5LCWL

Cryo-em structure of the anaphase-promoting complex/cyclosome, in complex with the mitotic checkpoint complex (apc/c-mcc) at 4.2 angstrom resolution
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
183
structure length
182
Chain Sequence
TPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVESSIGKFPRCTTIDFMMYRSIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anaphase-promoting complex subunit 1
publication title Molecular basis of APC/C regulation by the spindle assembly checkpoint.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 30
structure length 182
sequence length 183
ec nomenclature
pdb deposition date 2016-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF03256 ANAPC10 Anaphase-promoting complex, subunit 10 (APC10)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 5lcwL00
4M4PA 3WF3A 1JZ5A 5DMYA 3OGRA 1ULPA 4A45A 3WEZA 4AAXA 3U37A 1BHGA 2KD7A 5LA2A 5IHRA 1XC6A 1MPXA 1UY0A 3AC0A 4PQQA 4CU6A 3LE0A 2W92A 3HPNA 2VZVA 3NNGA 2VR4A 5I0DA 4W50A 3MV11 4OUEA 3FHAA 4L0PA 5EIYB 4QDRA 2VZQA 2B4KA 3WF0A 2VMDA 4PF1A 4OYUA 2V5DA 4OZOA 1DYOA 1TVGA 3EB7A 3I2HA 4CU9A 2ZXQA 3OEBA 3ZM8A 2ID4A 2W1QA 3CIHA 1XNAA 2ZEWA 4XUPA 2XOMA 3WF1A 5C71A 3GDBA 2J22A 3C7OA 2C9KA 1WKYA 4BK4A 3LPGA 3K77A 1RYYA 4LHSA 4ZZ5A 2JKXA 2EIDA 1P8JA 3HN3A 3SKJE 3SEPA 1K45A 1EUTA 3MUY1 3W5MA 2VO5A 4HG6B 3FL7A 3GGLA 3PUHA 2X10A 4MGQA 4XVHA 2W3JA 3VD4A 1PMHX 5JXHA 2J1VA 1UXZA 3WNPA 2ORXA 3VD7A 5C70A 5JUVA 2VMFA 1SG3A 3DECA 4A44A 4BK5A 1JYWA 3HNBM 4MO3M 2J1EA 3C7GA 3ABZA 3F2ZA 2Y8KA 2YFUA 1JZ7A 5IYYA 3VD3A 3ETPA 4JKMA 4QDQA 2Y6GA 3A21A 3JXSA 1JZ4A 3MUZ1 3C7EA 1TG7A 1DP0A 3D3AA 5CZKA 5LA0A 1OD3A 4TXWA 4RN5A 1W0NA 4DXRA 4QB1A 3OG2A 4DXTA 4ARXA 4A6OA 4OMDA 2VL4A 3MO4A 3DYMA 1PX3A 2WN3A 4CUCA 1EUUA 1W9SA 3WNKA 2Y64A 1JI6A 2YC2A 3I2GA 1UY1A 2Y6JA 4W4ZA 2YC4A 1W9WA 3VDCA 1JZ2A 5JMOA 1GNYA 2VM9A 3T2QA 1OT5A 5G04L 3VD9A 1L7RA 2WZ8A 4YPJA 2J1UA 5IJRA 4DUVA 1OF4A 1GOFA 2E31A 1F4AA 3J7HA 2C26A 3GXUA 3OBAA 5FUIA 2JE8A 4LPLA 1H6YA 5DN2A 3WF2A 1PX4A 2BZDA 2BGOA 1JU4A 3A7QA 3K75B 4E8CA 1UMIA 2W1WA 5IFPA 1JU3A 3HJRA 1J83A 4DEQA 4M4RA 2J1SA 2VMEA 3IAPA 3IAQA 5JXJA 2E32A 4JKKA 5C7GA 1UY4A 3ACFA 2HYXA 3IDAA 2VMCA 3T0DA 1W99A 3WNOA 3LEKA 3I3BA 2R7EB 2WUHA 2YB7A 4W8JA 4MGSA 4P00B 4Z2AA 1GOHA 4BXSV 4D8MA 1I5PA 2VZSA 4DEVA 4RYDA 4GZ9A 4PT6A 4OMCA 3T0BA 2V4VA 4AG4A 4QDSA 5CYYA 2EIEA 2W47A 2WABA 4JKLA 5JXGA 1JZ8A 2J7MA 2CDPA 2VZ3A 2LW8A 5B4NA 2C4XA 2W87A 4DUWA 3IIIA 5DPNA 1JHJA 4IUGA 4E8DA 3CZJA 2Y6LA 2BBAA 2QBXA 2VZOA 1UXXX 1UZ0A 2JDAA 4FI9A 2V72A 5G05L 4LQRA 2RV9A 3I2FA 4KMQA 3W5NA 1L7QA 3WNLA 3THCA 4QX0A 2WAAA 1US2A 3BGAA 4JHZA 5A1AA 5EJZB 2VQTA 1US3A 4A4AA 4KWUA 2EICA 1O8SA 1R64A 3T2OA 3SKVA 2ZEYA 3C8XA 4CU8A 2WO3A 1NKGA 2Y6HA 5EJ1B 2J1TA 1UYYA 2VZUA 1JZ6A 2WN2A 2WO2A 2ORZA 2QQNA 3K4DA 5HPOA 4P08A 2JD9A 2QQOA 2Y6KA 4QX3A 3WNNA 3ECQA 5LA1A 2W9XA 5HXMA 2QQJA 2WDBA 2J1AA 3I2IA 4CU7A 1CZSA 1UMHA 4GWJA 1CX1A 1O8PA 2W5FA 3WSOA 4QAWA 4DUXA 4UI9L 1GQPA 4TTGA 4GWIA 1DLCA 1LNSA 3NJXA 4JX0A 4XUTA 3UESA 1UY2A 2VZPA 3K46A 3SEEA 1JZ3A 2VQUA 3A22A 1CZTA 3VDAA 1K3IA 1KGYA 2WO1A 1K42A 2W1SA 1PMJX 3OGVA 4LKSA 5B4XA 1CIYA 3T09A 2BGPA 3CDZB 3NQHA 4ZY9A 1T2XA 3LEIA 3VDBA 2QQLA 1CZVA 4KI5M 2VOTA 1SDDB 3WQBA 1UYZA 3UNPA 1SHWB 1XNTA 3HNYM 2QQMA 4A42A 1ULOA 4P02B 5DQ0A 4ARYA 1NX9A 2VCBA 3DYPA 4ET7A 2B9VA 3I2KA 1IQDC 3THDA 1JYXA 2RVAA 4UAPA 3NJVA 3BN6A 2RJ2A 1UY3A 5F7UA 1NUKA 3PUIA 3E1F1 2DCJA 4CUAA 1J84A 2WAOA 3T2PA 1JYNA 1UX7A 4CVUA 2W1UA 3MV01 3OGSA 1KEXA 3ACGA 2WYSA 2X05A 4P5YA 4ZXEA 2VZ1A 2E33A 1UYXA 1JYVA 3FHQA 4XUQA 2HLEA 3LQCA 2W95A 3ACHA 4MADA 2OKXA 4DXSA 1WCQA 4A3ZA 3K4AA 2WBKA 2VJXA 2DDUA 3I3DA 2VC9A 4QX1A 2VCCA 3LPFA 3T0AA 4CUBA 2W94A 4QX2A 3OB8A 2VCAA 4QB6A 1OH4A 3EYPA 1OF3A 3LEGA 4MOAA 3ACIA 3IB3A 1W8OA 4D0QA 2ZEZA 2WZEA 3FN9A 1F4HA 3GM8A 2X09A 2XQXA 3P1IA 2XONA 3CZUA 3I2JA 4XURA 2BERA 1HN1A 4QB2A 1NAEA 2VTFA 2PQSA 2YG0A 4ZZ8A 4QPWA 1O59A 2DCKA 2VZTA 1XPWA 3HNMA 1GU3A 3P6BA 2Z4FA 5IFTA 3C7FA 2QQKA 4UOJA 2L9LA 1YQ2A 4XUOA 4XUNA 1GMMA 2XHNA 2VZRA 3WF4A 3WNMA 2W46A 3HOBA 3CQOA 2J1RA 2LS6A 2E26A 1GUIA 3UETA 1UWWA 4BJ0A 3K4ZA 3C7HA 3OEAA 2ZEXA 3I97A 3VD5A 1D7PM 1H6XA 1W9TA 2YFZA 3CMGA 3HEIA 2WQ8A 2W91A 3A23A 3NRUA 4A41A 3I3EA 3T08A 2EIBA 1K12A 1GOGA 3DYOA 5J1XA 2QQIA 4XZUG 5JXIA 5JR2A 3CKHA 4BDVB 5LCWL 1W8NA 3MBWA 2CDOA
chains in the Genus database with same CATH superfamily
2W08A 5FY7A 5JSPA 2YGLA 3WF3A 4NO4A 3NWKA 3MPPG 4BIFA 3VKOA 5FY1A 3WEZA 4QXHA 1BHGA 4I3PA 5JAXA 1J59A 1VMFA 3MF6A 4XIOA 4AL9A 1XC6A 2I2SA 4Q4W1 4X8PA 3AC0A 4PQQA 1OA4A 2HWC3 2W92A 2Z42A 3LE0A 2VR4A 5F6LB 2EF6A 2J42A 3N9NA 3T30A 1NG0A 4HVOA 4BQ3A 1IS6A 3MV11 1ENQA 3VBFC 3UGHA 4CTEA 1UKGA 5HXVA 3AKTA 4I2OA 3FHAA 2WNVC 5EIYB 2IZWA 4S2FA 5F8PA 5C5UA 2HYKA 1FNYA 3K3NA 1DQ5A 4X6RB 5JMCA 2VMDA 4PF1A 2Q8OA 5FPAA 5KBFA 1XOYA 5EPAA 4AI9A 1E5IA 1LKNA 4BQ5A 1V6KA 3K3OA 1F15A 5C8CC 5JPNB 3EB7A 2BUKA 1NLSA 5BNOA 1FMD3 3HMYA 5EFUA 1LGBA 3LGRA 3OEBA 3ZN6A 3NV1A 3I7DA 4BQYA 3CIHA 2P3IA 2ZEWA 4GXLA 3U4XA 4QPYA 1S0CA 4IV1C 3WF1A 1TMF1 1FXZA 5FZAA 2CAVA 1W8TA 2C9KA 4QGMA 4LTAA 2A6VA 1BMV2 4L9BA 3PNAA 1SLCA 3RQ0A 1RYYA 3ZYBA 3SCFA 1GQGA 3DPRC 2ZHLA 4K21A 3UL2A 2X53S 4HPKB 3TWIA 4A7ZA 1U0AA 1BEV3 3HN3A 3B69A 1NY71 1MS9A 1MZ6A 3CJIB 3H1WA 3KM5A 3MUY1 2O0OA 1EV13 1GZWA 1CESA 1OLRA 3L2YA 3W5MA 2A6XA 2WL1A 3FBMA 3FL7A 2C1FA 3MI8A 4E4ZA 1LTEA 4QHOA 2W3JA 2C9AA 3VD4A 2RMU2 3O1VA 3M7AA 1IPJA 2Q0AA 3D0JA 4RS5B 1RUH3 5E8AA 3MEPA 3MPBA 2BQPA 2JIGA 2Q1MA 3JD72 4AEDA 2VBPA 1TNRA 4FO9A 3AXDA 5T54A 5C70A 2JG8C 4IGQA 4DFSA 4NWVA 3DECA 4AF9A 2YROA 2Q30A 3AZXA 4AVBA 2JKBA 1JOBA 3ZXGA 1BMV1 4MO3M 4IE5A 2D6KA 3C7GA 2PHUA 1AX2A 2Y8KA 2ZGTA 3M3CA 1Y9QA 5E1RA 1JZ7A 1LAJA 1AL22 1RXGA 4HSLA 4QXKA 4JKMA 1FNZA 1ZA7A 4QDQA 3A21A 2DTWA 4H7MA 4CDWB 1JZ4A 4JHTA 1D4M2 3GBWA 1TG7A 4H3WA 1DP0A 5FZ3A 3NJZA 1YIFA 4BZ4A 4Q4Y3 1OD3A 1MS1A 2JXAA 4LULA 1XSQA 1XU2A 3B00A 4QX8A 2RMU1 4IESA 4DXRA 4O7XA 2JDUA 5BPXA 2VW1A 3SISA 3THPA 2QZ2A 1S55A 3MO4A 2QNKA 1PGL1 1NA1C 1ULCA 1UN1A 3BOPA 1ZBA1 1POV3 4NAOA 5BXXA 5FYYA 3RZZA 4XFHA 2KA3A 2QQWA 4PBOA 4NE9A 1PX3A 4NOTA 4NVPA 3S5QA 4CEWA 5J09A 3H8XA 4CUCA 1W9SA 4N43A 3HT1A 4WZFA 2FMYA 4W65A 4K7JA 2GC1A 2XJTA 4PLOA 3ZN6B 1BBT1 1QHDA 2OVUA 2XWBB 4BYYA 1AVBA 1JI6A 4Q27A 3IKWA 1AL21 4HFSA 2A6YA 3RWKX 1LOGA 1WUVA 2XDVA 1QDCA 1RUF3 1YI7A 2JWPA 1D4M1 3VDCA 3KMHA 4L11A 5IWFA 5JMOA 1DBNA 2WJSA 2UYBA 4P9GA 3NSTA 1RUD2 4A6SA 4FXGB 3ZFGA 4DUVA 1OF4A 1GOFA 2VTXJ 4HKWA 1UL9A 2PN5A 5HI0A 2WFF1 3TEYA 4K8FA 1D0HA 1UYPA 2F6BA 2IXHA 3GF6A 3N9OA 4E2QA 1ALYA 2YPDA 1XRUA 4LPLA 3ZYPA 2ZS6B 5DZEA 3MFAA 3OD0A 2BJSA 5JOZA 3T3YA 4XQ4A 1GANA 1JU4A 4QKDA 4WVWA 3A7QA 5BNPC 3ETQA 3VDDB 1ZRDA 3HAGA 4I09A 3S7IA 3U07A 5IATA 2B9UA 4AEDB 1JU3A 1OQDA 5FMOS 1W6PA 4M3CE 2RM23 3KT4A 2BVBA 2XLAA 4WM8B 3ZIXA 3RG0A 3IAPA 3IAQA 5HV0A 1AJOA 4R9AA 4YW1A 5LASA 3VBUA 3UYJA 3WW1A 5GZFA 1C57A 1KD7A 1RUI3 3ACFA 1QJU1 3KQ4B 3MW4A 4QKFA 5JIUA 2O1QA 2WT0A 2HWD1 1W2TA 2VQ0A 2BRTA 4HKOA 4X8NA 3WNOA 3LEKA 3ILNA 3I3BA 2BWCA 4OFGA 4K9SA 4P00B 4COVA 4ITCA 2TNFA 3HQRA 2VZSA 1ENSA 2UY8A 5KXCA 4C90A 4MXWB 4YVSB 4F8AA 4AVAA 5LY1A 3TEZA 4HONA 1V6MA 1S2KA 1R083 1QJZA 2A3XA 5GLZA 2ZGMA 1VBE3 2CAUA 3A4UA 4LNVA 4KQ7A 5FYVA 4BISA 2OT7A 4C1WA 4MX3A 5CYYA 1DQ6A 4JKLA 4N7UA 3KT1A 3NW4A 2J7MA 3UK9A 2CDPA 3WQ7A 3ZYHA 2VOXA 4XJAA 1YLLA 2PHLA 2GMPA 4OHZA 1H0BA 1LRHA 4J1WA 3SXWA 4AHXA 2I45A 2WR9A 4OLLA 1JHJA 2KXLA 5JIAA 2XJQA 4Q4W3 5BYNA 3MW3A 5H9RA 3I54A 1W9FA 2D43A 1H2LA 3ZPYA 4LA3A 4B1LA 5LBFA 4CEYA 4UF0B 5E89A 3LKJA 5LBEA 5FFOC 2TEPA 3I3QA 3CBNA 3JBG3 5FUNA 3TNQA 4B29A 1XU1A 2RS12 2RV9A 3I2FA 1W05A 3U10A 3W5NA 3KB5A 5FXZA 4QX0A 3WNLA 3RZHA 3S5AA 2BBVA 4YW6A 2DFCA 4P14A 3QOPA 5A1AA 2WLPA 1MZ5A 3O5SA 2XXZA 3UKTA 1PNGA 3CJIC 1UU4A 3ZFEB 1HRI3 2ZEYA 5F3EA 4XF9A 4EWDA 5C9AA 1F8VA 1OFNA 3AKPA 2Y6HA 3R4DB 2EXHA 5KHHA 5DAPA 3CHXA 2CHHA 3THTA 1AR91 4UW6A 3VBSA 5FK8A 2WNUB 2ES3A 4R52A 1JZ6A 1YXWA 3ZO0B 4JRAA 1APNA 1G9CA 5I0SA 4UW4A 4BQWA 4LITA 3TOJA 3B9IA 3VKNA 2JD9A 2QQOA 4LBOA 4HVRA 4GWMA 1BXHA 1W0PA 3NV3A 3H3ZA 2W9XA 2QQJA 4NHKA 1RC6A 1SLAA 5F3CA 1Q5OA 2IXIA 4WVZA 1W6OB 3M1HA 3DKWA 2HWF1 4LORA 1Q43A 4CDWC 1NYWA 3O1UA 3SCHA 1UZVA 2Y38A 3GHNA 3NVCA 2RS31 4Q0VA 2PLV2 1D2SA 4JCKA 1NLRA 2XMLA 3NMBA 1G86A 2R32A 3B94A 3H7JA 3UESA 1JZ3A 4AI2A 4IEXA 1HW5A 1CZTA 2ZACA 3VDAA 1K3IA 3JCIA 3KWVA 1VB4A 4NHMA 4Y33A 5CVRA 4CDQA 3ENRA 4XFBA 3S7EA 2ZBJA 4IE4A 4PIXA 3OGVA 4LBQD 3PL0A 5BNQA 1RXFA 4ZS2A 2VVFA 3AFKA 5FYCA 1VAMA 3DXUA 3X29B 2OIIA 4KGGA 4Y5TA 4XBNA 1FATA 4ATEA 4NAMA 1CIYA 1DQ2A 5BNOC 4M00A 4NHXA 1S1AA 3UGFA 2BGPA 3PDQA 1S0GA 3GHMA 5C3RA 1T2XA 2QE3A 4YNIA 5LEJA 1W6QB 4XOGA 3VDBA 5FY4A 1VBD2 1G9AA 2OZJA 2RMU3 5LCWL 5I93A 4KI5M 3U14A 1Q56A 1AF9A 1AR71 1SDDB 1DYKA 4AI3A 2VNGA 1UYZA 4LBNA 2YZ4A 1Q8VA 5AFBA 3JD73 4CDUA 2UURA 2BU9A 1QNYA 4LE4A 2N7GA 3OUIA 1H4GA 2ARXA 1A8MA 3C3VA 3NAPB 1LEMA 1QXPA 5C9AB 2JDKA 3A0KA 3ZKYA 3FHIB 2GH2A 1N47A 2BEOA 2DTYA 4I0BA 1GQHA 2AGSA 2DVAA 4QHZA 5GZDA 2VCBA 3DYPA 4ARYA 1AL23 5FR3A 1VB2A 3H7YA 1IQDC 1JYXA 2E63A 3MIDA 2ZGLA 3DV8A 3J26N 1LULA 2C6SA 2RVAA 3VDDC 3JU9A 5IUQA 1MS8A 1D4M3 4MUVA 3ZSKA 4GA9A 5HBAA 4AEDC 5EP9A 4G4FA 1UY3A 1GLHA 5F7UA 5LEKA 3E1F1 4WM8C 4YFWA 1VBD1 5GZCA 4FFIA 1J58A 4FOVA 3TRSB 3T2PA 1JYNA 2V09A 1PZ7A 4IEYA 3MV01 1J3QA 3PU8A 2OW4A 1ASJ2 4WM7B 2X05A 2DUOA 3CL1A 1CVNA 1REDA 4EROA 1UYXA 3OJBA 2GN3A 2PA7A 1BVVA 1JYVA 3BPSA 3ZFFB 1CAWB 1IHMA 1D2QA 2BWAA 3ACHA 5FP4A 2FDKA 4G9SB 4R4XA 3LB9A 2VMGA 2NN8A 2QDRA 1WMDA 4A3ZA 3RZLA 1CN1A 1VBA1 2VJXA 2XGXA 1CR7A 1QQP2 4ORFA 4BLIA 4YVSC 4QPGB 4FQ4A 3J8F2 1GZCA 1HIXA 3VBFA 1POV0 2VCCA 3POFA 3T0AA 3WG2A 4XMIA 4MGTA 3NNFA 5L9BA 3WOGA 3G7DA 4QB6A 2OUHA 2Q1FA 4G3YC 1R1ZA 5K0UB 1UIJA 3O0VA 4GKYA 2H6BA 1OF3A 4MOAA 2ZPXA 3ACIA 4XDOA 5I8YA 2ZAHA 4LJHA 4LIVA 4D0QA 1SCRA 3QCWA 4NN0A 5DAQA 1RUD3 2YY1A 4RFRB 2UWBA 5LBBA 3O1OA 3DXTA 2QDNA 4ZKTB 4Y22A 1ASJ1 4L92A 1AXZA 4XTPA 3ZOIA 4AR2A 3VHRA 4NPMA 2BOIA 3CZUA 3KV9A 4J1XA 4Z2WA 2JJ6A 4NUBA 5F5IA 3MZHA 4IV1A 4GB31 4QQLA 4A7KA 1WCUA 1O3RA 1OA3A 2FCVA 1WCDJ 3IN9A 4HT1T 3ALQA 3WT3A 4TSVA 2ZGSA 3ZXLA 3AB0A 3OOXA 4QPWA 1OH3A 2AACA 1O59A 1QQP1 2JDPA 2JENA 5FYHA 1IKQA 3H3LA 1OMIA 1V6OA 2HEVF 5C6CA 1DQ1A 2BNOA 5IFTA 2XWJB 2QQKA 2QFEA 1H4HA 4MG2A 2L9LA 3KV4A 5GKAC 4XUOA 1REFA 4JGZB 2B42B 2WNUC 4QPIB 2G1MA 3WF4A 4LKEA 3WG1A 2HWC1 5FQ0A 4ISQA 2ZTNA 2Y0IA 3HOBA 2ERFA 3EHKA 1L7LA 3N7LA 1AYM2 2PYTA 1VRBA 2ARBA 1SFPA 3PVBB 5LB6A 2A3WA 5T5OA 1HJGA 2JG8A 3UV9A 3KGLA 3WUCA 4LLFA 1X82A 3I97A 2VBDA 2Y60A 3MLJA 4M01A 2XKOA 4AFAA 1D7PM 3ELNA 3VBOB 1WW4A 1W9TA 3AP9A 2AH2A 1OLMA 3WDVA 3MLKA 4MVTA 3ZIWA 2W91A 5CIRA 2ETEA 4K20A 3ZXKA 4JC1A 1FMD1 1KITA 3FLRA 5L9VA 3AM2A 3I3EA 5C3PA 5HCHA 2DF7A 2RHPA 2KM2A 1J1LA 3D8CA 5B2GB 4FFGA 2EIBA 3WG3A 3M4FA 3DYOA 4AQ2A 3O1MA 1O5UA 1H1IA 1J3RA 1NXD1 3L2HA 3WLUA 4XZUG 2P3JA 1HB2A 4NIGA 5LRRA 3MF9A 5F37A 1XYNA 3H8OA 2HH9A 5CFDB 1Y9GA 1N3QA 1WZXA 4BDVB 2RS13 1NA1A 3GALA 4AVSA 4FPYA 5IAXA 1IS5A 4LIUA 1SEFA 2VH9A 2PTMA 5ABJB 5DMYA 2VUAA 1H8TB 3ASIA 1JXNA 2WZR2 4NIHA 4AAXA 2JE7A 3U37A 5IHRA 3WP5A 5KHKA 1QXJA 1IPSA 1R092 4OHWA 1UY0A 2K0GA 5FV3A 2ZA9A 1HJFA 4QQOA 2XUEA 3LSEA 4FSJA 1QEXA 5J37A 1ZA4A 4KU8A 4C91A 2DBNA 2VOVA 3I59B 4UBHA 4KNCA 2VNVA 1LOFC 1SLIA 2ET7A 5CKMA 3ZYIB 3LA2A 2LRPA 1ZYBA 1YC61 3H8UA 4HSJA 4D7YA 1YCIA 1CIWA 2VD7A 3ZSEA 1SDWA 5IK5A 2WC2A 5FZ9A 3I2DA 3NAPC 3KV6A 2C0ZA 5C9AC 3USUA 3I2HA 2YDEA 4FP3A 4CU9A 1C3HA 4HANA 2OPKA 2HJIA 1JMUB 3ZM8A 2ID4A 2QUOA 1XNAA 2IXKA 5FYZA 4Y5Z0 1AZDA 2IFRA 2XOMA 1ENXA 4Q4Y1 4XJUA 1A34A 2FDIA 4EV0A 3NNLA 4FOWA 4D6RA 3WY6A 1OPOA 3AMQA 1X9TA 1WKYA 3O14A 5A7WA 1REEA 4BK4A 3K77A 4XJWA 2PLV3 4LHSA 1AR62 4YGEA 2ZKLA 2JKXA 1N3OA 5K7PA 2UWAA 2RJLA 2EIDA 3BOWA 4IV3B 1P8JA 3OYWB 1K45A 5EYXA 3AXEA 5EHDA 4WM7C 3MFCA 5FZMA 1VAKA 3WD5A 3PURA 1X36A 2HWB3 3AZWA 3B01A 4I0AA 1UD1A 3POIA 2WWUA 4HG6B 5A3WA 3W21A 3GGLA 1FX5A 2V5YA 2X10A 1WLCA 1WA4A 3KCXA 4MGQA 4N53B 4AGGA 3ZFFC 2OS2A 3H1YA 5FXVA 4XTMA 5JXHA 3HN1A 3QBQA 4BIOA 2WNOA 2VVEA 2RDRA 4M3CB 2BPA2 4XJ9A 2AC1A 2XBO2 5FZ1A 2ORXA 4AGVA 4QPGC 1RUF1 1W2NA 4FBFA 1RIRA 1VBD3 1A8DA 4R8HA 1SG3A 1SMVA 3NL1A 3J7NA 1OUXA 2EXJA 2Y0OA 5E88A 5K0UC 1WWYA 4Z92B 1OKOA 5J3UA 1U5IA 2WFPA 3VD3A 5IYYA 1OSGA 1PGSA 2SLIA 3ETPA 2AZ5A 3LDBA 2MPFA 4M0NA 3JXSA 1C5HA 2D5FA 4NWWA 3EO6A 3MUZ1 4DO0A 1U5XA 3QACA 2R6QA 3TAYA 4XJ8A 4ZHNA 3D3AA 2VUDA 1B35A 5EYYA 4RN5A 1H2KA 1W0NA 4UBGA 3W9AA 5DG2A 4AK3A 4ARXA 4NJ4A 5A3MA 2VL4A 4XJZA 1O4TA 4P5HA 3GJBA 5A3UA 3BTZA 3KS7A 2VVDA 4LR4A 4NMIA 4HPKA 2DFBA 2RDSA 4RGAA 2H0VA 1RUI1 3GBFA 5IVYA 1JUIA 2GSYA 3E97A 3J9SA 2G4IA 4Y20B 4JGZC 1ASJ3 1XNBA 1V9U2 1JYTA 2VTXA 4LXLA 2Q4SA 5I0RA 3RSJA 1UY1A 4RS5A 2Y6JA 3AKSA 4W4ZA 2W2IA 4QD2A 1EP0A 2YXSA 3I2OA 1JZ2A 1QMJA 4OVEA 5A7WB 1WLWA 2VM9A 4HN1A 1OT5A 1R081 1W06A 1QQP3 3JQXA 3U1XA 5G04L 1VBE1 2ZKNA 3J8F3 2D6LX 4W6YA 3AVRA 2LM3A 4YPJA 1CPMA 2D3SA 3B93A 3OPZA 3IT8A 3VBOC 4CCDA 1KJRA 3EBRA 3WP3A 4OHVA 4PDWB 1F4AA 3KCCA 2FDJA 1TME2 3OBAA 1MQTB 4CDWA 1ND3B 1H6YA 3BTXA 3WF2A 2ZX4A 4EZ4A 2HEWF 1SACA 3WP4A 1ZX5A 4AVCA 1JOPA 2E9QA 3JB8A 4HVQA 1HV1A 1UMIA 3MLLA 4BQ4A 2JDHA 3JBG1 5IFPA 1VMJA 1LOAA 4U36A 2BV4A 2VW0A 4XFIA 5L19A 5CISA 4GALA 4DEQA 4M4RA 5CFDC 1O6UA 4CE8A 2A70A 4CCOA 1IOAA 4BLJA 1C8NA 4MHRA 4ASMB 4L2NA 4CCLA 1DYPA 1XBFA 4AYUA 5ABJC 1ULFA 4LBLA 5A7SA 3RI8A 1H8TC 2HYXA 1YQ6A 1ZZ8A 3FUOA 3IDAA 2VMCA 3AMHA 2XHKA 2Z69A 5DXDA 1HRI1 3K48A 3OPWA 4QX7A 5E6HA 3VL8A 4BB3A 1LHVA 4FOYA 2YYOA 1BVP1 1UW8A 1AR82 2OQ7A 3KZ4C 2YB7A 4W8JA 3TB0A 1GOHA 4D8MA 1I5PA 4I02A 1MS0A 2Y26A 1BK0A 1HXS2 5APAA 1UOFA 5FYIA 3AZZA 4GZ9A 1B35B 5ANNA 2WKKA 4LO8A 2WSUA 1W04A 4FQZA 4OMCA 5BNPA 2AREA 3WV6A 5FMBA 4CRQA 1NXMA 2V4VA 3RZGA 4QDSA 1ZBE2 1AYM3 1RUJ2 1V6IA 2EIEA 4XIKA 5CKQA 4XXPA 2Y6FA 5FKCA 5JVVA 1MEC2 1I1EA 2BNNA 5FO9B 1NQJA 1T6BX 4NIDA 2QTWB 4AI0A 3AP5A 5DPNA 4MZUA 4XF0A 4IUGA 4E8DA 2ZAAA 4QGLA 2D3RA 4KH9A 4P9XA 3J7MA 2QBXA 1V0AA 2JG9B 1OVSA 5FYUA 4BXFA 4CCEA 2NPIA 1SBFA 1RMU2 2WA3A 4K1ZA 2VW2A 4DQAA 4XACA 2XKPA 2V72A 1QJFA 4XC9A 1AR81 1KFUL 4IEUA 3RFRA 3VDDA 1VALA 2GC2A 4EN8B 4KMQA 1L7QA 1GKBA 1V6LA 1XNKA 1OXCA 3LIGA 3BGAA 4WM8A 5FZKA 4JHZA 3RYKA 1EPWA 3UT0A 1VBC2 4N9HA 5EJZB 4O9EA 4R9DA 2XL9A 4IV3C 4KWUA 4ZONA 3PVOA 3VZOA 5ERLA 3T2OA 4NIAA 3SKVA 5HCAA 1QU0A 1RUJ1 2EAKA 3Q8EA 3DL3A 1CAXB 1NKGA 1DCSA 1MEC1 1DQ0A 4PF5A 2DVBA 4N53C 1XJAA 1WLDA 4WZCA 5D1IA 5EJ1B 1S0IA 4META 1UYYA 3POSA 3ZR5A 2WZR3 1I6XA 3W58A 3QD6A 4AI1A 4LUKA 1R093 5JI9A 2CGNA 4MXWA 2XG3A 3K4DA 1RUE2 4YVSA 4M3CF 4S2HA 2Y6KA 4QX3A 3WNNA 2P3YA 4XQDA 1Y7BA 2P34A 2XH6A 3ZXEA 2ADDA 3JD71 3RYPA 5A6XA 4DNYA 3I2IA 1CZSA 1BZWA 1AXKA 1UMHA 1VBC1 3RGBA 4UFHA 2BDRA 4CCJA 1O8PA 2XJPA 3ON7A 3LD8A 3U78A 4DUXA 2B7YA 4UI9L 4UF0A 1JHNA 4IE0A 1A78A 5CG8A 2W68A 1CWPA 2WIIB 4PQ9A 4TTGA 4GWIA 4AFCA 1DLCA 1LNSA 5FZ7A 4YM0A 3WW3A 1VPHA 1V6NA 5AC92 2YHJA 5LA9A 3APBA 1KGYA 2WO1A 1RUE1 1Z78A 1RL3A 3WHUA 2IVJA 2R1BA 5A3TA 2W1SA 4YZ5A 2D40A 3BKZA 4A7YA 2ENRA 3BU7A 3ZFEA 1AR63 2W39A 4SBVA 5IW0A 4O9GA 4YZ2A 2JD4A 3MIBA 3P3PA 4LKSA 5B4XA 3ME2A 3I3MA 5A32B 3SNMA 3FMGA 4E9KA 2HBUA 2JDNA 2WNUA 3CDZB 4ZY9A 5I0TA 4Y3OA 3VKFC 4JZRA 2NP0A 3OY8B 5K8SA 1S0EA 5FP7A 2WWSA 3KLSA 4LMFA 3BI3A 1E5RA 2AEYA 3VBHB 4RGGA 2PMWB 2VPVA 4JQRA 4CP1A 2D6PA 2ET1A 1LECA 4ZS3A 2XBO3 3KVAA 2CGPA 1RVF2 1YQCA 5T55A 3BB6A 3NV4A 2R062 4UYBA 4O65A 3LA7A 4P9LA 2FCTA 1PM4A 5C4WA 2B46X 3DGTA 2E53A 2YBSA 1DLLA 1G9FA 3QLQA 4KWJA 5KR7A 1W6OA 5F6KA 2QQMA 2GALA 3Q8FA 3WDTA 1MQTC 1RUD1 4CA9A 1XQNA 1Y4WA 1C28A 1QOTA 1ULOA 1ND3C 3DKQA 1QOSA 5DQ0A 4JAAA 4LKDA 4A42A 4I0WB 1NX9A 2CGOA 3BPZA 4UFJA 5FYTA 2MNGA 4FPCA 1HB3A 2B9VA 4URTA 3I2KA 2CV6A 2GNBA 3NNJA 2ZX2A 3THDA 1RB8G 3KCYA 2ADEA 3LDRA 4UAPA 4XFGA 1G8WA 4YM2A 1PZ9A 1T6GC 1GWMA 1R1A2 1QKQA 4IEOA 5IVBA 1S2BA 3PVEA 4B7EA 3WVJA 1J84A 1W28A 3D82A 3AVSA 3WP6A 4YVWB 3I8TA 4P9WA 2IC1A 2QKDA 1UX7A 2BYVE 5LATA 3DUIA 1KEXA 3H42B 3ACGA 1EYBA 4P5YA 1FV2A 2R061 4EWAA 3AJZA 1PO12 1M06G 2WNEA 4JQTA 1YHFA 5F5QA 3LZZA 3ES1A 3FHQA 3INAA 4IXLA 1HLCA 2B45X 4M0HA 4XUQA 2RDQA 1Y9MA 2Q1ZB 4MADA 4B8EA 3HD8B 3P5BA 3WXPA 3ITQA 2CY6A 1W6QA 3HQUA 3K4AA 2JE9A 3GBGA 4XFCA 2VC9A 1B35C 1V9U3 3POYA 4QX1A 4C0BA 3N7KA 1LOFA 2ZX3A 1S0BA 1ZZ7A 4QWNA 4DIQA 5FY8A 1SFNA 4QX2A 1KRIA 2ATFA 5DUWA 1R1A1 3EYPA 1L3JA 5IVCA 2QQUA 3IB3A 1ND2B 5LBCA 3ZDSA 1DU3D 1UU5A 2ZEZA 3NAPA 4IW3A 2WZEA 3LOIA 1OPMA 4XE9A 1DHKB 3KSCA 3VHNA 4PLMA 5KHJA 4FPGA 2JG9C 3L9JT 1XYOA 5IVEA 4GMP3 2D44A 2XQXA 2PHWA 4E4HA 1TME3 1PO11 1UOGA 4J25A 5FTTC 3IMMA 4RS5C 2DVDA 3N3HA 4URAA 3FWEA 2BERA 4OZXA 5IVVA 5FZGA 1NAEA 2ZZQA 4N90A 1WGPA 2ARCA 4IEQA 5FP9A 4ZZ8A 5ACA2 5KXDA 5FPVA 1LENA 5K4LA 2GMEA 1RTVA 2VZTA 3H3UA 2VQAA 1PIV2 1GU3A 2A73B 2RS11 3P6BA 4XFFA 2UY9A 5DUUA 2HWE2 4MGKE 3ZSLA 4WM7A 5C4WB 4ES8A 2WQZC 3JUUA 4IGOA 5A7NA 3VLBB 1YQ2A 2VUJA 5FZOB 5F32A 1GMMA 1CAWA 3ZFFA 2WT1A 1DZQA 4QHBA 4TWTA 5A6ZA 1H8VA 1RUG3 3POGA 3WNMA 3AK0A 3DF0A 2X5IA 4AWDA 3Q8AA 1AR83 3H8RA 5FP3A 3PU3A 1VJ2A 1FPN2 1WCKA 3CQOA 4JGYB 4QPGA 2LS6A 1W6NA 2VOWA 2NMNA 1H1AA 2VXJA 1POQA 3PUQA 5BV6A 2G9ZA 1HXS3 5CEHA 5SV5A 4CP9B 3K4ZA 1BK1A 5K0UA 2HWB2 3HIFA 4PLNA 5JDBA 4RR3B 3PIJA 2QJVA 1ZBE3 2YFZA 1RUJ3 2PAKA 3AX4A 3VZJA 4UT5A 4W6WA 1MEC3 5FBZA 2DUPA 2WQ8A 5FLIA 4R4ZA 3N7JA 1MZEA 3Q9OA 3WX5A 1O91A 2PHXA 3PTRB 5H9PA 4A41A 4IERA 1CAUB 4TLFA 1HB4A 2TUNA 2W0XA 1RMU3 3GCXA 5FZ0A 5J1XA 3OD4A 5F3GA 1H9PA 3WUDA 3O0XA 4YARA 5JR2A 3UKNA 4D94A 5JXIA 3WZ1A 3C2UA 4QU1A 1K5JA 1RHI2 1OOPB 1GNHA 1FPN1 2PLV1 3ZYJB 4AXOA 2CDOA 2XL7A 4B1MA 1Y3TA 3NKGA 3ZMOA 3BIWE 1VBC3 2YBPA 5FWJA 5LA2A 1M4WA 2HWB1 4MXVA 4OHYA 4KBZA 1MPXA 2PHTA 4JGZA 4YGBA 2YMZA 4QPIA 2VZVA 2PAEA 2OZ6A 3NNGA 3P3NA 2YUEA 5CADA 5I0DA 2RG4A 1QH7A 2ZHNA 1YFWA 2QCSB 4FVVA 4W50A 4P9YA 1LOCA 3GCWA 3VBHC 3BALA 4OUEA 4YW2A 4L0PA 1QJY2 3TN92 4EN0A 2B4KA 1RUE3 1MVEA 3OCPA 5IK8A 2GNMA 4CXXA 4B4PA 1DYOA 3V64A 1W9YA 3VBOA 1RHI1 4YWAA 4PCRA 4Y5SA 3RNSA 4K3UA 3RI9A 2WZPP 1C1LA 1MACA 5DDJ2 2RS52 1ZZ9A 4DPNA 1CJPA 1U5ZA 1HX6A 1C5IA 1IGOA 4N9IA 3LOBA 2DCTA 4CZSA 1UX6A 5LK7B 2OA2A 3LCPA 1OURA 3VZLA 2X5IB 3OUJA 3GDBA 3ZXFA 5C71A 4Y1YA 2J22A 3C7OA 4R9CA 3NNMA 2PXJA 4NRMA 1IKPA 1GZTA 1W6NB 3PMEA 4XYXA 1EAH2 4ZU5A 5CFDA 1VIWB 1XB9A 4QM8A 1PHMA 1QJX2 3AKRA 2F4LA 3KD4A 3F95A 3ZXAC 4DZGA 3KT7A 3ZSJA 5AC93 4XMAA 1O3SA 1EUTA 5ABJA 4AEMA 4BA6A 1H8TA 2GMMA 2R072 3PJQA 2HEYF 3TN91 2VNOA 5KXEA 1IS3A 3ZKUA 4YGCA 4IEZA 2D97A 4XVHA 1UPSA 1PMHX 3BU0A 5L73A 1TNFA 3DCQA 2J1VA 1UXZA 3GZEA 2VCMA 3RMYA 3WNPA 1GICA 5IVJA 2RS51 5FZCA 2NZ9A 3I59A 1VBB2 3KHCA 1HV0A 3B7MA 3RYRA 3VD7A 4Q0PA 4RGKA 5JUVA 2VMFA 4WVVA 4UW5A 1GZ9A 2WS92 2Z2SB 4LUMA 3Q8BA 1RITA 4NR1A 5GZEA 3HNBM 5F2SA 4BK5A 2ZGKA 3J8F1 2J1EA 4U2AA 1ND2C 2WYFA 1RVF3 1SQ4A 3ABZA 1EPZA 3N9MA 5L9RA 4PJYA 1ULEA 2YFUA 3M2MA 3HVDA 2BVVA 2R063 3TYJA 3ZFEC 1B09A 2LALA 4JRLA 5DAVA 2YPJA 3ZMNA 3C7EA 3O1SA 1OUSA 1N1TA 2R071 4HK9A 4IEPA 2CL2A 4TYSA 3OSDA 4UW3A 4FTSA 3AMMA 2R0FA 2Q8DA 3LF7A 5KXBA 3CU7A 1N1YA 3MICA 2JICA 4QB1A 1VMHA 3OG2A 1LOEA 4Q4X2 4DXTA 4A6OA 1OHFA 1PMIA 1NCQB 4LBJA 4W6XA 5JCTA 4C0HA 3WW4A 1VBB1 4AQ6A 1R1A3 3DYMA 4JDMA 1Z0HA 4IV3A 5T5JA 3FLPA 3OYWA 1ZRCA 5JSRA 5C4WC 2WS91 1J3PA 1VRH2 1EUUA 2C5DA 4ISRA 4N53A 1QGLA 3WNKA 1UQXA 1ACCA 2E7AA 2Y64A 3PVNA 4QXCA 2YC2A 3BYWA 1MVQA 1PO13 1W8ZA 4M3CA 5FO8B 1JS9A 1J1TA 2XJSA 4JTOA 1W9WA 3J4UH 4JGYC 4ONUA 1JYCA 2G19A 2VE1A 5C33A 3KQRA 1GNYA 1YWKA 4WVMB 3V0AB 5A3PA 1IPKA 2P1BA 4FFHA 4UXAA 1AYM1 3VD9A 1L7RA 2WZ8A 5FAXA 1PM7A 3S57A 2E7TA 2J1UA 1OC1A 4OUSA 4RR3C 5D8AB 5IJRA 3RRDA 2E31A 4LT5A 4S2GA 3ZDVA 4QM9A 1O3TA 3IZOA 2XR4A 2Y33A 2C26A 2RE9A 2ZGUA 1XNDA 3J7HA 1A6CA 2IXLA 5FUIA 3KHBA 3FBYA 1VRH1 2BZDA 3UJQA 2BGOA 1C1FA 3ZYGA 4E8CA 2BOJA 2CWSA 1SLTA 3FUQA 3EJKA 2VBBA 1J83A 2GC3A 3HJRA 3IBMA 2RR12 2A71A 2DBIA 4J6GA 5J98B 3SH5A 2J1SA 2NQYA 3O1TA 1OOPC 2JB8A 2O14A 2GC0A 1RINA 1TE1B 4XHBA 2NYYA 1PZ8A 5JXJA 2E32A 5IAVA 2FD8A 4CP0A 5ACA3 3ATGA 1FOD2 3DEMA 4GMP0 5DAWA 3B3QE 4JV4A 5T50A 1GWLA 1SLBA 1PIV3 3I49A 3T0DA 4TZDA 2HWE3 3HBZA 4Y20A 4EN7B 4UFMA 2R7EB 2WUHA 4MGSA 4AE2A 4YFZA 4BXSV 4WBBA 5CA6A 2WZR1 2ZOEB 1HQLA 4RYDA 1GP4A 2JDMA 4PT6A 4YW5A 3WINE 5JOYA 5EJ3A 1R091 3RWNA 5FBJA 3S0MA 3BTYA 1S4CA 2P3KA 3LSDA 4OQ8A 4X6QB 1UOJA 5F2WA 3S30A 1FPN3 1JZ8A 2W47A 3UJOA 4E2GA 5EWSA 5JXGA 1V70A 2RR11 5FLHA 2LW8A 4CUGA 4AQSA 5B4NA 2C4XA 1W3XA 2W87A 4DUWA 4FPKA 4AOCA 3IIIA 5ISLA 5CG9A 5F5CA 4PDWA 2R1DA 3PUSA 1NCRB 3CF6E 3M70A 5GM0A 2OYZA 2A75A 1MQTA 1WMEA 2BBAA 1W3VA 3N9PA 4C8DA 5T5PA 4Q8KA 1ND3A 3CNAA 4D7SA 2JDAA 3O1RA 1SPPA 3EXUA 4B4RA 5T52A 5GLWA 2X5IC 3NKTA 1S0JA 3IDBB 5G05L 2XVLA 3AYCA 1AXYA 1W8FA 4CYDA 2WAAA 5K9YA 1G9BA 2GP3A 2ARAA 2VQTA 5A3NA 4Q4V2 2CNAA 2EICA 1O8SA 1DFQA 1R64A 1YIPA 5F3IA 1RHI3 2O8OA 3C8XA 4COWA 1PVC2 1AR61 2DCYA 2WO3A 2IVIB 4GAZA 3KF3A 1LODA 4XZPA 2WN2A 4FCAA 3SH4A 4BQXA 4Q26A 2QZ3A 2QQNA 3LEMA 1CX4A 4KU7A 2BNMA 3SCGA 4EN9B 1OI6A 4AEJA 4I30A 4P08A 3OGGA 1QIQA 3OPTA 4OCTA 4RA0A 4AHZA 1WMXA 5E16A 1QH6A 1YJKA 2ILMA 3M3QA 1LHUA 2H6CA 1W6MA 2XBO1 3M3OA 4XFAA 4CDXB 5LA1A 5HXMA 1O5LA 4D3WA 2WDBA 5C3QA 4R9BA 1QJY3 5FLJA 3TN93 1O4YA 3N35A 3PMSA 4IETA 1NZIA 3VHOA 1BLZA 1VAVA 4Q4V1 2ZHMA 3IWZA 2W5FA 5L7OA 2AYHA 5H9QA 3VL9A 1LOBA 3WSOA 1CONA 4QAWA 2JG9A 2A1XA 1COV2 3ZYFA 4BU2A 4QQ2A 3T1MA 4UWDA 4QPIC 1CPNA 1H2MA 1GQPA 1HRV2 1ZNPA 4CP2A 5I8TA 5DDJ3 2RS53 1A3KA 4JX0A 3NJXA 4XUTA 2CWMA 2WLQA 2VQUA 2GH8A 1LCLA 1NCQC 1GWKA 3SQOA 3RJ2X 1U5YA 5A80A 4BCUA 1NE6A 1DGWX 1AYN3 1EAH3 2ZZJA 4GH4B 4JTNA 1ZREA 3R0RA 1QJX3 5FYBA 4YM1A 4COZA 1CAXA 5FZ4A 3T1LA 2Y34A 1LU1A 4PHZA 1F5FA 2PELA 5KC5A 2R073 2EAAA 4RL7A 1LR5A 1MS3A 3M3IA 4MHUA 4MGZE 4Z82A 3LIHA 4F83A 1N1VA 1SPPB 2F4PA 2QQLA 4HOOA 1CZVA 4ZU4A 5FZBA 3VBRB 4EQVA 1X8EA 3IDEA 5M0TA 1V9U1 1W03A 2VOTA 4QGNA 1KS5A 1RGSA 5FRAA 3UNPA 1XNCA 1G7YA 1ODNA 1VBB3 3FFQA 4L97A 4S2DA 3PLQA 1JBCA 4P9JA 1SHWB 3NJYA 5D8AC 2GDFA 2JX9A 3HBKA 1LB2A 2WS93 4RHV2 1YEWA 3U4SA 3T4HB 1OLQA 1WCSA 1TMF2 2PHRA 1ZZBA 1OVPA 1RUG2 3CO2A 1Z7S2 2BGCA 1YO8A 5BUVA 4V2VA 3LDKA 2VULA 4GMP1 2CTVA 5FUPA 1HKDA 2AENA 1V6JA 2V4AA 2VAUA 1C8M3 1JH5A 1TME1 4XF3A 3HR9A 1QY4A 4YW7A 4CXYA 5FMCA 3NJVA 4GKXA 1HN0A 5FK7A 2RJ2A 1NY72 2GZWA 4B4QA 5LW9A 1YFYA 4CUAA 2DCJA 3V65A 2WWJA 5LZ6A 2JEMA 1KJLA 1W6MB 4NHLA 3W59A 5CAZA 2PHFA 4Y1XA 2DU0A 4Q4X3 3GNEA 1H2NA 2W1UA 1JUHA 2D6NA 3OGSA 1X8MA 2WYSA 1URXA 1WW5A 3MHZA 2Z79A 4YGDA 4ZXEA 1Y43B 5IT6A 2E33A 3POBA 2VGDA 3POEA 1OQEA 2HLEA 5FPBA 4XCBA 3LQCA 3R4UA 5A32A 5L7OB 3OBZA 4RHV1 1VRH3 2OKXA 4HN0A 4DXSA 5FOBB 2XUMA 3OY8A 1RUG1 1Z7S1 4QU2A 1OBNA 3A0NA 4Z07A 5A1LA 2WA4A 3VBHA 3LPFA 1NOVA 5A1FA 2W94A 3GJAA 2A5ZA 2D3PA 3EQEA 2WO7A 4HETA 1HXS1 4IDZA 4XEZA 4QKNA 5FKBA 3WCRA 2HKXA 1OH4A 1YFXA 2VMHA 4OI2A 2LUWA 5FPLA 4LEJA 1KXGA 3AZVA 2PAMA 4HBNA 4EE2A 2YV8A 4QMAA 5CNAA 1W8OA 2ZX0A 2VUCA 3O7OA 1CAVB 5CU1A 3IMNA 1NCRC 5F5AA 1ZBE1 2D5HA 3RS6A 3FN9A 4IEWA 5FY0A 5JLVA 2ZMKA 3FLTA 4XAEA 1PGW2 3P1IA 2XONA 3B9CA 1CQ9A 4DRRA 1F35A 1I5ZA 1PK6A 5JZGB 1QXRA 1IS4A 3I2JA 2B5HA 1PGL2 3KGZA 5A3LA 4JVAA 5CFCA 1ZBA2 5JOXA 5KHGA 4QB2A 3URFA 3ZLIA 2VNRA 3BIEA 4Y4RA 4IGPA 1S0DA 1RMU1 3D4KA 4RQPA 3B02A 4JDNA 2DCKA 1AX0A 4YVWA 3HNMA 4KG8A 2RR13 3EMRA 4GD4A 3VUOA 3AZYA 3C7FA 1BBT2 1RUNA 2W52A 3H9AA 1X33A 4UOJA 2DU1A 2FDGA 4BWOA 2AR6A 5JSOA 3BUCA 3PJYA 3H0OA 1ULDA 1F31A 4CCNA 4AEKA 4XUNA 5JR7B 2A6WA 5A7PA 3WDYA 1FOD3 2JDZA 2TBVA 4FTBA 5C8WA 5FZDA 1SCSA 3VV1A 1JYIA 5FXXA 1W39A 4ATFA 4F3JA 3WNXA 3VHPA 1NE4A 4YRDA 3CLPA 4LHLA 4AVVA 2J1RA 3RZMA 1PGW1 2E26A 3UGGA 2LTNA 3FC0A 1GUIA 3B5LB 4K6BA 4K1YA 3UETA 5A3OA 1LHOA 1UWWA 4FPHA 1E5HA 3PTYA 4CDXC 3C7HA 2WFF2 2Z5WA 3OEAA 3RZJA 4HL0A 2X29A 3CJXA 3VD5A 1I3HA 1LHWA 1ND2A 1H6XA 4N8MA 4SLIA 5SV8A 4Y1VA 1V00A 4Z1VA 3CMGA 3MGUA 1DDLA 3N36A 4Q2FA 5A7OA 5BNOB 3SMHA 1GP6A 3OGJA 4KGQA 1H9WA 4XQWA 1YQ8A 4BE3A 2Q8EA 4QQHA 1UZZA 2DV9A 1YUDA 1I9RA 4BMEA 3FFZA 1WMFA 3U11A 4DS0A 1QWRA 3T08A 1XSRA 3H50A 1K12A 1LESA 3ACLA 4Q29A 4CCMA 4DINB 1QJU2 2R042 4AFBA 5J7MA 2ZCWA 2HWD2 3OBTA 3VZKA 1W8NA 1UZWA 4XPVA 3BVCA 4M4PA 4Q0SA 4GH4C 4QX5A 1JZ5A 3RZKA 1GNZA 1ULPA 2DYCA 3KF5A 3OGRA 4A45A 1GZWB 1RUC2 5AC91 4I01A 4H2AA 4PDWC 2KD7A 4NRPA 4Q4V3 2EXKA 3FX3A 2BFUS 2IWGB 1ZZ6A 2FZ1A 2ZABA 2NMOA 3LFMA 5FZOA 4UFKA 5A7QA 1UNBA 2GP5A 4CU6A 1PVC3 3HPNA 1OLME 2PFWA 4LOSA 3WDWA 1PK6B 1VE0A 3PHMA 3VBRC 5AVAA 3VN4A 1JN2P 3AKQA 4JGYA 2FMDA 5CFCB 4NHYA 3QH6A 2IXJA 2DVGA 4RQPB 4QDRA 2VZQA 4CP9A 1NZCA 4E2SA 2DWRA 3WF0A 3K51A 3AP4A 2V5DA 4OYUA 2QQPA 4OZOA 2R041 4RR3A 1TVGA 1C4RA 1VP6A 1YRZA 1RVF1 1DG6A 4RD7A 1UAIA 2ZXQA 5HCBA 3IM0A 2CYFA 2MEV2 5AFEA 5FOJB 2W1QA 4AAPA 1RUC1 3LFIA 4V1PA 3T4VA 4COYA 4XUPA 5JOWA 1CAUA 1FV3A 4B3NA 1COV3 3ZYRA 1X50A 1QNWA 2P4EA 5JPMB 3N9LA 1G6NA 1HRV3 3LPGA 4IL7A 3V56A 2H0BA 2XB6C 4I3GA 4XDPA 4DMIA 1OOPA 4ZZ5A 3KVBA 3NV2A 3E6CC 3SKJE 4CEWB 1AR92 2BP6A 3SEPA 1YQ5A 4FFFA 4OI4A 5F39A 1Q8QA 4Y1UA 3RMXA 4E27A 2KR2A 3VB9A 2LROA 2VO5A 4N43B 4MSVA 1DF0A 3PIGA 1ODMA 3PUHA 4DY3A 5TSWA 5L7OC 1SLLA 1OQ1A 4XBQA 4XETA 3U0ZA 2XVGA 1JTZX 2YBKA 1E57A 2XVKA 3MW2A 3HQXA 1W2UA 2MEV1 1W0OA 4ASKA 4JDOA 4E4SA 2FDFA 3J7LA 4LKFA 2A6ZA 1BYHA 3AP6A 3AMPA 1DQ4A 2XQRA 1KS4A 4CCCA 5EXOA 3D0SA 2VMIA 1ZRRA 1DGLA 4HK8A 4A44A 3E5QA 2GNDA 2HWF2 2P37A 1JYWA 1MS5A 3E6DA 3M3EA 4KWLA 3ZFGB 2B39A 1WW6A 4C1XA 3WQ1A 3F2ZA 1HB1A 1VR3A 2RS32 4XXAA 4ZPIA 1JODA 1W8UA 2XJVA 2Y6GA 5GZGA 5KC6A 4RHV3 1DGRA 1OA2A 2WT2A 5CZKA 5BNNA 1H1MA 5JZGC 5LA0A 1TMF3 2IXCA 4PBPA 1Z7S3 5DAXA 4TXWA 4RSUA 4BH9A 1CJDA 4FOQA 4PIZA 4LBMA 4HXCA 1DGWA 1W6PB 2V73A 4NROA 1ONAA 2F17A 3AL5A 4FPJA 4OMDA 4AFDA 2UU8A 2O8QA 4FPEA 1D4VB 4XBLA 4YW3A 5DZGA 5FZ6A 1UF2C 2NM1A 4XDQA 1SZBA 3ORJA 5FJKA 3VBUB 2DVFA 2UWCA 5I8SA 3JB4C 2WN3A 2WSVA 4Y24A 1Q3EA 5GJ6A 3VZNA 5ACA1 4NIIA 3OUHA 1CGPA 3LWCA 1PIV1 1ENRA 3NO8A 4QXBA 2VOKA 5C3SA 3USSA 4BQ2A 5J36A 2HWE1 1AR72 4LO7A 1GFF2 1UKRA 4Z8BA 2I07B 3I2GA 1K5MA 4B7KA 1VLNA 2YC4A 4FXKB 1BKZA 4AVTA 4YG3A 4LO5B 5FPUA 3SITA 2AUYA 3T2QA 5LRSA 4XABA 1CD3G 1WW7A 1XE0A 5FJHA 3CEWA 4XILA 5CKNA 4EN6B 4YZ1A 2QVSB 3WQ0A 2HBTA 3GYDA 3WDXA 1XE8A 3ZR6A 1BJQA 2CU5A 3ZX7A 3N9QA 4IEVA 3GXUA 3ROUA 4COUA 5A6YA 4XF1A 4LOTA 2VY0A 4EWEA 2JE8A 5DN2A 5HCFA 3D5OA 1PX4A 1QOOA 3WG4A 4CEYB 4D69A 3I4IA 1MR5A 1LHNA 3JQWA 4YG0A 5IK7A 3K75B 5FDBA 1BQPA 3SHRA 2W1WA 2OQ6A 3G6JB 5D2AA 1GYKA 2P17A 3AMNA 5IVFA 4CPBD 2BFUL 3N7MA 2SBAA 3FZ3A 1D0GA 1HQNA 2VMEA 1NCQA 4N7IA 4OI1A 1GV9A 1ZBA3 1AJKA 5KWRA 1NT0A 3GZAA 3IDCB 1W2OA 1UOBA 2P5BA 4JKKA 5C7GA 1UY4A 5FMOL 5FYSA 2EVXA 4UFIA 2FBEA 4YZ4A 1VBA2 3DN7A 3OTFA 5CBLA 1W99A 1BBT3 5DUVA 3MIFA 3POWA 4QQPA 5GLTA 1UPIA 3VBSB 3ZPOA 4HKLA 4Z2AA 4GWNA 4LHKA 3ST7A 1WLTA 4BHPA 5BNNB 4DEVA 5DZFA 1PK6C 4GJYA 1ULGA 4LO4B 3AYAA 4BOWA 4H55A 5D21A 4DY5A 4KWKA 4ZU7A 2ZGNA 3T0BA 5CFCC 5BY5A 4HLTA 5FPZA 2JECA 4RQPC 4AW7A 1AYN2 1TQ5A 3QH7A 4AG4A 4WVMA 4FAGA 2WABA 3V0AA 1DGRN 1S0FA 4YVWC 5FZHA 5FXWA 2VZ3A 5D8AA 1SBDA 4OI0A 5LY2A 1QJY1 1ZRIA 2R49A 2GNTA 2WFF3 2GU9A 4NRQA 1ZZCA 4FP2A 2G9GA 3CZJA 1EY2A 4GB32 4LA2A 2Y6LA 1PO22 2VZOA 5EQUA 1GSLA 1NQDA 1DZTA 1H30A 1QF3A 1UXXX 1UZ0A 2BW8A 4BPZA 2E51A 5JWPA 2FDHA 2DURA 2I74A 4FI9A 1YJLA 4CXWA 4KG0A 1K5MB 2FCUA 5FO7B 1W8WA 5DDJ1 4LQRA 4IE7A 4E4DX 3HT2A 4IE6A 2ZGOA 3FE5A 3AYDA 5FP8A 5AVPA 2WNVA 5FREA 1US2A 3AJYA 1TZOA 4RFT0 3THCA 4AGRA 1AX1A 3T2TA 3O1PA 4INDA 1US3A 4CDQB 1ZRFA 4A4AA 2D7FA 4AFMA 1QJU3 2E6VA 4V2WA 2R043 4CEWC 1LGCA 5FY9A 2FZ2A 4L8QA 1AYN1 1EAH1 2HWD3 2BTVC 2OX0A 2ZX1A 4CU8A 5C8CA 2HWC2 4N43C 3WHTA 1QJX1 2J1TA 3W20A 4MV2A 4YLZA 1C8M2 2VZUA 1RUC3 3S6PA 1OKQA 1WD3A 1YI9A 3AFGA 4CCKA 2IFWA 2WO2A 2YU1A 3BCWA 3GZUC 2ORZA 4QT6A 4LBQA 3POJA 2OXBA 1PO21 2JB4A 3V0BA 4A3XA 1KFXL 3OBRA 5HPOA 2RDNA 5KHIA 3AL6A 5I91A 1UU6A 3VGIA 3ECQA 1GBGA 1HDKA 1JW6A 1UCXA 3DPRA 1N1SA 2R0HA 4Q0UA 5FZFA 4CDUB 2RJKA 5J48A 1W8HA 2ZHKA 5I0UA 5LK5A 3R6SA 3ZFGC 1FMD2 2J1AA 4GIQA 4ZXKA 4CU7A 2C24A 3E5XA 1LEDA 5A70A 4AHWA 5F9TA 4YM3A 3ZVXA 4GWJA 1NCRA 4CPBA 4ES9A 1CX1A 1NLQA 3GZTB 4OUMA 2K46A 3RVHA 3D6EA 4XAAA 2YU2A 1RUOA 3ZN4A 1F5JA 4IQPA 4FTEA 5JI7A 2MEV3 2PHDA 3SLIA 1C8M1 4ASLA 2DUQA 4Q5OA 1JOJA 5FYMA 1UY2A 2VZPA 2XJRA 3K46A 1IQAA 3OF1A 3SEEA 4BMBA 1BEV2 3A22A 3BTAA 2NLRA 4WV8A 4XHXA 1EV12 1RJ7A 4Q1RA 1K42A 3VBUC 2XLGA 1PMJX 5FZLA 4Q4X1 5DUXA 5DABA 5LWBA 2D93A 4XCAA 1IG0A 1RUH2 1AR93 3T09A 5FPXA 2OUJA 4MGYE 2ZGRA 3UKVA 2WQ4A 5CB7A 2UYAA 3NQHA 3K2OA 3MIEA 4K40A 4YZ3A 3RJRA 4DXZA 3LEIA 4F7ZA 1RJ8A 4XF4A 3AP7A 4YSFA 2G9FA 3VBFB 3FJSA 3WQBA 2WNVB 2WINB 4CDXA 1FI2A 1W2AX 5HV4A 2EXIA 4CSWA 1BCXA 2QQVA 1XNTA 3ZSMA 1BEV1 3HNYM 2PQQA 2ZMLA 3JZVA 3VKLA 2P2KA 3MIHA 1EV11 2HWF3 3R4SA 3SC7X 4EJRA 5C8CB 1KDKA 2K2SA 4Q4Y2 4YYOA 2D6OX 4UFLA 1TEIA 4Y22B 4MH0E 4P02B 1XYPA 4GJZA 1GR3A 1S2EA 2ZGQA 2RS33 2R30A 4CEYC 4ET7A 4EYUA 5J96B 3H1MA 4IV1B 1RUH1 4LHNA 4O61A 4LBQB 1Q8OA 2XLFA 5IK4A 4LBKA 4Y1ZA 1SFYA 4LE3A 4EZHA 3V0BB 3BN6A 3M8LA 2Q5TA 2ZJCA 5C3OA 4OHXA 1NUKA 3ILFA 3PUIA 1Q8SA 5GLVA 1YYNA 1LGNA 3WCSA 4AHYA 4LLOA 1DIWA 2WAOA 3DPRB 1MZFA 2VU9A 3ZXJA 3ES4A 3E5UA 1OFSA 4CVUA 4GH4A 4BQ1A 3SH3A 1XE7A 3PUAA 1WA6X 3R05A 5T3NA 2VZ1A 4FAHA 5A33A 3AYEA 2XJUA 5FZ8A 4FPOB 3TBDA 1RUF2 1WD4A 3VBSC 2GAUA 2W95A 2XPJA 1ST8A 1KQRA 1FOD1 4Q0QA 3N4MA 5BNNC 1WCQA 5FQ0B 1STMA 3MIGA 4PI0A 2WBKA 2IUWA 3IPVA 2DDUA 4PIYA 2WRAA 2R16A 3I3DA 4MLOA 1X9PA 1AR73 3VBRA 4XW3A 4D7TA 4DB5A 4OULA 4HZFA 4MGIE 4CUBA 4Y4YA 2JG8B 5T5LA 5C5TA 1DZRA 3OB8A 2VCAA 2YC0A 4NPLA 5H9SA 3WDUA 3MYXA 4TLGA 3VKMA 4DRVA 3WW2A 4KBBA 2FHRA 1POV1 3LEGA 1HQWA 1IG3A 1G9DA 2D98A 1LJ7A 1FT9A 4LK7A 3BODA 3LA3A 4H14A 3WR0A 4HMZA 2P6CA 4FT8A 2K9ZA 3KV5A 4D6QA 1F4HA 3GM8A 3TEXA 4GULA 2X09A 5FIXA 2EALA 1F9KA 4OQ9A 4K8RB 2JDYA 3VZMA 1K5MC 2RM22 4XURA 1F2NA 1HN1A 5L36A 3ILRA 1QDOA 2VTFA 1E5SA 1UZYA 2MHFA 2VECA 2ZMNA 2PQSA 2YG0A 2A3YA 2FQPA 1RUI2 4GQ7A 4Q1PA 3HWJA 1NA1B 1ZM1A 2VG9A 5GALA 4CDQC 1XPWA 2CSGA 2Z4FA 4BM8A 1FYUA 1FAYA 1QJEA 5FZEA 3IIAA 4YW4A 1GP5A 5FCCA 5F1RA 2E7QA 2P6HA 3U75A 2YGMA 4Q8LA 2AEZA 1MS4A 5FMDA 4YG6A 1LU2A 2XHNA 5FWEA 5FZIA 2VZRA 1UIKA 1VBA3 1SBEA 1WBFA 4L99A 1PVC1 3MDPA 1R082 3RDIA 2W46A 2DCZA 1VBE2 4Y26A 3ZN5A 3TEWA 1O4ZA 4TN7A 4D6SA 2B8MA 1N3PA 1KDMA 2RM21 2VXRA 4FPFA 2EIGA 4AI8A 4BJ0A 2X8KA 4A2UA 4CDUC 1AHSA 4AQTA 5FY5A 4DOUA 2ZEXA 1X7NA 4H7LA 5EV7A 1PNFA 3TNPB 4Q4W2 3CJIA 1IZ3A 4AZZA 1ZVFA 2OPWA 1O7FA 5GLUA 1CAVA 3E6BA 3USUB 1UO9A 1U12A 1YFUA 1O3QA 3O12A 3HEIA 5ANQA 4P9IA 2JIJA 3Q8CA 5A33B 3A23A 3NRUA 3JBG2 3LAGA 1XXNA 4MYEA 1W90A 1PVXA 2EA7A 3ZXDA 1AL0G 4LK6A 2ZGPA 4NPRA 5JZGA 4GB33 4KL1A 5EZWA 1PO23 5BNPB 1Q8PA 1WBLA 2A7AA 3IPVB 2D6MA 1GOGA 3RPQA 4QKBA 1AUYA 2QQIA 1COV1 3O0WA 1OD5A 1YNAA 4FPLA 4LO6B 4PI2A 2Q8CA 5A6QA 1HRV1 3CKHA 1HRI2 2GN7A 5DG1A 1UMZA 3MBWA
chains in the Genus database with same CATH topology
4M4PA 3WF3A 1JZ5A 5DMYA 3OGRA 1ULPA 4A45A 3WEZA 4AAXA 3U37A 1BHGA 2KD7A 5LA2A 5IHRA 1XC6A 1MPXA 1UY0A 3AC0A 4PQQA 4CU6A 3LE0A 2W92A 3HPNA 2VZVA 3NNGA 2VR4A 5I0DA 4W50A 3MV11 4OUEA 3FHAA 4L0PA 5EIYB 4QDRA 2VZQA 2B4KA 3WF0A 2VMDA 4PF1A 4OYUA 2V5DA 4OZOA 1DYOA 1TVGA 3EB7A 3I2HA 4CU9A 2ZXQA 3OEBA 3ZM8A 2ID4A 2W1QA 3CIHA 1XNAA 2ZEWA 4XUPA 2XOMA 3WF1A 5C71A 3GDBA 2J22A 3C7OA 2C9KA 1WKYA 4BK4A 3LPGA 3K77A 1RYYA 4LHSA 4ZZ5A 2JKXA 2EIDA 1P8JA 3HN3A 3SKJE 3SEPA 1K45A 1EUTA 3MUY1 3W5MA 2VO5A 4HG6B 3FL7A 3GGLA 3PUHA 2X10A 4MGQA 4XVHA 2W3JA 3VD4A 1PMHX 5JXHA 2J1VA 1UXZA 3WNPA 2ORXA 3VD7A 5C70A 5JUVA 2VMFA 1SG3A 3DECA 4A44A 4BK5A 1JYWA 3HNBM 4MO3M 2J1EA 3C7GA 3ABZA 3F2ZA 2Y8KA 2YFUA 1JZ7A 5IYYA 3VD3A 3ETPA 4JKMA 4QDQA 2Y6GA 3A21A 3JXSA 1JZ4A 3MUZ1 3C7EA 1TG7A 1DP0A 3D3AA 5CZKA 5LA0A 1OD3A 4TXWA 4RN5A 1W0NA 4DXRA 4QB1A 3OG2A 4DXTA 4ARXA 4A6OA 4OMDA 2VL4A 3MO4A 3DYMA 1PX3A 2WN3A 4CUCA 1EUUA 1W9SA 3WNKA 2Y64A 1JI6A 2YC2A 3I2GA 1UY1A 2Y6JA 4W4ZA 2YC4A 1W9WA 3VDCA 1JZ2A 5JMOA 1GNYA 2VM9A 3T2QA 1OT5A 5G04L 3VD9A 1L7RA 2WZ8A 4YPJA 2J1UA 5IJRA 4DUVA 1OF4A 1GOFA 2E31A 1F4AA 3J7HA 2C26A 3GXUA 3OBAA 5FUIA 2JE8A 4LPLA 1H6YA 5DN2A 3WF2A 1PX4A 2BZDA 2BGOA 1JU4A 3A7QA 3K75B 4E8CA 1UMIA 2W1WA 5IFPA 1JU3A 3HJRA 1J83A 4DEQA 4M4RA 2J1SA 2VMEA 3IAPA 3IAQA 5JXJA 2E32A 4JKKA 5C7GA 1UY4A 3ACFA 2HYXA 3IDAA 2VMCA 3T0DA 1W99A 3WNOA 3LEKA 3I3BA 2R7EB 2WUHA 2YB7A 4W8JA 4MGSA 4P00B 4Z2AA 1GOHA 4BXSV 4D8MA 1I5PA 2VZSA 4DEVA 4RYDA 4GZ9A 4PT6A 4OMCA 3T0BA 2V4VA 4AG4A 4QDSA 5CYYA 2EIEA 2W47A 2WABA 4JKLA 5JXGA 1JZ8A 2J7MA 2CDPA 2VZ3A 2LW8A 5B4NA 2C4XA 2W87A 4DUWA 3IIIA 5DPNA 1JHJA 4IUGA 4E8DA 3CZJA 2Y6LA 2BBAA 2QBXA 2VZOA 1UXXX 1UZ0A 2JDAA 4FI9A 2V72A 5G05L 4LQRA 2RV9A 3I2FA 4KMQA 3W5NA 1L7QA 3WNLA 3THCA 4QX0A 2WAAA 1US2A 3BGAA 4JHZA 5A1AA 5EJZB 2VQTA 1US3A 4A4AA 4KWUA 2EICA 1O8SA 1R64A 3T2OA 3SKVA 2ZEYA 3C8XA 4CU8A 2WO3A 1NKGA 2Y6HA 5EJ1B 2J1TA 1UYYA 2VZUA 1JZ6A 2WN2A 2WO2A 2ORZA 2QQNA 3K4DA 5HPOA 4P08A 2JD9A 2QQOA 2Y6KA 4QX3A 3WNNA 3ECQA 5LA1A 2W9XA 5HXMA 2QQJA 2WDBA 2J1AA 3I2IA 4CU7A 1CZSA 1UMHA 4GWJA 1CX1A 1O8PA 2W5FA 3WSOA 4QAWA 4DUXA 4UI9L 1GQPA 4TTGA 4GWIA 1DLCA 1LNSA 3NJXA 4JX0A 4XUTA 3UESA 1UY2A 2VZPA 3K46A 3SEEA 1JZ3A 2VQUA 3A22A 1CZTA 3VDAA 1K3IA 1KGYA 2WO1A 1K42A 2W1SA 1PMJX 3OGVA 4LKSA 5B4XA 1CIYA 3T09A 2BGPA 3CDZB 3NQHA 4ZY9A 1T2XA 3LEIA 3VDBA 2QQLA 1CZVA 4KI5M 2VOTA 1SDDB 3WQBA 1UYZA 3UNPA 1SHWB 1XNTA 3HNYM 2QQMA 4A42A 1ULOA 4P02B 5DQ0A 4ARYA 1NX9A 2VCBA 3DYPA 4ET7A 2B9VA 3I2KA 1IQDC 3THDA 1JYXA 2RVAA 4UAPA 3NJVA 3BN6A 2RJ2A 1UY3A 5F7UA 1NUKA 3PUIA 3E1F1 2DCJA 4CUAA 1J84A 2WAOA 3T2PA 1JYNA 1UX7A 4CVUA 2W1UA 3MV01 3OGSA 1KEXA 3ACGA 2WYSA 2X05A 4P5YA 4ZXEA 2VZ1A 2E33A 1UYXA 1JYVA 3FHQA 4XUQA 2HLEA 3LQCA 2W95A 3ACHA 4MADA 2OKXA 4DXSA 1WCQA 4A3ZA 3K4AA 2WBKA 2VJXA 2DDUA 3I3DA 2VC9A 4QX1A 2VCCA 3LPFA 3T0AA 4CUBA 2W94A 4QX2A 3OB8A 2VCAA 4QB6A 1OH4A 3EYPA 1OF3A 3LEGA 4MOAA 3ACIA 3IB3A 1W8OA 4D0QA 2ZEZA 2WZEA 3FN9A 1F4HA 3GM8A 2X09A 2XQXA 3P1IA 2XONA 3CZUA 3I2JA 4XURA 2BERA 1HN1A 4QB2A 1NAEA 2VTFA 2PQSA 2YG0A 4ZZ8A 4QPWA 1O59A 2DCKA 2VZTA 1XPWA 3HNMA 1GU3A 3P6BA 2Z4FA 5IFTA 3C7FA 2QQKA 4UOJA 2L9LA 1YQ2A 4XUOA 4XUNA 1GMMA 2XHNA 2VZRA 3WF4A 3WNMA 2W46A 3HOBA 3CQOA 2J1RA 2LS6A 2E26A 1GUIA 3UETA 1UWWA 4BJ0A 3K4ZA 3C7HA 3OEAA 2ZEXA 3I97A 3VD5A 1D7PM 1H6XA 1W9TA 2YFZA 3CMGA 3HEIA 2WQ8A 2W91A 3A23A 3NRUA 4A41A 3I3EA 3T08A 2EIBA 1K12A 1GOGA 3DYOA 5J1XA 2QQIA 4XZUG 5JXIA 5JR2A 3CKHA 4BDVB 5LCWL 1W8NA 3MBWA 2CDOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M4P A;  3WF3 A;  1JZ5 A;  5DMY A;  3OGR A;  1ULP A;  4A45 A;  3WEZ A;  4AAX A;  3U37 A;  1BHG A;  2KD7 A;  5LA2 A;  5IHR A;  1XC6 A;  1MPX A;  1UY0 A;  3AC0 A;  4PQQ A;  4CU6 A;  3LE0 A;  2W92 A;  3HPN A;  2VZV A;  3NNG A;  2VR4 A;  5I0D A;  4W50 A;  3MV1 1;  4OUE A;  3FHA A;  4L0P A;  5EIY B;  4QDR A;  2VZQ A;  2B4K A;  3WF0 A;  2VMD A;  4PF1 A;  4OYU A;  2V5D A;  4OZO A;  1DYO A;  1TVG A;  3EB7 A;  3I2H A;  4CU9 A;  2ZXQ A;  3OEB A;  3ZM8 A;  2ID4 A;  2W1Q A;  3CIH A;  1XNA A;  2ZEW A;  4XUP A;  2XOM A;  3WF1 A;  5C71 A;  3GDB A;  2J22 A;  3C7O A;  2C9K A;  1WKY A;  4BK4 A;  3LPG A;  3K77 A;  1RYY A;  4LHS A;  4ZZ5 A;  2JKX A;  2EID A;  1P8J A;  3HN3 A;  3SKJ E;  3SEP A;  1K45 A;  1EUT A;  3MUY 1;  3W5M A;  2VO5 A;  4HG6 B;  3FL7 A;  3GGL A;  3PUH A;  2X10 A;  4MGQ A;  4XVH A;  2W3J A;  3VD4 A;  1PMH X;  5JXH A;  2J1V A;  1UXZ A;  3WNP A;  2ORX A;  3VD7 A;  5C70 A;  5JUV A;  2VMF A;  1SG3 A;  3DEC A;  4A44 A;  4BK5 A;  1JYW A;  3HNB M;  4MO3 M;  2J1E A;  3C7G A;  3ABZ A;  3F2Z A;  2Y8K A;  2YFU A;  1JZ7 A;  5IYY A;  3VD3 A;  3ETP A;  4JKM A;  4QDQ A;  2Y6G A;  3A21 A;  3JXS A;  1JZ4 A;  3MUZ 1;  3C7E A;  1TG7 A;  1DP0 A;  3D3A A;  5CZK A;  5LA0 A;  1OD3 A;  4TXW A;  4RN5 A;  1W0N A;  4DXR A;  4QB1 A;  3OG2 A;  4DXT A;  4ARX A;  4A6O A;  4OMD A;  2VL4 A;  3MO4 A;  3DYM A;  1PX3 A;  2WN3 A;  4CUC A;  1EUU A;  1W9S A;  3WNK A;  2Y64 A;  1JI6 A;  2YC2 A;  3I2G A;  1UY1 A;  2Y6J A;  4W4Z A;  2YC4 A;  1W9W A;  3VDC A;  1JZ2 A;  5JMO A;  1GNY A;  2VM9 A;  3T2Q A;  1OT5 A;  5G04 L;  3VD9 A;  1L7R A;  2WZ8 A;  4YPJ A;  2J1U A;  5IJR A;  4DUV A;  1OF4 A;  1GOF A;  2E31 A;  1F4A A;  3J7H A;  2C26 A;  3GXU A;  3OBA A;  5FUI A;  2JE8 A;  4LPL A;  1H6Y A;  5DN2 A;  3WF2 A;  1PX4 A;  2BZD A;  2BGO A;  1JU4 A;  3A7Q A;  3K75 B;  4E8C A;  1UMI A;  2W1W A;  5IFP A;  1JU3 A;  3HJR A;  1J83 A;  4DEQ A;  4M4R A;  2J1S A;  2VME A;  3IAP A;  3IAQ A;  5JXJ A;  2E32 A;  4JKK A;  5C7G A;  1UY4 A;  3ACF A;  2HYX A;  3IDA A;  2VMC A;  3T0D A;  1W99 A;  3WNO A;  3LEK A;  3I3B A;  2R7E B;  2WUH A;  2YB7 A;  4W8J A;  4MGS A;  4P00 B;  4Z2A A;  1GOH A;  4BXS V;  4D8M A;  1I5P A;  2VZS A;  4DEV A;  4RYD A;  4GZ9 A;  4PT6 A;  4OMC A;  3T0B A;  2V4V A;  4AG4 A;  4QDS A;  5CYY A;  2EIE A;  2W47 A;  2WAB A;  4JKL A;  5JXG A;  1JZ8 A;  2J7M A;  2CDP A;  2VZ3 A;  2LW8 A;  5B4N A;  2C4X A;  2W87 A;  4DUW A;  3III A;  5DPN A;  1JHJ A;  4IUG A;  4E8D A;  3CZJ A;  2Y6L A;  2BBA A;  2QBX A;  2VZO A;  1UXX X;  1UZ0 A;  2JDA A;  4FI9 A;  2V72 A;  5G05 L;  4LQR A;  2RV9 A;  3I2F A;  4KMQ A;  3W5N A;  1L7Q A;  3WNL A;  3THC A;  4QX0 A;  2WAA A;  1US2 A;  3BGA A;  4JHZ A;  5A1A A;  5EJZ B;  2VQT A;  1US3 A;  4A4A A;  4KWU A;  2EIC A;  1O8S A;  1R64 A;  3T2O A;  3SKV A;  2ZEY A;  3C8X A;  4CU8 A;  2WO3 A;  1NKG A;  2Y6H A;  5EJ1 B;  2J1T A;  1UYY A;  2VZU A;  1JZ6 A;  2WN2 A;  2WO2 A;  2ORZ A;  2QQN A;  3K4D A;  5HPO A;  4P08 A;  2JD9 A;  2QQO A;  2Y6K A;  4QX3 A;  3WNN A;  3ECQ A;  5LA1 A;  2W9X A;  5HXM A;  2QQJ A;  2WDB A;  2J1A A;  3I2I A;  4CU7 A;  1CZS A;  1UMH A;  4GWJ A;  1CX1 A;  1O8P A;  2W5F A;  3WSO A;  4QAW A;  4DUX A;  4UI9 L;  1GQP A;  4TTG A;  4GWI A;  1DLC A;  1LNS A;  3NJX A;  4JX0 A;  4XUT A;  3UES A;  1UY2 A;  2VZP A;  3K46 A;  3SEE A;  1JZ3 A;  2VQU A;  3A22 A;  1CZT A;  3VDA A;  1K3I A;  1KGY A;  2WO1 A;  1K42 A;  2W1S A;  1PMJ X;  3OGV A;  4LKS A;  5B4X A;  1CIY A;  3T09 A;  2BGP A;  3CDZ B;  3NQH A;  4ZY9 A;  1T2X A;  3LEI A;  3VDB A;  2QQL A;  1CZV A;  4KI5 M;  2VOT A;  1SDD B;  3WQB A;  1UYZ A;  3UNP A;  1SHW B;  1XNT A;  3HNY M;  2QQM A;  4A42 A;  1ULO A;  4P02 B;  5DQ0 A;  4ARY A;  1NX9 A;  2VCB A;  3DYP A;  4ET7 A;  2B9V A;  3I2K A;  1IQD C;  3THD A;  1JYX A;  2RVA A;  4UAP A;  3NJV A;  3BN6 A;  2RJ2 A;  1UY3 A;  5F7U A;  1NUK A;  3PUI A;  3E1F 1;  2DCJ A;  4CUA A;  1J84 A;  2WAO A;  3T2P A;  1JYN A;  1UX7 A;  4CVU A;  2W1U A;  3MV0 1;  3OGS A;  1KEX A;  3ACG A;  2WYS A;  2X05 A;  4P5Y A;  4ZXE A;  2VZ1 A;  2E33 A;  1UYX A;  1JYV A;  3FHQ A;  4XUQ A;  2HLE A;  3LQC A;  2W95 A;  3ACH A;  4MAD A;  2OKX A;  4DXS A;  1WCQ A;  4A3Z A;  3K4A A;  2WBK A;  2VJX A;  2DDU A;  3I3D A;  2VC9 A;  4QX1 A;  2VCC A;  3LPF A;  3T0A A;  4CUB A;  2W94 A;  4QX2 A;  3OB8 A;  2VCA A;  4QB6 A;  1OH4 A;  3EYP A;  1OF3 A;  3LEG A;  4MOA A;  3ACI A;  3IB3 A;  1W8O A;  4D0Q A;  2ZEZ A;  2WZE A;  3FN9 A;  1F4H A;  3GM8 A;  2X09 A;  2XQX A;  3P1I A;  2XON A;  3CZU A;  3I2J A;  4XUR A;  2BER A;  1HN1 A;  4QB2 A;  1NAE A;  2VTF A;  2PQS A;  2YG0 A;  4ZZ8 A;  4QPW A;  1O59 A;  2DCK A;  2VZT A;  1XPW A;  3HNM A;  1GU3 A;  3P6B A;  2Z4F A;  5IFT A;  3C7F A;  2QQK A;  4UOJ A;  2L9L A;  1YQ2 A;  4XUO A;  4XUN A;  1GMM A;  2XHN A;  2VZR A;  3WF4 A;  3WNM A;  2W46 A;  3HOB A;  3CQO A;  2J1R A;  2LS6 A;  2E26 A;  1GUI A;  3UET A;  1UWW A;  4BJ0 A;  3K4Z A;  3C7H A;  3OEA A;  2ZEX A;  3I97 A;  3VD5 A;  1D7P M;  1H6X A;  1W9T A;  2YFZ A;  3CMG A;  3HEI A;  2WQ8 A;  2W91 A;  3A23 A;  3NRU A;  4A41 A;  3I3E A;  3T08 A;  2EIB A;  1K12 A;  1GOG A;  3DYO A;  5J1X A;  2QQI A;  4XZU G;  5JXI A;  5JR2 A;  3CKH A;  4BDV B;  5LCW L;  1W8N A;  3MBW A;  2CDO A; 
#chains in the Genus database with same CATH topology
 2W08 A;  5FY7 A;  5JSP A;  2YGL A;  3WF3 A;  4NO4 A;  3NWK A;  3MPP G;  4BIF A;  3VKO A;  5FY1 A;  3WEZ A;  4QXH A;  1BHG A;  4I3P A;  5JAX A;  1J59 A;  1VMF A;  3MF6 A;  4XIO A;  4AL9 A;  1XC6 A;  2I2S A;  4Q4W 1;  4X8P A;  3AC0 A;  4PQQ A;  1OA4 A;  2HWC 3;  2W92 A;  2Z42 A;  3LE0 A;  2VR4 A;  5F6L B;  2EF6 A;  2J42 A;  3N9N A;  3T30 A;  1NG0 A;  4HVO A;  4BQ3 A;  1IS6 A;  3MV1 1;  1ENQ A;  3VBF C;  3UGH A;  4CTE A;  1UKG A;  5HXV A;  3AKT A;  4I2O A;  3FHA A;  2WNV C;  5EIY B;  2IZW A;  4S2F A;  5F8P A;  5C5U A;  2HYK A;  1FNY A;  3K3N A;  1DQ5 A;  4X6R B;  5JMC A;  2VMD A;  4PF1 A;  2Q8O A;  5FPA A;  5KBF A;  1XOY A;  5EPA A;  4AI9 A;  1E5I A;  1LKN A;  4BQ5 A;  1V6K A;  3K3O A;  1F15 A;  5C8C C;  5JPN B;  3EB7 A;  2BUK A;  1NLS A;  5BNO A;  1FMD 3;  3HMY A;  5EFU A;  1LGB A;  3LGR A;  3OEB A;  3ZN6 A;  3NV1 A;  3I7D A;  4BQY A;  3CIH A;  2P3I A;  2ZEW A;  4GXL A;  3U4X A;  4QPY A;  1S0C A;  4IV1 C;  3WF1 A;  1TMF 1;  1FXZ A;  5FZA A;  2CAV A;  1W8T A;  2C9K A;  4QGM A;  4LTA A;  2A6V A;  1BMV 2;  4L9B A;  3PNA A;  1SLC A;  3RQ0 A;  1RYY A;  3ZYB A;  3SCF A;  1GQG A;  3DPR C;  2ZHL A;  4K21 A;  3UL2 A;  2X53 S;  4HPK B;  3TWI A;  4A7Z A;  1U0A A;  1BEV 3;  3HN3 A;  3B69 A;  1NY7 1;  1MS9 A;  1MZ6 A;  3CJI B;  3H1W A;  3KM5 A;  3MUY 1;  2O0O A;  1EV1 3;  1GZW A;  1CES A;  1OLR A;  3L2Y A;  3W5M A;  2A6X A;  2WL1 A;  3FBM A;  3FL7 A;  2C1F A;  3MI8 A;  4E4Z A;  1LTE A;  4QHO A;  2W3J A;  2C9A A;  3VD4 A;  2RMU 2;  3O1V A;  3M7A A;  1IPJ A;  2Q0A A;  3D0J A;  4RS5 B;  1RUH 3;  5E8A A;  3MEP A;  3MPB A;  2BQP A;  2JIG A;  2Q1M A;  3JD7 2;  4AED A;  2VBP A;  1TNR A;  4FO9 A;  3AXD A;  5T54 A;  5C70 A;  2JG8 C;  4IGQ A;  4DFS A;  4NWV A;  3DEC A;  4AF9 A;  2YRO A;  2Q30 A;  3AZX A;  4AVB A;  2JKB A;  1JOB A;  3ZXG A;  1BMV 1;  4MO3 M;  4IE5 A;  2D6K A;  3C7G A;  2PHU A;  1AX2 A;  2Y8K A;  2ZGT A;  3M3C A;  1Y9Q A;  5E1R A;  1JZ7 A;  1LAJ A;  1AL2 2;  1RXG A;  4HSL A;  4QXK A;  4JKM A;  1FNZ A;  1ZA7 A;  4QDQ A;  3A21 A;  2DTW A;  4H7M A;  4CDW B;  1JZ4 A;  4JHT A;  1D4M 2;  3GBW A;  1TG7 A;  4H3W A;  1DP0 A;  5FZ3 A;  3NJZ A;  1YIF A;  4BZ4 A;  4Q4Y 3;  1OD3 A;  1MS1 A;  2JXA A;  4LUL A;  1XSQ A;  1XU2 A;  3B00 A;  4QX8 A;  2RMU 1;  4IES A;  4DXR A;  4O7X A;  2JDU A;  5BPX A;  2VW1 A;  3SIS A;  3THP A;  2QZ2 A;  1S55 A;  3MO4 A;  2QNK A;  1PGL 1;  1NA1 C;  1ULC A;  1UN1 A;  3BOP A;  1ZBA 1;  1POV 3;  4NAO A;  5BXX A;  5FYY A;  3RZZ A;  4XFH A;  2KA3 A;  2QQW A;  4PBO A;  4NE9 A;  1PX3 A;  4NOT A;  4NVP A;  3S5Q A;  4CEW A;  5J09 A;  3H8X A;  4CUC A;  1W9S A;  4N43 A;  3HT1 A;  4WZF A;  2FMY A;  4W65 A;  4K7J A;  2GC1 A;  2XJT A;  4PLO A;  3ZN6 B;  1BBT 1;  1QHD A;  2OVU A;  2XWB B;  4BYY A;  1AVB A;  1JI6 A;  4Q27 A;  3IKW A;  1AL2 1;  4HFS A;  2A6Y A;  3RWK X;  1LOG A;  1WUV A;  2XDV A;  1QDC A;  1RUF 3;  1YI7 A;  2JWP A;  1D4M 1;  3VDC A;  3KMH A;  4L11 A;  5IWF A;  5JMO A;  1DBN A;  2WJS A;  2UYB A;  4P9G A;  3NST A;  1RUD 2;  4A6S A;  4FXG B;  3ZFG A;  4DUV A;  1OF4 A;  1GOF A;  2VTX J;  4HKW A;  1UL9 A;  2PN5 A;  5HI0 A;  2WFF 1;  3TEY A;  4K8F A;  1D0H A;  1UYP A;  2F6B A;  2IXH A;  3GF6 A;  3N9O A;  4E2Q A;  1ALY A;  2YPD A;  1XRU A;  4LPL A;  3ZYP A;  2ZS6 B;  5DZE A;  3MFA A;  3OD0 A;  2BJS A;  5JOZ A;  3T3Y A;  4XQ4 A;  1GAN A;  1JU4 A;  4QKD A;  4WVW A;  3A7Q A;  5BNP C;  3ETQ A;  3VDD B;  1ZRD A;  3HAG A;  4I09 A;  3S7I A;  3U07 A;  5IAT A;  2B9U A;  4AED B;  1JU3 A;  1OQD A;  5FMO S;  1W6P A;  4M3C E;  2RM2 3;  3KT4 A;  2BVB A;  2XLA A;  4WM8 B;  3ZIX A;  3RG0 A;  3IAP A;  3IAQ A;  5HV0 A;  1AJO A;  4R9A A;  4YW1 A;  5LAS A;  3VBU A;  3UYJ A;  3WW1 A;  5GZF A;  1C57 A;  1KD7 A;  1RUI 3;  3ACF A;  1QJU 1;  3KQ4 B;  3MW4 A;  4QKF A;  5JIU A;  2O1Q A;  2WT0 A;  2HWD 1;  1W2T A;  2VQ0 A;  2BRT A;  4HKO A;  4X8N A;  3WNO A;  3LEK A;  3ILN A;  3I3B A;  2BWC A;  4OFG A;  4K9S A;  4P00 B;  4COV A;  4ITC A;  2TNF A;  3HQR A;  2VZS A;  1ENS A;  2UY8 A;  5KXC A;  4C90 A;  4MXW B;  4YVS B;  4F8A A;  4AVA A;  5LY1 A;  3TEZ A;  4HON A;  1V6M A;  1S2K A;  1R08 3;  1QJZ A;  2A3X A;  5GLZ A;  2ZGM A;  1VBE 3;  2CAU A;  3A4U A;  4LNV A;  4KQ7 A;  5FYV A;  4BIS A;  2OT7 A;  4C1W A;  4MX3 A;  5CYY A;  1DQ6 A;  4JKL A;  4N7U A;  3KT1 A;  3NW4 A;  2J7M A;  3UK9 A;  2CDP A;  3WQ7 A;  3ZYH A;  2VOX A;  4XJA A;  1YLL A;  2PHL A;  2GMP A;  4OHZ A;  1H0B A;  1LRH A;  4J1W A;  3SXW A;  4AHX A;  2I45 A;  2WR9 A;  4OLL A;  1JHJ A;  2KXL A;  5JIA A;  2XJQ A;  4Q4W 3;  5BYN A;  3MW3 A;  5H9R A;  3I54 A;  1W9F A;  2D43 A;  1H2L A;  3ZPY A;  4LA3 A;  4B1L A;  5LBF A;  4CEY A;  4UF0 B;  5E89 A;  3LKJ A;  5LBE A;  5FFO C;  2TEP A;  3I3Q A;  3CBN A;  3JBG 3;  5FUN A;  3TNQ A;  4B29 A;  1XU1 A;  2RS1 2;  2RV9 A;  3I2F A;  1W05 A;  3U10 A;  3W5N A;  3KB5 A;  5FXZ A;  4QX0 A;  3WNL A;  3RZH A;  3S5A A;  2BBV A;  4YW6 A;  2DFC A;  4P14 A;  3QOP A;  5A1A A;  2WLP A;  1MZ5 A;  3O5S A;  2XXZ A;  3UKT A;  1PNG A;  3CJI C;  1UU4 A;  3ZFE B;  1HRI 3;  2ZEY A;  5F3E A;  4XF9 A;  4EWD A;  5C9A A;  1F8V A;  1OFN A;  3AKP A;  2Y6H A;  3R4D B;  2EXH A;  5KHH A;  5DAP A;  3CHX A;  2CHH A;  3THT A;  1AR9 1;  4UW6 A;  3VBS A;  5FK8 A;  2WNU B;  2ES3 A;  4R52 A;  1JZ6 A;  1YXW A;  3ZO0 B;  4JRA A;  1APN A;  1G9C A;  5I0S A;  4UW4 A;  4BQW A;  4LIT A;  3TOJ A;  3B9I A;  3VKN A;  2JD9 A;  2QQO A;  4LBO A;  4HVR A;  4GWM A;  1BXH A;  1W0P A;  3NV3 A;  3H3Z A;  2W9X A;  2QQJ A;  4NHK A;  1RC6 A;  1SLA A;  5F3C A;  1Q5O A;  2IXI A;  4WVZ A;  1W6O B;  3M1H A;  3DKW A;  2HWF 1;  4LOR A;  1Q43 A;  4CDW C;  1NYW A;  3O1U A;  3SCH A;  1UZV A;  2Y38 A;  3GHN A;  3NVC A;  2RS3 1;  4Q0V A;  2PLV 2;  1D2S A;  4JCK A;  1NLR A;  2XML A;  3NMB A;  1G86 A;  2R32 A;  3B94 A;  3H7J A;  3UES A;  1JZ3 A;  4AI2 A;  4IEX A;  1HW5 A;  1CZT A;  2ZAC A;  3VDA A;  1K3I A;  3JCI A;  3KWV A;  1VB4 A;  4NHM A;  4Y33 A;  5CVR A;  4CDQ A;  3ENR A;  4XFB A;  3S7E A;  2ZBJ A;  4IE4 A;  4PIX A;  3OGV A;  4LBQ D;  3PL0 A;  5BNQ A;  1RXF A;  4ZS2 A;  2VVF A;  3AFK A;  5FYC A;  1VAM A;  3DXU A;  3X29 B;  2OII A;  4KGG A;  4Y5T A;  4XBN A;  1FAT A;  4ATE A;  4NAM A;  1CIY A;  1DQ2 A;  5BNO C;  4M00 A;  4NHX A;  1S1A A;  3UGF A;  2BGP A;  3PDQ A;  1S0G A;  3GHM A;  5C3R A;  1T2X A;  2QE3 A;  4YNI A;  5LEJ A;  1W6Q B;  4XOG A;  3VDB A;  5FY4 A;  1VBD 2;  1G9A A;  2OZJ A;  2RMU 3;  5LCW L;  5I93 A;  4KI5 M;  3U14 A;  1Q56 A;  1AF9 A;  1AR7 1;  1SDD B;  1DYK A;  4AI3 A;  2VNG A;  1UYZ A;  4LBN A;  2YZ4 A;  1Q8V A;  5AFB A;  3JD7 3;  4CDU A;  2UUR A;  2BU9 A;  1QNY A;  4LE4 A;  2N7G A;  3OUI A;  1H4G A;  2ARX A;  1A8M A;  3C3V A;  3NAP B;  1LEM A;  1QXP A;  5C9A B;  2JDK A;  3A0K A;  3ZKY A;  3FHI B;  2GH2 A;  1N47 A;  2BEO A;  2DTY A;  4I0B A;  1GQH A;  2AGS A;  2DVA A;  4QHZ A;  5GZD A;  2VCB A;  3DYP A;  4ARY A;  1AL2 3;  5FR3 A;  1VB2 A;  3H7Y A;  1IQD C;  1JYX A;  2E63 A;  3MID A;  2ZGL A;  3DV8 A;  3J26 N;  1LUL A;  2C6S A;  2RVA A;  3VDD C;  3JU9 A;  5IUQ A;  1MS8 A;  1D4M 3;  4MUV A;  3ZSK A;  4GA9 A;  5HBA A;  4AED C;  5EP9 A;  4G4F A;  1UY3 A;  1GLH A;  5F7U A;  5LEK A;  3E1F 1;  4WM8 C;  4YFW A;  1VBD 1;  5GZC A;  4FFI A;  1J58 A;  4FOV A;  3TRS B;  3T2P A;  1JYN A;  2V09 A;  1PZ7 A;  4IEY A;  3MV0 1;  1J3Q A;  3PU8 A;  2OW4 A;  1ASJ 2;  4WM7 B;  2X05 A;  2DUO A;  3CL1 A;  1CVN A;  1RED A;  4ERO A;  1UYX A;  3OJB A;  2GN3 A;  2PA7 A;  1BVV A;  1JYV A;  3BPS A;  3ZFF B;  1CAW B;  1IHM A;  1D2Q A;  2BWA A;  3ACH A;  5FP4 A;  2FDK A;  4G9S B;  4R4X A;  3LB9 A;  2VMG A;  2NN8 A;  2QDR A;  1WMD A;  4A3Z A;  3RZL A;  1CN1 A;  1VBA 1;  2VJX A;  2XGX A;  1CR7 A;  1QQP 2;  4ORF A;  4BLI A;  4YVS C;  4QPG B;  4FQ4 A;  3J8F 2;  1GZC A;  1HIX A;  3VBF A;  1POV 0;  2VCC A;  3POF A;  3T0A A;  3WG2 A;  4XMI A;  4MGT A;  3NNF A;  5L9B A;  3WOG A;  3G7D A;  4QB6 A;  2OUH A;  2Q1F A;  4G3Y C;  1R1Z A;  5K0U B;  1UIJ A;  3O0V A;  4GKY A;  2H6B A;  1OF3 A;  4MOA A;  2ZPX A;  3ACI A;  4XDO A;  5I8Y A;  2ZAH A;  4LJH A;  4LIV A;  4D0Q A;  1SCR A;  3QCW A;  4NN0 A;  5DAQ A;  1RUD 3;  2YY1 A;  4RFR B;  2UWB A;  5LBB A;  3O1O A;  3DXT A;  2QDN A;  4ZKT B;  4Y22 A;  1ASJ 1;  4L92 A;  1AXZ A;  4XTP A;  3ZOI A;  4AR2 A;  3VHR A;  4NPM A;  2BOI A;  3CZU A;  3KV9 A;  4J1X A;  4Z2W A;  2JJ6 A;  4NUB A;  5F5I A;  3MZH A;  4IV1 A;  4GB3 1;  4QQL A;  4A7K A;  1WCU A;  1O3R A;  1OA3 A;  2FCV A;  1WCD J;  3IN9 A;  4HT1 T;  3ALQ A;  3WT3 A;  4TSV A;  2ZGS A;  3ZXL A;  3AB0 A;  3OOX A;  4QPW A;  1OH3 A;  2AAC A;  1O59 A;  1QQP 1;  2JDP A;  2JEN A;  5FYH A;  1IKQ A;  3H3L A;  1OMI A;  1V6O A;  2HEV F;  5C6C A;  1DQ1 A;  2BNO A;  5IFT A;  2XWJ B;  2QQK A;  2QFE A;  1H4H A;  4MG2 A;  2L9L A;  3KV4 A;  5GKA C;  4XUO A;  1REF A;  4JGZ B;  2B42 B;  2WNU C;  4QPI B;  2G1M A;  3WF4 A;  4LKE A;  3WG1 A;  2HWC 1;  5FQ0 A;  4ISQ A;  2ZTN A;  2Y0I A;  3HOB A;  2ERF A;  3EHK A;  1L7L A;  3N7L A;  1AYM 2;  2PYT A;  1VRB A;  2ARB A;  1SFP A;  3PVB B;  5LB6 A;  2A3W A;  5T5O A;  1HJG A;  2JG8 A;  3UV9 A;  3KGL A;  3WUC A;  4LLF A;  1X82 A;  3I97 A;  2VBD A;  2Y60 A;  3MLJ A;  4M01 A;  2XKO A;  4AFA A;  1D7P M;  3ELN A;  3VBO B;  1WW4 A;  1W9T A;  3AP9 A;  2AH2 A;  1OLM A;  3WDV A;  3MLK A;  4MVT A;  3ZIW A;  2W91 A;  5CIR A;  2ETE A;  4K20 A;  3ZXK A;  4JC1 A;  1FMD 1;  1KIT A;  3FLR A;  5L9V A;  3AM2 A;  3I3E A;  5C3P A;  5HCH A;  2DF7 A;  2RHP A;  2KM2 A;  1J1L A;  3D8C A;  5B2G B;  4FFG A;  2EIB A;  3WG3 A;  3M4F A;  3DYO A;  4AQ2 A;  3O1M A;  1O5U A;  1H1I A;  1J3R A;  1NXD 1;  3L2H A;  3WLU A;  4XZU G;  2P3J A;  1HB2 A;  4NIG A;  5LRR A;  3MF9 A;  5F37 A;  1XYN A;  3H8O A;  2HH9 A;  5CFD B;  1Y9G A;  1N3Q A;  1WZX A;  4BDV B;  2RS1 3;  1NA1 A;  3GAL A;  4AVS A;  4FPY A;  5IAX A;  1IS5 A;  4LIU A;  1SEF A;  2VH9 A;  2PTM A;  5ABJ B;  5DMY A;  2VUA A;  1H8T B;  3ASI A;  1JXN A;  2WZR 2;  4NIH A;  4AAX A;  2JE7 A;  3U37 A;  5IHR A;  3WP5 A;  5KHK A;  1QXJ A;  1IPS A;  1R09 2;  4OHW A;  1UY0 A;  2K0G A;  5FV3 A;  2ZA9 A;  1HJF A;  4QQO A;  2XUE A;  3LSE A;  4FSJ A;  1QEX A;  5J37 A;  1ZA4 A;  4KU8 A;  4C91 A;  2DBN A;  2VOV A;  3I59 B;  4UBH A;  4KNC A;  2VNV A;  1LOF C;  1SLI A;  2ET7 A;  5CKM A;  3ZYI B;  3LA2 A;  2LRP A;  1ZYB A;  1YC6 1;  3H8U A;  4HSJ A;  4D7Y A;  1YCI A;  1CIW A;  2VD7 A;  3ZSE A;  1SDW A;  5IK5 A;  2WC2 A;  5FZ9 A;  3I2D A;  3NAP C;  3KV6 A;  2C0Z A;  5C9A C;  3USU A;  3I2H A;  2YDE A;  4FP3 A;  4CU9 A;  1C3H A;  4HAN A;  2OPK A;  2HJI A;  1JMU B;  3ZM8 A;  2ID4 A;  2QUO A;  1XNA A;  2IXK A;  5FYZ A;  4Y5Z 0;  1AZD A;  2IFR A;  2XOM A;  1ENX A;  4Q4Y 1;  4XJU A;  1A34 A;  2FDI A;  4EV0 A;  3NNL A;  4FOW A;  4D6R A;  3WY6 A;  1OPO A;  3AMQ A;  1X9T A;  1WKY A;  3O14 A;  5A7W A;  1REE A;  4BK4 A;  3K77 A;  4XJW A;  2PLV 3;  4LHS A;  1AR6 2;  4YGE A;  2ZKL A;  2JKX A;  1N3O A;  5K7P A;  2UWA A;  2RJL A;  2EID A;  3BOW A;  4IV3 B;  1P8J A;  3OYW B;  1K45 A;  5EYX A;  3AXE A;  5EHD A;  4WM7 C;  3MFC A;  5FZM A;  1VAK A;  3WD5 A;  3PUR A;  1X36 A;  2HWB 3;  3AZW A;  3B01 A;  4I0A A;  1UD1 A;  3POI A;  2WWU A;  4HG6 B;  5A3W A;  3W21 A;  3GGL A;  1FX5 A;  2V5Y A;  2X10 A;  1WLC A;  1WA4 A;  3KCX A;  4MGQ A;  4N53 B;  4AGG A;  3ZFF C;  2OS2 A;  3H1Y A;  5FXV A;  4XTM A;  5JXH A;  3HN1 A;  3QBQ A;  4BIO A;  2WNO A;  2VVE A;  2RDR A;  4M3C B;  2BPA 2;  4XJ9 A;  2AC1 A;  2XBO 2;  5FZ1 A;  2ORX A;  4AGV A;  4QPG C;  1RUF 1;  1W2N A;  4FBF A;  1RIR A;  1VBD 3;  1A8D A;  4R8H A;  1SG3 A;  1SMV A;  3NL1 A;  3J7N A;  1OUX A;  2EXJ A;  2Y0O A;  5E88 A;  5K0U C;  1WWY A;  4Z92 B;  1OKO A;  5J3U A;  1U5I A;  2WFP A;  3VD3 A;  5IYY A;  1OSG A;  1PGS A;  2SLI A;  3ETP A;  2AZ5 A;  3LDB A;  2MPF A;  4M0N A;  3JXS A;  1C5H A;  2D5F A;  4NWW A;  3EO6 A;  3MUZ 1;  4DO0 A;  1U5X A;  3QAC A;  2R6Q A;  3TAY A;  4XJ8 A;  4ZHN A;  3D3A A;  2VUD A;  1B35 A;  5EYY A;  4RN5 A;  1H2K A;  1W0N A;  4UBG A;  3W9A A;  5DG2 A;  4AK3 A;  4ARX A;  4NJ4 A;  5A3M A;  2VL4 A;  4XJZ A;  1O4T A;  4P5H A;  3GJB A;  5A3U A;  3BTZ A;  3KS7 A;  2VVD A;  4LR4 A;  4NMI A;  4HPK A;  2DFB A;  2RDS A;  4RGA A;  2H0V A;  1RUI 1;  3GBF A;  5IVY A;  1JUI A;  2GSY A;  3E97 A;  3J9S A;  2G4I A;  4Y20 B;  4JGZ C;  1ASJ 3;  1XNB A;  1V9U 2;  1JYT A;  2VTX A;  4LXL A;  2Q4S A;  5I0R A;  3RSJ A;  1UY1 A;  4RS5 A;  2Y6J A;  3AKS A;  4W4Z A;  2W2I A;  4QD2 A;  1EP0 A;  2YXS A;  3I2O A;  1JZ2 A;  1QMJ A;  4OVE A;  5A7W B;  1WLW A;  2VM9 A;  4HN1 A;  1OT5 A;  1R08 1;  1W06 A;  1QQP 3;  3JQX A;  3U1X A;  5G04 L;  1VBE 1;  2ZKN A;  3J8F 3;  2D6L X;  4W6Y A;  3AVR A;  2LM3 A;  4YPJ A;  1CPM A;  2D3S A;  3B93 A;  3OPZ A;  3IT8 A;  3VBO C;  4CCD A;  1KJR A;  3EBR A;  3WP3 A;  4OHV A;  4PDW B;  1F4A A;  3KCC A;  2FDJ A;  1TME 2;  3OBA A;  1MQT B;  4CDW A;  1ND3 B;  1H6Y A;  3BTX A;  3WF2 A;  2ZX4 A;  4EZ4 A;  2HEW F;  1SAC A;  3WP4 A;  1ZX5 A;  4AVC A;  1JOP A;  2E9Q A;  3JB8 A;  4HVQ A;  1HV1 A;  1UMI A;  3MLL A;  4BQ4 A;  2JDH A;  3JBG 1;  5IFP A;  1VMJ A;  1LOA A;  4U36 A;  2BV4 A;  2VW0 A;  4XFI A;  5L19 A;  5CIS A;  4GAL A;  4DEQ A;  4M4R A;  5CFD C;  1O6U A;  4CE8 A;  2A70 A;  4CCO A;  1IOA A;  4BLJ A;  1C8N A;  4MHR A;  4ASM B;  4L2N A;  4CCL A;  1DYP A;  1XBF A;  4AYU A;  5ABJ C;  1ULF A;  4LBL A;  5A7S A;  3RI8 A;  1H8T C;  2HYX A;  1YQ6 A;  1ZZ8 A;  3FUO A;  3IDA A;  2VMC A;  3AMH A;  2XHK A;  2Z69 A;  5DXD A;  1HRI 1;  3K48 A;  3OPW A;  4QX7 A;  5E6H A;  3VL8 A;  4BB3 A;  1LHV A;  4FOY A;  2YYO A;  1BVP 1;  1UW8 A;  1AR8 2;  2OQ7 A;  3KZ4 C;  2YB7 A;  4W8J A;  3TB0 A;  1GOH A;  4D8M A;  1I5P A;  4I02 A;  1MS0 A;  2Y26 A;  1BK0 A;  1HXS 2;  5APA A;  1UOF A;  5FYI A;  3AZZ A;  4GZ9 A;  1B35 B;  5ANN A;  2WKK A;  4LO8 A;  2WSU A;  1W04 A;  4FQZ A;  4OMC A;  5BNP A;  2ARE A;  3WV6 A;  5FMB A;  4CRQ A;  1NXM A;  2V4V A;  3RZG A;  4QDS A;  1ZBE 2;  1AYM 3;  1RUJ 2;  1V6I A;  2EIE A;  4XIK A;  5CKQ A;  4XXP A;  2Y6F A;  5FKC A;  5JVV A;  1MEC 2;  1I1E A;  2BNN A;  5FO9 B;  1NQJ A;  1T6B X;  4NID A;  2QTW B;  4AI0 A;  3AP5 A;  5DPN A;  4MZU A;  4XF0 A;  4IUG A;  4E8D A;  2ZAA A;  4QGL A;  2D3R A;  4KH9 A;  4P9X A;  3J7M A;  2QBX A;  1V0A A;  2JG9 B;  1OVS A;  5FYU A;  4BXF A;  4CCE A;  2NPI A;  1SBF A;  1RMU 2;  2WA3 A;  4K1Z A;  2VW2 A;  4DQA A;  4XAC A;  2XKP A;  2V72 A;  1QJF A;  4XC9 A;  1AR8 1;  1KFU L;  4IEU A;  3RFR A;  3VDD A;  1VAL A;  2GC2 A;  4EN8 B;  4KMQ A;  1L7Q A;  1GKB A;  1V6L A;  1XNK A;  1OXC A;  3LIG A;  3BGA A;  4WM8 A;  5FZK A;  4JHZ A;  3RYK A;  1EPW A;  3UT0 A;  1VBC 2;  4N9H A;  5EJZ B;  4O9E A;  4R9D A;  2XL9 A;  4IV3 C;  4KWU A;  4ZON A;  3PVO A;  3VZO A;  5ERL A;  3T2O A;  4NIA A;  3SKV A;  5HCA A;  1QU0 A;  1RUJ 1;  2EAK A;  3Q8E A;  3DL3 A;  1CAX B;  1NKG A;  1DCS A;  1MEC 1;  1DQ0 A;  4PF5 A;  2DVB A;  4N53 C;  1XJA A;  1WLD A;  4WZC A;  5D1I A;  5EJ1 B;  1S0I A;  4MET A;  1UYY A;  3POS A;  3ZR5 A;  2WZR 3;  1I6X A;  3W58 A;  3QD6 A;  4AI1 A;  4LUK A;  1R09 3;  5JI9 A;  2CGN A;  4MXW A;  2XG3 A;  3K4D A;  1RUE 2;  4YVS A;  4M3C F;  4S2H A;  2Y6K A;  4QX3 A;  3WNN A;  2P3Y A;  4XQD A;  1Y7B A;  2P34 A;  2XH6 A;  3ZXE A;  2ADD A;  3JD7 1;  3RYP A;  5A6X A;  4DNY A;  3I2I A;  1CZS A;  1BZW A;  1AXK A;  1UMH A;  1VBC 1;  3RGB A;  4UFH A;  2BDR A;  4CCJ A;  1O8P A;  2XJP A;  3ON7 A;  3LD8 A;  3U78 A;  4DUX A;  2B7Y A;  4UI9 L;  4UF0 A;  1JHN A;  4IE0 A;  1A78 A;  5CG8 A;  2W68 A;  1CWP A;  2WII B;  4PQ9 A;  4TTG A;  4GWI A;  4AFC A;  1DLC A;  1LNS A;  5FZ7 A;  4YM0 A;  3WW3 A;  1VPH A;  1V6N A;  5AC9 2;  2YHJ A;  5LA9 A;  3APB A;  1KGY A;  2WO1 A;  1RUE 1;  1Z78 A;  1RL3 A;  3WHU A;  2IVJ A;  2R1B A;  5A3T A;  2W1S A;  4YZ5 A;  2D40 A;  3BKZ A;  4A7Y A;  2ENR A;  3BU7 A;  3ZFE A;  1AR6 3;  2W39 A;  4SBV A;  5IW0 A;  4O9G A;  4YZ2 A;  2JD4 A;  3MIB A;  3P3P A;  4LKS A;  5B4X A;  3ME2 A;  3I3M A;  5A32 B;  3SNM A;  3FMG A;  4E9K A;  2HBU A;  2JDN A;  2WNU A;  3CDZ B;  4ZY9 A;  5I0T A;  4Y3O A;  3VKF C;  4JZR A;  2NP0 A;  3OY8 B;  5K8S A;  1S0E A;  5FP7 A;  2WWS A;  3KLS A;  4LMF A;  3BI3 A;  1E5R A;  2AEY A;  3VBH B;  4RGG A;  2PMW B;  2VPV A;  4JQR A;  4CP1 A;  2D6P A;  2ET1 A;  1LEC A;  4ZS3 A;  2XBO 3;  3KVA A;  2CGP A;  1RVF 2;  1YQC A;  5T55 A;  3BB6 A;  3NV4 A;  2R06 2;  4UYB A;  4O65 A;  3LA7 A;  4P9L A;  2FCT A;  1PM4 A;  5C4W A;  2B46 X;  3DGT A;  2E53 A;  2YBS A;  1DLL A;  1G9F A;  3QLQ A;  4KWJ A;  5KR7 A;  1W6O A;  5F6K A;  2QQM A;  2GAL A;  3Q8F A;  3WDT A;  1MQT C;  1RUD 1;  4CA9 A;  1XQN A;  1Y4W A;  1C28 A;  1QOT A;  1ULO A;  1ND3 C;  3DKQ A;  1QOS A;  5DQ0 A;  4JAA A;  4LKD A;  4A42 A;  4I0W B;  1NX9 A;  2CGO A;  3BPZ A;  4UFJ A;  5FYT A;  2MNG A;  4FPC A;  1HB3 A;  2B9V A;  4URT A;  3I2K A;  2CV6 A;  2GNB A;  3NNJ A;  2ZX2 A;  3THD A;  1RB8 G;  3KCY A;  2ADE A;  3LDR A;  4UAP A;  4XFG A;  1G8W A;  4YM2 A;  1PZ9 A;  1T6G C;  1GWM A;  1R1A 2;  1QKQ A;  4IEO A;  5IVB A;  1S2B A;  3PVE A;  4B7E A;  3WVJ A;  1J84 A;  1W28 A;  3D82 A;  3AVS A;  3WP6 A;  4YVW B;  3I8T A;  4P9W A;  2IC1 A;  2QKD A;  1UX7 A;  2BYV E;  5LAT A;  3DUI A;  1KEX A;  3H42 B;  3ACG A;  1EYB A;  4P5Y A;  1FV2 A;  2R06 1;  4EWA A;  3AJZ A;  1PO1 2;  1M06 G;  2WNE A;  4JQT A;  1YHF A;  5F5Q A;  3LZZ A;  3ES1 A;  3FHQ A;  3INA A;  4IXL A;  1HLC A;  2B45 X;  4M0H A;  4XUQ A;  2RDQ A;  1Y9M A;  2Q1Z B;  4MAD A;  4B8E A;  3HD8 B;  3P5B A;  3WXP A;  3ITQ A;  2CY6 A;  1W6Q A;  3HQU A;  3K4A A;  2JE9 A;  3GBG A;  4XFC A;  2VC9 A;  1B35 C;  1V9U 3;  3POY A;  4QX1 A;  4C0B A;  3N7K A;  1LOF A;  2ZX3 A;  1S0B A;  1ZZ7 A;  4QWN A;  4DIQ A;  5FY8 A;  1SFN A;  4QX2 A;  1KRI A;  2ATF A;  5DUW A;  1R1A 1;  3EYP A;  1L3J A;  5IVC A;  2QQU A;  3IB3 A;  1ND2 B;  5LBC A;  3ZDS A;  1DU3 D;  1UU5 A;  2ZEZ A;  3NAP A;  4IW3 A;  2WZE A;  3LOI A;  1OPM A;  4XE9 A;  1DHK B;  3KSC A;  3VHN A;  4PLM A;  5KHJ A;  4FPG A;  2JG9 C;  3L9J T;  1XYO A;  5IVE A;  4GMP 3;  2D44 A;  2XQX A;  2PHW A;  4E4H A;  1TME 3;  1PO1 1;  1UOG A;  4J25 A;  5FTT C;  3IMM A;  4RS5 C;  2DVD A;  3N3H A;  4URA A;  3FWE A;  2BER A;  4OZX A;  5IVV A;  5FZG A;  1NAE A;  2ZZQ A;  4N90 A;  1WGP A;  2ARC A;  4IEQ A;  5FP9 A;  4ZZ8 A;  5ACA 2;  5KXD A;  5FPV A;  1LEN A;  5K4L A;  2GME A;  1RTV A;  2VZT A;  3H3U A;  2VQA A;  1PIV 2;  1GU3 A;  2A73 B;  2RS1 1;  3P6B A;  4XFF A;  2UY9 A;  5DUU A;  2HWE 2;  4MGK E;  3ZSL A;  4WM7 A;  5C4W B;  4ES8 A;  2WQZ C;  3JUU A;  4IGO A;  5A7N A;  3VLB B;  1YQ2 A;  2VUJ A;  5FZO B;  5F32 A;  1GMM A;  1CAW A;  3ZFF A;  2WT1 A;  1DZQ A;  4QHB A;  4TWT A;  5A6Z A;  1H8V A;  1RUG 3;  3POG A;  3WNM A;  3AK0 A;  3DF0 A;  2X5I A;  4AWD A;  3Q8A A;  1AR8 3;  3H8R A;  5FP3 A;  3PU3 A;  1VJ2 A;  1FPN 2;  1WCK A;  3CQO A;  4JGY B;  4QPG A;  2LS6 A;  1W6N A;  2VOW A;  2NMN A;  1H1A A;  2VXJ A;  1POQ A;  3PUQ A;  5BV6 A;  2G9Z A;  1HXS 3;  5CEH A;  5SV5 A;  4CP9 B;  3K4Z A;  1BK1 A;  5K0U A;  2HWB 2;  3HIF A;  4PLN A;  5JDB A;  4RR3 B;  3PIJ A;  2QJV A;  1ZBE 3;  2YFZ A;  1RUJ 3;  2PAK A;  3AX4 A;  3VZJ A;  4UT5 A;  4W6W A;  1MEC 3;  5FBZ A;  2DUP A;  2WQ8 A;  5FLI A;  4R4Z A;  3N7J A;  1MZE A;  3Q9O A;  3WX5 A;  1O91 A;  2PHX A;  3PTR B;  5H9P A;  4A41 A;  4IER A;  1CAU B;  4TLF A;  1HB4 A;  2TUN A;  2W0X A;  1RMU 3;  3GCX A;  5FZ0 A;  5J1X A;  3OD4 A;  5F3G A;  1H9P A;  3WUD A;  3O0X A;  4YAR A;  5JR2 A;  3UKN A;  4D94 A;  5JXI A;  3WZ1 A;  3C2U A;  4QU1 A;  1K5J A;  1RHI 2;  1OOP B;  1GNH A;  1FPN 1;  2PLV 1;  3ZYJ B;  4AXO A;  2CDO A;  2XL7 A;  4B1M A;  1Y3T A;  3NKG A;  3ZMO A;  3BIW E;  1VBC 3;  2YBP A;  5FWJ A;  5LA2 A;  1M4W A;  2HWB 1;  4MXV A;  4OHY A;  4KBZ A;  1MPX A;  2PHT A;  4JGZ A;  4YGB A;  2YMZ A;  4QPI A;  2VZV A;  2PAE A;  2OZ6 A;  3NNG A;  3P3N A;  2YUE A;  5CAD A;  5I0D A;  2RG4 A;  1QH7 A;  2ZHN A;  1YFW A;  2QCS B;  4FVV A;  4W50 A;  4P9Y A;  1LOC A;  3GCW A;  3VBH C;  3BAL A;  4OUE A;  4YW2 A;  4L0P A;  1QJY 2;  3TN9 2;  4EN0 A;  2B4K A;  1RUE 3;  1MVE A;  3OCP A;  5IK8 A;  2GNM A;  4CXX A;  4B4P A;  1DYO A;  3V64 A;  1W9Y A;  3VBO A;  1RHI 1;  4YWA A;  4PCR A;  4Y5S A;  3RNS A;  4K3U A;  3RI9 A;  2WZP P;  1C1L A;  1MAC A;  5DDJ 2;  2RS5 2;  1ZZ9 A;  4DPN A;  1CJP A;  1U5Z A;  1HX6 A;  1C5I A;  1IGO A;  4N9I A;  3LOB A;  2DCT A;  4CZS A;  1UX6 A;  5LK7 B;  2OA2 A;  3LCP A;  1OUR A;  3VZL A;  2X5I B;  3OUJ A;  3GDB A;  3ZXF A;  5C71 A;  4Y1Y A;  2J22 A;  3C7O A;  4R9C A;  3NNM A;  2PXJ A;  4NRM A;  1IKP A;  1GZT A;  1W6N B;  3PME A;  4XYX A;  1EAH 2;  4ZU5 A;  5CFD A;  1VIW B;  1XB9 A;  4QM8 A;  1PHM A;  1QJX 2;  3AKR A;  2F4L A;  3KD4 A;  3F95 A;  3ZXA C;  4DZG A;  3KT7 A;  3ZSJ A;  5AC9 3;  4XMA A;  1O3S A;  1EUT A;  5ABJ A;  4AEM A;  4BA6 A;  1H8T A;  2GMM A;  2R07 2;  3PJQ A;  2HEY F;  3TN9 1;  2VNO A;  5KXE A;  1IS3 A;  3ZKU A;  4YGC A;  4IEZ A;  2D97 A;  4XVH A;  1UPS A;  1PMH X;  3BU0 A;  5L73 A;  1TNF A;  3DCQ A;  2J1V A;  1UXZ A;  3GZE A;  2VCM A;  3RMY A;  3WNP A;  1GIC A;  5IVJ A;  2RS5 1;  5FZC A;  2NZ9 A;  3I59 A;  1VBB 2;  3KHC A;  1HV0 A;  3B7M A;  3RYR A;  3VD7 A;  4Q0P A;  4RGK A;  5JUV A;  2VMF A;  4WVV A;  4UW5 A;  1GZ9 A;  2WS9 2;  2Z2S B;  4LUM A;  3Q8B A;  1RIT A;  4NR1 A;  5GZE A;  3HNB M;  5F2S A;  4BK5 A;  2ZGK A;  3J8F 1;  2J1E A;  4U2A A;  1ND2 C;  2WYF A;  1RVF 3;  1SQ4 A;  3ABZ A;  1EPZ A;  3N9M A;  5L9R A;  4PJY A;  1ULE A;  2YFU A;  3M2M A;  3HVD A;  2BVV A;  2R06 3;  3TYJ A;  3ZFE C;  1B09 A;  2LAL A;  4JRL A;  5DAV A;  2YPJ A;  3ZMN A;  3C7E A;  3O1S A;  1OUS A;  1N1T A;  2R07 1;  4HK9 A;  4IEP A;  2CL2 A;  4TYS A;  3OSD A;  4UW3 A;  4FTS A;  3AMM A;  2R0F A;  2Q8D A;  3LF7 A;  5KXB A;  3CU7 A;  1N1Y A;  3MIC A;  2JIC A;  4QB1 A;  1VMH A;  3OG2 A;  1LOE A;  4Q4X 2;  4DXT A;  4A6O A;  1OHF A;  1PMI A;  1NCQ B;  4LBJ A;  4W6X A;  5JCT A;  4C0H A;  3WW4 A;  1VBB 1;  4AQ6 A;  1R1A 3;  3DYM A;  4JDM A;  1Z0H A;  4IV3 A;  5T5J A;  3FLP A;  3OYW A;  1ZRC A;  5JSR A;  5C4W C;  2WS9 1;  1J3P A;  1VRH 2;  1EUU A;  2C5D A;  4ISR A;  4N53 A;  1QGL A;  3WNK A;  1UQX A;  1ACC A;  2E7A A;  2Y64 A;  3PVN A;  4QXC A;  2YC2 A;  3BYW A;  1MVQ A;  1PO1 3;  1W8Z A;  4M3C A;  5FO8 B;  1JS9 A;  1J1T A;  2XJS A;  4JTO A;  1W9W A;  3J4U H;  4JGY C;  4ONU A;  1JYC A;  2G19 A;  2VE1 A;  5C33 A;  3KQR A;  1GNY A;  1YWK A;  4WVM B;  3V0A B;  5A3P A;  1IPK A;  2P1B A;  4FFH A;  4UXA A;  1AYM 1;  3VD9 A;  1L7R A;  2WZ8 A;  5FAX A;  1PM7 A;  3S57 A;  2E7T A;  2J1U A;  1OC1 A;  4OUS A;  4RR3 C;  5D8A B;  5IJR A;  3RRD A;  2E31 A;  4LT5 A;  4S2G A;  3ZDV A;  4QM9 A;  1O3T A;  3IZO A;  2XR4 A;  2Y33 A;  2C26 A;  2RE9 A;  2ZGU A;  1XND A;  3J7H A;  1A6C A;  2IXL A;  5FUI A;  3KHB A;  3FBY A;  1VRH 1;  2BZD A;  3UJQ A;  2BGO A;  1C1F A;  3ZYG A;  4E8C A;  2BOJ A;  2CWS A;  1SLT A;  3FUQ A;  3EJK A;  2VBB A;  1J83 A;  2GC3 A;  3HJR A;  3IBM A;  2RR1 2;  2A71 A;  2DBI A;  4J6G A;  5J98 B;  3SH5 A;  2J1S A;  2NQY A;  3O1T A;  1OOP C;  2JB8 A;  2O14 A;  2GC0 A;  1RIN A;  1TE1 B;  4XHB A;  2NYY A;  1PZ8 A;  5JXJ A;  2E32 A;  5IAV A;  2FD8 A;  4CP0 A;  5ACA 3;  3ATG A;  1FOD 2;  3DEM A;  4GMP 0;  5DAW A;  3B3Q E;  4JV4 A;  5T50 A;  1GWL A;  1SLB A;  1PIV 3;  3I49 A;  3T0D A;  4TZD A;  2HWE 3;  3HBZ A;  4Y20 A;  4EN7 B;  4UFM A;  2R7E B;  2WUH A;  4MGS A;  4AE2 A;  4YFZ A;  4BXS V;  4WBB A;  5CA6 A;  2WZR 1;  2ZOE B;  1HQL A;  4RYD A;  1GP4 A;  2JDM A;  4PT6 A;  4YW5 A;  3WIN E;  5JOY A;  5EJ3 A;  1R09 1;  3RWN A;  5FBJ A;  3S0M A;  3BTY A;  1S4C A;  2P3K A;  3LSD A;  4OQ8 A;  4X6Q B;  1UOJ A;  5F2W A;  3S30 A;  1FPN 3;  1JZ8 A;  2W47 A;  3UJO A;  4E2G A;  5EWS A;  5JXG A;  1V70 A;  2RR1 1;  5FLH A;  2LW8 A;  4CUG A;  4AQS A;  5B4N A;  2C4X A;  1W3X A;  2W87 A;  4DUW A;  4FPK A;  4AOC A;  3III A;  5ISL A;  5CG9 A;  5F5C A;  4PDW A;  2R1D A;  3PUS A;  1NCR B;  3CF6 E;  3M70 A;  5GM0 A;  2OYZ A;  2A75 A;  1MQT A;  1WME A;  2BBA A;  1W3V A;  3N9P A;  4C8D A;  5T5P A;  4Q8K A;  1ND3 A;  3CNA A;  4D7S A;  2JDA A;  3O1R A;  1SPP A;  3EXU A;  4B4R A;  5T52 A;  5GLW A;  2X5I C;  3NKT A;  1S0J A;  3IDB B;  5G05 L;  2XVL A;  3AYC A;  1AXY A;  1W8F A;  4CYD A;  2WAA A;  5K9Y A;  1G9B A;  2GP3 A;  2ARA A;  2VQT A;  5A3N A;  4Q4V 2;  2CNA A;  2EIC A;  1O8S A;  1DFQ A;  1R64 A;  1YIP A;  5F3I A;  1RHI 3;  2O8O A;  3C8X A;  4COW A;  1PVC 2;  1AR6 1;  2DCY A;  2WO3 A;  2IVI B;  4GAZ A;  3KF3 A;  1LOD A;  4XZP A;  2WN2 A;  4FCA A;  3SH4 A;  4BQX A;  4Q26 A;  2QZ3 A;  2QQN A;  3LEM A;  1CX4 A;  4KU7 A;  2BNM A;  3SCG A;  4EN9 B;  1OI6 A;  4AEJ A;  4I30 A;  4P08 A;  3OGG A;  1QIQ A;  3OPT A;  4OCT A;  4RA0 A;  4AHZ A;  1WMX A;  5E16 A;  1QH6 A;  1YJK A;  2ILM A;  3M3Q A;  1LHU A;  2H6C A;  1W6M A;  2XBO 1;  3M3O A;  4XFA A;  4CDX B;  5LA1 A;  5HXM A;  1O5L A;  4D3W A;  2WDB A;  5C3Q A;  4R9B A;  1QJY 3;  5FLJ A;  3TN9 3;  1O4Y A;  3N35 A;  3PMS A;  4IET A;  1NZI A;  3VHO A;  1BLZ A;  1VAV A;  4Q4V 1;  2ZHM A;  3IWZ A;  2W5F A;  5L7O A;  2AYH A;  5H9Q A;  3VL9 A;  1LOB A;  3WSO A;  1CON A;  4QAW A;  2JG9 A;  2A1X A;  1COV 2;  3ZYF A;  4BU2 A;  4QQ2 A;  3T1M A;  4UWD A;  4QPI C;  1CPN A;  1H2M A;  1GQP A;  1HRV 2;  1ZNP A;  4CP2 A;  5I8T A;  5DDJ 3;  2RS5 3;  1A3K A;  4JX0 A;  3NJX A;  4XUT A;  2CWM A;  2WLQ A;  2VQU A;  2GH8 A;  1LCL A;  1NCQ C;  1GWK A;  3SQO A;  3RJ2 X;  1U5Y A;  5A80 A;  4BCU A;  1NE6 A;  1DGW X;  1AYN 3;  1EAH 3;  2ZZJ A;  4GH4 B;  4JTN A;  1ZRE A;  3R0R A;  1QJX 3;  5FYB A;  4YM1 A;  4COZ A;  1CAX A;  5FZ4 A;  3T1L A;  2Y34 A;  1LU1 A;  4PHZ A;  1F5F A;  2PEL A;  5KC5 A;  2R07 3;  2EAA A;  4RL7 A;  1LR5 A;  1MS3 A;  3M3I A;  4MHU A;  4MGZ E;  4Z82 A;  3LIH A;  4F83 A;  1N1V A;  1SPP B;  2F4P A;  2QQL A;  4HOO A;  1CZV A;  4ZU4 A;  5FZB A;  3VBR B;  4EQV A;  1X8E A;  3IDE A;  5M0T A;  1V9U 1;  1W03 A;  2VOT A;  4QGN A;  1KS5 A;  1RGS A;  5FRA A;  3UNP A;  1XNC A;  1G7Y A;  1ODN A;  1VBB 3;  3FFQ A;  4L97 A;  4S2D A;  3PLQ A;  1JBC A;  4P9J A;  1SHW B;  3NJY A;  5D8A C;  2GDF A;  2JX9 A;  3HBK A;  1LB2 A;  2WS9 3;  4RHV 2;  1YEW A;  3U4S A;  3T4H B;  1OLQ A;  1WCS A;  1TMF 2;  2PHR A;  1ZZB A;  1OVP A;  1RUG 2;  3CO2 A;  1Z7S 2;  2BGC A;  1YO8 A;  5BUV A;  4V2V A;  3LDK A;  2VUL A;  4GMP 1;  2CTV A;  5FUP A;  1HKD A;  2AEN A;  1V6J A;  2V4A A;  2VAU A;  1C8M 3;  1JH5 A;  1TME 1;  4XF3 A;  3HR9 A;  1QY4 A;  4YW7 A;  4CXY A;  5FMC A;  3NJV A;  4GKX A;  1HN0 A;  5FK7 A;  2RJ2 A;  1NY7 2;  2GZW A;  4B4Q A;  5LW9 A;  1YFY A;  4CUA A;  2DCJ A;  3V65 A;  2WWJ A;  5LZ6 A;  2JEM A;  1KJL A;  1W6M B;  4NHL A;  3W59 A;  5CAZ A;  2PHF A;  4Y1X A;  2DU0 A;  4Q4X 3;  3GNE A;  1H2N A;  2W1U A;  1JUH A;  2D6N A;  3OGS A;  1X8M A;  2WYS A;  1URX A;  1WW5 A;  3MHZ A;  2Z79 A;  4YGD A;  4ZXE A;  1Y43 B;  5IT6 A;  2E33 A;  3POB A;  2VGD A;  3POE A;  1OQE A;  2HLE A;  5FPB A;  4XCB A;  3LQC A;  3R4U A;  5A32 A;  5L7O B;  3OBZ A;  4RHV 1;  1VRH 3;  2OKX A;  4HN0 A;  4DXS A;  5FOB B;  2XUM A;  3OY8 A;  1RUG 1;  1Z7S 1;  4QU2 A;  1OBN A;  3A0N A;  4Z07 A;  5A1L A;  2WA4 A;  3VBH A;  3LPF A;  1NOV A;  5A1F A;  2W94 A;  3GJA A;  2A5Z A;  2D3P A;  3EQE A;  2WO7 A;  4HET A;  1HXS 1;  4IDZ A;  4XEZ A;  4QKN A;  5FKB A;  3WCR A;  2HKX A;  1OH4 A;  1YFX A;  2VMH A;  4OI2 A;  2LUW A;  5FPL A;  4LEJ A;  1KXG A;  3AZV A;  2PAM A;  4HBN A;  4EE2 A;  2YV8 A;  4QMA A;  5CNA A;  1W8O A;  2ZX0 A;  2VUC A;  3O7O A;  1CAV B;  5CU1 A;  3IMN A;  1NCR C;  5F5A A;  1ZBE 1;  2D5H A;  3RS6 A;  3FN9 A;  4IEW A;  5FY0 A;  5JLV A;  2ZMK A;  3FLT A;  4XAE A;  1PGW 2;  3P1I A;  2XON A;  3B9C A;  1CQ9 A;  4DRR A;  1F35 A;  1I5Z A;  1PK6 A;  5JZG B;  1QXR A;  1IS4 A;  3I2J A;  2B5H A;  1PGL 2;  3KGZ A;  5A3L A;  4JVA A;  5CFC A;  1ZBA 2;  5JOX A;  5KHG A;  4QB2 A;  3URF A;  3ZLI A;  2VNR A;  3BIE A;  4Y4R A;  4IGP A;  1S0D A;  1RMU 1;  3D4K A;  4RQP A;  3B02 A;  4JDN A;  2DCK A;  1AX0 A;  4YVW A;  3HNM A;  4KG8 A;  2RR1 3;  3EMR A;  4GD4 A;  3VUO A;  3AZY A;  3C7F A;  1BBT 2;  1RUN A;  2W52 A;  3H9A A;  1X33 A;  4UOJ A;  2DU1 A;  2FDG A;  4BWO A;  2AR6 A;  5JSO A;  3BUC A;  3PJY A;  3H0O A;  1ULD A;  1F31 A;  4CCN A;  4AEK A;  4XUN A;  5JR7 B;  2A6W A;  5A7P A;  3WDY A;  1FOD 3;  2JDZ A;  2TBV A;  4FTB A;  5C8W A;  5FZD A;  1SCS A;  3VV1 A;  1JYI A;  5FXX A;  1W39 A;  4ATF A;  4F3J A;  3WNX A;  3VHP A;  1NE4 A;  4YRD A;  3CLP A;  4LHL A;  4AVV A;  2J1R A;  3RZM A;  1PGW 1;  2E26 A;  3UGG A;  2LTN A;  3FC0 A;  1GUI A;  3B5L B;  4K6B A;  4K1Y A;  3UET A;  5A3O A;  1LHO A;  1UWW A;  4FPH A;  1E5H A;  3PTY A;  4CDX C;  3C7H A;  2WFF 2;  2Z5W A;  3OEA A;  3RZJ A;  4HL0 A;  2X29 A;  3CJX A;  3VD5 A;  1I3H A;  1LHW A;  1ND2 A;  1H6X A;  4N8M A;  4SLI A;  5SV8 A;  4Y1V A;  1V00 A;  4Z1V A;  3CMG A;  3MGU A;  1DDL A;  3N36 A;  4Q2F A;  5A7O A;  5BNO B;  3SMH A;  1GP6 A;  3OGJ A;  4KGQ A;  1H9W A;  4XQW A;  1YQ8 A;  4BE3 A;  2Q8E A;  4QQH A;  1UZZ A;  2DV9 A;  1YUD A;  1I9R A;  4BME A;  3FFZ A;  1WMF A;  3U11 A;  4DS0 A;  1QWR A;  3T08 A;  1XSR A;  3H50 A;  1K12 A;  1LES A;  3ACL A;  4Q29 A;  4CCM A;  4DIN B;  1QJU 2;  2R04 2;  4AFB A;  5J7M A;  2ZCW A;  2HWD 2;  3OBT A;  3VZK A;  1W8N A;  1UZW A;  4XPV A;  3BVC A;  4M4P A;  4Q0S A;  4GH4 C;  4QX5 A;  1JZ5 A;  3RZK A;  1GNZ A;  1ULP A;  2DYC A;  3KF5 A;  3OGR A;  4A45 A;  1GZW B;  1RUC 2;  5AC9 1;  4I01 A;  4H2A A;  4PDW C;  2KD7 A;  4NRP A;  4Q4V 3;  2EXK A;  3FX3 A;  2BFU S;  2IWG B;  1ZZ6 A;  2FZ1 A;  2ZAB A;  2NMO A;  3LFM A;  5FZO A;  4UFK A;  5A7Q A;  1UNB A;  2GP5 A;  4CU6 A;  1PVC 3;  3HPN A;  1OLM E;  2PFW A;  4LOS A;  3WDW A;  1PK6 B;  1VE0 A;  3PHM A;  3VBR C;  5AVA A;  3VN4 A;  1JN2 P;  3AKQ A;  4JGY A;  2FMD A;  5CFC B;  4NHY A;  3QH6 A;  2IXJ A;  2DVG A;  4RQP B;  4QDR A;  2VZQ A;  4CP9 A;  1NZC A;  4E2S A;  2DWR A;  3WF0 A;  3K51 A;  3AP4 A;  2V5D A;  4OYU A;  2QQP A;  4OZO A;  2R04 1;  4RR3 A;  1TVG A;  1C4R A;  1VP6 A;  1YRZ A;  1RVF 1;  1DG6 A;  4RD7 A;  1UAI A;  2ZXQ A;  5HCB A;  3IM0 A;  2CYF A;  2MEV 2;  5AFE A;  5FOJ B;  2W1Q A;  4AAP A;  1RUC 1;  3LFI A;  4V1P A;  3T4V A;  4COY A;  4XUP A;  5JOW A;  1CAU A;  1FV3 A;  4B3N A;  1COV 3;  3ZYR A;  1X50 A;  1QNW A;  2P4E A;  5JPM B;  3N9L A;  1G6N A;  1HRV 3;  3LPG A;  4IL7 A;  3V56 A;  2H0B A;  2XB6 C;  4I3G A;  4XDP A;  4DMI A;  1OOP A;  4ZZ5 A;  3KVB A;  3NV2 A;  3E6C C;  3SKJ E;  4CEW B;  1AR9 2;  2BP6 A;  3SEP A;  1YQ5 A;  4FFF A;  4OI4 A;  5F39 A;  1Q8Q A;  4Y1U A;  3RMX A;  4E27 A;  2KR2 A;  3VB9 A;  2LRO A;  2VO5 A;  4N43 B;  4MSV A;  1DF0 A;  3PIG A;  1ODM A;  3PUH A;  4DY3 A;  5TSW A;  5L7O C;  1SLL A;  1OQ1 A;  4XBQ A;  4XET A;  3U0Z A;  2XVG A;  1JTZ X;  2YBK A;  1E57 A;  2XVK A;  3MW2 A;  3HQX A;  1W2U A;  2MEV 1;  1W0O A;  4ASK A;  4JDO A;  4E4S A;  2FDF A;  3J7L A;  4LKF A;  2A6Z A;  1BYH A;  3AP6 A;  3AMP A;  1DQ4 A;  2XQR A;  1KS4 A;  4CCC A;  5EXO A;  3D0S A;  2VMI A;  1ZRR A;  1DGL A;  4HK8 A;  4A44 A;  3E5Q A;  2GND A;  2HWF 2;  2P37 A;  1JYW A;  1MS5 A;  3E6D A;  3M3E A;  4KWL A;  3ZFG B;  2B39 A;  1WW6 A;  4C1X A;  3WQ1 A;  3F2Z A;  1HB1 A;  1VR3 A;  2RS3 2;  4XXA A;  4ZPI A;  1JOD A;  1W8U A;  2XJV A;  2Y6G A;  5GZG A;  5KC6 A;  4RHV 3;  1DGR A;  1OA2 A;  2WT2 A;  5CZK A;  5BNN A;  1H1M A;  5JZG C;  5LA0 A;  1TMF 3;  2IXC A;  4PBP A;  1Z7S 3;  5DAX A;  4TXW A;  4RSU A;  4BH9 A;  1CJD A;  4FOQ A;  4PIZ A;  4LBM A;  4HXC A;  1DGW A;  1W6P B;  2V73 A;  4NRO A;  1ONA A;  2F17 A;  3AL5 A;  4FPJ A;  4OMD A;  4AFD A;  2UU8 A;  2O8Q A;  4FPE A;  1D4V B;  4XBL A;  4YW3 A;  5DZG A;  5FZ6 A;  1UF2 C;  2NM1 A;  4XDQ A;  1SZB A;  3ORJ A;  5FJK A;  3VBU B;  2DVF A;  2UWC A;  5I8S A;  3JB4 C;  2WN3 A;  2WSV A;  4Y24 A;  1Q3E A;  5GJ6 A;  3VZN A;  5ACA 1;  4NII A;  3OUH A;  1CGP A;  3LWC A;  1PIV 1;  1ENR A;  3NO8 A;  4QXB A;  2VOK A;  5C3S A;  3USS A;  4BQ2 A;  5J36 A;  2HWE 1;  1AR7 2;  4LO7 A;  1GFF 2;  1UKR A;  4Z8B A;  2I07 B;  3I2G A;  1K5M A;  4B7K A;  1VLN A;  2YC4 A;  4FXK B;  1BKZ A;  4AVT A;  4YG3 A;  4LO5 B;  5FPU A;  3SIT A;  2AUY A;  3T2Q A;  5LRS A;  4XAB A;  1CD3 G;  1WW7 A;  1XE0 A;  5FJH A;  3CEW A;  4XIL A;  5CKN A;  4EN6 B;  4YZ1 A;  2QVS B;  3WQ0 A;  2HBT A;  3GYD A;  3WDX A;  1XE8 A;  3ZR6 A;  1BJQ A;  2CU5 A;  3ZX7 A;  3N9Q A;  4IEV A;  3GXU A;  3ROU A;  4COU A;  5A6Y A;  4XF1 A;  4LOT A;  2VY0 A;  4EWE A;  2JE8 A;  5DN2 A;  5HCF A;  3D5O A;  1PX4 A;  1QOO A;  3WG4 A;  4CEY B;  4D69 A;  3I4I A;  1MR5 A;  1LHN A;  3JQW A;  4YG0 A;  5IK7 A;  3K75 B;  5FDB A;  1BQP A;  3SHR A;  2W1W A;  2OQ6 A;  3G6J B;  5D2A A;  1GYK A;  2P17 A;  3AMN A;  5IVF A;  4CPB D;  2BFU L;  3N7M A;  2SBA A;  3FZ3 A;  1D0G A;  1HQN A;  2VME A;  1NCQ A;  4N7I A;  4OI1 A;  1GV9 A;  1ZBA 3;  1AJK A;  5KWR A;  1NT0 A;  3GZA A;  3IDC B;  1W2O A;  1UOB A;  2P5B A;  4JKK A;  5C7G A;  1UY4 A;  5FMO L;  5FYS A;  2EVX A;  4UFI A;  2FBE A;  4YZ4 A;  1VBA 2;  3DN7 A;  3OTF A;  5CBL A;  1W99 A;  1BBT 3;  5DUV A;  3MIF A;  3POW A;  4QQP A;  5GLT A;  1UPI A;  3VBS B;  3ZPO A;  4HKL A;  4Z2A A;  4GWN A;  4LHK A;  3ST7 A;  1WLT A;  4BHP A;  5BNN B;  4DEV A;  5DZF A;  1PK6 C;  4GJY A;  1ULG A;  4LO4 B;  3AYA A;  4BOW A;  4H55 A;  5D21 A;  4DY5 A;  4KWK A;  4ZU7 A;  2ZGN A;  3T0B A;  5CFC C;  5BY5 A;  4HLT A;  5FPZ A;  2JEC A;  4RQP C;  4AW7 A;  1AYN 2;  1TQ5 A;  3QH7 A;  4AG4 A;  4WVM A;  4FAG A;  2WAB A;  3V0A A;  1DGR N;  1S0F A;  4YVW C;  5FZH A;  5FXW A;  2VZ3 A;  5D8A A;  1SBD A;  4OI0 A;  5LY2 A;  1QJY 1;  1ZRI A;  2R49 A;  2GNT A;  2WFF 3;  2GU9 A;  4NRQ A;  1ZZC A;  4FP2 A;  2G9G A;  3CZJ A;  1EY2 A;  4GB3 2;  4LA2 A;  2Y6L A;  1PO2 2;  2VZO A;  5EQU A;  1GSL A;  1NQD A;  1DZT A;  1H30 A;  1QF3 A;  1UXX X;  1UZ0 A;  2BW8 A;  4BPZ A;  2E51 A;  5JWP A;  2FDH A;  2DUR A;  2I74 A;  4FI9 A;  1YJL A;  4CXW A;  4KG0 A;  1K5M B;  2FCU A;  5FO7 B;  1W8W A;  5DDJ 1;  4LQR A;  4IE7 A;  4E4D X;  3HT2 A;  4IE6 A;  2ZGO A;  3FE5 A;  3AYD A;  5FP8 A;  5AVP A;  2WNV A;  5FRE A;  1US2 A;  3AJY A;  1TZO A;  4RFT 0;  3THC A;  4AGR A;  1AX1 A;  3T2T A;  3O1P A;  4IND A;  1US3 A;  4CDQ B;  1ZRF A;  4A4A A;  2D7F A;  4AFM A;  1QJU 3;  2E6V A;  4V2W A;  2R04 3;  4CEW C;  1LGC A;  5FY9 A;  2FZ2 A;  4L8Q A;  1AYN 1;  1EAH 1;  2HWD 3;  2BTV C;  2OX0 A;  2ZX1 A;  4CU8 A;  5C8C A;  2HWC 2;  4N43 C;  3WHT A;  1QJX 1;  2J1T A;  3W20 A;  4MV2 A;  4YLZ A;  1C8M 2;  2VZU A;  1RUC 3;  3S6P A;  1OKQ A;  1WD3 A;  1YI9 A;  3AFG A;  4CCK A;  2IFW A;  2WO2 A;  2YU1 A;  3BCW A;  3GZU C;  2ORZ A;  4QT6 A;  4LBQ A;  3POJ A;  2OXB A;  1PO2 1;  2JB4 A;  3V0B A;  4A3X A;  1KFX L;  3OBR A;  5HPO A;  2RDN A;  5KHI A;  3AL6 A;  5I91 A;  1UU6 A;  3VGI A;  3ECQ A;  1GBG A;  1HDK A;  1JW6 A;  1UCX A;  3DPR A;  1N1S A;  2R0H A;  4Q0U A;  5FZF A;  4CDU B;  2RJK A;  5J48 A;  1W8H A;  2ZHK A;  5I0U A;  5LK5 A;  3R6S A;  3ZFG C;  1FMD 2;  2J1A A;  4GIQ A;  4ZXK A;  4CU7 A;  2C24 A;  3E5X A;  1LED A;  5A70 A;  4AHW A;  5F9T A;  4YM3 A;  3ZVX A;  4GWJ A;  1NCR A;  4CPB A;  4ES9 A;  1CX1 A;  1NLQ A;  3GZT B;  4OUM A;  2K46 A;  3RVH A;  3D6E A;  4XAA A;  2YU2 A;  1RUO A;  3ZN4 A;  1F5J A;  4IQP A;  4FTE A;  5JI7 A;  2MEV 3;  2PHD A;  3SLI A;  1C8M 1;  4ASL A;  2DUQ A;  4Q5O A;  1JOJ A;  5FYM A;  1UY2 A;  2VZP A;  2XJR A;  3K46 A;  1IQA A;  3OF1 A;  3SEE A;  4BMB A;  1BEV 2;  3A22 A;  3BTA A;  2NLR A;  4WV8 A;  4XHX A;  1EV1 2;  1RJ7 A;  4Q1R A;  1K42 A;  3VBU C;  2XLG A;  1PMJ X;  5FZL A;  4Q4X 1;  5DUX A;  5DAB A;  5LWB A;  2D93 A;  4XCA A;  1IG0 A;  1RUH 2;  1AR9 3;  3T09 A;  5FPX A;  2OUJ A;  4MGY E;  2ZGR A;  3UKV A;  2WQ4 A;  5CB7 A;  2UYA A;  3NQH A;  3K2O A;  3MIE A;  4K40 A;  4YZ3 A;  3RJR A;  4DXZ A;  3LEI A;  4F7Z A;  1RJ8 A;  4XF4 A;  3AP7 A;  4YSF A;  2G9F A;  3VBF B;  3FJS A;  3WQB A;  2WNV B;  2WIN B;  4CDX A;  1FI2 A;  1W2A X;  5HV4 A;  2EXI A;  4CSW A;  1BCX A;  2QQV A;  1XNT A;  3ZSM A;  1BEV 1;  3HNY M;  2PQQ A;  2ZML A;  3JZV A;  3VKL A;  2P2K A;  3MIH A;  1EV1 1;  2HWF 3;  3R4S A;  3SC7 X;  4EJR A;  5C8C B;  1KDK A;  2K2S A;  4Q4Y 2;  4YYO A;  2D6O X;  4UFL A;  1TEI A;  4Y22 B;  4MH0 E;  4P02 B;  1XYP A;  4GJZ A;  1GR3 A;  1S2E A;  2ZGQ A;  2RS3 3;  2R30 A;  4CEY C;  4ET7 A;  4EYU A;  5J96 B;  3H1M A;  4IV1 B;  1RUH 1;  4LHN A;  4O61 A;  4LBQ B;  1Q8O A;  2XLF A;  5IK4 A;  4LBK A;  4Y1Z A;  1SFY A;  4LE3 A;  4EZH A;  3V0B B;  3BN6 A;  3M8L A;  2Q5T A;  2ZJC A;  5C3O A;  4OHX A;  1NUK A;  3ILF A;  3PUI A;  1Q8S A;  5GLV A;  1YYN A;  1LGN A;  3WCS A;  4AHY A;  4LLO A;  1DIW A;  2WAO A;  3DPR B;  1MZF A;  2VU9 A;  3ZXJ A;  3ES4 A;  3E5U A;  1OFS A;  4CVU A;  4GH4 A;  4BQ1 A;  3SH3 A;  1XE7 A;  3PUA A;  1WA6 X;  3R05 A;  5T3N A;  2VZ1 A;  4FAH A;  5A33 A;  3AYE A;  2XJU A;  5FZ8 A;  4FPO B;  3TBD A;  1RUF 2;  1WD4 A;  3VBS C;  2GAU A;  2W95 A;  2XPJ A;  1ST8 A;  1KQR A;  1FOD 1;  4Q0Q A;  3N4M A;  5BNN C;  1WCQ A;  5FQ0 B;  1STM A;  3MIG A;  4PI0 A;  2WBK A;  2IUW A;  3IPV A;  2DDU A;  4PIY A;  2WRA A;  2R16 A;  3I3D A;  4MLO A;  1X9P A;  1AR7 3;  3VBR A;  4XW3 A;  4D7T A;  4DB5 A;  4OUL A;  4HZF A;  4MGI E;  4CUB A;  4Y4Y A;  2JG8 B;  5T5L A;  5C5T A;  1DZR A;  3OB8 A;  2VCA A;  2YC0 A;  4NPL A;  5H9S A;  3WDU A;  3MYX A;  4TLG A;  3VKM A;  4DRV A;  3WW2 A;  4KBB A;  2FHR A;  1POV 1;  3LEG A;  1HQW A;  1IG3 A;  1G9D A;  2D98 A;  1LJ7 A;  1FT9 A;  4LK7 A;  3BOD A;  3LA3 A;  4H14 A;  3WR0 A;  4HMZ A;  2P6C A;  4FT8 A;  2K9Z A;  3KV5 A;  4D6Q A;  1F4H A;  3GM8 A;  3TEX A;  4GUL A;  2X09 A;  5FIX A;  2EAL A;  1F9K A;  4OQ9 A;  4K8R B;  2JDY A;  3VZM A;  1K5M C;  2RM2 2;  4XUR A;  1F2N A;  1HN1 A;  5L36 A;  3ILR A;  1QDO A;  2VTF A;  1E5S A;  1UZY A;  2MHF A;  2VEC A;  2ZMN A;  2PQS A;  2YG0 A;  2A3Y A;  2FQP A;  1RUI 2;  4GQ7 A;  4Q1P A;  3HWJ A;  1NA1 B;  1ZM1 A;  2VG9 A;  5GAL A;  4CDQ C;  1XPW A;  2CSG A;  2Z4F A;  4BM8 A;  1FYU A;  1FAY A;  1QJE A;  5FZE A;  3IIA A;  4YW4 A;  1GP5 A;  5FCC A;  5F1R A;  2E7Q A;  2P6H A;  3U75 A;  2YGM A;  4Q8L A;  2AEZ A;  1MS4 A;  5FMD A;  4YG6 A;  1LU2 A;  2XHN A;  5FWE A;  5FZI A;  2VZR A;  1UIK A;  1VBA 3;  1SBE A;  1WBF A;  4L99 A;  1PVC 1;  3MDP A;  1R08 2;  3RDI A;  2W46 A;  2DCZ A;  1VBE 2;  4Y26 A;  3ZN5 A;  3TEW A;  1O4Z A;  4TN7 A;  4D6S A;  2B8M A;  1N3P A;  1KDM A;  2RM2 1;  2VXR A;  4FPF A;  2EIG A;  4AI8 A;  4BJ0 A;  2X8K A;  4A2U A;  4CDU C;  1AHS A;  4AQT A;  5FY5 A;  4DOU A;  2ZEX A;  1X7N A;  4H7L A;  5EV7 A;  1PNF A;  3TNP B;  4Q4W 2;  3CJI A;  1IZ3 A;  4AZZ A;  1ZVF A;  2OPW A;  1O7F A;  5GLU A;  1CAV A;  3E6B A;  3USU B;  1UO9 A;  1U12 A;  1YFU A;  1O3Q A;  3O12 A;  3HEI A;  5ANQ A;  4P9I A;  2JIJ A;  3Q8C A;  5A33 B;  3A23 A;  3NRU A;  3JBG 2;  3LAG A;  1XXN A;  4MYE A;  1W90 A;  1PVX A;  2EA7 A;  3ZXD A;  1AL0 G;  4LK6 A;  2ZGP A;  4NPR A;  5JZG A;  4GB3 3;  4KL1 A;  5EZW A;  1PO2 3;  5BNP B;  1Q8P A;  1WBL A;  2A7A A;  3IPV B;  2D6M A;  1GOG A;  3RPQ A;  4QKB A;  1AUY A;  2QQI A;  1COV 1;  3O0W A;  1OD5 A;  1YNA A;  4FPL A;  4LO6 B;  4PI2 A;  2Q8C A;  5A6Q A;  1HRV 1;  3CKH A;  1HRI 2;  2GN7 A;  5DG1 A;  1UMZ A;  3MBW A; 
#chains in the Genus database with same CATH homology
 4M4P A;  3WF3 A;  1JZ5 A;  5DMY A;  3OGR A;  1ULP A;  4A45 A;  3WEZ A;  4AAX A;  3U37 A;  1BHG A;  2KD7 A;  5LA2 A;  5IHR A;  1XC6 A;  1MPX A;  1UY0 A;  3AC0 A;  4PQQ A;  4CU6 A;  3LE0 A;  2W92 A;  3HPN A;  2VZV A;  3NNG A;  2VR4 A;  5I0D A;  4W50 A;  3MV1 1;  4OUE A;  3FHA A;  4L0P A;  5EIY B;  4QDR A;  2VZQ A;  2B4K A;  3WF0 A;  2VMD A;  4PF1 A;  4OYU A;  2V5D A;  4OZO A;  1DYO A;  1TVG A;  3EB7 A;  3I2H A;  4CU9 A;  2ZXQ A;  3OEB A;  3ZM8 A;  2ID4 A;  2W1Q A;  3CIH A;  1XNA A;  2ZEW A;  4XUP A;  2XOM A;  3WF1 A;  5C71 A;  3GDB A;  2J22 A;  3C7O A;  2C9K A;  1WKY A;  4BK4 A;  3LPG A;  3K77 A;  1RYY A;  4LHS A;  4ZZ5 A;  2JKX A;  2EID A;  1P8J A;  3HN3 A;  3SKJ E;  3SEP A;  1K45 A;  1EUT A;  3MUY 1;  3W5M A;  2VO5 A;  4HG6 B;  3FL7 A;  3GGL A;  3PUH A;  2X10 A;  4MGQ A;  4XVH A;  2W3J A;  3VD4 A;  1PMH X;  5JXH A;  2J1V A;  1UXZ A;  3WNP A;  2ORX A;  3VD7 A;  5C70 A;  5JUV A;  2VMF A;  1SG3 A;  3DEC A;  4A44 A;  4BK5 A;  1JYW A;  3HNB M;  4MO3 M;  2J1E A;  3C7G A;  3ABZ A;  3F2Z A;  2Y8K A;  2YFU A;  1JZ7 A;  5IYY A;  3VD3 A;  3ETP A;  4JKM A;  4QDQ A;  2Y6G A;  3A21 A;  3JXS A;  1JZ4 A;  3MUZ 1;  3C7E A;  1TG7 A;  1DP0 A;  3D3A A;  5CZK A;  5LA0 A;  1OD3 A;  4TXW A;  4RN5 A;  1W0N A;  4DXR A;  4QB1 A;  3OG2 A;  4DXT A;  4ARX A;  4A6O A;  4OMD A;  2VL4 A;  3MO4 A;  3DYM A;  1PX3 A;  2WN3 A;  4CUC A;  1EUU A;  1W9S A;  3WNK A;  2Y64 A;  1JI6 A;  2YC2 A;  3I2G A;  1UY1 A;  2Y6J A;  4W4Z A;  2YC4 A;  1W9W A;  3VDC A;  1JZ2 A;  5JMO A;  1GNY A;  2VM9 A;  3T2Q A;  1OT5 A;  5G04 L;  3VD9 A;  1L7R A;  2WZ8 A;  4YPJ A;  2J1U A;  5IJR A;  4DUV A;  1OF4 A;  1GOF A;  2E31 A;  1F4A A;  3J7H A;  2C26 A;  3GXU A;  3OBA A;  5FUI A;  2JE8 A;  4LPL A;  1H6Y A;  5DN2 A;  3WF2 A;  1PX4 A;  2BZD A;  2BGO A;  1JU4 A;  3A7Q A;  3K75 B;  4E8C A;  1UMI A;  2W1W A;  5IFP A;  1JU3 A;  3HJR A;  1J83 A;  4DEQ A;  4M4R A;  2J1S A;  2VME A;  3IAP A;  3IAQ A;  5JXJ A;  2E32 A;  4JKK A;  5C7G A;  1UY4 A;  3ACF A;  2HYX A;  3IDA A;  2VMC A;  3T0D A;  1W99 A;  3WNO A;  3LEK A;  3I3B A;  2R7E B;  2WUH A;  2YB7 A;  4W8J A;  4MGS A;  4P00 B;  4Z2A A;  1GOH A;  4BXS V;  4D8M A;  1I5P A;  2VZS A;  4DEV A;  4RYD A;  4GZ9 A;  4PT6 A;  4OMC A;  3T0B A;  2V4V A;  4AG4 A;  4QDS A;  5CYY A;  2EIE A;  2W47 A;  2WAB A;  4JKL A;  5JXG A;  1JZ8 A;  2J7M A;  2CDP A;  2VZ3 A;  2LW8 A;  5B4N A;  2C4X A;  2W87 A;  4DUW A;  3III A;  5DPN A;  1JHJ A;  4IUG A;  4E8D A;  3CZJ A;  2Y6L A;  2BBA A;  2QBX A;  2VZO A;  1UXX X;  1UZ0 A;  2JDA A;  4FI9 A;  2V72 A;  5G05 L;  4LQR A;  2RV9 A;  3I2F A;  4KMQ A;  3W5N A;  1L7Q A;  3WNL A;  3THC A;  4QX0 A;  2WAA A;  1US2 A;  3BGA A;  4JHZ A;  5A1A A;  5EJZ B;  2VQT A;  1US3 A;  4A4A A;  4KWU A;  2EIC A;  1O8S A;  1R64 A;  3T2O A;  3SKV A;  2ZEY A;  3C8X A;  4CU8 A;  2WO3 A;  1NKG A;  2Y6H A;  5EJ1 B;  2J1T A;  1UYY A;  2VZU A;  1JZ6 A;  2WN2 A;  2WO2 A;  2ORZ A;  2QQN A;  3K4D A;  5HPO A;  4P08 A;  2JD9 A;  2QQO A;  2Y6K A;  4QX3 A;  3WNN A;  3ECQ A;  5LA1 A;  2W9X A;  5HXM A;  2QQJ A;  2WDB A;  2J1A A;  3I2I A;  4CU7 A;  1CZS A;  1UMH A;  4GWJ A;  1CX1 A;  1O8P A;  2W5F A;  3WSO A;  4QAW A;  4DUX A;  4UI9 L;  1GQP A;  4TTG A;  4GWI A;  1DLC A;  1LNS A;  3NJX A;  4JX0 A;  4XUT A;  3UES A;  1UY2 A;  2VZP A;  3K46 A;  3SEE A;  1JZ3 A;  2VQU A;  3A22 A;  1CZT A;  3VDA A;  1K3I A;  1KGY A;  2WO1 A;  1K42 A;  2W1S A;  1PMJ X;  3OGV A;  4LKS A;  5B4X A;  1CIY A;  3T09 A;  2BGP A;  3CDZ B;  3NQH A;  4ZY9 A;  1T2X A;  3LEI A;  3VDB A;  2QQL A;  1CZV A;  4KI5 M;  2VOT A;  1SDD B;  3WQB A;  1UYZ A;  3UNP A;  1SHW B;  1XNT A;  3HNY M;  2QQM A;  4A42 A;  1ULO A;  4P02 B;  5DQ0 A;  4ARY A;  1NX9 A;  2VCB A;  3DYP A;  4ET7 A;  2B9V A;  3I2K A;  1IQD C;  3THD A;  1JYX A;  2RVA A;  4UAP A;  3NJV A;  3BN6 A;  2RJ2 A;  1UY3 A;  5F7U A;  1NUK A;  3PUI A;  3E1F 1;  2DCJ A;  4CUA A;  1J84 A;  2WAO A;  3T2P A;  1JYN A;  1UX7 A;  4CVU A;  2W1U A;  3MV0 1;  3OGS A;  1KEX A;  3ACG A;  2WYS A;  2X05 A;  4P5Y A;  4ZXE A;  2VZ1 A;  2E33 A;  1UYX A;  1JYV A;  3FHQ A;  4XUQ A;  2HLE A;  3LQC A;  2W95 A;  3ACH A;  4MAD A;  2OKX A;  4DXS A;  1WCQ A;  4A3Z A;  3K4A A;  2WBK A;  2VJX A;  2DDU A;  3I3D A;  2VC9 A;  4QX1 A;  2VCC A;  3LPF A;  3T0A A;  4CUB A;  2W94 A;  4QX2 A;  3OB8 A;  2VCA A;  4QB6 A;  1OH4 A;  3EYP A;  1OF3 A;  3LEG A;  4MOA A;  3ACI A;  3IB3 A;  1W8O A;  4D0Q A;  2ZEZ A;  2WZE A;  3FN9 A;  1F4H A;  3GM8 A;  2X09 A;  2XQX A;  3P1I A;  2XON A;  3CZU A;  3I2J A;  4XUR A;  2BER A;  1HN1 A;  4QB2 A;  1NAE A;  2VTF A;  2PQS A;  2YG0 A;  4ZZ8 A;  4QPW A;  1O59 A;  2DCK A;  2VZT A;  1XPW A;  3HNM A;  1GU3 A;  3P6B A;  2Z4F A;  5IFT A;  3C7F A;  2QQK A;  4UOJ A;  2L9L A;  1YQ2 A;  4XUO A;  4XUN A;  1GMM A;  2XHN A;  2VZR A;  3WF4 A;  3WNM A;  2W46 A;  3HOB A;  3CQO A;  2J1R A;  2LS6 A;  2E26 A;  1GUI A;  3UET A;  1UWW A;  4BJ0 A;  3K4Z A;  3C7H A;  3OEA A;  2ZEX A;  3I97 A;  3VD5 A;  1D7P M;  1H6X A;  1W9T A;  2YFZ A;  3CMG A;  3HEI A;  2WQ8 A;  2W91 A;  3A23 A;  3NRU A;  4A41 A;  3I3E A;  3T08 A;  2EIB A;  1K12 A;  1GOG A;  3DYO A;  5J1X A;  2QQI A;  4XZU G;  5JXI A;  5JR2 A;  3CKH A;  4BDV B;  5LCW L;  1W8N A;  3MBW A;  2CDO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...