3O1TA

Iron-catalyzed oxidation intermediates captured in a dna repair dioxygenase
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
202
structure length
202
Chain Sequence
EPLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLCLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-ketoglutarate-dependent dioxygenase AlkB
publication title Iron-catalysed oxidation intermediates captured in a DNA repair dioxygenase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 48
structure length 202
sequence length 202
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2010-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 3o1tA00
3RZJA 4NJ4A 3O1PA 4IE7A 2FD8A 2FDKA 3O1SA 3O1MA 4NIIA 4NRPA 3BKZA 3T4VA 4O61A 4ZHNA 3BTZA 3O1UA 3I3QA 3RZKA 3LFMA 4NROA 3RZLA 4O7XA 2FDIA 3O1OA 4NIDA 3I3MA 3BTYA 5DABA 4IDZA 4ZS3A 3RZHA 4NIHA 3BIEA 4IE5A 3T4HB 4IE0A 4QKBA 4QHOA 2FDFA 3T3YA 3H8OA 3O1VA 4NPMA 4IE6A 4ZS2A 3S57A 2IUWA 4QKDA 3BU0A 3O1TA 3O1RA 3I2OA 4NRQA 4NRMA 3I49A 3H8XA 4IE4A 4NPLA 3RZGA 4CXYA 4MG2A 2FDGA 3BUCA 3H8RA 4OCTA 4QKFA 2FDJA 4QKNA 3S5AA 4CXWA 3BI3A 2FDHA 3BTXA 3RZMA 3KHBA 4JHTA 3KHCA 4RFRB 4MGTA 5F8PA 4CXXA 4NIGA
chains in the Genus database with same CATH superfamily
3MBWA 4BZ4A 4AEDB 3MLJA 1NA1C 4NJ4A 4R4XA 2GMEA 4GWIA 4M3CB 4ARYA 4A45A 2FD8A 3N9LA 1VBA1 3O1SA 2FDKA 3ZFEA 2YFUA 4XUTA 4MGIE 1Y4WA 5FZ0A 2XJQA 4AHWA 4BE3A 1RL3A 1IKQA 5DXDA 3S30A 4AQ6A 4XFBA 2WNUA 3CEWA 1XU2A 4PDWC 4CZSA 2YZ4A 4JHZA 1ULPA 5H9RA 2P3JA 2WJSA 4ZXEA 3NV1A 4P14A 3BTZA 1CPNA 1LHWA 2IXCA 2WINB 4Z07A 2JG9A 1XYNA 2DBIA 1SEFA 3RMYA 1JYNA 3H3LA 2VQTA 4JTOA 4Y5Z0 1N1VA 3APBA 1DYKA 3RWNA 4DZGA 4OHYA 4P9LA 2CDOA 2W08A 5TSWA 1PM4A 4XIOA 1UYXA 1OFNA 2WZ8A 1WW6A 2WL1A 2VOXA 1ND2B 3A21A 4PDWB 2WT2A 4XFGA 3V64A 5HXMA 1HRI1 2BFUS 2Y6LA 3UYJA 2R063 5ACA3 3VHOA 4NIHA 3J7LA 3Q8EA 2B4KA 5J98B 3HOBA 1MR5A 1APNA 2OXBA 1U0AA 2QUOA 1U5XA 2TUNA 1UXZA 5KHHA 2WS91 4QPIB 2WWJA 3JCIA 1JYXA 3O1VA 3N4MA 2E26A 4BMBA 4XTPA 2OA2A 2WAOA 4Q0UA 4BYYA 4CP1A 4XW3A 5FYZA 1QHDA 1RXGA 2VVFA 5FP4A 2QFEA 3TN91 1VPHA 1RUI2 2EIDA 2W1WA 3ZYGA 3M4FA 4BB3A 2FMDA 3UGGA 2PLV1 1UOJA 4NMIA 4D0QA 1D7PM 2QCSB 2DVBA 3J8F2 1LNSA 3R4DB 4CDUA 2VXRA 3HT2A 2WKKA 1JHJA 3VBOA 4YSFA 5SV8A 4A3XA 4NRQA 1US3A 5FZGA 2V72A 2I74A 4XHBA 2A73B 1DYOA 4H3WA 1RUJ1 2EIEA 4AWDA 1OVPA 1XSRA 1WGPA 1QEXA 4FPFA 1WA4A 2VPVA 3P3PA 4IEUA 1UY3A 2PHUA 3GCWA 2GC2A 3OJBA 2W92A 4Q8LA 3FFZA 1OQDA 4IUGA 3D0JA 4UI9L 3RPQA 3K77A 5ABJC 4Q4V3 5E88A 1CAXA 3KHBA 1L7RA 4QGMA 3HVDA 1HRV3 3POYA 2DVAA 1OI6A 2BZDA 5G04L 5IYYA 4MGYE 1TNFA 1V6MA 1IS6A 4FPLA 3BPSA 3CJXA 5HXVA 3KCCA 4C8DA 5IVEA 3BOWA 4BQ3A 5GALA 2BYVE 3HWJA 5DAWA 1JZ6A 3WCRA 2D98A 2B9VA 3VDBA 1UU5A 3OGJA 5I0SA 2X29A 1V70A 4K3UA 4NHKA 1Q8VA 1VAMA 1HV0A 2VTXJ 3POBA 4P9IA 5JXHA 2AREA 2IZWA 4NIGA 2JKXA 5C33A 2JG8B 2WBKA 3OUJA 4OQ9A 3RYPA 2ZCWA 3FLRA 3WW2A 2X5IC 1RUF3 4Q4W1 1NA1A 2KD7A 4WVZA 4IEWA 1CAWB 3MICA 1MZ6A 1NCRC 3CLPA 2ZHNA 4UFMA 3H9AA 4LNVA 3D5OA 2V4AA 1PVC1 4IV1A 1FI2A 1SPPA 2ZZQA 1N1YA 4OQ8A 3O0XA 1MEC1 1ZZ8A 1QOOA 2VNRA 2VO5A 3AP6A 4GMP1 3PLQA 5L9BA 2C26A 5JCTA 3B93A 4WM8C 4CA9A 1S55A 1WW7A 4GZ9A 2L9LA 1MQTC 2P5BA 1EP0A 3FBYA 3LF7A 5L9VA 1GKBA 2EALA 1VAKA 2VUJA 2ZGRA 1NCRB 4XQDA 5A80A 2A6ZA 4XIKA 3TB0A 4RR3B 1WD4A 3DEMA 3KV5A 3ON7A 4XYXA 3VZLA 4AR2A 4E9KA 1G9BA 1S0JA 2VMGA 5FZFA 1GOGA 1QXPA 2KM2A 4LHNA 4GAZA 4UBHA 3DYPA 3HN3A 4WM8B 2OZJA 5FMOL 3WNXA 4FFIA 1W06A 4QXCA 2HWC2 2XJPA 3SCGA 2WAAA 4LO4B 5JVVA 1PX3A 3JD71 2D6LX 2Q5TA 4XQ4A 3U1XA 5JOYA 4YGDA 3MIGA 4EWAA 4XFFA 2LRPA 2GSYA 1W6OA 1PGW1 3JUUA 2K2SA 2CGOA 2ZMLA 4ARXA 2A6VA 4YG3A 4CP9B 3HNYM 2YROA 3LB9A 5F2SA 5C6CA 2ZJCA 4PBPA 3UGHA 2KR2A 4DXSA 1R082 1VBE3 4E4SA 2R061 3BU0A 5GZDA 5ACA1 3VDCA 1YI9A 2CU5A 1UMIA 4AI0A 2KA3A 1LGNA 4LE3A 1OUXA 3SKJE 1POQA 3QCWA 4URAA 4ZU5A 3WY6A 3N9PA 1BEV3 5A7QA 1O8SA 5JZGB 3DYOA 5DMYA 4UW6A 2B9UA 4OI4A 4ZU4A 2D40A 4E2GA 3CMGA 2XL7A 3ZXDA 2Z79A 2PHTA 4GIQA 5A7PA 4PJYA 2AGSA 2R043 2WDBA 2GNMA 4R9BA 3WG2A 3WQ7A 2FQPA 1V9U3 3V0AB 4ES8A 2FDJA 4IEOA 4AI2A 4A42A 3M2MA 2PXJA 3PTRB 3ZYPA 4QX3A 4F3JA 1M4WA 2ZHLA 3BI3A 3V0BA 4INDA 5FCCA 3WQ0A 3D4KA 3ZN6B 3VKNA 5AC93 4CEYB 1GANA 1VBC3 4ZY9A 3RYKA 4FO9A 4DUVA 3ALQA 1ZBA2 2GH8A 4ISQA 2VUDA 2ZKLA 1EV11 1K12A 4N43A 5A6QA 4LE4A 2XH6A 5T5LA 4EYUA 2YB7A 3ZYBA 3OUHA 4DOUA 3RDIA 3MHZA 1YIPA 5DQ0A 1UL9A 2ZOEB 1QJEA 4EZ4A 4IV3C 1QJY3 5GJ6A 1ST8A 4AI3A 1MZEA 4Q4V1 4YFZA 2CHHA 1KFUL 1NZCA 1NLRA 4RYDA 2VE1A 5FTTC 3VHRA 1HRV1 4TSVA 1MACA 1FPN3 2F17A 2WSVA 4CP2A 5J48A 1EAH3 2RS32 4IL7A 3IT8A 1VAVA 2J22A 2A3XA 2W1SA 3ZN5A 4E2QA 1AYM3 1NE4A 3RZJA 5FO7B 4X8NA 2X5IA 1CWPA 5JOXA 3JBG3 1XU1A 4CP0A 3SH4A 4BPZA 1PX4A 1TMF3 4ATFA 2MEV3 2Q8CA 3NMBA 3PVOA 2R1BA 4CUAA 2D97A 1SLLA 5E89A 4NWWA 2FHRA 2HLEA 3IKWA 2DFCA 1CONA 2JE9A 4PLOA 4UFKA 4AI8A 5JAXA 4QGLA 2WZEA 5EHDA 4ZONA 1MQTA 1JYTA 1RUF1 2C9AA 3CU7A 4IQPA 2PMWB 3WDTA 1C28A 2ZGNA 3B94A 4BA6A 5IVBA 1CPMA 4YWAA 5A3WA 2CV6A 2VZPA 3OEAA 5KXCA 2ARXA 2ARAA 4WVWA 5IFTA 2Y0OA 3ETQA 2IC1A 4CDWA 3TEYA 5I0DA 4FSJA 3GDBA 3J7NA 4WVMB 4ZKTB 3ABZA 3ZPOA 2R073 4X6QB 5D8AC 1H8TC 4TWTA 4MUVA 1UX7A 2Q0AA 2VZOA 1ULFA 1QGLA 1YCIA 1G86A 1VP6A 1K5MC 3I7DA 3WQBA 1S0BA 4NHLA 2EVXA 4MXVA 5IVFA 3PDQA 2RR13 2H0VA 3VBHB 2NMNA 3NL1A 3LQCA 4FTEA 2WNOA 3PJQA 5JPNB 5KHJA 5D8AB 4Y33A 1AX1A 3IIAA 5DG1A 3N7KA 3ZKYA 1ODMA 3VKLA 1W8TA 3IAQA 3MLLA 4AEJA 5IVVA 2XOMA 1T2XA 4HPKA 4B7EA 5C8CC 1W8OA 4IE4A 5GZEA 3OSDA 5CFCB 4L97A 5FFOC 4Y20A 5FYYA 3H3ZA 3NJZA 2ZEWA 4FBFA 2X10A 3PUQA 3UL2A 1S0EA 1QKQA 2D6MA 4CPBD 1VBE1 5JUVA 5FZ8A 2V09A 3KVBA 3BTXA 2QJVA 5J3UA 2WO2A 1UY2A 3THDA 1NLSA 1C1FA 3U11A 3MO4A 3VZKA 4Y3OA 4E2SA 3OEBA 5KXDA 1OH4A 1UMHA 1BEV1 4MGSA 4R9AA 5T52A 2JB4A 2YY1A 1LRHA 4BHPA 2ILMA 3POGA 5K0UA 1RUE3 3I54A 2R041 1ULEA 3MIEA 5F5CA 1BLZA 4V1PA 3E6BA 5FXXA 2IXLA 1V9U1 4KGQA 1O3RA 5KWRA 3M1HA 3AP7A 3OBZA 4GH4C 1GZ9A 2Y64A 1NCQA 4XZUG 2K0GA 3WP5A 4OI0A 1MS1A 1TME3 3K51A 3KLSA 3NNFA 4IV3A 4NPRA 3PUIA 2WZR2 4UW3A 1H1IA 4E27A 3GZTB 4FI9A 3QH7A 4XCBA 5FPBA 5AC91 1VBC1 2Y6FA 2PAEA 4RHV3 3EYPA 3U37A 4META 4LK7A 1OA3A 1D4M2 1WCQA 2VOKA 3H1WA 3NAPB 4E8DA 1NE6A 3ENRA 4QPWA 1BZWA 3CKHA 1N3OA 5AVAA 3ZO0B 4DMIA 2Y26A 4P5YA 2MNGA 4LBNA 3K3NA 4YG0A 5D1IA 3G7DA 4ES9A 1QJY1 5J96B 2AR6A 3ZYHA 3A0NA 2BWCA 4GB33 3GALA 3POIA 4O61A 4QX0A 1DYPA 1FPN1 4RD7A 1EAH1 1UYZA 2VMIA 5LB6A 3RZKA 2WABA 4AVSA 1AYM1 4NAOA 4PQ9A 4A3ZA 2WLQA 5CKQA 1GNYA 4PLMA 3JBG1 3VN4A 1US2A 3VZMA 2B7YA 3WG1A 2BEOA 1GR3A 1TMF1 1RUD3 2MEV1 3NNJA 4DQAA 3SITA 2BVVA 1UPSA 1HKDA 2BGPA 2EXJA 3OYWB 3FC0A 3U14A 1WD3A 1BVVA 3IDEA 4BDVB 4LOSA 4HXCA 4HFSA 1D2SA 1QIQA 4NE9A 2ZX0A 3KS7A 5FZOA 4HKLA 4XJWA 5J1XA 2HWF3 2HYKA 2LW8A 3CQOA 5GZCA 4OMCA 2R0FA 4BXFA 2VMFA 4QGNA 5J09A 3T3YA 1WLDA 3VV1A 5JSPA 1H8TA 2D6PA 4OI1A 1GSLA 5C9AB 1W99A 3AYEA 4XMIA 4CU7A 4Q4Y3 1Z7S3 4L0PA 1XRUA 4NPMA 2OPKA 2YGMA 1DGRA 4XDQA 2OKXA 2RM23 3KT7A 1ALYA 1AYN3 4ZS2A 1RMU2 1LJ7A 2NM1A 2XJRA 4EV0A 3N9MA 1QJU3 1ENXA 2I2SA 2JE8A 4ASMB 4CDXC 3BN6A 4XZPA 1H4HA 1F4HA 4UT5A 2R071 1OLRA 3UKNA 4Q2FA 4E4ZA 2O8QA 4OZOA 4K20A 4WZCA 2RMU1 1HB1A 3HNBM 1VRBA 5C8CA 3O7OA 1WA6X 3A7QA 4L99A 1QU0A 5G05L 1DDLA 1OLMA 3VKMA 2YXSA 2RR11 1W9TA 1YEWA 5DZGA 3WD5A 1Y43B 5E1RA 2NPIA 4XJAA 1XE7A 4FTSA 3MPBA 3BGAA 1OLQA 2Q8OA 1DGLA 3VKOA 1PK6C 1KD7A 4YVWA 4ZU7A 5L7OA 4GULA 1E5RA 1H1AA 3NV3A 1VRH3 4FQZA 3A22A 1LEMA 2ZZJA 2XXZA 3VDDB 2RS13 4Y1XA 1XE0A 2W1QA 1LOGA 4FP2A 5FY9A 2RHPA 4GKXA 1UXXX 4QQPA 2CAVA 3OCPA 4GH4A 4QHBA 3LZZA 5CKNA 1RIRA 1NT0A 4TN7A 2VOTA 3FE5A 2YC4A 4FXKB 1NAEA 5AFBA 1KDMA 1WCKA 1RUJ2 3THCA 5FYUA 2XHKA 3ES1A 1IQDC 4LHSA 1PHMA 1YFWA 5IWFA 4QAWA 1LEDA 1H30A 1HXS2 1RUE1 1UX6A 4MSVA 5D2AA 3UESA 4YW1A 4CUCA 5LWBA 1IG0A 4XAEA 3Q8AA 4ASKA 4BK5A 3PMSA 5FPZA 3CDZB 4FOVA 3CIHA 1W6QA 5L73A 4D94A 4CVUA 4HONA 3MIHA 5LK5A 1TME1 2XVGA 5FO8B 5JOWA 3BKZA 2XUMA 5FDBA 1OUSA 3RVHA 2VNGA 4LT5A 1BHGA 1SBDA 1Y9GA 3AP9A 4JV4A 4A41A 2UYAA 5C3RA 4XXPA 1AR63 5JSOA 1W6NA 4NROA 4RHV1 3OGSA 4FAHA 5EJ3A 5LBFA 5BNPB 3GZUC 4Q26A 3NJXA 5JSRA 1H0BA 3CF6E 4CCDA 2XWJB 5DDJ3 1BVP1 1KS5A 3F95A 3UKVA 5BUVA 5FMOS 3JXSA 4Y1YA 2J7MA 1HIXA 1G8WA 2VULA 1JOBA 2HYXA 5BNNA 3BVCA 3PUAA 1C57A 1CVNA 1UOBA 3IPVB 4GB31 5DABA 3PNAA 3MW3A 4Q0SA 4Q4W2 1T6BX 3FX3A 5L19A 5IK5A 2PHFA 3KV6A 3LIGA 2KXLA 2WFF3 1FAYA 4XBLA 4OVEA 2VGDA 4CCKA 2W95A 5HBAA 2QDRA 2JDMA 4K8RB 1PVC2 3WVJA 4IE6A 4IXLA 4QMAA 1X82A 1POV0 4YVSA 3BTAA 3VD7A 5KC5A 4DNYA 1YC61 3DPRC 3S57A 3GM8A 1PGL1 4XOGA 4R9DA 1VBD2 5FXVA 4CU6A 2RVAA 3LEIA 1HN1A 3QD6A 3KT4A 2HH9A 3NWKA 5E8AA 4I3PA 4CDXA 5FQ0B 1W0OA 2QQNA 2ZGPA 1C8NA 2BNMA 2HWF1 2R30A 3G6JB 3WW4A 1ACCA 1S0IA 2JD4A 1ND3A 5ERLA 3C2UA 4Q4Y1 1Z7S1 3T1MA 3VB9A 3TNQA 3ZFEB 3AXEA 2RM21 3ZFGB 5A1LA 1AYN1 3CZJA 3U10A 4AI9A 3C7GA 1VBB3 2YU2A 1QJU1 2O8OA 4EJRA 4DXRA 3SEEA 2WNUB 3POJA 4RSUA 2YBPA 1SFYA 2E6VA 3OPTA 4YW5A 3NKTA 1CR7A 5F39A 2QBXA 4COUA 5CA6A 1VIWB 1B35A 1RUC3 1KXGA 1PK6A 2XB6C 2GC0A 2WC2A 3AL6A 3P1IA 2RJLA 2VTXA 1G9FA 1OHFA 3UETA 3VL8A 5L9RA 3WW3A 5I93A 1GUIA 2VG9A 3K46A 1SLIA 4RA0A 2W5FA 1UWWA 3AFKA 2DCJA 2ADEA 3MYXA 4LQRA 5CFDC 3WX5A 2WQ8A 5DN2A 1GZWB 3QBQA 5ACA2 5I8YA 4FOQA 2ZX3A 3ETPA 3MW4A 4OI2A 4TZDA 1V6JA 3SNMA 2NYYA 4Z82A 4GALA 2ZACA 3WZ1A 5FOJB 3VBUB 1HJGA 1I6XA 1ZRCA 1BK0A 3CJIB 3SCHA 1VRH1 5A32A 5KXBA 1PMIA 3GZAA 4P00B 1KITA 4QB1A 3AVSA 4XFHA 1HLCA 5FZ9A 2BVBA 1POV3 1V6KA 2ENRA 2TNFA 1G7YA 4QD2A 4QPGA 2Q8DA 4DPNA 3OY8A 4LBOA 1YXWA 3FLPA 4YW7A 3ZMNA 2Z42A 2K46A 1E5HA 1W3XA 2VXJA 4O9GA 4AEDC 1LAJA 1S0DA 4L11A 3O1MA 3JB4C 4LBKA 1J59A 2SBAA 4N9HA 4M0NA 4XXAA 2WZPP 5C3SA 1FMD2 1FV3A 4QXBA 3NJVA 5JDBA 4JGYB 4S2HA 1RVF1 2VBBA 2W39A 4K8FA 5T55A 1R092 4CDUB 3VBOB 3FUQA 1DBNA 1X9TA 4JTNA 2XJSA 5FBZA 4FVVA 4PIXA 4P9YA 4L9BA 2WT1A 1RUG2 4A7ZA 5BNQA 3H1MA 2WN2A 5C5TA 5A7NA 5CIRA 5JWPA 2FDIA 1CESA 1WCUA 5A1AA 3O1OA 4EZHA 2ZEXA 4Q4V2 4BQ4A 4UYBA 1ASJ2 3AYCA 5FO9B 1DQ5A 1HRV2 3WEZA 3T0DA 1WLWA 3H7YA 1GP4A 3AP5A 2WNVA 3KSCA 3K3OA 1LOFC 4GA9A 4P9WA 2XBO3 2NZ9A 3N35A 1AR61 3NRUA 4IGPA 1ND2C 3T4HB 1AUYA 1KS4A 2YU1A 2ZX1A 1W6PB 3IB3A 3IMMA 4XURA 2GU9A 3H8OA 3VBFC 2DVGA 5DDJ1 1VB2A 3JD73 3OBRA 3NQHA 5A33A 3CL1A 4C91A 1LR5A 1OKOA 4PIZA 5FMDA 3EQEA 3LPFA 3WHUA 4KNCA 4Q29A 3ZFFC 1IPKA 1YLLA 3PUSA 5FYSA 3RRDA 2BOIA 4QDRA 4QPIC 4WM7A 5J7MA 2ZGUA 4M3CF 1H1MA 1PIV3 3GBWA 3JZVA 5LW9A 4LIVA 1Y9QA 2DV9A 3KV4A 1OD5A 3T2QA 3VBFB 2BBAA 3SH5A 5F2WA 3OGGA 2WFF1 5BYNA 1RITA 4LXLA 4UOJA 3MI8A 4MX3A 1ZRDA 1K5JA 4CCJA 3USUA 5IK7A 1WUVA 3ZFFB 2ZKNA 4FP3A 1VJ2A 4R4ZA 1SLTA 2V5YA 4UF0A 3MUY1 5FZAA 3I3DA 4IV1B 1N1TA 4QKFA 2OQ6A 3IDAA 5IW0A 5FJHA 1PZ9A 2YGLA 2F4LA 3FMGA 5LASA 4HN1A 1E5SA 2E51A 3VL9A 3PVBB 2BW8A 1WW5A 4BQ5A 5JI9A 1N1SA 2P3IA 5GLTA 4EN6B 4CCNA 3OD4A 1IKPA 4LLOA 2A6YA 5A7SA 4A4AA 2JICA 1GICA 3GHNA 1HQWA 3AB0A 3NNGA 4YM0A 5EQUA 3I2FA 5CU1A 1Q56A 5A6ZA 4LBQA 1VBB1 1W8UA 4MGKE 3WDYA 4MGTA 4IEPA 5CFDA 1RTVA 2Y33A 3LAGA 1EV13 2Z2SB 4AEMA 3WV6A 3KF5A 4YPJA 4CTEA 2DWRA 1SHWB 1WMEA 2CNAA 2D5HA 4YNIA 2VCAA 2OYZA 3I59A 4OFGA 4Y4RA 3WUDA 1RUC1 4Z8BA 2BNOA 1ZZCA 2JDKA 1X33A 3UK9A 4UFHA 3VGIA 3T08A 1OQ1A 5LEJA 3GJAA 3VBRB 2OZ6A 5I91A 4JX0A 4HMZA 3ZR6A 4AYUA 1W6OB 1GZTA 4IEXA 3ZIXA 2GC3A 2R16A 4L92A 4G9SB 4LKDA 4AQSA 1DG6A 1VBE2 3ACGA 3M3QA 4RS5C 4DEVA 1NQDA 1PO13 2NP0A 3VZOA 2F6BA 2JG8C 4ISRA 3IM0A 2YPJA 4PI2A 4GQ7A 3DF0A 3R4UA 3ZSEA 4AEDA 4NRPA 1W39A 2IWGB 2BTVC 3T4VA 5FRAA 1BEV2 3VBSB 4M3CA 1AR92 3OBTA 1C3HA 4CCCA 3PURA 4N53A 4V2WA 4I3GA 1K45A 4FTBA 4YGBA 4MXWB 1OMIA 4JKMA 2ZHKA 1POV1 1YIFA 4U2AA 4HKOA 4RS5B 3SQOA 1NOVA 4LEJA 4SBVA 5FZ3A 5GLZA 4Q0QA 1W2OA 4ZZ8A 3ZOIA 5HV4A 4MZUA 4M0HA 1TEIA 2A5ZA 2A6XA 2GNTA 4I0BA 4LPLA 5K9YA 5FZ1A 1DGWA 5AC92 3U4SA 1URXA 2BV4A 1JZ8A 4RR3C 1VE0A 1GZCA 1VBC2 3AMNA 4XF9A 4XJUA 2P4EA 5FZIA 3RGBA 3LDKA 5FAXA 3E1F1 2X05A 3IDCB 1REFA 4HN0A 4LUKA 2QQWA 4RQPC 3OGVA 3PHMA 1SLAA 4HBNA 4U36A 4AI1A 5C70A 5KHKA 4PDWA 5C3OA 1OVSA 1SMVA 4MOAA 3AKRA 1MZ5A 5FPVA 2YHJA 1SACA 5LCWL 1OF4A 4RL7A 1G6NA 1QJY2 1QQP2 4Z2WA 1VMHA 2D5FA 4WV8A 1CAVA 5JIUA 4LMFA 3HN1A 4ZPIA 4FOWA 5IUQA 1GNHA 3B9CA 1R1A3 1EAH2 2XR4A 4XCAA 4QPIA 1UIKA 4RQPB 3V56A 2XBO1 4EN0A 5K7PA 3KGZA 4XDPA 2AENA 3WDWA 3NW4A 4JZRA 4KU7A 4I01A 4CCLA 3AMQA 4EROA 4RGKA 2MEV2 2JDPA 4NIAA 3ZXFA 1BMV1 1H2KA 1GU3A 4XFAA 3HBZA 5FKBA 4HSJA 4MV2A 3ZR5A 4ATEA 2ET1A 1WBFA 3O5SA 1XOYA 5T5JA 4AXOA 4HT1T 4DS0A 1Y7BA 2DDUA 2EAKA 4Z2AA 4AOCA 5FP9A 1RUI3 3H8RA 4I30A 5JZGC 1COV2 1RUH2 5CG9A 5FPAA 1GOHA 3VD5A 5FYHA 1PIV1 3BYWA 3AZVA 3AKQA 3C8XA 5LY2A 3ZKUA 3ZDSA 1ULDA 3ZXKA 1Q5OA 2FZ1A 2VMCA 4K6BA 4BQ1A 2VR4A 1IPJA 2B46X 3BALA 2AC1A 2DUOA 1DGWX 5J36A 2QQLA 3N7LA 4JHTA 1A6CA 1V6NA 4K7JA 4LKFA 1FOD1 1OFSA 4NHMA 2JX9A 2XL9A 1F5JA 1X9PA 4YLZA 1W2AX 4JCKA 1JI6A 1O4YA 2B5HA 3WW1A 4B29A 4IGOA 3TRSB 5LBCA 2R072 4CEYC 3AJYA 4LO5B 3JQWA 2CAUA 4QXHA 2Y38A 4GWJA 4CXXA 4EN9B 5HCHA 4R8HA 2Y6GA 5F1RA 3TEWA 5FUIA 1LECA 3T2PA 1DHKB 3RMXA 1I3HA 4JRAA 2YDEA 1EPWA 1HW5A 4NAMA 4UWDA 3LEGA 5IJRA 1ENRA 4XUPA 5FP3A 3U4XA 2C4XA 5ABJA 4QXKA 1CZVA 1XNKA 1LHUA 4XABA 2OT7A 3NJYA 3Q8FA 3H8UA 1QH7A 4Q8KA 1XQNA 2OUHA 4BK4A 3USSA 2VCCA 2JG8A 1QJX2 4DUXA 5A6XA 4JGZB 3UKTA 4CDQC 4Q1PA 1W2NA 4YW2A 1S0CA 1Q8OA 1AF9A 1K42A 2YYOA 1CAWA 2W94A 4Q4X2 3UJQA 4COYA 5EP9A 3ZXGA 2VECA 4B1MA 2YC2A 1FX5A 2GC1A 1F9KA 1AL21 2HWB3 1WMDA 4AFBA 4Y20B 2C9KA 1PO11 1ULCA 3IAPA 4CDQB 3WP4A 1REDA 1W9FA 2J1EA 2XHNA 1LCLA 2P6CA 4YZ3A 1KDKA 1S1AA 1HDKA 1NCRA 1YJKA 3HD8B 1BJQA 3AM2A 3T09A 3BIEA 2W9XA 4RR3A 3HBKA 1RUE2 4KBBA 2PHRA 4YW3A 3RFRA 2HBTA 1JZ4A 1AXYA 1CX4A 3DGTA 4XC9A 2P34A 2BRTA 5K0UB 4GD4A 2VL4A 4WM8A 3PTYA 5FYTA 1A78A 1U5YA 1TME2 1OLME 5LBBA 2EXHA 2PA7A 1Y9MA 1NCQB 3FHIB 1UU4A 2HWC3 5FZCA 2RE9A 2W91A 4QM8A 3C7HA 5CB7A 2QQIA 1H8VA 3RNSA 3I2DA 2J1AA 5FYIA 4CP9A 2ORXA 2JENA 3KV9A 3VBHC 1YRZA 4FPKA 3D3AA 4CXYA 2DURA 4GB32 2RMU3 4DRVA 1PNGA 3M7AA 2VZQA 2ZGSA 2ZBJA 4W50A 4B4PA 2WT0A 1R1A1 1LGCA 1GQGA 2WQ4A 5DAPA 3WG4A 4D6SA 3MV11 4IERA 4XBNA 5FPUA 3B9IA 3S5QA 5CFCC 1AR72 2CY6A 3TOJA 3BIWE 2QQPA 1SZBA 1NKGA 2VW2A 1S2EA 3LSDA 1RUD2 4XFIA 1LU1A 3EMRA 4PLNA 3ZDVA 3ASIA 4O65A 2XWBB 2ZMKA 5A3UA 3PVNA 1JU4A 2JIJA 3VDAA 1X50A 2JDZA 4IETA 5CZKA 2A6WA 1RUI1 2PQQA 3CO2A 4LA3A 4XEZA 3ZN6A 1CX1A 2XJVA 3MDPA 2RV9A 1PZ8A 2HWF2 3J8F1 1VR3A 4OULA 4CEYA 4XF0A 1S0GA 2JIGA 5T3NA 3GNEA 4OLLA 3WQ1A 4M00A 1MZFA 2J1TA 2K9ZA 1RGSA 5FZOB 2ZGLA 4C1WA 5KHIA 4XDOA 2WA4A 3VUOA 5HCBA 2FZ2A 1Z7S2 5A70A 1VMFA 1NY72 2E53A 1X7NA 1AYN2 1ZBA3 2VW1A 3KGLA 4JVAA 5JR7B 1JHNA 1OD3A 4A2UA 3AZYA 2XDVA 2XLAA 3WF1A 1AHSA 4KBZA 2UYBA 1ZBE2 3AK0A 3A4UA 1DZTA 3WNOA 4CSWA 2LROA 4Y22B 4COWA 2Q1ZB 2VCMA 4CUGA 2CL2A 3BU7A 3WDXA 3P5BA 1O7FA 3NAPC 4RFT0 5A7WB 2FCVA 2WO3A 4W4ZA 4AK3A 4Y4YA 2JXAA 1A8MA 2VQUA 2RS33 3I2IA 5HI0A 1BBT2 2W87A 1P8JA 1ENQA 3I2HA 3LKJA 4Q1RA 3H1YA 4OHWA 4D6QA 1SCRA 3ZYRA 1NLQA 2VH9A 3D0SA 1AR82 2PHLA 3ILRA 1W6MB 1CN1A 4BIFA 1XSQA 3FHQA 2WUHA 1VRH2 4M4RA 1F8VA 4QQ2A 2WN3A 1W8FA 2GMPA 2CYFA 1QDOA 4YVWB 2IFRA 2G9FA 5FP7A 3ITQA 2AUYA 4IEZA 4D7YA 2RS12 3B3QE 3E5QA 3KQRA 1UO9A 3H0OA 4FPCA 1MVEA 2VOWA 4LK6A 3ILNA 3WCSA 1ZM1A 2HWB1 5JXGA 2DU0A 4XAAA 2P2KA 5IT6A 1Q8SA 5HCAA 3T2OA 3I2GA 2UU8A 1OOPB 5FV3A 3MEPA 5FYMA 3EO6A 4WVMA 1W2TA 5GM0A 3THPA 5FZEA 2PFWA 1JH5A 2AACA 2XJUA 3B00A 4COZA 3IN9A 3MV01 3H42B 1WLCA 5FXWA 4YZ5A 1RUNA 1O3SA 5C9AC 3Q8CA 5EYYA 5BV6A 3WSOA 5FK8A 1IQAA 2P17A 2VZ1A 5A1FA 1KRIA 5FYBA 4L8QA 3U75A 1SCSA 1Q3EA 3J4UH 4O9EA 1YQCA 4F7ZA 3I49A 1R1ZA 2GP5A 3GGLA 1UYYA 2EXIA 3HEIA 1S0FA 1HX6A 4J1WA 3VBHA 4B1LA 3ILFA 1VBA2 4FPYA 1DF0A 1DFQA 1GWKA 5D8AA 3ES4A 3E5XA 1QOTA 1YFYA 3C7OA 5F32A 2W46A 1W6QB 2HWC1 2GMMA 2HWE3 2VU9A 4LITA 3KB5A 3HIFA 1K5MA 3KM5A 1CGPA 2C24A 1H2LA 5CFCA 3GZEA 2D43A 1RHI3 5DDJ2 1W6NB 4TXWA 1IZ3A 4LBJA 1DQ0A 2EIGA 1HB2A 3B69A 2O1QA 4CPBA 3KHCA 2DCZA 4F8AA 5CAZA 5FIXA 1WZXA 1W8HA 3LA2A 1SFNA 2Z5WA 3IZOA 1IS4A 2GNDA 3ZXEA 2H6BA 5T5OA 2PYTA 5BNNB 1FV2A 2RDSA 5GZGA 1HV1A 2VMDA 4IESA 1HRI2 5A7OA 2FCUA 1LOBA 4BJ0A 1GBGA 1ULGA 2JKBA 5F5QA 1GQHA 3VDDC 4AVTA 5HV0A 4XPVA 4NVPA 1CIYA 4PHZA 4OUSA 1HB3A 1OSGA 1YYNA 3TBDA 5FPXA 2VD7A 4TLFA 1J3QA 2QDNA 4CEWB 1NG0A 2WS92 3ZSLA 4LO8A 3SHRA 5FZLA 5AFEA 1UIJA 2HEWF 3O14A 2ETEA 5CVRA 1ZX5A 4EN7B 1E57A 3DUIA 5T5PA 2VQ0A 1IG3A 4N8MA 4BQXA 1EUUA 3LOBA 1FT9A 3TN92 5BNOC 4E4DX 2WZR3 4KWLA 2VJXA 2PLV2 3L9JT 3K48A 2QVSB 4BOWA 4BQYA 2BGOA 3LOIA 2VNVA 3SKVA 1UW8A 3AP4A 1XNDA 4GJYA 1ZBA1 1D4M3 3I2KA 5LZ6A 2DU1A 3FUOA 3Q9OA 2A75A 2R0HA 1ND3B 2JJ6A 2DF7A 1RVF3 3ZXAC 4I2OA 1XNCA 2BGCA 4N90A 2IXIA 4O7XA 1UYPA 4HOOA 4B4RA 1KJRA 5BNOB 1JYVA 3I3MA 3IWZA 1N3QA 2E7QA 4Y1UA 5BNPC 1RUC2 2OIIA 2C0ZA 2A3YA 4H55A 4C0BA 1LOCA 2PAMA 3FHAA 4B4QA 5LY1A 4NIDA 3MFCA 4W6WA 2OPWA 4A6OA 2RS31 1B35B 4FFHA 4ITCA 4XUOA 4QKBA 3TYJA 3LDBA 4F83A 3OF1A 2OUJA 5F37A 1QDCA 2VVEA 1UAIA 4N7IA 3N36A 3PVEA 2XG3A 5H9PA 4OMDA 3WF3A 4EN8B 3VD4A 2ZAHA 3OYWA 5EXOA 4UFJA 1CAUB 1H6YA 1F31A 1QXRA 2CWSA 3I8TA 4H7MA 3KMHA 3AZZA 2P3KA 3VD9A 1GWLA 2BJSA 4FPJA 1ZZ7A 4OUMA 2B45X 1W04A 1OPOA 1C8M3 1ZYBA 2WO1A 3ZLIA 1KFXL 4E8CA 5C4WB 3S0MA 3QLQA 1C4RA 5C9AA 3O1RA 3E5UA 1IHMA 3GYDA 1UOFA 2EAAA 4MHRA 3GJBA 2RDNA 4TLGA 1CQ9A 1UKRA 2BU9A 3WR0A 1BYHA 4P5HA 2GNBA 2VMHA 4QPGB 4NPLA 4I0AA 2RDQA 4JQTA 1FYUA 1ZZBA 2P3YA 1AJKA 1RMU3 2PHXA 2YUEA 3SISA 1T6GC 1LOEA 5LA9A 1GYKA 4CXWA 1UNBA 4Y1ZA 4KMQA 1MEC2 1JZ7A 1CD3G 3ZFEC 2JE7A 4LJHA 3ZFGC 3HMYA 1UF2C 1G9DA 1QOSA 5F3CA 2VTFA 4HANA 3FL7A 5EJZB 2GALA 5JXIA 3IMNA 3ACHA 5LATA 1H4GA 2WWUA 4XMAA 2WNUC 4MH0E 1PM7A 2E33A 2IVIB 4FFFA 2HBUA 3ZM8A 2W1UA 3U0ZA 1YUDA 5JIAA 4J25A 2JG9C 5KC6A 4QPYA 1PZ7A 2VQAA 4A44A 1RYYA 1UZ0A 2HWE1 2MHFA 1JMUB 2QTWB 3WP6A 2PHWA 4LHKA 5DAQA 3EB7A 2WNVB 2D93A 4M3CE 1ZRRA 1JTZX 1RHI1 3JD72 3LEKA 4ZXKA 3DXTA 3SMHA 2LUWA 1YFXA 1OQEA 4JDMA 5A3NA 2WR9A 1QXJA 2BUKA 1OT5A 5A33B 1HN0A 1PGW2 2JG9B 2R49A 3TEXA 3VBUC 4DY3A 1F4AA 3OOXA 4AAPA 1K3IA 4K9SA 1OA4A 3CJIC 2XJTA 5LA2A 2B8MA 5CNAA 5A3LA 2GN3A 2Y0IA 4AVBA 1O4ZA 1S2KA 4AGVA 5SV5A 4WM7B 2R062 3O0WA 3T0BA 1STMA 1XPWA 3BPZA 3SC7X 4YW6A 3ZYIB 5I0UA 1D4VB 4AL9A 4AQ2A 1JBCA 3HAGA 3ATGA 4P9GA 2ZHMA 1QNYA 5B4XA 3ZSMA 1HXS3 5GKAC 3AXDA 2G9GA 2JDYA 2BERA 2JECA 5EFUA 5C3QA 3J7HA 1XNBA 4COVA 3CZUA 4JGYC 5JMOA 1J84A 4CDUC 4TYSA 2QQMA 4HSLA 1LKNA 1L7QA 3L2HA 4FQ4A 3T30A 4P08A 3VBOC 2YG0A 4H7LA 4XVHA 3ZSKA 2GZWA 4AG4A 4CU9A 5C5UA 1MS5A 2P37A 4YW4A 2WZR1 3TWIA 4D6RA 1JOJA 3NNMA 4CYDA 2I45A 1IS3A 3R05A 4IE0A 4NN0A 1F5FA 1D4M1 1JYCA 2XVKA 1G9AA 4CCMA 2VZVA 1GOFA 4IGQA 2FDFA 1CZSA 1FXZA 4HETA 2F4PA 1QY4A 5EJ1B 3IPVA 1EV12 4OHVA 5FZHA 5APAA 1BK1A 2DCKA 5DAXA 3T1LA 1NUKA 3THTA 1JYWA 2C5DA 3KCYA 1ZREA 2ERFA 3O0VA 1FATA 1Z78A 2J1RA 3PU3A 5M0TA 1W2UA 3E97A 5HCFA 3VD3A 2PTMA 3LWCA 3R6SA 2D6KA 1RJ7A 2XUEA 4NOTA 4XTMA 2A71A 2OQ7A 4M01A 1UZYA 4MVTA 2ZGTA 4QWNA 4Y26A 1PO12 1YQ8A 1CAXB 3KWVA 4LKEA 4UW5A 4MO3M 1ZZ9A 3T2TA 4AAXA 2HWD3 2ID4A 3AMHA 5DPNA 4BH9A 1GP5A 5B4NA 2FDGA 4WVVA 1GP6A 5FQ0A 3ZVXA 2ZGOA 1AL0G 1XNAA 1VBD3 2WSUA 4H14A 2Q8EA 3T0AA 1C8M1 3E6CC 3MFAA 2FDHA 2E7AA 3N9QA 4JAAA 4AGRA 1LGBA 3AVRA 1W05A 3OPZA 1AXZA 1ZVFA 3SH3A 5FKCA 2RG4A 1A8DA 2YPDA 3DPRA 4N53B 4ONUA 5H9QA 3ZFGA 3J26N 2QQVA 2VBDA 4IV1C 1RUF2 1GQPA 5IVCA 1JS9A 2Q4SA 5FZ6A 1ULOA 1OURA 2A70A 4DFSA 3AJZA 3AMPA 3GBGA 1OPMA 1H6XA 4FPHA 4LR4A 1RMU1 2EXKA 4YZ4A 2QZ3A 2WRAA 1NA1B 2N7GA 5F8PA 4X8PA 1KGYA 4WZFA 3FN9A 4A7KA 2PQSA 1FOD3 4BM8A 4AHZA 2YBSA 2LM3A 3ROUA 2WFPA 1SPPB 4AVCA 4Z1VA 1DGRN 5FWJA 2SLIA 5FLJA 4RGGA 2ZXQA 4KWJA 4JRLA 3O1PA 1JN2P 1GZWA 4QX5A 1YI7A 4B8EA 1VB4A 1YJLA 5CYYA 2WA3A 2IFWA 3K4AA 4UFLA 1R1A2 1PO23 3VBUA 3SCFA 1CAVB 3PIGA 4URTA 3CJIA 2GDFA 3VBRC 1UQXA 2VZUA 4N7UA 4D7SA 1F15A 2QE3A 4XETA 3GCXA 3DL3A 2J1UA 4QX1A 1VMJA 1WMXA 5F6KA 2VBPA 2EIBA 4OHZA 2G1MA 4DINB 3RI8A 1MS8A 2GAUA 2VVDA 3WG3A 4AF9A 4AFDA 4HVQA 1M06G 2X8KA 1DLCA 5EZWA 3UV9A 4PIYA 2DYCA 3IIIA 2D3RA 5F7UA 3JQXA 3VBSC 1OA2A 5CISA 1V6OA 2IXKA 3HQRA 4J6GA 1SLBA 3A0KA 4JGYA 4KG8A 4AFMA 3W5MA 3N3HA 5FZ4A 3BTYA 1W9SA 2D44A 1AL23 1SLCA 1FMD3 1H2NA 2WNEA 5T50A 4PF5A 2V73A 1LODA 4IE5A 5HPOA 1R093 1ZZ6A 2RS53 3ACFA 4KQ7A 1EPZA 2VZTA 5EPAA 5GLVA 1HXS1 1L3JA 1RUG3 3NNLA 5D21A 2D3PA 2BQPA 4Q5OA 4L2NA 5FYVA 3VZJA 5EYXA 3ZPYA 5LA1A 2R042 1WW4A 2BP6A 2IXJA 3KZ4C 4KL1A 4XE9A 1YQ2A 4JC1A 1U12A 4BQWA 5H9SA 5DZEA 1V6IA 1ASJ3 1V9U2 1WWYA 4KU8A 1W3VA 1RJ8A 2Y34A 1BXHA 1GV9A 2W2IA 1W6PA 2DFBA 3ZYJB 3OGRA 2TBVA 4N43C 3VHPA 4OUEA 2OW4A 5GLWA 2ARBA 1F35A 5JPMB 3FZ3A 1MVQA 5FOBB 1ZA7A 2LS6A 3ACIA 1TVGA 4H2AA 4QQLA 5FPLA 5ABJB 3V0BB 2CGPA 1OKQA 4QX7A 1LOFA 1HQNA 4K21A 5FZDA 2XKOA 4OYUA 1ND2A 4MG2A 3RSJA 3N7JA 2QNKA 1V6LA 4GJZA 1DZRA 4PCRA 2E7TA 3DN7A 3WP3A 2J1VA 2X53S 3N9NA 3KCXA 4N43B 3VBFA 2OX0A 4EWDA 2JDNA 4WBBA 1LHVA 1GMMA 5L7OB 4HG6B 3FLTA 3MLKA 1RINA 3DECA 3OUIA 1FPN2 4JDOA 3ZFFA 2HWB2 3SXWA 3WNNA 3FFQA 4KG0A 3J7MA 5LK7B 1AYM2 4YYOA 2NMOA 3KF3A 2E63A 4I02A 1WBLA 3JBG2 2HWD1 1I5PA 2VAUA 4HL0A 3UJOA 5IHRA 1SBFA 1TMF2 1G9CA 4C1XA 1JU3A 1DCSA 1VBD1 2G19A 2X5IB 1JW6A 1VLNA 5I0TA 2WYFA 1O5UA 3PUHA 2PHDA 5IK8A 1IOAA 1YWKA 4G3YC 4LOTA 1MS4A 3WOGA 4LULA 2J42A 4LUMA 2VZ3A 3EJKA 3OBAA 3J8F3 1S2BA 5LRRA 1Y3TA 3QH6A 1SFPA 1QMJA 3D82A 3OPWA 3WUCA 4FPGA 4N9IA 5EV7A 4CDWC 4D8MA 5E6HA 1MQTB 1NYWA 2VMEA 1UZWA 4UW4A 3ZXJA 2NQYA 1D0GA 3D6EA 1N47A 3ACLA 1MS9A 4NIIA 2ZGQA 4LORA 1YQ5A 3VBRA 4A7YA 2J1SA 3I97A 1LHNA 3RI9A 2WIIB 1L7LA 4KWUA 4K1YA 5DUXA 3VZNA 4BLIA 4CDWB 2HEVF 4IW3A 3C3VA 3ZYFA 2BWAA 3O12A 2PELA 2RMU2 4JGZC 2IVJA 4DRRA 1ZRFA 2DTYA 3IBMA 2EICA 1PO21 4AEKA 1DLLA 1W0PA 3VBSA 2Y8KA 4IEQA 2RR12 2ZMNA 3POFA 4EE2A 1A3KA 1J3RA 1DIWA 5GLUA 4IDZA 4MXWA 1WMFA 1ONAA 2BDRA 1AR93 1MPXA 1AZDA 3E6DA 4J1XA 4ORFA 4RS5A 4XACA 3LDRA 5DUVA 1H9PA 3TEZA 4FCAA 4YM1A 2H0BA 4NO4A 1TE1B 3U78A 1H9WA 2DTWA 3AZXA 1NXMA 2PN5A 2ZGKA 5GZFA 1I1EA 2NLRA 1MS0A 2GP3A 3ECQA 4HPKB 4LKSA 5FY7A 5IAVA 1SBEA 1W9YA 1FMD1 1PMJX 2PAKA 3HPNA 3AKTA 1J83A 5K0UC 1WLTA 1YQ6A 1R091 2G4IA 2RS51 1N3PA 4BQ2A 4YGCA 1Q8QA 1OF3A 4G4FA 5K8SA 3X29B 1RUG1 4NRMA 1A34A 1NCQC 1UMZA 3INAA 4DEQA 2RDRA 3OB8A 2LALA 4XUQA 2XQRA 3AFGA 1O4TA 1LENA 1PVXA 1QQP3 3LGRA 3OTFA 2VM9A 2OVUA 5FWEA 3RWKX 3U07A 5C3PA 1O3TA 3DCQA 4RQPA 4AQTA 1RUOA 1ASJ1 5FZKA 4AVVA 1XJAA 2WO7A 4LIUA 4OCTA 5KBFA 3WNMA 5KHGA 1YO8A 3S5AA 4NR1A 5B2GB 4I0WB 3GF6A 3RZMA 5F3EA 2Q30A 5JR2A 1B09A 4LBMA 4UAPA 5DUWA 2ADDA 1WKYA 3W58A 1LESA 2Y6JA 2NN8A 4IV3B 4R9CA 1J3PA 4RHV2 1QH6A 5F3GA 4K40A 5C8WA 5FXZA 1I5ZA 1LULA 4MADA 3W9AA 1JZ2A 5FZBA 2CSGA 2YMZA 3MZHA 5T54A 2Y6HA 4HLTA 4QX2A 5F5IA 2UURA 3HJRA 1SDWA 3H3UA 1COV3 1RUH3 3C7EA 4LLFA 5LEKA 1JODA 4HK8A 3WT3A 3HR9A 3N7MA 3M3EA 4GXLA 4EWEA 5JOZA 4XF3A 1R083 3OG2A 1AJOA 3P6BA 5JZGA 2JWPA 4HVOA 5A3TA 1R64A 4XJ8A 1AXKA 1QJFA 4P02B 3B02A 1DZQA 1JYIA 4JDNA 2A3WA 4DXTA 2R7EB 2DVDA 1C1LA 3I4IA 3V0AA 1VALA 3LD8A 3K2OA 4MHUA 3AYDA 1PGL2 3RS6A 5C71A 2D3SA 2XQXA 4GWNA 1JZ5A 1JUHA 3GHMA 3LA3A 3MGUA 5FYCA 1FNYA 4M4PA 1BCXA 4FOYA 3I3QA 4FFGA 2VOVA 3PU8A 1KJLA 2DBNA 2VW0A 3DKQA 4FPEA 3LSEA 1IPSA 2XVLA 2XMLA 4LBLA 4CCEA 2ZX4A 4IEVA 2ZEYA 5AVPA 2DCTA 4GKYA 4Q4Y2 2ZGMA 3EHKA 4JGZA 3UT0A 2HWE2 3GXUA 2BBVA 2RM22 1XE8A 2ORZA 3AKSA 4I09A 1YFUA 1H8TB 2XPJA 4DIQA 5CBLA 1ZA4A 2D7FA 1QJX3 1V0AA 5FP8A 3MIDA 3Q8BA 2H6CA 1QJU2 1RHI2 3POEA 3W20A 4W65A 1Z0HA 5IVJA 1RXFA 2VUAA 3RZHA 1OC1A 1K5MB 1X36A 2P6HA 4XJZA 1OBNA 2BFUL 3CNAA 3RZZA 3ZIWA 5FREA 4BWOA 2ATFA 4Q4X3 3AZWA 2A1XA 3M8LA 3W59A 4CDQA 4MGQA 2ZABA 3K75B 5E16A 3KD4A 4OHXA 4LO6B 1GNZA 2C1FA 2UWCA 4HVRA 5FR3A 3LA7A 5I8TA 4YVWC 4KGGA 4S2GA 4E4HA 5L7OC 2CDPA 5FUPA 3WNPA 4ET7A 4NHYA 5C8CB 1W8NA 4JKKA 2YC0A 3WLUA 1AR91 4JKLA 1CJPA 1Q8PA 1NX9A 4V2VA 2W3JA 2XLFA 4NUBA 4OZXA 5F9TA 1DQ6A 4FPOB 1OOPC 3S6PA 3ME2A 1BQPA 2Y6KA 3AKPA 2E9QA 3QOPA 3BB6A 5FK7A 5FUNA 2XKPA 1W28A 3H8XA 4LA2A 1F2NA 1O6UA 5LBEA 4KI5M 1UU6A 1PNFA 1O3QA 1AX2A 3HQUA 4D3WA 4D69A 2C6SA 1UD1A 4QKNA 4K1ZA 3MIFA 3VLBB 1UY1A 3MW2A 4A6SA 4UBGA 3UGFA 4TTGA 1JUIA 4MGZE 1OXCA 4YZ1A 1YHFA 3L2YA 3MIBA 3ORJA 1UKGA 4W6XA 1RVF2 1JOPA 3P3NA 4GH4B 4CRQA 2UWBA 3NKGA 3WXPA 5A3MA 3S7EA 4YM3A 3M70A 1U5ZA 1AVBA 1QQP1 3DV8A 1EUTA 4C0HA 4RFRB 5DG2A 5LRSA 3WINE 4W8JA 2HKXA 2X09A 1UZZA 4ASLA 1V00A 4YRDA 4PF1A 4AE2A 3NSTA 4KH9A 5EIYB 2EF6A 3WNLA 4DUWA 3M3CA 1QNWA 1AR73 2ET7A 1CIWA 2VNOA 3M3OA 4AFCA 4AZZA 1HJFA 1MS3A 1AR62 3B01A 4QX8A 4RGAA 4Q0PA 5BNNC 4IE7A 5FZMA 3POWA 4QB6A 1O5LA 3EXUA 3IDBB 3WNKA 4LO7A 3CBNA 5DUUA 1SQ4A 4W6YA 2Q1MA 4BISA 3A23A 2YV8A 1C8M2 1XYPA 4YM2A 4DXZA 2QQKA 3D8CA 4Z92B 1COV1 3AMMA 1NQJA 1RUH1 3F2ZA 1TZOA 3NV4A 4JQRA 4CE8A 4XQWA 4Q27A 4MYEA 4CEWC 4XJ9A 3WDVA 1UY4A 3B7MA 4R52A 1TQ5A 5FY5A 2BOJA 4ZHNA 1R081 3LE0A 4Q0VA 3O1UA 2VC9A 1IGOA 4NWVA 4UXAA 5ANQA 4YVSC 2CWMA 2Y60A 1QJZA 5DZFA 2RJ2A 2WFF2 4XUNA 5FBJA 3MF9A 4Y22A 4HZFA 1NXD1 1LTEA 1S4CA 1U5IA 2QZ2A 2ZPXA 1ZBE3 3C7FA 3FJSA 3RZLA 2VZRA 3AX4A 5FJKA 4YG6A 5A7WA 1OH3A 4YARA 5JXJA 3NVCA 5FY8A 5CG8A 3AYAA 3GBFA 3URFA 1LB2A 3HT1A 2XONA 4YVSB 3V65A 1ND3C 1WCDJ 2FCTA 1W9WA 4UFIA 1GWMA 4AHYA 3I3BA 5BY5A 3KQ4B 4QDQA 1BBT3 3ZMOA 3WDUA 3M3IA 4B3NA 3K4ZA 4GWMA 3BCWA 3NAPA 4CDXB 1W6MA 1E5IA 2YBKA 3RJ2X 1DQ4A 1UCXA 2QQJA 4Y1VA 1IS5A 3RQ0A 5C7GA 3MF6A 4YGEA 4B7KA 5CEHA 1O8PA 2LTNA 1AR83 1EY2A 5A6YA 2W47A 4X6RB 1B35C 1CJDA 3N9OA 1LU2A 1W8ZA 1QJX1 1VBB2 2IUWA 4QKDA 2WLPA 2ZEZA 3O1TA 2V4VA 5IAXA 3POSA 4HKWA 3B5LB 3FWEA 4QU1A 2AEYA 5JI7A 4Q4X1 3H50A 3I2OA 2HEYF 4C90A 3CHXA 1OOPA 2JD9A 2CGNA 3SEPA 1J1LA 2UWAA 1JXNA 1ODNA 4SLIA 1YNAA 1DP0A 1FNZA 2AH2A 3EBRA 3MPPG 2VCBA 5C4WC 1PK6B 5FY1A 3MUZ1 3RZGA 1QF3A 2CTVA 3WF4A 1W03A 1NZIA 3BODA 2O14A 4BXSV 5I0RA 1UZVA 2W0XA 3AC0A 4QPGC 5CADA 3H7JA 4AHXA 1I9RA 5I8SA 4CCOA 1BKZA 4XF1A 1RC6A 1X8MA 3PMEA 5L36A 5CKMA 2JDUA 4QT6A 5FLIA 1H2MA 1VBA3 1UY0A 3AL5A 5A32B 4LHLA 1XB9A 3ZN4A 4BLJA 3RYRA 1XC6A 1J58A 5BPXA 2ZX2A 3NO8A 3ZX7A 3OY8B 1DQ1A 2QQOA 5FMCA 3QACA 2JDHA 4DY5A 2E31A 2XLGA 2VUCA 1RB8G 2VY0A 5FLHA 1HB4A 1W0NA 2B42B 4QHZA 5KR7A 2BNNA 3ZXLA 2V5DA 3ELNA 5IVYA 4DO0A 4BMEA 2Q1FA 4QQOA 3VHNA 3SLIA 1JZ3A 1O59A 3HNMA 3LIHA 1O91A 2W52A 2MPFA 1WCSA 1KQRA 2WNVC 2ES3A 3KVAA 1SG3A 3LPGA 2Z4FA 1HRI3 5IK4A 4XHXA 2JEMA 4P9JA 5F6LB 1AR71 2DCYA 4CEWA 1C5HA 4FT8A 1UPIA 2AYHA 3PJYA 2XBO2 4AVAA 1CZTA 3LFMA 1RUD1 1W8WA 1ENSA 2E32A 2HWD2 4RN5A 2W68A 4BIOA 3WF2A 2WS93 2FMYA 3FBMA 4FAGA 1UN1A 2DUPA 1UOGA 4PBOA 4XFCA 3VDDA 5IFPA 4WM7C 1BMV2 2QQUA 4Y5SA 1XXNA 1AX0A 3VKFC 4HK9A 5BXXA 2ZAAA 4PI0A 4FXGB 4XILA 2OS2A 2VZSA 2Z69A 3DKWA 1KEXA 2B39A 2DUQA 3TN93 3RG0A 3LEMA 2DVFA 2PLV3 4ZS3A 1PIV2 2AZ5A 2D6OX 1LOAA 1W90A 2JDAA 4CUBA 4BCUA 4QQHA 1DQ2A 2WWSA 3KT1A 3DPRB 2D6NA 1LHOA 1NY71 2UY9A 4GMP0 4QHOA 5LA0A 1C5IA 2HJIA 3JU9A 5BNOA 3R4SA 4ZZ5A 3BOPA 5FY0A 1RUJ3 3K4DA 5ISLA 5J37A 1ZBE1 4YZ2A 4QDSA 3DYMA 2ZTNA 5K4LA 3ST7A 1FOD2 3HQXA 1DU3D 1ZRIA 4S2DA 4QM9A 1D0HA 3USUB 2O0OA 2AEZA 5ANNA 4Y5TA 2UY8A 2G9ZA 3LFIA 1PGSA 4QB2A 4D7TA 3I2JA 1TNRA 2YFZA 1EYBA 4DB5A 4MLOA 4NHXA 4UF0B 3W21A 5A3PA 2ARCA 4PT6A 3TNPB 5IATA 5KXEA 1BBT1 4KWKA 1SDDB 3TAYA 4QU2A 5JLVA 1QWRA 4BU2A 1CAUA 1REEA 2EA7A 2RJKA 2TEPA 3JB8A 5BNPA 2P1BA 1TG7A 4S2FA 4XBQA 1PO22 1GFF2 2FBEA 1Q43A 4AGGA 5EWSA 1D2QA 3RJRA 3WHTA 1AR81 1XNTA 4Y24A 4AFAA 1XYOA 5C4WA 5FZ7A 4CU8A 4XF4A 1XBFA 2QKDA 4LBQD 1HQLA 4LBQB 1PMHX 3I3EA 3PIJA 3WF0A 5CFDB 3R0RA 2RS11 3BUCA 2WYSA 2BPA2 2XGXA 3J9SA 3LCPA 3S7IA 2R1DA 2ZA9A 3PL0A 5A3OA 5JMCA 3UNPA 3ZSJA 3I59B 1J1TA 2JB8A 2WQZC 2R32A 4P9XA 4Q4W3 5DAVA 5F5AA 4AW7A 4EQVA 3W5NA 3OD0A 5FY4A 1AL22 4PQQA 3DXUA 4LTAA 1GLHA 2GH2A 4N53C 1PVC3 2ZS6B 4IEYA 1X8EA 2GN7A 2I07B 2A7AA 2RS52 1ZNPA 4YFWA 5F3IA 1MEC3 3NV2A 4GMP3 2IXHA 2R6QA 5FMBA
chains in the Genus database with same CATH topology
3RZJA 4NJ4A 3O1PA 4IE7A 2FD8A 2FDKA 3O1SA 3O1MA 4NIIA 4NRPA 3BKZA 3T4VA 4O61A 4ZHNA 3BTZA 3O1UA 3I3QA 3RZKA 3LFMA 4NROA 3RZLA 4O7XA 2FDIA 3O1OA 4NIDA 3I3MA 3BTYA 5DABA 4IDZA 4ZS3A 3RZHA 4NIHA 3BIEA 4IE5A 3T4HB 4IE0A 4QKBA 4QHOA 2FDFA 3T3YA 3H8OA 3O1VA 4NPMA 4IE6A 4ZS2A 3S57A 2IUWA 4QKDA 3BU0A 3O1TA 3O1RA 3I2OA 4NRQA 4NRMA 3I49A 3H8XA 4IE4A 4NPLA 3RZGA 4CXYA 4MG2A 2FDGA 3BUCA 3H8RA 4OCTA 4QKFA 2FDJA 4QKNA 3S5AA 4CXWA 3BI3A 2FDHA 3BTXA 3RZMA 3KHBA 4JHTA 3KHCA 4RFRB 4MGTA 5F8PA 4CXXA 4NIGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RZJ A;  4NJ4 A;  3O1P A;  4IE7 A;  2FD8 A;  2FDK A;  3O1S A;  3O1M A;  4NII A;  4NRP A;  3BKZ A;  3T4V A;  4O61 A;  4ZHN A;  3BTZ A;  3O1U A;  3I3Q A;  3RZK A;  3LFM A;  4NRO A;  3RZL A;  4O7X A;  2FDI A;  3O1O A;  4NID A;  3I3M A;  3BTY A;  5DAB A;  4IDZ A;  4ZS3 A;  3RZH A;  4NIH A;  3BIE A;  4IE5 A;  3T4H B;  4IE0 A;  4QKB A;  4QHO A;  2FDF A;  3T3Y A;  3H8O A;  3O1V A;  4NPM A;  4IE6 A;  4ZS2 A;  3S57 A;  2IUW A;  4QKD A;  3BU0 A;  3O1T A;  3O1R A;  3I2O A;  4NRQ A;  4NRM A;  3I49 A;  3H8X A;  4IE4 A;  4NPL A;  3RZG A;  4CXY A;  4MG2 A;  2FDG A;  3BUC A;  3H8R A;  4OCT A;  4QKF A;  2FDJ A;  4QKN A;  3S5A A;  4CXW A;  3BI3 A;  2FDH A;  3BTX A;  3RZM A;  3KHB A;  4JHT A;  3KHC A;  4RFR B;  4MGT A;  5F8P A;  4CXX A;  4NIG A; 
#chains in the Genus database with same CATH topology
 3MBW A;  4BZ4 A;  4AED B;  3MLJ A;  1NA1 C;  4NJ4 A;  4R4X A;  2GME A;  4GWI A;  4M3C B;  4ARY A;  4A45 A;  2FD8 A;  3N9L A;  1VBA 1;  3O1S A;  2FDK A;  3ZFE A;  2YFU A;  4XUT A;  4MGI E;  1Y4W A;  5FZ0 A;  2XJQ A;  4AHW A;  4BE3 A;  1RL3 A;  1IKQ A;  5DXD A;  3S30 A;  4AQ6 A;  4XFB A;  2WNU A;  3CEW A;  1XU2 A;  4PDW C;  4CZS A;  2YZ4 A;  4JHZ A;  1ULP A;  5H9R A;  2P3J A;  2WJS A;  4ZXE A;  3NV1 A;  4P14 A;  3BTZ A;  1CPN A;  1LHW A;  2IXC A;  2WIN B;  4Z07 A;  2JG9 A;  1XYN A;  2DBI A;  1SEF A;  3RMY A;  1JYN A;  3H3L A;  2VQT A;  4JTO A;  4Y5Z 0;  1N1V A;  3APB A;  1DYK A;  3RWN A;  4DZG A;  4OHY A;  4P9L A;  2CDO A;  2W08 A;  5TSW A;  1PM4 A;  4XIO A;  1UYX A;  1OFN A;  2WZ8 A;  1WW6 A;  2WL1 A;  2VOX A;  1ND2 B;  3A21 A;  4PDW B;  2WT2 A;  4XFG A;  3V64 A;  5HXM A;  1HRI 1;  2BFU S;  2Y6L A;  3UYJ A;  2R06 3;  5ACA 3;  3VHO A;  4NIH A;  3J7L A;  3Q8E A;  2B4K A;  5J98 B;  3HOB A;  1MR5 A;  1APN A;  2OXB A;  1U0A A;  2QUO A;  1U5X A;  2TUN A;  1UXZ A;  5KHH A;  2WS9 1;  4QPI B;  2WWJ A;  3JCI A;  1JYX A;  3O1V A;  3N4M A;  2E26 A;  4BMB A;  4XTP A;  2OA2 A;  2WAO A;  4Q0U A;  4BYY A;  4CP1 A;  4XW3 A;  5FYZ A;  1QHD A;  1RXG A;  2VVF A;  5FP4 A;  2QFE A;  3TN9 1;  1VPH A;  1RUI 2;  2EID A;  2W1W A;  3ZYG A;  3M4F A;  4BB3 A;  2FMD A;  3UGG A;  2PLV 1;  1UOJ A;  4NMI A;  4D0Q A;  1D7P M;  2QCS B;  2DVB A;  3J8F 2;  1LNS A;  3R4D B;  4CDU A;  2VXR A;  3HT2 A;  2WKK A;  1JHJ A;  3VBO A;  4YSF A;  5SV8 A;  4A3X A;  4NRQ A;  1US3 A;  5FZG A;  2V72 A;  2I74 A;  4XHB A;  2A73 B;  1DYO A;  4H3W A;  1RUJ 1;  2EIE A;  4AWD A;  1OVP A;  1XSR A;  1WGP A;  1QEX A;  4FPF A;  1WA4 A;  2VPV A;  3P3P A;  4IEU A;  1UY3 A;  2PHU A;  3GCW A;  2GC2 A;  3OJB A;  2W92 A;  4Q8L A;  3FFZ A;  1OQD A;  4IUG A;  3D0J A;  4UI9 L;  3RPQ A;  3K77 A;  5ABJ C;  4Q4V 3;  5E88 A;  1CAX A;  3KHB A;  1L7R A;  4QGM A;  3HVD A;  1HRV 3;  3POY A;  2DVA A;  1OI6 A;  2BZD A;  5G04 L;  5IYY A;  4MGY E;  1TNF A;  1V6M A;  1IS6 A;  4FPL A;  3BPS A;  3CJX A;  5HXV A;  3KCC A;  4C8D A;  5IVE A;  3BOW A;  4BQ3 A;  5GAL A;  2BYV E;  3HWJ A;  5DAW A;  1JZ6 A;  3WCR A;  2D98 A;  2B9V A;  3VDB A;  1UU5 A;  3OGJ A;  5I0S A;  2X29 A;  1V70 A;  4K3U A;  4NHK A;  1Q8V A;  1VAM A;  1HV0 A;  2VTX J;  3POB A;  4P9I A;  5JXH A;  2ARE A;  2IZW A;  4NIG A;  2JKX A;  5C33 A;  2JG8 B;  2WBK A;  3OUJ A;  4OQ9 A;  3RYP A;  2ZCW A;  3FLR A;  3WW2 A;  2X5I C;  1RUF 3;  4Q4W 1;  1NA1 A;  2KD7 A;  4WVZ A;  4IEW A;  1CAW B;  3MIC A;  1MZ6 A;  1NCR C;  3CLP A;  2ZHN A;  4UFM A;  3H9A A;  4LNV A;  3D5O A;  2V4A A;  1PVC 1;  4IV1 A;  1FI2 A;  1SPP A;  2ZZQ A;  1N1Y A;  4OQ8 A;  3O0X A;  1MEC 1;  1ZZ8 A;  1QOO A;  2VNR A;  2VO5 A;  3AP6 A;  4GMP 1;  3PLQ A;  5L9B A;  2C26 A;  5JCT A;  3B93 A;  4WM8 C;  4CA9 A;  1S55 A;  1WW7 A;  4GZ9 A;  2L9L A;  1MQT C;  2P5B A;  1EP0 A;  3FBY A;  3LF7 A;  5L9V A;  1GKB A;  2EAL A;  1VAK A;  2VUJ A;  2ZGR A;  1NCR B;  4XQD A;  5A80 A;  2A6Z A;  4XIK A;  3TB0 A;  4RR3 B;  1WD4 A;  3DEM A;  3KV5 A;  3ON7 A;  4XYX A;  3VZL A;  4AR2 A;  4E9K A;  1G9B A;  1S0J A;  2VMG A;  5FZF A;  1GOG A;  1QXP A;  2KM2 A;  4LHN A;  4GAZ A;  4UBH A;  3DYP A;  3HN3 A;  4WM8 B;  2OZJ A;  5FMO L;  3WNX A;  4FFI A;  1W06 A;  4QXC A;  2HWC 2;  2XJP A;  3SCG A;  2WAA A;  4LO4 B;  5JVV A;  1PX3 A;  3JD7 1;  2D6L X;  2Q5T A;  4XQ4 A;  3U1X A;  5JOY A;  4YGD A;  3MIG A;  4EWA A;  4XFF A;  2LRP A;  2GSY A;  1W6O A;  1PGW 1;  3JUU A;  2K2S A;  2CGO A;  2ZML A;  4ARX A;  2A6V A;  4YG3 A;  4CP9 B;  3HNY M;  2YRO A;  3LB9 A;  5F2S A;  5C6C A;  2ZJC A;  4PBP A;  3UGH A;  2KR2 A;  4DXS A;  1R08 2;  1VBE 3;  4E4S A;  2R06 1;  3BU0 A;  5GZD A;  5ACA 1;  3VDC A;  1YI9 A;  2CU5 A;  1UMI A;  4AI0 A;  2KA3 A;  1LGN A;  4LE3 A;  1OUX A;  3SKJ E;  1POQ A;  3QCW A;  4URA A;  4ZU5 A;  3WY6 A;  3N9P A;  1BEV 3;  5A7Q A;  1O8S A;  5JZG B;  3DYO A;  5DMY A;  4UW6 A;  2B9U A;  4OI4 A;  4ZU4 A;  2D40 A;  4E2G A;  3CMG A;  2XL7 A;  3ZXD A;  2Z79 A;  2PHT A;  4GIQ A;  5A7P A;  4PJY A;  2AGS A;  2R04 3;  2WDB A;  2GNM A;  4R9B A;  3WG2 A;  3WQ7 A;  2FQP A;  1V9U 3;  3V0A B;  4ES8 A;  2FDJ A;  4IEO A;  4AI2 A;  4A42 A;  3M2M A;  2PXJ A;  3PTR B;  3ZYP A;  4QX3 A;  4F3J A;  1M4W A;  2ZHL A;  3BI3 A;  3V0B A;  4IND A;  5FCC A;  3WQ0 A;  3D4K A;  3ZN6 B;  3VKN A;  5AC9 3;  4CEY B;  1GAN A;  1VBC 3;  4ZY9 A;  3RYK A;  4FO9 A;  4DUV A;  3ALQ A;  1ZBA 2;  2GH8 A;  4ISQ A;  2VUD A;  2ZKL A;  1EV1 1;  1K12 A;  4N43 A;  5A6Q A;  4LE4 A;  2XH6 A;  5T5L A;  4EYU A;  2YB7 A;  3ZYB A;  3OUH A;  4DOU A;  3RDI A;  3MHZ A;  1YIP A;  5DQ0 A;  1UL9 A;  2ZOE B;  1QJE A;  4EZ4 A;  4IV3 C;  1QJY 3;  5GJ6 A;  1ST8 A;  4AI3 A;  1MZE A;  4Q4V 1;  4YFZ A;  2CHH A;  1KFU L;  1NZC A;  1NLR A;  4RYD A;  2VE1 A;  5FTT C;  3VHR A;  1HRV 1;  4TSV A;  1MAC A;  1FPN 3;  2F17 A;  2WSV A;  4CP2 A;  5J48 A;  1EAH 3;  2RS3 2;  4IL7 A;  3IT8 A;  1VAV A;  2J22 A;  2A3X A;  2W1S A;  3ZN5 A;  4E2Q A;  1AYM 3;  1NE4 A;  3RZJ A;  5FO7 B;  4X8N A;  2X5I A;  1CWP A;  5JOX A;  3JBG 3;  1XU1 A;  4CP0 A;  3SH4 A;  4BPZ A;  1PX4 A;  1TMF 3;  4ATF A;  2MEV 3;  2Q8C A;  3NMB A;  3PVO A;  2R1B A;  4CUA A;  2D97 A;  1SLL A;  5E89 A;  4NWW A;  2FHR A;  2HLE A;  3IKW A;  2DFC A;  1CON A;  2JE9 A;  4PLO A;  4UFK A;  4AI8 A;  5JAX A;  4QGL A;  2WZE A;  5EHD A;  4ZON A;  1MQT A;  1JYT A;  1RUF 1;  2C9A A;  3CU7 A;  4IQP A;  2PMW B;  3WDT A;  1C28 A;  2ZGN A;  3B94 A;  4BA6 A;  5IVB A;  1CPM A;  4YWA A;  5A3W A;  2CV6 A;  2VZP A;  3OEA A;  5KXC A;  2ARX A;  2ARA A;  4WVW A;  5IFT A;  2Y0O A;  3ETQ A;  2IC1 A;  4CDW A;  3TEY A;  5I0D A;  4FSJ A;  3GDB A;  3J7N A;  4WVM B;  4ZKT B;  3ABZ A;  3ZPO A;  2R07 3;  4X6Q B;  5D8A C;  1H8T C;  4TWT A;  4MUV A;  1UX7 A;  2Q0A A;  2VZO A;  1ULF A;  1QGL A;  1YCI A;  1G86 A;  1VP6 A;  1K5M C;  3I7D A;  3WQB A;  1S0B A;  4NHL A;  2EVX A;  4MXV A;  5IVF A;  3PDQ A;  2RR1 3;  2H0V A;  3VBH B;  2NMN A;  3NL1 A;  3LQC A;  4FTE A;  2WNO A;  3PJQ A;  5JPN B;  5KHJ A;  5D8A B;  4Y33 A;  1AX1 A;  3IIA A;  5DG1 A;  3N7K A;  3ZKY A;  1ODM A;  3VKL A;  1W8T A;  3IAQ A;  3MLL A;  4AEJ A;  5IVV A;  2XOM A;  1T2X A;  4HPK A;  4B7E A;  5C8C C;  1W8O A;  4IE4 A;  5GZE A;  3OSD A;  5CFC B;  4L97 A;  5FFO C;  4Y20 A;  5FYY A;  3H3Z A;  3NJZ A;  2ZEW A;  4FBF A;  2X10 A;  3PUQ A;  3UL2 A;  1S0E A;  1QKQ A;  2D6M A;  4CPB D;  1VBE 1;  5JUV A;  5FZ8 A;  2V09 A;  3KVB A;  3BTX A;  2QJV A;  5J3U A;  2WO2 A;  1UY2 A;  3THD A;  1NLS A;  1C1F A;  3U11 A;  3MO4 A;  3VZK A;  4Y3O A;  4E2S A;  3OEB A;  5KXD A;  1OH4 A;  1UMH A;  1BEV 1;  4MGS A;  4R9A A;  5T52 A;  2JB4 A;  2YY1 A;  1LRH A;  4BHP A;  2ILM A;  3POG A;  5K0U A;  1RUE 3;  3I54 A;  2R04 1;  1ULE A;  3MIE A;  5F5C A;  1BLZ A;  4V1P A;  3E6B A;  5FXX A;  2IXL A;  1V9U 1;  4KGQ A;  1O3R A;  5KWR A;  3M1H A;  3AP7 A;  3OBZ A;  4GH4 C;  1GZ9 A;  2Y64 A;  1NCQ A;  4XZU G;  2K0G A;  3WP5 A;  4OI0 A;  1MS1 A;  1TME 3;  3K51 A;  3KLS A;  3NNF A;  4IV3 A;  4NPR A;  3PUI A;  2WZR 2;  4UW3 A;  1H1I A;  4E27 A;  3GZT B;  4FI9 A;  3QH7 A;  4XCB A;  5FPB A;  5AC9 1;  1VBC 1;  2Y6F A;  2PAE A;  4RHV 3;  3EYP A;  3U37 A;  4MET A;  4LK7 A;  1OA3 A;  1D4M 2;  1WCQ A;  2VOK A;  3H1W A;  3NAP B;  4E8D A;  1NE6 A;  3ENR A;  4QPW A;  1BZW A;  3CKH A;  1N3O A;  5AVA A;  3ZO0 B;  4DMI A;  2Y26 A;  4P5Y A;  2MNG A;  4LBN A;  3K3N A;  4YG0 A;  5D1I A;  3G7D A;  4ES9 A;  1QJY 1;  5J96 B;  2AR6 A;  3ZYH A;  3A0N A;  2BWC A;  4GB3 3;  3GAL A;  3POI A;  4O61 A;  4QX0 A;  1DYP A;  1FPN 1;  4RD7 A;  1EAH 1;  1UYZ A;  2VMI A;  5LB6 A;  3RZK A;  2WAB A;  4AVS A;  1AYM 1;  4NAO A;  4PQ9 A;  4A3Z A;  2WLQ A;  5CKQ A;  1GNY A;  4PLM A;  3JBG 1;  3VN4 A;  1US2 A;  3VZM A;  2B7Y A;  3WG1 A;  2BEO A;  1GR3 A;  1TMF 1;  1RUD 3;  2MEV 1;  3NNJ A;  4DQA A;  3SIT A;  2BVV A;  1UPS A;  1HKD A;  2BGP A;  2EXJ A;  3OYW B;  3FC0 A;  3U14 A;  1WD3 A;  1BVV A;  3IDE A;  4BDV B;  4LOS A;  4HXC A;  4HFS A;  1D2S A;  1QIQ A;  4NE9 A;  2ZX0 A;  3KS7 A;  5FZO A;  4HKL A;  4XJW A;  5J1X A;  2HWF 3;  2HYK A;  2LW8 A;  3CQO A;  5GZC A;  4OMC A;  2R0F A;  4BXF A;  2VMF A;  4QGN A;  5J09 A;  3T3Y A;  1WLD A;  3VV1 A;  5JSP A;  1H8T A;  2D6P A;  4OI1 A;  1GSL A;  5C9A B;  1W99 A;  3AYE A;  4XMI A;  4CU7 A;  4Q4Y 3;  1Z7S 3;  4L0P A;  1XRU A;  4NPM A;  2OPK A;  2YGM A;  1DGR A;  4XDQ A;  2OKX A;  2RM2 3;  3KT7 A;  1ALY A;  1AYN 3;  4ZS2 A;  1RMU 2;  1LJ7 A;  2NM1 A;  2XJR A;  4EV0 A;  3N9M A;  1QJU 3;  1ENX A;  2I2S A;  2JE8 A;  4ASM B;  4CDX C;  3BN6 A;  4XZP A;  1H4H A;  1F4H A;  4UT5 A;  2R07 1;  1OLR A;  3UKN A;  4Q2F A;  4E4Z A;  2O8Q A;  4OZO A;  4K20 A;  4WZC A;  2RMU 1;  1HB1 A;  3HNB M;  1VRB A;  5C8C A;  3O7O A;  1WA6 X;  3A7Q A;  4L99 A;  1QU0 A;  5G05 L;  1DDL A;  1OLM A;  3VKM A;  2YXS A;  2RR1 1;  1W9T A;  1YEW A;  5DZG A;  3WD5 A;  1Y43 B;  5E1R A;  2NPI A;  4XJA A;  1XE7 A;  4FTS A;  3MPB A;  3BGA A;  1OLQ A;  2Q8O A;  1DGL A;  3VKO A;  1PK6 C;  1KD7 A;  4YVW A;  4ZU7 A;  5L7O A;  4GUL A;  1E5R A;  1H1A A;  3NV3 A;  1VRH 3;  4FQZ A;  3A22 A;  1LEM A;  2ZZJ A;  2XXZ A;  3VDD B;  2RS1 3;  4Y1X A;  1XE0 A;  2W1Q A;  1LOG A;  4FP2 A;  5FY9 A;  2RHP A;  4GKX A;  1UXX X;  4QQP A;  2CAV A;  3OCP A;  4GH4 A;  4QHB A;  3LZZ A;  5CKN A;  1RIR A;  1NT0 A;  4TN7 A;  2VOT A;  3FE5 A;  2YC4 A;  4FXK B;  1NAE A;  5AFB A;  1KDM A;  1WCK A;  1RUJ 2;  3THC A;  5FYU A;  2XHK A;  3ES1 A;  1IQD C;  4LHS A;  1PHM A;  1YFW A;  5IWF A;  4QAW A;  1LED A;  1H30 A;  1HXS 2;  1RUE 1;  1UX6 A;  4MSV A;  5D2A A;  3UES A;  4YW1 A;  4CUC A;  5LWB A;  1IG0 A;  4XAE A;  3Q8A A;  4ASK A;  4BK5 A;  3PMS A;  5FPZ A;  3CDZ B;  4FOV A;  3CIH A;  1W6Q A;  5L73 A;  4D94 A;  4CVU A;  4HON A;  3MIH A;  5LK5 A;  1TME 1;  2XVG A;  5FO8 B;  5JOW A;  3BKZ A;  2XUM A;  5FDB A;  1OUS A;  3RVH A;  2VNG A;  4LT5 A;  1BHG A;  1SBD A;  1Y9G A;  3AP9 A;  4JV4 A;  4A41 A;  2UYA A;  5C3R A;  4XXP A;  1AR6 3;  5JSO A;  1W6N A;  4NRO A;  4RHV 1;  3OGS A;  4FAH A;  5EJ3 A;  5LBF A;  5BNP B;  3GZU C;  4Q26 A;  3NJX A;  5JSR A;  1H0B A;  3CF6 E;  4CCD A;  2XWJ B;  5DDJ 3;  1BVP 1;  1KS5 A;  3F95 A;  3UKV A;  5BUV A;  5FMO S;  3JXS A;  4Y1Y A;  2J7M A;  1HIX A;  1G8W A;  2VUL A;  1JOB A;  2HYX A;  5BNN A;  3BVC A;  3PUA A;  1C57 A;  1CVN A;  1UOB A;  3IPV B;  4GB3 1;  5DAB A;  3PNA A;  3MW3 A;  4Q0S A;  4Q4W 2;  1T6B X;  3FX3 A;  5L19 A;  5IK5 A;  2PHF A;  3KV6 A;  3LIG A;  2KXL A;  2WFF 3;  1FAY A;  4XBL A;  4OVE A;  2VGD A;  4CCK A;  2W95 A;  5HBA A;  2QDR A;  2JDM A;  4K8R B;  1PVC 2;  3WVJ A;  4IE6 A;  4IXL A;  4QMA A;  1X82 A;  1POV 0;  4YVS A;  3BTA A;  3VD7 A;  5KC5 A;  4DNY A;  1YC6 1;  3DPR C;  3S57 A;  3GM8 A;  1PGL 1;  4XOG A;  4R9D A;  1VBD 2;  5FXV A;  4CU6 A;  2RVA A;  3LEI A;  1HN1 A;  3QD6 A;  3KT4 A;  2HH9 A;  3NWK A;  5E8A A;  4I3P A;  4CDX A;  5FQ0 B;  1W0O A;  2QQN A;  2ZGP A;  1C8N A;  2BNM A;  2HWF 1;  2R30 A;  3G6J B;  3WW4 A;  1ACC A;  1S0I A;  2JD4 A;  1ND3 A;  5ERL A;  3C2U A;  4Q4Y 1;  1Z7S 1;  3T1M A;  3VB9 A;  3TNQ A;  3ZFE B;  3AXE A;  2RM2 1;  3ZFG B;  5A1L A;  1AYN 1;  3CZJ A;  3U10 A;  4AI9 A;  3C7G A;  1VBB 3;  2YU2 A;  1QJU 1;  2O8O A;  4EJR A;  4DXR A;  3SEE A;  2WNU B;  3POJ A;  4RSU A;  2YBP A;  1SFY A;  2E6V A;  3OPT A;  4YW5 A;  3NKT A;  1CR7 A;  5F39 A;  2QBX A;  4COU A;  5CA6 A;  1VIW B;  1B35 A;  1RUC 3;  1KXG A;  1PK6 A;  2XB6 C;  2GC0 A;  2WC2 A;  3AL6 A;  3P1I A;  2RJL A;  2VTX A;  1G9F A;  1OHF A;  3UET A;  3VL8 A;  5L9R A;  3WW3 A;  5I93 A;  1GUI A;  2VG9 A;  3K46 A;  1SLI A;  4RA0 A;  2W5F A;  1UWW A;  3AFK A;  2DCJ A;  2ADE A;  3MYX A;  4LQR A;  5CFD C;  3WX5 A;  2WQ8 A;  5DN2 A;  1GZW B;  3QBQ A;  5ACA 2;  5I8Y A;  4FOQ A;  2ZX3 A;  3ETP A;  3MW4 A;  4OI2 A;  4TZD A;  1V6J A;  3SNM A;  2NYY A;  4Z82 A;  4GAL A;  2ZAC A;  3WZ1 A;  5FOJ B;  3VBU B;  1HJG A;  1I6X A;  1ZRC A;  1BK0 A;  3CJI B;  3SCH A;  1VRH 1;  5A32 A;  5KXB A;  1PMI A;  3GZA A;  4P00 B;  1KIT A;  4QB1 A;  3AVS A;  4XFH A;  1HLC A;  5FZ9 A;  2BVB A;  1POV 3;  1V6K A;  2ENR A;  2TNF A;  1G7Y A;  4QD2 A;  4QPG A;  2Q8D A;  4DPN A;  3OY8 A;  4LBO A;  1YXW A;  3FLP A;  4YW7 A;  3ZMN A;  2Z42 A;  2K46 A;  1E5H A;  1W3X A;  2VXJ A;  4O9G A;  4AED C;  1LAJ A;  1S0D A;  4L11 A;  3O1M A;  3JB4 C;  4LBK A;  1J59 A;  2SBA A;  4N9H A;  4M0N A;  4XXA A;  2WZP P;  5C3S A;  1FMD 2;  1FV3 A;  4QXB A;  3NJV A;  5JDB A;  4JGY B;  4S2H A;  1RVF 1;  2VBB A;  2W39 A;  4K8F A;  5T55 A;  1R09 2;  4CDU B;  3VBO B;  3FUQ A;  1DBN A;  1X9T A;  4JTN A;  2XJS A;  5FBZ A;  4FVV A;  4PIX A;  4P9Y A;  4L9B A;  2WT1 A;  1RUG 2;  4A7Z A;  5BNQ A;  3H1M A;  2WN2 A;  5C5T A;  5A7N A;  5CIR A;  5JWP A;  2FDI A;  1CES A;  1WCU A;  5A1A A;  3O1O A;  4EZH A;  2ZEX A;  4Q4V 2;  4BQ4 A;  4UYB A;  1ASJ 2;  3AYC A;  5FO9 B;  1DQ5 A;  1HRV 2;  3WEZ A;  3T0D A;  1WLW A;  3H7Y A;  1GP4 A;  3AP5 A;  2WNV A;  3KSC A;  3K3O A;  1LOF C;  4GA9 A;  4P9W A;  2XBO 3;  2NZ9 A;  3N35 A;  1AR6 1;  3NRU A;  4IGP A;  1ND2 C;  3T4H B;  1AUY A;  1KS4 A;  2YU1 A;  2ZX1 A;  1W6P B;  3IB3 A;  3IMM A;  4XUR A;  2GU9 A;  3H8O A;  3VBF C;  2DVG A;  5DDJ 1;  1VB2 A;  3JD7 3;  3OBR A;  3NQH A;  5A33 A;  3CL1 A;  4C91 A;  1LR5 A;  1OKO A;  4PIZ A;  5FMD A;  3EQE A;  3LPF A;  3WHU A;  4KNC A;  4Q29 A;  3ZFF C;  1IPK A;  1YLL A;  3PUS A;  5FYS A;  3RRD A;  2BOI A;  4QDR A;  4QPI C;  4WM7 A;  5J7M A;  2ZGU A;  4M3C F;  1H1M A;  1PIV 3;  3GBW A;  3JZV A;  5LW9 A;  4LIV A;  1Y9Q A;  2DV9 A;  3KV4 A;  1OD5 A;  3T2Q A;  3VBF B;  2BBA A;  3SH5 A;  5F2W A;  3OGG A;  2WFF 1;  5BYN A;  1RIT A;  4LXL A;  4UOJ A;  3MI8 A;  4MX3 A;  1ZRD A;  1K5J A;  4CCJ A;  3USU A;  5IK7 A;  1WUV A;  3ZFF B;  2ZKN A;  4FP3 A;  1VJ2 A;  4R4Z A;  1SLT A;  2V5Y A;  4UF0 A;  3MUY 1;  5FZA A;  3I3D A;  4IV1 B;  1N1T A;  4QKF A;  2OQ6 A;  3IDA A;  5IW0 A;  5FJH A;  1PZ9 A;  2YGL A;  2F4L A;  3FMG A;  5LAS A;  4HN1 A;  1E5S A;  2E51 A;  3VL9 A;  3PVB B;  2BW8 A;  1WW5 A;  4BQ5 A;  5JI9 A;  1N1S A;  2P3I A;  5GLT A;  4EN6 B;  4CCN A;  3OD4 A;  1IKP A;  4LLO A;  2A6Y A;  5A7S A;  4A4A A;  2JIC A;  1GIC A;  3GHN A;  1HQW A;  3AB0 A;  3NNG A;  4YM0 A;  5EQU A;  3I2F A;  5CU1 A;  1Q56 A;  5A6Z A;  4LBQ A;  1VBB 1;  1W8U A;  4MGK E;  3WDY A;  4MGT A;  4IEP A;  5CFD A;  1RTV A;  2Y33 A;  3LAG A;  1EV1 3;  2Z2S B;  4AEM A;  3WV6 A;  3KF5 A;  4YPJ A;  4CTE A;  2DWR A;  1SHW B;  1WME A;  2CNA A;  2D5H A;  4YNI A;  2VCA A;  2OYZ A;  3I59 A;  4OFG A;  4Y4R A;  3WUD A;  1RUC 1;  4Z8B A;  2BNO A;  1ZZC A;  2JDK A;  1X33 A;  3UK9 A;  4UFH A;  3VGI A;  3T08 A;  1OQ1 A;  5LEJ A;  3GJA A;  3VBR B;  2OZ6 A;  5I91 A;  4JX0 A;  4HMZ A;  3ZR6 A;  4AYU A;  1W6O B;  1GZT A;  4IEX A;  3ZIX A;  2GC3 A;  2R16 A;  4L92 A;  4G9S B;  4LKD A;  4AQS A;  1DG6 A;  1VBE 2;  3ACG A;  3M3Q A;  4RS5 C;  4DEV A;  1NQD A;  1PO1 3;  2NP0 A;  3VZO A;  2F6B A;  2JG8 C;  4ISR A;  3IM0 A;  2YPJ A;  4PI2 A;  4GQ7 A;  3DF0 A;  3R4U A;  3ZSE A;  4AED A;  4NRP A;  1W39 A;  2IWG B;  2BTV C;  3T4V A;  5FRA A;  1BEV 2;  3VBS B;  4M3C A;  1AR9 2;  3OBT A;  1C3H A;  4CCC A;  3PUR A;  4N53 A;  4V2W A;  4I3G A;  1K45 A;  4FTB A;  4YGB A;  4MXW B;  1OMI A;  4JKM A;  2ZHK A;  1POV 1;  1YIF A;  4U2A A;  4HKO A;  4RS5 B;  3SQO A;  1NOV A;  4LEJ A;  4SBV A;  5FZ3 A;  5GLZ A;  4Q0Q A;  1W2O A;  4ZZ8 A;  3ZOI A;  5HV4 A;  4MZU A;  4M0H A;  1TEI A;  2A5Z A;  2A6X A;  2GNT A;  4I0B A;  4LPL A;  5K9Y A;  5FZ1 A;  1DGW A;  5AC9 2;  3U4S A;  1URX A;  2BV4 A;  1JZ8 A;  4RR3 C;  1VE0 A;  1GZC A;  1VBC 2;  3AMN A;  4XF9 A;  4XJU A;  2P4E A;  5FZI A;  3RGB A;  3LDK A;  5FAX A;  3E1F 1;  2X05 A;  3IDC B;  1REF A;  4HN0 A;  4LUK A;  2QQW A;  4RQP C;  3OGV A;  3PHM A;  1SLA A;  4HBN A;  4U36 A;  4AI1 A;  5C70 A;  5KHK A;  4PDW A;  5C3O A;  1OVS A;  1SMV A;  4MOA A;  3AKR A;  1MZ5 A;  5FPV A;  2YHJ A;  1SAC A;  5LCW L;  1OF4 A;  4RL7 A;  1G6N A;  1QJY 2;  1QQP 2;  4Z2W A;  1VMH A;  2D5F A;  4WV8 A;  1CAV A;  5JIU A;  4LMF A;  3HN1 A;  4ZPI A;  4FOW A;  5IUQ A;  1GNH A;  3B9C A;  1R1A 3;  1EAH 2;  2XR4 A;  4XCA A;  4QPI A;  1UIK A;  4RQP B;  3V56 A;  2XBO 1;  4EN0 A;  5K7P A;  3KGZ A;  4XDP A;  2AEN A;  3WDW A;  3NW4 A;  4JZR A;  4KU7 A;  4I01 A;  4CCL A;  3AMQ A;  4ERO A;  4RGK A;  2MEV 2;  2JDP A;  4NIA A;  3ZXF A;  1BMV 1;  1H2K A;  1GU3 A;  4XFA A;  3HBZ A;  5FKB A;  4HSJ A;  4MV2 A;  3ZR5 A;  4ATE A;  2ET1 A;  1WBF A;  3O5S A;  1XOY A;  5T5J A;  4AXO A;  4HT1 T;  4DS0 A;  1Y7B A;  2DDU A;  2EAK A;  4Z2A A;  4AOC A;  5FP9 A;  1RUI 3;  3H8R A;  4I30 A;  5JZG C;  1COV 2;  1RUH 2;  5CG9 A;  5FPA A;  1GOH A;  3VD5 A;  5FYH A;  1PIV 1;  3BYW A;  3AZV A;  3AKQ A;  3C8X A;  5LY2 A;  3ZKU A;  3ZDS A;  1ULD A;  3ZXK A;  1Q5O A;  2FZ1 A;  2VMC A;  4K6B A;  4BQ1 A;  2VR4 A;  1IPJ A;  2B46 X;  3BAL A;  2AC1 A;  2DUO A;  1DGW X;  5J36 A;  2QQL A;  3N7L A;  4JHT A;  1A6C A;  1V6N A;  4K7J A;  4LKF A;  1FOD 1;  1OFS A;  4NHM A;  2JX9 A;  2XL9 A;  1F5J A;  1X9P A;  4YLZ A;  1W2A X;  4JCK A;  1JI6 A;  1O4Y A;  2B5H A;  3WW1 A;  4B29 A;  4IGO A;  3TRS B;  5LBC A;  2R07 2;  4CEY C;  3AJY A;  4LO5 B;  3JQW A;  2CAU A;  4QXH A;  2Y38 A;  4GWJ A;  4CXX A;  4EN9 B;  5HCH A;  4R8H A;  2Y6G A;  5F1R A;  3TEW A;  5FUI A;  1LEC A;  3T2P A;  1DHK B;  3RMX A;  1I3H A;  4JRA A;  2YDE A;  1EPW A;  1HW5 A;  4NAM A;  4UWD A;  3LEG A;  5IJR A;  1ENR A;  4XUP A;  5FP3 A;  3U4X A;  2C4X A;  5ABJ A;  4QXK A;  1CZV A;  1XNK A;  1LHU A;  4XAB A;  2OT7 A;  3NJY A;  3Q8F A;  3H8U A;  1QH7 A;  4Q8K A;  1XQN A;  2OUH A;  4BK4 A;  3USS A;  2VCC A;  2JG8 A;  1QJX 2;  4DUX A;  5A6X A;  4JGZ B;  3UKT A;  4CDQ C;  4Q1P A;  1W2N A;  4YW2 A;  1S0C A;  1Q8O A;  1AF9 A;  1K42 A;  2YYO A;  1CAW A;  2W94 A;  4Q4X 2;  3UJQ A;  4COY A;  5EP9 A;  3ZXG A;  2VEC A;  4B1M A;  2YC2 A;  1FX5 A;  2GC1 A;  1F9K A;  1AL2 1;  2HWB 3;  1WMD A;  4AFB A;  4Y20 B;  2C9K A;  1PO1 1;  1ULC A;  3IAP A;  4CDQ B;  3WP4 A;  1RED A;  1W9F A;  2J1E A;  2XHN A;  1LCL A;  2P6C A;  4YZ3 A;  1KDK A;  1S1A A;  1HDK A;  1NCR A;  1YJK A;  3HD8 B;  1BJQ A;  3AM2 A;  3T09 A;  3BIE A;  2W9X A;  4RR3 A;  3HBK A;  1RUE 2;  4KBB A;  2PHR A;  4YW3 A;  3RFR A;  2HBT A;  1JZ4 A;  1AXY A;  1CX4 A;  3DGT A;  4XC9 A;  2P34 A;  2BRT A;  5K0U B;  4GD4 A;  2VL4 A;  4WM8 A;  3PTY A;  5FYT A;  1A78 A;  1U5Y A;  1TME 2;  1OLM E;  5LBB A;  2EXH A;  2PA7 A;  1Y9M A;  1NCQ B;  3FHI B;  1UU4 A;  2HWC 3;  5FZC A;  2RE9 A;  2W91 A;  4QM8 A;  3C7H A;  5CB7 A;  2QQI A;  1H8V A;  3RNS A;  3I2D A;  2J1A A;  5FYI A;  4CP9 A;  2ORX A;  2JEN A;  3KV9 A;  3VBH C;  1YRZ A;  4FPK A;  3D3A A;  4CXY A;  2DUR A;  4GB3 2;  2RMU 3;  4DRV A;  1PNG A;  3M7A A;  2VZQ A;  2ZGS A;  2ZBJ A;  4W50 A;  4B4P A;  2WT0 A;  1R1A 1;  1LGC A;  1GQG A;  2WQ4 A;  5DAP A;  3WG4 A;  4D6S A;  3MV1 1;  4IER A;  4XBN A;  5FPU A;  3B9I A;  3S5Q A;  5CFC C;  1AR7 2;  2CY6 A;  3TOJ A;  3BIW E;  2QQP A;  1SZB A;  1NKG A;  2VW2 A;  1S2E A;  3LSD A;  1RUD 2;  4XFI A;  1LU1 A;  3EMR A;  4PLN A;  3ZDV A;  3ASI A;  4O65 A;  2XWB B;  2ZMK A;  5A3U A;  3PVN A;  1JU4 A;  2JIJ A;  3VDA A;  1X50 A;  2JDZ A;  4IET A;  5CZK A;  2A6W A;  1RUI 1;  2PQQ A;  3CO2 A;  4LA3 A;  4XEZ A;  3ZN6 A;  1CX1 A;  2XJV A;  3MDP A;  2RV9 A;  1PZ8 A;  2HWF 2;  3J8F 1;  1VR3 A;  4OUL A;  4CEY A;  4XF0 A;  1S0G A;  2JIG A;  5T3N A;  3GNE A;  4OLL A;  3WQ1 A;  4M00 A;  1MZF A;  2J1T A;  2K9Z A;  1RGS A;  5FZO B;  2ZGL A;  4C1W A;  5KHI A;  4XDO A;  2WA4 A;  3VUO A;  5HCB A;  2FZ2 A;  1Z7S 2;  5A70 A;  1VMF A;  1NY7 2;  2E53 A;  1X7N A;  1AYN 2;  1ZBA 3;  2VW1 A;  3KGL A;  4JVA A;  5JR7 B;  1JHN A;  1OD3 A;  4A2U A;  3AZY A;  2XDV A;  2XLA A;  3WF1 A;  1AHS A;  4KBZ A;  2UYB A;  1ZBE 2;  3AK0 A;  3A4U A;  1DZT A;  3WNO A;  4CSW A;  2LRO A;  4Y22 B;  4COW A;  2Q1Z B;  2VCM A;  4CUG A;  2CL2 A;  3BU7 A;  3WDX A;  3P5B A;  1O7F A;  3NAP C;  4RFT 0;  5A7W B;  2FCV A;  2WO3 A;  4W4Z A;  4AK3 A;  4Y4Y A;  2JXA A;  1A8M A;  2VQU A;  2RS3 3;  3I2I A;  5HI0 A;  1BBT 2;  2W87 A;  1P8J A;  1ENQ A;  3I2H A;  3LKJ A;  4Q1R A;  3H1Y A;  4OHW A;  4D6Q A;  1SCR A;  3ZYR A;  1NLQ A;  2VH9 A;  3D0S A;  1AR8 2;  2PHL A;  3ILR A;  1W6M B;  1CN1 A;  4BIF A;  1XSQ A;  3FHQ A;  2WUH A;  1VRH 2;  4M4R A;  1F8V A;  4QQ2 A;  2WN3 A;  1W8F A;  2GMP A;  2CYF A;  1QDO A;  4YVW B;  2IFR A;  2G9F A;  5FP7 A;  3ITQ A;  2AUY A;  4IEZ A;  4D7Y A;  2RS1 2;  3B3Q E;  3E5Q A;  3KQR A;  1UO9 A;  3H0O A;  4FPC A;  1MVE A;  2VOW A;  4LK6 A;  3ILN A;  3WCS A;  1ZM1 A;  2HWB 1;  5JXG A;  2DU0 A;  4XAA A;  2P2K A;  5IT6 A;  1Q8S A;  5HCA A;  3T2O A;  3I2G A;  2UU8 A;  1OOP B;  5FV3 A;  3MEP A;  5FYM A;  3EO6 A;  4WVM A;  1W2T A;  5GM0 A;  3THP A;  5FZE A;  2PFW A;  1JH5 A;  2AAC A;  2XJU A;  3B00 A;  4COZ A;  3IN9 A;  3MV0 1;  3H42 B;  1WLC A;  5FXW A;  4YZ5 A;  1RUN A;  1O3S A;  5C9A C;  3Q8C A;  5EYY A;  5BV6 A;  3WSO A;  5FK8 A;  1IQA A;  2P17 A;  2VZ1 A;  5A1F A;  1KRI A;  5FYB A;  4L8Q A;  3U75 A;  1SCS A;  1Q3E A;  3J4U H;  4O9E A;  1YQC A;  4F7Z A;  3I49 A;  1R1Z A;  2GP5 A;  3GGL A;  1UYY A;  2EXI A;  3HEI A;  1S0F A;  1HX6 A;  4J1W A;  3VBH A;  4B1L A;  3ILF A;  1VBA 2;  4FPY A;  1DF0 A;  1DFQ A;  1GWK A;  5D8A A;  3ES4 A;  3E5X A;  1QOT A;  1YFY A;  3C7O A;  5F32 A;  2W46 A;  1W6Q B;  2HWC 1;  2GMM A;  2HWE 3;  2VU9 A;  4LIT A;  3KB5 A;  3HIF A;  1K5M A;  3KM5 A;  1CGP A;  2C24 A;  1H2L A;  5CFC A;  3GZE A;  2D43 A;  1RHI 3;  5DDJ 2;  1W6N B;  4TXW A;  1IZ3 A;  4LBJ A;  1DQ0 A;  2EIG A;  1HB2 A;  3B69 A;  2O1Q A;  4CPB A;  3KHC A;  2DCZ A;  4F8A A;  5CAZ A;  5FIX A;  1WZX A;  1W8H A;  3LA2 A;  1SFN A;  2Z5W A;  3IZO A;  1IS4 A;  2GND A;  3ZXE A;  2H6B A;  5T5O A;  2PYT A;  5BNN B;  1FV2 A;  2RDS A;  5GZG A;  1HV1 A;  2VMD A;  4IES A;  1HRI 2;  5A7O A;  2FCU A;  1LOB A;  4BJ0 A;  1GBG A;  1ULG A;  2JKB A;  5F5Q A;  1GQH A;  3VDD C;  4AVT A;  5HV0 A;  4XPV A;  4NVP A;  1CIY A;  4PHZ A;  4OUS A;  1HB3 A;  1OSG A;  1YYN A;  3TBD A;  5FPX A;  2VD7 A;  4TLF A;  1J3Q A;  2QDN A;  4CEW B;  1NG0 A;  2WS9 2;  3ZSL A;  4LO8 A;  3SHR A;  5FZL A;  5AFE A;  1UIJ A;  2HEW F;  3O14 A;  2ETE A;  5CVR A;  1ZX5 A;  4EN7 B;  1E57 A;  3DUI A;  5T5P A;  2VQ0 A;  1IG3 A;  4N8M A;  4BQX A;  1EUU A;  3LOB A;  1FT9 A;  3TN9 2;  5BNO C;  4E4D X;  2WZR 3;  4KWL A;  2VJX A;  2PLV 2;  3L9J T;  3K48 A;  2QVS B;  4BOW A;  4BQY A;  2BGO A;  3LOI A;  2VNV A;  3SKV A;  1UW8 A;  3AP4 A;  1XND A;  4GJY A;  1ZBA 1;  1D4M 3;  3I2K A;  5LZ6 A;  2DU1 A;  3FUO A;  3Q9O A;  2A75 A;  2R0H A;  1ND3 B;  2JJ6 A;  2DF7 A;  1RVF 3;  3ZXA C;  4I2O A;  1XNC A;  2BGC A;  4N90 A;  2IXI A;  4O7X A;  1UYP A;  4HOO A;  4B4R A;  1KJR A;  5BNO B;  1JYV A;  3I3M A;  3IWZ A;  1N3Q A;  2E7Q A;  4Y1U A;  5BNP C;  1RUC 2;  2OII A;  2C0Z A;  2A3Y A;  4H55 A;  4C0B A;  1LOC A;  2PAM A;  3FHA A;  4B4Q A;  5LY1 A;  4NID A;  3MFC A;  4W6W A;  2OPW A;  4A6O A;  2RS3 1;  1B35 B;  4FFH A;  4ITC A;  4XUO A;  4QKB A;  3TYJ A;  3LDB A;  4F83 A;  3OF1 A;  2OUJ A;  5F37 A;  1QDC A;  2VVE A;  1UAI A;  4N7I A;  3N36 A;  3PVE A;  2XG3 A;  5H9P A;  4OMD A;  3WF3 A;  4EN8 B;  3VD4 A;  2ZAH A;  3OYW A;  5EXO A;  4UFJ A;  1CAU B;  1H6Y A;  1F31 A;  1QXR A;  2CWS A;  3I8T A;  4H7M A;  3KMH A;  3AZZ A;  2P3K A;  3VD9 A;  1GWL A;  2BJS A;  4FPJ A;  1ZZ7 A;  4OUM A;  2B45 X;  1W04 A;  1OPO A;  1C8M 3;  1ZYB A;  2WO1 A;  3ZLI A;  1KFX L;  4E8C A;  5C4W B;  3S0M A;  3QLQ A;  1C4R A;  5C9A A;  3O1R A;  3E5U A;  1IHM A;  3GYD A;  1UOF A;  2EAA A;  4MHR A;  3GJB A;  2RDN A;  4TLG A;  1CQ9 A;  1UKR A;  2BU9 A;  3WR0 A;  1BYH A;  4P5H A;  2GNB A;  2VMH A;  4QPG B;  4NPL A;  4I0A A;  2RDQ A;  4JQT A;  1FYU A;  1ZZB A;  2P3Y A;  1AJK A;  1RMU 3;  2PHX A;  2YUE A;  3SIS A;  1T6G C;  1LOE A;  5LA9 A;  1GYK A;  4CXW A;  1UNB A;  4Y1Z A;  4KMQ A;  1MEC 2;  1JZ7 A;  1CD3 G;  3ZFE C;  2JE7 A;  4LJH A;  3ZFG C;  3HMY A;  1UF2 C;  1G9D A;  1QOS A;  5F3C A;  2VTF A;  4HAN A;  3FL7 A;  5EJZ B;  2GAL A;  5JXI A;  3IMN A;  3ACH A;  5LAT A;  1H4G A;  2WWU A;  4XMA A;  2WNU C;  4MH0 E;  1PM7 A;  2E33 A;  2IVI B;  4FFF A;  2HBU A;  3ZM8 A;  2W1U A;  3U0Z A;  1YUD A;  5JIA A;  4J25 A;  2JG9 C;  5KC6 A;  4QPY A;  1PZ7 A;  2VQA A;  4A44 A;  1RYY A;  1UZ0 A;  2HWE 1;  2MHF A;  1JMU B;  2QTW B;  3WP6 A;  2PHW A;  4LHK A;  5DAQ A;  3EB7 A;  2WNV B;  2D93 A;  4M3C E;  1ZRR A;  1JTZ X;  1RHI 1;  3JD7 2;  3LEK A;  4ZXK A;  3DXT A;  3SMH A;  2LUW A;  1YFX A;  1OQE A;  4JDM A;  5A3N A;  2WR9 A;  1QXJ A;  2BUK A;  1OT5 A;  5A33 B;  1HN0 A;  1PGW 2;  2JG9 B;  2R49 A;  3TEX A;  3VBU C;  4DY3 A;  1F4A A;  3OOX A;  4AAP A;  1K3I A;  4K9S A;  1OA4 A;  3CJI C;  2XJT A;  5LA2 A;  2B8M A;  5CNA A;  5A3L A;  2GN3 A;  2Y0I A;  4AVB A;  1O4Z A;  1S2K A;  4AGV A;  5SV5 A;  4WM7 B;  2R06 2;  3O0W A;  3T0B A;  1STM A;  1XPW A;  3BPZ A;  3SC7 X;  4YW6 A;  3ZYI B;  5I0U A;  1D4V B;  4AL9 A;  4AQ2 A;  1JBC A;  3HAG A;  3ATG A;  4P9G A;  2ZHM A;  1QNY A;  5B4X A;  3ZSM A;  1HXS 3;  5GKA C;  3AXD A;  2G9G A;  2JDY A;  2BER A;  2JEC A;  5EFU A;  5C3Q A;  3J7H A;  1XNB A;  4COV A;  3CZU A;  4JGY C;  5JMO A;  1J84 A;  4CDU C;  4TYS A;  2QQM A;  4HSL A;  1LKN A;  1L7Q A;  3L2H A;  4FQ4 A;  3T30 A;  4P08 A;  3VBO C;  2YG0 A;  4H7L A;  4XVH A;  3ZSK A;  2GZW A;  4AG4 A;  4CU9 A;  5C5U A;  1MS5 A;  2P37 A;  4YW4 A;  2WZR 1;  3TWI A;  4D6R A;  1JOJ A;  3NNM A;  4CYD A;  2I45 A;  1IS3 A;  3R05 A;  4IE0 A;  4NN0 A;  1F5F A;  1D4M 1;  1JYC A;  2XVK A;  1G9A A;  4CCM A;  2VZV A;  1GOF A;  4IGQ A;  2FDF A;  1CZS A;  1FXZ A;  4HET A;  2F4P A;  1QY4 A;  5EJ1 B;  3IPV A;  1EV1 2;  4OHV A;  5FZH A;  5APA A;  1BK1 A;  2DCK A;  5DAX A;  3T1L A;  1NUK A;  3THT A;  1JYW A;  2C5D A;  3KCY A;  1ZRE A;  2ERF A;  3O0V A;  1FAT A;  1Z78 A;  2J1R A;  3PU3 A;  5M0T A;  1W2U A;  3E97 A;  5HCF A;  3VD3 A;  2PTM A;  3LWC A;  3R6S A;  2D6K A;  1RJ7 A;  2XUE A;  4NOT A;  4XTM A;  2A71 A;  2OQ7 A;  4M01 A;  1UZY A;  4MVT A;  2ZGT A;  4QWN A;  4Y26 A;  1PO1 2;  1YQ8 A;  1CAX B;  3KWV A;  4LKE A;  4UW5 A;  4MO3 M;  1ZZ9 A;  3T2T A;  4AAX A;  2HWD 3;  2ID4 A;  3AMH A;  5DPN A;  4BH9 A;  1GP5 A;  5B4N A;  2FDG A;  4WVV A;  1GP6 A;  5FQ0 A;  3ZVX A;  2ZGO A;  1AL0 G;  1XNA A;  1VBD 3;  2WSU A;  4H14 A;  2Q8E A;  3T0A A;  1C8M 1;  3E6C C;  3MFA A;  2FDH A;  2E7A A;  3N9Q A;  4JAA A;  4AGR A;  1LGB A;  3AVR A;  1W05 A;  3OPZ A;  1AXZ A;  1ZVF A;  3SH3 A;  5FKC A;  2RG4 A;  1A8D A;  2YPD A;  3DPR A;  4N53 B;  4ONU A;  5H9Q A;  3ZFG A;  3J26 N;  2QQV A;  2VBD A;  4IV1 C;  1RUF 2;  1GQP A;  5IVC A;  1JS9 A;  2Q4S A;  5FZ6 A;  1ULO A;  1OUR A;  2A70 A;  4DFS A;  3AJZ A;  3AMP A;  3GBG A;  1OPM A;  1H6X A;  4FPH A;  4LR4 A;  1RMU 1;  2EXK A;  4YZ4 A;  2QZ3 A;  2WRA A;  1NA1 B;  2N7G A;  5F8P A;  4X8P A;  1KGY A;  4WZF A;  3FN9 A;  4A7K A;  2PQS A;  1FOD 3;  4BM8 A;  4AHZ A;  2YBS A;  2LM3 A;  3ROU A;  2WFP A;  1SPP B;  4AVC A;  4Z1V A;  1DGR N;  5FWJ A;  2SLI A;  5FLJ A;  4RGG A;  2ZXQ A;  4KWJ A;  4JRL A;  3O1P A;  1JN2 P;  1GZW A;  4QX5 A;  1YI7 A;  4B8E A;  1VB4 A;  1YJL A;  5CYY A;  2WA3 A;  2IFW A;  3K4A A;  4UFL A;  1R1A 2;  1PO2 3;  3VBU A;  3SCF A;  1CAV B;  3PIG A;  4URT A;  3CJI A;  2GDF A;  3VBR C;  1UQX A;  2VZU A;  4N7U A;  4D7S A;  1F15 A;  2QE3 A;  4XET A;  3GCX A;  3DL3 A;  2J1U A;  4QX1 A;  1VMJ A;  1WMX A;  5F6K A;  2VBP A;  2EIB A;  4OHZ A;  2G1M A;  4DIN B;  3RI8 A;  1MS8 A;  2GAU A;  2VVD A;  3WG3 A;  4AF9 A;  4AFD A;  4HVQ A;  1M06 G;  2X8K A;  1DLC A;  5EZW A;  3UV9 A;  4PIY A;  2DYC A;  3III A;  2D3R A;  5F7U A;  3JQX A;  3VBS C;  1OA2 A;  5CIS A;  1V6O A;  2IXK A;  3HQR A;  4J6G A;  1SLB A;  3A0K A;  4JGY A;  4KG8 A;  4AFM A;  3W5M A;  3N3H A;  5FZ4 A;  3BTY A;  1W9S A;  2D44 A;  1AL2 3;  1SLC A;  1FMD 3;  1H2N A;  2WNE A;  5T50 A;  4PF5 A;  2V73 A;  1LOD A;  4IE5 A;  5HPO A;  1R09 3;  1ZZ6 A;  2RS5 3;  3ACF A;  4KQ7 A;  1EPZ A;  2VZT A;  5EPA A;  5GLV A;  1HXS 1;  1L3J A;  1RUG 3;  3NNL A;  5D21 A;  2D3P A;  2BQP A;  4Q5O A;  4L2N A;  5FYV A;  3VZJ A;  5EYX A;  3ZPY A;  5LA1 A;  2R04 2;  1WW4 A;  2BP6 A;  2IXJ A;  3KZ4 C;  4KL1 A;  4XE9 A;  1YQ2 A;  4JC1 A;  1U12 A;  4BQW A;  5H9S A;  5DZE A;  1V6I A;  1ASJ 3;  1V9U 2;  1WWY A;  4KU8 A;  1W3V A;  1RJ8 A;  2Y34 A;  1BXH A;  1GV9 A;  2W2I A;  1W6P A;  2DFB A;  3ZYJ B;  3OGR A;  2TBV A;  4N43 C;  3VHP A;  4OUE A;  2OW4 A;  5GLW A;  2ARB A;  1F35 A;  5JPM B;  3FZ3 A;  1MVQ A;  5FOB B;  1ZA7 A;  2LS6 A;  3ACI A;  1TVG A;  4H2A A;  4QQL A;  5FPL A;  5ABJ B;  3V0B B;  2CGP A;  1OKQ A;  4QX7 A;  1LOF A;  1HQN A;  4K21 A;  5FZD A;  2XKO A;  4OYU A;  1ND2 A;  4MG2 A;  3RSJ A;  3N7J A;  2QNK A;  1V6L A;  4GJZ A;  1DZR A;  4PCR A;  2E7T A;  3DN7 A;  3WP3 A;  2J1V A;  2X53 S;  3N9N A;  3KCX A;  4N43 B;  3VBF A;  2OX0 A;  4EWD A;  2JDN A;  4WBB A;  1LHV A;  1GMM A;  5L7O B;  4HG6 B;  3FLT A;  3MLK A;  1RIN A;  3DEC A;  3OUI A;  1FPN 2;  4JDO A;  3ZFF A;  2HWB 2;  3SXW A;  3WNN A;  3FFQ A;  4KG0 A;  3J7M A;  5LK7 B;  1AYM 2;  4YYO A;  2NMO A;  3KF3 A;  2E63 A;  4I02 A;  1WBL A;  3JBG 2;  2HWD 1;  1I5P A;  2VAU A;  4HL0 A;  3UJO A;  5IHR A;  1SBF A;  1TMF 2;  1G9C A;  4C1X A;  1JU3 A;  1DCS A;  1VBD 1;  2G19 A;  2X5I B;  1JW6 A;  1VLN A;  5I0T A;  2WYF A;  1O5U A;  3PUH A;  2PHD A;  5IK8 A;  1IOA A;  1YWK A;  4G3Y C;  4LOT A;  1MS4 A;  3WOG A;  4LUL A;  2J42 A;  4LUM A;  2VZ3 A;  3EJK A;  3OBA A;  3J8F 3;  1S2B A;  5LRR A;  1Y3T A;  3QH6 A;  1SFP A;  1QMJ A;  3D82 A;  3OPW A;  3WUC A;  4FPG A;  4N9I A;  5EV7 A;  4CDW C;  4D8M A;  5E6H A;  1MQT B;  1NYW A;  2VME A;  1UZW A;  4UW4 A;  3ZXJ A;  2NQY A;  1D0G A;  3D6E A;  1N47 A;  3ACL A;  1MS9 A;  4NII A;  2ZGQ A;  4LOR A;  1YQ5 A;  3VBR A;  4A7Y A;  2J1S A;  3I97 A;  1LHN A;  3RI9 A;  2WII B;  1L7L A;  4KWU A;  4K1Y A;  5DUX A;  3VZN A;  4BLI A;  4CDW B;  2HEV F;  4IW3 A;  3C3V A;  3ZYF A;  2BWA A;  3O12 A;  2PEL A;  2RMU 2;  4JGZ C;  2IVJ A;  4DRR A;  1ZRF A;  2DTY A;  3IBM A;  2EIC A;  1PO2 1;  4AEK A;  1DLL A;  1W0P A;  3VBS A;  2Y8K A;  4IEQ A;  2RR1 2;  2ZMN A;  3POF A;  4EE2 A;  1A3K A;  1J3R A;  1DIW A;  5GLU A;  4IDZ A;  4MXW A;  1WMF A;  1ONA A;  2BDR A;  1AR9 3;  1MPX A;  1AZD A;  3E6D A;  4J1X A;  4ORF A;  4RS5 A;  4XAC A;  3LDR A;  5DUV A;  1H9P A;  3TEZ A;  4FCA A;  4YM1 A;  2H0B A;  4NO4 A;  1TE1 B;  3U78 A;  1H9W A;  2DTW A;  3AZX A;  1NXM A;  2PN5 A;  2ZGK A;  5GZF A;  1I1E A;  2NLR A;  1MS0 A;  2GP3 A;  3ECQ A;  4HPK B;  4LKS A;  5FY7 A;  5IAV A;  1SBE A;  1W9Y A;  1FMD 1;  1PMJ X;  2PAK A;  3HPN A;  3AKT A;  1J83 A;  5K0U C;  1WLT A;  1YQ6 A;  1R09 1;  2G4I A;  2RS5 1;  1N3P A;  4BQ2 A;  4YGC A;  1Q8Q A;  1OF3 A;  4G4F A;  5K8S A;  3X29 B;  1RUG 1;  4NRM A;  1A34 A;  1NCQ C;  1UMZ A;  3INA A;  4DEQ A;  2RDR A;  3OB8 A;  2LAL A;  4XUQ A;  2XQR A;  3AFG A;  1O4T A;  1LEN A;  1PVX A;  1QQP 3;  3LGR A;  3OTF A;  2VM9 A;  2OVU A;  5FWE A;  3RWK X;  3U07 A;  5C3P A;  1O3T A;  3DCQ A;  4RQP A;  4AQT A;  1RUO A;  1ASJ 1;  5FZK A;  4AVV A;  1XJA A;  2WO7 A;  4LIU A;  4OCT A;  5KBF A;  3WNM A;  5KHG A;  1YO8 A;  3S5A A;  4NR1 A;  5B2G B;  4I0W B;  3GF6 A;  3RZM A;  5F3E A;  2Q30 A;  5JR2 A;  1B09 A;  4LBM A;  4UAP A;  5DUW A;  2ADD A;  1WKY A;  3W58 A;  1LES A;  2Y6J A;  2NN8 A;  4IV3 B;  4R9C A;  1J3P A;  4RHV 2;  1QH6 A;  5F3G A;  4K40 A;  5C8W A;  5FXZ A;  1I5Z A;  1LUL A;  4MAD A;  3W9A A;  1JZ2 A;  5FZB A;  2CSG A;  2YMZ A;  3MZH A;  5T54 A;  2Y6H A;  4HLT A;  4QX2 A;  5F5I A;  2UUR A;  3HJR A;  1SDW A;  3H3U A;  1COV 3;  1RUH 3;  3C7E A;  4LLF A;  5LEK A;  1JOD A;  4HK8 A;  3WT3 A;  3HR9 A;  3N7M A;  3M3E A;  4GXL A;  4EWE A;  5JOZ A;  4XF3 A;  1R08 3;  3OG2 A;  1AJO A;  3P6B A;  5JZG A;  2JWP A;  4HVO A;  5A3T A;  1R64 A;  4XJ8 A;  1AXK A;  1QJF A;  4P02 B;  3B02 A;  1DZQ A;  1JYI A;  4JDN A;  2A3W A;  4DXT A;  2R7E B;  2DVD A;  1C1L A;  3I4I A;  3V0A A;  1VAL A;  3LD8 A;  3K2O A;  4MHU A;  3AYD A;  1PGL 2;  3RS6 A;  5C71 A;  2D3S A;  2XQX A;  4GWN A;  1JZ5 A;  1JUH A;  3GHM A;  3LA3 A;  3MGU A;  5FYC A;  1FNY A;  4M4P A;  1BCX A;  4FOY A;  3I3Q A;  4FFG A;  2VOV A;  3PU8 A;  1KJL A;  2DBN A;  2VW0 A;  3DKQ A;  4FPE A;  3LSE A;  1IPS A;  2XVL A;  2XML A;  4LBL A;  4CCE A;  2ZX4 A;  4IEV A;  2ZEY A;  5AVP A;  2DCT A;  4GKY A;  4Q4Y 2;  2ZGM A;  3EHK A;  4JGZ A;  3UT0 A;  2HWE 2;  3GXU A;  2BBV A;  2RM2 2;  1XE8 A;  2ORZ A;  3AKS A;  4I09 A;  1YFU A;  1H8T B;  2XPJ A;  4DIQ A;  5CBL A;  1ZA4 A;  2D7F A;  1QJX 3;  1V0A A;  5FP8 A;  3MID A;  3Q8B A;  2H6C A;  1QJU 2;  1RHI 2;  3POE A;  3W20 A;  4W65 A;  1Z0H A;  5IVJ A;  1RXF A;  2VUA A;  3RZH A;  1OC1 A;  1K5M B;  1X36 A;  2P6H A;  4XJZ A;  1OBN A;  2BFU L;  3CNA A;  3RZZ A;  3ZIW A;  5FRE A;  4BWO A;  2ATF A;  4Q4X 3;  3AZW A;  2A1X A;  3M8L A;  3W59 A;  4CDQ A;  4MGQ A;  2ZAB A;  3K75 B;  5E16 A;  3KD4 A;  4OHX A;  4LO6 B;  1GNZ A;  2C1F A;  2UWC A;  4HVR A;  5FR3 A;  3LA7 A;  5I8T A;  4YVW C;  4KGG A;  4S2G A;  4E4H A;  5L7O C;  2CDP A;  5FUP A;  3WNP A;  4ET7 A;  4NHY A;  5C8C B;  1W8N A;  4JKK A;  2YC0 A;  3WLU A;  1AR9 1;  4JKL A;  1CJP A;  1Q8P A;  1NX9 A;  4V2V A;  2W3J A;  2XLF A;  4NUB A;  4OZX A;  5F9T A;  1DQ6 A;  4FPO B;  1OOP C;  3S6P A;  3ME2 A;  1BQP A;  2Y6K A;  3AKP A;  2E9Q A;  3QOP A;  3BB6 A;  5FK7 A;  5FUN A;  2XKP A;  1W28 A;  3H8X A;  4LA2 A;  1F2N A;  1O6U A;  5LBE A;  4KI5 M;  1UU6 A;  1PNF A;  1O3Q A;  1AX2 A;  3HQU A;  4D3W A;  4D69 A;  2C6S A;  1UD1 A;  4QKN A;  4K1Z A;  3MIF A;  3VLB B;  1UY1 A;  3MW2 A;  4A6S A;  4UBG A;  3UGF A;  4TTG A;  1JUI A;  4MGZ E;  1OXC A;  4YZ1 A;  1YHF A;  3L2Y A;  3MIB A;  3ORJ A;  1UKG A;  4W6X A;  1RVF 2;  1JOP A;  3P3N A;  4GH4 B;  4CRQ A;  2UWB A;  3NKG A;  3WXP A;  5A3M A;  3S7E A;  4YM3 A;  3M70 A;  1U5Z A;  1AVB A;  1QQP 1;  3DV8 A;  1EUT A;  4C0H A;  4RFR B;  5DG2 A;  5LRS A;  3WIN E;  4W8J A;  2HKX A;  2X09 A;  1UZZ A;  4ASL A;  1V00 A;  4YRD A;  4PF1 A;  4AE2 A;  3NST A;  4KH9 A;  5EIY B;  2EF6 A;  3WNL A;  4DUW A;  3M3C A;  1QNW A;  1AR7 3;  2ET7 A;  1CIW A;  2VNO A;  3M3O A;  4AFC A;  4AZZ A;  1HJF A;  1MS3 A;  1AR6 2;  3B01 A;  4QX8 A;  4RGA A;  4Q0P A;  5BNN C;  4IE7 A;  5FZM A;  3POW A;  4QB6 A;  1O5L A;  3EXU A;  3IDB B;  3WNK A;  4LO7 A;  3CBN A;  5DUU A;  1SQ4 A;  4W6Y A;  2Q1M A;  4BIS A;  3A23 A;  2YV8 A;  1C8M 2;  1XYP A;  4YM2 A;  4DXZ A;  2QQK A;  3D8C A;  4Z92 B;  1COV 1;  3AMM A;  1NQJ A;  1RUH 1;  3F2Z A;  1TZO A;  3NV4 A;  4JQR A;  4CE8 A;  4XQW A;  4Q27 A;  4MYE A;  4CEW C;  4XJ9 A;  3WDV A;  1UY4 A;  3B7M A;  4R52 A;  1TQ5 A;  5FY5 A;  2BOJ A;  4ZHN A;  1R08 1;  3LE0 A;  4Q0V A;  3O1U A;  2VC9 A;  1IGO A;  4NWV A;  4UXA A;  5ANQ A;  4YVS C;  2CWM A;  2Y60 A;  1QJZ A;  5DZF A;  2RJ2 A;  2WFF 2;  4XUN A;  5FBJ A;  3MF9 A;  4Y22 A;  4HZF A;  1NXD 1;  1LTE A;  1S4C A;  1U5I A;  2QZ2 A;  2ZPX A;  1ZBE 3;  3C7F A;  3FJS A;  3RZL A;  2VZR A;  3AX4 A;  5FJK A;  4YG6 A;  5A7W A;  1OH3 A;  4YAR A;  5JXJ A;  3NVC A;  5FY8 A;  5CG8 A;  3AYA A;  3GBF A;  3URF A;  1LB2 A;  3HT1 A;  2XON A;  4YVS B;  3V65 A;  1ND3 C;  1WCD J;  2FCT A;  1W9W A;  4UFI A;  1GWM A;  4AHY A;  3I3B A;  5BY5 A;  3KQ4 B;  4QDQ A;  1BBT 3;  3ZMO A;  3WDU A;  3M3I A;  4B3N A;  3K4Z A;  4GWM A;  3BCW A;  3NAP A;  4CDX B;  1W6M A;  1E5I A;  2YBK A;  3RJ2 X;  1DQ4 A;  1UCX A;  2QQJ A;  4Y1V A;  1IS5 A;  3RQ0 A;  5C7G A;  3MF6 A;  4YGE A;  4B7K A;  5CEH A;  1O8P A;  2LTN A;  1AR8 3;  1EY2 A;  5A6Y A;  2W47 A;  4X6R B;  1B35 C;  1CJD A;  3N9O A;  1LU2 A;  1W8Z A;  1QJX 1;  1VBB 2;  2IUW A;  4QKD A;  2WLP A;  2ZEZ A;  3O1T A;  2V4V A;  5IAX A;  3POS A;  4HKW A;  3B5L B;  3FWE A;  4QU1 A;  2AEY A;  5JI7 A;  4Q4X 1;  3H50 A;  3I2O A;  2HEY F;  4C90 A;  3CHX A;  1OOP A;  2JD9 A;  2CGN A;  3SEP A;  1J1L A;  2UWA A;  1JXN A;  1ODN A;  4SLI A;  1YNA A;  1DP0 A;  1FNZ A;  2AH2 A;  3EBR A;  3MPP G;  2VCB A;  5C4W C;  1PK6 B;  5FY1 A;  3MUZ 1;  3RZG A;  1QF3 A;  2CTV A;  3WF4 A;  1W03 A;  1NZI A;  3BOD A;  2O14 A;  4BXS V;  5I0R A;  1UZV A;  2W0X A;  3AC0 A;  4QPG C;  5CAD A;  3H7J A;  4AHX A;  1I9R A;  5I8S A;  4CCO A;  1BKZ A;  4XF1 A;  1RC6 A;  1X8M A;  3PME A;  5L36 A;  5CKM A;  2JDU A;  4QT6 A;  5FLI A;  1H2M A;  1VBA 3;  1UY0 A;  3AL5 A;  5A32 B;  4LHL A;  1XB9 A;  3ZN4 A;  4BLJ A;  3RYR A;  1XC6 A;  1J58 A;  5BPX A;  2ZX2 A;  3NO8 A;  3ZX7 A;  3OY8 B;  1DQ1 A;  2QQO A;  5FMC A;  3QAC A;  2JDH A;  4DY5 A;  2E31 A;  2XLG A;  2VUC A;  1RB8 G;  2VY0 A;  5FLH A;  1HB4 A;  1W0N A;  2B42 B;  4QHZ A;  5KR7 A;  2BNN A;  3ZXL A;  2V5D A;  3ELN A;  5IVY A;  4DO0 A;  4BME A;  2Q1F A;  4QQO A;  3VHN A;  3SLI A;  1JZ3 A;  1O59 A;  3HNM A;  3LIH A;  1O91 A;  2W52 A;  2MPF A;  1WCS A;  1KQR A;  2WNV C;  2ES3 A;  3KVA A;  1SG3 A;  3LPG A;  2Z4F A;  1HRI 3;  5IK4 A;  4XHX A;  2JEM A;  4P9J A;  5F6L B;  1AR7 1;  2DCY A;  4CEW A;  1C5H A;  4FT8 A;  1UPI A;  2AYH A;  3PJY A;  2XBO 2;  4AVA A;  1CZT A;  3LFM A;  1RUD 1;  1W8W A;  1ENS A;  2E32 A;  2HWD 2;  4RN5 A;  2W68 A;  4BIO A;  3WF2 A;  2WS9 3;  2FMY A;  3FBM A;  4FAG A;  1UN1 A;  2DUP A;  1UOG A;  4PBO A;  4XFC A;  3VDD A;  5IFP A;  4WM7 C;  1BMV 2;  2QQU A;  4Y5S A;  1XXN A;  1AX0 A;  3VKF C;  4HK9 A;  5BXX A;  2ZAA A;  4PI0 A;  4FXG B;  4XIL A;  2OS2 A;  2VZS A;  2Z69 A;  3DKW A;  1KEX A;  2B39 A;  2DUQ A;  3TN9 3;  3RG0 A;  3LEM A;  2DVF A;  2PLV 3;  4ZS3 A;  1PIV 2;  2AZ5 A;  2D6O X;  1LOA A;  1W90 A;  2JDA A;  4CUB A;  4BCU A;  4QQH A;  1DQ2 A;  2WWS A;  3KT1 A;  3DPR B;  2D6N A;  1LHO A;  1NY7 1;  2UY9 A;  4GMP 0;  4QHO A;  5LA0 A;  1C5I A;  2HJI A;  3JU9 A;  5BNO A;  3R4S A;  4ZZ5 A;  3BOP A;  5FY0 A;  1RUJ 3;  3K4D A;  5ISL A;  5J37 A;  1ZBE 1;  4YZ2 A;  4QDS A;  3DYM A;  2ZTN A;  5K4L A;  3ST7 A;  1FOD 2;  3HQX A;  1DU3 D;  1ZRI A;  4S2D A;  4QM9 A;  1D0H A;  3USU B;  2O0O A;  2AEZ A;  5ANN A;  4Y5T A;  2UY8 A;  2G9Z A;  3LFI A;  1PGS A;  4QB2 A;  4D7T A;  3I2J A;  1TNR A;  2YFZ A;  1EYB A;  4DB5 A;  4MLO A;  4NHX A;  4UF0 B;  3W21 A;  5A3P A;  2ARC A;  4PT6 A;  3TNP B;  5IAT A;  5KXE A;  1BBT 1;  4KWK A;  1SDD B;  3TAY A;  4QU2 A;  5JLV A;  1QWR A;  4BU2 A;  1CAU A;  1REE A;  2EA7 A;  2RJK A;  2TEP A;  3JB8 A;  5BNP A;  2P1B A;  1TG7 A;  4S2F A;  4XBQ A;  1PO2 2;  1GFF 2;  2FBE A;  1Q43 A;  4AGG A;  5EWS A;  1D2Q A;  3RJR A;  3WHT A;  1AR8 1;  1XNT A;  4Y24 A;  4AFA A;  1XYO A;  5C4W A;  5FZ7 A;  4CU8 A;  4XF4 A;  1XBF A;  2QKD A;  4LBQ D;  1HQL A;  4LBQ B;  1PMH X;  3I3E A;  3PIJ A;  3WF0 A;  5CFD B;  3R0R A;  2RS1 1;  3BUC A;  2WYS A;  2BPA 2;  2XGX A;  3J9S A;  3LCP A;  3S7I A;  2R1D A;  2ZA9 A;  3PL0 A;  5A3O A;  5JMC A;  3UNP A;  3ZSJ A;  3I59 B;  1J1T A;  2JB8 A;  2WQZ C;  2R32 A;  4P9X A;  4Q4W 3;  5DAV A;  5F5A A;  4AW7 A;  4EQV A;  3W5N A;  3OD0 A;  5FY4 A;  1AL2 2;  4PQQ A;  3DXU A;  4LTA A;  1GLH A;  2GH2 A;  4N53 C;  1PVC 3;  2ZS6 B;  4IEY A;  1X8E A;  2GN7 A;  2I07 B;  2A7A A;  2RS5 2;  1ZNP A;  4YFW A;  5F3I A;  1MEC 3;  3NV2 A;  4GMP 3;  2IXH A;  2R6Q A;  5FMB A; 
#chains in the Genus database with same CATH homology
 3RZJ A;  4NJ4 A;  3O1P A;  4IE7 A;  2FD8 A;  2FDK A;  3O1S A;  3O1M A;  4NII A;  4NRP A;  3BKZ A;  3T4V A;  4O61 A;  4ZHN A;  3BTZ A;  3O1U A;  3I3Q A;  3RZK A;  3LFM A;  4NRO A;  3RZL A;  4O7X A;  2FDI A;  3O1O A;  4NID A;  3I3M A;  3BTY A;  5DAB A;  4IDZ A;  4ZS3 A;  3RZH A;  4NIH A;  3BIE A;  4IE5 A;  3T4H B;  4IE0 A;  4QKB A;  4QHO A;  2FDF A;  3T3Y A;  3H8O A;  3O1V A;  4NPM A;  4IE6 A;  4ZS2 A;  3S57 A;  2IUW A;  4QKD A;  3BU0 A;  3O1T A;  3O1R A;  3I2O A;  4NRQ A;  4NRM A;  3I49 A;  3H8X A;  4IE4 A;  4NPL A;  3RZG A;  4CXY A;  4MG2 A;  2FDG A;  3BUC A;  3H8R A;  4OCT A;  4QKF A;  2FDJ A;  4QKN A;  3S5A A;  4CXW A;  3BI3 A;  2FDH A;  3BTX A;  3RZM A;  3KHB A;  4JHT A;  3KHC A;  4RFR B;  4MGT A;  5F8P A;  4CXX A;  4NIG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...