2PYTA

Crystal structure of a putative ethanolamine utilization protein q (eutq, stm2468) from salmonella typhimurium lt2 at 1.90 a resolution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
128
structure length
128
Chain Sequence
LELGTMQPSFTSVTGKGGVKVIDGSSVKFGRFDGAEPHCVGLTDLVTEQDGSSMAAGFMQWDNAFFPWTLNYDEIDMVLEGELHVRHEGETMIAKAGDVMFIPKGSSIEFGTPTSVRFLYVAWPANWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Ethanolamine utilization protein eutQ
publication title Crystal structure of Ethanolamine utilization protein eutQ (16421009) from Salmonella typhimurium LT2 at 1.90 A resolution
rcsb
source organism Salmonella typhimurium lt2
total genus 22
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2pytA00
4QM9A 2OYZA 1L3JA 5EFUA 3RYPA 3CL1A 1UIJA 4UBGA 3S0MA 4XEZA 1EY2A 3I7DA 5FQ0A 5BXXA 2XL7A 2ETEA 2GU9A 4KWLA 1ZZ7A 4QM8A 4OFGA 2D93A 2ZCWA 3ELNA 3BPZA 2MHFA 4Q0PA 5KHHA 3I54A 1H1MA 4QMAA 2ZKLA 4WZCA 1DGRA 4MGZE 4LLOA 3BALA 5C6CA 4WVZA 1ZRCA 4IESA 1ZRDA 1ZZBA 1ZZ6A 3IIAA 1QXJA 2UY9A 3OD0A 2XLFA 1QXRA 4KWJA 3DV8A 4LUKA 5FDBA 3NVCA 3S7EA 1YWKA 2H6BA 3SXWA 4XF1A 3NW4A 1UW8A 5I0UA 1UD1A 5BPXA 2XHKA 2XKOA 4I3PA 4UXAA 1UCXA 3SMHA 4FT8A 3L2HA 2IXKA 1CAWA 2OZ6A 4E2GA 5FQ0B 4MZUA 3FHIB 5FLIA 4L11A 3LOIA 3LAGA 1G6NA 1XE8A 3KSCA 3R6SA 2QNKA 4H7LA 2PYTA 2QJVA 2OA2A 2PAKA 5AVPA 5T3NA 2FQPA 4Q0QA 5LEJA 2PAEA 5CVRA 2PHLA 4MGKE 1ZRRA 4E2QA 5KHGA 1O5UA 2Z2SB 3BCWA 1NE6A 3H7YA 3C3VA 4QGMA 3U10A 1FT9A 2KXLA 3KGZA 3E5QA 1V70A 4JV4A 1X82A 3RZZA 5LRSA 4O9GA 4MX3A 2N7GA 3PVBB 1SFNA 1Y9QA 1I6XA 4IEUA 4L2NA 3H50A 1Q43A 3LA2A 3SCGA 1SQ4A 3UKTA 2D40A 1CAUB 3DL3A 5I93A 1J58A 5CADA 3GYDA 3JZVA 4ORFA 2GC0A 2XLGA 1H1IA 4IEOA 4FBFA 4LTAA 4EWAA 5KHJA 5FPZA 3HQXA 2ET7A 5BY5A 5JSRA 5JSPA 4I2OA 2QVSB 1ZVFA 2CGPA 5I8YA 1O3TA 4N9IA 3H1YA 4LA2A 2XL9A 1YFWA 4NVPA 1FXZA 1ZREA 3EJKA 5JCTA 5CU1A 4IEWA 1QY4A 5K8SA 3QACA 3RPQA 2Q0AA 4X6RB 2CV6A 1JUHA 3RYKA 4IEVA 3KMHA 5J3UA 2PHDA 3PLQA 3H7JA 4PIZA 3H9AA 3I59B 2XKPA 5E16A 4LA3A 2CAVA 4IEQA 5I8TA 3H1WA 3D0JA 3E6CC 3EQEA 5FCCA 5FPXA 4META 2ET1A 1RUNA 5J48A 4HN1A 3E5UA 4F7ZA 1RTVA 3UKVA 3E6BA 4HVOA 4HVRA 2WC2A 3LA3A 3NKTA 3NSTA 4HN0A 2E9QA 3HIFA 4EV0A 4ONUA 4WBBA 3EO6A 1DZRA 4HSLA 4I02A 4CYDA 1O3SA 5D1IA 1NYWA 2HKXA 1EPZA 3PNAA 5I0RA 5BV6A 4XFFA 5LEKA 3HT1A 1EYBA 4HMZA 4Z82A 4X6QB 4XFAA 1ZX5A 1UPIA 5I8SA 1ZZ9A 3N4MA 1O4TA 4GULA 2ATFA 4N9HA 4QX5A 2P17A 3M70A 2GZWA 2PA7A 1CAVA 1QWRA 3FJSA 1YHFA 4AXOA 4ZU5A 1NZCA 5HI0A 3S7IA 3ES1A 2B9UA 1J59A 1O7FA 4D7SA 3SCFA 4QGNA 2BEOA 4LEJA 1CAXA 3CO2A 2MNGA 2IXIA 1HW5A 2CAUA 1U12A 3LA7A 4J1WA 4XFIA 4AQ6A 4I09A 4I0AA 3M3IA 4FAGA 1Y3TA 2Q4SA 1IPKA 1WA4A 4PJYA 4LULA 2V09A 2PQQA 3WW1A 4D7TA 1GQHA 4XFBA 4E2SA 1TQ5A 4Q0VA 1CX4A 2K9ZA 2B8MA 2UY8A 3WW3A 4J1XA 4BYYA 4PIXA 4F8AA 3MZHA 5KHIA 2UYBA 1Q3EA 4HLTA 3CEWA 5J7MA 1OD5A 4MUVA 3OCPA 3EHKA 4YNIA 2UYAA 5FLHA 4MV2A 3OGJA 2GAUA 1NE4A 1CAWB 2EAAA 3HT2A 4Z07A 1XE7A 4R52A 1WLTA 1X7NA 2C0ZA 4JTNA 4O9EA 4XFCA 3IWZA 4MH0E 3G7DA 1O5LA 1LRHA 3U11A 5BUVA 2GC1A 3ACLA 1CAXB 1OI6A 1ZZ8A 2BYVE 2IXLA 3WW2A 2O1QA 3FZ3A 3WW4A 2BNOA 1DGWA 3NL1A 5EZWA 2XGXA 1PMIA 2Y0OA 3B02A 3U0ZA 3D82A 1YFXA 1RL3A 4BIFA 3TNQA 4HZFA 2D5HA 1J3PA 1UIKA 3E5XA 4EROA 2PFWA 1J3QA 1ZZCA 4XFHA 3D0SA 4HBNA 3OTFA 1YFUA 2K0GA 5KBFA 4KL1A 2H6CA 3USSA 3RYRA 2PAMA 1LR5A 4BHPA 1CGPA 4XF0A 1XRUA 5KHKA 2EA7A 2I45A 2OPKA 3ST7A 4XF9A 3RDIA 3ROUA 4PIYA 4FAHA 3RNSA 2F4PA 3H8UA 3SHRA 3TNPB 4TLFA 3DKWA 4XF3A 4ZU4A 4EWEA 2GC2A 4IERA 4RD7A 4QXKA 1IPJA 3MPBA 1RC6A 4YARA 4YRDA 4IEYA 4XFGA 2Q30A 4XF4A 3IBMA 3GBFA 2O8QA 2VECA 1O3RA 4XETA 3LWCA 1WGPA 1RGSA 5I0TA 4K8FA 3CLPA 2QCSB 3VHRA 4AVAA 2GH2A 2IXHA 3H3UA 5JAXA 1X8EA 2B5HA 2MPFA 4YYOA 3UKNA 1O3QA 4IETA 4I0BA 4AVCA 4HSJA 3LZZA 1FI2A 4QGLA 3NJZA 1VP6A 3ES4A 1I5ZA 1SEFA 4R8HA 2VQAA 4IEZA 4AVBA 3MYXA 2OZJA 5I0SA 1CAUA 4B29A 4UBHA 4DINB 3BB6A 4HVQA 4Q0SA 3CJXA 4EWDA 1PM7A 2Q1ZB 1VJ2A 2WFPA 5JSOA 4MGYE 2HJIA 3FX3A 1YUDA 2Z69A 4LUMA 2IXCA 1NXMA 3E97A 2IC1A 4KU8A 4Q29A 3SCHA 3H3ZA 4I01A 4JTOA 4JVAA 1CAVB 1VR3A 4Q0UA 2BGCA 5I91A 3IDCB 1LKNA 3EBRA 2VPVA 2PTMA 1J1LA 4KWKA 4AQ2A 5F1RA 1YLLA 4A2UA 1DZTA 1J3RA 3FFQA 3KCCA 2FMYA 1EP0A 2IXJA 2D5FA 4ZU7A 4MGIE 5C8WA 5E1RA 3H1MA 4OLLA 3I59A 3QOPA 4IEPA 3CF6E 2BNNA 1ZNPA 1OMIA 3BU7A 2QDRA 5JR7B 4IEXA 3ZDSA 3FWEA 1X8MA 3IDBB 1Q5OA 4BH9A 1RUOA 5LRRA 3ETQA 1OFNA 2XLAA 3MDPA 4P9GA 1YFYA 1LB2A 1ZRFA 2EVXA 3DN7A 1GQGA 2DCTA 3OF1A 3O14A 4YSFA 3FE5A 4KU7A 5FLJA 2GC3A 2BNMA 3KGLA 3E6DA 2H0VA
chains in the Genus database with same CATH superfamily
1SDWA 1JS9A 2OYZA 1BBT1 1SDDB 3ZXLA 4AOCA 4QKBA 2JB8A 4YM2A 1UIJA 2JDMA 4LO8A 4IV3B 3NJYA 3SNMA 3LEKA 2VTXJ 2RS31 4H2AA 5FQ0A 5FZKA 5BXXA 5KR7A 5IK7A 4E4DX 1I1EA 2GU9A 4KQ7A 4WVMB 2GMMA 1ZZ7A 1ZBE3 2ZX0A 1UU6A 4O7XA 2ZCWA 3MPPG 3ZYRA 4QHOA 2YMZA 4Q0PA 4Y33A 2YBPA 2B4KA 3ZMNA 2X5IC 1NQJA 1W2UA 4DUWA 1GANA 2QQVA 2GP3A 4HK8A 2R0FA 3O0XA 4PT6A 3FC0A 5GLTA 4E4ZA 3CZJA 3VDDB 4QXCA 3ZXGA 5CFDB 1UY2A 4HETA 1PK6A 4MXVA 1WMEA 4WVZA 3NV4A 3WDTA 4WM8C 3JD71 2QTWB 2EXKA 4LO4B 3GBGA 5J09A 1QXJA 1NY71 5FK7A 1EV13 1PO13 3OD0A 4JHZA 1RUD2 1VIWB 2XLFA 5GLWA 1QHDA 1QXRA 5CNAA 4LUKA 3VZLA 4BISA 5IVEA 4CPBD 2L9LA 1YWKA 3SXWA 2NN8A 1KITA 3ZFEC 4I30A 1CZSA 3I8TA 3NRUA 5L19A 4NAMA 3TEXA 1UD1A 1DCSA 3V56A 1URXA 2XKOA 1MEC1 1UYZA 5BNQA 4UXAA 2A73B 1DQ0A 1UCXA 3AZXA 2W1QA 3SMHA 2R072 4IGQA 5IHRA 1CAWA 2D6OX 4GMP0 4LIVA 3VZJA 4RSUA 1LHUA 3M3CA 3FHIB 5IUQA 3WDYA 1DQ4A 4AI2A 1PGL1 4NO4A 4QX7A 4P9JA 3LAGA 4B7EA 1OSGA 4GA9A 4AW7A 3LCPA 2JJ6A 1Q8QA 3PVOA 3TEWA 2P6HA 5IVVA 5HCBA 1QJX3 4RHV1 4FOYA 5CFCB 1IGOA 2OPWA 1F4AA 4COVA 4CCEA 5T3NA 2FQPA 5M0TA 1ENQA 2FBEA 2VJXA 2CTVA 2B9VA 2PAEA 3OGSA 4FOQA 5KC5A 4N43B 1YQ6A 1N1SA 5CVRA 4MGKE 4XJ8A 5FPAA 1BXHA 5LY1A 4E2QA 4ITCA 2Z2SB 1NE6A 3C3VA 3MGUA 4OHZA 4M00A 1R083 3CDZB 2ZX3A 4CVUA 1NCRB 3HD8B 1JOBA 4P9WA 4LHSA 2Q5TA 2FCVA 1GWMA 2QQOA 1BVP1 3VL8A 4XIKA 3E5QA 4AZZA 4GWJA 3A4UA 5C4WB 3B01A 1PZ8A 1ND3B 2R32A 4MX3A 4AFDA 2A5ZA 4K21A 5IYYA 5IK8A 5ABJB 4FXKB 1NQDA 2DVAA 2IWGB 3VDBA 1PMHX 2WT0A 1WUVA 5FWEA 1R1A3 3ZXEA 3LA2A 1SCSA 1ULEA 4MYEA 4LO7A 3UKTA 4NE9A 1RJ8A 4IV1B 4AI0A 5C3RA 4DUXA 3PU3A 3SITA 3JZVA 4XCAA 2LM3A 1W06A 2G4IA 1H1IA 2AEYA 4IEOA 4P9LA 4OQ9A 5FO7B 1SMVA 3M3OA 4LTAA 3JU9A 2TEPA 3GZEA 1YQCA 2RMU3 4RQPB 5FPZA 3THCA 5BYNA 5KHJA 4KH9A 4V1PA 4N53C 5BY5A 1JUIA 5FXWA 5B4NA 1CONA 2QBXA 1ZVFA 3Q8AA 2PHRA 4OVEA 1OA2A 2Y6FA 3GALA 5FYHA 3OG2A 4LBLA 4CDUC 3O5SA 1OT5A 3H1YA 1FATA 1Y9MA 2VCCA 1QJY2 2XL9A 2Y6GA 3PMEA 3RGBA 5C71A 4KNCA 4NVPA 1MR5A 1LCLA 1VBA1 2ZGMA 1RUI3 3RZGA 1AJOA 4R9CA 4EZ4A 5JCTA 1MACA 3OUHA 1YEWA 3V65A 1UZYA 1NAEA 4MLOA 3PMSA 2W92A 4LT5A 1SPPB 5DDJ1 2YBSA 1AR73 1H8VA 3RVHA 1LOBA 1F2NA 2ORXA 3NAPA 3N9OA 1VALA 3SH4A 1TMF1 4CU9A 4GKYA 3PLQA 1CPNA 5C5TA 1ULOA 4CTEA 4TZDA 1BVVA 3I59B 3ZN5A 3MFAA 5FZ0A 4AI8A 2D6MA 1GWKA 1CZVA 3ILRA 4IEQA 4QDSA 4BB3A 2ARXA 3EQEA 1AX2A 2FDHA 5LWBA 4CEWC 2ET1A 1PVXA 1VPHA 1W3VA 2HYKA 2X5IA 1RUNA 1V6OA 2WYSA 4FPOB 5DUXA 4F7ZA 5C3SA 3O1RA 4QX0A 1RTVA 3UKVA 4K8RB 4BK4A 2WC2A 3NKTA 5JUVA 3K77A 3I2JA 3O1VA 4ONUA 1DZRA 4HSLA 2V73A 1QEXA 3LIHA 2QQKA 3PUQA 5FMOS 4WM8A 1VBC2 3IAQA 2BVBA 1GZ9A 1VBD2 2QQLA 2UWAA 2VZTA 3PIJA 2AACA 3SKJE 1OLRA 2Y6LA 1P8JA 2BERA 4YM1A 4LR4A 1F9KA 4QKDA 3TN93 4BQWA 1SFYA 2VOWA 4LNVA 4MXWA 4QQOA 5I8SA 4BXFA 1OURA 3PURA 1MS5A 3SEPA 4E9KA 1O4TA 1OLMA 1HQNA 2VZ1A 1WW4A 3VKOA 1KJRA 3OEBA 4N9HA 4Y1UA 3RJRA 2P17A 5IVYA 3ZFEA 4CP2A 1CIWA 4Z2AA 5GZCA 5L9BA 1QWRA 2ARAA 1B35B 3K75B 4EJRA 3HOBA 2WS92 5IVBA 1S0BA 1SLIA 4JGYC 2WQ8A 1J59A 2JDZA 4CU8A 3MLJA 4QX3A 5A1FA 1FOD2 1HRI2 1RJ7A 1EV12 2Y33A 4Y1ZA 3VBUB 2IXIA 4J1WA 1U12A 4NPLA 2VO5A 2DVDA 4I09A 4OMDA 4QKNA 4YM3A 2W94A 1OPMA 4PCRA 3UV9A 4FAGA 3MV11 4Q27A 2ZEWA 1PVC2 2C26A 3ECQA 3N7MA 4NMIA 1BZWA 1WWYA 1QJU1 2HWC3 4NROA 2WZPP 4D7TA 4ZHNA 2W91A 2DBIA 3A22A 2HWD3 2WNOA 1AUYA 4HK9A 4Q0VA 5FMOL 1S55A 4ZZ8A 5A80A 3AKSA 3OUIA 2K9ZA 2F6BA 5FPLA 3MV01 1GQPA 3PJYA 2UY8A 3AVSA 2SLIA 3SH3A 5FWJA 1JYXA 3OUJA 5IK5A 4K6BA 1ZBE1 2ZGKA 4DQAA 1WBFA 1TEIA 4FFGA 3EHKA 2ENRA 4H55A 4LBQD 3OY8B 3SQOA 5CISA 3KV5A 4GIQA 4YNIA 4C90A 1JYCA 4IQPA 4MV2A 4R4ZA 2A3WA 3AXEA 4NR1A 3DYPA 3HT2A 1W28A 4XDPA 2AGSA 1A6CA 1WLTA 1QQP2 1X7NA 4JTNA 4XFCA 4ES9A 3C7HA 2HWF2 3IWZA 4CUCA 4MH0E 2LTNA 1C5HA 2ZABA 4YGBA 1GOFA 1LRHA 3WF4A 1LEMA 1AL22 5CBLA 3AC0A 2VR4A 1TME3 2BYVE 3RWNA 2D44A 1UU4A 2W3JA 1EV11 1PO11 3WW2A 2P34A 2WA3A 4YVSA 2D43A 5GZEA 1WW6A 2GNBA 3WG2A 4O61A 5EZWA 2XGXA 2Y0OA 3D82A 1BMV1 4G9SB 1YFXA 2WWUA 5A32B 1RUJ2 4HZFA 4N53A 3MUZ1 4UOJA 2CYFA 3A0KA 2WAAA 5DXDA 1D2QA 1W6PB 2VVFA 3KQRA 4Q4Y2 3VHPA 4CDUA 4RS5B 1BEV2 3BPSA 3RWKX 3R0RA 1W6NB 3V0AA 4N8MA 1J3QA 1ZZCA 4XFHA 3VUOA 2R16A 1XNBA 3AYCA 3D0SA 3I3QA 3LEGA 5HPOA 1RUE3 3T08A 1A8MA 2BWCA 4HBNA 5JZGC 2K0GA 3EB7A 4Y22A 4CDQB 3DCQA 2Y26A 1QJX1 1WCKA 2WLPA 2W39A 2ZACA 3ZFFC 2JKBA 3CZUA 1C1LA 1C8M2 2H6CA 3MUY1 1HX6A 3D8CA 1LR5A 1HKDA 1RUH3 2VD7A 4HANA 4NWWA 3TWIA 3JBG3 4ISQA 4E8CA 5KHKA 1CZTA 3KB5A 3R4DB 3ROUA 1CR7A 3ZOIA 4AVSA 4FAHA 5FO8B 3ITQA 1MS3A 1R081 1W6MA 1XNAA 2F4PA 1ZYBA 2QFEA 3U75A 4EWEA 5BNPB 3MFCA 1D4VB 2GC2A 1PO22 1W8OA 2VUDA 2ZGPA 3AYEA 2X53S 3UESA 1F4HA 2PXJA 1IPJA 4YM0A 3VL9A 1J1TA 3PUIA 4BK5A 3I97A 2RDRA 3VBSC 4YARA 1N47A 4TSVA 1W2OA 4XXPA 4MSVA 4AAPA 2IVIB 1HXS3 4EE2A 4OUMA 4NHMA 2NP0A 4GKXA 3WQ7A 4CEYA 4I0WB 2G1MA 1HN1A 2VQ0A 1LOFA 1O3RA 5FP9A 3WG3A 1RGSA 1R1A1 5D8AA 4JQTA 5FY5A 3VD3A 3KV9A 3VHRA 1AYN2 3MLLA 4Q4V2 2XVLA 4XZUG 4AVAA 2JENA 2YBKA 5FYTA 1NLQA 5FPBA 3WG4A 2A1XA 2JDYA 3W20A 2IXHA 3WNPA 5K9YA 1QOTA 1X8EA 4QPGB 5LBBA 5JR2A 3UNPA 3A7QA 2VTFA 2RMU1 4IETA 5IT6A 2JG9B 4XBQA 4IL7A 4AHZA 2VG9A 3LZZA 1FI2A 2ZGSA 4JGYA 4BQXA 4FI9A 4QGLA 1GUIA 3S5AA 3LEMA 4XQDA 4PDWC 1GOGA 2Y64A 4W65A 3WSOA 2FCUA 1E5IA 2QQUA 5A3UA 3TN92 5LZ6A 1SEFA 2R1DA 5ACA2 1G9BA 2WNUC 1J84A 1COV2 1AR63 1SLLA 3DPRB 3KHBA 4QX8A 3VKLA 3MYXA 2OZJA 4AR2A 2BBVA 1RUI1 4QPYA 5A1LA 1WD4A 2JB4A 2W08A 5FMDA 3VGIA 4B1LA 1HQWA 5B4XA 3KCXA 2VL4A 1AR71 3CJXA 2J22A 4H3WA 1JYNA 4S2DA 3ZSKA 3ZXKA 2WFPA 3P3PA 2FD8A 3VD4A 3HR9A 5JSOA 1BK1A 2HJIA 3SLIA 4M3CE 2WDBA 3BIEA 3AX4A 4KU8A 3DXTA 4Q29A 1S2KA 2QQJA 2XJPA 3AKRA 1QOSA 2QQWA 5FIXA 3ACFA 1GZCA 3ZFGC 4AWDA 5FTTC 3PU8A 3PUHA 1CAVB 4BLIA 1HRV3 3Q8EA 3G6JB 4E4HA 1S0DA 5I91A 1LKNA 3BN6A 4GH4A 1KGYA 2VULA 4YW1A 3WF2A 1JZ6A 1A78A 2WNVB 2ZMNA 1NLRA 3IZOA 4KWKA 4LIUA 2D6NA 1T6BX 2V5DA 4Q1PA 4YW7A 3AXDA 4CDWA 5T52A 1KXGA 1J3RA 4Y20A 4EN0A 2HWE2 2JECA 2GMEA 4PLOA 1EP0A 1K5MA 2CU5A 2E7QA 1SFPA 3Q8FA 3CBNA 4M3CB 5F3CA 1E5RA 3O7OA 4DEQA 3H1MA 3B93A 4BA6A 1MZEA 3HWJA 5L7OA 2BNNA 3RQ0A 3TN91 1ASJ2 2QDRA 5JR7B 2QKDA 4P9XA 1GV9A 4IEXA 3BVCA 2CDPA 1J83A 4OHXA 3VZMA 4C1XA 2Y0IA 2W47A 5C9AB 3FMGA 3IDBB 3ZYPA 4UFMA 4BCUA 3VD9A 1ND2B 3N35A 1DQ1A 5D2AA 5LRRA 2ZOEB 2BZDA 3T3YA 4CCCA 4A6SA 4Y5SA 1UU5A 2P3IA 1G8WA 4P9GA 2AENA 4UW3A 5FZBA 3WP5A 1VB4A 5DG1A 1Y43B 2P5BA 2VOKA 2ZGUA 2PLV3 4COZA 2UU8A 2AUYA 2EVXA 3DN7A 4FPCA 4C0BA 1HQLA 1WMDA 3OF1A 4OZXA 4JDMA 4BLJA 3FE5A 2QUOA 4AHWA 4CE8A 1XOYA 4G4FA 2CGNA 5JIAA 5JZGA 2GC3A 3NV2A 4LE3A 4LO6B 5LA9A 3CJIC 5DZGA 1BQPA 2R042 1RITA 3O0VA 5EJ3A 5FYVA 2HWC1 1L3JA 5BNNC 2YDEA 2C9AA 2HWD1 1OH4A 3N7JA 4NHLA 3NV1A 5E88A 4OI1A 3ZN6B 1WA6X 2GN7A 2XL7A 3HNBM 2YGLA 1YQ5A 1HLCA 1TNRA 3VBHC 4LQRA 3TEYA 3BPZA 1REFA 4IXLA 2MHFA 4GJYA 5FZLA 4UW6A 5FYMA 4A3ZA 1V6MA 3HJRA 1H1MA 1DGWX 4QMAA 3BTAA 2LROA 3ETPA 5FZMA 2DFCA 4Q1RA 3UJOA 3ZXFA 3BU0A 2TBVA 5LBEA 4FPJA 3VBSA 4AVVA 3T30A 2RVAA 3SC7X 1DGRA 1N3QA 2Z42A 3ORJA 4JKLA 4MGZE 2WSUA 3BALA 4RYDA 4PI0A 4XTMA 5JPMB 1KDMA 3BIWE 3NQHA 4IESA 4GJZA 1ZZBA 1ZZ6A 2OT7A 1U5YA 1OKQA 5FOBB 3AZVA 4LBQB 4YGCA 4XACA 2W46A 1G9FA 3CU7A 2VMIA 1TME1 3NVCA 2WYFA 3POYA 3FLRA 4LKFA 2XJUA 5FY1A 5DAPA 4DNYA 4XF1A 4ZPIA 3B69A 1MVEA 4N7UA 2ARCA 2GNDA 4CRQA 2W1WA 3AMHA 2RDNA 5I0UA 1GZWB 5FY8A 3USUA 1JYWA 2GH8A 2XHKA 1JBCA 4BQ5A 4RGAA 3TAYA 2IFRA 2JDNA 1WBLA 3L2HA 3OOXA 3ATGA 4AE2A 1AHSA 4P5YA 2IXKA 5IAXA 3FHAA 3WY6A 1XC6A 4E2GA 2ZHMA 5FQ0B 4MZUA 5FLIA 4PDWA 1UKGA 5FZGA 1N1YA 1S0CA 1XE8A 2ORZA 4Y24A 1GZTA 2VMDA 3WCRA 2BPA2 4CP9A 4AEMA 3KSCA 2QNKA 4H7LA 1RUE1 2PYTA 2QJVA 4ZKTB 3D6EA 4U36A 2BVVA 3BGAA 2RJKA 5JI7A 3GNEA 3JUUA 5AVPA 4OI2A 1UZWA 4XVHA 1K5JA 3BUCA 3NNGA 4XIOA 5FZAA 1D0GA 1R093 1D4M2 3I2OA 1QNYA 1ULFA 2ZMKA 4K7JA 2PHLA 1EAH3 1OKOA 2BQPA 3L2YA 4NHXA 4XHBA 1RUH1 1PK6B 4URTA 3BCWA 5JWPA 3ACGA 1BYHA 1XU1A 3JBG1 1OPOA 1SG3A 1WCQA 3HN1A 5LW9A 1YRZA 4GB33 1BBT2 1SLBA 1VAKA 2RE9A 2KXLA 3ZFGA 4HXCA 5JXJA 2G9GA 3WQBA 2BP6A 2WINB 1W0OA 3IDAA 3C7OA 2RS32 2Z5WA 4JV4A 3GJBA 4BQ2A 4Z92B 3RZZA 1JN2P 3MO4A 1ENRA 3S57A 4JZRA 3NNFA 3OGVA 5HV0A 1SLCA 2OUJA 3IKWA 1SFNA 4TWTA 5A7PA 5EJZB 2VNGA 5FP8A 4IEUA 1BCXA 1HXS1 3H50A 4XUTA 4ZY9A 4FP3A 1GNZA 1UOFA 3E6DA 1LNSA 1W2TA 2DTYA 4IV3C 4SLIA 4ARYA 2VUCA 2X8KA 4CZSA 3KV6A 3JB4C 5FZ3A 2JD9A 4A7ZA 5I93A 2FDGA 3PHMA 4AHYA 3B3QE 4FPHA 4ORFA 1JZ5A 2XLGA 5DZEA 3C7GA 4FBFA 3VBOB 3VHNA 4GXLA 1EUTA 3KZ4C 3ZLIA 2ET7A 1AJKA 1NY72 5AFBA 2OVUA 4YW3A 4FPEA 1SLAA 4QXBA 2QVSB 4I2OA 2YC0A 4IE4A 4RL7A 1QH6A 1ZBA3 3FUQA 3VDDC 3LQCA 5CFDC 3AM2A 4N9IA 1YIPA 5C5UA 3LDBA 4LA2A 4KBZA 4QDQA 1JZ7A 3RJ2X 2VW1A 2J7MA 3NJVA 1FXZA 1CIYA 1TNFA 1MEC2 4QQHA 2B45X 3EJKA 4EN7B 1UX7A 3B00A 1AR61 3QACA 1JHJA 5F5AA 2FDJA 3I49A 2CV6A 5L9VA 3P5BA 1W6OB 3HBZA 1BJQA 2ZXQA 1PGL2 3CJIA 5J3UA 2ADDA 1HJGA 4AFCA 5TSWA 2XJVA 1RUF3 3V0BA 4IE0A 5F6LB 4DRVA 4UW5A 5FJHA 2J1TA 2A6ZA 4K3UA 1ONAA 2WN3A 4PIZA 3H9AA 4RHV2 2P3KA 5A7QA 1H9WA 1HDKA 2PLV2 1E5SA 4QXHA 4XBLA 1Z7S3 1D0HA 5GLVA 3ZO0B 3KCYA 4HKWA 1AX0A 1AXZA 1OH3A 3VBHA 5KXCA 5H9SA 4COWA 2OQ7A 4META 1UQXA 4HN1A 4AG4A 4WM7A 2ZPXA 3AZYA 3MIBA 4LPLA 4QHBA 4YW4A 5T5JA 3UYJA 4DS0A 1HRV1 5F2SA 4HN0A 4Q4X3 2WQZC 1UPSA 3HIFA 5CFCC 3AB0A 5DAQA 4WBBA 1ACCA 3EO6A 5FY4A 1PNFA 1NYWA 2HYXA 5FZ6A 4Y1YA 3BTXA 4N43C 2HKXA 2W68A 1YYNA 4LKEA 4HKLA 5I0RA 4URAA 5BV6A 2VXRA 5LEKA 3HT1A 4HMZA 1GKBA 3T4VA 4FOWA 2DU0A 4RN5A 5F5IA 1PX3A 2ZJCA 4X6QB 1ZX5A 5DAXA 1JZ8A 3DXUA 1ZZ9A 1NCRC 3M8LA 4L97A 2YC2A 3N4MA 1H0BA 4X8PA 4XOGA 4E4SA 5C70A 1DU3D 3MIGA 1RB8G 5A6XA 3NWKA 4QX5A 4XBNA 5CG9A 2PA7A 4LLFA 1QIQA 3NAPB 2D3RA 3KVBA 1QGLA 2W5FA 2IFWA 4OMCA 5JOYA 1Q56A 2XVGA 1V6KA 2BGPA 2VCAA 4ZXKA 1L7LA 5ABJC 2BEOA 4CSWA 1S4CA 2QZ3A 3O0WA 3CO2A 4XZPA 3AJZA 1DDLA 3ZSJA 2CAUA 2BU9A 2D6PA 2PLV1 1W99A 2UWBA 5FV3A 5FZEA 5FYUA 3M3IA 4HT1T 1VBE3 4TLGA 1V00A 2QDNA 1Y3TA 3NNLA 4L8QA 4YW6A 3VZKA 2Q4SA 5K0UC 1OLME 1JOPA 3WINE 2V09A 2P4EA 2MEV3 3CNAA 4XFBA 4XILA 5EPAA 2OX0A 1RVF3 1VBA2 1TQ5A 4RQPC 1KFUL 2A70A 5LA0A 3ACHA 1XNDA 5KXDA 3PJQA 3VDCA 2TNFA 3IMNA 2LW8A 3GXUA 1TG7A 2ZGTA 5DDJ2 2E7TA 5FZ8A 4PIXA 1NOVA 4WM8B 2X05A 4A42A 2VU9A 2Q1MA 2R1BA 2UYBA 2PHWA 1AR83 1H2LA 1PNGA 1TMF2 1XB9A 2D3PA 2VUJA 1Q3EA 3IPVA 4XUQA 1DF0A 4HLTA 1IKPA 3CEWA 4CUBA 4MXWB 1VBB3 4NN0A 4MUVA 1MS4A 4R9DA 4YFWA 1U5ZA 2ZGOA 2VZVA 4UFJA 3I3DA 1POQA 3P6BA 3T0DA 1VMJA 5B2GB 1UF2C 4PBOA 3AL5A 5F39A 5LBCA 3UGHA 2GMPA 1NE4A 2WQ4A 3ZFEB 4A7KA 5GZDA 4Z07A 1YO8A 4CXYA 1UXXX 3HNMA 2C0ZA 3L9JT 2VW0A 4O9EA 5FAXA 3ABZA 5IW0A 5F9TA 5IATA 2Y34A 4ZS2A 5J36A 2WNEA 1ODNA 1Z78A 4IV3A 1G86A 3U11A 3ACLA 1SBFA 5DG2A 1W04A 1OI6A 5A3WA 1HN0A 1ZZ8A 3LEIA 3HNYM 4D6QA 2O1QA 4WVMA 1B09A 4Z8BA 2BNOA 4RA0A 3WQ0A 3NL1A 3SKVA 4IUGA 4LXLA 1PGSA 1PMIA 3B02A 2RS53 4NRPA 5J96B 3U0ZA 3BKZA 3OYWA 3KV4A 4NIHA 1UMHA 1JZ4A 3RI9A 1AYM3 1TVGA 3TNQA 1X50A 2R6QA 4HG6B 1PX4A 1A34A 1T6GC 2Y6JA 1J3PA 5A6ZA 4CDXA 1S2EA 4QPIA 4OHYA 3VDDA 1MQTA 1UIKA 1H6YA 4EROA 2XOMA 4CP1A 4LBNA 2PFWA 3O1PA 1QJFA 3NNMA 4JKMA 5AC93 2BGOA 1FV3A 1SCRA 3N7KA 4FOVA 5GALA 4ZONA 5CEHA 1DHKB 2WZ8A 3OTFA 4KWUA 4WVWA 1YFUA 4IDZA 3J7HA 5KBFA 3OBTA 5ANQA 4KL1A 5JPNB 3J7MA 3BTZA 2ZAAA 3HBKA 2LUWA 4Q8LA 5IVJA 1BHGA 4LORA 2HH9A 3VZOA 3H8OA 1XSRA 2ZZQA 3RYRA 5FXZA 3EMRA 3T2QA 4BHPA 1CGPA 1W8TA 2YPDA 4S2FA 2BFUS 4XF0A 3WV6A 1R091 1XSQA 2ZHNA 1B35C 4YZ4A 2NMOA 4YZ5A 3AZZA 4UF0A 3VD7A 3RFRA 1EAH1 2EA7A 3WDUA 3ST7A 3RDIA 2VZ3A 1QNWA 4OI0A 1QJU2 3A21A 4CCKA 3H8UA 1JTZX 4QB1A 4ZU4A 5ANNA 2CGOA 4QXKA 1F5FA 1O91A 3VBUC 5BNOB 4GB31 3GJAA 2JWPA 3IAPA 4YVSB 4UT5A 1KQRA 2FDIA 3UETA 3U78A 3FFZA 2YV8A 4FPLA 1RC6A 5FPVA 1ALYA 2W0XA 4MO3M 5T5PA 3SH5A 1VRBA 3LFMA 4XFGA 5FUPA 1ZBE2 2Q30A 4XF4A 3AMQA 3IBMA 3M3EA 4Y3OA 3PTYA 5JI9A 1PIV3 5A6QA 3ME2A 1YI9A 5F6KA 4B1MA 2ZHKA 1M06G 1W2AX 1IHMA 2BV4A 5FZ7A 5ISLA 4QX1A 4XETA 1GU3A 2DCYA 3C7EA 1WGPA 4L0PA 5IFPA 4K9SA 4HONA 2DVFA 3V0AB 3WNNA 1OXCA 5J37A 2JDUA 5LA1A 4QD2A 4MG2A 3WNLA 3BI3A 4DZGA 3VB9A 4YGEA 3MEPA 2GH2A 2XQXA 1KEXA 4BOWA 1L7QA 3CMGA 3S5QA 4AHXA 2BFUL 4PQQA 1TE1B 5JAXA 4BQYA 4M01A 2OS2A 3CIHA 1UN1A 3H42B 4I0BA 5EP9A 3RMYA 3RMXA 1PO12 3UT0A 2VE1A 2X09A 1ENSA 4HSJA 2A6XA 2QQIA 1ZBA1 2RJ2A 5JOXA 1SACA 3I2GA 3POGA 5G05L 4D3WA 1BMV2 1CESA 5FZ1A 1I5ZA 4R8HA 2VQAA 4IEZA 3WP4A 1W6MB 3VBRB 5IVCA 1JW6A 4AVBA 2EXJA 2W1SA 1NT0A 4XUOA 5K0UA 4OHVA 5T55A 5F3EA 3FHQA 5H9RA 5LASA 1NKGA 4HVQA 4Q0SA 2JIJA 2CWSA 1E57A 4LKDA 3ZXJA 2EICA 3C8XA 4CCMA 5AFEA 1MZFA 1RUF1 1K3IA 4L99A 4CEYB 1O8SA 1VAVA 2ILMA 1QJX2 2VZQA 2OW4A 2IXCA 1KD7A 2IC1A 1C28A 5CZKA 1AR93 1Z7S1 1NCQB 5D8AB 1JYIA 1GP6A 4OUSA 4RS5C 4LO5B 5AVAA 3K3NA 3AFGA 3H3ZA 2DV9A 4I01A 1FMD3 4BXSV 2NLRA 5DUWA 4DB5A 4FTSA 1OUSA 1K45A 4RR3B 3AP9A 3EBRA 4GQ7A 4XJUA 3CHXA 1NZIA 2VPVA 1S1AA 2D97A 2RM23 1R082 3PL0A 4CDQC 5JOWA 2D6LX 1XNTA 2GSYA 3GZTB 4Q4X1 5JXGA 3DGTA 1OD3A 4YFZA 1RMU3 1SPPA 4XHXA 3AYAA 3LGRA 5FRAA 3LSDA 3GGLA 3K46A 4LOSA 3ZPOA 1G9AA 1DZTA 1LGNA 3AMNA 2VMEA 4MHUA 1IZ3A 4S2HA 2FMYA 2IXJA 1G7YA 2JG8B 4EQVA 2XG3A 4ZU7A 4MGIE 3HQRA 4D6RA 5E1RA 1NA1B 1MPXA 1MZ6A 4OLLA 3I59A 1JXNA 4IEPA 3CF6E 3WNMA 3WQ1A 3I2IA 3BU7A 5BNPC 2AREA 4AAXA 4GZ9A 1H4GA 2R063 2BRTA 3ZDSA 3O1OA 4F3JA 1NXD1 1X8MA 2ES3A 1R1A2 4K1YA 2CY6A 2Y60A 4BQ1A 1WLWA 3KM5A 4C0HA 4FXGB 4LJHA 2B46X 3WOGA 4CXWA 1WLDA 2J1EA 5I0DA 3HQUA 1YFYA 2SBAA 5CYYA 1LB2A 4YGDA 3WDVA 1ZRFA 3NV3A 2RV9A 2RMU2 2BOJA 1YQ8A 1GQGA 1A3KA 1AXYA 5KWRA 1LU1A 4KU7A 4YSFA 5FLJA 2JE8A 2BWAA 4QQPA 4AVTA 1VBE1 1AZDA 1JI6A 2RS52 4ATFA 1NUKA 1F8VA 2BNMA 3KGLA 4QHZA 4GH4B 2H0VA 1FPN3 1REEA 4AEKA 1YQ2A 2MEV1 2DFBA 4KI5M 3RYPA 4GD4A 4AI1A 1RVF1 5F3GA 3M2MA 1RUI2 4XEZA 4CDWB 3LB9A 3WUCA 1W9FA 1WCSA 3I7DA 4Y20B 4CEWA 2WAOA 4QU1A 2PELA 3K2OA 2ETEA 3K4DA 1K5MB 4KWLA 4QM8A 4OFGA 2D93A 1AR72 2C1FA 3ELNA 3PIGA 3ZSMA 1BKZA 5KHHA 4B7KA 2O8OA 4RFT0 3PTRB 3T0BA 4PLMA 4BZ4A 2WO7A 4CCDA 1AR81 5C33A 3VBFB 5L7OB 2W2IA 1CJPA 2A75A 4CCNA 3VKFC 3DPRC 1WD3A 4JQRA 5FFOC 5H9QA 1VBB1 3ZYGA 4BQ4A 1SBDA 4XW3A 2ZKLA 4DFSA 3I2KA 4JC1A 4WZCA 2V5YA 2P3YA 2HWB3 4LLOA 2AH2A 4LMFA 4XJ9A 2YU2A 2Y8KA 5T5LA 1U5XA 2DUPA 1D2SA 3QH6A 1YC61 1ZRCA 2ZS6B 1UKRA 3WNXA 2VNVA 3IIAA 4MOAA 4D8MA 3KS7A 2VZSA 2UWCA 2ZGNA 2UY9A 3WVJA 1IOAA 1JYTA 5A3PA 1H8TB 4JGZC 4EYUA 1DFQA 3AP7A 2YC4A 3W5MA 3S7EA 2H6BA 4LHKA 2O0OA 3WR0A 4EZHA 4XQWA 1UW8A 2WZR3 2RS51 3IIIA 2D7FA 5F5QA 2A3XA 5BPXA 3AP6A 1PIV2 3OY8A 4K20A 4CU7A 4YG3A 1AYM1 2WNVC 2DTWA 3U37A 3POBA 3W59A 3WNOA 1DQ5A 3W58A 5CB7A 3MI8A 2KD7A 1GOHA 1V6NA 3I2FA 1GR3A 1W6QA 4L11A 1OOPB 4OYUA 5FZOA 1H2NA 3A23A 1G6NA 2WFF3 3TRSB 5AC91 4RGGA 4CA9A 1QMJA 5GZFA 1T2XA 2RJLA 2WO2A 3R6SA 4Q0QA 2QQNA 4FQZA 2WO1A 3AVRA 1LGBA 3VBSB 1LHNA 3UK9A 1H6XA 1XBFA 5FUIA 4AFAA 1ZRRA 3IDEA 1DQ6A 1H2KA 1ULDA 5KHGA 3HAGA 1MZ5A 4SBVA 3T2TA 2QQPA 3POWA 4QGMA 1W0NA 5A33B 1AX1A 2JEMA 2HWC2 3U10A 2WA4A 2XB6C 2HWD2 3KGZA 1UYYA 4CPBA 1V70A 5DMYA 3BYWA 4YW2A 1JZ3A 4UFHA 4UWDA 2XBO3 2CL2A 1VMHA 2K2SA 2ZEXA 5LRSA 1RYYA 4O9GA 2IVJA 3RZLA 3RG0A 5A7WA 1Q8SA 4M4PA 3N9QA 2XWJB 2Y6KA 4XMIA 4AQTA 2ID4A 3E1F1 1CPMA 4L2NA 1PIV1 5JVVA 2WABA 2E51A 4M3CF 3THTA 2ZGRA 1WKYA 4OQ8A 1ST8A 1VRH3 2EIDA 3POSA 4W6XA 1AR92 3SCGA 2WLQA 4QX2A 4Q8KA 3BTYA 4PBPA 5E6HA 4AEJA 2D40A 1CAUB 1UY1A 1HV1A 1HB3A 2GP5A 2BTVC 1W8FA 1J58A 3DL3A 2EXIA 1IS6A 1JH5A 3GYDA 1V9U3 3RS6A 4Q4W3 4WV8A 4EWAA 4LBJA 3S30A 3ZXAC 3UGFA 3FUOA 5EHDA 5IJRA 5JSRA 4YVWB 1OUXA 1DYOA 3J4UH 2JDPA 5HCFA 4XABA 3SISA 1TME2 1VAMA 1KS4A 1LESA 5I8YA 1O3TA 1N1TA 2YPJA 5C8CB 2K46A 4DMIA 3WF0A 4UAPA 4BMBA 2ZHLA 4TTGA 1UNBA 3FBYA 4HPKA 5G04L 1ZREA 3PUAA 4NHKA 2YG0A 1O4ZA 4IGPA 3ZPYA 3IT8A 4LKSA 3ZFFA 3RPQA 2A6WA 2Q0AA 4X6RB 4AYUA 4FCAA 3T2OA 1JUHA 2C24A 1W2NA 3CKHA 3WG1A 4Q26A 3RI8A 3WX5A 4XTPA 3KMHA 1CX1A 4DO0A 4XDQA 4WVVA 2I74A 5FZFA 2W87A 1LHVA 3ASIA 4LE4A 2YB7A 2PHDA 3ZYHA 1QOOA 2IUWA 1IQAA 4FFHA 4NRQA 3H7JA 1RUE2 3W5NA 4XURA 2XKPA 4LBMA 1WMFA 4LA3A 5I8TA 3H1WA 3D0JA 1O4YA 3LPFA 3LD8A 3J9SA 5FCCA 4XJWA 5FPXA 1AR91 4FTBA 3E5UA 5JLVA 3J7NA 1RUH2 4BJ0A 1UOBA 5K4LA 1FMD1 4AEDC 2J1VA 3JBG2 1XYPA 3DPRA 2RS13 3O12A 4P02B 3NSTA 3R05A 1ZM1A 2E9QA 3WZ1A 1RUD3 3ZVXA 5LA2A 3EYPA 2RM21 3M4FA 4CYDA 3HEIA 1WCDJ 1O3SA 3O1UA 1DLLA 1RMU1 1CQ9A 3U4XA 4ET7A 1S0JA 1EPZA 2YU1A 3OPWA 4EN6B 5FY9A 4DRRA 2DWRA 2VZOA 1EYBA 2DYCA 1JOJA 5FR3A 4KGGA 4XFAA 1UPIA 2R073 2E33A 2NMNA 1HXS2 4JGZA 4HKOA 1CVNA 2Z79A 3OJBA 4ARXA 2ATFA 1IS3A 3FN9A 4OUEA 3WP6A 2R061 2VZUA 3M70A 4AFMA 5HBAA 1CAVA 1W9WA 3FJSA 2AYHA 2VC9A 4FPKA 3MIDA 4QWNA 5F5CA 3GZAA 5GKAC 5FMCA 4AXOA 4BQ3A 1YJKA 1NZCA 2A3YA 4PLNA 4ZXEA 3KT7A 1DYPA 3ES1A 5FBZA 4NIIA 2B9UA 1O7FA 2WNUA 4D7SA 3AP5A 3POEA 1CAXA 2GDFA 2NPIA 5FKBA 2MNGA 3ENRA 1HW5A 4AQ6A 4M4RA 2Z4FA 1ZA7A 3LA7A 4XFIA 5IVFA 3VBHB 1QF3A 4YZ1A 2VXJA 3Q8BA 2HBTA 2J1UA 5FP4A 4WM7B 3O1SA 3D3AA 3M3QA 4DEVA 4LULA 2WZR2 5FZHA 4OHWA 3WW1A 4AI9A 1FYUA 1LODA 1GQHA 4A45A 4L9BA 3K51A 3MBWA 1PGW1 5FZ4A 5ERLA 3VBOC 1FPN1 4K1ZA 3T1MA 2WSVA 4XYXA 1AR62 3ZR6A 4MGTA 2VMHA 3ON7A 4IE7A 4J1XA 2EALA 2ZGQA 3I4IA 3R4UA 1W03A 3TB0A 4F8AA 5IFTA 3MZHA 1PZ7A 5FKCA 5T5OA 5KHIA 3ZX7A 1DG6A 2YYOA 2HEVF 4G3YC 3C2UA 3ZIWA 1C8NA 4J25A 5CG8A 4N7IA 5IAVA 3URFA 5J7MA 1OD5A 1GYKA 5A7NA 1X9TA 3HN3A 4L92A 1CD3G 5SV8A 2GAUA 2DCJA 3ZSEA 3J26N 4O65A 1CAWB 2VH9A 5E89A 2EAAA 2XQRA 4FPFA 3MW2A 4R52A 1JYVA 2HWB1 2VNOA 1RINA 2J1RA 1XYOA 4MHRA 4P5HA 4MVTA 1YIFA 4YW5A 5HCHA 1HRV2 2PHXA 1O5LA 4MGQA 4DUVA 4W4ZA 2XUMA 1K12A 1US3A 5FXVA 5BUVA 3B94A 2JIGA 2FZ2A 2VCBA 5HV4A 2XR4A 3S6PA 4P08A 1SBEA 3WNKA 2IXLA 2VQUA 5K7PA 3WW4A 2ZTNA 3WP3A 2XJQA 2XBO2 4DIQA 2VW2A 5FJKA 1QJY3 2VUAA 2P37A 4BM8A 5F8PA 1JZ2A 2A6VA 2WZR1 3IM0A 5FBJA 3VKMA 5JDBA 4KGQA 3QLQA 1U0AA 3THPA 3WF1A 1G9CA 4Q5OA 4I3GA 3AMPA 1R64A 2FZ1A 4AFBA 1Y7BA 3VZNA 3MLKA 3INAA 1S0GA 3IPVB 4LK7A 1S2BA 2WFF1 1H1AA 2OXBA 2PHFA 1L7RA 1PM4A 2FMDA 2AR6A 4LBQA 5GLZA 2RG4A 5A1AA 5BNNA 3DKQA 5FMBA 1HB1A 5FZ9A 3MF9A 3EXUA 3USSA 1V0AA 2WIIB 2XUEA 4LBOA 5F3IA 2KM2A 2NYYA 2V4AA 4UI9L 1GZWA 3B9CA 1Q8VA 2I45A 4H7MA 2OPKA 4XF9A 4C91A 4BPZA 4PIYA 4C1WA 3RNSA 3TNPB 4XF3A 3DKWA 2CSGA 5J98B 4IERA 4B4RA 5F37A 2VZRA 1V6JA 1VBC3 2ZX2A 1XQNA 3MPBA 5T50A 1VBD3 3WHTA 3WEZA 1F5JA 4A6OA 5FK8A 4AEDA 4D0QA 3KVAA 5A32A 1N3OA 4YRDA 5FYZA 3VN4A 2XBO1 4AGVA 3OYWB 2KR2A 4YZ2A 2JX9A 1GLHA 3GBFA 5JXIA 4AL9A 1UAIA 3JB8A 2DUQA 4QB6A 3UGGA 4CDXB 4QPIB 5JOZA 1S0EA 1MQTB 5E8AA 4F83A 1GWLA 1XJAA 2BDRA 3I3BA 2XVKA 5I0TA 1UOJA 2WS93 1VRH1 3CLPA 1QXPA 1UX6A 2QCSB 1MVQA 3J8F1 3WDXA 5C4WC 4AK3A 1ND3C 2RS12 1FOD3 1HRI3 1V9U1 4EN9B 4Z1VA 2BW8A 3H3UA 3K48A 4Q4W1 4XQ4A 2B5HA 3ZKYA 4ZZ5A 3AP4A 1OF3A 3RZMA 2VM9A 3UKNA 1XPWA 1OA3A 4AVCA 3F2ZA 5C9AC 3A0NA 1PVC3 2YUEA 1UYXA 4UF0B 1MS8A 3N36A 3NJZA 1VP6A 2WL1A 4C8DA 2X5IB 4IV1C 4JX0A 5KXEA 4BMEA 1GNYA 2WKKA 2G9ZA 3MIEA 3ZXDA 3N9PA 4XMAA 3U1XA 4JHTA 3I3MA 2GN3A 2G19A 4B29A 4UBHA 2JKXA 4KG8A 4Y1VA 5KXBA 1GMMA 1PM7A 3JXSA 1OVSA 1RHI3 3VBOA 1VJ2A 4MGYE 2LRPA 2P6CA 3GF6A 5EIYB 3IMMA 3ZSLA 2VBBA 1YUDA 3DEMA 4LUMA 1JU4A 1UY4A 3IB3A 2VZPA 3V64A 3VV1A 1GP5A 2C4XA 5L36A 4FPYA 1QQP3 2VAUA 2CWMA 4M0NA 4D94A 5LK7B 1R092 1WLCA 2HWF3 3LDRA 4JTOA 1RUG3 4XCBA 4IGOA 4XAEA 1EAH2 2J1AA 3I2DA 2HEWF 3IDCB 2AEZA 1AL23 4KMQA 4HL0A 1J1LA 2RS11 4AQ2A 2ARBA 2XJSA 1YLLA 1OVPA 2AZ5A 1RUD1 1W6OA 5FY0A 4A2UA 4GB32 2A71A 4Q2FA 5F32A 1V6IA 1W8WA 1X9PA 1H2MA 1GP4A 3FFQA 3KCCA 1HB2A 5CKMA 2D5FA 2WR9A 1RUJ3 2PHTA 2W9XA 4RGKA 5C8WA 1C57A 4K40A 4QPWA 1E5HA 3ILNA 1POV0 3QOPA 1YJLA 1ZNPA 4Q4Y3 1OMIA 5CAZA 2R071 4YZ3A 4DY5A 1Z0HA 1BEV3 5BNOC 2QE3A 5K0UB 2XPJA 2E6VA 1FNZA 4FVVA 3FWEA 3ACIA 3N7LA 2YGMA 4YVSC 1SZBA 5CFDA 1Q5OA 5C3QA 4D6SA 2ERFA 1D7PM 1IKQA 3FBMA 1OFNA 2H0BA 2XLAA 1KRIA 3IN9A 1C5IA 2ZEZA 4XE9A 3ZDVA 1JHNA 2DBNA 1PMJX 2WT2A 5A7SA 3ZR5A 4AGGA 2XHNA 1C8M3 3OB8A 1W8ZA 2ADEA 3LIGA 3LSEA 1LTEA 3BOWA 1KFXL 3O14A 3DUIA 4DXRA 1W8HA 4KG0A 4INDA 3WD5A 1X36A 2VTXA 2VOXA 1ZBA2 4CUAA 1OA4A 2G9FA 3AFKA 1W0PA 1W8UA 2E31A 2B42B 3BODA 3ZYIB 1PO23 4QM9A 1VLNA 4QQ2A 3APBA 5EFUA 5EXOA 3CL1A 4UBGA 3S0MA 1EY2A 3OGRA 2DU1A 4DXZA 1Y4WA 2RDQA 1OHFA 4Y5Z0 1N3PA 4HOOA 2J1SA 2Q8CA 3I54A 1RUF2 2EIEA 2VVEA 2X10A 3ALQA 3VBRC 3WLUA 4B4PA 5CFCA 5HCAA 4N53B 3KHCA 1ENXA 2O14A 2RR13 1X33A 2EF6A 4QQLA 3WT3A 1AYN3 4N43A 1Z7S2 4Q4V3 4DY3A 4CDUB 2F17A 4XAAA 1APNA 1OC1A 4FO9A 5C6CA 1IPSA 1STMA 1QJZA 2EIGA 5FXXA 1UZZA 4GWIA 1ZRDA 5KC6A 1NCRA 2YXSA 2NZ9A 3PVNA 4CEYC 2HLEA 3KQ4B 4Q4X2 1ZRIA 2DF7A 4Y22B 4Y4YA 1LOFC 4ASLA 4MADA 2CNAA 4KWJA 3DV8A 4W8JA 5FDBA 3O1MA 4BWOA 3SEEA 2NQYA 1NCQC 5D8AC 5C4WA 4LK6A 1OF4A 1ND3A 2VQTA 3NW4A 3FLTA 1LOGA 3NNJA 4CP0A 3GBWA 5LK5A 5ACA3 1DGLA 1QJY1 1OQDA 4W6WA 1COV3 1RUC3 3HPNA 4RR3C 4W6YA 4P00B 4Z2WA 5ABJA 4I3PA 2WN2A 3OPZA 5GLUA 1O8PA 4FT8A 2TUNA 4FQ4A 5EYXA 5C9AA 5A7OA 5CKNA 2OZ6A 5JIUA 5J1XA 4NIAA 4CEWB 5LB6A 2XONA 3KT4A 3LOIA 3OEAA 4GALA 4IV1A 1KS5A 2JG8C 1LOCA 2YY1A 2JE9A 2VBPA 4R9AA 1NA1C 1R1ZA 3H8RA 2E53A 3QH7A 4JCKA 5EYYA 2OA2A 4E27A 4RQPA 2Q8OA 1HJFA 2PAKA 2OUHA 2Y6HA 2ZA9A 4COYA 5LEJA 4OI4A 5FPUA 5FZIA 4Y1XA 4GMP3 2WT1A 1UYPA 3NO8A 3R4SA 1O5UA 1VBE2 5JMCA 3H7YA 4JAAA 1H4HA 3RZKA 1Q8PA 1N1VA 4A41A 1W8NA 2DVBA 2E7AA 1FAYA 3N3HA 1UWWA 2MEV2 3M1HA 1FX5A 1FT9A 2J42A 4DXSA 4ES8A 2JDHA 2R49A 1RVF2 4WZFA 2WWSA 2HWE3 3C7FA 5FYBA 1X82A 2ZKNA 2GNMA 1VBC1 1VBD1 4JGYB 1RHI2 2N7GA 3PVBB 4A3XA 4U2AA 3AK0A 1ASJ3 1UO9A 1I6XA 1Y9QA 2LALA 3GM8A 3POJA 2A6YA 4GH4C 1AR82 3LOBA 1I5PA 1Y9GA 1VBB2 1RXFA 3LF7A 1AL0G 1Q43A 4CDWC 1AXKA 1JODA 4Y5TA 3MW3A 1SQ4A 4MGSA 1WW7A 2BUKA 2NM1A 3ILFA 3P3NA 1RUOA 1W6QB 5C3PA 1W9TA 1K5MC 1OLQA 1RUG2 2WS91 5FZOB 3U14A 5CADA 4QB2A 4YWAA 5HXMA 3LKJA 5GZGA 2GC0A 2VMFA 3NJXA 3P1IA 4A7YA 5A3TA 1O6UA 2ZX1A 3NKGA 5BNOA 3VBFC 1ULGA 5L7OC 1JMUB 1FOD1 1HRI1 3ZYJB 3HQXA 5C7GA 3AKQA 1POV3 5JSPA 1UL9A 5CKQA 3TBDA 1REDA 1XE0A 2CGPA 2D3SA 4EN8B 1PVC1 2R043 5CIRA 2ZMLA 5FYCA 3ZYBA 1OBNA 4NOTA 1F35A 2R7EB 1LHOA 1YFWA 3RZHA 3DECA 4NAOA 3T1LA 4COUA 3MF6A 3OPTA 1AYM2 4J6GA 3U07A 1S0IA 1ZA4A 1I3HA 1QY4A 4IEWA 5CU1A 5K8SA 3RYKA 1H8TC 4IEVA 4QPGC 5FP7A 2Y38A 2E26A 4LHNA 1B35A 3N9LA 1ULPA 4PI2A 2IZWA 2JG9C 3I3EA 3AL6A 5D21A 4YPJA 5A7WB 1GICA 2W1UA 5EV7A 3KWVA 2YROA 5AC92 5HXVA 5LCWL 1RHI1 1YI7A 2XH6A 3D4KA 2VBDA 1RIRA 4TYSA 3KLSA 4OCTA 2V72A 5E16A 3VBUA 3OD4A 2EAKA 1A8DA 2CAVA 2GALA 3FLPA 3E6CC 4BIOA 3ZYFA 1EPWA 2JICA 2E32A 4NUBA 5APAA 3W9AA 5A70A 2OQ6A 3LFIA 5J48A 1QQP1 1OOPC 3O1TA 2HWF1 3BOPA 3QD6A 1K42A 1RUG1 3K3OA 3VBRA 3E6BA 4HVOA 1YXWA 4HVRA 3LA3A 4AI3A 3MICA 3OSDA 1AL21 4R9BA 4EV0A 1Q8OA 3HVDA 4I02A 3AKPA 5D1IA 3W21A 3H3LA 2VY0A 1DGRN 2JE7A 4AF9A 3WF3A 3PNAA 1MS1A 1LGCA 4XFFA 3GDBA 4DOUA 4Z82A 2JDKA 2JDAA 1RUJ1 4FFFA 1WZXA 5JZGB 2VCMA 3UL2A 4HPKB 3VHOA 3WDWA 2VGDA 2X29A 4Q4Y1 3ZFFB 1NCQA 4N90A 2RR12 4GULA 4P9IA 1EUUA 1BEV1 3OGGA 2GZWA 2WZEA 1UY3A 1LOEA 3KD4A 4W50A 1YHFA 4RR3A 5DABA 4B3NA 2FHRA 3I2HA 1G9DA 4P9YA 4QU2A 4ZU5A 5HI0A 2W52A 3Q9OA 3S7IA 1QDCA 4NJ4A 2ZBJA 2R30A 1UXZA 4QGNA 1F15A 4LEJA 2PQSA 3SCFA 2KA3A 3LPGA 1D4M3 3FL7A 4JKKA 2Q8DA 3RRDA 1C8M1 2P1BA 5FYSA 4CCOA 2WUHA 1VB2A 3N9MA 2YZ4A 3K4ZA 4I0AA 2JG8A 1FV2A 4QDRA 4Y26A 4PF1A 2VOTA 1TZOA 4JDOA 1NA1A 5LY2A 4ASKA 1IPKA 1RXGA 1WA4A 2VOVA 2FDFA 1C3HA 4PJYA 1DP0A 5EJ1B 2PQQA 1RUC2 1DQ2A 1ND2C 1CJDA 1BBT3 2DURA 4LBKA 5DUVA 4E2SA 1LEDA 5FP3A 4A44A 4OULA 2D6KA 1PO21 2B39A 4QT6A 1CX4A 2RS33 1W6PA 5SV5A 2DCKA 4BE3A 1UZVA 4PQ9A 2RDSA 4YVWC 1NG0A 4GWMA 2B8MA 2E63A 4GAZA 4RS5A 3WW3A 1GBGA 4YLZA 1W6NA 2XXZA 3VD5A 4BYYA 3RSJA 4IW3A 3T2PA 3JQWA 5C8CC 4YG6A 2ZX4A 4CU6A 4IE5A 4D69A 2FCTA 3GCWA 3AKTA 1UMIA 1DYKA 1DZQA 1WW5A 2VNRA 5L9RA 1C4RA 4CDQA 3OCPA 4JGZB 3USUB 1US2A 1M4WA 4FFIA 1ULCA 3VKNA 2UYAA 5FLHA 1LECA 3OGJA 2A7AA 1PZ9A 3KT1A 4FSJA 2RR11 1AYN1 1SLTA 1XE7A 4Q4V1 3JD73 5IWFA 4NIDA 1YCIA 4PDWB 4FP2A 4LOTA 1FMD2 1IQDC 3G7DA 2WNUB 1ODMA 3ZMOA 2JD4A 4CP9B 5A3LA 2GC1A 2F4LA 4KBBA 5BNPA 4FTEA 1CAXB 1IS4A 2B7YA 2RM22 2YFUA 4M0HA 3FZ3A 2CDOA 1GNHA 1RMU2 1DGWA 1S0FA 1KDKA 4V2VA 5FY7A 1W39A 4QAWA 2BJSA 5DUUA 1HB4A 3VBFA 1MEC3 1RL3A 1W90A 4S2GA 3B7MA 3MIFA 3ZIXA 1AF9A 4BIFA 5ACA1 4XPVA 1WMXA 2D5HA 3PVEA 1COV1 1RUC1 5GM0A 5EWSA 1HIXA 1BLZA 4X8NA 5FZDA 5T54A 3TYJA 3E5XA 3TEZA 1UMZA 2GNTA 2R062 3ZFGB 5L73A 1MS9A 2PMWB 1U5IA 3LE0A 4D7YA 1LULA 4P14A 4BU2A 4ZS3A 5GJ6A 2VVDA 2XMLA 4AQSA 4RHV3 2P3JA 1DBNA 1H30A 1QKQA 1H8TA 2EIBA 3PDQA 3MHZA 4QPGA 4IE6A 1CN1A 4E8DA 4CCLA 4CXXA 4XJZA 2PAMA 2JG9A 2UURA 4A4AA 1XRUA 3HMYA 3UJQA 5DAWA 3KF5A 4ATEA 2BBAA 4GMP1 3POFA 2VMCA 2R0HA 2DUOA 5CA6A 3RZJA 1GFF2 3J7LA 1H9PA 2AC1A 3SHRA 3AJYA 4LITA 5DQ0A 2P2KA 1PGW2 1UZ0A 3DYOA 1QH7A 4TLFA 4BDVB 5FO9B 4RD7A 1FPN2 1XU2A 5A3OA 4XUNA 1DLCA 4XXAA 3MW4A 1OOPA 2HWE1 5A3NA 1KJLA 3Q8CA 2ZZJA 2ZGLA 4WM7C 3WXPA 2FDKA 5FREA 3K4AA 4IEYA 5EQUA 1PK6C 4ISRA 5A3MA 2WWJA 4UFKA 4HFSA 2O8QA 2V4VA 1ASJ1 2VECA 5A6YA 3M7AA 5C3OA 2I2SA 3F95A 3JCIA 4NIGA 4CCJA 2PN5A 2C5DA 3LWCA 4Y4RA 3T0AA 2OIIA 2QQMA 1LJ7A 3X29B 4K8FA 4FPGA 4XC9A 2YFZA 2DCZA 2DVGA 2RHPA 5DPNA 5H9PA 4R4XA 2HWB2 5A33A 2OKXA 3N9NA 3CJIB 4DXTA 1LAJA 4TXWA 3U4SA 3GZUC 4RFRB 2WNVA 5BNNB 3V0BB 3T09A 5IK4A 2MPFA 1C1FA 4YYOA 1F31A 3B5LB 1QJEA 1O3QA 1W9SA 3ZKUA 1CWPA 2VMGA 1POV1 3OBAA 2C6SA 3GHNA 1MS0A 4M3CA 2JXAA 3KF3A 1VBA3 2R041 3ES4A 3POIA 1YNAA 2WO3A 3JQXA 4UYBA 1XNKA 3GHMA 2W95A 4V2WA 5FZCA 3DYMA 3AZWA 4LHLA 5I0SA 4JRLA 5DDJ3 1CAUA 4DINB 1W9YA 4XUPA 3BB6A 5F7UA 4AEDB 5F2WA 2XWBB 1TMF3 2XDVA 1ND2A 4EWDA 2Q1ZB 3J8F3 2EXHA 4JRAA 2Q8EA 4DPNA 3MIHA 2WFF2 2PHUA 3OBZA 3H8XA 4JDNA 1OFSA 1QDOA 3VLBB 4YVWA 3FX3A 2Z69A 1UOGA 3E97A 1NXMA 4XJAA 1HV0A 3ZM8A 3AYDA 5JMOA 4QKFA 2HEYF 3CQOA 1XNCA 2D98A 5C8CA 5DN2A 3SCHA 1O59A 1FNYA 4JVAA 3VDAA 1VR3A 1SHWB 1WCUA 4Q0UA 2BGCA 1IG0A 1JU3A 2ZAHA 4YG0A 4UFLA 3WUDA 4PHZA 2YHJA 5DAVA 2PTMA 2WJSA 1UY0A 2XJRA 3WCSA 5F1RA 2XJTA 1AVBA 3ZN6A 1XXNA 1IS5A 3QBQA 5FUNA 4NWVA 5FYIA 1LHWA 4GWNA 5LATA 3THDA 3D5OA 1XYNA 1PHMA 4XDOA 3NMBA 2Q1FA 4NPRA 4NPMA 1W3XA 5DZFA 4AGRA 1IG3A 5JXHA 5FYYA 1VE0A 4UW4A 1VMFA 3OBRA 2WRAA 1VRH2 4NRMA 4UFIA 4BH9A 3AMMA 3JD72 5LBFA 3WHUA 4B8EA 1GSLA 1V6LA 2I07B 3ETQA 3GCXA 3J8F2 1OQ1A 3TOJA 1NX9A 4CUGA 2QZ2A 1OQEA 2DDUA 1V9U2 3MDPA 4ASMB 2WBKA 1LU2A 3ZN4A 4Q4W2 1DIWA 1LENA 5FOJB 4CDXC 4OZOA 2HBUA 2C9KA 1BK0A 4QPIC 1MQTC 1D4M1 2BOIA 2LS6A 2DCTA 4TN7A 1QU0A 3T4HB 4NHYA 3QCWA 4PF5A 4B4QA 3LDKA 2CHHA 3PUSA 1QJU3 1W05A 3B9IA 1I9RA 4H14A 2ZEYA 3H0OA 3NAPC 1LOAA 3DF0A 1NLSA
chains in the Genus database with same CATH topology
1SDWA 2OYZA 1BBT1 3ZXLA 4YM2A 1UIJA 4LO8A 4IV3B 3SNMA 2RS31 5FQ0A 5IK7A 5BXXA 4E4DX 1I1EA 2GU9A 4KQ7A 4WVMB 2GMMA 1ZZ7A 1ZBE3 2ZX0A 1UU6A 2ZCWA 3MPPG 3ZYRA 2YMZA 4Q0PA 3ZMNA 2X5IC 1NQJA 1W2UA 1GANA 4HK8A 2R0FA 3O0XA 3FC0A 5GLTA 4E4ZA 3VDDB 3ZXGA 5CFDB 4HETA 1PK6A 4MXVA 1WMEA 4WVZA 3NV4A 3WDTA 4WM8C 3JD71 2EXKA 4LO4B 3GBGA 5J09A 1QXJA 1NY71 1EV13 1PO13 3OD0A 1RUD2 1VIWB 2XLFA 5GLWA 1QHDA 1QXRA 5CNAA 4LUKA 3VZLA 1YWKA 3SXWA 2NN8A 1KITA 3ZFEC 4I30A 3I8TA 5L19A 1UD1A 3V56A 1URXA 2XKOA 1MEC1 5BNQA 4UXAA 2A73B 1DQ0A 1UCXA 3AZXA 3SMHA 2R072 1CAWA 2D6OX 4GMP0 3VZJA 4RSUA 1LHUA 3M3CA 3FHIB 5IUQA 3WDYA 1DQ4A 4AI2A 1PGL1 4NO4A 4P9JA 3LAGA 4B7EA 1OSGA 4GA9A 4AW7A 3LCPA 2JJ6A 1Q8QA 3PVOA 5HCBA 1QJX3 4RHV1 4FOYA 5CFCB 1IGOA 4COVA 5T3NA 2FQPA 1ENQA 2FBEA 2CTVA 2PAEA 4FOQA 5KC5A 4N43B 5CVRA 1N1SA 4MGKE 4XJ8A 1BXHA 4E2QA 4ITCA 2Z2SB 1NE6A 3C3VA 3MGUA 4OHZA 4M00A 1R083 2ZX3A 1NCRB 3HD8B 4P9WA 2Q5TA 1BVP1 3VL8A 4XIKA 3E5QA 3A4UA 5C4WB 3B01A 1PZ8A 1ND3B 2R32A 4MX3A 4AFDA 2A5ZA 4K21A 5IK8A 5ABJB 4FXKB 1NQDA 2DVAA 2IWGB 2WT0A 1WUVA 1R1A3 3ZXEA 3LA2A 1SCSA 1ULEA 4MYEA 4LO7A 3UKTA 1RJ8A 4IV1B 4AI0A 3SITA 3JZVA 2LM3A 2G4IA 1H1IA 4IEOA 4P9LA 5FO7B 1SMVA 3M3OA 4LTAA 3JU9A 2TEPA 4RQPB 5FPZA 2RMU3 5KHJA 5BYNA 4KH9A 4V1PA 4N53C 5BY5A 1JUIA 1CONA 1ZVFA 2PHRA 4OVEA 1OA2A 3GALA 4CDUC 4LBLA 3O5SA 3H1YA 1FATA 1QJY2 2XL9A 3PMEA 4KNCA 4NVPA 1MR5A 1LCLA 1VBA1 2ZGMA 1RUI3 1AJOA 4R9CA 5JCTA 1MACA 3V65A 1UZYA 4MLOA 3PMSA 4LT5A 5DDJ1 1AR73 1H8VA 1LOBA 1F2NA 3NAPA 1VALA 3SH4A 1TMF1 4GKYA 3PLQA 1CPNA 4CTEA 4TZDA 1BVVA 3I59B 3ZN5A 3MFAA 4AI8A 2D6MA 3ILRA 4IEQA 2ARXA 3EQEA 1AX2A 4CEWC 2ET1A 1PVXA 2HYKA 1RUNA 2X5IA 1V6OA 5DUXA 4FPOB 4F7ZA 1RTVA 3UKVA 2WC2A 3NKTA 4ONUA 1DZRA 4HSLA 2V73A 5FMOS 4WM8A 1VBC2 2BVBA 1GZ9A 1VBD2 2UWAA 1OLRA 4YM1A 4LR4A 1F9KA 3TN93 1SFYA 2VOWA 4LNVA 4MXWA 4QQOA 5I8SA 1MS5A 4E9KA 1O4TA 1HQNA 1WW4A 3VKOA 1KJRA 4N9HA 4Y1UA 5J36A 3RJRA 2P17A 3ZFEA 4CP2A 1CIWA 5GZCA 1QWRA 1B35B 4EJRA 2WS92 1S0BA 1SLIA 4JGYC 1J59A 2JDZA 3MLJA 1FOD2 1HRI2 1RJ7A 1EV12 4Y1ZA 3VBUB 2IXIA 4J1WA 1U12A 4I09A 2DVDA 4YM3A 1OPMA 4PCRA 3UV9A 4FAGA 4Q27A 1PVC2 3ECQA 3N7MA 2WZPP 4AHWA 1BZWA 2HWC3 1QJU1 4D7TA 2HWD3 4HK9A 1AUYA 4Q0VA 5FMOL 1S55A 3AKSA 2K9ZA 2F6BA 3PJYA 2UY8A 2SLIA 3SH3A 5IK5A 4K6BA 1ZBE1 2ZGKA 4DQAA 1WBFA 1TEIA 3EHKA 2ENRA 4H55A 4LBQD 3OY8B 4GIQA 4YNIA 4C90A 1JYCA 4IQPA 4MV2A 4R4ZA 2A3WA 3AXEA 4NR1A 3HT2A 2AGSA 1A6CA 1WLTA 1QQP2 1X7NA 4JTNA 4XFCA 4ES9A 3IWZA 2HWF2 4MH0E 2LTNA 1C5HA 2ZABA 4YGBA 1LRHA 1LEMA 1AL22 5CBLA 1TME3 2BYVE 3RWNA 2D44A 1UU4A 3WW2A 1EV11 1PO11 2P34A 2WA3A 4YVSA 2D43A 5GZEA 1WW6A 2GNBA 3WG2A 5EZWA 2XGXA 2Y0OA 3D82A 1BMV1 4G9SB 1YFXA 5A32B 1RUJ2 4HZFA 4N53A 2CYFA 3A0KA 5DXDA 1D2QA 1W6PB 2VVFA 3KQRA 4Q4Y2 3VHPA 4CDUA 4RS5B 1BEV2 3V0AA 3R0RA 1W6NB 1J3QA 1ZZCA 4XFHA 3VUOA 2R16A 1XNBA 3AYCA 3D0SA 1RUE3 1A8MA 2BWCA 4HBNA 5JZGC 2K0GA 4CDQB 4Y22A 2Y26A 1QJX1 1WCKA 2WLPA 2W39A 2ZACA 3ZFFC 2JKBA 1C1LA 1C8M2 2H6CA 1HX6A 3D8CA 1LR5A 1HKDA 1RUH3 4HANA 4NWWA 3TWIA 3JBG3 4ISQA 5KHKA 3KB5A 3R4DB 3ROUA 1CR7A 4AVSA 4FAHA 1MS3A 1R081 1W6MA 2F4PA 5BNPB 1ZYBA 2QFEA 4EWEA 3MFCA 1D4VB 2GC2A 1PO22 3AYEA 2ZGPA 2X53S 1IPJA 4YM0A 3VL9A 1J1TA 3VBSC 4YARA 1N47A 4TSVA 4XXPA 4MSVA 1HXS3 4OUMA 4NHMA 2NP0A 4GKXA 3WQ7A 4CEYA 4I0WB 2VQ0A 1LOFA 1O3RA 3WG3A 1RGSA 1R1A1 5D8AA 3VHRA 1AYN2 3MLLA 4Q4V2 2XVLA 4AVAA 2JENA 3WG4A 2IXHA 1QOTA 1X8EA 4QPGB 2RMU1 4IETA 5IT6A 2JG9B 4XBQA 4IL7A 4AHZA 2VG9A 3LZZA 1FI2A 2ZGSA 4JGYA 4QGLA 4XQDA 4PDWC 4W65A 3TN92 1SEFA 2R1DA 5ACA2 1G9BA 2WNUC 1SLLA 1COV2 1AR63 3DPRB 3VKLA 3MYXA 2OZJA 2BBVA 1RUI1 4QPYA 1WD4A 2W08A 3VGIA 1HQWA 3KCXA 3CJXA 1AR71 4H3WA 4S2DA 3ZSKA 3ZXKA 2WFPA 3P3PA 3HR9A 5JSOA 1BK1A 2HJIA 3SLIA 4M3CE 3AX4A 4KU8A 4Q29A 1S2KA 2XJPA 3AKRA 1QOSA 1GZCA 3ZFGC 4AWDA 5FTTC 1CAVB 4BLIA 1HRV3 3G6JB 1S0DA 5I91A 1LKNA 4GH4A 4YW1A 2VULA 1A78A 2WNVB 2ZMNA 1NLRA 4KWKA 2D6NA 4Q1PA 3AXDA 4CDWA 5T52A 1KXGA 1J3RA 4Y20A 4EN0A 2HWE2 2JECA 2GMEA 4PLOA 1EP0A 1K5MA 2E7QA 4M3CB 3O7OA 3H1MA 3B93A 4BA6A 1MZEA 3HWJA 5L7OA 2BNNA 3RQ0A 3TN91 1ASJ2 2QDRA 5JR7B 2QKDA 4P9XA 1GV9A 4IEXA 4C1XA 3VZMA 4OHXA 2Y0IA 3FMGA 3IDBB 3ZYPA 4BCUA 1ND2B 3N35A 1DQ1A 5LRRA 2ZOEB 1UU5A 2P3IA 1G8WA 4P9GA 2AENA 4UW3A 3WP5A 1VB4A 5DG1A 1Y43B 2VOKA 2ZGUA 2PLV3 4COZA 2UU8A 2AUYA 2EVXA 3DN7A 4FPCA 4C0BA 1HQLA 1WMDA 3OF1A 4OZXA 4JDMA 4BLJA 3FE5A 2QUOA 4G4FA 2CGNA 5JIAA 5JZGA 2GC3A 3NV2A 4LE3A 4LO6B 3CJIC 5DZGA 2R042 1BQPA 1RITA 3O0VA 5EJ3A 2HWC1 1L3JA 5BNNC 2YDEA 2C9AA 2HWD1 3N7JA 4NHLA 5E88A 3NV1A 4OI1A 3ZN6B 2GN7A 2XL7A 2YGLA 1HLCA 1TNRA 3VBHC 3BPZA 1REFA 4IXLA 2MHFA 4UW6A 1V6MA 1H1MA 1DGWX 4QMAA 3BTAA 3ZXFA 2DFCA 4Q1RA 3UJOA 2TBVA 4FPJA 3VBSA 4AVVA 1DGRA 1N3QA 2Z42A 4MGZE 2WSUA 3BALA 4XTMA 5JPMB 1KDMA 3BIWE 4IESA 1ZZBA 1ZZ6A 1U5YA 1OKQA 5FOBB 3AZVA 4LBQB 4YGCA 1G9FA 3CU7A 2VMIA 1TME1 3NVCA 3POYA 3FLRA 2XJUA 4DNYA 4XF1A 3B69A 1MVEA 4N7UA 2GNDA 4CRQA 3AMHA 5I0UA 1GZWB 3USUA 2GH8A 2XHKA 1JBCA 4RGAA 3TAYA 2IFRA 1WBLA 3L2HA 3ATGA 4AE2A 1AHSA 2IXKA 3WY6A 4E2GA 2ZHMA 5FQ0B 4MZUA 5FLIA 4PDWA 1UKGA 1N1YA 1S0CA 1XE8A 4Y24A 2BPA2 3WCRA 4AEMA 3KSCA 2QNKA 4H7LA 1RUE1 2PYTA 2QJVA 4ZKTB 3D6EA 4U36A 2BVVA 2RJKA 5JI7A 3GNEA 3JUUA 5AVPA 4OI2A 4XIOA 1D0GA 1R093 1D4M2 1QNYA 1ULFA 2ZMKA 4K7JA 2PHLA 1EAH3 4XHBA 2BQPA 3L2YA 1RUH1 1PK6B 4URTA 3BCWA 5JWPA 1BYHA 1XU1A 3JBG1 1OPOA 3HN1A 1YRZA 4GB33 1BBT2 1SLBA 1VAKA 2RE9A 2KXLA 3ZFGA 2G9GA 2WINB 1W0OA 4JV4A 2RS32 2Z5WA 4Z92B 3RZZA 1JN2P 1ENRA 1SLCA 2OUJA 3IKWA 1SFNA 4TWTA 2VNGA 4IEUA 1BCXA 1HXS1 3H50A 4FP3A 1GNZA 3E6DA 4IV3C 2DTYA 4SLIA 2X8KA 4CZSA 3JB4C 4A7ZA 5I93A 3PHMA 4AHYA 3B3QE 4FPHA 4ORFA 2XLGA 5DZEA 4FBFA 3VBOB 3VHNA 4GXLA 3KZ4C 5AFBA 2ET7A 1AJKA 1NY72 2OVUA 4YW3A 4FPEA 1SLAA 4I2OA 2QVSB 2YC0A 4RL7A 1QH6A 1ZBA3 3FUQA 3VDDC 5CFDC 3AM2A 4N9IA 1YIPA 4LA2A 3RJ2X 2VW1A 1FXZA 1TNFA 1MEC2 4QQHA 2B45X 3EJKA 4EN7B 3B00A 1AR61 3QACA 2CV6A 1W6OB 3HBZA 1BJQA 1PGL2 3CJIA 5J3UA 4AFCA 5TSWA 2XJVA 1RUF3 3V0BA 5F6LB 4DRVA 4UW5A 2A6ZA 4K3UA 1ONAA 4PIZA 3H9AA 4RHV2 2P3KA 1H9WA 1HDKA 2PLV2 4XBLA 1Z7S3 1D0HA 5GLVA 3ZO0B 3KCYA 4HKWA 1AX0A 1AXZA 3VBHA 5KXCA 5H9SA 4COWA 4META 4HN1A 4AG4A 4WM7A 2ZPXA 3AZYA 3MIBA 4QHBA 4YW4A 5T5JA 4DS0A 1HRV1 4HN0A 4Q4X3 2WQZC 1UPSA 3HIFA 5CFCC 3AB0A 4WBBA 3EO6A 1PNFA 1NYWA 4Y1YA 4N43C 2HKXA 2W68A 1YYNA 4HKLA 5I0RA 5BV6A 2VXRA 5LEKA 3HT1A 4HMZA 1GKBA 4FOWA 2DU0A 4X6QB 2ZJCA 1ZX5A 1ZZ9A 1NCRC 3M8LA 4L97A 3N4MA 1H0BA 4X8PA 4XOGA 4E4SA 1DU3D 3MIGA 1RB8G 3NWKA 4QX5A 4XBNA 5CG9A 2PA7A 4LLFA 3NAPB 2D3RA 1QGLA 2IFWA 5JOYA 1Q56A 2XVGA 1V6KA 4ZXKA 5ABJC 2BEOA 2QZ3A 3O0WA 3CO2A 4XZPA 3AJZA 1DDLA 3ZSJA 2CAUA 2D6PA 2PLV1 2UWBA 3M3IA 4HT1T 1VBE3 1V00A 2QDNA 1Y3TA 4L8QA 3VZKA 5K0UC 2Q4SA 3WINE 2V09A 2MEV3 3CNAA 4XFBA 4XILA 1RVF3 1VBA2 1TQ5A 4RQPC 1KFUL 2A70A 1XNDA 5KXDA 3PJQA 2TNFA 3IMNA 2ZGTA 5DDJ2 2E7TA 4PIXA 1NOVA 4WM8B 2VU9A 2Q1MA 2R1BA 2UYBA 2PHWA 1AR83 1H2LA 1PNGA 1TMF2 2VUJA 2D3PA 3IPVA 1Q3EA 1DF0A 4HLTA 1IKPA 3CEWA 4MXWB 1VBB3 4NN0A 4MUVA 1MS4A 4R9DA 4YFWA 1U5ZA 2ZGOA 5B2GB 1UF2C 4PBOA 3ZFEB 4A7KA 5C9AB 5FO8B 2GMPA 1NE4A 2WQ4A 5GZDA 4Z07A 1YO8A 4O9EA 2C0ZA 3L9JT 2VW0A 5FAXA 5F9TA 2WNEA 1Z78A 3U11A 4IV3A 1G86A 3ACLA 1SBFA 5DG2A 1OI6A 1ZZ8A 4Z8BA 2O1QA 4WVMA 1B09A 2BNOA 4RA0A 3WQ0A 3NL1A 1PGSA 1PMIA 3B02A 2RS53 5J96B 3U0ZA 3OYWA 3RI9A 1AYM3 3TNQA 1X50A 2R6QA 1T6GC 1J3PA 4CDXA 4QPIA 4OHYA 3VDDA 1MQTA 1UIKA 4EROA 4CP1A 4LBNA 2PFWA 5AC93 1FV3A 1SCRA 3N7KA 4FOVA 5GALA 1DHKB 3OTFA 4WVWA 1YFUA 5KBFA 3OBTA 4KL1A 5JPNB 2ZAAA 2LUWA 4Q8LA 3VZOA 2ZZQA 3RYRA 4BHPA 1CGPA 4S2FA 4XF0A 2BFUS 3WV6A 1R091 2ZHNA 1B35C 4YZ4A 2NMOA 4YZ5A 3AZZA 1EAH1 2EA7A 3WDUA 3ST7A 3RDIA 1QNWA 4OI0A 1QJU2 3H8UA 1JTZX 4ZU4A 2CGOA 4QXKA 1F5FA 1O91A 3VBUC 5BNOB 4GB31 4YVSB 1KQRA 3FFZA 2YV8A 4FPLA 1RC6A 1ALYA 2W0XA 5T5PA 3SH5A 4XFGA 5JI9A 1ZBE2 2Q30A 4XF4A 3AMQA 3IBMA 3M3EA 5KXEA 3PTYA 1PIV3 3ME2A 1YI9A 5F6KA 1M06G 2ZHKA 1IHMA 4XETA 2DCYA 1WGPA 4K9SA 2DVFA 3V0AB 5J37A 4QD2A 4DZGA 4YGEA 3MEPA 2GH2A 4BOWA 4AHXA 2BFUL 1TE1B 5JAXA 4M01A 1UN1A 3RMYA 4I0BA 3RMXA 1PO12 4HSJA 1ENSA 2A6XA 1ZBA1 5JOXA 1SACA 4D3WA 1BMV2 1CESA 1I5ZA 4R8HA 2VQAA 4IEZA 3WP4A 1W6MB 3VBRB 1JW6A 4AVBA 2EXJA 5K0UA 4OHVA 5T55A 5H9RA 4HVQA 4Q0SA 2CWSA 1E57A 5AFEA 1MZFA 1RUF1 4L99A 4CEYB 1VAVA 2ILMA 1QJX2 2OW4A 2IXCA 1KD7A 2IC1A 1C28A 1AR93 1Z7S1 1NCQB 5D8AB 1JYIA 4OUSA 4RS5C 4LO5B 5AVAA 3AFGA 3H3ZA 2DV9A 4I01A 1FMD3 2NLRA 5DUWA 4DB5A 4FTSA 4RR3B 3AP9A 3EBRA 4GQ7A 4XJUA 2VPVA 1S1AA 2D97A 2RM23 1R082 4CDQC 5JOWA 2D6LX 2GSYA 3GZTB 4Q4X1 3DGTA 4YFZA 1RMU3 4XHXA 3AYAA 3LGRA 5FRAA 3LSDA 1G9AA 1DZTA 1LGNA 3AMNA 1IZ3A 4S2HA 2FMYA 2IXJA 1G7YA 2JG8B 4ZU7A 2XG3A 4MGIE 5E1RA 1NA1B 1MZ6A 4OLLA 3I59A 1JXNA 4IEPA 3CF6E 3WQ1A 3BU7A 5BNPC 2AREA 1H4GA 2R063 3ZDSA 4F3JA 1NXD1 1X8MA 2ES3A 1R1A2 4K1YA 2CY6A 4BQ1A 1WLWA 3KM5A 4C0HA 4FXGB 2B46X 3WOGA 1WLDA 1LB2A 1YFYA 2SBAA 4YGDA 3WDVA 1ZRFA 3NV3A 2RMU2 5KWRA 1GQGA 1A3KA 1AXYA 1LU1A 4KU7A 4YSFA 5FLJA 2BWAA 4QQPA 4AVTA 1VBE1 1AZDA 2RS52 4ATFA 1F8VA 2BNMA 3KGLA 4GH4B 2H0VA 1FPN3 1REEA 4AEKA 2MEV1 2DFBA 3RYPA 4AI1A 1RVF1 3M2MA 1RUI2 4XEZA 4CDWB 3LB9A 3WUCA 1WCSA 3I7DA 4Y20B 4CEWA 5K9YA 2PELA 2ETEA 4KWLA 1K5MB 4QM8A 4OFGA 2D93A 1AR72 2C1FA 3ELNA 3ZSMA 1BKZA 5KHHA 4B7KA 2O8OA 4RFT0 4BZ4A 4PLMA 1AR81 5C33A 3VBFB 5L7OB 1CJPA 2A75A 3VKFC 3DPRC 1WD3A 4JQRA 5FFOC 5H9QA 1VBB1 3ZYGA 1SBDA 4XW3A 2ZKLA 4DFSA 4WZCA 4JC1A 2V5YA 2HWB3 4LLOA 2AH2A 4XJ9A 5T5LA 1U5XA 2DUPA 1D2SA 3QH6A 1ZRCA 2ZS6B 1UKRA 3WNXA 3IIAA 3KS7A 2UWCA 2ZGNA 2UY9A 3WVJA 1IOAA 1H8TB 4JGZC 1DFQA 3AP7A 3S7EA 2H6BA 4LHKA 2O0OA 3WR0A 4XQWA 1UW8A 2WZR3 2RS51 5BPXA 2D7FA 5F5QA 2A3XA 3AP6A 1PIV2 3OY8A 4K20A 4YG3A 1AYM1 2WNVC 2DTWA 3W59A 1DQ5A 3W58A 5CB7A 3MI8A 1V6NA 1GR3A 1W6QA 4L11A 1OOPB 1H2NA 1G6NA 2WFF3 3TRSB 5AC91 4RGGA 1QMJA 5GZFA 2RJLA 3R6SA 4Q0QA 4FQZA 1LGBA 3VBSB 1LHNA 3UK9A 4AFAA 1ZRRA 3IDEA 1DQ6A 1H2KA 1ULDA 5KHGA 3HAGA 1MZ5A 4SBVA 3T2TA 2QQPA 3POWA 4QGMA 5A33B 1AX1A 2JEMA 2HWC2 3U10A 2WA4A 2XB6C 2HWD2 3KGZA 1V70A 4YW2A 2XBO3 2CL2A 2K2SA 5LRSA 4O9GA 3RG0A 1Q8SA 2XWJB 4XMIA 4AQTA 4L2NA 1CPMA 1PIV1 5JVVA 2E51A 4M3CF 3THTA 2ZGRA 4Q8KA 1VRH3 3POSA 4W6XA 1AR92 3SCGA 2WLQA <