1NQDA

Crystal structure of clostridium histolyticum colg collagenase collagen-binding domain 3b at 1.65 angstrom resolution in presence of calcium
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
111
Chain Sequence
EKLKEKENNDSSDKATVIPNFNTTMQGSLLGDDSRDYYSFEVKEEGEVNIELDKKDEFGVTWTLHPESDRITYGQVDGNKVSNKVKLRPGKYYLLVYKYSGSGNYELRVNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A Bacterial Collagen-Binding Domain with Novel Calcium-Binding Motif Controls Domain Orientation
pubmed doi rcsb
source organism Clostridium histolyticum
molecule tags Hydrolase
molecule keywords class 1 collagenase
total genus 29
structure length 111
sequence length 114
chains with identical sequence B
ec nomenclature ec 3.4.24.3: Microbial collagenase.
pdb deposition date 2003-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.380 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1nqdA00
1NQJA 5FBZA 2O8OA 5SV5A 1WMDA 1NQDA 4I3GA 3BOWA 1WMEA 2XVKA 2LUWA 4HPKB 4DY3A 2QFEA 3AFGA 4HPKA 4G9SB 4DXZA 3JQXA 3DF0A 1KFXL 2XVLA 4DY5A 1WMFA 5FAXA 4DZGA 1QXPA 1KFUL 2XVGA 1U5IA 1DF0A 3JQWA
chains in the Genus database with same CATH superfamily
4AOCA 3RDIA 2SBAA 3U14A 3SH3A 1VIWB 2QQNA 2QQLA 4NPLA 3BKZA 2O8OA 1LGCA 4UW4A 5FO7B 4BLJA 1Z7S2 1VBA1 2RR11 4QX2A 5JR7B 2V5DA 4NRMA 2ZGTA 4JDNA 3FMGA 5CFDA 3GZAA 1JH5A 1F9KA 1SDWA 2A70A 3MFCA 3DCQA 4YZ2A 3ILFA 2MPFA 2XMLA 2ZTNA 3OBAA 4D7SA 1G7YA 1YJKA 3VZMA 3H1MA 2E6VA 2YU1A 3IIAA 5F5AA 5I8TA 1H4HA 1VALA 4PLMA 3RMXA 5IYYA 4W6WA 3VHPA 4XBQA 4GULA 1PIV3 1PK6A 4N90A 4COYA 2RS33 1D4M1 1MQTB 2J7MA 1OLRA 3MV11 5L7OA 3NV2A 1GICA 1DDLA 3WNPA 4IGQA 2XH6A 5H9QA 1XSQA 1E5HA 4IUGA 5GLVA 2BJSA 3ZYIB 1OFSA 4QXCA 1BCXA 4IE7A 1MVQA 1A8DA 3KMHA 1JZ4A 3VD7A 2JDMA 3FLTA 3HBZA 4XFAA 2F4PA 1ZRCA 4PT6A 3VHOA 1YLLA 1GP6A 2YMZA 2Y0IA 2X8KA 2NZ9A 1PMIA 2YPDA 5G05L 1TEIA 3KHBA 1UOBA 1WZXA 2D7FA 1COV1 1U5IA 3KCYA 4HSLA 2BOIA 5FYTA 2VMIA 2QQMA 1O3SA 3IAQA 4YG3A 1UX7A 4JQTA 2VUAA 4PIYA 3OD0A 1CZTA 4LA3A 1UQXA 2C9KA 4XF4A 2Q1ZB 5HCAA 2J1RA 3A22A 3MFAA 5BNPC 3LOBA 3RZZA 1CIWA 4D94A 4IERA 3RS6A 4GH4A 2F4LA 5JPNB 3OBTA 3C7GA 4JKKA 1RUD1 3QH6A 2JE9A 4IEQA 2JDNA 3ZSEA 2OUHA 5A7PA 2HWB1 1CIYA 1G6NA 1WW5A 1SDDB 3HT1A 1E5RA 1OQ1A 3PUQA 4ET7A 1MS4A 1W3XA 1A3KA 2VO5A 3CJIA 1ZX5A 4WM7A 1Z0HA 1GP4A 5H9SA 2ZGQA 4AQ6A 4QB2A 1SFYA 5EJ1B 2WAAA 3ZMNA 3Q8FA 2DBNA 2HWE1 5ACA2 2PQQA 3ZIXA 2H0VA 1FNZA 3TEXA 4UAPA 1F4AA 2VCAA 3KF5A 4XJWA 4Q8KA 2WC2A 3OGGA 4GWNA 1AYN2 4K21A 4NMIA 2HBUA 4CPBD 3NJZA 2AEZA 5J3UA 2VNRA 3WDWA 1NYWA 3IBMA 3DECA 2WWSA 4JTOA 1JYXA 2X09A 1W8OA 2B8MA 2Q1FA 3WHTA 2VZVA 2E32A 1H2KA 1JUIA 1PZ8A 3LD8A 1HW5A 4LA2A 4AVAA 2Z4FA 3B9CA 4Z2AA 3THTA 2Q5TA 3NL1A 5FP3A 3WXPA 1RXFA 1NCRC 1T6BX 3N7MA 3PVNA 4PCRA 2XB6C 3UGHA 3WW2A 3ZFEA 4QXBA 1OOPA 2R1DA 1XC6A 1ULOA 2EIBA 1ZNPA 1GSLA 2WL1A 2XUEA 2H0BA 2I45A 5EFUA 1VBB2 4Q26A 5FV3A 1PO21 4XXPA 4CXWA 2EALA 4GQ7A 5FP8A 2O1QA 3UNPA 1JOPA 2MEV1 3LEGA 5FRAA 5BNNA 4IE0A 5L9BA 5A3UA 3I2OA 3ORJA 1ENQA 4I0BA 1OC1A 1R091 4MYEA 4F7ZA 5F3CA 1PK6B 5FPBA 3VD5A 4ARXA 1TG7A 4ES8A 1IG3A 3ZYJB 3VBRB 1S0CA 2TUNA 4Q4V2 3RMYA 3ZSKA 3HBKA 1UZYA 5AFBA 1QJZA 3ZYBA 2QDNA 3X29B 4WM7C 3FHIB 2FMYA 3ZFGC 1N3OA 1MS9A 3K48A 1CX1A 4K1ZA 1RUG1 1OQDA 2VMCA 4FPHA 1HB3A 4F8AA 5CFDB 1Z7S1 1VBB1 2ORZA 1DZQA 1MZFA 1S1AA 1TME1 3CZJA 3N9PA 2XVKA 3OSDA 4LOSA 3S5QA 5FIXA 3RNSA 3KLSA 1PK6C 3WW4A 3K2OA 4A2UA 1EV11 4RD7A 1IG0A 3BIWE 3IIIA 4XACA 4QGLA 3T3YA 1HN0A 4XBLA 1W0NA 4BMEA 3ETPA 1AR61 5KHKA 5A7NA 4MOAA 3MPBA 4LKEA 2OUJA 3IT8A 4XIOA 3VBFC 1W9TA 4CDXC 2W68A 4AVBA 1BYHA 2W94A 5JOZA 4BM8A 4ZZ5A 1W6QA 4A7KA 2E63A 4UFMA 3WY6A 4XF3A 2OIIA 2OW4A 3AKPA 2C26A 2WWUA 4D6SA 4UF0A 1HRV2 1O6UA 3JD71 3L2HA 5T52A 4OQ8A 4NHYA 3ZR5A 1Y9QA 4FTEA 1YC61 4GXLA 4LO8A 3POFA 3LKJA 2KXLA 1UWWA 2BGOA 3N36A 3POWA 4LR4A 4RFRB 3GCXA 4BK4A 5JMCA 1VBB3 5FWJA 3W5MA 2FZ1A 3M8LA 2YC4A 4Y1XA 4HBNA 3AP6A 1NCQC 2WT0A 3ZM8A 3KWVA 5CZKA 3PNAA 3D0SA 1ENRA 2VZUA 1C5HA 3UJQA 1FOD1 4QKBA 2D3RA 4YW1A 4C8DA 1XRUA 2WQ8A 3ILNA 4N7UA 1XNKA 3MLKA 4IQPA 3TBDA 4RQPA 5A70A 1VBE3 4Y1UA 3AKRA 3OBRA 1H9WA 5LBFA 3BU0A 4PI2A 4J1WA 4N53C 1YUDA 3AMNA 5J09A 3IKWA 4JDMA 3BALA 2RS13 5LA1A 1ZZ6A 1W2AX 2Y34A 5E1RA 5E6HA 5GM0A 1W6OB 1LJ7A 1OOPB 4LO5B 4Y22B 3W20A 1DGRN 3RYKA 5JXIA 4CDQC 3ALQA 2WQ4A 3INAA 1AYM1 4MXVA 4KL1A 4C0HA 2Q4SA 2J1UA 1FV2A 1Y3TA 2HWD3 1OUSA 2IFWA 2A3XA 3JB8A 1LOEA 4PI0A 4XZPA 2XJQA 5HCHA 1QJX3 4Y3OA 5DUWA 1V70A 1EAH3 4CCEA 3H3LA 1VMJA 4QPGB 5FBJA 5C4WB 1OOPC 2FCUA 5CBLA 1LOGA 1RUNA 4A7ZA 4KMQA 5EWSA 5A33A 4QX8A 1WW6A 3ZIWA 5ABJA 5BNOB 1HRV3 4YZ1A 1FX5A 3I2JA 2VQAA 2GAUA 1M06G 3O14A 3LFMA 3H8OA 2ZX3A 1W6QB 4DEVA 2WR9A 5BYNA 4LUKA 1FPN2 1D7PM 2EXHA 1HXS2 4FPYA 5GLUA 1RVF1 3K4DA 4E4HA 5LRSA 1W28A 2VG9A 1UX6A 3WQ0A 4RS5C 5IVEA 1IKQA 4DY3A 2R16A 2OXBA 3N7KA 3I49A 3J7HA 1RB8G 1WW7A 3C3VA 5IHRA 2VQUA 2JDZA 3AYAA 4XAAA 5ACA3 1J3RA 4XUNA 1POQA 5A7QA 2ZX4A 2CHHA 5DUVA 1QOOA 2WABA 1AYN1 1LGBA 3M70A 4TZDA 2YV8A 4I09A 5JPMB 2DBIA 3ST7A 1HRI3 2JDHA 4OZXA 1BK0A 2G1MA 2OX0A 3AZYA 4KG8A 5HXVA 5AC92 3MIFA 4N9HA 1LCLA 1XPWA 1O4YA 4CEWA 1BZWA 1IHMA 4IE4A 1JI6A 4UFIA 5JI7A 4A7YA 5D2AA 3S57A 1RUE3 1GU3A 1K45A 1S0BA 2WIIB 3FE5A 2HWB2 1V9U3 3MW2A 4HKLA 5FZOA 3NJXA 3RSJA 5I91A 1LU2A 2P1BA 3RJ2X 3HEIA 3FLPA 2B4KA 5FJKA 2QVSB 4XCBA 4MGIE 3LA7A 2FMDA 4Q0SA 1FV3A 5JI9A 4M3CA 3UV9A 4K8FA 5LEKA 3M3QA 4HANA 4XMIA 4OQ9A 5FUNA 4BLIA 3M3IA 2BWCA 2I74A 2RDSA 3MIBA 1ZZ7A 4N9IA 2JX9A 1PVC3 2VH9A 1NT0A 1WCQA 4XQDA 3S6PA 4BQYA 1C4RA 3I3MA 4YG0A 5FLJA 4AGVA 1ALYA 1H6YA 2VR4A 5LCWL 5T5JA 3D5OA 2QJVA 1KDMA 2ZX0A 1FPN3 1TNRA 3AL6A 3OEBA 1Q8VA 2R071 4Q4V1 3BPZA 4AQSA 1GWLA 2WNUC 4FOQA 5FY1A 5FPZA 5IK5A 4Y20B 4XYXA 1FMD3 2FCVA 5I0SA 4DUWA 2JDUA 5A80A 2VL4A 5I8SA 1D4VB 2W08A 3J26N 4AHWA 5KXDA 1TQ5A 2J1TA 4JRLA 1R1A1 2WYFA 1GNYA 1XYNA 2BTVC 4IXLA 3U11A 3PJYA 5FZIA 1S2EA 4E2SA 4LJHA 4UW5A 3AP4A 2D44A 1XYOA 3WR0A 1WA6X 2GN7A 4Q0PA 2AC1A 4FPKA 1V6MA 3GJBA 4B29A 1W2TA 1E57A 2BUKA 3PUAA 3VBHB 4CP9A 4XFFA 4BHPA 2VZ3A 2XJPA 4LBLA 1UU4A 2HWC1 5KXCA 4K1YA 3GNEA 1VRH2 3ROUA 3ECQA 1XSRA 1JZ2A 3J8F2 1V00A 5T5PA 1HXS1 1W8WA 4P9YA 4RR3C 2CAVA 3K4AA 5FYHA 1QJY1 5FMOS 1RUE2 5D8AA 5BV6A 4EN0A 4PQ9A 1MQTA 4LK7A 3RI9A 1UMIA 1WLDA 2RE9A 1VBA2 3R6SA 1EY2A 4KWLA 3N35A 5F8PA 2HBTA 2ET7A 1H2NA 4JGZB 2XKOA 3IDBB 4NAOA 1SPPB 4TLFA 4XFBA 4H7LA 4XDOA 4E27A 2XBO3 2VW2A 4K8RB 4L97A 4DRRA 2PHTA 4YW6A 2D5HA 1UL9A 3UK9A 1R1A3 3LAGA 1HQNA 1S4CA 4LBNA 2XHKA 5L19A 2XKPA 5FJHA 2ADDA 1LOCA 2Q30A 2WNUA 4FTBA 1F5JA 2LRPA 1PO11 2VZRA 4ARYA 1UN1A 1W0OA 3AX4A 2OT7A 4Q0UA 2IC1A 1A34A 4ZU4A 5FYUA 5A3WA 1ST8A 1VB2A 1VBD3 1WBLA 2B5HA 3DGTA 4CRQA 1Y4WA 3AP9A 1MS1A 4R9BA 4XJAA 2K9ZA 3MUY1 1DYKA 4AVCA 1UU5A 2W46A 3IAPA 3IN9A 4DB5A 1YEWA 2RS12 5C9AB 2A1XA 4YW2A 3OYWB 1QQP1 5GLWA 4LBQB 1GOHA 1X9PA 3B5LB 1KGYA 4ZXEA 2K46A 4DNYA 1YFUA 2HWB3 2Z5WA 3WZ1A 3THPA 3H3ZA 4Q4X2 4AFAA 5CIRA 3WF0A 4CU7A 1WD3A 2RDNA 5EHDA 5KHIA 3W9AA 4E8DA 1NZIA 4TN7A 3CO2A 2ARCA 2WO2A 3AK0A 5DDJ3 5F2WA 4EZHA 5C8CA 3WV6A 1MEC3 1UOGA 1NA1A 2JKBA 3BCWA 3HQRA 3JXSA 4LHSA 5FAXA 5GJ6A 3T0BA 4AE2A 1ZBE3 4XFHA 1RUC2 5CB7A 5JCTA 1BK1A 1BBT2 4DUVA 2YROA 5JMOA 4O7XA 5FZAA 1SFNA 1UY3A 3FWEA 1Z78A 1LHVA 2LM3A 3I2DA 4FP2A 4L92A 3MPPG 4XUTA 2E9QA 5LW9A 2WNOA 3JQWA 3ZFFA 3V0AA 1IS4A 1GMMA 3A7QA 2K0GA 4BK5A 3ACIA 4AI1A 2W5FA 5L9VA 5SV5A 2FDIA 5FY9A 3E6CC 2D6NA 4QQPA 4AQTA 4BQWA 2PHDA 5FLIA 3SITA 2D3PA 2XR4A 2AUYA 2XL7A 1RHI2 3MIEA 4YSFA 3KVAA 2G19A 2X5IA 3OUIA 1SBDA 1ULFA 4LIUA 1ND3A 4Q4W3 4XDPA 2GH8A 3ZPYA 1H8VA 4RYDA 1OD3A 2R061 3FHAA 4D0QA 3S7IA 3MUZ1 3BYWA 3MW3A 1W8HA 2JIGA 2CY6A 4ZONA 3VD9A 3MO4A 2R042 1MEC1 4UW6A 4GB32 1RUJ3 2PYTA 2JXAA 1G9CA 1I5PA 4CUGA 3OPTA 5GLTA 1WCKA 1UD1A 2OPKA 3GBFA 4YNIA 3ES1A 1OBNA 4HKWA 1NY72 5FZ4A 4C1WA 3UJOA 1S55A 4FOYA 4D7TA 5LK7B 5C3RA 4ASMB 5FZ6A 1H0BA 2DVGA 4OHVA 4B4QA 2R062 2WO3A 1V9U2 3ASIA 3PVBB 5DAVA 5EZWA 5FZFA 4BXSV 4CU8A 1QJX1 1YWKA 1RUOA 3LZZA 4FFGA 1IGOA 5K0UC 3ABZA 1RL3A 4FP3A 2IXIA 4IDZA 3FZ3A 4BQ4A 3OG2A 4E8CA 4XBNA 1OH4A 4QPYA 2WN3A 4YVWB 4B4RA 1MQTC 5FUPA 1JYWA 1C3HA 5A6XA 1WMDA 1VMFA 4PIZA 1HV0A 1P8JA 1V6NA 3SLIA 1MZ5A 2LTNA 2BPA2 5FLHA 2HWE2 1BHGA 2OVUA 3OY8A 4BYYA 2JG8B 3MDPA 4QWNA 2RJ2A 4C1XA 5F39A 2ILMA 1RUJ1 1K5JA 2QZ2A 1GQGA 4CUAA 3S0MA 2DFBA 2UYBA 3K51A 4W6YA 1AR82 3W5NA 3D3AA 5FZ9A 4QDRA 1KFUL 1XNBA 2ZGRA 3A0KA 4MGQA 1SPPA 4XJ9A 5FZKA 1DGLA 4YW5A 3H7JA 5L7OB 2X05A 1GKBA 4RQPC 4EWEA 3AMQA 2GC2A 3NMBA 4P5YA 1O8SA 4JGYA 1MZEA 3NO8A 2PHUA 4KU8A 4N53A 2WUHA 1N1TA 1V6IA 1OVSA 1NA1B 4FAHA 4OI1A 1OXCA 2YYOA 4E9KA 3SCHA 1REDA 2OQ6A 3MIDA 3MIHA 5FTTC 1PVC1 5K4LA 4E4DX 3GGLA 1QQP2 3QLQA 2R30A 2AGSA 1QJU2 4NPMA 2P4EA 3WF1A 3ZXDA 1HB1A 2ZAAA 2AEYA 1JODA 4XFGA 1Q8SA 5FP9A 1E5IA 1LTEA 2DCYA 3GXUA 1YI9A 3OYWA 4P9JA 1J3PA 3VDBA 3KQ4B 1WLTA 3AYCA 5F6KA 3VBSA 5DZEA 1H8TA 4P08A 2IXCA 3CKHA 4QQHA 3ITQA 3T2PA 1OD5A 3I8TA 3KVBA 4HMZA 2VUDA 3KV5A 2VD7A 1PNFA 3AZWA 3DKWA 3H1YA 3RQ0A 2Y6JA 4NAMA 2DCJA 5CYYA 5LBBA 5AC91 4D6QA 4UYBA 4PDWB 1ASJ2 4MGYE 2QZ3A 1LODA 3ZFEB 4E2GA 4CXXA 3O0VA 2GP3A 5C9AC 1OPMA 1DGWX 2GH2A 4AEDC 1VLNA 3LDBA 2YBKA 1FMD1 4CDUB 2ZGNA 3AFKA 3KT7A 1KEXA 1RUD3 2DV9A 2J1VA 5FKCA 3B00A 3ZYPA 5JWPA 1VBD2 1AR83 1RXGA 2R1BA 5DXDA 3WG4A 5A3TA 3OY8B 1B35A 4Q5OA 3ZFEC 1EUUA 4CU9A 1ZZ8A 4D69A 2KA3A 2FDKA 2A75A 1WLCA 3IDEA 3RYPA 3TEZA 1DHKB 2R063 1YFWA 5F3IA 2YC2A 5BY5A 4ZU5A 4B3NA 2A73B 4Q4X3 2RS51 2XGXA 3LDKA 3BGAA 4LLFA 4BH9A 3POGA 4OHWA 5KR7A 3JD73 3G6JB 4XF1A 4W6XA 4YW7A 3RI8A 4FOVA 3RYRA 1DLCA 2Y0OA 2FHRA 1QMJA 1I5ZA 2WAOA 3POEA 4RHV2 5DQ0A 3T30A 3WUDA 2G9FA 4DQAA 4WM8C 4QDSA 5FYYA 4WM7B 1PO13 3KCCA 4RR3B 3P3PA 3WF3A 3LOIA 3WNMA 3L2YA 3POBA 4HOOA 5BXXA 3E1F1 1EUTA 4MGZE 4YM1A 5FKBA 1VR3A 3NW4A 4Q4Y1 2WA4A 4Q8LA 3AXDA 1T6GC 2J22A 5FYSA 2Q8OA 4JCKA 3LB9A 3R0RA 3I54A 4LMFA 3VKFC 4IE5A 5FMOL 5E16A 4MX3A 4BQ3A 2ZJCA 4P5HA 2WZR2 3TN93 3VV1A 1JYVA 3DPRA 1ULGA 5JIAA 4OHYA 3VN4A 1MS0A 3P6BA 2IUWA 3ZSLA 1RUH3 5C7GA 5GZGA 2HYKA 1AL23 5LA2A 3USUB 4DEQA 3A21A 2HWF1 2WO7A 2WNEA 2ZBJA 1VRBA 3GHNA 4FFFA 1REFA 3H7YA 3KGZA 3LEIA 4IL7A 2DVBA 5DDJ1 1R082 3N9OA 3T1LA 2B9UA 3NJVA 2W2IA 3OBZA 4Q4W2 3VBFA 1W6NA 1V6KA 2FDHA 4Q4X1 1AX0A 2E33A 5H9PA 3HR9A 1RUI3 3WW3A 4LO7A 4NHLA 1G86A 5J96B 2Z42A 1QQP3 1RUD2 4HPKA 2D6LX 2RM22 4PLNA 3USSA 2MHFA 3JQXA 5J98B 1RC6A 2VU9A 2RMU1 3I3EA 1PNGA 1RUJ2 3R4UA 2HWD1 4GJZA 5CKMA 1Z7S3 2WFF2 2DYCA 1AVBA 5CFCA 2Y33A 3BOPA 5I0DA 3GJAA 3EO6A 2ZHNA 4IGPA 3VBRC 2DCZA 5A6ZA 1RMU2 1F31A 4SLIA 4AF9A 4FSJA 1NCQB 3OGSA 4BISA 5FPXA 2YY1A 1ZRFA 1NLSA 4FXGB 1OURA 2XXZA 5LRRA 4L99A 3N9QA 3T08A 1HDKA 2W91A 5CKQA 4JHZA 1YQCA 4RA0A 4WM8A 1K5MB 2DVDA 1NCQA 1QKQA 1VAMA 2YUEA 3AVSA 4R9CA 3O1SA 1QDCA 3OJBA 5C3SA 3LWCA 1WGPA 2ZX1A 4AVTA 2O14A 4M01A 3HQXA 1BXHA 5JAXA 1BKZA 3VB9A 1PO12 4BQ5A 4DS0A 3O5SA 4W65A 2BOJA 2P37A 3PJQA 4LPLA 5A3OA 4YG6A 1CONA 2AYHA 4K6BA 3VZKA 1K12A 1GOFA 5L7OC 4L9BA 2JG9C 1YXWA 3JUUA 2NM1A 2W1UA 4HVRA 4ZS2A 2OKXA 1W9WA 3I59A 1QHDA 2JDPA 4CDQB 3CF6E 3HT2A 2WO1A 1YIFA 4MO3M 4CYDA 2GC1A 2EAKA 1KITA 2RG4A 1AL0G 2RMU3 5JSRA 1DGRA 3I59B 4CDQA 4LULA 2IXHA 1TE1B 5F1RA 1YFYA 1JBCA 3DKQA 4XVHA 3U75A 5DAPA 3ZN6A 5D8AB 4ISRA 1BVP1 3JBG3 4HVOA 1HQWA 4JX0A 3HNMA 3EB7A 1O8PA 4IEUA 1VRH3 4G9SB 4R9DA 4CCOA 4ASKA 3DF0A 3HOBA 1YO8A 1W9YA 4BA6A 2Z69A 3NNMA 3U0ZA 3O12A 1US2A 4COVA 1TZOA 4OI4A 1O3QA 4JKMA 3HVDA 3K3OA 4GJYA 5JOXA 3ON7A 2R6QA 5KXBA 3BVCA 1LESA 5IVBA 3MZHA 1RITA 3LQCA 4OVEA 4CCCA 5FZMA 2E7TA 4UW3A 3WLUA 2WFF3 3C8XA 4XURA 3AC0A 4N7IA 3ZYHA 3NSTA 1GNHA 1JZ3A 1XOYA 4LLOA 1UIJA 1XE0A 3DXTA 2Q1MA 1JOJA 1OKOA 4MHRA 4DRVA 4OCTA 3NKGA 3BI3A 3MHZA 3E5UA 1BEV2 4YZ3A 1QNWA 1GLHA 1LHUA 5BNPB 3KT4A 3CDZB 1DP0A 1C8M1 4JHTA 2VCCA 2ZZQA 1A8MA 4RS5A 3USUA 3C7HA 5LWBA 1C8NA 1ODMA 4HK9A 2Y6HA 4LBJA 4P9IA 2JWPA 2DWRA 5LY1A 2PELA 4MSVA 4FFIA 2DU0A 2Y64A 4QDQA 1ASJ1 5KC5A 2V72A 4Q2FA 2WFPA 3VKLA 4Z82A 5FYIA 3RZGA 3CEWA 3POYA 5CVRA 5KHGA 2D6MA 2YPJA 2VZ1A 5CU1A 2JE8A 1GP5A 2PAEA 3DPRC 5JOWA 1RUI2 4YYOA 2VVEA 1LB2A 5T55A 1UY4A 3VHNA 1O3RA 2RMU2 4NROA 2WYSA 2VMDA 5F3EA 4DY5A 2HWF3 4ZZ8A 1NE6A 5E89A 4Q0QA 1MS5A 3F2ZA 4E2QA 1JZ8A 1UY2A 3S30A 3TEWA 2ZHMA 1MR5A 2DDUA 5IFTA 4EZ4A 1LHOA 5A3NA 3UGFA 2G9ZA 2A3YA 3CU7A 4OUEA 1C28A 2BERA 5JR2A 5CEHA 2HLEA 3FX3A 2CGNA 2LW8A 1W3VA 3BPSA 1ZM1A 1GV9A 3Q8AA 4H55A 3LEMA 2PA7A 4JGZA 4QX5A 4YRDA 5FBZA 3TNPB 4FAGA 2W0XA 4XDQA 3EJKA 2JD9A 4FPJA 5BNNC 1NXMA 1QH6A 4QPGC 4LE3A 5FOJB 5LA9A 4C91A 2FZ2A 1C1FA 2ETEA 5IUQA 3CJXA 3I2HA 3LA2A 2K2SA 2UYAA 1R64A 1W2NA 2QBXA 3LSDA 4EN8B 3PUSA 4QXKA 1KS4A 2EF6A 4XJUA 1PZ9A 1FOD3 1XXNA 3I2IA 1GUIA 2D97A 1L3JA 2YC0A 2GALA 2VTXJ 1AR81 4H7MA 5GZCA 2W52A 2C0ZA 1DIWA 1DQ5A 3H0OA 2J1EA 4XUQA 4BMBA 1V9U1 2NQYA 3ZXEA 4FI9A 4EQVA 1VMHA 2AACA 5CKNA 1D4M2 1FNYA 1Y7BA 4BQ1A 4L2NA 2RS32 4YVSC 2ZGOA 3VKMA 3NJYA 4QGNA 2GC0A 3PU3A 1O91A 3BOWA 1UO9A 1ZA7A 1ZBA2 1CAXA 2HKXA 3MYXA 4Y4YA 2NLRA 3PDQA 3AXEA 4QKDA 3K77A 2RS31 4UBGA 5FZHA 2NMNA 4AXOA 4K3UA 3PVEA 3O1UA 3KF3A 4Z92B 1G9AA 4GD4A 2X29A 4FPCA 4B7KA 5LZ6A 4NWWA 1N1YA 2BBVA 1N1SA 3K75B 4FO9A 5EV7A 3MLLA 4PF1A 3RWKX 1SCRA 1UPIA 4LHNA 3T2OA 1XQNA 3EBRA 1K5MC 1KJLA 1NY71 4DINB 1J83A 1AX2A 1NQJA 1TMF1 4H14A 1AUYA 2GMMA 3CJIB 3ACFA 1K3IA 1PMHX 4AEMA 3AJZA 2F6BA 4HL0A 4XZUG 5F5QA 2DUQA 2LUWA 4ATFA 3J9SA 1UF2C 4R8HA 5A1LA 2WZ8A 3ZDVA 3I4IA 2ZXQA 3VDDC 3VBOB 2Q8DA 1NZCA 1VPHA 3QD6A 2W1QA 3CLPA 2VCBA 3M4FA 3OPZA 4UF0B 5HI0A 3IM0A 2A3WA 2RVAA 1V0AA 2ET1A 4P9WA 3SCGA 4MGKE 4O61A 4XW3A 5FREA 2XJVA 3LE0A 3NWKA 3AJYA 4P9XA 4BCUA 4SBVA 3UL2A 1APNA 1SLBA 4ZXKA 1RUI1 2VBPA 3WF2A 4AQ2A 5C3QA 1IOAA 5DPNA 5FY5A 2B45X 1R081 5HV0A 3HNBM 5KC6A 5I8YA 4X8NA 4YVSA 4FOWA 4CDWA 2TEPA 2WNUB 3CQOA 1PM7A 2OQ7A 4UFKA 4NR1A 2XOMA 3KT1A 4M00A 3WG2A 2VZQA 2HEYF 1OFNA 2DU1A 4X8PA 4Z1VA 1H2MA 4DIQA 4A6SA 1LULA 4RN5A 1JHJA 1ZBA3 4KWUA 4WBBA 4YWAA 5GKAC 4HZFA 1KS5A 3VKNA 2ZMLA 4OHXA 5C8CC 1WCSA 3P3NA 1US3A 1S0GA 3B69A 4IW3A 4AL9A 4IV1A 1B35C 2AZ5A 2D6KA 3HQUA 2C9AA 1Q56A 1SBFA 4TXWA 1WUVA 2GMPA 1UPSA 1UYZA 2Y6KA 1GZCA 3DYPA 4OZOA 5SV8A 1HX6A 2ENRA 4KG0A 4UT5A 3WUCA 5B4NA 1O5LA 4NVPA 4ZS3A 2A6WA 2LS6A 2DCTA 4GWMA 1GNZA 1VBE1 4QPGA 1N1VA 1QXPA 3RG0A 4JV4A 1NOVA 4GZ9A 1OSGA 2YXSA 3I3DA 2P3IA 3SKJE 1ZA4A 3KV4A 3MLJA 4S2FA 4UFHA 3W21A 4Q4V3 5JIUA 2BV4A 1SMVA 4IEWA 2BFUS 4QPIC 2X5IC 3LA3A 1C5IA 3E5QA 4CCKA 2OYZA 1Q3EA 2VNOA 1CESA 4RHV1 1ND3C 2ZAHA 1ENXA 1NCRB 2QQJA 2WNVC 2OZJA 5T50A 4Z8BA 1ZBA1 4YFWA 5EQUA 5JDBA 3PLQA 1AYM2 3AYEA 1S0EA 3H42B 4UOJA 2W3JA 4QMAA 3DYMA 1OVPA 2O0OA 3GALA 5J1XA 4IEPA 4QU2A 3VHRA 1S2BA 4LUMA 5A7WB 4E4ZA 4QD2A 1OA3A 2ZABA 3AMHA 2YU2A 5JLVA 4W8JA 3IMNA 4S2GA 2B39A 3WD5A 1WLWA 2JENA 1EV13 3SKVA 3ZYFA 1H9PA 3SISA 3QCWA 4CEWC 4EWAA 2R041 4BU2A 3O1OA 1UU6A 2FDGA 5JXJA 1PMJX 3NNLA 3SEEA 1REEA 3B3QE 3M2MA 2PXJA 2DURA 4Y1YA 2PAKA 5F3GA 1QJY3 1UIKA 1UYPA 4MXWA 5DZFA 2FBEA 2WKKA 4GMP0 4BZ4A 4CP1A 3CL1A 4LE4A 4BE3A 1RTVA 2V4AA 4CP2A 1AXYA 5T3NA 3IWZA 1J58A 3MF9A 4XABA 5F2SA 4BIOA 5A1FA 4QU1A 1HV1A 4OYUA 1OLME 3UKNA 1UZVA 3TEYA 3TN92 4OHZA 1JYCA 1W6NB 2QUOA 3WX5A 2VE1A 2GZWA 4ZKTB 2HJIA 2QQIA 2YFZA 3GYDA 3MW4A 4GALA 4EN7B 2XWBB 3LPFA 4E4SA 1AR72 2VAUA 2P3KA 3I3QA 2PMWB 1LOBA 5GZFA 1DGWA 2D98A 2N7GA 2O8QA 1W05A 4WVZA 3I3BA 4KBBA 4BQXA 3I2KA 1CAVB 2W92A 4N43B 2J42A 2QDRA 4XF0A 3WNLA 4B1MA 2VZTA 1D4M3 4TSVA 3OTFA 4K20A 1XB9A 4BQ2A 2QQUA 3AMMA 3V64A 1SHWB 3M3CA 1B35B 3MGUA 3THCA 4DPNA 2R043 3N4MA 4GB33 1WMFA 5F5CA 3WG1A 3RPQA 1CAVA 5IVFA 4UBHA 1NLQA 2G9GA 2A6VA 2RHPA 2YGLA 1YHFA 1UOFA 4Y1ZA 5JOYA 4B7EA 5K0UB 1LAJA 1Q43A 1MPXA 1AR91 2EICA 3HD8B 4LKFA 5B2GB 4PJYA 3U78A 3ATGA 5FK8A 4ZY9A 3OB8A 1X7NA 3ZXJA 3PURA 1ND2A 2YFUA 4YGDA 1ZBE1 5LEJA 5F7UA 1COV3 1OHFA 4X6QB 1KJRA 5JXHA 5D8AC 3H9AA 4L0PA 2KR2A 5EJ3A 4YGCA 1EAH2 1W03A 4JZRA 1LOAA 4Q27A 4ZU7A 1D2QA 1X9TA 1DU3D 1ULPA 3PU8A 2WZR1 1Q8QA 4QM8A 4NHMA 3TNQA 2P2KA 4PBOA 3VD4A 3VBSB 4QM9A 2TNFA 2C6SA 4RGAA 1IS6A 3ZMOA 5FMBA 5ANNA 1AR63 1CD3G 1DF0A 1HLCA 1KXGA 2XONA 4GB31 4H3WA 1WMXA 1HXS3 5L36A 1LHNA 5A3MA 4YW4A 2JJ6A 2QCSB 5J36A 1O59A 3MICA 5KXEA 3IDCB 4I3GA 5FUIA 2E7QA 2Y60A 5C71A 1HN1A 4MHUA 2JDAA 2C1FA 1HB2A 4YVWA 3BTAA 3JBG2 5FZOB 3RVHA 1LECA 2VY0A 3OPWA 3TB0A 3IMMA 3T2QA 4MVTA 4B8EA 4BOWA 5FR3A 1OLMA 3PIGA 1IQAA 4OMDA 2HWC2 1IPKA 2D43A 3SMHA 3O1RA 3FFZA 4QX1A 1OA2A 1OPOA 2PHXA 3AM2A 1MEC2 4V2WA 3T1MA 1JZ5A 2GMEA 4IV3A 1HRI2 4AGGA 2CTVA 2XJSA 5HBAA 4QKNA 1OMIA 2EA7A 2NYYA 4ORFA 4OLLA 5C4WA 3AMPA 4AWDA 4BJ0A 1HJGA 4EYUA 2KM2A 4IEXA 4KGQA 3AVRA 4R4ZA 4CP0A 4AZZA 1VBD1 1NKGA 2W87A 3NAPC 4GWIA 2VXRA 5FXXA 1BEV3 3ZR6A 4LITA 1UMHA 4AR2A 1E5SA 2AREA 1YRZA 4FTSA 4AI3A 3VBUB 1XNTA 1FXZA 1LEMA 1GYKA 5FXZA 2MEV3 3LIGA 3K4ZA 3J7MA 2ZGMA 1POV1 4META 4OUMA 1PO23 3B01A 4AEDB 4QPIB 2PHFA 4W50A 4NHXA 5C70A 2VVDA 2B46X 1QGLA 3TAYA 3WNOA 3DYOA 1OQEA 2A7AA 1H1AA 1N3PA 1LKNA 1UXZA 2HEWF 3H8XA 1HKDA 4CPBA 5BNNB 1OF3A 2WA3A 3O1VA 5CFCB 2VPVA 4QQOA 5I0TA 5HV4A 5DN2A 2NP0A 1DZRA 4HT1T 1AR92 3GZTB 3ZN6B 1QY4A 3MBWA 2IVJA 3Q9OA 1ZRDA 3NQHA 4GA9A 4LO6B 4CEYA 2HYXA 3T0AA 5FQ0B 1QF3A 4CEWB 3HJRA 1ONAA 1BEV1 1W8FA 1XU2A 3SHRA 4ZPIA 4GAZA 5D21A 1Q8OA 5F37A 4LO4B 5HCFA 3OUJA 2CYFA 3N7LA 3A0NA 3ELNA 4MH0E 4XQWA 3GF6A 3ZXGA 1COV2 3VD3A 2VW1A 3H3UA 1HRV1 3JD72 4I30A 3VDAA 4HPKB 3KV6A 4AAPA 1UYYA 3NRUA 1D0HA 2CSGA 5E8AA 2D6PA 1RUG2 3GDBA 5C5TA 2XLFA 1CPMA 3NVCA 2D6OX 3HNYM 2P6CA 5APAA 1RVF3 1ND2C 2ARXA 2FQPA 2VULA 4Z07A 4AGRA 2EIEA 3FBYA 3K46A 4NJ4A 2HWE3 2QQPA 1MS3A 1H1MA 2WN2A 2P3YA 4XUPA 3LPGA 4CZSA 1VBC2 4NPRA 1B09A 2JG9B 5C3PA 1GBGA 5J48A 1AR62 3WEZA 3AZZA 3DPRB 3PMEA 4DFSA 3ACLA 2JIJA 3LIHA 1NX9A 3OGVA 2ZA9A 5H9RA 5D1IA 5L9RA 4JDOA 4QX0A 1QDOA 4CCJA 2EIDA 5CG8A 2JG9A 1UCXA 4OI0A 2WT2A 2SLIA 1AYN3 1PO22 1AJKA 1QXJA 3FC0A 3IPVA 4FPOB 5A3PA 1CR7A 1JMUB 1YYNA 2QFEA 4LOTA 4AI8A 5FY0A 2W95A 4GIQA 2Y6FA 2CDPA 1ASJ3 1R1A2 3B9IA 2QQOA 2YBPA 5C3OA 5CADA 3BUCA 3SH5A 3IPVB 1GR3A 4LBKA 4TYSA 1CN1A 2QTWB 4M3CF 4CDXA 2CNAA 4IEYA 1TVGA 3AKSA 4JGYC 3NV1A 1EPZA 4S2HA 5DMYA 2ZHLA 5FYMA 5EXOA 1FATA 1PGL1 1QJU3 4PHZA 2B42B 4CDWC 3RZMA 4P9LA 5FYVA 1DQ2A 3DN7A 4LKSA 4AFDA 1NLRA 4AW7A 3O7OA 4PQQA 3B02A 4XAEA 1FAYA 1SFPA 3AB0A 2WSUA 5T5LA 4LXLA 4JGZC 3J4UH 3VZNA 4A6OA 3VBUA 3UKVA 1X33A 2ZPXA 1WMEA 2PN5A 3GBWA 4IETA 2A6YA 3GCWA 1J1LA 5LA0A 5FZCA 5JZGB 1QIQA 2VMGA 1XU1A 2BDRA 5IK4A 2GDFA 1BMV1 3C2UA 4QX3A 4OMCA 4Y5TA 1V6OA 5FXWA 4YARA 1N47A 4JC1A 4Z2WA 4MADA 4F3JA 5JZGA 4NRPA 2ZOEB 2ZKLA 3Q8CA 1W04A 4FFHA 4M0HA 2PTMA 4YM0A 3BN6A 1RYYA 1X82A 1JOBA 1ZBE2 2BNOA 4I0WB 4IV3B 4QAWA 5GLZA 4HG6B 4AVVA 4LBOA 5FYCA 3WVJA 2ZX2A 4V2VA 5CNAA 2XJRA 3KCXA 3V0BB 1PX3A 3Q8EA 4INDA 2EXJA 1A6CA 3RWNA 1JW6A 3OF1A 5F6LB 1KRIA 4HXCA 3HAGA 4RGGA 4RL7A 3WP6A 3E6BA 1RMU1 1L7QA 3KHCA 2EVXA 4A4AA 2WFF1 3D6EA 3MIGA 1LU1A 3Q8BA 4FPLA 4YLZA 4QT6A 4B1LA 4XCAA 3OD4A 1VB4A 1XJAA 3PUIA 2NPIA 3N7JA 1N3QA 5FO9B 3ZX7A 4Y26A 4DUXA 4XHBA 4QPIA 1AL22 1DG6A 4KNCA 2ZEWA 3DUIA 1SLTA 4Q4Y2 3S5AA 5GZEA 2A6ZA 3FBMA 3RGBA 4RFT0 3WP3A 3WQBA 4B4PA 1NAEA 2WWJA 1UKGA 4I0AA 3E5XA 4HFSA 1GANA 4WZFA 2CAUA 1J84A 4CEYC 5LASA 1C8M3 2ATFA 5L73A 2VMHA 1O3TA 3DL3A 3WDYA 3ETQA 3NKTA 3OGRA 3PL0A 1JN2P 4JQRA 1V6JA 1G8WA 4PLOA 2RM23 5DG2A 1YCIA 3AP5A 4GWJA 4NUBA 3ZLIA 2J1SA 1U5YA 2W47A 2VQ0A 3VDDA 3AZXA 5FZ3A 5BPXA 4CCDA 2LALA 1RUF1 4ASLA 4NO4A 5BNPA 1I9RA 5FZ0A 5EYYA 3ZSJA 1ZREA 1QWRA 2VW0A 2HEVF 1RMU3 3ENRA 3WQ7A 1PGL2 2E7AA 4XF9A 3RRDA 1JTZX 3NNJA 2NMOA 5IVCA 2Y38A 1IPSA 3HPNA 3BIEA 5LK5A 5B4XA 1UY1A 2V5YA 1UZZA 2OZ6A 2G4IA 4QQLA 3I2FA 3THDA 2WZR3 3R4DB 1UZWA 3SH4A 2VNGA 4XILA 2Y26A 1PHMA 4ISQA 1YFXA 4LTAA 2ARAA 4NIGA 5E88A 4A44A 4EJRA 1URXA 1OKQA 5DAQA 5DUUA 4CDXB 4EWDA 4DXSA 1IQDC 4Y33A 2EAAA 1AYM3 1R083 2QQKA 3QACA 3ZSMA 4BXFA 3P1IA 4XXAA 2XVLA 2ZZJA 4DZGA 2W1SA 2VJXA 3PVOA 1V6LA 5TSWA 4PIXA 1F5FA 2IZWA 2JICA 4QHBA 4Y5SA 3UYJA 1YQ5A 4DO0A 4K40A 5IVJA 2XQRA 1NQDA 1CWPA 3OEAA 4AHXA 1VRH1 5IK8A 5BUVA 3T2TA 5KBFA 3FN9A 4OULA 4Y24A 4IEZA 3FUQA 2DUPA 1F35A 3W58A 2R32A 3R4SA 3JB4C 1U0AA 1BLZA 2RDQA 3BB6A 3VGIA 2Y6GA 2BP6A 5JXGA 2PFWA 3UESA 4XFCA 4LHKA 2IXJA 3HMYA 3O1PA 4K7JA 4QB1A 4YZ5A 2FDJA 1W8ZA 1ZRRA 1JYIA 1S0FA 2UWBA 1BBT1 3EQEA 1LEDA 1JZ6A 2X5IB 3SNMA 2VC9A 3VZLA 2GNDA 1ND3B 3VZJA 2CU5A 5I0UA 1CJDA 1FOD2 3DEMA 1JHNA 3FUOA 3WQ1A 2BVVA 1NXD1 1W8UA 2BWAA 3WDVA 3ZFGA 5C5UA 1CZSA 1WCUA 3VBOA 2DTYA 1GFF2 1AL21 1HB4A 2GNMA 2IWGB 2QNKA 3KM5A 1UXXX 2GN3A 2GP5A 3NNFA 3PHMA 4XIKA 3VLBB 4NN0A 1YNAA 5F32A 5A6YA 3KS7A 3U4SA 3M3EA 1GQHA 1PGW2 1VJ2A 1POV0 1DQ0A 3AYDA 1GZTA 2JECA 4QGMA 2XQXA 1QJEA 2ZKNA 2VUJA 3SCFA 1JYTA 2VVFA 4FVVA 3V0BA 1W6MB 1H6XA 1JU4A 4UI9L 2IXLA 2XJUA 4AFMA 1C8M2 3N9NA 2CGOA 1ULCA 2Q0AA 3D82A 3LGRA 4EN6B 4AI2A 3LEKA 5IW0A 3T4VA 5EIYB 4KI5M 1JYNA 1SBEA 3WG3A 3VL8A 4D7YA 2ZEZA 1XE8A 1MZ6A 5A7WA 2VECA 3AKQA 2P17A 3C7FA 2Q8CA 4MXWB 2IXKA 2HWF2 4AG4A 2ZACA 3AP7A 3T4HB 3U4XA 1PIV1 4LBQD 1SG3A 4H2AA 2YDEA 4TLGA 2W9XA 5IVYA 1I1EA 5A32B 4OI2A 4NOTA 3DXUA 4IV3C 4LIVA 3T09A 1HIXA 4L8QA 5FMCA 4AVSA 2RJLA 2VM9A 3V0AB 2YGMA 1SLLA 1H1IA 4IV1B 3O1MA 5HXMA 1JZ7A 3WDTA 3M1HA 2BQPA 3N9MA 5A32A 5FZ7A 5C8WA 4UFLA 3WSOA 5ERLA 5JVVA 5J7MA 2BW8A 4XMAA 3ZXAC 4CA9A 3PTYA 1GQPA 1SACA 2VMFA 3WCRA 1H8TC 4CVUA 4FPFA 4BIFA 3VDDB 3I7DA 1FMD2 2EXIA 2VGDA 2XG3A 3AL5A 4IEOA 4MG2A 2KD7A 1W6OA 5FDBA 1GOGA 1FYUA 4C0BA 4TTGA 2R49A 2WS91 2WNVA 4A3ZA 2UY9A 1SEFA 4XOGA 2ZGPA 4LT5A 2OPWA 2W1WA 4FCAA 3ZFFB 2RV9A 4C90A 1NUKA 2HWC3 2P5BA 1XNCA 4PF5A 1CAWA 5FY8A 3RZHA 4TWTA 5A3LA 1F8VA 2VOWA 4OFGA 5KHJA 1EYBA 1UZ0A 4CE8A 1UAIA 2H6BA 2PQSA 3LFIA 4Y1VA 1POV3 1GWKA 4O9GA 5BNOA 4COWA 2FCTA 2LROA 2UY8A 4KQ7A 2VCMA 4RQPB 3L9JT 2Y8KA 1CGPA 5FPUA 4LHLA 3TOJA 1RUC1 1RINA 1S2KA 3SXWA 2VOVA 1NE4A 4AFBA 1YJLA 4HETA 2PHWA 1W90A 1UW8A 1VBA3 3D0JA 4BDVB 4XTMA 3CZUA 2VOKA 5FP7A 4L11A 5F5IA 2CWSA 3EHKA 5ABJC 4YGBA 5A6QA 4D8MA 1CZVA 4XQ4A 2ZGKA 5ACA1 4YZ4A 2XBO2 3FHQA 2DFCA 4Q1PA 3WDUA 1HQLA 1ODNA 4GH4C 4UXAA 1DQ6A 5FZEA 1JS9A 4HK8A 2YHJA 1YI7A 1LOFA 2CWMA 3J7NA 3PIJA 4UWDA 5CFDC 2VQTA 2VTXA 2BEOA 4CCLA 3EMRA 1VP6A 2PLV2 5K8SA 3QBQA 2X53S 2PHLA 4WV8A 3VBOC 3B93A 2BNMA 1W9SA 2QKDA 4GKYA 4R9AA 1DYPA 1I6XA 2NN8A 3B94A 2HH9A 3ILRA 1PZ7A 1XYPA 3R05A 4CSWA 5IWFA 4QB6A 5IAVA 1O4ZA 1QOTA 1TMF2 1W9FA 1CX4A 1YQ2A 2WQZC 2Z2SB 1RUF3 1UMZA 4N43A 5JSOA 2XPJA 2C5DA 2A71A 4AFCA 1BVVA 5DDJ2 1OH3A 4FQZA 5ANQA 5BNOC 3CBNA 3MV01 1FI2A 1ZVFA 3NAPA 1QJX2 1FT9A 1PGSA 2ADEA 4QKFA 4ATEA 4AAXA 1ZYBA 1RUG3 1NCRA 2OA2A 3BODA 4HKOA 3VDCA 5FZBA 1CAXB 1A78A 4U36A 4F83A 4GH4B 4IEVA 1CVNA 1F2NA 1FPN1 1R092 1SLIA 2XUMA 1EP0A 4CU6A 1H8TB 1W6MA 1RGSA 1RIRA 2R073 3ACGA 4NIIA 5A7OA 4LBQA 1K5MA 4LORA 4A42A 1DLLA 1UNBA 3VBRA 1QH7A 1MVEA 2VUCA 5FMDA 4HONA 3RFRA 3WNKA 4IE6A 2ZEYA 1AHSA 2XWJB 4NWVA 5FPLA 3ZVXA 1DFQA 5JSPA 2XLGA 4V1PA 2L9LA 1LOFC 4NIAA 3ES4A 3BTXA 5CG9A 4D6RA 5JZGC 3WCSA 2DVFA 4YM2A 5DZGA 2P6HA 5FO8B 1RHI3 4QPWA 4DXZA 2Z79A 3M3OA 3NV4A 2ORXA 4LBMA 4JTNA 4P00B 3UETA 4G4FA 5FPAA 2EIGA 2ZGUA 3LSEA 5LY2A 2DVAA 5LB6A 2XVGA 3A23A 4YVWC 1VBE2 4JRAA 1ENSA 2PLV3 2JKXA 2E51A 4YW3A 2BU9A 2BVBA 2E26A 1OT5A 5AC93 2UU8A 4JKLA 4KGGA 1F15A 3WDXA 2WS93 1W99A 5EPAA 4IGOA 4JVAA 5A33B 1H2LA 2EXKA 1W2UA 3JZVA 1PX4A 1M4WA 4COZA 1G9DA 1CAUA 4CCNA 1SZBA 3FJSA 4YFZA 2WSVA 4KH9A 5IAXA 2WNVB 4FQ4A 1TMF3 2GU9A 1WKYA 5C4WC 1L7LA 2HWD2 4J25A 2VZSA 2CV6A 3WINE 4IV1C 4LQRA 3ZDSA 5FWEA 1AX1A 3O1TA 5DAXA 4MZUA 1JUHA 5FZDA 4RR3A 3VBSC 1RHI1 2FDFA 4I3PA 1F4HA 1QJFA 1W0PA 5CA6A 3M7AA 2XHNA 1XNAA 4Y4RA 5FY4A 3UGGA 1PVC2 1R093 4NHKA 4WVWA 3N9LA 2VMEA 3APBA 3POJA 5FZLA 1JU3A 1STMA 3CHXA 3H8UA 3PUHA 4FXKB 5FK7A 2WDBA 5M0TA 4AK3A 1EPWA 4RS5B 2DF7A 3UKTA 5IT6A 4WZCA 3RZJA 1OA4A 4URAA 1YQ6A 1AZDA 1H4GA 4Q29A 4WM8B 2R0HA 4I2OA 4HVQA 3BTZA 1UYXA 1J59A 1YIPA 2ZHKA 2PLV1 1CJPA 4XFIA 2ZS6B 3VZOA 4I02A 1K42A 3KGLA 4XTPA 1X50A 3WNXA 4W4ZA 5A1AA 1QU0A 3GM8A 2AENA 1LRHA 3GZUC 2VXJA 3OOXA 3MI8A 4NE9A 4QHOA 3VUOA 3KZ4C 4A41A 2WJSA 4Q4Y3 1AR73 1Y43B 4M3CE 2ARBA 1WBFA 2ZGSA 4R52A 1VE0A 4YPJA 4COUA 1EV12 4FT8A 1IPJA 3KD4A 3ZKYA 3POSA 5HPOA 4HSJA 4X6RB 5DUXA 4ZHNA 1U5ZA 1TME2 4PBPA 1Q8PA 2F17A 3A4UA 1XNDA 2V09A 1VAVA 2GSYA 1WWYA 1Y9MA 1QJY2 1JXNA 2C4XA 2D93A 2WS92 2Y6LA 3J8F3 4M4PA 4N43C 2BFUL 1Q5OA 4CDUC 1GZWB 1O7FA 4KWJA 2RJKA 5HCBA 1H30A 4GKXA 2ZMNA 1OUXA 4HLTA 5T54A 4CUBA 2YG0A 1SCSA 5CISA 1NA1C 3K3NA 3ZXKA 4FBFA 4AYUA 5FZGA 3VBFB 4EROA 1IS5A 1DZTA 2ZCWA 4XC9A 1R1ZA 3O0WA 1X36A 4FPEA 4AHZA 5G04L 3JCIA 4CUCA 4YM3A 2V4VA 2MEV2 5FY7A 5C33A 1KD7A 3LDRA 3H1WA 4XJZA 2BBAA 1WCDJ 3NAPB 1QOSA 2OS2A 2WZPP 2RS52 3C7OA 4P9GA 1X8EA 1OLQA 4M3CB 3AFGA 1HRI1 1ULDA 2QQVA 5IK7A 4CXYA 3KB5A 4XEZA 2GNTA 2WLQA 4MGSA 2E53A 3CMGA 4EE2A 5FP4A 2BGPA 4AEJA 2D3SA 1VBC1 1DBNA 2C24A 3TRSB 5K9YA 3ZOIA 1RUE1 5FYZA 2R7EB 3AKTA 3FL7A 3VKOA 4LEJA 2ZEXA 3JU9A 4AEKA 4CEYB 4DOUA 4Y22A 2I07B 3P5BA 3T0DA 3J8F1 3OGJA 3TYJA 3ACHA 4KU7A 3J7LA 5LBCA 3MF6A 2RDRA 1ACCA 1J1TA 2V73A 1OI6A 3ZXLA 3WP5A 3RZLA 1X8MA 2UURA 3KV9A 5LATA 3VBHC 2JB8A 5IFPA 2YB7A 2GC3A 3U10A 1RUF2 5DABA 4MUVA 2CGPA 1HJFA 1PGW1 1QXRA 5FZ1A 3B7MA 2VBDA 3PMSA 1XBFA 3POIA 3W59A 4BPZA 4CDUA 2RM21 1S0DA 2PAMA 1LR5A 3OUHA 2AR6A 4DXTA 4N8MA 2VBBA 1OF4A 3DV8A 1RUC3 1ULEA 3FLRA 2D40A 2CDOA 3F95A 4QX7A 1EAH1 1ZRIA 4UFJA 2ERFA 3HIFA 2R072 3ZYRA 5K0UA 1ZZCA 1PVXA 1CAUB 1UOJA 2JG8A 5ISLA 1RJ8A 4ES9A 1VBC3 5EP9A 3ZO0B 4BB3A 3TN91 2VNVA 3FFQA 3V56A 5CAZA 5ABJB 1YQ8A 1MACA 5A7SA 3ZYGA 2JE7A 2Q8EA 3E6DA 3ZN4A 1ND2B 1QJU1 1LGNA 3G7DA 1O4TA 3HN1A 3PTRB 3H8RA 1SLCA 1RUH2 4JGYB 5DAWA 5LBEA 1ZZBA 4AI0A 4AI9A 5F9TA 1PM4A 4URTA 3SEPA 4WVMB 1NG0A 2J1AA 1AXKA 2UWCA 3SQOA 1QNYA 4DXRA 2ZMKA 1LENA 2BGCA 2ES3A 4XHXA 1T2XA 2VZPA 4IESA 1DQ4A 3WNNA 3IZOA 2P34A 4WVMA 1W39A 3E97A 1RJ7A 1WW4A 2VTFA 2VZOA 1GZWA 2QQWA 2WBKA 1AR93 2PHRA 3VBHA 4CP9B 4NIDA 4FPGA 1W2OA 4XE9A 4EN9B 4P02B 3TWIA 2D5FA 3S7EA 5KWRA 1AXZA 4Q0VA 2XBO1 4MGTA 1KFXL 1U12A 4P14A 5AFEA 3WT3A 4GMP3 3EXUA 1BMV2 4R4XA 5FYBA 4K9SA 1CQ9A 1O5UA 4KBZA 2YBSA 2JD4A 1G9FA 1KDKA 1W8TA 2ID4A 2AH2A 3URFA 1AJOA 1CPNA 2ZGLA 4J1XA 2P3JA 2IVIB 2BYVE 5EJZB 1L7RA 1DCSA 3ZN5A 4CTEA 1SQ4A 3H50A 1TNFA 2JDYA 3QOPA 4O9EA 5GALA 5KHHA 3U1XA 2XDVA 4XETA 1DYOA 4XPVA 3ZXFA 2RR12 2RS53 4M0NA 4PDWA 3I97A 4MV2A 3WP4A 1BBT3 2A5ZA 4HN1A 3ZFGB 2A6XA 1RVF2 3RZKA 3GBGA 4JAAA 3N3HA 1SLAA 5I93A 4AHYA 4BWOA 1C1LA 4Y20A 5I0RA 4I01A 2UWAA 4A3XA 4QHZA 1UKRA 1W8NA 1GWMA 4ITCA 1ZZ9A 5FFOC 1G9BA 3NV3A 4MLOA 4DMIA 4S2DA 2JB4A 3JBG1 3ZPOA 5C8CB 1GZ9A 2WLPA 1PIV2 2MNGA 3CIHA 4G3YC 3EYPA 4GMP1 4CDWB 5C9AA 3KSCA 4XJ8A 4AEDA 5J37A 3U07A 3LF7A 4M4RA 4Q1RA 1IS3A 3NNGA 3QH7A 4NRQA 2WRAA 4QQ2A 1D2SA 1U5XA 1W6PB 2JEMA 5IJRA 3V65A 4EV0A 4WVVA 4RSUA 1RUH1 5FZ8A 4J6GA 4YVSB 1MS8A 1W6PA 2BNNA 1TME3 4KWKA 5FOBB 5T5OA 1S0IA 2CL2A 5DG1A 2QE3A 4A45A 4D3WA 2R0FA 3LCPA 2IFRA 4U2AA 1WA4A 3AZVA 5BNQA 1AF9A 3HWJA 5FQ0A 5IVVA 2E31A 2H6CA 2GNBA 5FPVA 1WD4A 2I2SA 2XJTA 2WZEA 1J3QA 3IB3A 1BQPA 2TBVA 2W39A 3WW1A 4CCMA 2B9VA 2DCKA 1LHWA 4LK6A 1IZ3A 4PDWC 4Q4W1 3OCPA 3RJRA 4QXHA 5AVPA 2WT1A 3D8CA 3CJIC 3WF4A 3D4KA 1I3HA 4RHV3 2JDKA 2XLAA 1W06A 3UT0A 5C6CA 2JG8C 3ZFFC 2FD8A 2RR13 2BZDA 1Y9GA 4XUOA 5FXVA 2VOTA 4N53B 4RGKA 2YZ4A 4HN0A 1XE7A 5JUVA 3IDAA 4NIHA 3BU7A 4OUSA 3WHUA 3VL9A 4Y5Z0 5IATA 3CNAA 3BTYA 1DQ1A 3HN3A 5K7PA 4O65A 4LKDA 2RS11 1UY0A 1BJQA 2DUOA 1D0GA 2B7YA 3GZEA 1C57A 3U37A 1QEXA 1AR71 2XL9A 3WOGA 4ONUA 4LNVA 3ZKUA 4YGEA 5EYXA 3KQRA 1LNSA 3C7EA 2X10A 3ME2A 5AVAA 3SC7X 3I2GA 1S0JA 2WINB 2VOXA 2BRTA 5FCCA 1CAWB 1IKPA 3MEPA 5CFCC 1VAKA 5GZDA 3VBUC 3GHMA 3O0XA 2DTWA 1KQRA
chains in the Genus database with same CATH topology
3RDIA 2SBAA 3SH3A 1VIWB 2O8OA 1LGCA 4UW4A 5FO7B 4BLJA 1Z7S2 1VBA1 2RR11 5JR7B 2ZGTA 4JDNA 3FMGA 5CFDA 3GZAA 1JH5A 1F9KA 1SDWA 2A70A 3MFCA 4YZ2A 3ILFA 2MPFA 2ZTNA 4D7SA 1G7YA 1YJKA 3VZMA 3H1MA 2E6VA 3IIAA 5I8TA 1H4HA 1VALA 4PLMA 3RMXA 4W6WA 3VHPA 4XBQA 4GULA 1PIV3 1PK6A 4N90A 4COYA 2RS33 1D4M1 1MQTB 1OLRA 5L7OA 3NV2A 1GICA 1DDLA 2XH6A 5H9QA 5GLVA 3ZYIB 1OFSA 1BCXA 1MVQA 1A8DA 3KMHA 3FLTA 3HBZA 4XFAA 2F4PA 1ZRCA 3VHOA 1YLLA 2YMZA 2Y0IA 2X8KA 2NZ9A 1PMIA 1TEIA 2D7FA 1COV1 1U5IA 3KCYA 4HSLA 2VMIA 1O3SA 4YG3A 2VUAA 4PIYA 3OD0A 4LA3A 5HCAA 4XF4A 2Q1ZB 3MFAA 5BNPC 3LOBA 3RZZA 1CIWA 4D94A 4IERA 3RS6A 4GH4A 5JPNB 3OBTA 1RUD1 3QH6A 2JE9A 4IEQA 3ZSEA 2OUHA 2HWB1 1G6NA 1WW5A 3HT1A 1OQ1A 1MS4A 1A3KA 3CJIA 1ZX5A 4WM7A 1Z0HA 5H9SA 4AQ6A 2ZGQA 1SFYA 3ZMNA 2HWE1 5ACA2 2PQQA 3ZIXA 2H0VA 1FNZA 4XJWA 4Q8KA 2WC2A 3OGGA 4GWNA 1AYN2 4K21A 3NJZA 5J3UA 2VNRA 3WDWA 1NYWA 3IBMA 4JTOA 2WWSA 2B8MA 3WHTA 1H2KA 1JUIA 1PZ8A 4LA2A 1HW5A 4AVAA 3B9CA 3THTA 2Q5TA 3NL1A 3WXPA 1NCRC 3N7MA 3PVNA 4PCRA 3ZFEA 2XB6C 3WW2A 1OOPA 2R1DA 1ZNPA 1GSLA 2WL1A 2H0BA 2I45A 5EFUA 1VBB2 4Q26A 1PO21 4XXPA 2EALA 4GQ7A 2O1QA 2MEV1 5FRAA 5BNNA 4I0BA 1ENQA 1R091 4MYEA 4F7ZA 1PK6B 3ZYJB 3VBRB 1S0CA 2TUNA 4Q4V2 3RMYA 3ZSKA 1UZYA 5AFBA 1QJZA 2QDNA 3X29B 4WM7C 3FHIB 2FMYA 3ZFGC 1N3OA 1MS9A 3K48A 4K1ZA 1RUG1 1OQDA 4FPHA 4F8AA 5CFDB 1Z7S1 1VBB1 1DZQA 1MZFA 1TME1 1S1AA 4ES9A 4EWDA 2XVKA 3RNSA 3WW4A 3KLSA 1PK6C 4A2UA 1EV11 4RD7A 3BIWE 4QGLA 4XBLA 4BMEA 1AR61 5KHKA 3MPBA 3VBFC 2OUJA 3IT8A 4XIOA 4CDXC 2W68A 4AVBA 1BYHA 5JOZA 4BM8A 1W6QA 4A7KA 2E63A 3WY6A 4XF3A 2OIIA 2OW4A 3AKPA 5T52A 1HRV2 3JD71 3L2HA 4FTEA 1Y9QA 4GXLA 4LO8A 3LKJA 2KXLA 3N36A 3POWA 4LR4A 5JMCA 1VBB3 2FZ1A 3M8LA 4Y1XA 4HBNA 3AP6A 1NCQC 2WT0A 3PNAA 3D0SA 1ENRA 1C5HA 3UJQA 1FOD1 4YW1A 2D3RA 1XRUA 3ILNA 4N7UA 1XNKA 3MLKA 4IQPA 3TBDA 4RQPA 1VBE3 4Y1UA 3AKRA 3OBRA 1H9WA 4J1WA 4N53C 1YUDA 3AMNA 5J09A 3IKWA 4JDMA 3BALA 2RS13 1ZZ6A 5E1RA 5GM0A 1W6OB 1LJ7A 1OOPB 4LO5B 4Y22B 1DGRN 3RYKA 4CDQC 3ALQA 2WQ4A 3INAA 1AYM1 4MXVA 4KL1A 4C0HA 2Q4SA 1FV2A 1Y3TA 2HWD3 2IFWA 2A3XA 3JB8A 1LOEA 4XZPA 2XJQA 1QJX3 5DUWA 1V70A 1EAH3 4QPGB 5C4WB 1OOPC 5CBLA 1LOGA 1RUNA 4A7ZA 5A33A 5EWSA 1WW6A 3ZIWA 5ABJA 5BNOB 1HRV3 4YZ1A 1FX5A 2VQAA 2GAUA 1M06G 3O14A 2ZX3A 1W6QB 5BYNA 4LUKA 1FPN2 2EXHA 1HXS2 4FPYA 5GLUA 1RVF1 5LRSA 2VG9A 1UX6A 3WQ0A 4RS5C 1IKQA 4DY3A 2R16A 3N7KA 1RB8G 1WW7A 3C3VA 2JDZA 3AYAA 5ACA3 1J3RA 2ZX4A 5DUVA 1QOOA 3M70A 1AYN1 1LGBA 4TZDA 2YV8A 4I09A 5JPMB 3ST7A 1HRI3 4OZXA 4KG8A 3AZYA 5HXVA 5AC92 3MIFA 4N9HA 1LCLA 1O4YA 4CEWA 1BZWA 1IHMA 5JI7A 4A7YA 1RUE3 3MW2A 1S0BA 2WIIB 3FE5A 2HWB2 1V9U3 4HKLA 3RSJA 5I91A 1LU2A 3RJ2X 3FLPA 2QVSB 4MGIE 3LA7A 2FMDA 4Q0SA 1FV3A 5JI9A 4M3CA 3UV9A 4K8FA 5LEKA 3M3QA 4HANA 4XMIA 4BLIA 3M3IA 2BWCA 2I74A 3MIBA 4N9IA 1ZZ7A 4XQDA 1PVC3 2JX9A 2VH9A 3S6PA 1C4RA 4YG0A 5FLJA 4AGVA 1ALYA 5T5JA 3D5OA 2QJVA 1KDMA 2ZX0A 1FPN3 1TNRA 1Q8VA 2R071 4Q4V1 3BPZA 4AQSA 4FOQA 2WNUC 5IK5A 5FPZA 4Y20B 4XYXA 1FMD3 5I0SA 5I8SA 1D4VB 2W08A 3J26N 4AHWA 5KXDA 1TQ5A 4JRLA 1R1A1 1XYNA 2BTVC 4IXLA 3U11A 3PJYA 4E2SA 4UW5A 3AP4A 2D44A 1XYOA 3WR0A 2GN7A 4Q0PA 4FPKA 1V6MA 4B29A 1E57A 2BUKA 3VBHB 4XFFA 4BHPA 4LBLA 2XJPA 1UU4A 2HWC1 5KXCA 4K1YA 3GNEA 1VRH2 3ROUA 3ECQA 3J8F2 1V00A 5T5PA 1HXS1 4P9YA 4RR3C 2CAVA 1QJY1 5FMOS 1RUE2 5D8AA 5BV6A 4EN0A 4PQ9A 1MQTA 3RI9A 1WLDA 2RE9A 1VBA2 3R6SA 1EY2A 4KWLA 3N35A 2ET7A 1H2NA 4JGZB 2XKOA 3IDBB 4TLFA 4XFBA 4H7LA 4E27A 2XBO3 2VW2A 4L97A 4DRRA 2PHTA 2D5HA 1UL9A 3UK9A 1R1A3 3LAGA 1HQNA 4LBNA 2XHKA 5L19A 2XKPA 1LOCA 2Q30A 2WNUA 4FTBA 1F5JA 1PO11 1UN1A 1W0OA 3AX4A 4Q0UA 2IC1A 4ZU4A 1WBLA 1VB2A 1VBD3 3DGTA 2B5HA 4CRQA 3AP9A 4R9BA 1MS1A 4XJAA 4AVCA 2K9ZA 1DYKA 1UU5A 4DB5A 3IN9A 5C9AB 2RS12 4YW2A 3OYWB 1QQP1 5GLWA 4LBQB 3B5LB 4DNYA 1YFUA 2HWB3 2Z5WA 3WZ1A 3THPA 3H3ZA 4Q4X2 4AFAA 5CIRA 1WD3A 5KHIA 3W9AA 5C8CA 3CO2A 3AK0A 5DDJ3 3WV6A 1MEC3 4CDWB 1NA1A 2JKBA 3BCWA 5FAXA 4AE2A 5GJ6A 1F8VA 1ZBE3 4XFHA 1RUC2 5CB7A 5JCTA 1BK1A 1BBT2 2YROA 1SFNA 3FWEA 1Z78A 1LHVA 2LM3A 3I2DA 4FP2A 4L92A 3MPPG 2E9QA 3JQWA 3ZFFA 3V0AA 1IS4A 2K0GA 4AI1A 5SV5A 3E6CC 2D6NA 4QQPA 4AQTA 2PHDA 5FLIA 3SITA 2D3PA 2AUYA 2XL7A 1RHI2 3MIEA 4YSFA 2X5IA 1SBDA 1ULFA 1ND3A 4Q4W3 2GH8A 3ZPYA 2R061 3S7IA 3MW3A 2CY6A 2R042 1MEC1 4UW6A 4GB32 1RUJ3 2PYTA 2JXAA 1G9CA 5GLTA 1WCKA 1UD1A 2OPKA 3GBFA 4YNIA 3ES1A 4HKWA 1NY72 4C1WA 3UJOA 1S55A 4FOYA 4D7TA 5LK7B 4B4QA 1H0BA 2DVGA 4OHVA 2R062 3ASIA 1V9U2 3PVBB 5EZWA 1RUOA 1QJX1 1YWKA 3LZZA 1IGOA 5K0UC 1RL3A 4FP3A 2IXIA 3FZ3A 4XBNA 4QPYA 4YVWB 4B4RA 1MQTC 1C3HA 1WMDA 4PIZA 1HV0A 1V6NA 3SLIA 1MZ5A 2LTNA 2BPA2 5FLHA 2HWE2 2OVUA 3OY8A 4BYYA 2JG8B 3MDPA 4C1XA 2ILMA 1RUJ1 2QZ2A 1GQGA 3S0MA 2DFBA 2UYBA 3K51A 4W6YA 1AR82 1KFUL 1XNBA 2ZGRA 3A0KA 4XJ9A 1DGLA 4YW5A 3H7JA 5L7OB 1GKBA 4RQPC 4EWEA 3AMQA 2GC2A 4JGYA 1MZEA 3NO8A 2PHUA 4KU8A 4N53A 1N1TA 1V6IA 1NA1B 4FAHA 4OI1A 2YYOA 4E9KA 3SCHA 1REDA 3MIDA 5FTTC 3MIHA 4E4DX 1PVC1 4ES8A 3QLQA 1QQP2 2R30A 2AGSA 1QJU2 3ZXDA 2ZAAA 4XFGA 1Q8SA 1LTEA 2DCYA 1YI9A 3OYWA 4P9JA 1J3PA 1WLTA 3AYCA 5F6KA 3VBSA 5DZEA 1H8TA 2IXCA 4QQHA 1OD5A 3I8TA 4HMZA 1PNFA 3AZWA 3DKWA 3H1YA 3RQ0A 2DCJA 5AC91 4PDWB 1ASJ2 4MGYE 2QZ3A 1LODA 3ZFEB 4E2GA 3O0VA 5C9AC 1OPMA 1DGWX 2GH2A 4AEDC 1VLNA 1FMD1 4CDUB 2ZGNA 3AFKA 3KT7A 3ZYPA 1RUD3 2DV9A 3B00A 5JWPA 1VBD2 1AR83 2R1BA 5DXDA 3WG4A 3OY8B 1B35A 3ZFEC 1ZZ8A 4D69A 2KA3A 2A75A 1WLCA 3IDEA 3RYPA 1DHKB 2R063 1YFWA 5BY5A 4ZU5A 4B3NA 2A73B 4Q4X3 2RS51 2XGXA 4LLFA 4BH9A 4OHWA 3JD73 3G6JB 4XF1A 4W6XA 3RI8A 3RYRA 4FOVA 2Y0OA 2FHRA 1QMJA 1I5ZA 4RHV2 3WUDA 2G9FA 4DQAA 4WM8C 4WM7B 1PO13 3KCCA 4RR3B 3P3PA 3LOIA 3L2YA 5BXXA 4YM1A 4MGZE 1VR3A 3NW4A 4Q4Y1 2WA4A 4Q8LA 3AXDA 1T6GC 2Q8OA 4JCKA 3LB9A 3R0RA 3I54A 3VKFC 5FMOL 5E16A 4MX3A 2ZJCA 4P5HA 2WZR2 3TN93 3VV1A 4OHYA 3DPRA 1ULGA 5JIAA 3VN4A 1MS0A 3ZSLA 5GZGA 1RUH3 2HYKA 1AL23 3USUB 2HWF1 2ZBJA 2WNEA 4ASMB 1O3RA 3GHNA 1REFA 3H7YA 3KGZA 4IL7A 2DVBA 5DDJ1 1R082 3T1LA 3VBFA 2B9UA 4Q4W2 1W6NA 1V6KA 4Q4X1 1AX0A 5H9PA 3HR9A 1RUI3 3WW3A 4LO7A 4NHLA 1G86A 5J96B 2Z42A 1QQP3 1RUD2 4HPKA 2D6LX 2RM22 4PLNA 3USSA 2MHFA 3JQXA 5J98B 1RC6A 2VU9A 2RMU1 3R4UA 1PNGA 1RUJ2 2HWD1 1Z7S3 2WFF2 2DYCA 1AVBA 5CFCA 3BOPA 3EO6A 2ZHNA 3VBRC 2DCZA 1RMU2 1F31A 4SLIA 4AF9A 4FSJA 1NCQB 2YY1A 1ZRFA 1NLSA 4FXGB 5LRRA 4L99A 1HDKA 4RA0A 4WM8A 1K5MB 2DVDA 1NCQA 1QKQA 1VAMA 2YUEA 4R9CA 1QDCA 3OJBA 3LWCA 1WGPA 2ZX1A 4AVTA 4M01A 3HQXA 1BXHA 5JAXA 1BKZA 1PO12 4DS0A 3O5SA 4W65A 2P37A 3PJQA 4YG6A 1CONA 2AYHA 4K6BA 3VZKA 5L7OC 4L9BA 2JG9C 1YXWA 3JUUA 2NM1A 4HVRA 3I59A 4CDQB 1QHDA 3CF6E 3HT2A 1YIFA 4CYDA 2GC1A 2EAKA 1KITA 2RMU3 1AL0G 5JSRA 1DGRA 3I59B 4CDQA 4LULA 2IXHA 1TE1B 5F1RA 1YFYA 1JBCA 3ZN6A 5D8AB 4ISRA 1BVP1 3JBG3 4HVOA 1HQWA 4IEUA 4R9DA 1VRH3 4G9SB 4BA6A 3DF0A 1YO8A 2Z69A 3U0ZA 3O12A 4COVA 1O3QA 4OI4A 5JOXA 2R6QA 5KXBA 1LESA 3MZHA 1RITA 4OVEA 2E7TA 4UW3A 3WLUA 2WFF3 4N7IA 3NSTA 1GNHA 4LLOA 1UIJA 2Q1MA 1JOJA 4DRVA 3NKGA 3E5UA 1BEV2 4YZ3A 1QNWA 1GLHA 1LHUA 5BNPB 3KT4A 1C8M1 2ZZQA 1A8MA 4RS5A 3USUA 1C8NA 4LBJA 4HK9A 4P9IA 2DWRA 2PELA 4MSVA 2DU0A 1ASJ1 5KC5A 4Q2FA 2WFPA 3VKLA 4Z82A 3CEWA 3POYA 5CVRA 5KHGA 2D6MA 2YPJA 5CU1A 2PAEA 3DPRC 5JOWA 1RUI2 4YYOA 2VVEA 1LB2A 5T55A 3VHNA 2RMU2 4DY5A 2HWF3 1NE6A 5E89A 4Q0QA 1MS5A 4E2QA 3S30A 2ZHMA 1MR5A 1LHOA 2A3YA 3CU7A 1C28A 3FX3A 2CGNA 4H55A 1ZM1A 1GV9A 4QX5A 5FBZA 2PA7A 4JGZA 4FAGA 4YRDA 3TNPB 2W0XA 4XDQA 3EJKA 4FPJA 5BNNC 1NXMA 1QH6A 4QPGC 4LE3A 5FOJB 4C91A 2FZ2A 1C1FA 2ETEA 5IUQA 3CJXA 3LA2A 2K2SA 2UYAA 3LSDA 4EN8B 4QXKA 1KS4A 2EF6A 4XJUA 1PZ9A 1FOD3 1XXNA 2D97A 2YC0A 1L3JA 2GALA 5GZCA 1AR81 4H7MA 2W52A 1DIWA 2C0ZA 1DQ5A 3H0OA 4BMBA 1V9U1 2NQYA 3ZXEA 1D4M2 1FNYA 1Y7BA 4BQ1A 4L2NA 2RS32 4YVSC 2ZGOA 3VKMA 4QGNA 2GC0A 3BOWA 1O91A 1ZBA2 2HKXA 3MYXA 1CAXA 4Y4YA 2NLRA 3AXEA 4AXOA 2RS31 4UBGA 2NMNA 4K3UA 3PVEA 4Z92B 1G9AA 2X29A 4FPCA 4B7KA 4NWWA 1N1YA 2BBVA 1N1SA 4FO9A 5EV7A 3MLLA 1SCRA 1UPIA 4LHNA 1XQNA 3EBRA 1K5MC 1KJLA 1NY71 4DINB 1AX2A 1NQJA 1TMF1 4H14A 1AUYA 2GMMA 3CJIB 4AEMA 3AJZA 2F6BA 4HL0A 4ATFA 5F5QA 2DUQA 2LUWA 5C8CB 3J9SA 1UF2C 4R8HA 3I4IA 3VDDC 3VBOB 1NZCA 3QD6A 3CLPA 3M4FA 3OPZA 5HI0A 3IM0A 2A3WA 4P9WA 2ET1A 3SCGA 4MGKE 4XW3A 5FREA 2XJVA 3NWKA 3AJYA 4P9XA 4BCUA 4SBVA 3UL2A 1APNA 1SLBA 4ZXKA 1RUI1 4AQ2A 1IOAA 2B45X 1R081 5KC6A 5I8YA 4X8NA 4YVSA 4FOWA 4CDWA 2TEPA 2WNUB 1PM7A 4NR1A 3KT1A 3WG2A 4M00A 2HEYF 1OFNA 2DU1A 4X8PA 4Z1VA 1H2MA 1LULA 1ZBA3 4WBBA 5GKAC 4HZFA 1KS5A 3VKNA 2ZMLA 4OHXA 5C8CC 1WCSA 3P3NA 1S0GA 3B69A 4IV1A 1B35C 2AZ5A 2D6KA 2C9AA 1Q56A 1SBFA 1WUVA 2GMPA 1UPSA 1GZCA 5SV8A 1HX6A 2ENRA 4KG0A 3WUCA 1O5LA 4NVPA 2A6WA 2DCTA 4GWMA 1GNZA 1VBE1 4QPGA 1N1VA 1QXPA 3RG0A 4JV4A 1NOVA 1OSGA 2YXSA 2P3IA 1ZA4A 3MLJA 4S2FA 4Q4V3 1SMVA 4IEWA 2BFUS 4QPIC 2X5IC 3LA3A 1C5IA 3E5QA 2OYZA 1Q3EA 2VNOA 1CESA 4RHV1 1ND3C 2ZAHA 1ENXA 1NCRB 5T50A 2WNVC 2OZJA 4Z8BA 1ZBA1 4YFWA 5JDBA 3PLQA 1AYM2 3AYEA 1S0EA 4QMAA 2O0OA 3GALA 4IEPA 4QU2A 3VHRA 1S2BA 4LUMA 4E4ZA 4QD2A 1OA3A 2ZABA 3AMHA 5JLVA 3IMNA 4S2GA 2B39A 3WD5A 1WLWA 2JENA 1EV13 1H9PA 3SISA 3QCWA 4CEWC 4EWAA 2R041 1UU6A 1REEA 3B3QE 3M2MA 2DURA 4Y1YA 2PAKA 1QJY3 1UIKA 4MXWA 5DZFA 2FBEA 2WKKA 4GMP0 4BZ4A 4CP1A 3CL1A 4LE4A 4BE3A 1RTVA 4CP2A 1AXYA 5T3NA 3IWZA 1J58A 3MF9A 4BIOA 1HV1A 3UKNA 3TN92 4OHZA 1JYCA 1W6NB 2QUOA 3WX5A 2GZWA 4ZKTB 2HJIA 3MW4A 3GYDA 4GALA 4EN7B 2XWBB 4E4SA 1AR72 2P3KA 1LOBA 5GZFA 1DGWA 2D98A 2N7GA 2O8QA 4WVZA 4KBBA 1CAVB 4N43B 2QDRA 4XF0A 1D4M3 4TSVA 3OTFA 4K20A 3AMMA 3V64A 4DPNA 3M3CA 1B35B 3MGUA 3N4MA 2R043 4GB33 1WMFA 3WG1A 3RPQA 1CAVA 4UBHA 2G9GA 2A6VA 2RHPA 2YGLA 1YHFA 4Y1ZA 5JOYA 4B7EA 5K0UB 1Q43A 1AR91 3HD8B 5B2GB 4PJYA 3ATGA 1X7NA 3ZXJA 1ND2A 4YGDA 1ZBE1 5LEJA 1COV3 1OHFA 4X6QB 1KJRA 5D8AC 3H9AA 5EJ3A 4YGCA 1EAH2 1LOAA 4Q27A 4ZU7A 1D2QA 3TNQA 1DU3D 4QM8A 2WZR1 1Q8QA 4NHMA 2P2KA 4PBOA 3VBSB 4QM9A 2TNFA 4RGAA 1IS6A 3ZMOA 1AR63 1CD3G 1DF0A 1HLCA 1KXGA 4GB31 4H3WA 1HXS3 5L36A 1LHNA 5A3MA 4YW4A 2JJ6A 2QCSB 5J36A 3MICA 5KXEA 3IDCB 4I3GA 2E7QA 2C1FA 4YVWA 3BTAA 3JBG2 1LECA 2VY0A 3TB0A 4B8EA 4BOWA 4MVTA 1IQAA 2HWC2 1IPKA 2D43A 3SMHA 3FFZA 1OA2A 1OPOA 2PHXA 3AM2A 1MEC2 3T1MA 2GMEA 4IV3A 1HRI2 4AGGA 2CTVA 2XJSA 5HBAA 1OMIA 2EA7A 2NYYA 4ORFA 4OLLA 5C4WA 3AMPA 4AWDA 2KM2A 4IEXA 4KGQA 4R4ZA 4CP0A 1VBD1 3NAPC 2VXRA 1BEV3 2AREA 1YRZA 4FTSA 4AI3A 3VBUB 1FXZA 1LEMA 1GYKA 2MEV3 2ZGMA 1POV1 4META 4OUMA 1PO23 3B01A 4AEDB 4QPIB 2PHFA 2VVDA 2B46X 1QGLA 3TAYA 1OQEA 2A7AA 1H1AA 1N3PA 1LKNA 2HEWF 1HKDA 5BNNB 2WA3A 5CFCB 2VPVA 4QQOA 5I0TA 2NP0A 1DZRA 4HT1T 1AR92 3GZTB 3ZN6B 1QY4A 3Q9OA 1ZRDA 4GA9A 4LO6B 4CEYA 5FQ0B 1QF3A 4CEWB 1ONAA 1BEV1 1XU2A 3SHRA 1Q8OA 4LO4B 5HCFA 2CYFA 3N7LA 3A0NA 3ELNA 4MH0E 4XQWA 3GF6A 3ZXGA 1COV2 2VW1A 3H3UA 1HRV1 3JD72 4I30A 4HPKB 1D0HA 5E8AA 2D6PA 1RUG2 2XLFA 1CPMA 3NVCA 2D6OX 1RVF3 2VULA 1ND2C 2ARXA 2FQPA 4Z07A 4AGRA 3FBYA 2HWE3 2QQPA 1MS3A 1H1MA 4CZSA 1VBC2 4NPRA 1B09A 2JG9B 5J48A 1GBGA 1AR62 3AZZA 3DPRB 3PMEA 4DFSA 3ACLA 5H9RA 2ZA9A 5D1IA 4JDOA 1QDOA 5CG8A 2JG9A 1UCXA 4OI0A 2WT2A 2SLIA 1AYN3 1PO22 1AJKA 1QXJA 3FC0A 3IPVA 4FPOB 1CR7A 1YYNA 2QFEA 4AI8A 4GIQA 1ASJ3 1R1A2 3B9IA 5CADA 3SH5A 3IPVB 1GR3A 4LBKA 4TYSA 1CN1A 4M3CF 4CDXA 2CNAA 4IEYA 3AKSA 4JGYC 3NV1A 1EPZA 4S2HA 2ZHLA 5EXOA 1FATA 1PGL1 1QJU3 4CDWC 2B42B 4P9LA 1DQ2A 3DN7A 4AFDA 1NLRA 4AW7A 3O7OA 3B02A 1FAYA 3AB0A 2WSUA 5T5LA 3VZNA 4JGZC 3J4UH 3VBUA 3UKVA 1X33A 2ZPXA 1WMEA 2PN5A 3GBWA 4IETA 2A6YA 1J1LA 5JZGB 2VMGA 1XU1A 5IK4A 2GDFA 1BMV1 3C2UA 1V6OA 4YARA 1N47A 4JC1A 4Z2WA 4F3JA 5JZGA 2ZOEB 2ZKLA 4YM0A 4M0HA 2PTMA 5JIUA 1X82A 4AHZA 5GLZA 1ZBE2 2BNOA 4I0WB 4IV3B 4AVVA 4LBOA 3WVJA 2ZX2A 5CNAA 2XJRA 3KCXA 3V0BB 4INDA 2EXJA 1A6CA 3RWNA 1JW6A 3OF1A 5F6LB 1KRIA 4RL7A 3HAGA 4RGGA 3WP6A 3E6BA 1RMU1 2EVXA 2WFF1 3D6EA 3MIGA 1LU1A 4FPLA 4YLZA 4QT6A 3OD4A 1VB4A 2NPIA 3N7JA 1N3QA 5FO9B 3ZX7A 4Y26A 4XHBA 4QPIA 1AL22 1DG6A 4KNCA 3DUIA 1SLTA 4Q4Y2 5GZEA 2A6ZA 3FBMA 4RFT0 3WP3A 4B4PA 1UKGA 4I0AA 3E5XA 4HFSA 1GANA 4WZFA 2CAUA 4CEYC 1O3TA 1C8M3 2ATFA 5L73A 2VMHA 3DL3A 3WDYA 3ETQA 3NKTA 4JQRA 1JN2P 1V6JA 1G8WA 4PLOA 2RM23 5DG2A 1YCIA 3AP5A 1U5YA 3VDDA 2VQ0A 3AZXA 5BPXA 2LALA 1RUF1 4ASLA 4NO4A 5BNPA 1I9RA 1ZREA 5EYYA 3ZSJA 2VW0A 1QWRA 2HEVF 1RMU3 3ENRA 3WQ7A 1PGL2 2E7AA 4XF9A 3RRDA 1JTZX 2NMOA 2Y38A 5LK5A 2V5YA 1UZZA 2OZ6A 2G4IA 4QQLA 2WZR3 3R4DB 3SH4A 2VNGA 4XILA 2Y26A 1PHMA 4ISQA 1YFXA 4LTAA 5E88A 4EJRA 1URXA 1OKQA 5DUUA 4CDXB 2EAAA 1AYM3 1R083 3QACA 3ZSMA 4XXAA 2XVLA 2ZZJA 4DZGA 3PVOA 1V6LA 5TSWA 4PIXA 1F5FA 2IZWA 2JICA 4QHBA 4K40A 1NQDA 4AHXA 1VRH1 5IK8A 5BUVA 3T2TA 5KBFA 4OULA 4Y24A 4IEZA 3FUQA 2DUPA 3W58A 2R32A 3R4SA 3JB4C 1U0AA 3BB6A 3VGIA 2PFWA 4XFCA 4LHKA 2IXJA 3HMYA 4K7JA 4YZ5A 1ZRRA 1JYIA 1S0FA 2UWBA 1BBT1 3EQEA 1LEDA 2X5IB 1KQRA 3SNMA 3VZLA 2GNDA 1ND3B 3VZJA 5I0UA 1CJDA 1FOD2 1JHNA 3FUOA 3WQ1A 2BVVA 1NXD1 2BWAA 3WDVA 3ZFGA 3VBOA 2DTYA 1GFF2 1AL21 2QNKA 2GNMA 2IWGB 3KM5A 5FPXA 2GN3A 4XIKA 3VLBB 3PHMA 4NN0A 1YNAA 3KS7A 3M3EA 1GQHA 1PGW2 1VJ2A 1POV0 1DQ0A 3AYDA 4QGMA 2JECA 2ZKNA 2VUJA 3SCFA 2VVFA 4FVVA 3V0BA 1W6MB 2IXLA 2XJUA 4AFMA 1C8M2 2CGOA 1ULCA 2Q0AA 3D82A 3LGRA 4EN6B 4AI2A 1SBEA 3WG3A 3VL8A 4D7YA 1XE8A 1MZ6A 2VECA 3AKQA 2P17A 4MXWB 2IXKA 2HWF2 4AG4A 2ZACA 3AP7A 3U4XA 1PIV1 4LBQD 1I1EA 2YDEA 5A32B 4OI2A 4NOTA 4IV3C 1HIXA 4L8QA 4AVSA 3V0AB 2RJLA 2YGMA 1SLLA 1H1IA 4IV1B 3WDTA 3M1HA 2BQPA 5A32A 5C8WA 5JVVA 5J7MA 2BW8A 4XMAA 3ZXAC 3PTYA 1SACA 3WCRA 1H8TC 4FPFA 4BIFA 3VDDB 3I7DA 1FMD2 2EXIA 2VGDA 2XG3A 4IEOA 1W6OA 5FDBA 1FYUA 4C0BA 2R49A 2WS91 2WNVA 2UY9A 1SEFA 4XOGA 2ZGPA 4LT5A 4FCAA 3ZFFB 4C90A 2HWC3 4PF5A 1XNCA 1CAWA 4TWTA 5A3LA 2VOWA 4OFGA 5KHJA 1EYBA 1UAIA 2H6BA 4Y1VA 1POV3 4O9GA 5BNOA 4COWA 2UY8A 4KQ7A 3L9JT 1CGPA 4LHLA 3TOJA 1RUC1 1RINA 1S2KA 3SXWA 2VOVA 1NE4A 4AFBA 1YJLA 4HETA 2PHWA