2HEVF

Crystal structure of the complex between ox40l and ox40
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
126
structure length
126
Chain Sequence
RIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQDNSVIINCDGFYLISLKGYFSQEVDISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords Tumor necrosis factor ligand superfamily member 4
publication title The Crystal Structure of the Costimulatory OX40-OX40L Complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2006-06-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2hevF00
1TNRA 1D2QA 3B93A 1OQEA 1A8MA 2ZJCA 3B94A 2TNFA 2QE3A 2RJLA 3L9JT 2O0OA 2QDNA 3K51A 3WD5A 4EN0A 2RJKA 2R32A 3AB0A 4J6GA 2OIIA 1PK6A 1DU3D 4DOUA 3URFA 1ALYA 2JG8A 5TSWA 1S55A 1JH5A 1OSGA 2JG9C 1WCKA 4MXWA 1TNFA 4F3JA 1U5ZA 4QQPA 2RE9A 2WNVA 2R30A 5HBAA 4KGGA 4E4DX 2WNUC 4QQ2A 3QD6A 4G3YC 4TSVA 4OULA 5KWRA 2X29A 4HT1T 2Q8OA 4OUSA 4E4SA 2Z5WA 2R6QA 3ALQA 3FC0A 1RJ7A 3V56A 2JG9A 4MSVA 3MI8A 1IQAA 4QQOA 1XU1A 2WNUA 4QQLA 5BNQA 1KD7A 3QBQA 1RJ8A 3LKJA 1PK6B 4N90A 4TWTA 4D7YA 1C28A 2JG8B 4NN0A 1DG6A 4GIQA 1OQDA 4MXWB 3K48A 1I9RA 1KXGA 5L36A 1D0GA 2WNVB 2HEWF 2KA3A 5KC5A 4QQHA 2WNVC 4KGQA 3IT8A 4QPYA 2E7AA 2ZPXA 5CIRA 3B9IA 2Q1MA 1D4VB 3ME2A 5KC6A 2HEVF 1GR3A 4OUMA 1C3HA 1JTZX 2TUNA 1O91A 2JG9B 2HEYF 4RSUA 1PK6C 1U5YA 4G4FA 5L19A 2AZ5A 2WNUB 2JG8C 4DB5A 4KG8A 4MXVA 3TYJA 3TWIA 1XU2A 1U5XA
chains in the Genus database with same CATH superfamily
2G19A 2ZABA 5IK4A 5AFEA 4EV0A 2YPJA 2DTYA 3N9PA 4B4QA 3HVDA 1XPWA 5FMCA 3BUCA 4LQRA 3WDTA 1RTVA 4JDNA 4Z82A 2ZGTA 4JRLA 1PO12 5GZDA 4Q29A 2EF6A 4R9AA 5BYNA 2RJKA 1A6CA 3BTYA 3VZKA 1WW6A 2DWRA 4PLMA 4EZ4A 1BMV1 4MX3A 4DEQA 3E6CC 1ENQA 3V0AB 1ZX5A 3OD0A 1F8VA 1AR73 1VBE2 3H3LA 4XUOA 4HONA 1ZRIA 1PO13 2X09A 4LA2A 3PU3A 1ZRFA 3MIGA 4MXWA 4S2FA 4YW7A 1POV0 2A3WA 2E33A 1APNA 3Q8BA 1VBD2 1JW6A 2H6CA 2X10A 4LO8A 5JPNB 1VBE3 1JZ6A 1QOSA 1SCSA 2Q5TA 2VXRA 4QD2A 4DMIA 5C4WB 1ASJ2 3N3HA 1UZ0A 3L2YA 3GF6A 2J1UA 2JDZA 3V65A 1WD4A 3AP4A 1IGOA 4EROA 2NM1A 2VBBA 3T08A 3M2MA 5A7QA 1RGSA 2XGXA 4BMBA 4BISA 1JOJA 4RGAA 4GH4B 5JXIA 4FPGA 3U37A 1Q8QA 2MHFA 4A6SA 2DCKA 1ZM1A 2FDFA 4BQ3A 2VOVA 3OBZA 4EWDA 1JU3A 2CWMA 1L7RA 3IBMA 4XJUA 3KHCA 3J4UH 5F9TA 4D7TA 1IS5A 4E8CA 2YUEA 1HRI2 3H1MA 3ZXAC 5JI7A 2WWJA 4ASMB 1JOBA 4I3GA 4GKYA 4IL7A 1J1TA 5F3GA 1K45A 3KQRA 4QGLA 1S0EA 3IZOA 5IVBA 5C8WA 4V1PA 3CZJA 4N53C 2VH9A 5DDJ3 3ZXFA 1DQ2A 3NJYA 4MGIE 4W50A 1CONA 1OF4A 2E31A 3ENRA 1W05A 2A1XA 1IZ3A 1NZIA 2HWF3 4UFMA 3LFMA 4NWVA 3AP9A 3O5SA 4AFBA 1Z7S3 1FNYA 4DNYA 4BK4A 1URXA 4ISQA 1MS0A 4R52A 1BBT2 3MLLA 3V0BB 5DAPA 4DXRA 2VC9A 3GM8A 3T30A 3H8OA 1GANA 3WX5A 1JZ4A 4GMP3 2TBVA 1BKZA 1H2NA 2ET7A 3JUUA 5JDBA 4OUEA 2ZPXA 1SDDB 3A7QA 3OPWA 3LWCA 1WMFA 2Q1MA 2W87A 2J1VA 3PTRB 2R062 3NW4A 1KJLA 3VV1A 1BBT3 1OUXA 1GKBA 2PHWA 2WJSA 3TN91 3A0KA 4N53A 4Q26A 5A7SA 4Q4V2 1BYHA 1FT9A 1VBC2 1XXNA 2RV9A 4MGKE 4Q0QA 5C3OA 1ZREA 2G1MA 3GYDA 3QH6A 2ZACA 3FBYA 4AWDA 3M3QA 2YGLA 3ZPYA 1PK6C 2R063 5BNOB 4Q8LA 2P3JA 3H8RA 4C8DA 2CWSA 1WLTA 1O5UA 2R072 4FFFA 1PMJX 3N35A 4B7EA 1IOAA 5KXEA 4C0HA 4FTBA 5FY0A 2JKXA 1E57A 2WQ8A 3WF3A 4A2UA 3USUA 1O6UA 4A7KA 5IFTA 2QJVA 3ZFGB 2D43A 3LZZA 2QE3A 2GNBA 3POSA 2VE1A 3AMMA 2R073 3SLIA 2QUOA 4CCNA 2WABA 3WP6A 2W9XA 2DU0A 2X8KA 4XTPA 3VZNA 4BWOA 3P3PA 4TLFA 5A70A 5FP9A 4YVWA 3QACA 3R4DB 3DYMA 1PK6A 1DU3D 4IUGA 4EYUA 1EUTA 1N3PA 5FREA 4ZKTB 4LUMA 1MZ6A 3CU7A 5F6KA 4DUVA 3BVCA 4CVUA 5TSWA 2EIGA 2RS51 2XUMA 3VKLA 5JZGC 4AQ2A 4MLOA 2JDUA 3RVHA 4IE7A 1HQWA 2JIJA 2RE9A 5FBZA 5I8YA 2FCVA 4QX7A 4E4DX 1R093 2AREA 2ORZA 4Y1UA 1I5PA 5DAQA 2RS11 4ZONA 1UX6A 3ZYJB 1IS6A 1CAVA 2CAUA 4EZHA 5DABA 4HK9A 4NJ4A 1SFPA 2FCUA 4IEWA 1V6IA 3BN6A 4JGYC 1GP5A 1CAXB 5AC91 4K8FA 4QPIC 1N1YA 2QBXA 1O8PA 5FLHA 1DP0A 4DXTA 4A42A 4HL0A 1Q5OA 5A7WB 1QJY3 5JZGA 1NY72 3DYOA 5FMDA 2GC2A 5EIYB 1W03A 1EP0A 1UAIA 3DN7A 4UFIA 3E5UA 5JLVA 3ZXDA 3AKRA 3VKMA 4BQWA 4COUA 3AKQA 5T5JA 2NQYA 3ZFEC 2A6XA 2IC1A 3H50A 1NX9A 2QNKA 2QQUA 3NNJA 4P9WA 5M0TA 2JDAA 3UJOA 1J83A 2DFBA 3EO6A 3HOBA 4F8AA 2GH8A 2AGSA 3ZSMA 4D7YA 1Q56A 2BBAA 4JGYA 3MO4A 3IDEA 5FY1A 2VULA 4QPIA 1H6XA 4Q4W2 2QQPA 3J8F1 1ZBA3 5IW0A 2V4AA 1K12A 2RS32 4GQ7A 2H0VA 3K48A 1LOFC 3KV4A 1SACA 1KXGA 5F5QA 5FY9A 2VR4A 4Y33A 4CP9A 2ARBA 4DQAA 2VTFA 3T0BA 4HKOA 4Q4W3 4FFIA 3M1HA 2UYAA 5C3PA 1AXZA 1SLLA 1OKOA 1LODA 2RS33 4HOOA 3CBNA 4FFHA 5DZFA 4QKNA 3WV6A 1LESA 2VL4A 3ZFEA 3SXWA 1NXD1 3DXUA 4OI4A 2BVVA 2E7AA 4HZFA 4CEYC 1XYNA 2VZ1A 1GV9A 1UKGA 4GJYA 1BVP1 2J42A 4QB6A 3KF3A 1L7LA 1BXHA 4YZ1A 5KC6A 1B35B 1W3VA 2HWE2 2IVJA 2D5FA 2ZGLA 3MICA 4OUMA 3IIIA 1OA2A 1SLAA 1ZZ8A 2VUCA 1W8TA 3B69A 3TEYA 1LOFA 4XFCA 4UW5A 2HEYF 4XQDA 2VOXA 4M01A 4ZY9A 3BGAA 3KM5A 3MIHA 5FY8A 1AR71 2WNUB 4DB5A 4OI0A 3OJBA 4M4PA 2ZBJA 5FPAA 3RZZA 1QH7A 1XU2A 4XUTA 4YM2A 5D21A 1YQ2A 2KD7A 1J3PA 2PHLA 3WY6A 4HVQA 1TNRA 3TAYA 4XJAA 1YNAA 4IE6A 2LALA 4CEYA 3N7LA 3VDBA 3WDWA 1N1VA 1WWYA 2BU9A 2VZRA 3BPZA 1EYBA 3NJZA 5DAXA 4NHKA 2LRPA 4WV8A 3K51A 1QJX2 1FOD3 1UD1A 3ZPOA 3MZHA 1REFA 1VB2A 3K77A 3VD7A 1QXJA 5DZEA 2RDRA 2XVGA 1AXYA 2AR6A 3OB8A 1US3A 4UI9L 5FZ0A 5FZHA 2EXIA 4Q0UA 2Q30A 4BPZA 3KT4A 1JYCA 4HPKB 3URFA 5CZKA 1J59A 1YO8A 2I74A 2YBKA 3W21A 4AQSA 4NIIA 5FYUA 2QTWB 1TQ5A 4QXKA 4NIHA 1H8VA 3RPQA 3INAA 5D8AC 1FV3A 2WNVA 2WQ4A 1W6MA 4CUAA 5A7PA 4JHTA 3MF6A 3O1MA 3VBOC 2W1SA 1G7YA 3TOJA 3M4FA 2ZX1A 2BNOA 3PNAA 2D6PA 1YLLA 4JKKA 2Q8OA 1QNYA 4WZFA 3W20A 3TB0A 3KB5A 3PMSA 5FOJB 2JX9A 1AX2A 2WKKA 4AG4A 4ZHNA 4N7IA 5DDJ1 3AZVA 3THCA 3B7MA 4LXLA 1F9KA 1I1EA 1H8TB 5FZBA 1QIQA 2HWF1 1H1IA 3J7HA 4DEVA 5FLJA 4S2DA 4RR3B 3AX4A 2OUJA 3PIJA 5IVFA 1Z7S1 5D8AA 1YRZA 2CU5A 4CDUB 2MEV3 1AR62 1S2BA 4LO4B 2XDVA 4XE9A 1UMIA 3PJQA 3I2FA 1CZTA 3JZVA 4NPRA 3VBOA 2C9AA 1QF3A 1V6JA 2P37A 2R7EB 2VMIA 4GMP1 4AQ6A 5E8AA 2WC2A 4YZ4A 2ZMLA 1OD3A 3T1MA 2N7GA 5C5UA 4PF1A 1FPN3 4N90A 4XQWA 3UGGA 4TXWA 1UYYA 3WP5A 1H6YA 2BGPA 4XF0A 1ZZBA 1OH3A 1NE6A 1SFNA 2GMMA 5H9RA 4H55A 4RS5C 3WNLA 5F5IA 5C3RA 1GOFA 5A3PA 4BE3A 4IGOA 3NVCA 4XURA 4LIVA 1QKQA 4YGEA 3TEZA 2VNGA 1W6NA 4TYSA 2ZKLA 1DGLA 2C9KA 3POWA 5C8CC 2K9ZA 3VBSC 3R4UA 3HNMA 4QQHA 4CYDA 3UGHA 1QJEA 3N9NA 3JB4C 4PI2A 3OY8B 1GOGA 1OPOA 3MW4A 3PDQA 5A80A 1EUUA 2EAKA 1UOFA 2FDJA 4FPKA 1RUOA 5J98B 5C9AC 4N9HA 2XOMA 2XUEA 2A3XA 3SKVA 1RB8G 2FZ2A 2ZX2A 4Z1VA 4FXGB 4BHPA 1DQ0A 4KG0A 1CESA 4Q4Y3 3H3UA 4XF3A 1O4TA 1Z0HA 2EXHA 4PIZA 4ASKA 1WA4A 2VCCA 3NL1A 4PBPA 1UO9A 2NP0A 1S0JA 1MS1A 1OMIA 3O1UA 3IN9A 4ISRA 4UOJA 3ZYRA 1QY4A 2YU2A 4FPEA 1Y3TA 1VMHA 4QKDA 2PYTA 3C7GA 3VBSA 4CZSA 5BNNB 5C8CA 2XH6A 2Q8CA 4LMFA 5FMBA 5FQ0B 4JZRA 1W9YA 1OQEA 3ST7A 4HSJA 3B94A 5C9AA 5IT6A 1COV2 1R091 4KWUA 2ZMKA 1JN2P 1OURA 3N9OA 3HEIA 5DUXA 3AMPA 1W8OA 3THPA 3WNKA 4RGKA 5FYTA 4CXXA 3KHBA 4WM7A 2VCBA 3ATGA 1COV3 1V9U2 1PHMA 1ZNPA 4N8MA 4D69A 4XF1A 3MIEA 5FY7A 2VVEA 1W0NA 4XFBA 4D3WA 3WVJA 3OD4A 1FV2A 1RUI2 2Z79A 1QJY1 2XBO2 1VBA2 1PVC1 4JDMA 1UZWA 4QQPA 4XHXA 1A78A 1HB1A 1R1A3 1V9U3 3PLQA 2R30A 1O8SA 4JGZA 4UT5A 3OGGA 2CDOA 5L7OB 2DUOA 2WWSA 3I2DA 4QDSA 4X8NA 4JQRA 2JENA 2XJQA 4A7YA 4CDXC 5IATA 3JBG3 4E9KA 2RMU3 2ZX0A 2Y60A 2ZS6B 1EV12 3VBFB 2YBPA 3FZ3A 1YC61 2P1BA 4Y22A 2LM3A 1KGYA 3O0WA 1XE0A 2WNEA 1POV3 1JYIA 4K1ZA 1ZBA1 3AKPA 4A44A 2XMLA 3PVEA 2FQPA 3KS7A 1D2SA 3RYRA 1UKRA 1DLCA 4DXSA 2C5DA 4YG6A 4D0QA 3FBMA 3ZDVA 4JAAA 5CISA 1XRUA 3IPVA 4DY3A 1UZVA 1SLIA 1BEV2 1TME3 1RUE3 1XU1A 3RZMA 4YG0A 1HN1A 4OHZA 1XQNA 1FXZA 4S2GA 2HYXA 4HKLA 4LNVA 1Q43A 1ZVFA 5B2GB 3BTZA 4CDQB 2Z42A 3B5LB 1HW5A 1WCUA 2X5IC 5CEHA 1R1ZA 2JDNA 5A3NA 3UNPA 4GIQA 1N3OA 4QHOA 2B45X 5FZ7A 1VBB2 1ULCA 1GBGA 1QDOA 3N36A 4AI1A 4KWJA 5KBFA 3SH3A 1NCRC 4I0AA 5GLUA 4XZUG 4KQ7A 4Y4YA 1WLWA 3MF9A 2WZ8A 3RJRA 4YW3A 2Y64A 4XW3A 5FDBA 2CAVA 3A23A 2VUAA 1UYZA 4KGQA 1AR91 4WBBA 3AXEA 3Q8FA 3PIGA 4AXOA 5FKCA 2A75A 5DUVA 1FNZA 1QXRA 1F4AA 1D4VB 1YI7A 1MS8A 3ELNA 2X5IA 2LTNA 3FFZA 2PHRA 3ACIA 1DQ1A 1QOTA 3NV4A 3KZ4C 3T1LA 4TZDA 5HCHA 2IWGB 1FOD1 2UWBA 1WW7A 1ONAA 3AC0A 1NCRA 4INDA 4LBQD 2O14A 4M4RA 5FZ9A 4LKFA 1CQ9A 1HQNA 3N7MA 2VZTA 4PCRA 5C3QA 1JS9A 2VGDA 4XAEA 3CZUA 5ABJC 3OYWB 1M06G 1SFYA 3GZAA 1AYM2 2VPVA 4UFLA 3MIDA 5EJZB 1LCLA 4OFGA 2R49A 2ET1A 4IEQA 4URAA 1G9CA 1R082 1QDCA 1OKQA 1W3XA 3AYEA 3Q8EA 3WD5A 4ITCA 4BU2A 4BJ0A 1UPIA 1DF0A 1RUG3 1MS9A 4W8JA 1HDKA 5FWJA 4UFHA 2CTVA 4IEVA 1X82A 1MVQA 4DUWA 1RUD2 1SPPA 2VCMA 4BQ1A 1R083 3MIFA 4MYEA 4UWDA 4Y3OA 3CDZB 1PO22 5I93A 3BTXA 1GZCA 1ZBE3 3I2OA 1JH5A 2C26A 4P5YA 2L9LA 4R8HA 5AVPA 2BBVA 3OEAA 2ZGRA 1ND2A 3PMEA 4L0PA 4XF9A 2Y38A 1AL23 2RR11 3LA7A 4Q4X2 4XACA 3ZN6A 1EAH2 3CIHA 3V64A 2MEV1 5A6ZA 2VVDA 1PO23 2VO5A 4YVWB 1PIV3 3VD5A 5BNPA 2B9UA 1W2TA 3BB6A 1NYWA 3LDKA 4I02A 5K0UB 1MQTB 4ES8A 2OUHA 4AK3A 2EIEA 2NMOA 1NLQA 4XAAA 5E89A 3WG4A 4E4SA 3MYXA 1KJRA 1FPN1 1DYKA 4XTMA 3E6BA 4QX3A 3UYJA 2R6QA 2WFF2 5B4XA 2C4XA 5I91A 3U78A 2WN2A 2PXJA 4ONUA 1STMA 1RUC3 2R042 4MV2A 4AE2A 2BWAA 1JYXA 3U4XA 5GLWA 1OQ1A 4BIOA 1UU4A 3WQ7A 3O1SA 1IQDC 4WVZA 4HXCA 1CAVB 1PGSA 1W6PB 2V5YA 2WFF3 4BYYA 4AGRA 2RJ2A 1VRH3 3TRSB 3SITA 4XFGA 3NMBA 2EIBA 4PI0A 4QX2A 2P3IA 3WDUA 1W8HA 2GP3A 1NG0A 4TWTA 2VAUA 1GICA 4AAXA 1OXCA 2EXJA 5ACA2 3LB9A 4QPGB 1EPWA 4S2HA 2A73B 4MHRA 3SMHA 5BY5A 5LA1A 1X9PA 1R64A 2E32A 4HN1A 4PT6A 1H4HA 5IUQA 4Q4Y1 1BJQA 1HXS2 2A71A 2GAUA 4XDOA 1PMHX 1CAWB 3T2QA 3JU9A 4XDPA 5LEJA 3JXSA 5DN2A 3RDIA 2D6OX 2HWC2 4E4ZA 1SEFA 2XJTA 1F15A 4K9SA 3W58A 4QM8A 2ADEA 4CCCA 3S0MA 4IV1B 1REDA 1NA1A 3J7MA 1ZRDA 1S0IA 4XYXA 1VALA 2Z2SB 2NZ9A 1LJ7A 3I3QA 1YJLA 1XNCA 3POEA 3VGIA 4D94A 2VMCA 3DPRC 3POJA 2FDKA 3D8CA 1O59A 3O0XA 2OQ6A 4PDWC 4NHYA 4O61A 2WAAA 2R0HA 3U11A 3WF0A 1CJPA 5LK7B 2WSVA 2XVLA 4MGSA 5C5TA 1YJKA 3MV01 1U5YA 4LITA 3NV3A 3SQOA 1H1AA 4HSLA 3C8XA 4BA6A 3RYKA 3I59A 3LIHA 1UMZA 1GQHA 1RUJ3 4WM8B 2DYCA 5FO8B 4E8DA 3NSTA 2WN3A 1YYNA 2W2IA 3WHUA 2P5BA 3ACGA 3IWZA 3T4HB 1SQ4A 1R1A1 3DPRA 4NMIA 4K1YA 4BLJA 3ZYBA 5A7OA 1ULOA 5FV3A 4W4ZA 2JDKA 4PDWA 4XZPA 4YARA 3FFQA 3EQEA 5CNAA 2RMU1 2PMWB 4HFSA 3FHAA 5DG2A 1XNBA 2G9FA 4QX5A 5JSRA 1W99A 5EZWA 3RI8A 4MGZE 1MACA 2ZX3A 2ZHKA 2GC1A 4Q2FA 4K8RB 5FZ8A 1PGW1 1W28A 1CPMA 2QFEA 3SNMA 1O3QA 1IG3A 4F3JA 4GWJA 4LEJA 4FI9A 3NAPC 1QQP2 1E5RA 1WA6X 1OC1A 5JOZA 4KI5M 2H0BA 2W95A 1TME1 1MZ5A 1RUE1 3CO2A 1LOEA 2ENRA 3FN9A 4HG6B 4MGQA 3RGBA 3T2PA 4YZ3A 3OBTA 3VBRB 4BOWA 3VUOA 2ZMNA 5JSOA 1CD3G 1S4CA 2X29A 4OCTA 2XR4A 2GNDA 3GZTB 2PHFA 1IS3A 4OVEA 2XKOA 4AHZA 3NNMA 4XCAA 1VAKA 2GNTA 2QQIA 2D44A 4X8PA 1W04A 1RXGA 1PX3A 4F83A 1WCQA 1XJAA 1W9WA 4AFAA 3R6SA 1E5HA 1OLQA 2PTMA 2XJVA 1OPMA 3KLSA 4N43A 3ZO0B 1G9FA 5CBLA 2WQZC 1IS4A 2WBKA 3KMHA 4ASLA 5KXDA 4I2OA 4FP2A 5J1XA 1F5JA 2VD7A 2WZR1 2ZEXA 2W46A 3CQOA 3N9MA 2WNOA 3MBWA 3OBRA 1HB2A 4GWMA 1JYVA 4TTGA 3VL9A 1DYOA 2BWCA 1CZSA 2Y0OA 4L97A 2Q8DA 1YQCA 3GCWA 3VBUB 4DIQA 4W6YA 1UXXX 1NCQC 3LKJA 4PQ9A 5FYZA 2F4LA 1PGL1 1W6QA 4QDQA 5FP4A 3RSJA 4BQ2A 1HRV2 3E5XA 5FZLA 1VBD3 4Y24A 4BQYA 4NUBA 1BK1A 1OQDA 1RVF2 1ASJ3 3IMNA 1GZWA 3UL2A 2QQMA 4BXSV 3PVBB 5LW9A 1JMUB 5FP7A 1NQJA 3MHZA 3I2GA 4OQ8A 3AM2A 3O1OA 3ECQA 1GP4A 4KWLA 2ORXA 3C7EA 4YGDA 3C7FA 2QQKA 4NE9A 2XG3A 5DUUA 2BNNA 4FPOB 1OT5A 2B9VA 3B9CA 4IQPA 2WZPP 4CTEA 1JUHA 3M3CA 3ZXJA 4YW5A 1SBDA 1W06A 2HWB1 4K3UA 2ZHLA 4XUNA 2Y33A 1J3QA 4QAWA 2AUYA 5T5PA 1FYUA 3RWKX 4GB32 4LHSA 4Q8KA 2AENA 2HWD2 1MZEA 2C6SA 2HEVF 1NE4A 4IE4A 5CU1A 5E88A 5CFDB 3VDDB 1HRI3 4FTSA 2IXKA 2TEPA 5EXOA 1W6NB 5C70A 4L99A 2ZEZA 1RUG1 3MW3A 5FTTC 1H9PA 2I07B 3WDVA 4GB33 3WQ1A 3ZYFA 2HWD3 5L9BA 4JQTA 2A70A 1C1LA 3VDCA 2OXBA 4GALA 1VP6A 4XVHA 4AFCA 1ZBE1 2ES3A 5I0SA 3I8TA 1AR82 2WFPA 3AP5A 3K75B 3H1YA 4XXPA 4FBFA 4XHBA 5IVJA 1AL21 4META 4CDWC 4K6BA 4XPVA 3K4DA 4UF0B 5FLIA 3L9JT 3OGVA 5JPMB 2GNMA 3AFKA 5FFOC 5A1FA 4U36A 2AH2A 3ZYGA 1RUH2 5EHDA 1PIV1 2UYBA 2I45A 1NAEA 2E26A 3AB0A 4AFMA 4IV3B 3HQXA 4AW7A 4BMEA 1OBNA 5ERLA 1LOBA 1S0CA 3ZIXA 2D40A 2NMNA 1D4M2 3K3NA 1K5MC 5IVVA 1FMD2 1OLRA 2BW8A 4YM0A 2WRAA 1XB9A 1RUC1 2EVXA 2PLV2 4Q4V3 1VBC3 1PVXA 3HJRA 3WEZA 2RM22 4YVSC 5DAVA 4CDWA 4RQPC 2P4EA 4QQ2A 5FKBA 1FMD3 1KITA 1QJFA 1RHI1 1DQ5A 1GZTA 4WM7B 1VRH1 3MPPG 2OA2A 4QWNA 5E6HA 3VLBB 3WZ1A 1HJFA 1PNGA 2JB4A 1GQPA 3HMYA 5LBBA 1AUYA 3ETPA 3AKSA 3KV5A 1LHUA 4XJ9A 3TEXA 3ZFFC 5E16A 5JIUA 1MEC1 2J1RA 2VOKA 4PIYA 3ZSLA 3EYPA 1UOBA 2DV9A 2Z5WA 5ABJA 2Y26A 4LBQB 4ZS3A 1K5MA 4JGZB 2A6WA 1S0DA 4FOVA 1QWRA 4NAOA 3ZYPA 4CDQC 5CFCB 2J7MA 4XIOA 2D3SA 4QU2A 3WOGA 2Y6JA 2QKDA 4IEPA 1KS5A 5HI0A 1RUF2 4FQ4A 2YMZA 1ULEA 4L8QA 3IDBB 4RQPA 3N4MA 3WT3A 3VBHC 2VQ0A 5A33B 3QBQA 4K20A 3WW1A 4P14A 1P8JA 1YUDA 3ZFFA 3BI3A 2QVSB 3VD3A 3ZOIA 1KDMA 3K46A 2JD9A 3AKTA 4Q0VA 2JG8B 4MVTA 2E53A 3N7JA 1CX4A 1PZ7A 1TMF2 4LJHA 5BXXA 1S0GA 4B8EA 1CIWA 5KC5A 1W90A 4KNCA 3AZYA 3CJIB 1L7QA 2B46X 1RMU2 3OBAA 4AEJA 2ZKNA 5KHGA 2VBPA 1RUJ1 4QPYA 1CN1A 3E6DA 3AL6A 5K8SA 3VBHA 1TMF3 4NHXA 3AJYA 1US2A 4IV1C 1Q8OA 1OFSA 2XVKA 3LCPA 2VOTA 3POIA 1NLSA 3LSDA 5FPLA 1WBLA 2E7TA 2BTVC 1Z78A 1XNTA 2QZ2A 5JCTA 4YG3A 1OH4A 3PUAA 4W6XA 2B8MA 3UESA 2JG9B 3G6JB 4B7KA 2J1AA 3C7OA 4SLIA 2D6NA 2VZUA 4G4FA 5FZ6A 5JWPA 1JZ5A 2VUJA 4LE4A 5HXVA 4BXFA 5FUNA 4Y20B 5FZEA 2AYHA 2ZGPA 4CPBA 1O7FA 5FXXA 3T0AA 3I2HA 4D6SA 4WVMA 3VZJA 3B93A 4COYA 1HKDA 2OX0A 3APBA 4Z07A 2Q1ZB 5GLZA 4CEWB 4CA9A 3KF5A 4GKXA 1MVEA 1XOYA 3NQHA 4LK6A 5L73A 2VZ3A 4RL7A 4AVTA 1WW4A 1Q8VA 3DUIA 1YQ5A 1LGBA 1C8M2 4EWAA 4IERA 1UPSA 2IFRA 1O4YA 3WW4A 3GHNA 1LHNA 1G8WA 1ULFA 1JU4A 1XSRA 2D7FA 5FY5A 1LU1A 3QH7A 4H3WA 2HWE3 2GMEA 1RL3A 1CAUA 2FZ1A 2P3KA 3HNYM 1LOCA 3ZLIA 3R0RA 1ND3C 1PO11 3OG2A 3ILNA 2ARXA 4FPLA 4ZZ5A 4CP1A 1UZZA 4IEYA 3OTFA 1C57A 4OZOA 3QD6A 5LBFA 3IDAA 3VHRA 1C1FA 4QXHA 1VBE1 3WP3A 1N1SA 4R9CA 5KWRA 1W8FA 3AXDA 5A32B 1SPPB 1TEIA 2W1QA 3B00A 2BQPA 1JBCA 2W1UA 1QJU2 2D3PA 1WBFA 4JTOA 2OVUA 1UX7A 1VBD1 3POBA 1AYN2 1DZTA 1ND2B 1DCSA 2PAMA 1VLNA 3FC0A 3CHXA 3NWKA 5IYYA 1ASJ1 1YFUA 1W6OB 5A1AA 2WDBA 4A4AA 1QJX3 4GZ9A 1ND3A 2GU9A 3LF7A 1WMDA 3MGUA 4A3ZA 3BTAA 4OHWA 4XFAA 2X05A 5FZ3A 2UURA 1V6KA 2WYFA 4UBGA 2WS92 3SEEA 2VG9A 1F5FA 1V0AA 1LOAA 1WKYA 1X33A 3DKWA 4L92A 3UGFA 2C0ZA 1UOJA 2FCTA 1E5IA 3F95A 4NHLA 5APAA 5FPBA 1Y9QA 5JOWA 1HB3A 5C4WC 4YW6A 4ES9A 5FAXA 4L11A 5LY2A 2DVDA 4C91A 1PZ9A 1DG6A 2ZEYA 1AHSA 3L2HA 1ZA7A 2ZGQA 5CKMA 2Z69A 4CCMA 1YI9A 1HRI1 2OPWA 2XKPA 2ADDA 3HD8B 4QGMA 4RHV2 4CPBD 4DUXA 1L3JA 3SC7X 2KXLA 4GH4C 3V0AA 4HVOA 4AHXA 4D6QA 1MS4A 3JB8A 2Q8EA 5ISLA 2DCJA 5DG1A 3AFGA 3P5BA 4QGNA 4MOAA 2BPA2 3S7IA 3NV2A 3IMMA 4M3CE 3FX3A 2BV4A 4DY5A 5CKNA 4BLIA 1GZ9A 1W0OA 2DFCA 2CNAA 3ME2A 2YDEA 5DZGA 1G6NA 3I3BA 3J26N 4DS0A 5KHKA 1D0HA 1AR63 3R4SA 4NIGA 1BBT1 2P17A 4YZ2A 1UQXA 3LEGA 1SG3A 1WCDJ 4BK5A 3GALA 5H9QA 4YPJA 1YWKA 4J1WA 2XJUA 4CUGA 1TZOA 4IE0A 3T09A 4Q0SA 1DGWX 4GH4A 5GJ6A 4KG8A 2R061 1RXFA 2PHTA 1CX1A 1IPJA 1AJOA 1PM7A 2ZGKA 2ILMA 4Q4V1 1BCXA 2JE7A 4MGYE 4IDZA 2RJLA 3T2OA 2XONA 1XNDA 4FP3A 3THDA 3PHMA 1N3QA 2PAKA 1S2EA 4OHYA 2XQRA 4X6QB 4AGVA 2XHNA 2R071 4QPWA 1U12A 3M70A 1LNSA 2BDRA 3EMRA 2OZJA 2JKBA 3GXUA 4AI9A 4XJWA 5J37A 1ST8A 4FSJA 4C1XA 2WLQA 3AP6A 4LO7A 4RS5A 1CWPA 5L9RA 2R0FA 2BGCA 4DOUA 2BUKA 2JDYA 3HR9A 2A3YA 4LBOA 1V6OA 3H7JA 3T0DA 1H4GA 1F2NA 1Y4WA 4AEDB 5F32A 3ZIWA 2VXJA 3UJQA 4Q5OA 3MFAA 5BNOC 2SLIA 4WVWA 4YYOA 2CY6A 4D7SA 1K42A 2R1DA 2A5ZA 3V0BA 2ZCWA 2F6BA 3WNXA 4YFZA 3WP4A 4UW6A 1DBNA 1OOPB 4URTA 4GMP0 4NR1A 2CHHA 3O14A 5GZFA 3ZFGC 3OOXA 1H2LA 4I0BA 4LO5B 5T54A 1HIXA 3X29B 5I0DA 2RG4A 3WXPA 1GLHA 1ULDA 2W52A 1YHFA 5FP8A 1DZQA 4J25A 1I3HA 4NOTA 4ZU4A 5I8TA 4BDVB 2Y6LA 1MPXA 2GDFA 4JX0A 1ENXA 2XJRA 3IIAA 5BNOA 5C3SA 2DVFA 1IG0A 3O1VA 2A6VA 3ZXEA 5CADA 4KMQA 4YW4A 2ZAHA 3UV9A 2EA7A 2YC2A 2Z4FA 3ZN4A 1DLLA 2CDPA 1G9DA 1RUI3 2RDQA 3JD72 2XBO3 3MLJA 1GOHA 1NY71 1VBA3 2Q4SA 4N43B 3MW2A 4FVVA 5A3MA 2YBSA 4COZA 5LBEA 1JOPA 1VJ2A 2IFWA 3OGSA 4MXWB 4R9BA 4M3CF 4E2QA 4CU6A 5JUVA 5IFPA 3LE0A 1EV13 3JQWA 3C3VA 2VMEA 1X8MA 4AQTA 4AVVA 3AMHA 5HCBA 1ZA4A 1YQ8A 4YM1A 4BZ4A 2XWJB 2DVGA 2BOJA 2RDNA 2ZZJA 3FJSA 3HWJA 2VW2A 4LKSA 4P5HA 4Q4W1 3ZR6A 4CSWA 2WA3A 1UW8A 1Q8SA 3PVNA 4KL1A 3FHIB 4CP2A 2RS31 4LHLA 4IE5A 5JAXA 5HCFA 4LHNA 4CDXA 1DDLA 2QQNA 4DZGA 1LECA 3LDBA 1BEV3 1PZ8A 3NNFA 4A3XA 3DF0A 1V00A 1WLDA 2W68A 1AL0G 1W8UA 5FZGA 3ZR5A 4HVRA 1LHVA 1W8NA 2ARAA 4E2GA 3FHQA 5I8SA 5JMOA 1CAXA 2DCZA 3I4IA 1G9AA 4OHVA 3WNOA 1ZYBA 3SCHA 4B4PA 1LEDA 5A7NA 2CGPA 2B4KA 5FYYA 1V70A 1U5XA 3FUQA 4P02B 1DYPA 1YFYA 2HWE1 5A7WA 3M8LA 4B29A 5IK8A 2ZA9A 4AL9A 1BMV2 4LLFA 2XLAA 4FPFA 4HETA 1VBB3 3OGRA 4QHZA 1T6BX 2TNFA 1AJKA 3WCRA 4OYUA 2PQSA 2JDHA 4O65A 3PL0A 1VR3A 2VTXJ 4EN0A 3OPZA 4C1WA 5LASA 1SBFA 3F2ZA 5F3CA 4Y1YA 4AAPA 5T5OA 2XWBB 2FD8A 3AVSA 1B35C 4JV4A 3ACHA 1QEXA 4GXLA 1ODNA 4LPLA 3OEBA 5IHRA 2UY9A 4X6RB 4P9GA 4GAZA 2UU8A 4QB2A 2R1BA 5SV8A 1QJX1 1BLZA 1GQGA 1KQRA 5LCWL 4BIFA 2WNUC 2VMFA 1BZWA 2KR2A 3CKHA 4N53B 2FDHA 4EE2A 3AZWA 2NLRA 2V73A 1X50A 4OULA 3UK9A 1RC6A 2WUHA 4PIXA 3WDXA 3I3DA 4LBKA 3KCCA 1KS4A 4ZZ8A 2W3JA 2HWB2 1LB2A 3EJKA 2BGOA 1GWKA 1WUVA 4CCJA 1B35A 1AYM3 1UL9A 2X53S 4CUBA 3M3OA 2IUWA 3USUB 1H1MA 2YYOA 4IEUA 1UU5A 3M3EA 5FZCA 2DCTA 4AZZA 2WWUA 3MFCA 3OGJA 2WNUA 4K21A 5BNQA 1B09A 1RUD3 3BU7A 4FOYA 1OF3A 1UNBA 3SH5A 4R9DA 4CRQA 3TNPB 4EWEA 4BQXA 1LOGA 1PK6B 4L2NA 5G05L 4L9BA 1UY1A 5FYIA 3ZYIB 4XXAA 4Q4X3 1GNHA 3CL1A 1HV0A 1KRIA 1REEA 1EAH3 3ZXGA 2EALA 1JUIA 1A8DA 2BP6A 1AR61 5GZGA 1YFWA 1LAJA 3ZKYA 3TN92 3ZSEA 1VPHA 2YY1A 4PLOA 2VM9A 2FHRA 3PURA 3FLPA 3VDAA 3TEWA 3AL5A 4HANA 4PJYA 5FXWA 1W9FA 4HPKA 5H9PA 1H30A 1H8TC 1OLMA 5IVCA 3WNMA 2BOIA 1WZXA 4RR3C 2R043 1Y9MA 4KBBA 4CDUC 3W5NA 5D1IA 3BALA 5FRAA 4XMAA 2K2SA 3MDPA 4ATEA 1W9SA 1C3HA 2JEMA 4OZXA 2GP5A 5JZGB 1O91A 2VZQA 2VZVA 5HV4A 4FXKB 4P08A 2D98A 2ERFA 2HBUA 5FK7A 5T3NA 3WCSA 1C4RA 1U0AA 4B4RA 2AZ5A 2D3RA 3AP7A 4NWWA 4Y1VA 5ACA3 4N9IA 2FBEA 4C0BA 5A3UA 4FAHA 1BK0A 1HLCA 2ARCA 2Y6GA 1H8TA 2VZOA 4QDRA 1UF2C 3VHPA 2I2SA 4ZPIA 5EWSA 3WR0A 1HXS3 2JXAA 5F1RA 4IEOA 4LBJA 3KV6A 4RR3A 4JGYB 2BFUL 4QPIB 1FAYA 2DCYA 2QQWA 2HWC3 2RS52 3EXUA 3FLTA 3KT7A 4DFSA 1CVNA 3D6EA 3IAQA 1UCXA 3BPSA 4H2AA 5CA6A 4XFIA 4CP9B 1JZ7A 4WZCA 1V6LA 2OIIA 4RN5A 4W65A 1XSQA 2RS12 3OSDA 1RINA 4JDOA 1VB4A 3LSEA 4WVMB 3WHTA 3ZFEB 2J22A 1OFNA 2JECA 1COV1 3GDBA 3O1RA 5FOBB 3Q9OA 5AC92 1TNFA 4O7XA 2K0GA 3THTA 1OVPA 4CXYA 1JZ8A 2CL2A 2RS13 1HN0A 2VW0A 4JVAA 4AOCA 4KGGA 3E1F1 1VIWB 5HBAA 1HX6A 2OS2A 1NOVA 2P6HA 5BNNC 1V9U1 3KV9A 3KT1A 2VJXA 3LPFA 4Z8BA 3OY8A 2LS6A 1XYPA 3VZOA 5AFBA 2LW8A 3MPBA 1S0FA 2PFWA 4OUSA 3VL8A 2XJSA 4A45A 3JBG1 1RUI1 2V09A 4JCKA 1DGRN 2VTXA 4FT8A 5JVVA 2D93A 3EHKA 3I2KA 4FOWA 4NPLA 4M0NA 4LO6B 1O3SA 2DUQA 5FZFA 2DUPA 3VKFC 2A7AA 4M3CA 5LA2A 1POV1 4PLNA 1WMEA 3RMXA 4CEYB 3J8F2 5J96B 1UXZA 1IQAA 2E9QA 1K3IA 1EV11 2ATFA 4FOQA 1AF9A 2CGNA 3NV1A 3OF1A 5C7GA 5BNNA 1XNAA 3AZZA 1KD7A 5KHHA 5JXJA 3MEPA 1SHWB 2BNMA 4ORFA 4Q27A 4XETA 4AI8A 3J8F3 5C33A 2YPDA 1JHNA 3NKGA 3KD4A 1GSLA 1VAMA 2JICA 5L7OC 3O1PA 5FZOA 3IDCB 4ZXEA 4IW3A 2YB7A 1QQP3 2YXSA 3E97A 3K3OA 5EFUA 3WF4A 1BEV1 3U10A 1H0BA 3NNGA 3VBFC 4Z2WA 4COVA 4E2SA 5L36A 2WNVB 1J1LA 1IPSA 1W6MB 2YROA 3GJAA 3LEKA 2HEWF 3FL7A 4CCDA 2W1WA 1QXPA 1GNYA 2XPJA 4CE8A 2VU9A 1UOGA 4LT5A 1C5IA 1CJDA 2O8OA 4NO4A 1LGCA 3NAPA 2P2KA 4R4XA 3SKJE 3ZVXA 4ZU7A 3A0NA 3NJVA 3HQUA 3TBDA 1Y9GA 5FR3A 1EY2A 1AR72 4D8MA 3JQXA 1VBB1 5T50A 5LA9A 3I2JA 3JCIA 5FP3A 1JI6A 2VZPA 5L7OA 5LWBA 2EXKA 2JJ6A 1TE1B 2Y0IA 3WNNA 1W2NA 3AYAA 4Q1PA 3IB3A 2XLFA 2OT7A 4PHZA 1OHFA 3DL3A 5GLTA 2JDMA 1GUIA 2TUNA 4UFJA 5LRRA 4B1LA 1JYTA 1PMIA 3KGLA 3VBFA 4K7JA 3MUY1 4QX8A 3POGA 4UYBA 3SH4A 4AHYA 4QHBA 3C7HA 5D8AB 1DZRA 1YIFA 2ZGNA 5FZMA 1O5LA 3U07A 3RZKA 4FQZA 3U1XA 3S30A 2XQXA 1HRV3 3VBOB 1LENA 5L9VA 2DURA 2VW1A 3SHRA 4BB3A 2ZEWA 1K5JA 5LY1A 1IKPA 3ES4A 4XJZA 1RVF3 3HN3A 2QQLA 1HV1A 3PVOA 3S7EA 5LZ6A 2J1SA 3AMQA 4A41A 1A8MA 1AZDA 5GZEA 3FLRA 4XUPA 4EQVA 3AZXA 2O0OA 1NCQA 3NJXA 4QX1A 5JOYA 2WA4A 3DEMA 4YNIA 4TN7A 1X8EA 1X36A 2HBTA 4I0WB 3UETA 3UKNA 5FPUA 1T6GC 4CCOA 4KBZA 2NN8A 2FDGA 4H7MA 1JYWA 4CDQA 4AI0A 5F5CA 2VMHA 2IVIB 1AYM1 5IWFA 2VMDA 3FMGA 4XCBA 3WUDA 2KM2A 1R081 3DECA 3J9SA 1MS5A 3LEMA 5DDJ2 2YHJA 5DMYA 5FWEA 4FPCA 1GWMA 4WVVA 4XBNA 2HWF2 4G3YC 1RUD1 3D5OA 1DQ4A 3ILFA 3N9LA 4LHKA 4RS5B 3W5MA 2P6CA 1Z7S2 4HT1T 5DXDA 1PO21 3HQRA 1DIWA 3WF2A 1MR5A 5BV6A 2IXLA 3DGTA 1AR83 3KWVA 1QU0A 1F35A 4U2AA 1JODA 3RJ2X 4MHUA 1RIRA 2VNVA 2ZOEB 4Q4X1 3HN1A 3VBSB 5C8CB 1EAH1 3KVBA 2IZWA 4MO3M 5BPXA 3HAGA 4Q1RA 3ZM8A 5LRSA 1MS3A 1OD5A 1RUH3 2HLEA 4LOTA 3WSOA 2G9GA 2A6ZA 5C9AB 4V2WA 1W8ZA 5FIXA 4ARYA 1GNZA 1HB4A 2WO7A 4OQ9A 3GJBA 4C90A 4UW4A 4I01A 2VOWA 4Z2AA 1D4M3 2WFF1 5CG9A 2EIDA 2ZXQA 3LFIA 5EJ1B 2BEOA 3OYWA 4RGGA 2R041 2PLV3 3LGRA 2K46A 5JMCA 1D7PM 1LR5A 2RM23 1C28A 2WL1A 3HBZA 3LPGA 5AVAA 1H9WA 4YVWC 1DGRA 1W2AX 5LATA 5EV7A 5LA0A 1MZFA 3FE5A 5K0UC 1MQTC 3CNAA 3GCXA 2WT2A 3Q8CA 1H2MA 1I6XA 4Y5SA 3LQCA 3KVAA 5CYYA 1UMHA 1WMXA 2XLGA 4P9XA 4KWKA 2QCSB 4F7ZA 3GBFA 5IJRA 5ACA1 3BOPA 1SBEA 4YVSA 1SDWA 1PNFA 2B7YA 1SLBA 1HXS1 2XHKA 4LULA 4Y22B 2PN5A 4W6WA 1PX4A 1N47A 3NKTA 3ZXKA 4P9IA 1G9BA 2HWC1 4OMDA 4A6OA 4EN7B 1OI6A 3QLQA 4MH0E 5HCAA 1RUF3 1NLRA 2A6YA 3RYPA 5K0UA 1MQTA 4XBQA 3T4VA 4B3NA 1R092 5LK5A 3IPVB 5FY4A 4QPGC 4N7UA 3HT1A 2GN3A 1LHOA 3POFA 3TWIA 4GJZA 4MGTA 3IM0A 1SLCA 4CDXB 1ZZCA 3NRUA 3LAGA 3M7AA 4JC1A 2D6KA 3BIWE 3A22A 3P6BA 3HNBM 3VZMA 3MIBA 1W6PA 3WDYA 4QXBA 1QJY2 1UY2A 2GH2A 1PVC2 1RMU3 5SV5A 4RFT0 3RI9A 4AI3A 2UY8A 2WAOA 2ZTNA 3QOPA 3H42B 1KEXA 1CPNA 4QPGA 1KFXL 3VN4A 2WO2A 1PVC3 4LA3A 1ALYA 4AVBA 2WSUA 2OQ7A 1RYYA 4KU7A 5FPVA 4XEZA 1CAWA 3CJXA 2G9ZA 1ZBA2 1WGPA 1V6MA 2X5IB 1NKGA 3KSCA 5B4NA 2LROA 4TSVA 2Q1FA 4IV1A 4WM8C 5FO9B 1NUKA 1UY4A 1W39A 3I97A 2Y6FA 3ASIA 5IAXA 3EBRA 3H8XA 2QDRA 3BCWA 4LLOA 1NCRB 4EN8B 1NQDA 5FMOL 3W9AA 1OLME 2W47A 5FYMA 3H8UA 1HQLA 1W2UA 1W2OA 4B1MA 1QQP1 5IK7A 3T2TA 2UWAA 5FZ4A 3POYA 2BRTA 4RD7A 3LA2A 4O9EA 3V56A 3H0OA 2WINB 3HIFA 3BYWA 1G86A 2PAEA 4UW3A 4ZXKA 4CCEA 2ETEA 1GYKA 2B42B 1FATA 2VNRA 2W94A 3DV8A 3FWEA 1IKQA 1C8M3 2XXZA 3EB7A 4QQOA 4SBVA 1YXWA 2W08A 3HPNA 2FDIA 3RZGA 1Q3EA 2BFUS 3VKOA 4DXZA 4WM8A 1RUNA 4FPHA 4P9LA 4P9JA 3D0SA 3J7NA 4AEMA 3SISA 3GGLA 2WT1A 2VVFA 1UYPA 1AR92 1UWWA 3USSA 3VBRC 1ZRCA 2P34A 1KDKA 3ZSJA 1BVVA 3DYPA 4Y1XA 3UKTA 4LK7A 4FO9A 4NAMA 1I9RA 1LTEA 4XFHA 3S57A 5ABJB 4I30A 3WUCA 3GZEA 3RZJA 4LKDA 5I0TA 3I3EA 4NHMA 1AXKA 3ZN6B 5FCCA 1AR93 4P9YA 2B5HA 2YC0A 2C1FA 2D6MA 1QJU3 4NRQA 1FOD2 1N1TA 2O8QA 1HRV1 2WNVC 4AGGA 5BNPB 4YGCA 2HH9A 1AYN3 3U75A 5KHIA 3PJYA 3PTYA 4RFRB 1RVF1 4JRAA 4CU8A 3WINE 2GALA 2OPKA 3PUIA 1LRHA 1QOOA 3VBRA 3ZN5A 3VBUC 3B3QE 5IVEA 4LORA 2WS93 1CR7A 3ORJA 4NVPA 5FYVA 1NT0A 4OI2A 4R4ZA 4Y26A 1UIKA 4IETA 1UN1A 4AVCA 4JTNA 5J3UA 5L19A 1A34A 1J58A 1JZ2A 1FX5A 2ID4A 3U4SA 4XMIA 3TYJA 3DXTA 3N7KA 4GB31 3OUIA 2HWD1 3O0VA 4DPNA 4BH9A 4LBNA 5A3TA 4OHXA 3RMYA 1I5ZA 1C5HA 4RHV3 1W0PA 2V72A 2VBDA 5FO7B 1NXMA 5JOXA 4PF5A 3BIEA 2RVAA 2WT0A 3B01A 1XE8A 2QDNA 4O9GA 1FI2A 4CP0A 5FYSA 2RR12 5C4WA 3VBUA 5JSPA 5EPAA 2RDSA 2G4IA 1WD3A 4AHWA 2MEV2 1AR81 3IKWA 4TLGA 2YZ4A 4ZU5A 2HYKA 5CFDC 4IEZA 3UKVA 1NA1B 1ENRA 1ZRRA 4LR4A 3VDDC 4AFDA 2RR13 5T52A 2Y6KA 3SCFA 1WCKA 3WQ0A 4AEKA 5HV0A 1FPN2 5LEKA 1UIJA 1RUH1 1U5ZA 2VZSA 2WO1A 3H3ZA 3OPTA 1GFF2 5CVRA 5FYCA 1GMMA 3VHNA 1T2XA 5DQ0A 1VBC1 4GD4A 5H9SA 2WYSA 4XILA 4RYDA 1EPZA 2E63A 2NYYA 4GWNA 4IGQA 3RQ0A 2EAAA 1D4M1 3LOBA 1LU2A 1FMD1 3WF1A 4QKFA 3KQ4B 3BKZA 5D2AA 4D6RA 2UWCA 2PLV1 3M3IA 4PQQA 4FTEA 3C2UA 4ARXA 4A7ZA 2RM21 2VQTA 4Y4RA 5CFDA 3I59B 3RS6A 3R05A 1UYXA 5FK8A 3VHOA 3ZXLA 1YQ6A 4LE3A 3I2IA 4ATFA 3S5QA 1RJ7A 5CAZA 2AEZA 3VDDA 3BOWA 4IV3C 3WG3A 3T3YA 3K2OA 1DHKB 2PELA 3CMGA 4LTAA 1VE0A 3OCPA 1KFUL 3DPRB 4XOGA 2ZX4A 4BQ4A 2XL9A 1LEMA 3NO8A 4Q4Y2 4AI2A 3D82A 4PDWB 4QQLA 4Z92B 4KU8A 4YZ5A 4UAPA 5A6YA 3BODA 4M0HA 4PBOA 4XJ8A 2AEYA 1RJ8A 3I49A 4QT6A 1SZBA 1Y43B 3ZSKA 4JKLA 3KCYA 2CV6A 4M00A 5GKAC 4M3CB 1WCSA 4UF0A 4XQ4A 5K7PA 2W5FA 4LKEA 4NN0A 4WM7C 5F8PA 3RWNA 2XJPA 1RUF1 1QGLA 2F4PA 2GC3A 3P1IA 1E5SA 4IV3A 3BU0A 4DRRA 1S2KA 4YSFA 1SCRA 5T55A 5F7UA 5J09A 2PHUA 2DU1A 2KA3A 5EJ3A 1ODMA 1PM4A 1ULGA 4XDQA 5FZAA 4P00B 1CZVA 4CU9A 3H1WA 3GZUC 3G7DA 2J1TA 4JGZC 4OLLA 1M4WA 5FZOB 3HBKA 1LGNA 2W0XA 5CFCC 4YGBA 3U0ZA 3Q8AA 5EYYA 5FJKA 1X9TA 1TMF1 3H7YA 5FPZA 3RZHA 1QHDA 1UZYA 3ZFGA 3ZMNA 4COWA 2DBIA 1JTZX 5F5AA 3W59A 5HPOA 2PHDA 1R1A2 1RMU1 1XYOA 2IXHA 4XABA 1S1AA 5J36A 4RSUA 1O3TA 4CUCA 3NAPB 2ZGMA 3KGZA 1JYNA 4NRPA 5FUIA 4KH9A 1UU6A 4UFKA 1OA4A 4Q0PA 2JG8C 3JBG2 2IXJA 3JD73 2RMU2 3ZDSA 2FMYA 3RZLA 4NIDA 2VUDA 2HJIA 4LBQA 4CCLA 1D2QA 3GHMA 2WR9A 5F37A 1U5IA 5CFCA 1W6QB 4J1XA 1DQ6A 1XBFA 2ZJCA 4RA0A 5FXZA 2IXIA 2Y34A 2DVAA 1Q8PA 3CJIC 1PGW2 3ROUA 4JHZA 3U14A 1AVBA 1GZWB 1VMJA 5F3EA 3MLKA 4OI1A 3WNPA 3WQBA 3MUZ1 4HLTA 4J6GA 2E6VA 1QH6A 5A33A 2HKXA 5A3LA 1Y7BA 5C6CA 1YFXA 1TME2 1RUE2 3KCXA 4YW2A 2D97A 4EJRA 5KR7A 3ZKUA 4LUKA 3RG0A 5DAWA 2JG8A 2XL7A 5IVYA 2ZHNA 2ZGUA 1OSGA 2JG9C 3I3MA 5G04L 5GM0A 4BCUA 1A3KA 5EYXA 1J84A 1OA3A 1NCQB 3AJZA 3GNEA 4HBNA 4Y5Z0 4ZS2A 1J3RA 3I7DA 2DBNA 4FPJA 1C8M1 5A3OA 4IXLA 5GZCA 4YLZA 4FPYA 3CJIA 4MZUA 2P3YA 4DO0A 5A3WA 4V2VA 2YFZA 2F17A 2E51A 2WZR2 3A21A 4GWIA 1LKNA 4CEWC 3P3NA 5FZIA 2Y6HA 1WW5A 4HK8A 5F2SA 4E27A 4LBMA 4Y1ZA 2O1QA 4IEXA 2JD4A 4MUVA 3LOIA 3ALQA 3E5QA 3HT2A 4GULA 4XFFA 5IK5A 5CKQA 2MPFA 4DRVA 4IGPA 4BM8A 1TVGA 4NPMA 2GMPA 5FBJA 1PGL2 2JG9A 2WZR3 1RITA 3MI8A 3AK0A 3ZYHA 2GZWA 5ANNA 3ZX7A 3RNSA 5JR7B 1IPKA 3WLUA 1W9TA 1QJU1 5EP9A 4CCKA 1LULA 2ZAAA 4XUQA 4Y20A 2OKXA 3K4AA 1AYN1 2EICA 1YIPA 2BVBA 2B39A 3IAPA 2W91A 5FZKA 4AYUA 1GP6A 2RHPA 4CEWA 2OYZA 2VY0A 3AMNA 3O12A 5JIAA 3PUQA 4YM3A 2WLPA 3ACFA 4NIAA 2WS91 4GA9A 2VECA 4AF9A 5KXBA 2W92A 4HN0A 4AR2A 5JXGA 1NZCA 3MV11 4CDWB 5F39A 2GC0A 3S5AA 2OW4A 3GBWA 2HWB3 1ND2C 2JE8A 5A6XA 1RUG2 3ITQA 3VD4A 1VMFA 4H14A 5LBCA 1JHJA 1ZZ9A 1VAVA 2DVBA 3B9IA 3QCWA 5A6QA 2ZHMA 4RHV1 5BNPC 3TNQA 2WIIB 4HMZA 1SMVA 4QKBA 1ZBE2 5FUPA 1DFQA 3I54A 4AVAA 5K4LA 2JIGA 1K5MB 2WO3A 4IESA 5FMOS 4XC9A 4QX0A 1AL22 1AX1A 3D3AA 3PUHA 2V5DA 3WG1A 2JE9A 2YV8A 5A32A 5J7MA 4YVSB 2SBAA 1QNWA 3ACLA 1JXNA 4FFGA 1PIV2 4LIUA 4LOSA 2PQQA 4RQPB 2DF7A 2BJSA 4MXVA 5I0UA 2BYVE 4FCAA 4K40A 4EN6B 2OZ6A 2VNOA 3CLPA 2H6BA 3H9AA 3J7LA 1GWLA 1YEWA 1W6OA 2PHXA 1XNKA 2D6LX 3ZFFB 1ULPA 1CGPA 3LEIA 4I3PA 4FAGA 2JDPA 2JWPA 3TN93 4Y5TA 4I09A 1IHMA 1RUC2 3CEWA 4YWAA 2ZGOA 1O4ZA 3LA3A 2YFUA 2QQJA 2R32A 2VQAA 3O7OA 4YFWA 2Q0AA 5FJHA 3VD9A 3VB9A 3A4UA 5GLVA 3PUSA 1RHI2 1UY0A 2GN7A 1VRH2 1AX0A 1HJGA 5CG8A 4UBHA 5LB6A 5FQ0A 5FYBA 1S55A 1MEC2 2V4VA 4QXCA 5FZDA 3VBHB 5J48A 1XC6A 3K4ZA 5GALA 2CGOA 2DDUA 1NA1C 1RHI3 1WLCA 2PA7A 1XE7A 4DINB 2J1EA 5F2WA 1CIYA 1F31A 2YG0A 1MEC3 1UY3A 2YU1A 3WW3A 4CDUA 3AYDA 1ZZ7A 1ZZ6A 4LBLA 5A1LA 5C71A 3N9QA 4XF4A 2IXCA 3LIGA 2QQOA 2VQUA 2DTWA 2XB6C 5K9YA 5KXCA 4HKWA 4G9SB 4NRMA 3WW2A 3ILRA 1BQPA 4QU1A 2FMDA 1X7NA 2VMGA 3DCQA 2RS53 3OUJA 5DPNA 4YRDA 3ES1A 3RFRA 4BQ5A 1TG7A 3NNLA 2NPIA 1YCIA 4XBLA 2QZ3A 4MSVA 5FPXA 1QMJA 1F4HA 5KHJA 3D0JA 3OUHA 1GU3A 2CYFA 5JXHA 1ACCA 1SLTA 2Y8KA 4AVSA 3GBGA 3VZLA 4AEDC 1POQA 1C8NA 2ZGSA 5FYHA 4MG2A 5FXVA 3LDRA 4ET7A 5AC93 1LHWA 2GSYA 3O1TA 3AVRA 1RUJ2 4QM9A 1O3RA 1OOPC 2XBO1 2AACA 1VBA1 4JKMA 3B02A 5DUWA 2CSGA 1CAUB 1JZ3A 4H7LA 4E4HA 3ETQA 3PU8A 4EN9B 1D0GA 5IAVA 2LUWA 4QMAA 1QJZA 2BERA 2C24A 3ABZA 5FZ1A 3DKQA 1H2KA 4YW1A 3JD71 4XIKA 2W39A 5ANQA 5F3IA 3IT8A 3LD8A 3WG2A 3CF6E 4AEDA 5JI9A 2BZDA 5E1RA 1W8WA 4QB1A 2ZZQA 5CIRA 5HXMA 2R16A 2WZEA 2YC4A 5JR2A 5T5LA 3AYCA 1GR3A 1DGWA 4OMCA 5F6LB 3ZMOA 3SCGA 1OOPA 3SEPA 4UXAA 2VCAA 3S6PA 4NROA 1OUSA 3RRDA 2QQVA 5CB7A 4CXWA 2D5HA 5BUVA 1ENSA 5I0RA 1ND3B 1VRBA 1OVSA 2YGMA 5EQUA 4N43C 4CU7A 2E7QA 3FUOA 2JB8A 2MNGA 3ON7A 1S0BA 3UT0A 3VKNA 3D4KA 2AC1A 1V6NA 1BHGA 4MADA
chains in the Genus database with same CATH topology
2ZABA 5IK4A 5AFEA 4EV0A 2YPJA 2DTYA 4B4QA 3WDTA 1RTVA 4JDNA 4Z82A 2ZGTA 4JRLA 1PO12 5GZDA 4Q29A 2EF6A 4R9AA 5BYNA 2RJKA 1A6CA 3VZKA 1WW6A 2DWRA 4PLMA 1BMV1 4MX3A 3E6CC 1F8VA 1ENQA 3V0AB 1ZX5A 3OD0A 1AR73 1VBE2 1PO13 4LA2A 1ZRFA 3MIGA 4MXWA 4S2FA 1POV0 2A3WA 1APNA 1VBD2 1JW6A 2H6CA 4LO8A 1VBE3 1QOSA 1SCSA 2Q5TA 2VXRA 4QD2A 4DMIA 5C4WB 1ASJ2 3N3HA 3L2YA 3GF6A 2JDZA 3V65A 1WD4A 3AP4A 1IGOA 4EROA 2NM1A 3M2MA 1RGSA 2XGXA 4BMBA 1JOJA 4RGAA 4GH4B 4FPGA 1Q8QA 2MHFA 2DCKA 1ZM1A 2VOVA 4EWDA 2CWMA 3IBMA 4XJUA 3J4UH 5F9TA 4D7TA 1IS5A 2YUEA 1HRI2 3H1MA 3ZXAC 5JI7A 4ASMB 4I3GA 4GKYA 4IL7A 1J1TA 3KQRA 4QGLA 1S0EA 5C8WA 4V1PA 4N53C 3ZXFA 2VH9A 5DDJ3 1DQ2A 4MGIE 1CONA 3ENRA 1IZ3A 2HWF3 4NWVA 3AP9A 3O5SA 4AFBA 1Z7S3 1FNYA 4DNYA 1URXA 4ISQA 1MS0A 4R52A 1BBT2 3MLLA 3V0BB 1GANA 3WX5A 4GMP3 2TBVA 1BKZA 1H2NA 2ET7A 3JUUA 5JDBA 2ZPXA 3LWCA 1WMFA 2Q1MA 2R062 3NW4A 1KJLA 3VV1A 1BBT3 1GKBA 2PHWA 2WJSA 3TN91 3A0KA 4N53A 4Q26A 4Q4V2 1BYHA 1FT9A 1VBC2 1XXNA 4MGKE 4Q0QA 1ZREA 3GYDA 3QH6A 2ZACA 3FBYA 4AWDA 3M3QA 2YGLA 3ZPYA 1PK6C 2R063 5BNOB 4Q8LA 2P3JA 2CWSA 1WLTA 1O5UA 2R072 4B7EA 3N35A 1IOAA 5KXEA 4C0HA 4FTBA 1E57A 4A2UA 3USUA 4A7KA 2QJVA 3ZFGB 2D43A 3LZZA 2QE3A 2GNBA 3POSA 3AMMA 2R073 3SLIA 2QUOA 3WP6A 2DU0A 2X8KA 4XTPA 3VZNA 4BWOA 3P3PA 4TLFA 4YVWA 3QACA 3R4DB 1PK6A 1DU3D 1N3PA 5FREA 4ZKTB 4LUMA 1MZ6A 3CU7A 5F6KA 5TSWA 2EIGA 2RS51 2XUMA 5JZGC 4AQ2A 4MLOA 1HQWA 2RE9A 5FBZA 5I8YA 4E4DX 1R093 2AREA 4Y1UA 2RS11 1UX6A 3ZYJB 1IS6A 1CAVA 2CAUA 4HK9A 4IEWA 1V6IA 4JGYC 5AC91 1CAXB 4K8FA 4QPIC 1N1YA 5FLHA 4HL0A 1Q5OA 1QJY3 5JZGA 1NY72 2GC2A 3DN7A 1EP0A 1UAIA 3E5UA 5JLVA 3ZXDA 3AKRA 3VKMA 4COUA 3AKQA 5T5JA 2NQYA 3ZFEC 2A6XA 2IC1A 3H50A 2QNKA 4P9WA 3UJOA 3EO6A 2DFBA 4F8AA 2GH8A 2AGSA 3ZSMA 4D7YA 1Q56A 4JGYA 3IDEA 2VULA 4QPIA 4Q4W2 2QQPA 3J8F1 1ZBA3 2RS32 4GQ7A 2H0VA 3K48A 1LOFC 1SACA 1KXGA 5F5QA 2ARBA 4DQAA 4HKOA 4Q4W3 3M1HA 2UYAA 1AXZA 1SLLA 2RS33 1LODA 5DZFA 3WV6A 3ZFEA 1LESA 3SXWA 1NXD1 4OI4A 2BVVA 2E7AA 4HZFA 4CEYC 1XYNA 1GV9A 1UKGA 1BVP1 1BXHA 4YZ1A 5KC6A 1B35B 2HWE2 3MICA 2D5FA 2ZGLA 4OUMA 1OA2A 1SLAA 1ZZ8A 3B69A 1LOFA 4XFCA 4UW5A 2HEYF 4XQDA 2VOXA 4M01A 3KM5A 3MIHA 1AR71 2WNUB 4DB5A 4OI0A 3OJBA 2ZBJA 3RZZA 1QH7A 1XU2A 4YM2A 4HVQA 1J3PA 2PHLA 3WY6A 1TNRA 3TAYA 4XJAA 1YNAA 2LALA 4CEYA 3N7LA 3WDWA 1N1VA 3NJZA 3BPZA 1EYBA 4NHKA 4WV8A 3K51A 1QJX2 1FOD3 1UD1A 3MZHA 1REFA 1VB2A 1QXJA 5DZEA 2XVGA 1AXYA 2AR6A 2EXIA 4Q0UA 2Q30A 4BPZA 3KT4A 1JYCA 4HPKB 3URFA 1J59A 1YO8A 2I74A 4AQSA 1TQ5A 4QXKA 1H8VA 3RPQA 3INAA 5D8AC 1FV3A 2WNVA 2WQ4A 1W6MA 3MF6A 3VBOC 1G7YA 3TOJA 3M4FA 2ZX1A 2BNOA 3PNAA 2D6PA 1YLLA 2Q8OA 1QNYA 4WZFA 3TB0A 3KB5A 3PMSA 5FOJB 2JX9A 1AX2A 2WKKA 4AG4A 4N7IA 5DDJ1 3AZVA 3B7MA 1F9KA 1I1EA 1H8TB 2HWF1 1H1IA 5FLJA 4S2DA 4RR3B 3AX4A 2OUJA 1Z7S1 5D8AA 1YRZA 4CDUB 1AR62 2MEV3 1S2BA 4LO4B 4XE9A 3PJQA 3JZVA 4NPRA 3VBOA 2C9AA 1QF3A 1V6JA 2P37A 2VMIA 4GMP1 4AQ6A 5E8AA 2WC2A 4YZ4A 2ZMLA 3T1MA 2N7GA 1FPN3 4N90A 4XQWA 3WP5A 4XF0A 1ZZBA 1NE6A 1SFNA 2GMMA 5H9RA 4H55A 4RS5C 4BE3A 3NVCA 1QKQA 4YGEA 2VNGA 1W6NA 4TYSA 2ZKLA 1DGLA 3POWA 5C8CC 2K9ZA 3VBSC 3R4UA 4CYDA 4QQHA 3JB4C 3OY8B 1OPOA 3MW4A 2EAKA 4FPKA 1RUOA 5J98B 5C9AC 4N9HA 2A3XA 1RB8G 2FZ2A 2ZX2A 4Z1VA 4FXGB 4BHPA 1DQ0A 4KG0A 1CESA 4Q4Y3 3H3UA 4XF3A 1O4TA 1Z0HA 2EXHA 4PIZA 1WA4A 3NL1A 4PBPA 2NP0A 1S0JA 1MS1A 1OMIA 3IN9A 4ISRA 3ZYRA 1QY4A 4FPEA 1Y3TA 2PYTA 3VBSA 4CZSA 5BNNB 5C8CA 2XH6A 5FQ0B 1OQEA 3ST7A 4HSJA 3B94A 5C9AA 5IT6A 1COV2 1R091 2ZMKA 1JN2P 5DUXA 3AMPA 3THPA 4WM7A 3ATGA 1COV3 1V9U2 1PHMA 1ZNPA 4D69A 4XF1A 3MIEA 2VVEA 4XFBA 4D3WA 3WVJA 3OD4A 1FV2A 1RUI2 2Z79A 1QJY1 2XBO2 1VBA2 1PVC1 4JDMA 4XHXA 4QQPA 1A78A 1V9U3 1R1A3 3PLQA 4JGZA 2R30A 5L7OB 3OGGA 2DUOA 2WWSA 3I2DA 4A7YA 4X8NA 4JQRA 2JENA 2XJQA 4CDXC 3JBG3 4E9KA 2RMU3 2ZX0A 2ZS6B 1EV12 3VBFB 3FZ3A 4Y22A 2LM3A 3O0WA 2WNEA 1POV3 1JYIA 4K1ZA 1ZBA1 3AKPA 3PVEA 2FQPA 3KS7A 1D2SA 3RYRA 1UKRA 2C5DA 4YG6A 3FBMA 4JAAA 1XRUA 3IPVA 4DY3A 1SLIA 1BEV2 1TME3 1RUE3 1XU1A 4YG0A 4OHZA 1XQNA 1FXZA 4S2GA 4HKLA 4LNVA 1Q43A 1ZVFA 5B2GB 4CDQB 2Z42A 3B5LB 1HW5A 2X5IC 1R1ZA 4GIQA 1N3OA 2B45X 1VBB2 1ULCA 1GBGA 1QDOA 3N36A 4AI1A 4KWJA 5KBFA 3SH3A 1NCRC 4I0AA 5GLUA 4KQ7A 4Y4YA 1WLWA 3MF9A 3RJRA 4YW3A 4XW3A 5FDBA 2CAVA 2VUAA 4KGQA 1AR91 4WBBA 3AXEA 4AXOA 2A75A 5DUVA 1FNZA 1QXRA 1D4VB 1YI7A 1MS8A 3ELNA 2X5IA 2LTNA 3FFZA 2PHRA 1DQ1A 1QOTA 3NV4A 3KZ4C 3T1LA 4TZDA 2IWGB 1FOD1 2UWBA 1WW7A 1ONAA 1NCRA 4INDA 4LBQD 1CQ9A 1HQNA 3N7MA 4PCRA 2VGDA 5ABJC 3OYWB 1M06G 1SFYA 3GZAA 1AYM2 2VPVA 3MIDA 1LCLA 4OFGA 2R49A 2ET1A 4IEQA 1G9CA 1R082 1QDCA 1OKQA 3AYEA 3WD5A 4ITCA 1UPIA 1DF0A 1RUG3 1MS9A 1HDKA 2CTVA 4IEVA 1X82A 1MVQA 1RUD2 4BQ1A 1R083 3MIFA 4MYEA 5I93A 1PO22 1GZCA 1ZBE3 1JH5A 4R8HA 5AVPA 2BBVA 2ZGRA 1ND2A 3PMEA 5ABJA 4XF9A 2Y38A 1AL23 2RR11 3LA7A 4Q4X2 3ZN6A 1EAH2 3V64A 2MEV1 2VVDA 1PO23 4YVWB 1PIV3 5BNPA 2B9UA 3BB6A 4I02A 1NYWA 5K0UB 1MQTB 4ES8A 2OUHA 4AK3A 2NMOA 5E89A 3WG4A 4E4SA 3MYXA 1KJRA 1FPN1 1DYKA 4XTMA 3E6BA 2R6QA 2WFF2 5I91A 4ONUA 4MV2A 1RUC3 2R042 4AE2A 2BWAA 3U4XA 5GLWA 1OQ1A 4BIOA 1UU4A 3WQ7A 4WVZA 1CAVB 1PGSA 1W6PB 2V5YA 2WFF3 4BYYA 4AGRA 1VRH3 3TRSB 3SITA 4XFGA 2P3IA 3WDUA 1NG0A 4TWTA 5ACA2 1GICA 2EXJA 3LB9A 4QPGB 1EPWA 4S2HA 2A73B 3SMHA 5BY5A 4HN1A 1H4HA 5IUQA 4Q4Y1 1BJQA 1HXS2 2A71A 2GAUA 1CAWB 3JU9A 5LEJA 3RDIA 2D6OX 2HWC2 4E4ZA 1SEFA 2XJTA 4K9SA 3W58A 4QM8A 3S0MA 1ZRDA 4IV1B 1REDA 1NA1A 1S0IA 4XYXA 1VALA 2Z2SB 2NZ9A 1LJ7A 3VGIA 1YJLA 1XNCA 4D94A 3DPRC 3D8CA 3O0XA 4PDWC 2R0HA 3U11A 1CJPA 5LK7B 2WSVA 2XVLA 1YJKA 1U5YA 3NV3A 1H1AA 4HSLA 4BA6A 3RYKA 3I59A 1UMZA 1GQHA 1RUJ3 4WM8B 2DYCA 5FO8B 3NSTA 1YYNA 3WHUA 3IWZA 1SQ4A 1R1A1 3DPRA 4K1YA 4BLJA 4PDWA 4XZPA 4YARA 3FFQA 3EQEA 5CNAA 2RMU1 4HFSA 5DG2A 1XNBA 2G9FA 4QX5A 5JSRA 5EZWA 3RI8A 4MGZE 1MACA 2ZX3A 2ZHKA 2GC1A 4Q2FA 1PGW1 1CPMA 2QFEA 3SNMA 1O3QA 4F3JA 4LEJA 3NAPC 1QQP2 5JOZA 2H0BA 1TME1 1MZ5A 1RUE1 3CO2A 1LOEA 2ENRA 3VBRB 4YZ3A 3OBTA 4BOWA 3VUOA 2ZMNA 5JSOA 1CD3G 2X29A 3GZTB 2GNDA 2PHFA 1IS3A 4OVEA 2XKOA 4AHZA 1VAKA 2GNTA 2D44A 4X8PA 4F83A 4AFAA 3R6SA 1OLQA 2PTMA 2XJVA 1OPMA 3KLSA 4N43A 3ZO0B 1G9FA 5CBLA 2WQZC 1IS4A 3KMHA 4ASLA 4I2OA 4FP2A 1F5JA 2WZR1 3OBRA 4GWMA 3VL9A 2BWCA 2Y0OA 4L97A 3VBUB 4W6YA 1NCQC 3LKJA 4PQ9A 1PGL1 1W6QA 3RSJA 1HRV2 3E5XA 1VBD3 4Y24A 1BK1A 1OQDA 1RVF2 1ASJ3 3IMNA 1GZWA 3UL2A 3PVBB 1NQJA 3AM2A 3ECQA 4KWLA 4YGDA 5DUUA 2XG3A 2BNNA 4FPOB 3B9CA 4IQPA 2WZPP 4CTEA 1JUHA 3M3CA 3ZXJA 4YW5A 1SBDA 2HWB1 4K3UA 2ZHLA 1J3QA 2AUYA 5T5PA 1FYUA 4GB32 4Q8KA 2AENA 2HWD2 1MZEA 2HEVF 5CFDB 1NE4A 5E88A 5CU1A 3VDDB 1HRI3 4FTSA 2IXKA 2TEPA 5EXOA 1W6NB 4L99A 1RUG1 3MW3A 5FTTC 1H9PA 2I07B 3WDVA 4GB33 3WQ1A 2HWD3 2A70A 1C1LA 4GALA 1VP6A 4AFCA 1ZBE1 2ES3A 5I0SA 3I8TA 1AR82 2WFPA 3AP5A 3H1YA 4XXPA 4FBFA 4XHBA 1AL21 4META 4CDWC 4K6BA 4XPVA 5FLIA 5JPMB 3L9JT 2GNMA 3AFKA 5FFOC 4U36A 2AH2A 3ZYGA 1RUH2 1PIV1 2UYBA 2I45A 3AB0A 4AFMA 4IV3B 3HQXA 4AW7A 4BMEA 1LOBA 1S0CA 3ZIXA 2D40A 2NMNA 1D4M2 1K5MC 1FMD2 1OLRA 2BW8A 4YM0A 4Q4V3 1RUC1 2EVXA 2PLV2 1VBC3 1PVXA 2RM22 4YVSC 4CDWA 4RQPC 4QQ2A 1FMD3 1KITA 1RHI1 1DQ5A 4WM7B 1VRH1 3MPPG 2OA2A 3VLBB 3WZ1A 1PNGA 3HMYA 1AUYA 4XJ9A 3AKSA 3ZFFC 1LHUA 5JIUA 5E16A 1MEC1 2VOKA 4PIYA 3ZSLA 2DV9A 2Z5WA 2Y26A 4LBQB 1K5MA 4JGZB 2A6WA 1S0DA 4FOVA 1QWRA 3ZYPA 5CFCB 4XIOA 2D3SA 4QU2A 3WOGA 2QKDA 4IEPA 1KS5A 5HI0A 1RUF2 4FQ4A 2YMZA 1ULEA 4L8QA 3IDBB 4RQPA 3N4MA 3WT3A 3VBHC 2VQ0A 5A33B 3QBQA 4K20A 3WW1A 4P14A 3ZFFA 1YUDA 2QVSB 1KDMA 3AKTA 4Q0VA 2JG8B 4MVTA 2E53A 3N7JA 1CX4A 1PZ7A 1TMF2 5BXXA 1S0GA 4B8EA 1CIWA 5KC5A 4KNCA 3AZYA 3CJIB 2B46X 4AEJA 1RMU2 2ZKNA 5KHGA 1RUJ1 4QPYA 1CN1A 3E6DA 5K8SA 3VBHA 1TMF3 3AJYA 4IV1C 1Q8OA 1OFSA 2XVKA 3LCPA 1NLSA 3LSDA 1WBLA 2E7TA 2BTVC 1Z78A 2QZ2A 5JCTA 4YG3A 4W6XA 2B8MA 2JG9B 3G6JB 4B7KA 4SLIA 2D6NA 4G4FA 5JWPA 2VUJA 4LE4A 5HXVA 4Y20B 2AYHA 2ZGPA 1O7FA 4WVMA 3VZJA 3B93A 4COYA 1HKDA 3APBA 4Z07A 2Q1ZB 5GLZA 4CEWB 4GKXA 1MVEA 5L73A 4RL7A 4AVTA 1WW4A 1Q8VA 3DUIA 1LGBA 1C8M2 4EWAA 4IERA 1UPSA 2IFRA 1O4YA 3WW4A 3GHNA 1LHNA 1G8WA 1ULFA 2D7FA 1LU1A 3QH7A 4H3WA 2HWE3 2GMEA 1RL3A 1CAUA 2FZ1A 2P3KA 1LOCA 3R0RA 1ND3C 1PO11 3ILNA 2ARXA 4FPLA 4CP1A 1UZZA 4IEYA 3OTFA 1C57A 3QD6A 3VHRA 1C1FA 3WP3A 1VBE1 1N1SA 4R9CA 5KWRA 3AXDA 5A32B 1TEIA 3B00A 2BQPA 1JBCA 1QJU2 2D3PA 1WBFA 4JTOA 2OVUA 1VBD1 1AYN2 1DZTA 1ND2B 2PAMA 1VLNA 3FC0A 3NWKA 1ASJ1 1YFUA 1W6OB 1QJX3 1ND3A 2GU9A 3MGUA 1WMDA 3BTAA 4OHWA 4XFAA 2UURA 1V6KA 4UBGA 2WS92 2VG9A 1F5FA 1LOAA 1X33A 3DKWA 4L92A 2C0ZA 4NHLA 1Y9QA 5JOWA 5C4WC 4ES9A 5FAXA 4L11A 4C91A 2DVDA 1PZ9A 1DG6A 1AHSA 3L2HA 2ZGQA 2Z69A 1YI9A 1HRI1 2XKPA 3HD8B 4RHV2 4QGMA 1L3JA 2KXLA 4GH4C 3V0AA 4HVOA 4AHXA 1MS4A 3JB8A 2DCJA 5DG1A 3AFGA 4QGNA 2BPA2 3NV2A 4M3CE 3FX3A 4DY5A 4BLIA 1GZ9A 1W0OA 2DFCA 2CNAA 3ME2A 2YDEA 5DZGA 1G6NA 3J26N 4DS0A 5KHKA 1D0HA 1AR63 3R4SA 1BBT1 2P17A 4YZ2A 1WCDJ 3GALA 5H9QA 1YWKA 4J1WA 2XJUA 4Q0SA 1DGWX 4GH4A 5GJ6A 4KG8A 2R061 2PHTA 1IPJA 1AJOA 1PM7A 2ZGKA 2ILMA 4Q4V1 1BCXA 2JE7A 4MGYE 2RJLA 1XNDA 4FP3A 3PHMA 1N3QA 2PAKA 4OHYA 4X6QB 4AGVA 2R071 1U12A 3M70A 2OZJA 2JKBA 5J37A 4FSJA 4XJWA 4C1XA 2WLQA 3AP6A 4LO7A 4RS5A 2R0FA 2BGCA 4DOUA 2BUKA 3HR9A 2A3YA 4LBOA 1V6OA 3H7JA 1H4GA 1F2NA 4AEDB 3ZIWA 3UJQA 3MFAA 5BNOC 2SLIA 4WVWA 4YYOA 2CY6A 4D7SA 2R1DA 2A5ZA 3V0BA 2ZCWA 2F6BA 3WNXA 4YFZA 3WP4A 4UW6A 1DBNA 1OOPB 4URTA 4GMP0 4NR1A 3O14A 5GZFA 3ZFGC 1H2LA 4I0BA 4LO5B 5T54A 1HIXA 3X29B 3WXPA 1GLHA 1ULDA 2W52A 1YHFA 1DZQA 4ZU4A 1I3HA 4NOTA 5I8TA 2GDFA 1ENXA 2XJRA 3IIAA 5BNOA 2DVFA 2A6VA 3ZXEA 5CADA 4YW4A 2ZAHA 3UV9A 2EA7A 3ZN4A 1DLLA 1G9DA 1RUI3 3JD72 2XBO3 3MLJA 1NY71 1VBA3 2Q4SA 4N43B 3MW2A 4FVVA 5A3MA 4COZA 1VJ2A 2IFWA 4R9BA 4MXWB 4M3CF 4E2QA 1EV13 3JQWA 3C3VA 4AQTA 1X8MA 4AVVA 3AMHA 5HCBA 1ZA4A 4YM1A 4BZ4A 2XWJB 2DVGA 3FJSA 4P5HA 2ZZJA 3HWJA 2VW2A 4Q4W1 2WA3A 1UW8A 1Q8SA 3PVNA 4KL1A 3FHIB 4CP2A 2RS31 4LHLA 5JAXA 5HCFA 4LHNA 4CDXA 1DDLA 4DZGA 1LECA 1BEV3 1PZ8A 4A3XA 3DF0A 1V00A 1WLDA 2W68A 1AL0G 4HVRA 1LHVA 4E2GA 5I8SA 1CAXA 2DCZA 3I4IA 1G9AA 4OHVA 1ZYBA 3SCHA 4B4PA 1LEDA 1V70A 1U5XA 3FUQA 1DYPA 1YFYA 2HWE1 1BMV2 3M8LA 4B29A 5IK8A 2ZA9A 4LLFA 2XLAA 4FPFA 4HETA 1VBB3 2TNFA 1AJKA 3WCRA 4EN0A 1VR3A 3OPZA 4C1WA 1SBFA 4Y1YA 5T5OA 2XWBB 1B35C 4JV4A 4GXLA 2UY9A 4X6RB 4P9GA 2UU8A 2R1BA 5SV8A 1QJX1 1GQGA 1KQRA 4BIFA 2WNUC 1BZWA 4N53B 3AZWA 2NLRA 2V73A 1X50A 4OULA 3UK9A 1RC6A 4PIXA 3WDXA 4LBKA 3KCCA 1KS4A 2HWB2 1LB2A 3EJKA 1WUVA 1B35A 1AYM3 1UL9A 2X53S 3M3OA 3USUB 1H1MA 2YYOA 4IEUA 1UU5A 3M3EA 2DCTA 3MFCA 3OGJA 2WNUA 4K21A 5BNQA 1B09A 1RUD3 3BU7A 4FOYA 3SH5A 4R9DA 4CRQA 3TNPB 4EWEA 1LOGA 1PK6B 4L2NA 4L9BA 3ZYIB 4XXAA 4Q4X3 1GNHA 3CL1A 1HV0A 1KRIA 1REEA 1EAH3 3ZXGA 2EALA 1JUIA 1A8DA 5GZGA 1AR61 1YFWA 3TN92 3ZSEA 2YY1A 4PLOA 2FHRA 3FLPA 4HANA 4PJYA 4HPKA 5H9PA 1H30A 1H8TC 4RR3C 2R043 4KBBA 4CDUC 5D1IA 3BALA 5FRAA 4XMAA 2K2SA 3MDPA 4ATEA 2JEMA 1C3HA 4OZXA 5JZGB 1O91A 4FXKB 2D98A 2ERFA 5T3NA 3WCSA 1C4RA 1U0AA 4B4RA 2AZ5A 2D3RA 3AP7A 4NWWA 4Y1VA 5ACA3 4N9IA 2FBEA 4C0BA 4FAHA 1HLCA 1H8TA 1UF2C 3VHPA 2I2SA 3WR0A 5EWSA 1HXS3 2JXAA 5F1RA 4IEOA 4LBJA 4RR3A 4JGYB 2BFUL 4QPIB 1FAYA 2DCYA 2HWC3 2RS52 3EXUA 3FLTA 3KT7A 4DFSA 1CVNA 3D6EA 1UCXA 5CA6A 4XFIA 4WZCA 1V6LA 2OIIA 4W65A 2RS12 1RINA 4JDOA 1VB4A 3LSEA 4WVMB 3WHTA 3ZFEB 1OFNA 2JECA 1COV1 5FOBB 3Q9OA 5AC92 1TNFA 2K0GA 3THTA 2CL2A 2RS13 2VW0A 4JVAA 5HBAA 4KGGA 1VIWB 1HX6A 1NOVA 5BNNC 1V9U1 3KT1A 4Z8BA 3OY8A 1XYPA 3VZOA 5AFBA 3MPBA 1S0FA 2PFWA 4OUSA 3VL8A 2XJSA 3JBG1 1RUI1 2V09A 4JCKA 1DGRN 4FT8A 5JVVA 2D93A 3EHKA 4FOWA 4M0NA 4LO6B 1O3SA 2DUQA 2DUPA 3VKFC 2A7AA 4M3CA 1POV1 4PLNA 1WMEA 3RMXA 4CEYB 3J8F2 5J96B 1IQAA 2E9QA 1EV11 2ATFA 4FOQA 1AF9A 2CGNA 3NV1A 3OF1A 5BNNA 3AZZA 1KD7A 5KHHA 3MEPA 2BNMA 4ORFA 4Q27A 4XETA 4AI8A 3J8F3 5C33A 5FQ0A 1JHNA 3NKGA 3KD4A 1GSLA 1VAMA 2JICA 5L7OC 3IDCB 1QQP3 2YXSA 3E97A 5EFUA 1BEV1 3U10A 1H0BA 3VBFC 4Z2WA 4COVA 4E2SA 5L36A 2WNVB 1J1LA 2YROA 1W6MB 2HEWF 2XPJA 1QXPA 2VU9A 4LT5A 1C5IA 1CJDA 2O8OA 4NO4A 1LGCA 3NAPA 2P2KA 4R4XA 3ZVXA 4ZU7A 3A0NA 3TBDA 1EY2A 1AR72 3JQXA 1VBB1 5T50A 3JCIA 5L7OA 2EXKA 2JJ6A 1TE1B 2Y0IA 3AYAA 4Q1PA 2XLFA 5GLTA 1OHFA 3DL3A 5JPNB 2TUNA 5LRRA 1PMIA 3KGLA 3VBFA 4K7JA 3SH4A 4AHYA 4CDQC 5KXDA 4QHBA 5D8AB 1DZRA 1YIFA 2ZGNA 1O5LA 3U07A 4FQZA 3S30A 1HRV3 3VBOB 1LENA 2DURA 2VW1A 3SHRA 1IKPA 3ES4A 4XJZA 1RVF3 3S7EA 3PVOA 1HV1A 3AMQA 1A8MA 1AZDA 5GZEA 3FLRA 3AZXA 2O0OA 1NCQA 5JOYA 2WA4A 4YNIA 1X8EA 1X36A 4I0WB 3UKNA 1T6GC 2NN8A 4H7MA 4CDQA 4AI0A 2VMHA 1AYM1 3FMGA 3WUDA 2KM2A 1R081 3J9SA 1MS5A 5DDJ2 2YHJA 4FPCA 4WVVA 4XBNA 2HWF2 4G3YC 1RUD1 3D5OA 1DQ4A 3ILFA 4LHKA 4RS5B 1Z7S2 4HT1T 5DXDA 1PO21 1DIWA 1MR5A 5BV6A 2IXLA 3DGTA 1AR83 1QU0A 4U2AA 3RJ2X 1RIRA 2ZOEB 4Q4X1 3HN1A 3VBSB 5C8CB 1EAH1 2IZWA 5BPXA 5LRSA 3HAGA 4Q1RA 1MS3A 1OD5A 1RUH3 2G9GA 2A6ZA 5C9AB 1GNZA 4C90A 4UW4A 4I01A 2VOWA 1D4M3 2WFF1 5CG9A 2BEOA 3OYWA 4RGGA 2R041 2PLV3 3LGRA 5JMCA 1LR5A 2RM23 1C28A 2WL1A 3HBZA 5AVAA 1H9WA 4YVWC 1DGRA 5EV7A 1MZFA 3FE5A 5K0UC 1MQTC 3CNAA 2WT2A 1H2MA 1I6XA 2XLGA 4P9XA 4KWKA 2QCSB 4F7ZA 3GBFA 5ACA1 3BOPA 1SBEA 4YVSA 1SDWA 1PNFA 2B7YA </