2HEVF

Crystal structure of the complex between ox40l and ox40
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
126
structure length
126
Chain Sequence
RIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQDNSVIINCDGFYLISLKGYFSQEVDISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the Costimulatory OX40-OX40L Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
molecule keywords Tumor necrosis factor ligand superfamily member 4
total genus 19
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2006-06-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2hevF00
1OQDA 2OIIA 2X29A 2QDNA 1RJ7A 2TUNA 1RJ8A 1D4VB 4MXWA 2O0OA 1PK6A 4F3JA 2RJKA 1U5ZA 1D2QA 2AZ5A 2WNUC 3B94A 2WNVC 1C28A 1DU3D 3IT8A 3WD5A 3TWIA 2WNUB 4QQOA 3K51A 5CIRA 5HBAA 1I9RA 3AB0A 4OUSA 1U5XA 1JTZX 4E4SA 3V56A 3FC0A 4G3YC 4QQPA 2E7AA 2RJLA 4NN0A 2JG8A 5L36A 5KC5A 4QPYA 5KWRA 4TSVA 4OULA 4KG8A 2ZPXA 4MSVA 4TWTA 1OSGA 2WNUA 4D7YA 4DB5A 2RE9A 1A8MA 1S55A 1DG6A 2HEYF 1JH5A 3L9JT 2R6QA 3B9IA 3K48A 2HEVF 3ME2A 4KGQA 3QBQA 2KA3A 4G4FA 1GR3A 4HT1T 2JG9B 3URFA 1TNRA 3B93A 5L19A 1OQEA 4GIQA 2Q1MA 3QD6A 4EN0A 4QQLA 3TYJA 1KXGA 4KGGA 3LKJA 2QE3A 2R32A 4OUMA 2WNVB 1XU1A 1KD7A 4E4DX 1C3HA 3MI8A 2Z5WA 4QQHA 4MXVA 1WCKA 1PK6C 2JG8B 1ALYA 2ZJCA 5KC6A 1D0GA 2JG8C 3ALQA 2R30A 4N90A 4DOUA 1PK6B 1TNFA 2TNFA 4MXWB 2HEWF 1XU2A 2WNVA 1U5YA 2JG9C 5TSWA 5BNQA 4J6GA 4RSUA 4QQ2A 2JG9A 2Q8OA 1O91A 1IQAA
chains in the Genus database with same CATH superfamily
1ENRA 3I3QA 3VBOC 3O0XA 4AZZA 3LEKA 1FNYA 3HAGA 2VXRA 5DUUA 5EQUA 1NE6A 1J3PA 5ABJA 3I59A 3TB0A 4Z07A 3UETA 4QHOA 3LIGA 2D43A 1B35C 2E9QA 5KHJA 4C0BA 5JI9A 2K0GA 2IXHA 3AP6A 1RUF3 3U0ZA 2GDFA 4IE0A 1IS3A 1YQ2A 2HWF2 2WQ8A 4BMBA 3RWNA 1VR3A 2Z2SB 4QX2A 2HBUA 3SNMA 5LBEA 4NO4A 5FYYA 3WD5A 1UPIA 1MS1A 4ONUA 1ZBA3 3CO2A 1FAYA 1ZBE3 4K1YA 1VP6A 1QXJA 2VCBA 2JDHA 4RHV3 3LDRA 2WLPA 2XWBB 3PUHA 4D6SA 3ILNA 1FI2A 4FPLA 3RZKA 2X5IC 2WS91 2D6MA 2PHUA 1Q3EA 1Q8OA 2VPVA 4D94A 1DZRA 1PZ8A 5A33A 3ZXDA 1YC61 3H1YA 1AF9A 4P08A 5C8CC 2NMOA 4UFJA 3POIA 3LEIA 5A3TA 4HLTA 1HX6A 2OA2A 1AYM2 2MPFA 5LBFA 1NQJA 4IERA 1TE1B 3SLIA 2QFEA 3WDVA 3B7MA 2GU9A 2ZCWA 1CR7A 1S2EA 3OD4A 1BEV1 1LGBA 2X53S 2XJTA 5J1XA 4YVWB 4P02B 5A6XA 5C3OA 5FP3A 4AHYA 1LB2A 3PUQA 4EROA 1UPSA 4YGDA 3V0AB 2BPA2 3ZR5A 2W95A 1OH4A 4DS0A 5DAWA 4FPCA 4YZ4A 3WG4A 4AI9A 3CLPA 3IN9A 4L0PA 1CZSA 3NJYA 5FXXA 1KDKA 2Y6KA 4Q2FA 1ZYBA 1ULOA 4OZOA 3GHNA 3J4UH 3S7IA 4B7KA 1MQTB 2JWPA 5EIYB 4X6QB 3EQEA 3LD8A 1EV13 4Q29A 4OHZA 3ROUA 3VBUC 1SFYA 1KEXA 4QWNA 4URTA 1UMIA 2XJQA 2W91A 3ZN6A 3J9SA 1K3IA 2ZAAA 2WFF3 3ECQA 5CADA 4QU1A 2A3XA 1CJDA 4Q8KA 1S0DA 4WVZA 5BXXA 4H55A 5C9AA 3LFMA 4CP2A 3FBYA 4Y24A 4QQHA 2DURA 2HYKA 5F3CA 3OPTA 5DUWA 1OPOA 1KGYA 5A33B 5I8SA 3LPGA 5L9RA 3Q9OA 4W4ZA 2BVBA 2JDAA 3CF6E 1MZ5A 5A3WA 1X82A 4RGGA 3KMHA 4L97A 4FQ4A 1WCQA 5BYNA 1W9YA 2R061 4P14A 2VZSA 4AI1A 3MIDA 1UYXA 2OS2A 2WNVA 1BHGA 2R0HA 1HJGA 2DBNA 3FUOA 5TSWA 4LA3A 4TTGA 3K4DA 1RC6A 5DAXA 1JYIA 1Y9MA 1W9FA 2WC2A 4XF3A 4DINB 2FDFA 4R9CA 3V0AA 3IIIA 3AKTA 3KSCA 3PIJA 4E8CA 3FMGA 1UCXA 2DVDA 3WNKA 2FMDA 4CCMA 2JDYA 1JODA 2QDNA 5KR7A 1COV3 4QXKA 1GZCA 2JE7A 2JICA 4W8JA 5T52A 3VD9A 2VUCA 2XHKA 4YW5A 1PGW2 2DVBA 5FXZA 3WF1A 1J84A 5LA9A 2ZEXA 4LORA 2WSUA 4KBBA 4XDOA 1L7QA 2RS11 2L9LA 2IC1A 1YI7A 4JGYA 4EWAA 2WNUC 2ZMLA 4YVWC 5FZEA 4Y5TA 1HJFA 1W8TA 5FMBA 2R16A 4LBQD 1CONA 4A3XA 2B5HA 4Q0QA 3I49A 1UF2C 4CCJA 2H6CA 2OUJA 1RUG2 2XONA 2JECA 2YGMA 2ES3A 3D0JA 1R081 4IEYA 1PIV1 4O65A 1DIWA 1U5XA 1E5SA 1RITA 4E4SA 3OEAA 4FSJA 2E7QA 4HXCA 4GB33 4IEUA 1YLLA 3MIGA 2QQMA 1V0AA 1S0JA 2ZABA 3WW3A 3SITA 4AI2A 1POV0 4NROA 1C5HA 4YZ3A 4GZ9A 4I3GA 4AW7A 3OD0A 3PVEA 1JS9A 2O1QA 2VTXJ 5FP4A 1ND3C 3N9MA 1BZWA 1RMU2 5I93A 4MZUA 4LO7A 4TWTA 2WT1A 1RUD1 1VBD2 4DRRA 5CFDB 2UY9A 4HANA 2Q8DA 2RE9A 3TEYA 3I2FA 1FMD1 1R091 1D4M3 2V5YA 4UBGA 5GM0A 1CAWA 4Q0UA 1WCDJ 1HXS1 1PMJX 4TZDA 1UOGA 2E32A 2R0FA 4IGOA 4KWKA 4L2NA 3N7MA 4UFIA 4CDWC 1AR92 1ZRIA 1YUDA 3JQXA 1W8FA 5JPMB 5KHGA 5A7WA 3NV1A 1Q56A 4GWMA 4LXLA 3KF5A 4AHZA 1N1YA 2IFRA 4UW5A 3DXUA 4FOYA 5F5QA 1TNRA 1BVVA 4OHVA 3U07A 4UF0B 2MEV1 3MDPA 1RUI1 3JD72 2EALA 1BBT2 1OPMA 1XSRA 4LPLA 4YGBA 1KFXL 3OBRA 4BPZA 3P3PA 3J8F2 4A4AA 3CU7A 1LHNA 4BQXA 1OA2A 4BU2A 4DO0A 5HXMA 2WL1A 2VQUA 2P5BA 2ZGNA 4K20A 3RWKX 2AEYA 3H8RA 1QDOA 2ZZQA 4LHNA 1K5MC 3OTFA 3HNYM 4NRMA 1WCKA 3N3HA 1ACCA 3MYXA 4A7KA 4HG6B 1DGRN 1POV3 1UYYA 2Y6FA 1SPPA 2VNVA 4YW6A 4XAEA 3OUJA 3UJOA 2Y33A 2RDRA 2VL4A 2XL7A 5T54A 1J3RA 2W47A 4CUGA 2VD7A 3MIFA 4QXHA 5FZIA 5FO7B 3TEXA 3LZZA 3NAPB 4Y22A 3H8XA 5T5LA 5JSRA 1RHI3 2XPJA 2DTYA 4JVAA 5FZMA 3ZN6B 3KHBA 3P1IA 1V6IA 3WNPA 1LHOA 1CPNA 4JKMA 1CZTA 1SDWA 1PVC3 4LBQA 1BYHA 3IAPA 3ON7A 3AJZA 5FUNA 1CJPA 3SISA 5FMOL 2AGSA 4RFRB 3CEWA 1H8TB 2WLQA 3WVJA 1M4WA 4AGVA 3ZKYA 2EIGA 2H0BA 1JU4A 1PK6A 2QQOA 4OHWA 4BE3A 5JR7B 2GNBA 4QGMA 4B4PA 2WZR3 3G6JB 1H6YA 1ND2B 1U5ZA 2WYSA 5FJHA 4EZ4A 1YIFA 1C1FA 3MLJA 3HPNA 2RS13 2QCSB 1PZ9A 3B94A 2ZGKA 3B02A 3F2ZA 3I2DA 1JXNA 2FMYA 3OCPA 3OB8A 1GSLA 4MV2A 1ZBE1 2DYCA 4ZY9A 1XE7A 2MNGA 2PHLA 3R4UA 1GP4A 3E6BA 4GJZA 5JIUA 3DGTA 3K3NA 2XJPA 3FBMA 3AB0A 1UIKA 4IE7A 3DCQA 1DHKB 1XOYA 3NRUA 2VU9A 2SBAA 2WUHA 3MV11 3DEMA 2WT2A 4BXFA 5HCHA 1AR82 5CFCA 3T2PA 1RUH2 3KVBA 2DDUA 1XNKA 3WLUA 3LEGA 4BB3A 5FQ0B 1RUI3 4XQDA 1RYYA 2WAAA 4AGGA 5T55A 1F2NA 3RJ2X 2ZGUA 2VZTA 5FZ0A 2AENA 3VZNA 3D3AA 4LJHA 2JKBA 2VR4A 5K0UA 3ZFGA 4Y1YA 3CQOA 4CCCA 3A0KA 2ZX4A 1CAWB 4FXGB 1DG6A 4NAOA 4B3NA 4RYDA 2VNOA 1Y9GA 5BNNB 2VMGA 1SZBA 2C6SA 4NHYA 4CU8A 2BNMA 1PNGA 1U0AA 1WA4A 4BISA 4EE2A 4OHXA 4A45A 2G1MA 3BODA 4BHPA 5FZ6A 2UWBA 5EYYA 2R6QA 3LOIA 4N53C 4IE5A 4EZHA 5FPXA 5ERLA 5IK8A 4HL0A 5B2GB 3RZJA 3FLPA 4C1XA 4C90A 4RR3B 3RMYA 1JOPA 3MEPA 3HOBA 5FYTA 1ZZ8A 1C4RA 1IG0A 2EAAA 2P3IA 3HN1A 3MHZA 5LRSA 4XFCA 4IV3A 1TME3 2RMU1 1TZOA 3CJXA 3VKFC 4BH9A 1ZA4A 1MZ6A 1TME2 5FYBA 4BDVB 2UYBA 3RZZA 4OI1A 4XFAA 2XUEA 4NIGA 1ODNA 2Y64A 4NIAA 1LHVA 1VBA1 3O5SA 3M3OA 2P34A 2PFWA 3MI8A 3SH5A 4XW3A 4AVAA 3AMQA 1OA3A 4HOOA 4OCTA 5C5TA 3RRDA 2GH8A 5LK5A 5IFPA 3PNAA 1PGL1 5IJRA 3DN7A 1CIYA 1ND2C 5DABA 5JSPA 2D44A 4UW6A 1MEC2 1D0GA 3ALQA 4XUTA 1AL21 1RUE1 2VH9A 1DP0A 3WNOA 4AI8A 4FAHA 2ENRA 4GH4A 3LA2A 3UV9A 3BOWA 3KB5A 3WQBA 5C7GA 1UMHA 2CAVA 3KVAA 1CAUB 4CCNA 2JG9C 3ZXKA 1QJU1 5HCAA 1CX4A 3IDCB 1TMF3 3WP4A 1GQGA 2E51A 1BQPA 2Q8OA 4F83A 2WS93 1RINA 1GYKA 1GMMA 2Z79A 3E6CC 5HCBA 4FPGA 4WM7C 4BQ1A 5IHRA 3BTXA 2VCMA 3KWVA 3USUB 5FMCA 5G05L 5F5IA 2PELA 1SQ4A 3PUIA 2WFPA 3ZMNA 2BQPA 3FWEA 5C4WA 4NAMA 4OMCA 3NVCA 3NAPA 4Y22B 3W58A 1YWKA 1FV2A 4TXWA 2J1RA 1A6CA 1MS9A 1K5MB 1I5PA 2AZ5A 5CYYA 2Q30A 4HK9A 4CDUB 1JN2P 1YQ6A 1J59A 1GNHA 3BTYA 3ZYHA 4XCAA 1UZYA 1JYTA 3LE0A 3N4MA 2OQ7A 1YFUA 1GQPA 2ZGTA 3EJKA 3K77A 2ZEWA 4FP3A 1NCRB 3ZYBA 5AVPA 2IVIB 2BZDA 1I5ZA 3B5LB 5CIRA 3H1WA 4TLGA 1DQ1A 4N7UA 5DDJ1 1REEA 5DZGA 4JX0A 4ZXEA 2GNDA 2RM22 5BNOB 1HIXA 2W94A 1RUH3 1RGSA 2OXBA 5EZWA 2FCUA 2W46A 4NN0A 3U1XA 3ACHA 2B46X 2Z4FA 3K4ZA 4XQWA 4AYUA 2VZPA 5J09A 3RZHA 3S6PA 5D2AA 3EMRA 1KFUL 4KG0A 1RUD3 1UX6A 2FDHA 4ATFA 5DMYA 5FZAA 3TRSB 2ZKNA 4JHZA 2IWGB 2D6KA 2A3WA 5FKBA 1SLCA 4XFGA 4CXYA 4DY5A 2V73A 2G4IA 4QX3A 2WS92 1XNBA 4BM8A 3H7JA 2R063 4FT8A 4LEJA 2XB6C 3OY8B 3LWCA 1NLRA 2QQWA 3M3CA 2XJUA 5F3EA 1L7RA 4Q5OA 2VXJA 2EIBA 1SLBA 3ME2A 1UMZA 4MGYE 2EXJA 4N8MA 4P9IA 2YBSA 3PTRB 3T2QA 2DTWA 2K2SA 2BGCA 2QVSB 5BV6A 5K0UB 4LKFA 3BVCA 2Y6LA 1RVF1 2GN7A 2ZXQA 2D7FA 3RZGA 2HWE2 3OSDA 1IS4A 3MW3A 1HRI3 4LBLA 2A6VA 2JEMA 5A6ZA 2GC3A 2W08A 4AVTA 2Y60A 4AFMA 2JENA 4XC9A 3VN4A 1ZZ9A 5I0UA 5EJZB 2IVJA 3LDKA 2XGXA 4A3ZA 2WQ4A 3UKVA 4MH0E 3ST7A 3RZLA 1H2LA 1REDA 2JG8C 3S7EA 1RUI2 1LOGA 3JD71 1S0GA 2E31A 4JC1A 1VPHA 2BOIA 4PBPA 2W3JA 5J37A 1F4HA 1O3RA 1SHWB 3UK9A 3ITQA 3W9AA 4LA2A 2JB8A 5FP9A 3WHUA 1W6PB 2Z69A 2IXIA 2UURA 3JZVA 4OI0A 1B35B 3VHPA 4Q4Y1 1UX7A 3H8UA 4E9KA 3SQOA 5K8SA 2EXHA 1TMF1 2ZMNA 4ATEA 3B69A 3BU0A 3JBG1 1XSQA 3PTYA 4G9SB 4XEZA 3VDDB 2P6CA 4CTEA 3HEIA 5A7NA 4H3WA 2OVUA 1VBB3 5CKQA 5C4WB 2ETEA 4JGYB 4K8RB 2JD4A 1ZBA1 3HJRA 3OYWA 3ZXLA 1O3QA 5DN2A 3HQXA 2VZ3A 1CZVA 1IPKA 3MIEA 4UFHA 1QJY2 1W0PA 2DUPA 4O9GA 4UOJA 4ZS3A 2R042 4MHUA 3AX4A 4EJRA 1ZRCA 4U36A 4CUAA 3WF4A 3GZEA 2VOXA 3WG2A 4EV0A 1CQ9A 2CGNA 3A21A 5AFEA 5LRRA 2YB7A 3IWZA 1UOJA 4IEZA 1JYNA 4XF1A 1D7PM 3NJVA 2D3RA 3DF0A 1DLCA 1DCSA 3USUA 5LBBA 1WZXA 4BWOA 5JXHA 2A71A 2DBIA 5SV5A 3TN93 5BNOC 4FTBA 2DCTA 2ZS6B 2YROA 2CNAA 1N3OA 1HXS2 2XL9A 1QEXA 4YYOA 1H6XA 1HRV3 2A6YA 1HB1A 3HT2A 2BFUS 2D3PA 2VZVA 5FIXA 3U4SA 2HWB2 5I0TA 5KXCA 4K40A 4Y33A 4IV1B 3WW1A 4CUCA 2UWCA 1OVPA 2ADEA 4BQ5A 3MBWA 5IAVA 5A7WB 1JZ2A 3TEWA 3ZYFA 1S0BA 2WZPP 1FPN3 2FD8A 4FTSA 3I97A 4RGAA 5T5OA 1RUOA 3AM2A 3FJSA 3K4AA 4MUVA 2HEVF 4XABA 2ORZA 4XTMA 2DV9A 2GN3A 2VZRA 1CAVB 1U5IA 5APAA 1XNAA 3OOXA 3C7FA 4PLMA 2VMCA 1H9PA 5E89A 3I3DA 5HV0A 4A41A 2VQTA 4JAAA 3ACGA 1CAUA 2IUWA 2HLEA 4Z92B 1NY72 4JGYC 1HRI2 2V09A 4I2OA 3P5BA 5FZOB 4OLLA 5FY0A 4I30A 4AFAA 4Q4X1 1VLNA 2JJ6A 3PHMA 3VBSB 3AZYA 4XFIA 3KZ4C 2AYHA 4CA9A 1LOCA 2W1QA 3AP9A 3RG0A 1D2SA 2ZTNA 4YVSC 3THTA 5BNPC 4QKDA 2XHNA 1M06G 2Q0AA 1LECA 5EJ1B 1ULFA 4IETA 2BWCA 1AYM1 3WNNA 3OUHA 1LR5A 4IE4A 3HMYA 3WY6A 3QCWA 4AVVA 5DQ0A 1X9PA 1MVQA 4V2WA 3ZYRA 3N9LA 2BBAA 1PGL2 4N9IA 5F5AA 2Y38A 4RQPA 3AL6A 1C1LA 3W20A 1WKYA 4AEKA 5CISA 1W8OA 3T4VA 1WLCA 3PUAA 3VB9A 2YV8A 4QHZA 1GBGA 4KH9A 2DUOA 3R6SA 5D8AC 1XNDA 2EICA 5B4NA 3OGJA 1S2BA 3JB8A 1Q8QA 2X29A 5C3SA 3ZXFA 1AJKA 2A6XA 4YZ5A 4RD7A 5K4LA 5EXOA 1OBNA 4CZSA 4E2SA 1AR93 2BDRA 2D6OX 1YHFA 5JIAA 3ZFFA 4AE2A 2KXLA 1LHUA 1XJAA 1B35A 4K9SA 3BTZA 1EY2A 2HWE1 3JQWA 2VMDA 2NQYA 4QM8A 3TOJA 4AEMA 1H2NA 2BERA 4MO3M 3C8XA 1RB8G 4J25A 4LITA 3M8LA 4P5YA 1AR73 4CEWB 3O14A 1UXXX 2Q1ZB 4HMZA 3USSA 2O8QA 3VKOA 5T5JA 1LEDA 3S30A 1JOJA 3N9OA 4OI2A 4DUXA 1NAEA 4HPKB 4IV1A 4OUSA 1NT0A 2WNOA 3WF3A 3KV6A 4FFIA 4GULA 4JCKA 3RSJA 3JU9A 2CGOA 3V56A 3P6BA 3WZ1A 2ZX1A 1CVNA 4LBMA 3DUIA 1HQWA 1V9U3 4I0AA 5FMDA 4QDRA 4WZCA 1OD3A 4CYDA 1AR61 4XURA 4ZPIA 1YO8A 3N9PA 2WSVA 4TSVA 3OPWA 3KM5A 2CTVA 4JTOA 5F8PA 4OQ9A 1G9DA 1YQCA 2XKOA 3E6DA 2RR11 3J26N 3VD7A 4C91A 3ES1A 2DFBA 2DVGA 4ZONA 4QDSA 2XVGA 3FUQA 2VMIA 4IEOA 2JB4A 1U12A 1UWWA 3AYDA 2XXZA 3LQCA 4JKLA 4XOGA 2YDEA 4XJWA 4XFHA 2MEV3 1BCXA 2RM21 4B7EA 4ZU7A 4XXPA 3T0DA 2ZACA 4XMIA 5JOYA 2BOJA 3D4KA 3POSA 1O59A 1MVEA 3HQRA 1JHNA 4DZGA 4CPBD 4DUWA 4HSLA 1XPWA 4EWEA 2NM1A 4QPGC 1R64A 1AXKA 2NMNA 1H2MA 3IB3A 3NL1A 2PQSA 3ILRA 5H9PA 4A6SA 5AVAA 4LKSA 4ZU4A 3UL2A 3TYJA 1KXGA 3VBUA 4D69A 3OF1A 4GMP0 1W03A 1OLME 1SG3A 5GJ6A 1VAKA 1VE0A 2LUWA 4CDUA 1QQP2 3VDDA 4DMIA 4AG4A 4WM7B 5FY4A 3VBHB 3O1VA 3UGFA 1RUF1 5JCTA 3ATGA 4Y1VA 1PK6C 4MADA 1UY2A 4LO5B 3HBKA 5IVVA 1W6QA 1O4TA 1LOBA 1YYNA 2GAUA 4Q4X3 3MPBA 1HLCA 2OQ6A 5JZGB 2WJSA 4UYBA 5CFCC 3FN9A 3SEEA 2ID4A 3LPFA 5FZKA 3T08A 1RMU3 4HVOA 1GZ9A 2VY0A 3LDBA 5A6QA 1H1AA 2JXAA 3KCXA 4QPIA 5DZFA 3VL9A 5FXWA 5FMOS 1P8JA 4ARXA 4HKLA 1WLDA 4IEQA 2YBKA 4M0NA 1H2KA 4XCBA 5CB7A 1Z7S2 4RR3A 2VOKA 2E7TA 2AREA 2GMEA 2EVXA 3C3VA 4M4RA 1QQP1 4PHZA 3WUDA 5EJ3A 1W0OA 3N9QA 4D6RA 1G7YA 2VBPA 2W1UA 4AQTA 2J1EA 1E5IA 4AEDC 3LSEA 4XJ8A 1O3SA 3FE5A 4BK5A 5IFTA 2HWF3 1UN1A 5FWEA 1UO9A 3ZVXA 2KR2A 1G9CA 1HQNA 1AR72 1KITA 5C70A 4BQWA 5FR3A 2XOMA 1ND3A 2D40A 1GANA 3J8F3 4LO8A 1H4GA 1IG3A 3RZMA 1STMA 4V2VA 3ZSJA 5HV4A 3CJIC 1V00A 1VAMA 2E26A 4GQ7A 4W6YA 2D98A 3PL0A 3AVSA 5H9RA 3VBRA 3AKQA 4CDXC 4XF0A 4I0BA 4N53A 5EWSA 4OMDA 3ETQA 2J1AA 3CL1A 2P2KA 3OG2A 2YHJA 1YFYA 4L9BA 3VD4A 1UZWA 1PNFA 2AACA 1RUC1 2F6BA 2PQQA 2UY8A 2VQAA 3E5QA 4WVVA 2TBVA 4XFFA 4XUQA 2D3SA 3GJBA 5L9BA 3RYPA 3WQ1A 2FDKA 4Z8BA 4UWDA 4CEWA 4WM8A 3POJA 3BPSA 5C33A 4A42A 1GWKA 2XLAA 2ZHLA 3HQUA 2WFF1 3GM8A 4NHXA 3LCPA 1AX0A 1ZA7A 5D1IA 1A8MA 4YFZA 1JOBA 3MF9A 2HEYF 2RS53 1QGLA 2VW0A 4K1ZA 4META 1J83A 3ZDVA 3OGRA 3L9JT 3CJIB 2FCVA 3WQ7A 4URAA 4Q8LA 1VBC3 2WA4A 4FPKA 2PLV2 4XDQA 5JZGC 3O1PA 1KJLA 2FBEA 1YRZA 3AZXA 1NLSA 1RUG1 2PLV3 4YW2A 3ZKUA 4QPGA 3ZLIA 4M00A 1VBA3 5CZKA 1WW5A 3TNQA 1YEWA 1UZ0A 3DYMA 1R1A1 3K75B 4XUPA 5DPNA 1NX9A 4M3CB 1IKPA 4D0QA 5KXDA 4PLNA 2PYTA 3EO6A 1Q8VA 1UXZA 4Y26A 1VB4A 3ZN4A 1I6XA 3A0NA 3WF0A 3WDTA 3FZ3A 3WHTA 4MHRA 2R32A 4PDWA 3IBMA 1LTEA 2Z5WA 1XYPA 2ZGRA 3KV5A 4WBBA 2WINB 4DEQA 3WF2A 4YGEA 2B9UA 4CEYB 1N3PA 4ZXKA 4BOWA 3VBHC 3VZLA 3DKWA 1G8WA 3M7AA 2VJXA 5FO8B 5FREA 2ZGMA 5I91A 3EYPA 2JE9A 4XHXA 3H9AA 5F9TA 2VUJA 3H0OA 1CWPA 1HXS3 1PGSA 1H8TC 2WZEA 1W0NA 1NA1B 2XBO3 1HKDA 2HWF1 2WDBA 2DU0A 4HBNA 4W65A 1W2AX 5FXVA 5CFCB 1R083 2XWJB 1MQTA 3W21A 4KWLA 3Q8FA 5FOJB 4YW7A 4HSJA 3NNFA 4JZRA 5A32B 4L99A 2OPKA 3T4HB 4DFSA 2RVAA 2P37A 4XF9A 3KHCA 2J1TA 5K7PA 2ZMKA 1FT9A 3WG1A 3VLBB 1PIV3 4GWJA 4CCKA 2YC0A 3RMXA 2I07B 1RJ7A 2TUNA 1EYBA 5KHIA 1OF3A 4PJYA 1VBD1 5GZGA 5LASA 1FNZA 3ZYJB 4Q0PA 2ADDA 3S0MA 4FQZA 4IESA 1JYWA 2VCCA 4P9GA 3RPQA 3TNPB 1YXWA 2VMEA 5FFOC 5BY5A 3H1MA 2JDMA 1FPN1 4YZ2A 3EXUA 1BXHA 3T0AA 3GYDA 1QQP3 2VBDA 2VNGA 3POGA 4NPRA 3CDZB 4H7LA 1PMHX 4PF5A 4R4XA 4CDXA 3WT3A 1ZZBA 1W2UA 5AFBA 3PURA 1YJKA 2HKXA 3ZPOA 5CG9A 1W6PA 1WD4A 3Q8EA 5FYVA 4O9EA 1OD5A 2X8KA 1RUJ3 1W9SA 4QX5A 4LBJA 5C6CA 1CAXA 1F5JA 1X8MA 4JTNA 3TEZA 5GZDA 4QX0A 5A3PA 1I1EA 2FZ2A 1Y7BA 4CEWC 1PO21 3KGLA 4XUOA 3THPA 2H6BA 2JG8A 1DQ2A 4FTEA 5E8AA 1H1MA 1R1A3 4TYSA 2NP0A 1JUIA 3D82A 3AMMA 2RDSA 3ABZA 3LB9A 5LBCA 1AL22 4AEJA 1UY1A 3ZSLA 5CFDA 5JLVA 3K2OA 4IUGA 4EQVA 3MPPG 3LGRA 4Y4YA 2YUEA 1H8VA 2F4LA 3DV8A 4PI0A 3WW2A 4JRLA 2CL2A 3UKTA 3ZR6A 1AYM3 1JZ8A 3MFAA 2QZ2A 3M3QA 2R49A 1OH3A 1F31A 2CU5A 4Q0VA 3C7OA 4GALA 5SV8A 3RI9A 3ZYGA 5JZGA 4TN7A 3ZIXA 1A8DA 5FUPA 1EUUA 1W6QB 2YU2A 2NYYA 3OUIA 1COV2 2BNOA 4CXXA 3V0BB 2GMMA 3AXEA 4WM8B 1XNTA 4KGQA 5FZ7A 5FY5A 3FFZA 5IAXA 3W5NA 2KA3A 4S2GA 1GR3A 1LOEA 3QH7A 1EV11 4YGCA 2ET7A 4AI3A 5BNPB 2BNNA 2IXLA 3MIHA 2R7EB 4QGNA 1NG0A 1LNSA 2UYAA 1AZDA 5AC93 1H1IA 3SCHA 1QJY3 4QQLA 1V9U1 4KWUA 2PLV1 3MV01 1JZ3A 3N7JA 3GF6A 2WNVB 1TQ5A 3OGGA 5B4XA 5FOBB 3D5OA 4JGZC 1GNZA 1UKGA 5FYHA 2P4EA 5H9QA 1HV1A 3NV3A 4J1XA 4NWVA 2RM23 1L7LA 4RN5A 4OHYA 2QQVA 4KMQA 3ZMOA 2LROA 2D5HA 3HVDA 4HZFA 4CDWA 5KC6A 3AKSA 1A34A 1V6MA 4CVUA 3B01A 3NV2A 5BNOA 1PK6B 2PMWB 5ANNA 2PAMA 1TNFA 3IPVA 2V5DA 3UGHA 2J1VA 1NXMA 2R071 3WNXA 5A32A 4XAAA 3B3QE 4RS5A 3S5QA 3D8CA 2D5FA 4MGIE 5FAXA 2JG9A 1YIPA 4LNVA 4ET7A 1O91A 4EN6B 1PIV2 3AP7A 2MEV2 3KCYA 3MLLA 4JRAA 4XZUG 3VBFB 2R062 2B45X 1LKNA 1OLMA 5A7PA 1TME1 2RMU3 2JDKA 3RYKA 2D6PA 4CCLA 3O1SA 1S0FA 3SKJE 1W28A 4UFKA 5FZDA 4Y1XA 2FDGA 1RXFA 1VRH3 3AC0A 3E5UA 1Z7S3 1QHDA 3GZTB 1GICA 4IL7A 4MXWA 5JOWA 4C8DA 1HN0A 4PIXA 1REFA 3FFQA 3HIFA 4BIOA 5I0RA 1SPPB 4AXOA 1K12A 1IZ3A 3M2MA 5DG1A 4CU9A 2EF6A 1ZRFA 1FOD2 4YSFA 1ZX5A 2OUHA 2WFF2 3EB7A 4MYEA 4PLOA 1NCQB 1O7FA 4XPVA 2OYZA 1OFSA 1YI9A 3Q8CA 1GP5A 4QB1A 3I2GA 4P00B 2PA7A 3K51A 4RFT0 2DVFA 3V65A 3E97A 4BLJA 3AVRA 1JTZX 1XE0A 5FY8A 2W1SA 3TAYA 4KWJA 4KU8A 4ASKA 3RJRA 3W59A 4IDZA 2RJLA 1UZVA 5FZGA 1QMJA 4BLIA 4BYYA 2Q8EA 1K45A 3HNBM 1YQ5A 4A7ZA 4COUA 2YC4A 5LWBA 2R1BA 3PLQA 4HONA 4QHBA 5L36A 3RVHA 3ZN5A 2DCYA 1WLTA 5L7OB 1DLLA 2OKXA 3ZSKA 1VMJA 5JMOA 1DFQA 3C7EA 3AK0A 3PU3A 3A4UA 5JPNB 4DB5A 4F8AA 1W9TA 4CDQC 4CSWA 2NPIA 2Q4SA 1RXGA 4LK6A 2P6HA 2ZHNA 3AMHA 1V6JA 4Q4Y2 5LA0A 2ZGOA 1MS8A 4ORFA 5F7UA 1JZ4A 1AYN3 5IK7A 1QJZA 3U75A 5IATA 2V72A 4EYUA 4QX1A 1HW5A 3J8F1 5FRAA 4RA0A 1W6NA 1UOBA 1NLQA 2ATFA 3CHXA 4AEDA 1YFWA 5DAVA 1OT5A 1DBNA 3PMSA 4HT1T 3URFA 3IMNA 5M0TA 5DDJ3 1LODA 2CY6A 4L11A 2WWJA 1W6MB 1LCLA 4XJUA 2XH6A 3AP5A 4NVPA 5F39A 4EN0A 5BPXA 2ZHKA 4OFGA 2I74A 1GZTA 3WDYA 2VQ0A 2GC1A 1UYZA 4LHLA 2BW8A 3LKJA 4LUMA 3RI8A 4JV4A 5FYMA 5IVCA 5ACA3 1QJY1 3ZFGB 1CESA 3VBRC 3NSTA 5CBLA 1FMD3 1R093 3WNLA 1BJQA 1YJLA 3NMBA 1CPMA 3VBOB 4AWDA 2C26A 4S2FA 3POEA 5AC91 3HBZA 4GMP1 3WP6A 3LEMA 3U4XA 3BIEA 5EP9A 1RHI1 2JKXA 3NJXA 2RS51 1W3VA 2QTWB 4JDNA 1KQRA 5A1FA 2B7YA 3G7DA 3EHKA 1OOPC 1B09A 1OVSA 1XU2A 4UBHA 5GZEA 5IW0A 1QJFA 2BYVE 4XYXA 1Z0HA 1BMV2 5JI7A 1A3KA 4IV3C 5EHDA 3B9CA 5LATA 1AXYA 1CAXB 1QJU3 3AYCA 4IEXA 1NCQA 2F4PA 4DPNA 1W6NB 1ASJ2 1RUC3 2G9ZA 4LKDA 4PQ9A 2CYFA 1OQDA 1N3QA 1WCUA 2GP3A 5DAPA 5C3QA 5ABJB 5J48A 1JYXA 4LOSA 1AYN2 2OZJA 3VD5A 4S2DA 1DGLA 4QKNA 5J3UA 3KS7A 1UY0A 4JDOA 1JHJA 1VBA2 3I2HA 1POQA 4IE6A 1O3TA 4Q1PA 4EWDA 3K3OA 1DGWX 1OLQA 4FVVA 3U10A 4MLOA 3MW4A 1NA1C 3PU8A 4ZS2A 3UJQA 3I2KA 4DNYA 1NCRC 4E4HA 2ARCA 3OGSA 1W05A 3GALA 1HQLA 1RUG3 1ZBE2 1QF3A 1X36A 2HWC3 1QXRA 3NJZA 4BQYA 5JWPA 3P3NA 2RS33 4XFBA 3WDWA 3WR0A 1BKZA 4CDUC 3J7LA 4CCOA 1FATA 2LM3A 5J36A 2FDIA 1CN1A 3FHAA 2WA3A 4D6QA 2AC1A 3MO4A 2YPDA 1Q43A 5LEKA 4D7SA 4BA6A 4KI5M 1W8ZA 1RUH1 5KXBA 5FKCA 3NKTA 4XJAA 3WCSA 2ZX0A 1QIQA 5FK7A 3WSOA 1OKOA 1X8EA 3O0VA 4KG8A 2C4XA 1VBD3 1C8M3 4QD2A 4MSVA 2VUAA 1S0EA 2WAOA 3CBNA 4ZKTB 1CGPA 3BGAA 1QY4A 3VD3A 1D4M2 3WQ0A 1ODMA 1GWLA 3J7MA 1W6OA 4I0WB 1WWYA 1Z78A 1CD3G 3AZWA 3I4IA 5FYCA 5JMCA 1GOFA 2OZ6A 1JH5A 2G9FA 5FDBA 3UGGA 1JI6A 4CCDA 3HT1A 3CIHA 4I09A 4AFCA 4AFBA 1W8NA 4D7TA 5LA2A 1JZ6A 2WABA 3KQ4B 5LEJA 1O6UA 1W8HA 1JW6A 3HWJA 4NHMA 4YFWA 2QQKA 2VNRA 2DF7A 1X9TA 2A75A 3VDCA 3A23A 2EIEA 4F7ZA 5F37A 5HPOA 4G4FA 4M3CA 1WW4A 1DYKA 2JG9B 2P3JA 1W6MA 1E5RA 4CEYC 5E88A 3H8OA 1Q8PA 1MEC1 3FHIB 5E1RA 1PO12 4RQPC 5ACA2 3ZFEB 1LGCA 3AFKA 1OF4A 4XZPA 5HI0A 2O8OA 4KNCA 2QDRA 3S5AA 3MICA 3UT0A 5ACA1 2MHFA 2VOTA 2HWC2 1RUJ2 3C7HA 2QNKA 3NW4A 4P5HA 4CP9B 2YY1A 4MXVA 1US3A 2C5DA 1UY3A 1AR83 5ANQA 4AOCA 2OX0A 1RUE3 2X10A 5A70A 1LULA 3GJAA 2QQPA 5KXEA 1VBE1 1QNWA 3M4FA 1WMFA 5A7OA 1OA4A 3BIWE 4QKBA 3ZFFC 2QJVA 4NE9A 5IK5A 5KBFA 1TG7A 1LOFC 1OXCA 1Y3TA 5CA6A 2A70A 2IXJA 3T1MA 3GXUA 5IYYA 1QJU2 3J7HA 2E33A 4COWA 4ISQA 4RQPB 3O1TA 1LEMA 2HJIA 2ILMA 4LBNA 4N7IA 2B8MA 4FOQA 4YVSA 1PX3A 4IXLA 3DYOA 1SFPA 5FYUA 3WP3A 3WW4A 5CEHA 3MF6A 4KL1A 3VKLA 3PUSA 4FPEA 4XILA 1COV1 5E16A 3VHNA 3GCXA 2Y34A 2DUQA 4ES8A 4Y5Z0 1QNYA 4Y20B 2RJKA 1QJX2 4WM8C 4ASLA 3MZHA 3OBTA 2ZX3A 3KD4A 3VBSA 4MG2A 1BEV2 3ZFFB 4MGKE 3U37A 3HD8B 5FO9B 3L2HA 1JZ5A 1W9WA 3IZOA 3ASIA 1C28A 1SLTA 2QQUA 4ZU5A 1PO13 4JGZA 2ARBA 2EAKA 5DXDA 5FPBA 1WW7A 4QQOA 2R073 2A73B 1JMUB 4PIZA 2QBXA 2FQPA 4C0HA 4P9JA 2A6ZA 1W6OB 3RYRA 4I3PA 1SBEA 4RHV2 3KQRA 1KJRA 2DWRA 1MR5A 3AKPA 3T0BA 1DZTA 1J1LA 4R9BA 4QQPA 3MUY1 5F6KA 5GALA 3VBHA 4CP0A 1QJX1 2VZUA 3BPZA 5LA1A 1PGW1 2CWSA 2VULA 3FHQA 5F6LB 4PIYA 4FO9A 2XMLA 3RGBA 1HRV2 5KC5A 1QU0A 4QPYA 3WUCA 3VHOA 4YARA 4E4ZA 4RS5C 4QAWA 4FP2A 1Z7S1 5FPVA 4AL9A 1LHWA 1VBC1 3N36A 5GLUA 5C9AB 1R082 1OSGA 1HRV1 4LBQB 5FZCA 4PDWC 1KDMA 3GBWA 1BK0A 2ZZJA 1NQDA 4A7YA 5A1AA 2C0ZA 3KT7A 3WINE 4LHKA 3LFIA 3LA3A 3WG3A 2WN2A 1PO22 4RS5B 4R52A 1J3QA 1GU3A 2W39A 1GKBA 1AR81 2CDPA 4PQQA 5CAZA 1DYPA 2JIGA 3ACFA 3AL5A 4CEYA 5L9VA 4FPJA 1D4M1 5GLVA 3T2OA 1RVF3 4GKXA 4WZFA 4AI0A 3B93A 4QT6A 3VUOA 4OUEA 3ACIA 1ZRRA 2Q1MA 1O8PA 5IVJA 2ARAA 4XJ9A 3UYJA 2P3KA 2VGDA 4AQSA 1R1ZA 1IGOA 1QJEA 3O0WA 4LLOA 3SCFA 2IZWA 3MGUA 4OUMA 2V4AA 4HETA 2VZQA 2D97A 1XQNA 4R9DA 2WT0A 4DRVA 1S1AA 2VVEA 1AYN1 1TVGA 3MLKA 4QPGB 4BCUA 1UIJA 1S4CA 2Y26A 2ZBJA 1N47A 2ZKLA 4MGZE 3GZUC 1Y43B 1F35A 1O5LA 2VE1A 4UF0A 4Q4W2 2WQZC 5J7MA 1VALA 3VDBA 4INDA 4UI9L 4N90A 5F2WA 4XETA 3TBDA 2WZR1 5FBZA 2YBPA 3WDUA 1NUKA 2R1DA 1AJOA 2OPWA 4YM2A 1F15A 3GDBA 4FFHA 3V0BA 4I02A 3GGLA 5C5UA 3VBRB 4DXSA 3OYWB 3AP4A 5FZ4A 2GSYA 3T09A 5CFDC 1APNA 4YG0A 3VBOA 2YFUA 2I45A 4DY3A 3AYAA 1WMDA 2OIIA 5ABJC 4L8QA 1NY71 1W2OA 2VVFA 3HNMA 5FJKA 4PBOA 3THCA 5EFUA 4YWAA 5BNPA 1O4YA 2AR6A 2BTVC 3O12A 1D4VB 4RR3C 1ULDA 1KRIA 4Y20A 1QJX3 3NV4A 4IV3B 5F3IA 2CGPA 2DVAA 4EN7B 4UAPA 2QZ3A 1RUF2 3OY8A 1AR63 1WCSA 1LU1A 3K46A 2JDZA 3X29B 3POYA 2VW2A 1AR62 2VO5A 1PVC1 2VBBA 1V70A 4DEVA 4YG6A 2RR13 3I3EA 4COYA 2XR4A 5FQ0A 1DQ6A 2D6LX 5BNNC 5C8CA 2PHFA 3GZAA 3NNJA 2RS31 2IXCA 5L7OC 2WNUB 3ZX7A 1WBLA 1G86A 4D3WA 1SACA 2P1BA 4YVSB 5C3RA 1NXD1 1SLLA 5HBAA 4H2AA 4P9XA 5DUXA 1I9RA 4UFLA 1AXZA 3ES4A 1YNAA 2X5IA 3FL7A 3NWKA 4NR1A 5A3NA 4JQRA 4ZZ8A 3GNEA 5L73A 1RL3A 1V6NA 3GBFA 4B29A 2BVVA 4NRQA 3LSDA 4Q4W3 4K21A 2X09A 3TN92 2VMFA 3H7YA 2RDNA 2HH9A 1WUVA 2ZGPA 4LK7A 1RUD2 2NLRA 4LE4A 5F2SA 1WMEA 2XUMA 5FLIA 4XDPA 3T30A 4QX8A 4CDXB 5FZ1A 3POFA 4D7YA 1GOGA 2BJSA 2YYOA 1NCQC 2PTMA 5FCCA 3QOPA 3APBA 1H4HA 1TMF2 1OHFA 4XIKA 2LRPA 4EN9B 1PVC2 4H14A 2HBTA 2HWC1 4I01A 5FWJA 4XBQA 3AMNA 4LO6B 1WW6A 4QB2A 1VIWB 1G6NA 3RNSA 2WYFA 2PHRA 3BALA 2E53A 4IV1C 4AEDB 4A2UA 1UU4A 1AX2A 2Q1FA 2JD9A 3VL8A 3AZVA 1UOFA 4Q4V3 4XMAA 4YM3A 1EAH3 3KLSA 1W2TA 1NCRA 4LQRA 3SEPA 3BB6A 2W0XA 3O7OA 1VAVA 2BGOA 5GLWA 4IQPA 5FP8A 2YG0A 3BTAA 4TLFA 2R072 3SHRA 2W1WA 1XYOA 1LJ7A 4QXCA 5KHKA 3JXSA 1GWMA 3IIAA 4Q27A 4R4ZA 2VCAA 1TEIA 4COZA 5T50A 3VDAA 5ISLA 1RUE2 2LTNA 4K8FA 5DUVA 3V64A 1LOAA 1QXPA 5A1LA 4DXZA 3A7QA 1AL23 1AHSA 4MXWB 4GA9A 5FV3A 4B4RA 2B39A 4LMFA 4XBLA 5J98B 2CWMA 2VG9A 2W68A 2ZHMA 1GP6A 1UD1A 3PVBB 4YVWA 1LU2A 3OBZA 1J1TA 4YNIA 2CSGA 5DZEA 5JVVA 2ZA9A 1AVBA 1UY4A 4X6RB 3VDDC 3BCWA 3BKZA 1MS4A 1OI6A 4YM0A 5GKAC 5A7SA 3VBFC 3MW2A 1CIWA 2PHWA 2QUOA 1RJ8A 3AXDA 4FPYA 2X05A 1EUTA 2BEOA 3H3UA 2XLGA 2X5IB 1H8TA 3DECA 4F3JA 1ZZCA 2JIJA 4B4QA 3LIHA 3EBRA 1MQTC 4SBVA 4W6WA 1BBT3 4FPHA 4XE9A 2HWD2 3C7GA 4FAGA 4NRPA 5BNNA 4B8EA 2WR9A 2W2IA 5GZFA 3H50A 2XVLA 4FOVA 5H9SA 4XVHA 1E5HA 3GBGA 4MVTA 1OURA 1Q8SA 1ZZ6A 4HN1A 4XHBA 2RS32 3I59B 4IEVA 2BWAA 5HXVA 1W39A 1DGRA 4R9AA 5FTTC 2JDPA 4JKKA 4LBKA 4HPKA 2C1FA 4Y4RA 3KV4A 4NIDA 2WWSA 1F9KA 3THDA 3FC0A 5DAQA 3BN6A 4QKFA 1AX1A 1MEC3 4XF4A 2P3YA 4Y3OA 4YG3A 5D8AB 1Y4WA 1HB3A 3L2YA 5IUQA 4GKYA 2XJSA 4CP1A 3ZYIB 1JUHA 3IMMA 4M3CF 1V9U2 2WWUA 2XJVA 5C8CB 4Z82A 4NOTA 2BGPA 5FBJA 4YRDA 2A6WA 4RHV1 4GXLA 1OOPB 2XBO2 3NQHA 3M1HA 1OUSA 2ZPXA 1RHI2 3UKNA 2LALA 2Q8CA 3LA7A 3CMGA 1PX4A 1V6KA 2J1SA 1IQDC 2QQNA 4O61A 4QM9A 2PAKA 1N1SA 4M3CE 5FY1A 1FPN2 1XXNA 3CJIA 2FHRA 4WVMB 1VRH2 3R0RA 1ND2A 3R05A 4IEPA 4CPBA 4M01A 4E27A 2VUDA 4SLIA 4MGSA 1PO11 5FLJA 2FCTA 3K48A 1ZNPA 2WZR2 4CE8A 3OJBA 1BEV3 1W90A 3O1OA 4DXTA 2Y8KA 1RUNA 1SCRA 2BUKA 4NIIA 2B9VA 1HDKA 2GNTA 2WNEA 4FFGA 4JDMA 5LY2A 5J96B 1NA1A 1QH7A 4BQ4A 1W06A 1SDDB 1SBFA 1PZ7A 1ZZ7A 4Q1RA 4QPIB 3ZIWA 5A6YA 3WX5A 5AC92 5I0SA 1GOHA 3IM0A 2W5FA 4GWNA 3PJYA 4HVRA 4WV8A 2CDOA 1SLIA 2VVDA 4XACA 4QB6A 1EPZA 2IFWA 3CKHA 2KM2A 1HB2A 2V4VA 4MGTA 2YFZA 1H9WA 2I2SA 2GC0A 3O1RA 4NIHA 4ASMB 4E8DA 3NNGA 4P9YA 1BVP1 2QQIA 4YW4A 1LENA 4JQTA 1IOAA 4BMEA 5HCFA 5JOZA 2O14A 3ZO0B 1RUJ1 2ZEYA 1FV3A 3ZXGA 3VZMA 5IK4A 1V6LA 4FPOB 1RTVA 3LOBA 4Q4Y3 3VKNA 3WXPA 2IXKA 1UNBA 2GNMA 2GP5A 4FPFA 4AAXA 1PO23 2VTXA 3HN3A 4CCEA 2JDUA 4W6XA 1MS3A 1WMXA 4KBZA 2RMU2 3WNMA 4BZ4A 2JE8A 2ZGLA 2QQLA 1ULEA 2R041 5A80A 2O0OA 2W87A 2XQRA 4OYUA 5LK7B 3M70A 2Y6HA 2VM9A 4KU7A 3AMPA 2VZ1A 3IDEA 2Y6GA 1IKQA 1SCSA 5IWFA 4B1MA 3JBG3 4O7XA 4Z2WA 3NNMA 2C24A 2CHHA 3PJQA 1MS0A 2VTFA 5A3OA 4HK8A 4OZXA 5A3MA 4H7MA 5CNAA 3O1MA 1X50A 1GFF2 3QH6A 2WNVC 1DF0A 1ULGA 1O4ZA 3H3ZA 3T2TA 2A7AA 5F1RA 1FMD2 1R092 2GALA 5FY7A 3TWIA 5C9AC 1ENXA 4P9WA 1OQ1A 2ORXA 1QOOA 3ETPA 3S57A 5I0DA 2WO3A 3M3EA 1DGWA 3VZKA 3IPVB 4G3YC 4XXAA 5LCWL 1OFNA 4QMAA 4UXAA 1F4AA 3MFCA 3MIBA 3PDQA 1UKRA 1PMIA 3IDAA 4A44A 4GJYA 4AQ6A 2WRAA 1ZVFA 1ST8A 5GZCA 2VECA 4CXWA 1F8VA 4FOWA 2NZ9A 1AUYA 3U14A 4GB31 4Y1ZA 1LOFA 2AUYA 2HWB1 2WNUA 4NWWA 1ENQA 5JSOA 2J42A 4UW4A 4YW3A 3CZUA 3TN91 4XUNA 5IVBA 1ASJ3 1RUC2 1MS5A 1S55A 2XJRA 3ORJA 4N53B 2EA7A 3IAQA 5GLTA 5JXJA 2OT7A 2JDNA 4CDQA 4Y5SA 3N7KA 4LOTA 3ILFA 1AL0G 2Y6JA 3IDBB 1C8M1 3R4SA 2XKPA 3OGVA 1VBB2 4JGZB 4R8HA 4ARYA 2PXJA 3B9IA 3F95A 2Q5TA 4N43A 3RQ0A 3ZSMA 1FYUA 2XQXA 1MACA 3H42B 2DCKA 1RVF2 3OPZA 3ZDSA 1SEFA 2QQJA 5EYXA 3CNAA 4NHKA 3LAGA 4RGKA 4AQ2A 4DIQA 3JBG2 1OQEA 2RR12 5FPZA 3QD6A 3WOGA 5K0UC 1URXA 2OW4A 2RJ2A 1OOPA 3SMHA 3M3IA 5DG2A 4Z2AA 2AH2A 4ISRA 4KGGA 1POV1 1A78A 1HB4A 4FXKB 5FUIA 3KGZA 2VC9A 5A3LA 4OVEA 4C1WA 1W3XA 3AJYA 1C3HA 2WO1A 4Z1VA 2YPJA 5LW9A 1ZBA2 4QU2A 3DPRA 1BMV1 1VJ2A 1WD3A 1SFNA 4HKWA 4LR4A 5JUVA 4LBOA 4WM7A 4Q26A 1FX5A 5FYIA 3C2UA 3DPRB 1OKQA 3JCIA 3NKGA 1XE8A 2RG4A 1Q5OA 1UU5A 4XBNA 5T5PA 3VZOA 3QACA 2R30A 5I8YA 2XBO1 1VMHA 1O8SA 3KT4A 3PIGA 4GH4C 4OI4A 5IT6A 3QLQA 1DQ0A 1PHMA 1FXZA 2D6NA 1WA6X 2D93A 3FLTA 2TEPA 2ZEZA 1EAH1 1C8M2 2Z42A 2EIDA 2W52A 2CV6A 4PCRA 1XB9A 2LW8A 1C5IA 1DYOA 1UU6A 4NMIA 3I2JA 4XTPA 1LGNA 2J22A 1HV0A 4RSUA 3Q8BA 1LESA 4QPWA 5FZOA 4CP9A 5E6HA 3KV9A 3E5XA 3BUCA 1IQAA 4Q4W1 3POWA 4WVWA 5FP7A 4N43B 2GZWA 1IS6A 3I54A 3DYPA 1VBC2 3E1F1 1OLRA 4HFSA 5CKNA 1MPXA 2NN8A 1RIRA 4P9LA 3WV6A 5IVFA 3IKWA 1UAIA 1UZZA 4AVBA 1BLZA 1JZ7A 3NAPC 3AFGA 1MZFA 1YCIA 2N7GA 3ZPYA 4K7JA 3JD73 5JXIA 4QXBA 1QWRA 5FZ3A 4FI9A 4GMP3 2UU8A 2HWE3 3CZJA 3POBA 5FYZA 3DXTA 3I8TA 3DL3A 2HYXA 4GAZA 1ZRDA 2SLIA 2JX9A 1SBDA 2RHPA 3IT8A 1VBE2 1T2XA 3ZXEA 5FZ8A 1W8UA 1XBFA 2RDQA 2W92A 3D6EA 3SKVA 1CAVA 1UYPA 5FY9A 4FFFA 4M4PA 3ZFEA 2YMZA 4HVQA 2J7MA 5LZ6A 2VZOA 4YLZA 3ZM8A 1N1TA 1W99A 4S2HA 4HN0A 2BU9A 4PDWB 2DCJA 5C8WA 1UW8A 2E7AA 1EP0A 1C57A 1QH6A 5IVEA 1D0HA 5T3NA 4MOAA 3RDIA 1LAJA 4Q4X2 5LB6A 1IS5A 3SH3A 4AGRA 3ZYPA 5K9YA 5KWRA 1F5FA 4GD4A 4XIOA 4J1WA 4GWIA 4OULA 1ZM1A 3B00A 4YPJA 2ZX2A 3A22A 3UNPA 3RS6A 2EXIA 4DUVA 1QKQA 3AKRA 4AVCA 1C8NA 3WP5A 2G19A 4QGLA 2GMPA 4UT5A 5D21A 2HWB3 1GLHA 4IGQA 5A7QA 2ZGQA 3VZJA 4BIFA 2ZOEB 1W2NA 1W8WA 4XJZA 1XNCA 2VW1A 3VV1A 4AK3A 1FOD1 5FZBA 1H0BA 3MUZ1 3BI3A 1T6GC 1J58A 3BU7A 1IHMA 4N9HA 2HWD1 2WO2A 4N43C 3AYEA 4NJ4A 1L3JA 2ERFA 1GQHA 1UL9A 2VOVA 4U2AA 3QBQA 5DDJ2 3NNLA 1EAH2 1S0IA 2WBKA 3PVOA 3I3MA 2PAEA 1GV9A 2LS6A 1MZEA 1EV12 4L92A 4CUBA 4BXSV 5JR2A 1NZCA 3VGIA 1KS5A 4PT6A 3N9NA 1HN1A 4PF1A 4EN8B 2W9XA 1QDCA 4GH4B 2B4KA 1JU3A 2QE3A 4ES9A 4V1PA 1ZREA 5KHHA 2B42B 1V6OA 1KD7A 1XU1A 3DPRC 4E4DX 2BRTA 2PN5A 5L7OA 3ENRA 3SXWA 1T6BX 1BBT1 4YW1A 5I8TA 1ONAA 1ALYA 1S2KA 2ZJCA 1BK1A 4CU6A 5F3GA 3J7NA 5JAXA 2ARXA 1VMFA 5FPAA 4CDWB 5CVRA 4E2QA 1R1A2 2BFUL 1Y9QA 5JDBA 2HEWF 3KF3A 4DQAA 4Y1UA 3T1LA 4QX7A 5JXGA 3VBSC 1VRH1 4LUKA 3ZFGC 4MGQA 1U5YA 4LHSA 4BK4A 3SH4A 3BYWA 3OBAA 4FBFA 3N7LA 4IGPA 4LKEA 2CAUA 5FZHA 2F17A 2QKDA 1ND3B 3ZXJA 2EXKA 2ZGSA 5FZLA 3RFRA 1WLWA 4FCAA 3D0SA 3H3LA 1RMU1 5F5CA 3I3BA 2DCZA 4KQ7A 3ACLA 1X7NA 1GZWA 2GH2A 3R4DB 5EV7A 2E6VA 3BOPA 1GZWB 4LTAA 2K46A 1UQXA 2Y0IA 1JBCA 2YXSA 2PHDA 5FPLA 3FX3A 5FZ9A 4LIVA 5FZFA 3WDXA 1D2QA 3ZXAC 4Q4V2 4OQ8A 5FK8A 2WN3A 3Q8AA 4UFMA 2BBVA 3JB4C 3I2IA 1ULCA 3OEBA 5F32A 4CDQB 4ZHNA 2ZAHA 4NUBA 4CU7A 4NPLA 5CU1A 4CRQA 1W04A 3PVNA 1VBE3 5C71A 5FPUA 1JYVA 2FZ1A 1S0CA 1DU3D 1WBFA 2AEZA 2XVKA 1OC1A 4MX3A 5CG8A 4W50A 2C9KA 3ZFEC 4D8MA 3INAA 2K9ZA 3I2OA 2DU1A 1NZIA 3O1UA 1G9BA 4JHTA 4LT5A 1NE4A 1DDLA 1K5MA 4AF9A 1AR91 1PM7A 1G9AA 2C9AA 4UW3A 5FYSA 3I7DA 2XG3A 1PM4A 1PVXA 4HKOA 3VBUB 4AAPA 1H30A 2A3YA 4AVSA 1QOSA 4X8PA 1N1VA 1OMIA 1SMVA 3WEZA 2YZ4A 2ET1A 2YGLA 4LULA 4E2GA 3N35A 1US2A 2BP6A 4K3UA 2J1UA 3AZZA 1NKGA 3VKMA 3T3YA 5BUVA 2A5ZA 3U78A 1AR71 3FLRA 3JUUA 5GLZA 4BQ2A 3SC7X 1OUXA 3U11A 4Q4V1 4A6OA 2VOWA 3GCWA 4LLFA 2G9GA 2YU1A 3PMEA 1X33A 4COVA 4LIUA 2WO7A 4LE3A 2YC2A 3W5MA 1SLAA 4Q0SA 4BQ3A 1NYWA 3WCRA 1G9FA 1DQ4A 2VMHA 1VRBA 3SCGA 3VBFA 5C4WC 5A3UA 1CX1A 4B1LA 1IPSA 4YM1A 4AFDA 5C3PA 3KCCA 3VHRA 1XRUA 3LF7A 4XQ4A 1DQ5A 4QDQA 5L19A 4GIQA 1FOD3 1LRHA 4X8NA 5G04L 2HWD3 3ELNA 5FLHA 4LO4B 1K5JA 2PHTA 1JYCA 2GC2A 2RS12 2VAUA 4IW3A 4QPIC 1YFXA 4M0HA 4YZ1A 2WKKA 2R043 4BJ0A 2UWAA 1YQ8A 5LY1A 2BV4A 1QOTA 4IEWA 2Y0OA 2FDJA 5D8AA 1ULPA 2P17A 2XDVA 4NHLA 4ITCA 1ENSA 1WGPA 1EPWA 2JG8B 1KS4A 3DKQA 1K42A 1DZQA 2XLFA 3KT1A 1ASJ1 1E57A 1HRI1 2DFCA 3NO8A 2WIIB 4GB32 5IVYA 2WZ8A 3ZOIA 4PI2A 4DOUA 5JOXA 1GUIA 4K6BA 4AHXA 2RV9A 4AR2A 4NPMA 4AHWA 2E63A 2TNFA 4ZZ5A 4RL7A 5EPAA 3HR9A 5CKMA 3ZSEA 2KD7A 1XC6A 1GNYA 5BNQA 4J6GA 1I3HA 4WVMA 2PHXA 1VBB1 2H0VA 4QQ2A 3UESA 1IPJA 2RS52 4DXRA 1O5UA 1VB2A 2A1XA 1NOVA 3GHMA 1XYNA
chains in the Genus database with same CATH topology
1ENRA 3VBOC 3O0XA 1FNYA 3HAGA 2VXRA 5DUUA 5ABJA 1NE6A 1J3PA 3I59A 3TB0A 4Z07A 2D43A 1B35C 2E9QA 5KHJA 4C0BA 5JI9A 2K0GA 2IXHA 3AP6A 1RUF3 3U0ZA 2GDFA 1IS3A 2HWF2 4BMBA 3RWNA 1VR3A 2Z2SB 3SNMA 4NO4A 3WD5A 1UPIA 1MS1A 4ONUA 1ZBA3 3CO2A 1FAYA 1ZBE3 4K1YA 1VP6A 1QXJA 4RHV3 2WLPA 2XWBB 3ILNA 1FI2A 4FPLA 2X5IC 2WS91 2D6MA 2PHUA 1Q3EA 1Q8OA 2VPVA 4D94A 1DZRA 1PZ8A 5A33A 3ZXDA 3H1YA 1AF9A 5C8CC 2NMOA 4HLTA 1HX6A 2OA2A 1AYM2 2MPFA 1NQJA 4IERA 1TE1B 3SLIA 2QFEA 3WDVA 3B7MA 2GU9A 2ZCWA 1CR7A 3OD4A 1BEV1 1LGBA 2X53S 2XJTA 4YVWB 4AHYA 1LB2A 4EROA 1UPSA 4YGDA 3V0AB 2BPA2 4DS0A 4FPCA 4YZ4A 3WG4A 3CLPA 3IN9A 1KDKA 4Q2FA 1ZYBA 4B7KA 3GHNA 3J4UH 3S7IA 1MQTB 4X6QB 3EQEA 4Q29A 1EV13 3ROUA 4OHZA 3VBUC 1SFYA 4URTA 2XJQA 3ZN6A 3J9SA 2ZAAA 2WFF3 3ECQA 5CADA 2A3XA 1CJDA 4Q8KA 1S0DA 4WVZA 5BXXA 4H55A 5C9AA 4CP2A 3FBYA 4Y24A 4QQHA 2DURA 2HYKA 5DUWA 1OPOA 5A33B 5I8SA 3Q9OA 2BVBA 3CF6E 1MZ5A 1X82A 4RGGA 3KMHA 4L97A 4FQ4A 5BYNA 2R061 4AI1A 4P14A 3MIDA 2WNVA 2R0HA 3FUOA 5TSWA 4LA3A 1RC6A 1JYIA 2WC2A 4XF3A 4DINB 4R9CA 3V0AA 3AKTA 3KSCA 3FMGA 1UCXA 2DVDA 2FMDA 2QDNA 1COV3 4QXKA 1GZCA 2JE7A 2JICA 5T52A 2XHKA 4YW5A 1PGW2 2DVBA 2WSUA 4KBBA 2RS11 2IC1A 1YI7A 4JGYA 4EWAA 2WNUC 2ZMLA 4YVWC 2R16A 4LBQD 1CONA 4A3XA 2B5HA 4Q0QA 1UF2C 2H6CA 2OUJA 1RUG2 2JECA 2YGMA 2ES3A 3D0JA 1R081 4IEYA 1PIV1 1DIWA 1U5XA 1RITA 4E4SA 4FSJA 2E7QA 4GB33 4IEUA 1YLLA 3MIGA 1S0JA 2ZABA 3WW3A 3SITA 4AI2A 1POV0 1C5HA 4YZ3A 4I3GA 4AW7A 3OD0A 3PVEA 2O1QA 1ND3C 1BZWA 1RMU2 5I93A 4MZUA 4LO7A 4TWTA 2WT1A 1RUD1 1VBD2 4DRRA 5CFDB 2UY9A 4HANA 2RE9A 1FMD1 1R091 1D4M3 2V5YA 4UBGA 5GM0A 1CAWA 4Q0UA 1WCDJ 1HXS1 4TZDA 2R0FA 4KWKA 4L2NA 3N7MA 4CDWC 1AR92 5JPMB 1YUDA 3JQXA 5KHGA 3NV1A 1Q56A 4GWMA 4AHZA 1N1YA 2IFRA 4UW5A 5F5QA 4FOYA 1TNRA 1BVVA 4OHVA 3U07A 2MEV1 3MDPA 1RUI1 3JD72 2EALA 1BBT2 1OPMA 4YGBA 1KFXL 3OBRA 4BPZA 3P3PA 3J8F2 3CU7A 1LHNA 1OA2A 2WL1A 2ZGNA 4K20A 1QDOA 2ZZQA 4LHNA 1K5MC 3OTFA 1WCKA 3N3HA 3MYXA 4A7KA 1DGRN 1POV3 3UJOA 2XL7A 5T54A 1J3RA 3MIFA 5FO7B 3LZZA 3NAPB 4Y22A 5T5LA 5JSRA 1RHI3 2XPJA 2DTYA 4JVAA 3ZN6B 1V6IA 1LHOA 1CPNA 1SDWA 1PVC3 4LBQA 1BYHA 3AJZA 1CJPA 3SISA 5FMOL 2AGSA 3CEWA 1H8TB 2WLQA 3WVJA 1M4WA 4AGVA 2EIGA 2H0BA 1PK6A 4BE3A 4OHWA 5JR7B 2GNBA 4QGMA 4B4PA 2WZR3 3G6JB 1ND2B 1U5ZA 1YIFA 1C1FA 3MLJA 2RS13 3B94A 2QCSB 1PZ9A 2ZGKA 3B02A 3I2DA 1JXNA 2FMYA 3OCPA 1GSLA 4MV2A 1ZBE1 2DYCA 1XE7A 2MNGA 2PHLA 3R4UA 3E6BA 5JIUA 3DGTA 2XJPA 3FBMA 3AB0A 1UIKA 1DHKB 2VU9A 2SBAA 2WT2A 1AR82 5CFCA 1RUH2 1XNKA 3WLUA 5FQ0B 1RUI3 4XQDA 4AGGA 5T55A 1F2NA 3RJ2X 2ZGUA 2AENA 3VZNA 2JKBA 5K0UA 3ZFGA 4Y1YA 3A0KA 2ZX4A 1CAWB 4FXGB 1DG6A 4B3NA 2VNOA 5BNNB 2VMGA 2BNMA 1PNGA 1U0AA 1WA4A 4OHXA 3BODA 4BHPA 2UWBA 5EYYA 2R6QA 3LOIA 4N53C 5FPXA 5IK8A 4HL0A 5B2GB 3FLPA 4C1XA 4C90A 4RR3B 3RMYA 3MEPA 1ZZ8A 1C4RA 2EAAA 2P3IA 3HN1A 5LRSA 4XFCA 4IV3A 1TME3 2RMU1 3CJXA 3VKFC 4BH9A 1ZA4A 1MZ6A 1TME2 2UYBA 3RZZA 4OI1A 4XFAA 1LHVA 1VBA1 3O5SA 3M3OA 2P34A 2PFWA 3MI8A 3SH5A 4XW3A 4AVAA 3AMQA 1OA3A 3RRDA 2GH8A 5LK5A 3PNAA 1PGL1 3DN7A 1ND2C 5JSPA 2D44A 4UW6A 1MEC2 1D0GA 3ALQA 1AL21 1RUE1 2VH9A 4AI8A 4FAHA 2ENRA 4GH4A 3LA2A 3UV9A 3BOWA 3KB5A 2CAVA 1CAUB 5HCAA 2JG9C 3ZXKA 1QJU1 1CX4A 3IDCB 1TMF3 3WP4A 1GQGA 2E51A 1BQPA 2Q8OA 4F83A 2WS93 1RINA 1GYKA 2Z79A 3E6CC 5HCBA 4FPGA 4WM7C 4BQ1A 3USUB 2PELA 1SQ4A 2WFPA 3ZMNA 2BQPA 3FWEA 5C4WA 3NVCA 3NAPA 4Y22B 3W58A 1YWKA 1FV2A 1A6CA 1MS9A 1K5MB 2AZ5A 4CDUB 2Q30A 4HK9A 1J59A 1JN2P 1GNHA 1UZYA 3N4MA 1YFUA 2ZGTA 3EJKA 4FP3A 1NCRB 5AVPA 1I5ZA 3B5LB 5CIRA 3H1WA 1DQ1A 4N7UA 5DDJ1 1REEA 5DZGA 2GNDA 2RM22 5BNOB 1HIXA 1RUH3 1RGSA 5EZWA 4NN0A 2B46X 4XQWA 4AYUA 5J09A 3S6PA 1KFUL 4KG0A 1RUD3 1UX6A 4ATFA 3TRSB 2ZKNA 2D6KA 2IWGB 2A3WA 1SLCA 4XFGA 4DY5A 2V73A 2G4IA 2WS92 1XNBA 4BM8A 3H7JA 2R063 4FT8A 4LEJA 2XB6C 3OY8B 3LWCA 1NLRA 3M3CA 2XJUA 1SLBA 3ME2A 1UMZA 4MGYE 2EXJA 4P9IA 2DTWA 2K2SA 2BGCA 2QVSB 5BV6A 5K0UB 1RVF1 2GN7A 2D7FA 2HWE2 1IS4A 3MW3A 1HRI3 4LBLA 2A6VA 2JEMA 2GC3A 2W08A 4AVTA 2JENA 3VN4A 1ZZ9A 5I0UA 2XGXA 2WQ4A 3UKVA 4MH0E 3ST7A 1H2LA 1REDA 2JG8C 3S7EA 1RUI2 1LOGA 3JD71 1S0GA 4JC1A 4PBPA 5J37A 1O3RA 3UK9A 3W9AA 4LA2A 3WHUA 1W6PB 2Z69A 2IXIA 2UURA 3JZVA 4OI0A 1B35B 3VHPA 4Q4Y1 3H8UA 4E9KA 5K8SA 2EXHA 1TMF1 2ZMNA 3B69A 3JBG1 3PTYA 4G9SB 4XEZA 3VDDB 4CTEA 4H3WA 2OVUA 1VBB3 5C4WB 2ETEA 4JGYB 2JD4A 1ZBA1 3OYWA 3ZXLA 1O3QA 3HQXA 1IPKA 3MIEA 1QJY2 1W0PA 2DUPA 4O9GA 2R042 3AX4A 4EJRA 1ZRCA 4U36A 2VOXA 3WG2A 4EV0A 1CQ9A 2CGNA 5AFEA 5LRRA 3IWZA 4IEZA 4XF1A 2D3RA 3DF0A 3USUA 4BWOA 2A71A 5SV5A 3TN93 5BNOC 4FTBA 2DCTA 2ZS6B 2YROA 2CNAA 1N3OA 1HXS2 2XL9A 4YYOA 1HRV3 2A6YA 3HT2A 2BFUS 2D3PA 2HWB2 5I0TA 5KXCA 4K40A 4IV1B 3WW1A 2UWCA 1S0BA 2WZPP 1FPN3 4FTSA 4RGAA 5T5OA 1RUOA 3AM2A 3FJSA 4MUVA 2HEVF 4XTMA 2DV9A 2GN3A 1CAVB 1U5IA 4PLMA 1H9PA 5E89A 4JAAA 1CAUA 4Z92B 1NY72 4JGYC 1HRI2 2V09A 4I2OA 4OLLA 4I30A 4AFAA 4Q4X1 1VLNA 2JJ6A 3PHMA 3VBSB 3AZYA 4XFIA 3KZ4C 2AYHA 1LOCA 3AP9A 3RG0A 1D2SA 2ZTNA 4YVSC 3THTA 5BNPC 1M06G 2Q0AA 1LECA 1ULFA 4IETA 2BWCA 1AYM1 1LR5A 3WY6A 3HMYA 3QCWA 4AVVA 1MVQA 3ZYRA 1PGL2 4N9IA 2Y38A 4RQPA 1C1LA 4AEKA 1WLCA 2YV8A 1GBGA 4KH9A 2DUOA 3R6SA 5D8AC 1XNDA 3OGJA 1S2BA 3JB8A 1Q8QA 2X29A 3ZXFA 1AJKA 2A6XA 4YZ5A 4RD7A 5EXOA 4E2SA 4CZSA 1AR93 2D6OX 1YHFA 5JIAA 3ZFFA 4AE2A 2KXLA 1LHUA 1B35A 4K9SA 1EY2A 2HWE1 3JQWA 2NQYA 4QM8A 3TOJA 4AEMA 1H2NA 1RB8G 3M8LA 1AR73 4CEWB 3O14A 2Q1ZB 4HMZA 3VKOA 3USSA 2O8QA 5T5JA 1LEDA 3S30A 1JOJA 4OI2A 4HPKB 4IV1A 4OUSA 4GULA 4JCKA 3RSJA 3JU9A 2CGOA 3V56A 3WZ1A 2ZX1A 1CVNA 4LBMA 3DUIA 1HQWA 1V9U3 4I0AA 4WZCA 4CYDA 1AR61 1YO8A 4TSVA 2WSVA 3KM5A 2CTVA 4JTOA 1G9DA 3J26N 2XKOA 3E6DA 2RR11 4C91A 3ES1A 2DFBA 2DVGA 2XVGA 3FUQA 2VMIA 4IEOA 1U12A 3AYDA 4XOGA 2YDEA 4XJWA 4XFHA 2MEV3 1BCXA 2RM21 4B7EA 4ZU7A 4XXPA 2ZACA 4XMIA 5JOYA 3D4KA 3POSA 1MVEA 1JHNA 4DZGA 4HSLA 4EWEA 2NM1A 4QPGC 1AXKA 2NMNA 1H2MA 3NL1A 3ILRA 5H9PA 5AVAA 4ZU4A 3UL2A 3TYJA 1KXGA 3VBUA 4D69A 3OF1A 4GMP0 5GJ6A 1VAKA 2LUWA 4CDUA 1QQP2 3VDDA 4DMIA 4AG4A 4WM7B 3VBHB 1RUF1 5JCTA 3ATGA 4Y1VA 1PK6C 4LO5B 1W6QA 1O4TA 1LOBA 1YYNA 2GAUA 4Q4X3 3MPBA 1HLCA 5JZGB 2WJSA 5CFCC 1RMU3 4HVOA 1GZ9A 2VY0A 1H1AA 2JXAA 3KCXA 4QPIA 5DZFA 3VL9A 5FMOS 4HKLA 1WLDA 4IEQA 4M0NA 1H2KA 5CB7A 1Z7S2 4RR3A 2VOKA 2E7TA 2AREA 2GMEA 2EVXA 3C3VA 3WUDA 1QQP1 5EJ3A 1W0OA 1G7YA 4AQTA 4AEDC 3LSEA 4XJ8A 1O3SA 3FE5A 2HWF3 1UN1A 3ZVXA 1G9CA 1HQNA 1AR72 1KITA 3J8F3 1ND3A 2D40A 1GANA 4LO8A 1H4GA 3ZSJA 3CJIC 1V00A 1VAMA 4GQ7A 4W6YA 2D98A 5H9RA 3VBRA 3AKQA 4CDXC 4XF0A 4I0BA 4N53A 5EWSA 3ETQA 3CL1A 2P2KA 2YHJA 1YFYA 4L9BA 2PQQA 1PNFA 2F6BA 1RUC1 2VQAA 2UY8A 3E5QA 3WQ1A 4WVVA 2TBVA 4XFFA 3RYPA 2D3SA 4Z8BA 4CEWA 4WM8A 5C33A 2XLAA 2ZHLA 2WFF1 3LCPA 1AX0A 5D1IA 1A8MA 4YFZA 3MF9A 2HEYF 2RS53 1QGLA 2VW0A 4K1ZA 4META 3L9JT 3CJIB 3WQ7A 5JZGC 4Q8LA 1VBC3 2WA4A 4FPKA 2PLV2 4XDQA 1KJLA 2FBEA 1YRZA 3AZXA 1NLSA 1RUG1 2PLV3 4YW2A 4QPGA 4M00A 1VBA3 1WW5A 3TNQA 1R1A1 4M3CB 1IKPA 5KXDA 4PLNA 2PYTA 3EO6A 1Q8VA 4Y26A 3ZN4A 1VB4A 1I6XA 3A0NA 3WDTA 3FZ3A 3WHTA 2R32A 4PDWA 3IBMA 1LTEA 2Z5WA 1XYPA 2ZGRA 4WBBA 2WINB 4YGEA 2B9UA 4CEYB 1N3PA 4ZXKA 4BOWA 3VBHC 3VZLA 3DKWA 1G8WA 3M7AA 5FO8B 5FREA 2ZGMA 5I91A 2JE9A 4XHXA 3H9AA 5F9TA 2VUJA 3H0OA 1HXS3 1PGSA 1H8TC 1NA1B 2XBO3 1HKDA 2HWF1 4W65A 2DU0A 4HBNA 5CFCB 1R083 2XWJB 1MQTA 4KWLA 5FOJB 4HSJA 5A32B 4L99A 2OPKA 4DFSA 2P37A 4XF9A 5K7PA 2ZMKA 1FT9A 3WG1A 3VLBB 1PIV3 2YC0A 3RMXA 2I07B 1RJ7A 2TUNA 1EYBA 5KHIA 4PJYA 1VBD1 5GZGA 1FNZA 3ZYJB 4Q0PA 3S0MA 4FQZA 4IESA 4P9GA 3RPQA 3TNPB 1YXWA 5FFOC 5BY5A 3H1MA 1FPN1 4YZ2A 3EXUA 1BXHA 3GYDA 1QQP3 2VNGA 4NPRA 4PF5A 4H7LA 4R4XA 4CDXA 3WT3A 1ZZBA 1W2UA 5AFBA 1YJKA 2HKXA 5CG9A 1W6PA 1WD4A 4O9EA 1OD5A 2X8KA 1RUJ3 4QX5A 4LBJA 5C6CA 1CAXA 1F5JA 1X8MA 4JTNA 5GZDA 1I1EA 2FZ2A 1Y7BA 4CEWC 1PO21 3KGLA 3THPA 2H6BA 2JG8A 1DQ2A 4FTEA 5E8AA 1H1MA 1R1A3 4TYSA 2NP0A 1JUIA 3D82A 3AMMA 3LB9A 4AEJA 1AL22 3ZSLA 5CFDA 5JLVA 3MPPG 3LGRA 4Y4YA 2YUEA 1H8VA 3DV8A 3WW2A 4JRLA 2CL2A 3UKTA 1AYM3 3MFAA 2QZ2A 3M3QA 2R49A 1F31A 4Q0VA 4GALA 3ZYGA 5SV8A 3RI9A 5JZGA 3ZIXA 1A8DA 1W6QB 2NYYA 3V0BB 1COV2 2BNOA 2GMMA 3AXEA 4WM8B 4KGQA 3FFZA 2KA3A 4S2GA 1GR3A 1LOEA 3QH7A 1EV11 4YGCA 2ET7A 4AI3A 5BNPB 2BNNA 2IXLA 3MIHA 4QGNA 1NG0A 2UYAA 1AZDA 5AC93 1H1IA 3SCHA 1QJY3 4QQLA 1V9U1 2PLV1 3N7JA 3GF6A 2WNVB 1TQ5A 3OGGA 5FOBB 3D5OA 4JGZC 1GNZA 1UKGA 5H9QA 1HV1A 3NV3A 4J1XA 4NWVA 2RM23 4OHYA 3ZMOA 2D5HA 4HZFA 4CDWA 5KC6A 3AKSA 1V6MA 3B01A 3NV2A 5BNOA 1PK6B 2PAMA 1TNFA 3IPVA 1NXMA 3WNXA 5A32A 3B3QE 4RS5A 3D8CA 2D5FA 4MGIE 5FAXA 2JG9A 1YIPA 4LNVA 1O91A 4EN6B 1PIV2 3AP7A 2MEV2 3KCYA 3MLLA 4JRAA 3VBFB 2R062 2B45X 1LKNA 3RYKA 1TME1 2RMU3 2D6PA 1S0FA 4Y1XA 1VRH3 3E5UA 1Z7S3 1QHDA 3GZTB 1GICA 4IL7A 4MXWA 5JOWA 4PIXA 1REFA 3FFQA 3HIFA 4BIOA 5I0RA 4AXOA 1IZ3A 3M2MA 5DG1A 2EF6A 1ZRFA 1FOD2 4YSFA 1ZX5A 2OUHA 2WFF2 4XPVA 4MYEA 4PLOA 1NCQB 1O7FA 2OYZA 1OFSA 1YI9A 4RFT0 2PA7A 3K51A 2DVFA 3V65A 3E97A 4BLJA 1JTZX 3TAYA 4KWJA 4KU8A 3RJRA 3W59A 2RJLA 4BLIA 1QMJA 4BYYA 4A7ZA 4COUA 2R1BA 3PLQA 4QHBA 5L36A 3ZN5A 2DCYA 1WLTA 5L7OB 1DLLA 3ZSKA 1DFQA 3AK0A 5JPNB 3A4UA 4DB5A 4F8AA 4CDQC 2NPIA 2Q4SA 2ZHNA 3AMHA 1V6JA 4Q4Y2 2ZGOA 1MS8A 4ORFA 1AYN3 5IK7A 1QJZA 1HW5A 3J8F1 5FRAA 4RA0A 1W6NA 2ATFA 4AEDA 1YFWA 1DBNA 3PMSA 4HT1T 3URFA 3IMNA 5DDJ3 1LODA 2CY6A 4L11A 1W6MB 1LCLA 4XJUA 2XH6A 3AP5A 4NVPA 4EN0A 5BPXA 2ZHKA 4OFGA 2I74A 3WDYA 2VQ0A 2GC1A 4LHLA 2BW8A 3LKJA 4LUMA 3RI8A 4JV4A 5ACA3 1QJY1 3ZFGB 1CESA 3VBRC 3NSTA 5CBLA 1FMD3 1R093 1BJQA 1YJLA 4AWDA 1CPMA 3VBOB 4S2FA 5AC91 3HBZA 4GMP1 3WP6A 3U4XA 1RHI1 2RS51 4JDNA 1KQRA 2B7YA 3G7DA 3EHKA 1OOPC 1B09A 1XU2A 4UBHA 5GZEA 2BYVE 4XYXA 1Z0HA 1BMV2 5JI7A 1A3KA 4IV3C 3B9CA 1AXYA 1CAXB 1QJU3 3AYCA 4IEXA 1NCQA 2F4PA 4DPNA 1W6NB 1ASJ2 1RUC3 4PQ9A 2CYFA 1OQDA 1N3QA 5J48A 5ABJB 1AYN2 2OZJA 4S2DA 1DGLA 5J3UA 3KS7A 4JDOA 1VBA2 1O3TA 4Q1PA 4EWDA 4FVVA 1DGWX 1OLQA 3U10A 4MLOA 3MW4A 1NA1C 3UJQA 4DNYA 1NCRC 3GALA 1HQLA 1RUG3 1ZBE2 1QF3A 1X36A 2HWC3 1QXRA 3NJZA 5JWPA 3P3NA 2RS33 4XFBA 3WDWA 3WR0A 1BKZA 4CDUC 1FATA 2LM3A 5J36A 1CN1A 2WA3A 1Q43A 5LEKA 4D7SA 4BA6A 1RUH1 5KXBA 3NKTA 4XJAA 3WCSA 2ZX0A 1X8EA 3O0VA 4KG8A 4QD2A 1VBD3 1C8M3 4MSVA 2VUAA 1S0EA 4ZKTB 1CGPA 1QY4A 1D4M2 3WQ0A 1W6OA 4I0WB 1Z78A 3AZWA 1CD3G 3I4IA 5JMCA 2OZ6A 1JH5A 2G9FA 5FDBA 3HT1A 4I09A 4AFCA 4AFBA 4D7TA 5LEJA 3HWJA 1JW6A 4YFWA 4NHMA 2VNRA 2DF7A 2A75A 4F7ZA 4G4FA 4M3CA 1WW4A 1DYKA 2JG9B 2P3JA 1W6MA 4CEYC 5E88A 1Q8PA 1MEC1 3FHIB 5E1RA 1PO12 4RQPC 5ACA2 3ZFEB 1LGCA 3AFKA 4XZPA 5HI0A 2O8OA 4KNCA 2QDRA 3MICA 5ACA1 2MHFA 2HWC2 1RUJ2 3NW4A 2QNKA 4P5HA 2YY1A 4MXVA 2C5DA 1AR83 1RUE3 1LULA 2QQPA 5KXEA 1VBE1 1QNWA 3M4FA 1WMFA 1OA4A 3BIWE 3ZFFC 2QJVA 5IK5A 5KBFA 1LOFC 1Y3TA 5CA6A 2A70A 2IXJA 3T1MA 1QJU2 4COWA 4ISQA 4RQPB 1LEMA 2HJIA 2ILMA 4LBNA 4N7IA 2B8MA 4FOQA 4YVSA 3WP3A 4IXLA 3WW4A 3MF6A 4KL1A 3VKLA 4FPEA 4XILA 1COV1 5E16A 3VHNA 2DUQA 4ES8A 4Y5Z0 1QNYA 4Y20B 2RJKA 1QJX2 4WM8C 4ASLA 3MZHA 3OBTA 2ZX3A 3KD4A 3VBSA 1BEV2 3ZFFB 4MGKE 3HD8B 5FO9B 3L2HA 3ASIA 1C28A 1SLTA 4ZU5A 1PO13 4JGZA 2ARBA 2EAKA 5DXDA 1WW7A 4QQOA 2R073 2A73B 4PIZA 4C0HA 2FQPA 4P9JA 2A6ZA 1W6OB 3RYRA 4I3PA 1SBEA 4RHV2 3KQRA 1KJRA 2DWRA 1MR5A 3AKPA 1DZTA 1J1LA 4R9BA 4QQPA 5GALA 5F6KA 3VBHA 4CP0A 1QJX1 3BPZA 1PGW1 2CWSA 2VULA 5F6LB 4PIYA 4FO9A 1HRV2 5KC5A 1QU0A 4QPYA 3WUCA 3VHOA 4YARA 4E4ZA 4RS5C 4FP2A 1Z7S1 1LHWA 1VBC1 3N36A 5GLUA 5C9AB 1R082 1OSGA 1HRV1 4LBQB 4PDWC 1KDMA 3GBWA 2ZZJA 1NQDA 4A7YA 2C0ZA 3KT7A 3WINE 4LHKA 3WG3A 3LA3A 1PO22 4RS5B 4R52A 1J3QA 2W39A 1GKBA 1AR81 5CAZA 1DYPA 4CEYA 4FPJA 1D4M1 5GLVA 1RVF3 4GKXA 4WZFA 4AI0A 3B93A 4QT6A 3VUOA 1ZRRA 2Q1MA 4XJ9A 2P3KA 2VGDA 4AQSA 1R1ZA 1IGOA 3O0WA 4LLOA 3SCFA 2IZWA 3MGUA 4OUMA 4HETA 2D97A 1XQNA 4R9DA 2WT0A 4DRVA 1S1AA 2VVEA 1AYN1 3MLKA 4QPGB 4BCUA 1UIJA 2Y26A 2ZBJA 1N47A 2ZKLA 4MGZE 3GZUC 1Y43B 1O5LA 4Q4W2 2WQZC 5J7MA 1VALA 4INDA 4N90A 4XETA 3TBDA 2WZR1 5FBZA 3WDUA 2R1DA 1AJOA 4YM2A 3V0BA 4I02A 3VBRB 3OYWB 3AP4A 2GSYA 5CFDC 1APNA 4YG0A 3VBOA 2I45A 4DY3A 3AYAA 1WMDA 2OIIA 5ABJC 4L8QA 1NY71 2VVFA 4PBOA 5EFUA 5BNPA 1O4YA 2AR6A 2BTVC 3O12A 1D4VB 4RR3C 1ULDA 1KRIA 4Y20A 1QJX3 3NV4A 4IV3B 2CGPA 2DVAA 4EN7B 2QZ3A 1RUF2 3OY8A 1AR63 1WCSA 1LU1A 2JDZA 3X29B 3POYA 2VW2A 1AR62 1PVC1 1V70A 4YG6A 2RR13 4COYA 5FQ0A 1DQ6A 2D6LX 5BNNC 5C8CA 2PHFA 3GZAA 2RS31 2IXCA 5L7OC 2WNUB 3ZX7A 1WBLA 1G86A 4D3WA 1SACA 4YVSB 1NXD1 1SLLA 5HBAA 4P9XA 5DUXA 1I9RA 1AXZA 3ES4A 1YNAA 2X5IA 3NWKA 4NR1A 4JQRA 3GNEA 5L73A 1RL3A 1V6NA 3GBFA 4B29A 2BVVA 3LSDA 4Q4W3 4K21A 3TN92 3H7YA 1WUVA 2ZGPA 4AFMA 1RUD2 2NLRA 4LE4A 5FLIA 1WMEA 2XUMA 4CDXB 4D7YA 2YYOA 1NCQC 2PTMA 5FCCA 3QOPA 3APBA 1H4HA 1TMF2 1OHFA 4XIKA 4EN9B 1PVC2 4H14A 2HWC1 4I01A 4XBQA 3AMNA 4LO6B 1WW6A 1VIWB 1G6NA 3RNSA 2PHRA 3BALA 2E53A 4IV1C 4AEDB 4A2UA 1UU4A 1AX2A 3VL8A 3AZVA 4Q4V3 4XMAA 4YM3A 1EAH3 3KLSA 1NCRA 3BB6A 2W0XA 3O7OA 1VAVA 5GLWA 4IQPA 3BTAA 4TLFA 2R072 3SHRA 1XYOA 1LJ7A 5KHKA 3IIAA 4Q27A 4R4ZA 1TEIA 4COZA 5T50A 1RUE2 2LTNA 4K8FA 5DUVA 3V64A 1LOAA 1QXPA 4DXZA 1AL23 1AHSA 4MXWB 4GA9A 4B4RA 2B39A 4XBLA 5J98B 2CWMA 2VG9A 2W68A 2ZHMA 1UD1A 3PVBB 4YVWA 1LU2A 1J1TA