2HEVF

Crystal structure of the complex between ox40l and ox40
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
126
structure length
126
Chain Sequence
b'RIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQDNSVIINCDGFYLISLKGYFSQEVDISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tumor necrosis factor ligand superfamily member 4
molecule tags Cytokine
source organism Homo sapiens
publication title The Crystal Structure of the Costimulatory OX40-OX40L Complex.
pubmed doi rcsb
total genus 19
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2006-06-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2hevF00
2WNVC 5KC5A 4N90A 4MXVA 1PK6B 4QQLA 3QBQA 5KC6A 3TWIA 4MXWA 3TYJA 3IT8A 1ALYA 2X29A 4OUSA 2TNFA 4KGGA 3WD5A 3B9IA 3QD6A 1TNRA 1I9RA 2Q1MA 1U5ZA 4E4SA 3B94A 1PK6C 3AB0A 2WNVA 2HEYF 4QQ2A 4EN0A 5BNQA 1GR3A 5L19A 2WNUA 4TWTA 1U5XA 4DB5A 2WNVB 4DOUA 1KD7A 2Q8OA 4QQPA 1U5YA 3K51A 1S55A 3LKJA 2JG8A 2JG9C 1C28A 2RJKA 1RJ8A 1KXGA 4D7YA 1WCKA 4OUMA 3V56A 4RSUA 1XU1A 3K48A 5CIRA 2JG9B 4KG8A 2WNUB 2R32A 1A8MA 2QE3A 2ZPXA 4E4DX 4MXWB 4G4FA 1C3HA 2AZ5A 2ZJCA 1JH5A 1D2QA 1JTZX 2WNUC 5HBAA 1OQEA 3MI8A 4OULA 1DG6A 2JG8C 5TSWA 2JG9A 1RJ7A 2R6QA 3ALQA 1D0GA 1D4VB 2R30A 4QQOA 3L9JT 1DU3D 4GIQA 4NN0A 1O91A 2O0OA 3B93A 1IQAA 4F3JA 2HEVF 5KWRA 1OSGA 4HT1T 1XU2A 4G3YC 4TSVA 2TUNA 3ME2A 4J6GA 5L36A 4KGQA 1OQDA 4QPYA 2RE9A 2QDNA 2Z5WA 4MSVA 2KA3A 2E7AA 4QQHA 1TNFA 2RJLA 3FC0A 2HEWF 2OIIA 1PK6A 3URFA 2JG8B
chains in the Genus database with same CATH superfamily
4MOAA 3EB7A 2BU9A 1TE1B 2GC3A 3MV11 1Z7S2 4QX1A 3VBHB 1UPSA 4HKLA 3ZDSA 2YBPA 4BQ4A 3OY8B 4OI0A 2HWE2 1WCSA 3ASIA 5F3GA 3VBRA 5CISA 3HEIA 4I30A 4X8NA 1JUHA 2WQ8A 1XE8A 3UKNA 3DF0A 1S1AA 2WFF3 4OYUA 1QQP2 2Y6LA 2PHWA 4BB3A 3AKPA 1Z78A 1ZREA 1ZNPA 2UY8A 4FP2A 4AI1A 2OQ7A 5EZWA 4CEYC 1RUH2 1W6OB 2EA7A 2VZRA 4I09A 1G6NA 3RGBA 4MGSA 3DPRA 2WNVA 4C1WA 1PGL2 4YW5A 3LDBA 2VGDA 2DCZA 2W92A 5D8AA 1PMJX 1JZ2A 1S0EA 3BTXA 4CUAA 2ZGPA 2BRTA 3OUIA 3HR9A 4TWTA 4E2SA 5FZ9A 2D6LX 2X8KA 1LOCA 3K4DA 1S55A 3LKJA 1S0BA 2RVAA 4JTNA 4P9JA 4AEKA 2ZGQA 1HJGA 2B9UA 4LBMA 1QJX3 4LLFA 1WMEA 4CP9A 3U11A 1IS6A 4NHXA 5JDBA 5CZKA 3WF1A 2B5HA 3ZKUA 4DINB 4I02A 2BV4A 5FMBA 1DBNA 4Q27A 4B4QA 1O3RA 1RTVA 2WRAA 4AQ2A 2R32A 5A7OA 1A8MA 4N7UA 4C8DA 2VZQA 1WD4A 5FOJB 5FPLA 2RMU2 4G4FA 4JRLA 4Q4X2 5E88A 2JX9A 2XKOA 3RRDA 3VBOC 1O4ZA 1W8UA 1R083 1ND2A 2H6CA 2K46A 4FPFA 4XJAA 1EY2A 3GBFA 1WKYA 1VBC2 2P5BA 1GV9A 1UU5A 3UGFA 1PVC2 2K0GA 5FP3A 4HONA 3WDVA 1YRZA 5FKBA 2ET1A 1GICA 4NHKA 3UGHA 4YG0A 4R9BA 1LOFA 2PLV1 1MS4A 3RMYA 3RZZA 3ZXGA 1H9PA 2MHFA 3L9JT 3PMEA 5T52A 1WCUA 1ZRRA 1X50A 1R1A2 3UJQA 4D94A 1VMJA 3KGZA 1K5JA 1VAVA 2P6HA 2ZGNA 4NN0A 1ZBA3 1O3QA 1PMHX 2ZHLA 4A6SA 3MICA 3OGGA 4M3CA 3SKVA 3WNKA 2GH2A 2HEVF 4OVEA 5FZOB 2BPA2 5IVCA 2BGOA 2C4XA 4LA2A 1NCQA 3IMNA 1XRUA 1ZZ7A 3S6PA 1WLWA 1YFUA 4A45A 4CUBA 2VR4A 3FHQA 3FLTA 5FY9A 2IXKA 4OQ9A 3ATGA 4NOTA 1K12A 3BIEA 2WLQA 3CLPA 1S2BA 2QUOA 1A78A 2VE1A 4IE4A 4P5YA 4A3ZA 2IXIA 1EP0A 2ZMLA 2XWBB 4GALA 4B4RA 3BOPA 4QHZA 2WQZC 4YGBA 4R9CA 3UESA 5C9AA 4ZS2A 5GKAC 1VBE1 2W0XA 5FY0A 4XURA 1D2SA 1ZBE1 1DQ5A 1DLLA 1NCRA 4YVSC 4Y3OA 4FAHA 3FBMA 2K9ZA 3O1TA 4DFSA 1M4WA 4IW3A 4WVVA 1H2KA 2G9FA 1SHWB 5BNPA 3MIFA 1C8M3 3KCCA 4CUCA 4RR3C 1UOGA 3AP6A 5E1RA 1KS4A 4WM8A 4PCRA 2W5FA 5EP9A 2A3XA 4OHVA 1JHNA 1UMIA 2BERA 3Q8AA 4M0HA 1BJQA 1FATA 5FUNA 3WR0A 1W6PA 3Q8CA 5JWPA 1ZA7A 1JZ8A 1FPN3 1WW5A 4AF9A 1WCDJ 1NCQB 2DUPA 2VBBA 4XIOA 3OD0A 1R092 2IZWA 4LOTA 1GYKA 3ZSJA 5K8SA 4L9BA 5L73A 1S0GA 4M4RA 2VOVA 4E8CA 5FYCA 5CEHA 2EICA 3CJIC 1EPWA 2X29A 4GWNA 1CESA 1ULPA 4HBNA 3ZFFC 4D6RA 3VDDC 4FFGA 3L2HA 4XJ9A 5I0TA 2FD8A 3U78A 1OMIA 4OCTA 4M0NA 2RR13 4I0AA 3VKNA 1GQHA 2V73A 3I59B 1VBD2 5IK8A 5GLZA 4YW2A 5ERLA 5IFTA 5BNNA 4CDQB 4GH4B 1CONA 4V2VA 1XNDA 2MEV3 3C8XA 4JZRA 5SV8A 3RDIA 4B7KA 3WP5A 3THPA 1JS9A 2V5DA 1XNCA 3IWZA 4MLOA 4XAEA 1ZZCA 1HN1A 2EXHA 2IFWA 1WA4A 2QZ3A 2XBO2 4IEOA 3WW1A 2VECA 1C28A 4YZ3A 1RJ8A 1PIV2 2DUOA 1AL23 2FDJA 2JEMA 5CFDA 4O65A 1S4CA 3KCYA 1OLME 1ENQA 4IGQA 4AEJA 5A3LA 2WSVA 1Q8OA 2P37A 4WM7A 4U2AA 2E7QA 5BNOB 2WNEA 1LGCA 5FZ8A 2PHRA 3N7MA 3U37A 2WA4A 3C2UA 2FMYA 2HYXA 3PURA 5JZGA 2WNOA 4JKKA 1UYZA 1Z7S1 5EQUA 2R7EB 1NZCA 3WXPA 4IV1A 4WBBA 3VHNA 1AXKA 5A33A 3AL6A 2J1VA 2MNGA 3B9CA 4DXRA 3S0MA 2WT0A 4QX2A 3ON7A 3O0XA 2XJSA 3NJVA 3OG2A 1UKGA 4IE0A 1ASJ3 1MZ6A 1CX4A 3ZYFA 2WDBA 5FZHA 1O91A 4MGYE 2GDFA 1HXS3 3PL0A 1L7QA 3JQWA 4DQAA 3J8F2 3N9PA 1GNHA 4ES8A 3D6EA 1Y9QA 4XF3A 5FV3A 3E6DA 4XFAA 3VBHC 3GDBA 3R05A 4H55A 4CCNA 4HT1T 4NE9A 5LCWL 2YFZA 3BODA 2CU5A 1AR82 2IXCA 1NA1A 4GKYA 2V4AA 4IE7A 4GB31 5J09A 2FDIA 4CVUA 3TRSB 2LALA 4N9HA 1SFPA 1PO21 4UFKA 3TB0A 1XPWA 4B29A 2QNKA 3B01A 5ANNA 5F6KA 3OSDA 4HZFA 5LEJA 2UY9A 1PGW1 2PXJA 5FXXA 1QJEA 4CU6A 1EYBA 2GMPA 5FO7B 1MS8A 3AK0A 4KWUA 5BV6A 3DKQA 1SLIA 1XSQA 3BN6A 2YC2A 2NN8A 3FLPA 2E6VA 2Q8CA 4LO7A 1RMU3 4N43B 3LFMA 3ELNA 4YGDA 3OGSA 2V72A 4EQVA 1RUC3 4AW7A 4CDUA 3U07A 2W87A 2WNVC 2XJRA 1QXJA 4QQLA 4YM3A 2Q8EA 3CJXA 5GZGA 1LOBA 1SPPA 4QT6A 1H6XA 2ADDA 5FUIA 2NZ9A 1W3XA 4XXAA 5A7SA 2KM2A 3W59A 5BNNB 3UKTA 3FHIB 3WNPA 4EWDA 3JD73 1G7YA 4OZOA 2E63A 2DVAA 1GUIA 3ILNA 1OURA 3FFZA 3ZX7A 3AYEA 4W6WA 2WO2A 3M1HA 2PLV2 1TNRA 1UZZA 1QOSA 2BDRA 4LHLA 4Q4V2 1NKGA 4XW3A 2GN3A 3IZOA 1RUG1 2XDVA 3BTYA 1I6XA 4Q1RA 2D6PA 4YLZA 3POSA 3VD7A 2RHPA 3QACA 4M3CE 1Q8SA 4HN1A 1WMDA 4PDWB 4LBQD 5FZDA 4BK5A 2J1SA 1X8EA 2FBEA 3SMHA 1MZEA 1FX5A 2VZ1A 3VBOA 1W0OA 2VMEA 2Z4FA 2Q1FA 3LEGA 3ZYRA 5C5UA 1Q43A 4PDWC 3K75B 4IEYA 1RUD2 4FAGA 5KHKA 1J3QA 3KVBA 1FI2A 2CDOA 2P17A 4MADA 2DUQA 2KD7A 5FZBA 1T6BX 1KXGA 1UY2A 1WLTA 1A34A 2EXJA 2G9GA 3AFGA 1UKRA 4XACA 3AZYA 1DLCA 2ORXA 3W5MA 1C8NA 2ZOEB 4OHZA 1OLRA 1JYTA 3MV01 3AZZA 3J7HA 1Y7BA 2Q4SA 3VDDB 4ET7A 5ABJA 2ZPXA 3ZPYA 2H0BA 4MXWB 4UFJA 2GC2A 2ZEXA 1D2QA 2RS52 1COV2 1K5MA 1NCQC 1OQEA 2HWC1 4YGCA 3ZIXA 4P9XA 4CDQA 4NAOA 5K0UA 1XNBA 5F3EA 1OT5A 2PTMA 3G6JB 4RL7A 1FAYA 1OUXA 3GZTB 3NAPA 2F4LA 3JQXA 4BZ4A 3ZYPA 4KWJA 1UL9A 4OMDA 4J25A 4CP0A 1QDOA 4HANA 2W46A 5FXWA 2D6KA 3I3DA 1ZRCA 1O5LA 2GMMA 2WLPA 4JGYA 5FYIA 4DXTA 4IEQA 2D93A 3BPSA 1AR61 2ZHMA 3MPPG 4LORA 4JX0A 2ATFA 2GAUA 2XKPA 4MGIE 4XDPA 3PNAA 3RZLA 2HH9A 5FR3A 4KG0A 5JI9A 3FN9A 2WZR2 4XBNA 4G3YC 1ZRIA 2W1UA 3QOPA 1OC1A 5T55A 3T3YA 3UT0A 4YSFA 5CBLA 5ACA3 4QX7A 1L7LA 3WW3A 1VAMA 1FOD3 1ND2B 4AR2A 5KXDA 3CKHA 1J83A 2A75A 2AR6A 4AQTA 4BQXA 3VV1A 2D6OX 2BFUS 2D44A 4LIVA 2O8OA 2P3KA 5M0TA 3MW3A 1W05A 2QDNA 4I3PA 1W8TA 3MBWA 4HKWA 4LJHA 2UWCA 5EJ3A 1MEC3 3LDRA 4CU9A 3T2OA 1DQ4A 2ZABA 5F5QA 2DBNA 1V9U3 2HWF3 2OPWA 1N1YA 4YVWB 1W99A 4Q4W2 3HBZA 2OIIA 4LA3A 4BQWA 2BEOA 1E5IA 1PK6B 1YFYA 2BVBA 3KV9A 2E31A 2HWB3 2XBO1 3LA3A 4RFT0 1VRH1 1JOJA 4LT5A 2RM23 3AMPA 4P9YA 4QPIB 5FK8A 3TYJA 4AGVA 4E2QA 3CQOA 4TYSA 2ES3A 1UAIA 3PUIA 1SLCA 4QXBA 1D4M2 4OUSA 5LWBA 4CXYA 2XMLA 1EAH3 2VMHA 2MPFA 4V1PA 5BPXA 2UWBA 2VCAA 1U5ZA 3EHKA 5A1FA 1RUF1 4QX3A 2Q0AA 4OHXA 1LNSA 1H8TC 1NXD1 3UKVA 1S0CA 4I2OA 4DEQA 3K77A 1CAWA 5E8AA 5L7OA 2QCSB 2VUAA 4CA9A 4XJUA 3WUDA 1O4YA 1HV0A 5JR7B 4WZFA 3RNSA 5FQ0A 1SPPB 4Y1VA 4LBKA 3SCGA 4Y26A 3LD8A 2XPJA 5A1LA 3AKTA 3RZKA 4EN7B 1V0AA 4PIXA 1OVSA 1W6NB 4IERA 2RJKA 3SHRA 3WNNA 3H8OA 5C33A 1OBNA 4HLTA 3MFCA 1F5FA 5BNOC 1E5RA 4RS5C 4IEZA 1XU1A 4PHZA 2P2KA 3AP9A 1U12A 1YUDA 1VBA3 2KR2A 3B3QE 2OUJA 2ZEWA 4R9AA 5CIRA 5A70A 5C70A 4A6OA 2BVVA 1W04A 2PFWA 3R4UA 4RD7A 1JXNA 2R1DA 5FZ1A 4ZY9A 2VC9A 3WLUA 4LITA 2ZJCA 3LQCA 1AR92 2QQOA 1BXHA 1W8FA 3C3VA 4XTMA 5DUUA 4ISRA 3FZ3A 3D3AA 2OUHA 3LPFA 1HB4A 3BCWA 2QVSB 5KHJA 4BXSV 5BXXA 5FZCA 4FOQA 4L92A 4MYEA 1RVF2 2DCKA 3DUIA 1LESA 3MGUA 5TSWA 4FOYA 4JV4A 4PLNA 5A3PA 2X5IB 2C9AA 1BLZA 3ALQA 5HV4A 5JIAA 1D4VB 3HJRA 4NIAA 2J1EA 5IW0A 5BNPB 4K3UA 2R042 3BI3A 1SACA 5FP4A 3VZLA 4CU8A 1CPMA 4LLOA 2P6CA 2UYBA 5FYBA 2JENA 2YMZA 5FZGA 1OOPB 3IBMA 1SCSA 3LF7A 1UYPA 1BMV1 3F95A 2HJIA 3I4IA 2DFCA 4FFFA 4QKDA 5IVVA 1OVPA 2YFUA 3T1MA 1UU4A 1NXMA 1VIWB 3WG3A 3ZKYA 1FXZA 1OLQA 1TMF1 3O1RA 3NMBA 2A1XA 4KL1A 1V6OA 1YI9A 4CDUC 2Y38A 1ZBE2 3VBUC 3VDAA 1ULFA 5DAWA 1F35A 5DDJ2 4XQ4A 1IG0A 2DVGA 2FHRA 3SC7X 3M2MA 4URTA 4LIUA 1BVVA 2VH9A 5FOBB 2DCYA 1ND3C 3NAPB 4KGQA 2VG9A 4PT6A 5K0UB 2VZPA 1OOPC 1VB4A 1GBGA 2HBUA 3N7KA 3N9MA 2VUJA 4Q0QA 2VTXJ 1UY3A 3VD3A 5K7PA 3NV2A 4LPLA 4FQ4A 4XJZA 3RZHA 1DGRN 1AF9A 5B2GB 2Z5WA 5FYSA 4LBNA 3R4SA 4P5HA 2RJLA 5C4WC 3HMYA 4KWLA 1O8PA 4AHXA 4XDQA 4JVAA 4XCAA 4H14A 4XHXA 4BQ3A 1AYM3 2DBIA 3D0JA 1Q8PA 5F39A 3TWIA 3OGVA 4GH4A 3B69A 2NP0A 2GC1A 4UW4A 1J84A 2AREA 2VVDA 3RYPA 1MQTA 5GM0A 2ARAA 2IFRA 5T5JA 3TBDA 3B7MA 5CU1A 1JZ7A 1WLCA 1FNZA 2P34A 1JN2P 1RUE1 1W2NA 2VXRA 3T0AA 5BY5A 1Y9MA 1IS3A 3A0NA 3GJAA 1MACA 3HNYM 3NV1A 4AOCA 1YYNA 4EN9B 3RWKX 3PUSA 2R0FA 4O7XA 1AR63 3SH3A 3BIWE 4XOGA 3BU0A 1CZTA 1GU3A 2QQKA 4YZ5A 2VMIA 4E27A 3WNOA 3WW4A 1FPN2 1GZCA 2OPKA 2E33A 5C71A 5GLUA 1R093 1UZVA 4CEWA 4CSWA 4QXKA 1CAXB 4DB5A 5ACA1 2JECA 2JWPA 4D3WA 2WQ4A 4CCLA 4D8MA 2JB4A 4JDNA 1CR7A 5FK7A 4LBOA 1W8ZA 2RDNA 3GBGA 4QGLA 2JG9C 1NY71 5KBFA 5CKNA 3LEKA 4DZGA 3VB9A 3WF4A 2EVXA 4K1ZA 1MEC1 1G9CA 2AACA 1UXXX 3OUHA 1YIPA 4LO6B 1PGSA 4CDUB 5JXIA 4NIDA 4AI9A 2DYCA 1R081 5T50A 1C5HA 1F5JA 5D8AC 3I2HA 3ENRA 4Y5TA 4BCUA 3W21A 3AC0A 4TTGA 4I0BA 3T4HB 3THTA 5C3RA 4LO4B 4N8MA 3MLKA 3MI8A 1WBLA 5A7NA 3AZVA 3RJ2X 3VBFB 2XBO3 4HOOA 1L7RA 1G9DA 2H0VA 4FI9A 1L3JA 1LOGA 3LIHA 5CFCC 4Y1ZA 4BLIA 4HSLA 3VBFC 3I54A 4ZZ5A 3CZUA 3ES4A 5AVPA 1UY0A 3KMHA 2JJ6A 5FPBA 2K2SA 4LK7A 1V00A 2R071 1ZBA1 5DUVA 5DN2A 4B1MA 1VBD1 5D8AB 4OI1A 1Q56A 3HQXA 1K42A 1QJZA 5A7QA 1MS1A 2XWJB 5FTTC 2R16A 5A3OA 2JD9A 4UYBA 3I2OA 1W9YA 1ND2C 2A3YA 2CY6A 1XU2A 1CZVA 1FV2A 5EYYA 4LHNA 1IG3A 4Y4RA 2WJSA 3PUQA 1WBFA 2IXHA 4IEXA 3M70A 3QCWA 4RHV3 1I3HA 1JYCA 3T30A 5IVEA 2VNGA 4EN6B 1WW7A 1EUUA 1LULA 3D8CA 5FPZA 1HRV1 2F6BA 5A3MA 1B35A 4Y22B 3OY8A 1RL3A 1KDMA 1HXS2 2GALA 5FYZA 2CWMA 4XFCA 4B7EA 4GWIA 1NQJA 1V6IA 2XH6A 3FUQA 4N7IA 3WQ7A 1PM7A 1GNYA 2AENA 3PIJA 1J59A 2HYKA 3WP3A 3PVBB 4Z2AA 3POEA 2PQSA 3EYPA 4QMAA 4UI9L 5G04L 1PK6A 2XJVA 2AC1A 3WG2A 3A22A 4N90A 3TNQA 2ZZJA 1K3IA 5L7OC 3ACFA 4AXOA 2DVDA 2I74A 2EXKA 3MFAA 3GALA 4FP3A 1UF2C 2GP5A 3N35A 1DYOA 3I2DA 4SLIA 4FFHA 4ISQA 4ASMB 2PHXA 2Y26A 2FDHA 1OQ1A 1LENA 3WX5A 4MG2A 4QDQA 5T3NA 4Y1YA 1GOGA 1LCLA 4ORFA 5FQ0B 3WF2A 3NJYA 2R062 3WP6A 2AEYA 1UNBA 4IE6A 2E26A 3OPWA 4IV3C 1RUC2 2VQUA 1PGW2 3Q8EA 4LHKA 1RGSA 3IKWA 1XE7A 3HT2A 3N7LA 4AEDA 1PZ9A 4KBBA 2IVJA 5J98B 4HVOA 5KXCA 2VZUA 1UO9A 4O61A 3JD72 2W47A 4UW3A 3VKFC 1GLHA 3ZFGA 1W6QA 4COYA 2JDMA 3V64A 5SV5A 1LGNA 4BISA 5FXVA 4CDXB 1KD7A 4I3GA 2RS12 3DYMA 3OBTA 2PLV3 3I3BA 2WWSA 1QXRA 1VBB2 1UY1A 5C3PA 3AXDA 1IOAA 4UWDA 1O3SA 3N9NA 4XQWA 4FPOB 3POGA 1OXCA 2NM1A 3ZFEC 4UFMA 1WZXA 3BVCA 4XBQA 2JDAA 2Y6KA 1BVP1 3H8XA 3H1WA 3WNMA 1JH5A 5G05L 5BNNC 3FLRA 3APBA 2ZGUA 4QGNA 2X5IC 4R8HA 1V6LA 3H7YA 3VBUA 1N1TA 4JC1A 2O1QA 4D6SA 3WDWA 2BQPA 2HWD2 4AE2A 3VLBB 2OYZA 4BYYA 1POV1 5IVFA 3O14A 1RUG2 2CHHA 3P3NA 1W8HA 4QHOA 2OKXA 3T2PA 5F5CA 2XXZA 1RUE3 5J36A 5CKMA 3JBG2 2JDPA 1WMXA 3OD4A 3J7MA 4MUVA 4WM7C 2D40A 3OUJA 2RS53 4CTEA 4P9IA 1RHI2 3KT7A 1VMFA 1MS0A 3N7JA 3BPZA 4Q4X1 5FZOA 5KR7A 1MQTB 3HQUA 4XQDA 4DMIA 4OQ8A 1CAUA 2BWCA 2C1FA 2D5FA 2YV8A 3WVJA 2JKXA 4S2GA 4IV1C 1J3RA 1N3OA 1H1MA 4HPKB 2FDKA 2B7YA 3OGJA 5FZ7A 3SH4A 1BMV2 3S5QA 1D0HA 1F8VA 1UIKA 1RUF2 1KS5A 2JE8A 3UGGA 1W28A 1E57A 4GMP1 1JYVA 4LKSA 1B09A 4WM8B 5A80A 5LRSA 1BBT2 2Z42A 4QKFA 1Q8VA 4AYUA 5FO8B 2LUWA 2E9QA 3ZXLA 2WC2A 5I93A 2VMFA 3FC0A 2HEWF 2R30A 2B39A 4PBOA 1FOD2 4JDOA 4MXVA 5FJKA 3MF6A 4XEZA 1UMHA 3VZNA 4NRMA 2FQPA 3ACIA 3WV6A 1WLDA 2VOXA 1SBFA 2NMOA 3V0BB 4KU7A 4XJWA 1R64A 3MIDA 1U5IA 5DZFA 1RUI3 2GC0A 3ZYGA 2E32A 4LBLA 1KJLA 5JMOA 2TNFA 3CNAA 4UXAA 5HPOA 4Q2FA 4LR4A 4BPZA 1NOVA 3LA7A 1RIRA 4FPKA 4XFGA 1UX7A 3GGLA 5FZ0A 2PA7A 2AEZA 1C1LA 2R1BA 2P1BA 1VB2A 4W6XA 5IFPA 3ACLA 3A23A 3BYWA 4U36A 1AX2A 5A6YA 2W2IA 3KV4A 3U1XA 4QQ2A 3FFQA 2AYHA 3MLLA 4NRPA 1HRI1 1OH3A 4UFHA 5I8TA 2ZAAA 3QH7A 3ES1A 4QPGA 1LHNA 3LOBA 4QGMA 5BUVA 4LUMA 2X10A 1H1AA 4RR3B 1D4M3 3EO6A 3WQBA 1XC6A 3GJBA 5CFCA 4WVWA 2HWB1 4CP9B 4ARYA 2BGCA 5A6XA 2V09A 3F2ZA 3CBNA 5C3SA 2VNRA 4RSUA 3WZ1A 1LOFC 3NNMA 1V70A 2WZEA 1TMF2 1H6YA 1OA3A 1EAH1 1IPJA 4JHTA 4OI2A 4A41A 1AR71 5APAA 1QH7A 2VZSA 1OD5A 2UURA 4GB33 1YI7A 2OA2A 1PNFA 1US2A 4XBLA 4PDWA 5FY5A 2VUCA 1YC61 1W6MA 4K8RB 1PO23 2R041 5J37A 2F4PA 1X36A 1VPHA 4YFWA 4ZU7A 2ORZA 1IKQA 1GWKA 3AKSA 1W0NA 2VY0A 3MIBA 3VHPA 1JW6A 2HWC3 3E5UA 2R6QA 5GALA 1PX3A 4AHZA 2W9XA 1N3PA 3S5AA 2Q30A 2VXJA 1YIFA 4LKEA 4AVAA 1H0BA 4P14A 4PI2A 3P3PA 4AVTA 1B35B 4Y22A 3SLIA 1AR93 2O0OA 1ULDA 1S0DA 4F3JA 3H3UA 4YFZA 2W68A 1GFF2 1VBA1 2E53A 4BU2A 4KNCA 4YM2A 2R072 5GJ6A 1AYN3 2VUDA 3HPNA 3JD71 4XC9A 3UETA 2IC1A 3FUOA 3AMQA 1ND3B 3NAPC 4YVWC 2Q8DA 2TUNA 3WNLA 4FCAA 1JMUB 4CCEA 1URXA 4TN7A 4CPBA 1XNTA 1IGOA 2WBKA 5F3IA 4YW7A 1PZ7A 5CG8A 5FIXA 1O7FA 4IEUA 2YGLA 2Y0IA 3ITQA 4K8FA 4A7KA 3CJIA 1UCXA 2A6VA 2WINB 3A0KA 4C0HA 1DF0A 4ATFA 5A7PA 4XFFA 5DUXA 3AYDA 3CF6E 1AJKA 1LKNA 2WFF2 5T54A 5C6CA 1WUVA 3WCRA 1QQP3 3DYOA 5FXZA 4P9GA 1E5SA 5J96B 1Y9GA 3K4AA 4NUBA 3M3QA 2ZEYA 1REFA 1RUH3 4NHYA 1V9U1 2HWF1 4L99A 3HQRA 3ACHA 4HK9A 2Y6GA 5CNAA 3ZSLA 2LM3A 4AQSA 5IWFA 3U14A 3ZFGC 2P4EA 3CEWA 1UW8A 4NHLA 3CL1A 4XUQA 4HPKA 5KHIA 3HWJA 1IS5A 1JHJA 3ZM8A 2HWE1 4FTEA 1AXYA 1OF4A 1IHMA 3H1YA 4XCBA 5CFDC 2XHNA 4YARA 5FP9A 3RPQA 2BOJA 1DGWA 2L9LA 4IQPA 4MVTA 3G7DA 3BOWA 4A3XA 5K4LA 4P9WA 1CAXA 1DQ1A 4TXWA 2QQWA 3NKGA 4FXKB 3ZDVA 3MIGA 4M3CF 3KWVA 3MEPA 5CAZA 5LA2A 4CDWB 3M8LA 1KDKA 1GZTA 4QM9A 3ZYHA 3I2IA 4LO8A 3CZJA 3AYCA 4NO4A 4FXGB 4RA0A 4V2WA 4IV3B 2JG8A 5FYUA 5GLWA 2J42A 3NKTA 1VBC3 4D7YA 5DABA 1PVC3 1RUJ1 1ULCA 3NV3A 5FREA 4E9KA 4Q4Y2 3V0AA 5A3TA 1XYNA 4BOWA 3VZOA 2WL1A 1ASJ1 4MHRA 2WZPP 3PTYA 2OT7A 3WSOA 1JZ3A 1ODMA 3I7DA 3THCA 1SZBA 2ZTNA 4B3NA 1O3TA 4GD4A 4R4XA 3NW4A 4CPBD 2YDEA 2ZKNA 1C8M1 4K40A 5F1RA 4Q4V1 4YM1A 2Z69A 3WOGA 4Z1VA 3I2FA 2GN7A 3VKOA 3VBSB 3ZSEA 3LA2A 1UWWA 2XLGA 4Q5OA 4BWOA 4YM0A 4WVZA 2CDPA 5IJRA 1NA1C 3D0SA 3OCPA 4DY5A 2QQJA 3J8F1 2VULA 2PHUA 4XF9A 2CNAA 2BW8A 1PHMA 1XE0A 2P3IA 4DY3A 1W6QB 4ASKA 2ZGLA 1UOBA 2C26A 1QJY2 4P9LA 3IPVA 1UZWA 3ORJA 2OX0A 1PIV1 2RV9A 1MVQA 2TEPA 2Y8KA 4N53B 5JSPA 3I2JA 1VP6A 4HVQA 4TLGA 1LRHA 4S2DA 5KWRA 4IDZA 4AG4A 1NA1B 3H9AA 3HN3A 2QQPA 3ETQA 1UOJA 1I1EA 1HIXA 3UL2A 2R061 2A5ZA 1OPMA 5LATA 5LRRA 1MZFA 1SG3A 4QWNA 3RS6A 5DQ0A 2C5DA 1NE4A 4BJ0A 4CCDA 4XAAA 2YU1A 2JB8A 5JCTA 1IS4A 2VL4A 4XMAA 3WP4A 2ARBA 1OQDA 4N53C 1HQWA 1S2KA 3HN1A 4W6YA 4C90A 1OH4A 5A7WA 5FY4A 1CJDA 4YZ2A 2VPVA 2VZOA 4IV1B 4Y33A 4D6QA 3DPRC 3MDPA 4YPJA 1JOPA 5CVRA 1UD1A 1IPSA 1H9WA 3HAGA 4K6BA 1YNAA 4O9GA 3ZR5A 2CV6A 3LGRA 1BBT1 5DZGA 3Q8FA 4Z82A 1AYM1 2XJUA 2EALA 1JYXA 3I3MA 4AGRA 3MYXA 3ZYJB 2CL2A 2NQYA 2RJ2A 1CVNA 3PVEA 5FZAA 1N1SA 5FP8A 4LO5B 5IYYA 3RZMA 1OOPA 3DKWA 1W2AX 1OKOA 4NROA 3VZMA 5FO9B 1QY4A 5C8CC 1I9RA 1LHUA 1AZDA 2XLAA 3HD8B 2IWGB 1OFSA 1W8WA 1AR91 5IVJA 5FLIA 1AL22 1GOFA 3B94A 1VBB1 1AXZA 1R091 4JDMA 3UV9A 1AVBA 5ABJC 2SBAA 2UYAA 2HEYF 1SDWA 1VRBA 2VAUA 3GYDA 4N9IA 3UYJA 5L9BA 3MZHA 3W9AA 3AMMA 4UFLA 1QH6A 4A7ZA 5JZGB 2XUEA 2I2SA 3KCXA 5K0UC 1ENSA 5I0DA 1DYKA 3N3HA 3O0WA 1YFXA 4NRQA 1SMVA 4ZU5A 3LIGA 1QWRA 1BKZA 3OEAA 2RS32 2PELA 1ZA4A 3KD4A 3SH5A 2I45A 1ULOA 3WQ0A 5FZIA 4DEVA 3NNJA 5FAXA 2E7TA 1RHI1 3KSCA 4D7SA 2ZX2A 4JRAA 4YG6A 5EFUA 1AX0A 1JYIA 1RUC1 1RUH1 1LB2A 2Y6HA 3GM8A 1CGPA 2RS13 3H42B 4IEPA 4PJYA 1EV13 3WDTA 4OULA 5JOZA 2ZMNA 3KHBA 1SBEA 4BHPA 4Y20B 4Z8BA 1CQ9A 4LEJA 1UYYA 1WA6X 5A6ZA 3DEMA 1D4M1 5LASA 4FT8A 3VDCA 1DP0A 4WZCA 2JG9A 2RMU1 1CJPA 3M3EA 3AMNA 2ZX1A 5A3UA 4QKBA 1W2OA 1DHKB 1H30A 1WW4A 1ZVFA 4CEWB 1GWLA 2NMNA 4M4PA 5F7UA 2R0HA 3PVNA 2WZR1 3MW2A 4XABA 4F7ZA 3VBRB 2OVUA 4E4HA 3BTAA 1YLLA 2A6YA 5LK5A 1AL0G 1NCRC 1LHWA 2WN3A 3EQEA 4YVSA 1UQXA 4PF1A 3SCFA 1DQ0A 3ZO0B 3O1VA 1A3KA 2IXLA 2OW4A 3B00A 3NNFA 5EWSA 1TME3 3JXSA 2JDZA 3ZMNA 4CE8A 2FCTA 4OI4A 3IAQA 3H3LA 3AP5A 2VCCA 3VBFA 4M3CB 1RUE2 1K5MB 4F83A 1JU4A 2A6WA 4YVSB 2GNTA 2OZJA 4IESA 3V0BA 5FMOL 2VVFA 2UWAA 1RUJ3 5H9QA 4COWA 5KXBA 1Q5OA 4QPYA 4HVRA 4LMFA 1A8DA 3U4XA 2RG4A 5JUVA 4NPRA 2DTWA 4AWDA 1MS5A 1JU3A 4BIFA 1PO11 3AVSA 4MSVA 1KGYA 3TEWA 2DURA 2ZKLA 1JZ6A 5C8CB 5A3WA 4MV2A 1GQPA 1LOAA 4Q4V3 1OPOA 3K2OA 2HWD1 1VBE2 4JGZA 2BGPA 4KQ7A 5F6LB 2XL9A 1S0FA 5KC6A 1OI6A 1HV1A 2W1SA 4ZONA 3V0AB 2VO5A 4KMQA 2Y60A 4CP1A 2B4KA 1W2UA 4PBPA 1X9PA 4QU1A 3FHAA 4L8QA 3WD5A 2WT2A 3JBG1 1CAUB 1FMD2 2RDRA 2GSYA 2D43A 4RS5A 2DCJA 3UK9A 3IN9A 5BNPC 1GNZA 3RI9A 1GZWB 2VCMA 3DV8A 1YO8A 1CD3G 3ZXJA 1QDCA 3CDZB 3O1UA 1OD3A 3AP7A 3R4DB 4EN0A 5J1XA 2W1QA 1QJU1 1YQ8A 3J26N 2JDUA 4QHBA 1Y4WA 4IGPA 4BK4A 2WNVB 1GOHA 3NJXA 3LOIA 5FZFA 1H2MA 3R6SA 2YZ4A 3IDEA 3S30A 4A42A 3VDBA 3P1IA 2A6XA 2ZHNA 5AC93 5AVAA 1RXFA 1DGRA 1ZX5A 4RGKA 3VDDA 4CP2A 4BA6A 3PUAA 4CRQA 2XJPA 5FBZA 4COUA 4QD2A 2ET7A 1OA2A 4CCKA 2JG9B 4ASLA 1BEV1 3DGTA 1QKQA 5LBCA 2BYVE 4QX0A 2WO3A 5B4XA 4UT5A 4W4ZA 4XPVA 3S57A 3WG1A 4XHBA 5JR2A 1F9KA 1DZTA 4MGTA 1JTZX 3E1F1 1NG0A 4FPCA 4L0PA 1T6GC 3VD9A 3GXUA 1C4RA 4OLLA 1JYWA 1HRV3 5LZ6A 4LULA 4QDSA 3NJZA 2JE7A 2WO7A 4FPGA 2C24A 1IZ3A 2Y64A 3WDYA 2G9ZA 2YC0A 1CZSA 4G9SB 4GMP0 3DN7A 2Q5TA 5A7WB 1ENRA 4CEYB 3NWKA 1PVC1 1ND3A 2XUMA 1POV3 4Q4X3 4CCCA 5JSRA 1ODNA 4GB32 3WINE 5JMCA 4XMIA 2XJTA 1CAWB 4LBJA 3POFA 4UW6A 4NHMA 1R082 3B93A 4YGEA 4WVMB 4UW5A 2ZGTA 3WY6A 1HB1A 1RXGA 1EUTA 1MEC2 4Q0PA 1YQCA 3INAA 5BYNA 5JZGC 3LPGA 3ZN4A 4M00A 4ZHNA 1NLQA 1OA4A 2QTWB 1EPZA 3WT3A 4D0QA 5JXGA 2BFUL 5DAQA 4AVSA 1TVGA 3NNLA 1UY4A 3CJIB 3WDUA 5C8WA 1LJ7A 1ULEA 2VD7A 2VU9A 4HSJA 4META 2NLRA 4Q0UA 1YEWA 1QJX1 4QB2A 3THDA 3OPZA 2ILMA 2QQLA 2VM9A 4NMIA 3NRUA 2ZAHA 3L2YA 4Q1PA 1MPXA 5HCFA 1KQRA 1STMA 4XUNA 4K21A 1W06A 5CFDB 2E7AA 5EJ1B 3J7LA 3VBHA 1TEIA 1KFXL 3IAPA 3LCPA 2W3JA 1RUD1 5HV0A 1ZRFA 2Y6JA 1DIWA 5FY7A 2JE9A 3ZLIA 1JYNA 4AI2A 2D97A 1RYYA 2NYYA 5FYYA 5I8SA 3JUUA 4A44A 3DCQA 1POV0 3KHCA 2XOMA 3T0BA 1YFWA 4CEWC 1O59A 2F17A 3R0RA 1QGLA 4BH9A 5LK7B 5CFCB 2J1UA 3N36A 2WWJA 1Q3EA 4XFBA 4E2GA 3EBRA 3CU7A 4EE2A 2CGPA 3WF0A 2PHDA 3RG0A 2GZWA 4D69A 2DCTA 4LK6A 2I07B 4E4SA 1YJLA 4BQ1A 1YQ2A 4ZPIA 5IAXA 5JSOA 3J9SA 3AB0A 1W39A 1VBA2 2YB7A 2QDRA 4KI5M 4RN5A 1TME1 2D7FA 4YG3A 5FFOC 1REEA 2IVIB 4EROA 4H2AA 5L19A 3LSDA 2R49A 4AVBA 3H0OA 4DOUA 4JAAA 4XF1A 4CYDA 5I0SA 1HRI3 2VOTA 4FO9A 1GSLA 4TLFA 3D5OA 4AFBA 4PF5A 2A6ZA 1AUYA 4IL7A 5JAXA 3FL7A 1Z0HA 4OUMA 3V56A 2LRPA 2XR4A 3H1MA 3U75A 4BIOA 3SQOA 1AR73 3BGAA 1NAEA 1VBD3 2ZS6B 3CHXA 5LA1A 2DWRA 3T0DA 3PIGA 1XYPA 1HDKA 1X8MA 2BNNA 2R043 4I01A 4CDWC 1F15A 2C9KA 2MEV2 1W6PB 3NVCA 5DUWA 2GP3A 3JCIA 3KS7A 4QX5A 2WNUC 2QQMA 2FZ2A 1AR81 1HKDA 1XXNA 3PJYA 5CADA 1FPN1 3C7OA 3PU8A 3S7IA 2ZZQA 2TBVA 4Q4Y3 3KB5A 3OPTA 5FYMA 3ROUA 1BYHA 4MX3A 4R52A 5DDJ3 3HBKA 1NCRB 1QOTA 3T1LA 5HI0A 5FYVA 3POWA 4GZ9A 4NJ4A 4PIYA 4ONUA 2RR11 1E5HA 3O1PA 1IPKA 4PI0A 4PIZA 4Y4YA 2V5YA 4RQPA 4HXCA 1W9FA 3M3CA 2EF6A 3ZFGB 1OSGA 1VALA 2Y34A 3M3OA 1K5MC 2ARXA 2RS11 2WA3A 2EIEA 2Y0OA 5FKCA 3LDKA 4FQZA 4R9DA 1LOEA 4UF0A 4CCOA 4EJRA 1C1FA 3VD4A 4QB1A 1S0JA 2MEV1 3BALA 4ZXEA 4KU8A 1AYM2 3KQRA 5FDBA 1QJY3 2VZ3A 1HJFA 3SXWA 1OUSA 3PJQA 1ASJ2 2ZGOA 4OFGA 4SBVA 4AI0A 2A70A 1AL21 1QHDA 2ZXQA 5FYHA 4CXXA 3J8F3 3J4UH 4N43C 1J58A 3SCHA 3MHZA 3IM0A 4FPEA 5JIUA 2QQUA 4FPYA 4LKFA 3VHRA 4DXZA 1T2XA 4AK3A 5F2WA 1CAVA 2NPIA 3RMXA 3MLJA 4BQ2A 4YZ4A 3HT1A 4QPWA 3PMSA 3IIAA 2BOIA 4AVVA 2D6NA 3RZJA 2YPJA 1XQNA 3VZJA 3ZXDA 5JXHA 3H8RA 3DXTA 4HFSA 1W6NA 4XF4A 1NLRA 5CA6A 1ALYA 1UOFA 2DDUA 3WW2A 1LODA 5C9AC 4AL9A 4A4AA 1IKPA 2VW2A 2JIGA 5FUPA 5C3OA 1GWMA 1RMU2 2JDHA 3B9IA 5LBBA 4YW3A 3T2QA 4EV0A 1LEMA 2VQAA 4BQ5A 5BNOA 2OXBA 2J1TA 3OTFA 1HXS1 3OYWA 3Q9OA 4XILA 3T2TA 5EYXA 3ZYBA 3AM2A 3AX4A 2PYTA 4OUEA 3ZFEA 4RR3A 3C7FA 1QF3A 4WM8C 2JKBA 4QPGB 4COZA 2QQVA 4FBFA 3PUHA 2B42B 4CCMA 3EJKA 4W65A 2XONA 1GR3A 1HW5A 5IVBA 3A21A 4JHZA 5FMOS 4A7YA 4GWJA 2E51A 4J1XA 4XZUG 4XUOA 3LSEA 1OHFA 2W08A 5FZMA 4WV8A 3KLSA 2OQ6A 2XHKA 2YU2A 4QPIA 4AFDA 5JOYA 1WCKA 1JBCA 3NL1A 1GP5A 1X82A 3I59A 2VNOA 2FCUA 4IE5A 5FBJA 3WEZA 1GMMA 4P02B 3OB8A 4ZKTB 4QXHA 2RS51 4AHYA 5JXJA 3I8TA 3N9LA 1AYN1 4JCKA 1ONAA 4AZZA 1RUD3 1W6MB 1AJOA 2PHLA 3PU3A 4Q0VA 2YGMA 4LKDA 5I0UA 4M01A 1W9WA 4GXLA 3M7AA 4ZU4A 4ZS3A 2A3WA 2RS33 1DFQA 4LBQA 2YHJA 3AXEA 3NO8A 1ACCA 4S2FA 3AZXA 3GZEA 3U4SA 1H4GA 1H2LA 1QQP1 1CAVB 4JQRA 5A32B 2VOWA 4FPHA 3RJRA 5I0RA 3BUCA 2JDYA 2WKKA 1WGPA 2BNMA 2PN5A 3RI8A 5J48A 1COV3 1YQ5A 4DIQA 2HLEA 2ZACA 4LQRA 4A2UA 4L97A 5F5AA 4BQYA 2GU9A 3W20A 1UIJA 3VUOA 2DU0A 1S2EA 4BMEA 1JODA 1H8VA 2SLIA 3ILRA 2GMEA 2FMDA 3VKMA 3ACGA 4ZXKA 4H3WA 3ME2A 2Q1ZB 5D2AA 1EV11 4PLMA 4XETA 1R1ZA 4NWWA 1X9TA 3VBRC 4FTSA 4MO3M 4UAPA 4DRVA 5DZEA 1RUI1 5GZCA 3ZYIB 4XFHA 5DAVA 2DTYA 1US3A 2O8QA 2WIIB 3B5LB 2ZGRA 2ENRA 4AEMA 2O14A 3P6BA 3KGLA 1TME2 2WZR3 4IEWA 1NX9A 2VBPA 2WT1A 4YZ1A 1XNAA 1G9BA 2BZDA 1RUOA 3MO4A 4EZHA 3TEZA 1R1A1 3M3IA 2JG8B 2N7GA 1NLSA 4RQPB 5ACA2 2VQTA 1JZ5A 4MHUA 1G86A 4LTAA 4YWAA 1AX1A 3O1SA 5IK4A 3LB9A 3GCWA 1CN1A 1SLAA 1GANA 1WMFA 4C91A 3DECA 1RC6A 3LZZA 4QPGC 1HB2A 5FMDA 2WABA 5LW9A 1NQDA 1LHVA 3UNPA 3CMGA 1QEXA 1X33A 1SBDA 1HQLA 2PMWB 4N53A 3SISA 3GCXA 3AKQA 4F8AA 5HCAA 3I2GA 3QD6A 3AMHA 1VBB3 1SFYA 1LR5A 2Q1MA 2WR9A 4AI8A 4Q4W3 5FWJA 1GP4A 1HB3A 2YYOA 5I8YA 1DZQA 1MS9A 1SEFA 1VBE3 2XVGA 3OBZA 5C4WA 1ZRDA 1U0AA 1MR5A 5DG1A 2HWB2 4CDXA 3OBRA 4CDWA 1PO13 1SLTA 5LY1A 2ARCA 2RM22 2FDGA 4NIGA 4YW1A 3RYRA 5BNQA 3KVAA 2WNUA 2XG3A 5KHGA 1MQTC 1ULGA 3NQHA 4B1LA 5FZKA 2AH2A 2Y33A 1EAH2 1O5UA 3K51A 2FDFA 1CWPA 2H6BA 2XLFA 1F2NA 3USUA 4LHSA 5HCBA 2CGOA 3VD5A 1G9FA 1W9TA 4DS0A 3IB3A 5C8CA 5IT6A 1BQPA 3MF9A 3O5SA 3KV6A 4P00B 1HN0A 3VGIA 3K48A 1OF3A 1RUG3 1F4HA 2WNUB 1P8JA 1N3QA 3HVDA 3JBG3 1OFNA 5EIYB 1GQGA 2HKXA 2VVEA 2AZ5A 2G19A 3C7HA 1SDDB 4ATEA 3P5BA 3ZR6A 2J1RA 4HK8A 5D1IA 1RHI3 4HL0A 5LBEA 3WDXA 5AC92 1XJAA 2LROA 4JQTA 5C4WB 1A6CA 5JPNB 4HN0A 1VRH3 3RFRA 5C3QA 3WUCA 1DG6A 1W0PA 4OHWA 1YJKA 4XDOA 1DQ2A 3PVOA 5EXOA 3SKJE 4AGGA 3S7EA 5FZ3A 3VL9A 1QJU2 3ZSMA 4AEDB 1G8WA 4GA9A 1PX4A 2WS92 1CIYA 1B35C 5AFBA 4X6QB 4Y1UA 3VBOB 4N43A 1DU3D 2CAVA 1RUF3 4YW4A 5FZ6A 3RWNA 4BE3A 4CXWA 3ZSKA 2XB6C 2W39A 2WSUA 3EMRA 1QOOA 4GWMA 1W6OA 4X8PA 4KWKA 1HRV2 1PGL1 3PHMA 1BBT3 4QX8A 2ZBJA 1LAJA 2EIDA 1BEV2 1RVF3 2EIGA 1KEXA 4UOJA 1YHFA 5DMYA 2QQIA 3TN93 1BZWA 4B8EA 5B4NA 3I49A 3FX3A 2PAMA 3O12A 2BP6A 4YRDA 2D3PA 2WFF1 3U0ZA 3KF3A 1Z7S3 3AZWA 4IGOA 5J3UA 3LEIA 2D98A 2XVLA 2HWE3 3O1OA 4GULA 4OHYA 2D5HA 3V65A 2RE9A 2Z79A 5HCHA 4NWVA 2GNMA 3KT1A 3VKLA 2UU8A 4AHWA 1W3VA 4D7TA 1DQ6A 2JXAA 1ZBE3 1JZ4A 3VZKA 2C6SA 5DG2A 1TNFA 1S0IA 4WM7B 1UZ0A 1O6UA 5H9SA 3WF3A 4BM8A 2WYFA 3PLQA 5EV7A 5KC5A 2J7MA 2ZGMA 4WVMA 3O7OA 1FT9A 2RDSA 3LFIA 2D6MA 1HLCA 3CIHA 1VJ2A 3C7EA 3K3NA 4PQQA 1FOD1 5LBFA 4Z2WA 3X29B 3O0VA 5JOXA 4HG6B 4UFIA 4L2NA 1W9SA 4Y24A 3VN4A 3H3ZA 1VR3A 1VBC1 2X09A 5F2SA 4FPJA 4QPIC 1SLLA 4NAMA 4BXFA 2A7AA 1SQ4A 2PAKA 3TEXA 3AL5A 3ABZA 3HNBM 4W8JA 2W91A 3W58A 1QJX2 4YW6A 4Q8LA 4I0WB 1PK6C 3I2KA 1UMZA 1UPIA 4JGZC 5C7GA 4FOVA 1TMF3 4JKMA 1RMU1 3IPVB 2BBVA 1J1TA 2ERFA 2RMU3 4XTPA 1W90A 1KJRA 3PTRB 1U5XA 3JB8A 3ZOIA 2QFEA 2CTVA 1RINA 5LA9A 4ES9A 3ZMOA 4KBZA 4QQPA 3VBSC 1U5YA 1PO22 4QAWA 1TQ5A 1LECA 2W94A 3K46A 3MIEA 1GKBA 4EWAA 3A4UA 1AR62 3GHMA 2GH8A 5CKQA 4Q0SA 3IIIA 2YPDA 5GLTA 5FY1A 2D3SA 2WZ8A 1TG7A 4JGZB 5H9PA 4AEDC 1G9AA 2BNOA 4RS5B 4E4DX 4H7MA 1CIWA 2ETEA 5FMCA 4BDVB 1C3HA 1R1A3 2WUHA 4E8DA 2BBAA 5F9TA 3BB6A 5FWEA 1HRI2 1M06G 3ZFEB 1ZBA2 3USUB 1I5PA 1VLNA 1I5ZA 2JIJA 2VOKA 3RYKA 3BTZA 5GLVA 4UBGA 4QB6A 2B46X 5ABJB 3ZFFB 3TNPB 5EPAA 3RZGA 2WS91 3KZ4C 1JOBA 5H9RA 1AYN2 1RJ7A 3GZUC 1WD3A 5IUQA 1AR72 2X05A 2VNVA 3E5XA 2ZA9A 4LE3A 4AFMA 5EHDA 5F32A 1C57A 1LGBA 4LE4A 3T4VA 1H8TB 5FCCA 1C5IA 1KFUL 1ZYBA 3FWEA 2DFBA 1J3PA 1UU6A 5FPAA 1GZWA 3TAYA 3IDAA 3AVRA 2J22A 3B02A 1H4HA 1RUNA 1K45A 3ZXAC 2D3RA 3ZVXA 1FMD1 4GJYA 3DXUA 1SLBA 1V6MA 3USSA 5HXMA 4Z92B 1H1IA 3WNXA 3H50A 4JGYB 2EXIA 1PZ8A 4J1WA 4NVPA 1UX6A 2ZX0A 3J7NA 1C8M2 1NZIA 1DZRA 1SCRA 2GNBA 2QJVA 2VTFA 2XL7A 2WYSA 4J6GA 3ZN5A 1POQA 5JLVA 5JVVA 4MH0E 2WAOA 3VL8A 2CWSA 2XVKA 5A32A 4FSJA 2Y6FA 3ZXEA 3GZAA 4NR1A 4Q4Y1 3KM5A 3MIHA 3RVHA 1YCIA 4QKNA 4AAXA 4CCJA 1REDA 1HX6A 3SNMA 1VMHA 3I3QA 3N9QA 4IETA 2LS6A 5ISLA 3N4MA 5FZEA 4QQHA 3OJBA 3VBUB 1V6JA 1LTEA 2VZVA 5IK7A 4RHV2 3RQ0A 4HETA 2RR12 3VHOA 4CDXC 2ZGSA 3LAGA 3IMMA 1TZOA 2BUKA 5JPMB 1N1VA 5AC91 5FZLA 1LHOA 4ITCA 5F3CA 1LU2A 3POJA 5C9AB 2VCBA 5CYYA 1FV3A 2VMCA 1FNYA 3KF5A 4DO0A 1ZZ8A 4S2HA 2B9VA 3FJSA 1SFNA 1VE0A 3FMGA 1KRIA 1XNKA 4MGKE 4NIIA 4DUWA 1YWKA 2QKDA 4B4PA 4XYXA 3GF6A 2DVBA 4K7JA 1X7NA 2VJXA 4GKXA 2DV9A 4KH9A 4FVVA 1BK1A 1WCQA 3N9OA 4GJZA 4X6RB 5J7MA 1PIV3 3H7JA 3AFKA 1QJFA 4MGQA 2DU1A 1KITA 3GNEA 3MPBA 4RGAA 2CSGA 4BLJA 5IAVA 5IHRA 4NPLA 3OBAA 3TEYA 1ZZ9A 3ECQA 5E16A 5A1AA 3D82A 4P08A 5CB7A 3GHNA 4DUXA 3TN91 1ZZBA 4FPLA 4RHV1 4Y1XA 4QDRA 1N47A 2R063 2VZTA 4CDQC 3OYWB 4YNIA 5FRAA 1JI6A 5L9RA 1VAKA 2BTVC 2AUYA 1DDLA 2ZCWA 2A73B 3JB4C 3QH6A 4R4ZA 4DXSA 1QXPA 4CEYA 4HMZA 1PNGA 3DPRB 1QNWA 4LBQB 4XF0A 5A33B 4Q8KA 4EYUA 4KG8A 4JGYC 4MGZE 3GBWA 2ZMKA 5GZEA 2QE3A 4QU2A 4NIHA 5IVYA 4GQ7A 4AVCA 1O8SA 5A3NA 3KT4A 4L11A 2YC4A 2AGSA 2P3JA 4COVA 1FYUA 1Y43B 3H8UA 4RFRB 2GNDA 5AFEA 3E6BA 5HBAA 3M4FA 4URAA 1W8NA 3ETPA 2BJSA 5DXDA 3AYAA 3OF1A 1LU1A 2X53S 5T5OA 4IXLA 4BMBA 1AR83 3E5QA 2XQRA 4EN8B 5L7OB 1DGLA 4AFCA 2XGXA 1D0GA 4XIKA 2CAUA 1CX1A 1BCXA 1XB9A 2YROA 1GZ9A 4QQOA 2JICA 3BU7A 2JDNA 2W52A 2HBTA 1AHSA 5DDJ1 5L9VA 3NSTA 4C0BA 3LEMA 5T5LA 3KV5A 5E89A 3UJOA 3POBA 2WWUA 2Z2SB 1NUKA 2CGNA 5DAXA 3SEPA 5DAPA 2HWD3 4IEVA 4XUTA 1JUIA 4YYOA 1RB8G 2FZ1A 5F37A 1H2NA 3HIFA 4XZPA 4O9EA 2G1MA 4QXCA 5IK5A 1W8OA 5K9YA 3AJZA 1OKQA 1PVXA 3FE5A 4Y5Z0 4EZ4A 5A6QA 4AQ6A 1ZZ6A 4K20A 1ST8A 2IUWA 2P3YA 4OMCA 3LE0A 2WO1A 3ZPOA 3WCSA 3LWCA 4DUVA 3OGRA 3K4ZA 1NE6A 4QM8A 1WWYA 2VMDA 2DVFA 3KQ4B 3A7QA 4RGGA 2W1WA 2JD4A 4RQPC 3T08A 4CUGA 5I91A 5F5IA 3DL3A 4FTBA 1H8TA 4XUPA 1IQDC 3MW4A 3URFA 1RVF1 3MUZ1 2J1AA 2V4VA 4XVHA 3RSJA 3QBQA 1YQ6A 4YVWA 2B8MA 2EAAA 2C0ZA 4DNYA 4MXWA 2ADEA 3MUY1 3IT8A 5T5PA 2YBKA 3VBSA 1F31A 2FCVA 4H7LA 1DCSA 1GP6A 5D21A 2XJQA 4FFIA 2RM21 3D4KA 3OEBA 2XQXA 4KGGA 3HNMA 1OLMA 2PHFA 4NPMA 1XYOA 3ZXKA 4JTOA 2VW1A 1UZYA 1CPNA 4LNVA 4PLOA 5E6HA 1W2TA 1Q8QA 1WW6A 5JI7A 1J1LA 1DGWX 3K3OA 4HKOA 4UF0B 3SEEA 5IATA 5FPUA 4DRRA 1DYPA 4JKLA 1APNA 2LTNA 3QLQA 1MVEA 3O1MA 4C1XA 3E6CC 2ZHKA 2VQ0A 3PDQA 4UBHA 4EWEA 5GZDA 1RUI2 3Q8BA 5FLJA 1QNYA 2W95A 2Q8OA 2EIBA 4FOWA 2CYFA 2LW8A 5FPXA 1EV12 2DF7A 5LEKA 3AP4A 1UXZA 3T09A 3ZN6B 4TZDA 1HQNA 3ZFFA 2IXJA 2YXSA 4Y5SA 1BHGA 3I97A 4XJ8A 5EJZB 4GMP3 1LEDA 3I3EA 5FPVA 4IV3A 5GZFA 1Y3TA 5LA0A 4CZSA 1BK0A 2YG0A 2VTXA 1QMJA 2YUEA 3IDBB 5JOWA 1UYXA 1PO12 1V6KA 3ILFA 4INDA 3WG4A 1QIQA 2OS2A 2KXLA 4Y20A 5LB6A 2B45X 4Q4W1 1XSRA 3AJYA 2G4IA 2PHTA 3U10A 1F4AA 4GAZA 4DPNA 5FLHA 2RDQA 2WFPA 5ANQA 2JDKA 5FP7A 3DYPA 2OZ6A 1QJY1 3CO2A 1D7PM 4CU7A 3W5NA 3WQ1A 3WHTA 4OZXA 3IDCB 1NYWA 2JG8C 3HOBA 3NNGA 3NV4A 3ZN6A 4LOSA 5DPNA 2YBSA 5FY8A 1YXWA 1UN1A 2QQNA 2ZGKA 3ZXFA 1MS3A 5FYTA 4E4ZA 4ARXA 2RS31 4IUGA 4LXLA 1NT0A 4GIQA 1V6NA 3WHUA 4Z07A 1RUJ2 4XE9A 2QBXA 1NY72 4LUKA 2BWAA 5FJHA 1XOYA 5FZ4A 1IQAA 4W50A 3TOJA 4AI3A 2WAAA 2VW0A 1VRH2 4RYDA 3SITA 1W03A 2X5IA 4XXPA 5KHHA 4Q26A 3JU9A 1COV1 2HWC2 2ZX4A 4TSVA 1V9U2 2HWF2 4MZUA 2YY1A 3FBYA 4PQ9A 1QU0A 5KXEA 1QJU3 4XFIA 2ZEZA 1ZM1A 2WN2A 2WS93 3EXUA 3AKRA 3JZVA 2VMGA 3OOXA 3POIA 4GH4C 5L36A 2EAKA 2ID4A 1PM4A 2PQQA 2VBDA 3ZIWA 4AFAA 1ENXA 5C5TA 2ZX3A 3C7GA 2A71A 4ZZ8A 4K9SA 5CG9A 4AAPA 3BKZA 2PAEA 1RITA 3E97A 4K1YA 1BEV3 2R073 3ST7A 1O4TA 3POYA 1XBFA 2QZ2A 2KA3A 5F8PA 5HXVA 4Q29A 1FMD3 1PMIA 5LY2A 3TN92 1MZ5A
chains in the Genus database with same CATH topology
1TE1B 2GC3A 1Z7S2 3VBHB 1UPSA 4HKLA 3ZDSA 3OY8B 4OI0A 2HWE2 1WCSA 3ASIA 3VBRA 4I30A 4X8NA 1JUHA 1XE8A 3UKNA 3DF0A 1S1AA 2WFF3 1QQP2 2PHWA 3AKPA 1Z78A 1ZREA 1ZNPA 2UY8A 4FP2A 4AI1A 5EZWA 4CEYC 1RUH2 1W6OB 2EA7A 4I09A 1G6NA 3DPRA 2WNVA 4C1WA 1PGL2 4YW5A 2VGDA 2DCZA 5D8AA 1S0EA 2ZGPA 4TWTA 3HR9A 4E2SA 2D6LX 2X8KA 1LOCA 1S55A 3LKJA 1S0BA 4JTNA 4P9JA 4AEKA 2ZGQA 2B9UA 4LBMA 1QJX3 4LLFA 1WMEA 3U11A 1IS6A 5JDBA 4DINB 2B5HA 4I02A 4B4QA 1DBNA 4Q27A 1RTVA 4AQ2A 2R32A 1A8MA 4N7UA 1WD4A 5FOJB 2RMU2 4G4FA 4JRLA 4Q4X2 5E88A 2JX9A 2XKOA 3RRDA 3VBOC 1O4ZA 1R083 1ND2A 2H6CA 4FPFA 4XJAA 1EY2A 3GBFA 1VBC2 1GV9A 1UU5A 1PVC2 2K0GA 3WDVA 1YRZA 2ET1A 1GICA 4NHKA 4YG0A 4R9BA 1LOFA 2PLV1 1MS4A 3RMYA 3RZZA 3ZXGA 1H9PA 2MHFA 3L9JT 3PMEA 5T52A 1ZRRA 3UJQA 1X50A 1R1A2 4D94A 1F8VA 3KGZA 1VAVA 4NN0A 2ZGNA 1ZBA3 1O3QA 2ZHLA 3MICA 3OGGA 4M3CA 2GH2A 2HEVF 4OVEA 2BPA2 4LA2A 1NCQA 3IMNA 1XRUA 1ZZ7A 3S6PA 1WLWA 1YFUA 3FLTA 2IXKA 3ATGA 4NOTA 2WLQA 3CLPA 1S2BA 2QUOA 1A78A 2IXIA 1EP0A 2ZMLA 2XWBB 4GALA 4B4RA 3BOPA 2WQZC 4YGBA 4R9CA 5C9AA 5GKAC 1VBE1 2W0XA 1D2SA 1ZBE1 1DQ5A 1DLLA 1NCRA 4YVSC 4FAHA 3FBMA 2K9ZA 4DFSA 1M4WA 4WVVA 1H2KA 2G9FA 5BNPA 3MIFA 1C8M3 3KCCA 4RR3C 5E1RA 3AP6A 1KS4A 4WM8A 4PCRA 2A3XA 4OHVA 1JHNA 4M0HA 1BJQA 1FATA 3WR0A 1W6PA 5JWPA 1FPN3 1WW5A 4AF9A 1WCDJ 1NCQB 2DUPA 4XIOA 5K8SA 3OD0A 1R092 2IZWA 1GYKA 3ZSJA 4L9BA 5L73A 1S0GA 2VOVA 3CJIC 1EPWA 2X29A 4GWNA 1CESA 4HBNA 3ZFFC 3VDDC 3L2HA 4XJ9A 5I0TA 1OMIA 4M0NA 2RR13 4I0AA 3VKNA 1GQHA 2V73A 3I59B 1VBD2 5IK8A 5GLZA 4YW2A 5BNNA 4CDQB 4GH4B 1CONA 1XNDA 2MEV3 5SV8A 3RDIA 3WP5A 3THPA 1XNCA 3IWZA 4MLOA 1ZZCA 2EXHA 2IFWA 1WA4A 2QZ3A 2XBO2 4IEOA 3WW1A 2VECA 1C28A 4YZ3A 1RJ8A 1PIV2 2DUOA 1AL23 5CFDA 2JEMA 3KCYA 1ENQA 4AEJA 5A3LA 2WSVA 1Q8OA 2P37A 4WM7A 4U2AA 2E7QA 5BNOB 2WNEA 1LGCA 2PHRA 3N7MA 2WA4A 3C2UA 2FMYA 5JZGA 1Z7S1 1NZCA 3WXPA 4IV1A 4WBBA 3VHNA 1AXKA 5A33A 2MNGA 3B9CA 3S0MA 2WT0A 3O0XA 2XJSA 1UKGA 1ASJ3 1MZ6A 1CX4A 1O91A 4MGYE 2GDFA 1HXS3 3JQWA 4DQAA 3J8F2 1GNHA 4ES8A 3D6EA 1Y9QA 4XF3A 3E6DA 4XFAA 3VBHC 4H55A 3R05A 4HT1T 3BODA 1AR82 2IXCA 1NA1A 4GKYA 5J09A 4GB31 3TRSB 2LALA 4N9HA 1PO21 3TB0A 4B29A 2QNKA 3B01A 5F6KA 4HZFA 5LEJA 2UY9A 1PGW1 1EYBA 2GMPA 5FO7B 1MS8A 3AK0A 5BV6A 1SLIA 2NN8A 3FLPA 2E6VA 4LO7A 1RMU3 4N43B 3ELNA 4YGDA 1RUC3 4AW7A 4CDUA 3U07A 2XJRA 2WNVC 1QXJA 4QQLA 4YM3A 3CJXA 5GZGA 1LOBA 4QT6A 2NZ9A 4XXAA 2KM2A 3W59A 5BNNB 3UKTA 3FHIB 4EWDA 3JD73 1G7YA 2E63A 2DVAA 3ILNA 3FFZA 3ZX7A 3AYEA 4W6WA 3M1HA 2PLV2 1TNRA 1UZZA 1QOSA 4LHLA 4Q4V2 4XW3A 2GN3A 1RUG1 1I6XA 4Q1RA 2D6PA 4YLZA 3POSA 2RHPA 3QACA 4M3CE 1Q8SA 4HN1A 1WMDA 4PDWB 4LBQD 5I0RA 3SMHA 1X8EA 2FBEA 1MZEA 1FX5A 3VBOA 1W0OA 3ZYRA 1Q43A 4PDWC 4IEYA 1RUD2 4FAGA 5KHKA 1J3QA 1FI2A 2P17A 2DUQA 1KXGA 1WLTA 2EXJA 2G9GA 3AFGA 1UKRA 3AZYA 1C8NA 2ZOEB 4OHZA 1OLRA 3AZZA 1Y7BA 2Q4SA 3VDDB 5ABJA 2ZPXA 3ZPYA 2H0BA 4MXWB 2GC2A 1D2QA 2RS52 1COV2 1K5MA 1NCQC 1OQEA 2HWC1 4YGCA 3ZIXA 4P9XA 4CDQA 5K0UA 1XNBA 2PTMA 3G6JB 4RL7A 1FAYA 3GZTB 3NAPA 3JQXA 4BZ4A 3ZYPA 4KWJA 1UL9A 4CP0A 1QDOA 4HANA 2D6KA 1ZRCA 1O5LA 2GMMA 2WLPA 4JGYA 4IEQA 2D93A 1AR61 2ZHMA 3MPPG 2ATFA 2GAUA 2XKPA 4MGIE 3PNAA 4KG0A 5JI9A 2WZR2 4XBNA 4G3YC 3QOPA 5T55A 4YSFA 5CBLA 5ACA3 3WW3A 1VAMA 1FOD3 1ND2B 5KXDA 2A75A 2AR6A 4AQTA 2D6OX 2BFUS 2D44A 2O8OA 2P3KA 3MW3A 2QDNA 4I3PA 4HKWA 2UWCA 5EJ3A 1MEC3 1DQ4A 2ZABA 5F5QA 1V9U3 2HWF3 1N1YA 4YVWB 4Q4W2 3HBZA 2OIIA 4LA3A 2BEOA 1PK6B 1YFYA 2BVBA 2HWB3 3LA3A 2XBO1 4RFT0 1VRH1 1JOJA 4LT5A 2RM23 3AMPA 4P9YA 4QPIB 3TYJA 4AGVA 4E2QA 4TYSA 2ES3A 1UAIA 1SLCA 1D4M2 4OUSA 1EAH3 2VMHA 2MPFA 4V1PA 5BPXA 2UWBA 1U5ZA 3EHKA 1RUF1 2Q0AA 4OHXA 1H8TC 1NXD1 3UKVA 1S0CA 4I2OA 1CAWA 5E8AA 5L7OA 2QCSB 2VUAA 4XJUA 3WUDA 1O4YA 1HV0A 5JR7B 4WZFA 3RNSA 5FQ0A 4Y1VA 4LBKA 3SCGA 4Y26A 2XPJA 3AKTA 4EN7B 4PIXA 1W6NB 4IERA 2RJKA 3SHRA 5C33A 4HLTA 3MFCA 1F5FA 5BNOC 4RS5C 4IEZA 1XU1A 2P2KA 3AP9A 1U12A 1YUDA 1VBA3 3B3QE 5CIRA 2OUJA 4R9AA 2BVVA 2PFWA 3R4UA 3VV1A 4RD7A 1JXNA 2R1DA 3WLUA 2ZJCA 1AR92 1BXHA 3C3VA 4XTMA 5DUUA 4ISRA 3FZ3A 5KHJA 2OUHA 3BCWA 2QVSB 5BXXA 4FOQA 4L92A 4MYEA 1RVF2 2DCKA 3DUIA 1LESA 3MGUA 5TSWA 4FOYA 4JV4A 4PLNA 2X5IB 2C9AA 3ALQA 5JIAA 1D4VB 5BNPB 4K3UA 2R042 1SACA 3VZLA 1CPMA 4LLOA 2UYBA 2JENA 2YMZA 1OOPB 3IBMA 1SCSA 1BMV1 2HJIA 3I4IA 2DFCA 3T1MA 1UU4A 1NXMA 1VIWB 3WG3A 1FXZA 1OLQA 1TMF1 4KL1A 1V6OA 1YI9A 4CDUC 2Y38A 1ZBE2 3VBUC 1ULFA 5DDJ2 4XQ4A 2DVGA 2FHRA 3M2MA 4URTA 1BVVA 2VH9A 5FOBB 2DCYA 1ND3C 3NAPB 4KGQA 2VG9A 5K0UB 1OOPC 1VB4A 1GBGA 3N7KA 4Q0QA 5K7PA 2VUJA 3NV2A 4XJZA 4FQ4A 1DGRN 1AF9A 5B2GB 2Z5WA 4LBNA 3R4SA 4P5HA 2RJLA 5C4WC 3HMYA 4KWLA 4AHXA 4XDQA 4JVAA 4XHXA 4H14A 1AYM3 3D0JA 1Q8PA 3TWIA 4GH4A 3B69A 2NP0A 2GC1A 4UW4A 2AREA 2VVDA 3RYPA 1MQTA 5GM0A 3TBDA 2IFRA 5T5JA 3USUB 3B7MA 5CU1A 1WLCA 1FNZA 2P34A 1JN2P 1RUE1 2VXRA 5BY5A 3A0NA 1IS3A 3NV1A 1MACA 1YYNA 4EN9B 2R0FA 1AR63 3SH3A 3BIWE 4XOGA 4YZ5A 2VMIA 4E27A 3WW4A 1FPN2 1GZCA 2OPKA 5GLUA 1R093 4CEWA 4DB5A 4QXKA 1CAXB 5ACA1 2JECA 4D3WA 2WQ4A 4JDNA 1CR7A 4LBOA 3GBGA 4QGLA 2JG9C 1NY71 5KBFA 4DZGA 2EVXA 4K1ZA 1MEC1 1G9CA 1YIPA 4LO6B 1PGSA 4CDUB 2DYCA 1R081 5T50A 1C5HA 1F5JA 5D8AC 4BCUA 3ENRA 4I0BA 3THTA 4LO4B 3MLKA 3MI8A 1WBLA 3AZVA 3RJ2X 3VBFB 2XBO3 1G9DA 2H0VA 1L3JA 1LOGA 5CFCC 4Y1ZA 4BLIA 4HSLA 3VBFC 3I54A 3ES4A 5AVPA 3KMHA 2JJ6A 2K2SA 1V00A 2R071 1ZBA1 5DUVA 1VBD1 5D8AB 4OI1A 1Q56A 3HQXA 1QJZA 1MS1A 2XWJB 5FTTC 2R16A 1ND2C 2A3YA 2CY6A 1XU2A 1FV2A 5EYYA 4LHNA 2WJSA 4IEXA 1WBFA 2IXHA 3M70A 3QCWA 4RHV3 1I3HA 1JYCA 2VNGA 4EN6B 1WW7A 1LULA 3D8CA 5FPZA 1HRV1 2F6BA 5A3MA 1B35A 4Y22B 3OY8A 1RL3A 1KDMA 1HXS2 2GALA 2CWMA 4XFCA 4B7EA 1NQJA 1V6IA 2XH6A 3FUQA 4N7IA 3WQ7A 1PM7A 2AENA 1J59A 2HYKA 3WP3A 3PVBB 4QMAA 1PK6A 2XJVA 3WG2A 4N90A 5L7OC 3TNQA 2ZZJA 4AXOA 2DVDA 2I74A 2EXKA 3MFAA 3GALA 4FP3A 1UF2C 3N35A 3I2DA 4SLIA 4ISQA 4ASMB 2PHXA 2Y26A 1OQ1A 1LENA 3WX5A 5T3NA 4Y1YA 1LCLA 4ORFA 5FQ0B 2R062 3WP6A 4IV3C 1RUC2 1PGW2 4LHKA 1RGSA 3IKWA 1XE7A 3HT2A 3N7LA 4AEDA 1PZ9A 4KBBA 5J98B 4HVOA 5KXCA 3VKFC 4UW3A 3JD72 4COYA 1GLHA 3ZFGA 1W6QA 3V64A 5SV5A 1LGNA 4CDXB 1KD7A 4I3GA 2RS12 3OBTA 2PLV3 2WWSA 1QXRA 1VBB2 3AXDA 1IOAA 1O3SA 4XQWA 4FPOB 2NM1A 3ZFEC 4XBQA 1BVP1 3H1WA 1JH5A 5BNNC 3FLRA 3APBA 2ZGUA 4QGNA 2X5IC 4R8HA 1V6LA 3H7YA 3VBUA 1N1TA 4JC1A 2O1QA 3WDWA 2BQPA 2HWD2 4AE2A 3VLBB 2OYZA 4BYYA 1POV1 3O14A 1RUG2 3P3NA 1RUE3 5J36A 3JBG2 3OD4A 4MUVA 4WM7C 2D40A 2RS53 4CTEA 4P9IA 1RHI2 3KT7A 3N7JA 1MS0A 3BPZA 4Q4X1 1MQTB 4XQDA 4DMIA 1CAUA 2BWCA 2C1FA 2D5FA 2YV8A 3WVJA 4S2GA 4IV1C 1J3RA 1N3OA 1H1MA 4HPKB 2B7YA 3OGJA 3SH4A 1BMV2 1D0HA 1UIKA 1RUF2 1KS5A 1E57A 4GMP1 1B09A 4WM8B 5LRSA 1BBT2 2Z42A 1Q8VA 4AYUA 5FO8B 2LUWA 2E9QA 3ZXLA 2WC2A 5I93A 3FC0A 2HEWF 2R30A 2B39A 4PBOA 1FOD2 4JDOA 4MXVA 3MF6A 4XEZA 3VZNA 2FQPA 3WV6A 1WLDA 2VOXA 1SBFA 2NMOA 3V0BB 4KU7A 4XJWA 3MIDA 1U5IA 5DZFA 1RUI3 2GC0A 3ZYGA 4LBLA 1KJLA 2TNFA 3CNAA 4UXAA 4Q2FA 4LR4A 4BPZA 1NOVA 3LA7A 1RIRA 4FPKA 4XFGA 2PA7A 1C1LA 2R1BA 4W6XA 1VB2A 3ACLA 4U36A 1AX2A 4QQ2A 3FFQA 2AYHA 3MLLA 1HRI1 5I8TA 2ZAAA 3QH7A 3ES1A 4QPGA 1LHNA 3LOBA 4QGMA 5BUVA 4LUMA 1H1AA 4RR3B 1D4M3 3EO6A 5CFCA 4WVWA 2HWB1 2BGCA 2V09A 2VNRA 4RSUA 3WZ1A 1LOFC 1V70A 1TMF2 1OA3A 1EAH1 1IPJA 4OI2A 1AR71 1QH7A 1OD5A 2UURA 4GB33 1YI7A 1PNFA 2OA2A 4XBLA 4PDWA 1W6MA 1PO23 2R041 5J37A 2F4PA 1X36A 4ZU7A 4YFWA 1IKQA 3AKSA 3MIBA 2VY0A 3VHPA 1JW6A 2HWC3 3E5UA 2R6QA 5GALA 4AHZA 1N3PA 2Q30A 1YIFA 4AVAA 1H0BA 4P14A 3P3PA 4AVTA 1B35B 4Y22A 3SLIA 1AR93 2O0OA 1ULDA 1S0DA 4F3JA 3H3UA 4YFZA 2W68A 1GFF2 1VBA1 2E53A 4KNCA 4YM2A 2R072 5GJ6A 1AYN3 3JD71 2IC1A 3FUOA 3AMQA 1ND3B 3NAPC 4YVWC 2TUNA 4FCAA 1URXA 1IGOA 1PZ7A 5CG8A 1O7FA 4IEUA 2YGLA 2Y0IA 4K8FA 4A7KA 3CJIA 1UCXA 2A6VA 2WINB 3A0KA 4C0HA 1DF0A 4ATFA 4XFFA 5DUXA 3AYDA 3CF6E 1AJKA 1LKNA 2WFF2 5T54A 5C6CA 1WUVA 3WCRA 1QQP3 4P9GA 5J96B 3M3QA 1REFA 1RUH3 1V9U1 2HWF1 4L99A 4HK9A 5CNAA 3ZSLA 2LM3A 4AQSA 3ZFGC 3CEWA 1UW8A 4NHLA 3CL1A 4HPKA 5KHIA 3HWJA 1IS5A 2HWE1 4FTEA 1AXYA 1IHMA 3H1YA 5CFDC 4YARA 3RPQA 1DGWA 4IQPA 4MVTA 3G7DA 3BOWA 4A3XA 4P9WA 1CAXA 1DQ1A 3NKGA 4FXKB 3MIGA 4M3CF 3MEPA 5CAZA 4CDWB 3M8LA 1KDKA 4QM9A 4LO8A 3AYCA 4NO4A 4FXGB 4RA0A 4IV3B 2JG8A 5GLWA 3NKTA 1VBC3 4D7YA 1PVC3 1RUJ1 1ULCA 3NV3A 5FREA 4E9KA 4Q4Y2 3V0AA 1XYNA 4BOWA 3VZOA 2WL1A 1ASJ1 2WZPP 3PTYA 3I7DA 4B3NA 2ZTNA 1O3TA 4R4XA 3NW4A 2YDEA 2ZKNA 1C8M1 4K40A 5F1RA 4Q4V1 4YM1A 2Z69A 3WOGA 4Z1VA 2GN7A 3VKOA 3VBSB 3ZSEA 3LA2A 2XLGA 4BWOA 4YM0A 4WVZA 1NA1C 3D0SA 3OCPA 4DY5A 3J8F1 2VULA 2PHUA 4XF9A 2CNAA 2BW8A 1PHMA 2P3IA 4DY3A 1W6QB 2ZGLA 1QJY2 4P9LA 3IPVA 1PIV1 1MVQA 2TEPA 4N53B 5JSPA 1VP6A 4HVQA 1LRHA 4S2DA 5KWRA 4AG4A 1NA1B 3H9AA 2QQPA 3ETQA 1I1EA 1HIXA 3UL2A 2R061 2A5ZA 1OPMA 5LRRA 1MZFA 3RS6A 2C5DA 1NE4A 5JCTA 1IS4A 3WP4A 4XMAA 2ARBA 1OQDA 4N53C 1HQWA 1S2KA 3HN1A 4W6YA 4C90A 1CJDA 4YZ2A 2VPVA 4IV1B 3DPRC 3MDPA 5CVRA 1UD1A 1H9WA 3HAGA 4K6BA 1YNAA 4O9GA 2CV6A 3LGRA 1BBT1 5DZGA 4Z82A 1AYM1 2XJUA 2EALA 4AGRA 3MYXA 3ZYJB 2CL2A 2NQYA 1CVNA 3PVEA 1N1SA 4LO5B 1OOPA 3DKWA 3VZMA 5FO9B 1QY4A 5C8CC 1I9RA 1LHUA 1AZDA 2XLAA 3HD8B 2IWGB 1OFSA 1AR91 5FLIA 1AL22 3B94A 1VBB1 1AXZA 1R091 4JDMA 3UV9A 1AVBA 5ABJC 2SBAA 2UYAA 2HEYF 1SDWA 3GYDA 4N9IA 3MZHA 3W9AA 3AMMA 4A7ZA 1QH6A 5JZGB 2I2SA 3KCXA 5K0UC 1ENSA 1DYKA 3N3HA 3O0WA 1YFXA 1SMVA 4ZU5A 1QWRA 1BKZA 2RS32 2PELA 1ZA4A 3KD4A 3SH5A 2I45A 3WQ0A 5FAXA 2E7TA 1RHI1 3KSCA 4D7SA 2ZX2A 4JRAA 4YG6A 5EFUA 1AX0A 1JYIA 1RUC1 1RUH1 1LB2A 1CGPA 2RS13 4IEPA 4PJYA 1EV13 3WDTA 4OULA 5JOZA 2ZMNA 1SBEA 4BHPA 4Y20B 4Z8BA 1CQ9A 4LEJA 1D4M1 4FT8A 4WZCA 2JG9A 2RMU1 1CJPA 3M3EA 3AMNA 2ZX1A 1DHKB 1H30A 1WW4A 1ZVFA 4CEWB 2NMNA 2R0HA 3PVNA 2WZR1 3MW2A 4F7ZA 3VBRB 2OVUA 3BTAA 1YLLA 2A6YA 5LK5A 1AL0G 1NCRC 1LHWA 3EQEA 4YVSA 3SCFA 1DQ0A 3ZO0B 1A3KA 2IXLA 2OW4A 3B00A 5EWSA 1TME3 2JDZA 3ZMNA 4OI4A 3AP5A 3VBFA 4M3CB 1RUE2 1K5MB 4F83A 2A6WA 4YVSB 2GNTA 2OZJA 4IESA 3V0BA 5FMOL 2VVFA 2UWAA 1RUJ3 5H9QA 4COWA 5KXBA 1Q5OA 4QPYA 4HVRA 1A8DA 3U4XA 4NPRA 2DTWA 4AWDA 1MS5A 4BIFA 1PO11 4MSVA 2DURA 2ZKLA 5C8CB 4MV2A 1LOAA 4Q4V3 1OPOA 2HWD1 1VBE2 4JGZA 4KQ7A 5F6LB 2XL9A 1S0FA 5KC6A 1OI6A 1HV1A 3V0AB 4CP1A 1W2UA 4PBPA 4L8QA 3WD5A 2WT2A 3JBG1 1CAUB 1FMD2 2GSYA 2D43A 4RS5A 2DCJA 3UK9A 3IN9A 5BNPC 1GNZA 3RI9A 1GZWB 3DV8A 1YO8A 1CD3G 3ZXJA 1QDCA 3AP7A 3R4DB 4EN0A 1QJU1 3J26N 4QHBA 2WNVB 3S30A 3LOIA 1H2MA 3R6SA 2YZ4A 3IDEA 2ZHNA 2A6XA 5AC93 5AVAA 1ZX5A 1DGRA 3VDDA 4CP2A 4CRQA 4BA6A 2XJPA 5FBZA 4COUA 4QD2A 2ET7A 1OA2A 2JG9B 4ASLA 1BEV1 3DGTA 1QKQA 2BYVE 4XPVA 3WG1A 4XHBA 1F9KA 1DZTA 1JTZX 4FPCA 1NG0A 1T6GC 4OLLA 1C4RA 1HRV3 4LULA 3NJZA 2JE7A 4FPGA 1IZ3A 3WDYA 2YC0A 4G9SB 4GMP0 3DN7A 2Q5TA 1ENRA 4CEYB 3NWKA 1PVC1 1ND3A 2XUMA 1POV3 4Q4X3 5JSRA 4GB32 3WINE 5JMCA 4XMIA 2XJTA 1CAWB 4LBJA 4UW6A 4NHMA 1R082 3B93A 4YGEA 4WVMB 4UW5A 2ZGTA 3WY6A 1MEC2 4Q0PA 3INAA 5BYNA 5JZGC 3ZN4A 4M00A 1OA4A 1EPZA 3WT3A 2BFUL 4AVSA 3CJIB 3WDUA 5C8WA 1LJ7A 1ULEA 2VU9A 4HSJA 4META 2NLRA 4Q0UA 1QJX1 3OPZA 2ILMA 2ZAHA 3L2YA 4Q1PA 5HCFA 1KQRA 4K21A 5CFDB 2E7AA 3VBHA 1TEIA 1KFXL 3LCPA 1RUD1 1ZRFA 1DIWA 2JE9A 4AI2A 2D97A 2NYYA 5I8SA 3JUUA 1POV0 1YFWA 4CEWC 3R0RA 1QGLA 4BH9A 5LK7B 5CFCB 3N36A 1Q3EA 4XFBA 4E2GA 3EBRA 3CU7A 2CGPA 2PHDA 3RG0A 2GZWA 4D69A 2DCTA 2I07B 4E4SA 1YJLA 4BQ1A 5JSOA 3J9SA 3AB0A 1W39A 1VBA2 2QDRA 1TME1 2D7FA 4YG3A 5FFOC 1REEA 4EROA 5L19A 3LSDA 2R49A 4AVBA 3H0OA 4DOUA 4JAAA 4XF1A 4CYDA 5I0SA 1HRI3 4TLFA 4FO9A 1GSLA 3D5OA 4AFBA 4PF5A 2A6ZA 1AUYA 4IL7A 5JAXA 1Z0HA 4OUMA 3V56A 3H1MA 4BIOA 1AR73 1VBD3 2ZS6B 2DWRA 1XYPA 1HDKA 1X8MA 2BNNA 2R043 4I01A 4CDWC 3NVCA 2MEV2 1W6PB 5DUWA 3JCIA 3KS7A 4QX5A 2WNUC 2FZ2A 1AR81 1HKDA 1XXNA 3PJYA 5CADA 1FPN1 3S7IA 2ZZQA 2TBVA 4Q4Y3 3KB5A 3ROUA 1BYHA 4MX3A 4R52A 5DDJ3 1NCRB 1QOTA 3T1LA 5HI0A 3POWA 4PIYA 4ONUA 2RR11 1IPKA 4PIZA 4Y4YA 2V5YA 4RQPA 3ZFGB 3M3CA 2EF6A 1OSGA 1VALA 3M3OA 1K5MC 2ARXA 2RS11 2WA3A 2Y0OA 4FQZA 4R9DA 1LOEA 4EJRA 1C1FA 1S0JA 2MEV1 3BALA 4KU8A 1AYM2 3KQRA 5FDBA 1QJY3 3SXWA 4OFGA 3PJQA 1ASJ2 2ZGOA 4SBVA 4AI0A 2A70A 1AL21 1QHDA 3J8F3 3J4UH 4N43C 1J58A 3SCHA 3IM0A 4FPEA 5JIUA 4FPYA 3VHRA 4DXZA 4AK3A 1CAVA 2NPIA 3RMXA 3MLJA 4YZ4A 3HT1A 3PMSA 3IIAA 4AVVA 2D6NA 2YPJA 1XQNA 3VZJA 3ZXDA 5CA6A 4HFSA 1W6NA 4XF4A 1NLRA 1ALYA 3WW2A 1LODA 5C9AC 1IKPA 2VW2A 1RMU2 3B9IA 4EV0A 4YW3A 1LEMA 2VQAA 5BNOA 3OTFA 1HXS1 3OYWA 3Q9OA 4XILA 3T2TA 5EYXA 3AM2A 3AX4A 2PYTA 3ZFEA 4RR3A 1QF3A 4WM8C 2JKBA 4QPGB 4COZA 4FBFA 2B42B 3EJKA 4W65A 1GR3A 1HW5A 4A7YA 5FMOS 2E51A 4J1XA 3LSEA 1OHFA 2W08A 4WV8A 3KLSA 2XHKA 4QPIA 4AFDA 5JOYA 1WCKA 1JBCA 3NL1A 1X82A 3I59A 2VNOA 4ZKTB 2RS51 4AHYA 3I8TA 1AYN1 4JCKA 1ONAA 1RUD3 1W6MB 1AJOA 2PHLA 4Q0VA 2YGMA 5I0UA 4M01A 4GXLA 3M7AA 4ZU4A 2A3WA 2RS33 1DFQA 4LBQA 2YHJA 3AXEA 3NO8A 4S2FA 3AZXA 1H4GA 1H2LA 1QQP1 1CAVB 4JQRA 5A32B 2VOWA 4FPHA 3RJRA 2WKKA 1WGPA 2BNMA 2PN5A 3RI8A 5J48A 1COV3 2ZACA 4A2UA 4L97A 2GU9A 1UIJA 3VUOA 2DU0A 4BMEA 1H8VA 2SLIA 3ILRA 2GMEA 2FMDA 3VKMA 4ZXKA 4H3WA 3ME2A 2Q1ZB 1EV11 4PLMA 4XETA 1R1ZA 4NWWA 3VBRC 4FTSA 4DRVA 5DZEA 1RUI1 5GZCA 3ZYIB 4XFHA 2DTYA 2O8QA 3B5LB 2WIIB 4AEMA 2ZGRA 2ENRA 3KGLA 1TME2 2WZR3 4IE