3O1TA

Iron-catalyzed oxidation intermediates captured in a dna repair dioxygenase
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
202
structure length
202
Chain Sequence
EPLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLCLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-ketoglutarate-dependent dioxygenase AlkB
publication title Iron-catalysed oxidation intermediates captured in a DNA repair dioxygenase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 48
structure length 202
sequence length 202
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2010-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 3o1tA00
4QKDA 3RZKA 3S57A 3T3YA 2FDKA 3O1OA 4NIDA 3H8XA 4O61A 4CXYA 3S5AA 4NRPA 3I3MA 4IE6A 3T4HB 2FDFA 3O1VA 3BTYA 4IE5A 4NIIA 3O1UA 3RZGA 4NPMA 3O1SA 4QHOA 3RZJA 4O7XA 3H8OA 2FDHA 4NRQA 4CXWA 4ZS3A 3BTXA 3I49A 3T4VA 3KHBA 2FDJA 4JHTA 4MG2A 5F8PA 4QKBA 4IE4A 3RZMA 3H8RA 2FD8A 3LFMA 4MGTA 4NJ4A 2FDGA 2FDIA 3BKZA 3RZLA 4NROA 4NRMA 2IUWA 3I2OA 3BTZA 4IE7A 3O1MA 4QKFA 4RFRB 4ZHNA 3I3QA 5DABA 4QKNA 3O1TA 3BU0A 3RZHA 3BUCA 3BI3A 3O1PA 4IE0A 4NPLA 4NIGA 3BIEA 4CXXA 4NIHA 3O1RA 4IDZA 3KHCA 4ZS2A 4OCTA
chains in the Genus database with same CATH superfamily
4XFAA 1WW6A 1BVVA 5CG8A 4ZKTB 1MQTC 2VECA 4DUVA 3AMHA 1Y7BA 2ZMLA 3MPBA 4GQ7A 4HN0A 4BWOA 1UY2A 4ES8A 2QQWA 1WMFA 1MR5A 4YVSA 2H6CA 5A3TA 4Z07A 2WRAA 3I3MA 4Q4Y1 4Y1VA 2WZR2 1NT0A 1ZREA 4CDXA 1E5RA 4CUAA 3MIGA 5AC91 2P3JA 4OHXA 2BZDA 2ZX4A 2F17A 5ACA2 1UAIA 5F3GA 2WZ8A 4UW3A 2VMCA 4M4PA 5FZ6A 3ZXKA 2FCUA 1HRI1 3I2JA 3DXTA 1CAWB 1XNAA 3NKGA 4MXVA 4FPOB 4OI2A 4RGKA 1W8OA 3VD3A 1PGW2 1AR63 2KA3A 3OBTA 3N9LA 4QU2A 4JQTA 4LHLA 3VBHA 1PIV1 4XFIA 5KC6A 3UGFA 1FMD1 1IG3A 1XOYA 3B01A 3BIWE 3N9MA 4WM7A 1NA1A 5G04L 3WDTA 4INDA 4RD7A 2WDBA 1RUJ1 1H2NA 4PT6A 1NLRA 4XILA 1CAVB 3AXDA 3GYDA 5EJ3A 4FI9A 4Y5SA 4CEYC 1LOGA 1UQXA 2RM23 2ZGNA 2YGMA 2EVXA 1DGRN 4GH4B 4KG8A 4W6YA 2PAMA 4AFAA 5FUNA 3EXUA 4Y24A 4IEZA 3K3OA 4YGCA 4TXWA 2VOWA 1ASJ2 3MW4A 4K8RB 2EXHA 1O3RA 3B93A 3FN9A 5L73A 2WAOA 2CAVA 1C5IA 1IPSA 1HB1A 2B46X 2ZX3A 1BVP1 2X29A 3IIIA 3LZZA 5FBJA 4CU8A 5I0SA 3TEYA 3O14A 2W9XA 4PF5A 3VBSC 5FTTC 3RZMA 2V73A 2E33A 1WCQA 4I0WB 3HOBA 3FUOA 3WG2A 2XHNA 1W8ZA 5KC5A 5HV4A 2QQPA 4LBKA 1K5JA 2VUJA 1R1ZA 5C9AC 1S1AA 2IUWA 1DDLA 3I3BA 1GICA 4AQ6A 3FLRA 5LRRA 4GIQA 2WQ8A 2CTVA 3D6EA 2VC9A 5T3NA 1OKOA 2FCVA 4E2QA 3WW1A 3CIHA 1WCDJ 4BDVB 5IW0A 3OF1A 1GZWB 1CJPA 2IFRA 3CJXA 2WZR3 1K5MC 2LUWA 4QB2A 3J7HA 4P9JA 5ACA3 5FPUA 2X8KA 4AGRA 1RMU1 2J1RA 4AI1A 4XACA 2XGXA 4CEYA 1ODMA 2G4IA 1YIFA 3N35A 4YM2A 2TNFA 3O0WA 4KGGA 5GZCA 2VW2A 3VB9A 3HJRA 2NQYA 4NIHA 1HRV2 3BVCA 4G9SB 5K0UB 1KFXL 1PMHX 2NPIA 3WF2A 1WWYA 4CCKA 5IVVA 1TME1 4EROA 5LA1A 2Q4SA 3N3HA 4IEVA 4JGYC 4F8AA 1LJ7A 1GWLA 2JG8B 4QXCA 3ROUA 3C8XA 4H55A 4AR2A 2ZEXA 4PIYA 3DYMA 4CP1A 1HQLA 3MW3A 5JCTA 1SDDB 2CV6A 2XJPA 4KL1A 4OYUA 4ASLA 2RMU1 4O61A 2JDYA 4K6BA 5LASA 3ZKYA 1ASJ3 5C9AA 5FZCA 5L36A 1QJFA 3U0ZA 4BYYA 2BVBA 1YIPA 1MS0A 1GYKA 1YFXA 2JKBA 2VH9A 3KZ4C 2VMIA 3RYKA 4AFBA 5L7OC 3FMGA 2W1WA 1OKQA 3SEPA 1QJU1 3QD6A 5T5OA 3UJOA 5A3MA 4WM8A 1AYM1 4GAZA 1NLQA 3IKWA 2UWBA 4L99A 4I01A 5D2AA 1X36A 2B8MA 1UNBA 1OOPC 2A3XA 2DBNA 4BIOA 2DVBA 3KS7A 2WYFA 1AR81 2OUJA 5FWJA 1RVF1 2GNDA 1E5IA 1B35A 4P9GA 4Q27A 1FX5A 3VD5A 4NPMA 2NP0A 4NWWA 2PHTA 2YUEA 2ZX0A 3UT0A 4HMZA 1YHFA 4UFMA 4K9SA 5CFCB 1OQEA 3I2DA 4LHNA 4D7SA 4DEQA 3PURA 2VNVA 5GALA 1DCSA 3WQ0A 3AZVA 3NV3A 4TYSA 5A7QA 5CYYA 4OI4A 2PHUA 2WIIB 2EAAA 4YSFA 1S0JA 3N7KA 4JGYA 5F9TA 2AACA 2VAUA 1W0PA 3HD8B 2XJSA 3FZ3A 1DQ5A 2XR4A 1IKPA 4FPHA 4Q4X1 3CJIB 4S2DA 5C5UA 4QXHA 5KR7A 1L3JA 3SC7X 1VBA1 3VDAA 2WA3A 1VLNA 2JDHA 3MUZ1 4PDWC 5F6KA 4AHYA 4OI1A 4D6RA 1L7QA 1SLCA 2WO3A 1DF0A 3M3QA 2W87A 4FP3A 4J1WA 4QQLA 4XF4A 1H4HA 2PTMA 2AC1A 2VTXJ 1TE1B 3AMPA 4YNIA 5FZOA 4DY3A 4DY5A 3K2OA 1BMV2 3ZXGA 3VBHB 2BUKA 2VZSA 1QMJA 5L7OA 2VTXA 3POFA 1QU0A 3LD8A 3EYPA 3FL7A 4NJ4A 2CHHA 4ISRA 3VBOB 2ENRA 1VALA 1ULOA 1GV9A 1LOFA 1BXHA 4MSVA 3ZIWA 1OQ1A 3VV1A 1X50A 3RZLA 1PM4A 4XHXA 1OOPA 2P37A 1JYXA 4XF0A 3ZXAC 1OMIA 4MGQA 3KLSA 5ERLA 4TLGA 2R062 5JPNB 1PK6B 4AHZA 1AVBA 1WCSA 4ATFA 2YYOA 3PVOA 3JB8A 5EJ1B 1FATA 2W1UA 3VKNA 4AEDC 2P5BA 2Y6LA 3SMHA 1LGCA 4P08A 4DO0A 3WX5A 3ZR5A 1OF3A 1PZ9A 4YW6A 4A7YA 1VAKA 2BGCA 3PU3A 2XH6A 3PVBB 4QX2A 4LA3A 4BQXA 1Y9MA 1J1TA 2P3YA 3ACGA 5F37A 1H6XA 1NE4A 2UWAA 4XUQA 2J22A 3VLBB 4QX8A 2XL7A 5IK4A 1N1YA 2E31A 2AENA 3DECA 4LBNA 4PDWA 1JI6A 1MPXA 2RJ2A 3ZXFA 2YXSA 2VNGA 1FNYA 3PL0A 2BNOA 2VOTA 2QKDA 5F3IA 4ASMB 5JZGB 3K3NA 1US2A 3TEXA 3RWNA 2VPVA 1NX9A 1OXCA 4FPCA 2JB8A 4LOTA 2LW8A 3LA7A 1GP4A 2IXJA 2BP6A 2QQJA 3USUB 2QUOA 3M3CA 4BPZA 2ZHKA 4LK6A 3KV5A 4QWNA 3OEAA 5KBFA 2HWF2 2RDQA 3SXWA 4D0QA 2CDPA 2RS12 2FMDA 4MOAA 2UYBA 1X9TA 3MZHA 3QH6A 1W05A 4JZRA 4XE9A 5BV6A 3PLQA 1IQAA 3KT1A 1WD3A 1PZ8A 1VBD2 3DL3A 3VGIA 3B9IA 1AX1A 2Z2SB 5A7OA 2L9LA 5FK7A 2G1MA 4Q5OA 5BYNA 4JDNA 3JXSA 4LBLA 3VZJA 4CVUA 3CMGA 2E63A 4K1ZA 4OMCA 1U5YA 2BGOA 1ZRRA 2QZ2A 4RQPA 1RGSA 3I2GA 4AAXA 5LB6A 4EJRA 3GDBA 2V09A 2WT2A 3J8F1 5ABJB 3H50A 2X53S 2JKXA 4HLTA 1CZSA 5DG1A 2R063 3SKVA 2ZEZA 2YV8A 3AJYA 2MEV3 2JDUA 3GZEA 4R9CA 5FWEA 4TSVA 1UW8A 1ZBA1 4LTAA 3SITA 1LB2A 1UX6A 5DN2A 1OFNA 4H7LA 2HWD1 3MIEA 5IUQA 2PXJA 3RZJA 1ONAA 1WMEA 2RG4A 1D4M2 4IV1A 4FFIA 1GZTA 1G6NA 1JW6A 3OJBA 5FZLA 1ACCA 1O5UA 4AVTA 3W58A 4XQDA 4C0BA 2JDKA 5BNPB 5JPMB 3I49A 1KRIA 4NOTA 1OC1A 1H30A 4IXLA 2ZGQA 4CZSA 5CVRA 3KHBA 4LUMA 3I59A 1CAXB 1H2LA 1B35B 1E5SA 3G6JB 5JMOA 3VD4A 3MF9A 1SMVA 1RUH3 1MEC1 5FY8A 3GXUA 1Z0HA 1N1VA 3D82A 3QBQA 4FOWA 4UT5A 1EPWA 1W8UA 2ZGLA 3IIAA 4WVWA 4YW3A 2XJQA 2GMEA 2R072 2J1EA 4QPIC 1JZ3A 4OLLA 2R0HA 4R4ZA 1ULCA 4NHXA 3RSJA 4A41A 3O7OA 2D5HA 4BLIA 1MZ5A 1IQDC 4AI3A 4C8DA 5F1RA 2VZUA 1RUC1 2BERA 4H3WA 1NCRC 5CKQA 1AUYA 5FYBA 5A1FA 3WNNA 2V4VA 5LA9A 5FO7B 4NWVA 4WVVA 3EMRA 2HWF3 3IB3A 1QJEA 4N90A 2RS13 2EIDA 5HI0A 1ULEA 1UYPA 3O0XA 4R9AA 2EALA 4I0BA 5FUPA 4QPGC 1NY71 2KR2A 1VBD3 4D3WA 5LK7B 2OX0A 1YO8A 5E1RA 1W2UA 2F4LA 2DUOA 3POIA 3VZKA 3TEZA 1LHVA 2GNMA 4XTPA 4PI0A 5LA2A 1YQ6A 2VULA 4L0PA 3U11A 1WGPA 1AR91 5CKMA 4UW6A 2DURA 5FLIA 1Y9GA 5EFUA 5JDBA 1VRH2 2MNGA 4XCAA 3R4SA 4HPKA 2FZ2A 1YFUA 5A7NA 1YLLA 4DIQA 1TNRA 2R32A 4M3CB 5KHIA 4KWUA 5FLHA 4OQ9A 3ZFFC 1Q8VA 1D0GA 3QCWA 4CDWB 4FQZA 1JU3A 2BDRA 5C71A 1LNSA 2KD7A 2Q5TA 1QDOA 3BODA 3LCPA 1D4M3 1W2TA 1MZ6A 1AL21 1QXRA 4HK8A 2ZX1A 3SQOA 2DVAA 3PIJA 4GWJA 3HQRA 4KU7A 4HVQA 2HJIA 4LBOA 5BNNA 3V0AB 2F6BA 1AZDA 2IXLA 4LO6B 2OPWA 4NHLA 4EZHA 4K20A 4X8NA 2Y6GA 1NCRA 3X29B 1QGLA 4PI2A 5FOJB 3OSDA 4XZPA 4DOUA 2O8OA 2H6BA 2DYCA 4YZ3A 5AC92 5KXBA 3WDXA 4IE6A 3U78A 1JYWA 1GKBA 1V6MA 1W6NA 3DV8A 2XG3A 2VCAA 2R073 1SHWB 2BNMA 3OD0A 3RI9A 3SH5A 3BCWA 1HRI2 3HT2A 3PNAA 2A73B 2X5IB 2N7GA 4FFGA 4IE5A 4Z1VA 4NAMA 4MLOA 5B4XA 5A7WB 1PHMA 1LOAA 4TN7A 4DB5A 1JYVA 2YC4A 2OIIA 1XNDA 4FOVA 3MIBA 3IPVB 4LXLA 1PIV2 3K75B 1BYHA 4JGZC 3WW4A 1FMD2 3J7MA 1ND3A 4A45A 1Q8PA 3BOWA 5DXDA 1WLTA 2HWE1 3EHKA 4Z92B 4JQRA 1RUJ2 3MV11 5KHGA 2DTYA 3GALA 1H1IA 4OHZA 3ZFFA 5JSRA 4DRVA 4Y5Z0 1LGNA 5BXXA 2VUAA 3WP4A 2WA4A 3NJVA 3VBRA 2K46A 4Q0UA 2WAAA 3RYPA 3WW2A 2MHFA 4FFFA 1VRH3 3RMYA 1YWKA 1LEDA 2ZBJA 3JBG2 2VZRA 1KQRA 1S2KA 4TLFA 4HKLA 3GM8A 4IEQA 4CEWA 1W6PB 3T08A 4A44A 1X8MA 2JXAA 3PDQA 3RNSA 3HVDA 3FLPA 1QJX1 3IDEA 2JDNA 4I3PA 4LIUA 2BRTA 4KU8A 2ZGMA 4EWDA 1RUE1 3NWKA 1XJAA 2UURA 1ULDA 1W6MB 5A32A 3KT4A 1U5XA 4IV1B 3DXUA 4PJYA 5APAA 3EBRA 3S0MA 4N53A 3ZFGC 3BPZA 4RS5B 1ZRIA 2BQPA 4URTA 3ZKUA 4AVSA 3ITQA 3ZYPA 4CP0A 3LDKA 1O3SA 1CAUA 5JWPA 3AJZA 3WP5A 3JD71 3DPRC 3I3QA 3B3QE 3I59B 5F32A 1G7YA 3I4IA 4Q4Y3 3O1TA 1X33A 3P1IA 4JGZA 4ZY9A 1QOTA 2W91A 5AC93 1LOEA 2XVLA 3H8UA 4QX0A 1XXNA 1OUXA 2GC2A 4P5YA 3SCHA 4HOOA 3BI3A 1RMU2 3B02A 1HRI3 1Z78A 3EO6A 1LULA 3GCWA 2ZMNA 3LQCA 3UGGA 5B4NA 5GZFA 1G9DA 2JDMA 4ZXKA 3B7MA 2VMHA 4MX3A 3PVNA 4N43C 4FXGB 4ONUA 4V2VA 5FZKA 3IT8A 4AI9A 3N7MA 1PGL1 2YGLA 3PUQA 2QZ3A 1PIV3 4Q4V1 5FXVA 2WNEA 4Y22A 1FMD3 1TME2 4NVPA 3U37A 1N1TA 1O59A 1BBT1 5DAVA 5JI7A 1RUJ3 3A0KA 1JZ7A 3KHCA 2YG0A 2K9ZA 3JCIA 2ZACA 4CP9A 2RS31 4L97A 4BK4A 4CEWB 1PO11 5FPLA 4ZU5A 2AGSA 3CLPA 5FY1A 5KXEA 4YG3A 3Q8AA 1J3PA 2E7TA 1RUG1 1OT5A 2P1BA 2IWGB 1H1MA 3LF7A 3JBG3 1VBE1 3ZFGA 3MLLA 3VDCA 1KITA 4CA9A 2WNUA 1UD1A 1UO9A 1QJU2 5F3EA 5I0UA 2DTWA 1AYM2 2V5YA 4A4AA 3AP6A 3DPRA 2PHFA 3ZN6B 4FOQA 4MGKE 4PBPA 3AYAA 2HWB2 1KXGA 4FPJA 4A3XA 2C6SA 2TUNA 3FFZA 1EPZA 2B4KA 3WT3A 1K12A 1AR82 5JUVA 2V72A 1RVF2 3K4DA 5DMYA 2QTWB 3KGZA 2ID4A 5FJKA 4W6WA 1GSLA 1W9SA 2PHWA 2QQNA 4S2GA 3O1UA 2VQUA 2JG9C 3E5XA 5J98B 1W39A 5FMOS 1O4ZA 5JR7B 1Q8SA 2XL9A 3GGLA 4N43A 1UZ0A 1EV11 4FFHA 3TRSB 4JDMA 5IVFA 5E89A 4Q0QA 5IK8A 1ZX5A 4E2SA 4LT5A 2QCSB 3I3EA 3VBUC 3GHMA 4FCAA 1R081 4WZFA 2VW1A 4KWJA 5A1LA 2GZWA 1GUIA 3OTFA 1DGWX 1TZOA 1UKRA 4AW7A 4AWDA 1ZA4A 4R9DA 1RMU3 3HNMA 3NJXA 1OQDA 4FVVA 4Q4X2 4ES9A 2WS91 1VBA2 1HB2A 4LPLA 4R52A 2GAUA 1NCQA 1S0FA 1W90A 4MG2A 4CCEA 4WVMB 3OPZA 3POEA 2LRPA 4MXWB 3SKJE 4DXZA 5C70A 5CIRA 1TME3 2ZA9A 1ENXA 4IEOA 4M0HA 4QKBA 3WZ1A 1BQPA 4MGTA 3WF1A 5DZEA 3JBG1 2ZX2A 2Y34A 1W6OA 1NE6A 2UWCA 1O8SA 4QQPA 1H9PA 3M3IA 2FDGA 5ISLA 4X6RB 1C1LA 3TNPB 4DQAA 4E2GA 2BWCA 3BKZA 1UF2C 4NROA 1Q43A 5H9PA 3O5SA 3Q8EA 4SBVA 3ACFA 5DZGA 4BXSV 2W94A 4QQ2A 4XQ4A 1LKNA 3CHXA 2JG9A 1SBFA 4XBNA 1JU4A 4XYXA 2VMDA 3ES1A 3OUJA 4RL7A 1QJU3 2VM9A 5LBFA 3E5QA 3B5LB 2ZGSA 4E4DX 1AYM3 5FO9B 2WUHA 5DUUA 3RS6A 3D4KA 2HWB3 3VBUA 4ORFA 1AR83 4GJZA 5FFOC 1Q56A 1OVSA 1RVF3 2YHJA 4RN5A 4NIGA 3HEIA 1EAH1 4YM0A 5L9BA 3BIEA 3MYXA 2A3WA 4UW4A 3CU7A 3VHNA 3TWIA 4Z82A 3IAQA 5FO8B 2R6QA 1H4GA 4QX5A 4ZPIA 5BNOB 3VD7A 5LEKA 4KBZA 3OD4A 2DWRA 3MBWA 4YVWA 5C8CB 3SCGA 1CN1A 3W9AA 1MZEA 1D2QA 1H1AA 2K0GA 3JZVA 4OUMA 2A6XA 1NG0A 1ZZCA 3S57A 3P3NA 4AVCA 1XSRA 4YRDA 1WLDA 4XBLA 2FDKA 3H3LA 1WBFA 2PQSA 5FZ9A 4Q4X3 1POV1 3O1OA 1SFYA 3KSCA 1VBA3 2GSYA 2QQVA 5A3WA 2WO2A 2RHPA 1UIJA 3SHRA 2BTVC 4Q1RA 1CPMA 4YG0A 3FFQA 3S5AA 1FV3A 1ND2C 4HETA 2AEZA 4HXCA 4JVAA 2ATFA 4C0HA 1LHUA 2ZOEB 1QQP1 1NQJA 1I9RA 1C8NA 2TEPA 3NO8A 1LCLA 4HANA 1GP6A 2H0VA 2YC2A 3BN6A 4LORA 4OUSA 2ORXA 4UFHA 3A22A 5IVYA 2NZ9A 3OY8B 4OHYA 4JCKA 2JECA 3IZOA 4IEUA 2VZTA 3CJIC 3DUIA 2ZGRA 2IXHA 1XYPA 5A6XA 2VZPA 1ZBA2 3ZLIA 4LO4B 2HWD2 4XAAA 1JUHA 3U14A 2FBEA 2DCJA 4HT1T 4MADA 5F5IA 2XLFA 3AX4A 4O7XA 3DKWA 1AJKA 3BYWA 4UXAA 3R4UA 2NN8A 4LBMA 3VBFC 4Y4RA 4BE3A 5FYTA 1VMHA 1COV1 2Q1ZB 2YFUA 4B4RA 3MEPA 4CPBA 2R49A 2D6KA 2W92A 3AXEA 2I2SA 2Y8KA 2BYVE 1MEC2 2ZHNA 5FZBA 5CADA 4LKDA 5A3LA 1PM7A 2NMOA 2VBDA 2JE7A 3RVHA 2CGPA 1C57A 2ZXQA 4LLOA 4QMAA 3CNAA 5H9QA 5T5PA 3WY6A 1ND2A 1O3QA 1Q5OA 2I45A 1WA4A 3POBA 4IUGA 1BEV1 1YQ5A 1HXS1 1W8TA 1WKYA 2JICA 2WO1A 2XDVA 1RUC2 3AB0A 3IDAA 4HKWA 5KHKA 2DF7A 3C7HA 4QX7A 2VMGA 3LIGA 4N9IA 2WINB 5C4WB 2CYFA 4NRMA 1V70A 1XSQA 3HR9A 2GP5A 4XJ8A 1XU1A 4B3NA 4CDUB 1C8M1 4ZU7A 2DCKA 3NW4A 1G9CA 3NJZA 5D1IA 4AFMA 4LNVA 4XFBA 3KV6A 5DZFA 2XQXA 1NY72 5T52A 4FBFA 1Y3TA 2I07B 1OFSA 1MQTA 4IGOA 4E8DA 4NHMA 1CD3G 3LAGA 3AFGA 5IFTA 1GFF2 2P3IA 3ZR6A 2W47A 3RZHA 1AR92 4ASKA 4E4SA 4NPLA 5CNAA 5DDJ1 2VCBA 4AQSA 4BISA 5A33A 3VHPA 1VBB1 4FTBA 2R1BA 3UNPA 3MGUA 3VBFA 4IV3C 3MPPG 2OXBA 1BLZA 1PVC1 4LKSA 4XIKA 3RRDA 2WNVB 4EN9B 1ZBA3 3NNFA 1OURA 3MLKA 3ZSEA 1O5LA 4CCOA 2HWD3 5CAZA 4IDZA 1IS3A 1SLIA 2OPKA 1XNBA 4KI5M 3TEWA 5JXJA 4DNYA 2D98A 3K46A 3ETPA 4AXOA 3WP6A 2D93A 2E6VA 3T3YA 1O4YA 1W6QB 2RJLA 3E6CC 2JB4A 3ILFA 2BV4A 4META 4MYEA 4YW7A 4CUBA 5ABJC 2FCTA 1GNHA 4NR1A 1ZRCA 2RS51 1FAYA 3G7DA 1MEC3 3LEMA 4G4FA 1ZRFA 1WBLA 2XKOA 3V64A 3INAA 4AI0A 3BGAA 2VCMA 3C3VA 5HCFA 4E27A 1JYIA 4PCRA 2ZHMA 1VE0A 2OVUA 3OOXA 4PLOA 1VP6A 1OD3A 1FT9A 4XJUA 3WLUA 3HIFA 3LKJA 2OZJA 2AH2A 3MI8A 3WOGA 3K51A 1JHNA 2W1QA 3OUHA 5FV3A 5IJRA 4CDQC 5IT6A 1RUC3 2XKPA 4Y20B 5BNPC 4JV4A 3KT7A 1YFWA 3MF6A 4LR4A 3VBSA 1H8TC 3MV01 1GNZA 1YI9A 3KF5A 2PYTA 4CP2A 2ZGKA 2F4PA 2HWE2 4C90A 4DPNA 2VNRA 4IV3A 2ZGPA 2ZHLA 4XXAA 1N3QA 1F8VA 3HMYA 3DEMA 1W99A 4I0AA 4NPRA 5AFEA 3JQWA 2Y26A 3H8OA 3QH7A 2O1QA 1SLBA 1AR93 2A6WA 2HWC1 3M3OA 3IDCB 4BJ0A 2DBIA 4RR3B 2GH8A 1VAMA 2FZ1A 2KXLA 3CDZB 4AHXA 1A34A 1LECA 2WT1A 1K5MA 5FAXA 4EN0A 3R6SA 5SV8A 4J25A 3VKMA 4JKLA 5F5AA 3AKPA 1MS1A 1JYCA 5HBAA 2PA7A 4YM1A 1QJX2 1OI6A 2WFPA 2XVGA 3GJBA 4LA2A 4X8PA 4OQ8A 1RUE2 1I5PA 1AR71 1M4WA 1XNKA 3LFMA 3PJYA 4CCCA 1RL3A 3T2QA 1SBDA 3POWA 4Q8LA 2JIJA 1OLQA 1XNTA 1REDA 2ARAA 5HCBA 4YVSB 2W95A 3TN91 4XUTA 1CX4A 4WV8A 4D6QA 2XONA 4FQ4A 4GKXA 1YXWA 4CDXB 5T5LA 3EJKA 3B00A 1JN2P 3JD72 1DG6A 3C7OA 4JRLA 4XHBA 1NAEA 3Q9OA 2JDAA 1H8TA 4XUNA 1V00A 3ZDSA 4ZHNA 5HPOA 4P9IA 5CA6A 4EN7B 2VQTA 1POV0 2WN2A 4CDWC 3JU9A 1U5IA 3HPNA 2BGPA 3LPFA 3SLIA 2A6ZA 3RPQA 5FOBB 2OYZA 4XDQA 5FYZA 2RR12 5FYUA 1DP0A 1OHFA 5FZDA 3P6BA 3I54A 4GJYA 4PQ9A 4WM7B 1PGL2 1NA1B 4A6OA 2A75A 2VVFA 3D3AA 5FZ4A 5DAXA 3SCFA 5C3PA 1WMXA 1Y43B 4Q4V2 4O9GA 1HLCA 1UZYA 1AF9A 3ILRA 2E51A 3POJA 4QM8A 3W21A 1KD7A 3ZYJB 4BXFA 2HWE3 1BBT2 3GZAA 4I02A 4CU6A 4R8HA 4BK5A 5FDBA 1GWMA 2D6PA 2XJVA 4HKOA 1XQNA 4Q0VA 1W9YA 2RS32 1D2SA 1PO12 2MEV2 4Y5TA 5FMBA 2XPJA 3TBDA 1S4CA 5EYXA 1RUG2 3W20A 2VU9A 2XWJB 1AXYA 5FKCA 1VBE2 3DF0A 4Z2AA 2IXIA 5FBZA 5BNQA 2HBTA 2XOMA 3M70A 5FCCA 2QVSB 2XLAA 1W8NA 1ZM1A 4PQQA 1T6BX 1WCKA 4GZ9A 3CZUA 1CGPA 1QJX3 2W5FA 3KGLA 3HT1A 3LWCA 3PUHA 2E26A 2RV9A 2B39A 5FLJA 1RUE3 2B42B 1S2BA 1HX6A 1W8FA 3I2KA 3N7JA 3OYWA 4B4PA 4BMBA 3H9AA 1FNZA 1RUH2 5IK5A 4Q0PA 1LODA 4GB32 3WF4A 1H2MA 5E8AA 3UYJA 1UN1A 2VE1A 1JS9A 3OPWA 4P9LA 3VZLA 4FPYA 3JD73 2VXRA 1AXZA 1OPMA 4EYUA 2JE9A 4LUKA 3ST7A 1GWKA 3D0JA 3ABZA 4NO4A 1R082 2PAEA 1RXFA 1XRUA 2CWSA 5FZ0A 3ACIA 5A3PA 3NSTA 5JIUA 4CEYB 1UKGA 1JH5A 2VMEA 5DG2A 4AI2A 3IDBB 3ORJA 4YARA 1RIRA 2ADDA 2C4XA 2IXCA 2PLV1 3E1F1 5FZGA 3RJRA 5JXHA 2D6NA 4CUCA 2RR13 4NRQA 2WS92 3OPTA 1GP5A 3F95A 4GMP1 1W2OA 4N7UA 3M1HA 4OUEA 5F2SA 2W08A 4AEDA 3C7FA 1IS6A 4QD2A 2VVDA 1KJRA 3KV4A 3S6PA 3T0BA 4Q4V3 4LHKA 1NQDA 5D8AC 4COYA 5FZMA 3WQBA 5A3OA 2ZEYA 5FZ1A 1BBT3 1GR3A 2VZ1A 4NUBA 2GNTA 2HEVF 4W65A 1JZ4A 4YZ1A 2Q1FA 2ZKLA 2RS33 4ZONA 3ZIXA 3ZXDA 4YGBA 5C9AB 4GKYA 5IAVA 5C3OA 1PO13 4KH9A 1SLAA 3H1YA 1PMJX 3AP5A 2JX9A 2X09A 3L2HA 5A7SA 1SFNA 3THDA 4CCMA 1RUG3 5K4LA 5JAXA 1WLCA 3LEGA 4ITCA 1DQ0A 4D69A 3AVRA 1VBE3 1R1A1 3CQOA 4WM8B 2W39A 3WG3A 2G9ZA 5D21A 1SLTA 1PO21 2P2KA 3ZYFA 1AJOA 1POQA 2J1UA 2EAKA 5DAQA 5DPNA 2QBXA 2TBVA 2ADEA 4YZ5A 3AMMA 3K4AA 3NAPC 3TAYA 2QNKA 3RJ2X 3WDWA 3VDBA 4YW1A 3CF6E 3NNMA 5H9RA 4PBOA 1EAH2 2VZVA 4QX3A 4EQVA 4QHZA 4GB33 3U4XA 3HBKA 2QQIA 4EWAA 3LPGA 1QH6A 4XEZA 1S0BA 2A5ZA 4RA0A 4DMIA 1C28A 1XC6A 4ISQA 2D6LX 3QACA 2ZMKA 1IGOA 3NVCA 1SFPA 1J58A 4GWMA 4JGYB 1UY1A 2ZJCA 3HNYM 5EWSA 3SEEA 1LAJA 5KHHA 5D8AA 3D8CA 1R083 2BBVA 4QQHA 5CB7A 1ODNA 2WSVA 1D4VB 1VR3A 3THCA 4ZZ5A 2DFBA 3CL1A 4NMIA 5FZOB 1BCXA 2WS93 5FZHA 4QX1A 1HN1A 1ZZ7A 2VJXA 5EP9A 4GWNA 4NIDA 2EA7A 3AYCA 5L7OB 2LS6A 3ALQA 3ECQA 3MIHA 3OGVA 5I91A 5CISA 2DVDA 5FYSA 4Q2FA 1QQP2 5C33A 2AYHA 1ULFA 4BMEA 1OOPB 3LOIA 4CXYA 3SISA 4QPWA 1PNFA 3AKSA 2R041 3UESA 1C5HA 4EN6B 3ZSMA 5LEJA 3WEZA 3H3ZA 3IM0A 3WCRA 1MS3A 4E4HA 1WW4A 3VL8A 2G9GA 3NAPA 2GC1A 3UKVA 4D8MA 1Q8OA 2BFUL 3LA2A 1DYPA 1GBGA 3KCXA 2UY9A 1I3HA 1UXZA 4UYBA 4LLFA 5C5TA 5GLVA 3LB9A 1R64A 2ZGTA 4QPIA 1ENSA 2V5DA 3I3DA 5HV0A 4P9YA 1D7PM 3TOJA 3FHQA 4QHOA 5L9VA 2ES3A 3VDDA 1FPN1 3WCSA 4HBNA 1W06A 3GBGA 3GCXA 4CRQA 3FBMA 3QLQA 5GM0A 4CYDA 1ENRA 1XBFA 1DLLA 3HQUA 3T2TA 1IG0A 4Q4Y2 2CSGA 2BVVA 1EAH3 4LK7A 1NKGA 4XFCA 4PDWB 4ZS3A 1COV2 3I2IA 4QGLA 1SZBA 4QPGA 1QJZA 2FDJA 4JHTA 4BM8A 5FIXA 4B7EA 5FP4A 5FZ8A 1BK0A 1H6YA 3T1MA 4CTEA 1BKZA 2YDEA 1OA3A 5I8TA 5F5CA 4IE4A 4ARXA 3APBA 3I97A 3IMNA 3POYA 4AHWA 1BEV2 4ATEA 1JMUB 1ZVFA 1J83A 1HXS2 3LGRA 5T5JA 2EIEA 5T54A 1POV3 4Y1XA 1X9PA 3WF3A 1VAVA 3AP4A 3TB0A 2HKXA 3WNPA 1HW5A 2XXZA 2FDIA 1C8M2 1RYYA 2GALA 1CJDA 4FSJA 4KBBA 3POSA 1HRV1 3U1XA 2OQ7A 1C4RA 1RUF1 4LBQA 1JUIA 4Y33A 5BNOC 4RQPB 1YRZA 4UFIA 3T2OA 5LATA 1QQP3 3N36A 4A6SA 5CFDC 5T50A 3ZYIB 1W9TA 4XUPA 1CONA 4MGYE 2B9VA 4B1LA 2GH2A 1T2XA 2J1SA 2YC0A 3LDBA 5FZFA 1UOBA 5GZGA 2Q1MA 2Y6KA 5DDJ2 2FHRA 3ZFEC 2O0OA 3HAGA 4UF0A 1VBB2 1UU6A 3E97A 5A3NA 3WQ7A 1W3XA 2VOKA 1NXD1 4D7YA 3KQRA 4V1PA 2ZABA 1PVC2 1GQPA 4AAPA 2XJRA 2D5FA 2ZEWA 3E6DA 4E4ZA 1DGLA 4XF3A 2Q8DA 4FPEA 4XJ9A 5GKAC 3VHOA 5JI9A 4XOGA 3FBYA 4KWKA 3A4UA 3O1RA 1YUDA 1HB4A 3PMSA 4QDQA 2X10A 4XDPA 4PLMA 4ZS2A 2ETEA 2C9KA 5SV5A 3LOBA 1HV1A 4HVRA 4H2AA 2RJKA 3MO4A 4XQWA 1JOJA 1COV3 3OCPA 4Q1PA 2PMWB 1A78A 1Z7S1 3IBMA 4UBHA 4XURA 4JRAA 2RS52 3PIGA 1N1SA 3RI8A 2E7QA 4XZUG 4J6GA 3B69A 3H3UA 4AVAA 5I0TA 3NNGA 1LGBA 1O91A 3N9OA 4QB6A 5EZWA 1RTVA 3T30A 3FC0A 4Y1ZA 1G9BA 4Z2WA 3T4HB 2ZAAA 1BEV3 5CFDA 3V56A 4DUXA 4AQTA 1HXS3 2AREA 5GZDA 1PX4A 1Y4WA 2VTFA 3OUIA 4MZUA 2XJUA 1YCIA 3FJSA 4QU1A 1QXJA 3ON7A 4BQ4A 5JOYA 2BOJA 1C8M3 3HN3A 3ZFEA 4DRRA 2W68A 4CCLA 1V6OA 2GN7A 1LU1A 4ZU4A 3K4ZA 4GWIA 2RMU2 4YYOA 1S2EA 4X6QB 3ZYBA 2GN3A 2OA2A 1DFQA 3GJAA 4A7KA 2CL2A 1XNCA 4HPKB 1LR5A 1RUI1 3ZMNA 4A3ZA 1UL9A 1US3A 2YU2A 3KCYA 2FDHA 2HWC2 5DDJ3 1ZZ8A 3KQ4B 2QQLA 2W2IA 1VBB3 2J7MA 2OZ6A 2V4AA 4YG6A 3RFRA 4LO5B 1CWPA 3LDRA 3ZPOA 1XE0A 5KXDA 1DU3D 1PVC3 1UY0A 3L2YA 2CDOA 3LFIA 4AOCA 5I8SA 3V0BA 2R30A 5FMCA 1XE8A 5FQ0A 4IEYA 1NLSA 4GH4C 5BY5A 3T09A 3ZSKA 4LKFA 2OKXA 1A8MA 1LHNA 5BNNB 4E9KA 4QM9A 2XB6C 1URXA 1ZBE1 5J96B 1IHMA 1SCSA 1PMIA 1C3HA 4KWLA 2WYSA 3MIFA 3Q8FA 1NCRB 2VZQA 3TN92 3VKLA 4ZZ8A 3P5BA 5EHDA 4YGEA 1V6NA 4DEVA 4M01A 1ALYA 2A6YA 3AVSA 1APNA 1QHDA 2Y6HA 4HK9A 2IVJA 4XXPA 3LSEA 5EIYB 3URFA 1W6NB 2RS53 3AMQA 1UZZA 3ZX7A 3PU8A 1MVQA 1UCXA 2C1FA 2PFWA 5I0RA 1GLHA 2P6CA 2WLPA 3AKQA 1JZ6A 3H1MA 1CAWA 3HQXA 2WL1A 5FP7A 2YBPA 3WV6A 3PMEA 4U2AA 3ES4A 1T6GC 1H0BA 5A3UA 1ND3B 4XAEA 2XVKA 4XF9A 4OVEA 1LESA 2VXJA 2DVFA 3ZMOA 3VZMA 2HWF1 3A7QA 4LO7A 4LIVA 4BQWA 2Y6JA 4JDOA 3ZFFB 1CAVA 1CZTA 2RMU3 2D97A 2ZKNA 4RYDA 3VBRB 3KVAA 5C3QA 4LBJA 4GH4A 4RFT0 3ETQA 1RUOA 2ERFA 3LSDA 2Q30A 3MFCA 2VL4A 5IVBA 1F9KA 2DCTA 5K0UC 4QKDA 5IAXA 2HWC3 1LHOA 3M7AA 1WCUA 4I09A 1F5FA 2YFZA 4AG4A 3CZJA 5KWRA 3HWJA 2JG8C 2QJVA 4MGSA 4MV2A 5DUXA 3TNQA 4D6SA 1NXMA 5LY1A 3PUAA 3H8XA 1SPPA 2WC2A 4CCDA 2Y60A 5A70A 5JMCA 3PJQA 1GQHA 5A32B 2WN3A 4YW2A 1OSGA 1UOJA 5F5QA 2VY0A 3KV9A 1JZ2A 4R9BA 4N53B 1TVGA 1AR73 3BTAA 3RZZA 1CQ9A 5FXZA 1CVNA 2A3YA 3AMNA 5LBEA 4UAPA 1CAUB 5LWBA 3KCCA 3MFAA 5L9RA 2JDZA 2QE3A 4YPJA 3ZXLA 4AEMA 3O1VA 3TN93 3BTYA 1NYWA 3U4SA 4COUA 3PHMA 2Z69A 2FQPA 4JGZB 4NIIA 4PIZA 1GZWA 1S0GA 1XPWA 3N9QA 3RZGA 4W4ZA 4BQ3A 4URAA 2WSUA 4P02B 2WJSA 1YQCA 5LBBA 2RVAA 5K8SA 4BU2A 4V2WA 3WG1A 3UJQA 2QFEA 2P6HA 1MS5A 3N7LA 3MHZA 3NV1A 2B7YA 1RUD1 3SH3A 2PLV2 5A6YA 1HJGA 1HIXA 1S0IA 3POGA 1SDWA 2RDSA 3F2ZA 5CFCC 3VHRA 2C24A 4Y22B 2J1TA 4Q8KA 4QT6A 1UZVA 4FPFA 1OLMA 3ATGA 1LHWA 4YVSC 1V6IA 5K0UA 3WW3A 3BTXA 3T4VA 1HQWA 1O7FA 1VIWB 2VMFA 1W04A 1YC61 2P34A 3H7JA 1ST8A 4QGMA 4EWEA 4C91A 1OH3A 4CP9B 3ZYHA 3V65A 2JG8A 3PTRB 3J8F2 3RYRA 1UOGA 3ZN4A 2XQRA 3E5UA 5JSPA 5DUVA 1OLRA 5IHRA 1X7NA 5KXCA 4L11A 2AEYA 2ILMA 4KQ7A 3ASIA 3WG4A 4MGZE 1E5HA 2DUPA 3ZFGB 3B9CA 4LQRA 4OHWA 4HFSA 3VBHC 2WNUB 4KMQA 2ZTNA 1R1A2 4WM7C 3VBOC 1TMF1 1JOPA 3DPRB 4LHSA 2D6MA 4WVZA 4DZGA 3I2OA 2UU8A 4CPBD 1PO22 2A7AA 2PHXA 2YMZA 1R091 1IZ3A 4XCBA 3RWKX 1SEFA 3W59A 1V0AA 1SQ4A 1J3RA 3ZVXA 3PVEA 4MGIE 2Y0IA 1QKQA 3OGRA 1W0NA 2DV9A 3NL1A 1PK6C 1UU4A 2Y33A 2XBO1 4N43B 4LITA 3FHAA 5FP8A 2GU9A 1DGWA 5CFCA 1WLWA 2VOXA 3ILNA 3KM5A 1CX1A 4AFCA 1FYUA 1JXNA 1DZRA 4NIAA 1VPHA 2BJSA 2D43A 3JB4C 1AYN1 1X8EA 1QJY1 1RJ8A 2Q8OA 1F35A 4QPYA 4XFFA 3B94A 5FYIA 3S5QA 4TTGA 5FJHA 4I2OA 3ZPYA 2JWPA 2CU5A 4B7KA 4EZ4A 2Y38A 5LCWL 1GOFA 1NCQB 2PLV3 3CJIA 3AZZA 1OA4A 3RDIA 4B8EA 1RHI1 4BCUA 1RJ7A 2GNBA 3J4UH 1LU2A 4GMP3 3AL6A 1ZA7A 1NUKA 3WUCA 4GA9A 5AVPA 3N9NA 2WQ4A 5JZGC 4XDOA 4M4RA 1E57A 1ZZ9A 4DXSA 4IQPA 3AFKA 1V6JA 1W6OB 5GJ6A 3VBOA 2D3RA 2HH9A 3J8F3 3LIHA 1QDCA 2B9UA 4A42A 2DCYA 2R042 4CU9A 3FLTA 1OH4A 2ZZJA 3GZTB 4Q0SA 3W5MA 4NHYA 5CU1A 1OUSA 4EN8B 2MPFA 4FAGA 2EIBA 3NQHA 4UW5A 2FDFA 5GLTA 1JTZX 1DQ6A 2DDUA 3LEKA 5F39A 5FZEA 2JG9B 1PK6A 1W2AX 5I93A 1GOGA 2BU9A 1IPJA 1GNYA 1AL22 1KEXA 2DCZA 1R1A3 4PF1A 3VD9A 4YLZA 1U5ZA 4Q4W1 2NMNA 2EF6A 1PO23 4DUWA 3O0VA 3VBUB 5CBLA 1UMIA 1SPPB 2HEWF 5LZ6A 4P14A 4LOSA 1FPN2 1V6KA 2LM3A 4HZFA 1G9FA 4DFSA 4H7MA 2RDRA 1VRBA 2A6VA 1QEXA 5JOXA 3N9PA 1QY4A 4Y1YA 1G8WA 4YW5A 1UYXA 4CXWA 4B4QA 1LENA 3EQEA 4YVWB 2D3PA 3LEIA 5A80A 3VZNA 4WM8C 2WT0A 1HN0A 1MACA 4L9BA 4XJAA 3WNLA 4DXTA 3OBAA 5GLUA 5GLZA 5JZGA 5FK8A 4YM3A 2JDPA 4DXRA 1SBEA 2B45X 5E6HA 3RMXA 2GC0A 2ZCWA 3UETA 4J1XA 2VO5A 1B35C 3H8RA 3USUA 1OLME 2VUCA 4B1MA 4JTNA 3MICA 5FPZA 4MH0E 3LA3A 2A1XA 1RC6A 2WQZC 1KJLA 1RXGA 4B29A 1AL0G 5EXOA 1J59A 5A6QA 1JHJA 1GMMA 1RUF2 4IE7A 2UYAA 5HXVA 2D3SA 1SLLA 4BQ1A 3OBRA 1XE7A 4QKFA 5FZIA 1RUNA 2FMYA 4HSLA 1RB8G 5DABA 1PVXA 1IKQA 4D7TA 1JODA 2QDRA 2R043 2BBAA 3MW2A 4W6XA 4XIOA 5FY5A 1ZYBA 3DGTA 5FYVA 1QOOA 5ABJA 2PHDA 2VBPA 1JOBA 1Y9QA 3AK0A 4D94A 1H9WA 2GP3A 3M3EA 4XABA 4AEJA 2WLQA 2WBKA 1ULGA 4FXKB 4IE0A 1FOD1 1AL23 3J7NA 3WHTA 5C8WA 3WNMA 5EV7A 3BALA 1VMFA 4COVA 4QGNA 3ZSLA 4DS0A 4FTEA 5FYCA 1LOFC 4CDQA 2HEYF 1FPN3 3K48A 4O9EA 5IK7A 3KVBA 1VJ2A 4LE4A 5BNPA 3GF6A 2HWB1 4O65A 1EP0A 3ZDVA 1O8PA 3AP7A 3BU7A 1TQ5A 4BIFA 1YJKA 3RZKA 1CAXA 4BQYA 3D0SA 1TNFA 2CGOA 3IN9A 5JSOA 1Z7S2 2K2SA 5IYYA 1VBC1 1DLCA 4RHV1 1BZWA 2HYXA 1ND2B 1REFA 4P9WA 1QNWA 1DZQA 4DINB 2WFF1 1RINA 1EY2A 1QF3A 1OA2A 3VKOA 5A7PA 5K7PA 3USSA 1H2KA 1DZTA 1TG7A 3AM2A 1W2NA 1YNAA 4K1YA 1UMZA 1TEIA 1KFUL 1IOAA 5FXXA 2QQUA 3WXPA 2WNOA 3FX3A 3FWEA 1V9U1 4UWDA 3ZYRA 1KDKA 1C1FA 5CG9A 4BA6A 3UKTA 1HV0A 3VKFC 1MQTB 2IVIB 1HRV3 2OS2A 1HDKA 1RUF3 4K7JA 5AVAA 1JYNA 2XMLA 1GQGA 2OQ6A 2X5IC 1YEWA 2C26A 4IESA 4JAAA 5LK5A 5C6CA 3O1SA 4PIXA 2P17A 3THTA 5A33B 1QOSA 1RUI2 1W28A 3VBFB 4E8CA 2LTNA 2ZGOA 3A0NA 4LEJA 4IETA 5H9SA 3ZXJA 1S55A 3V0BB 2WWUA 5J1XA 3AP9A 4M3CA 2AZ5A 1DQ2A 4ARYA 3ELNA 3NRUA 1PX3A 4CDWA 1O6UA 2AR6A 1ZRDA 4FPKA 5J7MA 1F2NA 3O12A 4OZOA 5FPAA 3NJYA 3AKRA 4UI9L 4YZ2A 4RQPC 2ARCA 1ZBE2 3DYPA 2DU0A 2ARBA 5CEHA 1EV12 3V0AA 1FXZA 2R0FA 2FD8A 1O4TA 2W46A 3L9JT 4QQOA 3AC0A 2VUDA 1PGSA 3CBNA 2VW0A 4L8QA 4JHZA 3NKTA 3OBZA 1MVEA 3OGGA 4JKKA 1IS5A 2YB7A 4KNCA 4XMIA 1Z7S3 1HJFA 3C7EA 2E53A 2ZAHA 1DYKA 5JXIA 5BUVA 2OT7A 3WNKA 1DYOA 4IV1C 3U75A 4UOJA 2B5HA 2NYYA 2IZWA 4XJZA 1K45A 3WP3A 1UIKA 3QOPA 1F15A 1AR61 1UYZA 2YZ4A 4RS5C 3M2MA 4LO8A 3WINE 1JZ5A 2X5IA 3DKQA 3OB8A 5A7WA 3VBSB 3AKTA 1XU2A 1WD4A 2BNNA 3U10A 3T2PA 3ZYGA 3IPVA 1EUUA 1AHSA 3GBWA 3CEWA 3NV4A 4IV3B 4N9HA 5FY7A 3RGBA 3S7EA 4Z8BA 5A6ZA 1LEMA 1W03A 4AYUA 5M0TA 2RM21 3AYDA 5FP9A 4QHBA 1XYNA 1NZCA 4BH9A 1BK1A 1G9AA 5C7GA 3MIDA 3IAPA 5F6LB 4MHUA 3WQ1A 3T0AA 1YFYA 3KMHA 1RUI3 2ET1A 3HNBM 4JC1A 4G3YC 4QB1A 5FY0A 2R16A 1K5MB 4C1WA 2QDNA 1VB4A 2HYKA 2Y64A 4XPVA 1HQNA 5FRAA 4QXKA 4XC9A 3I7DA 4XTMA 1YQ2A 2ET7A 1W6PA 3NNLA 5FMOL 2JJ6A 2VNOA 5AFBA 4QAWA 2X05A 4CEWC 5TSWA 2PELA 3I8TA 1LOCA 4N8MA 5IVCA 1NOVA 2D6OX 3WR0A 1W6MA 1ZBE3 2QQMA 3LE0A 3OGJA 2GC3A 2KM2A 2XWBB 4AQ2A 1EV13 4YFWA 1DGRA 1Q3EA 5EJZB 4CDQB 4RS5A 4F7ZA 1U0AA 1YI7A 3VZOA 2CNAA 1YYNA 3ZM8A 1QNYA 2UY8A 2VG9A 2EICA 2WZR1 1H8TB 2WZPP 3ZXEA 3ZSJA 4XVHA 4CDXC 4BHPA 1N3PA 4AF9A 3M8LA 5ACA1 5FREA 3BOPA 4BQ5A 4IEXA 2J1VA 2BOIA 4S2HA 2E7AA 2VOVA 5BNNC 1PGW1 3W5NA 1RUD2 4NHKA 4AGVA 1Q8QA 5DAPA 4XFGA 1DBNA 3NMBA 3JQXA 2DUQA 4UFKA 3UK9A 2EXIA 5FY9A 4BLJA 1UX7A 4LJHA 5IVEA 1J1LA 3DCQA 1ENQA 3R4DB 5FMDA 4CU7A 5FPVA 4NE9A 4IW3A 4A7ZA 5I0DA 1S0DA 1W3VA 3AL5A 4CUGA 4XF1A 2PHRA 1GU3A 1UXXX 2AUYA 3AZYA 1ASJ1 1J3QA 3D5OA 4Y4YA 5FXWA 2QQOA 3ZN5A 1SCRA 1EYBA 1W9WA 5G05L 5JXGA 1WZXA 3WDYA 4LMFA 4M00A 2PN5A 1I6XA 5FUIA 3S30A 3IMMA 3SNMA 4AI8A 4EE2A 4M3CE 4GXLA 2Z4FA 4AFDA 2HBUA 1LRHA 1UU5A 3NNJA 1JYTA 4JTOA 1WA6X 1H8VA 1ND3C 2WKKA 3UV9A 1UOFA 1HKDA 1TMF2 5DUWA 4KGQA 5KHJA 1ZNPA 3CKHA 3OYWB 1R092 4TWTA 2YPJA 3WSOA 3ZN6A 4YFZA 1GOHA 1OBNA 3BB6A 1QH7A 4I30A 2ARXA 4AL9A 1LOBA 5FYMA 2DFCA 4IGPA 4FPGA 3GZUC 5HCAA 2Q8EA 1YQ8A 2GMPA 4AVVA 2DVGA 1UZWA 1XB9A 5LRSA 3H42B 5T55A 2XBO2 2P4EA 3NV2A 4AVBA 2A71A 4IEPA 2VVEA 2Q0AA 4LULA 3O1PA 3OEBA 4S2FA 2LALA 3VN4A 4MO3M 5FKBA 2VZ3A 4JKMA 4OHVA 4CCNA 1J84A 4YZ4A 4FAHA 5FZ7A 1AYN2 2VD7A 1QJY2 3KWVA 4XUOA 4P9XA 4Y26A 1V6LA 3VL9A 3VUOA 4LBQD 4PLNA 2C9AA 2D7FA 4HVOA 1MS8A 1RUD3 1ZZ6A 2C5DA 4N53C 4AEDB 3AZXA 2P3KA 3BUCA 1RHI2 3C2UA 1CIYA 1VMJA 4K8FA 5LY2A 5HXMA 4OZXA 2G9FA 2Z79A 3J26N 3PUSA 3N4MA 5C8CC 4WVMA 3KD4A 4MXWA 5A1AA 2C0ZA 3WDUA 1W8WA 4LKEA 1CIWA 1KDMA 1S0CA 1OPOA 1PNGA 4Y1UA 5DAWA 1NZIA 1XYOA 4K3UA 5LW9A 4XW3A 3Q8BA 4K21A 2JD4A 3Q8CA 4OFGA 2LROA 4MHRA 4I3GA 3S7IA 2G19A 4AK3A 3PUIA 4AEKA 1AXKA 4NRPA 5F7UA 4M3CF 1LTEA 3O1MA 1MS4A 2YROA 4BB3A 5L19A 2W0XA 3K77A 3TYJA 4WZCA 1UPSA 4XBQA 1TMF3 1UWWA 3WNOA 2Z42A 4Q4W2 3RQ0A 4TZDA 3AZWA 4Q29A 2XJTA 1P8JA 1R093 2PAKA 1L7LA 5ANQA 2BPA2 3OG2A 4OMDA 3ZOIA 4UFJA 3WF0A 5C3RA 3T0DA 4FO9A 3ME2A 4UBGA 2XUEA 3A21A 1WW7A 2XBO3 1WUVA 1SG3A 3WUDA 4ZXEA 1UY3A 1W0OA 3WHUA 2R7EB 5CKNA 3J9SA 4GMP0 2WNUC 4FP2A 5LBCA 5BNOA 5D8AB 5J36A 1S0EA 3R05A 5C8CA 4QDRA 4COWA 4FTSA 2R1DA 4F83A 3WVJA 1BHGA 2VR4A 4M0NA 1AYN3 5FYYA 1QJY3 2EXJA 4GALA 4XMAA 5GZEA 4QXBA 1DIWA 2D40A 1SACA 3UL2A 2HLEA 2YBKA 2PQQA 1X82A 3VBRC 5FR3A 1RHI3 1UY4A 3AYEA 2RR11 4FOYA 1BMV1 1FI2A 2ZGUA 4N7IA 3A23A 5FPBA 3R0RA 3C7GA 5IATA 2BW8A 1DQ4A 4Q26A 4ET7A 3J7LA 5EYYA 2VGDA 3SH4A 5J37A 1CR7A 1QXPA 2YBSA 3BTZA 1GANA 4W8JA 1U12A 2ORZA 5C4WC 1UPIA 3ENRA 4WBBA 5C3SA 1STMA 3NAPB 1IPKA 5K9YA 5FZ3A 2D44A 2WO7A 2R061 2XLGA 2W1SA 2WZEA 3OY8A 3WNXA 4CDUC 4CCJA 2MEV1 4QKNA 3KB5A 5J09A 3WD5A 3E6BA 1NCQC 2IC1A 4W50A 3CO2A 5E88A 4QPIB 3VDDC 1AR72 1UYYA 5F3CA 1FOD2 2E9QA 1QIQA 1GZ9A 1W9FA 2O14A 3GNEA 2DU1A 5GLWA 3VDDB 2QQKA 1REEA 4Q4W3 3H1WA 1CPNA 3ZO0B 2ZPXA 4R4XA 1EUTA 3ACLA 2JD9A 2WR9A 4COZA 4YWAA 1G86A 5I8YA 1F4HA 3I2HA 3I2FA 2VZOA 3RG0A 4YW4A 2VQ0A 4QPGB 1KGYA 1RUH1 2CY6A 1WW5A 1BJQA 2J42A 2WNVC 1CZVA 2RE9A 4CSWA 4RGAA 1MS9A 4OCTA 4MUVA 4GB31 4OI0A 3DN7A 3UKNA 2Z5WA 1A6CA 1VBC2 4RHV2 5EQUA 1I5ZA 4FPLA 4L2NA 4P00B 2WWSA 5E16A 1W8HA 2WFF2 4OULA 3EB7A 4BZ4A 2RDNA 1OF4A 3OGSA 4F3JA 1KS5A 1F5JA 2IXKA 2W52A 1K3IA 2RS11 5HCHA 1WMDA 2ZS6B 1IS4A 1ULPA 5C4WA 2J1AA 4XETA 1OD5A 4IL7A 5IVJA 4IEWA 4CDUA 1VBD1 1V9U2 4LBQB 4L92A 5J3UA 1DQ1A 5JR2A 3GHNA 5J48A 2NLRA 4YVWC 4HL0A 1L7RA 2BWAA 4IERA 4BOWA 4C1XA 2OUHA 5IWFA 3HBZA 2GDFA 3MLJA 1I1EA 2YPDA 4Y3OA 3PTYA 2NM1A 5FPXA 1AX2A 4UF0B 2A70A 4RGGA 2VCCA 5JLVA 4UFLA 1RITA 4AGGA 4CE8A 2YY1A 3M4FA 1KS4A 2IFWA 5FZAA 1DHKB 2WNVA 1FOD3 2CAUA 2EXKA 1D4M1 3GBFA 4RSUA 2Q8CA 5IFPA 2XUMA 4MVTA 1A8DA 4IGQA 4SLIA 4A2UA 4GULA 4JX0A 4AZZA 2VBBA 5F2WA 1JZ8A 1HB3A 2BFUS 2VQAA 3FHIB 1GZCA 2E32A 4RR3C 5F8PA 2SBAA 3FE5A 5FP3A 3THPA 3IWZA 1W6QA 1F31A 4LE3A 3DYOA 5BPXA 2I74A 1A3KA 2O8QA 3P3PA 4FT8A 5CZKA 2BEOA 3BPSA 5LA0A 5JOZA 2R071 1VBC3 1CESA 4RHV3 1F4AA 4AE2A 3U07A 4U36A 2JIGA 5EPAA 3T1LA 1ZZBA 2Y0OA 2JE8A 2WFF3 2CGNA 3HN1A 5CFDB 1AX0A 5FYHA 1AR62 3JUUA 3FUQA 2WABA 3KF3A 4RFRB 3UGHA 2ZZQA 5B2GB 3H0OA 4P5HA 3MDPA 1VB2A 5JVVA 4NN0A 2XHKA 1D0HA 1YJLA 4HSJA 4Y20A 1OVPA 2JENA 3ZFEB 3BU0A 3ACHA 5JIAA 2JEMA 4NAOA 1N47A 3WDVA 4H14A 1JBCA 3MUY1 5FY4A 3H7YA 1QWRA 1V9U3 4KG0A 4HONA 1UMHA 2SLIA 1N3OA 2GMMA 2RM22 5ANNA 1M06G 4YGDA 2EIGA 4CXXA 4K40A 1K42A 1FV2A 2Y6FA 2CWMA 2OW4A 5JOWA 4QDSA 1VRH1 4XJWA 4GD4A 1NA1C 2WWJA 4BQ2A 2H0BA 2PHLA 4PHZA 1MZFA 5DQ0A 1PZ7A 2YU1A 4RR3A 4HN1A 1B09A 2W3JA 1O3TA 4HG6B 4XFHA 5FQ0B 4EV0A
chains in the Genus database with same CATH topology
4QKDA 3RZKA 3S57A 3T3YA 2FDKA 3O1OA 4NIDA 3H8XA 4O61A 4CXYA 3S5AA 4NRPA 3I3MA 4IE6A 3T4HB 2FDFA 3O1VA 3BTYA 4IE5A 4NIIA 3O1UA 3RZGA 4NPMA 3O1SA 4QHOA 3RZJA 4O7XA 3H8OA 2FDHA 4NRQA 4CXWA 4ZS3A 3BTXA 3I49A 3T4VA 3KHBA 2FDJA 4JHTA 4MG2A 5F8PA 4QKBA 4IE4A 3RZMA 3H8RA 2FD8A 3LFMA 4MGTA 4NJ4A 2FDGA 2FDIA 3BKZA 3RZLA 4NROA 4NRMA 2IUWA 3I2OA 3BTZA 4IE7A 3O1MA 4QKFA 4RFRB 4ZHNA 3I3QA 5DABA 4QKNA 3O1TA 3BU0A 3RZHA 3BUCA 3BI3A 3O1PA 4IE0A 4NPLA 4NIGA 3BIEA 4CXXA 4NIHA 3O1RA 4IDZA 3KHCA 4ZS2A 4OCTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QKD A;  3RZK A;  3S57 A;  3T3Y A;  2FDK A;  3O1O A;  4NID A;  3H8X A;  4O61 A;  4CXY A;  3S5A A;  4NRP A;  3I3M A;  4IE6 A;  3T4H B;  2FDF A;  3O1V A;  3BTY A;  4IE5 A;  4NII A;  3O1U A;  3RZG A;  4NPM A;  3O1S A;  4QHO A;  3RZJ A;  4O7X A;  3H8O A;  2FDH A;  4NRQ A;  4CXW A;  4ZS3 A;  3BTX A;  3I49 A;  3T4V A;  3KHB A;  2FDJ A;  4JHT A;  4MG2 A;  5F8P A;  4QKB A;  4IE4 A;  3RZM A;  3H8R A;  2FD8 A;  3LFM A;  4MGT A;  4NJ4 A;  2FDG A;  2FDI A;  3BKZ A;  3RZL A;  4NRO A;  4NRM A;  2IUW A;  3I2O A;  3BTZ A;  4IE7 A;  3O1M A;  4QKF A;  4RFR B;  4ZHN A;  3I3Q A;  5DAB A;  4QKN A;  3O1T A;  3BU0 A;  3RZH A;  3BUC A;  3BI3 A;  3O1P A;  4IE0 A;  4NPL A;  4NIG A;  3BIE A;  4CXX A;  4NIH A;  3O1R A;  4IDZ A;  3KHC A;  4ZS2 A;  4OCT A; 
#chains in the Genus database with same CATH topology
 4XFA A;  1WW6 A;  1BVV A;  5CG8 A;  4ZKT B;  1MQT C;  2VEC A;  4DUV A;  3AMH A;  1Y7B A;  2ZML A;  3MPB A;  4GQ7 A;  4HN0 A;  4BWO A;  1UY2 A;  4ES8 A;  2QQW A;  1WMF A;  1MR5 A;  4YVS A;  2H6C A;  5A3T A;  4Z07 A;  2WRA A;  3I3M A;  4Q4Y 1;  4Y1V A;  2WZR 2;  1NT0 A;  1ZRE A;  4CDX A;  1E5R A;  4CUA A;  3MIG A;  5AC9 1;  2P3J A;  4OHX A;  2BZD A;  2ZX4 A;  2F17 A;  5ACA 2;  1UAI A;  5F3G A;  2WZ8 A;  4UW3 A;  2VMC A;  4M4P A;  5FZ6 A;  3ZXK A;  2FCU A;  1HRI 1;  3I2J A;  3DXT A;  1CAW B;  1XNA A;  3NKG A;  4MXV A;  4FPO B;  4OI2 A;  4RGK A;  1W8O A;  3VD3 A;  1PGW 2;  1AR6 3;  2KA3 A;  3OBT A;  3N9L A;  4QU2 A;  4JQT A;  4LHL A;  3VBH A;  1PIV 1;  4XFI A;  5KC6 A;  3UGF A;  1FMD 1;  1IG3 A;  1XOY A;  3B01 A;  3BIW E;  3N9M A;  4WM7 A;  1NA1 A;  5G04 L;  3WDT A;  4IND A;  4RD7 A;  2WDB A;  1RUJ 1;  1H2N A;  4PT6 A;  1NLR A;  4XIL A;  1CAV B;  3AXD A;  3GYD A;  5EJ3 A;  4FI9 A;  4Y5S A;  4CEY C;  1LOG A;  1UQX A;  2RM2 3;  2ZGN A;  2YGM A;  2EVX A;  1DGR N;  4GH4 B;  4KG8 A;  4W6Y A;  2PAM A;  4AFA A;  5FUN A;  3EXU A;  4Y24 A;  4IEZ A;  3K3O A;  4YGC A;  4TXW A;  2VOW A;  1ASJ 2;  3MW4 A;  4K8R B;  2EXH A;  1O3R A;  3B93 A;  3FN9 A;  5L73 A;  2WAO A;  2CAV A;  1C5I A;  1IPS A;  1HB1 A;  2B46 X;  2ZX3 A;  1BVP 1;  2X29 A;  3III A;  3LZZ A;  5FBJ A;  4CU8 A;  5I0S A;  3TEY A;  3O14 A;  2W9X A;  4PF5 A;  3VBS C;  5FTT C;  3RZM A;  2V73 A;  2E33 A;  1WCQ A;  4I0W B;  3HOB A;  3FUO A;  3WG2 A;  2XHN A;  1W8Z A;  5KC5 A;  5HV4 A;  2QQP A;  4LBK A;  1K5J A;  2VUJ A;  1R1Z A;  5C9A C;  1S1A A;  2IUW A;  1DDL A;  3I3B A;  1GIC A;  4AQ6 A;  3FLR A;  5LRR A;  4GIQ A;  2WQ8 A;  2CTV A;  3D6E A;  2VC9 A;  5T3N A;  1OKO A;  2FCV A;  4E2Q A;  3WW1 A;  3CIH A;  1WCD J;  4BDV B;  5IW0 A;  3OF1 A;  1GZW B;  1CJP A;  2IFR A;  3CJX A;  2WZR 3;  1K5M C;  2LUW A;  4QB2 A;  3J7H A;  4P9J A;  5ACA 3;  5FPU A;  2X8K A;  4AGR A;  1RMU 1;  2J1R A;  4AI1 A;  4XAC A;  2XGX A;  4CEY A;  1ODM A;  2G4I A;  1YIF A;  3N35 A;  4YM2 A;  2TNF A;  3O0W A;  4KGG A;  5GZC A;  2VW2 A;  3VB9 A;  3HJR A;  2NQY A;  4NIH A;  1HRV 2;  3BVC A;  4G9S B;  5K0U B;  1KFX L;  1PMH X;  2NPI A;  3WF2 A;  1WWY A;  4CCK A;  5IVV A;  1TME 1;  4ERO A;  5LA1 A;  2Q4S A;  3N3H A;  4IEV A;  4JGY C;  4F8A A;  1LJ7 A;  1GWL A;  2JG8 B;  4QXC A;  3ROU A;  3C8X A;  4H55 A;  4AR2 A;  2ZEX A;  4PIY A;  3DYM A;  4CP1 A;  1HQL A;  3MW3 A;  5JCT A;  1SDD B;  2CV6 A;  2XJP A;  4KL1 A;  4OYU A;  4ASL A;  2RMU 1;  4O61 A;  2JDY A;  4K6B A;  5LAS A;  3ZKY A;  1ASJ 3;  5C9A A;  5FZC A;  5L36 A;  1QJF A;  3U0Z A;  4BYY A;  2BVB A;  1YIP A;  1MS0 A;  1GYK A;  1YFX A;  2JKB A;  2VH9 A;  3KZ4 C;  2VMI A;  3RYK A;  4AFB A;  5L7O C;  3FMG A;  2W1W A;  1OKQ A;  3SEP A;  1QJU 1;  3QD6 A;  5T5O A;  3UJO A;  5A3M A;  4WM8 A;  1AYM 1;  4GAZ A;  1NLQ A;  3IKW A;  2UWB A;  4L99 A;  4I01 A;  5D2A A;  1X36 A;  2B8M A;  1UNB A;  1OOP C;  2A3X A;  2DBN A;  4BIO A;  2DVB A;  3KS7 A;  2WYF A;  1AR8 1;  2OUJ A;  5FWJ A;  1RVF 1;  2GND A;  1E5I A;  1B35 A;  4P9G A;  4Q27 A;  1FX5 A;  3VD5 A;  4NPM A;  2NP0 A;  4NWW A;  2PHT A;  2YUE A;  2ZX0 A;  3UT0 A;  4HMZ A;  1YHF A;  4UFM A;  4K9S A;  5CFC B;  1OQE A;  3I2D A;  4LHN A;  4D7S A;  4DEQ A;  3PUR A;  2VNV A;  5GAL A;  1DCS A;  3WQ0 A;  3AZV A;  3NV3 A;  4TYS A;  5A7Q A;  5CYY A;  4OI4 A;  2PHU A;  2WII B;  2EAA A;  4YSF A;  1S0J A;  3N7K A;  4JGY A;  5F9T A;  2AAC A;  2VAU A;  1W0P A;  3HD8 B;  2XJS A;  3FZ3 A;  1DQ5 A;  2XR4 A;  1IKP A;  4FPH A;  4Q4X 1;  3CJI B;  4S2D A;  5C5U A;  4QXH A;  5KR7 A;  1L3J A;  3SC7 X;  1VBA 1;  3VDA A;  2WA3 A;  1VLN A;  2JDH A;  3MUZ 1;  4PDW C;  5F6K A;  4AHY A;  4OI1 A;  4D6R A;  1L7Q A;  1SLC A;  2WO3 A;  1DF0 A;  3M3Q A;  2W87 A;  4FP3 A;  4J1W A;  4QQL A;  4XF4 A;  1H4H A;  2PTM A;  2AC1 A;  2VTX J;  1TE1 B;  3AMP A;  4YNI A;  5FZO A;  4DY3 A;  4DY5 A;  3K2O A;  1BMV 2;  3ZXG A;  3VBH B;  2BUK A;  2VZS A;  1QMJ A;  5L7O A;  2VTX A;  3POF A;  1QU0 A;  3LD8 A;  3EYP A;  3FL7 A;  4NJ4 A;  2CHH A;  4ISR A;  3VBO B;  2ENR A;  1VAL A;  1ULO A;  1GV9 A;  1LOF A;  1BXH A;  4MSV A;  3ZIW A;  1OQ1 A;  3VV1 A;  1X50 A;  3RZL A;  1PM4 A;  4XHX A;  1OOP A;  2P37 A;  1JYX A;  4XF0 A;  3ZXA C;  1OMI A;  4MGQ A;  3KLS A;  5ERL A;  4TLG A;  2R06 2;  5JPN B;  1PK6 B;  4AHZ A;  1AVB A;  1WCS A;  4ATF A;  2YYO A;  3PVO A;  3JB8 A;  5EJ1 B;  1FAT A;  2W1U A;  3VKN A;  4AED C;  2P5B A;  2Y6L A;  3SMH A;  1LGC A;  4P08 A;  4DO0 A;  3WX5 A;  3ZR5 A;  1OF3 A;  1PZ9 A;  4YW6 A;  4A7Y A;  1VAK A;  2BGC A;  3PU3 A;  2XH6 A;  3PVB B;  4QX2 A;  4LA3 A;  4BQX A;  1Y9M A;  1J1T A;  2P3Y A;  3ACG A;  5F37 A;  1H6X A;  1NE4 A;  2UWA A;  4XUQ A;  2J22 A;  3VLB B;  4QX8 A;  2XL7 A;  5IK4 A;  1N1Y A;  2E31 A;  2AEN A;  3DEC A;  4LBN A;  4PDW A;  1JI6 A;  1MPX A;  2RJ2 A;  3ZXF A;  2YXS A;  2VNG A;  1FNY A;  3PL0 A;  2BNO A;  2VOT A;  2QKD A;  5F3I A;  4ASM B;  5JZG B;  3K3N A;  1US2 A;  3TEX A;  3RWN A;  2VPV A;  1NX9 A;  1OXC A;  4FPC A;  2JB8 A;  4LOT A;  2LW8 A;  3LA7 A;  1GP4 A;  2IXJ A;  2BP6 A;  2QQJ A;  3USU B;  2QUO A;  3M3C A;  4BPZ A;  2ZHK A;  4LK6 A;  3KV5 A;  4QWN A;  3OEA A;  5KBF A;  2HWF 2;  2RDQ A;  3SXW A;  4D0Q A;  2CDP A;  2RS1 2;  2FMD A;  4MOA A;  2UYB A;  1X9T A;  3MZH A;  3QH6 A;  1W05 A;  4JZR A;  4XE9 A;  5BV6 A;  3PLQ A;  1IQA A;  3KT1 A;  1WD3 A;  1PZ8 A;  1VBD 2;  3DL3 A;  3VGI A;  3B9I A;  1AX1 A;  2Z2S B;  5A7O A;  2L9L A;  5FK7 A;  2G1M A;  4Q5O A;  5BYN A;  4JDN A;  3JXS A;  4LBL A;  3VZJ A;  4CVU A;  3CMG A;  2E63 A;  4K1Z A;  4OMC A;  1U5Y A;  2BGO A;  1ZRR A;  2QZ2 A;  4RQP A;  1RGS A;  3I2G A;  4AAX A;  5LB6 A;  4EJR A;  3GDB A;  2V09 A;  2WT2 A;  3J8F 1;  5ABJ B;  3H50 A;  2X53 S;  2JKX A;  4HLT A;  1CZS A;  5DG1 A;  2R06 3;  3SKV A;  2ZEZ A;  2YV8 A;  3AJY A;  2MEV 3;  2JDU A;  3GZE A;  4R9C A;  5FWE A;  4TSV A;  1UW8 A;  1ZBA 1;  4LTA A;  3SIT A;  1LB2 A;  1UX6 A;  5DN2 A;  1OFN A;  4H7L A;  2HWD 1;  3MIE A;  5IUQ A;  2PXJ A;  3RZJ A;  1ONA A;  1WME A;  2RG4 A;  1D4M 2;  4IV1 A;  4FFI A;  1GZT A;  1G6N A;  1JW6 A;  3OJB A;  5FZL A;  1ACC A;  1O5U A;  4AVT A;  3W58 A;  4XQD A;  4C0B A;  2JDK A;  5BNP B;  5JPM B;  3I49 A;  1KRI A;  4NOT A;  1OC1 A;  1H30 A;  4IXL A;  2ZGQ A;  4CZS A;  5CVR A;  3KHB A;  4LUM A;  3I59 A;  1CAX B;  1H2L A;  1B35 B;  1E5S A;  3G6J B;  5JMO A;  3VD4 A;  3MF9 A;  1SMV A;  1RUH 3;  1MEC 1;  5FY8 A;  3GXU A;  1Z0H A;  1N1V A;  3D82 A;  3QBQ A;  4FOW A;  4UT5 A;  1EPW A;  1W8U A;  2ZGL A;  3IIA A;  4WVW A;  4YW3 A;  2XJQ A;  2GME A;  2R07 2;  2J1E A;  4QPI C;  1JZ3 A;  4OLL A;  2R0H A;  4R4Z A;  1ULC A;  4NHX A;  3RSJ A;  4A41 A;  3O7O A;  2D5H A;  4BLI A;  1MZ5 A;  1IQD C;  4AI3 A;  4C8D A;  5F1R A;  2VZU A;  1RUC 1;  2BER A;  4H3W A;  1NCR C;  5CKQ A;  1AUY A;  5FYB A;  5A1F A;  3WNN A;  2V4V A;  5LA9 A;  5FO7 B;  4NWV A;  4WVV A;  3EMR A;  2HWF 3;  3IB3 A;  1QJE A;  4N90 A;  2RS1 3;  2EID A;  5HI0 A;  1ULE A;  1UYP A;  3O0X A;  4R9A A;  2EAL A;  4I0B A;  5FUP A;  4QPG C;  1NY7 1;  2KR2 A;  1VBD 3;  4D3W A;  5LK7 B;  2OX0 A;  1YO8 A;  5E1R A;  1W2U A;  2F4L A;  2DUO A;  3POI A;  3VZK A;  3TEZ A;  1LHV A;  2GNM A;  4XTP A;  4PI0 A;  5LA2 A;  1YQ6 A;  2VUL A;  4L0P A;  3U11 A;  1WGP A;  1AR9 1;  5CKM A;  4UW6 A;  2DUR A;  5FLI A;  1Y9G A;  5EFU A;  5JDB A;  1VRH 2;  2MNG A;  4XCA A;  3R4S A;  4HPK A;  2FZ2 A;  1YFU A;  5A7N A;  1YLL A;  4DIQ A;  1TNR A;  2R32 A;  4M3C B;  5KHI A;  4KWU A;  5FLH A;  4OQ9 A;  3ZFF C;  1Q8V A;  1D0G A;  3QCW A;  4CDW B;  4FQZ A;  1JU3 A;  2BDR A;  5C71 A;  1LNS A;  2KD7 A;  2Q5T A;  1QDO A;  3BOD A;  3LCP A;  1D4M 3;  1W2T A;  1MZ6 A;  1AL2 1;  1QXR A;  4HK8 A;  2ZX1 A;  3SQO A;  2DVA A;  3PIJ A;  4GWJ A;  3HQR A;  4KU7 A;  4HVQ A;  2HJI A;  4LBO A;  5BNN A;  3V0A B;  2F6B A;  1AZD A;  2IXL A;  4LO6 B;  2OPW A;  4NHL A;  4EZH A;  4K20 A;  4X8N A;  2Y6G A;  1NCR A;  3X29 B;  1QGL A;  4PI2 A;  5FOJ B;  3OSD A;  4XZP A;  4DOU A;  2O8O A;  2H6B A;  2DYC A;  4YZ3 A;  5AC9 2;  5KXB A;  3WDX A;  4IE6 A;  3U78 A;  1JYW A;  1GKB A;  1V6M A;  1W6N A;  3DV8 A;  2XG3 A;  2VCA A;  2R07 3;  1SHW B;  2BNM A;  3OD0 A;  3RI9 A;  3SH5 A;  3BCW A;  1HRI 2;  3HT2 A;  3PNA A;  2A73 B;  2X5I B;  2N7G A;  4FFG A;  4IE5 A;  4Z1V A;  4NAM A;  4MLO A;  5B4X A;  5A7W B;  1PHM A;  1LOA A;  4TN7 A;  4DB5 A;  1JYV A;  2YC4 A;  2OII A;  1XND A;  4FOV A;  3MIB A;  3IPV B;  4LXL A;  1PIV 2;  3K75 B;  1BYH A;  4JGZ C;  3WW4 A;  1FMD 2;  3J7M A;  1ND3 A;  4A45 A;  1Q8P A;  3BOW A;  5DXD A;  1WLT A;  2HWE 1;  3EHK A;  4Z92 B;  4JQR A;  1RUJ 2;  3MV1 1;  5KHG A;  2DTY A;  3GAL A;  1H1I A;  4OHZ A;  3ZFF A;  5JSR A;  4DRV A;  4Y5Z 0;  1LGN A;  5BXX A;  2VUA A;  3WP4 A;  2WA4 A;  3NJV A;  3VBR A;  2K46 A;  4Q0U A;  2WAA A;  3RYP A;  3WW2 A;  2MHF A;  4FFF A;  1VRH 3;  3RMY A;  1YWK A;  1LED A;  2ZBJ A;  3JBG 2;  2VZR A;  1KQR A;  1S2K A;  4TLF A;  4HKL A;  3GM8 A;  4IEQ A;  4CEW A;  1W6P B;  3T08 A;  4A44 A;  1X8M A;  2JXA A;  3PDQ A;  3RNS A;  3HVD A;  3FLP A;  1QJX 1;  3IDE A;  2JDN A;  4I3P A;  4LIU A;  2BRT A;  4KU8 A;  2ZGM A;  4EWD A;  1RUE 1;  3NWK A;  1XJA A;  2UUR A;  1ULD A;  1W6M B;  5A32 A;  3KT4 A;  1U5X A;  4IV1 B;  3DXU A;  4PJY A;  5APA A;  3EBR A;  3S0M A;  4N53 A;  3ZFG C;  3BPZ A;  4RS5 B;  1ZRI A;  2BQP A;  4URT A;  3ZKU A;  4AVS A;  3ITQ A;  3ZYP A;  4CP0 A;  3LDK A;  1O3S A;  1CAU A;  5JWP A;  3AJZ A;  3WP5 A;  3JD7 1;  3DPR C;  3I3Q A;  3B3Q E;  3I59 B;  5F32 A;  1G7Y A;  3I4I A;  4Q4Y 3;  3O1T A;  1X33 A;  3P1I A;  4JGZ A;  4ZY9 A;  1QOT A;  2W91 A;  5AC9 3;  1LOE A;  2XVL A;  3H8U A;  4QX0 A;  1XXN A;  1OUX A;  2GC2 A;  4P5Y A;  3SCH A;  4HOO A;  3BI3 A;  1RMU 2;  3B02 A;  1HRI 3;  1Z78 A;  3EO6 A;  1LUL A;  3GCW A;  2ZMN A;  3LQC A;  3UGG A;  5B4N A;  5GZF A;  1G9D A;  2JDM A;  4ZXK A;  3B7M A;  2VMH A;  4MX3 A;  3PVN A;  4N43 C;  4FXG B;  4ONU A;  4V2V A;  5FZK A;  3IT8 A;  4AI9 A;  3N7M A;  1PGL 1;  2YGL A;  3PUQ A;  2QZ3 A;  1PIV 3;  4Q4V 1;  5FXV A;  2WNE A;  4Y22 A;  1FMD 3;  1TME 2;  4NVP A;  3U37 A;  1N1T A;  1O59 A;  1BBT 1;  5DAV A;  5JI7 A;  1RUJ 3;  3A0K A;  1JZ7 A;  3KHC A;  2YG0 A;  2K9Z A;  3JCI A;  2ZAC A;  4CP9 A;  2RS3 1;  4L97 A;  4BK4 A;  4CEW B;  1PO1 1;  5FPL A;  4ZU5 A;  2AGS A;  3CLP A;  5FY1 A;  5KXE A;  4YG3 A;  3Q8A A;  1J3P A;  2E7T A;  1RUG 1;  1OT5 A;  2P1B A;  2IWG B;  1H1M A;  3LF7 A;  3JBG 3;  1VBE 1;  3ZFG A;  3MLL A;  3VDC A;  1KIT A;  4CA9 A;  2WNU A;  1UD1 A;  1UO9 A;  1QJU 2;  5F3E A;  5I0U A;  2DTW A;  1AYM 2;  2V5Y A;  4A4A A;  3AP6 A;  3DPR A;  2PHF A;  3ZN6 B;  4FOQ A;  4MGK E;  4PBP A;  3AYA A;  2HWB 2;  1KXG A;  4FPJ A;  4A3X A;  2C6S A;  2TUN A;  3FFZ A;  1EPZ A;  2B4K A;  3WT3 A;  1K12 A;  1AR8 2;  5JUV A;  2V72 A;  1RVF 2;  3K4D A;  5DMY A;  2QTW B;  3KGZ A;  2ID4 A;  5FJK A;  4W6W A;  1GSL A;  1W9S A;  2PHW A;  2QQN A;  4S2G A;  3O1U A;  2VQU A;  2JG9 C;  3E5X A;  5J98 B;  1W39 A;  5FMO S;  1O4Z A;  5JR7 B;  1Q8S A;  2XL9 A;  3GGL A;  4N43 A;  1UZ0 A;  1EV1 1;  4FFH A;  3TRS B;  4JDM A;  5IVF A;  5E89 A;  4Q0Q A;  5IK8 A;  1ZX5 A;  4E2S A;  4LT5 A;  2QCS B;  3I3E A;  3VBU C;  3GHM A;  4FCA A;  1R08 1;  4WZF A;  2VW1 A;  4KWJ A;  5A1L A;  2GZW A;  1GUI A;  3OTF A;  1DGW X;  1TZO A;  1UKR A;  4AW7 A;  4AWD A;  1ZA4 A;  4R9D A;  1RMU 3;  3HNM A;  3NJX A;  1OQD A;  4FVV A;  4Q4X 2;  4ES9 A;  2WS9 1;  1VBA 2;  1HB2 A;  4LPL A;  4R52 A;  2GAU A;  1NCQ A;  1S0F A;  1W90 A;  4MG2 A;  4CCE A;  4WVM B;  3OPZ A;  3POE A;  2LRP A;  4MXW B;  3SKJ E;  4DXZ A;  5C70 A;  5CIR A;  1TME 3;  2ZA9 A;  1ENX A;  4IEO A;  4M0H A;  4QKB A;  3WZ1 A;  1BQP A;  4MGT A;  3WF1 A;  5DZE A;  3JBG 1;  2ZX2 A;  2Y34 A;  1W6O A;  1NE6 A;  2UWC A;  1O8S A;  4QQP A;  1H9P A;  3M3I A;  2FDG A;  5ISL A;  4X6R B;  1C1L A;  3TNP B;  4DQA A;  4E2G A;  2BWC A;  3BKZ A;  1UF2 C;  4NRO A;  1Q43 A;  5H9P A;  3O5S A;  3Q8E A;  4SBV A;  3ACF A;  5DZG A;  4BXS V;  2W94 A;  4QQ2 A;  4XQ4 A;  1LKN A;  3CHX A;  2JG9 A;  1SBF A;  4XBN A;  1JU4 A;  4XYX A;  2VMD A;  3ES1 A;  3OUJ A;  4RL7 A;  1QJU 3;  2VM9 A;  5LBF A;  3E5Q A;  3B5L B;  2ZGS A;  4E4D X;  1AYM 3;  5FO9 B;  2WUH A;  5DUU A;  3RS6 A;  3D4K A;  2HWB 3;  3VBU A;  4ORF A;  1AR8 3;  4GJZ A;  5FFO C;  1Q56 A;  1OVS A;  1RVF 3;  2YHJ A;  4RN5 A;  4NIG A;  3HEI A;  1EAH 1;  4YM0 A;  5L9B A;  3BIE A;  3MYX A;  2A3W A;  4UW4 A;  3CU7 A;  3VHN A;  3TWI A;  4Z82 A;  3IAQ A;  5FO8 B;  2R6Q A;  1H4G A;  4QX5 A;  4ZPI A;  5BNO B;  3VD7 A;  5LEK A;  4KBZ A;  3OD4 A;  2DWR A;  3MBW A;  4YVW A;  5C8C B;  3SCG A;  1CN1 A;  3W9A A;  1MZE A;  1D2Q A;  1H1A A;  2K0G A;  3JZV A;  4OUM A;  2A6X A;  1NG0 A;  1ZZC A;  3S57 A;  3P3N A;  4AVC A;  1XSR A;  4YRD A;  1WLD A;  4XBL A;  2FDK A;  3H3L A;  1WBF A;  2PQS A;  5FZ9 A;  4Q4X 3;  1POV 1;  3O1O A;  1SFY A;  3KSC A;  1VBA 3;  2GSY A;  2QQV A;  5A3W A;  2WO2 A;  2RHP A;  1UIJ A;  3SHR A;  2BTV C;  4Q1R A;  1CPM A;  4YG0 A;  3FFQ A;  3S5A A;  1FV3 A;  1ND2 C;  4HET A;  2AEZ A;  4HXC A;  4JVA A;  2ATF A;  4C0H A;  1LHU A;  2ZOE B;  1QQP 1;  1NQJ A;  1I9R A;  1C8N A;  2TEP A;  3NO8 A;  1LCL A;  4HAN A;  1GP6 A;  2H0V A;  2YC2 A;  3BN6 A;  4LOR A;  4OUS A;  2ORX A;  4UFH A;  3A22 A;  5IVY A;  2NZ9 A;  3OY8 B;  4OHY A;  4JCK A;  2JEC A;  3IZO A;  4IEU A;  2VZT A;  3CJI C;  3DUI A;  2ZGR A;  2IXH A;  1XYP A;  5A6X A;  2VZP A;  1ZBA 2;  3ZLI A;  4LO4 B;  2HWD 2;  4XAA A;  1JUH A;  3U14 A;  2FBE A;  2DCJ A;  4HT1 T;  4MAD A;  5F5I A;  2XLF A;  3AX4 A;  4O7X A;  3DKW A;  1AJK A;  3BYW A;  4UXA A;  3R4U A;  2NN8 A;  4LBM A;  3VBF C;  4Y4R A;  4BE3 A;  5FYT A;  1VMH A;  1COV 1;  2Q1Z B;  2YFU A;  4B4R A;  3MEP A;  4CPB A;  2R49 A;  2D6K A;  2W92 A;  3AXE A;  2I2S A;  2Y8K A;  2BYV E;  1MEC 2;  2ZHN A;  5FZB A;  5CAD A;  4LKD A;  5A3L A;  1PM7 A;  2NMO A;  2VBD A;  2JE7 A;  3RVH A;  2CGP A;  1C57 A;  2ZXQ A;  4LLO A;  4QMA A;  3CNA A;  5H9Q A;  5T5P A;  3WY6 A;  1ND2 A;  1O3Q A;  1Q5O A;  2I45 A;  1WA4 A;  3POB A;  4IUG A;  1BEV 1;  1YQ5 A;  1HXS 1;  1W8T A;  1WKY A;  2JIC A;  2WO1 A;  2XDV A;  1RUC 2;  3AB0 A;  3IDA A;  4HKW A;  5KHK A;  2DF7 A;  3C7H A;  4QX7 A;  2VMG A;  3LIG A;  4N9I A;  2WIN B;  5C4W B;  2CYF A;  4NRM A;  1V70 A;  1XSQ A;  3HR9 A;  2GP5 A;  4XJ8 A;  1XU1 A;  4B3N A;  4CDU B;  1C8M 1;  4ZU7 A;  2DCK A;  3NW4 A;  1G9C A;  3NJZ A;  5D1I A;  4AFM A;  4LNV A;  4XFB A;  3KV6 A;  5DZF A;  2XQX A;  1NY7 2;  5T52 A;  4FBF A;  1Y3T A;  2I07 B;  1OFS A;  1MQT A;  4IGO A;  4E8D A;  4NHM A;  1CD3 G;  3LAG A;  3AFG A;  5IFT A;  1GFF 2;  2P3I A;  3ZR6 A;  2W47 A;  3RZH A;  1AR9 2;  4ASK A;  4E4S A;  4NPL A;  5CNA A;  5DDJ 1;  2VCB A;  4AQS A;  4BIS A;  5A33 A;  3VHP A;  1VBB 1;  4FTB A;  2R1B A;  3UNP A;  3MGU A;  3VBF A;  4IV3 C;  3MPP G;  2OXB A;  1BLZ A;  1PVC 1;  4LKS A;  4XIK A;  3RRD A;  2WNV B;  4EN9 B;  1ZBA 3;  3NNF A;  1OUR A;  3MLK A;  3ZSE A;  1O5L A;  4CCO A;  2HWD 3;  5CAZ A;  4IDZ A;  1IS3 A;  1SLI A;  2OPK A;  1XNB A;  4KI5 M;  3TEW A;  5JXJ A;  4DNY A;  2D98 A;  3K46 A;  3ETP A;  4AXO A;  3WP6 A;  2D93 A;  2E6V A;  3T3Y A;  1O4Y A;  1W6Q B;  2RJL A;  3E6C C;  2JB4 A;  3ILF A;  2BV4 A;  4MET A;  4MYE A;  4YW7 A;  4CUB A;  5ABJ C;  2FCT A;  1GNH A;  4NR1 A;  1ZRC A;  2RS5 1;  1FAY A;  3G7D A;  1MEC 3;  3LEM A;  4G4F A;  1ZRF A;  1WBL A;  2XKO A;  3V64 A;  3INA A;  4AI0 A;  3BGA A;  2VCM A;  3C3V A;  5HCF A;  4E27 A;  1JYI A;  4PCR A;  2ZHM A;  1VE0 A;  2OVU A;  3OOX A;  4PLO A;  1VP6 A;  1OD3 A;  1FT9 A;  4XJU A;  3WLU A;  3HIF A;  3LKJ A;  2OZJ A;  2AH2 A;  3MI8 A;  3WOG A;  3K51 A;  1JHN A;  2W1Q A;  3OUH A;  5FV3 A;  5IJR A;  4CDQ C;  5IT6 A;  1RUC 3;  2XKP A;  4Y20 B;  5BNP C;  4JV4 A;  3KT7 A;  1YFW A;  3MF6 A;  4LR4 A;  3VBS A;  1H8T C;  3MV0 1;  1GNZ A;  1YI9 A;  3KF5 A;  2PYT A;  4CP2 A;  2ZGK A;  2F4P A;  2HWE 2;  4C90 A;  4DPN A;  2VNR A;  4IV3 A;  2ZGP A;  2ZHL A;  4XXA A;  1N3Q A;  1F8V A;  3HMY A;  3DEM A;  1W99 A;  4I0A A;  4NPR A;  5AFE A;  3JQW A;  2Y26 A;  3H8O A;  3QH7 A;  2O1Q A;  1SLB A;  1AR9 3;  2A6W A;  2HWC 1;  3M3O A;  3IDC B;  4BJ0 A;  2DBI A;  4RR3 B;  2GH8 A;  1VAM A;  2FZ1 A;  2KXL A;  3CDZ B;  4AHX A;  1A34 A;  1LEC A;  2WT1 A;  1K5M A;  5FAX A;  4EN0 A;  3R6S A;  5SV8 A;  4J25 A;  3VKM A;  4JKL A;  5F5A A;  3AKP A;  1MS1 A;  1JYC A;  5HBA A;  2PA7 A;  4YM1 A;  1QJX 2;  1OI6 A;  2WFP A;  2XVG A;  3GJB A;  4LA2 A;  4X8P A;  4OQ8 A;  1RUE 2;  1I5P A;  1AR7 1;  1M4W A;  1XNK A;  3LFM A;  3PJY A;  4CCC A;  1RL3 A;  3T2Q A;  1SBD A;  3POW A;  4Q8L A;  2JIJ A;  1OLQ A;  1XNT A;  1RED A;  2ARA A;  5HCB A;  4YVS B;  2W95 A;  3TN9 1;  4XUT A;  1CX4 A;  4WV8 A;  4D6Q A;  2XON A;  4FQ4 A;  4GKX A;  1YXW A;  4CDX B;  5T5L A;  3EJK A;  3B00 A;  1JN2 P;  3JD7 2;  1DG6 A;  3C7O A;  4JRL A;  4XHB A;  1NAE A;  3Q9O A;  2JDA A;  1H8T A;  4XUN A;  1V00 A;  3ZDS A;  4ZHN A;  5HPO A;  4P9I A;  5CA6 A;  4EN7 B;  2VQT A;  1POV 0;  2WN2 A;  4CDW C;  3JU9 A;  1U5I A;  3HPN A;  2BGP A;  3LPF A;  3SLI A;  2A6Z A;  3RPQ A;  5FOB B;  2OYZ A;  4XDQ A;  5FYZ A;  2RR1 2;  5FYU A;  1DP0 A;  1OHF A;  5FZD A;  3P6B A;  3I54 A;  4GJY A;  4PQ9 A;  4WM7 B;  1PGL 2;  1NA1 B;  4A6O A;  2A75 A;  2VVF A;  3D3A A;  5FZ4 A;  5DAX A;  3SCF A;  5C3P A;  1WMX A;  1Y43 B;  4Q4V 2;  4O9G A;  1HLC A;  1UZY A;  1AF9 A;  3ILR A;  2E51 A;  3POJ A;  4QM8 A;  3W21 A;  1KD7 A;  3ZYJ B;  4BXF A;  2HWE 3;  1BBT 2;  3GZA A;  4I02 A;  4CU6 A;  4R8H A;  4BK5 A;  5FDB A;  1GWM A;  2D6P A;  2XJV A;  4HKO A;  1XQN A;  4Q0V A;  1W9Y A;  2RS3 2;  1D2S A;  1PO1 2;  2MEV 2;  4Y5T A;  5FMB A;  2XPJ A;  3TBD A;  1S4C A;  5EYX A;  1RUG 2;  3W20 A;  2VU9 A;  2XWJ B;  1AXY A;  5FKC A;  1VBE 2;  3DF0 A;  4Z2A A;  2IXI A;  5FBZ A;  5BNQ A;  2HBT A;  2XOM A;  3M70 A;  5FCC A;  2QVS B;  2XLA A;  1W8N A;  1ZM1 A;  4PQQ A;  1T6B X;  1WCK A;  4GZ9 A;  3CZU A;  1CGP A;  1QJX 3;  2W5F A;  3KGL A;  3HT1 A;  3LWC A;  3PUH A;  2E26 A;  2RV9 A;  2B39 A;  5FLJ A;  1RUE 3;  2B42 B;  1S2B A;  1HX6 A;  1W8F A;  3I2K A;  3N7J A;  3OYW A;  4B4P A;  4BMB A;  3H9A A;  1FNZ A;  1RUH 2;  5IK5 A;  4Q0P A;  1LOD A;  4GB3 2;  3WF4 A;  1H2M A;  5E8A A;  3UYJ A;  1UN1 A;  2VE1 A;  1JS9 A;  3OPW A;  4P9L A;  3VZL A;  4FPY A;  3JD7 3;  2VXR A;  1AXZ A;  1OPM A;  4EYU A;  2JE9 A;  4LUK A;  3ST7 A;  1GWK A;  3D0J A;  3ABZ A;  4NO4 A;  1R08 2;  2PAE A;  1RXF A;  1XRU A;  2CWS A;  5FZ0 A;  3ACI A;  5A3P A;  3NST A;  5JIU A;  4CEY B;  1UKG A;  1JH5 A;  2VME A;  5DG2 A;  4AI2 A;  3IDB B;  3ORJ A;  4YAR A;  1RIR A;  2ADD A;  2C4X A;  2IXC A;  2PLV 1;  3E1F 1;  5FZG A;  3RJR A;  5JXH A;  2D6N A;  4CUC A;  2RR1 3;  4NRQ A;  2WS9 2;  3OPT A;  1GP5 A;  3F95 A;  4GMP 1;  1W2O A;  4N7U A;  3M1H A;  4OUE A;  5F2S A;  2W08 A;  4AED A;  3C7F A;  1IS6 A;  4QD2 A;  2VVD A;  1KJR A;  3KV4 A;  3S6P A;  3T0B A;  4Q4V 3;  4LHK A;  1NQD A;  5D8A C;  4COY A;  5FZM A;  3WQB A;  5A3O A;  2ZEY A;  5FZ1 A;  1BBT 3;  1GR3 A;  2VZ1 A;  4NUB A;  2GNT A;  2HEV F;  4W65 A;  1JZ4 A;  4YZ1 A;  2Q1F A;  2ZKL A;  2RS3 3;  4ZON A;  3ZIX A;  3ZXD A;  4YGB A;  5C9A B;  4GKY A;  5IAV A;  5C3O A;  1PO1 3;  4KH9 A;  1SLA A;  3H1Y A;  1PMJ X;  3AP5 A;  2JX9 A;  2X09 A;  3L2H A;  5A7S A;  1SFN A;  3THD A;  4CCM A;  1RUG 3;  5K4L A;  5JAX A;  1WLC A;  3LEG A;  4ITC A;  1DQ0 A;  4D69 A;  3AVR A;  1VBE 3;  1R1A 1;  3CQO A;  4WM8 B;  2W39 A;  3WG3 A;  2G9Z A;  5D21 A;  1SLT A;  1PO2 1;  2P2K A;  3ZYF A;  1AJO A;  1POQ A;  2J1U A;  2EAK A;  5DAQ A;  5DPN A;  2QBX A;  2TBV A;  2ADE A;  4YZ5 A;  3AMM A;  3K4A A;  3NAP C;  3TAY A;  2QNK A;  3RJ2 X;  3WDW A;  3VDB A;  4YW1 A;  3CF6 E;  3NNM A;  5H9R A;  4PBO A;  1EAH 2;  2VZV A;  4QX3 A;  4EQV A;  4QHZ A;  4GB3 3;  3U4X A;  3HBK A;  2QQI A;  4EWA A;  3LPG A;  1QH6 A;  4XEZ A;  1S0B A;  2A5Z A;  4RA0 A;  4DMI A;  1C28 A;  1XC6 A;  4ISQ A;  2D6L X;  3QAC A;  2ZMK A;  1IGO A;  3NVC A;  1SFP A;  1J58 A;  4GWM A;  4JGY B;  1UY1 A;  2ZJC A;  3HNY M;  5EWS A;  3SEE A;  1LAJ A;  5KHH A;  5D8A A;  3D8C A;  1R08 3;  2BBV A;  4QQH A;  5CB7 A;  1ODN A;  2WSV A;  1D4V B;  1VR3 A;  3THC A;  4ZZ5 A;  2DFB A;  3CL1 A;  4NMI A;  5FZO B;  1BCX A;  2WS9 3;  5FZH A;  4QX1 A;  1HN1 A;  1ZZ7 A;  2VJX A;  5EP9 A;  4GWN A;  4NID A;  2EA7 A;  3AYC A;  5L7O B;  2LS6 A;  3ALQ A;  3ECQ A;  3MIH A;  3OGV A;  5I91 A;  5CIS A;  2DVD A;  5FYS A;  4Q2F A;  1QQP 2;  5C33 A;  2AYH A;  1ULF A;  4BME A;  1OOP B;  3LOI A;  4CXY A;  3SIS A;  4QPW A;  1PNF A;  3AKS A;  2R04 1;  3UES A;  1C5H A;  4EN6 B;  3ZSM A;  5LEJ A;  3WEZ A;  3H3Z A;  3IM0 A;  3WCR A;  1MS3 A;  4E4H A;  1WW4 A;  3VL8 A;  2G9G A;  3NAP A;  2GC1 A;  3UKV A;  4D8M A;  1Q8O A;  2BFU L;  3LA2 A;  1DYP A;  1GBG A;  3KCX A;  2UY9 A;  1I3H A;  1UXZ A;  4UYB A;  4LLF A;  5C5T A;  5GLV A;  3LB9 A;  1R64 A;  2ZGT A;  4QPI A;  1ENS A;  2V5D A;  3I3D A;  5HV0 A;  4P9Y A;  1D7P M;  3TOJ A;  3FHQ A;  4QHO A;  5L9V A;  2ES3 A;  3VDD A;  1FPN 1;  3WCS A;  4HBN A;  1W06 A;  3GBG A;  3GCX A;  4CRQ A;  3FBM A;  3QLQ A;  5GM0 A;  4CYD A;  1ENR A;  1XBF A;  1DLL A;  3HQU A;  3T2T A;  1IG0 A;  4Q4Y 2;  2CSG A;  2BVV A;  1EAH 3;  4LK7 A;  1NKG A;  4XFC A;  4PDW B;  4ZS3 A;  1COV 2;  3I2I A;  4QGL A;  1SZB A;  4QPG A;  1QJZ A;  2FDJ A;  4JHT A;  4BM8 A;  5FIX A;  4B7E A;  5FP4 A;  5FZ8 A;  1BK0 A;  1H6Y A;  3T1M A;  4CTE A;  1BKZ A;  2YDE A;  1OA3 A;  5I8T A;  5F5C A;  4IE4 A;  4ARX A;  3APB A;  3I97 A;  3IMN A;  3POY A;  4AHW A;  1BEV 2;  4ATE A;  1JMU B;  1ZVF A;  1J83 A;  1HXS 2;  3LGR A;  5T5J A;  2EIE A;  5T54 A;  1POV 3;  4Y1X A;  1X9P A;  3WF3 A;  1VAV A;  3AP4 A;  3TB0 A;  2HKX A;  3WNP A;  1HW5 A;  2XXZ A;  2FDI A;  1C8M 2;  1RYY A;  2GAL A;  1CJD A;  4FSJ A;  4KBB A;  3POS A;  1HRV 1;  3U1X A;  2OQ7 A;  1C4R A;  1RUF 1;  4LBQ A;  1JUI A;  4Y33 A;  5BNO C;  4RQP B;  1YRZ A;  4UFI A;  3T2O A;  5LAT A;  1QQP 3;  3N36 A;  4A6S A;  5CFD C;  5T50 A;  3ZYI B;  1W9T A;  4XUP A;  1CON A;  4MGY E;  2B9V A;  4B1L A;  2GH2 A;  1T2X A;  2J1S A;  2YC0 A;  3LDB A;  5FZF A;  1UOB A;  5GZG A;  2Q1M A;  2Y6K A;  5DDJ 2;  2FHR A;  3ZFE C;  2O0O A;  3HAG A;  4UF0 A;  1VBB 2;  1UU6 A;  3E97 A;  5A3N A;  3WQ7 A;  1W3X A;  2VOK A;  1NXD 1;  4D7Y A;  3KQR A;  4V1P A;  2ZAB A;  1PVC 2;  1GQP A;  4AAP A;  2XJR A;  2D5F A;  2ZEW A;  3E6D A;  4E4Z A;  1DGL A;  4XF3 A;  2Q8D A;  4FPE A;  4XJ9 A;  5GKA C;  3VHO A;  5JI9 A;  4XOG A;  3FBY A;  4KWK A;  3A4U A;  3O1R A;  1YUD A;  1HB4 A;  3PMS A;  4QDQ A;  2X10 A;  4XDP A;  4PLM A;  4ZS2 A;  2ETE A;  2C9K A;  5SV5 A;  3LOB A;  1HV1 A;  4HVR A;  4H2A A;  2RJK A;  3MO4 A;  4XQW A;  1JOJ A;  1COV 3;  3OCP A;  4Q1P A;  2PMW B;  1A78 A;  1Z7S 1;  3IBM A;  4UBH A;  4XUR A;  4JRA A;  2RS5 2;  3PIG A;  1N1S A;  3RI8 A;  2E7Q A;  4XZU G;  4J6G A;  3B69 A;  3H3U A;  4AVA A;  5I0T A;  3NNG A;  1LGB A;  1O91 A;  3N9O A;  4QB6 A;  5EZW A;  1RTV A;  3T30 A;  3FC0 A;  4Y1Z A;  1G9B A;  4Z2W A;  3T4H B;  2ZAA A;  1BEV 3;  5CFD A;  3V56 A;  4DUX A;  4AQT A;  1HXS 3;  2ARE A;  5GZD A;  1PX4 A;  1Y4W A;  2VTF A;  3OUI A;  4MZU A;  2XJU A;  1YCI A;  3FJS A;  4QU1 A;  1QXJ A;  3ON7 A;  4BQ4 A;  5JOY A;  2BOJ A;  1C8M 3;  3HN3 A;  3ZFE A;  4DRR A;  2W68 A;  4CCL A;  1V6O A;  2GN7 A;  1LU1 A;  4ZU4 A;  3K4Z A;  4GWI A;  2RMU 2;  4YYO A;  1S2E A;  4X6Q B;  3ZYB A;  2GN3 A;  2OA2 A;  1DFQ A;  3GJA A;  4A7K A;  2CL2 A;  1XNC A;  4HPK B;  1LR5 A;  1RUI 1;  3ZMN A;  4A3Z A;  1UL9 A;  1US3 A;  2YU2 A;  3KCY A;  2FDH A;  2HWC 2;  5DDJ 3;  1ZZ8 A;  3KQ4 B;  2QQL A;  2W2I A;  1VBB 3;  2J7M A;  2OZ6 A;  2V4A A;  4YG6 A;  3RFR A;  4LO5 B;  1CWP A;  3LDR A;  3ZPO A;  1XE0 A;  5KXD A;  1DU3 D;  1PVC 3;  1UY0 A;  3L2Y A;  2CDO A;  3LFI A;  4AOC A;  5I8S A;  3V0B A;  2R30 A;  5FMC A;  1XE8 A;  5FQ0 A;  4IEY A;  1NLS A;  4GH4 C;  5BY5 A;  3T09 A;  3ZSK A;  4LKF A;  2OKX A;  1A8M A;  1LHN A;  5BNN B;  4E9K A;  4QM9 A;  2XB6 C;  1URX A;  1ZBE 1;  5J96 B;  1IHM A;  1SCS A;  1PMI A;  1C3H A;  4KWL A;  2WYS A;  3MIF A;  3Q8F A;  1NCR B;  2VZQ A;  3TN9 2;  3VKL A;  4ZZ8 A;  3P5B A;  5EHD A;  4YGE A;  1V6N A;  4DEV A;  4M01 A;  1ALY A;  2A6Y A;  3AVS A;  1APN A;  1QHD A;  2Y6H A;  4HK9 A;  2IVJ A;  4XXP A;  3LSE A;  5EIY B;  3URF A;  1W6N B;  2RS5 3;  3AMQ A;  1UZZ A;  3ZX7 A;  3PU8 A;  1MVQ A;  1UCX A;  2C1F A;  2PFW A;  5I0R A;  1GLH A;  2P6C A;  2WLP A;  3AKQ A;  1JZ6 A;  3H1M A;  1CAW A;  3HQX A;  2WL1 A;  5FP7 A;  2YBP A;  3WV6 A;  3PME A;  4U2A A;  3ES4 A;  1T6G C;  1H0B A;  5A3U A;  1ND3 B;  4XAE A;  2XVK A;  4XF9 A;  4OVE A;  1LES A;  2VXJ A;  2DVF A;  3ZMO A;  3VZM A;  2HWF 1;  3A7Q A;  4LO7 A;  4LIV A;  4BQW A;  2Y6J A;  4JDO A;  3ZFF B;  1CAV A;  1CZT A;  2RMU 3;  2D97 A;  2ZKN A;  4RYD A;  3VBR B;  3KVA A;  5C3Q A;  4LBJ A;  4GH4 A;  4RFT 0;  3ETQ A;  1RUO A;  2ERF A;  3LSD A;  2Q30 A;  3MFC A;  2VL4 A;  5IVB A;  1F9K A;  2DCT A;  5K0U C;  4QKD A;  5IAX A;  2HWC 3;  1LHO A;  3M7A A;  1WCU A;  4I09 A;  1F5F A;  2YFZ A;  4AG4 A;  3CZJ A;  5KWR A;  3HWJ A;  2JG8 C;  2QJV A;  4MGS A;  4MV2 A;  5DUX A;  3TNQ A;  4D6S A;  1NXM A;  5LY1 A;  3PUA A;  3H8X A;  1SPP A;  2WC2 A;  4CCD A;  2Y60 A;  5A70 A;  5JMC A;  3PJQ A;  1GQH A;  5A32 B;  2WN3 A;  4YW2 A;  1OSG A;  1UOJ A;  5F5Q A;  2VY0 A;  3KV9 A;  1JZ2 A;  4R9B A;  4N53 B;  1TVG A;  1AR7 3;  3BTA A;  3RZZ A;  1CQ9 A;  5FXZ A;  1CVN A;  2A3Y A;  3AMN A;  5LBE A;  4UAP A;  1CAU B;  5LWB A;  3KCC A;  3MFA A;  5L9R A;  2JDZ A;  2QE3 A;  4YPJ A;  3ZXL A;  4AEM A;  3O1V A;  3TN9 3;  3BTY A;  1NYW A;  3U4S A;  4COU A;  3PHM A;  2Z69 A;  2FQP A;  4JGZ B;  4NII A;  4PIZ A;  1GZW A;  1S0G A;  1XPW A;  3N9Q A;  3RZG A;  4W4Z A;  4BQ3 A;  4URA A;  2WSU A;  4P02 B;  2WJS A;  1YQC A;  5LBB A;  2RVA A;  5K8S A;  4BU2 A;  4V2W A;  3WG1 A;  3UJQ A;  2QFE A;  2P6H A;  1MS5 A;  3N7L A;  3MHZ A;  3NV1 A;  2B7Y A;  1RUD 1;  3SH3 A;  2PLV 2;  5A6Y A;  1HJG A;  1HIX A;  1S0I A;  3POG A;  1SDW A;  2RDS A;  3F2Z A;  5CFC C;  3VHR A;  2C24 A;  4Y22 B;  2J1T A;  4Q8K A;  4QT6 A;  1UZV A;  4FPF A;  1OLM A;  3ATG A;  1LHW A;  4YVS C;  1V6I A;  5K0U A;  3WW3 A;  3BTX A;  3T4V A;  1HQW A;  1O7F A;  1VIW B;  2VMF A;  1W04 A;  1YC6 1;  2P34 A;  3H7J A;  1ST8 A;  4QGM A;  4EWE A;  4C91 A;  1OH3 A;  4CP9 B;  3ZYH A;  3V65 A;  2JG8 A;  3PTR B;  3J8F 2;  3RYR A;  1UOG A;  3ZN4 A;  2XQR A;  3E5U A;  5JSP A;  5DUV A;  1OLR A;  5IHR A;  1X7N A;  5KXC A;  4L11 A;  2AEY A;  2ILM A;  4KQ7 A;  3ASI A;  3WG4 A;  4MGZ E;  1E5H A;  2DUP A;  3ZFG B;  3B9C A;  4LQR A;  4OHW A;  4HFS A;  3VBH C;  2WNU B;  4KMQ A;  2ZTN A;  1R1A 2;  4WM7 C;  3VBO C;  1TMF 1;  1JOP A;  3DPR B;  4LHS A;  2D6M A;  4WVZ A;  4DZG A;  3I2O A;  2UU8 A;  4CPB D;  1PO2 2;  2A7A A;  2PHX A;  2YMZ A;  1R09 1;  1IZ3 A;  4XCB A;  3RWK X;  1SEF A;  3W59 A;  1V0A A;  1SQ4 A;  1J3R A;  3ZVX A;  3PVE A;  4MGI E;  2Y0I A;  1QKQ A;  3OGR A;  1W0N A;  2DV9 A;  3NL1 A;  1PK6 C;  1UU4 A;  2Y33 A;  2XBO 1;  4N43 B;  4LIT A;  3FHA A;  5FP8 A;  2GU9 A;  1DGW A;  5CFC A;  1WLW A;  2VOX A;  3ILN A;  3KM5 A;  1CX1 A;  4AFC A;  1FYU A;  1JXN A;  1DZR A;  4NIA A;  1VPH A;  2BJS A;  2D43 A;  3JB4 C;  1AYN 1;  1X8E A;  1QJY 1;  1RJ8 A;  2Q8O A;  1F35 A;  4QPY A;  4XFF A;  3B94 A;  5FYI A;  3S5Q A;  4TTG A;  5FJH A;  4I2O A;  3ZPY A;  2JWP A;  2CU5 A;  4B7K A;  4EZ4 A;  2Y38 A;  5LCW L;  1GOF A;  1NCQ B;  2PLV 3;  3CJI A;  3AZZ A;  1OA4 A;  3RDI A;  4B8E A;  1RHI 1;  4BCU A;  1RJ7 A;  2GNB A;  3J4U H;  1LU2 A;  4GMP 3;  3AL6 A;  1ZA7 A;  1NUK A;  3WUC A;  4GA9 A;  5AVP A;  3N9N A;  2WQ4 A;  5JZG C;  4XDO A;  4M4R A;  1E57 A;  1ZZ9 A;  4DXS A;  4IQP A;  3AFK A;  1V6J A;  1W6O B;  5GJ6 A;  3VBO A;  2D3R A;  2HH9 A;  3J8F 3;  3LIH A;  1QDC A;  2B9U A;  4A42 A;  2DCY A;  2R04 2;  4CU9 A;  3FLT A;  1OH4 A;  2ZZJ A;  3GZT B;  4Q0S A;  3W5M A;  4NHY A;  5CU1 A;  1OUS A;  4EN8 B;  2MPF A;  4FAG A;  2EIB A;  3NQH A;  4UW5 A;  2FDF A;  5GLT A;  1JTZ X;  1DQ6 A;  2DDU A;  3LEK A;  5F39 A;  5FZE A;  2JG9 B;  1PK6 A;  1W2A X;  5I93 A;  1GOG A;  2BU9 A;  1IPJ A;  1GNY A;  1AL2 2;  1KEX A;  2DCZ A;  1R1A 3;  4PF1 A;  3VD9 A;  4YLZ A;  1U5Z A;  4Q4W 1;  2NMN A;  2EF6 A;  1PO2 3;  4DUW A;  3O0V A;  3VBU B;  5CBL A;  1UMI A;  1SPP B;  2HEW F;  5LZ6 A;  4P14 A;  4LOS A;  1FPN 2;  1V6K A;  2LM3 A;  4HZF A;  1G9F A;  4DFS A;  4H7M A;  2RDR A;  1VRB A;  2A6V A;  1QEX A;  5JOX A;  3N9P A;  1QY4 A;  4Y1Y A;  1G8W A;  4YW5 A;  1UYX A;  4CXW A;  4B4Q A;  1LEN A;  3EQE A;  4YVW B;  2D3P A;  3LEI A;  5A80 A;  3VZN A;  4WM8 C;  2WT0 A;  1HN0 A;  1MAC A;  4L9B A;  4XJA A;  3WNL A;  4DXT A;  3OBA A;  5GLU A;  5GLZ A;  5JZG A;  5FK8 A;  4YM3 A;  2JDP A;  4DXR A;  1SBE A;  2B45 X;  5E6H A;  3RMX A;  2GC0 A;  2ZCW A;  3UET A;  4J1X A;  2VO5 A;  1B35 C;  3H8R A;  3USU A;  1OLM E;  2VUC A;  4B1M A;  4JTN A;  3MIC A;  5FPZ A;  4MH0 E;  3LA3 A;  2A1X A;  1RC6 A;  2WQZ C;  1KJL A;  1RXG A;  4B29 A;  1AL0 G;  5EXO A;  1J59 A;  5A6Q A;  1JHJ A;  1GMM A;  1RUF 2;  4IE7 A;  2UYA A;  5HXV A;  2D3S A;  1SLL A;  4BQ1 A;  3OBR A;  1XE7 A;  4QKF A;  5FZI A;  1RUN A;  2FMY A;  4HSL A;  1RB8 G;  5DAB A;  1PVX A;  1IKQ A;  4D7T A;  1JOD A;  2QDR A;  2R04 3;  2BBA A;  3MW2 A;  4W6X A;  4XIO A;  5FY5 A;  1ZYB A;  3DGT A;  5FYV A;  1QOO A;  5ABJ A;  2PHD A;  2VBP A;  1JOB A;  1Y9Q A;  3AK0 A;  4D94 A;  1H9W A;  2GP3 A;  3M3E A;  4XAB A;  4AEJ A;  2WLQ A;  2WBK A;  1ULG A;  4FXK B;  4IE0 A;  1FOD 1;  1AL2 3;  3J7N A;  3WHT A;  5C8W A;  3WNM A;  5EV7 A;  3BAL A;  1VMF A;  4COV A;  4QGN A;  3ZSL A;  4DS0 A;  4FTE A;  5FYC A;  1LOF C;  4CDQ A;  2HEY F;  1FPN 3;  3K48 A;  4O9E A;  5IK7 A;  3KVB A;  1VJ2 A;  4LE4 A;  5BNP A;  3GF6 A;  2HWB 1;  4O65 A;  1EP0 A;  3ZDV A;  1O8P A;  3AP7 A;  3BU7 A;  1TQ5 A;  4BIF A;  1YJK A;  3RZK A;  1CAX A;  4BQY A;  3D0S A;  1TNF A;  2CGO A;  3IN9 A;  5JSO A;  1Z7S 2;  2K2S A;  5IYY A;  1VBC 1;  1DLC A;  4RHV 1;  1BZW A;  2HYX A;  1ND2 B;  1REF A;  4P9W A;  1QNW A;  1DZQ A;  4DIN B;  2WFF 1;  1RIN A;  1EY2 A;  1QF3 A;  1OA2 A;  3VKO A;  5A7P A;  5K7P A;  3USS A;  1H2K A;  1DZT A;  1TG7 A;  3AM2 A;  1W2N A;  1YNA A;  4K1Y A;  1UMZ A;  1TEI A;  1KFU L;  1IOA A;  5FXX A;  2QQU A;  3WXP A;  2WNO A;  3FX3 A;  3FWE A;  1V9U 1;  4UWD A;  3ZYR A;  1KDK A;  1C1F A;  5CG9 A;  4BA6 A;  3UKT A;  1HV0 A;  3VKF C;  1MQT B;  2IVI B;  1HRV 3;  2OS2 A;  1HDK A;  1RUF 3;  4K7J A;  5AVA A;  1JYN A;  2XML A;  1GQG A;  2OQ6 A;  2X5I C;  1YEW A;  2C26 A;  4IES A;  4JAA A;  5LK5 A;  5C6C A;  3O1S A;  4PIX A;  2P17 A;  3THT A;  5A33 B;  1QOS A;  1RUI 2;  1W28 A;  3VBF B;  4E8C A;  2LTN A;  2ZGO A;  3A0N A;  4LEJ A;  4IET A;  5H9S A;  3ZXJ A;  1S55 A;  3V0B B;  2WWU A;  5J1X A;  3AP9 A;  4M3C A;  2AZ5 A;  1DQ2 A;  4ARY A;  3ELN A;  3NRU A;  1PX3 A;  4CDW A;  1O6U A;  2AR6 A;  1ZRD A;  4FPK A;  5J7M A;  1F2N A;  3O12 A;  4OZO A;  5FPA A;  3NJY A;  3AKR A;  4UI9 L;  4YZ2 A;  4RQP C;  2ARC A;  1ZBE 2;  3DYP A;  2DU0 A;  2ARB A;  5CEH A;  1EV1 2;  3V0A A;  1FXZ A;  2R0F A;  2FD8 A;  1O4T A;  2W46 A;  3L9J T;  4QQO A;  3AC0 A;  2VUD A;  1PGS A;  3CBN A;  2VW0 A;  4L8Q A;  4JHZ A;  3NKT A;  3OBZ A;  1MVE A;  3OGG A;  4JKK A;  1IS5 A;  2YB7 A;  4KNC A;  4XMI A;  1Z7S 3;  1HJF A;  3C7E A;  2E53 A;  2ZAH A;  1DYK A;  5JXI A;  5BUV A;  2OT7 A;  3WNK A;  1DYO A;  4IV1 C;  3U75 A;  4UOJ A;  2B5H A;  2NYY A;  2IZW A;  4XJZ A;  1K45 A;  3WP3 A;  1UIK A;  3QOP A;  1F15 A;  1AR6 1;  1UYZ A;  2YZ4 A;  4RS5 C;  3M2M A;  4LO8 A;  3WIN E;  1JZ5 A;  2X5I A;  3DKQ A;  3OB8 A;  5A7W A;  3VBS B;  3AKT A;  1XU2 A;  1WD4 A;  2BNN A;  3U10 A;  3T2P A;  3ZYG A;  3IPV A;  1EUU A;  1AHS A;  3GBW A;  3CEW A;  3NV4 A;  4IV3 B;  4N9H A;  5FY7 A;  3RGB A;  3S7E A;  4Z8B A;  5A6Z A;  1LEM A;  1W03 A;  4AYU A;  5M0T A;  2RM2 1;  3AYD A;  5FP9 A;  4QHB A;  1XYN A;  1NZC A;  4BH9 A;  1BK1 A;  1G9A A;  5C7G A;  3MID A;  3IAP A;  5F6L B;  4MHU A;  3WQ1 A;  3T0A A;  1YFY A;  3KMH A;  1RUI 3;  2ET1 A;  3HNB M;  4JC1 A;  4G3Y C;  4QB1 A;  5FY0 A;  2R16 A;  1K5M B;  4C1W A;  2QDN A;  1VB4 A;  2HYK A;  2Y64 A;  4XPV A;  1HQN A;  5FRA A;  4QXK A;  4XC9 A;  3I7D A;  4XTM A;  1YQ2 A;  2ET7 A;  1W6P A;  3NNL A;  5FMO L;  2JJ6 A;  2VNO A;  5AFB A;  4QAW A;  2X05 A;  4CEW C;  5TSW A;  2PEL A;  3I8T A;  1LOC A;  4N8M A;  5IVC A;  1NOV A;  2D6O X;  3WR0 A;  1W6M A;  1ZBE 3;  2QQM A;  3LE0 A;  3OGJ A;  2GC3 A;  2KM2 A;  2XWB B;  4AQ2 A;  1EV1 3;  4YFW A;  1DGR A;  1Q3E A;  5EJZ B;  4CDQ B;  4RS5 A;  4F7Z A;  1U0A A;  1YI7 A;  3VZO A;  2CNA A;  1YYN A;  3ZM8 A;  1QNY A;  2UY8 A;  2VG9 A;  2EIC A;  2WZR 1;  1H8T B;  2WZP P;  3ZXE A;  3ZSJ A;  4XVH A;  4CDX C;  4BHP A;  1N3P A;  4AF9 A;  3M8L A;  5ACA 1;  5FRE A;  3BOP A;  4BQ5 A;  4IEX A;  2J1V A;  2BOI A;  4S2H A;  2E7A A;  2VOV A;  5BNN C;  1PGW 1;  3W5N A;  1RUD 2;  4NHK A;  4AGV A;  1Q8Q A;  5DAP A;  4XFG A;  1DBN A;  3NMB A;  3JQX A;  2DUQ A;  4UFK A;  3UK9 A;  2EXI A;  5FY9 A;  4BLJ A;  1UX7 A;  4LJH A;  5IVE A;  1J1L A;  3DCQ A;  1ENQ A;  3R4D B;  5FMD A;  4CU7 A;  5FPV A;  4NE9 A;  4IW3 A;  4A7Z A;  5I0D A;  1S0D A;  1W3V A;  3AL5 A;  4CUG A;  4XF1 A;  2PHR A;  1GU3 A;  1UXX X;  2AUY A;  3AZY A;  1ASJ 1;  1J3Q A;  3D5O A;  4Y4Y A;  5FXW A;  2QQO A;  3ZN5 A;  1SCR A;  1EYB A;  1W9W A;  5G05 L;  5JXG A;  1WZX A;  3WDY A;  4LMF A;  4M00 A;  2PN5 A;  1I6X A;  5FUI A;  3S30 A;  3IMM A;  3SNM A;  4AI8 A;  4EE2 A;  4M3C E;  4GXL A;  2Z4F A;  4AFD A;  2HBU A;  1LRH A;  1UU5 A;  3NNJ A;  1JYT A;  4JTO A;  1WA6 X;  1H8V A;  1ND3 C;  2WKK A;  3UV9 A;  1UOF A;  1HKD A;  1TMF 2;  5DUW A;  4KGQ A;  5KHJ A;  1ZNP A;  3CKH A;  3OYW B;  1R09 2;  4TWT A;  2YPJ A;  3WSO A;  3ZN6 A;  4YFZ A;  1GOH A;  1OBN A;  3BB6 A;  1QH7 A;  4I30 A;  2ARX A;  4AL9 A;  1LOB A;  5FYM A;  2DFC A;  4IGP A;  4FPG A;  3GZU C;  5HCA A;  2Q8E A;  1YQ8 A;  2GMP A;  4AVV A;  2DVG A;  1UZW A;  1XB9 A;  5LRS A;  3H42 B;  5T55 A;  2XBO 2;  2P4E A;  3NV2 A;  4AVB A;  2A71 A;  4IEP A;  2VVE A;  2Q0A A;  4LUL A;  3O1P A;  3OEB A;  4S2F A;  2LAL A;  3VN4 A;  4MO3 M;  5FKB A;  2VZ3 A;  4JKM A;  4OHV A;  4CCN A;  1J84 A;  4YZ4 A;  4FAH A;  5FZ7 A;  1AYN 2;  2VD7 A;  1QJY 2;  3KWV A;  4XUO A;  4P9X A;  4Y26 A;  1V6L A;  3VL9 A;  3VUO A;  4LBQ D;  4PLN A;  2C9A A;  2D7F A;  4HVO A;  1MS8 A;  1RUD 3;  1ZZ6 A;  2C5D A;  4N53 C;  4AED B;  3AZX A;  2P3K A;  3BUC A;  1RHI 2;  3C2U A;  1CIY A;  1VMJ A;  4K8F A;  5LY2 A;  5HXM A;  4OZX A;  2G9F A;  2Z79 A;  3J26 N;  3PUS A;  3N4M A;  5C8C C;  4WVM A;  3KD4 A;  4MXW A;  5A1A A;  2C0Z A;  3WDU A;  1W8W A;  4LKE A;  1CIW A;  1KDM A;  1S0C A;  1OPO A;  1PNG A;  4Y1U A;  5DAW A;  1NZI A;  1XYO A;  4K3U A;  5LW9 A;  4XW3 A;  3Q8B A;  4K21 A;  2JD4 A;  3Q8C A;  4OFG A;  2LRO A;  4MHR A;  4I3G A;  3S7I A;  2G19 A;  4AK3 A;  3PUI A;  4AEK A;  1AXK A;  4NRP A;  5F7U A;  4M3C F;  1LTE A;  3O1M A;  1MS4 A;  2YRO A;  4BB3 A;  5L19 A;  2W0X A;  3K77 A;  3TYJ A;  4WZC A;  1UPS A;  4XBQ A;  1TMF 3;  1UWW A;  3WNO A;  2Z42 A;  4Q4W 2;  3RQ0 A;  4TZD A;  3AZW A;  4Q29 A;  2XJT A;  1P8J A;  1R09 3;  2PAK A;  1L7L A;  5ANQ A;  2BPA 2;  3OG2 A;  4OMD A;  3ZOI A;  4UFJ A;  3WF0 A;  5C3R A;  3T0D A;  4FO9 A;  3ME2 A;  4UBG A;  2XUE A;  3A21 A;  1WW7 A;  2XBO 3;  1WUV A;  1SG3 A;  3WUD A;  4ZXE A;  1UY3 A;  1W0O A;  3WHU A;  2R7E B;  5CKN A;  3J9S A;  4GMP 0;  2WNU C;  4FP2 A;  5LBC A;  5BNO A;  5D8A B;  5J36 A;  1S0E A;  3R05 A;  5C8C A;  4QDR A;  4COW A;  4FTS A;  2R1D A;  4F83 A;  3WVJ A;  1BHG A;  2VR4 A;  4M0N A;  1AYN 3;  5FYY A;  1QJY 3;  2EXJ A;  4GAL A;  4XMA A;  5GZE A;  4QXB A;  1DIW A;  2D40 A;  1SAC A;  3UL2 A;  2HLE A;  2YBK A;  2PQQ A;  1X82 A;  3VBR C;  5FR3 A;  1RHI 3;  1UY4 A;  3AYE A;  2RR1 1;  4FOY A;  1BMV 1;  1FI2 A;  2ZGU A;  4N7I A;  3A23 A;  5FPB A;  3R0R A;  3C7G A;  5IAT A;  2BW8 A;  1DQ4 A;  4Q26 A;  4ET7 A;  3J7L A;  5EYY A;  2VGD A;  3SH4 A;  5J37 A;  1CR7 A;  1QXP A;  2YBS A;  3BTZ A;  1GAN A;  4W8J A;  1U12 A;  2ORZ A;  5C4W C;  1UPI A;  3ENR A;  4WBB A;  5C3S A;  1STM A;  3NAP B;  1IPK A;  5K9Y A;  5FZ3 A;  2D44 A;  2WO7 A;  2R06 1;  2XLG A;  2W1S A;  2WZE A;  3OY8 A;  3WNX A;  4CDU C;  4CCJ A;  2MEV 1;  4QKN A;  3KB5 A;  5J09 A;  3WD5 A;  3E6B A;  1NCQ C;  2IC1 A;  4W50 A;  3CO2 A;  5E88 A;  4QPI B;  3VDD C;  1AR7 2;  1UYY A;  5F3C A;  1FOD 2;  2E9Q A;  1QIQ A;  1GZ9 A;  1W9F A;  2O14 A;  3GNE A;  2DU1 A;  5GLW A;  3VDD B;  2QQK A;  1REE A;  4Q4W 3;  3H1W A;  1CPN A;  3ZO0 B;  2ZPX A;  4R4X A;  1EUT A;  3ACL A;  2JD9 A;  2WR9 A;  4COZ A;  4YWA A;  1G86 A;  5I8Y A;  1F4H A;  3I2H A;  3I2F A;  2VZO A;  3RG0 A;  4YW4 A;  2VQ0 A;  4QPG B;  1KGY A;  1RUH 1;  2CY6 A;  1WW5 A;  1BJQ A;  2J42 A;  2WNV C;  1CZV A;  2RE9 A;  4CSW A;  4RGA A;  1MS9 A;  4OCT A;  4MUV A;  4GB3 1;  4OI0 A;  3DN7 A;  3UKN A;  2Z5W A;  1A6C A;  1VBC 2;  4RHV 2;  5EQU A;  1I5Z A;  4FPL A;  4L2N A;  4P00 B;  2WWS A;  5E16 A;  1W8H A;  2WFF 2;  4OUL A;  3EB7 A;  4BZ4 A;  2RDN A;  1OF4 A;  3OGS A;  4F3J A;  1KS5 A;  1F5J A;  2IXK A;  2W52 A;  1K3I A;  2RS1 1;  5HCH A;  1WMD A;  2ZS6 B;  1IS4 A;  1ULP A;  5C4W A;  2J1A A;  4XET A;  1OD5 A;  4IL7 A;  5IVJ A;  4IEW A;  4CDU A;  1VBD 1;  1V9U 2;  4LBQ B;  4L92 A;  5J3U A;  1DQ1 A;  5JR2 A;  3GHN A;  5J48 A;  2NLR A;  4YVW C;  4HL0 A;  1L7R A;  2BWA A;  4IER A;  4BOW A;  4C1X A;  2OUH A;  5IWF A;  3HBZ A;  2GDF A;  3MLJ A;  1I1E A;  2YPD A;  4Y3O A;  3PTY A;  2NM1 A;  5FPX A;  1AX2 A;  4UF0 B;  2A70 A;  4RGG A;  2VCC A;  5JLV A;  4UFL A;  1RIT A;  4AGG A;  4CE8 A;  2YY1 A;  3M4F A;  1KS4 A;  2IFW A;  5FZA A;  1DHK B;  2WNV A;  1FOD 3;  2CAU A;  2EXK A;  1D4M 1;  3GBF A;  4RSU A;  2Q8C A;  5IFP A;  2XUM A;  4MVT A;  1A8D A;  4IGQ A;  4SLI A;  4A2U A;  4GUL A;  4JX0 A;  4AZZ A;  2VBB A;  5F2W A;  1JZ8 A;  1HB3 A;  2BFU S;  2VQA A;  3FHI B;  1GZC A;  2E32 A;  4RR3 C;  5F8P A;  2SBA A;  3FE5 A;  5FP3 A;  3THP A;  3IWZ A;  1W6Q A;  1F31 A;  4LE3 A;  3DYO A;  5BPX A;  2I74 A;  1A3K A;  2O8Q A;  3P3P A;  4FT8 A;  5CZK A;  2BEO A;  3BPS A;  5LA0 A;  5JOZ A;  2R07 1;  1VBC 3;  1CES A;  4RHV 3;  1F4A A;  4AE2 A;  3U07 A;  4U36 A;  2JIG A;  5EPA A;  3T1L A;  1ZZB A;  2Y0O A;  2JE8 A;  2WFF 3;  2CGN A;  3HN1 A;  5CFD B;  1AX0 A;  5FYH A;  1AR6 2;  3JUU A;  3FUQ A;  2WAB A;  3KF3 A;  4RFR B;  3UGH A;  2ZZQ A;  5B2G B;  3H0O A;  4P5H A;  3MDP A;  1VB2 A;  5JVV A;  4NN0 A;  2XHK A;  1D0H A;  1YJL A;  4HSJ A;  4Y20 A;  1OVP A;  2JEN A;  3ZFE B;  3BU0 A;  3ACH A;  5JIA A;  2JEM A;  4NAO A;  1N47 A;  3WDV A;  4H14 A;  1JBC A;  3MUY 1;  5FY4 A;  3H7Y A;  1QWR A;  1V9U 3;  4KG0 A;  4HON A;  1UMH A;  2SLI A;  1N3O A;  2GMM A;  2RM2 2;  5ANN A;  1M06 G;  4YGD A;  2EIG A;  4CXX A;  4K40 A;  1K42 A;  1FV2 A;  2Y6F A;  2CWM A;  2OW4 A;  5JOW A;  4QDS A;  1VRH 1;  4XJW A;  4GD4 A;  1NA1 C;  2WWJ A;  4BQ2 A;  2H0B A;  2PHL A;  4PHZ A;  1MZF A;  5DQ0 A;  1PZ7 A;  2YU1 A;  4RR3 A;  4HN1 A;  1B09 A;  2W3J A;  1O3T A;  4HG6 B;  4XFH A;  5FQ0 B;  4EV0 A; 
#chains in the Genus database with same CATH homology
 4QKD A;  3RZK A;  3S57 A;  3T3Y A;  2FDK A;  3O1O A;  4NID A;  3H8X A;  4O61 A;  4CXY A;  3S5A A;  4NRP A;  3I3M A;  4IE6 A;  3T4H B;  2FDF A;  3O1V A;  3BTY A;  4IE5 A;  4NII A;  3O1U A;  3RZG A;  4NPM A;  3O1S A;  4QHO A;  3RZJ A;  4O7X A;  3H8O A;  2FDH A;  4NRQ A;  4CXW A;  4ZS3 A;  3BTX A;  3I49 A;  3T4V A;  3KHB A;  2FDJ A;  4JHT A;  4MG2 A;  5F8P A;  4QKB A;  4IE4 A;  3RZM A;  3H8R A;  2FD8 A;  3LFM A;  4MGT A;  4NJ4 A;  2FDG A;  2FDI A;  3BKZ A;  3RZL A;  4NRO A;  4NRM A;  2IUW A;  3I2O A;  3BTZ A;  4IE7 A;  3O1M A;  4QKF A;  4RFR B;  4ZHN A;  3I3Q A;  5DAB A;  4QKN A;  3O1T A;  3BU0 A;  3RZH A;  3BUC A;  3BI3 A;  3O1P A;  4IE0 A;  4NPL A;  4NIG A;  3BIE A;  4CXX A;  4NIH A;  3O1R A;  4IDZ A;  3KHC A;  4ZS2 A;  4OCT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...