5LCWL

Cryo-em structure of the anaphase-promoting complex/cyclosome, in complex with the mitotic checkpoint complex (apc/c-mcc) at 4.2 angstrom resolution
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
183
structure length
182
Chain Sequence
TPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVESSIGKFPRCTTIDFMMYRSIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Anaphase-promoting complex subunit 1
publication title Molecular basis of APC/C regulation by the spindle assembly checkpoint.
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 182
sequence length 183
ec nomenclature
pdb deposition date 2016-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF03256 ANAPC10 Anaphase-promoting complex, subunit 10 (APC10)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 5lcwL00
1JU4A 4E8CA 4XUQA 1JZ2A 3OG2A 3UNPA 3T2PA 3ACFA 2VZRA 2KD7A 2VZ1A 3MUZ1 3UESA 3HEIA 2ZEYA 4QX0A 4DXRA 3LEKA 4DUWA 1JU3A 1SG3A 1UXZA 2W47A 3CDZB 4XURA 2DCJA 4A45A 4YPJA 1UMHA 2YB7A 3I97A 3ECQA 1WKYA 2DDUA 2V72A 4RN5A 1DYOA 1UWWA 3PUHA 3HJRA 3WNPA 2VQUA 3U37A 3J7HA 4P00B 4QDSA 4XUPA 1J83A 1OD3A 3CKHA 5JR2A 2Z4FA 1MPXA 1GUIA 3OEAA 3THDA 4Z2AA 2J1AA 3OGRA 4A4AA 1GOHA 3CZJA 2W1QA 4D0QA 1TG7A 3ABZA 2XQXA 5DN2A 4HG6B 1UXXX 3SEPA 1W9SA 5JUVA 2XHNA 2VZVA 2JD9A 3K75B 2J1EA 3VDBA 4A42A 4OYUA 4XVHA 3IB3A 3GXUA 1JZ4A 3HNMA 4BXSV 4ZZ8A 4P08A 2VQTA 1KGYA 3WNLA 3SKVA 2C26A 1NAEA 3GDBA 2VCBA 5EJZB 3LPFA 2XONA 3VDAA 5IYYA 1W9WA 3MV01 3WSOA 5LA0A 1JI6A 4A3ZA 3ACGA 5JXJA 3HPNA 4FI9A 2J22A 1JHJA 1HN1A 1UZ0A 2VO5A 1W0NA 2V5DA 3WF2A 3SKJE 2WO2A 2YFZA 4CUCA 1OH4A 2QQLA 1CZSA 1US3A 2RJ2A 2Y6LA 1O59A 3A23A 4CVUA 1UYXA 2QQNA 3T0DA 3LPGA 2J1RA 3VD5A 2ZEWA 1JZ8A 1OT5A 2V4VA 5JXGA 4D8MA 1JYWA 1W8NA 1DP0A 3GGLA 3CQOA 5CYYA 3BN6A 1R64A 3IDAA 5IFTA 1OF4A 3NJVA 4ZZ5A 2EIDA 3K4ZA 1W9TA 4QB1A 2YG0A 2WQ8A 3K4DA 1BHGA 2BBAA 5C7GA 3W5NA 1EUTA 1W8OA 1UY1A 2QQMA 4PQQA 4MO3M 2ID4A 3MUY1 3K77A 2L9LA 3WF1A 1J84A 1ULOA 1XPWA 4DXTA 1PMJX 1O8SA 2W1UA 1PX3A 2WO3A 3HOBA 1K3IA 3JXSA 2WZ8A 1CZVA 1SDDB 3D3AA 3IAQA 4GZ9A 3T0AA 4MADA 1UY4A 2LS6A 3P1IA 4XZUG 3C7HA 2J1UA 2J1TA 4ZY9A 3CMGA 3I2GA 3HNBM 1L7QA 2WAOA 4GWIA 3I3BA 5LA1A 3HN3A 2JE8A 2XOMA 2E32A 3WF4A 3P6BA 4BK5A 2EICA 2X09A 4UOJA 3A22A 2WZEA 2VCAA 1XC6A 2WBKA 2VMFA 1PMHX 1UY3A 4QX1A 2Y6KA 4UAPA 2Y64A 3A7QA 3UETA 4CU9A 2WAAA 2WO1A 1PX4A 2OKXA 2C4XA 3WNMA 5G05L 1W99A 2J1VA 4PT6A 5IHRA 2B4KA 2ZEZA 1TVGA 2VL4A 4E8DA 2VZPA 4DUXA 1JZ3A 3FHQA 2J7MA 2ORXA 2VZOA 2W46A 1CIYA 4TTGA 2W5FA 2E33A 3ACHA 1KEXA 2W92A 4KI5M 4M4PA 1JZ5A 4QDQA 1LNSA 2VMCA 1H6YA 4XUNA 5LA2A 2W1WA 1JYNA 2BERA 2WN3A 1JZ7A 3FN9A 5DQ0A 5G04L 2Y6HA 5JXHA 4ARXA 5HPOA 1CX1A 4MGSA 3OGSA 2E31A 1NUKA 3LE0A 1K45A 3FL7A 5DPNA 3VD4A 2C9KA 5A1AA 1GOFA 2Y6JA 3C7GA 2CDPA 3VD9A 2VR4A 1GOGA 2VZQA 4GWJA 4JKKA 4CU8A 2WYSA 2QQOA 3BGAA 5LCWL 2QQKA 3NQHA 1UYZA 4QX3A 4AAXA 4UI9L 3IIIA 4DEVA 4LKSA 4MGQA 4ET7A 2Y6GA 1GU3A 1UMIA 2YC2A 2W9XA 1IQDC 3K46A 2RV9A 2ZXQA 3MO4A 3K4AA 4P02B 1UX7A 5EJ1B 2W91A 1OF3A 2YC4A 2WABA 2DCKA 4KMQA 4OMDA 2PQSA 5JMOA 5HXMA 1NX9A 2QQIA 1SHWB 3I2KA 1L7RA 1WCQA 4JKMA 5IJRA 4L0PA 4BK4A 2X10A 4CU6A 3A21A 4ZXEA 3WNOA 3PUIA 3C7EA 2VZSA 1K12A 2LW8A 3WQBA 3LQCA 3EYPA 4XUOA 4XUTA 4JHZA 1K42A 4DEQA 1I5PA 2HLEA 3HNYM 4BJ0A 3VD7A 2VOTA 4CUBA 2VMEA 3GM8A 4QX2A 3CIHA 3WEZA 5C71A 3OGVA 4LQRA 3DYOA 3NRUA 5J1XA 3I2FA 3C7OA 4LHSA 1EUUA 3NJXA 5B4XA 3ZM8A 3MV11 2W3JA 1GNYA 3WF0A 1XNTA 4QB2A 3DYPA 1UYYA 4ARYA 1XNAA 1JYVA 2VZ3A 3VD3A 3I2HA 2EIEA 3WNKA 4A44A 4QAWA 1O8PA 4QDRA 1RYYA 3T2OA 1ULPA 3T2QA 2W1SA 3OEBA 3THCA 2W94A 4JX0A 3ACIA 3F2ZA 1P8JA 2VZTA 1YQ2A 5JXIA 3WF3A 2JDAA 4MOAA 2RVAA 3I2IA 4JKLA 3IAPA 2Y8KA 3NNGA 4DXSA 3SEEA 2BGOA 1F4HA 4OUEA 2VC9A 2BZDA 4IUGA 3DECA 1UY0A 2QBXA 5F7UA 3FHAA 3LEIA 1JZ6A 3EB7A 2JKXA 2VMDA 2X05A 2R7EB 4P5YA 5C70A 2VTFA 2BGPA 4DUVA 5B4NA 4RYDA 5I0DA 4A41A 2B9VA 1DLCA 4M4RA 2WUHA 3LEGA 4PF1A 2ZEXA 4W50A 2VCCA 2YFUA 3T09A 5DMYA 4OMCA 3MBWA 1CZTA 2CDOA 3I3EA 1NKGA 2VM9A 4BDVB 1D7PM 2ORZA 3W5MA 4QB6A 2WN2A 3C7FA 2QQJA 3OB8A 3I3DA 4TXWA 3AC0A 1F4AA 5EIYB 2W87A 1H6XA 3I2JA 1T2XA 1US2A 2VZUA 5FUIA 4A6OA 4CU7A 3E1F1 3CZUA 1GQPA 2HYXA 4KWUA 4QPWA 3T08A 4LPLA 3T0BA 5IFPA 2E26A 3C8XA 2WDBA 3WNNA 2VJXA 3VDCA 4OZOA 4W4ZA 4CUAA 2EIBA 1GMMA 3ETPA 4AG4A 3OBAA 4W8JA 3DYMA 2J1SA 2W95A 1UY2A 1JYXA 5CZKA
chains in the Genus database with same CATH superfamily
1J58A 1JZ2A 2BW8A 4XUQA 3MIEA 2NMOA 4QPIA 4DIQA 3KV6A 3ACFA 3SISA 4CP0A 4XILA 4AVVA 4FPJA 1PO11 3NWKA 2PHRA 3IMNA 1REDA 3FWEA 3P5BA 1LHVA 4XFGA 1SLIA 1COV2 2CYFA 2ZEYA 4PDWB 3BU0A 1VAMA 5FZCA 4DXRA 3WDXA 3LEKA 4K40A 3O1TA 1TNRA 2DVGA 1QJFA 1SG3A 3SCHA 3OD0A 4XURA 1PM7A 1KJLA 1S0CA 3N4MA 4QT6A 4A45A 1COV3 2A7AA 2XVLA 3OBRA 1WKYA 1GBGA 3B93A 3HBZA 3IT8A 1VRH3 4RN5A 1XOYA 1QIQA 3AKPA 4Q4V2 5KR7A 4JTOA 5KHKA 4JHTA 4LE3A 1Q43A 3NV3A 2A1XA 3WP6A 4XUPA 3GZUC 4ZU5A 5CFCC 2EVXA 4FPOB 4AEJA 2PXJA 1K5JA 3V0BA 2WQ4A 3OYWA 5JR2A 3RS6A 2ZOEB 1LJ7A 4YW4A 4Q4V3 2RMU1 4LOSA 3THDA 3OGRA 1GOHA 1E5RA 3POBA 3WT3A 4KGGA 4OFGA 5KWRA 1BBT2 1YYNA 2ZGOA 3CZJA 4WVMA 1TG7A 3ABZA 3NNFA 2JG9C 1ALYA 4A2UA 3E6BA 4CCCA 2DTWA 3KVAA 1AL22 5DAXA 2GC0A 1RUJ3 5BNNA 1SCSA 5JZGB 3AZVA 2IFWA 4UBGA 4BB3A 4GMP1 2PHWA 3OSDA 2ERFA 4UWDA 4BLIA 3LSDA 5A7QA 1O4ZA 4UFKA 1LEMA 3J8F2 1IPJA 4D7SA 3IB3A 5F1RA 1JZ4A 4BQXA 5E88A 4UFIA 2D97A 4BXSV 2IXHA 4QMAA 4ZZ8A 3HQXA 2VQTA 4R4ZA 2A73B 1UYPA 3WNLA 3SKVA 2PHDA 3VBRC 2KXLA 1NAEA 4LK6A 4PBOA 3J8F3 4JRAA 4XOGA 1RUE2 4AI9A 4J1WA 5IVFA 1GV9A 3VDAA 4OI4A 3WNXA 4FPLA 1DQ2A 2WC2A 1WLCA 2HEWF 2P17A 3FUQA 4GD4A 3AYDA 1VR3A 2BUKA 4N53A 3ZN6A 4IL7A 4A3ZA 4LKFA 5H9SA 5GJ6A 1UF2C 2AEYA 3KV9A 4YW1A 1PO23 2QNKA 2DF7A 2ZX2A 3BOWA 5GZFA 3R4UA 2LM3A 2XXZA 5F5QA 5A6ZA 4PIXA 2ZGTA 5C5TA 5FLJA 1LOGA 4UW4A 3WF2A 5BY5A 5LBBA 2WFPA 1WCSA 5HXVA 2QQLA 3P3NA 4P9IA 4AVBA 4XFAA 1SPPB 2RM21 4MVTA 4Q29A 4QPYA 5FREA 1O59A 1LULA 5E6HA 5T5JA 2ZEWA 1JZ8A 1DZQA 1YFUA 5JXGA 2P37A 3B9CA 4R9AA 1CAVB 3VDDA 3QH7A 3WINE 4Q8KA 5IVEA 5JOWA 1DYPA 1XRUA 4IGQA 4D8MA 1OHFA 4P9YA 1H8TA 2JDUA 1Q8VA 3CQOA 4Q4Y1 1CIWA 2KM2A 1C8M2 2P6CA 2WNUC 5E1RA 1QKQA 4FQZA 2I2SA 2OIIA 5DAPA 3VKNA 1DZRA 1G9FA 4XDPA 3HQUA 4L8QA 5D8AB 2EIDA 1NA1C 5FZ1A 1LOFA 1YO8A 4QB1A 5FK7A 3O1SA 2WQ8A 3SMHA 1OA2A 1ZM1A 5EFUA 1PK6B 2BBAA 4YW7A 5C7GA 1AR81 2JDZA 2MPFA 2PHXA 4FXKB 4XBQA 3U10A 4MO3M 4AGRA 4ZS3A 1HDKA 1DYKA 2QQVA 1ULOA 4GIQA 1XPWA 2ZMLA 1PMJX 1VB4A 1QEXA 3HN1A 4HKLA 2PHTA 2W1UA 3B7MA 3LGRA 4XMAA 4AFBA 1ZBE1 1PGW2 3ILNA 1Z7S2 4RR3A 4DB5A 1HIXA 2VBPA 5A6XA 3ZFGC 2OT7A 3AP4A 4LBQB 1XSQA 1UZWA 5T5OA 4GH4B 1GP6A 4S2GA 2ARXA 3D3AA 3IAQA 4Y4YA 3E5XA 5FKBA 4IESA 1TMF2 1L3JA 3PURA 2BV4A 4XZUG 3RQ0A 1OLME 4W65A 1AZDA 3I2GA 4IV3A 1YFXA 4B3NA 1L7QA 1UPSA 3ATGA 5I93A 1HV1A 1MS1A 2HWB2 1WMXA 5FYHA 5KHHA 1OSGA 1NT0A 4GWIA 2BGCA 3H1MA 5ACA2 4I01A 5J98B 3SCFA 1IS3A 3BKZA 3P6BA 4YNIA 4GMP0 3U0ZA 1AJKA 2X09A 3BTZA 4QX5A 3A22A 4TYSA 4AFDA 4IGOA 5JLVA 2R061 4AEDC 4QQOA 5ACA3 4FP3A 1QWRA 4IV1B 4QPGC 2D3RA 5LASA 1ZZ7A 2HWE3 2Y6KA 4QU2A 2Y64A 5EV7A 3A7QA 4ISRA 1CR7A 1ZRIA 3B69A 3U4XA 1KS4A 1GZTA 4QX8A 1PX4A 1WMEA 2CWSA 1QGLA 3AMHA 1EV12 2ENRA 3PU8A 3DL3A 1SCRA 2FDFA 2Y0OA 3NV2A 2ADEA 2Z5WA 5IK4A 4O61A 4IE7A 4PLNA 4G3YC 1VBC1 3AMQA 5FZFA 1A34A 4ZU4A 1W99A 4IEOA 1R1A2 1TVGA 1HRV2 2YY1A 4D7YA 2VZPA 1APNA 1W2TA 5F2SA 2GP5A 4ORFA 5IWFA 4B1MA 2D98A 1POV1 1WGPA 2WT0A 2Q8DA 4PI0A 2W46A 4SBVA 5FMDA 1MZ6A 1R1A3 3UV9A 5BUVA 3CL1A 4TTGA 1KEXA 4KI5M 3AYAA 5E89A 3H3ZA 4IERA 3VBUB 3WCSA 1LOAA 3AZWA 5CVRA 3MF9A 5FJHA 4QDQA 3VKMA 4K1YA 4XUNA 5LA2A 4JV4A 1ODMA 3LF7A 2QTWB 1HRI3 1QY4A 4AL9A 2C24A 2P34A 4BHPA 4CDWB 4RGKA 1UZZA 2Y6HA 5FYIA 4ARXA 2GALA 4XXPA 5FQ0B 4MUVA 1QDCA 2GMMA 4XJ8A 1OPOA 4XJZA 3WW3A 1STMA 4E4SA 2RHPA 5GLUA 2W68A 5FZOA 4I3GA 1QQP2 3FL7A 2ZGQA 5DAWA 3DXUA 4I0BA 5DPNA 3VD4A 3QBQA 1PNGA 4Q4X3 4HONA 2CDPA 2DV9A 1IPKA 2D6OX 4EN7B 2HEYF 3BTAA 3OD4A 1GANA 4PCRA 2QQKA 3HT2A 4XETA 4QX3A 3AL6A 2HWF2 1WMDA 2RS53 2NPIA 4DNYA 2OXBA 2NP0A 3GNEA 1RL3A 4MGZE 3U14A 4CCKA 4TLFA 3H7YA 3KF3A 4MGQA 4NE9A 4ET7A 2YC2A 1UMIA 2AH2A 3SC7X 2VVEA 3TN93 1YWKA 3K46A 4Q0UA 2NN8A 1QJX2 2DCYA 5C9AB 2DVAA 1LECA 1OKQA 2GNTA 2HWF3 5BNOA 2FDIA 4DINB 1UX7A 4NAMA 3ZFFB 1LHNA 5FZ3A 3BIWE 3RYPA 4FPGA 4A3XA 1GNHA 3EBRA 5FY8A 2DCKA 1WW5A 5CB7A 5FY1A 1RUF1 2MEV2 3GBGA 3PVNA 1Y9QA 2D6PA 5HXMA 3VBOB 4OUMA 5I0UA 5IUQA 1AXYA 1IKPA 1VBA1 3I2KA 3AM2A 4MXWA 1LHUA 3EMRA 4XFFA 3LDKA 4M3CB 3ZIXA 5IJRA 4FTSA 2YPJA 1C3HA 4W6XA 5FJKA 1TQ5A 2MEV3 4AVAA 2VE1A 3ASIA 4CCEA 3QACA 3DKWA 3TNQA 3UT0A 1OXCA 3N35A 3LFMA 5DUVA 5F5AA 2OQ6A 3A21A 3GZAA 4META 4P9LA 5LK5A 1H8VA 4YYOA 1CJDA 3WNOA 4WZCA 1RVF1 3ZYFA 4AQ6A 4XC9A 5FMOL 1G7YA 1GYKA 1VJ2A 2VZSA 4A7ZA 4E4HA 1EY2A 1IHMA 2LW8A 2WFF1 3AKQA 2DFCA 3LQCA 4MV2A 5FYMA 3ZR6A 4KBZA 3CF6E 1V00A 2R071 4DOUA 3FLRA 3MPPG 1A8DA 1VBD2 4H3WA 5IK5A 1DU3D 1Y4WA 1K42A 2XWBB 2GH2A 2XH6A 1UZVA 1V6NA 1I5PA 5IVJA 4OI0A 1DQ5A 3HNYM 5JIAA 4YZ1A 1OQEA 1UL9A 1V6MA 1VBD3 3LA7A 3O14A 1D0HA 3OGVA 4Q8LA 4OHZA 4WVVA 2E7AA 4UXAA 3POWA 2FCTA 1AXKA 1EUUA 1POV0 5B4XA 3UJOA 5TSWA 4XEZA 3ZM8A 1GNYA 4M00A 1W2NA 4QPIB 2BTVC 1XNTA 3DKQA 2G1MA 4LO8A 1V6LA 1XNAA 1JYVA 5DG2A 1O3QA 1COV1 1YLLA 2EIEA 3VD3A 4A44A 3MZHA 1Q8OA 1OOPC 3OY8A 2B9UA 5IVYA 2BNMA 1BXHA 1OQDA 3T2OA 5LW9A 4NIIA 1WLDA 1YJLA 3ME2A 2W1SA 5JOZA 2RR12 2W94A 4JX0A 4I30A 2BFUS 3GF6A 1LR5A 3BOPA 2XUMA 3AZXA 4YZ5A 1JODA 3ACIA 1YJKA 3F2ZA 4N90A 1P8JA 2VZTA 4QHZA 4MOAA 3S5QA 3PMEA 4BQYA 3DCQA 4HXCA 4PBPA 3I2IA 4Q4V1 2Y8KA 1WA4A 3O0WA 4P9WA 3AXEA 3NNGA 1QOSA 1NCRA 3SEEA 2PHFA 3VBFA 1VALA 2ZMNA 4CP9A 3PJQA 3OUHA 3ITQA 2D40A 2GNDA 3DECA 4IEZA 1HKDA 4AFMA 3ZSLA 3ZFEB 1PVC3 5F7UA 1DG6A 3OYWB 2BNOA 2HWD2 2E9QA 3EB7A 3NAPA 4OULA 4WV8A 4Y1YA 3ZXDA 4C91A 5JIUA 4M01A 1N1TA 2Q8EA 3ELNA 3WW1A 1F35A 2VU9A 3RPQA 1XYOA 3THTA 5T3NA 1G9BA 4YGBA 5T52A 5LA9A 4P5YA 1CX4A 2WNVA 4DUVA 3IN9A 2HWD3 4RYDA 4XFHA 1G9CA 5GLVA 5BNNB 4CCJA 5C4WA 4DRRA 3KS7A 1TME3 4M4RA 4V2WA 1KFUL 3LEGA 2LRPA 4Q4Y2 1LGCA 1OOPB 2HBUA 3J8F1 4LE4A 3ZO0B 2K9ZA 5DAQA 4EZ4A 5DMYA 4OMCA 3ZXLA 3MBWA 4NIDA 2LALA 1CZTA 1ENRA 1VRBA 2CDOA 1U12A 2IXKA 3I3EA 1L7LA 4RQPB 4CA9A 1R092 4R9BA 2A6VA 3BYWA 2ORZA 1BVVA 3H1WA 1RUE1 4C1WA 4QB6A 5FZMA 3W5MA 5C3QA 1O7FA 4RA0A 4EWDA 5FPBA 1VP6A 4WM7A 1SLCA 2WWSA 1JH5A 1OLQA 3AVRA 5C3OA 5F37A 1WCUA 5K4LA 3I3DA 1R093 5ABJA 1AUYA 4HVRA 3ZN6B 4N53B 1ZBE2 2BWAA 4I2OA 1GWMA 1OBNA 3X29B 4P9XA 1UAIA 5DUUA 3I2JA 5JSOA 2VD7A 4NO4A 2UWCA 1US2A 1DFQA 4CCLA 1W28A 4EN0A 1CD3G 2DU0A 1UMZA 3PTRB 2A3XA 4HVOA 4N43B 2K2SA 2IFRA 5IT6A 4XJUA 3BI3A 1JYIA 3N9NA 4D94A 4AHWA 4XF1A 3OUJA 4KWUA 4XMIA 4LPLA 3T08A 4FAGA 4AHXA 4EYUA 4N9IA 2OYZA 2YU2A 4Z92B 2VJXA 1GZCA 3VDCA 2JG8C 2X5IA 1YI9A 1S1AA 2OUHA 1DQ0A 4GWNA 1X9PA 3HAGA 3VDDB 1W6QA 3NV1A 2MHFA 4A7KA 4Y3OA 1V9U3 3B3QE 1G6NA 2R062 2XVGA 1NQDA 3POFA 1LESA 1C8M1 4XHBA 4PF5A 4E8CA 1ULGA 4E2SA 2VH9A 3GZTB 1SLBA 5FYTA 2VZRA 1HQLA 3PVBB 3VZKA 3AP6A 1ZZBA 4YVSC 3K3NA 2PTMA 2VZ1A 3MUZ1 4HKWA 2XLAA 4HSLA 1N1SA 3BUCA 4LHLA 1HXS2 3B9IA 3HQRA 1FNYA 5C33A 1JXNA 4FFFA 4FOWA 4KGQA 5A7NA 3AKSA 2B7YA 3ZPOA 1KRIA 2AC1A 2FBEA 2VUDA 1LOCA 2GC1A 1BQPA 4LO4B 2YPDA 2DCJA 4FFGA 2BQPA 4LLOA 2BDRA 3RZGA 2DUOA 1D4M2 1NYWA 2QCSB 4AK3A 1UMHA 1PNFA 2YB7A 3AFGA 1XJAA 1PGW1 4QQLA 3U1XA 1AYN3 2XL9A 1WLWA 2JE9A 3CEWA 1ZVFA 5F6KA 3VZNA 1O3TA 4RR3B 1UWWA 5FY5A 2IXLA 5T54A 2DVBA 3WNPA 3ZR5A 3U37A 3UYJA 4IEYA 1ND3A 2A6ZA 4P00B 1QMJA 2AEZA 4QDSA 4K7JA 5F6LB 4MYEA 4COUA 1LHOA 1J83A 1OD3A 4LBLA 3ZFGA 3CKHA 3DF0A 2GMPA 3QH6A 3ZSMA 2Z4FA 3I3MA 1MVQA 3JU9A 1QHDA 1XNBA 3OEAA 4XJ9A 1XNCA 2FDJA 2OVUA 4Z2AA 4IV3B 2EXJA 4MX3A 2VECA 3U78A 4YVWA 5C6CA 3O1VA 3LEMA 5K0UA 5ACA1 2P1BA 1JUHA 3VV1A 2JWPA 2OPWA 3K51A 1W9FA 4HZFA 3RMXA 1WW4A 1K5MC 4Q0PA 2XJSA 5CFDA 2XQXA 4LO6B 1PZ8A 4UW6A 2DFBA 5EP9A 3SEPA 1W9SA 2QQWA 2XHNA 3BALA 4LTAA 1FPN3 4XABA 2J1EA 3V0AA 3F95A 3S6PA 4EE2A 4X8PA 1MQTA 3D6EA 3UL2A 1HJFA 2ZS6B 3HIFA 1IGOA 3LCPA 4LUMA 2D5FA 1WBLA 1E5SA 4QPGA 1DDLA 1UU5A 2PHLA 2YMZA 3NL1A 3POJA 4F3JA 2WA3A 2XJVA 2HKXA 3GDBA 5EJZB 1UN1A 1QXPA 3NV4A 4N7IA 3LOBA 3RJ2X 4LEJA 3RYKA 4QKBA 1R1A1 2XL7A 1ZA7A 1SEFA 2W39A 4QHBA 1H9WA 1JI6A 1SLLA 4XDQA 3ACGA 5FY7A 4BQWA 5CISA 1N1YA 1FT9A 4IEWA 4LHNA 4XTPA 5DUWA 2XR4A 1KJRA 4N8MA 4XJWA 2DVFA 1CVNA 5EPAA 3PVOA 3JB4C 4RGAA 2AGSA 1HRI1 1W0NA 3BCWA 4FPFA 4WBBA 4F7ZA 1YHFA 1MEC2 2WL1A 1SQ4A 2WO2A 4XQDA 2YFZA 4Q26A 1CQ9A 1OH4A 2YC0A 2C6SA 2ZHKA 3L2HA 5FRAA 4CUCA 5FWJA 2CU5A 4YM0A 5I91A 4AHYA 3LB9A 5H9PA 4C90A 3WW4A 2Y6LA 1Y43B 4CDUA 1H30A 5CAZA 5KBFA 4RSUA 3WQ1A 4G4FA 1IOAA 1SBEA 1UYXA 3KV5A 3BVCA 1GZWA 2J1RA 2A5ZA 5DZEA 3VB9A 4BE3A 4CXYA 3KHCA 4Q4X1 1OA3A 4NUBA 4ZU7A 2J42A 1PMIA 5DG1A 2FDGA 3RI9A 1S2KA 1W8NA 3PIJA 4RS5A 1KDMA 1RVF2 2ATFA 1SLAA 3M2MA 3GGLA 1QQP1 1XSRA 3ZSJA 5F3CA 3RSJA 1QXJA 2TNFA 1R64A 1JHNA 5FZOB 4YLZA 4Z1VA 2WFF2 2NQYA 3JQXA 3WHUA 2FZ2A 1DZTA 4QXCA 3RWKX 2R072 5BNPA 1IQAA 4RL7A 3NJVA 4LUKA 1Z0HA 3AX4A 3TN91 1S2EA 3WZ1A 3K4DA 2RJKA 4Q27A 5E16A 2HWF1 1H9PA 3KMHA 1UY1A 3HVDA 4LKEA 4XF3A 3I2OA 1VPHA 2XJQA 1XE7A 1X9TA 3MUY1 1I3HA 3KT7A 5KHJA 3N3HA 3QD6A 2L9LA 1LTEA 1J84A 3MLJA 4O9GA 1WD4A 1NOVA 1QJX1 3AP9A 5JZGC 4DRVA 4CDQB 1W03A 4NIGA 3WUDA 1ND2B 2XJTA 4X6QB 4CEWA 3PU3A 4GXLA 1AX1A 1MACA 4BISA 3MW3A 5F32A 1XQNA 1ULDA 3ALQA 3DUIA 4AGVA 4D3WA 2E53A 1ODNA 5FKCA 4E9KA 2VCMA 2GP3A 3O5SA 1UY4A 2MEV1 4MADA 4NPRA 2LS6A 1VRH2 2W0XA 1GWLA 5A3LA 1ZYBA 3WCRA 5LATA 4Q1RA 3WDUA 2J1TA 2UWBA 5HV0A 1C28A 3CMGA 4RFT0 5HI0A 5HCHA 3HNBM 2RS13 2B5HA 3BB6A 4XQWA 4MXWB 2WAOA 3OOXA 1ACCA 3LKJA 5LA1A 5IATA 4BQ1A 1F5FA 2YROA 1X82A 1H1AA 2XOMA 3S5AA 2LROA 3OBZA 1S0EA 1X36A 1R1ZA 1WBFA 4COWA 1DGWX 5C3RA 2P3YA 2O1QA 5AVPA 4LULA 5CKMA 5FZKA 2UY8A 1JS9A 1XC6A 1YQ5A 2WBKA 3I3QA 4JRLA 5IAVA 1RUJ2 1PM4A 1WCDJ 3OF1A 4BU2A 5L73A 1OD5A 1UY3A 4PJYA 1OUXA 2ZKNA 1UU4A 1VBD1 4WVWA 4OUSA 2QVSB 2IUWA 1W6PA 2AUYA 2WAAA 1H1IA 2WO1A 5DXDA 2VBBA 1RUI2 3VZMA 4C0HA 5C8CA 3WOGA 5FPXA 5GZGA 3O1PA 4AZZA 3SQOA 3WXPA 1N1VA 3Q9OA 3OGGA 4AI2A 3LIHA 2J1VA 3AB0A 4PT6A 5IHRA 2VQAA 2B4KA 2ARAA 5JPMB 1WWYA 1RUI3 2VL4A 2VNOA 3J4UH 4XQ4A 3PUQA 2GC2A 3I2DA 4AI1A 3WX5A 3UGFA 1E5HA 2WSVA 3DPRB 3FHQA 2ORXA 4UF0A 1W8TA 3LOIA 4BOWA 1W6MB 3D5OA 4B4RA 2FD8A 1A78A 3V56A 3ACHA 5FPAA 1FV2A 3VUOA 4M4PA 3OY8B 3H50A 3N9PA 3AYEA 3K3OA 4NN0A 1PO22 4QQHA 2WSUA 5D8AC 5H9RA 2RR11 2XKOA 2R6QA 3ZXFA 2H0BA 2VG9A 2IC1A 1PK6C 1RJ8A 4YW6A 5FPVA 2W1WA 1JYNA 2BERA 2WN3A 1FAYA 2TEPA 2YXSA 3Q8CA 5AVAA 5IVBA 4MGTA 2GNBA 2KA3A 5DQ0A 3IIAA 1PVC1 5G04L 3PVEA 2GZWA 4Q0VA 5HPOA 5FTTC 1E57A 2D6KA 1S0GA 2PQQA 4D7TA 3OGSA 4NHMA 1NCRB 5FY4A 3WQ0A 2E31A 4OHYA 4MH0E 5FZ4A 1YFYA 4Y33A 4X6RB 4YG3A 3KVBA 4OQ9A 1UKGA 4GH4C 2WINB 2HWD1 5JDBA 2XLGA 1V0AA 3C7GA 4FOQA 1FMD3 1HX6A 2A3WA 3VD9A 2VR4A 1GOGA 4CU8A 1ZA4A 3MW2A 2XJPA 5FIXA 3NAPB 1TME1 3IZOA 4CCOA 2OPKA 5A3WA 2R043 1H0BA 2WO7A 3BGAA 2OX0A 3JCIA 2JECA 4EWEA 3KT4A 1VBE3 1KD7A 5DDJ2 1W8ZA 2CAUA 4UI9L 1AX0A 1H4HA 4N9HA 5CEHA 2WNVB 4DEVA 5C5UA 4L97A 2B42B 2RE9A 2ZX4A 4OHVA 4UW5A 1ULEA 5F2WA 3R6SA 5C4WB 3ZLIA 4EJRA 1N47A 4V1PA 2Z42A 3MO4A 4YGEA 3K4AA 5DDJ3 1W6OA 5FBZA 4W6YA 3N7MA 2PYTA 4AEMA 2W91A 3VBHA 1OF3A 1R091 4IV1C 1ZRDA 4UBHA 4AEKA 1HQWA 2WABA 2DBNA 4CXWA 3U11A 4KMQA 2E51A 2VNRA 1OVSA 2PQSA 1EAH3 4M0NA 4OMDA 3JD73 1J1TA 4WM7B 5SV8A 1A6CA 1SHWB 2R0FA 1XBFA 3AZZA 2XMLA 1SFNA 3V64A 2Q4SA 4L0PA 2AZ5A 5ABJB 4ATFA 4LK7A 4BK4A 4D69A 2ZGPA 3IPVA 2X10A 3D0SA 1AR93 3QLQA 4IQPA 4XBNA 4AI0A 3M3OA 4ZXEA 4A6SA 4CDXC 4BQ4A 3WHTA 1JYTA 2JXAA 3D0JA 1LAJA 1OFNA 1YNAA 4TLGA 1YUDA 2BFUL 4MGIE 1K12A 1MS5A 4GB32 2BU9A 2IZWA 1NE4A 3EYPA 1V9U1 1X8MA 5JI9A 5FFOC 5F5CA 3VBUC 1GNZA 4ONUA 2HWE2 3VKOA 4DEQA 3MEPA 4GB33 4AYUA 2X5IB 4BJ0A 2WIIB 4CP1A 2UU8A 3ZN4A 4CUBA 3GM8A 4CDWC 5CKQA 3P3PA 4LQRA 2E6VA 4OCTA 5FUNA 2BYVE 3R4SA 3MFCA 3Q8BA 1T6BX 4KU8A 4DO0A 5AFBA 3IMMA 2BEOA 3MV11 3PIGA 5JPNB 4LBNA 1ASJ3 5LRSA 3QCWA 3MIFA 5K8SA 3DYPA 4ARYA 1RITA 1HXS1 2DUPA 2IXCA 3GHNA 3NVCA 4XF9A 5FYUA 4JGZA 4URTA 1NY71 4QDRA 2I74A 4K8FA 1AYN1 1UX6A 1QXRA 4GA9A 2QDNA 2H0VA 4XE9A 1ULPA 4MZUA 3T2QA 4LBMA 2WT1A 2R16A 2ILMA 3NJYA 5FYBA 3KGLA 1D4M1 1S0JA 2PMWB 3VBSA 3RJRA 5L7OA 1NCQA 4CDXB 1AF9A 4CTEA 5JXIA 2BPA2 1DF0A 2JDAA 5EZWA 2BOIA 4YG0A 4JKLA 1MS4A 1EP0A 4DXSA 4EWAA 3LZZA 3M3IA 1IKQA 1Q8SA 5C9AC 1HRI2 4JGYA 5FDBA 5FZBA 2VMGA 3MPBA 2XBO3 4CPBD 1ND3B 4HOOA 3ZFFC 4MHUA 5GZCA 3M3CA 1UY0A 1IZ3A 1W2AX 4XAEA 4K9SA 5A7OA 3ZKYA 3LEIA 3KLSA 2DUQA 3LFIA 4YZ4A 2P4EA 1AR73 2C1FA 5EYXA 2JKXA 3D4KA 4BPZA 5CBLA 2ZBJA 4KWJA 4COVA 2Q8CA 3NNLA 4NRQA 1GKBA 2OZJA 3MF6A 3VBOC 1BEV3 1W6NA 2H6BA 2D44A 3LDRA 4Q4X2 4QGMA 2VTFA 4YVWB 4BZ4A 5K0UB 2HYKA 4KH9A 2ZGRA 4YFZA 5CFDB 1R083 2QDRA 2VBDA 5I0DA 4A41A 2CGOA 1VMJA 4XBLA 1HN0A 1K5MA 1V70A 1ZBA3 4INDA 4LBJA 2RS52 5ANQA 3PTYA 2MNGA 2DWRA 5FZIA 1X7NA 3V0AB 1W3VA 2CY6A 3OPWA 4QM8A 3BTYA 1MQTB 3TN92 4BA6A 1Q8PA 1QH6A 1D7PM 4BDVB 4CEYB 1PGL2 1VB2A 3ZYGA 1FXZA 4IETA 1QF3A 4NHXA 3WVJA 3J7MA 2WN2A 3AMMA 4NRMA 2VVDA 5FXWA 3USUA 1WW7A 3AYCA 3NO8A 5LBCA 3ZMOA 3H3UA 1WW6A 4JDMA 4NHLA 1QJY2 1DQ6A 2YBSA 3AC0A 4R4XA 1X8EA 1QNWA 2W87A 4QGLA 1QJU3 3M3QA 1F9KA 1RHI3 3PHMA 1O3SA 3BODA 1H6XA 3FFQA 3B00A 1VE0A 4AQSA 4XFIA 1QJY3 3C3VA 2VZUA 3AFKA 3AP7A 3VZOA 1MEC1 4QPIC 1OVPA 2DCZA 5FV3A 1W8UA 3K2OA 4XAAA 1W2UA 3CZUA 1GQPA 2HYXA 4UFLA 5CA6A 1ZRFA 4AVCA 1YQCA 1S0DA 1CAWA 1MVEA 4QPWA 3GALA 3T0BA 4FP2A 3H3LA 4PQ9A 2E26A 5T5PA 4YM3A 2WDBA 5FYSA 4P5HA 3UKVA 1RUG3 3WNNA 4CDUB 1MZ5A 3M4FA 4PDWA 4YW3A 4B8EA 5FZEA 2D3PA 3MIGA 3INAA 1GZWB 3ZXEA 1PHMA 4WM8A 4YM1A 5J37A 2EIBA 1GMMA 1NE6A 2VUJA 3ETPA 5EQUA 4AG4A 1GZ9A 3RVHA 3CJIA 1UCXA 2J1SA 1UY2A 4UAPA 4Y1XA 4RS5B 4WVZA 1JYXA 2Q30A 1JU4A 4Q0SA 1B35A 3OG2A 3UNPA 3V0BB 4NR1A 1C5HA 3H8XA 1AL0G 2B8MA 2KD7A 5FP9A 3N7KA 3ZYHA 3UESA 3W20A 5BNPB 2R1BA 4Y1VA 2BNNA 2WS93 2ETEA 3HEIA 3PDQA 4HKOA 4QQPA 3ZFEC 5A1FA 4QX0A 2UYAA 2VNGA 2HWC2 2SLIA 4DUWA 3ILRA 1JU3A 2PA7A 3IDEA 5EHDA 5GM0A 2CSGA 4QD2A 5FAXA 4AVSA 4TN7A 5A3TA 2XKPA 1HB2A 4NAOA 1E5IA 4YPJA 3I97A 2HWC3 4Q0QA 5GLTA 4E2QA 1A3KA 3DGTA 1V6OA 5BNNC 1RB8G 3RDIA 1D2SA 3OPZA 5AC92 1BMV2 1DYOA 1KDKA 2BBVA 2RS11 2VQUA 3GZEA 4M3CF 2D93A 3MYXA 1VRH1 2RMU3 3WD5A 3WW2A 3PL0A 3DN7A 1U5YA 2VW1A 5A6YA 5GZEA 4RQPC 2Q1FA 4FQ4A 3ZYIB 5AC93 4J6GA 3VL9A 3KZ4C 2EXHA 1KFXL 2C0ZA 1GWKA 2J1AA 3MFAA 4L92A 4HT1T 4Y24A 2HJIA 2W1QA 5T55A 3EJKA 4D0QA 1DQ4A 2VOXA 4Z8BA 2FDKA 1PVC2 1YQ6A 2ZKLA 3MICA 3WR0A 3HMYA 2GSYA 2PAEA 4HG6B 1UXXX 3TBDA 1AR62 4N53C 2VAUA 5JUVA 1F5JA 2P6HA 2VZVA 1MR5A 3L2YA 2JD9A 2ZGMA 3K75B 3LWCA 4JDNA 4Z07A 2OW4A 4ASMB 3S57A 2WRAA 5FZDA 1DBNA 3NNJA 1RUJ1 4LHKA 1XYNA 5CKNA 5IVVA 2Z69A 4KU7A 1WCKA 2IWGB 5L19A 4XVHA 3VL8A 2JD4A 4V2VA 4CCDA 5CFCA 1AR63 2ZHNA 3GXUA 4N43C 3HNMA 4LO5B 5HCAA 5FY9A 1TME2 3JB8A 3OBTA 4P08A 5KC5A 1RUI1 2R49A 4WVMB 1SACA 1MS0A 2C9AA 1RMU2 2ZZJA 1UD1A 2C26A 1W6PB 2TBVA 3PNAA 5JOXA 3LA2A 2XONA 3LPFA 5C8CB 1TE1B 4R52A 1BCXA 2JG9A 1W90A 4OHWA 3ST7A 1W9WA 2Q0AA 3MV01 2RJLA 5LRRA 1ZX5A 2AACA 3ZIWA 5LA0A 4HL0A 1RMU3 2RS32 3PJYA 2G4IA 5FZLA 4DY3A 1QJZA 5A3OA 3VDDC 3KV4A 3NJZA 3H8UA 1UOFA 2IXJA 2DURA 4FI9A 1RINA 1GP5A 2J22A 1H8TC 3GHMA 5DZFA 1UZ0A 1VIWB 1IS5A 2RS33 2VO5A 5F3IA 5FLHA 2RM23 2A6WA 3I8TA 3CO2A 1PO21 3SKJE 3ES1A 2JDKA 3GJAA 4DFSA 5KXCA 3VBRA 5FXVA 4LIVA 1LOFC 4QKNA 2G9ZA 1QJEA 3FLPA 2JIJA 3A23A 4CVUA 2XB6C 2QQNA 3AMNA 1MS9A 3FUOA 3KCXA 4D6SA 1OT5A 2V4VA 2GH8A 2FZ1A 1FMD1 3VGIA 5CADA 2WLQA 4UW3A 3THPA 3TRSB 1JYWA 1F8VA 2N7GA 2R041 1DP0A 2JDPA 2D6LX 2WR9A 4YGCA 4RR3C 5CYYA 1EPWA 1Q3EA 4GALA 3BN6A 1RUC3 1XNDA 1DCSA 2D6NA 1OH3A 2VVFA 3D8CA 4KBBA 4N7UA 4XCBA 2UY9A 3ON7A 1V9U2 1OA4A 1S0FA 4ZZ5A 1SFPA 4R9CA 2BVVA 3K4ZA 4ES9A 1W9TA 1PIV3 2K46A 2YG0A 1GSLA 1UOJA 3POEA 4B29A 1EPZA 2XQRA 2ES3A 2V4AA 3W5NA 2LTNA 1O5LA 4H2AA 5DDJ1 1EUTA 4IV3C 2BJSA 4DMIA 1OUSA 4NOTA 2FHRA 3H7JA 4NWVA 2Q1ZB 4P9JA 5L36A 1RIRA 1FYUA 1H8TB 2RG4A 3K77A 4WZFA 5T5LA 1YI7A 3WF1A 4CPBA 3ZXGA 1G86A 1O8SA 1LB2A 5FOBB 1PX3A 3ZDSA 1D2QA 5JCTA 1EAH1 3O12A 2WO3A 4FOVA 4AAPA 3JD71 1LHWA 3HOBA 5FZ6A 3JXSA 1W6OB 2WNUA 2WZ8A 4CE8A 1W8HA 1CZVA 1GQHA 3M1HA 1NY72 2P5BA 2PAKA 3VBHB 4MHRA 1AYN2 5FXZA 1ONAA 4L11A 1NA1A 4XACA 1UNBA 3BIEA 2QQUA 1T6GC 3WG3A 1LU2A 1V6IA 3FC0A 3C7HA 2J1UA 2CTVA 4OI2A 4ZY9A 1H2NA 3T2TA 3O1OA 1RUD3 3GBFA 5A32A 3RZJA 4FVVA 2VOVA 1S0IA 3I3BA 5FZ8A 2E63A 2JE8A 4YSFA 4XPVA 1PGSA 3U75A 3WF4A 1LENA 3N7JA 1QOOA 5JSRA 4S2FA 2JDMA 1QU0A 2EICA 3IPVB 4H7LA 5FLIA 1I9RA 1XE8A 4LLFA 3B02A 2WZEA 1ZRRA 2WT2A 5FY0A 2UWAA 2WKKA 2VMFA 2OUJA 2XHKA 3KQRA 3VHRA 4GB31 1W06A 1OURA 5IVCA 3NW4A 2XG3A 3CBNA 5LEJA 4GULA 3MIBA 1UZYA 2CGNA 1FPN2 3UETA 3SCGA 4CU9A 3I59A 4XIOA 2HWE1 4E27A 3NKTA 1RGSA 2V73A 1ASJ1 2IVJA 3GJBA 5FP3A 1OMIA 4EN6B 1Q56A 1FNZA 5BPXA 3SXWA 2QKDA 2VOWA 1AYM3 2YBPA 4XFBA 2ZEZA 4DUXA 1ZREA 4BMBA 1JZ3A 1F31A 5L9VA 4NMIA 4AEDA 2ZMKA 4CDWA 1CAXA 4S2DA 1URXA 1O3RA 4GJZA 1U5IA 4JZRA 1W8WA 4XYXA 5FQ0A 1UOBA 4I0WB 1CIYA 1DLLA 2E33A 4JGZB 4ZHNA 5FO7B 2UURA 4D6RA 5EXOA 1JZ5A 1U0AA 2XPJA 1HV0A 1HB4A 2FCUA 4K1ZA 1H6YA 4FT8A 3U07A 4ES8A 1J59A 4JAAA 1PVXA 3HWJA 2WZR3 4IEVA 5L7OB 1NCQB 1JZ7A 1LCLA 2AENA 4U2AA 4FAHA 4Y1ZA 5LK7B 3KQ4B 3RZMA 5JXHA 1ENQA 1CX1A 3WDWA 1AR71 4RHV3 3VLBB 2V09A 3B01A 2BOJA 4CDQC 3N36A 1ND2C 1NUKA 3LE0A 4Q5OA 1K45A 4JGYB 1BEV1 3H0OA 2A6XA 1TNFA 3ZN5A 2DVDA 1B09A 2C9KA 3FJSA 2Y6JA 3KHBA 5I8SA 5AFEA 4CZSA 4KQ7A 2VZQA 1C57A 3KB5A 1BVP1 1RTVA 2G9FA 3CJXA 3R0RA 4XCAA 4IEUA 1ZBA1 4QXBA 2QQOA 1OLRA 1V6JA 2FDHA 4AI3A 3NSTA 1G9DA 5FO9B 2EXKA 2Z2SB 1POQA 3FHIB 3S7EA 4CSWA 1W6NB 4AAXA 4F83A 2O8OA 2XVKA 2ET7A 3UGGA 2Y6GA 1GU3A 4GKXA 4PIZA 2RS51 2W9XA 2PLV3 5FYYA 2RV9A 2Q8OA 3UJQA 4LNVA 2ZXQA 4KG8A 4AXOA 4IE5A 4P02B 2BRTA 3RG0A 2Y33A 5C3SA 3JBG3 1C1LA 1RUF3 3FBYA 4BIOA 1BKZA 2EAAA 2Y60A 3O0VA 1VBB3 5LY1A 1PGL1 3MLKA 2JEMA 1ZZ6A 1QJU1 1VBA3 1YEWA 1LOEA 1Q5OA 1RHI1 3IM0A 4QX7A 1FOD3 1W9YA 4AW7A 4Y5Z0 5CU1A 2QQIA 3USUB 1UIKA 1QJY1 3Q8AA 1WCQA 2QE3A 1CESA 4XFCA 4HBNA 3S0MA 2P3IA 4UFMA 5DAVA 3RRDA 5KXBA 1C4RA 4NWWA 2YHJA 5BNOB 3I4IA 3J9SA 3SH3A 2GMEA 3VKLA 2RS12 3W58A 3WQ7A 1RUG1 3DPRC 3PUIA 1PZ9A 5ANNA 1IG3A 1GICA 1HB3A 1CAUA 5FO8B 4RFRB 2VTXJ 4KWKA 2E7QA 3I54A 4RGGA 4XW3A 3WDVA 5A7WA 1CAWB 2W52A 4ZONA 2CNAA 1DGRA 2NZ9A 2QZ3A 1VLNA 4TWTA 4PLOA 4DXZA 1ZZ8A 4TZDA 4NJ4A 3IKWA 3O7OA 4AF9A 5FPZA 3ZYBA 2VUAA 2VOTA 4WM8B 1CPMA 2WS91 1HW5A 4JTNA 5C71A 4IGPA 3WP5A 3CJIB 3RI8A 3DYOA 3NRUA 4EQVA 4EROA 1S4CA 1REEA 1BK0A 1NCRC 1HQNA 1B35B 1W8FA 1YFWA 4K6BA 3UKTA 4H14A 3WG1A 5GLWA 3WF0A 2VGDA 2GN3A 1J3PA 4BQ2A 3VBFC 5K9YA 1N3OA 1S0BA 1KS5A 2FMYA 2HWC1 1O8PA 4HN0A 2HEVF 3FX3A 1CWPA 1N3PA 2YBKA 1NZIA 1RYYA 2PHUA 2ZX1A 3QOPA 3NAPC 5LEKA 2YYOA 1ULFA 4LA3A 4XJAA 4BYYA 3ZFEA 3E5UA 1N3QA 4H7MA 4JVAA 5I0TA 1M06G 4YW2A 4COZA 1O4YA 2WNVC 2Y26A 1YQ2A 5AC91 1BMV1 2RVAA 2JICA 4D6QA 5DABA 4KL1A 5C4WC 5I0RA 5JWPA 1C5IA 1F15A 4IE6A 4LOTA 2BGOA 4BWOA 5I0SA 1S2BA 4OUEA 2VC9A 4K3UA 4AR2A 2CGPA 3N9QA 5B2GB 2BZDA 1REFA 2RDNA 3SNMA 2PELA 1OOPA 1BBT3 3NNMA 4HSJA 2Y0IA 4R8HA 2B46X 3FHAA 2D7FA 3CLPA 2VXRA 2W2IA 3CNAA 1OKOA 1AL23 1J1LA 3AZYA 4Y5TA 4O65A 2NYYA 5FMCA 2VMDA 4CU6A 4RQPA 4LA2A 2I07B 5JVVA 2ZAHA 4WM7C 1W2OA 1DGLA 1FMD2 5C70A 4KNCA 1AR61 4LBOA 4FTBA 4C1XA 5B4NA 5F3GA 5A3NA 1RXGA 4UYBA 5ABJC 1YIPA 2VUCA 2ZTNA 3UKNA 2R042 4JQRA 3TEWA 1KXGA 2B9VA 3VBFB 4BMEA 4K8RB 4CP9B 2WUHA 3G7DA 4PF1A 1VBE2 1SMVA 1XNKA 2VCCA 3M7AA 4HK8A 4Y26A 4FBFA 4MLOA 5ISLA 3E6CC 2JDHA 2GU9A 3RZLA 3H42B 3ORJA 4XHXA 5FZHA 4FCAA 5GALA 5A33A 1RUE3 5CFCB 2CL2A 2AREA 3RGBA 2VY0A 4IE0A 1RMU1 2CWMA 5LBEA 4QKFA 2H6CA 3RWNA 2VNVA 2XLFA 3A0NA 4N43A 2GNMA 3H9AA 2NMNA 1XU2A 2A70A 2QZ2A 3KSCA 3WP4A 1WMFA 2QQJA 2YGMA 3VN4A 2JG9B 3M70A 2JDNA 4I0AA 2RS31 5A3UA 2WWUA 4TXWA 3RZZA 1TZOA 1MS3A 2VULA 2X5IC 1F4AA 2XJRA 4KG0A 4CXXA 3AMPA 3MIDA 1ZZCA 3KD4A 1EAH2 4HFSA 3WP3A 3JD72 1W39A 3WLUA 5DUXA 4K21A 1W3XA 4K20A 1T2XA 1LODA 1J3RA 3KT1A 3ZXJA 1Z78A 1H2KA 4FPHA 4GQ7A 5FYVA 4JQTA 2WJSA 4YW5A 3E1F1 4YFWA 2ZGKA 2YDEA 4QXHA 4ATEA 1AR92 1TEIA 4CCMA 4NHKA 3AL5A 1WUVA 1IPSA 2EAKA 4OHXA 5FP8A 3VBRB 1PZ7A 2AR6A 5IFPA 1RUH2 1ENXA 3LIGA 1JOJA 4LKDA 1OQ1A 1FI2A 4OZOA 1RUC1 1BLZA 4NIHA 5CIRA 2GC3A 4ZXKA 3TOJA 5F8PA 2R1DA 1C8M3 4CUAA 3E6DA 2G19A 3EQEA 5GZDA 4W8JA 4B7KA 4QXKA 1RUH3 1OPMA 1NXD1 1PIV1 4EZHA 5J96B 2Y6FA 2W95A 2TUNA 5A70A 2IVIB 2W08A 5CZKA 1LU1A 1H1MA 2PAMA 1GQGA 2ZJCA 4Y22A 3VHNA 3T2PA 2C5DA 4B4QA 2WNEA 4HANA 4OI1A 2YU1A 1ND3C 4ZKTB 4MG2A 2RDSA 2ZPXA 3ZDVA 4NHYA 4R9DA 1JBCA 2K0GA 3V65A 5F9TA 3I49A 3BPZA 2B39A 2JDYA 1JTZX 2ZHMA 3I7DA 4HLTA 4FPCA 3Q8FA 1BK1A 2Q5TA 1ASJ2 1QDOA 1XXNA 2JG8A 1UXZA 2W47A 3CDZB 1W6QB 2ET1A 4FPKA 1Z7S3 4G9SB 4Y20A 4COYA 1X33A 4YVWC 3O1MA 5K0UC 1WA6X 3KCYA 1KITA 2XGXA 5F3EA 5IK8A 5CFDC 3AVSA 3ECQA 2WZPP 4I3PA 2DDUA 4U36A 2V72A 1DIWA 2D43A 3FBMA 3MDPA 3ROUA 3PUHA 1RUD1 3DV8A 1TMF3 4B1LA 3HJRA 4URAA 4F8AA 1GFF2 4YVSA 2EALA 4Q4W2 5K7PA 3OUIA 3J7HA 2WNUB 4BM8A 4HPKA 4E4DX 4B4PA 1MQTC 2HWB3 3C2UA 1NA1B 4QU1A 2D5HA 4CEYC 2FCVA 1MPXA 1GUIA 1UOGA 4LBQD 3RYRA 5FPUA 5BV6A 4GWMA 4Q4W3 5E8AA 2XBO2 5A3PA 5KXDA 4A4AA 2Q1MA 5A32B 1SBDA 4DQAA 4IXLA 3GYDA 2ZA9A 4LR4A 2JIGA 2ZABA 1AR72 2EXIA 5DN2A 4AQTA 2P3JA 4XF4A 1LGBA 1YQ8A 1ZZ9A 5FZ7A 4LMFA 1BEV2 2JJ6A 3ZFGB 1BJQA 4BQ3A 2JENA 4NVPA 3ZPYA 4A42A 4YG6A 5H9QA 4OYUA 1R082 4XDOA 3TEXA 1EV13 1FPN1 2R30A 5IK7A 1AYM1 3EO6A 1UQXA 5BYNA 1ZBA2 1I1EA 1AX2A 1KGYA 3ENRA 1RXFA 3I59B 3POIA 5LBFA 1HRV3 1UO9A 2VCBA 5FZGA 4J1XA 4UFJA 1W05A 4CDUC 4IEPA 1SZBA 5IYYA 1Q8QA 2P3KA 3MI8A 1YCIA 3WSOA 3M3EA 2OZ6A 3LDBA 1SFYA 4Q1PA 5FXXA 3ZSKA 3TEYA 5JXJA 1D4VB 3HPNA 1O4TA 2GN7A 5FK8A 1NG0A 4M3CE 4LITA 4RS5C 5GLZA 4FFHA 3ZYPA 1JHJA 1HN1A 2A71A 1CAXB 1O6UA 5L9BA 4BLJA 2XWJB 4QPGB 4EN9B 3H8OA 2WZR1 3AKRA 4JDOA 1QJU2 4C8DA 1H2MA 2V5DA 5BXXA 4I02A 1RHI2 3EHKA 4E2GA 1U5XA 5BNPC 4AHZA 3FFZA 3ACLA 1JW6A 4RHV1 1CZSA 3ZX7A 1HB1A 1US3A 2RJ2A 3IDBB 3HT1A 4L2NA 2ZGNA 5FZAA 4AEDB 1CJPA 2NLRA 1JOPA 4FPYA 4E4ZA 3LSEA 3JZVA 3WG2A 2DYCA 3AXDA 4KWLA 3LPGA 3VD5A 3T0DA 4LT5A 2KR2A 3DEMA 1QQP3 2BWCA 5D1IA 3KF5A 1RUG2 5A3MA 2ADDA 3ES4A 4PIYA 1FATA 2WNOA 1HLCA 3ZMNA 3ZYRA 4CEWC 4CP2A 3IDAA 3VHPA 5IFTA 1MS8A 4CDQA 1OF4A 1JYCA 1Y9GA 1ND2A 4OVEA 2ARCA 3S30A 1Y7BA 4X8NA 3H8RA 1JUIA 1PO12 4AFAA 3WUCA 1DHKB 2BP6A 2PFWA 2OQ7A 4QWNA 3ZOIA 2PLV1 4RD7A 3N9MA 1CGPA 1BHGA 1XYPA 5FZ0A 1W8OA 2QQMA 4PQQA 4H55A 3RNSA 1C1FA 1QJX3 3JBG1 2QJVA 2ID4A 2WS92 1PO13 1ENSA 3O1RA 1VBB1 3MHZA 4O7XA 4Y1UA 1CONA 4LORA 4NROA 5ERLA 4DXTA 3AJZA 3ZXKA 2E7TA 1J3QA 1FOD1 4CYDA 4Z2WA 1UU6A 2EIGA 1K3IA 2SBAA 4HN1A 4BH9A 3B5LB 4OZXA 1H2LA 1SDDB 5A7SA 4Y5SA 3TB0A 4YGDA 3H1YA 4GZ9A 4EN8B 2EA7A 2R0HA 3DXTA 3T0AA 3APBA 3A4UA 3N9LA 3O0XA 3P1IA 4HK9A 5L9RA 2XUEA 3SITA 3W21A 1A8MA 1NLSA 1YRZA 1U5ZA 1YC61 3KWVA 4IE4A 4AVTA 1JOBA 3SLIA 3NMBA 2RMU2 5C8CC 5A7PA 3T3YA 3ILFA 3W9AA 5I8TA 5A1LA 4EV0A 3HN3A 4CEWB 4XXAA 2E32A 4IEQA 5JZGA 3ZKUA 4BK5A 1ST8A 3PUSA 4W6WA 4UOJA 3EXUA 4AE2A 2JE7A 4Q2FA 2LUWA 5D2AA 3OCPA 2VCAA 5LB6A 2JB8A 5LZ6A 1CAUB 1PMHX 1W0OA 1I5ZA 1IS4A 3DPRA 4OLLA 4QX1A 4FXGB 4XF0A 3ZSEA 3WG4A 4ASKA 1DGRN 2Y34A 3NKGA 1LKNA 4L99A 3RZHA 5A7WB 5C3PA 3IBMA 3ZYJB 1W6MA 2WQZC 4GMP3 4A7YA 2ZCWA 5J48A 5FPLA 4ZPIA 2OA2A 2A3YA 1OC1A 1M4WA 4QKDA 2C4XA 4MGKE 4NIAA 2OKXA 3S7IA 2EF6A 2WYFA 4YARA 3WNMA 5G05L 3T1MA 4IW3A 4AGGA 4FSJA 5J7MA 2AYHA 2NM1A 1LGNA 3URFA 1RUOA 5SV5A 5F39A 4E8DA 4Z82A 2ZGUA 4L9BA 4AWDA 4PHZA 2J7MA 1BYHA 1OI6A 1ZNPA 4I09A 1RC6A 2A75A 2VZOA 3IDCB 4S2HA 2RR13 5DZGA 3SH4A 2VOKA 2VMIA 2W5FA 3J7LA 3O1UA 4IDZA 5J3UA 4FPEA 2W92A 2B45X 1Y3TA 1MZEA 1SPPA 4QQ2A 2R32A 1GLHA 1LNSA 2VMCA 5I8YA 5M0TA 2RM22 5FYZA 2DCTA 2WLPA 4NPMA 2I45A 1BBT1 3FN9A 1CAVA 4CRQA 3B94A 4UF0B 5APAA 3FLTA 1AL21 1AVBA 1CPNA 3MGUA 4MGSA 3POYA 1G8WA 3BU7A 2JKBA 3FZ3A 1KQRA 2X53S 2O8QA 2XDVA 3RMYA 3GCXA 3TAYA 5A1AA 1GOFA 2VW0A 3VBHC 2CAVA 3TYJA 4NRPA 4GWJA 4JKKA 5D8AA 5EYYA 1I6XA 2G9GA 1UIJA 5JAXA 4LBKA 2X29A 1H4GA 2WYSA 5FOJB 1O5UA 3WY6A 5FBJA 1PK6A 1RUC2 2VPVA 4FTEA 1UPIA 2UYBA 2ZGLA 5LCWL 3NQHA 1W04A 1UYZA 2ZACA 4Q4Y3 3VHOA 1F2NA 4FO9A 3RFRA 1AR82 3IIIA 1PIV2 4LKSA 5KHIA 3TNPB 1VBE1 4BXFA 5KXEA 2O14A 1QH7A 4HETA 1IQDC 1RUNA 4QM9A 4SLIA 4BQ5A 5JI7A 5LWBA 4JCKA 3W59A 1AR83 4LBQA 5JOYA 5KHGA 4PI2A 2VXJA 1AJOA 2GAUA 3MW4A 3OGJA 4GH4A 5EJ1B 5A33B 1UW8A 1XB9A 2QFEA 4AOCA 2YC4A 3N7LA 1G9AA 3J26N 3WV6A 2P2KA 2YGLA 1DQ1A 4ASLA 4QHOA 1ZBE3 2F6BA 4CUGA 5JMOA 3OPTA 1NX9A 1WD3A 5IAXA 2ARBA 4FOYA 1NXMA 3ZXAC 1L7RA 1NLQA 4BIFA 1DGWA 4JKMA 2X8KA 4O9EA 4AFCA 3JUUA 3CU7A 2ZHLA 3Q8EA 3M8LA 4ZS2A 1RUD2 1LEDA 2Y38A 3AK0A 3AKTA 5FYCA 3HD8B 1BZWA 4LJHA 5F5IA 3WDTA 2DBIA 1HJGA 3GBWA 3JQWA 1QOTA 5D21A 1W0PA 5FCCA 4IV1A 1D0GA 3D82A 1AR91 4YRDA 2PN5A 5HBAA 5JMCA 3C7EA 1RJ7A 5HCFA 3RZKA 4XIKA 3WQBA 4JGZC 4ISQA 1RUH1 1WLTA 4XUOA 4XUTA 1ZRCA 2HBTA 4JHZA 1V6KA 3E97A 1NZCA 2CHHA 2DU1A 1O91A 3BPSA 1NLRA 1C8NA 2JX9A 2R063 3PLQA 2HLEA 5HV4A 4MGYE 1VAVA 3VD7A 3VBSC 5L7OC 1NCQC 2VMEA 4QX2A 3CIHA 3WEZA 1SLTA 1VBC2 3FE5A 4DY5A 1LRHA 2A6YA 3U4SA 2IXIA 1WZXA 1HXS3 3I2FA 5JR7B 5J1XA 3C7OA 3VZJA 4LHSA 4YM2A 3NJXA 1GR3A 4CDXA 3T4HB 1FV3A 1JMUB 2W3JA 4Y22B 3IWZA 1YXWA 1Z7S1 1AYM2 4JGYC 4QB2A 2RDRA 4XTMA 1UYYA 2F4LA 3VDBA 1VBC3 2VZ3A 3WNKA 2RDQA 3I2HA 5FUPA 3VKFC 4GAZA 4QAWA 3CHXA 5EWSA 1OLMA 1D4M3 3VBUA 4MXVA 4M0HA 3USSA 2VQ0A 3L9JT 5FP4A 1TMF1 2JB4A 3OEBA 3THCA 2ZGSA 1POV3 2JG8B 3G6JB 3PUAA 5FMOS 5J09A 5JSPA 2DTYA 2FQPA 4Y20B 2HWB1 2WWJA 3KM5A 2HH9A 3UK9A 3WF3A 4J25A 2GDFA 4UFHA 5IW0A 2V5YA 1XE0A 4GKYA 4BCUA 4FFIA 1Y9MA 3IAPA 2D6MA 4YZ2A 4Q4W1 3SH5A 4IEXA 4XZPA 2WZR2 2YV8A 1F4HA 2F17A 4LXLA 4YVSB 1X50A 4DZGA 3POSA 4PLMA 3ZVXA 4HPKB 4ITCA 4IUGA 5BNQA 2QBXA 4RHV2 4YWAA 5EJ3A 3FMGA 1JZ6A 2XBO1 2QQPA 4MSVA 3VBSB 2D3SA 5J36A 2VW2A 3KGZA 5FP7A 2X05A 3T4VA 2R7EB 4CEYA 2VMHA 4DPNA 3MLLA 4P9GA 1SBFA 2F4PA 1EV11 2BGPA 3R4DB 3OTFA 1OFSA 4HVQA 2OS2A 4P14A 5BNOC 5FR3A 1S55A 1DLCA 1CN1A 4HMZA 3POGA 3OJBA 1YIFA 2ZEXA 4W50A 1HRV1 2BVBA 2YFUA 3K48A 1R081 3T09A 5C8WA 5C9AA 2ZX3A 4GJYA 3ZFFA 1UKRA 2XJUA 1FX5A 4LO7A 1MZFA 1IG0A 2ZX0A 3UGHA 5FZ9A 5KC6A 1NKGA 2VM9A 2PLV2 1EYBA 5FWEA 2WA4A 3MIHA 1AXZA 4TSVA 3GCWA 4UT5A 1VAKA 4LIUA 4OQ8A 4QGNA 3VZLA 3C7FA 4JC1A 5T50A 3VBOA 3JBG2 1RUF2 5CNAA 3T30A 3OB8A 1VBB2 4M3CA 5A6QA 3ETQA 2ZAAA 1K5MB 3SHRA 4PDWC 3BTXA 5FMBA 1VBA2 5CG8A 1AHSA 5HCBA 1FOD2 1XU1A 3J7NA 1VMFA 5EIYB 3AP5A 4WM8C 4AQ2A 1MEC3 1QNYA 1JN2P 4B7EA 3PMSA 3CJIC 3AJYA 4AI8A 3HR9A 3LD8A 5FUIA 3LA3A 4A6OA 1B35C 4CU7A 3LAGA 2O0OA 3WDYA 3A0KA 5LY2A 4CCNA 4DS0A 5CG9A 3T1LA 2Z79A 1SDWA 5A80A 3KCCA 4NPLA 1ULCA 3C8XA 1LOBA 4C0BA 3R05A 4Y4RA 2CV6A 1RVF3 5GKAC 2VTXA 3E5QA 2YZ4A 1VMHA 4W4ZA 4YZ3A 2YUEA 1IS6A 3N9OA 2WFF3 1GP4A 3OBAA 3TEZA 3DYMA 1NQJA 2R073 2ZZQA 3HBKA 2QUOA 3TWIA 2FMDA
chains in the Genus database with same CATH topology
1JU4A 4E8CA 4XUQA 1JZ2A 3OG2A 3UNPA 3T2PA 3ACFA 2VZRA 2KD7A 2VZ1A 3MUZ1 3UESA 3HEIA 2ZEYA 4QX0A 4DXRA 3LEKA 4DUWA 1JU3A 1SG3A 1UXZA 2W47A 3CDZB 4XURA 2DCJA 4A45A 4YPJA 1UMHA 2YB7A 3I97A 3ECQA 1WKYA 2DDUA 2V72A 4RN5A 1DYOA 1UWWA 3PUHA 3HJRA 3WNPA 2VQUA 3U37A 3J7HA 4P00B 4QDSA 4XUPA 1J83A 1OD3A 3CKHA 5JR2A 2Z4FA 1MPXA 1GUIA 3OEAA 3THDA 4Z2AA 2J1AA 3OGRA 4A4AA 1GOHA 3CZJA 2W1QA 4D0QA 1TG7A 3ABZA 2XQXA 5DN2A 4HG6B 1UXXX 3SEPA 1W9SA 5JUVA 2XHNA 2VZVA 2JD9A 3K75B 2J1EA 3VDBA 4A42A 4OYUA 4XVHA 3IB3A 3GXUA 1JZ4A 3HNMA 4BXSV 4ZZ8A 4P08A 2VQTA 1KGYA 3WNLA 3SKVA 2C26A 1NAEA 3GDBA 2VCBA 5EJZB 3LPFA 2XONA 3VDAA 5IYYA 1W9WA 3MV01 3WSOA 5LA0A 1JI6A 4A3ZA 3ACGA 5JXJA 3HPNA 4FI9A 2J22A 1JHJA 1HN1A 1UZ0A 2VO5A 1W0NA 2V5DA 3WF2A 3SKJE 2WO2A 2YFZA 4CUCA 1OH4A 2QQLA 1CZSA 1US3A 2RJ2A 2Y6LA 1O59A 3A23A 4CVUA 1UYXA 2QQNA 3T0DA 3LPGA 2J1RA 3VD5A 2ZEWA 1JZ8A 1OT5A 2V4VA 5JXGA 4D8MA 1JYWA 1W8NA 1DP0A 3GGLA 3CQOA 5CYYA 3BN6A 1R64A 3IDAA 5IFTA 1OF4A 3NJVA 4ZZ5A 2EIDA 3K4ZA 1W9TA 4QB1A 2YG0A 2WQ8A 3K4DA 1BHGA 2BBAA 5C7GA 3W5NA 1EUTA 1W8OA 1UY1A 2QQMA 4PQQA 4MO3M 2ID4A 3MUY1 3K77A 2L9LA 3WF1A 1J84A 1ULOA 1XPWA 4DXTA 1PMJX 1O8SA 2W1UA 1PX3A 2WO3A 3HOBA 1K3IA 3JXSA 2WZ8A 1CZVA 1SDDB 3D3AA 3IAQA 4GZ9A 3T0AA 4MADA 1UY4A 2LS6A 3P1IA 4XZUG 3C7HA 2J1UA 2J1TA 4ZY9A 3CMGA 3I2GA 3HNBM 1L7QA 2WAOA 4GWIA 3I3BA 5LA1A 3HN3A 2JE8A 2XOMA 2E32A 3WF4A 3P6BA 4BK5A 2EICA 2X09A 4UOJA 3A22A 2WZEA 2VCAA 1XC6A 2WBKA 2VMFA 1PMHX 1UY3A 4QX1A 2Y6KA 4UAPA 2Y64A 3A7QA 3UETA 4CU9A 2WAAA 2WO1A 1PX4A 2OKXA 2C4XA 3WNMA 5G05L 1W99A 2J1VA 4PT6A 5IHRA 2B4KA 2ZEZA 1TVGA 2VL4A 4E8DA 2VZPA 4DUXA 1JZ3A 3FHQA 2J7MA 2ORXA 2VZOA 2W46A 1CIYA 4TTGA 2W5FA 2E33A 3ACHA 1KEXA 2W92A 4KI5M 4M4PA 1JZ5A 4QDQA 1LNSA 2VMCA 1H6YA 4XUNA 5LA2A 2W1WA 1JYNA 2BERA 2WN3A 1JZ7A 3FN9A 5DQ0A 5G04L 2Y6HA 5JXHA 4ARXA 5HPOA 1CX1A 4MGSA 3OGSA 2E31A 1NUKA 3LE0A 1K45A 3FL7A 5DPNA 3VD4A 2C9KA 5A1AA 1GOFA 2Y6JA 3C7GA 2CDPA 3VD9A 2VR4A 1GOGA 2VZQA 4GWJA 4JKKA 4CU8A 2WYSA 2QQOA 3BGAA 5LCWL 2QQKA 3NQHA 1UYZA 4QX3A 4AAXA 4UI9L 3IIIA 4DEVA 4LKSA 4MGQA 4ET7A 2Y6GA 1GU3A 1UMIA 2YC2A 2W9XA 1IQDC 3K46A 2RV9A 2ZXQA 3MO4A 3K4AA 4P02B 1UX7A 5EJ1B 2W91A 1OF3A 2YC4A 2WABA 2DCKA 4KMQA 4OMDA 2PQSA 5JMOA 5HXMA 1NX9A 2QQIA 1SHWB 3I2KA 1L7RA 1WCQA 4JKMA 5IJRA 4L0PA 4BK4A 2X10A 4CU6A 3A21A 4ZXEA 3WNOA 3PUIA 3C7EA 2VZSA 1K12A 2LW8A 3WQBA 3LQCA 3EYPA 4XUOA 4XUTA 4JHZA 1K42A 4DEQA 1I5PA 2HLEA 3HNYM 4BJ0A 3VD7A 2VOTA 4CUBA 2VMEA 3GM8A 4QX2A 3CIHA 3WEZA 5C71A 3OGVA 4LQRA 3DYOA 3NRUA 5J1XA 3I2FA 3C7OA 4LHSA 1EUUA 3NJXA 5B4XA 3ZM8A 3MV11 2W3JA 1GNYA 3WF0A 1XNTA 4QB2A 3DYPA 1UYYA 4ARYA 1XNAA 1JYVA 2VZ3A 3VD3A 3I2HA 2EIEA 3WNKA 4A44A 4QAWA 1O8PA 4QDRA 1RYYA 3T2OA 1ULPA 3T2QA 2W1SA 3OEBA 3THCA 2W94A 4JX0A 3ACIA 3F2ZA 1P8JA 2VZTA 1YQ2A 5JXIA 3WF3A 2JDAA 4MOAA 2RVAA 3I2IA 4JKLA 3IAPA 2Y8KA 3NNGA 4DXSA 3SEEA 2BGOA 1F4HA 4OUEA 2VC9A 2BZDA 4IUGA 3DECA 1UY0A 2QBXA 5F7UA 3FHAA 3LEIA 1JZ6A 3EB7A 2JKXA 2VMDA 2X05A 2R7EB 4P5YA 5C70A 2VTFA 2BGPA 4DUVA 5B4NA 4RYDA 5I0DA 4A41A 2B9VA 1DLCA 4M4RA 2WUHA 3LEGA 4PF1A 2ZEXA 4W50A 2VCCA 2YFUA 3T09A 5DMYA 4OMCA 3MBWA 1CZTA 2CDOA 3I3EA 1NKGA 2VM9A 4BDVB 1D7PM 2ORZA 3W5MA 4QB6A 2WN2A 3C7FA 2QQJA 3OB8A 3I3DA 4TXWA 3AC0A 1F4AA 5EIYB 2W87A 1H6XA 3I2JA 1T2XA 1US2A 2VZUA 5FUIA 4A6OA 4CU7A 3E1F1 3CZUA 1GQPA 2HYXA 4KWUA 4QPWA 3T08A 4LPLA 3T0BA 5IFPA 2E26A 3C8XA 2WDBA 3WNNA 2VJXA 3VDCA 4OZOA 4W4ZA 4CUAA 2EIBA 1GMMA 3ETPA 4AG4A 3OBAA 4W8JA 3DYMA 2J1SA 2W95A 1UY2A 1JYXA 5CZKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JU4 A;  4E8C A;  4XUQ A;  1JZ2 A;  3OG2 A;  3UNP A;  3T2P A;  3ACF A;  2VZR A;  2KD7 A;  2VZ1 A;  3MUZ 1;  3UES A;  3HEI A;  2ZEY A;  4QX0 A;  4DXR A;  3LEK A;  4DUW A;  1JU3 A;  1SG3 A;  1UXZ A;  2W47 A;  3CDZ B;  4XUR A;  2DCJ A;  4A45 A;  4YPJ A;  1UMH A;  2YB7 A;  3I97 A;  3ECQ A;  1WKY A;  2DDU A;  2V72 A;  4RN5 A;  1DYO A;  1UWW A;  3PUH A;  3HJR A;  3WNP A;  2VQU A;  3U37 A;  3J7H A;  4P00 B;  4QDS A;  4XUP A;  1J83 A;  1OD3 A;  3CKH A;  5JR2 A;  2Z4F A;  1MPX A;  1GUI A;  3OEA A;  3THD A;  4Z2A A;  2J1A A;  3OGR A;  4A4A A;  1GOH A;  3CZJ A;  2W1Q A;  4D0Q A;  1TG7 A;  3ABZ A;  2XQX A;  5DN2 A;  4HG6 B;  1UXX X;  3SEP A;  1W9S A;  5JUV A;  2XHN A;  2VZV A;  2JD9 A;  3K75 B;  2J1E A;  3VDB A;  4A42 A;  4OYU A;  4XVH A;  3IB3 A;  3GXU A;  1JZ4 A;  3HNM A;  4BXS V;  4ZZ8 A;  4P08 A;  2VQT A;  1KGY A;  3WNL A;  3SKV A;  2C26 A;  1NAE A;  3GDB A;  2VCB A;  5EJZ B;  3LPF A;  2XON A;  3VDA A;  5IYY A;  1W9W A;  3MV0 1;  3WSO A;  5LA0 A;  1JI6 A;  4A3Z A;  3ACG A;  5JXJ A;  3HPN A;  4FI9 A;  2J22 A;  1JHJ A;  1HN1 A;  1UZ0 A;  2VO5 A;  1W0N A;  2V5D A;  3WF2 A;  3SKJ E;  2WO2 A;  2YFZ A;  4CUC A;  1OH4 A;  2QQL A;  1CZS A;  1US3 A;  2RJ2 A;  2Y6L A;  1O59 A;  3A23 A;  4CVU A;  1UYX A;  2QQN A;  3T0D A;  3LPG A;  2J1R A;  3VD5 A;  2ZEW A;  1JZ8 A;  1OT5 A;  2V4V A;  5JXG A;  4D8M A;  1JYW A;  1W8N A;  1DP0 A;  3GGL A;  3CQO A;  5CYY A;  3BN6 A;  1R64 A;  3IDA A;  5IFT A;  1OF4 A;  3NJV A;  4ZZ5 A;  2EID A;  3K4Z A;  1W9T A;  4QB1 A;  2YG0 A;  2WQ8 A;  3K4D A;  1BHG A;  2BBA A;  5C7G A;  3W5N A;  1EUT A;  1W8O A;  1UY1 A;  2QQM A;  4PQQ A;  4MO3 M;  2ID4 A;  3MUY 1;  3K77 A;  2L9L A;  3WF1 A;  1J84 A;  1ULO A;  1XPW A;  4DXT A;  1PMJ X;  1O8S A;  2W1U A;  1PX3 A;  2WO3 A;  3HOB A;  1K3I A;  3JXS A;  2WZ8 A;  1CZV A;  1SDD B;  3D3A A;  3IAQ A;  4GZ9 A;  3T0A A;  4MAD A;  1UY4 A;  2LS6 A;  3P1I A;  4XZU G;  3C7H A;  2J1U A;  2J1T A;  4ZY9 A;  3CMG A;  3I2G A;  3HNB M;  1L7Q A;  2WAO A;  4GWI A;  3I3B A;  5LA1 A;  3HN3 A;  2JE8 A;  2XOM A;  2E32 A;  3WF4 A;  3P6B A;  4BK5 A;  2EIC A;  2X09 A;  4UOJ A;  3A22 A;  2WZE A;  2VCA A;  1XC6 A;  2WBK A;  2VMF A;  1PMH X;  1UY3 A;  4QX1 A;  2Y6K A;  4UAP A;  2Y64 A;  3A7Q A;  3UET A;  4CU9 A;  2WAA A;  2WO1 A;  1PX4 A;  2OKX A;  2C4X A;  3WNM A;  5G05 L;  1W99 A;  2J1V A;  4PT6 A;  5IHR A;  2B4K A;  2ZEZ A;  1TVG A;  2VL4 A;  4E8D A;  2VZP A;  4DUX A;  1JZ3 A;  3FHQ A;  2J7M A;  2ORX A;  2VZO A;  2W46 A;  1CIY A;  4TTG A;  2W5F A;  2E33 A;  3ACH A;  1KEX A;  2W92 A;  4KI5 M;  4M4P A;  1JZ5 A;  4QDQ A;  1LNS A;  2VMC A;  1H6Y A;  4XUN A;  5LA2 A;  2W1W A;  1JYN A;  2BER A;  2WN3 A;  1JZ7 A;  3FN9 A;  5DQ0 A;  5G04 L;  2Y6H A;  5JXH A;  4ARX A;  5HPO A;  1CX1 A;  4MGS A;  3OGS A;  2E31 A;  1NUK A;  3LE0 A;  1K45 A;  3FL7 A;  5DPN A;  3VD4 A;  2C9K A;  5A1A A;  1GOF A;  2Y6J A;  3C7G A;  2CDP A;  3VD9 A;  2VR4 A;  1GOG A;  2VZQ A;  4GWJ A;  4JKK A;  4CU8 A;  2WYS A;  2QQO A;  3BGA A;  5LCW L;  2QQK A;  3NQH A;  1UYZ A;  4QX3 A;  4AAX A;  4UI9 L;  3III A;  4DEV A;  4LKS A;  4MGQ A;  4ET7 A;  2Y6G A;  1GU3 A;  1UMI A;  2YC2 A;  2W9X A;  1IQD C;  3K46 A;  2RV9 A;  2ZXQ A;  3MO4 A;  3K4A A;  4P02 B;  1UX7 A;  5EJ1 B;  2W91 A;  1OF3 A;  2YC4 A;  2WAB A;  2DCK A;  4KMQ A;  4OMD A;  2PQS A;  5JMO A;  5HXM A;  1NX9 A;  2QQI A;  1SHW B;  3I2K A;  1L7R A;  1WCQ A;  4JKM A;  5IJR A;  4L0P A;  4BK4 A;  2X10 A;  4CU6 A;  3A21 A;  4ZXE A;  3WNO A;  3PUI A;  3C7E A;  2VZS A;  1K12 A;  2LW8 A;  3WQB A;  3LQC A;  3EYP A;  4XUO A;  4XUT A;  4JHZ A;  1K42 A;  4DEQ A;  1I5P A;  2HLE A;  3HNY M;  4BJ0 A;  3VD7 A;  2VOT A;  4CUB A;  2VME A;  3GM8 A;  4QX2 A;  3CIH A;  3WEZ A;  5C71 A;  3OGV A;  4LQR A;  3DYO A;  3NRU A;  5J1X A;  3I2F A;  3C7O A;  4LHS A;  1EUU A;  3NJX A;  5B4X A;  3ZM8 A;  3MV1 1;  2W3J A;  1GNY A;  3WF0 A;  1XNT A;  4QB2 A;  3DYP A;  1UYY A;  4ARY A;  1XNA A;  1JYV A;  2VZ3 A;  3VD3 A;  3I2H A;  2EIE A;  3WNK A;  4A44 A;  4QAW A;  1O8P A;  4QDR A;  1RYY A;  3T2O A;  1ULP A;  3T2Q A;  2W1S A;  3OEB A;  3THC A;  2W94 A;  4JX0 A;  3ACI A;  3F2Z A;  1P8J A;  2VZT A;  1YQ2 A;  5JXI A;  3WF3 A;  2JDA A;  4MOA A;  2RVA A;  3I2I A;  4JKL A;  3IAP A;  2Y8K A;  3NNG A;  4DXS A;  3SEE A;  2BGO A;  1F4H A;  4OUE A;  2VC9 A;  2BZD A;  4IUG A;  3DEC A;  1UY0 A;  2QBX A;  5F7U A;  3FHA A;  3LEI A;  1JZ6 A;  3EB7 A;  2JKX A;  2VMD A;  2X05 A;  2R7E B;  4P5Y A;  5C70 A;  2VTF A;  2BGP A;  4DUV A;  5B4N A;  4RYD A;  5I0D A;  4A41 A;  2B9V A;  1DLC A;  4M4R A;  2WUH A;  3LEG A;  4PF1 A;  2ZEX A;  4W50 A;  2VCC A;  2YFU A;  3T09 A;  5DMY A;  4OMC A;  3MBW A;  1CZT A;  2CDO A;  3I3E A;  1NKG A;  2VM9 A;  4BDV B;  1D7P M;  2ORZ A;  3W5M A;  4QB6 A;  2WN2 A;  3C7F A;  2QQJ A;  3OB8 A;  3I3D A;  4TXW A;  3AC0 A;  1F4A A;  5EIY B;  2W87 A;  1H6X A;  3I2J A;  1T2X A;  1US2 A;  2VZU A;  5FUI A;  4A6O A;  4CU7 A;  3E1F 1;  3CZU A;  1GQP A;  2HYX A;  4KWU A;  4QPW A;  3T08 A;  4LPL A;  3T0B A;  5IFP A;  2E26 A;  3C8X A;  2WDB A;  3WNN A;  2VJX A;  3VDC A;  4OZO A;  4W4Z A;  4CUA A;  2EIB A;  1GMM A;  3ETP A;  4AG4 A;  3OBA A;  4W8J A;  3DYM A;  2J1S A;  2W95 A;  1UY2 A;  1JYX A;  5CZK A; 
#chains in the Genus database with same CATH topology
 1J58 A;  1JZ2 A;  2BW8 A;  4XUQ A;  3MIE A;  2NMO A;  4QPI A;  4DIQ A;  3KV6 A;  3ACF A;  3SIS A;  4CP0 A;  4XIL A;  4AVV A;  4FPJ A;  1PO1 1;  3NWK A;  2PHR A;  3IMN A;  1RED A;  3FWE A;  3P5B A;  1LHV A;  4XFG A;  1SLI A;  1COV 2;  2CYF A;  2ZEY A;  4PDW B;  3BU0 A;  1VAM A;  5FZC A;  4DXR A;  3WDX A;  3LEK A;  4K40 A;  3O1T A;  1TNR A;  2DVG A;  1QJF A;  1SG3 A;  3SCH A;  3OD0 A;  4XUR A;  1PM7 A;  1KJL A;  1S0C A;  3N4M A;  4QT6 A;  4A45 A;  1COV 3;  2A7A A;  2XVL A;  3OBR A;  1WKY A;  1GBG A;  3B93 A;  3HBZ A;  3IT8 A;  1VRH 3;  4RN5 A;  1XOY A;  1QIQ A;  3AKP A;  4Q4V 2;  5KR7 A;  4JTO A;  5KHK A;  4JHT A;  4LE3 A;  1Q43 A;  3NV3 A;  2A1X A;  3WP6 A;  4XUP A;  3GZU C;  4ZU5 A;  5CFC C;  2EVX A;  4FPO B;  4AEJ A;  2PXJ A;  1K5J A;  3V0B A;  2WQ4 A;  3OYW A;  5JR2 A;  3RS6 A;  2ZOE B;  1LJ7 A;  4YW4 A;  4Q4V 3;  2RMU 1;  4LOS A;  3THD A;  3OGR A;  1GOH A;  1E5R A;  3POB A;  3WT3 A;  4KGG A;  4OFG A;  5KWR A;  1BBT 2;  1YYN A;  2ZGO A;  3CZJ A;  4WVM A;  1TG7 A;  3ABZ A;  3NNF A;  2JG9 C;  1ALY A;  4A2U A;  3E6B A;  4CCC A;  2DTW A;  3KVA A;  1AL2 2;  5DAX A;  2GC0 A;  1RUJ 3;  5BNN A;  1SCS A;  5JZG B;  3AZV A;  2IFW A;  4UBG A;  4BB3 A;  4GMP 1;  2PHW A;  3OSD A;  2ERF A;  4UWD A;  4BLI A;  3LSD A;  5A7Q A;  1O4Z A;  4UFK A;  1LEM A;  3J8F 2;  1IPJ A;  4D7S A;  3IB3 A;  5F1R A;  1JZ4 A;  4BQX A;  5E88 A;  4UFI A;  2D97 A;  4BXS V;  2IXH A;  4QMA A;  4ZZ8 A;  3HQX A;  2VQT A;  4R4Z A;  2A73 B;  1UYP A;  3WNL A;  3SKV A;  2PHD A;  3VBR C;  2KXL A;  1NAE A;  4LK6 A;  4PBO A;  3J8F 3;  4JRA A;  4XOG A;  1RUE 2;  4AI9 A;  4J1W A;  5IVF A;  1GV9 A;  3VDA A;  4OI4 A;  3WNX A;  4FPL A;  1DQ2 A;  2WC2 A;  1WLC A;  2HEW F;  2P17 A;  3FUQ A;  4GD4 A;  3AYD A;  1VR3 A;  2BUK A;  4N53 A;  3ZN6 A;  4IL7 A;  4A3Z A;  4LKF A;  5H9S A;  5GJ6 A;  1UF2 C;  2AEY A;  3KV9 A;  4YW1 A;  1PO2 3;  2QNK A;  2DF7 A;  2ZX2 A;  3BOW A;  5GZF A;  3R4U A;  2LM3 A;  2XXZ A;  5F5Q A;  5A6Z A;  4PIX A;  2ZGT A;  5C5T A;  5FLJ A;  1LOG A;  4UW4 A;  3WF2 A;  5BY5 A;  5LBB A;  2WFP A;  1WCS A;  5HXV A;  2QQL A;  3P3N A;  4P9I A;  4AVB A;  4XFA A;  1SPP B;  2RM2 1;  4MVT A;  4Q29 A;  4QPY A;  5FRE A;  1O59 A;  1LUL A;  5E6H A;  5T5J A;  2ZEW A;  1JZ8 A;  1DZQ A;  1YFU A;  5JXG A;  2P37 A;  3B9C A;  4R9A A;  1CAV B;  3VDD A;  3QH7 A;  3WIN E;  4Q8K A;  5IVE A;  5JOW A;  1DYP A;  1XRU A;  4IGQ A;  4D8M A;  1OHF A;  4P9Y A;  1H8T A;  2JDU A;  1Q8V A;  3CQO A;  4Q4Y 1;  1CIW A;  2KM2 A;  1C8M 2;  2P6C A;  2WNU C;  5E1R A;  1QKQ A;  4FQZ A;  2I2S A;  2OII A;  5DAP A;  3VKN A;  1DZR A;  1G9F A;  4XDP A;  3HQU A;  4L8Q A;  5D8A B;  2EID A;  1NA1 C;  5FZ1 A;  1LOF A;  1YO8 A;  4QB1 A;  5FK7 A;  3O1S A;  2WQ8 A;  3SMH A;  1OA2 A;  1ZM1 A;  5EFU A;  1PK6 B;  2BBA A;  4YW7 A;  5C7G A;  1AR8 1;  2JDZ A;  2MPF A;  2PHX A;  4FXK B;  4XBQ A;  3U10 A;  4MO3 M;  4AGR A;  4ZS3 A;  1HDK A;  1DYK A;  2QQV A;  1ULO A;  4GIQ A;  1XPW A;  2ZML A;  1PMJ X;  1VB4 A;  1QEX A;  3HN1 A;  4HKL A;  2PHT A;  2W1U A;  3B7M A;  3LGR A;  4XMA A;  4AFB A;  1ZBE 1;  1PGW 2;  3ILN A;  1Z7S 2;  4RR3 A;  4DB5 A;  1HIX A;  2VBP A;  5A6X A;  3ZFG C;  2OT7 A;  3AP4 A;  4LBQ B;  1XSQ A;  1UZW A;  5T5O A;  4GH4 B;  1GP6 A;  4S2G A;  2ARX A;  3D3A A;  3IAQ A;  4Y4Y A;  3E5X A;  5FKB A;  4IES A;  1TMF 2;  1L3J A;  3PUR A;  2BV4 A;  4XZU G;  3RQ0 A;  1OLM E;  4W65 A;  1AZD A;  3I2G A;  4IV3 A;  1YFX A;  4B3N A;  1L7Q A;  1UPS A;  3ATG A;  5I93 A;  1HV1 A;  1MS1 A;  2HWB 2;  1WMX A;  5FYH A;  5KHH A;  1OSG A;  1NT0 A;  4GWI A;  2BGC A;  3H1M A;  5ACA 2;  4I01 A;  5J98 B;  3SCF A;  1IS3 A;  3BKZ A;  3P6B A;  4YNI A;  4GMP 0;  3U0Z A;  1AJK A;  2X09 A;  3BTZ A;  4QX5 A;  3A22 A;  4TYS A;  4AFD A;  4IGO A;  5JLV A;  2R06 1;  4AED C;  4QQO A;  5ACA 3;  4FP3 A;  1QWR A;  4IV1 B;  4QPG C;  2D3R A;  5LAS A;  1ZZ7 A;  2HWE 3;  2Y6K A;  4QU2 A;  2Y64 A;  5EV7 A;  3A7Q A;  4ISR A;  1CR7 A;  1ZRI A;  3B69 A;  3U4X A;  1KS4 A;  1GZT A;  4QX8 A;  1PX4 A;  1WME A;  2CWS A;  1QGL A;  3AMH A;  1EV1 2;  2ENR A;  3PU8 A;  3DL3 A;  1SCR A;  2FDF A;  2Y0O A;  3NV2 A;  2ADE A;  2Z5W A;  5IK4 A;  4O61 A;  4IE7 A;  4PLN A;  4G3Y C;  1VBC 1;  3AMQ A;  5FZF A;  1A34 A;  4ZU4 A;  1W99 A;  4IEO A;  1R1A 2;  1TVG A;  1HRV 2;  2YY1 A;  4D7Y A;  2VZP A;  1APN A;  1W2T A;  5F2S A;  2GP5 A;  4ORF A;  5IWF A;  4B1M A;  2D98 A;  1POV 1;  1WGP A;  2WT0 A;  2Q8D A;  4PI0 A;  2W46 A;  4SBV A;  5FMD A;  1MZ6 A;  1R1A 3;  3UV9 A;  5BUV A;  3CL1 A;  4TTG A;  1KEX A;  4KI5 M;  3AYA A;  5E89 A;  3H3Z A;  4IER A;  3VBU B;  3WCS A;  1LOA A;  3AZW A;  5CVR A;  3MF9 A;  5FJH A;  4QDQ A;  3VKM A;  4K1Y A;  4XUN A;  5LA2 A;  4JV4 A;  1ODM A;  3LF7 A;  2QTW B;  1HRI 3;  1QY4 A;  4AL9 A;  2C24 A;  2P34 A;  4BHP A;  4CDW B;  4RGK A;  1UZZ A;  2Y6H A;  5FYI A;  4ARX A;  2GAL A;  4XXP A;  5FQ0 B;  4MUV A;  1QDC A;  2GMM A;  4XJ8 A;  1OPO A;  4XJZ A;  3WW3 A;  1STM A;  4E4S A;  2RHP A;  5GLU A;  2W68 A;  5FZO A;  4I3G A;  1QQP 2;  3FL7 A;  2ZGQ A;  5DAW A;  3DXU A;  4I0B A;  5DPN A;  3VD4 A;  3QBQ A;  1PNG A;  4Q4X 3;  4HON A;  2CDP A;  2DV9 A;  1IPK A;  2D6O X;  4EN7 B;  2HEY F;  3BTA A;  3OD4 A;  1GAN A;  4PCR A;  2QQK A;  3HT2 A;  4XET A;  4QX3 A;  3AL6 A;  2HWF 2;  1WMD A;  2RS5 3;  2NPI A;  4DNY A;  2OXB A;  2NP0 A;  3GNE A;  1RL3 A;  4MGZ E;  3U14 A;  4CCK A;  4TLF A;  3H7Y A;  3KF3 A;  4MGQ A;  4NE9 A;  4ET7 A;  2YC2 A;  1UMI A;  2AH2 A;  3SC7 X;  2VVE A;  3TN9 3;  1YWK A;  3K46 A;  4Q0U A;  2NN8 A;  1QJX 2;  2DCY A;  5C9A B;  2DVA A;  1LEC A;  1OKQ A;  2GNT A;  2HWF 3;  5BNO A;  2FDI A;  4DIN B;  1UX7 A;  4NAM A;  3ZFF B;  1LHN A;  5FZ3 A;  3BIW E;  3RYP A;  4FPG A;  4A3X A;  1GNH A;  3EBR A;  5FY8 A;  2DCK A;  1WW5 A;  5CB7 A;  5FY1 A;  1RUF 1;  2MEV 2;  3GBG A;  3PVN A;  1Y9Q A;  2D6P A;  5HXM A;  3VBO B;  4OUM A;  5I0U A;  5IUQ A;  1AXY A;  1IKP A;  1VBA 1;  3I2K A;  3AM2 A;  4MXW A;  1LHU A;  3EMR A;  4XFF A;  3LDK A;  4M3C B;  3ZIX A;  5IJR A;  4FTS A;  2YPJ A;  1C3H A;  4W6X A;  5FJK A;  1TQ5 A;  2MEV 3;  4AVA A;  2VE1 A;  3ASI A;  4CCE A;  3QAC A;  3DKW A;  3TNQ A;  3UT0 A;  1OXC A;  3N35 A;  3LFM A;  5DUV A;  5F5A A;  2OQ6 A;  3A21 A;  3GZA A;  4MET A;  4P9L A;  5LK5 A;  1H8V A;  4YYO A;  1CJD A;  3WNO A;  4WZC A;  1RVF 1;  3ZYF A;  4AQ6 A;  4XC9 A;  5FMO L;  1G7Y A;  1GYK A;  1VJ2 A;  2VZS A;  4A7Z A;  4E4H A;  1EY2 A;  1IHM A;  2LW8 A;  2WFF 1;  3AKQ A;  2DFC A;  3LQC A;  4MV2 A;  5FYM A;  3ZR6 A;  4KBZ A;  3CF6 E;  1V00 A;  2R07 1;  4DOU A;  3FLR A;  3MPP G;  1A8D A;  1VBD 2;  4H3W A;  5IK5 A;  1DU3 D;  1Y4W A;  1K42 A;  2XWB B;  2GH2 A;  2XH6 A;  1UZV A;  1V6N A;  1I5P A;  5IVJ A;  4OI0 A;  1DQ5 A;  3HNY M;  5JIA A;  4YZ1 A;  1OQE A;  1UL9 A;  1V6M A;  1VBD 3;  3LA7 A;  3O14 A;  1D0H A;  3OGV A;  4Q8L A;  4OHZ A;  4WVV A;  2E7A A;  4UXA A;  3POW A;  2FCT A;  1AXK A;  1EUU A;  1POV 0;  5B4X A;  3UJO A;  5TSW A;  4XEZ A;  3ZM8 A;  1GNY A;  4M00 A;  1W2N A;  4QPI B;  2BTV C;  1XNT A;  3DKQ A;  2G1M A;  4LO8 A;  1V6L A;  1XNA A;  1JYV A;  5DG2 A;  1O3Q A;  1COV 1;  1YLL A;  2EIE A;  3VD3 A;  4A44 A;  3MZH A;  1Q8O A;  1OOP C;  3OY8 A;  2B9U A;  5IVY A;  2BNM A;  1BXH A;  1OQD A;  3T2O A;  5LW9 A;  4NII A;  1WLD A;  1YJL A;  3ME2 A;  2W1S A;  5JOZ A;  2RR1 2;  2W94 A;  4JX0 A;  4I30 A;  2BFU S;  3GF6 A;  1LR5 A;  3BOP A;  2XUM A;  3AZX A;  4YZ5 A;  1JOD A;  3ACI A;  1YJK A;  3F2Z A;  4N90 A;  1P8J A;  2VZT A;  4QHZ A;  4MOA A;  3S5Q A;  3PME A;  4BQY A;  3DCQ A;  4HXC A;  4PBP A;  3I2I A;  4Q4V 1;  2Y8K A;  1WA4 A;  3O0W A;  4P9W A;  3AXE A;  3NNG A;  1QOS A;  1NCR A;  3SEE A;  2PHF A;  3VBF A;  1VAL A;  2ZMN A;  4CP9 A;  3PJQ A;  3OUH A;  3ITQ A;  2D40 A;  2GND A;  3DEC A;  4IEZ A;  1HKD A;  4AFM A;  3ZSL A;  3ZFE B;  1PVC 3;  5F7U A;  1DG6 A;  3OYW B;  2BNO A;  2HWD 2;  2E9Q A;  3EB7 A;  3NAP A;  4OUL A;  4WV8 A;  4Y1Y A;  3ZXD A;  4C91 A;  5JIU A;  4M01 A;  1N1T A;  2Q8E A;  3ELN A;  3WW1 A;  1F35 A;  2VU9 A;  3RPQ A;  1XYO A;  3THT A;  5T3N A;  1G9B A;  4YGB A;  5T52 A;  5LA9 A;  4P5Y A;  1CX4 A;  2WNV A;  4DUV A;  3IN9 A;  2HWD 3;  4RYD A;  4XFH A;  1G9C A;  5GLV A;  5BNN B;  4CCJ A;  5C4W A;  4DRR A;  3KS7 A;  1TME 3;  4M4R A;  4V2W A;  1KFU L;  3LEG A;  2LRP A;  4Q4Y 2;  1LGC A;  1OOP B;  2HBU A;  3J8F 1;  4LE4 A;  3ZO0 B;  2K9Z A;  5DAQ A;  4EZ4 A;  5DMY A;  4OMC A;  3ZXL A;  3MBW A;  4NID A;  2LAL A;  1CZT A;  1ENR A;  1VRB A;  2CDO A;  1U12 A;  2IXK A;  3I3E A;  1L7L A;  4RQP B;  4CA9 A;  1R09 2;  4R9B A;  2A6V A;  3BYW A;  2ORZ A;  1BVV A;  3H1W A;  1RUE 1;  4C1W A;  4QB6 A;  5FZM A;  3W5M A;  5C3Q A;  1O7F A;  4RA0 A;  4EWD A;  5FPB A;  1VP6 A;  4WM7 A;  1SLC A;  2WWS A;  1JH5 A;  1OLQ A;  3AVR A;  5C3O A;  5F37 A;  1WCU A;  5K4L A;  3I3D A;  1R09 3;  5ABJ A;  1AUY A;  4HVR A;  3ZN6 B;  4N53 B;  1ZBE 2;  2BWA A;  4I2O A;  1GWM A;  1OBN A;  3X29 B;  4P9X A;  1UAI A;  5DUU A;  3I2J A;  5JSO A;  2VD7 A;  4NO4 A;  2UWC A;  1US2 A;  1DFQ A;  4CCL A;  1W28 A;  4EN0 A;  1CD3 G;  2DU0 A;  1UMZ A;  3PTR B;  2A3X A;  4HVO A;  4N43 B;  2K2S A;  2IFR A;  5IT6 A;  4XJU A;  3BI3 A;  1JYI A;  3N9N A;  4D94 A;  4AHW A;  4XF1 A;  3OUJ A;  4KWU A;  4XMI A;  4LPL A;  3T08 A;  4FAG A;  4AHX A;  4EYU A;  4N9I A;  2OYZ A;  2YU2 A;  4Z92 B;  2VJX A;  1GZC A;  3VDC A;  2JG8 C;  2X5I A;  1YI9 A;  1S1A A;  2OUH A;  1DQ0 A;  4GWN A;  1X9P A;  3HAG A;  3VDD B;  1W6Q A;  3NV1 A;  2MHF A;  4A7K A;  4Y3O A;  1V9U 3;  3B3Q E;  1G6N A;  2R06 2;  2XVG A;  1NQD A;  3POF A;  1LES A;  1C8M 1;  4XHB A;  4PF5 A;  4E8C A;  1ULG A;  4E2S A;  2VH9 A;  3GZT B;  1SLB A;  5FYT A;  2VZR A;  1HQL A;  3PVB B;  3VZK A;  3AP6 A;  1ZZB A;  4YVS C;  3K3N A;  2PTM A;  2VZ1 A;  3MUZ 1;  4HKW A;  2XLA A;  4HSL A;  1N1S A;  3BUC A;  4LHL A;  1HXS 2;  3B9I A;  3HQR A;  1FNY A;  5C33 A;  1JXN A;  4FFF A;  4FOW A;  4KGQ A;  5A7N A;  3AKS A;  2B7Y A;  3ZPO A;  1KRI A;  2AC1 A;  2FBE A;  2VUD A;  1LOC A;  2GC1 A;  1BQP A;  4LO4 B;  2YPD A;  2DCJ A;  4FFG A;  2BQP A;  4LLO A;  2BDR A;  3RZG A;  2DUO A;  1D4M 2;  1NYW A;  2QCS B;  4AK3 A;  1UMH A;  1PNF A;  2YB7 A;  3AFG A;  1XJA A;  1PGW 1;  4QQL A;  3U1X A;  1AYN 3;  2XL9 A;  1WLW A;  2JE9 A;  3CEW A;  1ZVF A;  5F6K A;  3VZN A;  1O3T A;  4RR3 B;  1UWW A;  5FY5 A;  2IXL A;  5T54 A;  2DVB A;  3WNP A;  3ZR5 A;  3U37 A;  3UYJ A;  4IEY A;  1ND3 A;  2A6Z A;  4P00 B;  1QMJ A;  2AEZ A;  4QDS A;  4K7J A;  5F6L B;  4MYE A;  4COU A;  1LHO A;  1J83 A;  1OD3 A;  4LBL A;  3ZFG A;  3CKH A;  3DF0 A;  2GMP A;  3QH6 A;  3ZSM A;  2Z4F A;  3I3M A;  1MVQ A;  3JU9 A;  1QHD A;  1XNB A;  3OEA A;  4XJ9 A;  1XNC A;  2FDJ A;  2OVU A;  4Z2A A;  4IV3 B;  2EXJ A;  4MX3 A;  2VEC A;  3U78 A;  4YVW A;  5C6C A;  3O1V A;  3LEM A;  5K0U A;  5ACA 1;  2P1B A;  1JUH A;  3VV1 A;  2JWP A;  2OPW A;  3K51 A;  1W9F A;  4HZF A;  3RMX A;  1WW4 A;  1K5M C;  4Q0P A;  2XJS A;  5CFD A;  2XQX A;  4LO6 B;  1PZ8 A;  4UW6 A;  2DFB A;  5EP9 A;  3SEP A;  1W9S A;  2QQW A;  2XHN A;  3BAL A;  4LTA A;  1FPN 3;  4XAB A;  2J1E A;  3V0A A;  3F95 A;  3S6P A;  4EE2 A;  4X8P A;  1MQT A;  3D6E A;  3UL2 A;  1HJF A;  2ZS6 B;  3HIF A;  1IGO A;  3LCP A;  4LUM A;  2D5F A;  1WBL A;  1E5S A;  4QPG A;  1DDL A;  1UU5 A;  2PHL A;  2YMZ A;  3NL1 A;  3POJ A;  4F3J A;  2WA3 A;  2XJV A;  2HKX A;  3GDB A;  5EJZ B;  1UN1 A;  1QXP A;  3NV4 A;  4N7I A;  3LOB A;  3RJ2 X;  4LEJ A;  3RYK A;  4QKB A;  1R1A 1;  2XL7 A;  1ZA7 A;  1SEF A;  2W39 A;  4QHB A;  1H9W A;  1JI6 A;  1SLL A;  4XDQ A;  3ACG A;  5FY7 A;  4BQW A;  5CIS A;  1N1Y A;  1FT9 A;  4IEW A;  4LHN A;  4XTP A;  5DUW A;  2XR4 A;  1KJR A;  4N8M A;  4XJW A;  2DVF A;  1CVN A;  5EPA A;  3PVO A;  3JB4 C;  4RGA A;  2AGS A;  1HRI 1;  1W0N A;  3BCW A;  4FPF A;  4WBB A;  4F7Z A;  1YHF A;  1MEC 2;  2WL1 A;  1SQ4 A;  2WO2 A;  4XQD A;  2YFZ A;  4Q26 A;  1CQ9 A;  1OH4 A;  2YC0 A;  2C6S A;  2ZHK A;  3L2H A;  5FRA A;  4CUC A;  5FWJ A;  2CU5 A;  4YM0 A;  5I91 A;  4AHY A;  3LB9 A;  5H9P A;  4C90 A;  3WW4 A;  2Y6L A;  1Y43 B;  4CDU A;  1H30 A;  5CAZ A;  5KBF A;  4RSU A;  3WQ1 A;  4G4F A;  1IOA A;  1SBE A;  1UYX A;  3KV5 A;  3BVC A;  1GZW A;  2J1R A;  2A5Z A;  5DZE A;  3VB9 A;  4BE3 A;  4CXY A;  3KHC A;  4Q4X 1;  1OA3 A;  4NUB A;  4ZU7 A;  2J42 A;  1PMI A;  5DG1 A;  2FDG A;  3RI9 A;  1S2K A;  1W8N A;  3PIJ A;  4RS5 A;  1KDM A;  1RVF 2;  2ATF A;  1SLA A;  3M2M A;  3GGL A;  1QQP 1;  1XSR A;  3ZSJ A;  5F3C A;  3RSJ A;  1QXJ A;  2TNF A;  1R64 A;  1JHN A;  5FZO B;  4YLZ A;  4Z1V A;  2WFF 2;  2NQY A;  3JQX A;  3WHU A;  2FZ2 A;  1DZT A;  4QXC A;  3RWK X;  2R07 2;  5BNP A;  1IQA A;  4RL7 A;  3NJV A;  4LUK A;  1Z0H A;  3AX4 A;  3TN9 1;  1S2E A;  3WZ1 A;  3K4D A;  2RJK A;  4Q27 A;  5E16 A;  2HWF 1;  1H9P A;  3KMH A;  1UY1 A;  3HVD A;  4LKE A;  4XF3 A;  3I2O A;  1VPH A;  2XJQ A;  1XE7 A;  1X9T A;  3MUY 1;  1I3H A;  3KT7 A;  5KHJ A;  3N3H A;  3QD6 A;  2L9L A;  1LTE A;  1J84 A;  3MLJ A;  4O9G A;  1WD4 A;  1NOV A;  1QJX 1;  3AP9 A;  5JZG C;  4DRV A;  4CDQ B;  1W03 A;  4NIG A;  3WUD A;  1ND2 B;  2XJT A;  4X6Q B;  4CEW A;  3PU3 A;  4GXL A;  1AX1 A;  1MAC A;  4BIS A;  3MW3 A;  5F32 A;  1XQN A;  1ULD A;  3ALQ A;  3DUI A;  4AGV A;  4D3W A;  2E53 A;  1ODN A;  5FKC A;  4E9K A;  2VCM A;  2GP3 A;  3O5S A;  1UY4 A;  2MEV 1;  4MAD A;  4NPR A;  2LS6 A;  1VRH 2;  2W0X A;  1GWL A;  5A3L A;  1ZYB A;  3WCR A;  5LAT A;  4Q1R A;  3WDU A;  2J1T A;  2UWB A;  5HV0 A;  1C28 A;  3CMG A;  4RFT 0;  5HI0 A;  5HCH A;  3HNB M;  2RS1 3;  2B5H A;  3BB6 A;  4XQW A;  4MXW B;  2WAO A;  3OOX A;  1ACC A;  3LKJ A;  5LA1 A;  5IAT A;  4BQ1 A;  1F5F A;  2YRO A;  1X82 A;  1H1A A;  2XOM A;  3S5A A;  2LRO A;  3OBZ A;  1S0E A;  1X36 A;  1R1Z A;  1WBF A;  4COW A;  1DGW X;  5C3R A;  2P3Y A;  2O1Q A;  5AVP A;  4LUL A;  5CKM A;  5FZK A;  2UY8 A;  1JS9 A;  1XC6 A;  1YQ5 A;  2WBK A;  3I3Q A;  4JRL A;  5IAV A;  1RUJ 2;  1PM4 A;  1WCD J;  3OF1 A;  4BU2 A;  5L73 A;  1OD5 A;  1UY3 A;  4PJY A;  1OUX A;  2ZKN A;  1UU4 A;  1VBD 1;  4WVW A;  4OUS A;  2QVS B;  2IUW A;  1W6P A;  2AUY A;  2WAA A;  1H1I A;  2WO1 A;  5DXD A;  2VBB A;  1RUI 2;  3VZM A;  4C0H A;  5C8C A;  3WOG A;  5FPX A;  5GZG A;  3O1P A;  4AZZ A;  3SQO A;  3WXP A;  1N1V A;  3Q9O A;  3OGG A;  4AI2 A;  3LIH A;  2J1V A;  3AB0 A;  4PT6 A;  5IHR A;  2VQA A;  2B4K A;  2ARA A;  5JPM B;  1WWY A;  1RUI 3;  2VL4 A;  2VNO A;  3J4U H;  4XQ4 A;  3PUQ A;  2GC2 A;  3I2D A;  4AI1 A;  3WX5 A;  3UGF A;  1E5H A;  2WSV A;  3DPR B;  3FHQ A;  2ORX A;  4UF0 A;  1W8T A;  3LOI A;  4BOW A;  1W6M B;  3D5O A;  4B4R A;  2FD8 A;  1A78 A;  3V56 A;  3ACH A;  5FPA A;  1FV2 A;  3VUO A;  4M4P A;  3OY8 B;  3H50 A;  3N9P A;  3AYE A;  3K3O A;  4NN0 A;  1PO2 2;  4QQH A;  2WSU A;  5D8A C;  5H9R A;  2RR1 1;  2XKO A;  2R6Q A;  3ZXF A;  2H0B A;  2VG9 A;  2IC1 A;  1PK6 C;  1RJ8 A;  4YW6 A;  5FPV A;  2W1W A;  1JYN A;  2BER A;  2WN3 A;  1FAY A;  2TEP A;  2YXS A;  3Q8C A;  5AVA A;  5IVB A;  4MGT A;  2GNB A;  2KA3 A;  5DQ0 A;  3IIA A;  1PVC 1;  5G04 L;  3PVE A;  2GZW A;  4Q0V A;  5HPO A;  5FTT C;  1E57 A;  2D6K A;  1S0G A;  2PQQ A;  4D7T A;  3OGS A;  4NHM A;  1NCR B;  5FY4 A;  3WQ0 A;  2E31 A;  4OHY A;  4MH0 E;  5FZ4 A;  1YFY A;  4Y33 A;  4X6R B;  4YG3 A;  3KVB A;  4OQ9 A;  1UKG A;  4GH4 C;  2WIN B;  2HWD 1;  5JDB A;  2XLG A;  1V0A A;  3C7G A;  4FOQ A;  1FMD 3;  1HX6 A;  2A3W A;  3VD9 A;  2VR4 A;  1GOG A;  4CU8 A;  1ZA4 A;  3MW2 A;  2XJP A;  5FIX A;  3NAP B;  1TME 1;  3IZO A;  4CCO A;  2OPK A;  5A3W A;  2R04 3;  1H0B A;  2WO7 A;  3BGA A;  2OX0 A;  3JCI A;  2JEC A;  4EWE A;  3KT4 A;  1VBE 3;  1KD7 A;  5DDJ 2;  1W8Z A;  2CAU A;  4UI9 L;  1AX0 A;  1H4H A;  4N9H A;  5CEH A;  2WNV B;  4DEV A;  5C5U A;  4L97 A;  2B42 B;  2RE9 A;  2ZX4 A;  4OHV A;  4UW5 A;  1ULE A;  5F2W A;  3R6S A;  5C4W B;  3ZLI A;  4EJR A;  1N47 A;  4V1P A;  2Z42 A;  3MO4 A;  4YGE A;  3K4A A;  5DDJ 3;  1W6O A;  5FBZ A;  4W6Y A;  3N7M A;  2PYT A;  4AEM A;  2W91 A;  3VBH A;  1OF3 A;  1R09 1;  4IV1 C;  1ZRD A;  4UBH A;  4AEK A;  1HQW A;  2WAB A;  2DBN A;  4CXW A;  3U11 A;  4KMQ A;  2E51 A;  2VNR A;  1OVS A;  2PQS A;  1EAH 3;  4M0N A;  4OMD A;  3JD7 3;  1J1T A;  4WM7 B;  5SV8 A;  1A6C A;  1SHW B;  2R0F A;  1XBF A;  3AZZ A;  2XML A;  1SFN A;  3V64 A;  2Q4S A;  4L0P A;  2AZ5 A;  5ABJ B;  4ATF A;  4LK7 A;  4BK4 A;  4D69 A;  2ZGP A;  3IPV A;  2X10 A;  3D0S A;  1AR9 3;  3QLQ A;  4IQP A;  4XBN A;  4AI0 A;  3M3O A;  4ZXE A;  4A6S A;  4CDX C;  4BQ4 A;  3WHT A;  1JYT A;  2JXA A;  3D0J A;  1LAJ A;  1OFN A;  1YNA A;  4TLG A;  1YUD A;  2BFU L;  4MGI E;  1K12 A;  1MS5 A;  4GB3 2;  2BU9 A;  2IZW A;  1NE4 A;  3EYP A;  1V9U 1;  1X8M A;  5JI9 A;  5FFO C;  5F5C A;  3VBU C;  1GNZ A;  4ONU A;  2HWE 2;  3VKO A;  4DEQ A;  3MEP A;  4GB3 3;  4AYU A;  2X5I B;  4BJ0 A;  2WII B;  4CP1 A;  2UU8 A;  3ZN4 A;  4CUB A;  3GM8 A;  4CDW C;  5CKQ A;  3P3P A;  4LQR A;  2E6V A;  4OCT A;  5FUN A;  2BYV E;  3R4S A;  3MFC A;  3Q8B A;  1T6B X;  4KU8 A;  4DO0 A;  5AFB A;  3IMM A;  2BEO A;  3MV1 1;  3PIG A;  5JPN B;  4LBN A;  1ASJ 3;  5LRS A;  3QCW A;  3MIF A;  5K8S A;  3DYP A;  4ARY A;  1RIT A;  1HXS 1;  2DUP A;  2IXC A;  3GHN A;  3NVC A;  4XF9 A;  5FYU A;  4JGZ A;  4URT A;  1NY7 1;  4QDR A;  2I74 A;  4K8F A;  1AYN 1;  1UX6 A;  1QXR A;  4GA9 A;  2QDN A;  2H0V A;  4XE9 A;  1ULP A;  4MZU A;  3T2Q A;  4LBM A;  2WT1 A;  2R16 A;  2ILM A;  3NJY A;  5FYB A;  3KGL A;  1D4M 1;  1S0J A;  2PMW B;  3VBS A;  3RJR A;  5L7O A;  1NCQ A;  4CDX B;  1AF9 A;  4CTE A;  5JXI A;  2BPA 2;  1DF0 A;  2JDA A;  5EZW A;  2BOI A;  4YG0 A;  4JKL A;  1MS4 A;  1EP0 A;  4DXS A;  4EWA A;  3LZZ A;  3M3I A;  1IKQ A;  1Q8S A;  5C9A C;  1HRI 2;  4JGY A;  5FDB A;  5FZB A;  2VMG A;  3MPB A;  2XBO 3;  4CPB D;  1ND3 B;  4HOO A;  3ZFF C;  4MHU A;  5GZC A;  3M3C A;  1UY0 A;  1IZ3 A;  1W2A X;  4XAE A;  4K9S A;  5A7O A;  3ZKY A;  3LEI A;  3KLS A;  2DUQ A;  3LFI A;  4YZ4 A;  2P4E A;  1AR7 3;  2C1F A;  5EYX A;  2JKX A;  3D4K A;  4BPZ A;  5CBL A;  2ZBJ A;  4KWJ A;  4COV A;  2Q8C A;  3NNL A;  4NRQ A;  1GKB A;  2OZJ A;  3MF6 A;  3VBO C;  1BEV 3;  1W6N A;  2H6B A;  2D44 A;  3LDR A;  4Q4X 2;  4QGM A;  2VTF A;  4YVW B;  4BZ4 A;  5K0U B;  2HYK A;  4KH9 A;  2ZGR A;  4YFZ A;  5CFD B;  1R08 3;  2QDR A;  2VBD A;  5I0D A;  4A41 A;  2CGO A;  1VMJ A;  4XBL A;  1HN0 A;  1K5M A;  1V70 A;  1ZBA 3;  4IND A;  4LBJ A;  2RS5 2;  5ANQ A;  3PTY A;  2MNG A;  2DWR A;  5FZI A;  1X7N A;  3V0A B;  1W3V A;  2CY6 A;  3OPW A;  4QM8 A;  3BTY A;  1MQT B;  3TN9 2;  4BA6 A;  1Q8P A;  1QH6 A;  1D7P M;  4BDV B;  4CEY B;  1PGL 2;  1VB2 A;  3ZYG A;  1FXZ A;  4IET A;  1QF3 A;  4NHX A;  3WVJ A;  3J7M A;  2WN2 A;  3AMM A;  4NRM A;  2VVD A;  5FXW A;  3USU A;  1WW7 A;  3AYC A;  3NO8 A;  5LBC A;  3ZMO A;  3H3U A;  1WW6 A;  4JDM A;  4NHL A;  1QJY 2;  1DQ6 A;  2YBS A;  3AC0 A;  4R4X A;  1X8E A;  1QNW A;  2W87 A;  4QGL A;  1QJU 3;  3M3Q A;  1F9K A;  1RHI 3;  3PHM A;  1O3S A;  3BOD A;  1H6X A;  3FFQ A;  3B00 A;  1VE0 A;  4AQS A;  4XFI A;  1QJY 3;  3C3V A;  2VZU A;  3AFK A;  3AP7 A;  3VZO A;  1MEC 1;  4QPI C;  1OVP A;  2DCZ A;  5FV3 A;  1W8U A;  3K2O A;  4XAA A;  1W2U A;  3CZU A;  1GQP A;  2HYX A;  4UFL A;  5CA6 A;  1ZRF A;  4AVC A;  1YQC A;  1S0D A;  1CAW A;  1MVE A;  4QPW A;  3GAL A;  3T0B A;  4FP2 A;  3H3L A;  4PQ9 A;  2E26 A;  5T5P A;  4YM3 A;  2WDB A;  5FYS A;  4P5H A;  3UKV A;  1RUG 3;  3WNN A;  4CDU B;  1MZ5 A;  3M4F A;  4PDW A;  4YW3 A;  4B8E A;  5FZE A;  2D3P A;  3MIG A;  3INA A;  1GZW B;  3ZXE A;  1PHM A;  4WM8 A;  4YM1 A;  5J37 A;  2EIB A;  1GMM A;  1NE6 A;  2VUJ A;  3ETP A;  5EQU A;  4AG4 A;  1GZ9 A;  3RVH A;  3CJI A;  1UCX A;  2J1S A;  1UY2 A;  4UAP A;  4Y1X A;  4RS5 B;  4WVZ A;  1JYX A;  2Q30 A;  1JU4 A;  4Q0S A;  1B35 A;  3OG2 A;  3UNP A;  3V0B B;  4NR1 A;  1C5H A;  3H8X A;  1AL0 G;  2B8M A;  2KD7 A;  5FP9 A;  3N7K A;  3ZYH A;  3UES A;  3W20 A;  5BNP B;  2R1B A;  4Y1V A;  2BNN A;  2WS9 3;  2ETE A;  3HEI A;  3PDQ A;  4HKO A;  4QQP A;  3ZFE C;  5A1F A;  4QX0 A;  2UYA A;  2VNG A;  2HWC 2;  2SLI A;  4DUW A;  3ILR A;  1JU3 A;  2PA7 A;  3IDE A;  5EHD A;  5GM0 A;  2CSG A;  4QD2 A;  5FAX A;  4AVS A;  4TN7 A;  5A3T A;  2XKP A;  1HB2 A;  4NAO A;  1E5I A;  4YPJ A;  3I97 A;  2HWC 3;  4Q0Q A;  5GLT A;  4E2Q A;  1A3K A;  3DGT A;  1V6O A;  5BNN C;  1RB8 G;  3RDI A;  1D2S A;  3OPZ A;  5AC9 2;  1BMV 2;  1DYO A;  1KDK A;  2BBV A;  2RS1 1;  2VQU A;  3GZE A;  4M3C F;  2D93 A;  3MYX A;  1VRH 1;  2RMU 3;  3WD5 A;  3WW2 A;  3PL0 A;  3DN7 A;  1U5Y A;  2VW1 A;  5A6Y A;  5GZE A;  4RQP C;  2Q1F A;  4FQ4 A;  3ZYI B;  5AC9 3;  4J6G A;  3VL9 A;  3KZ4 C;  2EXH A;  1KFX L;  2C0Z A;  1GWK A;  2J1A A;  3MFA A;  4L92 A;  4HT1 T;  4Y24 A;  2HJI A;  2W1Q A;  5T55 A;  3EJK A;  4D0Q A;  1DQ4 A;  2VOX A;  4Z8B A;  2FDK A;  1PVC 2;  1YQ6 A;  2ZKL A;  3MIC A;  3WR0 A;  3HMY A;  2GSY A;  2PAE A;  4HG6 B;  1UXX X;  3TBD A;  1AR6 2;  4N53 C;  2VAU A;  5JUV A;  1F5J A;  2P6H A;  2VZV A;  1MR5 A;  3L2Y A;  2JD9 A;  2ZGM A;  3K75 B;  3LWC A;  4JDN A;  4Z07 A;  2OW4 A;  4ASM B;  3S57 A;  2WRA A;  5FZD A;  1DBN A;  3NNJ A;  1RUJ 1;  4LHK A;  1XYN A;  5CKN A;  5IVV A;  2Z69 A;  4KU7 A;  1WCK A;  2IWG B;  5L19 A;  4XVH A;  3VL8 A;  2JD4 A;  4V2V A;  4CCD A;  5CFC A;  1AR6 3;  2ZHN A;  3GXU A;  4N43 C;  3HNM A;  4LO5 B;  5HCA A;  5FY9 A;  1TME 2;  3JB8 A;  3OBT A;  4P08 A;  5KC5 A;  1RUI 1;  2R49 A;  4WVM B;  1SAC A;  1MS0 A;  2C9A A;  1RMU 2;  2ZZJ A;  1UD1 A;  2C26 A;  1W6P B;  2TBV A;  3PNA A;  5JOX A;  3LA2 A;  2XON A;  3LPF A;  5C8C B;  1TE1 B;  4R52 A;  1BCX A;  2JG9 A;  1W90 A;  4OHW A;  3ST7 A;  1W9W A;  2Q0A A;  3MV0 1;  2RJL A;  5LRR A;  1ZX5 A;  2AAC A;  3ZIW A;  5LA0 A;  4HL0 A;  1RMU 3;  2RS3 2;  3PJY A;  2G4I A;  5FZL A;  4DY3 A;  1QJZ A;  5A3O A;  3VDD C;  3KV4 A;  3NJZ A;  3H8U A;  1UOF A;  2IXJ A;  2DUR A;  4FI9 A;  1RIN A;  1GP5 A;  2J22 A;  1H8T C;  3GHM A;  5DZF A;  1UZ0 A;  1VIW B;  1IS5 A;  2RS3 3;  2VO5 A;  5F3I A;  5FLH A;  2RM2 3;  2A6W A;  3I8T A;  3CO2 A;  1PO2 1;  3SKJ E;  3ES1 A;  2JDK A;  3GJA A;  4DFS A;  5KXC A;  3VBR A;  5FXV A;  4LIV A;  1LOF C;  4QKN A;  2G9Z A;  1QJE A;  3FLP A;  2JIJ A;  3A23 A;  4CVU A;  2XB6 C;  2QQN A;  3AMN A;  1MS9 A;  3FUO A;  3KCX A;  4D6S A;  1OT5 A;  2V4V A;  2GH8 A;  2FZ1 A;  1FMD 1;  3VGI A;  5CAD A;  2WLQ A;  4UW3 A;  3THP A;  3TRS B;  1JYW A;  1F8V A;  2N7G A;  2R04 1;  1DP0 A;  2JDP A;  2D6L X;  2WR9 A;  4YGC A;  4RR3 C;  5CYY A;  1EPW A;  1Q3E A;  4GAL A;  3BN6 A;  1RUC 3;  1XND A;  1DCS A;  2D6N A;  1OH3 A;  2VVF A;  3D8C A;  4KBB A;  4N7U A;  4XCB A;  2UY9 A;  3ON7 A;  1V9U 2;  1OA4 A;  1S0F A;  4ZZ5 A;  1SFP A;  4R9C A;  2BVV A;  3K4Z A;  4ES9 A;  1W9T A;  1PIV 3;  2K46 A;  2YG0 A;  1GSL A;  1UOJ A;  3POE A;  4B29 A;  1EPZ A;  2XQR A;  2ES3 A;  2V4A A;  3W5N A;  2LTN A;  1O5L A;  4H2A A;  5DDJ 1;  1EUT A;  4IV3 C;  2BJS A;  4DMI A;  1OUS A;  4NOT A;  2FHR A;  3H7J A;  4NWV A;  2Q1Z B;  4P9J A;  5L36 A;  1RIR A;  1FYU A;  1H8T B;  2RG4 A;  3K77 A;  4WZF A;  5T5L A;  1YI7 A;  3WF1 A;  4CPB A;  3ZXG A;  1G86 A;  1O8S A;  1LB2 A;  5FOB B;  1PX3 A;  3ZDS A;  1D2Q A;  5JCT A;  1EAH 1;  3O12 A;  2WO3 A;  4FOV A;  4AAP A;  3JD7 1;  1LHW A;  3HOB A;  5FZ6 A;  3JXS A;  1W6O B;  2WNU A;  2WZ8 A;  4CE8 A;  1W8H A;  1CZV A;  1GQH A;  3M1H A;  1NY7 2;  2P5B A;  2PAK A;  3VBH B;  4MHR A;  1AYN 2;  5FXZ A;  1ONA A;  4L11 A;  1NA1 A;  4XAC A;  1UNB A;  3BIE A;  2QQU A;  1T6G C;  3WG3 A;  1LU2 A;  1V6I A;  3FC0 A;  3C7H A;  2J1U A;  2CTV A;  4OI2 A;  4ZY9 A;  1H2N A;  3T2T A;  3O1O A;  1RUD 3;  3GBF A;  5A32 A;  3RZJ A;  4FVV A;  2VOV A;  1S0I A;  3I3B A;  5FZ8 A;  2E63 A;  2JE8 A;  4YSF A;  4XPV A;  1PGS A;  3U75 A;  3WF4 A;  1LEN A;  3N7J A;  1QOO A;  5JSR A;  4S2F A;  2JDM A;  1QU0 A;  2EIC A;  3IPV B;  4H7L A;  5FLI A;  1I9R A;  1XE8 A;  4LLF A;  3B02 A;  2WZE A;  1ZRR A;  2WT2 A;  5FY0 A;  2UWA A;  2WKK A;  2VMF A;  2OUJ A;  2XHK A;  3KQR A;  3VHR A;  4GB3 1;  1W06 A;  1OUR A;  5IVC A;  3NW4 A;  2XG3 A;  3CBN A;  5LEJ A;  4GUL A;  3MIB A;  1UZY A;  2CGN A;  1FPN 2;  3UET A;  3SCG A;  4CU9 A;  3I59 A;  4XIO A;  2HWE 1;  4E27 A;  3NKT A;  1RGS A;  2V73 A;  1ASJ 1;  2IVJ A;  3GJB A;  5FP3 A;  1OMI A;  4EN6 B;  1Q56 A;  1FNZ A;  5BPX A;  3SXW A;  2QKD A;  2VOW A;  1AYM 3;  2YBP A;  4XFB A;  2ZEZ A;  4DUX A;  1ZRE A;  4BMB A;  1JZ3 A;  1F31 A;  5L9V A;  4NMI A;  4AED A;  2ZMK A;  4CDW A;  1CAX A;  4S2D A;  1URX A;  1O3R A;  4GJZ A;  1U5I A;  4JZR A;  1W8W A;  4XYX A;  5FQ0 A;  1UOB A;  4I0W B;  1CIY A;  1DLL A;  2E33 A;  4JGZ B;  4ZHN A;  5FO7 B;  2UUR A;  4D6R A;  5EXO A;  1JZ5 A;  1U0A A;  2XPJ A;  1HV0 A;  1HB4 A;  2FCU A;  4K1Z A;  1H6Y A;  4FT8 A;  3U07 A;  4ES8 A;  1J59 A;  4JAA A;  1PVX A;  3HWJ A;  2WZR 3;  4IEV A;  5L7O B;  1NCQ B;  1JZ7 A;  1LCL A;  2AEN A;  4U2A A;  4FAH A;  4Y1Z A;  5LK7 B;  3KQ4 B;  3RZM A;  5JXH A;  1ENQ A;  1CX1 A;  3WDW A;  1AR7 1;  4RHV 3;  3VLB B;  2V09 A;  3B01 A;  2BOJ A;  4CDQ C;  3N36 A;  1ND2 C;  1NUK A;  3LE0 A;  4Q5O A;  1K45 A;  4JGY B;  1BEV 1;  3H0O A;  2A6X A;  1TNF A;  3ZN5 A;  2DVD A;  1B09 A;  2C9K A;  3FJS A;  2Y6J A;  3KHB A;  5I8S A;  5AFE A;  4CZS A;  4KQ7 A;  2VZQ A;  1C57 A;  3KB5 A;  1BVP 1;  1RTV A;  2G9F A;  3CJX A;  3R0R A;  4XCA A;  4IEU A;  1ZBA 1;  4QXB A;  2QQO A;  1OLR A;  1V6J A;  2FDH A;  4AI3 A;  3NST A;  1G9D A;  5FO9 B;  2EXK A;  2Z2S B;  1POQ A;  3FHI B;  3S7E A;  4CSW A;  1W6N B;  4AAX A;  4F83 A;  2O8O A;  2XVK A;  2ET7 A;  3UGG A;  2Y6G A;  1GU3 A;  4GKX A;  4PIZ A;  2RS5 1;  2W9X A;  2PLV 3;  5FYY A;  2RV9 A;  2Q8O A;  3UJQ A;  4LNV A;  2ZXQ A;  4KG8 A;  4AXO A;  4IE5 A;  4P02 B;  2BRT A;  3RG0 A;  2Y33 A;  5C3S A;  3JBG 3;  1C1L A;  1RUF 3;  3FBY A;  4BIO A;  1BKZ A;  2EAA A;  2Y60 A;  3O0V A;  1VBB 3;  5LY1 A;  1PGL 1;  3MLK A;  2JEM A;  1ZZ6 A;  1QJU 1;  1VBA 3;  1YEW A;  1LOE A;  1Q5O A;  1RHI 1;  3IM0 A;  4QX7 A;  1FOD 3;  1W9Y A;  4AW7 A;  4Y5Z 0;  5CU1 A;  2QQI A;  3USU B;  1UIK A;  1QJY 1;  3Q8A A;  1WCQ A;  2QE3 A;  1CES A;  4XFC A;  4HBN A;  3S0M A;  2P3I A;  4UFM A;  5DAV A;  3RRD A;  5KXB A;  1C4R A;  4NWW A;  2YHJ A;  5BNO B;  3I4I A;  3J9S A;  3SH3 A;  2GME A;  3VKL A;  2RS1 2;  3W58 A;  3WQ7 A;  1RUG 1;  3DPR C;  3PUI A;  1PZ9 A;  5ANN A;  1IG3 A;  1GIC A;  1HB3 A;  1CAU A;  5FO8 B;  4RFR B;  2VTX J;  4KWK A;  2E7Q A;  3I54 A;  4RGG A;  4XW3 A;  3WDV A;  5A7W A;  1CAW B;  2W52 A;  4ZON A;  2CNA A;  1DGR A;  2NZ9 A;  2QZ3 A;  1VLN A;  4TWT A;  4PLO A;  4DXZ A;  1ZZ8 A;  4TZD A;  4NJ4 A;  3IKW A;  3O7O A;  4AF9 A;  5FPZ A;  3ZYB A;  2VUA A;  2VOT A;  4WM8 B;  1CPM A;  2WS9 1;  1HW5 A;  4JTN A;  5C71 A;  4IGP A;  3WP5 A;  3CJI B;  3RI8 A;  3DYO A;  3NRU A;  4EQV A;  4ERO A;  1S4C A;  1REE A;  1BK0 A;  1NCR C;  1HQN A;  1B35 B;  1W8F A;  1YFW A;  4K6B A;  3UKT A;  4H14 A;  3WG1 A;  5GLW A;  3WF0 A;  2VGD A;  2GN3 A;  1J3P A;  4BQ2 A;  3VBF C;  5K9Y A;  1N3O A;  1S0B A;  1KS5 A;  2FMY A;  2HWC 1;  1O8P A;  4HN0 A;  2HEV F;  3FX3 A;  1CWP A;  1N3P A;  2YBK A;  1NZI A;  1RYY A;  2PHU A;  2ZX1 A;  3QOP A;  3NAP C;  5LEK A;  2YYO A;  1ULF A;  4LA3 A;  4XJA A;  4BYY A;  3ZFE A;  3E5U A;  1N3Q A;  4H7M A;  4JVA A;  5I0T A;  1M06 G;  4YW2 A;  4COZ A;  1O4Y A;  2WNV C;  2Y26 A;  1YQ2 A;  5AC9 1;  1BMV 1;  2RVA A;  2JIC A;  4D6Q A;  5DAB A;  4KL1 A;  5C4W C;  5I0R A;  5JWP A;  1C5I A;  1F15 A;  4IE6 A;  4LOT A;  2BGO A;  4BWO A;  5I0S A;  1S2B A;  4OUE A;  2VC9 A;  4K3U A;  4AR2 A;  2CGP A;  3N9Q A;  5B2G B;  2BZD A;  1REF A;  2RDN A;  3SNM A;  2PEL A;  1OOP A;  1BBT 3;  3NNM A;  4HSJ A;  2Y0I A;  4R8H A;  2B46 X;  3FHA A;  2D7F A;  3CLP A;  2VXR A;  2W2I A;  3CNA A;  1OKO A;  1AL2 3;  1J1L A;  3AZY A;  4Y5T A;  4O65 A;  2NYY A;  5FMC A;  2VMD A;  4CU6 A;  4RQP A;  4LA2 A;  2I07 B;  5JVV A;  2ZAH A;  4WM7 C;  1W2O A;  1DGL A;  1FMD 2;  5C70 A;  4KNC A;  1AR6 1;  4LBO A;  4FTB A;  4C1X A;  5B4N A;  5F3G A;  5A3N A;  1RXG A;  4UYB A;  5ABJ C;  1YIP A;  2VUC A;  2ZTN A;  3UKN A;  2R04 2;  4JQR A;  3TEW A;  1KXG A;  2B9V A;  3VBF B;  4BME A;  4K8R B;  4CP9 B;  2WUH A;  3G7D A;  4PF1 A;  1VBE 2;  1SMV A;  1XNK A;  2VCC A;  3M7A A;  4HK8 A;  4Y26 A;  4FBF A;  4MLO A;  5ISL A;  3E6C C;  2JDH A;  2GU9 A;  3RZL A;  3H42 B;  3ORJ A;  4XHX A;  5FZH A;  4FCA A;  5GAL A;  5A33 A;  1RUE 3;  5CFC B;  2CL2 A;  2ARE A;  3RGB A;  2VY0 A;  4IE0 A;  1RMU 1;  2CWM A;  5LBE A;  4QKF A;  2H6C A;  3RWN A;  2VNV A;  2XLF A;  3A0N A;  4N43 A;  2GNM A;  3H9A A;  2NMN A;  1XU2 A;  2A70 A;  2QZ2 A;  3KSC A;  3WP4 A;  1WMF A;  2QQJ A;  2YGM A;  3VN4 A;  2JG9 B;  3M70 A;  2JDN A;  4I0A A;  2RS3 1;  5A3U A;  2WWU A;  4TXW A;  3RZZ A;  1TZO A;  1MS3 A;  2VUL A;  2X5I C;  1F4A A;  2XJR A;  4KG0 A;  4CXX A;  3AMP A;  3MID A;  1ZZC A;  3KD4 A;  1EAH 2;  4HFS A;  3WP3 A;  3JD7 2;  1W39 A;  3WLU A;  5DUX A;  4K21 A;  1W3X A;  4K20 A;  1T2X A;  1LOD A;  1J3R A;  3KT1 A;  3ZXJ A;  1Z78 A;  1H2K A;  4FPH A;  4GQ7 A;  5FYV A;  4JQT A;  2WJS A;  4YW5 A;  3E1F 1;  4YFW A;  2ZGK A;  2YDE A;  4QXH A;  4ATE A;  1AR9 2;  1TEI A;  4CCM A;  4NHK A;  3AL5 A;  1WUV A;  1IPS A;  2EAK A;  4OHX A;  5FP8 A;  3VBR B;  1PZ7 A;  2AR6 A;  5IFP A;  1RUH 2;  1ENX A;  3LIG A;  1JOJ A;  4LKD A;  1OQ1 A;  1FI2 A;  4OZO A;  1RUC 1;  1BLZ A;  4NIH A;  5CIR A;  2GC3 A;  4ZXK A;  3TOJ A;  5F8P A;  2R1D A;  1C8M 3;  4CUA A;  3E6D A;  2G19 A;  3EQE A;  5GZD A;  4W8J A;  4B7K A;  4QXK A;  1RUH 3;  1OPM A;  1NXD 1;  1PIV 1;  4EZH A;  5J96 B;  2Y6F A;  2W95 A;  2TUN A;  5A70 A;  2IVI B;  2W08 A;  5CZK A;  1LU1 A;  1H1M A;  2PAM A;  1GQG A;  2ZJC A;  4Y22 A;  3VHN A;  3T2P A;  2C5D A;  4B4Q A;  2WNE A;  4HAN A;  4OI1 A;  2YU1 A;  1ND3 C;  4ZKT B;  4MG2 A;  2RDS A;  2ZPX A;  3ZDV A;  4NHY A;  4R9D A;  1JBC A;  2K0G A;  3V65 A;  5F9T A;  3I49 A;  3BPZ A;  2B39 A;  2JDY A;  1JTZ X;  2ZHM A;  3I7D A;  4HLT A;  4FPC A;  3Q8F A;  1BK1 A;  2Q5T A;  1ASJ 2;  1QDO A;  1XXN A;  2JG8 A;  1UXZ A;  2W47 A;  3CDZ B;  1W6Q B;  2ET1 A;  4FPK A;  1Z7S 3;  4G9S B;  4Y20 A;  4COY A;  1X33 A;  4YVW C;  3O1M A;  5K0U C;  1WA6 X;  3KCY A;  1KIT A;  2XGX A;  5F3E A;  5IK8 A;  5CFD C;  3AVS A;  3ECQ A;  2WZP P;  4I3P A;  2DDU A;  4U36 A;  2V72 A;  1DIW A;  2D43 A;  3FBM A;  3MDP A;  3ROU A;  3PUH A;  1RUD 1;  3DV8 A;  1TMF 3;  4B1L A;  3HJR A;  4URA A;  4F8A A;  1GFF 2;  4YVS A;  2EAL A;  4Q4W 2;  5K7P A;  3OUI A;  3J7H A;  2WNU B;  4BM8 A;  4HPK A;  4E4D X;  4B4P A;  1MQT C;  2HWB 3;  3C2U A;  1NA1 B;  4QU1 A;  2D5H A;  4CEY C;  2FCV A;  1MPX A;  1GUI A;  1UOG A;  4LBQ D;  3RYR A;  5FPU A;  5BV6 A;  4GWM A;  4Q4W 3;  5E8A A;  2XBO 2;  5A3P A;  5KXD A;  4A4A A;  2Q1M A;  5A32 B;  1SBD A;  4DQA A;  4IXL A;  3GYD A;  2ZA9 A;  4LR4 A;  2JIG A;  2ZAB A;  1AR7 2;  2EXI A;  5DN2 A;  4AQT A;  2P3J A;  4XF4 A;  1LGB A;  1YQ8 A;  1ZZ9 A;  5FZ7 A;  4LMF A;  1BEV 2;  2JJ6 A;  3ZFG B;  1BJQ A;  4BQ3 A;  2JEN A;  4NVP A;  3ZPY A;  4A42 A;  4YG6 A;  5H9Q A;  4OYU A;  1R08 2;  4XDO A;  3TEX A;  1EV1 3;  1FPN 1;  2R30 A;  5IK7 A;  1AYM 1;  3EO6 A;  1UQX A;  5BYN A;  1ZBA 2;  1I1E A;  1AX2 A;  1KGY A;  3ENR A;  1RXF A;  3I59 B;  3POI A;  5LBF A;  1HRV 3;  1UO9 A;  2VCB A;  5FZG A;  4J1X A;  4UFJ A;  1W05 A;  4CDU C;  4IEP A;  1SZB A;  5IYY A;  1Q8Q A;  2P3K A;  3MI8 A;  1YCI A;  3WSO A;  3M3E A;  2OZ6 A;  3LDB A;  1SFY A;  4Q1P A;  5FXX A;  3ZSK A;  3TEY A;  5JXJ A;  1D4V B;  3HPN A;  1O4T A;  2GN7 A;  5FK8 A;  1NG0 A;  4M3C E;  4LIT A;  4RS5 C;  5GLZ A;  4FFH A;  3ZYP A;  1JHJ A;  1HN1 A;  2A71 A;  1CAX B;  1O6U A;  5L9B A;  4BLJ A;  2XWJ B;  4QPG B;  4EN9 B;  3H8O A;  2WZR 1;  3AKR A;  4JDO A;  1QJU 2;  4C8D A;  1H2M A;  2V5D A;  5BXX A;  4I02 A;  1RHI 2;  3EHK A;  4E2G A;  1U5X A;  5BNP C;  4AHZ A;  3FFZ A;  3ACL A;  1JW6 A;  4RHV 1;  1CZS A;  3ZX7 A;  1HB1 A;  1US3 A;  2RJ2 A;  3IDB B;  3HT1 A;  4L2N A;  2ZGN A;  5FZA A;  4AED B;  1CJP A;  2NLR A;  1JOP A;  4FPY A;  4E4Z A;  3LSE A;  3JZV A;  3WG2 A;  2DYC A;  3AXD A;  4KWL A;  3LPG A;  3VD5 A;  3T0D A;  4LT5 A;  2KR2 A;  3DEM A;  1QQP 3;  2BWC A;  5D1I A;  3KF5 A;  1RUG 2;  5A3M A;  2ADD A;  3ES4 A;  4PIY A;  1FAT A;  2WNO A;  1HLC A;  3ZMN A;  3ZYR A;  4CEW C;  4CP2 A;  3IDA A;  3VHP A;  5IFT A;  1MS8 A;  4CDQ A;  1OF4 A;  1JYC A;  1Y9G A;  1ND2 A;  4OVE A;  2ARC A;  3S30 A;  1Y7B A;  4X8N A;  3H8R A;  1JUI A;  1PO1 2;  4AFA A;  3WUC A;  1DHK B;  2BP6 A;  2PFW A;  2OQ7 A;  4QWN A;  3ZOI A;  2PLV 1;  4RD7 A;  3N9M A;  1CGP A;  1BHG A;  1XYP A;  5FZ0 A;  1W8O A;  2QQM A;  4PQQ A;  4H55 A;  3RNS A;  1C1F A;  1QJX 3;  3JBG 1;  2QJV A;  2ID4 A;  2WS9 2;  1PO1 3;  1ENS A;  3O1R A;  1VBB 1;  3MHZ A;  4O7X A;  4Y1U A;  1CON A;  4LOR A;  4NRO A;  5ERL A;  4DXT A;  3AJZ A;  3ZXK A;  2E7T A;  1J3Q A;  1FOD 1;  4CYD A;  4Z2W A;  1UU6 A;  2EIG A;  1K3I A;  2SBA A;  4HN1 A;  4BH9 A;  3B5L B;  4OZX A;  1H2L A;  1SDD B;  5A7S A;  4Y5S A;  3TB0 A;  4YGD A;  3H1Y A;  4GZ9 A;  4EN8 B;  2EA7 A;  2R0H A;  3DXT A;  3T0A A;  3APB A;  3A4U A;  3N9L A;  3O0X A;  3P1I A;  4HK9 A;  5L9R A;  2XUE A;  3SIT A;  3W21 A;  1A8M A;  1NLS A;  1YRZ A;  1U5Z A;  1YC6 1;  3KWV A;  4IE4 A;  4AVT A;  1JOB A;  3SLI A;  3NMB A;  2RMU 2;  5C8C C;  5A7P A;  3T3Y A;  3ILF A;  3W9A A;  5I8T A;  5A1L A;  4EV0 A;  3HN3 A;  4CEW B;  4XXA A;  2E32 A;  4IEQ A;  5JZG A;  3ZKU A;  4BK5 A;  1ST8 A;  3PUS A;  4W6W A;  4UOJ A;  3EXU A;  4AE2 A;  2JE7 A;  4Q2F A;  2LUW A;  5D2A A;  3OCP A;  2VCA A;  5LB6 A;  2JB8 A;  5LZ6 A;  1CAU B;  1PMH X;  1W0O A;  1I5Z A;  1IS4 A;  3DPR A;  4OLL A;  4QX1 A;  4FXG B;  4XF0 A;  3ZSE A;  3WG4 A;  4ASK A;  1DGR N;  2Y34 A;  3NKG A;  1LKN A;  4L99 A;  3RZH A;  5A7W B;  5C3P A;  3IBM A;  3ZYJ B;  1W6M A;  2WQZ C;  4GMP 3;  4A7Y A;  2ZCW A;  5J48 A;  5FPL A;  4ZPI A;  2OA2 A;  2A3Y A;  1OC1 A;  1M4W A;  4QKD A;  2C4X A;  4MGK E;  4NIA A;  2OKX A;  3S7I A;  2EF6 A;  2WYF A;  4YAR A;  3WNM A;  5G05 L;  3T1M A;  4IW3 A;  4AGG A;  4FSJ A;  5J7M A;  2AYH A;  2NM1 A;  1LGN A;  3URF A;  1RUO A;  5SV5 A;  5F39 A;  4E8D A;  4Z82 A;  2ZGU A;  4L9B A;  4AWD A;  4PHZ A;  2J7M A;  1BYH A;  1OI6 A;  1ZNP A;  4I09 A;  1RC6 A;  2A75 A;  2VZO A;  3IDC B;  4S2H A;  2RR1 3;  5DZG A;  3SH4 A;  2VOK A;  2VMI A;  2W5F A;  3J7L A;  3O1U A;  4IDZ A;  5J3U A;  4FPE A;  2W92 A;  2B45 X;  1Y3T A;  1MZE A;  1SPP A;  4QQ2 A;  2R32 A;  1GLH A;  1LNS A;  2VMC A;  5I8Y A;  5M0T A;  2RM2 2;  5FYZ A;  2DCT A;  2WLP A;  4NPM A;  2I45 A;  1BBT 1;  3FN9 A;  1CAV A;  4CRQ A;  3B94 A;  4UF0 B;  5APA A;  3FLT A;  1AL2 1;  1AVB A;  1CPN A;  3MGU A;  4MGS A;  3POY A;  1G8W A;  3BU7 A;  2JKB A;  3FZ3 A;  1KQR A;  2X53 S;  2O8Q A;  2XDV A;  3RMY A;  3GCX A;  3TAY A;  5A1A A;  1GOF A;  2VW0 A;  3VBH C;  2CAV A;  3TYJ A;  4NRP A;  4GWJ A;  4JKK A;  5D8A A;  5EYY A;  1I6X A;  2G9G A;  1UIJ A;  5JAX A;  4LBK A;  2X29 A;  1H4G A;  2WYS A;  5FOJ B;  1O5U A;  3WY6 A;  5FBJ A;  1PK6 A;  1RUC 2;  2VPV A;  4FTE A;  1UPI A;  2UYB A;  2ZGL A;  5LCW L;  3NQH A;  1W04 A;  1UYZ A;  2ZAC A;  4Q4Y 3;  3VHO A;  1F2N A;  4FO9 A;  3RFR A;  1AR8 2;  3III A;  1PIV 2;  4LKS A;  5KHI A;  3TNP B;  1VBE 1;  4BXF A;  5KXE A;  2O14 A;  1QH7 A;  4HET A;  1IQD C;  1RUN A;  4QM9 A;  4SLI A;  4BQ5 A;  5JI7 A;  5LWB A;  4JCK A;  3W59 A;  1AR8 3;  4LBQ A;  5JOY A;  5KHG A;  4PI2 A;  2VXJ A;  1AJO A;  2GAU A;  3MW4 A;  3OGJ A;  4GH4 A;  5EJ1 B;  5A33 B;  1UW8 A;  1XB9 A;  2QFE A;  4AOC A;  2YC4 A;  3N7L A;  1G9A A;  3J26 N;  3WV6 A;  2P2K A;  2YGL A;  1DQ1 A;  4ASL A;  4QHO A;  1ZBE 3;  2F6B A;  4CUG A;  5JMO A;  3OPT A;  1NX9 A;  1WD3 A;  5IAX A;  2ARB A;  4FOY A;  1NXM A;  3ZXA C;  1L7R A;  1NLQ A;  4BIF A;  1DGW A;  4JKM A;  2X8K A;  4O9E A;  4AFC A;  3JUU A;  3CU7 A;  2ZHL A;  3Q8E A;  3M8L A;  4ZS2 A;  1RUD 2;  1LED A;  2Y38 A;  3AK0 A;  3AKT A;  5FYC A;  3HD8 B;  1BZW A;  4LJH A;  5F5I A;  3WDT A;  2DBI A;  1HJG A;  3GBW A;  3JQW A;  1QOT A;  5D21 A;  1W0P A;  5FCC A;  4IV1 A;  1D0G A;  3D82 A;  1AR9 1;  4YRD A;  2PN5 A;  5HBA A;  5JMC A;  3C7E A;  1RJ7 A;  5HCF A;  3RZK A;  4XIK A;  3WQB A;  4JGZ C;  4ISQ A;  1RUH 1;  1WLT A;  4XUO A;  4XUT A;  1ZRC A;  2HBT A;  4JHZ A;  1V6K A;  3E97 A;  1NZC A;  2CHH A;  2DU1 A;  1O91 A;  3BPS A;  1NLR A;  1C8N A;  2JX9 A;  2R06 3;  3PLQ A;  2HLE A;  5HV4 A;  4MGY E;  1VAV A;  3VD7 A;  3VBS C;  5L7O C;  1NCQ C;  2VME A;  4QX2 A;  3CIH A;  3WEZ A;  1SLT A;  1VBC 2;  3FE5 A;  4DY5 A;  1LRH A;  2A6Y A;  3U4S A;  2IXI A;  1WZX A;  1HXS 3;  3I2F A;  5JR7 B;  5J1X A;  3C7O A;  3VZJ A;  4LHS A;  4YM2 A;  3NJX A;  1GR3 A;  4CDX A;  3T4H B;  1FV3 A;  1JMU B;  2W3J A;  4Y22 B;  3IWZ A;  1YXW A;  1Z7S 1;  1AYM 2;  4JGY C;  4QB2 A;  2RDR A;  4XTM A;  1UYY A;  2F4L A;  3VDB A;  1VBC 3;  2VZ3 A;  3WNK A;  2RDQ A;  3I2H A;  5FUP A;  3VKF C;  4GAZ A;  4QAW A;  3CHX A;  5EWS A;  1OLM A;  1D4M 3;  3VBU A;  4MXV A;  4M0H A;  3USS A;  2VQ0 A;  3L9J T;  5FP4 A;  1TMF 1;  2JB4 A;  3OEB A;  3THC A;  2ZGS A;  1POV 3;  2JG8 B;  3G6J B;  3PUA A;  5FMO S;  5J09 A;  5JSP A;  2DTY A;  2FQP A;  4Y20 B;  2HWB 1;  2WWJ A;  3KM5 A;  2HH9 A;  3UK9 A;  3WF3 A;  4J25 A;  2GDF A;  4UFH A;  5IW0 A;  2V5Y A;  1XE0 A;  4GKY A;  4BCU A;  4FFI A;  1Y9M A;  3IAP A;  2D6M A;  4YZ2 A;  4Q4W 1;  3SH5 A;  4IEX A;  4XZP A;  2WZR 2;  2YV8 A;  1F4H A;  2F17 A;  4LXL A;  4YVS B;  1X50 A;  4DZG A;  3POS A;  4PLM A;  3ZVX A;  4HPK B;  4ITC A;  4IUG A;  5BNQ A;  2QBX A;  4RHV 2;  4YWA A;  5EJ3 A;  3FMG A;  1JZ6 A;  2XBO 1;  2QQP A;  4MSV A;  3VBS B;  2D3S A;  5J36 A;  2VW2 A;  3KGZ A;  5FP7 A;  2X05 A;  3T4V A;  2R7E B;  4CEY A;  2VMH A;  4DPN A;  3MLL A;  4P9G A;  1SBF A;  2F4P A;  1EV1 1;  2BGP A;  3R4D B;  3OTF A;  1OFS A;  4HVQ A;  2OS2 A;  4P14 A;  5BNO C;  5FR3 A;  1S55 A;  1DLC A;  1CN1 A;  4HMZ A;  3POG A;  3OJB A;  1YIF A;  2ZEX A;  4W50 A;  1HRV 1;  2BVB A;  2YFU A;  3K48 A;  1R08 1;  3T09 A;  5C8W A;  5C9A A;  2ZX3 A;  4GJY A;  3ZFF A;  1UKR A;  2XJU A;  1FX5 A;  4LO7 A;  1MZF A;  1IG0 A;  2ZX0 A;  3UGH A;  5FZ9 A;  5KC6 A;  1NKG A;  2VM9 A;  2PLV 2;  1EYB A;  5FWE A;  2WA4 A;  3MIH A;  1AXZ A;  4TSV A;  3GCW A;  4UT5 A;  1VAK A;  4LIU A;  4OQ8 A;  4QGN A;  3VZL A;  3C7F A;  4JC1 A;  5T50 A;  3VBO A;  3JBG 2;  1RUF 2;  5CNA A;  3T30 A;  3OB8 A;  1VBB 2;  4M3C A;  5A6Q A;  3ETQ A;  2ZAA A;  1K5M B;  3SHR A;  4PDW C;  3BTX A;  5FMB A;  1VBA 2;  5CG8 A;  1AHS A;  5HCB A;  1FOD 2;  1XU1 A;  3J7N A;  1VMF A;  5EIY B;  3AP5 A;  4WM8 C;  4AQ2 A;  1MEC 3;  1QNY A;  1JN2 P;  4B7E A;  3PMS A;  3CJI C;  3AJY A;  4AI8 A;  3HR9 A;  3LD8 A;  5FUI A;  3LA3 A;  4A6O A;  1B35 C;  4CU7 A;  3LAG A;  2O0O A;  3WDY A;  3A0K A;  5LY2 A;  4CCN A;  4DS0 A;  5CG9 A;  3T1L A;  2Z79 A;  1SDW A;  5A80 A;  3KCC A;  4NPL A;  1ULC A;  3C8X A;  1LOB A;  4C0B A;  3R05 A;  4Y4R A;  2CV6 A;  1RVF 3;  5GKA C;  2VTX A;  3E5Q A;  2YZ4 A;  1VMH A;  4W4Z A;  4YZ3 A;  2YUE A;  1IS6 A;  3N9O A;  2WFF 3;  1GP4 A;  3OBA A;  3TEZ A;  3DYM A;  1NQJ A;  2R07 3;  2ZZQ A;  3HBK A;  2QUO A;  3TWI A;  2FMD A; 
#chains in the Genus database with same CATH homology
 1JU4 A;  4E8C A;  4XUQ A;  1JZ2 A;  3OG2 A;  3UNP A;  3T2P A;  3ACF A;  2VZR A;  2KD7 A;  2VZ1 A;  3MUZ 1;  3UES A;  3HEI A;  2ZEY A;  4QX0 A;  4DXR A;  3LEK A;  4DUW A;  1JU3 A;  1SG3 A;  1UXZ A;  2W47 A;  3CDZ B;  4XUR A;  2DCJ A;  4A45 A;  4YPJ A;  1UMH A;  2YB7 A;  3I97 A;  3ECQ A;  1WKY A;  2DDU A;  2V72 A;  4RN5 A;  1DYO A;  1UWW A;  3PUH A;  3HJR A;  3WNP A;  2VQU A;  3U37 A;  3J7H A;  4P00 B;  4QDS A;  4XUP A;  1J83 A;  1OD3 A;  3CKH A;  5JR2 A;  2Z4F A;  1MPX A;  1GUI A;  3OEA A;  3THD A;  4Z2A A;  2J1A A;  3OGR A;  4A4A A;  1GOH A;  3CZJ A;  2W1Q A;  4D0Q A;  1TG7 A;  3ABZ A;  2XQX A;  5DN2 A;  4HG6 B;  1UXX X;  3SEP A;  1W9S A;  5JUV A;  2XHN A;  2VZV A;  2JD9 A;  3K75 B;  2J1E A;  3VDB A;  4A42 A;  4OYU A;  4XVH A;  3IB3 A;  3GXU A;  1JZ4 A;  3HNM A;  4BXS V;  4ZZ8 A;  4P08 A;  2VQT A;  1KGY A;  3WNL A;  3SKV A;  2C26 A;  1NAE A;  3GDB A;  2VCB A;  5EJZ B;  3LPF A;  2XON A;  3VDA A;  5IYY A;  1W9W A;  3MV0 1;  3WSO A;  5LA0 A;  1JI6 A;  4A3Z A;  3ACG A;  5JXJ A;  3HPN A;  4FI9 A;  2J22 A;  1JHJ A;  1HN1 A;  1UZ0 A;  2VO5 A;  1W0N A;  2V5D A;  3WF2 A;  3SKJ E;  2WO2 A;  2YFZ A;  4CUC A;  1OH4 A;  2QQL A;  1CZS A;  1US3 A;  2RJ2 A;  2Y6L A;  1O59 A;  3A23 A;  4CVU A;  1UYX A;  2QQN A;  3T0D A;  3LPG A;  2J1R A;  3VD5 A;  2ZEW A;  1JZ8 A;  1OT5 A;  2V4V A;  5JXG A;  4D8M A;  1JYW A;  1W8N A;  1DP0 A;  3GGL A;  3CQO A;  5CYY A;  3BN6 A;  1R64 A;  3IDA A;  5IFT A;  1OF4 A;  3NJV A;  4ZZ5 A;  2EID A;  3K4Z A;  1W9T A;  4QB1 A;  2YG0 A;  2WQ8 A;  3K4D A;  1BHG A;  2BBA A;  5C7G A;  3W5N A;  1EUT A;  1W8O A;  1UY1 A;  2QQM A;  4PQQ A;  4MO3 M;  2ID4 A;  3MUY 1;  3K77 A;  2L9L A;  3WF1 A;  1J84 A;  1ULO A;  1XPW A;  4DXT A;  1PMJ X;  1O8S A;  2W1U A;  1PX3 A;  2WO3 A;  3HOB A;  1K3I A;  3JXS A;  2WZ8 A;  1CZV A;  1SDD B;  3D3A A;  3IAQ A;  4GZ9 A;  3T0A A;  4MAD A;  1UY4 A;  2LS6 A;  3P1I A;  4XZU G;  3C7H A;  2J1U A;  2J1T A;  4ZY9 A;  3CMG A;  3I2G A;  3HNB M;  1L7Q A;  2WAO A;  4GWI A;  3I3B A;  5LA1 A;  3HN3 A;  2JE8 A;  2XOM A;  2E32 A;  3WF4 A;  3P6B A;  4BK5 A;  2EIC A;  2X09 A;  4UOJ A;  3A22 A;  2WZE A;  2VCA A;  1XC6 A;  2WBK A;  2VMF A;  1PMH X;  1UY3 A;  4QX1 A;  2Y6K A;  4UAP A;  2Y64 A;  3A7Q A;  3UET A;  4CU9 A;  2WAA A;  2WO1 A;  1PX4 A;  2OKX A;  2C4X A;  3WNM A;  5G05 L;  1W99 A;  2J1V A;  4PT6 A;  5IHR A;  2B4K A;  2ZEZ A;  1TVG A;  2VL4 A;  4E8D A;  2VZP A;  4DUX A;  1JZ3 A;  3FHQ A;  2J7M A;  2ORX A;  2VZO A;  2W46 A;  1CIY A;  4TTG A;  2W5F A;  2E33 A;  3ACH A;  1KEX A;  2W92 A;  4KI5 M;  4M4P A;  1JZ5 A;  4QDQ A;  1LNS A;  2VMC A;  1H6Y A;  4XUN A;  5LA2 A;  2W1W A;  1JYN A;  2BER A;  2WN3 A;  1JZ7 A;  3FN9 A;  5DQ0 A;  5G04 L;  2Y6H A;  5JXH A;  4ARX A;  5HPO A;  1CX1 A;  4MGS A;  3OGS A;  2E31 A;  1NUK A;  3LE0 A;  1K45 A;  3FL7 A;  5DPN A;  3VD4 A;  2C9K A;  5A1A A;  1GOF A;  2Y6J A;  3C7G A;  2CDP A;  3VD9 A;  2VR4 A;  1GOG A;  2VZQ A;  4GWJ A;  4JKK A;  4CU8 A;  2WYS A;  2QQO A;  3BGA A;  5LCW L;  2QQK A;  3NQH A;  1UYZ A;  4QX3 A;  4AAX A;  4UI9 L;  3III A;  4DEV A;  4LKS A;  4MGQ A;  4ET7 A;  2Y6G A;  1GU3 A;  1UMI A;  2YC2 A;  2W9X A;  1IQD C;  3K46 A;  2RV9 A;  2ZXQ A;  3MO4 A;  3K4A A;  4P02 B;  1UX7 A;  5EJ1 B;  2W91 A;  1OF3 A;  2YC4 A;  2WAB A;  2DCK A;  4KMQ A;  4OMD A;  2PQS A;  5JMO A;  5HXM A;  1NX9 A;  2QQI A;  1SHW B;  3I2K A;  1L7R A;  1WCQ A;  4JKM A;  5IJR A;  4L0P A;  4BK4 A;  2X10 A;  4CU6 A;  3A21 A;  4ZXE A;  3WNO A;  3PUI A;  3C7E A;  2VZS A;  1K12 A;  2LW8 A;  3WQB A;  3LQC A;  3EYP A;  4XUO A;  4XUT A;  4JHZ A;  1K42 A;  4DEQ A;  1I5P A;  2HLE A;  3HNY M;  4BJ0 A;  3VD7 A;  2VOT A;  4CUB A;  2VME A;  3GM8 A;  4QX2 A;  3CIH A;  3WEZ A;  5C71 A;  3OGV A;  4LQR A;  3DYO A;  3NRU A;  5J1X A;  3I2F A;  3C7O A;  4LHS A;  1EUU A;  3NJX A;  5B4X A;  3ZM8 A;  3MV1 1;  2W3J A;  1GNY A;  3WF0 A;  1XNT A;  4QB2 A;  3DYP A;  1UYY A;  4ARY A;  1XNA A;  1JYV A;  2VZ3 A;  3VD3 A;  3I2H A;  2EIE A;  3WNK A;  4A44 A;  4QAW A;  1O8P A;  4QDR A;  1RYY A;  3T2O A;  1ULP A;  3T2Q A;  2W1S A;  3OEB A;  3THC A;  2W94 A;  4JX0 A;  3ACI A;  3F2Z A;  1P8J A;  2VZT A;  1YQ2 A;  5JXI A;  3WF3 A;  2JDA A;  4MOA A;  2RVA A;  3I2I A;  4JKL A;  3IAP A;  2Y8K A;  3NNG A;  4DXS A;  3SEE A;  2BGO A;  1F4H A;  4OUE A;  2VC9 A;  2BZD A;  4IUG A;  3DEC A;  1UY0 A;  2QBX A;  5F7U A;  3FHA A;  3LEI A;  1JZ6 A;  3EB7 A;  2JKX A;  2VMD A;  2X05 A;  2R7E B;  4P5Y A;  5C70 A;  2VTF A;  2BGP A;  4DUV A;  5B4N A;  4RYD A;  5I0D A;  4A41 A;  2B9V A;  1DLC A;  4M4R A;  2WUH A;  3LEG A;  4PF1 A;  2ZEX A;  4W50 A;  2VCC A;  2YFU A;  3T09 A;  5DMY A;  4OMC A;  3MBW A;  1CZT A;  2CDO A;  3I3E A;  1NKG A;  2VM9 A;  4BDV B;  1D7P M;  2ORZ A;  3W5M A;  4QB6 A;  2WN2 A;  3C7F A;  2QQJ A;  3OB8 A;  3I3D A;  4TXW A;  3AC0 A;  1F4A A;  5EIY B;  2W87 A;  1H6X A;  3I2J A;  1T2X A;  1US2 A;  2VZU A;  5FUI A;  4A6O A;  4CU7 A;  3E1F 1;  3CZU A;  1GQP A;  2HYX A;  4KWU A;  4QPW A;  3T08 A;  4LPL A;  3T0B A;  5IFP A;  2E26 A;  3C8X A;  2WDB A;  3WNN A;  2VJX A;  3VDC A;  4OZO A;  4W4Z A;  4CUA A;  2EIB A;  1GMM A;  3ETP A;  4AG4 A;  3OBA A;  4W8J A;  3DYM A;  2J1S A;  2W95 A;  1UY2 A;  1JYX A;  5CZK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...