMFA 3MLKA 3U1XA 1LHOA 4EYUA 1BJQA 2SLIA 1N1TA 1HXS1 4AFBA 4BJ0A 2CGOA 2H6CA 3K2OA 3O12A 2DBIA 3HQUA 2ZX0A 1V9U2 3H3UA 2R32A 4MLOA 5DG1A 4ZY9A 1W0OA 3MUY1 5IJRA 2NM1A 5LATA 4CDQC 5FYTA 2W1SA 3P3PA 1AF9A 1XNCA 1W2AX 2GP3A 2QQJA 2HWC3 3OUHA 3KVBA 3VHNA 4K40A 5BNOB 4GB31 3NRUA 4URTA 4LA2A 4DO0A 1C5HA 4GIQA 1JOPA 3H1MA 2JG9C 2CU5A 2VBDA 2ZZJA 1QJU1 2NPIA 3A0KA 1AR91 3D82A 5DABA 5T5OA 3FZ3A 1GZ9A 4D7YA 1CIWA 5C8CA 3KVAA 2HWD1 5ANQA 3ZN6B 1PK6A 1Y4WA 5DAVA 1HRI3 2WKKA 1DQ6A 5SV8A 4G3YC 4E4SA 1X7NA 4B4PA 4E8CA 1NCRC 5F3CA 2R072 3A21A 3A23A 3FWEA 3IPVB 4AI3A 4RHV2 1BVP1 1J1LA 1NA1A 2G4IA 3PUAA 5FYCA 1POV1 2QQMA 2ARXA 3B02A 2ZEXA 1ZX5A 2JG8A 3WCRA 3WP5A 4YGCA 4YRDA 1POV0 4RR3C 2W39A 5IAVA 3TB0A 4IE7A 3GZUC 4A41A 1OD3A 1W9YA 4DUXA 1JZ2A 2VQAA 1A8DA 3ETPA 3RZGA 4LO6B 5L36A 5KHJA 4IEQA 4E2GA 1BVVA 1R082 3P1IA 2OYZA 4RYDA 5LZ6A 2RMU2 4RS5B 2PAKA 1SACA 4YW2A 3ZYJB 2Q1MA 3TEWA 2EXHA 1XXNA 3N9PA 4XE9A 2XL9A 1KS4A 5FY5A 1IZ3A 2P17A 5FZHA 4W6WA 1OQDA 1ULGA 1C1FA 3H3LA 2HBUA 1VBB3 5FKBA 4XBQA 2VZQA 5FLJA 4AFCA 1L7QA 4P9YA 5A3WA 3IKWA 1TMF2 2ORZA 4G4FA 1WZXA 3D0JA 4IEXA 3VBOA 1DIWA 3ACLA 4CEWB 1BMV2 1GOGA 4AGGA 3CZUA 5K9YA 4AEJA 4IGQA 5C8WA 1OKQA 4NRMA 3JBG2 1AHSA 4XZUG 2D6LX 3K4DA 2LROA 5LA2A 3O1TA 3PU3A 2YUEA 2WT0A 2D5HA 4GD4A 3RPQA 2XONA 4P9GA 2D40A 2DURA 4Q4X1 1XNTA 2I07B 2BQPA 2GMPA 3KV5A 1J1TA 1H8VA 2JECA 2O14A 3N9MA 4LLOA 4HMZA 3J8F3 4GXLA 1FT9A 3KQ4B 5BNQA 2A5ZA 3HQXA 3AKRA 2YC2A 4BZ4A 1TG7A 1PVC1 1AYM3 2DU1A 2YC4A 2Y60A 3VBSA 3NSTA 3KMHA 4BU2A 4QB6A 4HN0A 3O1VA 4Q27A 1CWPA 2W87A 5FY1A 1VBB1 5F6LB 5A3UA 3AVRA 4M3CB 2O8OA 4DIQA 1W6OA 2OQ6A 2LS6A 1H2MA 2IC1A 4ES8A 1SLIA 2WC2A 5C33A 5IK8A 1L7RA 2RJKA 3KT1A 3WNKA 4BB3A 3IMMA 3JD73 1RXGA 4XAEA 3ZPYA 2MHFA 2W0XA 2VCCA 4OQ9A 4P00B 3JUUA 1SLTA 1CAUA 3PIGA 3U0ZA 2CNAA 4AAPA 3ZFFB 1VBA3 4HOOA 1TME1 4GJZA 5FV3A 1KJRA 4HBNA 5F3GA 2VL4A 3E6CC 1WUVA 4DRVA 4OUEA 3SH5A 1UPSA 1ASJ3 1C4RA 1LULA 1W8NA 3IT8A 3LCPA 2GNDA 1W9SA 2VW1A 4ARXA 4CPBA 1T2XA 3RJ2X 3WQ7A 4IV1C 1GKBA 5EV7A 1WLTA 5FOJB 2DFCA 3THTA 5FAXA 1LOFA 2C9KA 4Z07A 4B3NA 4ZZ8A 1H6YA 2R49A 1FPN1 1XE7A 2XVLA 1V70A 5JPMB 5CAZA 2WO3A 1PO12 1ZBE3 5C3PA 3MF6A 3WD5A 1XJAA 1CPMA 1REEA 1IPJA 4Y33A 3IMNA 1UCXA 1B35C 2NN8A 2ZXQA 3P6BA 3BOWA 4Y1VA 5IVYA 3JD71 1OQEA 4GMP0 2GNTA 3AK0A 2R041 4QPIC 2UY9A 4JVAA 2PLV3 2YBKA 4BH9A 1ULPA 4L8QA 2Z5WA 4NJ4A 3V0AB 1HIXA 2BW8A 4XC9A 4YYOA 3UGGA 1NT0A 2Q1ZB 3FFZA 3Q8EA 4TZDA 4LEJA 2C6SA 1E5IA 2XJSA 3LEMA 2C5DA 3OGRA 1V0AA 2WNUC 5GZEA 4RQPC 2WZ8A 3N35A 4SBVA 2R6QA 4UW3A 1QJY2 4XURA 5K0UC 4AQ6A 3ZMOA 3TWIA 1PNGA 5BNNB 3GXUA 3E6BA 4K7JA 4LPLA 5FR3A 1V6LA 3OJBA 3CU7A 1OLQA 1RUF2 2VZOA 1QIQA 1ZBE1 4YVWA 2FZ2A 3J7NA 2Q4SA 5A3OA 3W58A 5FZFA 4MGTA 4CPBD 5FZBA 2BNNA 1C28A 2MNGA 2PHXA 3FL7A 3JU9A 4XUQA 4YGDA 1Y43B 5I0SA 4HPKA 2C9AA 3NJYA 4NR1A 1RHI2 5A32B 5BXXA 4Y22B 2GDFA 2PLV1 3NNMA 1WW6A 2PAMA 3ME2A 1SMVA 5CZKA 5H9QA 1VBE2 5H9PA 2P3YA 2ZHMA 4WVZA 5FZOA 3RVHA 2DU0A 1JZ6A 1QJEA 1XOYA 3GYDA 4QGMA 1UPIA 5A1LA 1BLZA 3CLPA 4C90A 1QDCA 1VP6A 1TNFA 4JDNA 4ET7A 2Y34A 1ZBA3 3F95A 4GWNA 5D2AA 4URAA 1W3VA 2VZVA 2Q8DA 2V5YA 2ZAHA 3GZTB 3KSCA 1UY1A 2J1AA 2YBPA 3WV6A 2ZBJA 3D3AA 2DV9A 4AVSA 5C4WB 1S0CA 1LOBA 4LT5A 1RMU2 3I3QA 2IZWA 3RG0A 4IEOA 4AF9A 4FPJA 5E88A 3W20A 5CKMA 5E89A 5E8AA 2D7FA 2DCJA 4KG8A 4LBKA 3AB0A 4NWVA 3NKGA 5T3NA 2W94A 3U75A 1IGOA 4WM7A 3ZDSA 4RSUA 1ND3A 3CDZB 5ABJA 1PX3A 1S0JA 3JXSA 4MX3A 3AP9A 1KDKA 5FJKA 3IIIA 4NROA 5L73A 1BEV1 1ZA4A 2WN2A 5CISA 1JI6A 2D6KA 2ZS6B 4KG0A 1ENRA 2WR9A 4XEZA 2IVJA 3RMYA 3H42B 4QX1A 3KM5A 4XDOA 1NXD1 2Z42A 1RUNA 2YC0A 5CFCA 1RYYA 5FY9A 4CXYA 4QD2A 4UAPA 3MPBA 4LJHA 1AL0G 1UY2A 2CDOA 5KHIA 2P2KA 1PIV2 3GBFA 3AXDA 3VD5A 1XC6A 2ZGUA 3LA3A 2IXCA 4RA0A 3VD9A 5C3SA 1LR5A 2JIJA 4LO4B 5ANNA 1K12A 2W52A 2Q8EA 1F8VA 2CAVA 4BYYA 4QX2A 4BLIA 4SLIA 4QQOA 3KWVA 3MV11 2R073 1JYIA 1KRIA 4PDWA 2OX0A 4XQDA 4XHBA 5IYYA 4RHV3 1OLRA 3SCHA 2XGXA 1UXZA 4QXHA 5C3OA 2WNOA 5JCTA 4QPGB 4OI1A 1XQNA 3TAYA 4JDOA 4WM8A 4D94A 3ZIXA 4CZSA 2WFF2 3KS7A 5DUVA 1V9U1 4AI1A 3H8RA 1BYHA 1CIYA 1N3OA 2WYFA 5CFDA 2RS52 1YXWA 2R30A 3AYDA 2XLFA 1J83A 1TQ5A 1NCQC 1SCSA 1W6NB 1NLQA 4R4ZA 4H3WA 2RMU3 1YFWA 3RZZA 3WP6A 5HPOA 1VBD2 3ZN5A 1FV2A 2XPJA 4XF9A 1COV1 1HLCA 2VOXA 4C0HA 4FAHA 3I2HA 1UY0A 3LEIA 5JXHA 1RINA 4UBHA 4YWAA 2WS93 4YM2A 1F5FA 3V64A 2XHNA 2ES3A 1YJLA 4QXKA 3I2IA 2CWSA 5F7UA 4NPLA 1AXKA 3Q8BA 3FX3A 4DXTA 2FDKA 3THDA 3WW4A 1TMF3 2PHFA 4L9BA 5IK7A 1UMZA 4MG2A 2XL7A 5DZFA 4NIHA 2X10A 2QQKA 1D0GA 1REDA 1HN1A 4RHV1 1JYCA 3JBG3 1OXCA 3HEIA 3SKVA 3S30A 4N7UA 4RR3A 4C1XA 4QT6A 1NUKA 5DQ0A 3WG4A 3N9OA 4JGYA 5FREA 1NE4A 1NLSA 4Y3OA 1IS6A 1SQ4A 5FZ7A 1LEMA 1RL3A 1KDMA 5CU1A 2EAAA 3LEKA 5F8PA 3X29B 2Y0IA 1X9PA 4QMAA 4AHXA 4D6SA 2JWPA 1NAEA 2PHWA 1R081 3USUB 4DNYA 2BDRA 2RMU1 5HV4A 3WLUA 4UXAA 1DZRA 4QX8A 5KC5A 2H0VA 3ZOIA 4DUVA 1Q43A 4HONA 2FQPA 1GR3A 2YGMA 1FAYA 5CIRA 4HSJA 3SISA 5AVPA 3WG1A 5FO7B 3POEA 4QGLA 1WCQA 4QM8A 3AYEA 1DCSA 5C8CC 5FYVA 4K21A 1RTVA 3PNAA 4Y4RA 3T0AA 1PK6C 2DVAA 3WQ0A 1TMF1 1V6OA 1Z0HA 2LALA 5FUNA 3SITA 1QHDA 1PX4A 4EZ4A 1BMV1 5J98B 4M01A 4JHTA 3VD4A 3E1F1 3MBWA 2WWJA 3D8CA 3PVEA 1F2NA 3ZYBA 1JZ4A 5HCHA 3S0MA 2P3IA 3WDTA 3KGZA 1Y9MA 4KWUA 4Q4W2 5A33A 1NA1C 2JDHA 1NX9A 1CR7A 3Q9OA 1S0DA 4HKWA 2GALA 1IQAA 2WT1A 5ACA1 2VBPA 1AL21 3PTYA 4XHXA 5LA9A 2BOJA 1H8TC 3WNMA 4NHMA 1UY3A 2Q0AA 4OHVA 5FXXA 5GKAC 1OLME 1JZ3A 2E6VA 2HWC2 3WNLA 4PLOA 4AGVA 3SQOA 3LZZA 3HJRA 3MO4A 1YCIA 4COZA 1W0NA 4IV3B 1W8TA 4NUBA 3ST7A 1CX1A 1QH6A 5DXDA 3U78A 5FY4A 1C57A 1SFNA 1X33A 1XNBA 5I0RA 5HCFA 1OH3A 1PO13 1P8JA 1PVXA 4N53C 1BCXA 4CCLA 1CAXA 4DUWA 2JDZA 2YGLA 3C7EA 4AEDC 1DGLA 1HRI2 4C0BA 2VOTA 3ZXLA 2H0BA 2XR4A 4MGQA 4BLJA 2WABA 4GWJA 5FDBA 5JWPA 5JXGA 5FK7A 1GANA 1IQDC 4MGIE 2VZSA 2JG8B 5KHHA 2FMDA 2BJSA 4FPKA 1W6QA 3POGA 4OQ8A 3NO8A 3KCYA 4XBLA 2VG9A 3B5LB 1QDOA 4Y5Z0 4V1PA 4BOWA 5EP9A 2OVUA 4AHZA 4K8FA 4P08A 3TNQA 2JB4A 4CCCA 1AR63 1H2NA 3WDWA 4XF1A 5A3TA 2KM2A 4IV1A 2ID4A 1ACCA 1W2TA 2HYXA 2VZ3A 3OBTA 3S7EA 3WXPA 2BWAA 2JD4A 4E27A 5BUVA 2B45X 1RUC2 5CG8A 2BP6A 1PZ8A 5I91A 1G9DA 1JOJA 5FP8A 1GQGA 1O8SA 4INDA 4P5YA 2WA3A 1K42A 3UL2A 5CEHA 1H30A 3IBMA 3G6JB 3VL9A 4BIFA 3ITQA 1NY72 2UWAA 4LUKA 4XUTA 4AFAA 4DQAA 5IVFA 1URXA 4XXAA 1O3SA 2E7TA 3BIEA 3VBSC 1RUF3 2GC1A 1AZDA 3WG3A 2VXJA 4XDQA 4QHOA 3VUOA 3HBZA 2PXJA 3VBOB 1O3QA 1BK0A 2OS2A 1B35A 1W06A 1WMXA 3AFGA 4CXWA 3TEXA 1RGSA 2A3WA 1ZREA 2VVDA 3J26N 3ZYGA 3TOJA 2BEOA 3ZXGA 3ILNA 3M3QA 4WVMA 3C8XA 3ZYFA 4AQTA 4YW3A 5FZGA 3KV9A 1ODMA 2QQNA 2Y6JA 4FPOB 4ONUA 3B69A 5EJ1B 5LB6A 3EHKA 4XPVA 1S2EA 5KXBA 1VBE3 4C1WA 1J84A 2DTYA 3OGJA 5IVVA 2IXHA 4RQPA 1NG0A 2BBVA 2JE7A 2UURA 2WAAA 1R092 2IXKA 2X5IB 4M4RA 4Y20A 2DF7A 5K0UA 4S2DA 2BFUL 4GQ7A 1QJY1 2JDPA 3NAPA 3OYWB 3ASIA 1QEXA 1AYM2 1GYKA 2HEYF 3O0WA 5IVBA 3QBQA 1LOFC 2WJSA 3FUOA 5F39A 1ZRFA 1LGNA 1X9TA 1HKDA 2AC1A 1RUF1 1VIWB 1VLNA 1AX2A 4HANA 4A2UA 4IE6A 2G1MA 2HEVF 1RJ8A 2CDPA 4LBQA 4JQTA 4BPZA 5FQ0A 3MLLA 2XJTA 1GWMA 1OT5A 1I3HA 2D3RA 3LQCA 4I3PA 1RHI1 3CF6E 1C5IA 3CIHA 2Y8KA 2VPVA 3MYXA 1JZ5A 1BKZA 3FLPA 1OUSA 1VBA2 2XKPA 3K4AA 4Q5OA 1WLDA 2YY1A 2CWMA 3LGRA 5KHGA 4LXLA 4BQ3A 5F3IA 4AEKA 3ACHA 4RL7A 3VKLA 5A7PA 3PTRB 4QKBA 1CAWA 4OHXA 1AYN3 3BPZA 2P34A 2VZPA 1OURA 5GZDA 1YJKA 2A3YA 4NAOA 3N4MA 1PIV3 3WHUA 3LA2A 3T1MA 5D8AA 3LA7A 2VMHA 3HT1A 4F83A 3IZOA 4RFRB 1X8EA 4KGGA 3VBFC 2VO5A 4AVBA 2P6HA 3DCQA 4S2FA 4P5HA 4YW6A 1ENXA 5AC91 1RMU1 1S4CA 4EWDA 2IXJA 3CJIC 2QVSB 1OFSA 1PZ9A 2WO1A 5FYUA 5ERLA 3NNLA 2YPJA 4LR4A 4YVWC 3FJSA 2NLRA 2HWE2 5HCBA 3AP6A 3ACGA 2AEYA 4WVWA 3I2KA 4ASLA 4B8EA 4XTMA 3K3OA 2PMWB 2DTWA 1VR3A 4HSLA 5IVJA 4U36A 1OMIA 4DXZA 2GC0A 2WFF3 3NVCA 5AVAA 4GWIA 2Y6LA 4QQHA 5BY5A 5FO8B 4MHRA 2RS53 3SH4A 3O1OA 1EUUA 4LULA 1OPMA 5BPXA 1E5RA 3WG2A 5JUVA 4IEWA 4W50A 4QKDA 4FQ4A 4ZXEA 1ULCA 1VBD3 1W6PB 5A7WB 1W8HA 2J1TA 4FQZA 4AQ2A 4CU7A 2ZX4A 4XFFA 3M3IA 4FTEA 3ZXFA 3WW1A 3CZJA 2WNVB 2JJ6A 1IS5A 1UOBA 4N7IA 5I0TA 2A75A 4QX3A 4YZ3A 1T6BX 1O5UA 3JZVA 2VU9A 3LDBA 1EY2A 4HZFA 1FATA 1UU5A 1WD3A 1ZNPA 3H1YA 4HPKB 4CCOA 3FHIB 2ZGRA 3ZFGB 2W1UA 1RUD2 3JQWA 4KWLA 4PLMA 3V56A 2B39A 4YM0A 2EXJA 1MZ6A 2QDNA 4GH4B 4J25A 3O7OA 1NOVA 2FD8A 5FP4A 5FZ9A 1ND3C 2XUMA 3OB8A 4MXVA 2W3JA 4P9LA 4G9SB 5IUQA 1AUYA 1WLWA 4QDRA 2RS51 3DEMA 3ZSMA 3FFQA 2B8MA 2CGNA 1OOPA 2VQ0A 2W5FA 1CZVA 3R0RA 4QPWA 4AE2A 1GWKA 4DY5A 4NOTA 5FZ6A 4KQ7A 4YLZA 1VBD1 5EXOA 1PZ7A 4Q4V2 4CEYA 3BUCA 2PHDA 3B94A 1LHUA 3PJQA 3QD6A 1MS9A 3T2TA 4MZUA 1DHKB 4XMAA 3C7HA 3U07A 5FMDA 1JYXA 3NJZA 4D8MA 1UZ0A 3IB3A 3AVSA 5DAQA 4O65A 1HRV2 2RDSA 1S0FA 3VD3A 1Q8OA 1W39A 3BTZA 4XF0A 4PI0A 2EALA 1UX6A 4R52A 2EAKA 1JXNA 2ZX3A 5EJZB 3VKFC 1UNBA 2JIGA 1RUH2 4YGBA 3FN9A 1ENQA 2PHUA 4WM7B 2C0ZA 2RHPA 5LY2A 1Z7S2 1CZSA 1JU4A 1G8WA 1LKNA 1XE8A 1KGYA 2XBO1 4P14A 3URFA 4CP9B 1OBNA 5BNPB 5ABJB 4E4HA 1OD5A 3AX4A 3CQOA 5L19A 2VULA 3HQRA 4IUGA 3MIBA 4ITCA 1IPSA 3AKTA 5FTTC 2VOVA 3CBNA 4QGNA 1DQ4A 1V6MA 2XG3A 2ZKNA 3ROUA 4DXRA 4WM8C 5IVCA 4FPLA 1O59A 4XFBA 1VAVA 5FIXA 3VBRA 4CDWA 5LEKA 4Q0QA 3TNPB 1YUDA 1FMD2 2JD9A 3S7IA 5CFDC 1SLAA 3VHPA 3BTYA 5FZKA 2B5HA 2QQIA 3GM8A 1DZQA 3I97A 5CFCB 2CSGA 4FFGA 3KCCA 3DXTA 2A6WA 1ULEA 3INAA 3UJOA 5LRSA 2ADEA 2QE3A 5DN2A 1Q8SA 4DFSA 2WSVA 1WA6X 4D6RA 4FXGB 2ETEA 1JMUB 5CBLA 3DKWA 3DF0A 5A70A 5DDJ2 1C3HA 2MEV1 3CO2A 3PUHA 4LHNA 4XDPA 4DEVA 5T55A 3LDKA 2UU8A 3P5BA 4AVTA 2CL2A 2FDGA 2PA7A 4PDWB 3DUIA 1PHMA 4EN6B 2PFWA 2PHTA 3C7GA 4M3CF 3ZVXA 4P9IA 1MS5A 2D44A 2RM23 1A78A 1WBLA 3VDDA 1SFYA 4Q4W1 4B1LA 1GZTA 4CDQB 1GNHA 1XBFA 1KS5A 4B1MA 4DY3A 5EIYB 3UKNA 3PUSA 2ATFA 1H8TA 4LOSA 3THPA 2J42A 2W1QA 3I59A 1R1A2 4I09A 3ILRA 2HWF2 4JGYC 3NNFA 4YGEA 4CA9A 5LBEA 3T2PA 2JG9B 2IXIA 2AUYA 2WO7A 1RUC3 2QQLA 2ADDA 2PELA 2HWC1 2V09A 1K5MA 2UWCA 3L2YA 4CCNA 1YWKA 3I8TA 2WZEA 3IDBB 4NHYA 4QX0A 3J9SA 1WA4A 4EN7B 2WRAA 2ZMLA 2ARBA 2FZ1A 4IXLA 2GN7A 1IS4A 3ZYPA 3T4VA 3KQRA 4EZHA 1ODNA 4N53A 4BDVB 1OF3A 2WS92 3WT3A 4I0AA 3CJXA 4AEDA 5JLVA 1UD1A 3RWNA 3POBA 1NCRB 2HWB2 3ZYRA 4QQPA 5AFEA 1HRI1 1RVF2 2HEWF 3LKJA 5DZGA 4Z92B 5SV5A 1W8WA 2R062 1QJX2 2ZKLA 3KF5A 1REFA 3POJA 4RR3B 2A6VA 1MS1A 4AHYA 4XYXA 2VCAA 4KL1A 3NNGA 3W59A 1BHGA 1GFF2 4H14A 4I3GA 4FAGA 4O9EA 5FZ3A 1WD4A 3FLRA 1MQTC 2GNBA 2TBVA 3B9CA 4R8HA 1JHJA 5C6CA 3UNPA 4P9XA 4OHYA 4MGYE 5E16A 1GP4A 3P3NA 4L92A 5A3PA 2ZGLA 4U2AA 1APNA 4YG6A 4ZU7A 1R093 4XCAA 4ZXKA 1UZWA 3U37A 1RUC1 3WNNA 4BIOA 4TLFA 1VAKA 2RDRA 5F1RA 1YC61 2JX9A 1WW4A 2XUEA 4CCKA 2AYHA 1O5LA 3JCIA 2WZR2 1HB3A 1FOD2 1GQHA 4YZ5A 3RI9A 1NY71 2NZ9A 3HIFA 1VRH2 1E5SA 4L11A 4CDUA 3RZJA 1S0GA 1ZYBA 4LIUA 5DUWA 2IWGB 1LOAA 3WP4A 3BTAA 4HL0A 3O1PA 3J7HA 1ZZ9A 2RJLA 1W0PA 1R64A 4Q8LA 4XIKA 4FPEA 3ALQA 1SCRA 4AI9A 3JB4C 3C2UA 4BQ2A 4S2HA 5ISLA 5LWBA 3MGUA 1ALYA 2ZX1A 3M3CA 4KBBA 3T30A 3T3YA 3BVCA 4COWA 3S57A 5A33B 3A7QA 1JW6A 1MS4A 3WP3A 4ZU5A 1OF4A 2DCTA 1SPPA 1YFUA 2DVGA 2JDNA 2OXBA 3I3BA 2AEZA 1NQDA 2VGDA 3TYJA 4A6SA 5D21A 2AACA 3MI8A 2E51A 4BXFA 3WUCA 1SEFA 4W8JA 4AFDA 2Q5TA 4N9HA 5JPNB 3SHRA 2QQOA 4XW3A 3ZO0B 1PNFA 4GMP3 3J8F1 4EV0A 3KHBA 1KQRA 2E7AA 3MHZA 4C91A 1XU2A 2FMYA 4CU9A 4COUA 3LFMA 1AYM1 3B93A 3R05A 5DAPA 1F4HA 2BFUS 5FP3A 4NIAA 3KHCA 1CAXB 2RE9A 2C1FA 2KD7A 5EFUA 2CGPA 3WQ1A 1VMJA 2GP5A 5GLZA 2F6BA 1TZOA 1K45A 5GJ6A 4IW3A 3PLQA 2ERFA 4LO8A 4JDMA 2HWE3 3ZLIA 1MR5A 3LF7A 3QH7A 2K2SA 3POSA 4BCUA 5EPAA 2YFUA 4UI9L 5GLVA 1C8M2 1W6QB 4Y24A 3AC0A 4TN7A 4QDSA 4CUBA 4DPNA 2ZTNA 4YVSA 1N3QA 1X8MA 4P9WA 1VBA1 3ZXDA 2W2IA 4AOCA 2D97A 3CMGA 4IV1B 1KXGA 1W8FA 3MIHA 3T2QA 1AR62 3BTXA 2WZPP 1IHMA 5CVRA 3CNAA 1ASJ1 4LE4A 4OZOA 1TEIA 2DYCA 2V72A 4I2OA 3MV01 3ZDVA 4OI4A 3RQ0A 3ZSKA 3VDCA 5I93A 2XQXA 3KV4A 1X50A 3KT7A 4R9DA 3BCWA 1LGCA 1UYXA 2J22A 2VR4A 3DKQA 5LBFA 4OZXA 2Y33A 3VBFA 4OYUA 4OFGA 3NAPC 4LK7A 4UT5A 4C8DA 2D93A 3ZSLA 4CDXA 2JKBA 3CJIA 4QHBA 1G9BA 1B35B 3MIDA 1AR72 1G9CA 4W4ZA 4QPIB 4WVMB 4CCMA 2MPFA 1ZRIA 3VHOA 2V73A 3MEPA 5FPVA 4ASKA 1RUD3 4BXSV 5C3RA 1VBC2 3K46A 4XJWA 1OFNA 4FPHA 1W6MA 5J37A 4DMIA 3AZXA 3BI3A 1NZIA 5FUPA 1EAH2 2YPDA 3NKTA 3THCA 4FCAA 4N9IA 1ZZBA 3RI8A 4MGZE 2WNUB 3BN6A 4UFHA 4JRAA 1BZWA 2KR2A 4RQPB 4D0QA 2BVBA 5KXCA 2QCSB 2R16A 1GOFA 4YZ2A 5CG9A 5K0UB 1AR82 1CGPA 4Q4V3 4JHZA 2D3PA 4AL9A 5JXJA 1IG0A 3J4UH 3KD4A 1OQ1A 3VBUA 1GU3A 2P4EA 5B2GB 4UFKA 4DRRA 3ETQA 3OSDA 2VQTA 4XFAA 3TEYA 1K5JA 3VZLA 3DPRC 1HRV3 4NMIA 2R7EB 1LJ7A 1XNKA 5D8AC 4NAMA 3VV1A 4WV8A 5L7OA 4J1WA 1JODA 5FFOC 3WZ1A 4LBQB 4XJUA 3ZKYA 4FOVA 3ZPOA 4CP2A 1RUH3 5C9AC 3E5UA 5B4XA 2RG4A 2Q30A 3OBAA 2IXLA 3L9JT 1Z7S3 2DUOA 5J7MA 3ZYIB 2FCUA 2J1UA 4A7YA 5JZGB 1EPWA 3PUIA 1AXYA 2VVFA 2VY0A 3HMYA 2YFZA 2VZRA 4XXPA 3JB8A 4FFFA 3WINE 5DPNA 4P9JA 4NVPA 4CUCA 4ZKTB 4NHLA 5IVEA 4LE3A 1FMD3 2WBKA 1CD3G 2W08A 4RGAA 4I02A 3WDYA 3BGAA 1J59A 4Q4V1 3I3DA 4JC1A 1ZBA1 4PI2A 3ZSJA 3I54A 1Q5OA 1AYN2 4LBMA 3AXEA 1YQ5A 4HXCA 4AI0A 1UKGA 3DYMA 1GNYA 2AREA 1HRV1 5DDJ3 2ZABA 5KXDA 4DOUA 1RIRA 2VUDA 2F4LA 1RUJ2 1HW5A 3AFKA 2VECA 4FI9A 4XUNA 2VUCA 1GWLA 1GZWB 1LOGA 2ET1A 4MXWA 3EBRA 1XU1A 4JKLA 1Z7S1 4WZFA 1DG6A 3ZM8A 4N43C 2P3JA 1O6UA 1ONAA 5FZAA 4QM9A 5BNOA 1AJKA 3LSEA 4H2AA 3VGIA 5T52A 4JX0A 4WBBA 1VAMA 5FLIA 3VKMA 4H55A 2GC3A 3NMBA 5FZDA 1R1A3 2HWF3 5TSWA 3OPWA 2QQPA 2J1SA 1N1VA 3PMSA 1AXZA 1UQXA 4CRQA 1OOPC 1RUE2 1Z78A 3WOGA 1V6KA 1XYOA 3NJVA 1YFYA 3LAGA 4OI0A 3I2GA 4XQ4A 1NE6A 2BGCA 3PVOA 4CEYC 2OUHA 3VL8A 1QJZA 1YQCA 5T54A 3N7JA 3ZFEC 1ND2C 5FLHA 1LB2A 4FSJA 2VNRA 2HWB3 3RDIA 2P1BA 2VZUA 4RD7A 3UGHA 4CXXA 4CU6A 3MFAA 1W3XA 1WMFA 3LPGA 3POYA 1LODA 1RVF3 2EXKA 2XH6A 1YEWA 1YI7A 2EVXA 4KWJA 1VE0A 5FZEA 2PHLA 2R063 1QJX3 2P6CA 2R071 1F35A 1RUG2 2PQQA 5C7GA 2YBSA 4EWAA 5I0DA 1ZZ6A 3ATGA 3M8LA 3TN92 3N9QA 3U14A 1YI9A 4FOWA 1NCQB 3F2ZA 4PLNA 4FP2A 3UGFA 2ZHKA 1VJ2A 2WFPA 4BK5A 1KITA 2HWF1 1UOGA 3K77A 4OMDA 1X36A 2JE9A 3VBHC 3W21A 3OUIA 4CDWC 3VBRC 5LBBA 4CUAA 2C26A 1NYWA 1MPXA 1N47A 2WZR3 3VDBA 1FOD3 4A6OA 2Y64A 3O0XA 1H4HA 1HB4A 1OVSA 1VRH3 3DL3A 4YW7A 1UY4A 2HH9A 5EYYA 2VMGA 2WS91 3PJYA 1MVEA 4IE5A 1QMJA 2DCKA 4M3CE 5DG2A 2VMDA 5A1AA 2R0HA 4HETA 4IEPA 4GJYA 3EO6A 5FZIA 1RVF1 2GMEA 2JE8A 5FJHA 2I2SA 1A3KA 4D7TA 2R061 3WW3A 1OA3A 1LRHA 2RDNA 3O14A 3WVJA 1I9RA 5FO9B 1US3A 2ILMA 4GB32 3JBG1 4QU2A 5JZGA 1MQTA 3M1HA 3MIGA 3UESA 1PM7A 1DQ1A 2X29A 1QJU2 3VDDC 4DB5A 3AL5A 3AZZA 4FT8A 2DVDA 2ARAA 1SLCA 4XAAA 4FVVA 2AH2A 3IIAA 3LWCA 5L9RA 4BK4A 2Q8OA 4A4AA 2QFEA 1D0HA 3FE5A 1CONA 4M3CA 1TE1B 4B4QA 5EJ3A 4Y26A 2OPWA 1DF0A 1I6XA 1QQP2 3AYAA 3H7JA 1K5MC 5FYHA 1LU1A 2WZR1 1FOD1 2ZGKA 4OUSA 3WW2A 5C8CB 3H9AA 3AMHA 4HN1A 1KEXA 5I8YA 1PK6B 3ZSEA 5CKNA 4TYSA 3AZVA 1CAVA 3AKSA 3V0BA 1EV13 1XSQA 2A70A 2WO2A 1W99A 4HG6B 4Q0UA 4A3ZA 1HJFA 3CEWA 4XABA 5LASA 3DGTA 4GKXA 1WLCA 2DVFA 3ZFFA 2W46A 5F5IA 4M4PA 3I49A 2VNVA 1A6CA 1D4M3 1NA1B 1UOJA 2ZX2A 3UKTA 5JOYA 3BALA 2WINB 3QH6A 1C8M3 3WF2A 4ZU4A 2YXSA 1VB2A 2EF6A 2XOMA 3LB9A 1OLMA 2RM22 2XQRA 2Y6HA 2WT2A 1VRBA 2DFBA 3LOIA 1H8TB 1JYTA 3VDAA 3AP5A 1OH4A 2W95A 4OHZA 5A3NA 4F7ZA 3PVBB 4ZPIA 4JGZC 2BTVC 2A6YA 4E2QA 2WQ8A 2ZACA 3GCXA 2VW0A 1ULFA 3N7MA 4JKMA 5F5QA 4W65A 5FOBB 3HBKA 2XJPA 4JTOA 5J1XA 4B29A 5EWSA 2XWBB 1DGWA 1V6NA 3GGLA 5I8SA 3ZXEA 4N53B 4XBNA 3DXUA 4YFWA 1EYBA 3IAQA 3WNOA 3HVDA 3TEZA 4AEDB 1G7YA 4UW6A 3OF1A 3C3VA 4M00A 3RYRA 1Q3EA 3GBGA 1W2UA 1HX6A 2RR12 1KFUL 1DQ2A 1PO11 4CDUC 4IETA 3RYKA 4XACA 1AR73 1OUXA 2A6ZA 1PGL2 1J3QA 4HK9A 4Q29A 3V0AA 1GOHA 1D2QA 2OUJA 1UZYA 3NNJA 5FPXA 4HVQA 3PDQA 2RS32 4IEVA 2B7YA 4Q4X2 1D2SA 1VBC3 4JAAA 1C8M1 5T5JA 4QX5A 5FYZA 1JUHA 3D6EA 3EYPA 4Y5SA 2CYFA 3HNBM 5GLTA 4CVUA 1ZRCA 2QQWA 1EAH3 4QQ2A 1FXZA 3K3NA 3W5MA 3AP4A 2LW8A 3C7FA 5FY0A 4F3JA 3NQHA 2BWCA 1DP0A 3T0BA 1AR61 2RV9A 2X8KA 1CVNA 4E4ZA 2Z4FA 1AR83 3H3ZA 1BBT3 2OT7A 1PMIA 4UFJA 5JI7A 3T2OA 1GP5A 1TVGA 4RGGA 1UOFA 3AM2A 5GLUA 1H4GA 3AZYA 3EJKA 3GF6A 3IDEA 5F2SA 1J58A 3VBSB 5FYMA 1H0BA 2YV8A 2J7MA 3IM0A 1DU3D 4LKSA 5FWEA 3O1RA 1W2NA 1F5JA 4FXKB 1DZTA 3RZKA 4KNCA 4Q0VA 1W6OB 2GZWA 2R0FA 1TME2 4QPYA 3OBRA 5DZEA 3MFCA 1SHWB 1I1EA 4AI2A 3WDUA 4K6BA 1NLRA 4AVAA 4AR2A 1GICA 1W90A 1CAUB 3PUQA 3BODA 2BOIA 3M3EA 4BQYA 1YIFA 1U5XA 5F5AA 1VBE1 3UK9A 4YVSC 1GV9A 1FPN2 5FYBA 3WY6A 4BM8A 4JTNA 2CV6A 2JDYA 4V2WA 3ES4A 1J3PA 2WA4A 4AEMA 4AZZA 1JTZX 1AR81 1LEDA 3GZAA 2BPA2 4Q26A 5F2WA 5CNAA 4JRLA 3OTFA 4O7XA 2ZCWA 2XDVA 3DPRA 5IATA 3I7DA 1NQJA 3AMPA 2VAUA 2X09A 3HNMA 4MH0E 4B4RA 1LESA 1CESA 4YM3A 1T6GC 1QNYA 1RUJ3 5C9AA 4CDXC 5JVVA 3SH3A 4Y1YA 1QWRA 1QXRA 3UYJA 3N7KA 4NIDA 4JKKA 2Q8CA 5FZCA 4A7ZA 1Q8PA 4OHWA 1F4AA 2DBNA 4D7SA 3MICA 4Z8BA 1FNYA 1UMHA 2VMCA 2FCTA 4RGKA 2ZEYA 3FMGA 2NP0A 3VLBB 4KH9A 2LM3A 2BUKA 1I5ZA 4UF0A 4GZ9A 2FDJA 2TUNA 3OD0A 4H7LA 1RUE3 3UT0A 2PHRA 1JYWA 4A44A 4M0HA 4ZS3A 2ET7A 3R4DB 1AYN1 3VBFB 3VBUC 1DBNA 2WAOA 4AAXA 1PIV1 1FV3A 4CDXB 3AJYA 5DAXA 1K3IA 3CJIB 4HVRA 3BU7A 1Y9QA 3RS6A 4YVWB 4Q2FA 1LHNA 1Y9GA 1UN1A 3A4UA 2VXRA 1IKPA 3WF0A 3OEBA 4LK6A 3OY8A 3POFA 3NV4A 4N43A 5A1FA 5L7OC 3KF3A 1RUG3 1UX7A 4UFMA 1W6NA 3TN93 5FYYA 1M06G 2E7QA 4EROA 4QWNA 2QZ3A 3Q8FA 5IT6A 1WBFA 4XJZA 1EP0A 2JKXA 2QBXA 2WFF1 5FZOB 5JXIA 1TNRA 2CTVA 3MW3A 1GP6A 4FFIA 1GZCA 2EXIA 3NW4A 3MIFA 4NE9A 4PF1A 3RNSA 3FBMA 4Z2WA 4LHLA 5FCCA 4UFLA 2E9QA 1RUE1 2YG0A 4Z82A 4ISRA 4UW4A 3WDVA 1LTEA 4D69A 3CL1A 2PYTA 2A73B 1ND2A 1UW8A 1SDDB 4FFHA 4S2GA 3ZFEA 3PL0A 3M3OA 4EN0A 2Z69A 1R1ZA 3PVNA 1F15A 2F4PA 1HXS3 2RVAA 2XJUA 4LUMA 2ARCA 3ZN4A 5A6ZA 4I0WB 1OI6A 4PT6A 1DGRN 4R9CA 1UMIA 5HBAA 1OA2A 5LK5A 2AR6A 1H6XA 2NMNA 4OVEA 4FPCA 3D5OA 2VW2A 3LEGA 1RUG1 2C24A 1ND3B 3ECQA 4GB33 4PIXA 4I0BA 4AFMA 2ZJCA 3BKZA 3TN91 3MIEA 1DGWX 1HB1A 2IFRA 4IEUA 1QJU3 2OZ6A 4CP1A 3VBHA 5A7OA 3M2MA 5BNOC 4XETA 1OPOA 3GALA 1D7PM 1LHVA 2HWD3 1RXFA 3H50A 2DCZA 2VCBA 4CP0A 1G86A 5H9SA 5LBCA 4AVVA 4LBJA 4O61A 2GNMA 5C3QA 1JUIA 1UAIA 4AW7A 1W8ZA 1QQP3 3S5AA 2V4VA 1STMA 1F31A 1HDKA 2ZGSA 2EICA 1RJ7A 2QJVA 3HT2A 3O0VA 3MUZ1 1NXMA 1POV3 4MOAA 3I2FA 4QX7A 1GNZA 2VM9A 4OCTA 5A6QA 2Z2SB 3HPNA 2E63A 4CCEA 1UZVA 1ZZ8A 2D3SA 4NRQA 4MXWB 3AMQA 1UZZA 5F3EA 4CCJA 3GCWA 1DGRA 3IWZA 4TXWA 4BQ1A 3UETA 4YZ1A 4BMBA 5G05L 1PMHX 1COV2 2VQUA 3E5XA 4O9GA 3E97A 4WM8B 5C71A 4Q8KA 1CJDA 2E31A 3B3QE 3WX5A 4LBLA 2A71A 2AZ5A 1ENSA 4RS5C 4YW5A 3EB7A 4IGOA 5JIAA 5CFDB 4IV3A 5IWFA 4RN5A 1Q8QA 2VMEA 2WWUA 3KCXA 1D4VB 1SZBA 3GJBA 4XF4A 5A7QA 2F17A 2VTFA 1O4YA 2RS12 1W9TA 1QQP1 2ZZQA 3EMRA 4WVVA 3MW4A 1Y3TA 3S5QA 3SCFA 4XTPA 4CEWC 1S2KA 2RR13 2D43A 4LNVA 5BV6A 1W2OA 1XYPA 2EIGA 1EUTA 3ZR5A 2GMMA 2A7AA 2RS33 4NPRA 5FYSA 4HFSA 4Q4X3 2J1RA 1E5HA 4BQ4A 4MHUA 1W8OA 4EQVA 5GM0A 3T0DA 4Q4Y2 1M4WA 4CU8A 2RM21 2VJXA 2HBTA 3AKQA 1W05A 3GBWA 3PMEA 4JGYB 4MVTA 1DLCA 3ABZA 1PVC3 2G19A 2VUJA 4JGZA 5A3MA 1H9PA 5J96B 4LKFA 3ZR6A 5JZGC 2SBAA 1GLHA 4OULA 1HQLA 2J1EA 2HKXA 3T09A 5BYNA 5KR7A 4OI2A 4L99A 5IK4A 5JMCA 1UL9A 4IQPA 5FZ8A 4M0NA 2N7GA 4Q1PA 4V2VA 2BRTA 1C8NA 3WNPA 5A6XA 3D0SA 4XJ9A 4KMQA 4AVCA 4EN9B 2Y38A 3HAGA 1H2LA 2ZGQA 2CY6A 3SMHA 2RR11 4DEQA 1JH5A 1TME3 1PGL1 1WCUA 1CN1A 5ACA2 1AL22 4LORA 5HI0A 1FYUA 2B46X 1H2KA 2RS31 4GALA 5GALA 3ZFFC 2OW4A 4EN8B 3FC0A 2VTXA 3BB6A 3TRSB 3LFIA 5DMYA 2X5IA 1MQTB 3WF3A 2OA2A 2V4AA 1HV0A 4A42A 4BISA 4B7KA 5KHKA 4NIIA 3PU8A 3RZLA 1A8MA 3POWA 4NN0A 3VZKA 4K1ZA 1LECA 1SFPA 1JS9A 2WLQA 3OYWA 1FPN3 5GLWA 3S6PA 2QUOA 3ZXJA 1JU3A 1CJPA 1ZM1A 4KBZA 5M0TA 4LHSA 1POQA 1JYNA 5K8SA 1R091 1FNZA 4K3UA 1Q56A 3GDBA 5LRRA 5LEJA 2BVVA 4LLFA 2K46A 4YPJA 5FZMA 1AJOA 4OMCA 5D1IA 2TNFA 4AGRA 2NYYA 1CAVB 5FPUA 2R043 1XSRA 3V0BB 1WMEA 3PIJA 4BE3A 5FMOS 1OC1A 3N3HA 4A3XA 5FYIA 1EV12 1UYYA 4PHZA 3HN3A 2J1VA 4KI5M 2YDEA 2FHRA 4Y4YA 5A7SA 4A45A 4EWEA 5HXMA 2EA7A 1RB8G 2HYKA 4MUVA 2JENA 4ZONA 1D4M2 2WWSA 3WEZA 5J48A 3TBDA 2JB8A 2ZGPA 4LO7A 4K8RB 4QAWA 1XPWA 1GSLA 3AKPA 2A3XA 3RWKX 4KGQA 3VZNA 1OVPA 4XF3A 4QKFA 5IFPA 1W04A 4L97A 3ZKUA 5G04L 2WQ4A 1V00A 5E1RA 5BNNC 1QOOA 1JBCA 1PO22 2BBAA 5IK5A 4XZPA 4GMP1 2RJ2A 2TEPA 3WNXA 4FPGA 3UKVA 5K7PA 3FHAA 2D6PA 1L7LA 3ZYHA 3M4FA 3ZXKA 1DFQA 4XFHA 1S2BA 4CCDA 2X05A 2YYOA 4QU1A 3OGGA 4L2NA 4GKYA 3GJAA 4Y5TA 2WL1A 2YB7A 1W28A 2ZMKA 1C1LA 5L9VA 2GSYA 3HOBA 2VE1A 2DDUA 2HWE1 4AXOA 2AENA 2WQZC 3V65A 2ZMNA 3WR0A 1W6PA 2K0GA 2A1XA 3HWJA 5A7WA 1YHFA 4Y1ZA 3M7AA 4QHZA 3E6DA 1OHFA 2QKDA 3VKNA 5AFBA 5F9TA 3H8OA 1YO8A 2I74A 5HV0A
chains in the Genus database with same CATH topology
3PL0A 4NAOA 2RDNA 5IAVA 2RDQA 4XC9A 4NHLA 4NHKA 4NHXA 4XAAA 5L9RA 5ERLA 3NNLA 5DAPA 4BQYA 5C5UA 5DAWA 5EP9A 2HBUA 2OPWA 2V4AA 4IW3A 5LBCA 4MHRA 5EPAA 4KBZA 5M0TA 5IATA 4XABA 5LASA 3ITQA 3NNFA 5LBEA 4UWDA 3OBZA 4JZRA 4NHYA 3NNMA 5C5TA 3KT7A 4ZPIA 3DKQA 3KT4A 5LBFA 2Y33A 2FCTA 5LB6A 2Y34A 4ZONA 5IAXA 3OUJA 4XCBA 5A3UA 5HV4A 4J25A 4BQWA 3GJBA 3KT1A 4BQXA 4XACA 5DAXA 3W20A 3EMRA 3HQUA 3NNJA 5LATA 4XCAA 2RDRA 5EQUA 3OUHA 4Y5SA 5DAQA 2RDSA 2G1MA 3W21A 3OUIA 3GJAA 4Y5TA 4MHUA 5LBBA 2JIGA 5L9VA 4NMIA 2HBTA 5LA9A 5DAVA 3GZEA 2G19A 4NHMA 4Q5OA 3HQRA 3MGUA 3BVCA 2A1XA 2FCVA 5L9BA 2RG4A 2JIJA 2FCUA 5HV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PL0 A;  4NAO A;  2RDN A;  5IAV A;  2RDQ A;  4XC9 A;  4NHL A;  4NHK A;  4NHX A;  4XAA A;  5L9R A;  5ERL A;  3NNL A;  5DAP A;  4BQY A;  5C5U A;  5DAW A;  5EP9 A;  2HBU A;  2OPW A;  2V4A A;  4IW3 A;  5LBC A;  4MHR A;  5EPA A;  4KBZ A;  5M0T A;  5IAT A;  4XAB A;  5LAS A;  3ITQ A;  3NNF A;  5LBE A;  4UWD A;  3OBZ A;  4JZR A;  4NHY A;  3NNM A;  5C5T A;  3KT7 A;  4ZPI A;  3DKQ A;  3KT4 A;  5LBF A;  2Y33 A;  2FCT A;  5LB6 A;  2Y34 A;  4ZON A;  5IAX A;  3OUJ A;  4XCB A;  5A3U A;  5HV4 A;  4J25 A;  4BQW A;  3GJB A;  3KT1 A;  4BQX A;  4XAC A;  5DAX A;  3W20 A;  3EMR A;  3HQU A;  3NNJ A;  5LAT A;  4XCA A;  2RDR A;  5EQU A;  3OUH A;  4Y5S A;  5DAQ A;  2RDS A;  2G1M A;  3W21 A;  3OUI A;  3GJA A;  4Y5T A;  4MHU A;  5LBB A;  2JIG A;  5L9V A;  4NMI A;  2HBT A;  5LA9 A;  5DAV A;  3GZE A;  2G19 A;  4NHM A;  4Q5O A;  3HQR A;  3MGU A;  3BVC A;  2A1X A;  2FCV A;  5L9B A;  2RG4 A;  2JIJ A;  2FCU A;  5HV0 A; 
#chains in the Genus database with same CATH topology
 1ZVF A;  2WNV A;  4NRP A;  4Y20 B;  2YU1 A;  2JIC A;  3ACI A;  2RDQ A;  1BBT 2;  1QXJ A;  4MAD A;  1UWW A;  3HD8 B;  3WF4 A;  1RUI 2;  4CTE A;  4PIY A;  3NAP B;  2OQ7 A;  4LIV A;  3T4H B;  2VNG A;  5C4W C;  3VKO A;  2P3K A;  1HQN A;  3OG2 A;  1UIJ A;  1JZ7 A;  1MZE A;  1WMD A;  3UV9 A;  3ZIW A;  4FO9 A;  1S0B A;  2VBB A;  2GAU A;  3B00 A;  2BNO A;  3ZFG A;  1LGB A;  4E4D X;  2W1W A;  4H7M A;  5FXZ A;  5C5U A;  1BEV 3;  4QXC A;  4GH4 A;  4X8N A;  5DAW A;  2D5F A;  1DQ5 A;  1ZZ7 A;  1QXP A;  5T5P A;  3QAC A;  5FQ0 B;  1XE0 A;  1YFX A;  1VPH A;  3ELN A;  1IOA A;  3I2O A;  4COV A;  4ATF A;  3CHX A;  2EIB A;  2PAE A;  1RUD 1;  3QOP A;  4TLG A;  5I8T A;  2ZEZ A;  1H9W A;  2Y26 A;  3POI A;  1H1M A;  5J36 A;  2ZA9 A;  2GH2 A;  2XWJ B;  1UYP A;  3ENR A;  3BOP A;  3APB A;  5CYY A;  2ZGO A;  5CAD A;  1HQW A;  3J7M A;  2WUH A;  4GAZ A;  4P02 B;  2W9X A;  3R6S A;  4CUG A;  1O3R A;  2WDB A;  3BYW A;  3OBZ A;  5AC9 2;  3WQB A;  5FBZ A;  1CAW B;  5LA0 A;  2D98 A;  3QCW A;  1QNW A;  3DPR B;  3H8X A;  3O5S A;  4Q0P A;  2VZ1 A;  3NL1 A;  5JSO A;  3LIG A;  2G9G A;  5D8A B;  5BNP A;  1SBE A;  3RMX A;  4QKN A;  1BQP A;  2WII B;  2PTM A;  4CP9 A;  5C9A B;  4NIG A;  5A6Y A;  2D6O X;  3R4S A;  1O8P A;  1V9U 3;  1E57 A;  5FZ0 A;  5IAX A;  4QPG C;  3T08 A;  3OUJ A;  5KBF A;  4ZS2 A;  4BQ5 A;  4YSF A;  1RUH 1;  5F32 A;  4R4X A;  2DVB A;  4RFT 0;  5A7N A;  2AGS A;  1COV 3;  2ENR A;  4IGP A;  2QZ2 A;  3AMN A;  4AI8 A;  5JMO A;  4YW4 A;  3N7L A;  2XJR A;  5FKC A;  3UJQ A;  4CE8 A;  3NV1 A;  2O8Q A;  4UF0 B;  2LRP A;  4HT1 T;  3BPS A;  3G7D A;  1UO9 A;  4FPY A;  3HN1 A;  1PGW 2;  1QF3 A;  4MSV A;  5A3L A;  2B42 B;  2WNE A;  2ZHL A;  3ILF A;  3N9L A;  4ZHN A;  2XXZ A;  3NV3 A;  4MGS A;  1FMD 1;  4LMF A;  3ZN6 A;  2FDI A;  2V5D A;  4KU8 A;  5DUU A;  4YW1 A;  5EQU A;  2RS1 3;  1CX4 A;  3D4K A;  1JOB A;  3KB5 A;  2DCY A;  3FLT A;  2NQY A;  4YNI A;  3IPV A;  3W5N A;  1NZC A;  4D6Q A;  2WYS A;  1SBF A;  4YFZ A;  1US2 A;  3USS A;  2B4K A;  5DDJ 1;  1U5Z A;  4Y1X A;  4W6X A;  4IDZ A;  1XRU A;  2P37 A;  4CDQ A;  1JHN A;  1KFX L;  4N43 B;  3OY8 B;  4X6Q B;  4IEZ A;  3LDR A;  3I4I A;  2PN5 A;  4FBF A;  1MEC 2;  4LTA A;  1R08 3;  1IS3 A;  1YQ2 A;  2FCV A;  2NMO A;  3VZO A;  2JG9 A;  4Q4Y 3;  1HJG A;  5FK8 A;  3MZH A;  2BER A;  2I45 A;  4NWW A;  1KD7 A;  2XLG A;  4RS5 A;  1G9A A;  3RYP A;  3NJX A;  4HK8 A;  1Q8V A;  3HR9 A;  4BWO A;  4BA6 A;  1VAL A;  4YM1 A;  1SDW A;  3WSO A;  5LCW L;  3KV6 A;  2BGO A;  1OOP B;  3K75 B;  1R1A 1;  4AQS A;  3I2D A;  1WCS A;  2QNK A;  1HN0 A;  1WCD J;  4CEY B;  1NCR A;  5FZL A;  5F5C A;  1WWY A;  2XKO A;  1S1A A;  4NHX A;  1V6I A;  3ZFE B;  1ND2 B;  4I01 A;  1FX5 A;  3BU0 A;  1OA4 A;  2RS1 1;  3H7Y A;  5T5L A;  1SG3 A;  4CEW A;  2BGP A;  1HV1 A;  2XBO 2;  4Y1U A;  5J3U A;  3EXU A;  3Q8C A;  3B9I A;  2W92 A;  3HNY M;  4GUL A;  3AP7 A;  1HXS 2;  1XND A;  2HWB 1;  1RIT A;  3B7M A;  3H0O A;  1SLL A;  2WSU A;  3K4Z A;  3L2H A;  4F8A A;  2YHJ A;  3B01 A;  5LW9 A;  1QKQ A;  5LY1 A;  1O91 A;  5ACA 3;  1AL2 3;  4HKO A;  5IHR A;  2ZPX A;  3H1W A;  5CA6 A;  3DEC A;  4AWD A;  3SEE A;  1ZZC A;  3GNE A;  1QJX 1;  2Y6G A;  2VCM A;  4IL7 A;  4K9S A;  4LO5 B;  1DYO A;  1MVQ A;  2VZT A;  3WUD A;  4Q4Y 1;  3RZH A;  1N3P A;  3LE0 A;  3VBH B;  2E33 A;  3C7O A;  5IW0 A;  2G9F A;  3U4S A;  1QJF A;  5CKQ A;  4CDW B;  1AR9 2;  4X6R B;  3VBR B;  4WZC A;  2ZEW A;  3IAP A;  1S0E A;  2QQU A;  2HWD 2;  3W9A A;  4ARY A;  2MEV 2;  4IV3 C;  4QDQ A;  3RGB A;  3RJR A;  2O1Q A;  1MS3 A;  1SLB A;  2VVE A;  2W68 A;  1WW5 A;  3I2J A;  3LPF A;  1LOE A;  1QY4 A;  2GC2 A;  3NWK A;  2YRO A;  5JOZ A;  1VRH 1;  1IG3 A;  2X53 S;  3FHQ A;  3R4U A;  1EPZ A;  4LQR A;  3SCG A;  4XFG A;  1ZA7 A;  2OZJ A;  2R1B A;  3KLS A;  3SLI A;  4QXB A;  1H1A A;  3DN7 A;  2FDH A;  5IFT A;  2OPK A;  2E32 A;  2JG8 C;  3Q8A A;  4FOQ A;  2OKX A;  4KWK A;  2WN3 A;  3AZW A;  1UYZ A;  2HLE A;  2L9L A;  2FBE A;  1BXH A;  1CQ9 A;  3GHM A;  3OPT A;  2E53 A;  4XUO A;  5CB7 A;  3VDD B;  4MYE A;  5A80 A;  4BQX A;  5JSP A;  3H8U A;  1DDL A;  3I3M A;  4Z2A A;  4IE0 A;  2KA3 A;  1GBG A;  5I0U A;  4ORF A;  3I59 B;  1G9F A;  2DUQ A;  2A6X A;  5FPZ A;  1X82 A;  3IN9 A;  2JDM A;  5KC6 A;  4MET A;  3O1M A;  1GUI A;  4LHK A;  3O1S A;  5FPB A;  2W47 A;  1K5M B;  1MAC A;  4YG3 A;  3A0N A;  1PO2 3;  2XVG A;  3ACF A;  5FY8 A;  3DYP A;  2CAU A;  4XMI A;  2KXL A;  4R9A A;  5KXE A;  4UOJ A;  2ORX A;  5FXV A;  5H9R A;  1UF2 C;  4AYU A;  4OLL A;  3VBO C;  1XYN A;  3MW2 A;  1W9W A;  4J1X A;  1MZF A;  3ORJ A;  1HB2 A;  4ASM B;  4J6G A;  1VB4 A;  2D6N A;  4MO3 M;  1NKG A;  5HCA A;  1EV1 1;  1LCL A;  4HVO A;  5FXW A;  3WF1 A;  2ZOE B;  2GH8 A;  4BHP A;  1DLL A;  5GZF A;  2UYA A;  2IUW A;  5J09 A;  2JDU A;  5EZW A;  4HKL A;  2VMI A;  1A34 A;  5FY7 A;  2JDK A;  4BME A;  2XJQ A;  1ZRD A;  1QOT A;  4AK3 A;  1D4M 1;  1QOS A;  5EYX A;  2Y6K A;  4JGZ B;  4YZ4 A;  1QU0 A;  3PUR A;  1QJY 3;  4XJ8 A;  2FDF A;  1JZ8 A;  1B09 A;  2X5I C;  4DS0 A;  1PVC 2;  1WGP A;  2B9U A;  4QQL A;  5DUX A;  2JEM A;  4PBP A;  1MS0 A;  3LSD A;  5BNN A;  1ST8 A;  1VBB 2;  4IEY A;  1I5P A;  4LKD A;  5JOX A;  3FBY A;  4GWM A;  4LBN A;  5KWR A;  2Y0O A;  4FP3 A;  1PO2 1;  1RUI 3;  4COY A;  4AHW A;  5JAX A;  2Y6F A;  1XNA A;  3RSJ A;  1JYV A;  4AG4 A;  1YQ6 A;  3T1L A;  5GZG A;  3DYO A;  4QPI A;  5FMO L;  5FPL A;  4IES A;  4D3W A;  4CDU B;  2BYV E;  2OII A;  1ZRR A;  2DUP A;  3OGV A;  1RHI 3;  5FP9 A;  4UBG A;  4XFI A;  5A32 A;  1UU4 A;  4FOY A;  4Y22 A;  5JI9 A;  1YLL A;  4E8D A;  1AR7 1;  3SNM A;  4DXS A;  1Y7B A;  4JCK A;  4TSV A;  1ULD A;  2WNU A;  2E26 A;  3WCS A;  3O1U A;  2QDR A;  5LA1 A;  1CZT A;  3SXW A;  1VBC 1;  2EIE A;  4UWD A;  5FRA A;  1W03 A;  4JZR A;  4L0P A;  4MGK E;  3J8F 2;  2XJV A;  4XFC A;  1SPP B;  4QB1 A;  1L3J A;  3SC7 X;  1EAH 1;  2GN3 A;  4K20 A;  5JOW A;  2UY8 A;  3MPP G;  2D6M A;  1IPK A;  4IE4 A;  5FZ4 A;  5FWJ A;  3OGS A;  2VNO A;  3MF9 A;  1U12 A;  1O7F A;  2LUW A;  3M70 A;  1RMU 3;  4OUM A;  5FPA A;  5AC9 3;  1KJL A;  3K51 A;  5FZ1 A;  5C4W A;  2R1D A;  3LD8 A;  1BBT 1;  1WW7 A;  2XLA A;  2VOK A;  1RUI 1;  4FTB A;  4JQR A;  1AVB A;  3ES1 A;  1PMJ X;  1O4Z A;  2GU9 A;  2YZ4 A;  4XCB A;  3JD7 2;  2VTX J;  1QGL A;  2R04 2;  1WKY A;  4N8M A;  1J3R A;  3LIH A;  3CKH A;  4BQW A;  5LK7 B;  2BV4 A;  4UW5 A;  3N9N A;  2IFW A;  1PM4 A;  2YU2 A;  4PIZ A;  2ZGN A;  1LEN A;  3KGL A;  4I30 A;  2VOW A;  2XHK A;  1IKQ A;  4DZG A;  1VMH A;  1ASJ 2;  4LIT A;  5FUI A;  4Q1R A;  1S0I A;  5HXV A;  4UYB A;  1LHW A;  4XVH A;  4YVS B;  3VZM A;  4XOG A;  2CHH A;  1O4T A;  3DV8 A;  4PCR A;  3OD4 A;  3JQX A;  5E6H A;  1WCK A;  3ZXA C;  1O3T A;  1UKR A;  3VB9 A;  4MV2 A;  3IDA A;  1LAJ A;  2H6B A;  2PQS A;  4B7E A;  3MLJ A;  2DWR A;  1YIP A;  4PJY A;  3KZ4 C;  1CPN A;  1MS8 A;  1N1S A;  1ZBE 2;  3OOX A;  2WNV C;  3U10 A;  1DYK A;  1UU6 A;  3N36 A;  4ATE A;  3ON7 A;  1DQ0 A;  3VHR A;  3GZE A;  2XVK A;  1GQP A;  1GZW A;  4KU7 A;  4E9K A;  3AYC A;  3MDP A;  1MZ5 A;  1PGS A;  5EHD A;  1YRZ A;  1JN2 P;  2VH9 A;  2O0O A;  2UWB A;  3PHM A;  3ZMN A;  5L9B A;  1AX0 A;  4QPG A;  2PLV 2;  3A22 A;  1UXX X;  1YYN A;  3ZFG C;  4HLT A;  4XIO A;  1RUJ 1;  3SKJ E;  1QH7 A;  1YNA A;  2JXA A;  3U11 A;  1W8U A;  4XUP A;  2ZAA A;  4IER A;  4GH4 C;  1MEC 3;  1FI2 A;  2Q1F A;  1UIK A;  2ZGM A;  4DIN B;  1SBD A;  3RZM A;  2XML A;  1XB9 A;  2LTN A;  4LBQ D;  1W6M B;  4K1Y A;  2P5B A;  1V6J A;  1S55 A;  3J7L A;  2YMZ A;  4NHK A;  1AX1 A;  3WDX A;  4QB2 A;  4FTS A;  1W9F A;  2ZGT A;  4ISQ A;  4W6Y A;  4UFI A;  1PGW 1;  2VC9 A;  2VUA A;  4XJA A;  2JDA A;  1OKO A;  5JR7 B;  4NPM A;  3ZX7 A;  3VBU B;  3U4X A;  1LU2 A;  3OEA A;  4LKE A;  2BNM A;  3VN4 A;  2W91 A;  2HJI A;  2VD7 A;  2WLP A;  4PBO A;  2BU9 A;  4ES9 A;  3OPZ A;  1BK1 A;  1GMM A;  1H1I A;  2XBO 3;  3E5Q A;  4GA9 A;  4PF5 A;  1F9K A;  1ULO A;  1DYP A;  3AMM A;  5K4L A;  3RRD A;  5B4N A;  1OSG A;  4R9B A;  5F37 A;  2BZD A;  2Z79 A;  1LNS A;  2G9Z A;  2QTW B;  4CYD A;  1U0A A;  5FP7 A;  4WM7 C;  3BIW E;  4LBO A;  4FPF A;  5GZC A;  5L7O B;  1RUO A;  4LOT A;  5BNP C;  5ABJ C;  1YQ8 A;  1BEV 2;  4PQQ A;  4Q0S A;  2ZHN A;  3IDC B;  3K48 A;  2K9Z A;  3QLQ A;  1RC6 A;  1NCQ A;  5APA A;  3GHN A;  3RFR A;  4ZZ5 A;  4TTG A;  4TWT A;  5FBJ A;  1MEC 1;  4E2S A;  3I3E A;  1G6N A;  5C70 A;  3EQE A;  3USU A;  4EE2 A;  2IVI B;  1ZBA 2;  3SEP A;  2QQV A;  1U5Y A;  2UYB A;  4Z1V A;  5C5T A;  3LOB A;  5FMB A;  1AR9 3;  5FMC A;  4XQW A;  5CFC C;  3KT4 A;  3AL6 A;  3NV2 A;  4EJR A;  4N90 A;  4LA3 A;  4X8P A;  5JDB A;  3WHT A;  2MEV 3;  2C4X A;  5T50 A;  1LOC A;  4XIL A;  1U5I A;  3OCP A;  2EID A;  4PQ9 A;  4NO4 A;  2XB6 C;  3VD7 A;  2VMF A;  3FUQ A;  5JIU A;  4YAR A;  5JSR A;  5JR2 A;  1N1Y A;  4A7K A;  2B9V A;  3VZJ A;  3AJZ A;  4CSW A;  4PDW C;  4JV4 A;  4YG0 A;  4Q4W 3;  5F6K A;  1VMF A;  3MLK A;  3U1X A;  1LHO A;  4EYU A;  1BJQ A;  2SLI A;  1N1T A;  1HXS 1;  4AFB A;  4BJ0 A;  2CGO A;  2H6C A;  3K2O A;  3O12 A;  2DBI A;  3HQU A;  2ZX0 A;  1V9U 2;  3H3U A;  2R32 A;  4MLO A;  5DG1 A;  4ZY9 A;  1W0O A;  3MUY 1;  5IJR A;  2NM1 A;  5LAT A;  4CDQ C;  5FYT A;  2W1S A;  3P3P A;  1AF9 A;  1XNC A;  1W2A X;  2GP3 A;  2QQJ A;  2HWC 3;  3OUH A;  3KVB A;  3VHN A;  4K40 A;  5BNO B;  4GB3 1;  3NRU A;  4URT A;  4LA2 A;  4DO0 A;  1C5H A;  4GIQ A;  1JOP A;  3H1M A;  2JG9 C;  2CU5 A;  2VBD A;  2ZZJ A;  1QJU 1;  2NPI A;  3A0K A;  1AR9 1;  3D82 A;  5DAB A;  5T5O A;  3FZ3 A;  1GZ9 A;  4D7Y A;  1CIW A;  5C8C A;  3KVA A;  2HWD 1;  5ANQ A;  3ZN6 B;  1PK6 A;  1Y4W A;  5DAV A;  1HRI 3;  2WKK A;  1DQ6 A;  5SV8 A;  4G3Y C;  4E4S A;  1X7N A;  4B4P A;  4E8C A;  1NCR C;  5F3C A;  2R07 2;  3A21 A;  3A23 A;  3FWE A;  3IPV B;  4AI3 A;  4RHV 2;  1BVP 1;  1J1L A;  1NA1 A;  2G4I A;  3PUA A;  5FYC A;  1POV 1;  2QQM A;  2ARX A;  3B02 A;  2ZEX A;  1ZX5 A;  2JG8 A;  3WCR A;  3WP5 A;  4YGC A;  4YRD A;  1POV 0;  4RR3 C;  2W39 A;  5IAV A;  3TB0 A;  4IE7 A;  3GZU C;  4A41 A;  1OD3 A;  1W9Y A;  4DUX A;  1JZ2 A;  2VQA A;  1A8D A;  3ETP A;  3RZG A;  4LO6 B;  5L36 A;  5KHJ A;  4IEQ A;  4E2G A;  1BVV A;  1R08 2;  3P1I A;  2OYZ A;  4RYD A;  5LZ6 A;  2RMU 2;  4RS5 B;  2PAK A;  1SAC A;  4YW2 A;  3ZYJ B;  2Q1M A;  3TEW A;  2EXH A;  1XXN A;  3N9P A;  4XE9 A;  2XL9 A;  1KS4 A;  5FY5 A;  1IZ3 A;  2P17 A;  5FZH A;  4W6W A;  1OQD A;  1ULG A;  1C1F A;  3H3L A;  2HBU A;  1VBB 3;  5FKB A;  4XBQ A;  2VZQ A;  5FLJ A;  4AFC A;  1L7Q A;  4P9Y A;  5A3W A;  3IKW A;  1TMF 2;  2ORZ A;  4G4F A;  1WZX A;  3D0J A;  4IEX A;  3VBO A;  1DIW A;  3ACL A;  4CEW B;  1BMV 2;  1GOG A;  4AGG A;  3CZU A;  5K9Y A;  4AEJ A;  4IGQ A;  5C8W A;  1OKQ A;  4NRM A;  3JBG 2;  1AHS A;  4XZU G;  2D6L X;  3K4D A;  2LRO A;  5LA2 A;  3O1T A;  3PU3 A;  2YUE A;  2WT0 A;  2D5H A;  4GD4 A;  3RPQ A;  2XON A;  4P9G A;  2D40 A;  2DUR A;  4Q4X 1;  1XNT A;  2I07 B;  2BQP A;  2GMP A;  3KV5 A;  1J1T A;  1H8V A;  2JEC A;  2O14 A;  3N9M A;  4LLO A;  4HMZ A;  3J8F 3;  4GXL A;  1FT9 A;  3KQ4 B;  5BNQ A;  2A5Z A;  3HQX A;  3AKR A;  2YC2 A;  4BZ4 A;  1TG7 A;  1PVC 1;  1AYM 3;  2DU1 A;  2YC4 A;  2Y60 A;  3VBS A;  3NST A;  3KMH A;  4BU2 A;  4QB6 A;  4HN0 A;  3O1V A;  4Q27 A;  1CWP A;  2W87 A;  5FY1 A;  1VBB 1;  5F6L B;  5A3U A;  3AVR A;  4M3C B;  2O8O A;  4DIQ A;  1W6O A;  2OQ6 A;  2LS6 A;  1H2M A;  2IC1 A;  4ES8 A;  1SLI A;  2WC2 A;  5C33 A;  5IK8 A;  1L7R A;  2RJK A;  3KT1 A;  3WNK A;  4BB3 A;  3IMM A;  3JD7 3;  1RXG A;  4XAE A;  3ZPY A;  2MHF A;  2W0X A;  2VCC A;  4OQ9 A;  4P00 B;  3JUU A;  1SLT A;  1CAU A;  3PIG A;  3U0Z A;  2CNA A;  4AAP A;  3ZFF B;  1VBA 3;  4HOO A;  1TME 1;  4GJZ A;  5FV3 A;  1KJR A;  4HBN A;  5F3G A;  2VL4 A;  3E6C C;  1WUV A;  4DRV A;  4OUE A;  3SH5 A;  1UPS A;  1ASJ 3;  1C4R A;  1LUL A;  1W8N A;  3IT8 A;  3LCP A;  2GND A;  1W9S A;  2VW1 A;  4ARX A;  4CPB A;  1T2X A;  3RJ2 X;  3WQ7 A;  4IV1 C;  1GKB A;  5EV7 A;  1WLT A;  5FOJ B;  2DFC A;  3THT A;  5FAX A;  1LOF A;  2C9K A;  4Z07 A;  4B3N A;  4ZZ8 A;  1H6Y A;  2R49 A;  1FPN 1;  1XE7 A;  2XVL A;  1V70 A;  5JPM B;  5CAZ A;  2WO3 A;  1PO1 2;  1ZBE 3;  5C3P A;  3MF6 A;  3WD5 A;  1XJA A;  1CPM A;  1REE A;  1IPJ A;  4Y33 A;  3IMN A;  1UCX A;  1B35 C;  2NN8 A;  2ZXQ A;  3P6B A;  3BOW A;  4Y1V A;  5IVY A;  3JD7 1;  1OQE A;  4GMP 0;  2GNT A;  3AK0 A;  2R04 1;  4QPI C;  2UY9 A;  4JVA A;  2PLV 3;  2YBK A;  4BH9 A;  1ULP A;  4L8Q A;  2Z5W A;  4NJ4 A;  3V0A B;  1HIX A;  2BW8 A;  4XC9 A;  4YYO A;  3UGG A;  1NT0 A;  2Q1Z B;  3FFZ A;  3Q8E A;  4TZD A;  4LEJ A;  2C6S A;  1E5I A;  2XJS A;  3LEM A;  2C5D A;  3OGR A;  1V0A A;  2WNU C;  5GZE A;  4RQP C;  2WZ8 A;  3N35 A;  4SBV A;  2R6Q A;  4UW3 A;  1QJY 2;  4XUR A;  5K0U C;  4AQ6 A;  3ZMO A;  3TWI A;  1PNG A;  5BNN B;  3GXU A;  3E6B A;  4K7J A;  4LPL A;  5FR3 A;  1V6L A;  3OJB A;  3CU7 A;  1OLQ A;  1RUF 2;  2VZO A;  1QIQ A;  1ZBE 1;  4YVW A;  2FZ2 A;  3J7N A;  2Q4S A;  5A3O A;  3W58 A;  5FZF A;  4MGT A;  4CPB D;  5FZB A;  2BNN A;  1C28 A;  2MNG A;  2PHX A;  3FL7 A;  3JU9 A;  4XUQ A;  4YGD A;  1Y43 B;  5I0S A;  4HPK A;  2C9A A;  3NJY A;  4NR1 A;  1RHI 2;  5A32 B;  5BXX A;  4Y22 B;  2GDF A;  2PLV 1;  3NNM A;  1WW6 A;  2PAM A;  3ME2 A;  1SMV A;  5CZK A;  5H9Q A;  1VBE 2;  5H9P A;  2P3Y A;  2ZHM A;  4WVZ A;  5FZO A;  3RVH A;  2DU0 A;  1JZ6 A;  1QJE A;  1XOY A;  3GYD A;  4QGM A;  1UPI A;  5A1L A;  1BLZ A;  3CLP A;  4C90 A;  1QDC A;  1VP6 A;  1TNF A;  4JDN A;  4ET7 A;  2Y34 A;  1ZBA 3;  3F95 A;  4GWN A;  5D2A A;  4URA A;  1W3V A;  2VZV A;  2Q8D A;  2V5Y A;  2ZAH A;  3GZT B;  3KSC A;  1UY1 A;  2J1A A;  2YBP A;  3WV6 A;  2ZBJ A;  3D3A A;  2DV9 A;  4AVS A;  5C4W B;  1S0C A;  1LOB A;  4LT5 A;  1RMU 2;  3I3Q A;  2IZW A;  3RG0 A;  4IEO A;  4AF9 A;  4FPJ A;  5E88 A;  3W20 A;  5CKM A;  5E89 A;  5E8A A;  2D7F A;  2DCJ A;  4KG8 A;  4LBK A;  3AB0 A;  4NWV A;  3NKG A;  5T3N A;  2W94 A;  3U75 A;  1IGO A;  4WM7 A;  3ZDS A;  4RSU A;  1ND3 A;  3CDZ B;  5ABJ A;  1PX3 A;  1S0J A;  3JXS A;  4MX3 A;  3AP9 A;  1KDK A;  5FJK A;  3III A;  4NRO A;  5L73 A;  1BEV 1;  1ZA4 A;  2WN2 A;  5CIS A;  1JI6 A;  2D6K A;  2ZS6 B;  4KG0 A;  1ENR A;  2WR9 A;  4XEZ A;  2IVJ A;  3RMY A;  3H42 B;  4QX1 A;  3KM5 A;  4XDO A;  1NXD 1;  2Z42 A;  1RUN A;  2YC0 A;  5CFC A;  1RYY A;  5FY9 A;  4CXY A;  4QD2 A;  4UAP A;  3MPB A;  4LJH A;  1AL0 G;  1UY2 A;  2CDO A;  5KHI A;  2P2K A;  1PIV 2;  3GBF A;  3AXD A;  3VD5 A;  1XC6 A;  2ZGU A;  3LA3 A;  2IXC A;  4RA0 A;  3VD9 A;  5C3S A;  1LR5 A;  2JIJ A;  4LO4 B;  5ANN A;  1K12 A;  2W52 A;  2Q8E A;  1F8V A;  2CAV A;  4BYY A;  4QX2 A;  4BLI A;  4SLI A;  4QQO A;  3KWV A;  3MV1 1;  2R07 3;  1JYI A;  1KRI A;  4PDW A;  2OX0 A;  4XQD A;  4XHB A;  5IYY A;  4RHV 3;  1OLR A;  3SCH A;  2XGX A;  1UXZ A;  4QXH A;  5C3O A;  2WNO A;  5JCT A;  4QPG B;  4OI1 A;  1XQN A;  3TAY A;  4JDO A;  4WM8 A;  4D94 A;  3ZIX A;  4CZS A;  2WFF 2;  3KS7 A;  5DUV A;  1V9U 1;  4AI1 A;  3H8R A;  1BYH A;  1CIY A;  1N3O A;  2WYF A;  5CFD A;  2RS5 2;  1YXW A;  2R30 A;  3AYD A;  2XLF A;  1J83 A;  1TQ5 A;  1NCQ C;  1SCS A;  1W6N B;  1NLQ A;  4R4Z A;  4H3W A;  2RMU 3;  1YFW A;  3RZZ A;  3WP6 A;  5HPO A;  1VBD 2;  3ZN5 A;  1FV2 A;  2XPJ A;  4XF9 A;  1COV 1;  1HLC A;  2VOX A;  4C0H A;  4FAH A;  3I2H A;  1UY0 A;  3LEI A;  5JXH A;  1RIN A;  4UBH A;  4YWA A;  2WS9 3;  4YM2 A;  1F5F A;  3V64 A;  2XHN A;  2ES3 A;  1YJL A;  4QXK A;  3I2I A;  2CWS A;  5F7U A;  4NPL A;  1AXK A;  3Q8B A;  3FX3 A;  4DXT A;  2FDK A;  3THD A;  3WW4 A;  1TMF 3;  2PHF A;  4L9B A;  5IK7 A;  1UMZ A;  4MG2 A;  2XL7 A;  5DZF A;  4NIH A;  2X10 A;  2QQK A;  1D0G A;  1RED A;  1HN1 A;  4RHV 1;  1JYC A;  3JBG 3;  1OXC A;  3HEI A;  3SKV A;  3S30 A;  4N7U A;  4RR3 A;  4C1X A;  4QT6 A;  1NUK A;  5DQ0 A;  3WG4 A;  3N9O A;  4JGY A;  5FRE A;  1NE4 A;  1NLS A;  4Y3O A;  1IS6 A;  1SQ4 A;  5FZ7 A;  1LEM A;  1RL3 A;  1KDM A;  5CU1 A;  2EAA A;  3LEK A;  5F8P A;  3X29 B;  2Y0I A;  1X9P A;  4QMA A;  4AHX A;  4D6S A;  2JWP A;  1NAE A;  2PHW A;  1R08 1;  3USU B;  4DNY A;  2BDR A;  2RMU 1;  5HV4 A;  3WLU A;  4UXA A;  1DZR A;  4QX8 A;  5KC5 A;  2H0V A;  3ZOI A;  4DUV A;  1Q43 A;  4HON A;  2FQP A;  1GR3 A;  2YGM A;  1FAY A;  5CIR A;  4HSJ A;  3SIS A;  5AVP A;  3WG1 A;  5FO7 B;  3POE A;  4QGL A;  1WCQ A;  4QM8 A;  3AYE A;  1DCS A;  5C8C C;  5FYV A;  4K21 A;  1RTV A;  3PNA A;  4Y4R A;  3T0A A;  1PK6 C;  2DVA A;  3WQ0 A;  1TMF 1;  1V6O A;  1Z0H A;  2LAL A;  5FUN A;  3SIT A;  1QHD A;  1PX4 A;  4EZ4 A;  1BMV 1;  5J98 B;  4M01 A;  4JHT A;  3VD4 A;  3E1F 1;  3MBW A;  2WWJ A;  3D8C A;  3PVE A;  1F2N A;  3ZYB A;  1JZ4 A;  5HCH A;  3S0M A;  2P3I A;  3WDT A;  3KGZ A;  1Y9M A;  4KWU A;  4Q4W 2;  5A33 A;  1NA1 C;  2JDH A;  1NX9 A;  1CR7 A;  3Q9O A;  1S0D A;  4HKW A;  2GAL A;  1IQA A;  2WT1 A;  5ACA 1;  2VBP A;  1AL2 1;  3PTY A;  4XHX A;  5LA9 A;  2BOJ A;  1H8T C;  3WNM A;  4NHM A;  1UY3 A;  2Q0A A;  4OHV A;  5FXX A;  5GKA C;  1OLM E;  1JZ3 A;  2E6V A;  2HWC 2;  3WNL A;  4PLO A;  4AGV A;  3SQO A;  3LZZ A;  3HJR A;  3MO4 A;  1YCI A;  4COZ A;  1W0N A;  4IV3 B;  1W8T A;  4NUB A;  3ST7 A;  1CX1 A;  1QH6 A;  5DXD A;  3U78 A;  5FY4 A;  1C57 A;  1SFN A;  1X33 A;  1XNB A;  5I0R A;  5HCF A;  1OH3 A;  1PO1 3;  1P8J A;  1PVX A;  4N53 C;  1BCX A;  4CCL A;  1CAX A;  4DUW A;  2JDZ A;  2YGL A;  3C7E A;  4AED C;  1DGL A;  1HRI 2;  4C0B A;  2VOT A;  3ZXL A;  2H0B A;  2XR4 A;  4MGQ A;  4BLJ A;  2WAB A;  4GWJ A;  5FDB A;  5JWP A;  5JXG A;  5FK7 A;  1GAN A;  1IQD C;  4MGI E;  2VZS A;  2JG8 B;  5KHH A;  2FMD A;  2BJS A;  4FPK A;  1W6Q A;  3POG A;  4OQ8 A;  3NO8 A;  3KCY A;  4XBL A;  2VG9 A;  3B5L B;  1QDO A;  4Y5Z 0;  4V1P A;  4BOW A;  5EP9 A;  2OVU A;  4AHZ A;  4K8F A;  4P08 A;  3TNQ A;  2JB4 A;  4CCC A;  1AR6 3;  1H2N A;  3WDW A;  4XF1 A;  5A3T A;  2KM2 A;  4IV1 A;  2ID4 A;  1ACC A;  1W2T A;  2HYX A;  2VZ3 A;  3OBT A;  3S7E A;  3WXP A;  2BWA A;  2JD4 A;  4E27 A;  5BUV A;  2B45 X;  1RUC 2;  5CG8 A;  2BP6 A;  1PZ8 A;  5I91 A;  1G9D A;  1JOJ A;  5FP8 A;  1GQG A;  1O8S A;  4IND A;  4P5Y A;  2WA3 A;  1K42 A;  3UL2 A;  5CEH A;  1H30 A;  3IBM A;  3G6J B;  3VL9 A;  4BIF A;  3ITQ A;  1NY7 2;  2UWA A;  4LUK A;  4XUT A;  4AFA A;  4DQA A;  5IVF A;  1URX A;  4XXA A;  1O3S A;  2E7T A;  3BIE A;  3VBS C;  1RUF 3;  2GC1 A;  1AZD A;  3WG3 A;  2VXJ A;  4XDQ A;  4QHO A;  3VUO A;  3HBZ A;  2PXJ A;  3VBO B;  1O3Q A;  1BK0 A;  2OS2 A;  1B35 A;  1W06 A;  1WMX A;  3AFG A;  4CXW A;  3TEX A;  1RGS A;  2A3W A;  1ZRE A;  2VVD A;  3J26 N;  3ZYG A;  3TOJ A;  2BEO A;  3ZXG A;  3ILN A;  3M3Q A;  4WVM A;  3C8X A;  3ZYF A;  4AQT A;  4YW3 A;  5FZG A;  3KV9 A;  1ODM A;  2QQN A;  2Y6J A;  4FPO B;  4ONU A;  3B69 A;  5EJ1 B;  5LB6 A;  3EHK A;  4XPV A;  1S2E A;  5KXB A;  1VBE 3;  4C1W A;  1J84 A;  2DTY A;  3OGJ A;  5IVV A;  2IXH A;  4RQP A;  1NG0 A;  2BBV A;  2JE7 A;  2UUR A;  2WAA A;  1R09 2;  2IXK A;  2X5I B;  4M4R A;  4Y20 A;  2DF7 A;  5K0U A;  4S2D A;  2BFU L;  4GQ7 A;  1QJY 1;  2JDP A;  3NAP A;  3OYW B;  3ASI A;  1QEX A;  1AYM 2;  1GYK A;  2HEY F;  3O0W A;  5IVB A;  3QBQ A;  1LOF C;  2WJS A;  3FUO A;  5F39 A;  1ZRF A;  1LGN A;  1X9T A;  1HKD A;  2AC1 A;  1RUF 1;  1VIW B;  1VLN A;  1AX2 A;  4HAN A;  4A2U A;  4IE6 A;  2G1M A;  2HEV F;  1RJ8 A;  2CDP A;  4LBQ A;  4JQT A;  4BPZ A;  5FQ0 A;  3MLL A;  2XJT A;  1GWM A;  1OT5 A;  1I3H A;  2D3R A;  3LQC A;  4I3P A;  1RHI 1;  3CF6 E;  1C5I A;  3CIH A;  2Y8K A;  2VPV A;  3MYX A;  1JZ5 A;  1BKZ A;  3FLP A;  1OUS A;  1VBA 2;  2XKP A;  3K4A A;  4Q5O A;  1WLD A;  2YY1 A;  2CWM A;  3LGR A;  5KHG A;  4LXL A;  4BQ3 A;  5F3I A;  4AEK A;  3ACH A;  4RL7 A;  3VKL A;  5A7P A;  3PTR B;  4QKB A;  1CAW A;  4OHX A;  1AYN 3;  3BPZ A;  2P34 A;  2VZP A;  1OUR A;  5GZD A;  1YJK A;  2A3Y A;  4NAO A;  3N4M A;  1PIV 3;  3WHU A;  3LA2 A;  3T1M A;  5D8A A;  3LA7 A;  2VMH A;  3HT1 A;  4F83 A;  3IZO A;  4RFR B;  1X8E A;  4KGG A;  3VBF C;  2VO5 A;  4AVB A;  2P6H A;  3DCQ A;  4S2F A;  4P5H A;  4YW6 A;  1ENX A;  5AC9 1;  1RMU 1;  1S4C A;  4EWD A;  2IXJ A;  3CJI C;  2QVS B;  1OFS A;  1PZ9 A;  2WO1 A;  5FYU A;  5ERL A;  3NNL A;  2YPJ A;  4LR4 A;  4YVW C;  3FJS A;  2NLR A;  2HWE 2;  5HCB A;  3AP6 A;  3ACG A;  2AEY A;  4WVW A;  3I2K A;  4ASL A;  4B8E A;  4XTM A;  3K3O A;  2PMW B;  2DTW A;  1VR3 A;  4HSL A;  5IVJ A;  4U36 A;  1OMI A;  4DXZ A;  2GC0 A;  2WFF 3;  3NVC A;  5AVA A;  4GWI A;  2Y6L A;  4QQH A;  5BY5 A;  5FO8 B;  4MHR A;  2RS5 3;  3SH4 A;  3O1O A;  1EUU A;  4LUL A;  1OPM A;  5BPX A;  1E5R A;  3WG2 A;  5JUV A;  4IEW A;  4W50 A;  4QKD A;  4FQ4 A;  4ZXE A;  1ULC A;  1VBD 3;  1W6P B;  5A7W B;  1W8H A;  2J1T A;  4FQZ A;  4AQ2 A;  4CU7 A;  2ZX4 A;  4XFF A;  3M3I A;  4FTE A;  3ZXF A;  3WW1 A;  3CZJ A;  2WNV B;  2JJ6 A;  1IS5 A;  1UOB A;  4N7I A;  5I0T A;  2A75 A;  4QX3 A;  4YZ3 A;  1T6B X;  1O5U A;  3JZV A;  2VU9 A;  3LDB A;  1EY2 A;  4HZF A;  1FAT A;  1UU5 A;  1WD3 A;  1ZNP A;  3H1Y A;  4HPK B;  4CCO A;  3FHI B;  2ZGR A;  3ZFG B;  2W1U A;  1RUD 2;  3JQW A;  4KWL A;  4PLM A;  3V56 A;  2B39 A;  4YM0 A;  2EXJ A;  1MZ6 A;  2QDN A;  4GH4 B;  4J25 A;  3O7O A;  1NOV A;  2FD8 A;  5FP4 A;  5FZ9 A;  1ND3 C;  2XUM A;  3OB8 A;  4MXV A;  2W3J A;  4P9L A;  4G9S B;  5IUQ A;  1AUY A;  1WLW A;  4QDR A;  2RS5 1;  3DEM A;  3ZSM A;  3FFQ A;  2B8M A;  2CGN A;  1OOP A;  2VQ0 A;  2W5F A;  1CZV A;  3R0R A;  4QPW A;  4AE2 A;  1GWK A;  4DY5 A;  4NOT A;  5FZ6 A;  4KQ7 A;  4YLZ A;  1VBD 1;  5EXO A;  1PZ7 A;  4Q4V 2;  4CEY A;  3BUC A;  2PHD A;  3B94 A;  1LHU A;  3PJQ A;  3QD6 A;  1MS9 A;  3T2T A;  4MZU A;  1DHK B;  4XMA A;  3C7H A;  3U07 A;  5FMD A;  1JYX A;  3NJZ A;  4D8M A;  1UZ0 A;  3IB3 A;  3AVS A;  5DAQ A;  4O65 A;  1HRV 2;  2RDS A;  1S0F A;  3VD3 A;  1Q8O A;  1W39 A;  3BTZ A;  4XF0 A;  4PI0 A;  2EAL A;  1UX6 A;  4R52 A;  2EAK A;  1JXN A;  2ZX3 A;  5EJZ B;  3VKF C;  1UNB A;  2JIG A;  1RUH 2;  4YGB A;  3FN9 A;  1ENQ A;  2PHU A;  4WM7 B;  2C0Z A;  2RHP A;  5LY2 A;  1Z7S 2;  1CZS A;  1JU4 A;  1G8W A;  1LKN A;  1XE8 A;  1KGY A;  2XBO 1;  4P14 A;  3URF A;  4CP9 B;  1OBN A;  5BNP B;  5ABJ B;  4E4H A;  1OD5 A;  3AX4 A;  3CQO A;  5L19 A;  2VUL A;  3HQR A;  4IUG A;  3MIB A;  4ITC A;  1IPS A;  3AKT A;  5FTT C;  2VOV A;  3CBN A;  4QGN A;  1DQ4 A;  1V6M A;  2XG3 A;  2ZKN A;  3ROU A;  4DXR A;  4WM8 C;  5IVC A;  4FPL A;  1O59 A;  4XFB A;  1VAV A;  5FIX A;  3VBR A;  4CDW A;  5LEK A;  4Q0Q A;  3TNP B;  1YUD A;  1FMD 2;  2JD9 A;  3S7I A;  5CFD C;  1SLA A;  3VHP A;  3BTY A;  5FZK A;  2B5H A;  2QQI A;  3GM8 A;  1DZQ A;  3I97 A;  5CFC B;  2CSG A;  4FFG A;  3KCC A;  3DXT A;  2A6W A;  1ULE A;  3INA A;  3UJO A;  5LRS A;  2ADE A;  2QE3 A;  5DN2 A;  1Q8S A;  4DFS A;  2WSV A;  1WA6 X;  4D6R A;  4FXG B;  2ETE A;  1JMU B;  5CBL A;  3DKW A;  3DF0 A;  5A70 A;  5DDJ 2;  1C3H A;  2MEV 1;  3CO2 A;  3PUH A;  4LHN A;  4XDP A;  4DEV A;  5T55 A;  3LDK A;  2UU8 A;  3P5B A;  4AVT A;  2CL2 A;  2FDG A;  2PA7 A;  4PDW B;  3DUI A;  1PHM A;  4EN6 B;  2PFW A;  2PHT A;  3C7G A;  4M3C F;  3ZVX A;  4P9I A;  1MS5 A;  2D44 A;  2RM2 3;  1A78 A;  1WBL A;  3VDD A;  1SFY A;  4Q4W 1;  4B1L A;  1GZT A;  4CDQ B;  1GNH A;  1XBF A;  1KS5 A;  4B1M A;  4DY3 A;  5EIY B;  3UKN A;  3PUS A;  2ATF A;  1H8T A;  4LOS A;  3THP A;  2J42 A;  2W1Q A;  3I59 A;  1R1A 2;  4I09 A;  3ILR A;  2HWF 2;  4JGY C;  3NNF A;  4YGE A;  4CA9 A;  5LBE A;  3T2P A;  2JG9 B;  2IXI A;  2AUY A;  2WO7 A;  1RUC 3;  2QQL A;  2ADD A;  2PEL A;  2HWC 1;  2V09 A;  1K5M A;  2UWC A;  3L2Y A;  4CCN A;  1YWK A;  3I8T A;  2WZE A;  3IDB B;  4NHY A;  4QX0 A;  3J9S A;  1WA4 A;  4EN7 B;  2WRA A;  2ZML A;  2ARB A;  2FZ1 A;  4IXL A;  2GN7 A;  1IS4 A;  3ZYP A;  3T4V A;  3KQR A;  4EZH A;  1ODN A;  4N53 A;  4BDV B;  1OF3 A;  2WS9 2;  3WT3 A;  4I0A A;  3CJX A;  4AED A;  5JLV A;  1UD1 A;  3RWN A;  3POB A;  1NCR B;  2HWB 2;  3ZYR A;  4QQP A;  5AFE A;  1HRI 1;  1RVF 2;  2HEW F;  3LKJ A;  5DZG A;  4Z92 B;  5SV5 A;  1W8W A;  2R06 2;  1QJX 2;  2ZKL A;  3KF5 A;  1REF A;  3POJ A;  4RR3 B;  2A6V A;  1MS1 A;  4AHY A;  4XYX A;  2VCA A;  4KL1 A;  3NNG A;  3W59 A;  1BHG A;  1GFF 2;  4H14 A;  4I3G A;  4FAG A;  4O9E A;  5FZ3 A;  1WD4 A;  3FLR A;  1MQT C;  2GNB A;  2TBV A;  3B9C A;  4R8H A;  1JHJ A;  5C6C A;  3UNP A;  4P9X A;  4OHY A;  4MGY E;  5E16 A;  1GP4 A;  3P3N A;  4L92 A;  5A3P A;  2ZGL A;  4U2A A;  1APN A;  4YG6 A;  4ZU7 A;  1R09 3;  4XCA A;  4ZXK A;  1UZW A;  3U37 A;  1RUC 1;  3WNN A;  4BIO A;  4TLF A;  1VAK A;  2RDR A;  5F1R A;  1YC6 1;  2JX9 A;  1WW4 A;  2XUE A;  4CCK A;  2AYH A;  1O5L A;  3JCI A;  2WZR 2;  1HB3 A;  1FOD 2;  1GQH A;  4YZ5 A;  3RI9 A;  1NY7 1;  2NZ9 A;  3HIF A;  1VRH 2;  1E5S A;  4L11 A;  4CDU A;  3RZJ A;  1S0G A;  1ZYB A;  4LIU A;  5DUW A;  2IWG B;  1LOA A;  3WP4 A;  3BTA A;  4HL0 A;  3O1P A;  3J7H A;  1ZZ9 A;  2RJL A;  1W0P A;  1R64 A;  4Q8L A;  4XIK A;  4FPE A;  3ALQ A;  1SCR A;  4AI9 A;  3JB4 C;  3C2U A;  4BQ2 A;  4S2H A;  5ISL A;  5LWB A;  3MGU A;  1ALY A;  2ZX1 A;  3M3C A;  4KBB A;  3T30 A;  3T3Y A;  3BVC A;  4COW A;  3S57 A;  5A33 B;  3A7Q A;  1JW6 A;  1MS4 A;  3WP3 A;  4ZU5 A;  1OF4 A;  2DCT A;  1SPP A;  1YFU A;  2DVG A;  2JDN A;  2OXB A;  3I3B A;  2AEZ A;  1NQD A;  2VGD A;  3TYJ A;  4A6S A;  5D21 A;  2AAC A;  3MI8 A;  2E51 A;  4BXF A;  3WUC A;  1SEF A;  4W8J A;  4AFD A;  2Q5T A;  4N9H A;  5JPN B;  3SHR A;  2QQO A;  4XW3 A;  3ZO0 B;  1PNF A;  4GMP 3;  3J8F 1;  4EV0 A;  3KHB A;  1KQR A;  2E7A A;  3MHZ A;  4C91 A;  1XU2 A;  2FMY A;  4CU9 A;  4COU A;  3LFM A;  1AYM 1;  3B93 A;  3R05 A;  5DAP A;  1F4H A;  2BFU S;  5FP3 A;  4NIA A;  3KHC A;  1CAX B;  2RE9 A;  2C1F A;  2KD7 A;  5EFU A;  2CGP A;  3WQ1 A;  1VMJ A;  2GP5 A;  5GLZ A;  2F6B A;  1TZO A;  1K45 A;  5GJ6 A;  4IW3 A;  3PLQ A;  2ERF A;  4LO8 A;  4JDM A;  2HWE 3;  3ZLI A;  1MR5 A;  3LF7 A;  3QH7 A;  2K2S A;  3POS A;  4BCU A;  5EPA A;  2YFU A;  4UI9 L;  5GLV A;  1C8M 2;  1W6Q B;  4Y24 A;  3AC0 A;  4TN7 A;  4QDS A;  4CUB A;  4DPN A;  2ZTN A;  4YVS A;  1N3Q A;  1X8M A;  4P9W A;  1VBA 1;  3ZXD A;  2W2I A;  4AOC A;  2D97 A;  3CMG A;  4IV1 B;  1KXG A;  1W8F A;  3MIH A;  3T2Q A;  1AR6 2;  3BTX A;  2WZP P;  1IHM A;  5CVR A;  3CNA A;  1ASJ 1;  4LE4 A;  4OZO A;  1TEI A;  2DYC A;  2V72 A;  4I2O A;  3MV0 1;  3ZDV A;  4OI4 A;  3RQ0 A;  3ZSK A;  3VDC A;  5I93 A;  2XQX A;  3KV4 A;  1X50 A;  3KT7 A;  4R9D A;  3BCW A;  1LGC A;  1UYX A;  2J22 A;  2VR4 A;  3DKQ A;  5LBF A;  4OZX A;  2Y33 A;  3VBF A;  4OYU A;  4OFG A;  3NAP C;  4LK7 A;  4UT5 A;  4C8D A;  2D93 A;  3ZSL A;  4CDX A;  2JKB A;  3CJI A;  4QHB A;  1G9B A;  1B35 B;  3MID A;  1AR7 2;  1G9C A;  4W4Z A;  4QPI B;  4WVM B;  4CCM A;  2MPF A;  1ZRI A;  3VHO A;  2V73 A;  3MEP A;  5FPV A;  4ASK A;  1RUD 3;  4BXS V;  5C3R A;  1VBC 2;  3K46 A;  4XJW A;  1OFN A;  4FPH A;  1W6M A;  5J37 A;  4DMI A;  3AZX A;  3BI3 A;  1NZI A;  5FUP A;  1EAH 2;  2YPD A;  3NKT A;  3THC A;  4FCA A;  4N9I A;  1ZZB A;  3RI8 A;  4MGZ E;  2WNU B;  3BN6 A;  4UFH A;  4JRA A;  1BZW A;  2KR2 A;  4RQP B;  4D0Q A;  2BVB A;  5KXC A;  2QCS B;  2R16 A;  1GOF A;  4YZ2 A;  5CG9 A;  5K0U B;  1AR8 2;  1CGP A;  4Q4V 3;  4JHZ A;  2D3P A;  4AL9 A;  5JXJ A;  1IG0 A;  3J4U H;  3KD4 A;  1OQ1 A;  3VBU A;  1GU3 A;  2P4E A;  5B2G B;  4UFK A;  4DRR A;  3ETQ A;  3OSD A;  2VQT A;  4XFA A;  3TEY A;  1K5J A;  3VZL A;  3DPR C;  1HRV 3;  4NMI A;  2R7E B;  1LJ7 A;  1XNK A;  5D8A C;  4NAM A;  3VV1 A;  4WV8 A;  5L7O A;  4J1W A;  1JOD A;  5FFO C;  3WZ1 A;  4LBQ B;  4XJU A;  3ZKY A;  4FOV A;  3ZPO A;  4CP2 A;  1RUH 3;  5C9A C;  3E5U A;  5B4X A;  2RG4 A;  2Q30 A;  3OBA A;  2IXL A;  3L9J T;  1Z7S 3;  2DUO A;  5J7M A;  3ZYI B;  2FCU A;  2J1U A;  4A7Y A;  5JZG B;  1EPW A;  3PUI A;  1AXY A;  2VVF A;  2VY0 A;  3HMY A;  2YFZ A;  2VZR A;  4XXP A;  3JB8 A;  4FFF A;  3WIN E;  5DPN A;  4P9J A;  4NVP A;  4CUC A;  4ZKT B;  4NHL A;  5IVE A;  4LE3 A;  1FMD 3;  2WBK A;  1CD3 G;  2W08 A;  4RGA A;  4I02 A;  3WDY A;  3BGA A;  1J59 A;  4Q4V 1;  3I3D A;  4JC1 A;  1ZBA 1;  4PI2 A;  3ZSJ A;  3I54 A;  1Q5O A;  1AYN 2;  4LBM A;  3AXE A;  1YQ5 A;  4HXC A;  4AI0 A;  1UKG A;  3DYM A;  1GNY A;  2ARE A;  1HRV 1;  5DDJ 3;  2ZAB A;  5KXD A;  4DOU A;  1RIR A;  2VUD A;  2F4L A;  1RUJ 2;  1HW5 A;  3AFK A;  2VEC A;  4FI9 A;  4XUN A;  2VUC A;  1GWL A;  1GZW B;  1LOG A;  2ET1 A;  4MXW A;  3EBR A;  1XU1 A;  4JKL A;  1Z7S 1;  4WZF A;  1DG6 A;  3ZM8 A;  4N43 C;  2P3J A;  1O6U A;  1ONA A;  5FZA A;  4QM9 A;  5BNO A;  1AJK A;  3LSE A;  4H2A A;  3VGI A;  5T52 A;  4JX0 A;  4WBB A;  1VAM A;  5FLI A;  3VKM A;  4H55 A;  2GC3 A;  3NMB A;  5FZD A;  1R1A 3;  2HWF 3;  5TSW A;  3OPW A;  2QQP A;  2J1S A;  1N1V A;  3PMS A;  1AXZ A;  1UQX A;  4CRQ A;  1OOP C;  1RUE 2;  1Z78 A;  3WOG A;  1V6K A;  1XYO A;  3NJV A;  1YFY A;  3LAG A;  4OI0 A;  3I2G A;  4XQ4 A;  1NE6 A;  2BGC A;  3PVO A;  4CEY C;  2OUH A;  3VL8 A;  1QJZ A;  1YQC A;  5T54 A;  3N7J A;  3ZFE C;  1ND2 C;  5FLH A;  1LB2 A;  4FSJ A;  2VNR A;  2HWB 3;  3RDI A;  2P1B A;  2VZU A;  4RD7 A;  3UGH A;  4CXX A;  4CU6 A;  3MFA A;  1W3X A;  1WMF A;  3LPG A;  3POY A;  1LOD A;  1RVF 3;  2EXK A;  2XH6 A;  1YEW A;  1YI7 A;  2EVX A;  4KWJ A;  1VE0 A;  5FZE A;  2PHL A;  2R06 3;  1QJX 3;  2P6C A;  2R07 1;  1F35 A;  1RUG 2;  2PQQ A;  5C7G A;  2YBS A;  4EWA A;  5I0D A;  1ZZ6 A;  3ATG A;  3M8L A;  3TN9 2;  3N9Q A;  3U14 A;  1YI9 A;  4FOW A;  1NCQ B;  3F2Z A;  4PLN A;  4FP2 A;  3UGF A;  2ZHK A;  1VJ2 A;  2WFP A;  4BK5 A;  1KIT A;  2HWF 1;  1UOG A;  3K77 A;  4OMD A;  1X36 A;  2JE9 A;  3VBH C;  3W21 A;  3OUI A;  4CDW C;  3VBR C;  5LBB A;  4CUA A;  2C26 A;  1NYW A;  1MPX A;  1N47 A;  2WZR 3;  3VDB A;  1FOD 3;  4A6O A;  2Y64 A;  3O0X A;  1H4H A;  1HB4 A;  1OVS A;  1VRH 3;  3DL3 A;  4YW7 A;  1UY4 A;  2HH9 A;  5EYY A;  2VMG A;  2WS9 1;  3PJY A;  1MVE A;  4IE5 A;  1QMJ A;  2DCK A;  4M3C E;  5DG2 A;  2VMD A;  5A1A A;  2R0H A;  4HET A;  4IEP A;  4GJY A;  3EO6 A;  5FZI A;  1RVF 1;  2GME A;  2JE8 A;  5FJH A;  2I2S A;  1A3K A;  4D7T A;  2R06 1;  3WW3 A;  1OA3 A;  1LRH A;  2RDN A;  3O14 A;  3WVJ A;  1I9R A;  5FO9 B;  1US3 A;  2ILM A;  4GB3 2;  3JBG 1;  4QU2 A;  5JZG A;  1MQT A;  3M1H A;  3MIG A;  3UES A;  1PM7 A;  1DQ1 A;  2X29 A;  1QJU 2;  3VDD C;  4DB5 A;  3AL5 A;  3AZZ A;  4FT8 A;  2DVD A;  2ARA A;  1SLC A;  4XAA A;  4FVV A;  2AH2 A;  3IIA A;  3LWC A;  5L9R A;  4BK4 A;  2Q8O A;  4A4A A;  2QFE A;  1D0H A;  3FE5 A;  1CON A;  4M3C A;  1TE1 B;  4B4Q A;  5EJ3 A;  4Y26 A;  2OPW A;  1DF0 A;  1I6X A;  1QQP 2;  3AYA A;  3H7J A;  1K5M C;  5FYH A;  1LU1 A;  2WZR 1;  1FOD 1;  2ZGK A;  4OUS A;  3WW2 A;  5C8C B;  3H9A A;  3AMH A;  4HN1 A;  1KEX A;  5I8Y A;  1PK6 B;  3ZSE A;  5CKN A;  4TYS A;  3AZV A;  1CAV A;  3AKS A;  3V0B A;  1EV1 3;  1XSQ A;  2A70 A;  2WO2 A;  1W99 A;  4HG6 B;  4Q0U A;  4A3Z A;  1HJF A;  3CEW A;  4XAB A;  5LAS A;  3DGT A;  4GKX A;  1WLC A;  2DVF A;  3ZFF A;  2W46 A;  5F5I A;  4M4P A;  3I49 A;  2VNV A;  1A6C A;  1D4M 3;  1NA1 B;  1UOJ A;  2ZX2 A;  3UKT A;  5JOY A;  3BAL A;  2WIN B;  3QH6 A;  1C8M 3;  3WF2 A;  4ZU4 A;  2YXS A;  1VB2 A;  2EF6 A;  2XOM A;  3LB9 A;  1OLM A;  2RM2 2;  2XQR A;  2Y6H A;  2WT2 A;  1VRB A;  2DFB A;  3LOI A;  1H8T B;  1JYT A;  3VDA A;  3AP5 A;  1OH4 A;  2W95 A;  4OHZ A;  5A3N A;  4F7Z A;  3PVB B;  4ZPI A;  4JGZ C;  2BTV C;  2A6Y A;  4E2Q A;  2WQ8 A;  2ZAC A;  3GCX A;  2VW0 A;  1ULF A;  3N7M A;  4JKM A;  5F5Q A;  4W65 A;  5FOB B;  3HBK A;  2XJP A;  4JTO A;  5J1X A;  4B29 A;  5EWS A;  2XWB B;  1DGW A;  1V6N A;  3GGL A;  5I8S A;  3ZXE A;  4N53 B;  4XBN A;  3DXU A;  4YFW A;  1EYB A;  3IAQ A;  3WNO A;  3HVD A;  3TEZ A;  4AED B;  1G7Y A;  4UW6 A;  3OF1 A;  3C3V A;  4M00 A;  3RYR A;  1Q3E A;  3GBG A;  1W2U A;  1HX6 A;  2RR1 2;  1KFU L;  1DQ2 A;  1PO1 1;  4CDU C;  4IET A;  3RYK A;  4XAC A;  1AR7 3;  1OUX A;  2A6Z A;  1PGL 2;  1J3Q A;  4HK9 A;  4Q29 A;  3V0A A;  1GOH A;  1D2Q A;  2OUJ A;  1UZY A;  3NNJ A;  5FPX A;  4HVQ A;  3PDQ A;  2RS3 2;  4IEV A;  2B7Y A;  4Q4X 2;  1D2S A;  1VBC 3;  4JAA A;  1C8M 1;  5T5J A;  4QX5 A;  5FYZ A;  1JUH A;  3D6E A;  3EYP A;  4Y5S A;  2CYF A;  3HNB M;  5GLT A;  4CVU A;  1ZRC A;  2QQW A;  1EAH 3;  4QQ2 A;  1FXZ A;  3K3N A;  3W5M A;  3AP4 A;  2LW8 A;  3C7F A;  5FY0 A;  4F3J A;  3NQH A;  2BWC A;  1DP0 A;  3T0B A;  1AR6 1;  2RV9 A;  2X8K A;  1CVN A;  4E4Z A;  2Z4F A;  1AR8 3;  3H3Z A;  1BBT 3;  2OT7 A;  1PMI A;  4UFJ A;  5JI7 A;  3T2O A;  1GP5 A;  1TVG A;  4RGG A;  1UOF A;  3AM2 A;  5GLU A;  1H4G A;  3AZY A;  3EJK A;  3GF6 A;  3IDE A;  5F2S A;  1J58 A;  3VBS B;  5FYM A;  1H0B A;  2YV8 A;  2J7M A;  3IM0 A;  1DU3 D;  4LKS A;  5FWE A;  3O1R A;  1W2N A;  1F5J A;  4FXK B;  1DZT A;  3RZK A;  4KNC A;  4Q0V A;  1W6O B;  2GZW A;  2R0F A;  1TME 2;  4QPY A;  3OBR A;  5DZE A;  3MFC A;  1SHW B;  1I1E A;  4AI2 A;  3WDU A;  4K6B A;  1NLR A;  4AVA A;  4AR2 A;  1GIC A;  1W90 A;  1CAU B;  3PUQ A;  3BOD A;  2BOI A;  3M3E A;  4BQY A;  1YIF A;  1U5X A;  5F5A A;  1VBE 1;  3UK9 A;  4YVS C;  1GV9 A;  1FPN 2;  5FYB A;  3WY6 A;  4BM8 A;  4JTN A;  2CV6 A;  2JDY A;  4V2W A;  3ES4 A;  1J3P A;  2WA4 A;  4AEM A;  4AZZ A;  1JTZ X;  1AR8 1;  1LED A;  3GZA A;  2BPA 2;  4Q26 A;  5F2W A;  5CNA A;  4JRL A;  3OTF A;  4O7X A;  2ZCW A;  2XDV A;  3DPR A;  5IAT A;  3I7D A;  1NQJ A;  3AMP A;  2VAU A;  2X09 A;  3HNM A;  4MH0 E;  4B4R A;  1LES A;  1CES A;  4YM3 A;  1T6G C;  1QNY A;  1RUJ 3;  5C9A A;  4CDX C;  5JVV A;  3SH3 A;  4Y1Y A;  1QWR A;  1QXR A;  3UYJ A;  3N7K A;  4NID A;  4JKK A;  2Q8C A;  5FZC A;  4A7Z A;  1Q8P A;  4OHW A;  1F4A A;  2DBN A;  4D7S A;  3MIC A;  4Z8B A;  1FNY A;  1UMH A;  2VMC A;  2FCT A;  4RGK A;  2ZEY A;  3FMG A;  2NP0 A;  3VLB B;  4KH9 A;  2LM3 A;  2BUK A;  1I5Z A;  4UF0 A;  4GZ9 A;  2FDJ A;  2TUN A;  3OD0 A;  4H7L A;  1RUE 3;  3UT0 A;  2PHR A;  1JYW A;  4A44 A;  4M0H A;  4ZS3 A;  2ET7 A;  3R4D B;  1AYN 1;  3VBF B;  3VBU C;  1DBN A;  2WAO A;  4AAX A;  1PIV 1;  1FV3 A;  4CDX B;  3AJY A;  5DAX A;  1K3I A;  3CJI B;  4HVR A;  3BU7 A;  1Y9Q A;  3RS6 A;  4YVW B;  4Q2F A;  1LHN A;  1Y9G A;  1UN1 A;  3A4U A;  2VXR A;  1IKP A;  3WF0 A;  3OEB A;  4LK6 A;  3OY8 A;  3POF A;  3NV4 A;  4N43 A;  5A1F A;  5L7O C;  3KF3 A;  1RUG 3;  1UX7 A;  4UFM A;  1W6N A;  3TN9 3;  5FYY A;  1M06 G;  2E7Q A;  4ERO A;  4QWN A;  2QZ3 A;  3Q8F A;  5IT6 A;  1WBF A;  4XJZ A;  1EP0 A;  2JKX A;  2QBX A;  2WFF 1;  5FZO B;  5JXI A;  1TNR A;  2CTV A;  3MW3 A;  1GP6 A;  4FFI A;  1GZC A;  2EXI A;  3NW4 A;  3MIF A;  4NE9 A;  4PF1 A;  3RNS A;  3FBM A;  4Z2W A;  4LHL A;  5FCC A;  4UFL A;  2E9Q A;  1RUE 1;  2YG0 A;  4Z82 A;  4ISR A;  4UW4 A;  3WDV A;  1LTE A;  4D69 A;  3CL1 A;  2PYT A;  2A73 B;  1ND2 A;  1UW8 A;  1SDD B;  4FFH A;  4S2G A;  3ZFE A;  3PL0 A;  3M3O A;  4EN0 A;  2Z69 A;  1R1Z A;  3PVN A;  1F15 A;  2F4P A;  1HXS 3;  2RVA A;  2XJU A;  4LUM A;  2ARC A;  3ZN4 A;  5A6Z A;  4I0W B;  1OI6 A;  4PT6 A;  1DGR N;  4R9C A;  1UMI A;  5HBA A;  1OA2 A;  5LK5 A;  2AR6 A;  1H6X A;  2NMN A;  4OVE A;  4FPC A;  3D5O A;  2VW2 A;  3LEG A;  1RUG 1;  2C24 A;  1ND3 B;  3ECQ A;  4GB3 3;  4PIX A;  4I0B A;  4AFM A;  2ZJC A;  3BKZ A;  3TN9 1;  3MIE A;  1DGW X;  1HB1 A;  2IFR A;  4IEU A;  1QJU 3;  2OZ6 A;  4CP1 A;  3VBH A;  5A7O A;  3M2M A;  5BNO C;  4XET A;  1OPO A;  3GAL A;  1D7P M;  1LHV A;  2HWD 3;  1RXF A;  3H50 A;  2DCZ A;  2VCB A;  4CP0 A;  1G86 A;  5H9S A;  5LBC A;  4AVV A;  4LBJ A;  4O61 A;  2GNM A;  5C3Q A;  1JUI A;  1UAI A;  4AW7 A;  1W8Z A;  1QQP 3;  3S5A A;  2V4V A;  1STM A;  1F31 A;  1HDK A;  2ZGS A;  2EIC A;  1RJ7 A;  2QJV A;  3HT2 A;  3O0V A;  3MUZ 1;  1NXM A;  1POV 3;  4MOA A;  3I2F A;  4QX7 A;  1GNZ A;  2VM9 A;  4OCT A;  5A6Q A;  2Z2S B;  3HPN A;  2E63 A;  4CCE A;  1UZV A;  1ZZ8 A;  2D3S A;  4NRQ A;  4MXW B;  3AMQ A;  1UZZ A;  5F3E A;  4CCJ A;  3GCW A;  1DGR A;  3IWZ A;  4TXW A;  4BQ1 A;  3UET A;  4YZ1 A;  4BMB A;  5G05 L;  1PMH X;  1COV 2;  2VQU A;  3E5X A;  4O9G A;  3E97 A;  4WM8 B;  5C71 A;  4Q8K A;  1CJD A;  2E31 A;  3B3Q E;  3WX5 A;  4LBL A;  2A71 A;  2AZ5 A;  1ENS A;  4RS5 C;  4YW5 A;  3EB7 A;  4IGO A;  5JIA A;  5CFD B;  4IV3 A;  5IWF A;  4RN5 A;  1Q8Q A;  2VME A;  2WWU A;  3KCX A;  1D4V B;  1SZB A;  3GJB A;  4XF4 A;  5A7Q A;  2F17 A;  2VTF A;  1O4Y A;  2RS1 2;  1W9T A;  1QQP 1;  2ZZQ A;  3EMR A;  4WVV A;  3MW4 A;  1Y3T A;  3S5Q A;  3SCF A;  4XTP A;  4CEW C;  1S2K A;  2RR1 3;  2D43 A;  4LNV A;  5BV6 A;  1W2O A;  1XYP A;  2EIG A;  1EUT A;  3ZR5 A;  2GMM A;  2A7A A;  2RS3 3;  4NPR A;  5FYS A;  4HFS A;  4Q4X 3;  2J1R A;  1E5H A;  4BQ4 A;  4MHU A;  1W8O A;  4EQV A;  5GM0 A;  3T0D A;  4Q4Y 2;  1M4W A;  4CU8 A;  2RM2 1;  2VJX A;  2HBT A;  3AKQ A;  1W05 A;  3GBW A;  3PME A;  4JGY B;  4MVT A;  1DLC A;  3ABZ A;  1PVC 3;  2G19 A;  2VUJ A;  4JGZ A;  5A3M A;  1H9P A;  5J96 B;  4LKF A;  3ZR6 A;  5JZG C;  2SBA A;  1GLH A;  4OUL A;  1HQL A;  2J1E A;  2HKX A;  3T09 A;  5BYN A;  5KR7 A;  4OI2 A;  4L99 A;  5IK4 A;  5JMC A;  1UL9 A;  4IQP A;  5FZ8 A;  4M0N A;  2N7G A;  4Q1P A;  4V2V A;  2BRT A;  1C8N A;  3WNP A;  5A6X A;  3D0S A;  4XJ9 A;  4KMQ A;  4AVC A;  4EN9 B;  2Y38 A;  3HAG A;  1H2L A;  2ZGQ A;  2CY6 A;  3SMH A;  2RR1 1;  4DEQ A;  1JH5 A;  1TME 3;  1PGL 1;  1WCU A;  1CN1 A;  5ACA 2;  1AL2 2;  4LOR A;  5HI0 A;  1FYU A;  2B46 X;  1H2K A;  2RS3 1;  4GAL A;  5GAL A;  3ZFF C;  2OW4 A;  4EN8 B;  3FC0 A;  2VTX A;  3BB6 A;  3TRS B;  3LFI A;  5DMY A;  2X5I A;  1MQT B;  3WF3 A;  2OA2 A;  2V4A A;  1HV0 A;  4A42 A;  4BIS A;  4B7K A;  5KHK A;  4NII A;  3PU8 A;  3RZL A;  1A8M A;  3POW A;  4NN0 A;  3VZK A;  4K1Z A;  1LEC A;  1SFP A;  1JS9 A;  2WLQ A;  3OYW A;  1FPN 3;  5GLW A;  3S6P A;  2QUO A;  3ZXJ A;  1JU3 A;  1CJP A;  1ZM1 A;  4KBZ A;  5M0T A;  4LHS A;  1POQ A;  1JYN A;  5K8S A;  1R09 1;  1FNZ A;  4K3U A;  1Q56 A;  3GDB A;  5LRR A;  5LEJ A;  2BVV A;  4LLF A;  2K46 A;  4YPJ A;  5FZM A;  1AJO A;  4OMC A;  5D1I A;  2TNF A;  4AGR A;  2NYY A;  1CAV B;  5FPU A;  2R04 3;  1XSR A;  3V0B B;  1WME A;  3PIJ A;  4BE3 A;  5FMO S;  1OC1 A;  3N3H A;  4A3X A;  5FYI A;  1EV1 2;  1UYY A;  4PHZ A;  3HN3 A;  2J1V A;  4KI5 M;  2YDE A;  2FHR A;  4Y4Y A;  5A7S A;  4A45 A;  4EWE A;  5HXM A;  2EA7 A;  1RB8 G;  2HYK A;  4MUV A;  2JEN A;  4ZON A;  1D4M 2;  2WWS A;  3WEZ A;  5J48 A;  3TBD A;  2JB8 A;  2ZGP A;  4LO7 A;  4K8R B;  4QAW A;  1XPW A;  1GSL A;  3AKP A;  2A3X A;  3RWK X;  4KGQ A;  3VZN A;  1OVP A;  4XF3 A;  4QKF A;  5IFP A;  1W04 A;  4L97 A;  3ZKU A;  5G04 L;  2WQ4 A;  1V00 A;  5E1R A;  5BNN C;  1QOO A;  1JBC A;  1PO2 2;  2BBA A;  5IK5 A;  4XZP A;  4GMP 1;  2RJ2 A;  2TEP A;  3WNX A;  4FPG A;  3UKV A;  5K7P A;  3FHA A;  2D6P A;  1L7L A;  3ZYH A;  3M4F A;  3ZXK A;  1DFQ A;  4XFH A;  1S2B A;  4CCD A;  2X05 A;  2YYO A;  4QU1 A;  3OGG A;  4L2N A;  4GKY A;  3GJA A;  4Y5T A;  2WL1 A;  2YB7 A;  1W28 A;  2ZMK A;  1C1L A;  5L9V A;  2GSY A;  3HOB A;  2VE1 A;  2DDU A;  2HWE 1;  4AXO A;  2AEN A;  2WQZ C;  3V65 A;  2ZMN A;  3WR0 A;  1W6P A;  2K0G A;  2A1X A;  3HWJ A;  5A7W A;  1YHF A;  4Y1Z A;  3M7A A;  4QHZ A;  3E6D A;  1OHF A;  2QKD A;  3VKN A;  5AFB A;  5F9T A;  3H8O A;  1YO8 A;  2I74 A;  5HV0 A; 
#chains in the Genus database with same CATH homology
 3PL0 A;  4NAO A;  2RDN A;  5IAV A;  2RDQ A;  4XC9 A;  4NHL A;  4NHK A;  4NHX A;  4XAA A;  5L9R A;  5ERL A;  3NNL A;  5DAP A;  4BQY A;  5C5U A;  5DAW A;  5EP9 A;  2HBU A;  2OPW A;  2V4A A;  4IW3 A;  5LBC A;  4MHR A;  5EPA A;  4KBZ A;  5M0T A;  5IAT A;  4XAB A;  5LAS A;  3ITQ A;  3NNF A;  5LBE A;  4UWD A;  3OBZ A;  4JZR A;  4NHY A;  3NNM A;  5C5T A;  3KT7 A;  4ZPI A;  3DKQ A;  3KT4 A;  5LBF A;  2Y33 A;  2FCT A;  5LB6 A;  2Y34 A;  4ZON A;  5IAX A;  3OUJ A;  4XCB A;  5A3U A;  5HV4 A;  4J25 A;  4BQW A;  3GJB A;  3KT1 A;  4BQX A;  4XAC A;  5DAX A;  3W20 A;  3EMR A;  3HQU A;  3NNJ A;  5LAT A;  4XCA A;  2RDR A;  5EQU A;  3OUH A;  4Y5S A;  5DAQ A;  2RDS A;  2G1M A;  3W21 A;  3OUI A;  3GJA A;  4Y5T A;  4MHU A;  5LBB A;  2JIG A;  5L9V A;  4NMI A;  2HBT A;  5LA9 A;  5DAV A;  3GZE A;  2G19 A;  4NHM A;  4Q5O A;  3HQR A;  3MGU A;  3BVC A;  2A1X A;  2FCV A;  5L9B A;  2RG4 A;  2JIJ A;  2FCU A;  5HV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...