5LCWL

Cryo-em structure of the anaphase-promoting complex/cyclosome, in complex with the mitotic checkpoint complex (apc/c-mcc) at 4.2 angstrom resolution
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
183
structure length
182
Chain Sequence
TPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVESSIGKFPRCTTIDFMMYRSIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of APC/C regulation by the spindle assembly checkpoint.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords Anaphase-promoting complex subunit 1
total genus 30
structure length 182
sequence length 183
ec nomenclature
pdb deposition date 2016-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF03256 ANAPC10 Anaphase-promoting complex, subunit 10 (APC10)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 5lcwL00
4OUEA 3WNKA 1H6YA 4UAPA 4MO3M 3I3BA 2QQMA 4PF1A 2W87A 4E8CA 1R64A 2QQIA 2Y6GA 3AC0A 1DLCA 4JKLA 1UYZA 3A21A 4XUTA 3WNLA 2DCKA 5C7GA 2RV9A 2VZTA 2VZPA 2YC4A 3MO4A 3VD9A 5DPNA 3T2QA 3I2FA 4FI9A 4W4ZA 1YQ2A 3NNGA 1US2A 3CIHA 2WO2A 4UI9L 5JMOA 3SKVA 1JZ8A 2VZ1A 1DYOA 4QDRA 5C71A 2E31A 3LE0A 4ET7A 3J7HA 4P08A 2WN3A 3I2GA 4MADA 2WDBA 4DXSA 3WNOA 2QQLA 4YPJA 5EJZB 1WCQA 3UESA 1CZTA 1I5PA 2HYXA 3FHQA 1US3A 3WF4A 3PUHA 2VQUA 2W46A 2VCBA 3THDA 1NX9A 2RJ2A 1GOHA 3T2OA 3VD5A 2W1WA 1LNSA 3UNPA 2JD9A 2W47A 3C8XA 2VMDA 2QQJA 3C7HA 1GU3A 1KEXA 1W99A 1JU3A 2W1UA 3K4DA 4RN5A 3IIIA 2VMEA 2J1EA 4ARYA 3W5MA 4QX3A 1O8SA 4ZXEA 3W5NA 2W1QA 4QB2A 3A22A 3MBWA 4P00B 1T2XA 1GUIA 4XUPA 5JR2A 4D8MA 3WQBA 1UY4A 3LEIA 4E8DA 2WZ8A 4Z2AA 5F7UA 2Y6HA 1L7QA 3FHAA 1UY2A 1IQDC 2BBAA 4RYDA 5IYYA 2YFZA 4AAXA 3OG2A 1W0NA 4QB1A 1OF3A 3K75B 3K77A 3HEIA 3VDCA 3A23A 2CDPA 4QX2A 2W9XA 2ID4A 3THCA 3MV01 4D0QA 2W1SA 4DEVA 3HNYM 4XUNA 5DQ0A 3SEPA 1EUUA 4QX1A 2Y8KA 2JE8A 3NQHA 1W8NA 1H6XA 4L0PA 1MPXA 2J1AA 3P6BA 4JKMA 5LA2A 3ZM8A 1UY3A 3I2JA 3GM8A 1JHJA 4ZZ5A 1JYVA 1L7RA 4P02B 4DUVA 3IB3A 4TXWA 3NJVA 2OKXA 3IAQA 1CZVA 4OMDA 2BERA 4BDVB 1UXZA 2QQKA 4W50A 3WF3A 2ZEXA 2VZOA 5I0DA 1WKYA 3WF1A 2JKXA 1XNAA 3IAPA 1CIYA 3EYPA 1XC6A 3ACIA 3VD7A 2Y6JA 4M4RA 4ZZ8A 1W9SA 3GXUA 5IJRA 3C7GA 2VCAA 3BGAA 2W94A 2WYSA 4OZOA 1JYXA 3FL7A 3MUZ1 3EB7A 1HN1A 1OH4A 4CVUA 3C7OA 4OMCA 5JXHA 1JZ3A 1UY1A 4QPWA 5LA0A 4TTGA 1O59A 2WO3A 1JZ4A 2WQ8A 3LEKA 1OF4A 1W8OA 1PX3A 2BZDA 3ACHA 3PUIA 3K4ZA 4LHSA 4P5YA 4W8JA 3LPFA 2QQOA 3K4AA 3ETPA 4GWIA 4XZUG 3T0AA 1JI6A 1JZ6A 1D7PM 4QDQA 2J1SA 3A7QA 1CZSA 4A4AA 2E32A 4A44A 3T2PA 1UYXA 4M4PA 2W5FA 3K46A 2ZEYA 2J22A 3SKJE 1CX1A 2ZEWA 2J1VA 1JYNA 3T09A 3BN6A 2LW8A 5HXMA 2RVAA 1UZ0A 3I3DA 3UETA 3I2HA 5G05L 2WAAA 2VMFA 2VR4A 1UMIA 1NUKA 2BGPA 2VJXA 3DYPA 2YC2A 3OGRA 4QDSA 4BK4A 2VCCA 3I2KA 5DMYA 2Y64A 5J1XA 2C26A 2WABA 2Y6LA 4CUBA 3T08A 4QAWA 1UXXX 2W95A 2J1RA 3MV11 3CDZB 5EIYB 4CU7A 3CKHA 1F4AA 2VZ3A 3OB8A 4GWJA 5FUIA 4CU8A 1OD3A 3I97A 2JDAA 4CU6A 2J1UA 2PQSA 3LQCA 4MOAA 2E26A 3P1IA 5JXIA 2L9LA 5B4NA 1SHWB 2J1TA 4A3ZA 1JZ7A 4CUCA 3F2ZA 1K12A 4KMQA 3LEGA 3HPNA 5JXGA 5CZKA 5JUVA 3WNNA 3CQOA 2XONA 1PMHX 4DEQA 1UX7A 2J7MA 4XVHA 1GNYA 5CYYA 5JXJA 4XUQA 1GQPA 5IFPA 1PMJX 3C7EA 3CZUA 3OEAA 3LPGA 3HNMA 4JX0A 1BHGA 3WEZA 2WBKA 1J84A 2Y6KA 2V4VA 4JHZA 1OT5A 4MGSA 1XPWA 3WNMA 5A1AA 1GOGA 3HJRA 2VZRA 2R7EB 2YB7A 3CMGA 2VQTA 3I3EA 2X05A 4BXSV 1NAEA 4XUOA 1GOFA 3U37A 2V5DA 2W91A 2W92A 4IUGA 2WAOA 5IFTA 5HPOA 5LA1A 3FN9A 3OBAA 2VM9A 4OYUA 3ABZA 3OGVA 4DUWA 3VDAA 4KI5M 4XURA 3ECQA 4DXTA 5C70A 3T0BA 1JYWA 2WO1A 4BJ0A 4BK5A 2VZUA 1P8JA 4JKKA 3HN3A 3GDBA 2VZSA 3JXSA 5B4XA 1K45A 3OGSA 1JZ2A 1NKGA 1XNTA 2DDUA 2WZEA 3VDBA 2HLEA 2V72A 4A41A 2XOMA 1UWWA 2ORZA 3WNPA 1K42A 2EIDA 4PQQA 3IDAA 3DYOA 3C7FA 1F4HA 4ZY9A 2VL4A 2EIEA 2EICA 1W9WA 1ULOA 1JU4A 4LPLA 3WSOA 4AG4A 3MUY1 1K3IA 2KD7A 5DN2A 3HNBM 4CU9A 1UMHA 2YFUA 3CZJA 3DYMA 3HOBA 4HG6B 2XQXA 4KWUA 2ZEZA 3ACFA 4A45A 2VMCA 2VZQA 2DCJA 3GGLA 3SEEA 2X09A 4GZ9A 4A42A 1UY0A 3WF0A 3VD4A 4DUXA 2VC9A 2C9KA 2CDOA 3E1F1 2E33A 1JZ5A 3OEBA 4QB6A 1UYYA 2B4KA 2QBXA 2WUHA 2B9VA 4PT6A 1TG7A 2X10A 2ZXQA 2QQNA 2XHNA 5G04L 4DXRA 4LQRA 1GMMA 3D3AA 1RYYA 5LCWL 1O8PA 3ACGA 2LS6A 1EUTA 3VD3A 4QX0A 1PX4A 1KGYA 2WN2A 3NJXA 2C4XA 2VO5A 5EJ1B 2VOTA 4A6OA 2Z4FA 1SDDB 3WF2A 3I2IA 3T0DA 1J83A 2ORXA 4CUAA 2VTFA 2W3JA 3DECA 5IHRA 1DP0A 4ARXA 1TVGA 4LKSA 4UOJA 3NRUA 2EIBA 1SG3A 1ULPA 2BGOA 4MGQA 2VZVA 1W9TA 2YG0A
chains in the Genus database with same CATH superfamily
4QGMA 4OUEA 5A6XA 5C5UA 3NNFA 4NHXA 5JWPA 1H9WA 3B5LB 1O5UA 3KB5A 4MVTA 5GZFA 3J4UH 4UAPA 3RJRA 4A7ZA 5GZEA 1ODMA 4I01A 4PF1A 2ZBJA 3VBHA 4FXGB 4AI2A 1RUJ1 2WFPA 4JRLA 1WZXA 3AZYA 2GC3A 2Y6GA 3NVCA 2W2IA 3AC0A 4GD4A 1LENA 3WNXA 2XB6C 1H0BA 3AM2A 2DBNA 3UJQA 1QOSA 5JZGC 3U10A 4NMIA 1SFNA 4HONA 3WNLA 2DCKA 3AP4A 4PI2A 2BDRA 1JOPA 2XWBB 2VZPA 1U5IA 2BFUS 3N9LA 4FT8A 1FX5A 2ZZJA 2RS52 2XL7A 1W6MA 1OUXA 2WS93 3OF1A 1G9DA 1NE4A 2HWF2 1ND3B 4EWEA 1F9KA 4FAGA 1YQ2A 3HT2A 5BNOA 4EV0A 2FCVA 1US2A 5I0SA 1VBB3 3LFIA 5IK8A 3AYAA 5FXXA 1DQ4A 5JMOA 1JZ8A 5CB7A 4CXWA 3AMMA 4AEMA 4O7XA 4BQYA 2PHLA 4XFHA 5I8SA 3KV6A 4ZU4A 4P08A 3WCSA 5FPVA 1SPPA 1VBD1 2VAUA 4BMEA 3NNJA 4LUMA 4QQPA 1LU1A 1PVC3 5FJKA 2XR4A 3N7JA 4J1XA 2ARXA 2WDBA 2YGMA 3WNOA 4YRDA 4YPJA 3ZXKA 3GALA 4Q4X2 2XJUA 2GSYA 1OPOA 1RUH1 4QQHA 3TOJA 2G9ZA 3KZ4C 4UW6A 1QXJA 4KBZA 2WO7A 3OPZA 5FUNA 1ZRCA 2QZ2A 4QM8A 1GWLA 1QJX2 1V70A 1W3XA 3VKLA 3Q8BA 2G19A 1WLWA 2RS11 3WF4A 4QXHA 2VTXA 4CTEA 2E9QA 3PUHA 3ZDSA 3WINE 4AFCA 1PGL2 1Q8QA 1PO12 4XXPA 5ANQA 1W6PA 3JD73 1VBC1 2UWAA 4YG3A 2HH9A 1LNSA 3ZYBA 4XABA 2P3JA 2JB8A 4CEWC 1QKQA 5A3MA 3ALQA 1AJOA 1UU6A 4LO7A 1W99A 3KF5A 2YBKA 2DTYA 3ZYPA 1RUG1 2BEOA 3EBRA 3M7AA 2VMEA 1LAJA 2DF7A 3W5MA 4QX3A 3AKQA 2JENA 5FJHA 4P00B 5DABA 1DIWA 3WX5A 4BQ5A 3OPWA 1REFA 2CY6A 3ZN4A 4AHXA 1W90A 1H2LA 3WQBA 3BVCA 3V0AB 4XFIA 4Y1UA 5LRRA 3ROUA 4Z2AA 2H0VA 3AYDA 3WXPA 2Y6HA 3AMPA 3H42B 4O65A 4CEYA 3ZR5A 2AR6A 4IE6A 2ZOEB 1UY2A 4U36A 1G9CA 4Y20B 4D6RA 4HN0A 4QXCA 2JG9B 5FO8B 2KR2A 3UGGA 1JOBA 2A6XA 4QQ2A 5IYYA 3AP9A 3PUAA 4IERA 5T52A 5F1RA 3O0VA 3ZXFA 5A3OA 1DQ0A 1GP6A 3RYRA 4CDXC 4OI4A 3K77A 1ULCA 2R071 4JQTA 1AYM1 4QKFA 4XMIA 3VDCA 2WT1A 1CAXA 4IV1B 4DRRA 4B8EA 4YW1A 1IPKA 5HCHA 3R4UA 4HPKA 3W59A 2W9XA 2ID4A 5FKCA 1HRV1 3MFCA 3W58A 4D0QA 2NPIA 3HNYM 1AR71 3CBNA 1YQCA 4AGVA 2ZMKA 1LOAA 3H7JA 2RS32 3SEPA 1KDKA 1G9AA 4RHV2 5FYVA 4AE2A 2Y8KA 2CL2A 5J36A 3Q8EA 4IEYA 4BZ4A 4WVVA 1FI2A 4LXLA 1IS4A 1H6XA 1EV12 1GZWB 3PVBB 4M00A 1V9U2 2J1AA 1I6XA 3ZM8A 4AI3A 4XJZA 3WHUA 1E5HA 1TMF2 2WA3A 1UY3A 3I2JA 3GM8A 5F5IA 3I54A 4KH9A 1QHDA 3PIJA 4P02B 3BTAA 1COV1 4DUVA 1EYBA 1PGL1 3KM5A 4RS5C 4GKYA 4TXWA 5HI0A 3VUOA 3BTZA 4Q4W3 3IAQA 3WR0A 1JODA 4RL7A 3SCFA 2UYAA 3VBFA 2WLQA 1UXZA 2QQKA 5F3GA 3O12A 3VZKA 3I4IA 4BDVB 2VZOA 3O1UA 2ZPXA 4OUMA 2XQRA 5FV3A 4GB32 3RFRA 4FPEA 4MGTA 4YSFA 4XQDA 4GQ7A 5A33B 1LHOA 3LA3A 4E4SA 2HWE1 5CVRA 3BTXA 2VG9A 1B35A 2RMU3 1W05A 3NAPC 1A8MA 3POEA 1CIYA 3EYPA 2Q8CA 1XC6A 1DQ1A 3NSTA 3WD5A 5KR7A 4Z8BA 2JD4A 2XH6A 4NHKA 4XAEA 3BODA 1MVQA 1QJZA 4Y22A 1W9SA 5J96B 3C7GA 4ITCA 2RJKA 2X5IC 5FYYA 5AC91 1HB1A 1V6OA 1JYXA 3AMHA 4OHVA 4META 4OZOA 1FMD2 3LOIA 3FL7A 2VW2A 3MUZ1 3OSDA 5I0UA 2ZX4A 3C7OA 2XJTA 4KWKA 4FFIA 2HWB1 4QPWA 1EAH3 1LHWA 4YVSB 5A33A 4TTGA 4RFT0 1OVPA 1AR92 3W9AA 1O59A 3KHCA 2JIGA 2I07B 3CLPA 3P3PA 1ULFA 2HWD2 1V6KA 1WW4A 3HIFA 2VOKA 4QPGA 1QGLA 2C5DA 4IEPA 4AVVA 3VN4A 1IS3A 3PUIA 5FUPA 1JUHA 1OLMA 1W39A 2VQAA 4LHSA 4Q5OA 5FZ7A 4LBMA 5DAXA 4GWIA 3K4AA 3E6BA 4RHV3 3ZN6A 3BYWA 1DF0A 2EXJA 2ZGOA 2D3PA 1WD4A 1ZA4A 2J1SA 4LKFA 5CNAA 4CDUB 2E32A 3P3NA 5E89A 2P3KA 3K46A 4I3GA 4CCOA 2ZA9A 1ODNA 3IDEA 1DGRA 1NQJA 3ES4A 1GP5A 1NY72 3USUB 3VKOA 3ZSJA 3BOWA 2R6QA 4I0BA 1TZOA 3J7NA 3ZIXA 1ENSA 2ARAA 3I2HA 1RL3A 3ZFFC 3GJAA 4S2DA 1SQ4A 1NUKA 4IV3C 5FZKA 2BGPA 3S6PA 3FC0A 5L7OB 1E5IA 2VUDA 4MZUA 4N53B 4ZXKA 4MG2A 1ZBA1 2Q30A 4RGKA 4WZFA 1QH7A 1D2QA 1SZBA 3RI9A 4YWAA 2D6OX 4XBLA 3I2KA 2DVBA 5DDJ1 3H1MA 5IT6A 3RS6A 2Y64A 2C26A 4N43C 3ZN6B 3RWNA 1RGSA 1RUJ2 4QAWA 1SBDA 4NAMA 5CFDB 5KHGA 3OBZA 4ZKTB 3WDXA 1BZWA 4CU7A 2A71A 1T6GC 3ZFFB 4S2GA 1R091 4Q4Y3 4Y22B 1TQ5A 1FAYA 3G6JB 2GC2A 3PJQA 4XJUA 2GMMA 2EA7A 5CAZA 5L73A 1F2NA 2V4AA 1HRI2 2JDAA 1LEDA 2O0OA 4GMP1 4IEWA 4XFBA 3V56A 2J1UA 3LQCA 4MYEA 3HT1A 4JAAA 4QXBA 2E26A 1OQDA 5B4NA 2P37A 5EJ3A 5BNPA 1BBT1 3DEMA 3LFMA 3MPPG 3ZSMA 2TBVA 4A3ZA 4CUCA 2FDFA 2XMLA 2VMGA 4OZXA 2JDZA 2RM23 3JBG3 3KS7A 4FAHA 2OW4A 3H50A 4P9LA 2KM2A 3RDIA 2MNGA 4BA6A 2XJPA 4BXFA 3UGFA 2VY0A 3ZFEA 3N7LA 5JXGA 1WBLA 4JTOA 5IVFA 3H8UA 5JUVA 1GKBA 3GZAA 4NR1A 1DBNA 3WNNA 1B35B 5T55A 4CSWA 1PMHX 4QKBA 3CL1A 1RUE3 1KJLA 3RZHA 3H0OA 4FPCA 3RJ2X 2JIJA 4DEQA 4J1WA 2VUCA 3UKNA 3WDWA 3E5QA 4QPGC 1RVF1 1X50A 4DNYA 1MQTB 4YM2A 2GP5A 2F6BA 1HQNA 5F5CA 1JH5A 1PMJX 3CZUA 4R9BA 3OEAA 3V64A 2ZJCA 2VOWA 1VAVA 5C9AA 3FWEA 4NPRA 5CG9A 2R49A 4CE8A 5ISLA 3B94A 5FQ0B 1RMU1 4GULA 3MLJA 4YZ2A 2ZGLA 2YPJA 1XJAA 2C24A 3X29B 4AQ6A 1ZBA2 2VZRA 1B35C 1C4RA 4I2OA 3ILRA 1V0AA 2WNUC 1S0DA 4UYBA 2UY9A 4Q4V2 5F9TA 5F5QA 2CYFA 2X05A 3B69A 4BXSV 5C6CA 1XU1A 1PGSA 1VAMA 1LOGA 3AB0A 2LRPA 1NE6A 2GDFA 5FY0A 1GOFA 3WT3A 3OYWB 1RUJ3 2D7FA 1VRH3 1QXPA 1SLCA 1W8TA 1XOYA 4Z07A 4KWJA 4UFJA 1MVEA 5FP9A 3TN92 3SH3A 4W65A 3GCXA 3DGTA 3ZLIA 5IFTA 1WW7A 2TUNA 3B93A 4MX3A 1A8DA 4IGPA 2P17A 2PHDA 5LY1A 5D1IA 3UGHA 4E2GA 5K9YA 3O1OA 2VTXJ 2VVFA 3RWKX 4FSJA 4FPLA 5HCBA 3E5XA 4QXKA 2P4EA 4LNVA 1RUD3 4GH4B 4YZ1A 2QVSB 5FREA 4MHRA 3HN3A 5EXOA 1FPN3 2HBTA 1OPMA 1LOCA 2OVUA 2EXHA 3J26N 2YGLA 2WZEA 3AVSA 3VDBA 5EQUA 2RE9A 1WCUA 3H1WA 1Y9QA 4P9IA 1RINA 1C5IA 3IDAA 3DYOA 3E97A 2E7QA 4QMAA 5GJ6A 2JEMA 3TWIA 1RUE2 2LUWA 1I9RA 4XC9A 2RDNA 5L19A 3ZYGA 1D0HA 1HN0A 1JU4A 1V6MA 2ZGQA 4M3CE 4SBVA 4EN6B 1F5JA 1V6NA 1R1A3 2A3XA 4LPLA 4CCLA 2GAUA 4AG4A 4LHNA 5GZCA 5DN2A 1MS4A 2GZWA 3HNBM 3LAGA 3LDBA 3TNQA 4IL7A 5LBFA 3MICA 5EZWA 3DYMA 4IGOA 4AI8A 3VZJA 2XQXA 1NXMA 1LOFC 3NWKA 4GWMA 2VMCA 4HBNA 5GZGA 4C91A 1BXHA 2OQ7A 2VGDA 4AFAA 1UOBA 1X8MA 3VBOC 3TEWA 1PK6B 1XNDA 2O8OA 2YMZA 3WY6A 3R4SA 1LGBA 2JE9A 2FCUA 3AVRA 3AZVA 3B7MA 4DUXA 4FFGA 1C3HA 2QDRA 3BI3A 5FMOL 4CPBA 2CDOA 1OFNA 4CCEA 4BLIA 4DY3A 1LTEA 1ZZCA 4Q8KA 2HWC3 4CXYA 4IEUA 3ON7A 1E5SA 1BK0A 1UYYA 3AL6A 3JU9A 4DINB 5FBZA 2PAKA 1VMFA 2B9VA 3IBMA 3VHOA 1TG7A 3ZX7A 4XHBA 4D69A 1LJ7A 4OI0A 1A6CA 2F4PA 2W68A 4PIXA 3ZSEA 3LGRA 4OI1A 1GBGA 4YFWA 1DLLA 4COZA 3RZLA 3GYDA 1ZZ7A 2WS91 1O4YA 1WCKA 4TSVA 2NP0A 4QX0A 1YRZA 4NRPA 3I3QA 2RG4A 3NJXA 1POQA 2C4XA 4EE2A 2ZGNA 2VO5A 2ZAAA 1C8M3 4LBOA 2BU9A 5CFCC 4DY5A 3I2IA 3INAA 3PVOA 5A3LA 1H2KA 2EF6A 3VBRA 4IW3A 3D0SA 4CUAA 2W3JA 5IHRA 2HWB2 3DPRB 5JOXA 3LA7A 2PHUA 3DXTA 1OUSA 3HBZA 3K2OA 3NRUA 3LB9A 3U4SA 2ZGMA 1H9PA 1HQWA 4XF0A 2FMYA 2NYYA 1UF2C 1NCRB 2X5IA 5IUQA 4AW7A 1SG3A 1GR3A 1ST8A 1ULPA 1OKQA 2BGOA 2GNBA 2WSVA 4MGQA 2VZVA 4N43A 4Q27A 5KHIA 4ZHNA 1NXD1 4Q1PA 4CA9A 1FNZA 3WNKA 4N9IA 1H6YA 5KXDA 1CAWA 4XAAA 4HVQA 1N1VA 1CJPA 4JDOA 2QQMA 1VBC3 3BCWA 2K2SA 1C8M1 5IAXA 2RS51 4K3UA 3SMHA 3VBRB 3IN9A 4MXVA 4X8PA 2XXZA 3N9OA 3LDRA 1VPHA 3NV4A 2RDSA 3MLLA 3DPRC 1AL0G 2ZACA 1SLTA 3ETQA 4LK6A 4LHLA 4JKLA 4HMZA 3WDYA 1UN1A 2WT0A 3AP6A 4RR3B 2ZMLA 3A21A 4ZU5A 4GMP0 3TN93 1OXCA 2AH2A 2VOVA 1VBA3 2XBO3 4NJ4A 5K4LA 2NM1A 2UU8A 5IW0A 2D6KA 2G9GA 1RUF1 2XPJA 3DF0A 1DFQA 3I2FA 5FZ8A 1SFYA 3VGIA 2ADDA 1YLLA 4W4ZA 2OZJA 2R041 1QDOA 4GALA 4QPYA 3VBFC 2R0FA 5IVVA 3CIHA 5AVPA 1KFXL 3SC7X 2AC1A 3VZOA 1VIWB 3K48A 3ZFFA 3J9SA 1JS9A 2FBEA 2VZ1A 3N35A 4QDRA 1UCXA 2YV8A 5AC92 1WMEA 5C71A 4LA3A 1RVF3 2JB4A 3UJOA 1ZZ6A 2VVDA 3VLBB 4QD2A 1GSLA 3U1XA 4LULA 3ILFA 5GLZA 4I3PA 1WWYA 4XFGA 3BTYA 5GLVA 3TBDA 5EJZB 2G9FA 1B09A 5FZLA 1GYKA 2YZ4A 5F2SA 1R1A2 2YXSA 5A3TA 1W8HA 1AX2A 1XB9A 1ENXA 3ZSLA 2OA2A 2VUJA 4MGIE 3OGJA 1Z7S3 5C3RA 3ZYFA 1CAVA 1UL9A 1HB2A 4OI2A 4HSLA 2D6MA 5FP7A 1CJDA 5T54A 5C9AB 2I74A 5LBEA 1F15A 2VCBA 5FYSA 3THDA 1NX9A 3ZXGA 1W6NB 2RJ2A 3FLPA 3T2OA 3VD5A 5JPNB 2R0HA 1ZZ9A 5FYHA 3VBOA 3C7HA 4O61A 3T1MA 1W9YA 1YWKA 2VXJA 3WUDA 1AXKA 4TLGA 5FZ9A 1PZ7A 4FPHA 5A6QA 4IEOA 2Q1MA 1GV9A 5FMDA 3MF6A 1YQ8A 5BY5A 4RN5A 2MEV1 3IIAA 2XKOA 3DV8A 1OLRA 1O8SA 2W1QA 1LGCA 1O5LA 5BPXA 4K8FA 2BP6A 2GH2A 1IHMA 2GC1A 5FXZA 1GUIA 1HRI3 2BRTA 4RQPB 2QUOA 4LITA 4XF1A 1UY4A 2XJSA 5A32B 4QT6A 3JD72 3QCWA 4ONUA 4URTA 4XIOA 3FBYA 5F7UA 1TMF3 5JMCA 3MIBA 4LLFA 3PUSA 4HPKB 3S57A 5FY1A 5I8TA 3HAGA 4Q2FA 1H4HA 3R0RA 4XIKA 5A7PA 2HJIA 4KL1A 2V09A 2FD8A 4LKEA 3ASIA 1ASJ3 2PAMA 4RYDA 1MS0A 2WNUB 2W0XA 4IE4A 2O1QA 3OD4A 4AGRA 1V6JA 3POJA 1OF3A 1OLQA 1S55A 1SCRA 2GU9A 2YROA 4RGGA 3H1YA 4F7ZA 1XQNA 3EXUA 1ND2A 4AEJA 4BQ2A 5JOYA 3BU0A 2PYTA 4QX2A 5FZCA 1PK6A 4KGQA 4JRAA 2W1SA 1C28A 1BQPA 3POIA 2BNNA 4PDWA 4Y1YA 1GWMA 4WM8C 4IDZA 1HRI1 4HFSA 4QX1A 5FZOA 2JE8A 2Q1FA 4RA0A 4KU7A 1W8NA 1EY2A 1QWRA 5A3WA 1MQTA 1W3VA 3PMEA 3POSA 4L0PA 1MPXA 4JKMA 1Z7S2 3UT0A 1LECA 3IDCB 4FOWA 1U0AA 2WFF2 3IPVB 1JHJA 4GH4C 3H7YA 4ZZ5A 2G4IA 1JYVA 2A3YA 2ENRA 2HEWF 5FZEA 2XJQA 1AL22 2C0ZA 5FPBA 2DUOA 1QQP2 4Z1VA 4OCTA 1CZVA 5JLVA 5DUUA 3VBSA 2UURA 2ES3A 1BEV3 4BPZA 4W6YA 4E2QA 2BERA 1LHUA 2CWSA 1COV2 1AXYA 3C3VA 3NAPA 4W50A 4Y5SA 4COYA 1FMD1 1ENQA 4LTAA 5I0DA 3ZFEC 4D6SA 1RTVA 3H3LA 3PHMA 4Y33A 1LKNA 3ES1A 1V9U3 4MXWB 4NWWA 4PI0A 2GNMA 5HV4A 3IAPA 4LIUA 5LZ6A 2HEYF 1DDLA 4GA9A 1EV11 3POFA 3WW3A 2AYHA 4UWDA 4JV4A 1POV1 2Y6JA 2ZHKA 4M4RA 1SCSA 4ZZ8A 4Z2WA 5JIUA 5IJRA 3LKJA 1YJLA 3D4KA 4OLLA 4HLTA 2IZWA 2WNVC 1GZWA 2W94A 2CAUA 3B3QE 3SH5A 1E5RA 1HN1A 1W04A 2X53S 4Q4V1 1C8NA 2E63A 1BEV1 5FYBA 1T6BX 4Y20A 4AL9A 2VPVA 2Q0AA 1UY1A 2HEVF 4GIQA 4LKDA 1AYN2 4OFGA 5FYIA 3THTA 3MZHA 2DVAA 4K6BA 3A0KA 1RUG3 1W2AX 1W0OA 2WO3A 1CVNA 1G86A 3KLSA 3ILNA 4CP1A 4Q4Y1 2ARCA 1JZ4A 3SITA 1O3RA 3MW2A 4IV1C 4Q26A 1MACA 1ONAA 2WQ8A 5JOWA 2B46X 2BZDA 3MLKA 1UYPA 1KITA 2IXLA 3K4ZA 4HSJA 4P5YA 1LULA 5EPAA 1TME1 3LPFA 2VOXA 3CO2A 3L2HA 4AQSA 3M3IA 1XNCA 1S0EA 1Z0HA 3DXUA 1IG0A 1TEIA 3MI8A 4YW4A 1LRHA 1K5MA 4RS5B 3WDTA 3DKWA 1AZDA 1U12A 2GMEA 2J22A 2OZ6A 2BBVA 5ABJB 4RQPA 4N53A 3AKPA 4RGAA 5A80A 3WUCA 3ZYRA 4H7MA 4Q0VA 3O1MA 2ZEWA 3OCPA 4L2NA 5DDJ2 5CKMA 1TE1B 4W6WA 3AFGA 3VHRA 3ZDVA 5JCTA 1N3OA 1N1SA 5HXMA 2C6SA 4IESA 5FY5A 3AZZA 1UZZA 1ZRFA 4LT5A 2DFCA 2JE7A 4XDQA 3IPVA 1U5YA 4BQXA 5FR3A 4NHMA 2VR4A 1PGW2 1LOEA 1URXA 5F39A 4WBBA 3HBKA 1FV2A 3EQEA 5LK5A 1C57A 2A7AA 1W6MB 2Z2SB 5F6KA 3AKTA 2JDYA 2PELA 2X5IB 1HXS3 2B7YA 1H8VA 3I7DA 1O3SA 1QQP1 4XE9A 5A7WB 1MZ5A 2VCCA 2CAVA 1E57A 2WIIB 3R4DB 3LEMA 4I02A 4XXAA 4CUBA 2WABA 1VE0A 2Y6LA 4ZS3A 4EN9B 3GZUC 5IWFA 3ZMNA 3EHKA 5KC5A 5FZ6A 5EIYB 1S0JA 4G9SB 5FZ4A 4NRQA 2A75A 1UAIA 2DVFA 5EHDA 1NY71 1CPMA 5DG2A 1HQLA 1F4AA 2VZ3A 5FUIA 1AR81 1DZQA 1LEMA 2DUQA 4CU8A 1BLZA 4F8AA 5JSOA 3I97A 4Y24A 4LJHA 4EQVA 4UFKA 1GP4A 1ND3A 2DWRA 3GBFA 4CU6A 2A70A 1JMUB 2BQPA 4AVCA 1QJU2 3BIWE 4YM1A 2VUAA 2ZCWA 2FQPA 1RHI2 4QU2A 1JZ7A 1ENRA 1CIWA 3CJIA 3F2ZA 1AR62 1OA3A 2VMHA 3GNEA 3POBA 1J3QA 1QEXA 3HWJA 5JOZA 1KD7A 2AEZA 4UFLA 5CIRA 5FWJA 2XJRA 2UYBA 5CZKA 3O0WA 2BWAA 1CAVB 4CCKA 3LD8A 1VRH2 4Q4Y2 4QU1A 1QY4A 1EAH1 1XU2A 3QBQA 3RNSA 3ZYIB 5JZGB 3MYXA 1YFWA 4CPBD 5LW9A 1OA2A 1KS4A 1NZCA 4XVHA 1DHKB 2VECA 4XETA 1FT9A 5CYYA 3WW4A 5JXJA 1EP0A 4FPOB 2AUYA 5JI7A 5T5OA 3PU8A 1GQPA 1K5MB 4RS5A 1GNHA 5D8AC 4EN8B 1UU5A 1ZBE1 3Q9OA 2ERFA 3CJIB 1CONA 4AOCA 4GMP3 1S2EA 3PTRB 5GLTA 2WBKA 3D0JA 2RM22 3JBG2 3PVEA 2Y6KA 2AEYA 1JHNA 2RR12 2V4VA 2VNVA 4HKWA 4SLIA 5ERLA 1RUOA 1YQ5A 5L7OC 3WNMA 2PHTA 1GOGA 4LLOA 1LHVA 3T4HB 1JYIA 1ASJ1 1D4VB 3AYEA 2AENA 2R7EB 2XVLA 1NLSA 4LOSA 3CMGA 4NWVA 1O4TA 4AXOA 5DXDA 3I3EA 2ZGSA 3ZYHA 5F5AA 2WYFA 1YI9A 1Q56A 3ENRA 4Q4W2 1DG6A 5ABJA 5IK7A 1OC1A 1KRIA 3KT4A 2I45A 5E1RA 1RUE1 2RJLA 4AHYA 3H9AA 2PLV1 3B00A 4XCBA 2JJ6A 2ATFA 3WVJA 2XBO1 1FXZA 2LM3A 4FP3A 4QM9A 5C5TA 3ABZA 1BVP1 2XWJB 1RUH3 3VDDC 4DUWA 1OOPA 4TWTA 2VW0A 1O6UA 2EIGA 3G7DA 1JOJA 3T0BA 2Z5WA 4R8HA 1V00A 1ZBA3 3PLQA 1SLBA 4HZFA 2RMU2 1OD5A 3VBSC 3GDBA 3URFA 1D4M2 1QJU1 1ALYA 2VZSA 2FZ1A 5FK7A 1UIJA 2DVGA 3JXSA 4LORA 3RPQA 3PVNA 1K45A 3OGSA 3NV1A 4JVAA 4CCNA 3SCGA 3KSCA 1XNTA 1NT0A 5FZFA 3O1RA 1I3HA 1DQ6A 1VMJA 2HLEA 4MXWA 3FZ3A 5FMCA 3T30A 1R083 4EZ4A 1UWWA 2AACA 3AJYA 1WW6A 5FO9B 1UQXA 1R093 2ORZA 1BYHA 1YYNA 1OLME 4PQQA 2W39A 2VMIA 1F4HA 2VL4A 2QCSB 2WNVB 4MLOA 2EIEA 3MIHA 3JB4C 4N53C 4R52A 2HWD3 3DL3A 4FCAA 4YW5A 1A78A 5A3PA 4Z82A 2GP3A 4LBQA 3V65A 1RUC2 2E53A 4HANA 4V1PA 1IPJA 2KD7A 3CF6E 3MIFA 4CU9A 1XRUA 2YFUA 4HG6B 3RQ0A 2TEPA 2DURA 1DZTA 3ZIWA 5FY9A 1YI7A 5BYNA 3NL1A 2Y26A 4R4ZA 5GLUA 2P3IA 5BNPB 5JPMB 2DU0A 3S5QA 1H2NA 4LOTA 1BMV1 4GZ9A 4K20A 1V6LA 4A42A 3S30A 3WF0A 2BUKA 2H0BA 5IK5A 5FBJA 1NOVA 1AR91 4QPIC 2DBIA 3FLRA 2VXRA 2FZ2A 3ZFEB 3E1F1 2JXAA 5E8AA 3HQXA 2HKXA 4Q29A 4L11A 4JGZC 3TEZA 4OHYA 4K1YA 2JDKA 5EV7A 5APAA 2QBXA 5FZ0A 5T50A 2ZGRA 1IS6A 3F95A 3VHPA 3L9JT 2E6VA 3CHXA 4PT6A 4J6GA 3ZN5A 2QQNA 2XHNA 1MS5A 1NA1C 2XLGA 1YFYA 4CP0A 4QKDA 2EXIA 5FZ3A 3NV3A 5LCWL 2FMDA 1GANA 5IVCA 1TNRA 1EUTA 2Z79A 2WL1A 1W2NA 3U14A 2EVXA 4XJ9A 1AR63 4YGDA 1BBT2 4OHXA 1KFUL 2BYVE 1WW5A 3H3UA 3OY8A 4FPFA 1DCSA 3V0AA 5KBFA 1NLRA 5EJ1B 1W06A 4K1ZA 4A6OA 4AEDB 5LB6A 3W21A 2Z4FA 4NIIA 1J3PA 3IZOA 3TB0A 2H6CA 4OHZA 3S5AA 1R082 2JG9A 3N7KA 1DP0A 4YZ4A 1TVGA 4UOJA 2XLAA 4AI0A 4Y4YA 4XTPA 4BU2A 4OQ9A 4B4RA 3BUCA 1WCDJ 1WLTA 1JN2P 2GN7A 4Q1RA 2EIBA 5FZIA 3U78A 2QQPA 5IK4A 1PNGA 3ELNA 4HKOA 4N7UA 5T5JA 1VB2A 5LA0A 4YNIA 1QXRA 4E2SA 4KU8A 2R042 2B45X 4NVPA 4YLZA 4YW6A 3MIEA 1IGOA 1HXS1 4AFDA 4MO3M 4CZSA 4L97A 4COWA 5FPXA 1FPN1 4DXZA 5F2WA 5J98B 3S0MA 3KHBA 3GHMA 2WSUA 4IQPA 3WDVA 4TN7A 1R64A 2QQIA 5F3EA 3WG4A 1BJQA 4C0BA 3HD8B 1DLCA 5CFDA 4ES8A 2SLIA 4EWDA 2XL9A 1UYZA 4PCRA 5FYZA 5KHJA 2PAEA 4CDWC 1AYM2 2A6YA 4G3YC 4XUTA 3EMRA 4OUSA 1LODA 4KG0A 4LBQD 4CDUA 1S2KA 3ME2A 1MEC2 1RUH2 5A1LA 3VD9A 2E7TA 4XDOA 3MHZA 3PIGA 2D97A 2VCMA 3T2QA 1YFUA 5CKNA 2BFUL 4BHPA 2PN5A 1S0GA 5IVYA 5LEKA 2K46A 3NNGA 4A3XA 4UI9L 5C8CC 5IATA 3VZNA 1RUI2 3AXEA 3UK9A 4KGGA 4B1MA 4E4HA 3FLTA 3ZR6A 5IVBA 2XVKA 4XBNA 2VNOA 3M2MA 5A7QA 3AZWA 3FUQA 3LE0A 4JGZB 4Q4V3 5M0TA 5L36A 3I2GA 1EPWA 1LR5A 2IUWA 1VBA2 1UZWA 5CFCB 4Z92B 1QMJA 5FYUA 2UWBA 2QQLA 2JICA 1WCQA 3UESA 1NCQC 3GCWA 2FDJA 4GB31 1CZTA 2HWD1 3LSDA 3SNMA 4BWOA 3E5UA 4AAPA 3OUJA 5FPLA 4AR2A 1Q5OA 5KHKA 1TME3 4AEDC 1QIQA 2QTWB 1US3A 1UPIA 2ZS6B 1SFPA 5I93A 4NUBA 1LHNA 2YPDA 1CAUA 4L8QA 3ZYJB 4C1XA 2CV6A 3BB6A 1XYOA 2D6NA 5HCFA 2YUEA 1ND3C 3PURA 1MS1A 2JD9A 2O8QA 2P34A 2W47A 4LO4B 2D6PA 4M0HA 4RR3C 1DQ2A 4BOWA 1UD1A 1SPPB 4WVMA 3MEPA 1KEXA 3ZVXA 3AZXA 5JSPA 4FTSA 2A6WA 1JU3A 1ZM1A 3VKNA 3N3HA 3ZXLA 2PA7A 2D5FA 2W1UA 2XUEA 5E6HA 4ASMB 3CJIC 1HJFA 1XXNA 2IFRA 4DRVA 4M3CF 5LASA 1GZTA 1H30A 4ARYA 4CEWA 5C3OA 1RUNA 2WZR1 1RC6A 3HVDA 4MSVA 4MGYE 2HWF3 2PHFA 4AFBA 3A22A 2R30A 2ZGUA 3MBWA 1ZREA 3JCIA 1T2XA 4UFHA 5JR2A 1H8TC 4BIOA 2G1MA 4BMBA 3N9NA 1BK1A 3LEIA 3MGUA 1SDWA 3M3EA 4E8DA 2WZ8A 2VBPA 1XBFA 2R1DA 1NZIA 4K8RB 1JTZX 1QJU3 1L7QA 3FHAA 3VKMA 3RRDA 2WRAA 1UNBA 1IQDC 2DFBA 1RUI3 5D8AA 3KV5A 1JYCA 4QHOA 1IPSA 3AP5A 4PDWC 2XLFA 2KXLA 3AK0A 1LESA 1W0NA 4GKXA 3HEIA 3J7MA 1MQTC 1AR83 1RXFA 3A23A 4BH9A 2CDPA 3WOGA 5IVJA 1NG0A 1AR73 4FPJA 2XVGA 3IT8A 4GJZA 3GZEA 2P5BA 2HYKA 3MV01 2D44A 4QX5A 3THCA 4DEVA 4F83A 1XYNA 4XUNA 4IE5A 1VBE2 4H14A 3LIHA 1SACA 5F8PA 4ZPIA 1FYUA 1CWPA 4QKNA 5CU1A 3P5BA 1IKPA 2XDVA 3R6SA 3GZTB 5FP4A 3NJYA 1UMZA 3O1PA 3P6BA 2C1FA 5LA2A 1AHSA 4DMIA 5C4WA 1STMA 1FNYA 3HR9A 3WZ1A 4PBOA 3WW2A 5JSRA 2VQ0A 2VU9A 5FZHA 2VNRA 3KV9A 3LOBA 1L7RA 1ZRIA 5DUVA 3J8F1 4W6XA 5AFBA 1Q8OA 1W0PA 2B39A 4K40A 4CRQA 5J37A 1Q3EA 3NJVA 1QJY1 1RJ8A 2DVDA 4NRMA 3ST7A 4C8DA 4NPLA 2WWSA 1M06G 1UKRA 1RUG2 3LWCA 4CDQB 3FUOA 4OMDA 4HL0A 5DUXA 3ZXJA 3V0BA 2JDPA 4NAOA 3AKSA 3WF3A 5F3CA 3B9CA 1SBFA 2Y6FA 5EYYA 4A2UA 2ZHMA 1WKYA 2YBSA 4YM0A 3O14A 1FV3A 4CEYC 2QDNA 1PIV3 2WNOA 3B01A 1M4WA 1MEC3 4ZS2A 3TAYA 4CDUC 5FRAA 1XNAA 3WQ0A 4YVWC 3ZFGA 5BNNB 1N1TA 3FFQA 4N7IA 4LBQB 3WW1A 1KDMA 4I09A 1CESA 3T2TA 4Y1VA 4R9CA 3N9PA 1OOPB 1F35A 4B7KA 4QX7A 1PNFA 1AXZA 3IDBB 4FVVA 4LEJA 1VBC2 4QHZA 4BIFA 4NROA 2WYSA 1D4M3 5I0RA 5E88A 4WVWA 3EB7A 4WM8A 5C3QA 2ILMA 1WA6X 2R072 4I30A 4KWLA 4B7EA 3DUIA 4B4QA 1DQ5A 4D6QA 1JZ3A 2DCTA 5A7OA 1Y3TA 2YYOA 2ZMNA 4S2HA 2QE3A 5FZDA 2MEV3 1ULEA 2BOIA 3H3ZA 2QNKA 2QZ3A 4E9KA 4YVWB 4EROA 2WZPP 3WG2A 4EYUA 5BNNC 3ITQA 5JVVA 1W28A 2XBO2 3LEKA 4GH4A 4MH0E 3VBSB 4LO6B 2ZX3A 3AKRA 1OF4A 5JR7B 1PX3A 4AGGA 2TNFA 4PJYA 1G6NA 4XFCA 5FPAA 1PO23 2ZGPA 3VBUB 4AQ2A 2FCTA 4TYSA 4ATFA 3ETPA 3AFKA 1L7LA 3RGBA 1HIXA 1MZFA 1JW6A 2WNEA 3N9QA 4XZUG 1VRBA 4RHV1 3M4FA 4QDQA 2A73B 1CZSA 4XILA 1VAKA 5A7SA 3T2PA 4A44A 5LK7B 1UYXA 2Q8OA 1OOPC 1NA1A 2JG8A 2ZEYA 4MGKE 5A32A 1GZ9A 1AYN3 1AJKA 3PJYA 3SKJE 4YG0A 4NIDA 2HWC1 1UIKA 3NV2A 2ZHLA 1HB4A 2AZ5A 3N9MA 4XYXA 5FO7B 1CX1A 1W6NA 2XJVA 2D43A 3BN6A 1DZRA 1YUDA 2QQVA 4K21A 2RVAA 3TRSB 2HBUA 4ZU7A 1RMU2 1ZBE3 1KQRA 2IXJA 3AYCA 3UETA 3Q8AA 3VBUC 1GFF2 5FYTA 4PLOA 5CEHA 5G05L 1UW8A 2IFWA 2VMFA 2WAAA 4DPNA 4ASLA 1O3QA 5FP8A 5BUVA 2NN8A 3S7EA 5DG1A 2WNVA 4CP9B 1OKOA 2VJXA 1RHI3 2YC2A 3MW3A 5DAWA 1X36A 3OGRA 5FTTC 2JG8B 1QU0A 4BK4A 4RD7A 3U0ZA 1YIFA 1QJY2 1QDCA 5LY2A 5F6LB 1YCIA 5DMYA 4HVOA 2R061 2WINB 1OBNA 5J1XA 3POYA 4FXKB 4QPIB 5DDJ3 5C33A 1HJGA 5A7NA 5AVAA 3E6DA 1PM7A 4IV1A 1WA4A 4S2FA 2OXBA 1LOFA 1AR93 4YZ5A 2R16A 3PMSA 5FWEA 4URAA 3NKGA 2H6BA 2XGXA 2XG3A 4HKLA 1VRH1 1AR72 2D40A 3PUQA 2D93A 4Q0PA 4G4FA 2PQSA 1XNBA 1D2SA 2WQ4A 1L3JA 2JDHA 4FQZA 4M01A 3GHNA 5JXIA 5FZGA 2L9LA 4WVMB 4D7SA 4PIZA 5I8YA 4AHWA 3SQOA 4QPIA 1YC61 1KJRA 3BALA 3JB8A 1SHWB 5KXEA 4I0WB 4CCDA 4TLFA 2CHHA 5FMOS 1S0FA 1K12A 2FDIA 4BYYA 3HPNA 5F32A 4JGYC 5DUWA 3THPA 3UL2A 5K8SA 1Q43A 3O0XA 5H9PA 3MW4A 4LA2A 3CQOA 3ZFGB 1ND2C 2GNDA 3SHRA 1UX7A 2J7MA 2OX0A 4XQ4A 3SH4A 1Y9GA 3M70A 3LIGA 3BOPA 2B42B 3T4VA 1N1YA 4N43B 4IEQA 4XUQA 3O1SA 1ZYBA 5ACA3 5IFPA 2ARBA 5FXWA 4YVSC 4UW5A 1RMU3 3LPGA 1W8ZA 3HNMA 4FTEA 4JX0A 1BHGA 3LCPA 5SV8A 3WEZA 1VR3A 1TNFA 2QQUA 4XZPA 5GZDA 1J84A 1W2OA 2Y34A 3NKTA 3RMYA 4E27A 3RZMA 2F4LA 4JHZA 2B8MA 1GICA 4WM7A 3VBUA 2D3SA 1XPWA 2IVJA 4MGSA 4BQ4A 1IS5A 3HJRA 5FZAA 1QNWA 3ZFGC 3C2UA 2PXJA 2X29A 2VQTA 3SLIA 3CNAA 2JKBA 4B4PA 1REEA 2B9UA 4XCAA 1AL23 4AK3A 4EN0A 1NYWA 1J1LA 1QJFA 1D4M1 3U37A 3WP3A 2V5DA 2W91A 2ZKLA 1OURA 2W92A 3QOPA 4IUGA 4M3CB 3HMYA 2UWCA 1PVC2 2WAOA 3TEXA 2IXHA 2P2KA 1COV3 5HPOA 1UOGA 1QNYA 3O1VA 3FN9A 5LBBA 3UYJA 4OYUA 5D2AA 3NAPB 3OGVA 3BPZA 4LBLA 5L9VA 3UKVA 4RR3A 3ZXEA 4XURA 1MR5A 3ECQA 4DXTA 2HWE3 5C70A 4YYOA 1PK6C 3H8RA 4HT1T 1PO22 2ZKNA 1Q8SA 3U07A 1P8JA 2WT2A 3LZZA 1W8WA 4JKKA 4P9JA 1PO13 3GBGA 2Y60A 2QFEA 3J8F3 3O7OA 5I0TA 3RYPA 1LOBA 5FK8A 1TME2 4QQLA 5LA9A 3RSJA 1JZ2A 1NKGA 4YW7A 2DDUA 3USUA 1Y43B 3WHTA 1NLQA 2V72A 1PHMA 3KCXA 4XBQA 4A41A 4OQ8A 5T5LA 4E4DX 3IM0A 4IEVA 4UF0A 3A0NA 3WNPA 4JHTA 1Y9MA 5IVEA 4FFFA 4PDWB 4DOUA 4DS0A 5C8CA 4ZY9A 3OGGA 1PIV1 5L7OA 3KWVA 4EWAA 4EZHA 4AQTA 3KQRA 1PZ8A 1RUF3 1ULOA 1DGWA 2VBBA 2HWB3 3WV6A 3N4MA 5KXBA 4FP2A 3WSOA 5C4WB 2WA4A 1RITA 3MUY1 4KBBA 1K3IA 4QGLA 5JAXA 1KXGA 3KV4A 3CZJA 3HOBA 3WDUA 4DO0A 2ZEZA 4A45A 1ZX5A 4QHBA 3WP5A 4BB3A 1YNAA 3OOXA 5EYXA 2YY1A 1H1MA 2D3RA 2DUPA 2P1BA 3WP6A 1AX1A 2CTVA 4X6RB 5FPZA 3USSA 4BCUA 2WKKA 4AYUA 4B3NA 2JDNA 5KXCA 3VDDA 4JGZA 1YO8A 4XQWA 3LDKA 4AVTA 3OBRA 4LMFA 2VC9A 3M3QA 2DU1A 2IXIA 4NOTA 5FDBA 2C9KA 5JDBA 3OJBA 2P6CA 5DAPA 5FY8A 5BNPC 4D7YA 5C4WC 2E33A 1CAXB 2ET1A 2WC2A 1UZVA 5H9SA 1JZ5A 4QX8A 1C1LA 3D6EA 3OY8B 4CDQC 2RS33 1ZRDA 5J48A 1OQ1A 1LU2A 2QJVA 4IETA 1RUC1 3I3MA 1WLCA 4IE7A 2WZR2 4XPVA 5G04L 1N3QA 1BVVA 1YQ6A 2FHRA 1WMFA 4JDNA 5IAVA 1GQGA 2DCZA 2JWPA 1GMMA 1UKGA 1RYYA 2RS13 1OH3A 3RMXA 1HXS2 2LS6A 4WM8B 4BISA 2A6VA 1XSQA 2Q8EA 1SMVA 3OPTA 3U11A 4CCMA 5CG8A 5EWSA 3M8LA 5FLIA 4Y1ZA 4BQ1A 4DB5A 5BV6A 1JBCA 1G7YA 3WQ7A 3BKZA 2K9ZA 4Q0UA 1BMV2 4NHYA 2D98A 4XACA 3WF2A 1A3KA 3PTYA 5DZFA 1K5MC 1OA4A 2CU5A 1J83A 2ORXA 1OMIA 4IXLA 1W6OA 3E6CC 1CGPA 4IE0A 2VTFA 3IWZA 1RVF2 1OI6A 1QOOA 4ARXA 4LKSA 1MZ6A 2PLV3 2Y33A 3BPSA 4GB33 2ZX0A 5J3UA 5FIXA 1CR7A 3T1LA 4XTMA 3APBA 4R9AA 1DGLA 5ANNA 4CDXB 1OSGA 4LHKA 1RUF2 4NHLA 2VW1A 1W9TA 3MDPA 1GLHA 2YG0A 4AI1A 3JUUA 1Y4WA 2ZGTA 1BBT3 4FBFA 1W2UA 3IKWA 4Q0SA 2RS53 2RM21 3JBG1 3I3BA 3U4XA 3CEWA 5FAXA 1W6OB 4P9WA 1WMDA 3KCYA 2W87A 4M0NA 3RZZA 4E8CA 4OHWA 3WCRA 2NQYA 1VBD3 2CNAA 2V73A 4FQ4A 2PHRA 1BKZA 4QPGB 2OQ6A 4R4XA 2EALA 4Y4RA 1KS5A 1GNZA 1PM4A 3AP7A 4XW3A 2YU2A 4K9SA 4KG8A 2VD7A 3PL0A 3UKTA 1EAH2 1WGPA 4AZZA 3QH6A 4NIAA 4COVA 2Q5TA 5C7GA 2ETEA 2IXCA 2LROA 2R073 2RV9A 4FPKA 1IQAA 2OPWA 1X33A 2VZTA 2HWF1 1EPZA 1Q8VA 4GJYA 2YC4A 3MO4A 3M3CA 1PZ9A 2NLRA 3PDQA 4YGCA 5DPNA 3WG3A 5JZGA 3T3YA 2RR13 3EJKA 4FI9A 1HW5A 3PNAA 4LO8A 3N7MA 1QJX3 4EJRA 1NCRC 3MIDA 2WO2A 4UFIA 3OUHA 3SCHA 3SKVA 4IEZA 4K7JA 1ULGA 2ZAHA 1DYOA 4YVSA 2BGCA 1NCQA 2E31A 4ET7A 1OFSA 3J7HA 4O9EA 1O7FA 3RZKA 1RUI1 3VBOB 1VB4A 1UPSA 2WN3A 1HB3A 4AWDA 4YW2A 2JECA 1XYPA 3GBWA 4R9DA 4MADA 4DXSA 5FOBB 5FPUA 3FMGA 1MZEA 5ACA1 2OPKA 4BM8A 1S0CA 1BCXA 2D6LX 2BNMA 3VL9A 1YFXA 3CU7A 1I5PA 3Q8FA 3SISA 4AI9A 3QLQA 2HYXA 3FHQA 3POGA 2WS92 3ACLA 3KVAA 1S0IA 5FYCA 5A70A 2VQUA 1AL21 2W46A 4XDPA 5TSWA 3ZKYA 1GOHA 4CCJA 1IOAA 4CXXA 3I49A 2W1WA 1Y7BA 2RDQA 3UNPA 1QJY3 3C8XA 2LALA 2WFF3 4XJAA 2VMDA 2QQJA 3VB9A 1GU3A 4C1WA 3LSEA 3KF3A 4TZDA 1WMXA 5C3SA 1V6IA 1AYN1 3S7IA 4XHXA 1ND2B 3BU7A 3K4DA 1YXWA 4HK8A 4X8NA 4V2WA 3IIIA 1UZYA 2J1EA 4ZXEA 4CDWB 3W5NA 1VBE1 1LB2A 5GM0A 2JG8C 4Q4X3 5DAQA 4QB2A 1HV1A 1W2TA 1PO11 4QQOA 4UF0B 4BQ3A 4XUPA 1RUC3 4D8MA 2SBAA 5A3UA 1G9FA 3NJZA 3RYKA 2RS12 3B9IA 4DIQA 2BV4A 1RJ7A 3JQXA 3VBRC 1V9U1 3FFZA 3VZLA 1I5ZA 2WJSA 5BXXA 4BLJA 1WCSA 2GNTA 2R063 4HETA 4QGNA 1H8TB 5FP3A 4L92A 1EV13 2VE1A 1N47A 2WFF1 4FOVA 3KCCA 2GN3A 2CSGA 5F3IA 2BBAA 1CN1A 3UV9A 2JDMA 2YFZA 3OD0A 4YZ3A 3WG1A 4AAXA 1HRV2 1SLIA 3OG2A 4QB1A 5DZEA 5FFOC 3H8XA 3K75B 1VLNA 4AEDA 4LK7A 4XF4A 1J59A 4LBJA 2OUJA 4KQ7A 3AL5A 1IZ3A 4GAZA 4JQRA 2PMWB 5DQ0A 1CAWB 2GMPA 2YDEA 3ZSKA 1VP6A 5FQ0A 4FTBA 2OUHA 1A34A 2WWUA 5E16A 1EUUA 3K51A 5ACA2 3ZPOA 3NQHA 3DKQA 1Q8PA 4OULA 4JGYB 3AMNA 3Q8CA 3VHNA 4UFMA 4CCCA 1PO21 2P3YA 3IMNA 5L9RA 3POWA 1HLCA 5KHHA 2OT7A 3EO6A 1RB8G 3NMBA 4AHZA 2BNOA 2OS2A 2J42A 2R32A 3D82A 4AVAA 4UBHA 5C8WA 1H2MA 1DYKA 2WWJA 3MF9A 3KGLA 5FY4A 2IXKA 3IB3A 3FHIB 4DFSA 2WNUA 3KMHA 5L9BA 3W20A 2OKXA 5GKAC 3QACA 2RDRA 3ZKUA 2MEV2 2W52A 4COUA 1VALA 1FMD3 1XNKA 2ZEXA 4P5HA 1XSRA 1SLLA 2VVEA 5FXVA 2OYZA 1FOD3 5CISA 2Y0IA 3ORJA 4JGYA 4ISRA 1WBFA 3I2DA 2DCYA 1PVXA 1O91A 5D21A 3WF1A 3KVBA 1UX6A 1TMF1 1W6QA 2I2SA 2JKXA 2R1BA 2ZHNA 3I8TA 4H2AA 1ZVFA 1R1ZA 1YEWA 4JTNA 3ACIA 2PQQA 2RR11 4P9GA 4KNCA 3DN7A 3VD7A 2YC0A 1S1AA 3KD4A 4PHZA 3LF7A 3GXUA 4FPYA 4NN0A 2VCAA 4AFMA 2ZX1A 5CFDC 3BGAA 2FDHA 5I91A 1UOFA 4WM7B 4P9XA 3J8F2 2F17A 3KGZA 1O3TA 1OH4A 4CVUA 4OMCA 5JXHA 4CP2A 4NO4A 4QWNA 3WLUA 5J7MA 3HN1A 1W03A 1AYM3 2DV9A 5CADA 3AJZA 3ZPYA 5BNOB 2A6ZA 4PBPA 1XE7A 2N7GA 2YU1A 3JZVA 1QH6A 4CYDA 5K7PA 2CWMA 1W8OA 3ACHA 1VBB2 3ZO0B 2X8KA 5AFEA 2VH9A 3AX4A 4W8JA 3A4UA 1X82A 2PFWA 2QQOA 3JD71 3FE5A 2DTWA 2EXKA 2VBDA 1DYPA 2GH8A 3T0AA 5KWRA 1RXGA 1JI6A 1JZ6A 1D7PM 3A7QA 3IMMA 2Z42A 4A4AA 4NIGA 1SBEA 2XUMA 4XF3A 4M4PA 1RIRA 2W5FA 5FZ1A 4PLNA 1LCLA 4OVEA 2CGOA 2LTNA 4C90A 4CP9A 2VNGA 2C9AA 4B29A 3MFAA 2CGPA 4LE3A 4BQWA 2KA3A 2BVVA 2J1VA 5BNOC 3T09A 1JYNA 1VMHA 2LW8A 5A6YA 1MS8A 1YJKA 4P14A 1UZ0A 2VULA 3I3DA 2HWC2 4FPGA 2IC1A 2GALA 2DYCA 4ATEA 1X8EA 2Q4SA 2ET7A 4HOOA 1IKQA 1UMIA 3ATGA 4WV8A 4LUKA 1S4CA 4YGEA 3WQ1A 1C1FA 4FOYA 3NNLA 3DYPA 1F5FA 1AUYA 1ACCA 3FBMA 4CDXA 4QDSA 3M1HA 3ZXAC 3O1TA 2IWGB 3DPRA 1POV0 5A7WA 3M3OA 1NQDA 5C9AC 1F31A 3B02A 5A1FA 3QH7A 5CKQA 1C8M2 3T08A 2O14A 4PF5A 1UXXX 2W95A 5FLJA 2J1RA 5A3NA 2E7AA 3MV11 3CDZB 4XFAA 1HRV3 1CPNA 3CKHA 3RG0A 4XF9A 2YHJA 4GXLA 3OB8A 1D0GA 3O5SA 4GWJA 4MHUA 5FYMA 2BJSA 1MS9A 1OD3A 2B5HA 4O9GA 5EFUA 4CEWB 1MS3A 1H1IA 4H3WA 2RS31 4D94A 1H8TA 5HV0A 5JI9A 3ZXDA 3OBTA 4UW3A 4MOAA 3HQUA 1XE8A 5FY7A 4YFZA 2ADEA 2UY8A 3P1IA 5CA6A 5HBAA 3RZJA 2Y38A 3KT1A 2FDKA 5JIAA 4E4ZA 1ZRRA 2J1TA 4WZCA 1AF9A 4RQPC 3TNPB 3L2YA 1VBB1 2JX9A 5LATA 2Q8DA 2AGSA 4X6QB 4KMQA 2Z69A 4JC1A 4NPMA 3LEGA 1JYTA 2PHXA 1J3RA 4C0HA 2PTMA 4FOQA 5LWBA 4LO5B 1ZNPA 5SV5A 4DZGA 5K0UA 4XJ8A 2XONA 4IEXA 3OTFA 4YARA 2A3WA 1GWKA 1PVC1 4GWNA 1AR82 4JZRA 4LBNA 4PLMA 1R081 1GNYA 1R092 2W08A 4UT5A 5FZMA 1SLAA 3NNMA 2D5HA 3NW4A 1VBE3 2ZABA 2HWE2 2GC0A 3C7EA 3PU3A 4LE4A 4DQAA 4ES9A 3J7LA 1CAUB 4U2AA 4XJWA 4FFHA 5FZBA 3RVHA 1HDKA 3AXDA 3VBHC 5KC6A 1OT5A 5LEJA 1DGRN 2CGNA 5LRSA 3K3NA 1JUIA 4V2VA 5A1AA 2EAAA 4ASKA 1HX6A 2WLPA 3JQWA 4ZONA 1DU3D 1UU4A 2YBPA 4HK9A 5DZGA 2YB7A 1RUD2 1UOJA 4HN1A 4N9HA 1QJEA 4Q0QA 5HXVA 5AC93 3BIEA 2NZ9A 4Q8LA 1FATA 1NAEA 3RI8A 4INDA 2EAKA 4Y26A 4XUOA 3CJXA 4LIVA 1I1EA 1WD3A 3I59B 4N90A 2FDGA 1J1TA 1W8FA 1ZA7A 4HXCA 5BNQA 5LBCA 1JXNA 5LA1A 1WUVA 1CX4A 5FCCA 1F8VA 1NCQB 3KQ4B 5CBLA 1R1A1 3OBAA 2VM9A 3V0BB 4N8MA 1PGW1 2NMNA 1GZCA 3N36A 4KI5M 2V5YA 3VDAA 3VZMA 1G8WA 1OQEA 1AVBA 1PIV2 2BOJA 3DCQA 2A5ZA 4ISQA 1RHI1 2WO1A 4PIYA 4A6SA 1JYWA 4CDWA 3NO8A 4BJ0A 4BK5A 5BNNA 2VZUA 5D8AB 1YIPA 1SEFA 2MHFA 1LGNA 3H8OA 3FX3A 3VBHB 1VJ2A 1OVSA 1HKDA 1S2BA 4H55A 5GLWA 4MGZE 2BWCA 4D7TA 5B4XA 1H1AA 3U75A 5T5PA 2OIIA 4Y3OA 3TYJA 4A7KA 2Q1ZB 4PQ9A 1POV3 2E51A 1QF3A 1W6QB 3VBFB 4IV3A 2XOMA 1REDA 4NE9A 1AX0A 4F3JA 2MPFA 1N3PA 4AVBA 1K42A 4LR4A 2EIDA 2ZTNA 4MUVA 2PHWA 1Z78A 3C7FA 1NA1B 1NCRA 1DGWX 4YGBA 3ZMOA 2AREA 4JCKA 4WM7C 3TN91 2EICA 1S0BA 1W9WA 4UXAA 3FJSA 2ZX2A 1ZZ8A 4A7YA 2BTVC 1FOD1 4BE3A 2Y0OA 5FLHA 5J09A 5A6ZA 3MPBA 4YM3A 4Y5Z0 1W8UA 4L9BA 4AEKA 2BVBA 5FMBA 5C3PA 2K0GA 2BW8A 1UMHA 4FO9A 4KWUA 4MV2A 1C5HA 2JG9C 3R05A 1ZZBA 3ACFA 2WR9A 4XOGA 5T3NA 1CD3G 1UO9A 3AMQA 4IV3B 4JDMA 4D3WA 5ABJC 2R043 4YVWA 1G9BA 2IVIB 2VZQA 2DCJA 3GGLA 1HV0A 2JDUA 3SEEA 4ORFA 1O4ZA 2ZZQA 1FPN2 2X09A 4CDQA 3WP4A 4HVRA 4AVSA 1IG3A 1ASJ2 1UY0A 2R062 1APNA 1X7NA 5F37A 5HCAA 3VD4A 5K0UB 3VL8A 4UW4A 2PLV2 3K3OA 4I0AA 4B1LA 2A1XA 1K5JA 2XHKA 1W9FA 3GF6A 3HQRA 4XMAA 4Y1XA 3VKFC 5B2GB 4NIHA 4YG6A 3OEBA 4QB6A 5FKBA 2B4KA 2BPA2 2WUHA 4Q4W1 1ZBE2 1XE0A 5H9QA 3VV1A 2ZXQA 2X10A 4XEZA 3TEYA 1ULDA 1RUD1 4DXRA 4RSUA 3QD6A 3D8CA 2RMU1 5FZOB 1X9TA 4LQRA 1X9PA 1Z7S1 2QQWA 2ZGKA 3D3AA 3I59A 3OYWA 4Q4X1 2P6HA 4WVZA 1O8PA 2NMOA 1AR61 3ACGA 4UBGA 1WLDA 1PMIA 1U5ZA 1U5XA 4H7LA 4IGQA 3VD3A 3OUIA 1W6PB 1OHFA 5GALA 3MIGA 1GQHA 1PX4A 1QJX1 1KGYA 1VBD2 2WN2A 5H9RA 5EP9A 2VOTA 5DAVA 4RFRB 4Y5TA 2QKDA 1QQP3 1SDDB 2RHPA 4EN7B 4LBKA 3T0DA 4L99A 3D5OA 1H4GA 3DECA 4P9YA 3SXWA 5K0UC 1VBA1 1YHFA 1BEV2 3VDDB 1QOTA 3ZOIA 4CUGA 5FOJB 2WZR3 4YW3A 3KT7A 4CEYB 1J58A 2WQZC 3GJBA 5C8CB 5CFCA 4M3CA 2XKPA 4XFFA 1CQ9A 3I2OA 1MEC1 4J25A 3RZGA 1FOD2 3LA2A 4AF9A
chains in the Genus database with same CATH topology
4OUEA 3WNKA 1H6YA 4UAPA 4MO3M 3I3BA 2QQMA 4PF1A 2W87A 4E8CA 1R64A 2QQIA 2Y6GA 3AC0A 1DLCA 4JKLA 1UYZA 3A21A 4XUTA 3WNLA 2DCKA 5C7GA 2RV9A 2VZTA 2VZPA 2YC4A 3MO4A 3VD9A 5DPNA 3T2QA 3I2FA 4FI9A 4W4ZA 1YQ2A 3NNGA 1US2A 3CIHA 2WO2A 4UI9L 5JMOA 3SKVA 1JZ8A 2VZ1A 1DYOA 4QDRA 5C71A 2E31A 3LE0A 4ET7A 3J7HA 4P08A 2WN3A 3I2GA 4MADA 2WDBA 4DXSA 3WNOA 2QQLA 4YPJA 5EJZB 1WCQA 3UESA 1CZTA 1I5PA 2HYXA 3FHQA 1US3A 3WF4A 3PUHA 2VQUA 2W46A 2VCBA 3THDA 1NX9A 2RJ2A 1GOHA 3T2OA 3VD5A 2W1WA 1LNSA 3UNPA 2JD9A 2W47A 3C8XA 2VMDA 2QQJA 3C7HA 1GU3A 1KEXA 1W99A 1JU3A 2W1UA 3K4DA 4RN5A 3IIIA 2VMEA 2J1EA 4ARYA 3W5MA 4QX3A 1O8SA 4ZXEA 3W5NA 2W1QA 4QB2A 3A22A 3MBWA 4P00B 1T2XA 1GUIA 4XUPA 5JR2A 4D8MA 3WQBA 1UY4A 3LEIA 4E8DA 2WZ8A 4Z2AA 5F7UA 2Y6HA 1L7QA 3FHAA 1UY2A 1IQDC 2BBAA 4RYDA 5IYYA 2YFZA 4AAXA 3OG2A 1W0NA 4QB1A 1OF3A 3K75B 3K77A 3HEIA 3VDCA 3A23A 2CDPA 4QX2A 2W9XA 2ID4A 3THCA 3MV01 4D0QA 2W1SA 4DEVA 3HNYM 4XUNA 5DQ0A 3SEPA 1EUUA 4QX1A 2Y8KA 2JE8A 3NQHA 1W8NA 1H6XA 4L0PA 1MPXA 2J1AA 3P6BA 4JKMA 5LA2A 3ZM8A 1UY3A 3I2JA 3GM8A 1JHJA 4ZZ5A 1JYVA 1L7RA 4P02B 4DUVA 3IB3A 4TXWA 3NJVA 2OKXA 3IAQA 1CZVA 4OMDA 2BERA 4BDVB 1UXZA 2QQKA 4W50A 3WF3A 2ZEXA 2VZOA 5I0DA 1WKYA 3WF1A 2JKXA 1XNAA 3IAPA 1CIYA 3EYPA 1XC6A 3ACIA 3VD7A 2Y6JA 4M4RA 4ZZ8A 1W9SA 3GXUA 5IJRA 3C7GA 2VCAA 3BGAA 2W94A 2WYSA 4OZOA 1JYXA 3FL7A 3MUZ1 3EB7A 1HN1A 1OH4A 4CVUA 3C7OA 4OMCA 5JXHA 1JZ3A 1UY1A 4QPWA 5LA0A 4TTGA 1O59A 2WO3A 1JZ4A 2WQ8A 3LEKA 1OF4A 1W8OA 1PX3A 2BZDA 3ACHA 3PUIA 3K4ZA 4LHSA 4P5YA 4W8JA 3LPFA 2QQOA 3K4AA 3ETPA 4GWIA 4XZUG 3T0AA 1JI6A 1JZ6A 1D7PM 4QDQA 2J1SA 3A7QA 1CZSA 4A4AA 2E32A 4A44A 3T2PA 1UYXA 4M4PA 2W5FA 3K46A 2ZEYA 2J22A 3SKJE 1CX1A 2ZEWA 2J1VA 1JYNA 3T09A 3BN6A 2LW8A 5HXMA 2RVAA 1UZ0A 3I3DA 3UETA 3I2HA 5G05L 2WAAA 2VMFA 2VR4A 1UMIA 1NUKA 2BGPA 2VJXA 3DYPA 2YC2A 3OGRA 4QDSA 4BK4A 2VCCA 3I2KA 5DMYA 2Y64A 5J1XA 2C26A 2WABA 2Y6LA 4CUBA 3T08A 4QAWA 1UXXX 2W95A 2J1RA 3MV11 3CDZB 5EIYB 4CU7A 3CKHA 1F4AA 2VZ3A 3OB8A 4GWJA 5FUIA 4CU8A 1OD3A 3I97A 2JDAA 4CU6A 2J1UA 2PQSA 3LQCA 4MOAA 2E26A 3P1IA 5JXIA 2L9LA 5B4NA 1SHWB 2J1TA 4A3ZA 1JZ7A 4CUCA 3F2ZA 1K12A 4KMQA 3LEGA 3HPNA 5JXGA 5CZKA 5JUVA 3WNNA 3CQOA 2XONA 1PMHX 4DEQA 1UX7A 2J7MA 4XVHA 1GNYA 5CYYA 5JXJA 4XUQA 1GQPA 5IFPA 1PMJX 3C7EA 3CZUA 3OEAA 3LPGA 3HNMA 4JX0A 1BHGA 3WEZA 2WBKA 1J84A 2Y6KA 2V4VA 4JHZA 1OT5A 4MGSA 1XPWA 3WNMA 5A1AA 1GOGA 3HJRA 2VZRA 2R7EB 2YB7A 3CMGA 2VQTA 3I3EA 2X05A 4BXSV 1NAEA 4XUOA 1GOFA 3U37A 2V5DA 2W91A 2W92A 4IUGA 2WAOA 5IFTA 5HPOA 5LA1A 3FN9A 3OBAA 2VM9A 4OYUA 3ABZA 3OGVA 4DUWA 3VDAA 4KI5M 4XURA 3ECQA 4DXTA 5C70A 3T0BA 1JYWA 2WO1A 4BJ0A 4BK5A 2VZUA 1P8JA 4JKKA 3HN3A 3GDBA 2VZSA 3JXSA 5B4XA 1K45A 3OGSA 1JZ2A 1NKGA 1XNTA 2DDUA 2WZEA 3VDBA 2HLEA 2V72A 4A41A 2XOMA 1UWWA 2ORZA 3WNPA 1K42A 2EIDA 4PQQA 3IDAA 3DYOA 3C7FA 1F4HA 4ZY9A 2VL4A 2EIEA 2EICA 1W9WA 1ULOA 1JU4A 4LPLA 3WSOA 4AG4A 3MUY1 1K3IA 2KD7A 5DN2A 3HNBM 4CU9A 1UMHA 2YFUA 3CZJA 3DYMA 3HOBA 4HG6B 2XQXA 4KWUA 2ZEZA 3ACFA 4A45A 2VMCA 2VZQA 2DCJA 3GGLA 3SEEA 2X09A 4GZ9A 4A42A 1UY0A 3WF0A 3VD4A 4DUXA 2VC9A 2C9KA 2CDOA 3E1F1 2E33A 1JZ5A 3OEBA 4QB6A 1UYYA 2B4KA 2QBXA 2WUHA 2B9VA 4PT6A 1TG7A 2X10A 2ZXQA 2QQNA 2XHNA 5G04L 4DXRA 4LQRA 1GMMA 3D3AA 1RYYA 5LCWL 1O8PA 3ACGA 2LS6A 1EUTA 3VD3A 4QX0A 1PX4A 1KGYA 2WN2A 3NJXA 2C4XA 2VO5A 5EJ1B 2VOTA 4A6OA 2Z4FA 1SDDB 3WF2A 3I2IA 3T0DA 1J83A 2ORXA 4CUAA 2VTFA 2W3JA 3DECA 5IHRA 1DP0A 4ARXA 1TVGA 4LKSA 4UOJA 3NRUA 2EIBA 1SG3A 1ULPA 2BGOA 4MGQA 2VZVA 1W9TA 2YG0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OUE A;  3WNK A;  1H6Y A;  4UAP A;  4MO3 M;  3I3B A;  2QQM A;  4PF1 A;  2W87 A;  4E8C A;  1R64 A;  2QQI A;  2Y6G A;  3AC0 A;  1DLC A;  4JKL A;  1UYZ A;  3A21 A;  4XUT A;  3WNL A;  2DCK A;  5C7G A;  2RV9 A;  2VZT A;  2VZP A;  2YC4 A;  3MO4 A;  3VD9 A;  5DPN A;  3T2Q A;  3I2F A;  4FI9 A;  4W4Z A;  1YQ2 A;  3NNG A;  1US2 A;  3CIH A;  2WO2 A;  4UI9 L;  5JMO A;  3SKV A;  1JZ8 A;  2VZ1 A;  1DYO A;  4QDR A;  5C71 A;  2E31 A;  3LE0 A;  4ET7 A;  3J7H A;  4P08 A;  2WN3 A;  3I2G A;  4MAD A;  2WDB A;  4DXS A;  3WNO A;  2QQL A;  4YPJ A;  5EJZ B;  1WCQ A;  3UES A;  1CZT A;  1I5P A;  2HYX A;  3FHQ A;  1US3 A;  3WF4 A;  3PUH A;  2VQU A;  2W46 A;  2VCB A;  3THD A;  1NX9 A;  2RJ2 A;  1GOH A;  3T2O A;  3VD5 A;  2W1W A;  1LNS A;  3UNP A;  2JD9 A;  2W47 A;  3C8X A;  2VMD A;  2QQJ A;  3C7H A;  1GU3 A;  1KEX A;  1W99 A;  1JU3 A;  2W1U A;  3K4D A;  4RN5 A;  3III A;  2VME A;  2J1E A;  4ARY A;  3W5M A;  4QX3 A;  1O8S A;  4ZXE A;  3W5N A;  2W1Q A;  4QB2 A;  3A22 A;  3MBW A;  4P00 B;  1T2X A;  1GUI A;  4XUP A;  5JR2 A;  4D8M A;  3WQB A;  1UY4 A;  3LEI A;  4E8D A;  2WZ8 A;  4Z2A A;  5F7U A;  2Y6H A;  1L7Q A;  3FHA A;  1UY2 A;  1IQD C;  2BBA A;  4RYD A;  5IYY A;  2YFZ A;  4AAX A;  3OG2 A;  1W0N A;  4QB1 A;  1OF3 A;  3K75 B;  3K77 A;  3HEI A;  3VDC A;  3A23 A;  2CDP A;  4QX2 A;  2W9X A;  2ID4 A;  3THC A;  3MV0 1;  4D0Q A;  2W1S A;  4DEV A;  3HNY M;  4XUN A;  5DQ0 A;  3SEP A;  1EUU A;  4QX1 A;  2Y8K A;  2JE8 A;  3NQH A;  1W8N A;  1H6X A;  4L0P A;  1MPX A;  2J1A A;  3P6B A;  4JKM A;  5LA2 A;  3ZM8 A;  1UY3 A;  3I2J A;  3GM8 A;  1JHJ A;  4ZZ5 A;  1JYV A;  1L7R A;  4P02 B;  4DUV A;  3IB3 A;  4TXW A;  3NJV A;  2OKX A;  3IAQ A;  1CZV A;  4OMD A;  2BER A;  4BDV B;  1UXZ A;  2QQK A;  4W50 A;  3WF3 A;  2ZEX A;  2VZO A;  5I0D A;  1WKY A;  3WF1 A;  2JKX A;  1XNA A;  3IAP A;  1CIY A;  3EYP A;  1XC6 A;  3ACI A;  3VD7 A;  2Y6J A;  4M4R A;  4ZZ8 A;  1W9S A;  3GXU A;  5IJR A;  3C7G A;  2VCA A;  3BGA A;  2W94 A;  2WYS A;  4OZO A;  1JYX A;  3FL7 A;  3MUZ 1;  3EB7 A;  1HN1 A;  1OH4 A;  4CVU A;  3C7O A;  4OMC A;  5JXH A;  1JZ3 A;  1UY1 A;  4QPW A;  5LA0 A;  4TTG A;  1O59 A;  2WO3 A;  1JZ4 A;  2WQ8 A;  3LEK A;  1OF4 A;  1W8O A;  1PX3 A;  2BZD A;  3ACH A;  3PUI A;  3K4Z A;  4LHS A;  4P5Y A;  4W8J A;  3LPF A;  2QQO A;  3K4A A;  3ETP A;  4GWI A;  4XZU G;  3T0A A;  1JI6 A;  1JZ6 A;  1D7P M;  4QDQ A;  2J1S A;  3A7Q A;  1CZS A;  4A4A A;  2E32 A;  4A44 A;  3T2P A;  1UYX A;  4M4P A;  2W5F A;  3K46 A;  2ZEY A;  2J22 A;  3SKJ E;  1CX1 A;  2ZEW A;  2J1V A;  1JYN A;  3T09 A;  3BN6 A;  2LW8 A;  5HXM A;  2RVA A;  1UZ0 A;  3I3D A;  3UET A;  3I2H A;  5G05 L;  2WAA A;  2VMF A;  2VR4 A;  1UMI A;  1NUK A;  2BGP A;  2VJX A;  3DYP A;  2YC2 A;  3OGR A;  4QDS A;  4BK4 A;  2VCC A;  3I2K A;  5DMY A;  2Y64 A;  5J1X A;  2C26 A;  2WAB A;  2Y6L A;  4CUB A;  3T08 A;  4QAW A;  1UXX X;  2W95 A;  2J1R A;  3MV1 1;  3CDZ B;  5EIY B;  4CU7 A;  3CKH A;  1F4A A;  2VZ3 A;  3OB8 A;  4GWJ A;  5FUI A;  4CU8 A;  1OD3 A;  3I97 A;  2JDA A;  4CU6 A;  2J1U A;  2PQS A;  3LQC A;  4MOA A;  2E26 A;  3P1I A;  5JXI A;  2L9L A;  5B4N A;  1SHW B;  2J1T A;  4A3Z A;  1JZ7 A;  4CUC A;  3F2Z A;  1K12 A;  4KMQ A;  3LEG A;  3HPN A;  5JXG A;  5CZK A;  5JUV A;  3WNN A;  3CQO A;  2XON A;  1PMH X;  4DEQ A;  1UX7 A;  2J7M A;  4XVH A;  1GNY A;  5CYY A;  5JXJ A;  4XUQ A;  1GQP A;  5IFP A;  1PMJ X;  3C7E A;  3CZU A;  3OEA A;  3LPG A;  3HNM A;  4JX0 A;  1BHG A;  3WEZ A;  2WBK A;  1J84 A;  2Y6K A;  2V4V A;  4JHZ A;  1OT5 A;  4MGS A;  1XPW A;  3WNM A;  5A1A A;  1GOG A;  3HJR A;  2VZR A;  2R7E B;  2YB7 A;  3CMG A;  2VQT A;  3I3E A;  2X05 A;  4BXS V;  1NAE A;  4XUO A;  1GOF A;  3U37 A;  2V5D A;  2W91 A;  2W92 A;  4IUG A;  2WAO A;  5IFT A;  5HPO A;  5LA1 A;  3FN9 A;  3OBA A;  2VM9 A;  4OYU A;  3ABZ A;  3OGV A;  4DUW A;  3VDA A;  4KI5 M;  4XUR A;  3ECQ A;  4DXT A;  5C70 A;  3T0B A;  1JYW A;  2WO1 A;  4BJ0 A;  4BK5 A;  2VZU A;  1P8J A;  4JKK A;  3HN3 A;  3GDB A;  2VZS A;  3JXS A;  5B4X A;  1K45 A;  3OGS A;  1JZ2 A;  1NKG A;  1XNT A;  2DDU A;  2WZE A;  3VDB A;  2HLE A;  2V72 A;  4A41 A;  2XOM A;  1UWW A;  2ORZ A;  3WNP A;  1K42 A;  2EID A;  4PQQ A;  3IDA A;  3DYO A;  3C7F A;  1F4H A;  4ZY9 A;  2VL4 A;  2EIE A;  2EIC A;  1W9W A;  1ULO A;  1JU4 A;  4LPL A;  3WSO A;  4AG4 A;  3MUY 1;  1K3I A;  2KD7 A;  5DN2 A;  3HNB M;  4CU9 A;  1UMH A;  2YFU A;  3CZJ A;  3DYM A;  3HOB A;  4HG6 B;  2XQX A;  4KWU A;  2ZEZ A;  3ACF A;  4A45 A;  2VMC A;  2VZQ A;  2DCJ A;  3GGL A;  3SEE A;  2X09 A;  4GZ9 A;  4A42 A;  1UY0 A;  3WF0 A;  3VD4 A;  4DUX A;  2VC9 A;  2C9K A;  2CDO A;  3E1F 1;  2E33 A;  1JZ5 A;  3OEB A;  4QB6 A;  1UYY A;  2B4K A;  2QBX A;  2WUH A;  2B9V A;  4PT6 A;  1TG7 A;  2X10 A;  2ZXQ A;  2QQN A;  2XHN A;  5G04 L;  4DXR A;  4LQR A;  1GMM A;  3D3A A;  1RYY A;  5LCW L;  1O8P A;  3ACG A;  2LS6 A;  1EUT A;  3VD3 A;  4QX0 A;  1PX4 A;  1KGY A;  2WN2 A;  3NJX A;  2C4X A;  2VO5 A;  5EJ1 B;  2VOT A;  4A6O A;  2Z4F A;  1SDD B;  3WF2 A;  3I2I A;  3T0D A;  1J83 A;  2ORX A;  4CUA A;  2VTF A;  2W3J A;  3DEC A;  5IHR A;  1DP0 A;  4ARX A;  1TVG A;  4LKS A;  4UOJ A;  3NRU A;  2EIB A;  1SG3 A;  1ULP A;  2BGO A;  4MGQ A;  2VZV A;  1W9T A;  2YG0 A; 
#chains in the Genus database with same CATH topology
 4QGM A;  4OUE A;  5A6X A;  5C5U A;  3NNF A;  4NHX A;  5JWP A;  1H9W A;  3B5L B;  1O5U A;  3KB5 A;  4MVT A;  5GZF A;  3J4U H;  4UAP A;  3RJR A;  4A7Z A;  5GZE A;  1ODM A;  4I01 A;  4PF1 A;  2ZBJ A;  3VBH A;  4FXG B;  4AI2 A;  1RUJ 1;  2WFP A;  4JRL A;  1WZX A;  3AZY A;  2GC3 A;  2Y6G A;  3NVC A;  2W2I A;  3AC0 A;  4GD4 A;  1LEN A;  3WNX A;  2XB6 C;  1H0B A;  3AM2 A;  2DBN A;  3UJQ A;  1QOS A;  5JZG C;  3U10 A;  4NMI A;  1SFN A;  4HON A;  3WNL A;  2DCK A;  3AP4 A;  4PI2 A;  2BDR A;  1JOP A;  2XWB B;  2VZP A;  1U5I A;  2BFU S;  3N9L A;  4FT8 A;  1FX5 A;  2ZZJ A;  2RS5 2;  2XL7 A;  1W6M A;  1OUX A;  2WS9 3;  3OF1 A;  1G9D A;  1NE4 A;  2HWF 2;  1ND3 B;  4EWE A;  1F9K A;  4FAG A;  1YQ2 A;  3HT2 A;  5BNO A;  4EV0 A;  2FCV A;  1US2 A;  5I0S A;  1VBB 3;  3LFI A;  5IK8 A;  3AYA A;  5FXX A;  1DQ4 A;  5JMO A;  1JZ8 A;  5CB7 A;  4CXW A;  3AMM A;  4AEM A;  4O7X A;  4BQY A;  2PHL A;  4XFH A;  5I8S A;  3KV6 A;  4ZU4 A;  4P08 A;  3WCS A;  5FPV A;  1SPP A;  1VBD 1;  2VAU A;  4BME A;  3NNJ A;  4LUM A;  4QQP A;  1LU1 A;  1PVC 3;  5FJK A;  2XR4 A;  3N7J A;  4J1X A;  2ARX A;  2WDB A;  2YGM A;  3WNO A;  4YRD A;  4YPJ A;  3ZXK A;  3GAL A;  4Q4X 2;  2XJU A;  2GSY A;  1OPO A;  1RUH 1;  4QQH A;  3TOJ A;  2G9Z A;  3KZ4 C;  4UW6 A;  1QXJ A;  4KBZ A;  2WO7 A;  3OPZ A;  5FUN A;  1ZRC A;  2QZ2 A;  4QM8 A;  1GWL A;  1QJX 2;  1V70 A;  1W3X A;  3VKL A;  3Q8B A;  2G19 A;  1WLW A;  2RS1 1;  3WF4 A;  4QXH A;  2VTX A;  4CTE A;  2E9Q A;  3PUH A;  3ZDS A;  3WIN E;  4AFC A;  1PGL 2;  1Q8Q A;  1PO1 2;  4XXP A;  5ANQ A;  1W6P A;  3JD7 3;  1VBC 1;  2UWA A;  4YG3 A;  2HH9 A;  1LNS A;  3ZYB A;  4XAB A;  2P3J A;  2JB8 A;  4CEW C;  1QKQ A;  5A3M A;  3ALQ A;  1AJO A;  1UU6 A;  4LO7 A;  1W99 A;  3KF5 A;  2YBK A;  2DTY A;  3ZYP A;  1RUG 1;  2BEO A;  3EBR A;  3M7A A;  2VME A;  1LAJ A;  2DF7 A;  3W5M A;  4QX3 A;  3AKQ A;  2JEN A;  5FJH A;  4P00 B;  5DAB A;  1DIW A;  3WX5 A;  4BQ5 A;  3OPW A;  1REF A;  2CY6 A;  3ZN4 A;  4AHX A;  1W90 A;  1H2L A;  3WQB A;  3BVC A;  3V0A B;  4XFI A;  4Y1U A;  5LRR A;  3ROU A;  4Z2A A;  2H0V A;  3AYD A;  3WXP A;  2Y6H A;  3AMP A;  3H42 B;  4O65 A;  4CEY A;  3ZR5 A;  2AR6 A;  4IE6 A;  2ZOE B;  1UY2 A;  4U36 A;  1G9C A;  4Y20 B;  4D6R A;  4HN0 A;  4QXC A;  2JG9 B;  5FO8 B;  2KR2 A;  3UGG A;  1JOB A;  2A6X A;  4QQ2 A;  5IYY A;  3AP9 A;  3PUA A;  4IER A;  5T52 A;  5F1R A;  3O0V A;  3ZXF A;  5A3O A;  1DQ0 A;  1GP6 A;  3RYR A;  4CDX C;  4OI4 A;  3K77 A;  1ULC A;  2R07 1;  4JQT A;  1AYM 1;  4QKF A;  4XMI A;  3VDC A;  2WT1 A;  1CAX A;  4IV1 B;  4DRR A;  4B8E A;  4YW1 A;  1IPK A;  5HCH A;  3R4U A;  4HPK A;  3W59 A;  2W9X A;  2ID4 A;  5FKC A;  1HRV 1;  3MFC A;  3W58 A;  4D0Q A;  2NPI A;  3HNY M;  1AR7 1;  3CBN A;  1YQC A;  4AGV A;  2ZMK A;  1LOA A;  3H7J A;  2RS3 2;  3SEP A;  1KDK A;  1G9A A;  4RHV 2;  5FYV A;  4AE2 A;  2Y8K A;  2CL2 A;  5J36 A;  3Q8E A;  4IEY A;  4BZ4 A;  4WVV A;  1FI2 A;  4LXL A;  1IS4 A;  1H6X A;  1EV1 2;  1GZW B;  3PVB B;  4M00 A;  1V9U 2;  2J1A A;  1I6X A;  3ZM8 A;  4AI3 A;  4XJZ A;  3WHU A;  1E5H A;  1TMF 2;  2WA3 A;  1UY3 A;  3I2J A;  3GM8 A;  5F5I A;  3I54 A;  4KH9 A;  1QHD A;  3PIJ A;  4P02 B;  3BTA A;  1COV 1;  4DUV A;  1EYB A;  1PGL 1;  3KM5 A;  4RS5 C;  4GKY A;  4TXW A;  5HI0 A;  3VUO A;  3BTZ A;  4Q4W 3;  3IAQ A;  3WR0 A;  1JOD A;  4RL7 A;  3SCF A;  2UYA A;  3VBF A;  2WLQ A;  1UXZ A;  2QQK A;  5F3G A;  3O12 A;  3VZK A;  3I4I A;  4BDV B;  2VZO A;  3O1U A;  2ZPX A;  4OUM A;  2XQR A;  5FV3 A;  4GB3 2;  3RFR A;  4FPE A;  4MGT A;  4YSF A;  4XQD A;  4GQ7 A;  5A33 B;  1LHO A;  3LA3 A;  4E4S A;  2HWE 1;  5CVR A;  3BTX A;  2VG9 A;  1B35 A;  2RMU 3;  1W05 A;  3NAP C;  1A8M A;  3POE A;  1CIY A;  3EYP A;  2Q8C A;  1XC6 A;  1DQ1 A;  3NST A;  3WD5 A;  5KR7 A;  4Z8B A;  2JD4 A;  2XH6 A;  4NHK A;  4XAE A;  3BOD A;  1MVQ A;  1QJZ A;  4Y22 A;  1W9S A;  5J96 B;  3C7G A;  4ITC A;  2RJK A;  2X5I C;  5FYY A;  5AC9 1;  1HB1 A;  1V6O A;  1JYX A;  3AMH A;  4OHV A;  4MET A;  4OZO A;  1FMD 2;  3LOI A;  3FL7 A;  2VW2 A;  3MUZ 1;  3OSD A;  5I0U A;  2ZX4 A;  3C7O A;  2XJT A;  4KWK A;  4FFI A;  2HWB 1;  4QPW A;  1EAH 3;  1LHW A;  4YVS B;  5A33 A;  4TTG A;  4RFT 0;  1OVP A;  1AR9 2;  3W9A A;  1O59 A;  3KHC A;  2JIG A;  2I07 B;  3CLP A;  3P3P A;  1ULF A;  2HWD 2;  1V6K A;  1WW4 A;  3HIF A;  2VOK A;  4QPG A;  1QGL A;  2C5D A;  4IEP A;  4AVV A;  3VN4 A;  1IS3 A;  3PUI A;  5FUP A;  1JUH A;  1OLM A;  1W39 A;  2VQA A;  4LHS A;  4Q5O A;  5FZ7 A;  4LBM A;  5DAX A;  4GWI A;  3K4A A;  3E6B A;  4RHV 3;  3ZN6 A;  3BYW A;  1DF0 A;  2EXJ A;  2ZGO A;  2D3P A;  1WD4 A;  1ZA4 A;  2J1S A;  4LKF A;  5CNA A;  4CDU B;  2E32 A;  3P3N A;  5E89 A;  2P3K A;  3K46 A;  4I3G A;  4CCO A;  2ZA9 A;  1ODN A;  3IDE A;  1DGR A;  1NQJ A;  3ES4 A;  1GP5 A;  1NY7 2;  3USU B;  3VKO A;  3ZSJ A;  3BOW A;  2R6Q A;  4I0B A;  1TZO A;  3J7N A;  3ZIX A;  1ENS A;  2ARA A;  3I2H A;  1RL3 A;  3ZFF C;  3GJA A;  4S2D A;  1SQ4 A;  1NUK A;  4IV3 C;  5FZK A;  2BGP A;  3S6P A;  3FC0 A;  5L7O B;  1E5I A;  2VUD A;  4MZU A;  4N53 B;  4ZXK A;  4MG2 A;  1ZBA 1;  2Q30 A;  4RGK A;  4WZF A;  1QH7 A;  1D2Q A;  1SZB A;  3RI9 A;  4YWA A;  2D6O X;  4XBL A;  3I2K A;  2DVB A;  5DDJ 1;  3H1M A;  5IT6 A;  3RS6 A;  2Y64 A;  2C26 A;  4N43 C;  3ZN6 B;  3RWN A;  1RGS A;  1RUJ 2;  4QAW A;  1SBD A;  4NAM A;  5CFD B;  5KHG A;  3OBZ A;  4ZKT B;  3WDX A;  1BZW A;  4CU7 A;  2A71 A;  1T6G C;  3ZFF B;  4S2G A;  1R09 1;  4Q4Y 3;  4Y22 B;  1TQ5 A;  1FAY A;  3G6J B;  2GC2 A;  3PJQ A;  4XJU A;  2GMM A;  2EA7 A;  5CAZ A;  5L73 A;  1F2N A;  2V4A A;  1HRI 2;  2JDA A;  1LED A;  2O0O A;  4GMP 1;  4IEW A;  4XFB A;  3V56 A;  2J1U A;  3LQC A;  4MYE A;  3HT1 A;  4JAA A;  4QXB A;  2E26 A;  1OQD A;  5B4N A;  2P37 A;  5EJ3 A;  5BNP A;  1BBT 1;  3DEM A;  3LFM A;  3MPP G;  3ZSM A;  2TBV A;  4A3Z A;  4CUC A;  2FDF A;  2XML A;  2VMG A;  4OZX A;  2JDZ A;  2RM2 3;  3JBG 3;  3KS7 A;  4FAH A;  2OW4 A;  3H50 A;  4P9L A;  2KM2 A;  3RDI A;  2MNG A;  4BA6 A;  2XJP A;  4BXF A;  3UGF A;  2VY0 A;  3ZFE A;  3N7L A;  5JXG A;  1WBL A;  4JTO A;  5IVF A;  3H8U A;  5JUV A;  1GKB A;  3GZA A;  4NR1 A;  1DBN A;  3WNN A;  1B35 B;  5T55 A;  4CSW A;  1PMH X;  4QKB A;  3CL1 A;  1RUE 3;  1KJL A;  3RZH A;  3H0O A;  4FPC A;  3RJ2 X;  2JIJ A;  4DEQ A;  4J1W A;  2VUC A;  3UKN A;  3WDW A;  3E5Q A;  4QPG C;  1RVF 1;  1X50 A;  4DNY A;  1MQT B;  4YM2 A;  2GP5 A;  2F6B A;  1HQN A;  5F5C A;  1JH5 A;  1PMJ X;  3CZU A;  4R9B A;  3OEA A;  3V64 A;  2ZJC A;  2VOW A;  1VAV A;  5C9A A;  3FWE A;  4NPR A;  5CG9 A;  2R49 A;  4CE8 A;  5ISL A;  3B94 A;  5FQ0 B;  1RMU 1;  4GUL A;  3MLJ A;  4YZ2 A;  2ZGL A;  2YPJ A;  1XJA A;  2C24 A;  3X29 B;  4AQ6 A;  1ZBA 2;  2VZR A;  1B35 C;  1C4R A;  4I2O A;  3ILR A;  1V0A A;  2WNU C;  1S0D A;  4UYB A;  2UY9 A;  4Q4V 2;  5F9T A;  5F5Q A;  2CYF A;  2X05 A;  3B69 A;  4BXS V;  5C6C A;  1XU1 A;  1PGS A;  1VAM A;  1LOG A;  3AB0 A;  2LRP A;  1NE6 A;  2GDF A;  5FY0 A;  1GOF A;  3WT3 A;  3OYW B;  1RUJ 3;  2D7F A;  1VRH 3;  1QXP A;  1SLC A;  1W8T A;  1XOY A;  4Z07 A;  4KWJ A;  4UFJ A;  1MVE A;  5FP9 A;  3TN9 2;  3SH3 A;  4W65 A;  3GCX A;  3DGT A;  3ZLI A;  5IFT A;  1WW7 A;  2TUN A;  3B93 A;  4MX3 A;  1A8D A;  4IGP A;  2P17 A;  2PHD A;  5LY1 A;  5D1I A;  3UGH A;  4E2G A;  5K9Y A;  3O1O A;  2VTX J;  2VVF A;  3RWK X;  4FSJ A;  4FPL A;  5HCB A;  3E5X A;  4QXK A;  2P4E A;  4LNV A;  1RUD 3;  4GH4 B;  4YZ1 A;  2QVS B;  5FRE A;  4MHR A;  3HN3 A;  5EXO A;  1FPN 3;  2HBT A;  1OPM A;  1LOC A;  2OVU A;  2EXH A;  3J26 N;  2YGL A;  2WZE A;  3AVS A;  3VDB A;  5EQU A;  2RE9 A;  1WCU A;  3H1W A;  1Y9Q A;  4P9I A;  1RIN A;  1C5I A;  3IDA A;  3DYO A;  3E97 A;  2E7Q A;  4QMA A;  5GJ6 A;  2JEM A;  3TWI A;  1RUE 2;  2LUW A;  1I9R A;  4XC9 A;  2RDN A;  5L19 A;  3ZYG A;  1D0H A;  1HN0 A;  1JU4 A;  1V6M A;  2ZGQ A;  4M3C E;  4SBV A;  4EN6 B;  1F5J A;  1V6N A;  1R1A 3;  2A3X A;  4LPL A;  4CCL A;  2GAU A;  4AG4 A;  4LHN A;  5GZC A;  5DN2 A;  1MS4 A;  2GZW A;  3HNB M;  3LAG A;  3LDB A;  3TNQ A;  4IL7 A;  5LBF A;  3MIC A;  5EZW A;  3DYM A;  4IGO A;  4AI8 A;  3VZJ A;  2XQX A;  1NXM A;  1LOF C;  3NWK A;  4GWM A;  2VMC A;  4HBN A;  5GZG A;  4C91 A;  1BXH A;  2OQ7 A;  2VGD A;  4AFA A;  1UOB A;  1X8M A;  3VBO C;  3TEW A;  1PK6 B;  1XND A;  2O8O A;  2YMZ A;  3WY6 A;  3R4S A;  1LGB A;  2JE9 A;  2FCU A;  3AVR A;  3AZV A;  3B7M A;  4DUX A;  4FFG A;  1C3H A;  2QDR A;  3BI3 A;  5FMO L;  4CPB A;  2CDO A;  1OFN A;  4CCE A;  4BLI A;  4DY3 A;  1LTE A;  1ZZC A;  4Q8K A;  2HWC 3;  4CXY A;  4IEU A;  3ON7 A;  1E5S A;  1BK0 A;  1UYY A;  3AL6 A;  3JU9 A;  4DIN B;  5FBZ A;  2PAK A;  1VMF A;  2B9V A;  3IBM A;  3VHO A;  1TG7 A;  3ZX7 A;  4XHB A;  4D69 A;  1LJ7 A;  4OI0 A;  1A6C A;  2F4P A;  2W68 A;  4PIX A;  3ZSE A;  3LGR A;  4OI1 A;  1GBG A;  4YFW A;  1DLL A;  4COZ A;  3RZL A;  3GYD A;  1ZZ7 A;  2WS9 1;  1O4Y A;  1WCK A;  4TSV A;  2NP0 A;  4QX0 A;  1YRZ A;  4NRP A;  3I3Q A;  2RG4 A;  3NJX A;  1POQ A;  2C4X A;  4EE2 A;  2ZGN A;  2VO5 A;  2ZAA A;  1C8M 3;  4LBO A;  2BU9 A;  5CFC C;  4DY5 A;  3I2I A;  3INA A;  3PVO A;  5A3L A;  1H2K A;  2EF6 A;  3VBR A;  4IW3 A;  3D0S A;  4CUA A;  2W3J A;  5IHR A;  2HWB 2;  3DPR B;  5JOX A;  3LA7 A;  2PHU A;  3DXT A;  1OUS A;  3HBZ A;  3K2O A;  3NRU A;  3LB9 A;  3U4S A;  2ZGM A;  1H9P A;  1HQW A;  4XF0 A;  2FMY A;  2NYY A;  1UF2 C;  1NCR B;  2X5I A;  5IUQ A;  4AW7 A;  1SG3 A;  1GR3 A;  1ST8 A;  1ULP A;  1OKQ A;  2BGO A;  2GNB A;  2WSV A;  4MGQ A;  2VZV A;  4N43 A;  4Q27 A;  5KHI A;  4ZHN A;  1NXD 1;  4Q1P A;  4CA9 A;  1FNZ A;  3WNK A;  4N9I A;  1H6Y A;  5KXD A;  1CAW A;  4XAA A;  4HVQ A;  1N1V A;  1CJP A;  4JDO A;  2QQM A;  1VBC 3;  3BCW A;  2K2S A;  1C8M 1;  5IAX A;  2RS5 1;  4K3U A;  3SMH A;  3VBR B;  3IN9 A;  4MXV A;  4X8P A;  2XXZ A;  3N9O A;  3LDR A;  1VPH A;  3NV4 A;  2RDS A;  3MLL A;  3DPR C;  1AL0 G;  2ZAC A;  1SLT A;  3ETQ A;  4LK6 A;  4LHL A;  4JKL A;  4HMZ A;  3WDY A;  1UN1 A;  2WT0 A;  3AP6 A;  4RR3 B;  2ZML A;  3A21 A;  4ZU5 A;  4GMP 0;  3TN9 3;  1OXC A;  2AH2 A;  2VOV A;  1VBA 3;  2XBO 3;  4NJ4 A;  5K4L A;  2NM1 A;  2UU8 A;  5IW0 A;  2D6K A;  2G9G A;  1RUF 1;  2XPJ A;  3DF0 A;  1DFQ A;  3I2F A;  5FZ8 A;  1SFY A;  3VGI A;  2ADD A;  1YLL A;  4W4Z A;  2OZJ A;  2R04 1;  1QDO A;  4GAL A;  4QPY A;  3VBF C;  2R0F A;  5IVV A;  3CIH A;  5AVP A;  1KFX L;  3SC7 X;  2AC1 A;  3VZO A;  1VIW B;  3K48 A;  3ZFF A;  3J9S A;  1JS9 A;  2FBE A;  2VZ1 A;  3N35 A;  4QDR A;  1UCX A;  2YV8 A;  5AC9 2;  1WME A;  5C71 A;  4LA3 A;  1RVF 3;  2JB4 A;  3UJO A;  1ZZ6 A;  2VVD A;  3VLB B;  4QD2 A;  1GSL A;  3U1X A;  4LUL A;  3ILF A;  5GLZ A;  4I3P A;  1WWY A;  4XFG A;  3BTY A;  5GLV A;  3TBD A;  5EJZ B;  2G9F A;  1B09 A;  5FZL A;  1GYK A;  2YZ4 A;  5F2S A;  1R1A 2;  2YXS A;  5A3T A;  1W8H A;  1AX2 A;  1XB9 A;  1ENX A;  3ZSL A;  2OA2 A;  2VUJ A;  4MGI E;  3OGJ A;  1Z7S 3;  5C3R A;  3ZYF A;  1CAV A;  1UL9 A;  1HB2 A;  4OI2 A;  4HSL A;  2D6M A;  5FP7 A;  1CJD A;  5T54 A;  5C9A B;  2I74 A;  5LBE A;  1F15 A;  2VCB A;  5FYS A;  3THD A;  1NX9 A;  3ZXG A;  1W6N B;  2RJ2 A;  3FLP A;  3T2O A;  3VD5 A;  5JPN B;  2R0H A;  1ZZ9 A;  5FYH A;  3VBO A;  3C7H A;  4O61 A;  3T1M A;  1W9Y A;  1YWK A;  2VXJ A;  3WUD A;  1AXK A;  4TLG A;  5FZ9 A;  1PZ7 A;  4FPH A;  5A6Q A;  4IEO A;  2Q1M A;  1GV9 A;  5FMD A;  3MF6 A;  1YQ8 A;  5BY5 A;  4RN5 A;  2MEV 1;  3IIA A;  2XKO A;  3DV8 A;  1OLR A;  1O8S A;  2W1Q A;  1LGC A;  1O5L A;  5BPX A;  4K8F A;  2BP6 A;  2GH2 A;  1IHM A;  2GC1 A;  5FXZ A;  1GUI A;  1HRI 3;  2BRT A;  4RQP B;  2QUO A;  4LIT A;  4XF1 A;  1UY4 A;  2XJS A;  5A32 B;  4QT6 A;  3JD7 2;  3QCW A;  4ONU A;  4URT A;  4XIO A;  3FBY A;  5F7U A;  1TMF 3;  5JMC A;  3MIB A;  4LLF A;  3PUS A;  4HPK B;  3S57 A;  5FY1 A;  5I8T A;  3HAG A;  4Q2F A;  1H4H A;  3R0R A;  4XIK A;  5A7P A;  2HJI A;  4KL1 A;  2V09 A;  2FD8 A;  4LKE A;  3ASI A;  1ASJ 3;  2PAM A;  4RYD A;  1MS0 A;  2WNU B;  2W0X A;  4IE4 A;  2O1Q A;  3OD4 A;  4AGR A;  1V6J A;  3POJ A;  1OF3 A;  1OLQ A;  1S55 A;  1SCR A;  2GU9 A;  2YRO A;  4RGG A;  3H1Y A;  4F7Z A;  1XQN A;  3EXU A;  1ND2 A;  4AEJ A;  4BQ2 A;  5JOY A;  3BU0 A;  2PYT A;  4QX2 A;  5FZC A;  1PK6 A;  4KGQ A;  4JRA A;  2W1S A;  1C28 A;  1BQP A;  3POI A;  2BNN A;  4PDW A;  4Y1Y A;  1GWM A;  4WM8 C;  4IDZ A;  1HRI 1;  4HFS A;  4QX1 A;  5FZO A;  2JE8 A;  2Q1F A;  4RA0 A;  4KU7 A;  1W8N A;  1EY2 A;  1QWR A;  5A3W A;  1MQT A;  1W3V A;  3PME A;  3POS A;  4L0P A;  1MPX A;  4JKM A;  1Z7S 2;  3UT0 A;  1LEC A;  3IDC B;  4FOW A;  1U0A A;  2WFF 2;  3IPV B;  1JHJ A;  4GH4 C;  3H7Y A;  4ZZ5 A;  2G4I A;  1JYV A;  2A3Y A;  2ENR A;  2HEW F;  5FZE A;  2XJQ A;  1AL2 2;  2C0Z A;  5FPB A;  2DUO A;  1QQP 2;  4Z1V A;  4OCT A;  1CZV A;  5JLV A;  5DUU A;  3VBS A;  2UUR A;  2ES3 A;  1BEV 3;  4BPZ A;  4W6Y A;  4E2Q A;  2BER A;  1LHU A;  2CWS A;  1COV 2;  1AXY A;  3C3V A;  3NAP A;  4W50 A;  4Y5S A;  4COY A;  1FMD 1;  1ENQ A;  4LTA A;  5I0D A;  3ZFE C;  4D6S A;  1RTV A;  3H3L A;  3PHM A;  4Y33 A;  1LKN A;  3ES1 A;  1V9U 3;  4MXW B;  4NWW A;  4PI0 A;  2GNM A;  5HV4 A;  3IAP A;  4LIU A;  5LZ6 A;  2HEY F;  1DDL A;  4GA9 A;  1EV1 1;  3POF A;  3WW3 A;  2AYH A;  4UWD A;  4JV4 A;  1POV 1;  2Y6J A;  2ZHK A;  4M4R A;  1SCS A;  4ZZ8 A;  4Z2W A;  5JIU A;  5IJR A;  3LKJ A;  1YJL A;  3D4K A;  4OLL A;  4HLT A;  2IZW A;  2WNV C;  1GZW A;  2W94 A;  2CAU A;  3B3Q E;  3SH5 A;  1E5R A;  1HN1 A;  1W04 A;  2X53 S;  4Q4V 1;  1C8N A;  2E63 A;  1BEV 1;  5FYB A;  1T6B X;  4Y20 A;  4AL9 A;  2VPV A;  2Q0A A;  1UY1 A;  2HEV F;  4GIQ A;  4LKD A;  1AYN 2;  4OFG A;  5FYI A;  3THT A;  3MZH A;  2DVA A;  4K6B A;  3A0K A;  1RUG 3;  1W2A X;  1W0O A;  2WO3 A;  1CVN A;  1G86 A;  3KLS A;  3ILN A;  4CP1 A;  4Q4Y 1;  2ARC A;  1JZ4 A;  3SIT A;  1O3R A;  3MW2 A;  4IV1 C;  4Q26 A;  1MAC A;  1ONA A;  2WQ8 A;  5JOW A;  2B46 X;  2BZD A;  3MLK A;  1UYP A;  1KIT A;  2IXL A;  3K4Z A;  4HSJ A;  4P5Y A;  1LUL A;  5EPA A;  1TME 1;  3LPF A;  2VOX A;  3CO2 A;  3L2H A;  4AQS A;  3M3I A;  1XNC A;  1S0E A;  1Z0H A;  3DXU A;  1IG0 A;  1TEI A;  3MI8 A;  4YW4 A;  1LRH A;  1K5M A;  4RS5 B;  3WDT A;  3DKW A;  1AZD A;  1U12 A;  2GME A;  2J22 A;  2OZ6 A;  2BBV A;  5ABJ B;  4RQP A;  4N53 A;  3AKP A;  4RGA A;  5A80 A;  3WUC A;  3ZYR A;  4H7M A;  4Q0V A;  3O1M A;  2ZEW A;  3OCP A;  4L2N A;  5DDJ 2;  5CKM A;  1TE1 B;  4W6W A;  3AFG A;  3VHR A;  3ZDV A;  5JCT A;  1N3O A;  1N1S A;  5HXM A;  2C6S A;  4IES A;  5FY5 A;  3AZZ A;  1UZZ A;  1ZRF A;  4LT5 A;  2DFC A;  2JE7 A;  4XDQ A;  3IPV A;  1U5Y A;  4BQX A;  5FR3 A;  4NHM A;  2VR4 A;  1PGW 2;  1LOE A;  1URX A;  5F39 A;  4WBB A;  3HBK A;  1FV2 A;  3EQE A;  5LK5 A;  1C57 A;  2A7A A;  1W6M B;  2Z2S B;  5F6K A;  3AKT A;  2JDY A;  2PEL A;  2X5I B;  1HXS 3;  2B7Y A;  1H8V A;  3I7D A;  1O3S A;  1QQP 1;  4XE9 A;  5A7W B;  1MZ5 A;  2VCC A;  2CAV A;  1E57 A;  2WII B;  3R4D B;  3LEM A;  4I02 A;  4XXA A;  4CUB A;  2WAB A;  1VE0 A;  2Y6L A;  4ZS3 A;  4EN9 B;  3GZU C;  5IWF A;  3ZMN A;  3EHK A;  5KC5 A;  5FZ6 A;  5EIY B;  1S0J A;  4G9S B;  5FZ4 A;  4NRQ A;  2A75 A;  1UAI A;  2DVF A;  5EHD A;  1NY7 1;  1CPM A;  5DG2 A;  1HQL A;  1F4A A;  2VZ3 A;  5FUI A;  1AR8 1;  1DZQ A;  1LEM A;  2DUQ A;  4CU8 A;  1BLZ A;  4F8A A;  5JSO A;  3I97 A;  4Y24 A;  4LJH A;  4EQV A;  4UFK A;  1GP4 A;  1ND3 A;  2DWR A;  3GBF A;  4CU6 A;  2A70 A;  1JMU B;  2BQP A;  4AVC A;  1QJU 2;  3BIW E;  4YM1 A;  2VUA A;  2ZCW A;  2FQP A;  1RHI 2;  4QU2 A;  1JZ7 A;  1ENR A;  1CIW A;  3CJI A;  3F2Z A;  1AR6 2;  1OA3 A;  2VMH A;  3GNE A;  3POB A;  1J3Q A;  1QEX A;  3HWJ A;  5JOZ A;  1KD7 A;  2AEZ A;  4UFL A;  5CIR A;  5FWJ A;  2XJR A;  2UYB A;  5CZK A;  3O0W A;  2BWA A;  1CAV B;  4CCK A;  3LD8 A;  1VRH 2;  4Q4Y 2;  4QU1 A;  1QY4 A;  1EAH 1;  1XU2 A;  3QBQ A;  3RNS A;  3ZYI B;  5JZG B;  3MYX A;  1YFW A;  4CPB D;  5LW9 A;  1OA2 A;  1KS4 A;  1NZC A;  4XVH A;  1DHK B;  2VEC A;  4XET A;  1FT9 A;  5CYY A;  3WW4 A;  5JXJ A;  1EP0 A;  4FPO B;  2AUY A;  5JI7 A;  5T5O A;  3PU8 A;  1GQP A;  1K5M B;  4RS5 A;  1GNH A;  5D8A C;  4EN8 B;  1UU5 A;  1ZBE 1;  3Q9O A;  2ERF A;  3CJI B;  1CON A;  4AOC A;  4GMP 3;  1S2E A;  3PTR B;  5GLT A;  2WBK A;  3D0J A;  2RM2 2;  3JBG 2;  3PVE A;  2Y6K A;  2AEY A;  1JHN A;  2RR1 2;  2V4V A;  2VNV A;  4HKW A;  4SLI A;  5ERL A;  1RUO A;  1YQ5 A;  5L7O C;  3WNM A;  2PHT A;  1GOG A;  4LLO A;  1LHV A;  3T4H B;  1JYI A;  1ASJ 1;  1D4V B;  3AYE A;  2AEN A;  2R7E B;  2XVL A;  1NLS A;  4LOS A;  3CMG A;  4NWV A;  1O4T A;  4AXO A;  5DXD A;  3I3E A;  2ZGS A;  3ZYH A;  5F5A A;  2WYF A;  1YI9 A;  1Q56 A;  3ENR A;  4Q4W 2;  1DG6 A;  5ABJ A;  5IK7 A;  1OC1 A;  1KRI A;  3KT4 A;  2I45 A;  5E1R A;  1RUE 1;  2RJL A;  4AHY A;  3H9A A;  2PLV 1;  3B00 A;  4XCB A;  2JJ6 A;  2ATF A;  3WVJ A;  2XBO 1;  1FXZ A;  2LM3 A;  4FP3 A;  4QM9 A;  5C5T A;  3ABZ A;  1BVP 1;  2XWJ B;  1RUH 3;  3VDD C;  4DUW A;  1OOP A;  4TWT A;  2VW0 A;  1O6U A;  2EIG A;  3G7D A;  1JOJ A;  3T0B A;  2Z5W A;  4R8H A;  1V00 A;  1ZBA 3;  3PLQ A;  1SLB A;  4HZF A;  2RMU 2;  1OD5 A;  3VBS C;  3GDB A;  3URF A;  1D4M 2;  1QJU 1;  1ALY A;  2VZS A;  2FZ1 A;  5FK7 A;  1UIJ A;  2DVG A;  3JXS A;  4LOR A;  3RPQ A;  3PVN A;  1K45 A;  3OGS A;  3NV1 A;  4JVA A;  4CCN A;  3SCG A;  3KSC A;  1XNT A;  1NT0 A;  5FZF A;  3O1R A;  1I3H A;  1DQ6 A;  1VMJ A;  2HLE A;  4MXW A;  3FZ3 A;  5FMC A;  3T30 A;  1R08 3;  4EZ4 A;  1UWW A;  2AAC A;  3AJY A;  1WW6 A;  5FO9 B;  1UQX A;  1R09 3;  2ORZ A;  1BYH A;  1YYN A;  1OLM E;  4PQQ A;  2W39 A;  2VMI A;  1F4H A;  2VL4 A;  2QCS B;  2WNV B;  4MLO A;  2EIE A;  3MIH A;  3JB4 C;  4N53 C;  4R52 A;  2HWD 3;  3DL3 A;  4FCA A;  4YW5 A;  1A78 A;  5A3P A;  4Z82 A;  2GP3 A;  4LBQ A;  3V65 A;  1RUC 2;  2E53 A;  4HAN A;  4V1P A;  1IPJ A;  2KD7 A;  3CF6 E;  3MIF A;  4CU9 A;  1XRU A;  2YFU A;  4HG6 B;  3RQ0 A;  2TEP A;  2DUR A;  1DZT A;  3ZIW A;  5FY9 A;  1YI7 A;  5BYN A;  3NL1 A;  2Y26 A;  4R4Z A;  5GLU A;  2P3I A;  5BNP B;  5JPM B;  2DU0 A;  3S5Q A;  1H2N A;  4LOT A;  1BMV 1;  4GZ9 A;  4K20 A;  1V6L A;  4A42 A;  3S30 A;  3WF0 A;  2BUK A;  2H0B A;  5IK5 A;  5FBJ A;  1NOV A;  1AR9 1;  4QPI C;  2DBI A;  3FLR A;  2VXR A;  2FZ2 A;  3ZFE B;  3E1F 1;  2JXA A;  5E8A A;  3HQX A;  2HKX A;  4Q29 A;  4L11 A;  4JGZ C;  3TEZ A;  4OHY A;  4K1Y A;  2JDK A;  5EV7 A;  5APA A;  2QBX A;  5FZ0 A;  5T50 A;  2ZGR A;  1IS6 A;  3F95 A;  3VHP A;  3L9J T;  2E6V A;  3CHX A;  4PT6 A;  4J6G A;  3ZN5 A;  2QQN A;  2XHN A;  1MS5 A;  1NA1 C;  2XLG A;  1YFY A;  4CP0 A;  4QKD A;  2EXI A;  5FZ3 A;  3NV3 A;  5LCW L;  2FMD A;  1GAN A;  5IVC A;  1TNR A;  1EUT A;  2Z79 A;  2WL1 A;  1W2N A;  3U14 A;  2EVX A;  4XJ9 A;  1AR6 3;  4YGD A;  1BBT 2;  4OHX A;  1KFU L;  2BYV E;  1WW5 A;  3H3U A;  3OY8 A;  4FPF A;  1DCS A;  3V0A A;  5KBF A;  1NLR A;  5EJ1 B;  1W06 A;  4K1Z A;  4A6O A;  4AED B;  5LB6 A;  3W21 A;  2Z4F A;  4NII A;  1J3P A;  3IZO A;  3TB0 A;  2H6C A;  4OHZ A;  3S5A A;  1R08 2;  2JG9 A;  3N7K A;  1DP0 A;  4YZ4 A;  1TVG A;  4UOJ A;  2XLA A;  4AI0 A;  4Y4Y A;  4XTP A;  4BU2 A;  4OQ9 A;  4B4R A;  3BUC A;  1WCD J;  1WLT A;  1JN2 P;  2GN7 A;  4Q1R A;  2EIB A;  5FZI A;  3U78 A;  2QQP A;  5IK4 A;  1PNG A;  3ELN A;  4HKO A;  4N7U A;  5T5J A;  1VB2 A;  5LA0 A;  4YNI A;  1QXR A;  4E2S A;  4KU8 A;  2R04 2;  2B45 X;  4NVP A;  4YLZ A;  4YW6 A;  3MIE A;  1IGO A;  1HXS 1;  4AFD A;  4MO3 M;  4CZS A;  4L97 A;  4COW A;  5FPX A;  1FPN 1;  4DXZ A;  5F2W A;  5J98 B;  3S0M A;  3KHB A;  3GHM A;  2WSU A;  4IQP A;  3WDV A;  4TN7 A;  1R64 A;  2QQI A;  5F3E A;  3WG4 A;  1BJQ A;  4C0B A;  3HD8 B;  1DLC A;  5CFD A;  4ES8 A;  2SLI A;  4EWD A;  2XL9 A;  1UYZ A;  4PCR A;  5FYZ A;  5KHJ A;  2PAE A;  4CDW C;  1AYM 2;  2A6Y A;  4G3Y C;  4XUT A;  3EMR A;  4OUS A;  1LOD A;  4KG0 A;  4LBQ D;  4CDU A;  1S2K A;  3ME2 A;  1MEC 2;  1RUH 2;  5A1L A;  3VD9 A;  2E7T A;  4XDO A;  3MHZ A;  3PIG A;  2D97 A;  2VCM A;  3T2Q A;  1YFU A;  5CKN A;  2BFU L;  4BHP A;  2PN5 A;  1S0G A;  5IVY A;  5LEK A;  2K46 A;  3NNG A;  4A3X A;  4UI9 L;  5C8C C;  5IAT A;  3VZN A;  1RUI 2;  3AXE A;  3UK9 A;  4KGG A;  4B1M A;  4E4H A;  3FLT A;  3ZR6 A;  5IVB A;  2XVK A;  4XBN A;  2VNO A;  3M2M A;  5A7Q A;  3AZW A;  3FUQ A;  3LE0 A;  4JGZ B;  4Q4V 3;  5M0T A;  5L36 A;  3I2G A;  1EPW A;  1LR5 A;  2IUW A;  1VBA 2;  1UZW A;  5CFC B;  4Z92 B;  1QMJ A;  5FYU A;  2UWB A;  2QQL A;  2JIC A;  1WCQ A;  3UES A;  1NCQ C;  3GCW A;  2FDJ A;  4GB3 1;  1CZT A;  2HWD 1;  3LSD A;  3SNM A;  4BWO A;  3E5U A;  4AAP A;  3OUJ A;  5FPL A;  4AR2 A;  1Q5O A;  5KHK A;  1TME 3;  4AED C;  1QIQ A;  2QTW B;  1US3 A;  1UPI A;  2ZS6 B;  1SFP A;  5I93 A;  4NUB A;  1LHN A;  2YPD A;  1CAU A;  4L8Q A;  3ZYJ B;  4C1X A;  2CV6 A;  3BB6 A;  1XYO A;  2D6N A;  5HCF A;  2YUE A;  1ND3 C;  3PUR A;  1MS1 A;  2JD9 A;  2O8Q A;  2P34 A;  2W47 A;  4LO4 B;  2D6P A;  4M0H A;  4RR3 C;  1DQ2 A;  4BOW A;  1UD1 A;  1SPP B;  4WVM A;  3MEP A;  1KEX A;  3ZVX A;  3AZX A;  5JSP A;  4FTS A;  2A6W A;  1JU3 A;  1ZM1 A;  3VKN A;  3N3H A;  3ZXL A;  2PA7 A;  2D5F A;  2W1U A;  2XUE A;  5E6H A;  4ASM B;  3CJI C;  1HJF A;  1XXN A;  2IFR A;  4DRV A;  4M3C F;  5LAS A;  1GZT A;  1H30 A;  4ARY A;  4CEW A;  5C3O A;  1RUN A;  2WZR 1;  1RC6 A;  3HVD A;  4MSV A;  4MGY E;  2HWF 3;  2PHF A;  4AFB A;  3A22 A;  2R30 A;  2ZGU A;  3MBW A;  1ZRE A;  3JCI A;  1T2X A;  4UFH A;  5JR2 A;  1H8T C;  4BIO A;  2G1M A;  4BMB A;  3N9N A;  1BK1 A;  3LEI A;  3MGU A;  1SDW A;  3M3E A;  4E8D A;  2WZ8 A;  2VBP A;  1XBF A;  2R1D A;  1NZI A;  4K8R B;  1JTZ X;  1QJU 3;  1L7Q A;  3FHA A;  3VKM A;  3RRD A;  2WRA A;  1UNB A;  1IQD C;  2DFB A;  1RUI 3;  5D8A A;  3KV5 A;  1JYC A;  4QHO A;  1IPS A;  3AP5 A;  4PDW C;  2XLF A;  2KXL A;  3AK0 A;  1LES A;  1W0N A;  4GKX A;  3HEI A;  3J7M A;  1MQT C;  1AR8 3;  1RXF A;  3A23 A;  4BH9 A;  2CDP A;  3WOG A;  5IVJ A;  1NG0 A;  1AR7 3;  4FPJ A;  2XVG A;  3IT8 A;  4GJZ A;  3GZE A;  2P5B A;  2HYK A;  3MV0 1;  2D44 A;  4QX5 A;  3THC A;  4DEV A;  4F83 A;  1XYN A;  4XUN A;  4IE5 A;  1VBE 2;  4H14 A;  3LIH A;  1SAC A;  5F8P A;  4ZPI A;  1FYU A;  1CWP A;  4QKN A;  5CU1 A;  3P5B A;  1IKP A;  2XDV A;  3R6S A;  3GZT B;  5FP4 A;  3NJY A;  1UMZ A;  3O1P A;  3P6B A;  2C1F A;  5LA2 A;  1AHS A;  4DMI A;  5C4W A;  1STM A;  1FNY A;  3HR9 A;  3WZ1 A;  4PBO A;  3WW2 A;  5JSR A;  2VQ0 A;  2VU9 A;  5FZH A;  2VNR A;  3KV9 A;  3LOB A;  1L7R A;  1ZRI A;  5DUV A;  3J8F 1;  4W6X A;  5AFB A;  1Q8O A;  1W0P A;  2B39 A;  4K40 A;  4CRQ A;  5J37 A;  1Q3E A;  3NJV A;  1QJY 1;  1RJ8 A;  2DVD A;  4NRM A;  3ST7 A;  4C8D A;  4NPL A;  2WWS A;  1M06 G;  1UKR A;  1RUG 2;  3LWC A;  4CDQ B;  3FUO A;  4OMD A;  4HL0 A;  5DUX A;  3ZXJ A;  3V0B A;  2JDP A;  4NAO A;  3AKS A;  3WF3 A;  5F3C A;  3B9C A;  1SBF A;  2Y6F A;  5EYY A;  4A2U A;  2ZHM A;  1WKY A;  2YBS A;  4YM0 A;  3O14 A;  1FV3 A;  4CEY C;  2QDN A;  1PIV 3;  2WNO A;  3B01 A;  1M4W A;  1MEC 3;  4ZS2 A;  3TAY A;  4CDU C;  5FRA A;  1XNA A;  3WQ0 A;  4YVW C;  3ZFG A;  5BNN B;  1N1T A;  3FFQ A;  4N7I A;  4LBQ B;  3WW1 A;  1KDM A;  4I09 A;  1CES A;  3T2T A;  4Y1V A;  4R9C A;  3N9P A;  1OOP B;  1F35 A;  4B7K A;  4QX7 A;  1PNF A;  1AXZ A;  3IDB B;  4FVV A;  4LEJ A;  1VBC 2;  4QHZ A;  4BIF A;  4NRO A;  2WYS A;  1D4M 3;  5I0R A;  5E88 A;  4WVW A;  3EB7 A;  4WM8 A;  5C3Q A;  2ILM A;  1WA6 X;  2R07 2;  4I30 A;  4KWL A;  4B7E A;  3DUI A;  4B4Q A;  1DQ5 A;  4D6Q A;  1JZ3 A;  2DCT A;  5A7O A;  1Y3T A;  2YYO A;  2ZMN A;  4S2H A;  2QE3 A;  5FZD A;  2MEV 3;  1ULE A;  2BOI A;  3H3Z A;  2QNK A;  2QZ3 A;  4E9K A;  4YVW B;  4ERO A;  2WZP P;  3WG2 A;  4EYU A;  5BNN C;  3ITQ A;  5JVV A;  1W28 A;  2XBO 2;  3LEK A;  4GH4 A;  4MH0 E;  3VBS B;  4LO6 B;  2ZX3 A;  3AKR A;  1OF4 A;  5JR7 B;  1PX3 A;  4AGG A;  2TNF A;  4PJY A;  1G6N A;  4XFC A;  5FPA A;  1PO2 3;  2ZGP A;  3VBU B;  4AQ2 A;  2FCT A;  4TYS A;  4ATF A;  3ETP A;  3AFK A;  1L7L A;  3RGB A;  1HIX A;  1MZF A;  1JW6 A;  2WNE A;  3N9Q A;  4XZU G;  1VRB A;  4RHV 1;  3M4F A;  4QDQ A;  2A73 B;  1CZS A;  4XIL A;  1VAK A;  5A7S A;  3T2P A;  4A44 A;  5LK7 B;  1UYX A;  2Q8O A;  1OOP C;  1NA1 A;  2JG8 A;  2ZEY A;  4MGK E;  5A32 A;  1GZ9 A;  1AYN 3;  1AJK A;  3PJY A;  3SKJ E;  4YG0 A;  4NID A;  2HWC 1;  1UIK A;  3NV2 A;  2ZHL A;  1HB4 A;  2AZ5 A;  3N9M A;  4XYX A;  5FO7 B;  1CX1 A;  1W6N A;  2XJV A;  2D43 A;  3BN6 A;  1DZR A;  1YUD A;  2QQV A;  4K21 A;  2RVA A;  3TRS B;  2HBU A;  4ZU7 A;  1RMU 2;  1ZBE 3;  1KQR A;  2IXJ A;  3AYC A;  3UET A;  3Q8A A;  3VBU C;  1GFF 2;  5FYT A;  4PLO A;  5CEH A;  5G05 L;  1UW8 A;  2IFW A;  2VMF A;  2WAA A;  4DPN A;  4ASL A;  1O3Q A;  5FP8 A;  5BUV A;  2NN8 A;  3S7E A;  5DG1 A;  2WNV A;  4CP9 B;  1OKO A;  2VJX A;  1RHI 3;  2YC2 A;  3MW3 A;  5DAW A;  1X36 A;  3OGR A;  5FTT C;  2JG8 B;  1QU0 A;  4BK4 A;  4RD7 A;  3U0Z A;  1YIF A;  1QJY 2;  1QDC A;  5LY2 A;  5F6L B;  1YCI A;  5DMY A;  4HVO A;  2R06 1;  2WIN B;  1OBN A;  5J1X A;  3POY A;  4FXK B;  4QPI B;  5DDJ 3;  5C33 A;  1HJG A;  5A7N A;  5AVA A;  3E6D A;  1PM7 A;  4IV1 A;  1WA4 A;  4S2F A;  2OXB A;  1LOF A;  1AR9 3;  4YZ5 A;  2R16 A;  3PMS A;  5FWE A;  4URA A;  3NKG A;  2H6B A;  2XGX A;  2XG3 A;  4HKL A;  1VRH 1;  1AR7 2;  2D40 A;  3PUQ A;  2D93 A;  4Q0P A;  4G4F A;  2PQS A;  1XNB A;  1D2S A;  2WQ4 A;  1L3J A;  2JDH A;  4FQZ A;  4M01 A;  3GHN A;  5JXI A;  5FZG A;  2L9L A;  4WVM B;  4D7S A;  4PIZ A;  5I8Y A;  4AHW A;  3SQO A;  4QPI A;  1YC6 1;  1KJR A;  3BAL A;  3JB8 A;  1SHW B;  5KXE A;  4I0W B;  4CCD A;  4TLF A;  2CHH A;  5FMO S;  1S0F A;  1K12 A;  2FDI A;  4BYY A;  3HPN A;  5F32 A;  4JGY C;  5DUW A;  3THP A;  3UL2 A;  5K8S A;  1Q43 A;  3O0X A;  5H9P A;  3MW4 A;  4LA2 A;  3CQO A;  3ZFG B;  1ND2 C;  2GND A;  3SHR A;  1UX7 A;  2J7M A;  2OX0 A;  4XQ4 A;  3SH4 A;  1Y9G A;  3M70 A;  3LIG A;  3BOP A;  2B42 B;  3T4V A;  1N1Y A;  4N43 B;  4IEQ A;  4XUQ A;  3O1S A;  1ZYB A;  5ACA 3;  5IFP A;  2ARB A;  5FXW A;  4YVS C;  4UW5 A;  1RMU 3;  3LPG A;  1W8Z A;  3HNM A;  4FTE A;  4JX0 A;  1BHG A;  3LCP A;  5SV8 A;  3WEZ A;  1VR3 A;  1TNF A;  2QQU A;  4XZP A;  5GZD A;  1J84 A;  1W2O A;  2Y34 A;  3NKT A;  3RMY A;  4E27 A;  3RZM A;  2F4L A;  4JHZ A;  2B8M A;  1GIC A;  4WM7 A;  3VBU A;  2D3S A;  1XPW A;  2IVJ A;  4MGS A;  4BQ4 A;  1IS5 A;  3HJR A;  5FZA A;  1QNW A;  3ZFG C;  3C2U A;  2PXJ A;  2X29 A;  2VQT A;  3SLI A;  3CNA A;  2JKB A;  4B4P A;  1REE A;  2B9U A;  4XCA A;  1AL2 3;  4AK3 A;  4EN0 A;  1NYW A;  1J1L A;  1QJF A;  1D4M 1;  3U37 A;  3WP3 A;  2V5D A;  2W91 A;  2ZKL A;  1OUR A;  2W92 A;  3QOP A;  4IUG A;  4M3C B;  3HMY A;  2UWC A;  1PVC 2;  2WAO A;  3TEX A;  2IXH A;  2P2K A;  1COV 3;  5HPO A;  1UOG A;  1QNY A;  3O1V A;  3FN9 A;  5LBB A;  3UYJ A;  4OYU A;  5D2A A;  3NAP B;  3OGV A;  3BPZ A;  4LBL A;  5L9V A;  3UKV A;  4RR3 A;  3ZXE A;  4XUR A;  1MR5 A;  3ECQ A;  4DXT A;  2HWE 3;  5C70 A;  4YYO A;  1PK6 C;  3H8R A;  4HT1 T;  1PO2 2;  2ZKN A;  1Q8S A;  3U07 A;  1P8J A;  2WT2 A;  3LZZ A;  1W8W A;  4JKK A;  4P9J A;  1PO1 3;  3GBG A;  2Y60 A;  2QFE A;  3J8F 3;  3O7O A;  5I0T A;  3RYP A;  1LOB A;  5FK8 A;  1TME 2;  4QQL A;  5LA9 A;  3RSJ A;  1JZ2 A;  1NKG A;  4YW7 A;  2DDU A;  3USU A;  1Y43 B;  3WHT A;  1NLQ A;  2V72 A;  1PHM A;  3KCX A;  4XBQ A;  4A41 A;  4OQ8 A;  5T5L A;  4E4D X;  3IM0 A;  4IEV A;  4UF0 A;  3A0N A;  3WNP A;  4JHT A;  1Y9M A;  5IVE A;  4FFF A;  4PDW B;  4DOU A;  4DS0 A;  5C8C A;  4ZY9 A;  3OGG A;  1PIV 1;  5L7O A;  3KWV A;  4EWA A;  4EZH A;  4AQT A;  3KQR A;  1PZ8 A;  1RUF 3;  1ULO A;  1DGW A;  2VBB A;  2HWB 3;  3WV6 A;  3N4M A;  5KXB A;  4FP2 A;  3WSO A;  5C4W B;  2WA4 A;  1RIT A;  3MUY 1;  4KBB A;  1K3I A;  4QGL A;  5JAX A;  1KXG A;  3KV4 A;  3CZJ A;  3HOB A;  3WDU A;  4DO0 A;  2ZEZ A;  4A45 A;  1ZX5 A;  4QHB A;  3WP5 A;  4BB3 A;  1YNA A;  3OOX A;  5EYX A;  2YY1 A;  1H1M A;  2D3R A;  2DUP A;  2P1B A;  3WP6 A;  1AX1 A;  2CTV A;  4X6R B;  5FPZ A;  3USS A;  4BCU A;  2WKK A;  4AYU A;  4B3N A;  2JDN A;  5KXC A;  3VDD A;  4JGZ A;  1YO8 A;  4XQW A;  3LDK A;  4AVT A;  3OBR A;  4LMF A;  2VC9 A;  3M3Q A;  2DU1 A;  2IXI A;  4NOT A;  5FDB A;  2C9K A;  5JDB A;  3OJB A;  2P6C A;  5DAP A;  5FY8 A;  5BNP C;  4D7Y A;  5C4W C;  2E33 A;  1CAX B;  2ET1 A;  2WC2 A;  1UZV A;  5H9S A;  1JZ5 A;  4QX8 A;  1C1L A;  3D6E A;  3OY8 B;  4CDQ C;  2RS3 3;  1ZRD A;  5J48 A;  1OQ1 A;  1LU2 A;  2QJV A;  4IET A;  1RUC 1;  3I3M A;  1WLC A;  4IE7 A;  2WZR 2;  4XPV A;  5G04 L;  1N3Q A;  1BVV A;  1YQ6 A;  2FHR A;  1WMF A;  4JDN A;  5IAV A;  1GQG A;  2DCZ A;  2JWP A;  1GMM A;  1UKG A;  1RYY A;  2RS1 3;  1OH3 A;  3RMX A;  1HXS 2;  2LS6 A;  4WM8 B;  4BIS A;  2A6V A;  1XSQ A;  2Q8E A;  1SMV A;  3OPT A;  3U11 A;  4CCM A;  5CG8 A;  5EWS A;  3M8L A;  5FLI A;  4Y1Z A;  4BQ1 A;  4DB5 A;  5BV6 A;  1JBC A;  1G7Y A;  3WQ7 A;  3BKZ A;  2K9Z A;  4Q0U A;  1BMV 2;  4NHY A;  2D98 A;  4XAC A;  3WF2 A;  1A3K A;  3PTY A;  5DZF A;  1K5M C;  1OA4 A;  2CU5 A;  1J83 A;  2ORX A;  1OMI A;  4IXL A;  1W6O A;  3E6C C;  1CGP A;  4IE0 A;  2VTF A;  3IWZ A;  1RVF 2;  1OI6 A;  1QOO A;  4ARX A;  4LKS A;  1MZ6 A;  2PLV 3;  2Y33 A;  3BPS A;  4GB3 3;  2ZX0 A;  5J3U A;  5FIX A;  1CR7 A;  3T1L A;  4XTM A;  3APB A;  4R9A A;  1DGL A;  5ANN A;  4CDX B;  1OSG A;  4LHK A;  1RUF 2;  4NHL A;  2VW1 A;  1W9T A;  3MDP A;  1GLH A;  2YG0 A;  4AI1 A;  3JUU A;  1Y4W A;  2ZGT A;  1BBT 3;  4FBF A;  1W2U A;  3IKW A;  4Q0S A;  2RS5 3;  2RM2 1;  3JBG 1;  3I3B A;  3U4X A;  3CEW A;  5FAX A;  1W6O B;  4P9W A;  1WMD A;  3KCY A;  2W87 A;  4M0N A;  3RZZ A;  4E8C A;  4OHW A;  3WCR A;  2NQY A;  1VBD 3;  2CNA A;  2V73 A;  4FQ4 A;  2PHR A;  1BKZ A;  4QPG B;  2OQ6 A;  4R4X A;  2EAL A;  4Y4R A;  1KS5 A;  1GNZ A;  1PM4 A;  3AP7 A;  4XW3 A;  2YU2 A;  4K9S A;  4KG8 A;  2VD7 A;  3PL0 A;  3UKT A;  1EAH 2;  1WGP A;  4AZZ A;  3QH6 A;  4NIA A;  4COV A;  2Q5T A;  5C7G A;  2ETE A;  2IXC A;  2LRO A;  2R07 3;  2RV9 A;  4FPK A;  1IQA A;  2OPW A;  1X33 A;  2VZT A;  2HWF 1;  1EPZ A;  1Q8V A;  4GJY A;  2YC4 A;  3MO4 A;  3M3C A;  1PZ9 A;  2NLR A;  3PDQ A;  4YGC A;  5DPN A;  3WG3 A;  5JZG A;  3T3Y A;  2RR1 3;  3EJK A;  4FI9 A;  1HW5 A;  3PNA A;  4LO8 A;  3N7M A;  1QJX 3;  4EJR A;  1NCR C;  3MID A;  2WO2 A;  4UFI A;  3OUH A;  3SCH A;  3SKV A;  4IEZ A;  4K7J A;  1ULG A;  2ZAH A;  1DYO A;  4YVS A;  2BGC A;  1NCQ A;  2E31 A;  4ET7 A;  1OFS A;  3J7H A;  4O9E A;  1O7F A;  3RZK A;  1RUI 1;  3VBO B;  1VB4 A;  1UPS A;  2WN3 A;  1HB3 A;  4AWD A;  4YW2 A;  2JEC A;  1XYP A;  3GBW A;  4R9D A;  4MAD A;  4DXS A;  5FOB B;  5FPU A;  3FMG A;  1MZE A;  5ACA 1;  2OPK A;  4BM8 A;  1S0C A;  1BCX A;  2D6L X;  2BNM A;  3VL9 A;  1YFX A;  3CU7 A;  1I5P A;  3Q8F A;  3SIS A;  4AI9 A;  3QLQ A;  2HYX A;  3FHQ A;  3POG A;  2WS9 2;  3ACL A;  3KVA A;  1S0I A;  5FYC A;  5A70 A;  2VQU A;  1AL2 1;  2W46 A;  4XDP A;  5TSW A;  3ZKY A;  1GOH A;  4CCJ A;  1IOA A;  4CXX A;  3I49 A;  2W1W A;  1Y7B A;  2RDQ A;  3UNP A;  1QJY 3;  3C8X A;  2LAL A;  2WFF 3;  4XJA A;  2VMD A;  2QQJ A;  3VB9 A;  1GU3 A;  4C1W A;  3LSE A;  3KF3 A;  4TZD A;  1WMX A;  5C3S A;  1V6I A;  1AYN 1;  3S7I A;  4XHX A;  1ND2 B;  3BU7 A;  3K4D A;  1YXW A;  4HK8 A;  4X8N A;  4V2W A;  3III A;  1UZY A;  2J1E A;  4ZXE A;  4CDW B;  3W5N A;  1VBE 1;  1LB2 A;  5GM0 A;  2JG8 C;  4Q4X 3;  5DAQ A;  4QB2 A;  1HV1 A;  1W2T A;  1PO1 1;  4QQO A;  4UF0 B;  4BQ3 A;  4XUP A;  1RUC 3;  4D8M A;  2SBA A;  5A3U A;  1G9F A;  3NJZ A;  3RYK A;  2RS1 2;  3B9I A;  4DIQ A;  2BV4 A;  1RJ7 A;  3JQX A;  3VBR C;  1V9U 1;  3FFZ A;  3VZL A;  1I5Z A;  2WJS A;  5BXX A;  4BLJ A;  1WCS A;  2GNT A;  2R06 3;  4HET A;  4QGN A;  1H8T B;  5FP3 A;  4L92 A;  1EV1 3;  2VE1 A;  1N47 A;  2WFF 1;  4FOV A;  3KCC A;  2GN3 A;  2CSG A;  5F3I A;  2BBA A;  1CN1 A;  3UV9 A;  2JDM A;  2YFZ A;  3OD0 A;  4YZ3 A;  3WG1 A;  4AAX A;  1HRV 2;  1SLI A;  3OG2 A;  4QB1 A;  5DZE A;  5FFO C;  3H8X A;  3K75 B;  1VLN A;  4AED A;  4LK7 A;  4XF4 A;  1J59 A;  4LBJ A;  2OUJ A;  4KQ7 A;  3AL5 A;  1IZ3 A;  4GAZ A;  4JQR A;  2PMW B;  5DQ0 A;  1CAW B;  2GMP A;  2YDE A;  3ZSK A;  1VP6 A;  5FQ0 A;  4FTB A;  2OUH A;  1A34 A;  2WWU A;  5E16 A;  1EUU A;  3K51 A;  5ACA 2;  3ZPO A;  3NQH A;  3DKQ A;  1Q8P A;  4OUL A;  4JGY B;  3AMN A;  3Q8C A;  3VHN A;  4UFM A;  4CCC A;  1PO2 1;  2P3Y A;  3IMN A;  5L9R A;  3POW A;  1HLC A;  5KHH A;  2OT7 A;  3EO6 A;  1RB8 G;  3NMB A;  4AHZ A;  2BNO A;  2OS2 A;  2J42 A;  2R32 A;  3D82 A;  4AVA A;  4UBH A;  5C8W A;  1H2M A;  1DYK A;  2WWJ A;  3MF9 A;  3KGL A;  5FY4 A;  2IXK A;  3IB3 A;  3FHI B;  4DFS A;  2WNU A;  3KMH A;  5L9B A;  3W20 A;  2OKX A;  5GKA C;  3QAC A;  2RDR A;  3ZKU A;  2MEV 2;  2W52 A;  4COU A;  1VAL A;  1FMD 3;  1XNK A;  2ZEX A;  4P5H A;  1XSR A;  1SLL A;  2VVE A;  5FXV A;  2OYZ A;  1FOD 3;  5CIS A;  2Y0I A;  3ORJ A;  4JGY A;  4ISR A;  1WBF A;  3I2D A;  2DCY A;  1PVX A;  1O91 A;  5D21 A;  3WF1 A;  3KVB A;  1UX6 A;  1TMF 1;  1W6Q A;  2I2S A;  2JKX A;  2R1B A;  2ZHN A;  3I8T A;  4H2A A;  1ZVF A;  1R1Z A;  1YEW A;  4JTN A;  3ACI A;  2PQQ A;  2RR1 1;  4P9G A;  4KNC A;  3DN7 A;  3VD7 A;  2YC0 A;  1S1A A;  3KD4 A;  4PHZ A;  3LF7 A;  3GXU A;  4FPY A;  4NN0 A;  2VCA A;  4AFM A;  2ZX1 A;  5CFD C;  3BGA A;  2FDH A;  5I91 A;  1UOF A;  4WM7 B;  4P9X A;  3J8F 2;  2F17 A;  3KGZ A;  1O3T A;  1OH4 A;  4CVU A;  4OMC A;  5JXH A;  4CP2 A;  4NO4 A;  4QWN A;  3WLU A;  5J7M A;  3HN1 A;  1W03 A;  1AYM 3;  2DV9 A;  5CAD A;  3AJZ A;  3ZPY A;  5BNO B;  2A6Z A;  4PBP A;  1XE7 A;  2N7G A;  2YU1 A;  3JZV A;  1QH6 A;  4CYD A;  5K7P A;  2CWM A;  1W8O A;  3ACH A;  1VBB 2;  3ZO0 B;  2X8K A;  5AFE A;  2VH9 A;  3AX4 A;  4W8J A;  3A4U A;  1X82 A;  2PFW A;  2QQO A;  3JD7 1;  3FE5 A;  2DTW A;  2EXK A;  2VBD A;  1DYP A;  2GH8 A;  3T0A A;  5KWR A;  1RXG A;  1JI6 A;  1JZ6 A;  1D7P M;  3A7Q A;  3IMM A;  2Z42 A;  4A4A A;  4NIG A;  1SBE A;  2XUM A;  4XF3 A;  4M4P A;  1RIR A;  2W5F A;  5FZ1 A;  4PLN A;  1LCL A;  4OVE A;  2CGO A;  2LTN A;  4C90 A;  4CP9 A;  2VNG A;  2C9A A;  4B29 A;  3MFA A;  2CGP A;  4LE3 A;  4BQW A;  2KA3 A;  2BVV A;  2J1V A;  5BNO C;  3T09 A;  1JYN A;  1VMH A;  2LW8 A;  5A6Y A;  1MS8 A;  1YJK A;  4P14 A;  1UZ0 A;  2VUL A;  3I3D A;  2HWC 2;  4FPG A;  2IC1 A;  2GAL A;  2DYC A;  4ATE A;  1X8E A;  2Q4S A;  2ET7 A;  4HOO A;  1IKQ A;  1UMI A;  3ATG A;  4WV8 A;  4LUK A;  1S4C A;  4YGE A;  3WQ1 A;  1C1F A;  4FOY A;  3NNL A;  3DYP A;  1F5F A;  1AUY A;  1ACC A;  3FBM A;  4CDX A;  4QDS A;  3M1H A;  3ZXA C;  3O1T A;  2IWG B;  3DPR A;  1POV 0;  5A7W A;  3M3O A;  1NQD A;  5C9A C;  1F31 A;  3B02 A;  5A1F A;  3QH7 A;  5CKQ A;  1C8M 2;  3T08 A;  2O14 A;  4PF5 A;  1UXX X;  2W95 A;  5FLJ A;  2J1R A;  5A3N A;  2E7A A;  3MV1 1;  3CDZ B;  4XFA A;  1HRV 3;  1CPN A;  3CKH A;  3RG0 A;  4XF9 A;  2YHJ A;  4GXL A;  3OB8 A;  1D0G A;  3O5S A;  4GWJ A;  4MHU A;  5FYM A;  2BJS A;  1MS9 A;  1OD3 A;  2B5H A;  4O9G A;  5EFU A;  4CEW B;  1MS3 A;  1H1I A;  4H3W A;  2RS3 1;  4D94 A;  1H8T A;  5HV0 A;  5JI9 A;  3ZXD A;  3OBT A;  4UW3 A;  4MOA A;  3HQU A;  1XE8 A;  5FY7 A;  4YFZ A;  2ADE A;  2UY8 A;  3P1I A;  5CA6 A;  5HBA A;  3RZJ A;  2Y38 A;  3KT1 A;  2FDK A;  5JIA A;  4E4Z A;  1ZRR A;  2J1T A;  4WZC A;  1AF9 A;  4RQP C;  3TNP B;  3L2Y A;  1VBB 1;  2JX9 A;  5LAT A;  2Q8D A;  2AGS A;  4X6Q B;  4KMQ A;  2Z69 A;  4JC1 A;  4NPM A;  3LEG A;  1JYT A;  2PHX A;  1J3R A;  4C0H A;  2PTM A;  4FOQ A;  5LWB A;  4LO5 B;  1ZNP A;  5SV5 A;  4DZG A;  5K0U A;  4XJ8 A;  2XON A;  4IEX A;  3OTF A;  4YAR A;  2A3W A;  1GWK A;  1PVC 1;  4GWN A;  1AR8 2;  4JZR A;  4LBN A;  4PLM A;  1R08 1;  1GNY A;  1R09 2;  2W08 A;  4UT5 A;  5FZM A;  1SLA A;  3NNM A;  2D5H A;  3NW4 A;  1VBE 3;  2ZAB A;  2HWE 2;  2GC0 A;  3C7E A;  3PU3 A;  4LE4 A;  4DQA A;  4ES9 A;  3J7L A;  1CAU B;  4U2A A;  4XJW A;  4FFH A;  5FZB A;  3RVH A;  1HDK A;  3AXD A;  3VBH C;  5KC6 A;  1OT5 A;  5LEJ A;  1DGR N;  2CGN A;  5LRS A;  3K3N A;  1JUI A;  4V2V A;  5A1A A;  2EAA A;  4ASK A;  1HX6 A;  2WLP A;  3JQW A;  4ZON A;  1DU3 D;  1UU4 A;  2YBP A;  4HK9 A;  5DZG A;  2YB7 A;  1RUD 2;  1UOJ A;  4HN1 A;  4N9H A;  1QJE A;  4Q0Q A;  5HXV A;  5AC9 3;  3BIE A;  2NZ9 A;  4Q8L A;  1FAT A;  1NAE A;  3RI8 A;  4IND A;  2EAK A;  4Y26 A;  4XUO A;  3CJX A;  4LIV A;  1I1E A;  1WD3 A;  3I59 B;  4N90 A;  2FDG A;  1J1T A;  1W8F A;  1ZA7 A;  4HXC A;  5BNQ A;  5LBC A;  1JXN A;  5LA1 A;  1WUV A;  1CX4 A;  5FCC A;  1F8V A;  1NCQ B;  3KQ4 B;  5CBL A;  1R1A 1;  3OBA A;  2VM9 A;  3V0B B;  4N8M A;  1PGW 1;  2NMN A;  1GZC A;  3N36 A;  4KI5 M;  2V5Y A;  3VDA A;  3VZM A;  1G8W A;  1OQE A;  1AVB A;  1PIV 2;  2BOJ A;  3DCQ A;  2A5Z A;  4ISQ A;  1RHI 1;  2WO1 A;  4PIY A;  4A6S A;  1JYW A;  4CDW A;  3NO8 A;  4BJ0 A;  4BK5 A;  5BNN A;  2VZU A;  5D8A B;  1YIP A;  1SEF A;  2MHF A;  1LGN A;  3H8O A;  3FX3 A;  3VBH B;  1VJ2 A;  1OVS A;  1HKD A;  1S2B A;  4H55 A;  5GLW A;  4MGZ E;  2BWC A;  4D7T A;  5B4X A;  1H1A A;  3U75 A;  5T5P A;  2OII A;  4Y3O A;  3TYJ A;  4A7K A;  2Q1Z B;  4PQ9 A;  1POV 3;  2E51 A;  1QF3 A;  1W6Q B;  3VBF B;  4IV3 A;  2XOM A;  1RED A;  4NE9 A;  1AX0 A;  4F3J A;  2MPF A;  1N3P A;  4AVB A;  1K42 A;  4LR4 A;  2EID A;  2ZTN A;  4MUV A;  2PHW A;  1Z78 A;  3C7F A;  1NA1 B;  1NCR A;  1DGW X;  4YGB A;  3ZMO A;  2ARE A;  4JCK A;  4WM7 C;  3TN9 1;  2EIC A;  1S0B A;  1W9W A;  4UXA A;  3FJS A;  2ZX2 A;  1ZZ8 A;  4A7Y A;  2BTV C;  1FOD 1;  4BE3 A;  2Y0O A;  5FLH A;  5J09 A;  5A6Z A;  3MPB A;  4YM3 A;  4Y5Z 0;  1W8U A;  4L9B A;  4AEK A;  2BVB A;  5FMB A;  5C3P A;  2K0G A;  2BW8 A;  1UMH A;  4FO9 A;  4KWU A;  4MV2 A;  1C5H A;  2JG9 C;  3R05 A;  1ZZB A;  3ACF A;  2WR9 A;  4XOG A;  5T3N A;  1CD3 G;  1UO9 A;  3AMQ A;  4IV3 B;  4JDM A;  4D3W A;  5ABJ C;  2R04 3;  4YVW A;  1G9B A;  2IVI B;  2VZQ A;  2DCJ A;  3GGL A;  1HV0 A;  2JDU A;  3SEE A;  4ORF A;  1O4Z A;  2ZZQ A;  1FPN 2;  2X09 A;  4CDQ A;  3WP4 A;  4HVR A;  4AVS A;  1IG3 A;  1ASJ 2;  1UY0 A;  2R06 2;  1APN A;  1X7N A;  5F37 A;  5HCA A;  3VD4 A;  5K0U B;  3VL8 A;  4UW4 A;  2PLV 2;  3K3O A;  4I0A A;  4B1L A;  2A1X A;  1K5J A;  2XHK A;  1W9F A;  3GF6 A;  3HQR A;  4XMA A;  4Y1X A;  3VKF C;  5B2G B;  4NIH A;  4YG6 A;  3OEB A;  4QB6 A;  5FKB A;  2B4K A;  2BPA 2;  2WUH A;  4Q4W 1;  1ZBE 2;  1XE0 A;  5H9Q A;  3VV1 A;  2ZXQ A;  2X10 A;  4XEZ A;  3TEY A;  1ULD A;  1RUD 1;  4DXR A;  4RSU A;  3QD6 A;  3D8C A;  2RMU 1;  5FZO B;  1X9T A;  4LQR A;  1X9P A;  1Z7S 1;  2QQW A;  2ZGK A;  3D3A A;  3I59 A;  3OYW A;  4Q4X 1;  2P6H A;  4WVZ A;  1O8P A;  2NMO A;  1AR6 1;  3ACG A;  4UBG A;  1WLD A;  1PMI A;  1U5Z A;  1U5X A;  4H7L A;  4IGQ A;  3VD3 A;  3OUI A;  1W6P B;  1OHF A;  5GAL A;  3MIG A;  1GQH A;  1PX4 A;  1QJX 1;  1KGY A;  1VBD 2;  2WN2 A;  5H9R A;  5EP9 A;  2VOT A;  5DAV A;  4RFR B;  4Y5T A;  2QKD A;  1QQP 3;  1SDD B;  2RHP A;  4EN7 B;  4LBK A;  3T0D A;  4L99 A;  3D5O A;  1H4G A;  3DEC A;  4P9Y A;  3SXW A;  5K0U C;  1VBA 1;  1YHF A;  1BEV 2;  3VDD B;  1QOT A;  3ZOI A;  4CUG A;  5FOJ B;  2WZR 3;  4YW3 A;  3KT7 A;  4CEY B;  1J58 A;  2WQZ C;  3GJB A;  5C8C B;  5CFC A;  4M3C A;  2XKP A;  4XFF A;  1CQ9 A;  3I2O A;  1MEC 1;  4J25 A;  3RZG A;  1FOD 2;  3LA2 A;  4AF9 A; 
#chains in the Genus database with same CATH homology
 4OUE A;  3WNK A;  1H6Y A;  4UAP A;  4MO3 M;  3I3B A;  2QQM A;  4PF1 A;  2W87 A;  4E8C A;  1R64 A;  2QQI A;  2Y6G A;  3AC0 A;  1DLC A;  4JKL A;  1UYZ A;  3A21 A;  4XUT A;  3WNL A;  2DCK A;  5C7G A;  2RV9 A;  2VZT A;  2VZP A;  2YC4 A;  3MO4 A;  3VD9 A;  5DPN A;  3T2Q A;  3I2F A;  4FI9 A;  4W4Z A;  1YQ2 A;  3NNG A;  1US2 A;  3CIH A;  2WO2 A;  4UI9 L;  5JMO A;  3SKV A;  1JZ8 A;  2VZ1 A;  1DYO A;  4QDR A;  5C71 A;  2E31 A;  3LE0 A;  4ET7 A;  3J7H A;  4P08 A;  2WN3 A;  3I2G A;  4MAD A;  2WDB A;  4DXS A;  3WNO A;  2QQL A;  4YPJ A;  5EJZ B;  1WCQ A;  3UES A;  1CZT A;  1I5P A;  2HYX A;  3FHQ A;  1US3 A;  3WF4 A;  3PUH A;  2VQU A;  2W46 A;  2VCB A;  3THD A;  1NX9 A;  2RJ2 A;  1GOH A;  3T2O A;  3VD5 A;  2W1W A;  1LNS A;  3UNP A;  2JD9 A;  2W47 A;  3C8X A;  2VMD A;  2QQJ A;  3C7H A;  1GU3 A;  1KEX A;  1W99 A;  1JU3 A;  2W1U A;  3K4D A;  4RN5 A;  3III A;  2VME A;  2J1E A;  4ARY A;  3W5M A;  4QX3 A;  1O8S A;  4ZXE A;  3W5N A;  2W1Q A;  4QB2 A;  3A22 A;  3MBW A;  4P00 B;  1T2X A;  1GUI A;  4XUP A;  5JR2 A;  4D8M A;  3WQB A;  1UY4 A;  3LEI A;  4E8D A;  2WZ8 A;  4Z2A A;  5F7U A;  2Y6H A;  1L7Q A;  3FHA A;  1UY2 A;  1IQD C;  2BBA A;  4RYD A;  5IYY A;  2YFZ A;  4AAX A;  3OG2 A;  1W0N A;  4QB1 A;  1OF3 A;  3K75 B;  3K77 A;  3HEI A;  3VDC A;  3A23 A;  2CDP A;  4QX2 A;  2W9X A;  2ID4 A;  3THC A;  3MV0 1;  4D0Q A;  2W1S A;  4DEV A;  3HNY M;  4XUN A;  5DQ0 A;  3SEP A;  1EUU A;  4QX1 A;  2Y8K A;  2JE8 A;  3NQH A;  1W8N A;  1H6X A;  4L0P A;  1MPX A;  2J1A A;  3P6B A;  4JKM A;  5LA2 A;  3ZM8 A;  1UY3 A;  3I2J A;  3GM8 A;  1JHJ A;  4ZZ5 A;  1JYV A;  1L7R A;  4P02 B;  4DUV A;  3IB3 A;  4TXW A;  3NJV A;  2OKX A;  3IAQ A;  1CZV A;  4OMD A;  2BER A;  4BDV B;  1UXZ A;  2QQK A;  4W50 A;  3WF3 A;  2ZEX A;  2VZO A;  5I0D A;  1WKY A;  3WF1 A;  2JKX A;  1XNA A;  3IAP A;  1CIY A;  3EYP A;  1XC6 A;  3ACI A;  3VD7 A;  2Y6J A;  4M4R A;  4ZZ8 A;  1W9S A;  3GXU A;  5IJR A;  3C7G A;  2VCA A;  3BGA A;  2W94 A;  2WYS A;  4OZO A;  1JYX A;  3FL7 A;  3MUZ 1;  3EB7 A;  1HN1 A;  1OH4 A;  4CVU A;  3C7O A;  4OMC A;  5JXH A;  1JZ3 A;  1UY1 A;  4QPW A;  5LA0 A;  4TTG A;  1O59 A;  2WO3 A;  1JZ4 A;  2WQ8 A;  3LEK A;  1OF4 A;  1W8O A;  1PX3 A;  2BZD A;  3ACH A;  3PUI A;  3K4Z A;  4LHS A;  4P5Y A;  4W8J A;  3LPF A;  2QQO A;  3K4A A;  3ETP A;  4GWI A;  4XZU G;  3T0A A;  1JI6 A;  1JZ6 A;  1D7P M;  4QDQ A;  2J1S A;  3A7Q A;  1CZS A;  4A4A A;  2E32 A;  4A44 A;  3T2P A;  1UYX A;  4M4P A;  2W5F A;  3K46 A;  2ZEY A;  2J22 A;  3SKJ E;  1CX1 A;  2ZEW A;  2J1V A;  1JYN A;  3T09 A;  3BN6 A;  2LW8 A;  5HXM A;  2RVA A;  1UZ0 A;  3I3D A;  3UET A;  3I2H A;  5G05 L;  2WAA A;  2VMF A;  2VR4 A;  1UMI A;  1NUK A;  2BGP A;  2VJX A;  3DYP A;  2YC2 A;  3OGR A;  4QDS A;  4BK4 A;  2VCC A;  3I2K A;  5DMY A;  2Y64 A;  5J1X A;  2C26 A;  2WAB A;  2Y6L A;  4CUB A;  3T08 A;  4QAW A;  1UXX X;  2W95 A;  2J1R A;  3MV1 1;  3CDZ B;  5EIY B;  4CU7 A;  3CKH A;  1F4A A;  2VZ3 A;  3OB8 A;  4GWJ A;  5FUI A;  4CU8 A;  1OD3 A;  3I97 A;  2JDA A;  4CU6 A;  2J1U A;  2PQS A;  3LQC A;  4MOA A;  2E26 A;  3P1I A;  5JXI A;  2L9L A;  5B4N A;  1SHW B;  2J1T A;  4A3Z A;  1JZ7 A;  4CUC A;  3F2Z A;  1K12 A;  4KMQ A;  3LEG A;  3HPN A;  5JXG A;  5CZK A;  5JUV A;  3WNN A;  3CQO A;  2XON A;  1PMH X;  4DEQ A;  1UX7 A;  2J7M A;  4XVH A;  1GNY A;  5CYY A;  5JXJ A;  4XUQ A;  1GQP A;  5IFP A;  1PMJ X;  3C7E A;  3CZU A;  3OEA A;  3LPG A;  3HNM A;  4JX0 A;  1BHG A;  3WEZ A;  2WBK A;  1J84 A;  2Y6K A;  2V4V A;  4JHZ A;  1OT5 A;  4MGS A;  1XPW A;  3WNM A;  5A1A A;  1GOG A;  3HJR A;  2VZR A;  2R7E B;  2YB7 A;  3CMG A;  2VQT A;  3I3E A;  2X05 A;  4BXS V;  1NAE A;  4XUO A;  1GOF A;  3U37 A;  2V5D A;  2W91 A;  2W92 A;  4IUG A;  2WAO A;  5IFT A;  5HPO A;  5LA1 A;  3FN9 A;  3OBA A;  2VM9 A;  4OYU A;  3ABZ A;  3OGV A;  4DUW A;  3VDA A;  4KI5 M;  4XUR A;  3ECQ A;  4DXT A;  5C70 A;  3T0B A;  1JYW A;  2WO1 A;  4BJ0 A;  4BK5 A;  2VZU A;  1P8J A;  4JKK A;  3HN3 A;  3GDB A;  2VZS A;  3JXS A;  5B4X A;  1K45 A;  3OGS A;  1JZ2 A;  1NKG A;  1XNT A;  2DDU A;  2WZE A;  3VDB A;  2HLE A;  2V72 A;  4A41 A;  2XOM A;  1UWW A;  2ORZ A;  3WNP A;  1K42 A;  2EID A;  4PQQ A;  3IDA A;  3DYO A;  3C7F A;  1F4H A;  4ZY9 A;  2VL4 A;  2EIE A;  2EIC A;  1W9W A;  1ULO A;  1JU4 A;  4LPL A;  3WSO A;  4AG4 A;  3MUY 1;  1K3I A;  2KD7 A;  5DN2 A;  3HNB M;  4CU9 A;  1UMH A;  2YFU A;  3CZJ A;  3DYM A;  3HOB A;  4HG6 B;  2XQX A;  4KWU A;  2ZEZ A;  3ACF A;  4A45 A;  2VMC A;  2VZQ A;  2DCJ A;  3GGL A;  3SEE A;  2X09 A;  4GZ9 A;  4A42 A;  1UY0 A;  3WF0 A;  3VD4 A;  4DUX A;  2VC9 A;  2C9K A;  2CDO A;  3E1F 1;  2E33 A;  1JZ5 A;  3OEB A;  4QB6 A;  1UYY A;  2B4K A;  2QBX A;  2WUH A;  2B9V A;  4PT6 A;  1TG7 A;  2X10 A;  2ZXQ A;  2QQN A;  2XHN A;  5G04 L;  4DXR A;  4LQR A;  1GMM A;  3D3A A;  1RYY A;  5LCW L;  1O8P A;  3ACG A;  2LS6 A;  1EUT A;  3VD3 A;  4QX0 A;  1PX4 A;  1KGY A;  2WN2 A;  3NJX A;  2C4X A;  2VO5 A;  5EJ1 B;  2VOT A;  4A6O A;  2Z4F A;  1SDD B;  3WF2 A;  3I2I A;  3T0D A;  1J83 A;  2ORX A;  4CUA A;  2VTF A;  2W3J A;  3DEC A;  5IHR A;  1DP0 A;  4ARX A;  1TVG A;  4LKS A;  4UOJ A;  3NRU A;  2EIB A;  1SG3 A;  1ULP A;  2BGO A;  4MGQ A;  2VZV A;  1W9T A;  2YG0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...