4HKWA

Crystal structures of mutant endo-beta-1,4-xylanase ii complexed with substrate and products
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
190
structure length
190
Chain Sequence
ETIQPGTGYNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGNFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDYQIVAVEGYFSSGSASITVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-xylanase 2
publication title X-ray crystallographic studies of family 11 xylanase Michaelis and product complexes: implications for the catalytic mechanism.
pubmed doi rcsb
total genus 55
structure length 190
sequence length 190
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2012-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hkwA00
2Z79A 4XQWA 4S2GA 1XYNA 3HD8B 2BWCA 2B42B 3LGRA 4XQDA 2NQYA 4HKWA 1YNAA 4XQ4A 1PVXA 1UKRA 1OLRA 2VG9A 1KS5A 2DCZA 1F5JA 3AMPA 3RI9A 2VUJA 1REDA 4S2HA 3VHNA 1XNKA 2D98A 4HK9A 3AMNA 1H1AA 1XYPA 1XNBA 3VHOA 1TE1B 2B46X 2DCJA 1HV0A 3VGIA 3VZLA 3VZMA 1OLQA 2DFCA 3WX5A 1OA4A 2QZ3A 1UU4A 1UU6A 3LB9A 4S2DA 3M4FA 1ENXA 3AMMA 4HKLA 1REEA 2QZ2A 1H4GA 1XYOA 3VZKA 3B7MA 1IGOA 1HIXA 3WT3A 3WQ1A 3EXUA 3MFCA 4H7MA 4HK8A 3RI8A 4IXLA 2BWAA 5HXVA 2D97A 3WY6A 1T6GC 2F6BA 3ZSEA 1OA3A 1QH7A 3MFAA 3MF9A 3O7OA 1BK1A 3AMQA 3WP4A 1OA2A 3WQ0A 3B5LB 1C5HA 3WXPA 2VULA 1C5IA 2DFBA 2JEMA 1KS4A 1AXKA 3VLBB 3MF6A 3WP6A 3AMHA 3VZJA 2BW8A 1BCXA 1REFA 5K9YA 3AKTA 3WP3A 2JENA 3VL9A 4S2FA 3VZOA 1XNDA 3WR0A 3AKQA 3WP5A 2DCKA 3AKSA 2JICA 4XPVA 2B45X 2BVVA 2NLRA 1H0BA 3VHPA 3AKPA 5K7PA 3WQ7A 2VGDA 1XXNA 1BVVA 1HV1A 4HKOA 1UU5A 1H8VA 1M4WA 3VL8A 2C1FA 1W2UA 3VZNA 3AKRA 5EJ3A 1NLRA 1QH6A 4NPRA 2DCYA 1H4HA 1XNCA
chains in the Genus database with same CATH superfamily
2WZPP 4RYDA 2ZOEB 5ACA2 1WCDJ 2YPJA 3G7DA 3IKWA 4ZS3A 2ZEYA 4NROA 2YBPA 4IE4A 1OLRA 2D6MA 4YZ2A 1OURA 3LDKA 4XACA 2WUHA 1CAUA 2WS92 2RMU2 5FV3A 3RZGA 4NHXA 4Z2AA 1WBFA 2QQMA 2PHXA 3BU7A 5FYHA 1PNGA 1YWKA 4Q4X3 1REDA 4S2HA 5HI0A 2VMIA 2Y0IA 4JAAA 4LO5B 3ZN6A 3V0AA 2BNOA 3T0AA 3QOPA 5FXVA 2YPDA 4G9SB 4FFHA 4QWNA 5I8SA 1O5UA 5IHRA 3K4AA 3B9IA 2MNGA 1UY0A 1HQNA 1RUH2 4H14A 4BA6A 1DLCA 4V1PA 4C8DA 4CDQA 1UU6A 5C70A 1YQ6A 3U4SA 4YGBA 1L7QA 4PIXA 4CP9B 5CYYA 1W28A 4XJZA 2ZX3A 1AXYA 5FP3A 1U12A 2Z42A 1BEV1 4W8JA 2Q1FA 4FI9A 4NIIA 2QQUA 4CP1A 4LXLA 2ILMA 4Q4Y3 2XKOA 5IAVA 2E63A 2FZ1A 2X8KA 4PDWC 3KV6A 4AGGA 2XBO3 3V0AB 2JD9A 2VOVA 3WEZA 3WNOA 5I0RA 3WY6A 4HMZA 4WVVA 4LBLA 4CDXC 2HWF2 4E8CA 5I8TA 3AM2A 1J59A 5F6KA 1R1A1 1MZ6A 3FE5A 5JSRA 3FLRA 3LEGA 3SCGA 1C1FA 1ZRIA 1A8MA 1KQRA 3LIGA 4K6BA 2C9AA 1S4CA 3KVBA 1YI7A 4FFGA 2JG8C 1H8TA 3DCQA 3K3NA 5CG8A 2PLV3 2NM1A 2XB6C 2J1TA 1YFXA 4COUA 1KFUL 3ZYBA 2VVFA 4UWDA 2A6YA 2PQQA 3RRDA 3ZDSA 3WP6A 4NIAA 1IQDC 2PELA 4BMEA 3C3VA 3EO6A 1X9TA 2WT0A 3GBWA 4WZCA 5LBBA 1CQ9A 1AR63 1LOFC 1MR5A 4X8NA 4P9JA 4DINB 1OF4A 2D6PA 4YW7A 1NY72 4LQRA 5I8YA 4OFGA 3AZYA 1G6NA 3G6JB 3B9CA 1JZ4A 4XURA 1DYPA 1T6BX 3VZNA 2VMFA 1GP4A 1OT5A 4F3JA 2OQ7A 2RS52 2B45X 2PHUA 1UQXA 3URFA 3VKMA 3WW4A 4CVUA 4MGIE 2DF7A 1H8TB 1LB2A 5FP7A 1XNAA 2YC0A 5K7PA 4RGKA 2VW2A 3MUY1 2WDBA 1SFYA 3K3OA 1CIYA 2GZWA 3KVAA 2VNRA 5E88A 1ULGA 2YY1A 3IMNA 3VBHA 1QHDA 3LEIA 3BYWA 4PI0A 3WUCA 3CF6E 1U5YA 2WO7A 2JE8A 3IB3A 4GZ9A 2VZVA 2CYFA 3WF1A 1QWRA 1XNCA 1DP0A 5IW0A 5FZ3A 3RZHA 4UF0B 4OHVA 1KGYA 1CAWA 3WNNA 2VZ1A 5J96B 1LODA 1TQ5A 2O1QA 3AYAA 3WLUA 1A3KA 2R1BA 3L2YA 5FLIA 4XQDA 4OQ9A 5A3UA 5F3GA 4WVMA 4JQTA 2RVAA 2WINB 1QXPA 2Y34A 3NVCA 1ZRDA 1TNRA 2ADEA 3SQOA 3TYJA 4YW4A 2BDRA 4LBNA 2PTMA 1CX1A 4GKYA 2ZS6B 1NZIA 1UZVA 2CDPA 3TEWA 1ZRFA 5BNNB 4R9CA 2OVUA 5FZBA 1EYBA 1OH3A 1QJX1 3T4VA 3W58A 1FOD1 1QU0A 1WBLA 1YHFA 1W3XA 1YXWA 5FBZA 4M0HA 3CEWA 4RN5A 1SLTA 4EE2A 1OD5A 5FK8A 2D44A 3PNAA 4FPEA 4COWA 1OA4A 5CA6A 2JD4A 1H2NA 4AEDB 4MHUA 5CADA 4IUGA 3LA2A 1ALYA 3C7HA 5F9TA 2CV6A 3O1MA 3OG2A 4FPHA 3MO4A 1PVC1 4IEOA 3O1OA 1H4GA 4D69A 4R4XA 1YQCA 1GBGA 1Z0HA 2DVBA 3N9MA 1WD3A 3NNLA 4KGGA 4Y4RA 1PK6A 3MV11 1VIWB 1IG0A 4IETA 4H3WA 5FO7B 4AE2A 3AP7A 3ZSEA 2GNMA 1MS4A 1UOGA 4LULA 3NV3A 1WCKA 1NZCA 1QIQA 2TEPA 3ZXLA 4XF1A 5JPMB 4JDMA 1RVF1 5GZCA 5JR2A 4AWDA 3ZYGA 4AVAA 2DVGA 4BMBA 2AEZA 5C9AB 1FXZA 2EXKA 2V4VA 3WNMA 1ZBE3 1MS3A 3GHMA 5AC91 2CAVA 5FZDA 2AYHA 1Q8PA 2Y6KA 2IUWA 1OMIA 2P3IA 2V4AA 3TN91 5HCAA 1JHNA 3BVCA 4XW3A 3ZFFC 4UW3A 5A7PA 4RS5B 1FATA 1LHUA 1AF9A 3JQWA 4BLJA 5GLUA 3VZJA 1V9U2 3SEEA 1PK6B 2QKDA 2XJSA 1LENA 1O5LA 2GU9A 4BOWA 4C1WA 2DU0A 1FAYA 3I2JA 4AZZA 2W95A 5K0UC 1XE8A 1LNSA 3P3PA 4PBPA 1OQDA 3HWJA 2EIGA 2EAAA 4JDOA 2WFPA 1VBA2 5FZEA 4CDUA 5IFTA 4GB33 3BOPA 1W6OA 3ZVXA 1H0BA 2VO5A 3O14A 4N9HA 1FPN1 1JUIA 3GBGA 5FP9A 1K5MA 3I3QA 5JLVA 1Z7S3 4RL7A 5LRRA 1PO12 4OMDA 4FP2A 2AZ5A 2RS12 5FY7A 2UWBA 1OFNA 3I59B 4JKMA 1OSGA 2Q0AA 1V6OA 3ORJA 4MGYE 2AENA 2OA2A 3MLLA 4L8QA 1RUI2 2HWC1 2A73B 3AXDA 5JI9A 1FYUA 3APBA 5IK4A 5LA2A 1K3IA 2JB8A 1UCXA 3FMGA 4CDUB 2HH9A 2PAEA 4BQ2A 1W6OB 2NQYA 1LGCA 4CSWA 4HXCA 2W1QA 2VMEA 1PVXA 1UO9A 1ZM1A 1GP6A 2IXIA 1K5MB 2Z69A 4LHKA 1D0HA 4E4ZA 2XQXA 3MPPG 4KWJA 1WWYA 1X33A 1W6NA 5D21A 1HRI3 5FZ1A 3W59A 4Q4W3 5A7WB 3ST7A 5B2GB 1GQHA 4XIOA 3IDEA 5F7UA 4HANA 1W8FA 3ES1A 4OLLA 2VMHA 3CJXA 5HXMA 2W9XA 4RFT0 4XVHA 1RUD2 3I2GA 1FMD2 1HV0A 1AL22 2JDNA 3EQEA 2WWJA 3VGIA 1EUTA 4B1MA 5HCHA 1OLQA 3USSA 3KGZA 4AVSA 3R0RA 4YG0A 2WA4A 3RMXA 4OI2A 4K8FA 4QDRA 1I5PA 2XJTA 2VZQA 1R1ZA 2XQRA 3C7FA 4QDQA 4XUNA 5FP8A 3T4HB 3MIDA 1W6NB 3WNLA 3VZKA 1HRV3 3FFQA 5EJ1B 5DAVA 1DDLA 2Q8CA 2WT1A 5BPXA 3SCHA 4ZZ5A 2D6KA 1DZTA 3RI8A 1HLCA 3RSJA 5HXVA 4AVTA 5IVFA 2OXBA 1K5JA 2P6HA 3RVHA 4CU8A 1QJFA 4GMP1 1MVQA 1SPPB 2P17A 2Q30A 2JE9A 4COZA 3MF9A 5FPUA 2DUOA 3I7DA 1V6NA 4UFMA 4MH0E 1W03A 1QJU2 2ADDA 3W20A 4BQ4A 3LCPA 4PLOA 4P02B 5J7MA 2MEV1 2ZMNA 1A6CA 2WL1A 5GKAC 2A3YA 2C5DA 2IXJA 5LEKA 1C8NA 4LT5A 1G8WA 3TEZA 4L11A 3ZFGC 2BOIA 5BNPC 5KHIA 3B02A 1AYM3 1DGLA 2RS53 1CIWA 4XFHA 1AR72 3BPZA 1OOPA 4KWLA 1RUC1 2BOJA 4OUMA 4LIVA 1ASJ1 5LASA 2HWB1 1RINA 5GALA 3UNPA 4ZXKA 3JZVA 1HW5A 2DU1A 2DCKA 2VMDA 2BGCA 4J25A 3N3HA 4TLGA 3AKSA 2SBAA 3POJA 4PLMA 1DYOA 5J3UA 2KR2A 3AC0A 2K9ZA 4CXWA 3ZFEA 4W65A 1OH4A 3H3LA 4M4RA 2ZXQA 2XVGA 4H55A 4JCKA 4CUBA 1WCQA 3AFKA 3KV5A 1QNWA 4XC9A 3N9NA 5L19A 1H8VA 2ARXA 2P1BA 4BM8A 5C8CA 1M4WA 5FZ4A 3OPWA 4MVTA 5FZ0A 1JS9A 4O61A 5FYVA 3AKRA 3IMMA 2J1EA 4IEZA 3HT1A 5FXXA 5L9BA 3PVEA 5BY5A 5K8SA 3VD4A 4QM9A 1EUUA 5DUVA 3OBTA 2B8MA 2W2IA 1OFSA 3A0NA 3ZYHA 5FZLA 2Y64A 3FN9A 4RGAA 1KITA 2RS31 2ZACA 4KQ7A 5GLTA 3GM8A 3MYXA 1GOGA 4UI9L 4XETA 1MZFA 2EIBA 1YCIA 3I2OA 2GC3A 3JXSA 4QKFA 3RQ0A 1QOOA 2FBEA 3VKFC 4ZXEA 2ZX4A 5L73A 1ULEA 4XHBA 3MPBA 3PVBB 5JUVA 1LEMA 2GMEA 1W0PA 4V2VA 4COYA 1WCUA 1AVBA 4XBLA 4ZHNA 1AR92 3KHCA 3BUCA 2ETEA 1UZ0A 2BQPA 2VBBA 4AHXA 3PUAA 4CXYA 1HX6A 4WBBA 1FT9A 2JIJA 1S0EA 1PX4A 4YGDA 5C5UA 2QNKA 5LBFA 1TG7A 4FO9A 4JGZA 2X05A 4A44A 2QE3A 3AYDA 3CIHA 3VZLA 2X09A 3AFGA 4UFJA 5IWFA 4OHZA 3RDIA 4OI1A 3VZMA 5CZKA 1YI9A 4ITCA 1NOVA 4LBKA 4XUPA 4D6SA 1AR82 5A70A 4BJ0A 2WKKA 4IV1A 4WM7B 3GCWA 3N36A 3M8LA 1COV1 4XHXA 5CBLA 4Y5TA 2XONA 5KC5A 1LGBA 1ENQA 3H7YA 1UZYA 4META 2E33A 4NOTA 3Q8AA 5FLHA 2GP3A 5FUNA 5HCFA 4XUOA 1DF0A 3UESA 4IL7A 3LFIA 3RZLA 1GFF2 4PT6A 1HB4A 2D3SA 1NE6A 4LHLA 3AL6A 4GWNA 4PHZA 4QPGB 5FYIA 4EZ4A 4QQLA 2IFWA 2ZGNA 3A22A 4QPIA 1AJOA 2OS2A 2ZGSA 2EIDA 4JGYA 3WP4A 1CGPA 1ZRCA 3U0ZA 5DUXA 4IV1B 3HNBM 1BEV3 1C5IA 1HQLA 4HSLA 5LEJA 3VDDA 3HJRA 1IKQA 4ZU4A 1MEC1 1W8UA 2JDAA 2WAAA 3VDCA 4Q4V1 1Y7BA 1CZSA 2SLIA 1QOTA 4MSVA 1QJY1 1DZQA 5CFCA 4CUGA 1TVGA 2LTNA 1DBNA 2BP6A 4LE4A 3T3YA 2YB7A 1ZBA1 2VUDA 3J9SA 1H8TC 3VL9A 3MEPA 2EALA 2W87A 2CGNA 4Y1VA 5C6CA 1I1EA 3O1PA 1QJZA 1XNTA 4AI2A 4Y5Z0 3RZKA 4I02A 2A6ZA 4CCEA 4QPIB 4IEVA 2GAUA 4GH4A 5IJRA 4EV0A 5IVCA 1JYVA 3AL5A 4EN7B 2J1RA 2D6LX 4YGEA 5JMCA 5JI7A 4YSFA 3O1SA 5D8AA 4LKFA 4P9WA 3Q8EA 3M70A 1US3A 3KWVA 4NPLA 3OEBA 3VDDB 4QKBA 1GZCA 1MZ5A 1O8SA 3ON7A 4OUSA 2A6WA 2ZKLA 5J37A 5KC6A 1HV1A 3NAPA 2ERFA 1O8PA 2JIGA 2MEV2 1B35A 1CPNA 1W2UA 2EXIA 3IAQA 3NJVA 3P1IA 4O9GA 2BEOA 4W6WA 2QCSB 2WIIB 4QU1A 4XE9A 5JOZA 1O91A 2K2SA 1UNBA 5DDJ1 2VL4A 1UIKA 1OLMA 3LIHA 3HOBA 4BQWA 4CPBA 3BIEA 3ZXKA 4B8EA 4AR2A 4DS0A 1TNFA 2J1VA 1DQ4A 1MQTA 5FOBB 1AR62 1XE7A 3O1RA 1VBB1 2VW0A 3ALQA 4E9KA 5BNNC 5FJHA 3IWZA 3WG2A 3WNKA 1R091 3VBFA 5FCCA 4UOJA 3WF4A 5HV0A 4GXLA 3FLTA 1POV3 4KWKA 3KV9A 4CDWA 3INAA 3NAPB 3NJYA 2HEVF 3ACGA 4A7KA 2VE1A 2Y26A 3KF5A 4LHNA 2R6QA 4LO4B 1K42A 4XFIA 1B35B 5DMYA 4CEWB 4H2AA 1Q8VA 5L7OA 3Q9OA 4IESA 2IZWA 3K51A 2BJSA 4AEDC 4B7KA 2GC0A 2OIIA 1BLZA 4JC1A 4BLIA 3MGUA 4OI4A 2XOMA 2YXSA 4NHKA 4DEQA 5A6XA 5T55A 1TZOA 4YG3A 1GP5A 3U07A 3UV9A 4AVCA 1OKOA 3C7OA 3ZYIB 3LB9A 1MQTB 2BBAA 2NZ9A 1GNHA 3ZLIA 1W9SA 4CU9A 3KZ4C 1STMA 3HAGA 2ZJCA 1AL0G 4LO7A 4QXBA 4YVWA 4BHPA 4CDWB 1SZBA 1N3QA 1RUJ1 1LGNA 2E9QA 3O0VA 3I49A 1NE4A 1LAJA 1O4TA 3MIEA 3MIHA 1QNYA 5LZ6A 3QCWA 1FOD3 3EXUA 5L7OB 1XSRA 1F4HA 3I3BA 2D5HA 5T5JA 5C9AC 3N4MA 1POQA 1EV11 5F5IA 1W6PB 3TB0A 4AEMA 4JKLA 2J42A 2RM22 1WMEA 2R1DA 3DF0A 4IE7A 3WF0A 4CU6A 1H6XA 1R081 1XSQA 1CX4A 1SQ4A 2VZUA 4IEYA 4IE0A 1W8NA 3KLSA 4RS5C 1HJGA 3K75B 2A75A 2EVXA 3B5LB 1PK6C 4YVSA 4B4RA 1PVC3 2L9LA 4KG0A 1WW5A 1DU3D 1GR3A 3H3ZA 4MGQA 4QD2A 4I0WB 5FPAA 5SV8A 1BYHA 1ND3A 1SLBA 4Q1PA 4QPYA 2JDPA 5FMCA 3V0BA 1DIWA 2Y6GA 1YEWA 2ARBA 2YC2A 4G4FA 5M0TA 4HONA 3FBYA 3R4UA 3WG3A 3IIAA 1AUYA 1XU1A 4JDNA 4XILA 2UYAA 1JYCA 4JQRA 1NA1B 2LS6A 2JDUA 3GZAA 4XF4A 2PHDA 5C71A 2VUAA 4CCDA 1RVF3 4RGGA 2XVLA 4NWVA 1BQPA 2WSVA 1V6IA 5D1IA 5F5CA 1AJKA 5AC93 2OZ6A 4XXPA 1Q43A 3VBSA 3DPRA 3WHTA 4XJAA 3RS6A 3TN93 3TEYA 1CAXA 5BNOB 2DUPA 1WLDA 4ZU5A 1ND3B 3POWA 3V0BB 2F4LA 3VD7A 4C91A 4BB3A 2FCTA 4CUCA 2R0HA 3PDQA 2ZTNA 1JYNA 2YBKA 3WW3A 1MACA 1FV3A 3DKWA 4HPKB 4CDUC 2VD7A 3POEA 5J36A 5JVVA 2WNVA 4YM0A 1AYN1 1U0AA 1HXS1 4E2SA 1YLLA 4D7SA 4EZHA 3ITQA 2EA7A 4IW3A 1K5MC 5DG2A 5FYYA 4AGVA 2JDKA 1W99A 2YDEA 2FDJA 3CO2A 1AR93 2RDNA 4HOOA 4JX0A 3N7LA 3VBSB 1FPN3 3PJQA 3T30A 4BQ3A 5FY8A 4QX1A 4FOVA 4Y26A 3BI3A 5EYXA 1CAXB 2H0BA 2XJUA 5L9VA 2VUCA 2EXHA 4OYUA 2J1SA 2R071 2R061 2ZX2A 5FRAA 5G04L 2ZGKA 4LKDA 4W4ZA 2I45A 4BK4A 3WDTA 1E5RA 1BKZA 5FK7A 3NV1A 4I09A 1N3PA 4KU7A 3RJRA 2EF6A 4GWMA 2HWC3 3RYRA 4COVA 1SDDB 3UYJA 1ULOA 4AEKA 3VBOA 3HIFA 3TRSB 1VBC1 2VVDA 5FZOA 4D3WA 1XYPA 2AUYA 1XNBA 2PHFA 4HVOA 1X82A 5FYBA 4C0HA 1YQ8A 1TE1B 4FFIA 1ZZ8A 1JYWA 2B46X 2R32A 5J48A 3J7LA 2KM2A 1H1MA 2GALA 5KR7A 1QKQA 1W3VA 1GWMA 1JOBA 4MO3M 4N53B 3ZSLA 4DB5A 4DXSA 3HT2A 3LF7A 2H0VA 4LUKA 2WZR2 4P9LA 1E5SA 3H0OA 4XJUA 2OKXA 1LOEA 3DV8A 5ANQA 2C6SA 4Y3OA 1VBB2 5EQUA 2QJVA 5IVYA 3WQ1A 5HV4A 1GMMA 2D6NA 5LCWL 3VBOB 3AZWA 5E16A 5FZOB 3I97A 1CESA 1PMIA 1TME2 4K8RB 4R9AA 1XRUA 1L7RA 3KS7A 5DXDA 5TSWA 4WM8B 3HVDA 4QKDA 3OY8A 4QQOA 2ORXA 4LNVA 1HRI2 1RUF2 3V56A 4Q4W2 1OVPA 4XFBA 3H8UA 1S55A 3OYWA 3OPZA 5GZGA 1SFNA 5IVJA 4Z92B 5FDBA 1VAMA 4D94A 2YBSA 2HEYF 4CCOA 1X36A 4AXOA 2WO3A 3LE0A 3WHUA 1KJRA 2J7MA 3MF6A 1CAUB 4AG4A 1A34A 1D4M1 5IK8A 4AI0A 3OGJA 3ZIWA 5J09A 4OZXA 4FTEA 2CTVA 4PI2A 1RUG1 2BW8A 2P6CA 3HN1A 4DEVA 3ZN6B 4BXSV 3ZSMA 3MUZ1 1DGWX 1JUHA 3ZR6A 1SFPA 2ZGUA 3PTRB 3ZPOA 3EYPA 4S2FA 2ZHMA 4E8DA 4BYYA 4CTEA 4EN8B 2HBTA 3OY8B 1GQPA 5JPNB 3O1TA 1NCRA 4YZ1A 5IVVA 4W6YA 1HRV2 2R49A 1VBD2 4CDQB 4XPVA 2MEV3 1Q8QA 1X8EA 5A3NA 4QX2A 3PIJA 4XTPA 1XB9A 5FWEA 3M3CA 4OZOA 3ZSKA 1SDWA 4YFZA 4E4SA 1LHWA 1WLCA 4LPLA 1LKNA 4DUXA 2JDHA 3N35A 2GH2A 3ZSJA 3VBUA 1KDKA 3QLQA 4K21A 1I5ZA 1ASJ3 4NE9A 2C1FA 5A3LA 2RG4A 3LPGA 1V00A 3ZOIA 3ZYPA 1VR3A 2FMYA 3AJYA 4R4ZA 1VALA 3CU7A 4YFWA 4TSVA 4YW2A 4UBGA 5BXXA 3CLPA 2BNNA 3WW2A 2VPVA 5LK5A 2H6CA 2UWCA 1AZDA 2DV9A 2VZ3A 5L9RA 1TEIA 2GP5A 4FPLA 3VKLA 5FPLA 5JCTA 1AYM2 3HQUA 1C57A 4A3XA 4M01A 5ERLA 3BKZA 4JRAA 2YMZA 1RMU1 1HB3A 1S1AA 2PMWB 5FY9A 4LA2A 5LBEA 3GF6A 2DCZA 3V65A 2D5FA 3A0KA 4XF0A 3H8OA 2FHRA 5FZ8A 1S0BA 3CL1A 1UY2A 1WMFA 4QQPA 1V0AA 4AK3A 5FZGA 1TMF1 1DQ5A 2LM3A 2D98A 5FBJA 2G4IA 4D0QA 2QQNA 3CKHA 4IE5A 4QU2A 4FVVA 3LOBA 3VHOA 4WM7C 1V6JA 3ACIA 3NW4A 4BZ4A 3TNPB 1PGL1 1O4YA 2ZEXA 2XL7A 5C3PA 1VBE1 1RUNA 4N7UA 4XZUG 3D8CA 2C0ZA 4I3GA 4I0AA 1MPXA 2B7YA 1OD3A 5KHKA 1IKPA 1ENXA 2E53A 1O3TA 3HR9A 4DOUA 1R64A 2RM23 1DG6A 1UX6A 1VLNA 1W9FA 1IZ3A 3FHQA 5GLVA 2EICA 4B3NA 4DY3A 4QPGC 3W5MA 2P34A 5T5OA 2BERA 5A7NA 2R062 3VBHB 2WFF1 3J8F1 3LSEA 3WF3A 1YIPA 2D97A 3U14A 2F6BA 3ZXJA 3FC0A 2PN5A 4IV1C 4IV3A 4ZY9A 1W6QA 3ILRA 2VW1A 1G7YA 1OA3A 1YIFA 3BALA 4Y33A 3PMEA 2X10A 4IEWA 1CAWB 2HWE1 3JBG2 4DO0A 4A2UA 2P37A 1UMHA 5C4WA 4AI3A 4WVMB 2O0OA 1RHI1 2JEMA 4LO8A 5FO9B 3ILFA 2OUHA 3GZTB 1KD7A 2R041 4CP0A 2GH8A 1ULFA 1KRIA 5F5QA 3IBMA 3AMHA 1QEXA 4QPIC 3ZXAC 3B93A 5A6ZA 1RB8G 4HVQA 4HT1T 4IDZA 3ROUA 4CZSA 2YROA 4NPMA 2D3PA 4LBMA 1MS5A 4IV3B 5JDBA 1W6QB 5DZGA 2CL2A 3VDDC 4UAPA 4URAA 1RXFA 4YPJA 3AP5A 2F4PA 5EIYB 1C8M1 4CCCA 3B00A 5CU1A 5DABA 2G19A 1YQ2A 3O12A 3S6PA 3VBRA 2CGPA 4P5YA 1MZEA 3LA7A 1MEC3 1GUIA 2LUWA 1MS8A 4HN0A 3ZM8A 1X8MA 1SCRA 4P9XA 4U2AA 3RGBA 1GNZA 4D7TA 2VNVA 2KXLA 4FPKA 3NNMA 1XPWA 4E2GA 1ZBA3 4PIZA 4I2OA 2W52A 2GMMA 3VUOA 2GN7A 4MGKE 3ZXFA 1QJEA 1NCQA 1UMZA 3SXWA 3PVNA 3E6BA 4M3CA 1BEV2 5FP4A 2D40A 2XJVA 4IEQA 4ES8A 4CP2A 3KCXA 1GICA 2QQVA 4CPBD 4M3CF 5C3QA 1RUG2 4KU8A 1JOPA 1PZ9A 2PHTA 3OGSA 4S2GA 1S0FA 3NAPC 4NAOA 3ZX7A 5A1FA 5FXZA 3VBRB 2B42B 1B35C 2HJIA 2CGOA 4CEWC 1JMUB 3IN9A 4NWWA 1R1A2 1JU4A 2VJXA 3GDBA 1S0DA 1OI6A 2FD8A 4YM3A 2CAUA 4I0BA 5CKNA 3GCXA 5BV6A 3O1VA 3OBRA 5LB6A 4EN9B 1W2TA 3QBQA 1I6XA 4RR3A 4XF9A 1P8JA 1I9RA 1ND2A 1N1TA 4PQQA 1MQTC 4HK9A 4M3CB 4GKXA 2VH9A 3NSTA 3AZXA 2Q8OA 5DDJ3 4QKNA 2WA3A 5JOXA 2WZR3 2GSYA 4FFFA 3ES4A 3WQBA 4IEPA 2O8OA 4CDWC 3H50A 1LHOA 4D8MA 2XWBB 1VBB3 2QZ3A 3JQXA 4DUWA 2ZAAA 1R093 2W94A 3LKJA 5KHJA 5L7OC 3LD8A 3JD71 4I3PA 4XEZA 3WVJA 1WW7A 2LROA 2PQSA 4HZFA 1TME3 1Y4WA 4AI9A 2Y6JA 2HWD1 4P9YA 2QQLA 2P3JA 1UPSA 4UT5A 2QQKA 2VXRA 2D43A 3N7MA 3THDA 3OGVA 1RUF3 3LPFA 1OKQA 2WN3A 5JXHA 2WABA 4A3ZA 4ZKTB 3BTXA 4MXVA 2VCCA 4GULA 4INDA 4M4PA 3I2FA 4QT6A 5CKQA 5FZ6A 3USUA 1PGSA 4BXFA 1WW4A 4XMAA 2O14A 3MZHA 2GC1A 4JZRA 5A6YA 2XKPA 3R4SA 3FL7A 4WVZA 4KMQA 2XJPA 1MS9A 1ZZBA 1NLSA 3FHIB 4KL1A 1C5HA 1F5FA 2VULA 1T2XA 1N1SA 2XHNA 3FUOA 4LR4A 1RUJ3 5FPZA 3ZO0B 1NA1C 5CFDA 4WV8A 2BNMA 5BNQA 1ONAA 4FPGA 1WD4A 2KD7A 1URXA 2JECA 4LJHA 4AF9A 3BPSA 4DPNA 1LTEA 5JOYA 1VBD3 3E97A 5IVBA 4FSJA 1Z78A 1BCXA 1GU3A 5A80A 3DUIA 4UFLA 4Q4X1 1YJKA 4NN0A 3GYDA 5CIRA 4J6GA 2MPFA 3VD5A 5K9YA 3AKTA 5BNOC 3NNJA 3AVRA 2W3JA 4Q0VA 1IG3A 3AKQA 1ND3C 3GZEA 4Q5OA 3ZMNA 4AW7A 4E4HA 4MOAA 5FZMA 3H1MA 4Q26A 1W06A 4UFHA 3PURA 1PMHX 1QJX2 3U1XA 5FR3A 4OHWA 1FOD2 4EYUA 3KM5A 3B94A 1AX0A 2ID4A 2Q1ZB 2GC2A 2JB4A 1J3QA 2UY8A 1PGW1 2AACA 2V5DA 4CRQA 4PBOA 2ZX1A 1AX2A 5H9SA 2P3KA 4FT8A 4Z1VA 4AFDA 2AH2A 2C26A 3VBSC 5A3MA 5F6LB 4FAGA 3FUQA 1PVC2 1UY1A 1W2AX 2XBO1 5A1LA 2X5IA 2LRPA 2ZA9A 4I01A 4BWOA 3OEAA 4PDWA 3R4DB 1OPMA 1DQ1A 2GDFA 4NIGA 5DG1A 1QY4A 4LK7A 5T3NA 4CDXA 3P6BA 2OW4A 4HKWA 5A3WA 2NMNA 1OHFA 2K0GA 2VG9A 3HNMA 2A1XA 1RVF2 1IPSA 1GOHA 3A21A 2PLV1 1SHWB 2ZHNA 3GALA 3GHNA 1OUXA 4P14A 3SEPA 3RI9A 5AC92 2VUJA 1PMJX 2Z4FA 1AYN3 1HXS3 1PO21 2B4KA 3AYEA 1O7FA 3TN92 1OOPB 4MGTA 4N53C 3OCPA 3DYPA 1Y3TA 5I0TA 4AFBA 1NKGA 2BGOA 4RQPA 2OT7A 2X5IB 2W39A 3IDCB 3P5BA 3RYKA 3WW1A 4DRVA 2VMGA 4MG2A 1W6MA 4O65A 3VKNA 1YO8A 3TWIA 2VU9A 2FDHA 3TBDA 3WX5A 3HN3A 1J3RA 3OTFA 2J22A 2E7AA 2R073 1UZZA 2R063 3CJIA 1YFYA 3MV01 3OGGA 4N7IA 2XWJB 2W92A 2WZ8A 3M4FA 1EPWA 4N90A 4UXAA 5IUQA 4Q0QA 3VBOC 3ZFEB 3H9AA 4BIOA 2DUQA 1UOBA 1VRBA 5E6HA 5LW9A 3AJZA 5EJZB 4WM8C 5FZ7A 3KB5A 4R9BA 4XUTA 1UYZA 4L92A 5JXGA 1VBC3 1UXXX 3HEIA 5C8CB 1WLTA 5A7SA 1DLLA 1FPN2 3JBG3 5F37A 4BE3A 4E2QA 4NRPA 2BWAA 4AHYA 3RG0A 4JTOA 3NO8A 2W0XA 4NR1A 1QMJA 2VBDA 3KSCA 1F15A 4RQPB 4CU7A 1K12A 2YG0A 4ONUA 1W6MB 1KJLA 1US2A 3BIWE 4QX5A 2HYXA 3PTYA 5F39A 1U5IA 2XPJA 4LIUA 1BBT1 4XOGA 5FJKA 5T54A 3RZMA 1OA2A 2ZEZA 2HWC2 2P5BA 3CJIB 4XUQA 1N1VA 2UWAA 3U11A 4RHV1 5DAQA 3I3MA 1LHNA 5GLZA 4I30A 5IT6A 2TBVA 1FI2A 3A23A 4SBVA 1O59A 3MI8A 4GIQA 5F32A 4CDQC 3ETQA 1RUE1 1FV2A 1J84A 4YM1A 4FPFA 4LHSA 1KDMA 2G9ZA 4JGZB 1VRH1 1VAVA 2ZZJA 4A42A 3MIFA 4LBQA 1EPZA 5EPAA 1B09A 2RR11 3LZZA 2P2KA 3PLQA 2P4EA 2BVBA 5A7QA 5FUPA 2DVAA 4NAMA 4NHMA 1RIRA 1D4M3 1XU2A 2OPWA 1Q8OA 4BCUA 1ZRRA 2VC9A 4YG6A 5A33A 1UOJA 5KXEA 3NKTA 1J83A 4A7ZA 1H9PA 1RUG3 2P3YA 2WQ4A 1W9TA 5FYTA 2AC1A 3H8RA 3D5OA 1Q8SA 5T5LA 5FOJB 4E4DX 2DVFA 3KHBA 3SKJE 3PL0A 5CVRA 2GNDA 5FYZA 4NMIA 5AVAA 1R1A3 4QXCA 4BU2A 3K4ZA 5DAPA 3UETA 1E5HA 2A71A 2ATFA 1DQ0A 4GA9A 4LE3A 2Z79A 5DAXA 2IVIB 4GD4A 3QACA 1XYNA 2XGXA 1IS6A 1WGPA 3M2MA 3ZIXA 4JGYB 5IATA 2V72A 2I2SA 2ARAA 1ZBE1 3EHKA 4PF5A 1EAH1 1MVEA 1DYKA 4WZFA 3LDRA 4MZUA 4AHWA 2VOWA 3JB4C 3PIGA 1GSLA 1UX7A 4QQHA 1DFQA 2GMPA 4A6OA 3AMPA 4X6RB 4Y1YA 2VQAA 3UKTA 1AXZA 5CFCB 5CB7A 4NIHA 1V6LA 1OQEA 2QQOA 4J1WA 3ACFA 4LLFA 1XNKA 4Q0SA 5DPNA 4C90A 1O3SA 4TZDA 1PGW2 3I2KA 3H7JA 2X53S 4OMCA 4F8AA 2WBKA 3ZFFA 2VVEA 3E6DA 5A7OA 2YGLA 5FZCA 4ZPIA 3ZN5A 1XOYA 4A4AA 3VDBA 4B29A 4GH4B 2QQJA 1RUC2 2DTYA 1FX5A 4KBZA 5IK7A 1ASJ2 1RXGA 1RMU3 2HWB2 3Q8BA 3VBHC 5K0UA 2VQUA 4GB31 2IVJA 3DEMA 3SLIA 5D8AB 2PFWA 5CG9A 3AVSA 4YM2A 4CE8A 5IVEA 1GNYA 3WCSA 3ZYRA 3UL2A 2CHHA 2G9FA 1PIV1 1TMF3 2OQ6A 4FOWA 5JR7B 1RUOA 3POSA 1AHSA 3MFCA 5GZFA 1H9WA 3KGLA 4M00A 3ZKUA 4IXLA 1NQJA 3BU0A 3NQHA 4U36A 2ZAHA 2E7QA 4L97A 1SBFA 1LEDA 2UYBA 5F5AA 5FIXA 1RL3A 5FQ0A 2WS91 2VZRA 2D93A 2RMU1 3ELNA 3OUIA 1BK1A 1DCSA 1JU3A 1ST8A 3ILNA 4QHOA 4TXWA 3C7EA 3UKNA 4QX7A 4JVAA 4Y5SA 3BTYA 4ASKA 4AGRA 1JN2P 5B4XA 1VPHA 1WMDA 4F7ZA 3BN6A 3KT4A 4OVEA 4ASLA 2QQWA 5JMOA 1JZ8A 3VBFB 4IV3C 4WVWA 2RS32 3KCYA 4ZZ8A 1NX9A 3I3EA 4HN1A 2E31A 1GV9A 4H7LA 3ZDVA 3HBKA 4HSJA 1VMFA 1RUH1 1QJX3 1YJLA 3BCWA 1MS1A 2CWMA 1VAKA 3I8TA 1Y9MA 2VZOA 4Y22A 1XNDA 2PAKA 1NAEA 2BU9A 2XXZA 2BTVC 1GQGA 2YU1A 3NMBA 2GN3A 2HWE3 4MXWA 4NIDA 2JG9A 1S0IA 5I93A 3N7KA 1NUKA 3T1MA 1RHI3 3RMYA 4BQYA 3IPVA 4FBFA 1WW6A 2RDSA 2UU8A 3LFMA 4Q4Y1 2WNEA 1MS0A 1EP0A 4GWIA 4LKEA 3N9PA 3TOJA 1BBT2 4HFSA 4UW6A 2NPIA 1XXNA 2VGDA 2HWF1 4OULA 4R52A 4YVWB 3WINE 3M3QA 4BIFA 4AOCA 1SG3A 3SISA 2LW8A 3O0WA 2ZABA 1CONA 4C0BA 1IPKA 2QDRA 4AQ6A 4AI8A 4URTA 1COV2 1XC6A 5EJ3A 3VBRC 3PVOA 4AHZA 2XL9A 4JTNA 4XFAA 3S7IA 3WOGA 5C33A 1F2NA 2Q8EA 3RNSA 1C8M3 4C1XA 3POBA 1G9DA 4MXWB 4XXAA 3RZJA 2JG9B 1W2NA 2ZHKA 5CEHA 4OQ8A 3T0BA 3VD3A 5C8WA 1Q3EA 5GM0A 4V2WA 3WZ1A 4XZPA 4YVSB 4EWAA 1UKRA 2ES3A 1W39A 4EJRA 3ACHA 5LY1A 1VB4A 1X9PA 4K7JA 1LESA 4LBJA 5C3SA 5F3CA 1NY71 2I07B 1N47A 1U5ZA 2VR4A 3FHAA 2NMOA 3QH7A 4CCJA 4LKSA 4XYXA 1PZ8A 3AX4A 3GXUA 2YV8A 2V09A 4Z2WA 1YC61 3ZXGA 2WAOA 3AMNA 2ORZA 2RS51 5K4LA 1ZA4A 1HB2A 1MEC2 3HBZA 3OB8A 4Q4V2 4JV4A 4CUAA 3OD4A 1JYIA 3ZFGA 1QJY2 3NNFA 4Y1ZA 3D0JA 1SBDA 2CNAA 1GOFA 3OUJA 4YRDA 5BNPA 2E7TA 3KT1A 3B01A 4IGQA 1LR5A 2QQPA 1ZBA2 2YGMA 2DBIA 3IT8A 3RWNA 3DPRB 4L0PA 3NRUA 2XHKA 1CZVA 3WNXA 2FCVA 2PXJA 1QXJA 3KF3A 3AMMA 4OHXA 2BZDA 3KT7A 4Q29A 3O5SA 5ANNA 1WKYA 2B39A 5ISLA 2QZ2A 1GWLA 5I91A 5FREA 2ZGRA 1JOJA 1ZX5A 4F83A 5C5TA 5JWPA 4Y1XA 1S2KA 3CNAA 1HN0A 2DBNA 4G3YC 4KGQA 1YFUA 2TUNA 4IEXA 4MHRA 2WNVB 2BFUL 3GBFA 1UW8A 1SLCA 1W9WA 4DXRA 2XMLA 4UFIA 4Y20A 2WWUA 3ZMOA 3LOIA 1X50A 3O7OA 4B4PA 4YWAA 1GZWA 3POFA 2YZ4A 4XDOA 4P5HA 5EYYA 1JHJA 3JD73 4QM8A 5JSOA 3U37A 5LWBA 3BB6A 4KNCA 5C3OA 1CN1A 1VMHA 2ZGPA 3WDUA 2BV4A 1ENSA 1LHVA 4D7YA 5KWRA 3H8XA 2HWD3 1BMV1 4ET7A 4AL9A 5DDJ2 4PCRA 3ZKYA 4FPYA 4Q27A 3CZJA 1RJ7A 1UF2C 1F4AA 1GZTA 2VZSA 4XF3A 1S2EA 4XMIA 1UN1A 4FPOB 3FFZA 4LO6B 5T50A 3PUHA 3AXEA 4RFRB 1CWPA 1DQ6A 5CAZA 1LRHA 1JH5A 2OX0A 2W08A 1R092 3ABZA 4YW1A 4AYUA 4OUEA 5E8AA 5FKBA 2JENA 3VZOA 2A3WA 1UIJA 2DVDA 2RDQA 5EV7A 1JYTA 5F3EA 1GZWB 3I2DA 1OPOA 3N9QA 3PMSA 4FTSA 3V64A 3I54A 2W1UA 4FPJA 2JICA 1QGLA 2D7FA 3LSDA 4KG8A 3POGA 4QXKA 3X29B 5KBFA 4CP9A 5FYCA 1JW6A 2XDVA 4B1LA 1A8DA 2XLFA 3BTAA 4M3CE 3A7QA 4TYSA 1XE0A 4XDQA 2W68A 2QDNA 5FKCA 2AGSA 4LK6A 5DQ0A 4QHBA 3THPA 4J1XA 4E27A 1RJ8A 2IXCA 2ZPXA 5G05L 1XBFA 4LEJA 1JZ7A 1UU5A 4QMAA 5JXJA 2Y38A 5FZ9A 4Q0UA 3T2OA 1YQ5A 2FMDA 4GMP3 3AP4A 1QOSA 1RUJ2 3S0MA 2LALA 1ODMA 1S0JA 4ATFA 3NWKA 1G9AA 2JX9A 4FQ4A 4UBHA 3W9AA 5EP9A 3H1YA 3RJ2X 3EJKA 2A6XA 5CNAA 3UGGA 5JSPA 2XG3A 4MV2A 4UW4A 1EV12 3OYWB 1LCLA 2RE9A 5T52A 1YNAA 1V9U1 4JHTA 1R082 2WT2A 1OOPC 1W2OA 1KS5A 1SCSA 2WZEA 4RA0A 2BFUS 2A5ZA 2X5IC 3SHRA 3I2HA 3PUIA 1ODNA 1YYNA 3LEMA 3SC7X 2Y0OA 1ZZ7A 1H6YA 1RUC3 2YUEA 3LAGA 1J1TA 3N9LA 1VBA1 3RWKX 2HWB3 1YUDA 2YFZA 3ZFEC 1BK0A 2JDZA 3IAPA 2ARCA 2DCJA 2V73A 3MLKA 1Y43B 3ECQA 1NCRB 3WNPA 3PJYA 1PO11 2DFCA 4KH9A 3ZN4A 1S0CA 2RS11 4D6QA 5FMBA 3U78A 4EN6B 2OYZA 5C8CC 4XFGA 3KQRA 5FO8B 4LMFA 1VB2A 3S5QA 1REEA 1RUI1 2FQPA 1NG0A 2IXKA 2W46A 4XABA 4RQPC 3K48A 2J1AA 1SMVA 1V70A 2AEYA 1PO23 1IGOA 3T1LA 4XCAA 3DYMA 1QQP1 2C24A 3VBUB 3VKOA 4PJYA 4HK8A 3BOWA 3CJIC 1J3PA 3WUDA 1POV0 3ZXDA 5BUVA 1ZREA 3NJXA 1RTVA 1G86A 5KXCA 5FYMA 4DUVA 2CSGA 2FDIA 2RS33 4FOYA 4UF0A 2QTWB 5JOWA 2MHFA 4A45A 3UKVA 2IC1A 5FTTC 1W8HA 2WNUA 1AYN2 5ABJA 1HXS2 2VCAA 2VOKA 1WZXA 2EAKA 1QDCA 1YRZA 3OJBA 1XJAA 2Y33A 3DXUA 3FX3A 3M3EA 4GWJA 4JGZC 1RUD1 2WQZC 1POV1 3SH3A 5AFEA 1JXNA 1PNFA 1FMD1 1G9FA 2WN2A 1GKBA 1AL21 2ZGMA 4QX8A 4FP3A 5DUUA 5BNNA 2R072 3D82A 1HDKA 2ZMKA 5E1RA 1J58A 2BUKA 1ZZ6A 3MW3A 2F17A 1NT0A 1O4ZA 4LBQD 5DZEA 1BBT3 3MHZA 3TEXA 3WG4A 5F2WA 4N9IA 2VM9A 1IHMA 4LORA 2VZPA 1VP6A 2WNUB 3I4IA 1W0NA 1DHKB 1VBC2 3K4DA 5F2SA 5ABJB 3VV1A 1UWWA 2PA7A 4AEDA 4AQSA 4RHV3 4W50A 1COV3 3LWCA 5AVPA 5IAXA 3RFRA 3AZVA 2QQIA 4DY5A 1VMJA 3MIGA 3DL3A 3N9OA 1BVVA 3P3NA 2A70A 1G9CA 1RUE3 4CXXA 5KXBA 4LUMA 3D0SA 4B4QA 1BMV2 2IWGB 1C28A 2ZGLA 3SH5A 4JGYC 3SKVA 3Q8CA 1NLRA 1VRH3 1WA6X 5FYUA 2UURA 1QH6A 1QJU1 1W90A 1JZ6A 2RR13 5JIAA 4CCMA 2GNBA 1VJ2A 3OUHA 5C9AA 5CFCC 1W8TA 2H6BA 5C4WB 4MADA 2JJ6A 4IGOA 2WLPA 2DURA 4N43A 5FPXA 1CJPA 1AR71 4Q4V3 1QJY3 1I3HA 1IS5A 4RS5A 2WYSA 2VAUA 1DGRN 4ISQA 1WCSA 4FPCA 1HQWA 3NKGA 3WSOA 2ZGQA 4ZU7A 5T5PA 5HBAA 4GH4C 3VHNA 4TLFA 1D2SA 2VTFA 2DYCA 2R7EB 4TWTA 1UZWA 2R0FA 5IYYA 1NYWA 1D4M2 5D8AC 5CKMA 5EFUA 4L9BA 4QB1A 3ETPA 3RZZA 1WA4A 1IS4A 2DTWA 3S5AA 1GWKA 1ZVFA 3DKQA 5FY5A 5J98B 1CD3G 1EAH3 4N43B 5GZDA 4KBBA 2DWRA 4DMIA 2VQTA 4BPZA 4XTMA 1F8VA 1JTZX 5H9RA 5KHGA 4LLOA 3AP9A 3DN7A 1D7PM 4QHZA 3I59A 3MIBA 3CZUA 3B7MA 2RHPA 4XJ9A 3F2ZA 3SH4A 2WJSA 3ATGA 1RGSA 3ZYJB 1NXD1 1NCQB 2XJQA 1ULPA 2JDYA 3CQOA 4CCKA 2B9VA 3OOXA 2XH6A 4QQ2A 3VBFC 4OHYA 5LATA 2JWPA 4IQPA 4CEYA 3AMQA 5APAA 4DNYA 1AR91 2BPA2 3WQ0A 4MGZE 2G9GA 2A3XA 2WLQA 2DFBA 1IS3A 4ARXA 3SCFA 3PU8A 1PIV3 4LA3A 5FY0A 3BGAA 2XLAA 2NN8A 3BODA 4NHYA 3ZR5A 4AEJA 4AVVA 3A4UA 5A7WA 5JZGA 4JHZA 4XAEA 4LTAA 4RR3B 5FZKA 3LA3A 4XBQA 1NXMA 1REFA 1J1LA 3D3AA 5ACA1 1ND2B 1RMU2 2NYYA 4DXZA 1ZZ9A 2N7GA 1N3OA 4DFSA 2G1MA 2WS93 2RMU3 1AR81 1LULA 2R16A 4K3UA 1QQP2 4EQVA 5L36A 4YVWC 2W5FA 4CEYB 3Q8FA 1TMF2 2D6OX 1W05A 1HKDA 2W1WA 1LOBA 3KV4A 4IEUA 3NV4A 4DXTA 3VHPA 1RC6A 2AR6A 2E51A 2ZX0A 5A6QA 3E5XA 3PU3A 2VNGA 4PF1A 2W47A 4YYOA 1PGL2 2I74A 4P9IA 4YZ5A 3E6CC 3WF2A 1VBE2 4K40A 5D2AA 4O7XA 1RUH3 3PUQA 1F35A 5JZGB 4Q1RA 2JG9C 4ATEA 4FAHA 3LDBA 3VL8A 1LOGA 1EV13 3AP6A 1SBEA 2Z2SB 1APNA 2B5HA 2ZEWA 3O1UA 5LK7B 3R05A 4ES9A 4YVSC 5A32A 3RPQA 2WR9A 1R083 4YW3A 3SMHA 3USUB 1UY3A 3QD6A 4YW5A 1SPPA 5CFDC 4MYEA 1CJDA 3HQRA 2WWSA 3T2TA 2YHJA 4XQWA 4OI0A 2WFF2 3LQCA 4GMP0 3J8F2 5I0UA 5J1XA 4CA9A 1ZNPA 3HD8B 4MUVA 2QUOA 2VTXJ 2VZTA 3LGRA 3WDXA 1RITA 3DYOA 2Y6HA 3FLPA 4RD7A 4XQ4A 3VN4A 2HWF3 4TN7A 5I0SA 5CFDB 1JZ5A 2ET7A 1HJFA 1LOAA 1NLQA 2HWE2 2YC4A 4W6XA 1OLME 4P00B 1D2QA 1SLAA 2HKXA 2IXHA 4GALA 4IERA 2JKXA 3E5QA 1JI6A 1RHI2 2CDOA 2J1UA 2Q5TA 3CMGA 3DPRC 3FWEA 3OF1A 4P08A 1A78A 5GLWA 5A32B 2W1SA 1PX3A 2R042 1E57A 2PHWA 2C9KA 5FFOC 4FTBA 4O9EA 4TTGA 3F95A 4JKKA 1OVSA 1W9YA 3U75A 1FNZA 1BJQA 2TNFA 5B4NA 1EY2A 5FZFA 5LA1A 2FDGA 4Y4YA 3MW4A 5BYNA 4AVBA 1IOAA 1S0GA 2WNVC 1M06G 4JRLA 2C4XA 1C8M2 2D3RA 1Q5OA 2YYOA 3JUUA 4XJWA 3LEKA 3KMHA 2DDUA 2VQ0A 4CCNA 4PIYA 5SV5A 2FZ2A 4CCLA 1HIXA 5FMDA 2QFEA 1H30A 1NQDA 5E89A 2GNTA 2JG8A 2WQ8A 4FOQA 5FZAA 5A3TA 1LU2A 1AR61 5FY1A 4HL0A 4NHLA 1QH7A 4LITA 1GLHA 1L7LA 1UXZA 1WUVA 3SNMA 3W5NA 4PDWB 1W0OA 3ASIA 1BVP1 3UK9A 1LOFA 4ISRA 4ZONA 1UYPA 2BGPA 5LBCA 3WV6A 4CDXB 2EXJA 1KS4A 1AXKA 3JB8A 4AI1A 4KI5M 3NV2A 4AAXA 3H42B 1OF3A 5EXOA 2ZGTA 4XIKA 3M7AA 4FXKB 3J4UH 5IFPA 4XDPA 1JZ3A 1PHMA 1JZ2A 2JG8B 1KEXA 2WSUA 4NRMA 1O3QA 2VMCA 3EMRA 1PM7A 4GAZA 2XVKA 4DRRA 1ULCA 3M3IA 1CAVA 2ZZQA 4AFAA 2VTXA 3O0XA 2HYKA 2V5YA 3FZ3A 4B7EA 3IDAA 2ENRA 3FJSA 3W21A 3ACLA 1DGRA 3D6EA 3H1WA 2NLRA 4NJ4A 5HCBA 3J26N 4AAPA 5EZWA 4WM7A 1CVNA 1UAIA 4ARYA 3AKPA 4Q2FA 2CU5A 3THTA 2VCMA 3T2QA 1KXGA 2FCUA 2RJ2A 3WQ7A 1Y9QA 1D0GA 2RM21 3GZUC 1HB1A 1E5IA 4HKOA 2XLGA 4NVPA 1CPMA 3GNEA 4Q8LA 3WG1A 3JD72 1HN1A 3DXTA 2VCBA 4OCTA 2ZMLA 3E5UA 1H4HA 3THCA 3K2OA 3OD0A 2HWD2 1SEFA 5FYSA 1CAVB 4QPGA 4BQ5A 2JKBA 1W04A 2PYTA 1C1LA 3GJAA 2PHLA 3WD5A 1OXCA 1Q56A 4A7YA 2XR4A 5DUWA 3WCRA 4XFCA 3CDZB 4ORFA 1ENRA 5DAWA 1IQAA 1VE0A 3K77A 4EROA 3VDAA 2JDMA 3WDWA 1OBNA 1F5JA 1LECA 2X29A 3OPTA 3L2HA 1NCRC 3C2UA 1G9BA 1CZTA 1UMIA 4K1ZA 4QXHA 1DQ2A 3J7MA 2VY0A 2UY9A 1H1AA 3H3UA 4DZGA 2Y6FA 2FDFA 4IGPA 3MW2A 3WDVA 4NO4A 4QX0A 5H9PA 5H9QA 3N7JA 2QVSB 3EB7A 3I3DA 4LBQB 4XBNA 4FXGB 1V9U3 1X7NA 1OQ1A 1UU4A 4Q4X2 5LY2A 4BISA 4S2DA 3VBUC 2XUMA 5FXWA 3CHXA 4YZ4A 1RYYA 3HQXA 4YLZA 3ZXEA 1UYYA 3VD9A 3NL1A 5A33B 4HG6B 1XYOA 1GANA 5HPOA 1VBA3 1ZYBA 2XUEA 3NJZA 5FY4A 1V6KA 2FDKA 4H7MA 4BH9A 3DECA 5EHDA 5A3PA 5DZFA 5AFBA 1ZA7A 3PUSA 2CY6A 1T6GC 4GQ7A 4MX3A 4BDVB 4PQ9A 4ZS2A 3IIIA 2JE7A 1PO13 1DGWA 1D4VB 5F1RA 2RS13 4DQAA 4Q4Y2 3VHRA 2PHRA 4YW6A 1GZ9A 2HBUA 3CBNA 2B9UA 2RJLA 2XBO2 3J7HA 1RUI3 3UT0A 4AQTA 3ENRA 1UYXA 3MLJA 5A1AA 4XFFA 5FWJA 1UPIA 1LJ7A 3VLBB 4BQXA 2O8QA 4Z82A 5GZEA 1OC1A 1JYXA 1O6UA 4EN0A 1QQP3 3RYPA 1H1IA 4L99A 2VNOA 1Z7S1 2K46A 4MLOA 1DZRA 4CEWA 1GYKA 1QF3A 2ZKNA 4LBOA 2WNUC 5FPVA 5ABJC 2XJRA 2AREA 2NP0A 3C7GA 4SLIA 3WP3A 2PLV2 4Y24A 3WR0A 5DN2A 3ZFFB 2W91A 4UFKA 1VBE3 1W8OA 2WZR1 4UW5A 3I2IA 1PO22 3S57A 3K46A 2RDRA 3WDYA 5F3IA 1BZWA 2BBVA 2BVVA 3QH6A 1JBCA 5K0UB 3M3OA 4MGSA 2BRTA 1BHGA 2CWSA 3B3QE 4LOTA 1RUD3 4M0NA 5KHHA 1TME1 1FMD3 1AL23 3ZPYA 1UKGA 5FZIA 3HNYM 2WFF3 4A6SA 3J8F3 3U10A 1S2BA 3UGHA 5C3RA 1HRI1 1ACCA 1RUF1 1UY4A 4HBNA 4Q4W1 3AB0A 4QGLA 1W6PA 3OSDA 4HETA 4L2NA 5FUIA 5C4WC 4Y1UA 2WNOA 2HEWF 4NPRA 5JIUA 5KXDA 3PHMA 5FZHA 5LRSA 1FNYA 2OUJA 1JODA 5FQ0B 2Q8DA 1N1YA 4K20A 5JXIA 5C7GA 1CR7A 3POYA 3SITA 1OUSA 4AQ2A 2BWCA 2IFRA 3D4KA 3JCIA 3ZYFA 3EBRA 4X6QB 4QB2A 3TNQA 3HPNA 3FBMA 3KQ4B 4XCBA 4FQZA 2JXAA 2R043 4N8MA 4Q0PA 5FMOL 3U4XA 5A3OA 3MICA 4NUBA 1QJU3 1HRV1 1VBD1 2QBXA 1ULDA 1NA1A 2BYVE 2WRAA 2Q1MA 4QAWA 4RHV2 4N43C 2Q4SA 4Y22B 3JU9A 4R8HA 3NNGA 3BTZA 3TAYA 3T2PA 4AFMA 2WC2A 3ME2A 1Y9GA 4XJ8A 3S7EA 3S30A 1RUE2 1K45A 4EWEA 1AR73 4HLTA 3IPVB 5BNOA 2YFUA 1WMXA 1AX1A 2VECA 1PM4A 1V6MA 2VOTA 1C3HA 1NCQC 3MDPA 4NRQA 1VRH2 4HKLA 1KFXL 3J7NA 2PAMA 5F8PA 1L3JA 2E32A 4AFCA 2RV9A 4R9DA 3T08A 1H2KA 2RR12 1PZ7A 2OZJA 2ET1A 1O3RA 2R30A 4YGCA 4HPKA 3WT3A 2VBPA 5FPBA 3GJBA 1LU1A 3IM0A 4KWUA 1AYM1 1C4RA 4D6RA 2EIEA 2ZBJA 5CISA 2ZHLA 3R6SA 1F31A 2IXLA 3MFAA 4QGNA 1IPJA 1SACA 3OBAA 3AYCA 1W8WA 4FCAA 2HLEA 2Y60A 2A7AA 4RR3C 1SLIA 3UJOA 3WXPA 1W8ZA 1QDOA 2Y6LA 4IE6A 1ND2C 4HVRA 4RSUA 3IZOA 5I0DA 4K1YA 1SLLA 4P9GA 4QGMA 3DGTA 5EWSA 3UGFA 4DIQA 3MBWA 5LA0A 3OBZA 1YFWA 1H2MA 4QB6A 4EWDA 3AZZA 4A41A 2RJKA 3C8XA 3POIA 2OPKA 4YZ3A 4CEYC 1ZBE2 2VOXA 1F9KA 3HMYA 1EAH2 2ZGOA 2Y8KA 4GJYA 4CYDA 1WLWA 2WYFA 2E6VA 4XAAA 3B69A 4QX3A 2KA3A 3WP5A 1ZZCA 5FLJA 3AK0A 3ZFGB 5BNPB 2E26A 4QPWA 5FAXA 5GJ6A 4BK5A 4K9SA 5FMOS 1UD1A 5JZGC 3M1HA 4YNIA 3T09A 1XQNA 3L9JT 3OGRA 4N53A 3UJQA 3T0DA 1LOCA 4YARA 3KD4A 2DCTA 4Q8KA 4QDSA 1UL9A 5JAXA 2VXJA 1UOFA 2ZCWA 4PLNA 4ASMB 3GGLA 5ACA3 1BXHA 3IDBB 2WO1A 4Z8BA 1U5XA 4GB32 3KCCA 3VB9A 4LOSA 5LA9A 4GJZA 2WO2A 1AR83 2YU2A 5IK5A 3JBG1 2A6VA 4Z07A 4BQ1A 1QXRA 4UYBA 2Z5WA 4X8PA 2DCYA 4WM8A 1Z7S2 1PIV2 3E1F1 4Y20B 1H2LA
chains in the Genus database with same CATH topology
2WZPP 2ZOEB 1WCDJ 2YPJA 3G7DA 3IKWA 1OLRA 2D6MA 4YZ2A 1CAUA 2WS92 2RMU2 1WBFA 2PHXA 3BU7A 1PNGA 1YWKA 4Q4X3 1REDA 4S2HA 5HI0A 2VMIA 2Y0IA 4JAAA 4LO5B 3ZN6A 3V0AA 2BNOA 3QOPA 4G9SB 5I8SA 1O5UA 3B9IA 2MNGA 1HQNA 1RUH2 4H14A 4BA6A 4V1PA 4CDQA 1UU6A 4YGBA 4PIXA 4XJZA 2ZX3A 1AXYA 1U12A 2Z42A 1BEV1 2ILMA 4Q4Y3 2XKOA 2E63A 2FZ1A 2X8KA 4PDWC 4AGGA 2XBO3 3V0AB 2VOVA 5I0RA 3WY6A 4HMZA 4WVVA 4LBLA 4CDXC 2HWF2 5I8TA 3AM2A 1J59A 5F6KA 1R1A1 1MZ6A 3FE5A 5JSRA 3FLRA 3SCGA 1C1FA 1A8MA 1KQRA 4K6BA 2C9AA 1YI7A 2JG8C 1H8TA 5CG8A 2PLV3 2NM1A 2XB6C 1YFXA 4COUA 1KFUL 2VVFA 2A6YA 2PQQA 3RRDA 3ZDSA 3WP6A 2PELA 4BMEA 3C3VA 3EO6A 2WT0A 3GBWA 4WZCA 1CQ9A 1AR63 1LOFC 1MR5A 4X8NA 4P9JA 4DINB 2D6PA 1NY72 5I8YA 4OFGA 3AZYA 1G6NA 3G6JB 3B9CA 1DYPA 4F3JA 2RS52 3URFA 2B45X 2PHUA 3VKMA 3WW4A 4MGIE 2DF7A 1H8TB 1LB2A 2YC0A 5K7PA 2VW2A 1SFYA 2GZWA 2VNRA 5E88A 1ULGA 2YY1A 3IMNA 3VBHA 1QHDA 3WUCA 3CF6E 1U5YA 2CYFA 1QWRA 1XNCA 4OHVA 1CAWA 5J96B 1LODA 1TQ5A 2O1QA 3AYAA 3WLUA 1A3KA 2R1BA 3L2YA 5FLIA 4XQDA 4AFMA 4WVMA 2WINB 1QXPA 3NVCA 1ZRDA 1TNRA 3TYJA 4YW4A 4LBNA 2PTMA 4GKYA 2ZS6B 1ZRFA 5BNNB 4R9CA 2OVUA 1EYBA 1QJX1 3W58A 1FOD1 1QU0A 1WBLA 1YHFA 1YXWA 5FBZA 4M0HA 3CEWA 1SLTA 1OD5A 2D44A 3PNAA 4FPEA 4COWA 1OA4A 5CA6A 2JD4A 1H2NA 4AEDB 5CADA 3LA2A 1ALYA 5F9TA 2CV6A 4FPHA 4IEOA 1PVC1 1H4GA 4D69A 4R4XA 1GBGA 1Z0HA 2DVBA 1WD3A 4KGGA 1PK6A 1VIWB 4IETA 4H3WA 5FO7B 4AE2A 3AP7A 3ZSEA 2GNMA 1MS4A 4LULA 3NV3A 1WCKA 1NZCA 2TEPA 3ZXLA 4XF1A 5JPMB 4JDMA 1RVF1 5GZCA 4AWDA 3ZYGA 4AVAA 2DVGA 4BMBA 5C9AB 1FXZA 2EXKA 1ZBE3 1MS3A 3GHMA 5AC91 2CAVA 2AYHA 1Q8PA 1OMIA 2P3IA 3TN91 5HCAA 1JHNA 4XW3A 3ZFFC 4UW3A 4RS5B 1FATA 1LHUA 1AF9A 3JQWA 4BLJA 5GLUA 3VZJA 1V9U2 1PK6B 2QKDA 2XJSA 1LENA 1O5LA 2GU9A 4BOWA 4C1WA 2DU0A 1FAYA 5K0UC 1XE8A 3P3PA 4PBPA 1OQDA 3HWJA 2EIGA 2EAAA 4JDOA 2WFPA 1VBA2 4CDUA 4GB33 3BOPA 1W6OA 3ZVXA 1H0BA 3O14A 4N9HA 1FPN1 1JUIA 3GBGA 1K5MA 5JLVA 1Z7S3 4RL7A 5LRRA 1PO12 4FP2A 2AZ5A 2RS12 2UWBA 1OFNA 3I59B 1OSGA 2Q0AA 1V6OA 4MGYE 2AENA 2OA2A 3MLLA 4L8QA 1RUI2 2HWC1 2A73B 3AXDA 5JI9A 1FYUA 3APBA 5IK4A 1UCXA 3FMGA 4CDUB 2PAEA 1W6OB 2NQYA 1LGCA 1PVXA 1ZM1A 2IXIA 1K5MB 2Z69A 4LHKA 1D0HA 4E4ZA 3MPPG 4KWJA 1X33A 1W6NA 1HRI3 3W59A 4Q4W3 3ST7A 5B2GB 1GQHA 4XIOA 3IDEA 4HANA 3ES1A 4OLLA 2VMHA 3CJXA 4RFT0 1RUD2 1FMD2 1HV0A 1AL22 3EQEA 3VGIA 1OLQA 3USSA 3KGZA 4AVSA 3R0RA 4YG0A 2WA4A 3RMXA 4OI2A 4K8FA 2XJTA 1R1ZA 3MIDA 1W6NB 3VZKA 1HRV3 3FFQA 1DDLA 2WT1A 5BPXA 3SCHA 2D6KA 1DZTA 3RI8A 1HLCA 3RSJA 5HXVA 4AVTA 4GMP1 1MVQA 2P17A 4COZA 2Q30A 2JE9A 3MF9A 2DUOA 3I7DA 1V6NA 4MH0E 1QJU2 5J7MA 3LCPA 4PLOA 2MEV1 2ZMNA 1A6CA 2WL1A 5GKAC 2A3YA 2C5DA 2IXJA 5LEKA 1C8NA 4LT5A 1G8WA 4L11A 3ZFGC 5BNPC 5KHIA 3B02A 1AYM3 1DGLA 2RS53 1CIWA 4XFHA 1AR72 3BPZA 1OOPA 4KWLA 1RUC1 4OUMA 1ASJ1 2HWB1 1RINA 5GALA 4ZXKA 3JZVA 1HW5A 2DU1A 2DCKA 2BGCA 3N3HA 3AKSA 2SBAA 4PLMA 5J3UA 2K9ZA 3ZFEA 4W65A 2XVGA 4H55A 4JCKA 3AFKA 1QNWA 5L19A 1H8VA 2ARXA 4BM8A 5C8CA 1M4WA 4MVTA 3VZNA 5BY5A 3AKRA 4IEZA 3HT1A 3PVEA 5K8SA 4QM9A 5DUVA 3OBTA 2B8MA 3A0NA 1OFSA 4RGAA 1KITA 2RS31 2ZACA 4KQ7A 5GLTA 3MYXA 4XETA 1MZFA 1YCIA 2GC3A 3RQ0A 1QOOA 2FBEA 3VKFC 2ZX4A 5L73A 1ULEA 4XHBA 3MPBA 3PVBB 1LEMA 2GMEA 1W0PA 4COYA 1AVBA 4XBLA 1AR92 2ETEA 2BQPA 4AHXA 1HX6A 4WBBA 1FT9A 1S0EA 4YGDA 2QNKA 4FO9A 4JGZA 2QE3A 3AYDA 3VZLA 3VZMA 3AFGA 5ACA2 4OHZA 3RDIA 4OI1A 1YI9A 4ITCA 1NOVA 4LBKA 1AR82 2WKKA 4IV1A 4WM7B 4XHXA 3N36A 3M8LA 1COV1 5CBLA 5KC5A 1LGBA 1ENQA 3H7YA 1UZYA 4META 4NOTA 5FLHA 5HCFA 1DF0A 4IL7A 1GFF2 2D3SA 1NE6A 4LHLA 4GWNA 4QPGB 4QQLA 2IFWA 2ZGNA 4QPIA 1AJOA 3WP4A 2ZGSA 4JGYA 1CGPA 1ZRCA 3U0ZA 5DUXA 4IV1B 1BEV3 1C5IA 1HQLA 4HSLA 5LEJA 3VDDA 1IKQA 4ZU4A 1MEC1 4Q4V1 1Y7BA 2SLIA 1QOTA 4MSVA 1QJY1 1DZQA 5CFCA 2LTNA 1DBNA 4LE4A 1ZBA1 3J9SA 1H8TC 3VL9A 3MEPA 2EALA 5C6CA 2CGNA 4Y1VA 1I1EA 1QJZA 4AI2A 4Y5Z0 4I02A 2A6ZA 4QPIB 4IEVA 2GAUA 4GH4A 4EV0A 4EN7B 2D6LX 4YGEA 5JMCA 5JI7A 4YSFA 5D8AA 4P9WA 3M70A 3VDDB 1GZCA 1MZ5A 4OUSA 2A6WA 2ZKLA 5J37A 5KC6A 1HV1A 3NAPA 2ERFA 2MEV2 1B35A 1CPNA 1W2UA 2EXIA 4O9GA 2BEOA 4W6WA 2QCSB 2WIIB 4XE9A 5JOZA 2K2SA 1O91A 5DDJ1 1UIKA 3ZXKA 4B8EA 4DS0A 1TNFA 1DQ4A 1MQTA 5FOBB 1AR62 1XE7A 1VBB1 2VW0A 3ALQA 4E9KA 5BNNC 3WG2A 3IWZA 1R091 3VBFA 5FCCA 4GXLA 3FLTA 1POV3 4KWKA 4CDWA 3INAA 3NAPB 2HEVF 4A7KA 2Y26A 4LHNA 4LO4B 2R6QA 4XFIA 1B35B 4CEWB 1Q8VA 5L7OA 3Q9OA 4IESA 2IZWA 3K51A 4B7KA 4AEDC 2GC0A 2OIIA 4JC1A 4BLIA 3MGUA 4OI4A 2YXSA 4NHKA 5T55A 4YG3A 3U07A 3UV9A 4AVCA 3ZYIB 3LB9A 1MQTB 2NZ9A 1GNHA 3KZ4C 3HAGA 2ZJCA 1AL0G 4LO7A 4BHPA 4YVWA 4CDWB 1N3QA 1RUJ1 1LGNA 2E9QA 3O0VA 1NE4A 1O4TA 3MIEA 3MIHA 1QNYA 3QCWA 1FOD3 3EXUA 5L7OB 5T5JA 2D5HA 5C9AC 3N4MA 1EV11 1W6PB 3TB0A 4AEMA 2RM22 1WMEA 2R1DA 3DF0A 1R081 1CX4A 1SQ4A 4IEYA 3KLSA 4RS5C 2A75A 2EVXA 3B5LB 1PK6C 4YVSA 4B4RA 1PVC3 4KG0A 1WW5A 1DU3D 1GR3A 3H3ZA 4QD2A 5SV8A 4I0WB 1BYHA 1ND3A 1SLBA 4Q1PA 4QPYA 3V0BA 1DIWA 2ARBA 4G4FA 3FBYA 3R4UA 3WG3A 3IIAA 1AUYA 1XU1A 4JDNA 4XILA 2UYAA 1JYCA 4JQRA 1NA1B 3GZAA 4XF4A 2PHDA 2VUAA 1RVF3 4RGGA 2XVLA 4NWVA 1BQPA 2WSVA 1V6IA 5D1IA 5AC93 1AJKA 2OZ6A 4XXPA 1Q43A 3VBSA 3DPRA 3WHTA 4XJAA 3RS6A 3TN93 1CAXA 5BNOB 2DUPA 1WLDA 4ZU5A 1ND3B 3POWA 3V0BB 4C91A 2R0HA 2ZTNA 3WW3A 1MACA 1FV3A 3DKWA 4HPKB 4CDUC 5J36A 5JVVA 2WNVA 4YM0A 1AYN1 1U0AA 1HXS1 4E2SA 1YLLA 4D7SA 2EA7A 1K5MC 5DG2A 4AGVA 2YDEA 3CO2A 1AR93 3N7LA 3VBSB 1FPN3 3PJQA 4Y26A 4FOVA 5EYXA 1CAXB 2H0BA 2XJUA 2EXHA 2R071 2R061 2ZX2A 5FRAA 2ZGKA 2I45A 3WDTA 1BKZA 3NV1A 4I09A 1N3PA 4KU7A 3RJRA 2EF6A 4GWMA 2HWC3 3RYRA 4AEKA 3VBOA 3HIFA 3TRSB 1VBC1 2VVDA 4D3WA 1XYPA 2AUYA 1XNBA 2PHFA 4HVOA 1X82A 4C0HA 1TE1B 1ZZ8A 2B46X 2R32A 5J48A 2KM2A 1H1MA 2GALA 1QKQA 4DB5A 4N53B 3ZSLA 3HT2A 4LUKA 2H0VA 2WZR2 4P9LA 3H0OA 4XJUA 1LOEA 3DV8A 1VBB2 2QJVA 3WQ1A 2D6NA 3VBOB 3AZWA 5E16A 1CESA 1PMIA 1TME2 4R9AA 1XRUA 3KS7A 5DXDA 5TSWA 4WM8B 3OY8A 4QQOA 4LNVA 1HRI2 1RUF2 3V56A 4Q4W2 4XFBA 3H8UA 1S55A 3OYWA 3OPZA 5GZGA 1SFNA 4Z92B 5FDBA 1VAMA 4D94A 2HEYF 1X36A 4AXOA 3WHUA 1KJRA 3MF6A 1CAUB 4AG4A 1D4M1 5IK8A 4AI0A 3OGJA 3ZIWA 5J09A 4OZXA 4FTEA 2CTVA 1RUG1 2BW8A 3HN1A 3ZN6B 3ZSMA 1DGWX 1JUHA 2ZGUA 4S2FA 2ZHMA 4BYYA 4CTEA 4EN8B 3OY8B 5JPNB 1NCRA 4YZ1A 4W6YA 1HRV2 2R49A 1VBD2 4CDQB 4XPVA 2MEV3 1Q8QA 1X8EA 3M3CA 3ZSKA 1SDWA 4YFZA 4E4SA 1LHWA 1WLCA 1LKNA 3N35A 2GH2A 3ZSJA 3VBUA 1KDKA 3QLQA 4K21A 1I5ZA 1ASJ3 2C1FA 5A3LA 1V00A 3ZYPA 1VR3A 2FMYA 3AJYA 4R4ZA 1VALA 3CU7A 4YFWA 4TSVA 4YW2A 4UBGA 3CLPA 2BNNA 3WW2A 2VPVA 5LK5A 2H6CA 2UWCA 1AZDA 2DV9A 1TEIA 4FPLA 3VKLA 5JCTA 1AYM2 1C57A 4A3XA 4M01A 4JRAA 2YMZA 1RMU1 1S1AA 4LA2A 3GF6A 2DCZA 3V65A 2D5FA 3A0KA 4XF0A 2FHRA 1S0BA 3CL1A 1WMFA 4QQPA 4AK3A 1TMF1 1DQ5A 2LM3A 2D98A 2G4IA 3LOBA 4QU2A 4FVVA 3VHOA 4WM7C 1V6JA 3NW4A 4BZ4A 3TNPB 1PGL1 1O4YA 2XL7A 1VBE1 1RUNA 4N7UA 3D8CA 2C0ZA 4I3GA 4I0AA 5KHKA 2B7YA 1IKPA 1ENXA 2E53A 1O3TA 3HR9A 4DOUA 2RM23 1DG6A 1UX6A 1VLNA 1IZ3A 5GLVA 4B3NA 4DY3A 4QPGC 2P34A 5T5OA 2R062 3VBHB 2WFF1 3J8F1 3LSEA 1YIPA 2D97A 2F6BA 3ZXJA 3FC0A 2PN5A 4IV1C 4IV3A 1W6QA 3ILRA 2VW1A 1G7YA 1OA3A 1YIFA 3BALA 3PMEA 4IEWA 1CAWB 2HWE1 3JBG2 4A2UA 2P37A 5C4WA 4AI3A 4WVMB 2O0OA 1RHI1 2JEMA 4LO8A 5FO9B 3ILFA 2OUHA 3GZTB 1KD7A 2R041 4CP0A 2GH8A 1ULFA 1KRIA 5F5QA 3IBMA 3AMHA 4QPIC 3ZXAC 3B93A 1RB8G 4HVQA 4HT1T 3ROUA 4CZSA 2YROA 2D3PA 4LBMA 1MS5A 4IV3B 5JDBA 1W6QB 5DZGA 2CL2A 3VDDC 3AP5A 2F4PA 1C8M1 3B00A 5CU1A 3O12A 3S6PA 3VBRA 2CGPA 1MZEA 3LA7A 1MEC3 2LUWA 1MS8A 4HN0A 1X8MA 1SCRA 4P9XA 4U2AA 1GNZA 4D7TA 2KXLA 4FPKA 4E2GA 4I2OA 1ZBA3 4PIZA 2W52A 2GMMA 3VUOA 2GN7A 4MGKE 3ZXFA 1NCQA 1UMZA 3SXWA 3PVNA 3E6BA 4M3CA 1BEV2 2D40A 2XJVA 4IEQA 4ES8A 4CP2A 3KCXA 1GICA 4M3CF 1RUG2 4KU8A 1PZ9A 2PHTA 4S2GA 1S0FA 3NAPC 3ZX7A 3VBRB 2B42B 1B35C 2HJIA 2CGOA 4CEWC 3IN9A 4NWWA 1R1A2 1S0DA 1OI6A 4YM3A 2CAUA 4I0BA 5BV6A 3OBRA 4EN9B 3QBQA 1I6XA 4RR3A 4XF9A 1I9RA 1ND2A 1N1TA 1MQTC 4HK9A 4M3CB 4GKXA 2VH9A 3NSTA 3AZXA 2Q8OA 5DDJ3 2WA3A 5JOXA 2WZR3 2GSYA 3ES4A 4IEPA 2O8OA 4CDWC 3H50A 1LHOA 2XWBB 1VBB3 2QZ3A 3JQXA 2ZAAA 1R093 3LKJA 5KHJA 5L7OC 3JD71 4I3PA 4XEZA 3WVJA 1WW7A 4HZFA 1TME3 2HWD1 4P9YA 2P3JA 1UPSA 2VXRA 2D43A 3N7MA 1RUF3 1OKQA 4ZKTB 4MXVA 4GULA 4INDA 4QT6A 3USUA 1PGSA 3MZHA 1WW4A 4XMAA 2GC1A 2XKPA 3R4SA 4WVZA 2XJPA 1MS9A 1ZZBA 1NLSA 3FHIB 4KL1A 1C5HA 2VULA 1F5FA 5FPZA 1N1SA 3FUOA 4LR4A 3ZO0B 1RUJ3 1NA1C 5CFDA 4WV8A 2BNMA 5BNQA 1ONAA 4FPGA 1WD4A 4AF9A 1URXA 2JECA 4DPNA 1LTEA 5JOYA 1VBD3 3E97A 4FSJA 1Z78A 1BCXA 3DUIA 4Q4X1 1YJKA 4NN0A 3GYDA 5CIRA 4J6GA 2MPFA 5K9YA 3AKTA 5BNOC 4AW7A 4Q0VA 3AKQA 1ND3C 3ZMNA 3H1MA 4Q26A 1QJX2 4OHWA 1FOD2 3KM5A 3B94A 1AX0A 2Q1ZB 2GC2A 2UY8A 1J3QA 1PGW1 4CRQA 4PBOA 2ZX1A 1AX2A 5H9SA 2P3KA 4FT8A 4Z1VA 4AFDA 2AH2A 3VBSC 5A3MA 5F6LB 4FAGA 3FUQA 1PVC2 2XBO1 2X5IA 2ZA9A 4I01A 4BWOA 4PDWA 3R4DB 1OPMA 1DQ1A 2GDFA 5DG1A 1QY4A 5T3NA 4CDXA 2OW4A 4HKWA 2NMNA 1OHFA 2K0GA 2VG9A 1RVF2 2PLV1 2ZHNA 3GALA 3GHNA 4P14A 3RI9A 5AC92 2VUJA 1AYN3 1HXS3 1PO21 3AYEA 1O7FA 3TN92 1OOPB 4N53C 3OCPA 1Y3TA 5I0TA 4AFBA 3RYKA 4RQPA 2X5IB 3IDCB 2W39A 4DRVA 3WW1A 2VMGA 1W6MA 3VKNA 1YO8A 3TWIA 2VU9A 3TBDA 3WX5A 1J3RA 3OTFA 2R073 2E7AA 2R063 1UZZA 4N7IA 3CJIA 1YFYA 3OGGA 4N90A 4UXAA 2XWJB 3M4FA 4XTPA 3VBOC 1EPWA 5IUQA 3ZFEB 4BIOA 4Q0QA 3H9AA 2DUQA 3AJZA 4WM8C 3KB5A 4R9BA 4L92A 1VBC3 5C8CB 1WLTA 1DLLA 1FPN2 3JBG3 4BE3A 4E2QA 2BWAA 4AHYA 3RG0A 4JTOA 3NO8A 2W0XA 4NR1A 1QMJA 3KSCA 4RQPB 4ONUA 1W6MB 1KJLA 3BIWE 4QX5A 3PTYA 2XPJA 1U5IA 1BBT1 4XOGA 5T54A 1OA2A 2HWC2 3CJIB 1N1VA 2UWAA 3U11A 4RHV1 1LHNA 5GLZA 4I30A 5IT6A 2TBVA 1FI2A 4SBVA 3MI8A 4GIQA 4CDQC 3ETQA 1RUE1 1FV2A 4YM1A 4FPFA 1KDMA 4JGZB 1VRH1 1VAVA 2ZZJA 3MIFA 4LBQA 1EPZA 1B09A 2RR11 3LZZA 2P2KA 3PLQA 2BVBA 2DVAA 4NHMA 1RIRA 1D4M3 1XU2A 1Q8OA 4BCUA 1ZRRA 4YG6A 5A33A 3NKTA 4A7ZA 1H9PA 1RUG3 2WQ4A 3D5OA 1Q8SA 5T5LA 5FOJB 4E4DX 2DVFA 5CVRA 2GNDA 5AVAA 1R1A3 2A71A 2ATFA 1DQ0A 4GA9A 4LE3A 2Z79A 3QACA 1XYNA 2XGXA 1IS6A 1WGPA 3M2MA 3ZIXA 4JGYB 2I2SA 1ZBE1 3EHKA 4PF5A 1EAH1 1MVEA 1DYKA 4WZFA 4MZUA 4AHWA 2VOWA 3JB4C 1GSLA 4QQHA 1DFQA 2GMPA 3AMPA 4X6RB 4Y1YA 2VQAA 3UKTA 1AXZA 5CFCB 5CB7A 1V6LA 1OQEA 1O3SA 4J1WA 4Q0SA 4LLFA 1XNKA 4C90A 4TZDA 1PGW2 3H7JA 2X53S 4F8AA 3ZFFA 2VVEA 3E6DA 2YGLA 3ZN5A 4B29A 4GH4B 1RUC2 2DTYA 1FX5A 5IK7A 1ASJ2 1RMU3 2HWB2 3VBHC 5K0UA 4GB31 3SLIA 5D8AB 2PFWA 5CG9A 4YM2A 3WCSA 3ZYRA 3UL2A 2G9FA 1PIV1 1TMF3 4FOWA 5JR7B 1RUOA 3POSA 1AHSA 3MFCA 5GZFA 1H9WA 3KGLA 4M00A 4IXLA 1NQJA 4U36A 2ZAHA 2E7QA 4L97A 1SBFA 1LEDA 2UYBA 1RL3A 5FQ0A 2WS91 3ELNA 2D93A 2RMU1 1BK1A 3ILNA 3UKNA 4JVAA 4AGRA 1JN2P 1WMDA 4F7ZA 3KT4A 4OVEA 4ASLA 3VBFB 4IV3C 4WVWA 2RS32 3KCYA 4HN1A 1GV9A 4H7LA 4HSJA 1RUH1 1QJX3 1YJLA 3BCWA 1MS1A 2CWMA 1VAKA 3I8TA 4Y22A 1XNDA 2PAKA 2BTVC 1GQGA 4MXWA 2GN3A 2HWE3 2JG9A 1S0IA 5I93A 3N7KA 3T1MA 1RHI3 3RMYA 3IPVA 4FBFA 1WW6A 2UU8A 2WNEA 1MS0A 1EP0A 3TOJA 1BBT2 4HFSA 4UW6A 2NPIA 1XXNA 2VGDA 2HWF1 4OULA 4R52A 4YVWB 3WINE 3M3QA 4BIFA 3SISA 3O0WA 2ZABA 1CONA 4C0BA 1IPKA 2QDRA 4AQ6A 4AI8A 4URTA 1COV2 5EJ3A 3VBRC 3PVOA 4AHZA 2XL9A 4JTNA 4XFAA 3S7IA 3WOGA 5C33A 1F2NA 3RNSA 1C8M3 4C1XA 1G9DA 4MXWB 4XXAA 2JG9B 2ZHKA 5C8WA 1Q3EA 5GM0A 3WZ1A 4XZPA 4YVSB 4EWAA 1UKRA 2ES3A 1W39A 4EJRA 1VB4A 4K7JA 4LBJA 1LESA 1NY71 2I07B 1N47A 1U5ZA 3QH7A 2NMOA 4XYXA 1PZ8A 3AX4A 2YV8A 2V09A 4Z2WA 3ZXGA 3AMNA 2RS51 1ZA4A 1MEC2 3HBZA 4Q4V2 4JV4A 1JYIA 3OD4A 3ZFGA 1QJY2 4Y1ZA 4YRDA 3D0JA 1SBDA 2CNAA 5BNPA 2E7TA 3KT1A 3B01A 1LR5A 2QQPA 1ZBA2 2YGMA 3IT8A 3RWNA 3DPRB 2XHKA 3WNXA 1QXJA 4OHXA 3AMMA 5BXXA 3KT7A 4Q29A 3O5SA 2B39A 2QZ2A 5I91A 5FREA 2ZGRA 1JOJA 1ZX5A 4F83A 5JWPA 4Y1XA 1S2KA 3CNAA 4G3YC 4KGQA 1YFUA 2TUNA 4IEXA 2WNVB 2BFUL 3GBFA 1UW8A 1SLCA 4Y20A 3ZMOA 3LOIA 1X50A 3O7OA 4B4PA 1GZWA 2YZ4A 4P5HA 5EYYA 3JD73 4QM8A 5JSOA 3BB6A 4KNCA 1CN1A 2ZGPA 3WDUA 5KWRA 1ENSA 1LHVA 4D7YA 2HWD3 1BMV1 5DDJ2 4PCRA 4FPYA 4Q27A 1RJ7A 1UF2C 4XF3A 5T50A 4XMIA 1UN1A 4FPOB 3FFZA 4LO6B 3AXEA 1DQ6A 5CAZA 1LRHA 1JH5A 2W08A 4AYUA 1R092 4YW1A 5E8AA 2JENA 3VZOA 2A3WA 1UIJA 2DVDA 5EV7A 1GZWB 3I2DA 1OPOA 3PMSA 4FTSA 3V64A 3I54A 4FPJA 2JICA 1QGLA 2D7FA 3LSDA 4KG8A 4QXKA 3X29B 5KBFA 1JW6A 1A8DA 2XLFA 3BTAA 4M3CE 4TYSA 4XDQA 2W68A 2QDNA 4E27A 2AGSA 3THPA 4QHBA 4J1XA 1RJ8A 2IXCA 2ZPXA 4LEJA 1UU5A 4QMAA 2Y38A 4Q0UA 2FMDA 4GMP3 3AP4A 1QOSA 1RUJ2 3S0MA 2LALA 4ATFA 1S0JA 1G9AA 3NWKA 2JX9A 4FQ4A 4UBHA 3W9AA 3H1YA 3RJ2X 3EJKA 2A6XA 5CNAA 5JSPA 2XG3A 4MV2A 4UW4A 1EV12 3OYWB 1LCLA 2RE9A 5T52A 1YNAA 1V9U1 1R082 2WT2A 1OOPC 1KS5A 1SCSA 4RA0A 2BFUS 2A5ZA 2X5IC 3SHRA 1YYNA 2Y0OA 1ZZ7A 1RUC3 2YUEA 3LAGA 1J1TA 1VBA1 2HWB3 1YUDA 3ZFEC 2JDZA 2DCJA 2V73A 3MLKA 1Y43B 3ECQA 1NCRB 3PJYA 1PO11 2DFCA 4KH9A 3ZN4A 1S0CA 2RS11 4EN6B 2OYZA 5C8CC 4XFGA 3KQRA 5FO8B 1VB2A 1REEA 1RUI1 2FQPA 1NG0A 2IXKA 4RQPC 3K48A 1SMVA 1V70A 1PO23 1IGOA 3T1LA 1QQP1 3VBUB 3VKOA 4PJYA 4HK8A 3BOWA 3CJIC 1J3PA 3WUDA 1POV0 3ZXDA 5BUVA 1ZREA 1RTVA 1G86A 5KXCA 2RS33 4FOYA 5JOWA 2MHFA 3UKVA 2IC1A 5FTTC 2WNUA 1AYN2 5ABJA 1HXS2 2VOKA 2EAKA 1QDCA 1YRZA 3OJBA 3FX3A 3M3EA 4JGZC