2B42B

Crystal structure of the triticum xylanse inhibitor-i in complex with bacillus subtilis xylanase
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
184
structure length
184
Chain Sequence
STDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDGDRTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQVMATEGYQSSGSSNVTVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor/hydrolase
molecule keywords xylanase inhibitor-I
publication title Identification of structural determinants for inhibition strength and specificity of wheat xylanase inhibitors TAXI-IA and TAXI-IIA.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 50
structure length 184
sequence length 184
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2005-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2b42B00
1XNCA 1QH6A 1XYOA 3AMQA 2VGDA 2NQYA 2VULA 2VG9A 1XYNA 2BWCA 1AXKA 1XYPA 4S2DA 3VZJA 1XNDA 2DCKA 3VHPA 1BCXA 3WP5A 1UKRA 1HV1A 2B45X 3WQ0A 2F6BA 4HKWA 3WP3A 2VUJA 3LB9A 3B7MA 1C5IA 2DCZA 1M4WA 1H8VA 3EXUA 3VZNA 1NLRA 1YNAA 5K7PA 2NLRA 3VZMA 1PVXA 3VL9A 3VGIA 4S2HA 2Z79A 3AKRA 3WX5A 1ENXA 3LGRA 5EJ3A 2B42B 2JEMA 3ZSEA 3MFCA 1BVVA 4HKLA 3VHOA 3VLBB 3WP6A 4H7MA 3AMMA 1REEA 3AMPA 3AKQA 3WQ7A 1REFA 1H1AA 2C1FA 1H4HA 3WY6A 1HIXA 3VZLA 3AMHA 1XNBA 3B5LB 4HK8A 3HD8B 4XQ4A 1H0BA 2DFCA 1H4GA 1XNKA 3VZOA 3MFAA 3RI8A 2BWAA 1KS4A 3VL8A 4NPRA 3M4FA 3WXPA 1XXNA 1T6GC 3AKPA 2QZ3A 2BVVA 4HKOA 1OLRA 3AKSA 2BW8A 3WQ1A 1UU5A 1OA2A 3RI9A 5HXVA 1KS5A 1F5JA 3WT3A 1UU6A 1HV0A 3VHNA 2JENA 3O7OA 1TE1B 1OA4A 1REDA 4HK9A 2D97A 3MF9A 1BK1A 2DCYA 3MF6A 4S2FA 1OLQA 2JICA 2B46X 1W2UA 4XPVA 1OA3A 1QH7A 2QZ2A 5K9YA 1UU4A 3AKTA 3WR0A 4S2GA 1IGOA 4XQWA 3WP4A 4XQDA 2DCJA 3VZKA 2DFBA 3AMNA 2D98A 1C5HA 4IXLA
chains in the Genus database with same CATH superfamily
4MGYE 1XNCA 5F6LB 2WO3A 1RUC3 4D6SA 2YBPA 4UFKA 1SLBA 2WAOA 2YROA 2DVFA 4E4HA 3QOPA 2FZ2A 4XC9A 4UAPA 4AHZA 1Z0HA 5A6QA 4LO5B 3J7HA 3P5BA 2ZEXA 1DG6A 3POGA 3ACGA 3MGUA 2TNFA 4CEYA 4DRVA 2PMWB 1UKRA 2BRTA 1EPWA 4ARXA 5JMCA 1HXS1 1YFUA 1YQCA 2A73B 5LASA 4COVA 1AX1A 1A3KA 3E5QA 4JC1A 3M70A 4O9EA 5FK7A 2XJRA 4CDQA 3VBFA 1O8SA 1UXXX 4JKMA 2OUHA 2R061 1ZRRA 1BXHA 3MPPG 1ND2A 5EIYB 2OZ6A 4M01A 3WDXA 5D8AB 3IPVB 4IEZA 4XAEA 4OI1A 4YG0A 1WBLA 1HB2A 4OYUA 2Y0IA 4NIHA 2A3XA 2FQPA 1IZ3A 1GWMA 1QDOA 2UWAA 1SLTA 4IV3B 5DUVA 1S2KA 3LGRA 3IDEA 4CVUA 1S0JA 1QJY3 4QDRA 2EIEA 1OLME 2W1SA 3CJIA 3VDDA 1SZBA 3T09A 3J7MA 5CG8A 4AHXA 4DEVA 5JCTA 3AYCA 2BNNA 1OUXA 2WO7A 1PO11 2FCVA 5JIUA 2NMOA 2ZEWA 4CDXA 1WLCA 3LIGA 2ET1A 3WQ7A 1PIV1 4W6WA 5A3PA 3A7QA 1RUD2 4NE9A 4FSJA 1J58A 2P3KA 2E7AA 1G6NA 4OFGA 3VD7A 1DDLA 3AMHA 3E5XA 3AX4A 2XUMA 4ET7A 4XIOA 5FP8A 1MEC3 1I1EA 2VTXJ 5FO7B 2WQ8A 1TMF3 3DV8A 3PUHA 4RFRB 3ROUA 2FDFA 2J1VA 1IG0A 3RI8A 1W99A 1KS4A 4J1XA 2X05A 1YRZA 4XOGA 5LRRA 4DB5A 4DXRA 5DAPA 3DCQA 4QD2A 5IW0A 4NIDA 1XNAA 3WXPA 5LBBA 4ZS2A 1LAJA 4IEXA 5IAXA 2EF6A 5CFCB 3AKSA 2CU5A 2IFWA 3ENRA 5HCBA 2FDKA 2R30A 4FP2A 1RUC2 2DF7A 2O0OA 2R49A 1VAMA 3ACIA 3IIAA 3N7MA 4Q0PA 5K4LA 1VB4A 3ZN6A 4W50A 1UKGA 1DGLA 1GZTA 1ZZ9A 3U4XA 2HEWF 2VCBA 5EWSA 2E53A 1R083 3KCYA 4Y1YA 4H14A 2FMDA 4P9WA 5T5PA 4Y4YA 1I3HA 1RUD1 1DQ4A 1GZWB 2VC9A 4CEWA 2NYYA 3N35A 4ZKTB 3LEIA 1QJX3 3MI8A 4N9HA 4FFHA 1WKYA 1ZYBA 2ZTNA 1GNHA 1WMEA 5GLWA 1QJU1 2VOXA 3K3OA 2HKXA 4MHRA 4RHV3 2KR2A 4CXXA 1ZM1A 3WUDA 2Q30A 2EIGA 4PI2A 4DUWA 1FV3A 1QJY2 5HV0A 4B7EA 1UX7A 3ZYIB 3KVBA 4LBMA 4UFIA 3ZYJB 2YFZA 5LEJA 1PHMA 2R071 3FLTA 4RR3B 4BDVB 4LIUA 4YW7A 4CUGA 2E26A 5FV3A 5EZWA 5DPNA 1X9PA 2A1XA 4OLLA 5JZGB 1W6QB 1JHNA 1I9RA 3B7MA 4AEDC 1EUTA 1I6XA 4FO9A 5AVAA 1V6IA 3DF0A 3RQ0A 3VB9A 1W90A 1X7NA 4QXHA 1G9DA 3O1TA 1POQA 3P1IA 3N7LA 4NMIA 2D6LX 2D7FA 2QQUA 4IQPA 4D6RA 5A3NA 1L7QA 3H42B 5IATA 1RINA 3BODA 2GC1A 4KG8A 1LOAA 5ISLA 3WDUA 3UJQA 5I0TA 1UY1A 4YVSB 3ZIWA 4V1PA 1CQ9A 1DYKA 1W6PA 1TG7A 3ILNA 3N4MA 4CEYC 3ZSEA 2DVBA 4E8DA 2L9LA 2OT7A 5F5IA 5F3CA 2EXIA 5JAXA 5KXBA 5E1RA 4D69A 1TQ5A 2IUWA 5JOXA 2YBKA 1S0CA 1R082 4PT6A 4BIFA 4CDQC 1HJFA 1XOYA 4RFT0 2HYKA 4GMP0 4B4QA 1ND2C 3TBDA 3VBRB 4EV0A 1HQWA 2IXCA 2XJPA 4QM9A 2JIGA 1DYPA 5KC6A 1A78A 5E6HA 3ZXAC 2BYVE 1J3PA 3LAGA 4RGGA 4META 1MEC1 3H1WA 2KA3A 3LCPA 5IUQA 1TMF1 1O7FA 4L92A 2IXIA 2JDKA 4AVVA 4Y33A 2YGLA 3POFA 5A3LA 1T6GC 3CJIC 4XFGA 3VDDC 2OPWA 2B8MA 1RC6A 1GP4A 3QD6A 5EXOA 5A7OA 5FLJA 5BNPA 2AYHA 4CCDA 2ERFA 4PBOA 4D7TA 5HXVA 3J26N 4J6GA 4CDXC 1KXGA 1Q3EA 4M00A 5AFBA 3VHNA 3O7OA 2FDHA 3ETQA 3H50A 4QT6A 1FV2A 5T50A 2QUOA 4NOTA 4Q8KA 5CG9A 5C33A 2VD7A 1KJLA 3UGFA 3ETPA 4WM8A 5FJHA 3TEZA 3FL7A 4GULA 1R081 1UOGA 1JTZX 4QHOA 5L9RA 3B93A 4RA0A 4PBPA 2VMCA 4WV8A 2R6QA 2WZPP 4XETA 3JB4C 1TME2 1X33A 2D93A 2N7GA 1Y9MA 4ZU7A 2GH2A 3N7KA 2ZGQA 1N3PA 4IE0A 1QJX1 4FPOB 3RZZA 4GB33 1JZ8A 1VAKA 4QPWA 2DFBA 3FX3A 3NV1A 4NRMA 3UV9A 1CAWB 1PMJX 3AXEA 3KCXA 1W0NA 1NXMA 4RYDA 5I8SA 3HVDA 4RHV1 2AC1A 1XU2A 4AEJA 4TLGA 1GQPA 3BOPA 4D94A 3O12A 2WABA 5FP3A 2VMGA 2XB6C 1XYOA 2RJLA 4ZZ8A 4Q4V2 3WW3A 3B9IA 4MX3A 1BZWA 5FMBA 2BGCA 4YWAA 2KD7A 3WV6A 1G8WA 4GKXA 3BI3A 1KFUL 5FXXA 4BWOA 4Z07A 1NQDA 3POEA 4Y4RA 3UT0A 4IV1B 4ZZ5A 1QEXA 2DVGA 5T52A 4CEWC 1YIPA 2WWUA 5A3TA 1R64A 3KGZA 2OQ7A 3KGLA 4KBBA 4ASLA 5A32A 2XBO3 1VR3A 1UAIA 1ULGA 1YQ6A 2CDOA 2VNGA 1MS1A 5CKQA 4ZU5A 1UZVA 3WNOA 4D3WA 1SBEA 1C1FA 2NPIA 1M4WA 3MIFA 1KRIA 2BZDA 5FYTA 3ES4A 1PK6B 2WT1A 5FY8A 3K77A 1HN1A 2CNAA 1LU1A 2G9ZA 4G3YC 4LXLA 4MLOA 3ZDSA 1CZVA 5DXDA 2ARCA 3DL3A 4FOWA 3ZN5A 5JXHA 2LS6A 2HJIA 2XL9A 1BLZA 3ASIA 3N9MA 4CUCA 5C3OA 5FYUA 1AR83 5LY2A 2P37A 4R9AA 4LBKA 4V2VA 5JLVA 1ZZ7A 4Q0VA 2VW0A 4KL1A 2XXZA 4HKLA 4IEUA 3U78A 4DXSA 4TXWA 4Q4X3 1VRH3 2GN7A 1UD1A 5LATA 5ACA2 2WAAA 4RGKA 1GP6A 4JDOA 1SLAA 2JDUA 2UURA 3AMPA 4RS5A 3VBUA 3LA2A 4P9IA 2WNUA 3AL6A 3JD71 3T0DA 3K75B 5ABJA 1QDCA 3NNJA 2DTYA 3H3ZA 3IZOA 1D0HA 4XABA 2RDQA 1X82A 5F8PA 1I5ZA 1LGCA 4JGZA 2YC2A 2QFEA 3H0OA 2AEYA 4NN0A 5M0TA 4NHKA 3V56A 2C9AA 4A44A 2CY6A 5DUUA 1PO21 2BWAA 2G1MA 3L2HA 4DUXA 3WF4A 2Y6JA 4GB32 1HDKA 3INAA 3M4FA 4XYXA 3WNXA 1XXNA 5J48A 3NSTA 4AI3A 1AZDA 2QZ3A 2BVVA 2VH9A 2VUDA 5A1AA 1HRI2 2CV6A 1OLRA 2VW1A 3O0XA 2BW8A 3PL0A 4IDZA 1LKNA 3AP5A 1UN1A 1UY4A 3OPWA 4AAXA 1JYTA 4LE4A 3OGSA 3WF2A 1UF2C 2VOVA 2VNOA 5A33A 3LEMA 4SLIA 5LWBA 2GNTA 1FPN1 4GA9A 1QJZA 2DU0A 3USUA 4AEMA 5L9VA 1AX2A 2Q8EA 4AQTA 2BFUS 4XFAA 4MXVA 3JXSA 5C8CB 2RMU3 2YC0A 1VALA 2VCMA 2OZJA 3NQHA 2ZPXA 4XMIA 3MLKA 4TWTA 1PGW1 4COUA 3KVAA 2XBO2 3PUAA 4A45A 2WO2A 1NG0A 1UU4A 4W6YA 3JQWA 4YZ1A 1OSGA 5DAVA 2O8OA 2CTVA 3SMHA 3VBSB 4GD4A 1O3SA 2GALA 4L97A 1OQDA 4MUVA 1TEIA 1LGNA 5F2SA 5DDJ3 1UOJA 1PMHX 1LHWA 3B3QE 3NV4A 3EO6A 5BNPC 1NY72 2WT0A 1LULA 3RFRA 2QQIA 3NNFA 2R1DA 5J36A 2YDEA 1VBD2 1STMA 4CP9B 2DVAA 1HRV2 1AR82 1W9FA 2GMEA 3JCIA 2ENRA 3OD4A 5LK7B 2EAKA 2JB4A 3AK0A 3NJYA 3PU3A 3AZXA 4PLMA 1WLTA 4Z92B 3RWNA 2X8KA 4WM8C 3T30A 1YHFA 1SQ4A 4CU7A 3WEZA 1AYN3 5JVVA 3VBOB 3VKMA 2ZA9A 1VRH2 5GZEA 2DBIA 2PXJA 5JOZA 4FPCA 3GZAA 3SH3A 2QQPA 3NAPB 4P5HA 4QHBA 2AREA 4ASMB 2WN2A 2QBXA 2ZGOA 2BBVA 3I59A 4N7UA 3C7OA 1KEXA 3ZN4A 2ZGKA 2XBO1 3H3LA 4XE9A 3OPTA 2B9UA 4FOQA 1U5YA 4BLJA 4FFFA 1PGSA 2UY9A 1VAVA 2IXLA 4Y5TA 4L9BA 1LJ7A 2RR11 2GMPA 4RD7A 3I3EA 1VBB1 2NLRA 2PLV3 3BUCA 1JOPA 2VVFA 2ZKLA 3HT1A 4AI9A 3OY8A 3RZJA 4JHZA 2PAMA 1EAH1 3VDAA 3I2GA 2CAUA 1H2LA 5AVPA 2ZEYA 1GNYA 3RDIA 2PHDA 5BNOB 2FDGA 4CU8A 1JYWA 3PUIA 3O1UA 4ES8A 2QQWA 4Q4X1 1REEA 2JDMA 3EMRA 2RMU2 2WO1A 4CCKA 5C9AA 3BKZA 1JZ4A 3A0NA 4XIKA 3BTAA 3BN6A 2AACA 1KJRA 1FXZA 4QGLA 1HIXA 5FCCA 5CFDA 4WVWA 1X36A 2W94A 1XNKA 4XXPA 4P02B 4NHYA 1V6LA 5LK5A 4Z1VA 2A7AA 3NJVA 4O9GA 4I30A 5JI7A 2BUKA 5DDJ2 5DUXA 4CUAA 5D21A 3RJ2X 1A8MA 4GWIA 4EWDA 4XW3A 4JRAA 4BQYA 5K8SA 2VMIA 5KHHA 5JPMB 2FHRA 4MXWA 1W8HA 4MGZE 2UYAA 1NE4A 3ZYBA 4F7ZA 4FPLA 2B7YA 1BVP1 1XSQA 4HT1T 5IVFA 2XR4A 3TEYA 1COV3 1QOSA 1OPMA 4NVPA 1BMV1 3SLIA 1YJLA 1KGYA 2EAAA 1ZBE1 4FPJA 3PDQA 4CP0A 2Y38A 4RS5C 4MHUA 3VBUC 4C0BA 2JG9B 2WNUC 3LE0A 3Q8BA 2W1WA 1AYN2 2LTNA 3T4HB 4DINB 2D97A 5ABJC 3VD4A 1OT5A 4LBQB 3PTRB 1VB2A 4UI9L 3LSDA 1OOPB 2ZGUA 4GWMA 4JGZC 4UW5A 1U5IA 1ACCA 1MS3A 3EB7A 1UMZA 4AAPA 5KHGA 1OA3A 4AW7A 4I02A 2IVJA 1W06A 1O4YA 1SLLA 2GZWA 3HQUA 4IESA 4LBJA 4BPZA 3HIFA 1RUJ2 2XLFA 4QX3A 1UWWA 1W39A 2OUJA 1ULEA 2VZUA 4M3CB 3WNMA 1ODMA 2RS53 4INDA 5H9PA 4BQ5A 5DUWA 5CU1A 4XAAA 2JECA 1NA1B 5CZKA 2D3SA 1WMXA 3ZKUA 3ZR5A 4LT5A 3A0KA 5DDJ1 3WNPA 3V0AA 1QU0A 1YFWA 3USSA 3SCHA 5LCWL 4I2OA 2ZGTA 3POWA 3DXUA 3OOXA 5FZ6A 3OBZA 1LOEA 3LA3A 4OHYA 1W2NA 5C3RA 3B69A 3S57A 1Q8VA 2VAUA 4YW5A 1C3HA 2WSUA 4ITCA 4B4PA 1YJKA 3KV5A 5HXMA 2WWJA 4YW3A 1RUOA 3DECA 2W87A 1OQEA 3FUQA 2MPFA 3PVEA 4K6BA 3VV1A 1G9BA 5EV7A 4HN0A 1POV3 1AXYA 3RNSA 4YLZA 1H9WA 2QCSB 4UF0A 3KZ4C 2J22A 1C5IA 4XJWA 4IEQA 4JQRA 2A6ZA 2RJKA 1OLMA 2VQUA 1DLLA 1CONA 3J9SA 4Q0SA 4EN0A 4X8NA 1SFNA 4Y1ZA 3U07A 4FQ4A 2PN5A 5K7PA 2I2SA 5GLZA 4AR2A 2GDFA 2PLV1 5H9SA 3K3NA 5TSWA 2RDNA 3FFZA 4NIGA 3QBQA 4GIQA 1COV2 4YW1A 4XILA 2XJUA 1J1TA 1HXS3 4L99A 4QB1A 3ECQA 5C3QA 1QNYA 4E2GA 1VBA2 2OW4A 4HG6B 4XFIA 5GLVA 4Z82A 1AUYA 4YW2A 1OUSA 2R063 3ORJA 4RL7A 3Q8AA 2FBEA 4DY5A 2RE9A 1RUI1 3LEGA 2ORZA 5FZ9A 1XE7A 2P5BA 5BNNB 4CSWA 4AFBA 5FLIA 4C1WA 3OCPA 1ZRFA 2P34A 1HB3A 4YM3A 2D6KA 1ZZBA 4IGQA 2Y64A 4LBOA 2RS52 3SC7X 2ZGMA 1YI9A 3URFA 2VNRA 4FT8A 4LR4A 5F39A 5FFOC 4CDQB 2XPJA 4FCAA 4DXTA 1RUG1 1QQP2 5F3EA 3FBMA 2GU9A 3V0BB 1ND2B 4OI0A 1UO9A 1PO13 1PVC2 2PAEA 5DABA 2I45A 4YM1A 4LITA 4E4DX 1F5FA 3CLPA 1UU5A 4H3WA 4TSVA 1OA2A 1PIV3 4Q4W2 1KS5A 4R4XA 2R042 2E32A 1COV1 2WIIB 1YIFA 1GQGA 2JENA 5C9AC 1FX5A 4AVCA 1LOFA 1O3RA 5G04L 4OI4A 2XGXA 3E5UA 3MF6A 3CJIB 1GR3A 2VECA 3VDDB 5CFDC 1V00A 1JMUB 4N53C 2D40A 2E9QA 4N43A 3WW2A 2HWF3 4A7KA 4TTGA 4LHSA 2QNKA 3C7GA 4XF1A 1ZNPA 2XHNA 5FY7A 3R4SA 4PDWA 5IYYA 1JZ3A 4P00B 3IKWA 4AQ2A 3ME2A 4KWKA 1WLDA 4TYSA 3SCGA 3MYXA 1IQDC 3J8F3 1XJAA 5FQ0A 4YGCA 3BPSA 5FDBA 5HI0A 4XFCA 4QWNA 2XJQA 4LHNA 2D98A 3ACLA 2MHFA 2YPDA 1Q8SA 4XEZA 4A2UA 3ZXDA 2VW2A 5KWRA 4UXAA 4HANA 3E6CC 1OQ1A 1XYNA 4JAAA 1HXS2 5K0UB 3GBFA 2GSYA 1SPPA 2LW8A 4UW6A 1ZZ6A 1RUH1 3NV2A 5DAWA 1J3RA 1MPXA 2ZKNA 3PJYA 3WP5A 2R062 4WM7A 5FUNA 3JBG3 5JSPA 5GKAC 1GQHA 1T6BX 2Y6FA 4NPMA 4XTPA 1VIWB 1Z7S3 1RMU1 2OS2A 4HKWA 1SACA 4ZPIA 4YGBA 3ZYFA 5A7QA 4PI0A 2X5IB 4HXCA 4JZRA 2GP5A 1POV1 2BV4A 4XDOA 5HPOA 2B5HA 4O61A 4D0QA 2VMHA 2ZOEB 3RYPA 3DYMA 4P9GA 2PYTA 4JX0A 2VE1A 1BHGA 1PGL1 4K40A 4E4ZA 1CJDA 1UYYA 4FFIA 4AE2A 3TNPB 4B29A 1JZ7A 3W9AA 1PO12 2FCUA 3F2ZA 3ES1A 2R073 1GOHA 3ZLIA 5FZLA 1SBDA 4FTEA 1PIV2 2PQQA 1MS0A 1NT0A 4JTNA 3VLBB 2CAVA 1W9SA 5FYHA 4HLTA 3ZFFA 5FZ7A 1S4CA 4HSLA 3IDBB 4OULA 5C4WB 2QQMA 1E5SA 1DGRA 2Q1MA 2E33A 5DG1A 1UZYA 1C8NA 5A7PA 2NZ9A 2ZHLA 3H7YA 3LWCA 2VY0A 2ZXQA 5BY5A 4N90A 5A7SA 4B3NA 4EE2A 2C9KA 3HR9A 3O0WA 5EPAA 4JVAA 4UFLA 2DUOA 5CNAA 3B00A 4ISQA 1O3QA 2VUAA 1RUE3 5FZFA 4YZ5A 5FYMA 1HW5A 1O91A 2EXJA 3J8F2 1W6NA 4P08A 4C90A 5T54A 1QIQA 1LESA 5IK4A 3AZZA 3TOJA 1UYXA 1W3VA 3K2OA 2YBSA 3U14A 3WVJA 1NQJA 4Q29A 5F5AA 1CPMA 1IS5A 5CA6A 1W6OA 4AK3A 5JXIA 3RJRA 4ZU4A 3NWKA 4QXKA 1WBFA 1BK1A 4FP3A 1W6PB 4S2FA 4I09A 4FPYA 3KHCA 3FC0A 1JYNA 4QU2A 4JDMA 2H6CA 4P9LA 1QJU2 3UKVA 4QXCA 4BM8A 1CX1A 3S5AA 2HWF1 4P9JA 4Y20A 3DPRB 4CXYA 4Y1UA 2DV9A 4Z8BA 5A6ZA 1LOCA 3BGAA 4LO6B 1ENRA 3ZPYA 5L7OA 3OEAA 2OYZA 2YXSA 2GNBA 4LO4B 1DP0A 4MYEA 4SBVA 4BISA 4E27A 4QPGA 3POJA 3J8F1 2RS13 4PQ9A 3I2KA 5DN2A 4PLNA 3LA7A 5FP4A 4FPEA 5C3PA 4R8HA 2R072 4GH4A 1LOFC 4RQPA 4LOTA 5FAXA 2LROA 5HBAA 1UYZA 1JYIA 1Z78A 1IS6A 4Y5SA 4CPBD 4WVVA 5EYYA 4XUNA 4MGKE 3DYPA 4XFBA 3O0VA 5F6KA 4EN6B 3KWVA 1W2OA 3ZSKA 2E31A 2W91A 3ZFEB 1S0GA 4PDWC 1QY4A 3JBG1 3NMBA 4UBHA 4LUKA 3WCSA 5HCHA 3UYJA 4GJZA 1Z7S1 1YXWA 1OKOA 4Y1VA 4ZXEA 3VDCA 5KHIA 1RITA 4Z2AA 4KWUA 2XQXA 3ILFA 3ZIXA 3RZGA 3VZNA 4EN7B 3QCWA 2Y0OA 2W5FA 4ZY9A 1JU4A 4K7JA 4AOCA 3SNMA 3WOGA 4NUBA 2HYXA 3OB8A 1CAVA 1UCXA 1V6JA 4YM2A 1GOFA 1H1MA 2BDRA 3AKRA 4FFGA 4HFSA 3AZWA 5EP9A 3EHKA 1AR62 1KD7A 1EPZA 2KM2A 4WM7C 1JYVA 3X29B 2Q5TA 2ZX4A 2J1UA 3KV6A 2DUPA 4Q0UA 3T4VA 1EUUA 1N1YA 3CEWA 4LBQD 5FMOS 4FOVA 4KGGA 1WLWA 3ZFGA 3ZOIA 5J7MA 1MZEA 3ZM8A 1J59A 4XBNA 2RVAA 3KM5A 5A3OA 1JHJA 1O6UA 3OGGA 4QPIB 1MEC2 2ZHKA 3N9OA 3N3HA 1TMF2 3BU7A 4IGPA 2MEV1 1RVF3 4W4ZA 3I2IA 1UQXA 2WA4A 4AVAA 5BYNA 2IXJA 2ZBJA 1PX3A 1WCSA 2XMLA 4R9DA 4CUBA 2TEPA 4MVTA 2WLQA 2D5HA 5FUPA 1GWLA 2WWSA 5D8AA 5FZ8A 2OQ6A 1J1LA 4AXOA 2GH8A 3H8OA 4QX0A 3VL8A 2VPVA 3SISA 3CO2A 1RUE1 2WNVB 1AL0G 3T2QA 3ZSLA 4P9XA 5A6YA 4IV3A 5FPLA 3MPBA 1M06G 1S55A 2RM21 2VL4A 4DQAA 1OD3A 3VUOA 4YRDA 3ZFFC 3RI9A 3JD73 3M3CA 3FHAA 4M4RA 5HV4A 1Q43A 1ZZCA 3VBFC 2R0FA 4KU8A 4MZUA 1VMJA 2JD4A 3NJZA 1PNGA 2OXBA 2ZX2A 4UWDA 3O1SA 2B39A 1LHNA 5FKBA 3ZXKA 5A3WA 3T2PA 2FDIA 2VZPA 4YG3A 1PO23 2BOIA 1JODA 1Q8QA 1DGWA 3OD0A 3THTA 4AFDA 3H8RA 1OVPA 1QJX2 1GZ9A 3WUCA 1D4M3 1GLHA 5I0DA 5JMOA 4LA3A 2XWBB 4PIZA 3M2MA 4S2GA 4RS5B 2B4KA 4RHV2 5ABJB 5JDBA 1UL9A 2DCJA 2K2SA 3BYWA 1RXFA 4XDQA 4YGEA 1N47A 4QHZA 4J25A 5LA9A 4GJYA 3U4SA 3IMMA 1AXZA 3KS7A 1FPN3 2DU1A 4YYOA 2V09A 2D6NA 3TYJA 3W20A 2HEVF 3I54A 5C71A 2K46A 3C3VA 3K4ZA 4YW6A 2R0HA 4KQ7A 1OXCA 2XG3A 3ZYGA 2RS11 2BP6A 1S0IA 1AR93 1GMMA 2E63A 2VGDA 4MO3M 4F3JA 2VULA 2VG9A 3S6PA 2ID4A 1NLQA 5FYZA 1GUIA 2ARAA 3H8XA 2GN3A 2W0XA 5C5UA 1XNDA 1H6XA 1NLSA 1CAUB 3R6SA 3OBRA 4LO8A 5JPNB 4MV2A 1CJPA 3BTXA 1LR5A 3N9NA 4CDUB 3RZMA 4NHMA 5FREA 1X8MA 5A7WB 5GLUA 5C5TA 5L7OC 1SCRA 3KCCA 1GZWA 1UZWA 5FMCA 4CP1A 3N9QA 3O14A 4FXKB 5FY0A 2ZX1A 2G19A 2QQOA 4U2AA 4DIQA 3O1OA 4QPGC 1ALYA 1D7PM 1U5XA 4HONA 4N9IA 5SV8A 3TWIA 4LLFA 4GH4C 2VMDA 1BYHA 4RQPC 4MGIE 3TAYA 3C2UA 2EA7A 1MQTB 2ZGLA 3J4UH 4XMAA 1W8TA 3POBA 4K1YA 1ENXA 1R1A3 1SLCA 2Q4SA 3AP4A 4KGQA 1A34A 3GZUC 3JD72 3CZUA 2JEMA 3CL1A 3J7NA 3FHQA 2JDYA 3KV9A 1B35A 1JH5A 3MUZ1 5F7UA 5B4XA 1AVBA 5LZ6A 1C28A 1LRHA 3AMMA 3BU0A 3GHNA 5IJRA 3BOWA 3VD9A 5DAQA 4IEYA 2D6OX 2QTWB 2VZVA 4W65A 1TNFA 3I3QA 2JKBA 1PO22 3GYDA 3SITA 3AL5A 5JZGA 2RR13 1W28A 1VBB3 2OA2A 1W6QA 2KXLA 3HPNA 1ULOA 4HPKB 1OF3A 1D4M2 2DFCA 3PVOA 3LOIA 1H4GA 1RVF1 1WCQA 4ZS3A 1DCSA 1EAH3 3RZHA 3Q8FA 4YVWA 4OHXA 1TNRA 4LBLA 4JGYA 5FZEA 4YPJA 1K12A 2W39A 2ZAHA 1FPN2 4FQZA 3WF0A 3ZPOA 2DBNA 1P8JA 4ASKA 4FOYA 1J84A 1JYCA 3NW4A 1ND3B 4K3UA 2Y6HA 4YVSA 3U0ZA 4XDPA 1QOOA 1PX4A 5FLHA 3OY8B 3ZFGC 1ULDA 2C0ZA 1EYBA 1PGW2 3HBKA 3I3DA 3BIEA 3GBWA 1JW6A 1OURA 4QX1A 2PHUA 3ALQA 4I3GA 3B94A 1RL3A 2B46X 1SFPA 5D8AC 2BNMA 3WNNA 2WFF3 3HBZA 1YO8A 3AKTA 3DXTA 1JOBA 4GMP1 4AVTA 2I74A 5JWPA 2Z4FA 5C9AB 1D4M1 4TZDA 2Q1ZB 4QQLA 1YYNA 4IV3C 3I49A 4BYYA 3LZZA 1ZBE3 3AYAA 4N53B 3RVHA 5KHKA 4XJ8A 2J7MA 4AQSA 4D6QA 2K9ZA 3UK9A 5A80A 3LD8A 4JHTA 4Q4Y3 5FYCA 2WC2A 4IXLA 3WG3A 4XBQA 3LPFA 3WLUA 5JUVA 3OBAA 3VD5A 5LA1A 2DURA 4CTEA 4W6XA 1W6MA 2PHXA 2VOWA 4NWVA 1AR91 1Y9QA 4MXWB 5EJZB 2ZACA 4OHZA 3UNPA 3I3MA 3EQEA 1UW8A 1LB2A 4LKSA 3VKNA 2X10A 3WHUA 1BCXA 2FCTA 1R093 2Z2SB 3KQRA 3NV3A 4LPLA 2RR12 1VBB2 1PMIA 1MR5A 4IEWA 3FBYA 2OIIA 2DCZA 4BMBA 1XC6A 2G9GA 1EAH2 3I7DA 2ORXA 1D2SA 1VMFA 1WW6A 2YGMA 3FFQA 5IVEA 2VBBA 5F3IA 2YG0A 3THDA 2CGPA 1CAWA 3VGIA 4S2HA 3A22A 4CDWB 5C7GA 3GCWA 3AYEA 3L2YA 3K48A 2ZMNA 3N9PA 3E1F1 4CCMA 4I01A 1WA6X 4Q4X2 4BXFA 4EJRA 2BOJA 5FZOA 5FPVA 1IKQA 2ZHMA 1R1A1 2A6XA 5FYYA 1BVVA 2VQ0A 3D0JA 3IB3A 3KHBA 2PA7A 3KT1A 2ZEZA 4EWAA 5JI9A 1MACA 1FAYA 2ZMLA 1REFA 3DGTA 1VRBA 2D6PA 3FLRA 2WZ8A 4IE7A 4Z2WA 2WFPA 2VR4A 4GAZA 1K5MA 3I2OA 2GC0A 3UESA 3K4DA 3WG4A 1NZIA 1JU3A 1CX4A 1FT9A 4V2WA 1S0EA 4YGDA 4L0PA 3M3OA 4CCOA 2ZHNA 3HEIA 2PHLA 4IUGA 1PK6A 4LMFA 1D2QA 2AZ5A 1U0AA 3F95A 2BQPA 2WR9A 4IGOA 3VHRA 5FRAA 2P3JA 4QAWA 4NPRA 1WMDA 4UF0B 1I5PA 1D4VB 4OZOA 1BMV2 1ZBE2 3FZ3A 2J1EA 4YG6A 1G9AA 1SLIA 1VBC3 2A70A 2ETEA 4OI2A 1U5ZA 1B35C 4Q4Y2 1TVGA 4QKNA 1ULPA 5LA2A 4IEOA 1WWYA 4NAOA 1RUI3 3GZTB 2P6HA 3OF1A 4PCRA 2WSVA 5ERLA 4ATFA 3WDYA 4ATEA 4CE8A 4XUQA 2XKOA 1REDA 1DZQA 2WT2A 3ON7A 4BH9A 5JZGC 2EXKA 1RGSA 2PHTA 3ZMOA 3IAPA 3ZXJA 1JS9A 3ATGA 1O5LA 1AR71 4X6RB 4QQOA 4HBNA 1F9KA 2V5DA 3R05A 3WD5A 1RXGA 4E9KA 4OHWA 1DQ2A 3OBTA 1LTEA 4YVWC 1IG3A 1N1SA 4AZZA 1QJFA 1RUG3 1US3A 5AC93 4JGYC 2D43A 1BKZA 4CCJA 2WFF1 1OD5A 3OYWB 2C24A 4LHLA 4FPHA 4FPKA 4IERA 4AF9A 1LENA 5KXDA 1RYYA 1KITA 4YVSC 1H8TA 3BVCA 2ET7A 3ST7A 3MEPA 3MLJA 2AH2A 3O1MA 2JWPA 2PHFA 4XCAA 3CF6E 1QH6A 1W8ZA 1XQNA 4ES9A 5FO8B 4Q4Y1 1CN1A 2D5FA 3OJBA 4DS0A 1V6NA 1AXKA 1IOAA 1XYPA 4MSVA 4I3PA 4NIAA 5ANQA 1VMHA 3R0RA 3G6JB 3VHPA 1KDMA 4K21A 3AZYA 4C0HA 2DDUA 1T2XA 1CAXB 4HZFA 4K1ZA 1F15A 2HWB1 4GXLA 1VP6A 4PLOA 1R091 3HQXA 3LB9A 4XCBA 3CHXA 1G86A 1ZX5A 3VBSA 3NKTA 2BERA 2PLV2 1GANA 3LKJA 2W95A 4BZ4A 3RMXA 3U11A 1MS9A 5LA0A 5JIAA 4NHLA 2C5DA 2W1QA 4HVQA 5GZCA 2CGOA 4LHKA 1UX6A 1ZZ8A 4C91A 5JXJA 1H2NA 5CKMA 1RUH3 1JZ6A 4CP9A 2VMFA 3S7IA 1VBC2 5EYXA 3WX5A 3LQCA 5IK7A 1O8PA 5FQ0B 3LFMA 1BEV1 3LEKA 3KT7A 3AVSA 3M8LA 2XJVA 4XHBA 4EN8B 1QXJA 4ZHNA 1RUI2 1RMU3 1XE0A 1WCUA 2WS93 3M1HA 5E8AA 3TNQA 5CEHA 4CU6A 5E88A 1ZBA3 1D0GA 5LBEA 3WG2A 4FAGA 2LM3A 1NOVA 2R7EB 2W92A 3NAPA 3T1MA 3T3YA 2X29A 2YU2A 1SPPB 1H4HA 5FZAA 3VZLA 1RUG2 2CL2A 1NCQA 4AGGA 3N36A 1POV0 4KG0A 1MZFA 4FTBA 1YUDA 1KQRA 2ARBA 3AB0A 4NPLA 3RMYA 3ZO0B 1F31A 4AEDB 3QH6A 2HEYF 2TBVA 3AKPA 3PMSA 2WYSA 1UIKA 3JZVA 5FY1A 3AJYA 3VKFC 1AJOA 3WW1A 4XACA 1RUF3 1VBC1 1NXD1 3IWZA 5FBZA 3RG0A 5A3MA 2R1BA 4MGSA 1G7YA 1B09A 1F5JA 1LODA 4MH0E 4COZA 2RS33 4LJHA 1YWKA 1VBE3 2WZR3 5BNOA 4JDNA 4WVZA 2LUWA 2GC3A 4HK9A 2ZCWA 3I2FA 1K5MC 3MF9A 4M0NA 2WUHA 4NRPA 5FZ0A 2QQJA 3O5SA 2HWE1 2IFRA 4CEYB 3JB8A 4F83A 1PK6C 3V65A 1QOTA 2QDNA 1N1TA 4NHXA 3Q8CA 3VBFB 5AC91 2SLIA 1ASJ3 1ULCA 1H30A 3MIDA 3CU7A 4XQDA 3MV01 2PFWA 4C1XA 2VU9A 4KI5M 4PJYA 5IFPA 3VKLA 1HQLA 1DLCA 1DGWX 2X53S 1H6YA 3U75A 4CCEA 1AR61 1RUH2 4YZ4A 2D6MA 1K3IA 3IAQA 4NR1A 4QGNA 2NM1A 1V9U3 4KBZA 1W6NB 2DUQA 3UGHA 4AVSA 4DUVA 2JJ6A 3LSEA 3UL2A 4BK5A 5FY5A 2D3PA 4QKBA 1RMU2 2JG9A 3FE5A 3I4IA 4ISRA 2XDVA 3GCXA 2WS92 3NVCA 4S2DA 3WQBA 1PZ8A 2YB7A 1JZ2A 5BPXA 2X09A 1DZTA 1ZBA2 3MW2A 3VBHA 4B8EA 1OOPA 4CDXB 3DKQA 1K5JA 4IL7A 5IVVA 4BHPA 4PF5A 1QKQA 1F8VA 1W6OB 2F6BA 2XJSA 1NE6A 5LEKA 1JUHA 2Q1FA 2V72A 2PHRA 4OUSA 2AGSA 3K4AA 3SKVA 5FPXA 5I93A 3BTYA 1PGL2 3NL1A 3SQOA 4K8FA 1H8TC 4HVOA 4KWJA 1Q56A 3ELNA 3JUUA 4L11A 4E2SA 3OPZA 3ZXGA 4GZ9A 5LBFA 1NA1A 3W59A 1O5UA 2V4VA 3AFGA 2HBTA 1GU3A 1YNAA 2QJVA 3T08A 5FO9B 2VJXA 2UWBA 4JKKA 4YSFA 4CCLA 1DF0A 3G7DA 2DVDA 1K42A 5FZIA 4GKYA 1Y9GA 3PJQA 4LE3A 5IWFA 5E89A 2YHJA 3TN91 3ZN6B 1KDKA 2B42B 5FZ1A 3RGBA 3UGGA 1L3JA 4DY3A 3HNYM 2F17A 2W3JA 4QXBA 4GH4B 5B2GB 3NJXA 2WS91 2BFUL 1N1VA 2DWRA 5GM0A 3C7FA 3WNLA 4BXSV 4UBGA 2BU9A 1ZBA1 3AKQA 2JG8A 2YMZA 3E6DA 3T0BA 3VBSC 1O59A 1IS3A 3AZVA 2J1AA 5DZGA 3SXWA 5DG2A 3GALA 3RRDA 1NCRA 4HK8A 4Y22A 5HCFA 1GICA 1H0BA 4EN9B 2WYFA 1N3QA 5I8YA 4CEWB 2MNGA 3CIHA 1JUIA 3NNGA 5BUVA 2RDRA 4M0HA 4KU7A 3TEXA 4QDQA 2BVBA 1WZXA 4DO0A 3I2JA 5EHDA 4RSUA 3SH4A 1PNFA 2VVEA 2CDPA 3RSJA 5L9BA 1DU3D 3MDPA 4WZCA 1YQ8A 1GBGA 2OX0A 3UKNA 1EV13 3OG2A 3DN7A 5IK5A 2W2IA 1CD3G 4LNVA 2VBPA 4P5YA 2LALA 4PF1A 1NAEA 1WCDJ 4JKLA 5IVJA 1CAVB 4XUPA 4BMEA 1RUF1 4CA9A 3NAPC 1ZA4A 5FR3A 4WZFA 2MEV3 3B9CA 4Y26A 1OA4A 5FYBA 1XB9A 1XE8A 2RS31 2VQAA 2HWF2 4QX5A 4AWDA 1VBE1 2WZR1 3D4KA 4E8CA 4WVMA 5FZHA 3IDCB 1NCQC 3ITQA 3OGJA 1HB4A 4XPVA 1FMD1 2F4LA 4BQ1A 5BNNA 5FIXA 5FZCA 5F1RA 4XJ9A 3ZFGB 2Y8KA 1F35A 4AHYA 4BQ2A 2CSGA 2RM23 3MUY1 1YQ2A 3PUSA 3WHTA 1SDDB 3QACA 2Y6GA 5F5CA 3RS6A 4KWLA 1UNBA 4UFMA 5I0SA 1IKPA 1ASJ1 3POIA 3VZKA 4AEKA 2E6VA 3LPGA 1L7LA 1V6KA 1ST8A 3ILRA 4H7LA 4QU1A 2IXHA 2Y60A 2EIBA 3V0BA 2Q8DA 1O3TA 2QVSB 4Q26A 5T5LA 5BNOC 4URTA 2VTXA 1VE0A 3T2OA 2BGPA 4ORFA 2RDSA 1GNZA 2NQYA 5CYYA 4W8JA 1V0AA 2JX9A 1V9U1 2VZ1A 3JBG2 4U36A 2V4AA 4AI2A 1OMIA 1R1ZA 1W3XA 2GC2A 5LB6A 2CYFA 3VZJA 1Z7S2 4NJ4A 4BQWA 2E51A 4YZ2A 2DCKA 2R16A 4DPNA 3KB5A 1Y7BA 4G9SB 1MZ5A 4IE4A 4BE3A 1ZA7A 2VOTA 5FTTC 2B45X 2PTMA 1JI6A 3PIJA 2BNOA 1FI2A 2J1RA 3HNBM 3HOBA 1FNYA 4UW4A 4BIOA 2VZOA 5KR7A 3KT4A 2PHWA 1W03A 1C8M3 3OGRA 3OUJA 4AVBA 1LECA 2A6WA 4OHVA 4XF4A 3MHZA 1V70A 2JDHA 4K8RB 3VL9A 4BLIA 4EYUA 4Q8LA 3QH7A 2JG9C 4XF9A 1EV12 4N43C 3PHMA 5FYSA 3BALA 1UMIA 5BNPB 2VM9A 2P4EA 3JQXA 3VBHC 1HQNA 2JE7A 1OOPC 5K0UA 2ADDA 1W8FA 2OVUA 1ULFA 1RIRA 4O65A 1MZ6A 1VPHA 2MEV2 3WP6A 3WINE 2NN8A 2FMYA 5FOJB 4WM8B 1UOBA 1C57A 4XXAA 4XZUG 2WL1A 5CIRA 3WY6A 1FNZA 2DCTA 3E97A 1NA1C 2X5IA 1RUE2 1WA4A 4CCNA 4DOUA 5KXEA 4J1WA 4R52A 2RM22 3IDAA 4GWNA 4DXZA 3WCRA 3H3UA 4EWEA 3OUIA 4M3CE 2WN3A 4R4ZA 5FMDA 3EJKA 1YFYA 3POSA 4XVHA 5IVCA 3GZEA 4XTMA 2BEOA 1JBCA 5G05L 4X8PA 3LDKA 3H9AA 1G9CA 1SBFA 2BBAA 2HLEA 3KQ4B 1MVEA 2HWC3 3MW3A 2E7QA 4QB6A 4KMQA 1E5IA 2RJ2A 1EV11 1QWRA 1GSLA 3ZYHA 2JG8C 2WNEA 1W8OA 4LKEA 3IN9A 5GZDA 5C4WA 2A3YA 5GALA 1NCRC 3CZJA 3ZMNA 4M3CF 1RUC1 2G9FA 2QKDA 4OQ9A 3GXUA 1HKDA 3Q8EA 1B35B 5FKCA 4IETA 5FOBB 3BB6A 5A32B 1JYXA 5FWEA 2VBDA 2QZ2A 3DEMA 1V6OA 3IPVA 5F3GA 3WR0A 5FZ3A 2Z5WA 3TB0A 1MVQA 1IGOA 2H6BA 3GDBA 5E16A 1C8M2 1IPJA 3WP4A 3LOBA 2RS12 2WA3A 3PMEA 2JDZA 3SCFA 5DMYA 4QPYA 3MIHA 1OH4A 1TME3 1UPSA 2R32A 1ZVFA 3UJOA 3R4UA 1NX9A 1PZ7A 3GF6A 1OC1A 4XJUA 3QLQA 4YVWB 3U1XA 4DEQA 4DZGA 5J3UA 4JGYB 3WF3A 3O1RA 4G4FA 2VZTA 1IHMA 1UPIA 3NKGA 1UXZA 4DRRA 4XFHA 1LCLA 1AJKA 1V6MA 1W8UA 4OMCA 3WZ1A 2IC1A 1A6CA 3D82A 1XSRA 3IMNA 3HJRA 3AYDA 3ZX7A 1NKGA 2JDNA 4Q4V3 3B02A 2ZGNA 4GMP3 2GMMA 1OF4A 1QXRA 1GZCA 3E6BA 1W0OA 2WNOA 2WZEA 5F5QA 5BNNC 5C6CA 3UKTA 1QJY1 1O4ZA 4UFHA 2Q8OA 3VBUB 4LKFA 2IZWA 4AHWA 2WNUB 5FY9A 2A3WA 4D7YA 1UOFA 4CYDA 5LBCA 2VUJA 4MOAA 3O1VA 2GNDA 3DPRA 5T55A 1RHI3 4JGZB 4UYBA 1OFSA 4B1MA 4A41A 3I8TA 1IS4A 4LLOA 1F4HA 2YFUA 1OPOA 1IPKA 5CFCA 1FOD3 1NUKA 1NLRA 1ZRIA 1C8M1 1YCIA 3SHRA 1LHOA 4QDSA 3WDVA 5JR7B 1W2AX 4LBNA 5C70A 3W21A 1PVXA 2RG4A 2YUEA 2XVLA 2Z79A 4QQPA 4Q1PA 1WGPA 4UFJA 3O1PA 1W8WA 2XUEA 5FYIA 5B4NA 4WBBA 5IFTA 3ZXEA 2VTFA 2XVKA 1LEMA 2HWC2 3I2DA 4EZHA 5I91A 4OQ8A 3KF3A 3V64A 4LTAA 3FLPA 4HVRA 5APAA 3T2TA 2P6CA 5A33B 3ACHA 1WW7A 3USUB 1CIYA 2XKPA 5A3UA 3RYKA 1RVF2 5FZBA 4XUOA 1W6MB 5KBFA 3ZFEA 2WDBA 1H1AA 5ACA3 4ZONA 5IVBA 2A5ZA 2VQTA 1YI7A 3AFKA 4B4RA 4LKDA 1AX0A 2ZZJA 3HMYA 5ANNA 4FXGB 3W58A 1W9YA 5JXGA 1UYPA 2QE3A 4HOOA 1JXNA 2BTVC 1W9WA 3VZOA 1W2TA 5FZ4A 2YYOA 2Z42A 4QKFA 4BQXA 1CWPA 5CBLA 3FMGA 3D3AA 3R4DB 1VLNA 5BXXA 5I8TA 3W5NA 5K0UC 2ZGSA 4AI8A 4LORA 5A6XA 4RR3A 3PIGA 5EJ1B 1SDWA 1CR7A 2HH9A 2HWC1 1HRI3 3N9LA 3WNKA 2ADEA 3H1MA 4YM0A 3EYPA 3WSOA 3AXDA 2P17A 1DBNA 1JOJA 2OKXA 5FZOB 5GZFA 3WDWA 3OGVA 2X5IC 2O1QA 1OLQA 2VZRA 4QPIA 2DTWA 1YFXA 3A21A 4CRQA 2EIDA 1SEFA 4YNIA 5CKNA 5DQ0A 1W0PA 3I59B 2YPJA 2DYCA 1BQPA 1RHI2 3H8UA 1FATA 3KMHA 5C8WA 5J1XA 5KHJA 4LA2A 2ZX3A 3PNAA 1K5MB 4TN7A 3JU9A 1FOD2 1E57A 4UT5A 2WNVA 1ZREA 1F2NA 3D5OA 5FYVA 3AMNA 2XONA 5I0UA 1AR92 2ATFA 1DQ6A 1TME1 1FYUA 2XOMA 3M3QA 2XL7A 4K9SA 4Q5OA 5L36A 3EBRA 1AR73 3AMQA 2P2KA 5C4WC 2CWSA 1VBD3 2D44A 2TUNA 3PUQA 4TLFA 5FPZA 1RJ7A 2FD8A 1HRV3 4L2NA 3NNMA 3VBRA 2W68A 4LO7A 2IXKA 3GJBA 4PIYA 2ZGPA 4Q4V1 2XJTA 4Y1XA 1MS8A 3P6BA 2ILMA 1S1AA 1OFNA 2AUYA 4M4PA 2PELA 2H0VA 3SEPA 5CFDB 3KD4A 4AFCA 3BIWE 1QF3A 1VJ2A 4BJ0A 5T5OA 3RZKA 1H1IA 1RHI1 4AG4A 4COWA 1XNTA 2K0GA 3MW4A 2UY8A 4XHXA 3SH5A 1FOD1 1R1A2 1Y4WA 3L9JT 2B9VA 1UY0A 3K51A 2JDAA 1BBT3 1E5RA 3CJXA 2Q8CA 2VXJA 2I07B 1HB1A 4GQ7A 5FP7A 4D7SA 2ZZQA 5EJ3A 1H8TB 3LF7A 2FZ1A 1SCSA 2BPA2 3IIIA 2E7TA 4A7ZA 2HWB3 5KXCA 3MIBA 5IVYA 4H7MA 4DFSA 2VXRA 2CHHA 1CAUA 4D8MA 3IT8A 4N8MA 3VKOA 2VCAA 3DPRC 2A6VA 4HN1A 4IE6A 4K20A 4CDUA 3MIEA 2C1FA 3GJAA 3D8CA 3ZYPA 5A7WA 2ZGRA 1UZ0A 2JB8A 5C3SA 3ZR6A 3HQRA 1XNBA 3B5LB 2XQRA 3MO4A 3TRSB 4CXWA 5ACA1 4HSJA 4XF3A 4ZXKA 5AFEA 4RGAA 3K46A 4FVVA 1BEV3 4DMIA 5CAZA 1C1LA 2IWGB 2YZ4A 1N3OA 3VD3A 2JE9A 4LK7A 2ARXA 3M3IA 4JCKA 1UY3A 1UIJA 3AP9A 4QM8A 1MQTA 5A1FA 5A1LA 3V0AB 4MGTA 4HKOA 1OKQA 2QQNA 3AP7A 4CCCA 2WBKA 4FAHA 5J09A 5GJ6A 1AR72 2C26A 5CVRA 4GB31 4IV1A 4B1LA 3MV11 4BA6A 1DFQA 3BCWA 3ZFEC 4KH9A 1HJGA 2VZQA 1HRI1 5H9QA 1DQ1A 1H2KA 2Y6LA 2V5YA 4DNYA 1DYOA 2DCYA 2P3IA 2WFF2 3P3NA 1YQ5A 4QQ2A 1RB8G 3RZLA 2JICA 3HT2A 2XVGA 4URAA 2J1TA 3THCA 4AFAA 2JD9A 3ABZA 4HPKA 1G9FA 3U10A 5CISA 1CVNA 1OI6A 3CKHA 5FPUA 4AFMA 3OEBA 4MADA 5JOYA 1WUVA 2VOKA 3ZYRA 4ONUA 3OSDA 3PLQA 2CGNA 1RUJ3 3D6EA 3GHMA 4L8QA 4Y3OA 3POYA 1NCQB 1ZRDA 1LOGA 4RR3C 1UY2A 3GM8A 5FZKA 2JE8A 3S7EA 2QQLA 4OVEA 1GOGA 1BBT2 2ZJCA 3FWEA 2RV9A 1ND3A 3FJSA 2P3YA 5SV5A 3WDTA 5L19A 2OPKA 4H2AA 2J42A 2EICA 2HWE3 4H55A 2AR6A 4MGQA 1NY71 4A3ZA 3SKJE 4QPIC 2QQKA 2HWB2 1VBD1 3C8XA 1R092 4IE5A 1DQ5A 2O8QA 1HRV1 4BOWA 4YFZA 1SG3A 1AR81 2WINB 4OUEA 5FMOL 2WLPA 5H9RA 2EVXA 1J83A 5FP9A 1W9TA 4QMAA 1US2A 4QX7A 4X6QB 4YARA 4FI9A 5J98B 2ZAAA 4N7IA 1S0BA 1H2MA 4FPFA 1VRH1 1CZSA 4HETA 3HN3A 5DZFA 2BGOA 2WNVC 4LK6A 5FXZA 4I0AA 1AR63 4LUMA 1H8VA 4EZ4A 5FZDA 1WW4A 1YLLA 2QQVA 2YY1A 2ZS6B 1JZ5A 1BEV2 1LGBA 1K45A 1PM7A 2WJSA 2ZABA 4NRQA 4N53A 4NROA 4FBFA 3IBMA 1X8EA 2ES3A 5KC5A 3AM2A 4AGVA 4XURA 3FHIB 2Z69A 4KNCA 3MLLA 4EQVA 1YC61 3ZSMA 2GNMA 5IT6A 1BBT1 2W47A 5FXWA 2LRPA 3VBRC 5C8CA 2UU8A 1XPWA 5T5JA 1AYM3 1DZRA 1CGPA 2VZSA 3U37A 2HWD3 3NRUA 1NYWA 2ZX0A 3S0MA 5IHRA 1GP5A 5JSRA 2VZ3A 4NO4A 3HWJA 2EALA 2VUCA 4Q2FA 5FXVA 1ENSA 1VBA3 4O7XA 3WG1A 4N43B 1AL23 3DYOA 3VBHB 2FDJA 4QKDA 2NP0A 2JKXA 5F2WA 4NWWA 2BJSA 2RMU1 4XJAA 4PDWB 1LU2A 1LNSA 5FZMA 2F4PA 2V73A 1LOBA 4PHZA 4Q1RA 5FPAA 3C7HA 1WD3A 1ZRCA 3TN93 3ZXLA 2YV8A 3W5MA 3RPQA 4RN5A 4XFFA 3N7JA 5FK8A 4ARYA 4CDWA 1CESA 1SFYA 3KSCA 2JIJA 4HL0A 3VBOA 3WQ1A 3PU8A 1CZTA 2XLGA 2AENA 5I0RA 2J1SA 1QQP3 1OVSA 1Q8OA 4IEVA 2WKKA 1EY2A 4C8DA 2HWE2 1PVC3 1WW5A 2W52A 4A6OA 4CDUC 1HN0A 2VCCA 3T1LA 1CIWA 1GFF2 1QXPA 2P1BA 4Q4W3 1J3QA 2R043 3MBWA 1RUNA 5AC92 4A4AA 4WM7B 4GALA 5LY1A 1Y43B 1W2UA 2XWJB 4QQHA 1W05A 3KF5A 3KV4A 4YW4A 4XBLA 1QH7A 2VVDA 1AYN1 1OBNA 1IQAA 5J37A 2QDRA 4FTSA 4FPGA 4I0WB 1ENQA 2JG8B 3A4UA 1WMFA 3CDZB 2C4XA 1S2BA 2XLAA 4XQWA 1DHKB 3CQOA 1TZOA 3ZKYA 4CU9A 2W9XA 1E5HA 1MQTC 3H7JA 3AP6A 4JV4A 4AL9A 4BCUA 1Q8PA 1NCRB 4OZXA 1X50A 4Y22B 2XHKA 4AGRA 1QMJA 4JTOA 3KLSA 4LIVA 5IAVA 1AF9A 3ZSJA 5BNQA 5CADA 1RUJ1 4NIIA 1AHSA 4IW3A 4IV1C 4Q27A 1OH3A 4CPBA 4GWJA 1C5HA 1QJEA 1WCKA 3PTYA 3PVNA 5GLTA 1LEDA 5L73A 1GKBA 3P3PA 5FBJA 4A6SA 5D2AA 2W46A 2HBUA 2A71A 1DIWA 3ZDVA 5JR2A 1RTVA 3C7EA 2WQ4A 1AYM2 1QGLA 3PVBB 4JQTA 5EQUA 1FMD3 2BWCA 4PQQA 3NNLA 2HWD2 1U12A 2Q0AA 3T0AA 1PZ9A 4EROA 3ZFFB 1LHVA 2Y33A 4LOSA 2CWMA 3MIGA 4QX8A 3FN9A 1S0DA 4Q0QA 1HV1A 2JXAA 5T3NA 3D0SA 4E4SA 5IK8A 3WQ0A 5EFUA 4B7KA 4AI0A 4LEJA 5BV6A 3SEEA 3DKWA 1AL22 4R9BA 1APNA 3J7LA 3WP3A 4QGMA 4WVMB 3H1YA 2W08A 5J96B 3MZHA 3OYWA 3LDRA 1HX6A 4BQ4A 1ONAA 3NO8A 1XRUA 5FWJA 3EXUA 3CNAA 1GWKA 4Y24A 5JSOA 4XF0A 2WQZC 5F32A 3FUOA 5CB7A 1BK0A 4A3XA 1YEWA 1ND3C 4AI1A 3TN92 1OHFA 1W04A 3VN4A 3VZMA 4UW3A 2VNVA 4QB2A 2W1UA 3GGLA 3CBNA 1KFXL 5FZGA 2GP3A 3BPZA 5D1IA 4BK4A 2EXHA 3BTZA 4LBQA 1GYKA 5LRSA 3ZVXA 3A23A 3LIHA 2JDPA 3TEWA 1JN2P 5FPBA 2SBAA 3MFCA 2YU1A 3PURA 1BJQA 3VHOA 1AYM1 1XBFA 2GAUA 4CP2A 4XZPA 5F37A 1PM4A 4A7YA 5CFCC 3S5QA 2Y34A 2PAKA 2UWCA 2HWD1 3AJZA 1CAXA 1X9TA 3I3BA 1A8DA 4M3CA 2UYBA 4YZ3A 3VDBA 1CPNA 1S2EA 3IM0A 4IEPA 1Q5OA 1VBA1 2C6SA 3HD8B 4LULA 4R9CA 4XQ4A 1AL21 4Y20B 3THPA 4AQ6A 4JRLA 4COYA 4MG2A 3UETA 4BB3A 1SHWB 3MFAA 3OTFA 1HLCA 4LQRA 2A6YA 1F4AA 1QNWA 5L7OB 4P9YA 1UZZA 1NZCA 5F9TA 1RUF2 4PIXA 3ZXFA 4A42A 1URXA 1WD4A 5C8CC 4QPGB 1H9PA 5FJKA 3RWKX 2RHPA 4F8AA 1XU1A 2A75A 2RS32 3LDBA 4YFWA 1QHDA 1VBE2 2WZR2 2RS51 5JOWA 1C4RA 1EP0A 1Y3TA 2IVIB 3I2HA 3LFIA 5FY4A 4RQPB 4CZSA 5DAXA 1MS5A 5A7NA 3HN1A 3WT3A 1UU6A 1HV0A 1QQP1 4OMDA 1O4TA 3DUIA 1FMD2 3GBGA 4P14A 3S30A 5GZGA 4QX2A 4BU2A 1TE1B 1PVC1 1ODNA 5HCAA 3M7AA 3HNMA 4UOJA 3RYRA 2ZMKA 3I97A 1MS4A 4Q4W1 4OCTA 4Y5Z0 1RUD3 2D3RA 2R041 3APBA 1SMVA 3B01A 4NAMA 3M3EA 4I0BA 2Y26A 2Y6KA 4AYUA 4HMZA 1ASJ2 1DGRN 3Q9OA 3OUHA 1W8NA 2PQSA 1IPSA 2NMNA 3MICA 1DQ0A 5K9YA 2WRAA 1L7RA 1S0FA 2YC4A 4XUTA 3AVRA 2XH6A 5DZEA 4XJZA 1QJU3 4CDWC 2G4IA 1UMHA 3HAGA 4E2QA 2VMEA 1LHUA 3ACFA 1RJ8A 3AC0A 3VBOC 4AEDA 3WW4A 5A70A 2AEZA 1GV9A 1V9U2 3CMGA 4OUMA 2H0BA 5FUIA 4BQ3A 3WF1A 2O14A 3GNEA 5LW9A 2VO5A
chains in the Genus database with same CATH topology
4MGYE 1XNCA 5F6LB 1RUC3 1SLBA 2YROA 2DVFA 3QOPA 2FZ2A 4AHZA 1Z0HA 4LO5B 1DG6A 3MGUA 2TNFA 4CEYA 4DRVA 1UKRA 1EPWA 5JMCA 1HXS1 1YFUA 2A73B 4COVA 1AX1A 1A3KA 3E5QA 4JC1A 3M70A 4O9EA 4CDQA 2XJRA 3VBFA 2OUHA 2R061 1ZRRA 1BXHA 3MPPG 1ND2A 2OZ6A 4M01A 3WDXA 5D8AB 3IPVB 4IEZA 4OI1A 4YG0A 1WBLA 2Y0IA 2A3XA 2FQPA 1IZ3A 1QDOA 2UWAA 4IV3B 1SLTA 5DUVA 1S2KA 3LGRA 3IDEA 1S0JA 1QJY3 3CJIA 3VDDA 5CG8A 4AHXA 5JCTA 3AYCA 2BNNA 1PO11 5JIUA 2NMOA 4CDXA 1WLCA 2ET1A 3WQ7A 1PIV1 4W6WA 4FSJA 1RUD2 1J58A 2P3KA 2E7AA 1G6NA 4OFGA 1DDLA 3AMHA 3E5XA 3AX4A 2XUMA 4XIOA 1MEC3 1I1EA 5FO7B 3DV8A 1TMF3 3ROUA 3RI8A 1KS4A 4J1XA 1YRZA 4XOGA 5LRRA 4DB5A 4QD2A 3WXPA 4IEXA 2EF6A 5CFCB 3AKSA 2IFWA 3ENRA 5HCBA 2R30A 4FP2A 1RUC2 2DF7A 2O0OA 2R49A 1VAMA 3IIAA 3N7MA 4Q0PA 3ZN6A 1VB4A 1UKGA 1DGLA 1ZZ9A 3U4XA 2HEWF 5EWSA 2E53A 1R083 3KCYA 4Y1YA 4H14A 2FMDA 4P9WA 5T5PA 4Y4YA 1I3HA 1RUD1 1DQ4A 1GZWB 4CEWA 2NYYA 3N35A 4ZKTB 1QJX3 3MI8A 4N9HA 1ZYBA 2ZTNA 1GNHA 1WMEA 5GLWA 1QJU1 2VOXA 2HKXA 4RHV3 1ZM1A 3WUDA 2Q30A 2EIGA 1FV3A 1QJY2 4B7EA 3ZYIB 4LBMA 3ZYJB 5LEJA 1PHMA 2R071 3FLTA 4RR3B 5EZWA 4OLLA 5JZGB 1W6QB 1JHNA 1I9RA 3B7MA 4AEDC 1I6XA 4FO9A 5AVAA 1V6IA 3DF0A 3RQ0A 1X7NA 1G9DA 3N7LA 2D6LX 2D7FA 4IQPA 1RINA 3BODA 2GC1A 4KG8A 1LOAA 3WDUA 3UJQA 5I0TA 4YVSB 3ZIWA 4V1PA 1CQ9A 1DYKA 1W6PA 3ILNA 3N4MA 4CEYC 3ZSEA 2DVBA 2EXIA 5JAXA 5KXBA 5E1RA 4D69A 1TQ5A 5JOXA 1S0CA 1R082 4BIFA 4CDQC 4RFT0 2HYKA 4GMP0 4B4QA 1ND2C 3TBDA 3VBRB 4EV0A 1HQWA 2IXCA 2XJPA 4QM9A 1DYPA 5KC6A 1A78A 3ZXAC 2BYVE 1J3PA 3LAGA 4RGGA 4META 1MEC1 3H1WA 2KA3A 3LCPA 5IUQA 1TMF1 1O7FA 4L92A 2IXIA 4AVVA 5A3LA 2YGLA 1T6GC 3CJIC 4XFGA 3VDDC 2B8MA 1RC6A 3QD6A 5EXOA 5FLJA 5BNPA 2AYHA 4D7TA 2ERFA 4PBOA 5HXVA 3J26N 4J6GA 4CDXC 1KXGA 1Q3EA 4M00A 5AFBA 3VHNA 3O7OA 3ETQA 3H50A 4QT6A 1FV2A 5T50A 2QUOA 4NOTA 4Q8KA 5CG9A 5C33A 1KJLA 4WM8A 4GULA 1R081 1JTZX 3B93A 4RA0A 4PBPA 4WV8A 2WZPP 2R6QA 4XETA 3JB4C 1TME2 1X33A 2D93A 2N7GA 4ZU7A 2GH2A 3N7KA 2ZGQA 1N3PA 1QJX1 4FPOB 3RZZA 4GB33 1VAKA 2DFBA 3FX3A 3NV1A 3UV9A 1CAWB 3AXEA 3KCXA 5I8SA 1NXMA 4RHV1 4AEJA 1XU2A 3BOPA 4D94A 3O12A 2VMGA 2XB6C 1XYOA 2RJLA 4Q4V2 3WW3A 3B9IA 4MX3A 1BZWA 2BGCA 3WV6A 1G8WA 4GKXA 1KFUL 4BWOA 4Z07A 1NQDA 4IV1B 2DVGA 5T52A 4CEWC 1YIPA 3KGZA 3KGLA 4KBBA 4ASLA 5A32A 2XBO3 1VR3A 1UAIA 1ULGA 2VNGA 1MS1A 4ZU5A 4D3WA 1SBEA 1C1FA 2NPIA 1M4WA 3MIFA 1KRIA 3ES4A 1PK6B 2WT1A 2CNAA 1LU1A 4G3YC 4MLOA 3ZDSA 5DXDA 3DL3A 4FOWA 3ZN5A 2HJIA 2XL9A 3ASIA 1AR83 2P37A 4R9AA 4LBKA 5JLVA 1ZZ7A 4Q0VA 2VW0A 4KL1A 4HKLA 4IEUA 4Q4X3 1VRH3 2GN7A 1UD1A 5ACA2 4JDOA 1SLAA 2UURA 3AMPA 4RS5A 3VBUA 3LA2A 4P9IA 2WNUA 3JD71 5ABJA 1QDCA 2DTYA 3H3ZA 1D0HA 1X82A 1I5ZA 1LGCA 4JGZA 3H0OA 2QFEA 4NN0A 4NHKA 3V56A 2C9AA 2CY6A 5DUUA 1PO21 2BWAA 3L2HA 4GB32 1HDKA 3INAA 3M4FA 4XYXA 3WNXA 1XXNA 3NSTA 4AI3A 1AZDA 2QZ3A 2BVVA 2VH9A 1HRI2 2CV6A 1OLRA 2VW1A 3O0XA 2BW8A 4P9JA 1LKNA 3AP5A 1UN1A 4LE4A 1UF2C 2VOVA 2VNOA 5A33A 4SLIA 2GNTA 1FPN1 4GA9A 1QJZA 2DU0A 3USUA 4AEMA 1AX2A 4AQTA 2BFUS 4XFAA 4MXVA 5C8CB 2RMU3 2YC0A 1VALA 2OZJA 2ZPXA 4XMIA 3MLKA 4TWTA 1PGW1 4COUA 2XBO2 1NG0A 1UU4A 4W6YA 3JQWA 4YZ1A 1OSGA 2O8OA 2CTVA 3SMHA 3VBSB 1O3SA 2GALA 4L97A 1OQDA 4MUVA 1TEIA 1LGNA 5DDJ3 3B3QE 1LHWA 3NV4A 3EO6A 5BNPC 1NY72 2WT0A 1LULA 5J36A 2R1DA 2YDEA 1VBD2 2DVAA 1HRV2 1AR82 3OD4A 2GMEA 3JCIA 2ENRA 5LK7B 2EAKA 3AK0A 3AZXA 4PLMA 1WLTA 4Z92B 3RWNA 2X8KA 4WM8C 1YHFA 1SQ4A 1AYN3 5JVVA 3VBOB 3VKMA 2ZA9A 1VRH2 5GZEA 5JOZA 4FPCA 3GZAA 3SH3A 2QQPA 3NAPB 4P5HA 4QHBA 2AREA 4ASMB 2ZGOA 2BBVA 3I59A 4N7UA 3ZN4A 2ZGKA 2XBO1 4XE9A 2B9UA 4FOQA 1U5YA 4BLJA 1PGSA 2UY9A 1VAVA 2IXLA 4L9BA 1LJ7A 2RR11 2GMPA 4RD7A 1VBB1 2NLRA 2PLV3 2VVFA 2ZKLA 3HT1A 3OY8A 2PAMA 1EAH1 2CAUA 1H2LA 5AVPA 3RDIA 2PHDA 5BNOB 4ES8A 4Q4X1 1REEA 2RMU2 5C9AA 3A0NA 4XIKA 3BTAA 1KJRA 1FXZA 4QGLA 1HIXA 5FCCA 5CFDA 4WVWA 1X36A 1XNKA 4XXPA 1V6LA 5LK5A 4Z1VA 2A7AA 4O9GA 4I30A 5JI7A 2BUKA 5DDJ2 5DUXA 3RJ2X 1A8MA 4EWDA 4XW3A 4JRAA 2VMIA 5KHHA 5JPMB 2FHRA 4MXWA 4MGZE 2UYAA 1NE4A 4F7ZA 4FPLA 1BVP1 2B7YA 4HT1T 1COV3 1QOSA 1OPMA 4NVPA 1BMV1 3SLIA 1YJLA 2EAAA 4FPJA 1ZBE1 4CP0A 2Y38A 4RS5C 3VBUC 4C0BA 2JG9B 2WNUC 5ABJC 1AYN2 2LTNA 4DINB 2D97A 4LBQB 1VB2A 3LSDA 1OOPB 2ZGUA 4GWMA 4JGZC 4UW5A 1U5IA 1MS3A 1UMZA 5KHGA 1OA3A 4AW7A 4I02A 1O4YA 1SLLA 2GZWA 4IESA 4LBJA 4BPZA 3HIFA 1RUJ2 2XLFA 2OUJA 1W39A 4M3CB 1ULEA 4INDA 2RS53 5H9PA 5DUWA 5CU1A 2JECA 1NA1B 2D3SA 4LT5A 3A0KA 5DDJ1 3V0AA 1QU0A 1YFWA 3USSA 3SCHA 4I2OA 2ZGTA 3POWA 1LOEA 3LA3A 4OHYA 3B69A 1Q8VA 4YW5A 1C3HA 2WSUA 4ITCA 4B4PA 1YJKA 4YW3A 1RUOA 1OQEA 3FUQA 2MPFA 3PVEA 4K6BA 3VV1A 1G9BA 5EV7A 4HN0A 1POV3 1AXYA 3RNSA 4YLZA 1H9WA 2QCSB 3KZ4C 1C5IA 4XJWA 4IEQA 4JQRA 2A6ZA 2RJKA 1DLLA 1CONA 3J9SA 4Q0SA 4EN0A 4X8NA 1SFNA 4Y1ZA 3U07A 4FQ4A 2PN5A 5K7PA 2I2SA 5GLZA 2GDFA 2PLV1 5H9SA 5TSWA 3FFZA 3QBQA 4GIQA 1COV2 4YW1A 4XILA 2XJUA 1J1TA 1HXS3 4L99A 3ECQA 1QNYA 4E2GA 1VBA2 2OW4A 4XFIA 5GLVA 4Z82A 1AUYA 4YW2A 2R063 4RL7A 4DY5A 2FBEA 2RE9A 1RUI1 1XE7A 5BNNB 4AFBA 5FLIA 4C1WA 3OCPA 1ZRFA 2P34A 4YM3A 2D6KA 1ZZBA 4LBOA 2RS52 2ZGMA 1YI9A 3URFA 2VNRA 4FT8A 4LR4A 4CDQB 5FFOC 2XPJA 4FCAA 1RUG1 1QQP2 3FBMA 2GU9A 3V0BB 1ND2B 4OI0A 1PO13 1PVC2 2PAEA 2I45A 4YM1A 4E4DX 1F5FA 3CLPA 1UU5A 4H3WA 4TSVA 1OA2A 1PIV3 4Q4W2 1KS5A 4R4XA 2R042 1COV1 2WIIB 1YIFA 1GQGA 2JENA 5C9AC 1FX5A 4AVCA 1LOFA 1O3RA 4OI4A 2XGXA 3E5UA 3MF6A 3CJIB 1GR3A 2VECA 3VDDB 5CFDC 1V00A 4N53C 2D40A 2E9QA 4N43A 3WW2A 2HWF3 4A7KA 2QNKA 4XF1A 1ZNPA 3R4SA 4PDWA 4AQ2A 3IKWA 3ME2A 4KWKA 1WLDA 4TYSA 3SCGA 3MYXA 3J8F3 5FQ0A 4YGCA 5FDBA 5HI0A 4XFCA 2XJQA 4LHNA 2D98A 3ACLA 2MHFA 1Q8SA 4XEZA 4A2UA 3ZXDA 2VW2A 5KWRA 4UXAA 4HANA 3E6CC 1OQ1A 1XYNA 4JAAA 1HXS2 5K0UB 3GBFA 2GSYA 4UW6A 1ZZ6A 1RUH1 3NV2A 1J3RA 2ZKNA 3PJYA 3WP5A 2R062 4WM7A 3JBG3 5JSPA 5GKAC 1GQHA 4XTPA 1VIWB 1Z7S3 1RMU1 4HKWA 1SACA 4YGBA 2X5IB 1POV1 2B5HA 2VMHA 2ZOEB 3RYPA 4P9GA 2PYTA 1PGL1 4K40A 4E4ZA 1CJDA 4AE2A 3TNPB 4B29A 3W9AA 1PO12 3ES1A 2R073 1SBDA 4FTEA 1PIV2 2PQQA 1MS0A 4JTNA 3VLBB 2CAVA 4HLTA 3ZFFA 4HSLA 3IDBB 4OULA 5C4WB 1DGRA 2Q1MA 5DG1A 1UZYA 1C8NA 2NZ9A 2ZHLA 3H7YA 3LWCA 2VY0A 5BY5A 4N90A 4B3NA 3HR9A 3O0WA 4JVAA 2DUOA 5CNAA 3B00A 4ISQA 1O3QA 2VUAA 1RUE3 4YZ5A 1HW5A 1O91A 2EXJA 3J8F2 1W6NA 4C90A 5T54A 1LESA 5IK4A 3AZZA 3TOJA 3WVJA 1NQJA 4Q29A 5CA6A 1CPMA 1IS5A 1W6OA 4AK3A 3RJRA 4ZU4A 3NWKA 4QXKA 1WBFA 1BK1A 4FP3A 1W6PB 4S2FA 4I09A 4FPYA 3FC0A 4QU2A 4JDMA 2H6CA 4P9LA 1QJU2 3UKVA 4BM8A 2HWF1 4Y20A 3DPRB 4Y1UA 2DV9A 4Z8BA 1LOCA 4LO6B 1ENRA 3ZPYA 5L7OA 2OYZA 2YXSA 2GNBA 4LO4B 4MYEA 4SBVA 4E27A 4QPGA 3J8F1 2RS13 4PQ9A 4PLNA 3LA7A 4FPEA 4R8HA 2R072 4GH4A 1LOFC 4RQPA 5FAXA 5HBAA 1JYIA 1Z78A 1IS6A 4WVVA 5EYYA 4MGKE 4XFBA 5F6KA 3O0VA 4EN6B 3ZSKA 3ZFEB 1S0GA 4PDWC 1QY4A 3JBG1 4UBHA 4LUKA 3WCSA 4Y1VA 1Z7S1 1YXWA 5KHIA 1RITA 3ILFA 3ZIXA 3VZNA 4EN7B 3QCWA 2Y0OA 4K7JA 3SNMA 3WOGA 1CAVA 1UCXA 1V6JA 4YM2A 1H1MA 3AKRA 4HFSA 3AZWA 3EHKA 1KD7A 1EPZA 2KM2A 4WM7C 3X29B 2Q5TA 2ZX4A 4Q0UA 2DUPA 1N1YA 3CEWA 4LBQD 5FMOS 4FOVA 4KGGA 1WLWA 3ZFGA 5J7MA 1MZEA 1J59A 4XBNA 3KM5A 3OGGA 4QPIB 1MEC2 2ZHKA 3N3HA 1TMF2 3BU7A 2MEV1 1RVF3 4AVAA 2WA4A 5BYNA 2IXJA 2ZBJA 1WCSA 4R9DA 2TEPA 4MVTA 2WLQA 2D5HA 2WWSA 5D8AA 1J1LA 4AXOA 2GH8A 3VL8A 2VPVA 3SISA 3CO2A 1RUE1 2WNVB 1AL0G 3ZSLA 4P9XA 4IV3A 3MPBA 1M06G 1S55A 2RM21 4DQAA 3VUOA 4YRDA 3ZFFC 3RI9A 3JD73 3M3CA 1Q43A 1ZZCA 3VBFC 2R0FA 4KU8A 4MZUA 2JD4A 3NJZA 1PNGA 2ZX2A 2B39A 1LHNA 3ZXKA 4YG3A 1PO23 3THTA 1Q8QA 3OD0A 1DGWA 4AFDA 1QJX2 1GZ9A 3WUCA 1D4M3 1GLHA 4LA3A 2XWBB 4PIZA 3M2MA 4S2GA 4RS5B 4RHV2 5ABJB 5JDBA 1UL9A 2DCJA 2K2SA 4XDQA 4YGEA 1N47A 3KS7A 1AXZA 1ZRDA 1FPN3 2DU1A 4YYOA 2V09A 2D6NA 3TYJA 2HEVF 3I54A 3C3VA 2R0HA 4KQ7A 2XG3A 3ZYGA 2RS11 1S0IA 1AR93 2E63A 2VGDA 4F3JA 2VULA 2VG9A 3S6PA 2GN3A 2W0XA 1XNDA 1NLSA 1CAUB 3R6SA 3OBRA 4LO8A 5JPNB 4MV2A 1CJPA 1LR5A 4CDUB 4NHMA 5FREA 1X8MA 5GLUA 5L7OC 1SCRA 3KCCA 1GZWA 4CP1A 4FXKB 3O14A 2ZX1A 4U2AA 4QPGC 1ALYA 4N9IA 1U5XA 5SV8A 3TWIA 4LLFA 4GH4C 1BYHA 4RQPC 4MGIE 3TAYA 3C2UA 2EA7A 1MQTB 2ZGLA 3J4UH 4XMAA 4K1YA 1ENXA 1R1A3 1SLCA 2Q4SA 3AP4A 4KGQA 3GZUC 3JD72 5J48A 2JEMA 3CL1A 5K8SA 1B35A 1JH5A 1AVBA 1C28A 1LRHA 3AMMA 3GHNA 3BOWA 4IEYA 2D6OX 4W65A 1TNFA 2JKBA 1PO22 3GYDA 3SITA 5JZGA 2RR13 1VBB3 2OA2A 1W6QA 2KXLA 4HPKB 1D4M2 2DFCA 3PVOA 3LOIA 1H4GA 1RVF1 1EAH3 4YVWA 4OHXA 1TNRA 4LBLA 4JGYA 2W39A 2ZAHA 1FPN2 4FQZA 4FOYA 1JYCA 3NW4A 1ND3B 4K3UA 4YVSA 3U0ZA 1QOOA 5FLHA 3OY8B 3ZFGC 1ULDA 2C0ZA 1EYBA 1PGW2 3GBWA 1JW6A 2PHUA 3ALQA 4I3GA 3B94A 1RL3A 2B46X 5D8AC 2BNMA 2WFF3 3HBZA 1YO8A 3AKTA 4AVTA 4GMP1 2I74A 5JWPA 5C9AB 1D4M1 4TZDA 2Q1ZB 4QQLA 1YYNA 4IV3C 4BYYA 3LZZA 1ZBE3 3AYAA 4N53B 5KHKA 4XJ8A 4AQSA 2K9ZA 3UK9A 4Q4Y3 2WC2A 4IXLA 3WG3A 4XBQA 3WLUA 2DURA 4CTEA 4W6XA 1W6MA 2PHXA 2VOWA 4NWVA 1AR91 1Y9QA 4MXWB 1LB2A 2ZACA 4OHZA 3EQEA 1UW8A 3VKNA 3WHUA 1BCXA 1R093 2Z2SB 3KQRA 3NV3A 2RR12 1VBB2 1PMIA 1MR5A 4IEWA 3FBYA 2OIIA 2DCZA 4BMBA 2G9GA 1EAH2 3I7DA 1D2SA 1WW6A 2YGMA 3FFQA 2CGPA 1CAWA 3VGIA 4S2HA 4CDWB 3AYEA 3L2YA 3K48A 2ZMNA 4I01A 4Q4X2 4EJRA 1IKQA 2ZHMA 1R1A1 2A6XA 1BVVA 2VQ0A 3D0JA 2PA7A 3KT1A 4EWAA 5JI9A 1MACA 1FAYA 2ZMLA 1REFA 3DGTA 2D6PA 3FLRA 4Z2WA 2WFPA 1K5MA 2GC0A 3WG4A 1CX4A 1FT9A 1S0EA 4YGDA 3M3OA 2ZHNA 2PHLA 1PK6A 1D2QA 2AZ5A 1U0AA 2BQPA 3VHRA 5FRAA 2P3JA 4NPRA 1WMDA 1BMV2 1D4VB 1ZBE2 3FZ3A 4YG6A 1G9AA 1SLIA 1VBC3 2A70A 2ETEA 4OI2A 1U5ZA 1B35C 4Q4Y2 4IEOA 1RUI3 3GZTB 3OF1A 4PCRA 2WSVA 4ATFA 3WDYA 4ATEA 2XKOA 1REDA 1DZQA 2WT2A 4BH9A 5JZGC 2EXKA 1RGSA 2PHTA 3ZMOA 3ZXJA 3ATGA 1O5LA 1AR71 4X6RB 4QQOA 4HBNA 1F9KA 3R05A 3WD5A 4E9KA 4OHWA 1DQ2A 3OBTA 1LTEA 4YVWC 1N1SA 5AC93 1RUG3 4JGYC 2D43A 1BKZA 2WFF1 1OD5A 3OYWB 4LHLA 4FPHA 4FPKA 4IERA 4AF9A 1LENA 5KXDA 1KITA 4YVSC 1H8TA 2ET7A 3ST7A 3MEPA 3MLJA 2AH2A 2PHFA 3CF6E 1QH6A 1XQNA 4ES9A 5FO8B 4Q4Y1 1CN1A 2D5FA 3OJBA 4DS0A 1V6NA 1AXKA 1IOAA 1XYPA 4MSVA 4I3PA 3R0RA 3G6JB 3VHPA 1KDMA 4K21A 3AZYA 4C0HA 1CAXB 4HZFA 4K1ZA 2HWB1 4GXLA 1VP6A 4PLOA 1R091 3HQXA 3LB9A 1G86A 1ZX5A 3VBSA 3NKTA 2PLV2 1GANA 3LKJA 4BZ4A 3RMXA 3U11A 1MS9A 5JIAA 4NHLA 2C5DA 4HVQA 5GZCA 2CGOA 4LHKA 1UX6A 1ZZ8A 4C91A 1H2NA 1RUH3 3S7IA 1VBC2 5EYXA 3WX5A 5IK7A 5FQ0B 1BEV1 4EN8B 3KT7A 3M8LA 2XJVA 4XHBA 1QXJA 1RUI2 1RMU3 2WS93 3M1HA 5E8AA 3TNQA 5E88A 1ZBA3 1D0GA 3WG2A 4FAGA 2LM3A 1NOVA 3NAPA 3T1MA 2X29A 1H4HA 3VZLA 1RUG2 2CL2A 1NCQA 4AGGA 3N36A 1POV0 4KG0A 1MZFA 4FTBA 1YUDA 1KQRA 2ARBA 3AB0A 3RMYA 3ZO0B 1F31A 4AEDB 3QH6A 2HEYF 2TBVA 3AKPA 3PMSA 3JZVA 1UIKA 3AJYA 3VKFC 1AJOA 3WW1A 1RUF3 1VBC1 1NXD1 3IWZA 5FBZA 3RG0A 2R1BA 4MH0E 1G7YA 1LODA 1B09A 1F5JA 4COZA 2RS33 1YWKA 1VBE3 2WZR3 5BNOA 4JDNA 4WVZA 2LUWA 2GC3A 4HK9A 2ZCWA 1K5MC 3MF9A 4M0NA 4CEYB 3O5SA 4F83A 2HWE1 2IFRA 3JB8A 1PK6C 3V65A 1QOTA 2QDNA 1N1TA 3VBFB 5AC91 2SLIA 1ASJ3 1ULCA 1H30A 3MIDA 3CU7A 4XQDA 4C1XA 2PFWA 2VU9A 4PJYA 3VKLA 1HQLA 1DGWX 2X53S 1AR61 1RUH2 4YZ4A 2D6MA 4NR1A 4QGNA 2NM1A 1V9U3 1W6NB 2DUQA 4AVSA 2JJ6A 3LSEA 3UL2A 2D3PA 1RMU2 2JG9A 3FE5A 3I4IA 4ISRA 4S2DA 2WS92 3NVCA 1PZ8A 5BPXA 1DZTA 1ZBA2 3MW2A 3VBHA 4B8EA 1OOPA 4CDXB 4IL7A 4BHPA 4PF5A 1QKQA 1F8VA 1W6OB 2F6BA 2XJSA 1NE6A 5LEKA 1JUHA 2PHRA 4OUSA 2AGSA 5FPXA 5I93A 1PGL2 3NL1A 4K8FA 1H8TC 4HVOA 4KWJA 1Q56A 3ELNA 3JUUA 4L11A 4E2SA 3OPZA 3ZXGA 1NA1A 3W59A 1O5UA 3AFGA 1YNAA 2QJVA 5FO9B 2UWBA 4YSFA 1DF0A 3G7DA 2DVDA 4GKYA 3PJQA 4LE3A 5E89A 2YHJA 3TN91 3ZN6B 1KDKA 2B42B 1L3JA 4DY3A 4GH4B 5B2GB 2WS91 2BFUL 1N1VA 2DWRA 5GM0A 4UBGA 1ZBA1 3AKQA 2JG8A 2YMZA 3E6DA 3VBSC 1IS3A 3AZVA 5DZGA 3SXWA 5DG2A 3GALA 3RRDA 1NCRA 4HK8A 4Y22A 5HCFA 1GICA 1H0BA 4EN9B 1N3QA 5I8YA 4CEWB 2MNGA 1JUIA 5BUVA 4M0HA 4KU7A 2BVBA 4RSUA 3SH4A 1PNFA 2VVEA 3RSJA 1DU3D 3MDPA 4WZCA 1GBGA 3UKNA 1EV13 3DN7A 5IK5A 1CD3G 4LNVA 2LALA 1WCDJ 1CAVB 4BMEA 1RUF1 3NAPC 1ZA4A 4WZFA 2MEV3 3B9CA 4Y26A 1OA4A 2RS31 2VQAA 1XE8A 4QX5A 2HWF2 4AWDA 1VBE1 2WZR1 3D4KA 4WVMA 3IDCB 1NCQC 3OGJA 4XPVA 1FMD1 4BQ1A 5BNNA 5F1RA 4XJ9A 3ZFGB 4AHYA 2RM23 3WHTA 3QACA 3RS6A 4KWLA 5I0SA 1IKPA 1ASJ1 3VZKA 4AEKA 2E6VA 1V6KA 3ILRA 4H7LA 1O3TA 3V0BA 2IXHA 2QVSB 4Q26A 5T5LA 5BNOC 4URTA 4ORFA 1GNZA 2NQYA 2JX9A 1V9U1 3JBG2 4U36A 4AI2A 1OMIA 1R1ZA 2GC2A 3VZJA 4YZ2A 2CYFA 5A3MA 1Z7S2 2E51A 2DCKA 2R16A 4DPNA 3KB5A 1Y7BA 4G9SB 1MZ5A 4BE3A 2B45X 2PTMA 2BNOA 1FI2A 4UW4A 1FNYA 4BIOA 3KT4A 2PHWA 1C8M3 4AVBA 1LECA 2A6WA 4OHVA 4XF4A 1V70A 3VL9A 4BLIA 4Q8LA 3QH7A 2JG9C 4XF9A 1EV12 4N43C 3PHMA 3BALA 5BNPB 3JQXA 3VBHC 1HQNA 2JE7A 1OOPC 5K0UA 2OVUA 1ULFA 1RIRA 1MZ6A 2MEV2 3WP6A 3WINE 2NN8A 2FMYA 5FOJB 4WM8B 1C57A 4XXAA 2WL1A 5CIRA 3WY6A 1FNZA 2DCTA 3E97A 1NA1C 2X5IA 1RUE2 1WA4A 4DOUA 5KXEA 4J1WA 4R52A 2RM22 4GWNA 4DXZA 3WCRA 3H3UA 4EWEA 4M3CE 4R4ZA 3EJKA 1YFYA 3POSA 4XTMA 2BEOA 1JBCA 4X8PA 3H9AA 1G9CA 1SBFA 1MVEA 2HWC3 3MW3A 2E7QA 1EV11 1QWRA 1GSLA 2JG8C 2WNEA 3IN9A 5GZDA 5C4WA 2A3YA 5GALA 1NCRC 3ZMNA 4M3CF 1RUC1 2G9FA 2QKDA 1HKDA 5FOBB 1B35B 4IETA 3BB6A 5A32B 2QZ2A 1V6OA 3IPVA 3WR0A 2Z5WA 3TB0A 1MVQA 1IGOA 2H6BA 5E16A 1C8M2 1IPJA 3WP4A