5LCWL

Cryo-em structure of the anaphase-promoting complex/cyclosome, in complex with the mitotic checkpoint complex (apc/c-mcc) at 4.2 angstrom resolution
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
183
structure length
182
Chain Sequence
b'TPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVESSIGKFPRCTTIDFMMYRSIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anaphase-promoting complex subunit 1
publication title Molecular basis of APC/C regulation by the spindle assembly checkpoint.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 30
structure length 182
sequence length 183
ec nomenclature
pdb deposition date 2016-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF03256 ANAPC10 Anaphase-promoting complex, subunit 10 (APC10)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 5lcwL00
3C7HA 2ZEZA 1H6XA 4ZZ5A 2QQIA 3BN6A 2C4XA 1EUTA 5IFTA 1CZSA 1NKGA 3LQCA 5JUVA 1J84A 4DUVA 4QX1A 3LEIA 1JZ2A 4LQRA 2WO2A 1JYWA 3ACGA 3BGAA 3J7HA 3NQHA 4JKMA 3D3AA 3I2HA 2QQKA 2DCKA 4MOAA 1H6YA 3WNMA 5EIYB 2Y6LA 1UY3A 2QQOA 2YB7A 3T2OA 3VD5A 3C7OA 2XQXA 2X10A 3K4AA 3GXUA 2W5FA 3OEAA 2B9VA 2X09A 3OGRA 2J1RA 4A4AA 3WEZA 2WDBA 1JZ8A 4QDRA 3DECA 4E8CA 1SG3A 4W4ZA 1GOFA 1W8NA 3I3DA 1PX4A 2WUHA 2VCCA 2J1VA 4BJ0A 3I2FA 5HXMA 4D0QA 4QX3A 2JKXA 1KGYA 1JZ6A 2XONA 3DYOA 3WNPA 4QAWA 3IB3A 1UMIA 3ACIA 5B4XA 1WKYA 1US2A 1UYZA 4P5YA 3LE0A 5I0DA 1TVGA 3K4ZA 3T0BA 2CDPA 4MADA 3CMGA 1CZTA 2V4VA 4QDSA 3PUIA 1OF3A 3IAPA 3WSOA 1F4AA 3K77A 4XVHA 2WN2A 2WABA 3ETPA 2VTFA 2VMFA 2BZDA 2Y64A 1NX9A 2VMDA 3LPGA 3NRUA 4IUGA 2CDOA 1UYYA 5A1AA 4L0PA 1MPXA 2E26A 4XUNA 2VZ1A 1UZ0A 2QQJA 2RJ2A 3WNOA 2X05A 1PMJX 4QX2A 3HEIA 1I5PA 3W5MA 3THDA 3W5NA 3ECQA 3A21A 4JKKA 3MO4A 1XNAA 3U37A 2VR4A 3CQOA 1W9SA 1OT5A 2E33A 1J83A 2QQMA 1L7RA 3T09A 2W47A 4A44A 1XNTA 4KI5M 1JHJA 1DYOA 5JXHA 1UXZA 1JI6A 1O8SA 4BXSV 4CU6A 4A42A 1NUKA 1ULOA 2ZEYA 2J1SA 2WAAA 2W46A 1D7PM 2W1QA 1LNSA 1UY4A 5IHRA 3T2QA 1K42A 3OEBA 2VM9A 1DP0A 4GZ9A 1JYNA 2WQ8A 5DQ0A 2Z4FA 4UAPA 2RVAA 2VQTA 4LKSA 3VD9A 1O59A 2C9KA 3HN3A 1K45A 3OBAA 1L7QA 3NNGA 2VZVA 3OGSA 3A7QA 3C7GA 3ABZA 3VD7A 2LW8A 4ZXEA 4ET7A 4JX0A 2HLEA 3FHAA 2VZPA 1KEXA 4XUOA 3SKVA 1RYYA 3IAQA 5C7GA 4LPLA 1W9TA 1UX7A 2RV9A 1GOHA 3FHQA 4DEVA 3SEPA 4DXRA 2EIEA 4M4RA 4ARYA 3CIHA 2ZEWA 2C26A 4A45A 2W1SA 3P1IA 2VMCA 2WZ8A 3AC0A 2Y6KA 1UXXX 2EIDA 4CUAA 1HN1A 2Y8KA 3ACHA 3I2IA 5J1XA 1JYVA 3DYMA 4PQQA 5G04L 3WQBA 2L9LA 2W94A 2WO1A 3WNNA 1O8PA 3IDAA 1YQ2A 1PX3A 2VJXA 3C7FA 4CVUA 1UYXA 2W1WA 4QDQA 3JXSA 2VC9A 2VZSA 4XUPA 1W99A 3GGLA 5C70A 1GUIA 4E8DA 2VZQA 1IQDC 1US3A 1CX1A 3SEEA 1XPWA 2LS6A 2BERA 3ZM8A 5JXJA 3HNMA 2DCJA 3LEGA 3CZJA 1NAEA 2YC4A 4CU9A 4A41A 4CU7A 4ZZ8A 2ORZA 1GQPA 3HPNA 5C71A 4P02B 4MGSA 4QB1A 3NJXA 4XUTA 3K75B 3DYPA 5B4NA 4BK4A 4TXWA 3GDBA 1DLCA 3HJRA 3T2PA 3WF0A 2YFZA 2BGPA 2JD9A 3T0AA 5JXGA 4D8MA 1OH4A 4LHSA 2XOMA 2OKXA 2WZEA 2W95A 3CKHA 1BHGA 2KD7A 2QQNA 3IIIA 2Y6GA 3HOBA 2Y6HA 4JKLA 5LA0A 4A6OA 2VZOA 2VOTA 1GNYA 5DPNA 2VO5A 3E1F1 4OMDA 3VD4A 2XHNA 2BGOA 4A3ZA 1SHWB 4W8JA 2VCBA 5LCWL 1TG7A 3OG2A 2Y6JA 4QB6A 4DXTA 3GM8A 3THCA 3OB8A 3UESA 1T2XA 2J1EA 3EB7A 4XZUG 1EUUA 1JZ4A 4BK5A 3C7EA 4OYUA 4ZY9A 2E31A 3HNYM 4P00B 5IJRA 2ORXA 1ULPA 3I3BA 5FUIA 1JZ5A 5JR2A 3NJVA 2WO3A 3MV01 3C8XA 3F2ZA 4HG6B 2WN3A 1P8JA 2J22A 4QPWA 3WF2A 4UOJA 1SDDB 2V5DA 5CZKA 1UY0A 3WF3A 4DXSA 5EJ1B 3CZUA 5DMYA 5IYYA 1W9WA 2WBKA 3MBWA 2J7MA 1UY2A 3UETA 5DN2A 5F7UA 3WNLA 2QQLA 4MGQA 5HPOA 3LPFA 2VZTA 3LEKA 3VDCA 5LA2A 3P6BA 2W1UA 5JMOA 3WF1A 4CU8A 2WAOA 3K4DA 2VQUA 3VDBA 2EIBA 3WF4A 1JZ3A 3MUZ1 4CUBA 4XUQA 3I2GA 2JDAA 3OGVA 3I3EA 2DDUA 2B4KA 3A23A 3FN9A 1GOGA 2PQSA 3MUY1 4W50A 4BDVB 4XURA 3VDAA 2EICA 3I97A 4PT6A 2R7EB 4QX0A 4GWIA 2VZ3A 2VL4A 4FI9A 1OD3A 2ZXQA 4OMCA 1XC6A 4ARXA 4Z2AA 4OZOA 2QBXA 3SKJE 2J1AA 3A22A 3FL7A 1R64A 4QB2A 5EJZB 2YG0A 2E32A 4JHZA 1K3IA 4AG4A 4KMQA 5G05L 5CYYA 5IFPA 2ZEXA 2VZRA 3I2JA 4RYDA 4RN5A 3T0DA 4PF1A 3UNPA 1UWWA 2VMEA 3EYPA 2VZUA 1W0NA 3I2KA 4DUXA 2W91A 1GU3A 2ID4A 1CZVA 1UMHA 3HNBM 1K12A 4MO3M 3WNKA 1UY1A 2YFUA 4YPJA 2W9XA 2HYXA 2J1UA 4UI9L 4P08A 2V72A 1GMMA 4KWUA 1JYXA 1W8OA 2BBAA 2W92A 1PMHX 3K46A 1CIYA 1F4HA 5LA1A 4M4PA 4DUWA 1JU3A 2J1TA 4CUCA 2W87A 1OF4A 3VD3A 3MV11 2VCAA 1JZ7A 4DEQA 2W3JA 3T08A 4TTGA 1WCQA 3ACFA 3CDZB 2YC2A 3PUHA 4GWJA 2JE8A 2WYSA 1JU4A 4AAXA 4OUEA 5JXIA
chains in the Genus database with same CATH superfamily
3C7HA 5FREA 3PMSA 2XVGA 4FFFA 4HVOA 2JDUA 4Y26A 4ZZ5A 1YIFA 2JDMA 4GJZA 1POV3 2QQVA 4LOSA 5FZKA 4LIVA 2ZABA 1EYBA 1EUTA 4AGVA 4LO5B 2WNVA 2W0XA 4M0HA 2EIGA 2XVLA 4Y5SA 5LBCA 1RVF3 3TAYA 4CE8A 3WUDA 1OLME 4H14A 4BQ2A 2XJTA 2Y6FA 3LEIA 1JZ2A 4R9DA 5EP9A 2BOIA 1QJY2 1W6NB 3AMPA 5C3OA 5C3RA 2MHFA 3PJYA 5EWSA 1HQWA 1Z7S3 1T6GC 4YM1A 5KHGA 2P3IA 3D3AA 4LBNA 2QQKA 4NHYA 1LB2A 1IG0A 2PHRA 4NROA 1RMU3 1H2NA 2VNRA 3ES1A 5F2WA 3X29B 1UY3A 2PHTA 1GP6A 3AX4A 1OA2A 1ENXA 2QQOA 2YB7A 4WM7A 1O3QA 4NWWA 2Q0AA 2VU9A 1MEC3 4HKOA 4QPIC 1UN1A 2TBVA 3OGRA 3LDKA 4W6WA 2WSUA 4A4AA 3OPTA 1WD4A 5H9RA 4XBNA 5JOXA 1CVNA 1W6OA 3BKZA 2AYHA 3AMMA 1IKQA 3WEZA 4JRAA 5C33A 1HN0A 1L7LA 3J7LA 4K6BA 4CDXB 2WFPA 2B5HA 3DECA 5KXDA 1JN2P 2CGOA 1W8NA 1QNWA 2P34A 2DBIA 1QJU2 1PO23 5FWEA 3CF6E 1EAH1 1YQ6A 2CGPA 1C8NA 4YW4A 1UKRA 4TLFA 5LRRA 1JOPA 4KWKA 1IGOA 2JJ6A 2FDFA 2JKXA 1VBE3 4RGAA 5ACA2 4Q2FA 3VZNA 1HXS3 3KT1A 4WV8A 4IEOA 1BVP1 3S0MA 3MPBA 1CAVA 1UMIA 5CIRA 1MR5A 5B4XA 4BQWA 2AREA 4HSJA 1RUE2 1XBFA 2ZKLA 5LBBA 3KGLA 4OHXA 5DDJ1 2XKPA 1UYZA 3RMXA 3LE0A 5A32A 3WP6A 4AW7A 2HWB1 2YBKA 1HIXA 3VZKA 1LEMA 2Y60A 3CMGA 2V4VA 4CP2A 3KF5A 1OF3A 4BA6A 2VVFA 5CFDC 1BK0A 2QVSB 3E97A 4N9HA 3NAPB 1W03A 2VH9A 3K77A 2YGMA 3IKWA 2WN2A 2BWAA 2C9AA 2WABA 2JXAA 3DGTA 4AFMA 1XYPA 4RS5B 2A6YA 3ETPA 4YW2A 3SCGA 4ATEA 2VTFA 2ZMNA 1S0FA 3N9LA 3PURA 1HRI3 5KXCA 2Y64A 4BM8A 2P3JA 4ITCA 3RZLA 1GWMA 4GD4A 4Y22B 3LFIA 4IUGA 3QBQA 2JIGA 4XILA 1S0BA 3M2MA 2LRPA 2XDVA 5A1AA 2UYBA 1PGW1 1ZYBA 5DZGA 5IAXA 5FZ8A 2DCTA 2E26A 4XUNA 3U07A 4COWA 2D6MA 3MFCA 1RUJ3 4O65A 3FX3A 2Q1ZB 2Z79A 1Z0HA 2VZ1A 4JAAA 5DAQA 4HXCA 1JOJA 1GSLA 1PMJX 5K0UB 1RUI3 4I3GA 3HEIA 5EFUA 4C0HA 2IC1A 5JMCA 1AR93 1KFXL 4L11A 1DGWA 1BEV1 4UFMA 3HN1A 1GICA 3W5NA 4XJUA 5A6QA 4XJAA 3CJIA 3WR0A 3ECQA 4XYXA 1AYN1 1BK1A 3VKMA 3B9IA 3JB8A 1UOGA 4JQRA 3WG4A 2D6KA 1RUD3 3JD72 2ZPXA 2ZAHA 4CCLA 1IS6A 3D4KA 4ASLA 4DMIA 4FOYA 4Z1VA 1O91A 3CQOA 2UWAA 5E1RA 3I59A 5J98B 4CP1A 4LT5A 1VMFA 2UYAA 1H4HA 2WFF3 1L7RA 5FXZA 2NP0A 3L9JT 3IMMA 2WT0A 3QCWA 4CDWC 2XUMA 2W47A 4Q5OA 1W8TA 1XNTA 4KI5M 5D8AB 4JCKA 5KC6A 4CDQA 3KF3A 1ENRA 4QXBA 3A4UA 2ZGNA 3HBKA 4GJYA 5FK7A 3WD5A 5GLWA 3ZFEC 3HQRA 4QX8A 2XL7A 5M0TA 4GB32 4LHNA 2HWF3 3HIFA 4YRDA 3AFKA 4MHRA 2ZGPA 4RGKA 1NCQC 2X29A 1AR82 1NXD1 4XFHA 3BTAA 4HT1T 5E6HA 3VDDC 4E27A 2WAAA 5BNPB 2ZS6B 4COZA 2W46A 2IXLA 2VECA 2W1QA 1UY4A 4EWEA 1E5SA 5E89A 4CCNA 4D7TA 3OEBA 1QH7A 1AJKA 1DG6A 1XE8A 1DP0A 2ADEA 2VM9A 4FFGA 5F6KA 2JENA 2P4EA 2PTMA 4INDA 1TMF1 2D5HA 4Q4W2 1RJ8A 4YZ1A 5J7MA 1GQGA 2Z4FA 5FZEA 2VQ0A 3VBRB 1CN1A 5FPAA 2RVAA 2VOWA 4BQ4A 2C9KA 2X53S 1YJLA 1L7QA 5KR7A 1UU4A 5FZOA 4XHBA 4K8FA 3OGSA 3T30A 4CEWB 1A34A 1R093 3A7QA 2PHXA 5IK7A 4JZRA 2MEV1 3P3PA 2LW8A 2PLV1 4D7SA 3B5LB 4PLNA 1SBEA 2YYOA 4RR3C 1ASJ2 2RR11 3ZFGC 5IVEA 2CWMA 1KEXA 4N43B 1UAIA 1ZBE3 4XFIA 1W9FA 1S2BA 3ZXLA 2A70A 3IAQA 5FZCA 1FOD2 2Y33A 4LITA 5F3GA 4AL9A 2EXHA 1W9TA 4AI3A 4COYA 2DVFA 2RV9A 4UW4A 3MYXA 5A70A 5L7OA 3AKQA 1DCSA 3VBOC 1D4M3 1X9TA 5HCAA 2R0FA 2HWD1 3H1YA 2LUWA 2Q8DA 5C4WB 4DXRA 2OQ7A 1QQP1 3ZR6A 1SACA 4XHXA 4IV3A 5EPAA 2WNUA 4HPKB 4AOCA 1C4RA 4QPGA 5ABJB 1LHNA 2WZ8A 3AC0A 1UXXX 1BQPA 3CNAA 4QQHA 1V6NA 1YQ5A 2EIDA 2RJLA 1GQHA 3MGUA 4Z82A 2ENRA 3BVCA 3I2IA 2GC0A 5AC91 1JYVA 1UZWA 1B09A 4HFSA 2W94A 4AQ6A 2YBSA 2D6PA 1SFNA 1S0GA 3JUUA 3TNQA 5LW9A 4GWMA 1MZ5A 3J8F1 4IEUA 4CZSA 1LRHA 4XF4A 1Y43B 5J48A 1X50A 1NXMA 2OZJA 2PMWB 4P5HA 4C90A 1NLQA 3N36A 2VZSA 2Q8OA 2PAEA 5JI9A 2BNMA 2HWE2 5CADA 2R061 2KR2A 1GLHA 3I2DA 2YUEA 5C5UA 5KXBA 3ACLA 1POQA 1GBGA 2VZQA 1A8DA 1IQDC 3BPSA 1TNFA 1PNGA 1VBD3 4LBQA 3KM5A 3ZFFB 1NCRC 1ZZBA 2XLFA 4K40A 3SXWA 1STMA 5SV5A 3SEEA 3AVSA 1C3HA 3PNAA 5JXJA 1VRH2 5CFCB 5FUNA 4YFZA 1YJKA 4YLZA 2WA3A 2YC4A 4R9AA 4E2GA 4A41A 5F5IA 4CYDA 4YARA 4ZZ8A 1F5FA 2RS32 1GQPA 2RS52 5FZ4A 3L2HA 2IZWA 3HPNA 4RHV3 5C71A 4UFLA 4JHTA 1WMFA 1DQ5A 4AEDA 2CYFA 5AFEA 1JYCA 1LULA 2WS92 1ND3B 1XYNA 3VLBB 3NJXA 1JODA 3K75B 4H3WA 4Z07A 4NHMA 2UY8A 1SFPA 2XJSA 4B29A 1R1A3 2AEYA 4BK4A 4Y20B 5FZDA 2Y0IA 1DLCA 3W58A 1VB4A 1PZ8A 3HJRA 1KS5A 3T2PA 3BTZA 5FP7A 2GSYA 2ZGRA 3KWVA 4Q4X3 2A3WA 2JB4A 2R1DA 1MQTA 3MLKA 3PU3A 5L73A 1UOBA 5DUVA 3T0AA 1C28A 1VJ2A 5JXGA 1KDKA 5BNNB 4D8MA 3IN9A 3TYJA 2ZAAA 4LHSA 1AL0G 2XOMA 4JDMA 1PM7A 1G6NA 2GNMA 2WNOA 3DL3A 5JZGB 4KU7A 3RVHA 3ZR5A 3CKHA 1EPWA 1YQ8A 5GALA 1UU6A 3DEMA 2X5IB 4ASMB 1O7FA 1GNYA 2VOTA 1SLIA 2PFWA 3VBFB 4IEQA 1FV2A 3ES4A 4H7LA 5CVRA 1I1EA 4A3XA 1UCXA 4OMDA 4PBOA 2PHWA 2XHNA 4QKDA 3VUOA 1XNKA 4GMP1 4TLGA 1DBNA 2D7FA 4A3ZA 2VE1A 2OPKA 2QKDA 1SHWB 3KVAA 2VCBA 4N9IA 3J4UH 2DFCA 1DQ6A 5LCWL 1CJDA 1QJZA 3LD8A 3WW4A 4DXTA 5E16A 5FAXA 2TEPA 1OUXA 3OB8A 5JOWA 4FQZA 3UESA 4XZUG 4E9KA 4AFAA 3C7EA 4XPVA 4OYUA 2E31A 3HNYM 1ULFA 3S7EA 4P00B 1UOFA 1ULPA 4RD7A 5FTTC 5LY2A 4NRPA 3POIA 2DU0A 3NJVA 4FPOB 4QPIB 5DAPA 2WO3A 2BBVA 4DQAA 3C3VA 3MV01 4ES8A 1S0JA 4K20A 3QD6A 2UWCA 5DUUA 4RFT0 2J22A 4QPWA 1W28A 1EAH3 1OXCA 1RUF2 1URXA 1AX2A 1SDDB 1JXNA 5A3WA 5A7WA 1UY0A 4K3UA 5L9VA 1VAKA 2RDSA 4FP2A 4GH4A 3SCFA 3TN91 5FOBB 4YYOA 1W9WA 4D7YA 2O14A 2D44A 2WZR1 1AX1A 1VMHA 2BV4A 1PO12 1RUH1 3JBG3 2C24A 3K51A 5FMOL 1ENQA 2GNBA 2J7MA 4M3CF 5FMOS 3THTA 2WKKA 4XACA 3BODA 5DDJ3 2PHDA 3WNLA 5C5TA 4HOOA 2HWB3 4FBFA 1NQDA 1DF0A 1UZYA 4YG3A 1BCXA 2YROA 4CDXC 3J9SA 2VULA 3IIAA 4YG0A 1PO11 3P6BA 4I30A 5JMOA 3WF1A 3H8UA 4XBQA 4AQTA 4DS0A 1ZRFA 4YW5A 3QACA 3TEZA 3K4DA 1IQAA 2VQUA 5I8TA 1IKPA 4NIAA 4YVSC 4CUBA 3AM2A 3T1LA 3ZSMA 3T2TA 3M1HA 4MUVA 4S2FA 5CA6A 3AP9A 1MVQA 2YU2A 4Y1VA 2AZ5A 3GZAA 1GOGA 3RZGA 3MUY1 4IEPA 4W50A 4XIKA 3ZXJA 5HBAA 2ZGMA 4CPBA 1QHDA 1IZ3A 1S2KA 4PLMA 4PT6A 5F39A 4QX0A 2VBPA 4GALA 3UJOA 2P5BA 3LSEA 3ZIXA 4BOWA 1CWPA 1OOPB 1PVC2 2YMZA 2EALA 3CU7A 4HL0A 1DGWX 4LEJA 4YW7A 5A33B 2ZXQA 2FD8A 1XC6A 4WVVA 4Z2AA 1AR72 2CNAA 2J1AA 1BEV3 4PI2A 3WT3A 1AL22 4QQ2A 3A22A 5FY5A 4LK6A 1IS5A 4JDNA 5EJZB 3GJAA 5FZHA 4LBJA 4AG4A 4EN8B 4LKEA 1O4YA 1O4ZA 1QIQA 2D5FA 5FZGA 1AYN3 2ZGOA 2B45X 3RG0A 5IFPA 2PXJA 4P9LA 1COV2 3I8TA 5J09A 4P9IA 1PVC1 3MW2A 4RYDA 3TEYA 1LOCA 1BBT2 1AL21 2B46X 2IVJA 1OPOA 1W0NA 2VZUA 3EYPA 4WM8C 5LASA 2W91A 3VV1A 2VUAA 3AYAA 1GU3A 5CG9A 3O0WA 1W6PB 4H55A 4OI1A 1COV1 2BOJA 2P3KA 1EV13 1LKNA 2H6CA 5L9RA 1UY1A 2Y38A 2YFUA 3AKSA 2J1UA 3ROUA 4R4ZA 5K0UC 1Q5OA 3MDPA 1S55A 5CFDA 2Z42A 4LHLA 4AHZA 1VBB3 5JSPA 5A1LA 2H6BA 3QH6A 3DF0A 3H7JA 3R4SA 4A7ZA 1V6JA 2AGSA 4LE4A 1WWYA 4QKBA 1WLWA 1HB2A 1CIYA 1F4HA 3KQ4B 3D6EA 4HKLA 2BP6A 3ZFEB 3ZPOA 4G9SB 3RZHA 3WG1A 1SZBA 2Q1MA 1OF4A 2W87A 1UOJA 4IGOA 1RUI2 3T08A 3VDDB 1WCQA 2FCVA 1TMF3 4X8PA 1VB2A 2P1BA 3ACFA 4MH0E 4IEVA 3LDRA 1DU3D 1UO9A 2PAKA 1ZBA2 1ONAA 2JE7A 1PGL1 1ULEA 2VUCA 2OUHA 1HJFA 4K1ZA 1W04A 5D8AC 1MVEA 5DZEA 4XE9A 1DQ4A 4M3CB 1ZREA 4LO6B 1VMJA 2Y26A 3JU9A 5JXIA 3G7DA 2B42B 1LHVA 1BZWA 5CBLA 1D2QA 2QUOA 4PLOA 1BXHA 2RJKA 2FCUA 3MIDA 3NNLA 1BKZA 2MEV3 3BN6A 4E4HA 3V0AA 1ZBA1 2PLV3 2ZOEB 4OHWA 3LQCA 3Q8AA 3ZKUA 3ZN5A 3FFZA 5KBFA 1NLRA 4FQ4A 1QEXA 1RXGA 3JQXA 4AAPA 1J84A 3AFGA 4XAAA 4DUVA 2XVKA 1HW5A 1G9FA 3WQ0A 1NZIA 2PHLA 2R072 2XHKA 5C6CA 4FOVA 1CONA 3BPZA 3BGAA 4BPZA 4EN7B 1H1MA 3NQHA 4Z8BA 2BVVA 1K5MA 3I2HA 3OY8B 1NY71 5FZMA 4NUBA 5FZ0A 4MOAA 1H6YA 4AHYA 4CDWA 1VE0A 4GXLA 2Y6LA 2B8MA 3I3QA 1AXKA 3ZFGB 3O1VA 2I2SA 3VBRC 4FPFA 5LK5A 2EAKA 5T55A 2HWD3 3HD8B 5KHJA 1PIV2 3J26N 5AVPA 1QQP3 2EXJA 3GXUA 3QLQA 3VBUB 2X09A 2J1RA 1RHI1 1VPHA 3AZZA 2AC1A 1UIJA 3PU8A 3VGIA 2W68A 2IXHA 4CEWC 3VBOB 1X82A 4LORA 4HZFA 1NCQA 2TNFA 4BQ5A 1JZ8A 4FPGA 5F37A 4EQVA 3USSA 1LU2A 5AC93 2RS12 2IFWA 3AXDA 4CUGA 3N7LA 5FWJA 3DXUA 5DUWA 1SLCA 1C8M1 1RJ7A 3I3DA 4N43C 3BALA 4IETA 3RWKX 2VCCA 2J1VA 4XETA 1TME2 1H2KA 4BJ0A 3I2FA 4XEZA 3H3UA 4IV1A 5JSOA 4QX3A 4S2GA 1A8MA 2XBO2 3ETQA 2ZMLA 4O7XA 3ZMNA 4QAWA 4AI0A 1SBFA 3IB3A 4CCDA 2HWC3 4EZ4A 4N7UA 4IE0A 3N7MA 1AUYA 3LCPA 5C4WC 2P37A 2CV6A 3NJZA 4LBKA 5FYYA 3R05A 4V1PA 1CR7A 4META 3RZKA 1PGSA 3KGZA 1CPNA 3B01A 4QT6A 4QX5A 4UXAA 2XJUA 4IGPA 3USUB 4MADA 4EE2A 3S57A 1VBC3 4QDSA 1UX6A 4QU1A 5HI0A 2ARAA 4CEYB 2QQWA 3H1MA 1WW6A 3WSOA 3ZX7A 2CSGA 4IW3A 1A6CA 1UKGA 4RR3A 1D4M2 4XVHA 1S0DA 2QDNA 3AK0A 4XF1A 4FP3A 4IGQA 2DCZA 1RUG3 2A7AA 4OZXA 3ILRA 5IK8A 1ZM1A 5FO7B 5T5PA 3S5QA 4BU2A 1NX9A 1VAVA 2BTVC 3MI8A 3LPGA 4NRMA 4DOUA 1F8VA 3NRUA 3BTXA 4H2AA 3AKPA 4XABA 4IEXA 4WVWA 4LE3A 4Q29A 3M3QA 4XTMA 1RUC1 3ZPYA 1QOTA 1U0AA 5FK8A 1OSGA 2ZGKA 2VW1A 4JQTA 3AKRA 1O3RA 1R083 1H1AA 4X8NA 2G9FA 2D6NA 1DDLA 2RJ2A 3WNOA 3P5BA 1E5HA 5FZ6A 2HH9A 3N7JA 1HRV1 2WIIB 5IK4A 2PA7A 1I5PA 2VPVA 2JWPA 5LA9A 1I3HA 4WZFA 1VRBA 3ZN6B 1FMD1 3PTYA 1XU2A 4NVPA 4CP9B 5A3LA 2A6XA 1W8UA 1BMV1 4Q27A 1YQCA 1CAWB 2JG8A 5FBJA 1LGCA 3HWJA 2V5YA 4GMP3 1LOGA 1NA1C 1GP5A 1CIWA 1QJX3 2PYTA 1AZDA 1LEDA 4H7MA 3UKNA 3UYJA 2DUOA 1W9SA 2CU5A 1J83A 3NNFA 5HV4A 2VG9A 3ZN4A 3O0VA 4M01A 1KITA 5JLVA 1G9AA 2GALA 4YZ2A 4QQPA 3H9AA 4DO0A 1G7YA 2AEZA 4WM7B 1NCRA 4QKFA 1ZZ6A 4FTBA 2YY1A 5ANQA 1CAUA 3E6DA 1I5ZA 3LOIA 4LO7A 2QE3A 3O1TA 5JZGC 1OHFA 2N7GA 1O8SA 2RMU1 3NV4A 3ZVXA 4CU6A 4A42A 2X5IC 3PIJA 4Y33A 1QOSA 3POYA 1SBDA 4NPMA 4QHBA 4BQXA 3VBFC 3TN93 5IUQA 2GNTA 4Q4X2 2E51A 4NIIA 3VBHC 2WZR3 3OPZA 1YO8A 4WVMB 4KBZA 3UK9A 1GZWB 2WRAA 2BYVE 2X8KA 2I07B 3VHRA 4Y5Z0 1S4CA 1CAXB 3KV4A 1GV9A 4GZ9A 1JYNA 4GQ7A 2WQ8A 3GYDA 4ATFA 4UBHA 3QH7A 2EXIA 1LOEA 1TZOA 4EV0A 4L8QA 1YFXA 3MIGA 4XXAA 4XQWA 2ZACA 3WXPA 1QJY1 3OBAA 3FJSA 1PK6B 3ELNA 2VZVA 4UFJA 1EPZA 2YBPA 2WO7A 1ULDA 4K1YA 4FAHA 2CWSA 3C7GA 3ABZA 2FDHA 1OPMA 1H8TA 4BH9A 3DPRB 3PTRB 3KD4A 3QOPA 1F15A 5C8CA 1N3PA 1Y9GA 4XDPA 2NZ9A 3M3IA 3UGFA 4NHLA 1XXNA 3AB0A 1JYTA 2HJIA 5C3PA 2NQYA 4TZDA 2XJVA 4ZU5A 1H8VA 1RYYA 2D6OX 4YVSB 3WV6A 2ZX3A 3AYCA 3RRDA 1C1FA 1FPN3 3H3ZA 4IE5A 4DPNA 3ORJA 5FFOC 5JOZA 1OD5A 4BWOA 4NRQA 5FKCA 5LATA 1BYHA 4F8AA 4DEVA 3EJKA 3SEPA 3WG2A 1QJU1 2EIEA 2HKXA 4ARYA 3T4HB 3OUJA 2AR6A 5FP8A 3V56A 4JGZB 1W6NA 4IE7A 2Y6KA 3NO8A 5ACA1 2NYYA 5I8YA 1RTVA 5F2SA 4FOQA 3BOWA 1EY2A 2DV9A 3H3LA 4AGRA 4PQQA 1RUE1 3WQBA 1XU1A 3CLPA 4L92A 1SFYA 3IMNA 3NL1A 4YW6A 5JWPA 1MS8A 2GH8A 3THPA 3LGRA 3LA3A 3RZZA 4CCCA 2AUYA 5FY1A 4NJ4A 1PX3A 1G9CA 3ZYJB 1MS5A 2IUWA 5SV8A 4CXYA 1SLAA 1W90A 5FMCA 1OOPC 2WWJA 4QDQA 3SH4A 4WM8B 4I0BA 4CDXA 5FY8A 4OUMA 3UKVA 1AHSA 1VBA2 1AF9A 1GUIA 2QCSB 4IDZA 4E8DA 2XKOA 4OQ8A 1V6LA 4BYYA 4FPCA 4IQPA 4FPEA 1LOFC 3IDCB 2VCMA 1V9U2 1PZ7A 2BERA 2GP3A 3HT2A 4DY5A 1FAYA 1RL3A 3RPQA 5CG8A 2DCJA 3VZMA 3ZYBA 2BJSA 1NAEA 2Q4SA 2Z69A 4ZPIA 4CU7A 4XCBA 4D3WA 4AI1A 2VTXJ 4A2UA 3PIGA 4MV2A 3T1MA 4MGSA 3TRSB 1V9U1 3RJRA 3KT4A 4XUTA 2D97A 1IS3A 1OKOA 1D0GA 2FHRA 4IEZA 1FNZA 3KV9A 4TXWA 3RS6A 5CNAA 4EWDA 3WF0A 3B69A 2YPJA 3ILNA 1FATA 3FHIB 2BGCA 2D43A 3NAPA 4Q4Y2 1RB8G 1IPJA 2DF7A 3OBZA 2JD9A 3JD71 1G8WA 5H9QA 4XQDA 2JG9C 1OQDA 5DG1A 4RS5A 5F5CA 1OH4A 4UFKA 3B3QE 1KXGA 4COVA 5IK5A 2W95A 1BHGA 2KD7A 1EV12 2ZX1A 4Y22A 3WW3A 1N3QA 2FQPA 2Y6HA 1HV1A 4CTEA 5LA0A 2ZGUA 4FPLA 1G86A 2VZOA 5TSWA 4XAEA 4HKWA 4DNYA 1FV3A 1VBB2 3E1F1 2XPJA 2WT2A 2FDIA 2GP5A 1YFYA 3AYDA 1CD3G 2P2KA 2ZGSA 3HQXA 2WZPP 2NLRA 4IXLA 1R1ZA 3TWIA 1HQLA 4W8JA 2LROA 4GB31 1TG7A 4QB6A 2GZWA 2WC2A 3FE5A 5FKBA 5K0UA 2BPA2 3BCWA 1AR81 1APNA 2OW4A 5F8PA 1SMVA 1V0AA 5FYIA 1T2XA 1DIWA 2VXRA 4BK5A 4OI4A 1QOOA 2ZA9A 3I3BA 3UT0A 1V00A 3JQWA 3MEPA 3K3OA 5T5OA 5JR2A 4LIUA 3B9CA 4N53B 4EN6B 1XRUA 5FLJA 4HG6B 1I9RA 2ZHKA 2WN3A 1OVPA 3JZVA 1C8M3 1ZRCA 3D82A 4Q4W1 3WF2A 2WLPA 4CSWA 5I0UA 2DVBA 2BRTA 4YSFA 5C9AB 5IVJA 3PDQA 4LJHA 5LEKA 3H8XA 5EJ1B 3SQOA 3CZUA 5I91A 4IL7A 3KMHA 3O1SA 2R6QA 1UIKA 3K48A 5LBEA 1W6MB 2KM2A 1QXJA 2D98A 3HVDA 3MBWA 2VY0A 3PUAA 5BNOC 1Q8SA 3LA2A 1IOAA 4ZHNA 3I49A 4CDUB 3UETA 1AR62 2RE9A 4XDOA 2ZHMA 3VBUC 1ZZ8A 5LBFA 3RYPA 1XNDA 4AVSA 4MGQA 4Q4V3 3AP7A 4HLTA 4QPYA 5IVCA 2XQRA 2VBDA 2XB6C 4UW6A 1ASJ1 3ME2A 2ZGQA 1OUSA 3VDCA 4JGYB 4ZKTB 3A0NA 5LA2A 2W1UA 4G4FA 4W6XA 2A3YA 4TYSA 1KS4A 5BNPA 2HEVF 2GH2A 3Q8EA 1F9KA 1FOD1 4TN7A 5EQUA 4EJRA 3EBRA 1H0BA 1PMIA 2OQ6A 3SMHA 4DINB 3FLRA 5F3IA 5FQ0B 2ERFA 3EXUA 2EIBA 3N9MA 3WF4A 1JZ3A 3MUZ1 5F1RA 2JICA 3M70A 4XUQA 3SH3A 2JDAA 3OGVA 2OT7A 3I3EA 4LO4B 4IE6A 1AYM2 1G9BA 1Q43A 2WNEA 3FN9A 3VBRA 5GZFA 4XFBA 1RUC3 4YM0A 3HMYA 4XURA 4AHWA 4YGEA 4B4PA 2K0GA 2P6HA 2R7EB 1UF2C 2P6CA 3NMBA 4PDWC 3LFMA 3WP5A 4CEWA 4E2QA 4HK9A 4TSVA 5BPXA 5GM0A 1Y9MA 1GYKA 4OMCA 4YVWC 4ARXA 5FPLA 1YFUA 2ADDA 1HRV3 2UURA 2IXIA 4O61A 4CEYC 4XJWA 5JCTA 1AXYA 4OLLA 3FL7A 1FMD3 1R64A 2BQPA 3IBMA 4ZXKA 3WDVA 4R8HA 3K3NA 1W6QB 4JHZA 4LA3A 4KMQA 2R0HA 2GAUA 2HWC2 4N43A 5E88A 2ZEXA 2VZRA 3CBNA 2RM23 4V2WA 3ZMOA 5FRAA 4BMEA 3T0DA 1PNFA 1Q8PA 2HWE1 5GJ6A 1RXFA 4AFCA 4HVQA 2GMPA 1ND2B 5L9BA 3UNPA 1UWWA 4XMAA 4AQ2A 2VMEA 1VBC2 4UFHA 3AZVA 3VB9A 5KC5A 4MZUA 2OXBA 3AVRA 3ZSJA 1DZRA 4SLIA 5C4WA 2A6VA 5A3NA 1VRH1 1NA1B 2EA7A 4HPKA 3WDUA 2VUDA 4L99A 4MO3M 1Q8OA 2D6LX 2PN5A 2XJQA 5ABJA 3V65A 3N9OA 4P14A 2R49A 2OS2A 2W9XA 2PQQA 3MLJA 4UI9L 2RS31 3WQ7A 2NMNA 2RS51 4X6RB 5GZCA 4WVZA 4XC9A 4NIGA 1XSQA 3AZXA 2RMU3 3GCXA 3MFAA 5FBZA 4A7KA 2WS91 1B35B 1C57A 4AK3A 1PMHX 3K46A 1V70A 2GDFA 1SCSA 4FPJA 4AF9A 3IPVB 2XH6A 4M4PA 4JTOA 5KWRA 4DUWA 5LA1A 3O1RA 1JU3A 3UJQA 2D3SA 4MSVA 1R082 2ZZQA 4Y1XA 3H8OA 1CESA 3ALQA 3N9PA 3RFRA 5ISLA 1RIRA 4KU8A 1YI7A 2WYFA 4N7IA 5F32A 2W3JA 2IFRA 2JDNA 4JDOA 4FTSA 1ULGA 3AXEA 4Q0QA 1GKBA 3N3HA 3VBHB 1GNHA 5H9SA 1XOYA 2OYZA 3PUHA 2VAUA 3N7KA 2EF6A 1DZQA 4GKYA 2V09A 2F4PA 4NPLA 1QJY3 2VNVA 4WM7C 5FPVA 3ZFFA 1E5IA 3Q8CA 1JU4A 3MLLA 3D0SA 4PQ9A 4Y4RA 5FO8B 3POBA 2R042 5CFCA 2JDPA 2VMIA 2ZEZA 1H6XA 4V2VA 1QJX2 1DQ0A 3TB0A 3CJXA 4LBMA 5IVYA 2PHUA 3UV9A 5FPXA 1YWKA 3KV6A 5IFTA 3FZ3A 2JDYA 4E4ZA 2D93A 2NM1A 4UFIA 4OHYA 1ND3A 4QWNA 1N1YA 3ACGA 4XBLA 2QJVA 3GJBA 3J7HA 3SNMA 1LODA 4JKMA 4Y20A 2EXKA 3AMHA 3E6CC 3N4MA 3N9NA 3GF6A 4QD2A 2WA4A 1MS9A 5A6XA 1S0IA 3T2OA 3H8RA 1WCKA 1RVF2 2XQXA 5BNNA 1QJU3 1WA4A 5A7PA 3DN7A 2B39A 1RUF1 2PELA 2VD7A 1U5XA 2W5FA 4RSUA 5JZGA 1PK6C 1JTZX 4LHKA 5BXXA 4LBQD 1SPPB 1U12A 1Z7S2 5ACA3 5FP3A 4C8DA 2VOXA 2A3XA 3Q8BA 3KT7A 3GALA 4CCKA 3DPRC 2B7YA 1RMU2 4UF0B 3VBFA 1XE7A 1NLSA 1QKQA 4QDRA 4UBGA 1W9YA 1RUE3 1H2MA 1UPSA 2W52A 3AP4A 5FJHA 4W4ZA 4QHZA 1GOFA 4ISRA 2GN3A 3POEA 3WP3A 4YG6A 1PX4A 1MEC2 5DG2A 1N3OA 1KJLA 2JKBA 1ZVFA 2I74A 3LIHA 2FZ1A 5H9PA 2IXKA 3SHRA 4LBLA 2DVAA 4MXWB 2VGDA 4AEJA 1OQEA 1KGYA 3VKOA 3DYOA 3WNPA 3RQ0A 4FXGB 1KQRA 4YFWA 1QJFA 4QPIA 2DCYA 5L36A 3AZWA 5FZAA 5L19A 3WDTA 1TEIA 3BIWE 1MEC1 1RUOA 4P5YA 2G9ZA 5I0DA 1TVGA 1F5JA 3K4ZA 1PO22 2XGXA 4JGZC 4UYBA 2HBTA 3T0BA 3WY6A 3ZOIA 1SLTA 1CGPA 3VBSB 1VR3A 2Y34A 1UU5A 3NKTA 1X36A 2F6BA 4OULA 3ZYPA 4BZ4A 2QQUA 3IAPA 4KG8A 1FPN2 1VBE2 3MW3A 4OCTA 2DFBA 4GIQA 1F4AA 5APAA 3RGBA 2EAAA 1HXS2 4FSJA 3CJIC 1H9WA 3IDBB 3S5AA 4EN0A 5T54A 3R6SA 2VMFA 2ILMA 3RI9A 4Q8LA 1LGNA 1AR71 2VMDA 2ZCWA 2ARBA 1LOAA 2CDOA 3ZKYA 1UYYA 5LY1A 5KHIA 3WZ1A 1UD1A 3P3NA 1W39A 4URTA 2QNKA 5F9TA 1VP6A 3W9AA 3M3CA 3FLPA 3JD73 4F83A 5GLZA 1UNBA 1JBCA 1UZ0A 3ZSEA 4IESA 2QQJA 1BBT1 1WMDA 2QTWB 3W21A 4LUKA 1HRI2 2DBNA 4QX2A 1W3XA 4AVAA 4CDQC 2ZGTA 4GA9A 3W5MA 1KFUL 3THDA 5GZEA 4ZONA 3MPPG 1HB1A 1LJ7A 2JG9B 5I93A 1RUNA 3WCSA 2AH2A 4JKKA 2WR9A 1YC61 5T5LA 3CL1A 1FI2A 1RUJ2 3MO4A 1DHKB 3H42B 2GMEA 4RL7A 2W39A 3U37A 2VR4A 5LZ6A 5A7SA 1CPMA 1OOPA 4LMFA 3V0BB 4GB33 4B4RA 2WINB 4E4DX 5A33A 2QQMA 4IE4A 5GLUA 1AR92 1RITA 3VKNA 1QMJA 3ZDSA 5FYSA 1GNZA 3NJYA 2XLAA 5F5QA 4EZHA 3RSJA 4ZU7A 1DYKA 4K21A 4A44A 4UW5A 3O5SA 3FBYA 3RMYA 1V6KA 1JHJA 2ZJCA 5JAXA 1DYOA 4NAMA 4TWTA 2FBEA 1RUD2 4DY3A 4Q8KA 1RUI1 5FZ7A 3E5UA 4P9YA 2BU9A 1LTEA 2GU9A 2WFF2 3FFQA 3VN4A 1ULOA 2YPDA 2J1SA 2JD4A 2DVDA 3CO2A 4FO9A 3PHMA 1V6MA 5CB7A 4NWVA 5FMDA 3PMEA 2RR13 1NE4A 3FMGA 1W6PA 2BFUL 1OA3A 4CRQA 1D7PM 4ES9A 4OHVA 2BFUS 2RG4A 2Q30A 2UY9A 4JC1A 4A7YA 5FDBA 5DAVA 2VNGA 4FPKA 4BQYA 1POV0 4PIYA 4CPBD 2WFF1 4KG0A 2XLGA 3MF9A 4HMZA 4AHXA 4Z2WA 2HWF2 4QM8A 1OVSA 4FT8A 1ASJ3 3EQEA 5BNOB 5FYHA 3KSCA 3GZUC 4LKSA 4UAPA 5LWBA 3VD9A 1IG3A 1O59A 2R071 5J96B 2VTXA 3HN3A 2QFEA 4N53C 3Q9OA 2IXJA 3FLTA 3NNGA 3U78A 3OYWB 2DUQA 3ZFEA 3DCQA 2WNUC 5FPUA 2BUKA 1MS1A 4IERA 1BJQA 1LECA 4QPGC 1HB4A 4P9XA 1WA6X 4MGKE 5C9AC 4BIOA 3VDDA 4N8MA 2G1MA 1UZZA 1JUHA 3OBRA 1DYPA 3PVOA 4ZS2A 1PIV1 5FJKA 3FHAA 4JV4A 2WQ4A 2ZTNA 3PUQA 4YZ5A 2VZPA 2G4IA 2QZ3A 4RQPB 4QQOA 1PM4A 4M3CA 3SKVA 4CDUC 4MG2A 3J8F3 2VXJA 3VHPA 3WX5A 4OUSA 1R092 1W06A 1HDKA 4PIZA 2RS11 4KNCA 1IS4A 5HXVA 5JI7A 2R063 4JGYC 3GNEA 1UYPA 4M4RA 1Q8QA 1TME1 1O5UA 2ZEWA 2C26A 4QGLA 4PDWB 3O1UA 2PAMA 1ZBE2 1PVXA 3SLIA 1UQXA 2VMCA 5IVBA 2C5DA 3AYEA 5JSRA 4YVWB 1R091 2XBO1 1HB3A 3OY8A 4G3YC 2HWE3 4CUAA 2Y8KA 4OI2A 4Q4V2 3ACHA 4GWNA 1OFSA 5J1XA 3BB6A 5AVAA 3ZFGA 4KH9A 2L9LA 4R9CA 5JOYA 1NQJA 4AFDA 1O8PA 2WLQA 3AKTA 3OBTA 4LR4A 4MGIE 1YQ2A 3E5XA 3VBUA 1VRH3 3VKFC 3C7FA 1UYXA 1SEFA 4WZCA 3TNPB 2W1WA 3AMNA 3JXSA 3VBOA 5A3MA 3LAGA 2E9QA 2RS33 4LK7A 2RS53 3GGLA 5K7PA 1E5RA 2JEMA 1D4M1 1HX6A 3HAGA 4BQ1A 2WS93 3AJYA 1MQTC 2W2IA 1W2UA 2JDKA 4MYEA 5FZBA 3V64A 3INAA 2G9GA 3WVJA 2KXLA 3ZM8A 4YNIA 1OH3A 3M4FA 1QY4A 4PJYA 4XF0A 4CU9A 1ND2C 5FP9A 1ZZ7A 5DXDA 3AMQA 4BISA 3H50A 2OUJA 2WNVB 4P02B 5FY7A 1YHFA 4QB1A 4AR2A 4UT5A 2FMDA 1WW7A 4Q0SA 1VBD2 2D3RA 4Y1UA 3DYPA 3M3OA 4AYUA 5B4NA 5J37A 3USUA 2RM22 2G19A 3GDBA 5FMBA 4R9BA 3IDEA 2BGPA 5IATA 4CEYA 2QZ2A 1J59A 2GNDA 4IEWA 1B35C 4RHV2 2DVGA 1TQ5A 4LLFA 3RWNA 3FBMA 1VBD1 5CKNA 2Q8CA 1D0HA 5FXXA 1WCUA 1VIWB 1W6OB 2QQNA 3IIIA 1R1A2 4JKLA 4R52A 4A6OA 1J1TA 2LM3A 2Q5TA 2WSVA 5DPNA 4CCMA 1OBNA 1Z78A 2VO5A 5FYUA 2CY6A 4I09A 3SH5A 3BU0A 3VD4A 5LRSA 2E53A 2FMYA 2ZX0A 1GANA 1RUH3 1GP4A 2O1QA 4BLJA 1NG0A 2ZMKA 4C91A 4RA0A 1RUF3 3OG2A 2Y6JA 1D2SA 3GM8A 5FCCA 3WDWA 1ZZCA 2DWRA 4KGQA 5I0RA 3VZLA 4L9BA 1NE6A 5EHDA 2J1EA 3EB7A 1W8FA 2JIJA 3AJZA 3ZN6A 4BHPA 4Q4X1 1WLCA 5IJRA 4CP9A 4CXWA 1CAVB 1QDCA 1YYNA 1PO13 1JZ5A 1U5YA 4K9SA 1C5IA 3FC0A 5FR3A 4Y4YA 2V73A 3F95A 2LTNA 1QXRA 1CAWA 4M0NA 2K46A 3F2ZA 5HCBA 5C3QA 1MZFA 1WBFA 3WDXA 5A32B 2QQPA 5FZ9A 2FDKA 1P8JA 1PZ9A 1YNAA 3VL8A 4UOJA 2XUEA 4DXZA 2V5DA 2Q1FA 5CZKA 2XWBB 2XG3A 2D40A 1ZX5A 5JIUA 1TNRA 1REDA 2WWUA 3OOXA 3OUIA 4ZU4A 5FZ3A 3MZHA 4XCAA 3AP6A 4DFSA 5IYYA 4XDQA 2NMOA 3ZYGA 2WBKA 3NKGA 1ODMA 2K2SA 2LALA 2KA3A 1UY2A 2DYCA 3TBDA 1DGRA 1LU1A 5F7UA 1WCDJ 2QQLA 5KHHA 3B93A 1QDOA 2GC3A 1EAH2 1XSRA 2CAVA 3FUQA 1LESA 4E2SA 3O1OA 1XNCA 4XZPA 3U75A 3K2OA 3KVBA 1TE1B 3OPWA 4O9EA 1ULCA 3D8CA 2Y0OA 1O4TA 4BLIA 1OI6A 4CU8A 2YDEA 1N47A 1YUDA 2ZBJA 3EHKA 3WLUA 3JBG2 4WVMA 5BUVA 1S2EA 4URAA 1GZWA 1MS4A 1PVC3 3VDBA 1CX4A 3TOJA 1UL9A 5DDJ2 4I0WB 3WW2A 4PHZA 4EROA 1CAXA 2FDJA 4GAZA 4NN0A 2OIIA 1AR73 2HWB2 3I2GA 3NNMA 1Y9QA 1QH6A 1AL23 2DDUA 2B4KA 2YZ4A 3A23A 3CJIB 2WQZC 2YGLA 5FY0A 3MICA 4BDVB 3JBG1 1DFQA 3AZYA 4NO4A 3OTFA 5DUXA 3I3MA 1COV3 3VDAA 5C8WA 2EICA 2RDQA 3I97A 1X33A 1PK6A 3DV8A 4XJ9A 5FZFA 4FI9A 2RDNA 2O0OA 5JPNB 5IW0A 1N1TA 1ZRIA 1BBT3 3I59B 4LBOA 1Y4WA 1OD3A 3MIBA 2E6VA 3VBSC 4XMIA 4D94A 1W3VA 1ZA7A 1FNYA 2QBXA 1REFA 3DPRA 1YLLA 2DU1A 4OZOA 5DZFA 3SKJE 3WOGA 5FY9A 4AI9A 5CU1A 2MNGA 4DB5A 4JRLA 1JUIA 2ARCA 1K3IA 2R16A 2R32A 3NV3A 1YXWA 1PGW2 4XTPA 4CDQB 3I2JA 4YVSA 1G9DA 1WGPA 4RN5A 3O1PA 3ON7A 3U14A 4D69A 1UZVA 1OLRA 1QJEA 3ZXAC 1VBA1 1YFWA 3E6BA 4CA9A 3O1MA 3U1XA 3HBZA 3NV2A 3M8LA 4Q1RA 1W2NA 4FPYA 3RYRA 3I2KA 3GZTB 4B1LA 1LGBA 1JYIA 3WUCA 1BEV2 4FXKB 4MGYE 2ID4A 3FWEA 5ANNA 2QDRA 5FPBA 1W2OA 4BXFA 4XW3A 1DQ2A 4K8RB 1CZVA 1UMHA 3HNBM 1AYN2 1W2AX 4JGZA 1MZEA 1AX0A 3WHUA 1O3SA 2HYXA 1VAMA 4HANA 3KLSA 2V72A 2DTYA 1GMMA 2OZ6A 2OPWA 2DUPA 3GCWA 3OSDA 3NV1A 4I02A 4KWUA 3O14A 5A1FA 1JYXA 3U4SA 2ES3A 4AZZA 1L3JA 1W8OA 1ZBA3 2W92A 3MF6A 3OUHA 1D4VB 3R4UA 4ORFA 3ITQA 4FVVA 1N1SA 5FZ1A 3WCRA 4S2DA 2CGNA 5EYXA 1X9PA 5FZOB 2J1TA 4LOTA 4QXKA 3ZYRA 3W59A 3I4IA 3UL2A 2YHJA 1OFNA 2VCAA 2W08A 3MV11 4Q4Y1 4WM8A 3VD3A 4HN0A 1JZ7A 1LAJA 2ETEA 4TTGA 5CKQA 1K5MC 4K7JA 1FT9A 1KJRA 1FXZA 1NOVA 2ZHNA 3ZXGA 2YC2A 2IWGB 3LEMA 3OD0A 2VVEA 1LHUA 4B8EA 2R073 2F4LA 1WCSA 1EV11 1JS9A 2IVIB 5BV6A 1PHMA 4AAXA 4OUEA 1RHI3 3MIHA 3KCXA 5F5AA 2ATFA 4NOTA 1GFF2 5L7OB 2QQIA 1VBB1 5GZDA 2VOKA 1V6OA 1KRIA 1AJOA 3PVEA 2C4XA 3BI3A 2MPFA 4HN1A 1CZSA 1NKGA 2Z5WA 1AVBA 1TMF2 5JUVA 1ZRDA 1WD3A 5A7OA 1PIV3 4KQ7A 4QX1A 3G6JB 4IV3B 5A80A 4AVBA 2WNUB 5AFBA 4LQRA 4QQLA 2WO2A 4QPGB 1JYWA 4Y1YA 1XJAA 3KCCA 2Q8EA 3WDYA 5FUPA 4IEYA 1IPSA 4AVTA 1S1AA 2YV8A 3H1WA 4Y24A 2DCKA 5A6YA 3POJA 3WNMA 5EIYB 4IV1C 1QNYA 3VZOA 2RS13 2MEV2 5F3CA 2VMGA 4SBVA 4OI0A 2PLV2 3H0OA 4D6QA 2AACA 2BNNA 3GBGA 5D8AA 2BNOA 3VD5A 3C7OA 5HCHA 2X10A 3K4AA 1ZNPA 1HQNA 1W2TA 1OA4A 2BVBA 3OEAA 4JTNA 3KS7A 2B9VA 1TME3 1HLCA 2RR12 4LNVA 5FYMA 2CAUA 4XXPA 4MXVA 5I8SA 3GBWA 1ST8A 5FIXA 1OLMA 1XYOA 3APBA 3LOBA 3O7OA 2WDBA 2XBO3 3I2OA 4KWLA 4FAGA 3KZ4C 3ZYHA 4W65A 3KB5A 1GWLA 1AR61 1SG3A 4YW1A 4Q0PA 5GLVA 4E8CA 2DURA 4LBQB 2HWD2 5F3EA 4RQPC 1QQP2 2WUHA 3LA7A 5FYBA 3DUIA 5HXMA 4D0QA 1XNBA 5EXOA 5HCFA 5T3NA 1JZ6A 2XONA 5FZIA 5JPMB 1S0CA 1C5HA 3ACIA 2HEWF 4AEDB 3DXTA 1WKYA 4PF5A 4AVCA 4N53A 5AC92 5IVFA 3DKQA 4CCJA 1US2A 4DIQA 2E7TA 3AL6A 2CL2A 5A3PA 2CDPA 1AYM1 1CZTA 2BEOA 1SLBA 3J8F2 3KV5A 1O5LA 5C9AA 3PUIA 4DZGA 3URFA 1YI9A 5FXWA 4EYUA 2ZX2A 4J1XA 1MQTB 1WUVA 4XFFA 3E5QA 2VMHA 2H0VA 5FV3A 4L2NA 1Q56A 1W6MA 2R062 4QHOA 3ZXFA 5GZGA 3N35A 3IZOA 4A6SA 2VOVA 3B02A 3KHCA 2R1BA 4CDUA 4D6RA 2BZDA 2JB8A 2JG8C 5GKAC 3HR9A 1GR3A 3L2YA 5KXEA 1DZTA 1LHOA 3HT1A 4CCOA 4P9WA 2ZGLA 4YGDA 5EZWA 1H1IA 3ST7A 4C1WA 2CTVA 3JCIA 1W05A 2HWC1 4ISQA 4JGYA 4L0PA 4C0BA 5FYCA 1MPXA 3PVBB 3BIEA 2FCTA 3Q8FA 1OLQA 2ZHLA 4LO8A 4QGNA 3UGGA 3VHNA 2B9UA 5FQ0A 5IT6A 1RUG2 5KHKA 1DLLA 1XQNA 4OFGA 2X05A 3UKTA 4DRVA 1SDWA 1VBC1 2K9ZA 3D0JA 4ONUA 4GKXA 5F6LB 4BMBA 3N9QA 2OA2A 2JDZA 4HSLA 1LCLA 4FFIA 1GZTA 4YM2A 1CQ9A 4OHZA 5A6ZA 3A21A 2WNVC 4HK8A 4I3PA 4NIDA 3S7IA 3D5OA 1RUG1 4OVEA 1XNAA 2P3YA 2A71A 1IHMA 1VALA 3EO6A 5CKMA 5FPZA 4ZS3A 2E33A 1OT5A 4BCUA 5A7WB 5J3UA 5FZLA 2VVDA 3I54A 4GH4B 1OQ1A 1LOBA 1QGLA 3B94A 1W8WA 3T09A 1Y7BA 1LR5A 1A78A 1W6QA 5DABA 1BVVA 3GBFA 2ZKNA 1R081 1RC6A 5JXHA 3OGJA 3ENRA 5ERLA 2O8OA 1UXZA 1JI6A 5FXVA 1W8HA 3U0ZA 4XIOA 4J6GA 2RDRA 5FYVA 2XMLA 1ND2A 1WBLA 2CHHA 4BXSV 2XL9A 3WP4A 4MGTA 1NUKA 3SC7X 2BWCA 3O0XA 1H8TC 2ZEYA 5FYZA 1O3TA 4NPRA 1ZA4A 2UWBA 2R041 5C8CC 3M7AA 1NA1A 1CJPA 5HV0A 1LNSA 5LEJA 1REEA 5IHRA 3T2QA 1K42A 1F31A 1QJX1 3R4DB 4ASKA 3RZJA 3MIEA 3U10A 3TEXA 3C2UA 5FO9B 5DQ0A 4NR1A 3IM0A 4JVAA 1ACCA 4B4QA 1B35A 4CCEA 1UMZA 4M3CE 3ZDVA 2VQTA 3MHZA 3TN92 4X6QB 1K45A 1M4WA 3IPVA 1EP0A 4LULA 2WZR2 5T5JA 1RUH2 3HQUA 4BIFA 5A3UA 4AXOA 1X8EA 2VW2A 2NPIA 1POV1 2X5IA 2ZZJA 3VD7A 2IXCA 1VLNA 4ZXEA 4J25A 4LLOA 3S30A 4JX0A 1K5JA 3UGHA 4ET7A 4EWAA 4BE3A 1RVF1 2HLEA 4FCAA 3ZSLA 3VBHA 4AI2A 5BNQA 2D3PA 1GZ9A 1J3RA 4XUOA 1OC1A 5CEHA 3PJQA 4N90A 5A3TA 1FX5A 4MVTA 1Z7S1 2E63A 2YU1A 4HBNA 3VZJA 3RYKA 1YIPA 4LPLA 1NT0A 5C7GA 1YRZA 4D6SA 2XWJB 1IPKA 1UX7A 1RMU1 3RJ2X 1Y3TA 4Q0UA 1WMEA 5FOJB 1GOHA 3FHQA 2VQAA 4C1XA 2Z2SB 3PL0A 3RNSA 4F3JA 3CIHA 4M00A 1F2NA 2HBUA 4YW3A 4A45A 2VW0A 3ILFA 4NIHA 1ZZ9A 4QU2A 2W1SA 3P1IA 4NE9A 3ZIWA 3RDIA 2RHPA 4LA2A 3OCPA 5CFDB 1HN1A 1W0PA 1VBA3 3CHXA 3M3EA 1RINA 1QWRA 2E7QA 1PGL2 3DYMA 1E57A 5IVVA 3R0RA 1Q3EA 5G04L 4RFRB 3ZYFA 4HVRA 2WO1A 4XFCA 3VHOA 3WNNA 4AEKA 4XJ8A 3IDAA 1PO21 3POWA 2VUJA 3SISA 1V9U3 2SBAA 3FUOA 4NHXA 1WMXA 1MS0A 3BU7A 3EMRA 3ZO0B 2VJXA 2XJRA 1QXPA 4CVUA 3H7YA 2YC0A 4GULA 1SCRA 1OKQA 2R30A 4NHKA 1FPN1 3RI8A 1SPPA 1VBE1 4PI0A 2VC9A 4XUPA 2OVUA 4KGGA 1W99A 1HXS1 4AFBA 4AWDA 1H9PA 2H0BA 5C70A 5FYTA 1C1LA 3NWKA 1X8MA 3LWCA 4I01A 4UF0A 3WHTA 4BB3A 4WBBA 1US3A 2JX9A 3NAPC 4QXCA 3WQ1A 4NMIA 3NW4A 3ZYIB 1CX1A 1XPWA 2LS6A 4RS5C 4W6YA 5A7QA 5LK7B 3POFA 1V6IA 1U5ZA 1MZ6A 3PUSA 2P17A 4FFHA 3HNMA 3OD4A 3LEGA 3CZJA 4MXWA 4R4XA 5FY4A 2ORZA 5C3SA 4Q4Y3 3V0AB 1S0EA 1XB9A 2JE9A 3TEWA 1JOBA 4AVVA 1M06G 1W0OA 1HRI1 3GZEA 1HKDA 5K9YA 2I45A 1GWKA 2GC2A 4MLOA 5JIAA 2FZ2A 3VBSA 5K4LA 5JVVA 3B00A 3NVCA 1K5MB 1AR83 2UU8A 4PBPA 2YFZA 4QX7A 4CDWB 2A6WA 5B2GB 3LIGA 4XFAA 1LOFA 1RUJ1 2EVXA 3WINE 3ZXDA 3VL9A 4GMP0 5CISA 2OKXA 1LHWA 2WZEA 3T4VA 3WNXA 3JB4C 1AR91 4Q4W3 2Y6GA 3HOBA 1Q8VA 2TUNA 4LKDA 1NCQB 3U4XA 2A73B 4HONA 4QGMA 5D21A 5EV7A 4B7KA 3KCYA 3ZXKA 5LB6A 3LSDA 1OMIA 1J3QA 2JDHA 1RUD1 2BGOA 4YGCA 3A0KA 3ATGA 4KL1A 4XQ4A 5DAXA 3MW4A 3LB9A 1H4GA 5JDBA 2F17A 4U2AA 1F35A 3THCA 4HETA 4IV1B 5JR7B 5L7OC 1EUUA 2O8QA 1KDMA 3WG3A 1UW8A 1JZ4A 4ZY9A 1NY72 3OF1A 2JG9A 1JW6A 2ORXA 2XJPA 5D1IA 5FUIA 3WW1A 3BYWA 1T6BX 4QXHA 2FDGA 4FPHA 3OGGA 4AE2A 2VNOA 3C8XA 1AR63 1FOD3 2C6SA 4Y1ZA 4IV3C 5FP4A 3J7MA 1DGLA 5BNPC 1DQ1A 4Z92B 1HV0A 1OURA 4E4SA 1GZCA 2C0ZA 3OJBA 5J36A 3ASIA 1WW4A 4YZ4A 3POGA 3V0BA 2GN7A 2HWF1 1WLTA 1J1LA 3WF3A 2OX0A 1RHI2 2WL1A 4PCRA 3AL5A 4DXSA 3LDBA 4UWDA 5IAVA 3VKLA 4RR3B 5DMYA 4NAOA 1WW5A 1W8ZA 1N1VA 3ZXEA 3GHMA 3LKJA 1WLDA 5DN2A 5EJ3A 3IT8A 4XOGA 4OQ9A 3BTYA 1C8M2 2JECA 1ZRRA 3NSTA 2XXZA 5I0TA 1J58A 5HPOA 3BOPA 1KD7A 1AYM3 3LPFA 2VZTA 3SCHA 3LEKA 2GMMA 4U36A 1RGSA 4LTAA 4COUA 4YGBA 2WAOA 1NYWA 1QU0A 1ODNA 5EYYA 2A75A 3S6PA 1JHNA 4FTEA 3I7DA 3POSA 4CP0A 4AQSA 1MACA 5FLIA 4B7EA 4MGZE 4AGGA 5T52A 4MHUA 5A3OA 1YCIA 2J42A 1JMUB 1FYUA 2PQSA 1MS3A 4MX3A 5BNOA 3BUCA 2AENA 4LKFA 4EN9B 1ZBE1 1J3PA 4AEDC 2A5ZA 2YXSA 4KWJA 3O12A 2JG8B 5FLHA 3OYWA 4XFGA 5GLTA 4GWIA 2VZ3A 4UW3A 2VL4A 4YM3A 4KBBA 4YWAA 3LZZA 4Q4V1 4B3NA 5ABJC 1A3KA 3PVNA 4XF9A 4Y5TA 3KQRA 4BQ3A 4QB2A 1LENA 1H30A 2YG0A 4P9JA 2E32A 1RUC2 1NCRB 5G05L 3W20A 4RQPA 5CYYA 2ET7A 1I6XA 3GHNA 3T3YA 1SLLA 2HEYF 1CAUB 2VBBA 3KHBA 3ZLIA 2V4AA 4LUMA 4PF1A 4Y3OA 4AI8A 4CXXA 4S2HA 1O6UA 1HRV2 2WT1A 3DKWA 4DUXA 1ALYA 3U11A 5BY5A 2ARXA 1FMD2 1HJGA 2A6ZA 4L97A 5T50A 4F7ZA 2ET1A 3ZSKA 4YZ3A 1K12A 1NZCA 4PDWA 1ENSA 1BMV2 3ZFFC 3WNKA 3LF7A 4P9GA 3MIFA 4YPJA 4YVWA 2SLIA 4P08A 5A7NA 5CFCC 1BLZA 1H2LA 1AXZA 5E8AA 5IWFA 4FOWA 4QKNA 2A1XA 2BBAA 4QM9A 5K8SA 2ZX4A 5BYNA 2BW8A 4AEMA 3PLQA 2E7AA 4Q1PA 1JH5A 5DAWA 2RM21 4XF3A 2R043 4I0AA 1ND3C 1UPIA 1YEWA 4XJZA 3J7NA 4DRRA 4CUCA 4I2OA 1X7NA 2WJSA 5D2AA 3RZMA 5CAZA 4DEQA 2DTWA 1H8TB 4Q0VA 1SQ4A 1U5IA 2BDRA 2HYKA 2XR4A 4O9GA 4GH4C 4RHV1 2RMU2 4LXLA 4B1MA 2WWSA 3IWZA 3CDZB 4RGGA 3NNJA 5C8CB 4GWJA 1WZXA 4QMAA 2PHFA 3B7MA 3SITA 4PIXA 2JE8A 4J1WA 2WYSA 1QF3A 5I0SA 4Q26A 5BNNC 1XE0A 1R1A1 2C1FA 2GC1A 3AP5A 2NN8A 3CEWA 1DGRN
chains in the Genus database with same CATH topology
3C7HA 2ZEZA 1H6XA 4ZZ5A 2QQIA 3BN6A 2C4XA 1EUTA 5IFTA 1CZSA 1NKGA 3LQCA 5JUVA 1J84A 4DUVA 4QX1A 3LEIA 1JZ2A 4LQRA 2WO2A 1JYWA 3ACGA 3BGAA 3J7HA 3NQHA 4JKMA 3D3AA 3I2HA 2QQKA 2DCKA 4MOAA 1H6YA 3WNMA 5EIYB 2Y6LA 1UY3A 2QQOA 2YB7A 3T2OA 3VD5A 3C7OA 2XQXA 2X10A 3K4AA 3GXUA 2W5FA 3OEAA 2B9VA 2X09A 3OGRA 2J1RA 4A4AA 3WEZA 2WDBA 1JZ8A 4QDRA 3DECA 4E8CA 1SG3A 4W4ZA 1GOFA 1W8NA 3I3DA 1PX4A 2WUHA 2VCCA 2J1VA 4BJ0A 3I2FA 5HXMA 4D0QA 4QX3A 2JKXA 1KGYA 1JZ6A 2XONA 3DYOA 3WNPA 4QAWA 3IB3A 1UMIA 3ACIA 5B4XA 1WKYA 1US2A 1UYZA 4P5YA 3LE0A 5I0DA 1TVGA 3K4ZA 3T0BA 2CDPA 4MADA 3CMGA 1CZTA 2V4VA 4QDSA 3PUIA 1OF3A 3IAPA 3WSOA 1F4AA 3K77A 4XVHA 2WN2A 2WABA 3ETPA 2VTFA 2VMFA 2BZDA 2Y64A 1NX9A 2VMDA 3LPGA 3NRUA 4IUGA 2CDOA 1UYYA 5A1AA 4L0PA 1MPXA 2E26A 4XUNA 2VZ1A 1UZ0A 2QQJA 2RJ2A 3WNOA 2X05A 1PMJX 4QX2A 3HEIA 1I5PA 3W5MA 3THDA 3W5NA 3ECQA 3A21A 4JKKA 3MO4A 1XNAA 3U37A 2VR4A 3CQOA 1W9SA 1OT5A 2E33A 1J83A 2QQMA 1L7RA 3T09A 2W47A 4A44A 1XNTA 4KI5M 1JHJA 1DYOA 5JXHA 1UXZA 1JI6A 1O8SA 4BXSV 4CU6A 4A42A 1NUKA 1ULOA 2ZEYA 2J1SA 2WAAA 2W46A 1D7PM 2W1QA 1LNSA 1UY4A 5IHRA 3T2QA 1K42A 3OEBA 2VM9A 1DP0A 4GZ9A 1JYNA 2WQ8A 5DQ0A 2Z4FA 4UAPA 2RVAA 2VQTA 4LKSA 3VD9A 1O59A 2C9KA 3HN3A 1K45A 3OBAA 1L7QA 3NNGA 2VZVA 3OGSA 3A7QA 3C7GA 3ABZA 3VD7A 2LW8A 4ZXEA 4ET7A 4JX0A 2HLEA 3FHAA 2VZPA 1KEXA 4XUOA 3SKVA 1RYYA 3IAQA 5C7GA 4LPLA 1W9TA 1UX7A 2RV9A 1GOHA 3FHQA 4DEVA 3SEPA 4DXRA 2EIEA 4M4RA 4ARYA 3CIHA 2ZEWA 2C26A 4A45A 2W1SA 3P1IA 2VMCA 2WZ8A 3AC0A 2Y6KA 1UXXX 2EIDA 4CUAA 1HN1A 2Y8KA 3ACHA 3I2IA 5J1XA 1JYVA 3DYMA 4PQQA 5G04L 3WQBA 2L9LA 2W94A 2WO1A 3WNNA 1O8PA 3IDAA 1YQ2A 1PX3A 2VJXA 3C7FA 4CVUA 1UYXA 2W1WA 4QDQA 3JXSA 2VC9A 2VZSA 4XUPA 1W99A 3GGLA 5C70A 1GUIA 4E8DA 2VZQA 1IQDC 1US3A 1CX1A 3SEEA 1XPWA 2LS6A 2BERA 3ZM8A 5JXJA 3HNMA 2DCJA 3LEGA 3CZJA 1NAEA 2YC4A 4CU9A 4A41A 4CU7A 4ZZ8A 2ORZA 1GQPA 3HPNA 5C71A 4P02B 4MGSA 4QB1A 3NJXA 4XUTA 3K75B 3DYPA 5B4NA 4BK4A 4TXWA 3GDBA 1DLCA 3HJRA 3T2PA 3WF0A 2YFZA 2BGPA 2JD9A 3T0AA 5JXGA 4D8MA 1OH4A 4LHSA 2XOMA 2OKXA 2WZEA 2W95A 3CKHA 1BHGA 2KD7A 2QQNA 3IIIA 2Y6GA 3HOBA 2Y6HA 4JKLA 5LA0A 4A6OA 2VZOA 2VOTA 1GNYA 5DPNA 2VO5A 3E1F1 4OMDA 3VD4A 2XHNA 2BGOA 4A3ZA 1SHWB 4W8JA 2VCBA 5LCWL 1TG7A 3OG2A 2Y6JA 4QB6A 4DXTA 3GM8A 3THCA 3OB8A 3UESA 1T2XA 2J1EA 3EB7A 4XZUG 1EUUA 1JZ4A 4BK5A 3C7EA 4OYUA 4ZY9A 2E31A 3HNYM 4P00B 5IJRA 2ORXA 1ULPA 3I3BA 5FUIA 1JZ5A 5JR2A 3NJVA 2WO3A 3MV01 3C8XA 3F2ZA 4HG6B 2WN3A 1P8JA 2J22A 4QPWA 3WF2A 4UOJA 1SDDB 2V5DA 5CZKA 1UY0A 3WF3A 4DXSA 5EJ1B 3CZUA 5DMYA 5IYYA 1W9WA 2WBKA 3MBWA 2J7MA 1UY2A 3UETA 5DN2A 5F7UA 3WNLA 2QQLA 4MGQA 5HPOA 3LPFA 2VZTA 3LEKA 3VDCA 5LA2A 3P6BA 2W1UA 5JMOA 3WF1A 4CU8A 2WAOA 3K4DA 2VQUA 3VDBA 2EIBA 3WF4A 1JZ3A 3MUZ1 4CUBA 4XUQA 3I2GA 2JDAA 3OGVA 3I3EA 2DDUA 2B4KA 3A23A 3FN9A 1GOGA 2PQSA 3MUY1 4W50A 4BDVB 4XURA 3VDAA 2EICA 3I97A 4PT6A 2R7EB 4QX0A 4GWIA 2VZ3A 2VL4A 4FI9A 1OD3A 2ZXQA 4OMCA 1XC6A 4ARXA 4Z2AA 4OZOA 2QBXA 3SKJE 2J1AA 3A22A 3FL7A 1R64A 4QB2A 5EJZB 2YG0A 2E32A 4JHZA 1K3IA 4AG4A 4KMQA 5G05L 5CYYA 5IFPA 2ZEXA 2VZRA 3I2JA 4RYDA 4RN5A 3T0DA 4PF1A 3UNPA 1UWWA 2VMEA 3EYPA 2VZUA 1W0NA 3I2KA 4DUXA 2W91A 1GU3A 2ID4A 1CZVA 1UMHA 3HNBM 1K12A 4MO3M 3WNKA 1UY1A 2YFUA 4YPJA 2W9XA 2HYXA 2J1UA 4UI9L 4P08A 2V72A 1GMMA 4KWUA 1JYXA 1W8OA 2BBAA 2W92A 1PMHX 3K46A 1CIYA 1F4HA 5LA1A 4M4PA 4DUWA 1JU3A 2J1TA 4CUCA 2W87A 1OF4A 3VD3A 3MV11 2VCAA 1JZ7A 4DEQA 2W3JA 3T08A 4TTGA 1WCQA 3ACFA 3CDZB 2YC2A 3PUHA 4GWJA 2JE8A 2WYSA 1JU4A 4AAXA 4OUEA 5JXIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C7H A;  2ZEZ A;  1H6X A;  4ZZ5 A;  2QQI A;  3BN6 A;  2C4X A;  1EUT A;  5IFT A;  1CZS A;  1NKG A;  3LQC A;  5JUV A;  1J84 A;  4DUV A;  4QX1 A;  3LEI A;  1JZ2 A;  4LQR A;  2WO2 A;  1JYW A;  3ACG A;  3BGA A;  3J7H A;  3NQH A;  4JKM A;  3D3A A;  3I2H A;  2QQK A;  2DCK A;  4MOA A;  1H6Y A;  3WNM A;  5EIY B;  2Y6L A;  1UY3 A;  2QQO A;  2YB7 A;  3T2O A;  3VD5 A;  3C7O A;  2XQX A;  2X10 A;  3K4A A;  3GXU A;  2W5F A;  3OEA A;  2B9V A;  2X09 A;  3OGR A;  2J1R A;  4A4A A;  3WEZ A;  2WDB A;  1JZ8 A;  4QDR A;  3DEC A;  4E8C A;  1SG3 A;  4W4Z A;  1GOF A;  1W8N A;  3I3D A;  1PX4 A;  2WUH A;  2VCC A;  2J1V A;  4BJ0 A;  3I2F A;  5HXM A;  4D0Q A;  4QX3 A;  2JKX A;  1KGY A;  1JZ6 A;  2XON A;  3DYO A;  3WNP A;  4QAW A;  3IB3 A;  1UMI A;  3ACI A;  5B4X A;  1WKY A;  1US2 A;  1UYZ A;  4P5Y A;  3LE0 A;  5I0D A;  1TVG A;  3K4Z A;  3T0B A;  2CDP A;  4MAD A;  3CMG A;  1CZT A;  2V4V A;  4QDS A;  3PUI A;  1OF3 A;  3IAP A;  3WSO A;  1F4A A;  3K77 A;  4XVH A;  2WN2 A;  2WAB A;  3ETP A;  2VTF A;  2VMF A;  2BZD A;  2Y64 A;  1NX9 A;  2VMD A;  3LPG A;  3NRU A;  4IUG A;  2CDO A;  1UYY A;  5A1A A;  4L0P A;  1MPX A;  2E26 A;  4XUN A;  2VZ1 A;  1UZ0 A;  2QQJ A;  2RJ2 A;  3WNO A;  2X05 A;  1PMJ X;  4QX2 A;  3HEI A;  1I5P A;  3W5M A;  3THD A;  3W5N A;  3ECQ A;  3A21 A;  4JKK A;  3MO4 A;  1XNA A;  3U37 A;  2VR4 A;  3CQO A;  1W9S A;  1OT5 A;  2E33 A;  1J83 A;  2QQM A;  1L7R A;  3T09 A;  2W47 A;  4A44 A;  1XNT A;  4KI5 M;  1JHJ A;  1DYO A;  5JXH A;  1UXZ A;  1JI6 A;  1O8S A;  4BXS V;  4CU6 A;  4A42 A;  1NUK A;  1ULO A;  2ZEY A;  2J1S A;  2WAA A;  2W46 A;  1D7P M;  2W1Q A;  1LNS A;  1UY4 A;  5IHR A;  3T2Q A;  1K42 A;  3OEB A;  2VM9 A;  1DP0 A;  4GZ9 A;  1JYN A;  2WQ8 A;  5DQ0 A;  2Z4F A;  4UAP A;  2RVA A;  2VQT A;  4LKS A;  3VD9 A;  1O59 A;  2C9K A;  3HN3 A;  1K45 A;  3OBA A;  1L7Q A;  3NNG A;  2VZV A;  3OGS A;  3A7Q A;  3C7G A;  3ABZ A;  3VD7 A;  2LW8 A;  4ZXE A;  4ET7 A;  4JX0 A;  2HLE A;  3FHA A;  2VZP A;  1KEX A;  4XUO A;  3SKV A;  1RYY A;  3IAQ A;  5C7G A;  4LPL A;  1W9T A;  1UX7 A;  2RV9 A;  1GOH A;  3FHQ A;  4DEV A;  3SEP A;  4DXR A;  2EIE A;  4M4R A;  4ARY A;  3CIH A;  2ZEW A;  2C26 A;  4A45 A;  2W1S A;  3P1I A;  2VMC A;  2WZ8 A;  3AC0 A;  2Y6K A;  1UXX X;  2EID A;  4CUA A;  1HN1 A;  2Y8K A;  3ACH A;  3I2I A;  5J1X A;  1JYV A;  3DYM A;  4PQQ A;  5G04 L;  3WQB A;  2L9L A;  2W94 A;  2WO1 A;  3WNN A;  1O8P A;  3IDA A;  1YQ2 A;  1PX3 A;  2VJX A;  3C7F A;  4CVU A;  1UYX A;  2W1W A;  4QDQ A;  3JXS A;  2VC9 A;  2VZS A;  4XUP A;  1W99 A;  3GGL A;  5C70 A;  1GUI A;  4E8D A;  2VZQ A;  1IQD C;  1US3 A;  1CX1 A;  3SEE A;  1XPW A;  2LS6 A;  2BER A;  3ZM8 A;  5JXJ A;  3HNM A;  2DCJ A;  3LEG A;  3CZJ A;  1NAE A;  2YC4 A;  4CU9 A;  4A41 A;  4CU7 A;  4ZZ8 A;  2ORZ A;  1GQP A;  3HPN A;  5C71 A;  4P02 B;  4MGS A;  4QB1 A;  3NJX A;  4XUT A;  3K75 B;  3DYP A;  5B4N A;  4BK4 A;  4TXW A;  3GDB A;  1DLC A;  3HJR A;  3T2P A;  3WF0 A;  2YFZ A;  2BGP A;  2JD9 A;  3T0A A;  5JXG A;  4D8M A;  1OH4 A;  4LHS A;  2XOM A;  2OKX A;  2WZE A;  2W95 A;  3CKH A;  1BHG A;  2KD7 A;  2QQN A;  3III A;  2Y6G A;  3HOB A;  2Y6H A;  4JKL A;  5LA0 A;  4A6O A;  2VZO A;  2VOT A;  1GNY A;  5DPN A;  2VO5 A;  3E1F 1;  4OMD A;  3VD4 A;  2XHN A;  2BGO A;  4A3Z A;  1SHW B;  4W8J A;  2VCB A;  5LCW L;  1TG7 A;  3OG2 A;  2Y6J A;  4QB6 A;  4DXT A;  3GM8 A;  3THC A;  3OB8 A;  3UES A;  1T2X A;  2J1E A;  3EB7 A;  4XZU G;  1EUU A;  1JZ4 A;  4BK5 A;  3C7E A;  4OYU A;  4ZY9 A;  2E31 A;  3HNY M;  4P00 B;  5IJR A;  2ORX A;  1ULP A;  3I3B A;  5FUI A;  1JZ5 A;  5JR2 A;  3NJV A;  2WO3 A;  3MV0 1;  3C8X A;  3F2Z A;  4HG6 B;  2WN3 A;  1P8J A;  2J22 A;  4QPW A;  3WF2 A;  4UOJ A;  1SDD B;  2V5D A;  5CZK A;  1UY0 A;  3WF3 A;  4DXS A;  5EJ1 B;  3CZU A;  5DMY A;  5IYY A;  1W9W A;  2WBK A;  3MBW A;  2J7M A;  1UY2 A;  3UET A;  5DN2 A;  5F7U A;  3WNL A;  2QQL A;  4MGQ A;  5HPO A;  3LPF A;  2VZT A;  3LEK A;  3VDC A;  5LA2 A;  3P6B A;  2W1U A;  5JMO A;  3WF1 A;  4CU8 A;  2WAO A;  3K4D A;  2VQU A;  3VDB A;  2EIB A;  3WF4 A;  1JZ3 A;  3MUZ 1;  4CUB A;  4XUQ A;  3I2G A;  2JDA A;  3OGV A;  3I3E A;  2DDU A;  2B4K A;  3A23 A;  3FN9 A;  1GOG A;  2PQS A;  3MUY 1;  4W50 A;  4BDV B;  4XUR A;  3VDA A;  2EIC A;  3I97 A;  4PT6 A;  2R7E B;  4QX0 A;  4GWI A;  2VZ3 A;  2VL4 A;  4FI9 A;  1OD3 A;  2ZXQ A;  4OMC A;  1XC6 A;  4ARX A;  4Z2A A;  4OZO A;  2QBX A;  3SKJ E;  2J1A A;  3A22 A;  3FL7 A;  1R64 A;  4QB2 A;  5EJZ B;  2YG0 A;  2E32 A;  4JHZ A;  1K3I A;  4AG4 A;  4KMQ A;  5G05 L;  5CYY A;  5IFP A;  2ZEX A;  2VZR A;  3I2J A;  4RYD A;  4RN5 A;  3T0D A;  4PF1 A;  3UNP A;  1UWW A;  2VME A;  3EYP A;  2VZU A;  1W0N A;  3I2K A;  4DUX A;  2W91 A;  1GU3 A;  2ID4 A;  1CZV A;  1UMH A;  3HNB M;  1K12 A;  4MO3 M;  3WNK A;  1UY1 A;  2YFU A;  4YPJ A;  2W9X A;  2HYX A;  2J1U A;  4UI9 L;  4P08 A;  2V72 A;  1GMM A;  4KWU A;  1JYX A;  1W8O A;  2BBA A;  2W92 A;  1PMH X;  3K46 A;  1CIY A;  1F4H A;  5LA1 A;  4M4P A;  4DUW A;  1JU3 A;  2J1T A;  4CUC A;  2W87 A;  1OF4 A;  3VD3 A;  3MV1 1;  2VCA A;  1JZ7 A;  4DEQ A;  2W3J A;  3T08 A;  4TTG A;  1WCQ A;  3ACF A;  3CDZ B;  2YC2 A;  3PUH A;  4GWJ A;  2JE8 A;  2WYS A;  1JU4 A;  4AAX A;  4OUE A;  5JXI A; 
#chains in the Genus database with same CATH topology
 3C7H A;  5FRE A;  3PMS A;  2XVG A;  4FFF A;  4HVO A;  2JDU A;  4Y26 A;  4ZZ5 A;  1YIF A;  2JDM A;  4GJZ A;  1POV 3;  2QQV A;  4LOS A;  5FZK A;  4LIV A;  2ZAB A;  1EYB A;  1EUT A;  4AGV A;  4LO5 B;  2WNV A;  2W0X A;  4M0H A;  2EIG A;  2XVL A;  4Y5S A;  5LBC A;  1RVF 3;  3TAY A;  4CE8 A;  3WUD A;  1OLM E;  4H14 A;  4BQ2 A;  2XJT A;  2Y6F A;  3LEI A;  1JZ2 A;  4R9D A;  5EP9 A;  2BOI A;  1QJY 2;  1W6N B;  3AMP A;  5C3O A;  5C3R A;  2MHF A;  3PJY A;  5EWS A;  1HQW A;  1Z7S 3;  1T6G C;  4YM1 A;  5KHG A;  2P3I A;  3D3A A;  4LBN A;  2QQK A;  4NHY A;  1LB2 A;  1IG0 A;  2PHR A;  4NRO A;  1RMU 3;  1H2N A;  2VNR A;  3ES1 A;  5F2W A;  3X29 B;  1UY3 A;  2PHT A;  1GP6 A;  3AX4 A;  1OA2 A;  1ENX A;  2QQO A;  2YB7 A;  4WM7 A;  1O3Q A;  4NWW A;  2Q0A A;  2VU9 A;  1MEC 3;  4HKO A;  4QPI C;  1UN1 A;  2TBV A;  3OGR A;  3LDK A;  4W6W A;  2WSU A;  4A4A A;  3OPT A;  1WD4 A;  5H9R A;  4XBN A;  5JOX A;  1CVN A;  1W6O A;  3BKZ A;  2AYH A;  3AMM A;  1IKQ A;  3WEZ A;  4JRA A;  5C33 A;  1HN0 A;  1L7L A;  3J7L A;  4K6B A;  4CDX B;  2WFP A;  2B5H A;  3DEC A;  5KXD A;  1JN2 P;  2CGO A;  1W8N A;  1QNW A;  2P34 A;  2DBI A;  1QJU 2;  1PO2 3;  5FWE A;  3CF6 E;  1EAH 1;  1YQ6 A;  2CGP A;  1C8N A;  4YW4 A;  1UKR A;  4TLF A;  5LRR A;  1JOP A;  4KWK A;  1IGO A;  2JJ6 A;  2FDF A;  2JKX A;  1VBE 3;  4RGA A;  5ACA 2;  4Q2F A;  3VZN A;  1HXS 3;  3KT1 A;  4WV8 A;  4IEO A;  1BVP 1;  3S0M A;  3MPB A;  1CAV A;  1UMI A;  5CIR A;  1MR5 A;  5B4X A;  4BQW A;  2ARE A;  4HSJ A;  1RUE 2;  1XBF A;  2ZKL A;  5LBB A;  3KGL A;  4OHX A;  5DDJ 1;  2XKP A;  1UYZ A;  3RMX A;  3LE0 A;  5A32 A;  3WP6 A;  4AW7 A;  2HWB 1;  2YBK A;  1HIX A;  3VZK A;  1LEM A;  2Y60 A;  3CMG A;  2V4V A;  4CP2 A;  3KF5 A;  1OF3 A;  4BA6 A;  2VVF A;  5CFD C;  1BK0 A;  2QVS B;  3E97 A;  4N9H A;  3NAP B;  1W03 A;  2VH9 A;  3K77 A;  2YGM A;  3IKW A;  2WN2 A;  2BWA A;  2C9A A;  2WAB A;  2JXA A;  3DGT A;  4AFM A;  1XYP A;  4RS5 B;  2A6Y A;  3ETP A;  4YW2 A;  3SCG A;  4ATE A;  2VTF A;  2ZMN A;  1S0F A;  3N9L A;  3PUR A;  1HRI 3;  5KXC A;  2Y64 A;  4BM8 A;  2P3J A;  4ITC A;  3RZL A;  1GWM A;  4GD4 A;  4Y22 B;  3LFI A;  4IUG A;  3QBQ A;  2JIG A;  4XIL A;  1S0B A;  3M2M A;  2LRP A;  2XDV A;  5A1A A;  2UYB A;  1PGW 1;  1ZYB A;  5DZG A;  5IAX A;  5FZ8 A;  2DCT A;  2E26 A;  4XUN A;  3U07 A;  4COW A;  2D6M A;  3MFC A;  1RUJ 3;  4O65 A;  3FX3 A;  2Q1Z B;  2Z79 A;  1Z0H A;  2VZ1 A;  4JAA A;  5DAQ A;  4HXC A;  1JOJ A;  1GSL A;  1PMJ X;  5K0U B;  1RUI 3;  4I3G A;  3HEI A;  5EFU A;  4C0H A;  2IC1 A;  5JMC A;  1AR9 3;  1KFX L;  4L11 A;  1DGW A;  1BEV 1;  4UFM A;  3HN1 A;  1GIC A;  3W5N A;  4XJU A;  5A6Q A;  4XJA A;  3CJI A;  3WR0 A;  3ECQ A;  4XYX A;  1AYN 1;  1BK1 A;  3VKM A;  3B9I A;  3JB8 A;  1UOG A;  4JQR A;  3WG4 A;  2D6K A;  1RUD 3;  3JD7 2;  2ZPX A;  2ZAH A;  4CCL A;  1IS6 A;  3D4K A;  4ASL A;  4DMI A;  4FOY A;  4Z1V A;  1O91 A;  3CQO A;  2UWA A;  5E1R A;  3I59 A;  5J98 B;  4CP1 A;  4LT5 A;  1VMF A;  2UYA A;  1H4H A;  2WFF 3;  1L7R A;  5FXZ A;  2NP0 A;  3L9J T;  3IMM A;  2WT0 A;  3QCW A;  4CDW C;  2XUM A;  2W47 A;  4Q5O A;  1W8T A;  1XNT A;  4KI5 M;  5D8A B;  4JCK A;  5KC6 A;  4CDQ A;  3KF3 A;  1ENR A;  4QXB A;  3A4U A;  2ZGN A;  3HBK A;  4GJY A;  5FK7 A;  3WD5 A;  5GLW A;  3ZFE C;  3HQR A;  4QX8 A;  2XL7 A;  5M0T A;  4GB3 2;  4LHN A;  2HWF 3;  3HIF A;  4YRD A;  3AFK A;  4MHR A;  2ZGP A;  4RGK A;  1NCQ C;  2X29 A;  1AR8 2;  1NXD 1;  4XFH A;  3BTA A;  4HT1 T;  5E6H A;  3VDD C;  4E27 A;  2WAA A;  5BNP B;  2ZS6 B;  4COZ A;  2W46 A;  2IXL A;  2VEC A;  2W1Q A;  1UY4 A;  4EWE A;  1E5S A;  5E89 A;  4CCN A;  4D7T A;  3OEB A;  1QH7 A;  1AJK A;  1DG6 A;  1XE8 A;  1DP0 A;  2ADE A;  2VM9 A;  4FFG A;  5F6K A;  2JEN A;  2P4E A;  2PTM A;  4IND A;  1TMF 1;  2D5H A;  4Q4W 2;  1RJ8 A;  4YZ1 A;  5J7M A;  1GQG A;  2Z4F A;  5FZE A;  2VQ0 A;  3VBR B;  1CN1 A;  5FPA A;  2RVA A;  2VOW A;  4BQ4 A;  2C9K A;  2X53 S;  1YJL A;  1L7Q A;  5KR7 A;  1UU4 A;  5FZO A;  4XHB A;  4K8F A;  3OGS A;  3T30 A;  4CEW B;  1A34 A;  1R09 3;  3A7Q A;  2PHX A;  5IK7 A;  4JZR A;  2MEV 1;  3P3P A;  2LW8 A;  2PLV 1;  4D7S A;  3B5L B;  4PLN A;  1SBE A;  2YYO A;  4RR3 C;  1ASJ 2;  2RR1 1;  3ZFG C;  5IVE A;  2CWM A;  1KEX A;  4N43 B;  1UAI A;  1ZBE 3;  4XFI A;  1W9F A;  1S2B A;  3ZXL A;  2A70 A;  3IAQ A;  5FZC A;  1FOD 2;  2Y33 A;  4LIT A;  5F3G A;  4AL9 A;  2EXH A;  1W9T A;  4AI3 A;  4COY A;  2DVF A;  2RV9 A;  4UW4 A;  3MYX A;  5A70 A;  5L7O A;  3AKQ A;  1DCS A;  3VBO C;  1D4M 3;  1X9T A;  5HCA A;  2R0F A;  2HWD 1;  3H1Y A;  2LUW A;  2Q8D A;  5C4W B;  4DXR A;  2OQ7 A;  1QQP 1;  3ZR6 A;  1SAC A;  4XHX A;  4IV3 A;  5EPA A;  2WNU A;  4HPK B;  4AOC A;  1C4R A;  4QPG A;  5ABJ B;  1LHN A;  2WZ8 A;  3AC0 A;  1UXX X;  1BQP A;  3CNA A;  4QQH A;  1V6N A;  1YQ5 A;  2EID A;  2RJL A;  1GQH A;  3MGU A;  4Z82 A;  2ENR A;  3BVC A;  3I2I A;  2GC0 A;  5AC9 1;  1JYV A;  1UZW A;  1B09 A;  4HFS A;  2W94 A;  4AQ6 A;  2YBS A;  2D6P A;  1SFN A;  1S0G A;  3JUU A;  3TNQ A;  5LW9 A;  4GWM A;  1MZ5 A;  3J8F 1;  4IEU A;  4CZS A;  1LRH A;  4XF4 A;  1Y43 B;  5J48 A;  1X50 A;  1NXM A;  2OZJ A;  2PMW B;  4P5H A;  4C90 A;  1NLQ A;  3N36 A;  2VZS A;  2Q8O A;  2PAE A;  5JI9 A;  2BNM A;  2HWE 2;  5CAD A;  2R06 1;  2KR2 A;  1GLH A;  3I2D A;  2YUE A;  5C5U A;  5KXB A;  3ACL A;  1POQ A;  1GBG A;  2VZQ A;  1A8D A;  1IQD C;  3BPS A;  1TNF A;  1PNG A;  1VBD 3;  4LBQ A;  3KM5 A;  3ZFF B;  1NCR C;  1ZZB A;  2XLF A;  4K40 A;  3SXW A;  1STM A;  5SV5 A;  3SEE A;  3AVS A;  1C3H A;  3PNA A;  5JXJ A;  1VRH 2;  5CFC B;  5FUN A;  4YFZ A;  1YJK A;  4YLZ A;  2WA3 A;  2YC4 A;  4R9A A;  4E2G A;  4A41 A;  5F5I A;  4CYD A;  4YAR A;  4ZZ8 A;  1F5F A;  2RS3 2;  1GQP A;  2RS5 2;  5FZ4 A;  3L2H A;  2IZW A;  3HPN A;  4RHV 3;  5C71 A;  4UFL A;  4JHT A;  1WMF A;  1DQ5 A;  4AED A;  2CYF A;  5AFE A;  1JYC A;  1LUL A;  2WS9 2;  1ND3 B;  1XYN A;  3VLB B;  3NJX A;  1JOD A;  3K75 B;  4H3W A;  4Z07 A;  4NHM A;  2UY8 A;  1SFP A;  2XJS A;  4B29 A;  1R1A 3;  2AEY A;  4BK4 A;  4Y20 B;  5FZD A;  2Y0I A;  1DLC A;  3W58 A;  1VB4 A;  1PZ8 A;  3HJR A;  1KS5 A;  3T2P A;  3BTZ A;  5FP7 A;  2GSY A;  2ZGR A;  3KWV A;  4Q4X 3;  2A3W A;  2JB4 A;  2R1D A;  1MQT A;  3MLK A;  3PU3 A;  5L73 A;  1UOB A;  5DUV A;  3T0A A;  1C28 A;  1VJ2 A;  5JXG A;  1KDK A;  5BNN B;  4D8M A;  3IN9 A;  3TYJ A;  2ZAA A;  4LHS A;  1AL0 G;  2XOM A;  4JDM A;  1PM7 A;  1G6N A;  2GNM A;  2WNO A;  3DL3 A;  5JZG B;  4KU7 A;  3RVH A;  3ZR5 A;  3CKH A;  1EPW A;  1YQ8 A;  5GAL A;  1UU6 A;  3DEM A;  2X5I B;  4ASM B;  1O7F A;  1GNY A;  2VOT A;  1SLI A;  2PFW A;  3VBF B;  4IEQ A;  1FV2 A;  3ES4 A;  4H7L A;  5CVR A;  1I1E A;  4A3X A;  1UCX A;  4OMD A;  4PBO A;  2PHW A;  2XHN A;  4QKD A;  3VUO A;  1XNK A;  4GMP 1;  4TLG A;  1DBN A;  2D7F A;  4A3Z A;  2VE1 A;  2OPK A;  2QKD A;  1SHW B;  3KVA A;  2VCB A;  4N9I A;  3J4U H;  2DFC A;  1DQ6 A;  5LCW L;  1CJD A;  1QJZ A;  3LD8 A;  3WW4 A;  4DXT A;  5E16 A;  5FAX A;  2TEP A;  1OUX A;  3OB8 A;  5JOW A;  4FQZ A;  3UES A;  4XZU G;  4E9K A;  4AFA A;  3C7E A;  4XPV A;  4OYU A;  2E31 A;  3HNY M;  1ULF A;  3S7E A;  4P00 B;  1UOF A;  1ULP A;  4RD7 A;  5FTT C;  5LY2 A;  4NRP A;  3POI A;  2DU0 A;  3NJV A;  4FPO B;  4QPI B;  5DAP A;  2WO3 A;  2BBV A;  4DQA A;  3C3V A;  3MV0 1;  4ES8 A;  1S0J A;  4K20 A;  3QD6 A;  2UWC A;  5DUU A;  4RFT 0;  2J22 A;  4QPW A;  1W28 A;  1EAH 3;  1OXC A;  1RUF 2;  1URX A;  1AX2 A;  1SDD B;  1JXN A;  5A3W A;  5A7W A;  1UY0 A;  4K3U A;  5L9V A;  1VAK A;  2RDS A;  4FP2 A;  4GH4 A;  3SCF A;  3TN9 1;  5FOB B;  4YYO A;  1W9W A;  4D7Y A;  2O14 A;  2D44 A;  2WZR 1;  1AX1 A;  1VMH A;  2BV4 A;  1PO1 2;  1RUH 1;  3JBG 3;  2C24 A;  3K51 A;  5FMO L;  1ENQ A;  2GNB A;  2J7M A;  4M3C F;  5FMO S;  3THT A;  2WKK A;  4XAC A;  3BOD A;  5DDJ 3;  2PHD A;  3WNL A;  5C5T A;  4HOO A;  2HWB 3;  4FBF A;  1NQD A;  1DF0 A;  1UZY A;  4YG3 A;  1BCX A;  2YRO A;  4CDX C;  3J9S A;  2VUL A;  3IIA A;  4YG0 A;  1PO1 1;  3P6B A;  4I30 A;  5JMO A;  3WF1 A;  3H8U A;  4XBQ A;  4AQT A;  4DS0 A;  1ZRF A;  4YW5 A;  3QAC A;  3TEZ A;  3K4D A;  1IQA A;  2VQU A;  5I8T A;  1IKP A;  4NIA A;  4YVS C;  4CUB A;  3AM2 A;  3T1L A;  3ZSM A;  3T2T A;  3M1H A;  4MUV A;  4S2F A;  5CA6 A;  3AP9 A;  1MVQ A;  2YU2 A;  4Y1V A;  2AZ5 A;  3GZA A;  1GOG A;  3RZG A;  3MUY 1;  4IEP A;  4W50 A;  4XIK A;  3ZXJ A;  5HBA A;  2ZGM A;  4CPB A;  1QHD A;  1IZ3 A;  1S2K A;  4PLM A;  4PT6 A;  5F39 A;  4QX0 A;  2VBP A;  4GAL A;  3UJO A;  2P5B A;  3LSE A;  3ZIX A;  4BOW A;  1CWP A;  1OOP B;  1PVC 2;  2YMZ A;  2EAL A;  3CU7 A;  4HL0 A;  1DGW X;  4LEJ A;  4YW7 A;  5A33 B;  2ZXQ A;  2FD8 A;  1XC6 A;  4WVV A;  4Z2A A;  1AR7 2;  2CNA A;  2J1A A;  1BEV 3;  4PI2 A;  3WT3 A;  1AL2 2;  4QQ2 A;  3A22 A;  5FY5 A;  4LK6 A;  1IS5 A;  4JDN A;  5EJZ B;  3GJA A;  5FZH A;  4LBJ A;  4AG4 A;  4EN8 B;  4LKE A;  1O4Y A;  1O4Z A;  1QIQ A;  2D5F A;  5FZG A;  1AYN 3;  2ZGO A;  2B45 X;  3RG0 A;  5IFP A;  2PXJ A;  4P9L A;  1COV 2;  3I8T A;  5J09 A;  4P9I A;  1PVC 1;  3MW2 A;  4RYD A;  3TEY A;  1LOC A;  1BBT 2;  1AL2 1;  2B46 X;  2IVJ A;  1OPO A;  1W0N A;  2VZU A;  3EYP A;  4WM8 C;  5LAS A;  2W91 A;  3VV1 A;  2VUA A;  3AYA A;  1GU3 A;  5CG9 A;  3O0W A;  1W6P B;  4H55 A;  4OI1 A;  1COV 1;  2BOJ A;  2P3K A;  1EV1 3;  1LKN A;  2H6C A;  5L9R A;  1UY1 A;  2Y38 A;  2YFU A;  3AKS A;  2J1U A;  3ROU A;  4R4Z A;  5K0U C;  1Q5O A;  3MDP A;  1S55 A;  5CFD A;  2Z42 A;  4LHL A;  4AHZ A;  1VBB 3;  5JSP A;  5A1L A;  2H6B A;  3QH6 A;  3DF0 A;  3H7J A;  3R4S A;  4A7Z A;  1V6J A;  2AGS A;  4LE4 A;  1WWY A;  4QKB A;  1WLW A;  1HB2 A;  1CIY A;  1F4H A;  3KQ4 B;  3D6E A;  4HKL A;  2BP6 A;  3ZFE B;  3ZPO A;  4G9S B;  3RZH A;  3WG1 A;  1SZB A;  2Q1M A;  1OF4 A;  2W87 A;  1UOJ A;  4IGO A;  1RUI 2;  3T08 A;  3VDD B;  1WCQ A;  2FCV A;  1TMF 3;  4X8P A;  1VB2 A;  2P1B A;  3ACF A;  4MH0 E;  4IEV A;  3LDR A;  1DU3 D;  1UO9 A;  2PAK A;  1ZBA 2;  1ONA A;  2JE7 A;  1PGL 1;  1ULE A;  2VUC A;  2OUH A;  1HJF A;  4K1Z A;  1W04 A;  5D8A C;  1MVE A;  5DZE A;  4XE9 A;  1DQ4 A;  4M3C B;  1ZRE A;  4LO6 B;  1VMJ A;  2Y26 A;  3JU9 A;  5JXI A;  3G7D A;  2B42 B;  1LHV A;  1BZW A;  5CBL A;  1D2Q A;  2QUO A;  4PLO A;  1BXH A;  2RJK A;  2FCU A;  3MID A;  3NNL A;  1BKZ A;  2MEV 3;  3BN6 A;  4E4H A;  3V0A A;  1ZBA 1;  2PLV 3;  2ZOE B;  4OHW A;  3LQC A;  3Q8A A;  3ZKU A;  3ZN5 A;  3FFZ A;  5KBF A;  1NLR A;  4FQ4 A;  1QEX A;  1RXG A;  3JQX A;  4AAP A;  1J84 A;  3AFG A;  4XAA A;  4DUV A;  2XVK A;  1HW5 A;  1G9F A;  3WQ0 A;  1NZI A;  2PHL A;  2R07 2;  2XHK A;  5C6C A;  4FOV A;  1CON A;  3BPZ A;  3BGA A;  4BPZ A;  4EN7 B;  1H1M A;  3NQH A;  4Z8B A;  2BVV A;  1K5M A;  3I2H A;  3OY8 B;  1NY7 1;  5FZM A;  4NUB A;  5FZ0 A;  4MOA A;  1H6Y A;  4AHY A;  4CDW A;  1VE0 A;  4GXL A;  2Y6L A;  2B8M A;  3I3Q A;  1AXK A;  3ZFG B;  3O1V A;  2I2S A;  3VBR C;  4FPF A;  5LK5 A;  2EAK A;  5T55 A;  2HWD 3;  3HD8 B;  5KHJ A;  1PIV 2;  3J26 N;  5AVP A;  1QQP 3;  2EXJ A;  3GXU A;  3QLQ A;  3VBU B;  2X09 A;  2J1R A;  1RHI 1;  1VPH A;  3AZZ A;  2AC1 A;  1UIJ A;  3PU8 A;  3VGI A;  2W68 A;  2IXH A;  4CEW C;  3VBO B;  1X82 A;  4LOR A;  4HZF A;  1NCQ A;  2TNF A;  4BQ5 A;  1JZ8 A;  4FPG A;  5F37 A;  4EQV A;  3USS A;  1LU2 A;  5AC9 3;  2RS1 2;  2IFW A;  3AXD A;  4CUG A;  3N7L A;  5FWJ A;  3DXU A;  5DUW A;  1SLC A;  1C8M 1;  1RJ7 A;  3I3D A;  4N43 C;  3BAL A;  4IET A;  3RWK X;  2VCC A;  2J1V A;  4XET A;  1TME 2;  1H2K A;  4BJ0 A;  3I2F A;  4XEZ A;  3H3U A;  4IV1 A;  5JSO A;  4QX3 A;  4S2G A;  1A8M A;  2XBO 2;  3ETQ A;  2ZML A;  4O7X A;  3ZMN A;  4QAW A;  4AI0 A;  1SBF A;  3IB3 A;  4CCD A;  2HWC 3;  4EZ4 A;  4N7U A;  4IE0 A;  3N7M A;  1AUY A;  3LCP A;  5C4W C;  2P37 A;  2CV6 A;  3NJZ A;  4LBK A;  5FYY A;  3R05 A;  4V1P A;  1CR7 A;  4MET A;  3RZK A;  1PGS A;  3KGZ A;  1CPN A;  3B01 A;  4QT6 A;  4QX5 A;  4UXA A;  2XJU A;  4IGP A;  3USU B;  4MAD A;  4EE2 A;  3S57 A;  1VBC 3;  4QDS A;  1UX6 A;  4QU1 A;  5HI0 A;  2ARA A;  4CEY B;  2QQW A;  3H1M A;  1WW6 A;  3WSO A;  3ZX7 A;  2CSG A;  4IW3 A;  1A6C A;  1UKG A;  4RR3 A;  1D4M 2;  4XVH A;  1S0D A;  2QDN A;  3AK0 A;  4XF1 A;  4FP3 A;  4IGQ A;  2DCZ A;  1RUG 3;  2A7A A;  4OZX A;  3ILR A;  5IK8 A;  1ZM1 A;  5FO7 B;  5T5P A;  3S5Q A;  4BU2 A;  1NX9 A;  1VAV A;  2BTV C;  3MI8 A;  3LPG A;  4NRM A;  4DOU A;  1F8V A;  3NRU A;  3BTX A;  4H2A A;  3AKP A;  4XAB A;  4IEX A;  4WVW A;  4LE3 A;  4Q29 A;  3M3Q A;  4XTM A;  1RUC 1;  3ZPY A;  1QOT A;  1U0A A;  5FK8 A;  1OSG A;  2ZGK A;  2VW1 A;  4JQT A;  3AKR A;  1O3R A;  1R08 3;  1H1A A;  4X8N A;  2G9F A;  2D6N A;  1DDL A;  2RJ2 A;  3WNO A;  3P5B A;  1E5H A;  5FZ6 A;  2HH9 A;  3N7J A;  1HRV 1;  2WII B;  5IK4 A;  2PA7 A;  1I5P A;  2VPV A;  2JWP A;  5LA9 A;  1I3H A;  4WZF A;  1VRB A;  3ZN6 B;  1FMD 1;  3PTY A;  1XU2 A;  4NVP A;  4CP9 B;  5A3L A;  2A6X A;  1W8U A;  1BMV 1;  4Q27 A;  1YQC A;  1CAW B;  2JG8 A;  5FBJ A;  1LGC A;  3HWJ A;  2V5Y A;  4GMP 3;  1LOG A;  1NA1 C;  1GP5 A;  1CIW A;  1QJX 3;  2PYT A;  1AZD A;  1LED A;  4H7M A;  3UKN A;  3UYJ A;  2DUO A;  1W9S A;  2CU5 A;  1J83 A;  3NNF A;  5HV4 A;  2VG9 A;  3ZN4 A;  3O0V A;  4M01 A;  1KIT A;  5JLV A;  1G9A A;  2GAL A;  4YZ2 A;  4QQP A;  3H9A A;  4DO0 A;  1G7Y A;  2AEZ A;  4WM7 B;  1NCR A;  4QKF A;  1ZZ6 A;  4FTB A;  2YY1 A;  5ANQ A;  1CAU A;  3E6D A;  1I5Z A;  3LOI A;  4LO7 A;  2QE3 A;  3O1T A;  5JZG C;  1OHF A;  2N7G A;  1O8S A;  2RMU 1;  3NV4 A;  3ZVX A;  4CU6 A;  4A42 A;  2X5I C;  3PIJ A;  4Y33 A;  1QOS A;  3POY A;  1SBD A;  4NPM A;  4QHB A;  4BQX A;  3VBF C;  3TN9 3;  5IUQ A;  2GNT A;  4Q4X 2;  2E51 A;  4NII A;  3VBH C;  2WZR 3;  3OPZ A;  1YO8 A;  4WVM B;  4KBZ A;  3UK9 A;  1GZW B;  2WRA A;  2BYV E;  2X8K A;  2I07 B;  3VHR A;  4Y5Z 0;  1S4C A;  1CAX B;  3KV4 A;  1GV9 A;  4GZ9 A;  1JYN A;  4GQ7 A;  2WQ8 A;  3GYD A;  4ATF A;  4UBH A;  3QH7 A;  2EXI A;  1LOE A;  1TZO A;  4EV0 A;  4L8Q A;  1YFX A;  3MIG A;  4XXA A;  4XQW A;  2ZAC A;  3WXP A;  1QJY 1;  3OBA A;  3FJS A;  1PK6 B;  3ELN A;  2VZV A;  4UFJ A;  1EPZ A;  2YBP A;  2WO7 A;  1ULD A;  4K1Y A;  4FAH A;  2CWS A;  3C7G A;  3ABZ A;  2FDH A;  1OPM A;  1H8T A;  4BH9 A;  3DPR B;  3PTR B;  3KD4 A;  3QOP A;  1F15 A;  5C8C A;  1N3P A;  1Y9G A;  4XDP A;  2NZ9 A;  3M3I A;  3UGF A;  4NHL A;  1XXN A;  3AB0 A;  1JYT A;  2HJI A;  5C3P A;  2NQY A;  4TZD A;  2XJV A;  4ZU5 A;  1H8V A;  1RYY A;  2D6O X;  4YVS B;  3WV6 A;  2ZX3 A;  3AYC A;  3RRD A;  1C1F A;  1FPN 3;  3H3Z A;  4IE5 A;  4DPN A;  3ORJ A;  5FFO C;  5JOZ A;  1OD5 A;  4BWO A;  4NRQ A;  5FKC A;  5LAT A;  1BYH A;  4F8A A;  4DEV A;  3EJK A;  3SEP A;  3WG2 A;  1QJU 1;  2EIE A;  2HKX A;  4ARY A;  3T4H B;  3OUJ A;  2AR6 A;  5FP8 A;  3V56 A;  4JGZ B;  1W6N A;  4IE7 A;  2Y6K A;  3NO8 A;  5ACA 1;  2NYY A;  5I8Y A;  1RTV A;  5F2S A;  4FOQ A;  3BOW A;  1EY2 A;  2DV9 A;  3H3L A;  4AGR A;  4PQQ A;  1RUE 1;  3WQB A;  1XU1 A;  3CLP A;  4L92 A;  1SFY A;  3IMN A;  3NL1 A;  4YW6 A;  5JWP A;  1MS8 A;  2GH8 A;  3THP A;  3LGR A;  3LA3 A;  3RZZ A;  4CCC A;  2AUY A;  5FY1 A;  4NJ4 A;  1PX3 A;  1G9C A;  3ZYJ B;  1MS5 A;  2IUW A;  5SV8 A;  4CXY A;  1SLA A;  1W90 A;  5FMC A;  1OOP C;  2WWJ A;  4QDQ A;  3SH4 A;  4WM8 B;  4I0B A;  4CDX A;  5FY8 A;  4OUM A;  3UKV A;  1AHS A;  1VBA 2;  1AF9 A;  1GUI A;  2QCS B;  4IDZ A;  4E8D A;  2XKO A;  4OQ8 A;  1V6L A;  4BYY A;  4FPC A;  4IQP A;  4FPE A;  1LOF C;  3IDC B;  2VCM A;  1V9U 2;  1PZ7 A;  2BER A;  2GP3 A;  3HT2 A;  4DY5 A;  1FAY A;  1RL3 A;  3RPQ A;  5CG8 A;  2DCJ A;  3VZM A;  3ZYB A;  2BJS A;  1NAE A;  2Q4S A;  2Z69 A;  4ZPI A;  4CU7 A;  4XCB A;  4D3W A;  4AI1 A;  2VTX J;  4A2U A;  3PIG A;  4MV2 A;  3T1M A;  4MGS A;  3TRS B;  1V9U 1;  3RJR A;  3KT4 A;  4XUT A;  2D97 A;  1IS3 A;  1OKO A;  1D0G A;  2FHR A;  4IEZ A;  1FNZ A;  3KV9 A;  4TXW A;  3RS6 A;  5CNA A;  4EWD A;  3WF0 A;  3B69 A;  2YPJ A;  3ILN A;  1FAT A;  3FHI B;  2BGC A;  2D43 A;  3NAP A;  4Q4Y 2;  1RB8 G;  1IPJ A;  2DF7 A;  3OBZ A;  2JD9 A;  3JD7 1;  1G8W A;  5H9Q A;  4XQD A;  2JG9 C;  1OQD A;  5DG1 A;  4RS5 A;  5F5C A;  1OH4 A;  4UFK A;  3B3Q E;  1KXG A;  4COV A;  5IK5 A;  2W95 A;  1BHG A;  2KD7 A;  1EV1 2;  2ZX1 A;  4Y22 A;  3WW3 A;  1N3Q A;  2FQP A;  2Y6H A;  1HV1 A;  4CTE A;  5LA0 A;  2ZGU A;  4FPL A;  1G86 A;  2VZO A;  5TSW A;  4XAE A;  4HKW A;  4DNY A;  1FV3 A;  1VBB 2;  3E1F 1;  2XPJ A;  2WT2 A;  2FDI A;  2GP5 A;  1YFY A;  3AYD A;  1CD3 G;  2P2K A;  2ZGS A;  3HQX A;  2WZP P;  2NLR A;  4IXL A;  1R1Z A;  3TWI A;  1HQL A;  4W8J A;  2LRO A;  4GB3 1;  1TG7 A;  4QB6 A;  2GZW A;  2WC2 A;  3FE5 A;  5FKB A;  5K0U A;  2BPA 2;  3BCW A;  1AR8 1;  1APN A;  2OW4 A;  5F8P A;  1SMV A;  1V0A A;  5FYI A;  1T2X A;  1DIW A;  2VXR A;  4BK5 A;  4OI4 A;  1QOO A;  2ZA9 A;  3I3B A;  3UT0 A;  1V00 A;  3JQW A;  3MEP A;  3K3O A;  5T5O A;  5JR2 A;  4LIU A;  3B9C A;  4N53 B;  4EN6 B;  1XRU A;  5FLJ A;  4HG6 B;  1I9R A;  2ZHK A;  2WN3 A;  1OVP A;  3JZV A;  1C8M 3;  1ZRC A;  3D82 A;  4Q4W 1;  3WF2 A;  2WLP A;  4CSW A;  5I0U A;  2DVB A;  2BRT A;  4YSF A;  5C9A B;  5IVJ A;  3PDQ A;  4LJH A;  5LEK A;  3H8X A;  5EJ1 B;  3SQO A;  3CZU A;  5I91 A;  4IL7 A;  3KMH A;  3O1S A;  2R6Q A;  1UIK A;  3K48 A;  5LBE A;  1W6M B;  2KM2 A;  1QXJ A;  2D98 A;  3HVD A;  3MBW A;  2VY0 A;  3PUA A;  5BNO C;  1Q8S A;  3LA2 A;  1IOA A;  4ZHN A;  3I49 A;  4CDU B;  3UET A;  1AR6 2;  2RE9 A;  4XDO A;  2ZHM A;  3VBU C;  1ZZ8 A;  5LBF A;  3RYP A;  1XND A;  4AVS A;  4MGQ A;  4Q4V 3;  3AP7 A;  4HLT A;  4QPY A;  5IVC A;  2XQR A;  2VBD A;  2XB6 C;  4UW6 A;  1ASJ 1;  3ME2 A;  2ZGQ A;  1OUS A;  3VDC A;  4JGY B;  4ZKT B;  3A0N A;  5LA2 A;  2W1U A;  4G4F A;  4W6X A;  2A3Y A;  4TYS A;  1KS4 A;  5BNP A;  2HEV F;  2GH2 A;  3Q8E A;  1F9K A;  1FOD 1;  4TN7 A;  5EQU A;  4EJR A;  3EBR A;  1H0B A;  1PMI A;  2OQ6 A;  3SMH A;  4DIN B;  3FLR A;  5F3I A;  5FQ0 B;  2ERF A;  3EXU A;  2EIB A;  3N9M A;  3WF4 A;  1JZ3 A;  3MUZ 1;  5F1R A;  2JIC A;  3M70 A;  4XUQ A;  3SH3 A;  2JDA A;  3OGV A;  2OT7 A;  3I3E A;  4LO4 B;  4IE6 A;  1AYM 2;  1G9B A;  1Q43 A;  2WNE A;  3FN9 A;  3VBR A;  5GZF A;  4XFB A;  1RUC 3;  4YM0 A;  3HMY A;  4XUR A;  4AHW A;  4YGE A;  4B4P A;  2K0G A;  2P6H A;  2R7E B;  1UF2 C;  2P6C A;  3NMB A;  4PDW C;  3LFM A;  3WP5 A;  4CEW A;  4E2Q A;  4HK9 A;  4TSV A;  5BPX A;  5GM0 A;  1Y9M A;  1GYK A;  4OMC A;  4YVW C;  4ARX A;  5FPL A;  1YFU A;  2ADD A;  1HRV 3;  2UUR A;  2IXI A;  4O61 A;  4CEY C;  4XJW A;  5JCT A;  1AXY A;  4OLL A;  3FL7 A;  1FMD 3;  1R64 A;  2BQP A;  3IBM A;  4ZXK A;  3WDV A;  4R8H A;  3K3N A;  1W6Q B;  4JHZ A;  4LA3 A;  4KMQ A;  2R0H A;  2GAU A;  2HWC 2;  4N43 A;  5E88 A;  2ZEX A;  2VZR A;  3CBN A;  2RM2 3;  4V2W A;  3ZMO A;  5FRA A;  4BME A;  3T0D A;  1PNF A;  1Q8P A;  2HWE 1;  5GJ6 A;  1RXF A;  4AFC A;  4HVQ A;  2GMP A;  1ND2 B;  5L9B A;  3UNP A;  1UWW A;  4XMA A;  4AQ2 A;  2VME A;  1VBC 2;  4UFH A;  3AZV A;  3VB9 A;  5KC5 A;  4MZU A;  2OXB A;  3AVR A;  3ZSJ A;  1DZR A;  4SLI A;  5C4W A;  2A6V A;  5A3N A;  1VRH 1;  1NA1 B;  2EA7 A;  4HPK A;  3WDU A;  2VUD A;  4L99 A;  4MO3 M;  1Q8O A;  2D6L X;  2PN5 A;  2XJQ A;  5ABJ A;  3V65 A;  3N9O A;  4P14 A;  2R49 A;  2OS2 A;  2W9X A;  2PQQ A;  3MLJ A;  4UI9 L;  2RS3 1;  3WQ7 A;  2NMN A;  2RS5 1;  4X6R B;  5GZC A;  4WVZ A;  4XC9 A;  4NIG A;  1XSQ A;  3AZX A;  2RMU 3;  3GCX A;  3MFA A;  5FBZ A;  4A7K A;  2WS9 1;  1B35 B;  1C57 A;  4AK3 A;  1PMH X;  3K46 A;  1V70 A;  2GDF A;  1SCS A;  4FPJ A;  4AF9 A;  3IPV B;  2XH6 A;  4M4P A;  4JTO A;  5KWR A;  4DUW A;  5LA1 A;  3O1R A;  1JU3 A;  3UJQ A;  2D3S A;  4MSV A;  1R08 2;  2ZZQ A;  4Y1X A;  3H8O A;  1CES A;  3ALQ A;  3N9P A;  3RFR A;  5ISL A;  1RIR A;  4KU8 A;  1YI7 A;  2WYF A;  4N7I A;  5F32 A;  2W3J A;  2IFR A;  2JDN A;  4JDO A;  4FTS A;  1ULG A;  3AXE A;  4Q0Q A;  1GKB A;  3N3H A;  3VBH B;  1GNH A;  5H9S A;  1XOY A;  2OYZ A;  3PUH A;  2VAU A;  3N7K A;  2EF6 A;  1DZQ A;  4GKY A;  2V09 A;  2F4P A;  4NPL A;  1QJY 3;  2VNV A;  4WM7 C;  5FPV A;  3ZFF A;  1E5I A;  3Q8C A;  1JU4 A;  3MLL A;  3D0S A;  4PQ9 A;  4Y4R A;  5FO8 B;  3POB A;  2R04 2;  5CFC A;  2JDP A;  2VMI A;  2ZEZ A;  1H6X A;  4V2V A;  1QJX 2;  1DQ0 A;  3TB0 A;  3CJX A;  4LBM A;  5IVY A;  2PHU A;  3UV9 A;  5FPX A;  1YWK A;  3KV6 A;  5IFT A;  3FZ3 A;  2JDY A;  4E4Z A;  2D93 A;  2NM1 A;  4UFI A;  4OHY A;  1ND3 A;  4QWN A;  1N1Y A;  3ACG A;  4XBL A;  2QJV A;  3GJB A;  3J7H A;  3SNM A;  1LOD A;  4JKM A;  4Y20 A;  2EXK A;  3AMH A;  3E6C C;  3N4M A;  3N9N A;  3GF6 A;  4QD2 A;  2WA4 A;  1MS9 A;  5A6X A;  1S0I A;  3T2O A;  3H8R A;  1WCK A;  1RVF 2;  2XQX A;  5BNN A;  1QJU 3;  1WA4 A;  5A7P A;  3DN7 A;  2B39 A;  1RUF 1;  2PEL A;  2VD7 A;  1U5X A;  2W5F A;  4RSU A;  5JZG A;  1PK6 C;  1JTZ X;  4LHK A;  5BXX A;  4LBQ D;  1SPP B;  1U12 A;  1Z7S 2;  5ACA 3;  5FP3 A;  4C8D A;  2VOX A;  2A3X A;  3Q8B A;  3KT7 A;  3GAL A;  4CCK A;  3DPR C;  2B7Y A;  1RMU 2;  4UF0 B;  3VBF A;  1XE7 A;  1NLS A;  1QKQ A;  4QDR A;  4UBG A;  1W9Y A;  1RUE 3;  1H2M A;  1UPS A;  2W52 A;  3AP4 A;  5FJH A;  4W4Z A;  4QHZ A;  1GOF A;  4ISR A;  2GN3 A;  3POE A;  3WP3 A;  4YG6 A;  1PX4 A;  1MEC 2;  5DG2 A;  1N3O A;  1KJL A;  2JKB A;  1ZVF A;  2I74 A;  3LIH A;  2FZ1 A;  5H9P A;  2IXK A;  3SHR A;  4LBL A;  2DVA A;  4MXW B;  2VGD A;  4AEJ A;  1OQE A;  1KGY A;  3VKO A;  3DYO A;  3WNP A;  3RQ0 A;  4FXG B;  1KQR A;  4YFW A;  1QJF A;  4QPI A;  2DCY A;  5L36 A;  3AZW A;  5FZA A;  5L19 A;  3WDT A;  1TEI A;  3BIW E;  1MEC 1;  1RUO A;  4P5Y A;  2G9Z A;  5I0D A;  1TVG A;  1F5J A;  3K4Z A;  1PO2 2;  2XGX A;  4JGZ C;  4UYB A;  2HBT A;  3T0B A;  3WY6 A;  3ZOI A;  1SLT A;  1CGP A;  3VBS B;  1VR3 A;  2Y34 A;  1UU5 A;  3NKT A;  1X36 A;  2F6B A;  4OUL A;  3ZYP A;  4BZ4 A;  2QQU A;  3IAP A;  4KG8 A;  1FPN 2;  1VBE 2;  3MW3 A;  4OCT A;  2DFB A;  4GIQ A;  1F4A A;  5APA A;  3RGB A;  2EAA A;  1HXS 2;  4FSJ A;  3CJI C;  1H9W A;  3IDB B;  3S5A A;  4EN0 A;  5T54 A;  3R6S A;  2VMF A;  2ILM A;  3RI9 A;  4Q8L A;  1LGN A;  1AR7 1;  2VMD A;  2ZCW A;  2ARB A;  1LOA A;  2CDO A;  3ZKY A;  1UYY A;  5LY1 A;  5KHI A;  3WZ1 A;  1UD1 A;  3P3N A;  1W39 A;  4URT A;  2QNK A;  5F9T A;  1VP6 A;  3W9A A;  3M3C A;  3FLP A;  3JD7 3;  4F83 A;  5GLZ A;  1UNB A;  1JBC A;  1UZ0 A;  3ZSE A;  4IES A;  2QQJ A;  1BBT 1;  1WMD A;  2QTW B;  3W21 A;  4LUK A;  1HRI 2;  2DBN A;  4QX2 A;  1W3X A;  4AVA A;  4CDQ C;  2ZGT A;  4GA9 A;  3W5M A;  1KFU L;  3THD A;  5GZE A;  4ZON A;  3MPP G;  1HB1 A;  1LJ7 A;  2JG9 B;  5I93 A;  1RUN A;  3WCS A;  2AH2 A;  4JKK A;  2WR9 A;  1YC6 1;  5T5L A;  3CL1 A;  1FI2 A;  1RUJ 2;  3MO4 A;  1DHK B;  3H42 B;  2GME A;  4RL7 A;  2W39 A;  3U37 A;  2VR4 A;  5LZ6 A;  5A7S A;  1CPM A;  1OOP A;  4LMF A;  3V0B B;  4GB3 3;  4B4R A;  2WIN B;  4E4D X;  5A33 A;  2QQM A;  4IE4 A;  5GLU A;  1AR9 2;  1RIT A;  3VKN A;  1QMJ A;  3ZDS A;  5FYS A;  1GNZ A;  3NJY A;  2XLA A;  5F5Q A;  4EZH A;  3RSJ A;  4ZU7 A;  1DYK A;  4K21 A;  4A44 A;  4UW5 A;  3O5S A;  3FBY A;  3RMY A;  1V6K A;  1JHJ A;  2ZJC A;  5JAX A;  1DYO A;  4NAM A;  4TWT A;  2FBE A;  1RUD 2;  4DY3 A;  4Q8K A;  1RUI 1;  5FZ7 A;  3E5U A;  4P9Y A;  2BU9 A;  1LTE A;  2GU9 A;  2WFF 2;  3FFQ A;  3VN4 A;  1ULO A;  2YPD A;  2J1S A;  2JD4 A;  2DVD A;  3CO2 A;  4FO9 A;  3PHM A;  1V6M A;  5CB7 A;  4NWV A;  5FMD A;  3PME A;  2RR1 3;  1NE4 A;  3FMG A;  1W6P A;  2BFU L;  1OA3 A;  4CRQ A;  1D7P M;  4ES9 A;  4OHV A;  2BFU S;  2RG4 A;  2Q30 A;  2UY9 A;  4JC1 A;  4A7Y A;  5FDB A;  5DAV A;  2VNG A;  4FPK A;  4BQY A;  1POV 0;  4PIY A;  4CPB D;  2WFF 1;  4KG0 A;  2XLG A;  3MF9 A;  4HMZ A;  4AHX A;  4Z2W A;  2HWF 2;  4QM8 A;  1OVS A;  4FT8 A;  1ASJ 3;  3EQE A;  5BNO B;  5FYH A;  3KSC A;  3GZU C;  4LKS A;  4UAP A;  5LWB A;  3VD9 A;  1IG3 A;  1O59 A;  2R07 1;  5J96 B;  2VTX A;  3HN3 A;  2QFE A;  4N53 C;  3Q9O A;  2IXJ A;  3FLT A;  3NNG A;  3U78 A;  3OYW B;  2DUQ A;  3ZFE A;  3DCQ A;  2WNU C;  5FPU A;  2BUK A;  1MS1 A;  4IER A;  1BJQ A;  1LEC A;  4QPG C;  1HB4 A;  4P9X A;  1WA6 X;  4MGK E;  5C9A C;  4BIO A;  3VDD A;  4N8M A;  2G1M A;  1UZZ A;  1JUH A;  3OBR A;  1DYP A;  3PVO A;  4ZS2 A;  1PIV 1;  5FJK A;  3FHA A;  4JV4 A;  2WQ4 A;  2ZTN A;  3PUQ A;  4YZ5 A;  2VZP A;  2G4I A;  2QZ3 A;  4RQP B;  4QQO A;  1PM4 A;  4M3C A;  3SKV A;  4CDU C;  4MG2 A;  3J8F 3;  2VXJ A;  3VHP A;  3WX5 A;  4OUS A;  1R09 2;  1W06 A;  1HDK A;  4PIZ A;  2RS1 1;  4KNC A;  1IS4 A;  5HXV A;  5JI7 A;  2R06 3;  4JGY C;  3GNE A;  1UYP A;  4M4R A;  1Q8Q A;  1TME 1;  1O5U A;  2ZEW A;  2C26 A;  4QGL A;  4PDW B;  3O1U A;  2PAM A;  1ZBE 2;  1PVX A;  3SLI A;  1UQX A;  2VMC A;  5IVB A;  2C5D A;  3AYE A;  5JSR A;  4YVW B;  1R09 1;  2XBO 1;  1HB3 A;  3OY8 A;  4G3Y C;  2HWE 3;  4CUA A;  2Y8K A;  4OI2 A;  4Q4V 2;  3ACH A;  4GWN A;  1OFS A;  5J1X A;  3BB6 A;  5AVA A;  3ZFG A;  4KH9 A;  2L9L A;  4R9C A;  5JOY A;  1NQJ A;  4AFD A;  1O8P A;  2WLQ A;  3AKT A;  3OBT A;  4LR4 A;  4MGI E;  1YQ2 A;  3E5X A;  3VBU A;  1VRH 3;  3VKF C;  3C7F A;  1UYX A;  1SEF A;  4WZC A;  3TNP B;  2W1W A;  3AMN A;  3JXS A;  3VBO A;  5A3M A;  3LAG A;  2E9Q A;  2RS3 3;  4LK7 A;  2RS5 3;  3GGL A;  5K7P A;  1E5R A;  2JEM A;  1D4M 1;  1HX6 A;  3HAG A;  4BQ1 A;  2WS9 3;  3AJY A;  1MQT C;  2W2I A;  1W2U A;  2JDK A;  4MYE A;  5FZB A;  3V64 A;  3INA A;  2G9G A;  3WVJ A;  2KXL A;  3ZM8 A;  4YNI A;  1OH3 A;  3M4F A;  1QY4 A;  4PJY A;  4XF0 A;  4CU9 A;  1ND2 C;  5FP9 A;  1ZZ7 A;  5DXD A;  3AMQ A;  4BIS A;  3H50 A;  2OUJ A;  2WNV B;  4P02 B;  5FY7 A;  1YHF A;  4QB1 A;  4AR2 A;  4UT5 A;  2FMD A;  1WW7 A;  4Q0S A;  1VBD 2;  2D3R A;  4Y1U A;  3DYP A;  3M3O A;  4AYU A;  5B4N A;  5J37 A;  3USU A;  2RM2 2;  2G19 A;  3GDB A;  5FMB A;  4R9B A;  3IDE A;  2BGP A;  5IAT A;  4CEY A;  2QZ2 A;  1J59 A;  2GND A;  4IEW A;  1B35 C;  4RHV 2;  2DVG A;  1TQ5 A;  4LLF A;  3RWN A;  3FBM A;  1VBD 1;  5CKN A;  2Q8C A;  1D0H A;  5FXX A;  1WCU A;  1VIW B;  1W6O B;  2QQN A;  3III A;  1R1A 2;  4JKL A;  4R52 A;  4A6O A;  1J1T A;  2LM3 A;  2Q5T A;  2WSV A;  5DPN A;  4CCM A;  1OBN A;  1Z78 A;  2VO5 A;  5FYU A;  2CY6 A;  4I09 A;  3SH5 A;  3BU0 A;  3VD4 A;  5LRS A;  2E53 A;  2FMY A;  2ZX0 A;  1GAN A;  1RUH 3;  1GP4 A;  2O1Q A;  4BLJ A;  1NG0 A;  2ZMK A;  4C91 A;  4RA0 A;  1RUF 3;  3OG2 A;  2Y6J A;  1D2S A;  3GM8 A;  5FCC A;  3WDW A;  1ZZC A;  2DWR A;  4KGQ A;  5I0R A;  3VZL A;  4L9B A;  1NE6 A;  5EHD A;  2J1E A;  3EB7 A;  1W8F A;  2JIJ A;  3AJZ A;  3ZN6 A;  4BHP A;  4Q4X 1;  1WLC A;  5IJR A;  4CP9 A;  4CXW A;  1CAV B;  1QDC A;  1YYN A;  1PO1 3;  1JZ5 A;  1U5Y A;  4K9S A;  1C5I A;  3FC0 A;  5FR3 A;  4Y4Y A;  2V73 A;  3F95 A;  2LTN A;  1QXR A;  1CAW A;  4M0N A;  2K46 A;  3F2Z A;  5HCB A;  5C3Q A;  1MZF A;  1WBF A;  3WDX A;  5A32 B;  2QQP A;  5FZ9 A;  2FDK A;  1P8J A;  1PZ9 A;  1YNA A;  3VL8 A;  4UOJ A;  2XUE A;  4DXZ A;  2V5D A;  2Q1F A;  5CZK A;  2XWB B;  2XG3 A;  2D40 A;  1ZX5 A;  5JIU A;  1TNR A;  1RED A;  2WWU A;  3OOX A;  3OUI A;  4ZU4 A;  5FZ3 A;  3MZH A;  4XCA A;  3AP6 A;  4DFS A;  5IYY A;  4XDQ A;  2NMO A;  3ZYG A;  2WBK A;  3NKG A;  1ODM A;  2K2S A;  2LAL A;  2KA3 A;  1UY2 A;  2DYC A;  3TBD A;  1DGR A;  1LU1 A;  5F7U A;  1WCD J;  2QQL A;  5KHH A;  3B93 A;  1QDO A;  2GC3 A;  1EAH 2;  1XSR A;  2CAV A;  3FUQ A;  1LES A;  4E2S A;  3O1O A;  1XNC A;  4XZP A;  3U75 A;  3K2O A;  3KVB A;  1TE1 B;  3OPW A;  4O9E A;  1ULC A;  3D8C A;  2Y0O A;  1O4T A;  4BLI A;  1OI6 A;  4CU8 A;  2YDE A;  1N47 A;  1YUD A;  2ZBJ A;  3EHK A;  3WLU A;  3JBG 2;  4WVM A;  5BUV A;  1S2E A;  4URA A;  1GZW A;  1MS4 A;  1PVC 3;  3VDB A;  1CX4 A;  3TOJ A;  1UL9 A;  5DDJ 2;  4I0W B;  3WW2 A;  4PHZ A;  4ERO A;  1CAX A;  2FDJ A;  4GAZ A;  4NN0 A;  2OII A;  1AR7 3;  2HWB 2;  3I2G A;  3NNM A;  1Y9Q A;  1QH6 A;  1AL2 3;  2DDU A;  2B4K A;  2YZ4 A;  3A23 A;  3CJI B;  2WQZ C;  2YGL A;  5FY0 A;  3MIC A;  4BDV B;  3JBG 1;  1DFQ A;  3AZY A;  4NO4 A;  3OTF A;  5DUX A;  3I3M A;  1COV 3;  3VDA A;  5C8W A;  2EIC A;  2RDQ A;  3I97 A;  1X33 A;  1PK6 A;  3DV8 A;  4XJ9 A;  5FZF A;  4FI9 A;  2RDN A;  2O0O A;  5JPN B;  5IW0 A;  1N1T A;  1ZRI A;  1BBT 3;  3I59 B;  4LBO A;  1Y4W A;  1OD3 A;  3MIB A;  2E6V A;  3VBS C;  4XMI A;  4D94 A;  1W3V A;  1ZA7 A;  1FNY A;  2QBX A;  1REF A;  3DPR A;  1YLL A;  2DU1 A;  4OZO A;  5DZF A;  3SKJ E;  3WOG A;  5FY9 A;  4AI9 A;  5CU1 A;  2MNG A;  4DB5 A;  4JRL A;  1JUI A;  2ARC A;  1K3I A;  2R16 A;  2R32 A;  3NV3 A;  1YXW A;  1PGW 2;  4XTP A;  4CDQ B;  3I2J A;  4YVS A;  1G9D A;  1WGP A;  4RN5 A;  3O1P A;  3ON7 A;  3U14 A;  4D69 A;  1UZV A;  1OLR A;  1QJE A;  3ZXA C;  1VBA 1;  1YFW A;  3E6B A;  4CA9 A;  3O1M A;  3U1X A;  3HBZ A;  3NV2 A;  3M8L A;  4Q1R A;  1W2N A;  4FPY A;  3RYR A;  3I2K A;  3GZT B;  4B1L A;  1LGB A;  1JYI A;  3WUC A;  1BEV 2;  4FXK B;  4MGY E;  2ID4 A;  3FWE A;  5ANN A;  2QDR A;  5FPB A;  1W2O A;  4BXF A;  4XW3 A;  1DQ2 A;  4K8R B;  1CZV A;  1UMH A;  3HNB M;  1AYN 2;  1W2A X;  4JGZ A;  1MZE A;  1AX0 A;  3WHU A;  1O3S A;  2HYX A;  1VAM A;  4HAN A;  3KLS A;  2V72 A;  2DTY A;  1GMM A;  2OZ6 A;  2OPW A;  2DUP A;  3GCW A;  3OSD A;  3NV1 A;  4I02 A;  4KWU A;  3O14 A;  5A1F A;  1JYX A;  3U4S A;  2ES3 A;  4AZZ A;  1L3J A;  1W8O A;  1ZBA 3;  2W92 A;  3MF6 A;  3OUH A;  1D4V B;  3R4U A;  4ORF A;  3ITQ A;  4FVV A;  1N1S A;  5FZ1 A;  3WCR A;  4S2D A;  2CGN A;  5EYX A;  1X9P A;  5FZO B;  2J1T A;  4LOT A;  4QXK A;  3ZYR A;  3W59 A;  3I4I A;  3UL2 A;  2YHJ A;  1OFN A;  2VCA A;  2W08 A;  3MV1 1;  4Q4Y 1;  4WM8 A;  3VD3 A;  4HN0 A;  1JZ7 A;  1LAJ A;  2ETE A;  4TTG A;  5CKQ A;  1K5M C;  4K7J A;  1FT9 A;  1KJR A;  1FXZ A;  1NOV A;  2ZHN A;  3ZXG A;  2YC2 A;  2IWG B;  3LEM A;  3OD0 A;  2VVE A;  1LHU A;  4B8E A;  2R07 3;  2F4L A;  1WCS A;  1EV1 1;  1JS9 A;  2IVI B;  5BV6 A;  1PHM A;  4AAX A;  4OUE A;  1RHI 3;  3MIH A;  3KCX A;  5F5A A;  2ATF A;  4NOT A;  1GFF 2;  5L7O B;  2QQI A;  1VBB 1;  5GZD A;  2VOK A;  1V6O A;  1KRI A;  1AJO A;  3PVE A;  2C4X A;  3BI3 A;  2MPF A;  4HN1 A;  1CZS A;  1NKG A;  2Z5W A;  1AVB A;  1TMF 2;  5JUV A;  1ZRD A;  1WD3 A;  5A7O A;  1PIV 3;  4KQ7 A;  4QX1 A;  3G6J B;  4IV3 B;  5A80 A;  4AVB A;  2WNU B;  5AFB A;  4LQR A;  4QQL A;  2WO2 A;  4QPG B;  1JYW A;  4Y1Y A;  1XJA A;  3KCC A;  2Q8E A;  3WDY A;  5FUP A;  4IEY A;  1IPS A;  4AVT A;  1S1A A;  2YV8 A;  3H1W A;  4Y24 A;  2DCK A;  5A6Y A;  3POJ A;  3WNM A;  5EIY B;  4IV1 C;  1QNY A;  3VZO A;  2RS1 3;  2MEV 2;  5F3C A;  2VMG A;  4SBV A;  4OI0 A;  2PLV 2;  3H0O A;  4D6Q A;  2AAC A;  2BNN A;  3GBG A;  5D8A A;  2BNO A;  3VD5 A;  3C7O A;  5HCH A;  2X10 A;  3K4A A;  1ZNP A;  1HQN A;  1W2T A;  1OA4 A;  2BVB A;  3OEA A;  4JTN A;  3KS7 A;  2B9V A;  1TME 3;  1HLC A;  2RR1 2;  4LNV A;  5FYM A;  2CAU A;  4XXP A;  4MXV A;  5I8S A;  3GBW A;  1ST8 A;  5FIX A;  1OLM A;  1XYO A;  3APB A;  3LOB A;  3O7O A;  2WDB A;  2XBO 3;  3I2O A;  4KWL A;  4FAG A;  3KZ4 C;  3ZYH A;  4W65 A;  3KB5 A;  1GWL A;  1AR6 1;  1SG3 A;  4YW1 A;  4Q0P A;  5GLV A;  4E8C A;  2DUR A;  4LBQ B;  2HWD 2;  5F3E A;  4RQP C;  1QQP 2;  2WUH A;  3LA7 A;  5FYB A;  3DUI A;  5HXM A;  4D0Q A;  1XNB A;  5EXO A;  5HCF A;  5T3N A;  1JZ6 A;  2XON A;  5FZI A;  5JPM B;  1S0C A;  1C5H A;  3ACI A;  2HEW F;  4AED B;  3DXT A;  1WKY A;  4PF5 A;  4AVC A;  4N53 A;  5AC9 2;  5IVF A;  3DKQ A;  4CCJ A;  1US2 A;  4DIQ A;  2E7T A;  3AL6 A;  2CL2 A;  5A3P A;  2CDP A;  1AYM 1;  1CZT A;  2BEO A;  1SLB A;  3J8F 2;  3KV5 A;  1O5L A;  5C9A A;  3PUI A;  4DZG A;  3URF A;  1YI9 A;  5FXW A;  4EYU A;  2ZX2 A;  4J1X A;  1MQT B;  1WUV A;  4XFF A;  3E5Q A;  2VMH A;  2H0V A;  5FV3 A;  4L2N A;  1Q56 A;  1W6M A;  2R06 2;  4QHO A;  3ZXF A;  5GZG A;  3N35 A;  3IZO A;  4A6S A;  2VOV A;  3B02 A;  3KHC A;  2R1B A;  4CDU A;  4D6R A;  2BZD A;  2JB8 A;  2JG8 C;  5GKA C;  3HR9 A;  1GR3 A;  3L2Y A;  5KXE A;  1DZT A;  1LHO A;  3HT1 A;  4CCO A;  4P9W A;  2ZGL A;  4YGD A;  5EZW A;  1H1I A;  3ST7 A;  4C1W A;  2CTV A;  3JCI A;  1W05 A;  2HWC 1;  4ISQ A;  4JGY A;  4L0P A;  4C0B A;  5FYC A;  1MPX A;  3PVB B;  3BIE A;  2FCT A;  3Q8F A;  1OLQ A;  2ZHL A;  4LO8 A;  4QGN A;  3UGG A;  3VHN A;  2B9U A;  5FQ0 A;  5IT6 A;  1RUG 2;  5KHK A;  1DLL A;  1XQN A;  4OFG A;  2X05 A;  3UKT A;  4DRV A;  1SDW A;  1VBC 1;  2K9Z A;  3D0J A;  4ONU A;  4GKX A;  5F6L B;  4BMB A;  3N9Q A;  2OA2 A;  2JDZ A;  4HSL A;  1LCL A;  4FFI A;  1GZT A;  4YM2 A;  1CQ9 A;  4OHZ A;  5A6Z A;  3A21 A;  2WNV C;  4HK8 A;  4I3P A;  4NID A;  3S7I A;  3D5O A;  1RUG 1;  4OVE A;  1XNA A;  2P3Y A;  2A71 A;  1IHM A;  1VAL A;  3EO6 A;  5CKM A;  5FPZ A;  4ZS3 A;  2E33 A;  1OT5 A;  4BCU A;  5A7W B;  5J3U A;  5FZL A;  2VVD A;  3I54 A;  4GH4 B;  1OQ1 A;  1LOB A;  1QGL A;  3B94 A;  1W8W A;  3T09 A;  1Y7B A;  1LR5 A;  1A78 A;  1W6Q A;  5DAB A;  1BVV A;  3GBF A;  2ZKN A;  1R08 1;  1RC6 A;  5JXH A;  3OGJ A;  3ENR A;  5ERL A;  2O8O A;  1UXZ A;  1JI6 A;  5FXV A;  1W8H A;  3U0Z A;  4XIO A;  4J6G A;  2RDR A;  5FYV A;  2XML A;  1ND2 A;  1WBL A;  2CHH A;  4BXS V;  2XL9 A;  3WP4 A;  4MGT A;  1NUK A;  3SC7 X;  2BWC A;  3O0X A;  1H8T C;  2ZEY A;  5FYZ A;  1O3T A;  4NPR A;  1ZA4 A;  2UWB A;  2R04 1;  5C8C C;  3M7A A;  1NA1 A;  1CJP A;  5HV0 A;  1LNS A;  5LEJ A;  1REE A;  5IHR A;  3T2Q A;  1K42 A;  1F31 A;  1QJX 1;  3R4D B;  4ASK A;  3RZJ A;  3MIE A;  3U10 A;  3TEX A;  3C2U A;  5FO9 B;  5DQ0 A;  4NR1 A;  3IM0 A;  4JVA A;  1ACC A;  4B4Q A;  1B35 A;  4CCE A;  1UMZ A;  4M3C E;  3ZDV A;  2VQT A;  3MHZ A;  3TN9 2;  4X6Q B;  1K45 A;  1M4W A;  3IPV A;  1EP0 A;  4LUL A;  2WZR 2;  5T5J A;  1RUH 2;  3HQU A;  4BIF A;  5A3U A;  4AXO A;  1X8E A;  2VW2 A;  2NPI A;  1POV 1;  2X5I A;  2ZZJ A;  3VD7 A;  2IXC A;  1VLN A;  4ZXE A;  4J25 A;  4LLO A;  3S30 A;  4JX0 A;  1K5J A;  3UGH A;  4ET7 A;  4EWA A;  4BE3 A;  1RVF 1;  2HLE A;  4FCA A;  3ZSL A;  3VBH A;  4AI2 A;  5BNQ A;  2D3P A;  1GZ9 A;  1J3R A;  4XUO A;  1OC1 A;  5CEH A;  3PJQ A;  4N90 A;  5A3T A;  1FX5 A;  4MVT A;  1Z7S 1;  2E63 A;  2YU1 A;  4HBN A;  3VZJ A;  3RYK A;  1YIP A;  4LPL A;  1NT0 A;  5C7G A;  1YRZ A;  4D6S A;  2XWJ B;  1IPK A;  1UX7 A;  1RMU 1;  3RJ2 X;  1Y3T A;  4Q0U A;  1WME A;  5FOJ B;  1GOH A;  3FHQ A;  2VQA A;  4C1X A;  2Z2S B;  3PL0 A;  3RNS A;  4F3J A;  3CIH A;  4M00 A;  1F2N A;  2HBU A;  4YW3 A;  4A45 A;  2VW0 A;  3ILF A;  4NIH A;  1ZZ9 A;  4QU2 A;  2W1S A;  3P1I A;  4NE9 A;  3ZIW A;  3RDI A;  2RHP A;  4LA2 A;  3OCP A;  5CFD B;  1HN1 A;  1W0P A;  1VBA 3;  3CHX A;  3M3E A;  1RIN A;  1QWR A;  2E7Q A;  1PGL 2;  3DYM A;  1E57 A;  5IVV A;  3R0R A;  1Q3E A;  5G04 L;  4RFR B;  3ZYF A;  4HVR A;  2WO1 A;  4XFC A;  3VHO A;  3WNN A;  4AEK A;  4XJ8 A;  3IDA A;  1PO2 1;  3POW A;  2VUJ A;  3SIS A;  1V9U 3;  2SBA A;  3FUO A;  4NHX A;  1WMX A;  1MS0 A;  3BU7 A;  3EMR A;  3ZO0 B;  2VJX A;  2XJR A;  1QXP A;  4CVU A;  3H7Y A;  2YC0 A;  4GUL A;  1SCR A;  1OKQ A;  2R30 A;  4NHK A;  1FPN 1;  3RI8 A;  1SPP A;  1VBE 1;  4PI0 A;  2VC9 A;  4XUP A;  2OVU A;  4KGG A;  1W99 A;  1HXS 1;  4AFB A;  4AWD A;  1H9P A;  2H0B A;  5C70 A;  5FYT A;  1C1L A;  3NWK A;  1X8M A;  3LWC A;  4I01 A;  4UF0 A;  3WHT A;  4BB3 A;  4WBB A;  1US3 A;  2JX9 A;  3NAP C;  4QXC A;  3WQ1 A;  4NMI A;  3NW4 A;  3ZYI B;  1CX1 A;  1XPW A;  2LS6 A;  4RS5 C;  4W6Y A;  5A7Q A;  5LK7 B;  3POF A;  1V6I A;  1U5Z A;  1MZ6 A;  3PUS A;  2P17 A;  4FFH A;  3HNM A;  3OD4 A;  3LEG A;  3CZJ A;  4MXW A;  4R4X A;  5FY4 A;  2ORZ A;  5C3S A;  4Q4Y 3;  3V0A B;  1S0E A;  1XB9 A;  2JE9 A;  3TEW A;  1JOB A;  4AVV A;  1M06 G;  1W0O A;  1HRI 1;  3GZE A;  1HKD A;  5K9Y A;  2I45 A;  1GWK A;  2GC2 A;  4MLO A;  5JIA A;  2FZ2 A;  3VBS A;  5K4L A;  5JVV A;  3B00 A;  3NVC A;  1K5M B;  1AR8 3;  2UU8 A;  4PBP A;  2YFZ A;  4QX7 A;  4CDW B;  2A6W A;  5B2G B;  3LIG A;  4XFA A;  1LOF A;  1RUJ 1;  2EVX A;  3WIN E;  3ZXD A;  3VL9 A;  4GMP 0;  5CIS A;  2OKX A;  1LHW A;  2WZE A;  3T4V A;  3WNX A;  3JB4 C;  1AR9 1;  4Q4W 3;  2Y6G A;  3HOB A;  1Q8V A;  2TUN A;  4LKD A;  1NCQ B;  3U4X A;  2A73 B;  4HON A;  4QGM A;  5D21 A;  5EV7 A;  4B7K A;  3KCY A;  3ZXK A;  5LB6 A;  3LSD A;  1OMI A;  1J3Q A;  2JDH A;  1RUD 1;  2BGO A;  4YGC A;  3A0K A;  3ATG A;  4KL1 A;  4XQ4 A;  5DAX A;  3MW4 A;  3LB9 A;  1H4G A;  5JDB A;  2F17 A;  4U2A A;  1F35 A;  3THC A;  4HET A;  4IV1 B;  5JR7 B;  5L7O C;  1EUU A;  2O8Q A;  1KDM A;  3WG3 A;  1UW8 A;  1JZ4 A;  4ZY9 A;  1NY7 2;  3OF1 A;  2JG9 A;  1JW6 A;  2ORX A;  2XJP A;  5D1I A;  5FUI A;  3WW1 A;  3BYW A;  1T6B X;  4QXH A;  2FDG A;  4FPH A;  3OGG A;  4AE2 A;  2VNO A;  3C8X A;  1AR6 3;  1FOD 3;  2C6S A;  4Y1Z A;  4IV3 C;  5FP4 A;  3J7M A;  1DGL A;  5BNP C;  1DQ1 A;  4Z92 B;  1HV0 A;  1OUR A;  4E4S A;  1GZC A;  2C0Z A;  3OJB A;  5J36 A;  3ASI A;  1WW4 A;  4YZ4 A;  3POG A;  3V0B A;  2GN7 A;  2HWF 1;  1WLT A;  1J1L A;  3WF3 A;  2OX0 A;  1RHI 2;  2WL1 A;  4PCR A;  3AL5 A;  4DXS A;  3LDB A;  4UWD A;  5IAV A;  3VKL A;  4RR3 B;  5DMY A;  4NAO A;  1WW5 A;  1W8Z A;  1N1V A;  3ZXE A;  3GHM A;  3LKJ A;  1WLD A;  5DN2 A;  5EJ3 A;  3IT8 A;  4XOG A;  4OQ9 A;  3BTY A;  1C8M 2;  2JEC A;  1ZRR A;  3NST A;  2XXZ A;  5I0T A;  1J58 A;  5HPO A;  3BOP A;  1KD7 A;  1AYM 3;  3LPF A;  2VZT A;  3SCH A;  3LEK A;  2GMM A;  4U36 A;  1RGS A;  4LTA A;  4COU A;  4YGB A;  2WAO A;  1NYW A;  1QU0 A;  1ODN A;  5EYY A;  2A75 A;  3S6P A;  1JHN A;  4FTE A;  3I7D A;  3POS A;  4CP0 A;  4AQS A;  1MAC A;  5FLI A;  4B7E A;  4MGZ E;  4AGG A;  5T52 A;  4MHU A;  5A3O A;  1YCI A;  2J42 A;  1JMU B;  1FYU A;  2PQS A;  1MS3 A;  4MX3 A;  5BNO A;  3BUC A;  2AEN A;  4LKF A;  4EN9 B;  1ZBE 1;  1J3P A;  4AED C;  2A5Z A;  2YXS A;  4KWJ A;  3O12 A;  2JG8 B;  5FLH A;  3OYW A;  4XFG A;  5GLT A;  4GWI A;  2VZ3 A;  4UW3 A;  2VL4 A;  4YM3 A;  4KBB A;  4YWA A;  3LZZ A;  4Q4V 1;  4B3N A;  5ABJ C;  1A3K A;  3PVN A;  4XF9 A;  4Y5T A;  3KQR A;  4BQ3 A;  4QB2 A;  1LEN A;  1H30 A;  2YG0 A;  4P9J A;  2E32 A;  1RUC 2;  1NCR B;  5G05 L;  3W20 A;  4RQP A;  5CYY A;  2ET7 A;  1I6X A;  3GHN A;  3T3Y A;  1SLL A;  2HEY F;  1CAU B;  2VBB A;  3KHB A;  3ZLI A;  2V4A A;  4LUM A;  4PF1 A;  4Y3O A;  4AI8 A;  4CXX A;  4S2H A;  1O6U A;  1HRV 2;  2WT1 A;  3DKW A;  4DUX A;  1ALY A;  3U11 A;  5BY5 A;  2ARX A;  1FMD 2;  1HJG A;  2A6Z A;  4L97 A;  5T50 A;  4F7Z A;  2ET1 A;  3ZSK A;  4YZ3 A;  1K12 A;  1NZC A;  4PDW A;  1ENS A;  1BMV 2;  3ZFF C;  3WNK A;  3LF7 A;  4P9G A;  3MIF A;  4YPJ A;  4YVW A;  2SLI A;  4P08 A;  5A7N A;  5CFC C;  1BLZ A;  1H2L A;  1AXZ A;  5E8A A;  5IWF A;  4FOW A;  4QKN A;  2A1X A;  2BBA A;  4QM9 A;  5K8S A;  2ZX4 A;  5BYN A;  2BW8 A;  4AEM A;  3PLQ A;  2E7A A;  4Q1P A;  1JH5 A;  5DAW A;  2RM2 1;  4XF3 A;  2R04 3;  4I0A A;  1ND3 C;  1UPI A;  1YEW A;  4XJZ A;  3J7N A;  4DRR A;  4CUC A;  4I2O A;  1X7N A;  2WJS A;  5D2A A;  3RZM A;  5CAZ A;  4DEQ A;  2DTW A;  1H8T B;  4Q0V A;  1SQ4 A;  1U5I A;  2BDR A;  2HYK A;  2XR4 A;  4O9G A;  4GH4 C;  4RHV 1;  2RMU 2;  4LXL A;  4B1M A;  2WWS A;  3IWZ A;  3CDZ B;  4RGG A;  3NNJ A;  5C8C B;  4GWJ A;  1WZX A;  4QMA A;  2PHF A;  3B7M A;  3SIT A;  4PIX A;  2JE8 A;  4J1W A;  2WYS A;  1QF3 A;  5I0S A;  4Q26 A;  5BNN C;  1XE0 A;  1R1A 1;  2C1F A;  2GC1 A;  3AP5 A;  2NN8 A;  3CEW A;  1DGR N; 
#chains in the Genus database with same CATH homology
 3C7H A;  2ZEZ A;  1H6X A;  4ZZ5 A;  2QQI A;  3BN6 A;  2C4X A;  1EUT A;  5IFT A;  1CZS A;  1NKG A;  3LQC A;  5JUV A;  1J84 A;  4DUV A;  4QX1 A;  3LEI A;  1JZ2 A;  4LQR A;  2WO2 A;  1JYW A;  3ACG A;  3BGA A;  3J7H A;  3NQH A;  4JKM A;  3D3A A;  3I2H A;  2QQK A;  2DCK A;  4MOA A;  1H6Y A;  3WNM A;  5EIY B;  2Y6L A;  1UY3 A;  2QQO A;  2YB7 A;  3T2O A;  3VD5 A;  3C7O A;  2XQX A;  2X10 A;  3K4A A;  3GXU A;  2W5F A;  3OEA A;  2B9V A;  2X09 A;  3OGR A;  2J1R A;  4A4A A;  3WEZ A;  2WDB A;  1JZ8 A;  4QDR A;  3DEC A;  4E8C A;  1SG3 A;  4W4Z A;  1GOF A;  1W8N A;  3I3D A;  1PX4 A;  2WUH A;  2VCC A;  2J1V A;  4BJ0 A;  3I2F A;  5HXM A;  4D0Q A;  4QX3 A;  2JKX A;  1KGY A;  1JZ6 A;  2XON A;  3DYO A;  3WNP A;  4QAW A;  3IB3 A;  1UMI A;  3ACI A;  5B4X A;  1WKY A;  1US2 A;  1UYZ A;  4P5Y A;  3LE0 A;  5I0D A;  1TVG A;  3K4Z A;  3T0B A;  2CDP A;  4MAD A;  3CMG A;  1CZT A;  2V4V A;  4QDS A;  3PUI A;  1OF3 A;  3IAP A;  3WSO A;  1F4A A;  3K77 A;  4XVH A;  2WN2 A;  2WAB A;  3ETP A;  2VTF A;  2VMF A;  2BZD A;  2Y64 A;  1NX9 A;  2VMD A;  3LPG A;  3NRU A;  4IUG A;  2CDO A;  1UYY A;  5A1A A;  4L0P A;  1MPX A;  2E26 A;  4XUN A;  2VZ1 A;  1UZ0 A;  2QQJ A;  2RJ2 A;  3WNO A;  2X05 A;  1PMJ X;  4QX2 A;  3HEI A;  1I5P A;  3W5M A;  3THD A;  3W5N A;  3ECQ A;  3A21 A;  4JKK A;  3MO4 A;  1XNA A;  3U37 A;  2VR4 A;  3CQO A;  1W9S A;  1OT5 A;  2E33 A;  1J83 A;  2QQM A;  1L7R A;  3T09 A;  2W47 A;  4A44 A;  1XNT A;  4KI5 M;  1JHJ A;  1DYO A;  5JXH A;  1UXZ A;  1JI6 A;  1O8S A;  4BXS V;  4CU6 A;  4A42 A;  1NUK A;  1ULO A;  2ZEY A;  2J1S A;  2WAA A;  2W46 A;  1D7P M;  2W1Q A;  1LNS A;  1UY4 A;  5IHR A;  3T2Q A;  1K42 A;  3OEB A;  2VM9 A;  1DP0 A;  4GZ9 A;  1JYN A;  2WQ8 A;  5DQ0 A;  2Z4F A;  4UAP A;  2RVA A;  2VQT A;  4LKS A;  3VD9 A;  1O59 A;  2C9K A;  3HN3 A;  1K45 A;  3OBA A;  1L7Q A;  3NNG A;  2VZV A;  3OGS A;  3A7Q A;  3C7G A;  3ABZ A;  3VD7 A;  2LW8 A;  4ZXE A;  4ET7 A;  4JX0 A;  2HLE A;  3FHA A;  2VZP A;  1KEX A;  4XUO A;  3SKV A;  1RYY A;  3IAQ A;  5C7G A;  4LPL A;  1W9T A;  1UX7 A;  2RV9 A;  1GOH A;  3FHQ A;  4DEV A;  3SEP A;  4DXR A;  2EIE A;  4M4R A;  4ARY A;  3CIH A;  2ZEW A;  2C26 A;  4A45 A;  2W1S A;  3P1I A;  2VMC A;  2WZ8 A;  3AC0 A;  2Y6K A;  1UXX X;  2EID A;  4CUA A;  1HN1 A;  2Y8K A;  3ACH A;  3I2I A;  5J1X A;  1JYV A;  3DYM A;  4PQQ A;  5G04 L;  3WQB A;  2L9L A;  2W94 A;  2WO1 A;  3WNN A;  1O8P A;  3IDA A;  1YQ2 A;  1PX3 A;  2VJX A;  3C7F A;  4CVU A;  1UYX A;  2W1W A;  4QDQ A;  3JXS A;  2VC9 A;  2VZS A;  4XUP A;  1W99 A;  3GGL A;  5C70 A;  1GUI A;  4E8D A;  2VZQ A;  1IQD C;  1US3 A;  1CX1 A;  3SEE A;  1XPW A;  2LS6 A;  2BER A;  3ZM8 A;  5JXJ A;  3HNM A;  2DCJ A;  3LEG A;  3CZJ A;  1NAE A;  2YC4 A;  4CU9 A;  4A41 A;  4CU7 A;  4ZZ8 A;  2ORZ A;  1GQP A;  3HPN A;  5C71 A;  4P02 B;  4MGS A;  4QB1 A;  3NJX A;  4XUT A;  3K75 B;  3DYP A;  5B4N A;  4BK4 A;  4TXW A;  3GDB A;  1DLC A;  3HJR A;  3T2P A;  3WF0 A;  2YFZ A;  2BGP A;  2JD9 A;  3T0A A;  5JXG A;  4D8M A;  1OH4 A;  4LHS A;  2XOM A;  2OKX A;  2WZE A;  2W95 A;  3CKH A;  1BHG A;  2KD7 A;  2QQN A;  3III A;  2Y6G A;  3HOB A;  2Y6H A;  4JKL A;  5LA0 A;  4A6O A;  2VZO A;  2VOT A;  1GNY A;  5DPN A;  2VO5 A;  3E1F 1;  4OMD A;  3VD4 A;  2XHN A;  2BGO A;  4A3Z A;  1SHW B;  4W8J A;  2VCB A;  5LCW L;  1TG7 A;  3OG2 A;  2Y6J A;  4QB6 A;  4DXT A;  3GM8 A;  3THC A;  3OB8 A;  3UES A;  1T2X A;  2J1E A;  3EB7 A;  4XZU G;  1EUU A;  1JZ4 A;  4BK5 A;  3C7E A;  4OYU A;  4ZY9 A;  2E31 A;  3HNY M;  4P00 B;  5IJR A;  2ORX A;  1ULP A;  3I3B A;  5FUI A;  1JZ5 A;  5JR2 A;  3NJV A;  2WO3 A;  3MV0 1;  3C8X A;  3F2Z A;  4HG6 B;  2WN3 A;  1P8J A;  2J22 A;  4QPW A;  3WF2 A;  4UOJ A;  1SDD B;  2V5D A;  5CZK A;  1UY0 A;  3WF3 A;  4DXS A;  5EJ1 B;  3CZU A;  5DMY A;  5IYY A;  1W9W A;  2WBK A;  3MBW A;  2J7M A;  1UY2 A;  3UET A;  5DN2 A;  5F7U A;  3WNL A;  2QQL A;  4MGQ A;  5HPO A;  3LPF A;  2VZT A;  3LEK A;  3VDC A;  5LA2 A;  3P6B A;  2W1U A;  5JMO A;  3WF1 A;  4CU8 A;  2WAO A;  3K4D A;  2VQU A;  3VDB A;  2EIB A;  3WF4 A;  1JZ3 A;  3MUZ 1;  4CUB A;  4XUQ A;  3I2G A;  2JDA A;  3OGV A;  3I3E A;  2DDU A;  2B4K A;  3A23 A;  3FN9 A;  1GOG A;  2PQS A;  3MUY 1;  4W50 A;  4BDV B;  4XUR A;  3VDA A;  2EIC A;  3I97 A;  4PT6 A;  2R7E B;  4QX0 A;  4GWI A;  2VZ3 A;  2VL4 A;  4FI9 A;  1OD3 A;  2ZXQ A;  4OMC A;  1XC6 A;  4ARX A;  4Z2A A;  4OZO A;  2QBX A;  3SKJ E;  2J1A A;  3A22 A;  3FL7 A;  1R64 A;  4QB2 A;  5EJZ B;  2YG0 A;  2E32 A;  4JHZ A;  1K3I A;  4AG4 A;  4KMQ A;  5G05 L;  5CYY A;  5IFP A;  2ZEX A;  2VZR A;  3I2J A;  4RYD A;  4RN5 A;  3T0D A;  4PF1 A;  3UNP A;  1UWW A;  2VME A;  3EYP A;  2VZU A;  1W0N A;  3I2K A;  4DUX A;  2W91 A;  1GU3 A;  2ID4 A;  1CZV A;  1UMH A;  3HNB M;  1K12 A;  4MO3 M;  3WNK A;  1UY1 A;  2YFU A;  4YPJ A;  2W9X A;  2HYX A;  2J1U A;  4UI9 L;  4P08 A;  2V72 A;  1GMM A;  4KWU A;  1JYX A;  1W8O A;  2BBA A;  2W92 A;  1PMH X;  3K46 A;  1CIY A;  1F4H A;  5LA1 A;  4M4P A;  4DUW A;  1JU3 A;  2J1T A;  4CUC A;  2W87 A;  1OF4 A;  3VD3 A;  3MV1 1;  2VCA A;  1JZ7 A;  4DEQ A;  2W3J A;  3T08 A;  4TTG A;  1WCQ A;  3ACF A;  3CDZ B;  2YC2 A;  3PUH A;  4GWJ A;  2JE8 A;  2WYS A;  1JU4 A;  4AAX A;  4OUE A;  5JXI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...