4P5YA

Structure of cbm32-3 from a family 31 glycoside hydrolase from clostridium perfringens in complex with n-acetylgalactosamine
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
157
structure length
157
Chain Sequence
LYKKAGSEFALDSSKLEAIYATSEADRDYKENAVDGDENTIWHSAYQAADKLPVSITIKLDKAYDLNQIDYLPRQNSRNGHVTEYKIETSLDNENWTEVRTGNLEVNEAGNALANRGYNPIRFNTINAQYLRFTALKTLGDTNNKYASAAELVFYGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Glycosyl hydrolase, family 31/fibronectin type III domain pr
publication title Diverse modes of galacto-specific carbohydrate recognition by a family 31 glycoside hydrolase from Clostridium perfringens.
pubmed doi rcsb
source organism Clostridium perfringens
total genus 37
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2014-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4p5yA00
2WBKA 2WZ8A 3FN9A 3CIHA 4QDSA 2CDOA 1GNYA 1BHGA 4A45A 4CUBA 5JXHA 3I2IA 1O8SA 2W87A 3DYMA 2XQXA 2EIBA 1XNTA 3WF4A 4W4ZA 3A7QA 4DXRA 1RYYA 1OD3A 1OH4A 2VZQA 1F4AA 3K77A 4OMCA 2WDBA 5A1AA 3WQBA 1JYWA 3NJVA 3CMGA 3VD5A 2J7MA 2ZEZA 2Y6LA 2WN2A 3UETA 2DDUA 1W9SA 4JKMA 3I3EA 1JYXA 5B4NA 4L0PA 4JHZA 3VDBA 2ORXA 2W46A 3OGRA 4ZY9A 5DPNA 1WCQA 4RYDA 1ULOA 3WF3A 1TG7A 3PUIA 1GOGA 5HPOA 2JDAA 3I3DA 3C7HA 2Y6KA 5CYYA 1CX1A 1JZ5A 1UY1A 4RN5A 3WSOA 3IAPA 4E8DA 3WNKA 3CZJA 3SKJE 3C7OA 1GUIA 1LNSA 1US2A 3FHAA 3HN3A 2B9VA 4A42A 1J84A 4P00B 3THCA 4DUWA 5IFPA 2Y6HA 3IB3A 3D3AA 5HXMA 3OGSA 1NX9A 2VCBA 3SKVA 3NNGA 1UX7A 2YB7A 3SEPA 2QQMA 1JU4A 3C7EA 1XNAA 4M4PA 2J1SA 4D8MA 3ACFA 4DEQA 3W5NA 1UXZA 2BGOA 3GXUA 3NQHA 2QQNA 4LQRA 3FL7A 1JYVA 4LKSA 2VL4A 1CZSA 3I2JA 4XZUG 3U37A 2W47A 3HNBM 3C7FA 2ZEWA 4FI9A 2Y6GA 3GGLA 3K46A 2YFUA 2C4XA 4QPWA 5EIYB 5I0DA 1T2XA 1PMHX 1D7PM 4W50A 2B4KA 2J1RA 1UZ0A 2Y6JA 3K4AA 2WN3A 1UYYA 2VZVA 2LS6A 5IYYA 2PQSA 1IQDC 5EJZB 3J7HA 4QAWA 4AAXA 2QQLA 4OUEA 2ORZA 4XUQA 1NKGA 3IIIA 3LEGA 2VMEA 5DN2A 2VZUA 2E31A 2W94A 3WNPA 3WF2A 2VQTA 4A3ZA 2WAAA 2WO2A 4KWUA 3T09A 4A44A 3T0AA 3LPGA 4QX3A 2EIDA 5LA1A 1F4HA 4XUTA 3T08A 4XUPA 4MOAA 3VD9A 4HG6B 3VD4A 1W9WA 1XC6A 1KGYA 1US3A 3CDZB 2VZPA 1CZVA 3MO4A 4IUGA 3I97A 2ZEXA 2W5FA 2WYSA 1EUUA 3P6BA 2VCCA 5JUVA 4CU6A 3DYOA 2YFZA 1H6YA 2VOTA 3HOBA 4OMDA 1UY3A 3A23A 4DEVA 4PT6A 3EYPA 2ID4A 2W92A 4AG4A 2HYXA 3T2OA 2J1UA 4A6OA 3PUHA 1YQ2A 3THDA 1JZ4A 1SHWB 1JZ7A 4TXWA 3BN6A 4ET7A 3W5MA 3E1F1 1UMHA 2VMCA 4P02B 1NAEA 1TVGA 3MBWA 3HEIA 2LW8A 3HPNA 2DCJA 5IHRA 2W3JA 3MV01 4ZXEA 1GOFA 5G05L 4LHSA 2V5DA 4QB1A 2OKXA 2YC2A 1H6XA 4ARXA 3OG2A 4OZOA 2VJXA 1UY2A 4YPJA 4P08A 2VZ1A 3WNLA 2E32A 2W91A 2Y64A 2JD9A 4GZ9A 5C7GA 1OF4A 3SEEA 1KEXA 1K3IA 3I2GA 2C26A 3EB7A 2KD7A 1JHJA 3HJRA 2BBAA 2WUHA 3UESA 2W1UA 1SG3A 3CZUA 1JZ6A 1J83A 4GWJA 3DYPA 2E26A 1JU3A 3VD7A 4MADA 4BK5A 1UYZA 1W0NA 3I2HA 5JR2A 1K42A 3LPFA 3GM8A 3F2ZA 1UY0A 2Y8KA 4DUVA 2VMFA 1WKYA 2XONA 3ECQA 2VTFA 1W99A 5LA0A 2WO3A 1DP0A 2W95A 3K4DA 4XVHA 1UY4A 2BZDA 1PX3A 4XURA 2J1TA 2W1SA 1P8JA 4KMQA 1UMIA 4DUXA 2VZTA 3I2KA 5C70A 2VO5A 3LQCA 5JMOA 5EJ1B 2L9LA 1ULPA 2VR4A 4P5YA 2J1EA 2JE8A 1XPWA 4ZZ8A 2VCAA 3VDCA 4KI5M 3P1IA 1JI6A 1DLCA 2QQJA 2EIEA 1UYXA 1L7RA 3MUZ1 4CUAA 2WAOA 3WNMA 2XOMA 3LEKA 2J22A 1W9TA 5IFTA 5LCWL 4QB6A 4BK4A 4QX0A 4JX0A 3WNNA 1JZ3A 2QQIA 5B4XA 3ABZA 3AC0A 1W8OA 3LE0A 4Z2AA 3I2FA 5LA2A 1GQPA 2ZXQA 2WZEA 4W8JA 1CZTA 4CU8A 2WQ8A 3OEAA 2RV9A 1OF3A 1JZ2A 1JYNA 3T2QA 3A22A 5DMYA 1NUKA 4XUNA 4PQQA 2VZOA 5DQ0A 4PF1A 2VZRA 4QX1A 1O59A 4ARYA 3WNOA 3FHQA 1I5PA 4BJ0A 5JXJA 2W9XA 1O8PA 2VQUA 3BGAA 3NJXA 2WO1A 2CDPA 4BDVB 5J1XA 4DXTA 3CQOA 2V4VA 4QDRA 4CVUA 3T2PA 4GWIA 3DECA 4CU9A 1L7QA 1R64A 1HN1A 3OB8A 2QQKA 2RVAA 1GOHA 4MGQA 3IDAA 1UXXX 1OT5A 3OEBA 2VM9A 3CKHA 3IAQA 2XHNA 2EICA 1K45A 1PX4A 1UWWA 1K12A 3WF0A 4A41A 3A21A 4CU7A 2VC9A 4A4AA 4DXSA 2V72A 2R7EB 2E33A 1CIYA 4QDQA 4TTGA 1SDDB 3LEIA 3HNYM 4MO3M 2BERA 3UNPA 1DYOA 3C8XA 2BGPA 2C9KA 1GMMA 5CZKA 3MV11 3WEZA 2YG0A 2QBXA 1PMJX 2W1QA 4OYUA 2X05A 4JKLA 4UI9L 2ZEYA 2VZSA 4E8CA 5JXIA 3OBAA 4QX2A 3OGVA 3JXSA 2VZ3A 3MUY1 4MGSA 3T0BA 2JKXA 4UAPA 4BXSV 3NRUA 5JXGA 4QB2A 4M4RA 2X09A 5FUIA 5F7UA 2X10A 2RJ2A 3VDAA 1JZ8A 2J1AA 3ETPA 3C7GA 2DCKA 2W1WA 3VD3A 4D0QA 3ACIA 2Z4FA 4ZZ5A 3K75B 1EUTA 4LPLA 1MPXA 3WF1A 4JKKA 2QQOA 4XUOA 2WABA 4UOJA 3ZM8A 5IJRA 2VMDA 2YC4A 3GDBA 3K4ZA 4CUCA 1W8NA 2HLEA 5C71A 5G04L 1GU3A 3I3BA 3ACGA 3T0DA 3ACHA 3HNMA 2J1VA
chains in the Genus database with same CATH superfamily
1QGLA 3LA7A 2WZ8A 3WG1A 4AK3A 1HX6A 2P2KA 3FN9A 4Q4X2 3VB9A 2IVJA 1L7LA 2RS12 4QDSA 4BOWA 4JCKA 4MGTA 4A45A 5AC91 4CUBA 1W39A 1EP0A 1EV13 4GKXA 1OQDA 1W6PA 1BEV2 2BDRA 2D6LX 3RSJA 4W4ZA 5BYNA 5JOXA 1CPNA 1R092 3AP4A 3QLQA 5LEKA 4CDXC 2HWD2 5CG9A 1GZCA 2VZQA 3RFRA 1PGW1 3K3NA 4W6XA 1QF3A 4NRMA 3WQBA 4YYOA 2OT7A 3CMGA 2ZEZA 3ILRA 3VBHA 3VD5A 4BIOA 1ZZCA 4LJHA 3WCSA 3ZXJA 1QOOA 3PJYA 3UK9A 2BOIA 2DU0A 5CB7A 5T54A 1EV11 1XE0A 1UU6A 4DO0A 5FOBB 2VOVA 2ORXA 5DPNA 1O6UA 4E27A 1H8VA 1V70A 2UYAA 5FY1A 3GYDA 5L9VA 5EYXA 4TWTA 3JQXA 2WINB 1RL3A 3RYKA 1NCQA 3I3DA 3C7HA 4LIVA 4SLIA 4QPIB 1CX1A 4FFGA 1POQA 1ALYA 1PGSA 2VUDA 3IKWA 3POEA 4N43C 4CDQA 1JZ5A 3VBUA 5JIUA 1W8ZA 1G9FA 3K3OA 4H14A 2VVDA 1CIWA 1GUIA 1US2A 3D0SA 3FHAA 3USUA 3H50A 2WT2A 3THCA 2DVBA 2DTYA 2IUWA 2Y6HA 4K6BA 5JLVA 4D7SA 2WIIB 4XHXA 4MGZE 2HBTA 5I93A 3OGSA 1NX9A 5J48A 3Q9OA 5CKNA 4BCUA 4PQ9A 2R1BA 1R081 2YB7A 3KB5A 3ZXFA 3WG4A 2MEV3 4M3CE 1C28A 2KM2A 4LBOA 4BLIA 4F7ZA 5KC6A 1O3RA 4Y33A 1AJKA 5ANQA 3BIEA 2XVKA 1AYN1 4IV3B 2WNUC 4RQPA 2G1MA 3MIHA 1XXNA 2GN3A 1HLCA 3J8F2 4M4PA 2J1SA 4D8MA 1W3VA 1MVEA 4LKDA 4LLOA 3O1RA 2RMU3 2G9GA 3VBSC 1AR63 5KBFA 5GALA 4UFKA 2B46X 3RPQA 4URAA 3ZYJB 3H8XA 1W9YA 3VZMA 4FPJA 1QXJA 2Z42A 2YYOA 2MEV1 5I91A 4LKSA 1Y9GA 2Q0AA 3MZHA 4ES8A 1X9PA 5HBAA 2BFUL 3H3UA 3JD71 5T55A 4URTA 2ZKNA 2NMNA 4CEWA 2JECA 2QFEA 1AR92 2R16A 1C8M2 4IE5A 1VP6A 2VW0A 3TN92 2FDFA 1BCXA 4OI4A 4F8AA 2WYFA 5T50A 4YM2A 1W0PA 5E16A 1REDA 3USSA 2W39A 4LLFA 4B3NA 4N9IA 3IMNA 1ODNA 5FWEA 5FYMA 2XLGA 1PMHX 3O7OA 5FY8A 2B4KA 3K4AA 1RMU1 2WN3A 3NMBA 2VZVA 3RG0A 1LHOA 3SCGA 5AFBA 5EFUA 5IYYA 4BISA 4AAXA 4L8QA 2QQLA 1WGPA 4CPBA 4OUEA 5FZ1A 4QMAA 4L97A 4XBNA 5EXOA 2ADDA 4HK9A 1ZRCA 1VBD2 1CQ9A 4JAAA 1NKGA 2KR2A 2WFPA 5DAWA 3CJIC 4DNYA 5FLIA 5DN2A 2ZPXA 2LROA 2VZUA 4IV1C 4JRLA 4Q4V3 2W94A 2GNBA 2YHJA 4O9EA 2N7GA 5FJHA 4AI0A 4A3ZA 1QHDA 3DF0A 2WAAA 4KWUA 5DAXA 2CYFA 2J42A 3RJRA 2CTVA 3LPGA 2XVGA 5GLVA 4JDNA 2EIDA 2ARBA 3I59A 2FCVA 3I2OA 3CL1A 4WZCA 4XUTA 3T08A 3LZZA 4XUPA 2W08A 3WR0A 4COWA 5LWBA 2G4IA 2HWE2 4RSUA 1F31A 3AM2A 3KGZA 1VPHA 1JYTA 4IEWA 4LT5A 1KGYA 1RUD1 1US3A 3CDZB 5L19A 2RM22 3DKWA 5F32A 2NM1A 3IIAA 1XBFA 5JVVA 2VUAA 5F39A 2VUCA 4OUSA 3E6DA 4BQ2A 5CG8A 2YGMA 5I0SA 4G4FA 4I02A 2PFWA 3U4XA 1ZZ8A 2V73A 4NE9A 4H7LA 1TNRA 3OSDA 2R073 5CIRA 4I09A 3ZYPA 4DS0A 5JPNB 2VCCA 4CDUB 3KVBA 1V6OA 4EE2A 3A4UA 4EN7B 2AEZA 2YFZA 3H8OA 1H6YA 1OQEA 4ATEA 5FZMA 3MICA 1HN0A 1J1TA 2K9ZA 5FZ9A 2NZ9A 3LKJA 3WP6A 3EYPA 2ID4A 2Q5TA 4AG4A 1J1LA 3T2OA 1ZM1A 2J1UA 1G9CA 1CPMA 1YQ2A 2R071 2VNVA 5F2SA 1PO22 5FYYA 4BQWA 3HBKA 4BWOA 1W8TA 4KWLA 3MF9A 1JZ7A 2BNMA 1UMHA 2VMCA 1GZWA 1XQNA 2RS33 3E6CC 1NAEA 5BNOC 1W6OA 2XBO2 5IWFA 3WD5A 1FXZA 3VDDB 1GR3A 1WBLA 3VBFA 1VMFA 1ZBE3 1OHFA 4ZU4A 1OQ1A 1Y3TA 4RL7A 1BBT3 1GOFA 1DDLA 4GIQA 3Q8CA 4TYSA 3WP5A 1ULEA 2RS31 3KQRA 4ITCA 3ORJA 4YG0A 4LUMA 1RUG2 4QB1A 1S0CA 2WA4A 2OKXA 2JG8C 2WQZC 3KV9A 4EV0A 2UU8A 3SCHA 1S0BA 2UWCA 4HETA 2RR13 4OZOA 2VJXA 3HQUA 5KHJA 1VBC3 1ZBE1 2E32A 2VZ1A 2W91A 4LBLA 4XFAA 1OF4A 2VBBA 4PIZA 3GHNA 5DUVA 1KEXA 1K3IA 3I2GA 4TN7A 3LD8A 4QM8A 2PHXA 3EB7A 2HEWF 4P9YA 4Q2FA 2B7YA 2WUHA 3GZUC 3POYA 5GLWA 1TEIA 2W1UA 4GULA 4D7YA 4NUBA 1X8EA 2HH9A 2B5HA 3B00A 3FE5A 4M3CB 4DY5A 1VBC1 3ZR5A 1JZ6A 4XMAA 5C5TA 1O4YA 4NAMA 3JBG3 1O4ZA 5GZEA 1JU3A 4F83A 3VD7A 4KWJA 1H1MA 3IDEA 4HPKB 4BK5A 1WLWA 2IXCA 5FMCA 4IQPA 3FMGA 1H2KA 2BYVE 1SCRA 3IM0A 5JR2A 1GICA 1RUF2 2AACA 2B8MA 5JMCA 1K42A 2BU9A 5LASA 4YW6A 1H0BA 5JR7B 2OVUA 1QY4A 3OUHA 3WDTA 4AHZA 2R061 5K0UA 1NCRC 5H9PA 1WKYA 2JG9C 1VMJA 3LOBA 1W99A 3DV8A 5BNPB 1QJX1 4FOQA 1KS5A 5ABJA 3TRSB 3ZMOA 3O0VA 1DP0A 2WO3A 4ZS3A 3PDQA 3KF5A 4XVHA 4FSJA 3M3IA 4NMIA 3GF6A 1VBE1 1RUC3 4XURA 3U78A 2W1SA 2ZX2A 3P3NA 1GKBA 4AVBA 1LENA 1RUI3 4XBLA 1YFYA 1ENQA 1YFUA 3I2KA 4HVRA 4QGLA 3TAYA 3LQCA 1LOGA 5A3MA 5C70A 2WFF2 3MDPA 2JXAA 1RITA 2VGDA 4V1PA 4CDXA 1AX2A 2VOKA 5A3LA 3N9QA 1UO9A 2L9LA 4RFRB 1JHNA 1N1YA 3TEXA 2CWMA 2A3XA 1XPWA 3NWKA 4ZZ8A 1D2SA 2GN7A 2P1BA 3D0JA 4B4PA 4XABA 1RUC1 2VU9A 1JI6A 1H1AA 4AGGA 1NG0A 2CWSA 2QQJA 4UFHA 4XQ4A 3AP6A 5FREA 2OQ7A 5GZGA 4LBKA 4LIUA 4M0HA 3FLTA 4LO5B 1IG0A 4XIOA 1MS0A 3KT7A 1JMUB 1YJLA 4CP1A 2FMDA 1DCSA 2UWAA 2XPJA 3ZXKA 1YO8A 1EAH2 2R0HA 2VQ0A 2C1FA 5LCWL 2VW2A 2A6VA 3WDVA 3R0RA 1VAKA 2O8QA 3PNAA 4EN0A 5BY5A 2FDHA 4N43A 5JDBA 2JD4A 1SBFA 4XJUA 3ZFEC 5DABA 4FPKA 4N7UA 5FPBA 1GLHA 2WNUB 5ACA1 2WZEA 3WW3A 4DXZA 1MZ5A 1Z78A 4Q4Y1 1SLIA 4YVWB 4CU8A 2WQ8A 1KFXL 3OEAA 4N90A 1REFA 4JQTA 3UJOA 3VL9A 4BYYA 5J09A 2ZHKA 3ZKYA 4IE4A 4CUGA 1QH7A 1FOD1 1GWKA 1NUKA 4BM8A 3OTFA 1GNHA 4MGYE 2VXJA 4XUNA 3RZZA 3ENRA 5DQ0A 2VZRA 4ARYA 1W9FA 3L2YA 4GB33 2VY0A 1HB4A 1MZFA 1HB2A 1I5PA 2WNUA 5TSWA 2XUMA 2JDZA 2WLPA 5JXJA 4OULA 2VQUA 3CEWA 5LY1A 2ZHLA 1DQ4A 1R1ZA 1MQTB 4Q8LA 4F3JA 4QU1A 3VBSA 4FPOB 2P3KA 5D21A 1ND2B 3NJXA 2GU9A 4AFAA 4LBQA 1Y7BA 4E2GA 4K1YA 5A6YA 4I01A 3B7MA 1S1AA 4TLFA 4GB31 5C3SA 2IFWA 5C8CB 2W52A 3ES4A 2IXHA 2V4VA 4QDRA 3WUCA 5F6KA 4FQ4A 1J3PA 1F15A 4FTSA 1URXA 5FKCA 1HN1A 3OB8A 1KFUL 1OA2A 2PHTA 2QQKA 4I0AA 3N7MA 1OC1A 1GOHA 2CV6A 3IDAA 1HRI1 3FJSA 1AVBA 4AQ6A 3H1YA 3CO2A 2VBPA 2JDMA 1JUHA 3OEBA 1RUJ2 1NOVA 3CKHA 4ISRA 4UFLA 3MIFA 2XHNA 4XJ9A 2Q1MA 4XFGA 4LKFA 3S30A 4FOVA 3W20A 4GQ7A 1K45A 5A32A 1LEMA 1OXCA 4KU8A 4HOOA 1UWWA 3WF0A 1LESA 3A21A 1PIV1 1YWKA 4X6RB 5DUWA 3ZN5A 3AMHA 1OI6A 4FPEA 3U75A 2VECA 1R1A3 3SHRA 3PIJA 5EYYA 1HXS2 5KHHA 1XNDA 5FAXA 3ZLIA 5FO8B 4NIGA 3POJA 1LAJA 4QQPA 1LEDA 4YM0A 3POIA 1COV3 4GWMA 4KBZA 3CJIA 4TTGA 3HNYM 2VBDA 5D8AB 2ZGKA 1ND3C 4IV1A 3DKQA 3ZSKA 4GJYA 3ES1A 3UNPA 3H3ZA 1DYOA 5FZOA 5A7WB 4Q0QA 3ZDSA 1BQPA 2BWCA 3C2UA 1R1A1 3MV11 4RHV2 3ZFFC 1PNFA 3O0XA 1H9WA 2YG0A 1QJZA 1PMJX 1NXD1 2AUYA 3GCWA 1VRH2 3NV1A 4OYUA 1COV1 4OHYA 4JGZB 4K1ZA 3VUOA 1TMF2 1H2MA 3ZXAC 4PI0A 3ZYRA 1JN2P 2DCYA 1BZWA 1ZBA2 1WA6X 1ZYBA 3E5UA 5FLJA 1QNYA 3VHOA 1AYM3 3V0AB 2ZX3A 1HB3A 1GSLA 4MGSA 5C9AB 2OQ6A 1VBA2 1U5ZA 4V2VA 4SBVA 2A6XA 4CXWA 5FMOL 2RJKA 2PHFA 2O0OA 4HKOA 4IE0A 1WD4A 2HJIA 2Y26A 3UKTA 4CCEA 1OPOA 4QB2A 4FFIA 2D5FA 2JJ6A 3LSEA 2DUPA 2LM3A 2RJ2A 3MLKA 1OOPC 1YQ6A 5F7UA 4XC9A 1NZIA 4R9DA 2PHDA 1AYM1 1LECA 2C9AA 2RDNA 2Z4FA 3AK0A 1YYNA 1B09A 1QOSA 3CF6E 4HZFA 4B1LA 4OCTA 1CONA 3DN7A 5HV4A 2JEMA 4FPHA 4M01A 4H2AA 4K20A 3HQXA 4HT1T 2Z79A 4N53B 2WNOA 5IJRA 1LOEA 2YC4A 3H1WA 4Q0PA 3ZM8A 4UBGA 2IXIA 4Q4W1 3GDBA 5A1FA 3K4ZA 3HWJA 4BHPA 1Z7S3 4PBOA 4YGEA 1OKQA 1V00A 3M3OA 3MIGA 5AVAA 5BNOA 1W8HA 3N36A 1NLRA 1WW5A 5FPXA 3ACHA 5E89A 1O3SA 2J1VA 4JTOA 4QWNA 4NPLA 4BQ1A 2FHRA 1UAIA 4INDA 4MXWB 4XAAA 2ARCA 3TBDA 4XBQA 1UZVA 4NIHA 1QQP2 4J25A 3VZLA 2CDOA 1GNYA 4AYUA 1Z7S1 1J3QA 1KQRA 3DYMA 1GZTA 4C91A 3KHCA 2EIBA 3Q8FA 3C3VA 1UF2C 3KS7A 5L7OB 5A3WA 5IVBA 2JG8A 1RYYA 1QEXA 1OD3A 2WZR1 4QT6A 5DZGA 3VKOA 4AVCA 1F4AA 2D6NA 2PAMA 5FYBA 3EMRA 4BZ4A 3BTYA 4Z07A 2DVFA 2VMGA 4RS5C 3AYCA 2CAUA 1YFXA 3TYJA 1FPN2 3I54A 4FO9A 2NN8A 4NOTA 5DUXA 2CGPA 2Y6LA 5IUQA 5KHIA 4A3XA 1W9SA 3V64A 4JKMA 3ZSEA 5C8WA 2ZMKA 3RWNA 1RXGA 4XYXA 1B35C 5CVRA 5B4NA 4JHZA 1N1TA 4BMBA 3OGRA 4ZY9A 4AVSA 5I8TA 2D3PA 4Q29A 4RYDA 2DUQA 4IEOA 2GC0A 1TME3 1OA3A 1UCXA 1JTZX 4YVSB 1XNKA 4UW5A 4P9JA 1H2LA 4AE2A 2Y6KA 1KDMA 5FBZA 4UFIA 1NY72 3LF7A 4WM7B 3IWZA 1LB2A 3IAPA 3WDWA 5FO9B 2HWB2 2YBPA 2VD7A 3DEMA 3ROUA 4PDWB 1SBEA 3KF3A 1N1VA 1V9U1 2XXZA 1LNSA 1QNWA 3HN3A 4UF0A 4A42A 4MYEA 5AVPA 2EVXA 4LMFA 2RS53 5C5UA 4DUWA 3GJBA 4UXAA 4CZSA 5FK8A 2AREA 5DAQA 3IB3A 2ERFA 1NCRA 4Q1RA 5GZFA 2JG9A 4IESA 1QJEA 1RVF2 2FDJA 3ZXLA 2YZ4A 3ZXGA 2QJVA 4XE9A 1C3HA 3ZN6B 1IOAA 4QGNA 4S2GA 1DQ1A 3MFAA 3C7EA 1XNAA 2XR4A 1LJ7A 4OI1A 1RUH1 4WVMA 1HRV1 2RS51 4RGAA 2WNVB 1PNGA 2VUJA 3IN9A 3WW4A 4CP9B 3ACFA 4DEQA 2DURA 2WS93 1QJY2 2H6CA 3EJKA 3ZO0B 2XL9A 1UXZA 4WVWA 2QQNA 3EQEA 3HR9A 4LQRA 1QXRA 5H9RA 4CDWC 4XJ8A 1AR82 4JV4A 4JGYA 5JZGB 2DBNA 4KU7A 4FOWA 2GSYA 1EPWA 1WMXA 3LFMA 5CFDB 2HWC1 1GP4A 1RHI2 3U37A 2BRTA 3O14A 4TSVA 3ZPOA 2ZZQA 3KWVA 1ASJ2 2C6SA 5C3PA 2GMMA 3RZKA 2E7QA 2Y6GA 4AQ2A 1UOGA 3GGLA 3K46A 4Y5TA 4LO4B 1IKQA 3DXUA 4QPWA 2GP3A 3ZSLA 5I0DA 2ZAHA 4RA0A 1O5UA 3LDKA 1D4M1 1VBB3 5A6QA 1D7PM 2J1RA 3MLLA 3NAPB 4C1XA 3ZFEA 5JWPA 5JSOA 2ILMA 4O65A 5EHDA 4KGGA 5EJZB 2ZS6B 2A75A 2PYTA 2XJPA 4RR3C 2YC0A 2ZGUA 4Y22B 3S5AA 5FMBA 2D3RA 3PLQA 4CXXA 4YM1A 5FPUA 3S6PA 2GP5A 4HKLA 3VZJA 4HSJA 2E31A 3WNPA 3NW4A 4IEUA 4CCOA 3NJYA 5A3UA 4KBBA 2VNGA 2GNDA 3IDCB 1W6PB 4HK8A 1ST8A 2WKKA 2WNEA 3AP7A 3QH7A 5LB6A 3W58A 5LA1A 1F4HA 3VZOA 3KZ4C 1PHMA 1LCLA 1PGL1 5A3NA 5ABJC 1CESA 3V65A 1PGW2 2R49A 1FMD3 4DZGA 2XB6C 2W0XA 3VBHB 2BQPA 2VZPA 1V6NA 4L11A 1GQGA 4IUGA 5FP3A 1HJFA 1HV0A 2IZWA 3A0NA 3ZVXA 3RZLA 3I97A 1ZX5A 3SH5A 2VW1A 2HWF1 3D4KA 5A33A 2XL7A 2Y0IA 3JU9A 2ARAA 3PIGA 2YU2A 1XOYA 4L99A 3ZKUA 4YGDA 1D4VB 4P9IA 5IK4A 3H7YA 1NCQB 1DGRA 1FMD1 4WVZA 3WCRA 3DYOA 2X53S 3RZJA 1W28A 3HOBA 4CDQB 1YIFA 4NO4A 1KJRA 4Q4X3 3VBUB 2ZGOA 2FDGA 2RS13 3MFCA 1X82A 5D2AA 4DEVA 4EN6B 1G7YA 3K48A 5C3OA 3USUB 1S2KA 4M0NA 1BEV3 1KD7A 2VAUA 1LOFC 2W92A 4KH9A 5DZFA 4X8PA 2HYXA 4JZRA 3NL1A 2DCTA 4XETA 5A70A 2FD8A 2Y33A 2XLAA 5FCCA 2HWD3 3PUHA 4A6OA 1V6LA 3PMEA 3ZYHA 1JZ4A 4GJZA 4NROA 1HB1A 1SHWB 3E6BA 2FZ1A 1ND3A 1TVGA 3MBWA 4QX7A 1Q8VA 1R082 4XACA 5E1RA 4AFCA 1ZRFA 1GYKA 5JI9A 4RQPB 1YLLA 1AYN2 5FXVA 4W65A 1ZZ7A 3PURA 3RDIA 1BK1A 1JOBA 3ZFFA 5FLHA 1RUOA 1ULFA 2DVAA 4KG8A 3BU7A 2BNOA 3MV01 2I45A 2ZHNA 1RUE3 3BYWA 5G05L 2D40A 4QXBA 4ZPIA 4D6RA 2QDNA 3H8RA 2G9FA 2YC2A 3FLPA 4GXLA 3BI3A 3AMMA 2Y0OA 4LA2A 5F5IA 1YQ5A 4ARXA 3AP9A 1WCKA 3VBRC 1UY2A 3JD72 1WW4A 4CEWB 4D69A 4Y20A 2JD9A 4S2DA 5C7GA 2ZKLA 1DBNA 1MR5A 1RUE1 4XMIA 4LK6A 3BOWA 4WZFA 1ZRIA 3CJXA 4A6SA 1CN1A 1K5MC 1RINA 1YRZA 2B42B 4OZXA 5I8YA 5KXDA 1OOPA 3O1MA 3PVOA 4R9BA 1JW6A 2LALA 3JQWA 1SG3A 2RHPA 4R52A 3H7JA 3IMMA 1YXWA 1RMU2 1U5IA 3G6JB 3J8F3 2RMU1 4XW3A 4D6QA 1WZXA 4S2HA 4XF0A 2ETEA 1AR61 5FTTC 4K3UA 4P5HA 2P4EA 2BJSA 2ZACA 3BODA 3GCXA 2K0GA 3SH4A 1IKPA 4C0BA 2QQPA 4AL9A 3F2ZA 5FKBA 3WX5A 5JOWA 1G6NA 4NWVA 2P6HA 4QHOA 5GM0A 1UY0A 2WLQA 3AZWA 4B7EA 3S0MA 5JI7A 3NNFA 2WQ4A 1JS9A 4EJRA 4DUVA 4U2AA 2BGCA 3J8F1 2XONA 3THPA 3ECQA 3NV2A 5GJ6A 2PLV3 2WSVA 3SC7X 1CAVA 4AFMA 1UPSA 3PVEA 5LA0A 1AR93 2D6MA 1C8M3 2JDPA 1DG6A 4HL0A 3TN93 4C90A 3BUCA 1C8NA 2GNMA 3K4DA 1S0DA 1KJLA 4CCCA 1UZWA 3H9AA 2X5IC 3I59B 1PO13 2J1TA 3QH6A 1W2NA 4TZDA 1W0OA 3HN1A 3M1HA 5D1IA 3INAA 1UMIA 4OVEA 4DUXA 1AXZA 1B35B 5JCTA 3OF1A 4PLOA 2VO5A 1MS5A 2BNNA 2QQUA 2DBIA 2WWUA 3WW1A 5IVVA 3S5QA 1NXMA 5FK7A 2PLV1 1RUD2 2X8KA 3NKGA 1Q8PA 4Y4RA 4RS5A 4ASMB 1QDCA 4UT5A 4V2WA 3H42B 3HT2A 2UYBA 2VCAA 4BA6A 3P1IA 4KGQA 3ZXEA 1PO11 1F35A 1VBD3 2AENA 3U1XA 4Q4V1 5LBBA 3THTA 1B35A 5JOYA 1UYXA 3FUOA 1VIWB 4QKDA 4CUAA 5CFCC 2WAOA 4XPVA 1NLQA 3VBOC 2D5HA 2XOMA 4XJAA 2ZMNA 2A7AA 2J22A 4AVAA 1ACCA 1HIXA 5HI0A 5FXWA 4P9WA 4JX0A 1CAWA 4NHMA 3IBMA 4YZ4A 3TOJA 1JZ3A 1W6QA 5C33A 1YEWA 2VMHA 4Z2AA 3AC0A 3DPRA 2ZGMA 3I2FA 5LA2A 3ACLA 1V6JA 2VOXA 1IZ3A 3M3QA 4YWAA 2PHWA 1DQ2A 2HWE3 2Z2SB 4AEDC 3ZYIB 4DMIA 5J96B 5IATA 1GZWB 3H3LA 1IS3A 4W8JA 2RV9A 3HT1A 1W6OB 2RM23 1JYNA 2BFUS 4CEYC 1AZDA 1S0GA 2AGSA 3PUAA 5IAVA 1W8FA 1WCDJ 1BLZA 2XLFA 3VBFB 2VZOA 3X29B 1VMHA 1XYNA 4QX1A 4XAEA 4HKWA 2YDEA 1ONAA 3NVCA 4K7JA 3FHQA 5DAVA 1GBGA 4YW2A 3V56A 5F6LB 2Q1FA 4BJ0A 3AZZA 4K21A 3RQ0A 2RS32 1X33A 3BPSA 2YU1A 3OYWA 3MW4A 3POSA 2Q8DA 2WO1A 4N9HA 3OPWA 4DB5A 1IPJA 2VPVA 2YGLA 4K8RB 4NN0A 4BDVB 4U36A 4K8FA 4E4SA 3FFQA 4CDWA 3UYJA 4IL7A 4EZ4A 1VB2A 5HCBA 1GWMA 3KM5A 1W6MA 2PAEA 4JHTA 1NQJA 2OYZA 2FCUA 2JDNA 3U14A 1AX1A 4GMP3 4YRDA 3AYEA 3OOXA 3RYRA 4MGQA 4GH4C 1UXXX 1OT5A 1OFNA 2XBO3 3HQRA 3N4MA 1ZZ6A 3OGGA 2Y34A 3K51A 4O9GA 3QBQA 2O1QA 1FV3A 2XJSA 3IAQA 5A80A 3WDUA 5JAXA 3W21A 3VHRA 4LE3A 1BBT1 1DQ0A 2AYHA 1YUDA 3M70A 4X8NA 2ZGTA 4MVTA 4R4XA 2FZ2A 1JXNA 1PX4A 1DU3D 1XYOA 3LSDA 1VE0A 1UX6A 4A41A 4FOYA 4GMP1 4AGVA 3O1VA 5FP9A 4AEMA 3VKNA 3FWEA 1RUG3 1SPPA 4RR3A 3PUQA 2R7EB 5JPMB 3RZHA 2RR11 5K0UB 4QDQA 2WWJA 2A73B 3UKVA 1F2NA 2R062 4LBQD 1SLBA 4LITA 1PK6C 1SDDB 4R8HA 2XKOA 3AL6A 3JUUA 2MNGA 4NVPA 2NP0A 3TNPB 4UYBA 5ABJB 1WCSA 2BERA 3AZYA 1QJX2 5I8SA 1UL9A 3HBZA 2C9KA 2NQYA 4CXYA 3AL5A 5FJKA 2F6BA 1GMMA 1VBE2 4DRRA 1WMEA 3WEZA 1FV2A 4AEKA 4BQ3A 2QBXA 5E6HA 3AKRA 4EN9B 1WLTA 2DYCA 4GALA 2X05A 5FYHA 4CDXB 3JBG1 2MPFA 4OQ8A 4FTBA 3OPZA 4LKEA 2JB4A 4QKBA 4Y4YA 4ORFA 1QWRA 4E8CA 3LFIA 4OFGA 4YG6A 5JXIA 1LOAA 2QE3A 4QKNA 1W2OA 5HCHA 3OGJA 4HSLA 1SLAA 4QHBA 2V4AA 3UGFA 3O1TA 1RUF3 4QX2A 1I1EA 2Q30A 4QQHA 5LK7B 3LCPA 1MS9A 1SCSA 3T0BA 4UAPA 4HANA 3B5LB 2GC2A 4OI0A 4XDQA 4M4RA 4Y1ZA 4RGGA 5FZ4A 3J4UH 3PVNA 1A3KA 1LHWA 2YMZA 5EP9A 5FUIA 5F9TA 2BWAA 5JSRA 3FBYA 1RIRA 3POWA 1Q8OA 4JGYC 4OHWA 1W2AX 1JZ8A 2JWPA 4TLGA 1OLME 4N43B 2DCKA 3KCXA 4D0QA 5KXCA 2OZ6A 4ZZ5A 1SLLA 2XJTA 3K75B 5GLTA 1RUI1 1EUTA 2DU1A 4OHXA 4J1XA 4UBHA 4YW1A 3RI8A 4H55A 2UURA 4COZA 4E2QA 5A3OA 2JE9A 4LHKA 2FCTA 2H6BA 4MHRA 3SQOA 1LOFA 3WG2A 5ANNA 5ACA2 1AL0G 2WFF3 2XUEA 4LULA 4Q4Y2 1QKQA 4Q0VA 3AKPA 4UOJA 2VMDA 1OFSA 2NPIA 1G9DA 1Q8SA 2ZGPA 1OA4A 1FOD2 5FO7B 2Q4SA 2BPA2 1E5SA 4COUA 5C71A 1G8WA 5CEHA 3VHPA 4IEVA 3KV4A 2D7FA 3FZ3A 3OBZA 2D6KA 4FQZA 4LTAA 5EWSA 5LBCA 5IVCA 4ASLA 5J3UA 1C1LA 4BPZA 2WBKA 1QU0A 3M2MA 4NRPA 1GP5A 3WUDA 3AMNA 3FBMA 4META 3VBSB 4K40A 2P3IA 1YC61 3CIHA 4IETA 1IS6A 5E88A 3V0BA 1BHGA 4LBQB 1EAH3 4D6SA 3I2IA 2Z5WA 1O8SA 1VR3A 4MXVA 2JDHA 1Y4WA 4PI2A 3ST7A 4XFIA 2XQXA 3FUQA 1W6NA 1XNTA 2XWBB 3L9JT 4NIDA 3A7QA 1XSRA 4LE4A 5BNNC 1IS5A 4I0BA 4XDPA 4GB32 1OH4A 4WBBA 1NA1C 2EXJA 3K77A 1OVSA 1X9TA 2WDBA 3VBRA 5A1AA 1DGWX 3K2OA 5CAZA 5BUVA 5CKQA 3NJVA 2J7MA 3AKQA 1YCIA 2WN2A 3UETA 4Z2WA 2DDUA 5KHGA 4LORA 5FYUA 4DRVA 5FPVA 1HRI2 2DFCA 3EBRA 3CU7A 2C5DA 1NT0A 4WM8C 4L0PA 4IERA 1D0GA 3VDBA 2PTMA 3GZAA 1K5MA 2W46A 4XXAA 3MW2A 4XCBA 1WCQA 2LUWA 4FT8A 4XZPA 2JENA 5A32B 1TG7A 3WF3A 3J9SA 1W05A 3ITQA 4QHZA 5HPOA 4A7KA 1AF9A 4EWDA 1MZEA 1OD5A 1POV3 5CYYA 1DGWA 1PIV2 4N8MA 3WSOA 5T5OA 1DZQA 2ATFA 3CZJA 3SKJE 1DYPA 3AVRA 4HN0A 3IDBB 3CJIB 5FZLA 4I30A 3I49A 1A78A 3BTZA 1J84A 1HW5A 5JOZA 1PVC3 4IV1B 2XJQA 1CAUA 4QX8A 3PHMA 5FZOB 1PZ9A 3WDYA 4K9SA 4D7TA 2OA2A 4FP3A 1POV1 1YNAA 3GJAA 2VCBA 4CCDA 1A8MA 4LO8A 3NNGA 1GWLA 1UX7A 1IS4A 3SCFA 5C4WC 4UWDA 4CCKA 1R1A2 4BQ4A 3SEPA 4AI8A 2X5IA 4DY3A 4QM9A 5KR7A 1RUJ3 3LIGA 3BTAA 1COV2 1PVC1 3WDXA 3NO8A 1H4GA 3MIDA 4J1WA 1OKOA 4QXCA 1LOBA 2BGOA 4ZU7A 4XTPA 3NQHA 4HLTA 1GNZA 2WC2A 2ZGQA 2OX0A 1WW6A 3HD8B 4R9AA 1LU1A 1QJU3 1AR72 1ZVFA 1TZOA 3T4HB 3ZPYA 2QZ3A 1ZNPA 2P34A 1HXS3 3O12A 1S0FA 1D2QA 1G86A 2CGNA 2VXRA 4XZUG 2AH2A 1MEC2 3ZFGA 5LZ6A 2ARXA 3HNBM 2V5YA 1ENXA 5CFCA 3FLRA 1QOTA 2Q8EA 4G9SB 1ODMA 5F5AA 5L9RA 3VBOA 1SFYA 4DINB 4LBMA 3WHTA 3I3QA 1PM7A 2ET1A 2OPWA 2PMWB 2YFUA 1DIWA 1QJU1 4BQYA 3SMHA 1RXFA 2GMEA 3PVBB 1HXS1 4XIKA 1QDOA 2RE9A 3VKFC 4MV2A 2Y6JA 1VRH3 4E9KA 1N3PA 2LS6A 1TMF3 3J26N 2PQSA 1IQDC 1CX4A 4HONA 4QPIC 1Y43B 4QAWA 4XTMA 3WW2A 4AEDA 3L2HA 4Q4W2 1ZBA3 3RWKX 4CCJA 5F37A 5F1RA 5A7QA 5FP8A 2ORZA 5BNOB 3D8CA 3IPVA 2WT1A 4Z82A 1ZREA 1BMV1 1TQ5A 1NZCA 3LEGA 4CEYA 5FQ0A 2VMEA 1Q8QA 3OY8A 1ULGA 1VLNA 1VBA3 3PJQA 1CGPA 1MS4A 1BKZA 5DG2A 2V09A 2E6VA 3WHUA 3WF2A 2TUNA 2VQTA 1MS3A 3WOGA 5IVJA 1W03A 2PHLA 2WO2A 1ZA4A 5T5LA 4IEXA 3T09A 2BV4A 4A44A 3BTXA 4LUKA 5FYVA 3T0AA 1Z7S2 2OZJA 4KG0A 3R6SA 3VKMA 4AW7A 4ZHNA 4IV3C 5F5CA 2JG8B 2R0FA 4QX3A 4YG3A 1S55A 1L3JA 4AVTA 4MX3A 4YW7A 2WZR2 4XILA 3D82A 2QNKA 5FPLA 3VD4A 1IHMA 1W9WA 1XC6A 1CJDA 2DF7A 1CZVA 4FTEA 3MO4A 4H7MA 4XOGA 1NYWA 5IVYA 5EQUA 2GNTA 2ZEXA 4Y3OA 2D43A 5J37A 2GC3A 2VNRA 3KSCA 3M8LA 4GH4A 2ZX0A 2WYSA 1EPZA 1C1FA 1J58A 4IDZA 2A3WA 1JUIA 2YPDA 1FNYA 1MS8A 2PQQA 1RGSA 4CU6A 4QU2A 2E7AA 5FIXA 4NAOA 1SBDA 2VOTA 4OHVA 2P5BA 3VHNA 1XU1A 3GBWA 4FVVA 4ZKTB 1LTEA 1G9BA 1UY3A 1FATA 1V6IA 1S0EA 3NKTA 5DDJ2 3ZYBA 4NJ4A 4PT6A 4UF0B 4WVVA 4IEYA 1V9U2 2ET7A 3J7NA 3WV6A 2GH8A 1T6BX 2CU5A 3O5SA 3PL0A 1NCRB 2JG9B 2JIJA 1PK6A 2ZABA 3BN6A 3W5MA 1GFF2 1FPN3 3E1F1 1WUVA 2SBAA 1QJFA 1ZZ9A 3OUIA 4P02B 4E4ZA 3DPRC 2WR9A 4FCAA 2LW8A 3HPNA 5FMOS 2Q1ZB 4HN1A 1LHUA 1LOCA 2P3JA 3NV3A 4RGKA 4O7XA 4WVMB 1TME1 2DCZA 4HXCA 3RMXA 1RUH2 2A6YA 1HRV2 4M00A 1BJQA 5FP7A 2W3JA 1I3HA 5IK8A 4KL1A 2RG4A 3G7DA 4ISQA 4BB3A 1VAMA 3RMYA 4FPFA 3AJZA 4Y1XA 4YW5A 4C8DA 1FPN1 2D97A 2ZTNA 1WW7A 2NLRA 4LHSA 5A3PA 2V5DA 5LRSA 3TEZA 1E5IA 2VTXJ 4JGYB 2QVSB 2HWB3 2K46A 4XFBA 1YIPA 4YPJA 2D98A 3AMPA 2HWC2 3RJ2X 1SDWA 1ULDA 4GZ9A 4ZS2A 2YY1A 1W2TA 5A7NA 2ZX4A 3RYPA 2GALA 2ZA9A 1AL22 3AP5A 1Y9MA 1H8TA 2QQVA 3T2TA 1JH5A 2C26A 2GH2A 3I2DA 4HMZA 2YXSA 1LRHA 2D3SA 1RVF3 4NHYA 5FZ6A 5FUNA 4O61A 2R042 4YZ3A 1D4M2 1MS1A 4Q27A 3CZUA 5HV0A 3ZFEB 4CDUC 1J83A 4MHUA 2EXIA 3DYPA 1F5JA 1K5JA 2E26A 2WS91 4FPLA 4BU2A 4QD2A 3DCQA 4MADA 3W9AA 1UYZA 3ASIA 1W0NA 1CVNA 2OXBA 2Y60A 2PA7A 1LODA 1IPKA 5ERLA 5J7MA 4Q26A 5KC5A 4FAGA 2G9ZA 5FYSA 4COVA 3KCYA 2Y8KA 5DUUA 4LXLA 4PLNA 4L9BA 3OD0A 4YFWA 1AR83 1XSQA 2QTWB 4UW6A 1S2EA 3BCWA 3POGA 4XF3A 4BMEA 5FPZA 1D0HA 2VTFA 1RHI3 4XF4A 4YARA 3KLSA 3AKTA 1VJ2A 5KXBA 1U5YA 1ASJ3 4E2SA 3TEYA 2XJVA 3TWIA 1UOBA 3N7LA 3E97A 5FZDA 5LK5A 1XJAA 2YBSA 3BB6A 2A6WA 3VDDC 4A7YA 3WLUA 1P8JA 1UNBA 2AEYA 2VCMA 1VBB1 5CA6A 1PGL2 4AVVA 4FP2A 5FRAA 5BNNA 2R1DA 5FDBA 1WA4A 1RHI1 3GBFA 3CHXA 5L36A 2BVBA 1NA1A 4GMP0 4XQWA 5DXDA 1ASJ1 2RJLA 5AC92 2BVVA 4QPGA 2JE8A 5A33B 2F17A 3NV4A 2E9QA 2HWF2 2JDKA 2ES3A 2EXKA 4G3YC 1GQHA 1MVQA 3M4FA 2EIEA 2EXHA 1EYBA 4WM8A 1N47A 4I3PA 1OSGA 1DGRN 1L7RA 4OLLA 5FXZA 3RZMA 1GP6A 3P3PA 1OLQA 5CADA 4MLOA 3LEKA 4P9LA 3N7KA 4Q1PA 2X29A 1N1SA 3CNAA 3MLJA 1EV12 4QX0A 2B39A 1H1IA 3ETQA 4CSWA 3WNNA 4CPBD 1PZ7A 2QQIA 3DGTA 5B4XA 3LE0A 2WWSA 4JDOA 2QUOA 3EHKA 3S7IA 2ZXQA 4N7IA 1E57A 5IW0A 1KRIA 3KV5A 2R32A 2CNAA 2CAVA 5LBFA 4AHYA 1CZTA 2XKPA 4I3GA 1ND3B 4LR4A 5FZKA 4FBFA 1RC6A 1OF3A 5FZ7A 2OPKA 3WG3A 4B8EA 1JZ2A 3Q8AA 3A22A 5APAA 3W59A 2EF6A 1APNA 4PQQA 4AQSA 3ZFFB 4PF1A 5C4WA 1R093 2BBVA 3MPBA 2R6QA 3HIFA 2WO7A 4M3CF 3WNOA 2TEPA 3ZX7A 4AI3A 3T1MA 4DIQA 1ULCA 1V6KA 2W9XA 2ZAAA 5BNPC 1O8PA 3WVJA 2DFBA 4A7ZA 4Q4X1 1AXYA 4B4RA 2RS11 3ZDVA 4AOCA 2GZWA 5F8PA 1HQNA 4XDOA 1KITA 2CDPA 1BEV1 2C0ZA 3VKLA 3O1PA 2BOJA 1BYHA 1R091 4Y20B 2HWD1 4DXTA 3ATGA 4LHLA 4OHZA 1N3QA 4B7KA 4Q8KA 4CVUA 3AKSA 1DZRA 3T2PA 4GWIA 3DECA 5FZ0A 1R64A 1RUE2 3LDRA 4IW3A 3ZIWA 2EIGA 2RVAA 5CBLA 3LOIA 2MEV2 1X50A 1OOPB 4KNCA 5K8SA 1FYUA 1R083 3OCPA 2VVFA 3QOPA 4B4QA 1SFPA 2VM9A 4NHXA 1AYN3 2RMU2 3GBGA 4EROA 1JBCA 1AR62 1STMA 2C24A 3PU8A 1XE7A 2XMLA 1AXKA 4XCAA 4EN8B 1YQCA 2VC9A 2HEVF 3BKZA 1VALA 3KGLA 4PF5A 1UD1A 4QPIA 4J6GA 2QDRA 2A71A 2KXLA 3B93A 4DXSA 2RDQA 4AXOA 5F3EA 1CIYA 3H8UA 3N35A 5FZ3A 1OMIA 3JD73 1CAVB 3O1OA 4MO3M 1BVVA 5FPAA 3T1LA 4EQVA 1W06A 4YVWC 5FP4A 2WRAA 2A70A 2AZ5A 4Z1VA 3H0OA 3VV1A 2BGPA 4LBJA 3WXPA 4AZZA 4FPGA 5CNAA 1Q43A 2A3YA 1HJGA 3PTRB 3R4UA 2PN5A 4HVQA 5CZKA 5LY2A 5FFOC 5FYZA 4C0HA 2P3YA 4IE7A 4IV3A 2BP6A 3NSTA 5EJ3A 5F5QA 4JKLA 5L73A 2ZEYA 1RMU3 2HEYF 2PLV2 3OBTA 4P9GA 4RS5B 2VZSA 1MQTC 4D3WA 3LWCA 1ND2C 3AYDA 2BUKA 5T5JA 3AYAA 2GMPA 4NHKA 3O0WA 1DGLA 3OBAA 3ELNA 3OGVA 3JXSA 4BQXA 1PO12 1SLTA 1SMVA 3D6EA 2YBKA 5C8CC 4Q4V2 4XFHA 4BXSV 1SLCA 3LAGA 3JZVA 3NRUA 5FOJB 1WLDA 5EPAA 3T3YA 1UZYA 1AR91 1C8M1 4FPYA 1PMIA 3TN91 5A6ZA 1POV0 3I8TA 4Y5Z0 5C3QA 1CAWB 1W6QB 2IFRA 2LRPA 2J1AA 3C7GA 4KWKA 3TNQA 4AQTA 2DWRA 2W1WA 1PM4A 3VLBB 2BEOA 3ACIA 2IXJA 2OW4A 3DPRB 2E51A 3ZFGC 1AJOA 1OUSA 4LPLA 4PIXA 2ZGSA 1IPSA 1MPXA 2VQAA 4IEPA 4PBPA 3RRDA 4XXPA 3S7EA 1HQLA 4ASKA 3WF1A 4JKKA 4PCRA 3RI9A 3ZR6A 3AB0A 4BQ5A 4KQ7A 5FY7A 2UY9A 2WABA 3R4DB 1RUD3 2Q8OA 1LGNA 1UOFA 3I4IA 5A6XA 2Y38A 1O5LA 5A7PA 2B45X 3I7DA 5FYTA 1FAYA 5LBEA 4NIAA 3VGIA 4CUCA 2JIGA 1LGCA 4NR1A 5FY4A 1VBD1 4YZ1A 4AHWA 1XB9A 1GU3A 3I3BA 4ATFA 3N3HA 2R072 3B3QE 3HNMA 5D8AC 1RB8G 4IE6A 3LB9A 2XQRA 4QPYA 4JVAA 2XVLA 3FX3A 3OYWB 2G19A 4NRQA 2ENRA 5JXHA 1OVPA 5LA9A 1LU2A 1O91A 5IVEA 4AGRA 5KWRA 4QQ2A 5IAXA 1O3QA 2W87A 2PXJA 4MGKE 1S0JA 3WF4A 3AXEA 1W3XA 3BOPA 4AI9A 4CDWB 3Q8EA 4DXRA 5HCAA 4XF1A 4JGZC 2HWE1 1KDKA 4OMCA 1W6MB 5FZCA 3RGBA 3U4SA 3PU3A 5SV8A 1JYWA 1ZZBA 2RM21 3EO6A 3N9NA 1ZRRA 2H0VA 2R30A 5CKMA 4Q0UA 5BPXA 1UYPA 2XJUA 4LOTA 3I3EA 2Y6FA 2P37A 1JYXA 5T52A 5C9AC 1KS4A 4YW4A 1ZBE2 4PJYA 3JB8A 4B29A 1ULOA 3WP3A 4UW3A 1BBT2 1PO23 3PUIA 5A1LA 1GOGA 1X8MA 4NHLA 2JDAA 4CDUA 4R4ZA 1O3TA 4IGOA 1JYCA 2EAAA 1SPPB 1UY1A 3GZTB 2ZBJA 1SFNA 4RN5A 1W04A 2OIIA 4FXGB 4RR3B 3WNKA 4E8DA 4MZUA 2GDFA 2DVDA 1CJPA 2RR12 2VG9A 3C7OA 1VBC2 3UKNA 2O14A 2B9VA 5FZEA 5FZBA 2ZGRA 4P00B 1F9KA 1OBNA 1PO21 3AZXA 5IFPA 4N53C 5FWJA 2ZCWA 1O7FA 3D3AA 3OPTA 3IT8A 3VZKA 4AWDA 5HXMA 5L9BA 1O4TA 4ONUA 3SKVA 2WT0A 4ZXKA 1UPIA 2FQPA 2XBO1 3DL3A 3WINE 1U12A 3B9CA 1E5HA 2QQMA 1JU4A 1WMDA 3VDDA 3WQ7A 1ZRDA 2W2IA 1T6GC 3JBG2 4QXKA 2PAKA 2ZX1A 3N7JA 3W5NA 4COYA 4ES9A 1H9PA 4YZ5A 3N9LA 3GXUA 3NJZA 3URFA 1RUG1 3ZIXA 2NMOA 3JB4C 4YGCA 2MHFA 3AVSA 3ZYGA 3FL7A 5L7OC 1JYVA 1DLLA 3FFZA 3AMQA 1WLCA 3HVDA 2VL4A 4JQRA 4MUVA 4LBNA 1A6CA 4OI2A 3AJYA 2R063 3SH3A 4BLJA 1CZSA 3I2JA 4DOUA 2W47A 1FI2A 1LHVA 4DPNA 5IVFA 1QJX3 3C7FA 2ZEWA 2JE7A 3B9IA 4FI9A 1RUC2 1Z0HA 4JRAA 3UGHA 2VVEA 3LA3A 5A7OA 4L92A 1VBE3 2C4XA 1RUI2 4CCNA 5EIYB 1J3RA 5SV5A 3QD6A 4UFMA 2UWBA 4FXKB 4XF9A 1T2XA 3LEMA 1H8TC 2EA7A 4W50A 3TEWA 1UZ0A 1XU2A 5F3CA 2JB8A 4M3CA 4YVSC 5FUPA 1UYYA 1Q3EA 2WJSA 3J7HA 4Z92B 5AFEA 2YROA 4WM7C 1CAXB 1UOJA 3ALQA 4HPKA 4W6WA 1RUF1 2VOWA 5BXXA 4GWNA 4XUQA 3RS6A 4PDWC 4FFFA 1DYKA 4UW4A 3IIIA 4PHZA 1ENSA 1REEA 4LA3A 2WL1A 2FDIA 4RFT0 1YHFA 1BXHA 2YUEA 2JDUA 3MW3A 3LGRA 2RDSA 5LW9A 1QIQA 3KD4A 1IGOA 4YFZA 3IZOA 1HQWA 1NE6A 1SEFA 5T3NA 3V0BB 2GAUA 3AFGA 3KMHA 5CU1A 5BNPA 3QCWA 2XJRA 4GA9A 4YM3A 1CAXA 2D44A 3Q8BA 4GAZA 1W6NB 2OUJA 1YI9A 5H9SA 1Q56A 4JC1A 2W68A 2OUHA 3NNMA 5H9QA 5FZAA 2AC1A 1S4CA 3VBRB 4MOAA 3VD9A 3MF6A 2WNVC 4HG6B 3SXWA 2WFF1 4IGQA 5ACA3 4Q4Y3 1UZZA 2SLIA 3ME2A 4CE8A 2CHHA 3VN4A 3B02A 1FOD3 4C1WA 1AX0A 1K5MB 1LGBA 2VH9A 2UY8A 2W5FA 3P5BA 1DZTA 4MH0E 4NWWA 3TB0A 5CISA 4CTEA 1RTVA 2D93A 2DUOA 5JZGC 5CFDC 3SITA 1EUUA 3ZMNA 2ZJCA 3WP4A 2IXLA 4QPGC 3P6BA 3SNMA 4MSVA 4AI1A 5JUVA 3N9OA 3PUSA 4EYUA 2ADEA 4Y24A 1C4RA 4Y1VA 4OQ9A 2E63A 4BIFA 1EAH1 2TNFA 4OMDA 3MHZA 2F4PA 3A23A 3AFKA 4BE3A 3ILNA 3M3CA 1NQDA 3KT4A 1U5XA 4NIIA 1JOJA 3QACA 4CP2A 1CAUB 2DV9A 3NAPC 3KT1A 1I9RA 1HKDA 1VB4A 2JX9A 1UW8A 3THDA 1XNBA 1MACA 4LNVA 4TXWA 5KHKA 4ET7A 1J59A 4YVWA 4IEZA 4GD4A 3ZOIA 3HEIA 1SZBA 4AFDA 4CP0A 1N3OA 2X5IB 1HRI3 4XQDA 5FZFA 5EZWA 2JICA 1XYPA 4HBNA 2DCJA 4NPRA 1WWYA 4BH9A 1BK0A 1YI7A 4XEZA 2VNOA 5A3TA 5BV6A 2EAKA 5IHRA 1PVC2 1W90A 1CR7A 1S2BA 4JTNA 4XHBA 4ZXEA 1XNCA 4E4DX 3GHMA 2H0BA 5DG1A 3N9PA 5FBJA 5IK5A 5I0TA 3BPZA 1MQTA 1PIV3 3KQ4B 1G9AA 5J36A 1W8WA 1ND2A 1H6XA 3LIHA 5HCFA 4EZHA 4QGMA 5FV3A 3UT0A 4XJWA 4CYDA 2O8OA 1DF0A 3OG2A 5GLUA 1SQ4A 3ZFGB 4P08A 3WNLA 2Z69A 2CGOA 2XH6A 2Y64A 4D94A 3VBHC 5C8CA 3SEEA 3ZN4A 5CFCB 1W8UA 1HV1A 3VBOB 1IG3A 2IVIB 2KD7A 1JHJA 3HJRA 3KVAA 2BBAA 1LKNA 4GKYA 3UESA 2QKDA 1QJU2 5C6CA 2YV8A 1LULA 1QMJA 1RUJ1 1UKGA 5FMDA 2IWGB 4LEJA 1UKRA 2K2SA 1NCQC 4GWJA 4LO7A 2D6PA 1YFWA 2E7TA 2IXKA 2D6OX 4AEDB 4Q5OA 4CDQC 4Z8BA 3VBUC 3I2HA 1CWPA 3D5OA 1F5FA 3WT3A 1AYM2 3MIBA 1UU5A 2CL2A 3IPVB 3GM8A 3LPFA 4ZU5A 2Q8CA 5K7PA 4CEYB 2E53A 2WSUA 5FQ0B 3OY8B 3CLPA 4RHV3 3U11A 1BMV2 5FR3A 3OJBA 3RVHA 2VTXA 4QXHA 4A2UA 1AR73 4XJZA 1M06G 5GKAC 4AAPA 3WQ1A 2VMFA 3BALA 1NE4A 1C5HA 1FX5A 4I0WB 4AHXA 3U0ZA 3B01A 1MEC3 3SLIA 1OPMA 2VMIA 5D8AA 3BIWE 1DQ6A 3NNJA 3POBA 3AZVA 5F3IA 2W95A 5J98B 5FY0A 1QH6A 1UY4A 1FNZA 4RQPC 3KCCA 4PIYA 1A34A 2BZDA 1OURA 1PX3A 4OUMA 1Q5OA 3DUIA 1U0AA 4RHV1 5A7WA 4KMQA 1GV9A 4YNIA 5KXEA 5I0RA 1AR71 1IQAA 2VZTA 5FZGA 1VRH1 3ZSJA 4PLMA 1M4WA 2DVGA 1TMF1 2A6ZA 3MI8A 3B69A 1MEC1 1NLSA 4FPCA 4JGZA 4LO6B 4XFFA 5EJ1B 5FZIA 5GLZA 5JMOA 4JDMA 2XHKA 1ULPA 1ZBA1 2VR4A 1UIJA 4W6YA 4P5YA 2J1EA 1YJKA 2WA3A 4Q4W3 3VDCA 4KI5M 1ZA7A 5BNQA 4GH4B 1JODA 2QQWA 1DLCA 1VBA1 4P9XA 3FHIB 4CEWC 3V0AA 2FMYA 1EY2A 5C9AA 5IK7A 3WY6A 3MUZ1 3VL8A 5K9YA 4YZ2A 3WNMA 2WZPP 2GC1A 1UIKA 4Q0SA 3RZGA 3RNSA 1CD3G 1W9TA 3VZNA 4FFHA 5IFTA 2CY6A 4QB6A 2VE1A 4BK4A 3MYXA 2IC1A 3WQ0A 4EWAA 3HAGA 1RJ8A 1TE1B 3ABZA 1W8OA 1HDKA 4YGBA 3KHBA 4Y1UA 3S57A 1GQPA 4I2OA 3E5QA 4HVOA 1ENRA 2WZR3 1PK6B 5GZCA 5I0UA 1KXGA 5DAPA 3UGGA 1QQP3 3GNEA 1AHSA 4N53A 4ZONA 3WZ1A 5FY5A 3T2QA 5DMYA 4CCLA 2XG3A 4YLZA 1PVXA 2PELA 1S0IA 1UN1A 2QCSB 2ZGLA 3ILFA 1O59A 2QZ2A 1DQ5A 1H2NA 3LDBA 1TME2 3APBA 4MGIE 2P6CA 3M3EA 2LTNA 5A7SA 1OLMA 3POFA 3FC0A 4L2NA 4IGPA 1WMFA 4AF9A 2I07B 3BGAA 5ISLA 2TBVA 3J7MA 4MXWA 1QQP1 3UV9A 1RUNA 3N9MA 3ZXDA 5IT6A 1WCUA 3PMSA 4IXLA 5HXVA 5DDJ3 2XDVA 1QXPA 1YQ8A 3DXTA 3UJQA 1RJ7A 5FY9A 5J1XA 5L7OA 1AUYA 1C5IA 1MZ6A 1V9U3 1WD3A 2RS52 3CQOA 2JKBA 4P14A 2NYYA 3GALA 3CBNA 1H8TB 5LEJA 1UQXA 4CU9A 1L7QA 2CSGA 1VAVA 3AX4A 2A1XA 3HMYA 4QQOA 3R05A 1DFQA 1GANA 5T5PA 2FDKA 4LHNA 5DDJ1 5FXXA 1WBFA 1OH3A 4LOSA 5GZDA 1UMZA 3J7LA 3PTYA 3SISA 3U07A 1H4HA 2EICA 1RUH3 2WS92 1HRV3 2JDYA 2XGXA 5JSPA 3I3MA 1JOPA 2EALA 1K12A 3BVCA 3MGUA 4AI2A 3MEPA 4CU7A 4YVSA 4FAHA 4A4AA 4X6QB 4WV8A 1NY71 1UU4A 4Y1YA 5F2WA 4MG2A 4AR2A 1A8DA 4YSFA 1E5RA 2HWB1 2V72A 4WM7A 5F3GA 3M7AA 2AR6A 2E33A 3WNXA 1Y9QA 4HFSA 3BU0A 3EXUA 4PDWA 4S2FA 5E8AA 3OD4A 1VRBA 3ZSMA 5C3RA 2ZMLA 3LEIA 1X7NA 4Y5SA 4CA9A 2HWC3 1LHNA 3T30A 1QJY3 3C8XA 1AL23 4CRQA 3U10A 2F4LA 5LRRA 1RVF1 4B1MA 2RDRA 4LK7A 3T4VA 4CCMA 1DHKB 3VBFC 3R4SA 1PZ8A 5B2GB 4XFCA 3MPPG 3OBRA 2BW8A 3ZN6A 2R043 1I6XA 3O1UA 1VBB2 4IEQA 2W1QA 1D4M3 3B94A 3F95A 5BNNB 1V0AA 2HKXA 2ZHMA 4UI9L 5DZEA 1NA1B 3AXDA 5FYIA 1H30A 5K4LA 1QJY1 2WNVA 4QPGB 4QX5A 4BXFA 5EV7A 4CP9A 1AL21 5LATA 1TNFA 2BTVC 2KA3A 2VULA 1W2UA 3E5XA 2I74A 4E4HA 2VZ3A 3MUY1 3GZEA 2PHUA 4RD7A 1AR81 4WM8B 2HYKA 3JCIA 3LA2A 2R041 2FBEA 3KV6A 2JKXA 4YW3A 5M0TA 1F8VA 2ZOEB 5JXGA 3A0KA 5JZGA 4AFBA 1FT9A 1OLRA 4Y26A 5CFDA 1BVP1 2XWJB 2X09A 1C57A 4H3WA 2P17A 2X10A 1OUXA 5FZHA 5JIAA 3VDAA 3ETPA 1LR5A 1XE8A 2I2SA 3VD3A 3OUJA 3UL2A 4DFSA 5FYCA 3ZYFA 3O1SA 4DQAA 1JYIA 1FMD2 2ZZJA 2HBUA 2QQOA 3NNLA 1SACA 4XUOA 4EWEA 3NAPA 1X36A 2OS2A 4QQLA 2ZGNA 5FZ8A 2DTWA 1V6MA 2PHRA 5AC93 3ON7A 4UFJA 3H1MA 1W8NA 2HLEA 4NPMA 5C4WB 2HWF3 3MIEA 4R9CA 5K0UC 1GZ9A 5G04L 4QKFA 4Y22A 1I5ZA 2A5ZA 3ACGA 2B9UA 2YPJA 1XRUA 3T0DA 4AEJA
chains in the Genus database with same CATH topology
2WBKA 2WZ8A 3FN9A 3CIHA 4QDSA 2CDOA 1GNYA 1BHGA 4A45A 4CUBA 5JXHA 3I2IA 1O8SA 2W87A 3DYMA 2XQXA 2EIBA 1XNTA 3WF4A 4W4ZA 3A7QA 4DXRA 1RYYA 1OD3A 1OH4A 2VZQA 1F4AA 3K77A 4OMCA 2WDBA 5A1AA 3WQBA 1JYWA 3NJVA 3CMGA 3VD5A 2J7MA 2ZEZA 2Y6LA 2WN2A 3UETA 2DDUA 1W9SA 4JKMA 3I3EA 1JYXA 5B4NA 4L0PA 4JHZA 3VDBA 2ORXA 2W46A 3OGRA 4ZY9A 5DPNA 1WCQA 4RYDA 1ULOA 3WF3A 1TG7A 3PUIA 1GOGA 5HPOA 2JDAA 3I3DA 3C7HA 2Y6KA 5CYYA 1CX1A 1JZ5A 1UY1A 4RN5A 3WSOA 3IAPA 4E8DA 3WNKA 3CZJA 3SKJE 3C7OA 1GUIA 1LNSA 1US2A 3FHAA 3HN3A 2B9VA 4A42A 1J84A 4P00B 3THCA 4DUWA 5IFPA 2Y6HA 3IB3A 3D3AA 5HXMA 3OGSA 1NX9A 2VCBA 3SKVA 3NNGA 1UX7A 2YB7A 3SEPA 2QQMA 1JU4A 3C7EA 1XNAA 4M4PA 2J1SA 4D8MA 3ACFA 4DEQA 3W5NA 1UXZA 2BGOA 3GXUA 3NQHA 2QQNA 4LQRA 3FL7A 1JYVA 4LKSA 2VL4A 1CZSA 3I2JA 4XZUG 3U37A 2W47A 3HNBM 3C7FA 2ZEWA 4FI9A 2Y6GA 3GGLA 3K46A 2YFUA 2C4XA 4QPWA 5EIYB 5I0DA 1T2XA 1PMHX 1D7PM 4W50A 2B4KA 2J1RA 1UZ0A 2Y6JA 3K4AA 2WN3A 1UYYA 2VZVA 2LS6A 5IYYA 2PQSA 1IQDC 5EJZB 3J7HA 4QAWA 4AAXA 2QQLA 4OUEA 2ORZA 4XUQA 1NKGA 3IIIA 3LEGA 2VMEA 5DN2A 2VZUA 2E31A 2W94A 3WNPA 3WF2A 2VQTA 4A3ZA 2WAAA 2WO2A 4KWUA 3T09A 4A44A 3T0AA 3LPGA 4QX3A 2EIDA 5LA1A 1F4HA 4XUTA 3T08A 4XUPA 4MOAA 3VD9A 4HG6B 3VD4A 1W9WA 1XC6A 1KGYA 1US3A 3CDZB 2VZPA 1CZVA 3MO4A 4IUGA 3I97A 2ZEXA 2W5FA 2WYSA 1EUUA 3P6BA 2VCCA 5JUVA 4CU6A 3DYOA 2YFZA 1H6YA 2VOTA 3HOBA 4OMDA 1UY3A 3A23A 4DEVA 4PT6A 3EYPA 2ID4A 2W92A 4AG4A 2HYXA 3T2OA 2J1UA 4A6OA 3PUHA 1YQ2A 3THDA 1JZ4A 1SHWB 1JZ7A 4TXWA 3BN6A 4ET7A 3W5MA 3E1F1 1UMHA 2VMCA 4P02B 1NAEA 1TVGA 3MBWA 3HEIA 2LW8A 3HPNA 2DCJA 5IHRA 2W3JA 3MV01 4ZXEA 1GOFA 5G05L 4LHSA 2V5DA 4QB1A 2OKXA 2YC2A 1H6XA 4ARXA 3OG2A 4OZOA 2VJXA 1UY2A 4YPJA 4P08A 2VZ1A 3WNLA 2E32A 2W91A 2Y64A 2JD9A 4GZ9A 5C7GA 1OF4A 3SEEA 1KEXA 1K3IA 3I2GA 2C26A 3EB7A 2KD7A 1JHJA 3HJRA 2BBAA 2WUHA 3UESA 2W1UA 1SG3A 3CZUA 1JZ6A 1J83A 4GWJA 3DYPA 2E26A 1JU3A 3VD7A 4MADA 4BK5A 1UYZA 1W0NA 3I2HA 5JR2A 1K42A 3LPFA 3GM8A 3F2ZA 1UY0A 2Y8KA 4DUVA 2VMFA 1WKYA 2XONA 3ECQA 2VTFA 1W99A 5LA0A 2WO3A 1DP0A 2W95A 3K4DA 4XVHA 1UY4A 2BZDA 1PX3A 4XURA 2J1TA 2W1SA 1P8JA 4KMQA 1UMIA 4DUXA 2VZTA 3I2KA 5C70A 2VO5A 3LQCA 5JMOA 5EJ1B 2L9LA 1ULPA 2VR4A 4P5YA 2J1EA 2JE8A 1XPWA 4ZZ8A 2VCAA 3VDCA 4KI5M 3P1IA 1JI6A 1DLCA 2QQJA 2EIEA 1UYXA 1L7RA 3MUZ1 4CUAA 2WAOA 3WNMA 2XOMA 3LEKA 2J22A 1W9TA 5IFTA 5LCWL 4QB6A 4BK4A 4QX0A 4JX0A 3WNNA 1JZ3A 2QQIA 5B4XA 3ABZA 3AC0A 1W8OA 3LE0A 4Z2AA 3I2FA 5LA2A 1GQPA 2ZXQA 2WZEA 4W8JA 1CZTA 4CU8A 2WQ8A 3OEAA 2RV9A 1OF3A 1JZ2A 1JYNA 3T2QA 3A22A 5DMYA 1NUKA 4XUNA 4PQQA 2VZOA 5DQ0A 4PF1A 2VZRA 4QX1A 1O59A 4ARYA 3WNOA 3FHQA 1I5PA 4BJ0A 5JXJA 2W9XA 1O8PA 2VQUA 3BGAA 3NJXA 2WO1A 2CDPA 4BDVB 5J1XA 4DXTA 3CQOA 2V4VA 4QDRA 4CVUA 3T2PA 4GWIA 3DECA 4CU9A 1L7QA 1R64A 1HN1A 3OB8A 2QQKA 2RVAA 1GOHA 4MGQA 3IDAA 1UXXX 1OT5A 3OEBA 2VM9A 3CKHA 3IAQA 2XHNA 2EICA 1K45A 1PX4A 1UWWA 1K12A 3WF0A 4A41A 3A21A 4CU7A 2VC9A 4A4AA 4DXSA 2V72A 2R7EB 2E33A 1CIYA 4QDQA 4TTGA 1SDDB 3LEIA 3HNYM 4MO3M 2BERA 3UNPA 1DYOA 3C8XA 2BGPA 2C9KA 1GMMA 5CZKA 3MV11 3WEZA 2YG0A 2QBXA 1PMJX 2W1QA 4OYUA 2X05A 4JKLA 4UI9L 2ZEYA 2VZSA 4E8CA 5JXIA 3OBAA 4QX2A 3OGVA 3JXSA 2VZ3A 3MUY1 4MGSA 3T0BA 2JKXA 4UAPA 4BXSV 3NRUA 5JXGA 4QB2A 4M4RA 2X09A 5FUIA 5F7UA 2X10A 2RJ2A 3VDAA 1JZ8A 2J1AA 3ETPA 3C7GA 2DCKA 2W1WA 3VD3A 4D0QA 3ACIA 2Z4FA 4ZZ5A 3K75B 1EUTA 4LPLA 1MPXA 3WF1A 4JKKA 2QQOA 4XUOA 2WABA 4UOJA 3ZM8A 5IJRA 2VMDA 2YC4A 3GDBA 3K4ZA 4CUCA 1W8NA 2HLEA 5C71A 5G04L 1GU3A 3I3BA 3ACGA 3T0DA 3ACHA 3HNMA 2J1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WBK A;  2WZ8 A;  3FN9 A;  3CIH A;  4QDS A;  2CDO A;  1GNY A;  1BHG A;  4A45 A;  4CUB A;  5JXH A;  3I2I A;  1O8S A;  2W87 A;  3DYM A;  2XQX A;  2EIB A;  1XNT A;  3WF4 A;  4W4Z A;  3A7Q A;  4DXR A;  1RYY A;  1OD3 A;  1OH4 A;  2VZQ A;  1F4A A;  3K77 A;  4OMC A;  2WDB A;  5A1A A;  3WQB A;  1JYW A;  3NJV A;  3CMG A;  3VD5 A;  2J7M A;  2ZEZ A;  2Y6L A;  2WN2 A;  3UET A;  2DDU A;  1W9S A;  4JKM A;  3I3E A;  1JYX A;  5B4N A;  4L0P A;  4JHZ A;  3VDB A;  2ORX A;  2W46 A;  3OGR A;  4ZY9 A;  5DPN A;  1WCQ A;  4RYD A;  1ULO A;  3WF3 A;  1TG7 A;  3PUI A;  1GOG A;  5HPO A;  2JDA A;  3I3D A;  3C7H A;  2Y6K A;  5CYY A;  1CX1 A;  1JZ5 A;  1UY1 A;  4RN5 A;  3WSO A;  3IAP A;  4E8D A;  3WNK A;  3CZJ A;  3SKJ E;  3C7O A;  1GUI A;  1LNS A;  1US2 A;  3FHA A;  3HN3 A;  2B9V A;  4A42 A;  1J84 A;  4P00 B;  3THC A;  4DUW A;  5IFP A;  2Y6H A;  3IB3 A;  3D3A A;  5HXM A;  3OGS A;  1NX9 A;  2VCB A;  3SKV A;  3NNG A;  1UX7 A;  2YB7 A;  3SEP A;  2QQM A;  1JU4 A;  3C7E A;  1XNA A;  4M4P A;  2J1S A;  4D8M A;  3ACF A;  4DEQ A;  3W5N A;  1UXZ A;  2BGO A;  3GXU A;  3NQH A;  2QQN A;  4LQR A;  3FL7 A;  1JYV A;  4LKS A;  2VL4 A;  1CZS A;  3I2J A;  4XZU G;  3U37 A;  2W47 A;  3HNB M;  3C7F A;  2ZEW A;  4FI9 A;  2Y6G A;  3GGL A;  3K46 A;  2YFU A;  2C4X A;  4QPW A;  5EIY B;  5I0D A;  1T2X A;  1PMH X;  1D7P M;  4W50 A;  2B4K A;  2J1R A;  1UZ0 A;  2Y6J A;  3K4A A;  2WN3 A;  1UYY A;  2VZV A;  2LS6 A;  5IYY A;  2PQS A;  1IQD C;  5EJZ B;  3J7H A;  4QAW A;  4AAX A;  2QQL A;  4OUE A;  2ORZ A;  4XUQ A;  1NKG A;  3III A;  3LEG A;  2VME A;  5DN2 A;  2VZU A;  2E31 A;  2W94 A;  3WNP A;  3WF2 A;  2VQT A;  4A3Z A;  2WAA A;  2WO2 A;  4KWU A;  3T09 A;  4A44 A;  3T0A A;  3LPG A;  4QX3 A;  2EID A;  5LA1 A;  1F4H A;  4XUT A;  3T08 A;  4XUP A;  4MOA A;  3VD9 A;  4HG6 B;  3VD4 A;  1W9W A;  1XC6 A;  1KGY A;  1US3 A;  3CDZ B;  2VZP A;  1CZV A;  3MO4 A;  4IUG A;  3I97 A;  2ZEX A;  2W5F A;  2WYS A;  1EUU A;  3P6B A;  2VCC A;  5JUV A;  4CU6 A;  3DYO A;  2YFZ A;  1H6Y A;  2VOT A;  3HOB A;  4OMD A;  1UY3 A;  3A23 A;  4DEV A;  4PT6 A;  3EYP A;  2ID4 A;  2W92 A;  4AG4 A;  2HYX A;  3T2O A;  2J1U A;  4A6O A;  3PUH A;  1YQ2 A;  3THD A;  1JZ4 A;  1SHW B;  1JZ7 A;  4TXW A;  3BN6 A;  4ET7 A;  3W5M A;  3E1F 1;  1UMH A;  2VMC A;  4P02 B;  1NAE A;  1TVG A;  3MBW A;  3HEI A;  2LW8 A;  3HPN A;  2DCJ A;  5IHR A;  2W3J A;  3MV0 1;  4ZXE A;  1GOF A;  5G05 L;  4LHS A;  2V5D A;  4QB1 A;  2OKX A;  2YC2 A;  1H6X A;  4ARX A;  3OG2 A;  4OZO A;  2VJX A;  1UY2 A;  4YPJ A;  4P08 A;  2VZ1 A;  3WNL A;  2E32 A;  2W91 A;  2Y64 A;  2JD9 A;  4GZ9 A;  5C7G A;  1OF4 A;  3SEE A;  1KEX A;  1K3I A;  3I2G A;  2C26 A;  3EB7 A;  2KD7 A;  1JHJ A;  3HJR A;  2BBA A;  2WUH A;  3UES A;  2W1U A;  1SG3 A;  3CZU A;  1JZ6 A;  1J83 A;  4GWJ A;  3DYP A;  2E26 A;  1JU3 A;  3VD7 A;  4MAD A;  4BK5 A;  1UYZ A;  1W0N A;  3I2H A;  5JR2 A;  1K42 A;  3LPF A;  3GM8 A;  3F2Z A;  1UY0 A;  2Y8K A;  4DUV A;  2VMF A;  1WKY A;  2XON A;  3ECQ A;  2VTF A;  1W99 A;  5LA0 A;  2WO3 A;  1DP0 A;  2W95 A;  3K4D A;  4XVH A;  1UY4 A;  2BZD A;  1PX3 A;  4XUR A;  2J1T A;  2W1S A;  1P8J A;  4KMQ A;  1UMI A;  4DUX A;  2VZT A;  3I2K A;  5C70 A;  2VO5 A;  3LQC A;  5JMO A;  5EJ1 B;  2L9L A;  1ULP A;  2VR4 A;  4P5Y A;  2J1E A;  2JE8 A;  1XPW A;  4ZZ8 A;  2VCA A;  3VDC A;  4KI5 M;  3P1I A;  1JI6 A;  1DLC A;  2QQJ A;  2EIE A;  1UYX A;  1L7R A;  3MUZ 1;  4CUA A;  2WAO A;  3WNM A;  2XOM A;  3LEK A;  2J22 A;  1W9T A;  5IFT A;  5LCW L;  4QB6 A;  4BK4 A;  4QX0 A;  4JX0 A;  3WNN A;  1JZ3 A;  2QQI A;  5B4X A;  3ABZ A;  3AC0 A;  1W8O A;  3LE0 A;  4Z2A A;  3I2F A;  5LA2 A;  1GQP A;  2ZXQ A;  2WZE A;  4W8J A;  1CZT A;  4CU8 A;  2WQ8 A;  3OEA A;  2RV9 A;  1OF3 A;  1JZ2 A;  1JYN A;  3T2Q A;  3A22 A;  5DMY A;  1NUK A;  4XUN A;  4PQQ A;  2VZO A;  5DQ0 A;  4PF1 A;  2VZR A;  4QX1 A;  1O59 A;  4ARY A;  3WNO A;  3FHQ A;  1I5P A;  4BJ0 A;  5JXJ A;  2W9X A;  1O8P A;  2VQU A;  3BGA A;  3NJX A;  2WO1 A;  2CDP A;  4BDV B;  5J1X A;  4DXT A;  3CQO A;  2V4V A;  4QDR A;  4CVU A;  3T2P A;  4GWI A;  3DEC A;  4CU9 A;  1L7Q A;  1R64 A;  1HN1 A;  3OB8 A;  2QQK A;  2RVA A;  1GOH A;  4MGQ A;  3IDA A;  1UXX X;  1OT5 A;  3OEB A;  2VM9 A;  3CKH A;  3IAQ A;  2XHN A;  2EIC A;  1K45 A;  1PX4 A;  1UWW A;  1K12 A;  3WF0 A;  4A41 A;  3A21 A;  4CU7 A;  2VC9 A;  4A4A A;  4DXS A;  2V72 A;  2R7E B;  2E33 A;  1CIY A;  4QDQ A;  4TTG A;  1SDD B;  3LEI A;  3HNY M;  4MO3 M;  2BER A;  3UNP A;  1DYO A;  3C8X A;  2BGP A;  2C9K A;  1GMM A;  5CZK A;  3MV1 1;  3WEZ A;  2YG0 A;  2QBX A;  1PMJ X;  2W1Q A;  4OYU A;  2X05 A;  4JKL A;  4UI9 L;  2ZEY A;  2VZS A;  4E8C A;  5JXI A;  3OBA A;  4QX2 A;  3OGV A;  3JXS A;  2VZ3 A;  3MUY 1;  4MGS A;  3T0B A;  2JKX A;  4UAP A;  4BXS V;  3NRU A;  5JXG A;  4QB2 A;  4M4R A;  2X09 A;  5FUI A;  5F7U A;  2X10 A;  2RJ2 A;  3VDA A;  1JZ8 A;  2J1A A;  3ETP A;  3C7G A;  2DCK A;  2W1W A;  3VD3 A;  4D0Q A;  3ACI A;  2Z4F A;  4ZZ5 A;  3K75 B;  1EUT A;  4LPL A;  1MPX A;  3WF1 A;  4JKK A;  2QQO A;  4XUO A;  2WAB A;  4UOJ A;  3ZM8 A;  5IJR A;  2VMD A;  2YC4 A;  3GDB A;  3K4Z A;  4CUC A;  1W8N A;  2HLE A;  5C71 A;  5G04 L;  1GU3 A;  3I3B A;  3ACG A;  3T0D A;  3ACH A;  3HNM A;  2J1V A; 
#chains in the Genus database with same CATH topology
 1QGL A;  3LA7 A;  2WZ8 A;  3WG1 A;  4AK3 A;  1HX6 A;  2P2K A;  3FN9 A;  4Q4X 2;  3VB9 A;  2IVJ A;  1L7L A;  2RS1 2;  4QDS A;  4BOW A;  4JCK A;  4MGT A;  4A45 A;  5AC9 1;  4CUB A;  1W39 A;  1EP0 A;  1EV1 3;  4GKX A;  1OQD A;  1W6P A;  1BEV 2;  2BDR A;  2D6L X;  3RSJ A;  4W4Z A;  5BYN A;  5JOX A;  1CPN A;  1R09 2;  3AP4 A;  3QLQ A;  5LEK A;  4CDX C;  2HWD 2;  5CG9 A;  1GZC A;  2VZQ A;  3RFR A;  1PGW 1;  3K3N A;  4W6X A;  1QF3 A;  4NRM A;  3WQB A;  4YYO A;  2OT7 A;  3CMG A;  2ZEZ A;  3ILR A;  3VBH A;  3VD5 A;  4BIO A;  1ZZC A;  4LJH A;  3WCS A;  3ZXJ A;  1QOO A;  3PJY A;  3UK9 A;  2BOI A;  2DU0 A;  5CB7 A;  5T54 A;  1EV1 1;  1XE0 A;  1UU6 A;  4DO0 A;  5FOB B;  2VOV A;  2ORX A;  5DPN A;  1O6U A;  4E27 A;  1H8V A;  1V70 A;  2UYA A;  5FY1 A;  3GYD A;  5L9V A;  5EYX A;  4TWT A;  3JQX A;  2WIN B;  1RL3 A;  3RYK A;  1NCQ A;  3I3D A;  3C7H A;  4LIV A;  4SLI A;  4QPI B;  1CX1 A;  4FFG A;  1POQ A;  1ALY A;  1PGS A;  2VUD A;  3IKW A;  3POE A;  4N43 C;  4CDQ A;  1JZ5 A;  3VBU A;  5JIU A;  1W8Z A;  1G9F A;  3K3O A;  4H14 A;  2VVD A;  1CIW A;  1GUI A;  1US2 A;  3D0S A;  3FHA A;  3USU A;  3H50 A;  2WT2 A;  3THC A;  2DVB A;  2DTY A;  2IUW A;  2Y6H A;  4K6B A;  5JLV A;  4D7S A;  2WII B;  4XHX A;  4MGZ E;  2HBT A;  5I93 A;  3OGS A;  1NX9 A;  5J48 A;  3Q9O A;  5CKN A;  4BCU A;  4PQ9 A;  2R1B A;  1R08 1;  2YB7 A;  3KB5 A;  3ZXF A;  3WG4 A;  2MEV 3;  4M3C E;  1C28 A;  2KM2 A;  4LBO A;  4BLI A;  4F7Z A;  5KC6 A;  1O3R A;  4Y33 A;  1AJK A;  5ANQ A;  3BIE A;  2XVK A;  1AYN 1;  4IV3 B;  2WNU C;  4RQP A;  2G1M A;  3MIH A;  1XXN A;  2GN3 A;  1HLC A;  3J8F 2;  4M4P A;  2J1S A;  4D8M A;  1W3V A;  1MVE A;  4LKD A;  4LLO A;  3O1R A;  2RMU 3;  2G9G A;  3VBS C;  1AR6 3;  5KBF A;  5GAL A;  4UFK A;  2B46 X;  3RPQ A;  4URA A;  3ZYJ B;  3H8X A;  1W9Y A;  3VZM A;  4FPJ A;  1QXJ A;  2Z42 A;  2YYO A;  2MEV 1;  5I91 A;  4LKS A;  1Y9G A;  2Q0A A;  3MZH A;  4ES8 A;  1X9P A;  5HBA A;  2BFU L;  3H3U A;  3JD7 1;  5T55 A;  4URT A;  2ZKN A;  2NMN A;  4CEW A;  2JEC A;  2QFE A;  1AR9 2;  2R16 A;  1C8M 2;  4IE5 A;  1VP6 A;  2VW0 A;  3TN9 2;  2FDF A;  1BCX A;  4OI4 A;  4F8A A;  2WYF A;  5T50 A;  4YM2 A;  1W0P A;  5E16 A;  1RED A;  3USS A;  2W39 A;  4LLF A;  4B3N A;  4N9I A;  3IMN A;  1ODN A;  5FWE A;  5FYM A;  2XLG A;  1PMH X;  3O7O A;  5FY8 A;  2B4K A;  3K4A A;  1RMU 1;  2WN3 A;  3NMB A;  2VZV A;  3RG0 A;  1LHO A;  3SCG A;  5AFB A;  5EFU A;  5IYY A;  4BIS A;  4AAX A;  4L8Q A;  2QQL A;  1WGP A;  4CPB A;  4OUE A;  5FZ1 A;  4QMA A;  4L97 A;  4XBN A;  5EXO A;  2ADD A;  4HK9 A;  1ZRC A;  1VBD 2;  1CQ9 A;  4JAA A;  1NKG A;  2KR2 A;  2WFP A;  5DAW A;  3CJI C;  4DNY A;  5FLI A;  5DN2 A;  2ZPX A;  2LRO A;  2VZU A;  4IV1 C;  4JRL A;  4Q4V 3;  2W94 A;  2GNB A;  2YHJ A;  4O9E A;  2N7G A;  5FJH A;  4AI0 A;  4A3Z A;  1QHD A;  3DF0 A;  2WAA A;  4KWU A;  5DAX A;  2CYF A;  2J42 A;  3RJR A;  2CTV A;  3LPG A;  2XVG A;  5GLV A;  4JDN A;  2EID A;  2ARB A;  3I59 A;  2FCV A;  3I2O A;  3CL1 A;  4WZC A;  4XUT A;  3T08 A;  3LZZ A;  4XUP A;  2W08 A;  3WR0 A;  4COW A;  5LWB A;  2G4I A;  2HWE 2;  4RSU A;  1F31 A;  3AM2 A;  3KGZ A;  1VPH A;  1JYT A;  4IEW A;  4LT5 A;  1KGY A;  1RUD 1;  1US3 A;  3CDZ B;  5L19 A;  2RM2 2;  3DKW A;  5F32 A;  2NM1 A;  3IIA A;  1XBF A;  5JVV A;  2VUA A;  5F39 A;  2VUC A;  4OUS A;  3E6D A;  4BQ2 A;  5CG8 A;  2YGM A;  5I0S A;  4G4F A;  4I02 A;  2PFW A;  3U4X A;  1ZZ8 A;  2V73 A;  4NE9 A;  4H7L A;  1TNR A;  3OSD A;  2R07 3;  5CIR A;  4I09 A;  3ZYP A;  4DS0 A;  5JPN B;  2VCC A;  4CDU B;  3KVB A;  1V6O A;  4EE2 A;  3A4U A;  4EN7 B;  2AEZ A;  2YFZ A;  3H8O A;  1H6Y A;  1OQE A;  4ATE A;  5FZM A;  3MIC A;  1HN0 A;  1J1T A;  2K9Z A;  5FZ9 A;  2NZ9 A;  3LKJ A;  3WP6 A;  3EYP A;  2ID4 A;  2Q5T A;  4AG4 A;  1J1L A;  3T2O A;  1ZM1 A;  2J1U A;  1G9C A;  1CPM A;  1YQ2 A;  2R07 1;  2VNV A;  5F2S A;  1PO2 2;  5FYY A;  4BQW A;  3HBK A;  4BWO A;  1W8T A;  4KWL A;  3MF9 A;  1JZ7 A;  2BNM A;  1UMH A;  2VMC A;  1GZW A;  1XQN A;  2RS3 3;  3E6C C;  1NAE A;  5BNO C;  1W6O A;  2XBO 2;  5IWF A;  3WD5 A;  1FXZ A;  3VDD B;  1GR3 A;  1WBL A;  3VBF A;  1VMF A;  1ZBE 3;  1OHF A;  4ZU4 A;  1OQ1 A;  1Y3T A;  4RL7 A;  1BBT 3;  1GOF A;  1DDL A;  4GIQ A;  3Q8C A;  4TYS A;  3WP5 A;  1ULE A;  2RS3 1;  3KQR A;  4ITC A;  3ORJ A;  4YG0 A;  4LUM A;  1RUG 2;  4QB1 A;  1S0C A;  2WA4 A;  2OKX A;  2JG8 C;  2WQZ C;  3KV9 A;  4EV0 A;  2UU8 A;  3SCH A;  1S0B A;  2UWC A;  4HET A;  2RR1 3;  4OZO A;  2VJX A;  3HQU A;  5KHJ A;  1VBC 3;  1ZBE 1;  2E32 A;  2VZ1 A;  2W91 A;  4LBL A;  4XFA A;  1OF4 A;  2VBB A;  4PIZ A;  3GHN A;  5DUV A;  1KEX A;  1K3I A;  3I2G A;  4TN7 A;  3LD8 A;  4QM8 A;  2PHX A;  3EB7 A;  2HEW F;  4P9Y A;  4Q2F A;  2B7Y A;  2WUH A;  3GZU C;  3POY A;  5GLW A;  1TEI A;  2W1U A;  4GUL A;  4D7Y A;  4NUB A;  1X8E A;  2HH9 A;  2B5H A;  3B00 A;  3FE5 A;  4M3C B;  4DY5 A;  1VBC 1;  3ZR5 A;  1JZ6 A;  4XMA A;  5C5T A;  1O4Y A;  4NAM A;  3JBG 3;  1O4Z A;  5GZE A;  1JU3 A;  4F83 A;  3VD7 A;  4KWJ A;  1H1M A;  3IDE A;  4HPK B;  4BK5 A;  1WLW A;  2IXC A;  5FMC A;  4IQP A;  3FMG A;  1H2K A;  2BYV E;  1SCR A;  3IM0 A;  5JR2 A;  1GIC A;  1RUF 2;  2AAC A;  2B8M A;  5JMC A;  1K42 A;  2BU9 A;  5LAS A;  4YW6 A;  1H0B A;  5JR7 B;  2OVU A;  1QY4 A;  3OUH A;  3WDT A;  4AHZ A;  2R06 1;  5K0U A;  1NCR C;  5H9P A;  1WKY A;  2JG9 C;  1VMJ A;  3LOB A;  1W99 A;  3DV8 A;  5BNP B;  1QJX 1;  4FOQ A;  1KS5 A;  5ABJ A;  3TRS B;  3ZMO A;  3O0V A;  1DP0 A;  2WO3 A;  4ZS3 A;  3PDQ A;  3KF5 A;  4XVH A;  4FSJ A;  3M3I A;  4NMI A;  3GF6 A;  1VBE 1;  1RUC 3;  4XUR A;  3U78 A;  2W1S A;  2ZX2 A;  3P3N A;  1GKB A;  4AVB A;  1LEN A;  1RUI 3;  4XBL A;  1YFY A;  1ENQ A;  1YFU A;  3I2K A;  4HVR A;  4QGL A;  3TAY A;  3LQC A;  1LOG A;  5A3M A;  5C70 A;  2WFF 2;  3MDP A;  2JXA A;  1RIT A;  2VGD A;  4V1P A;  4CDX A;  1AX2 A;  2VOK A;  5A3L A;  3N9Q A;  1UO9 A;  2L9L A;  4RFR B;  1JHN A;  1N1Y A;  3TEX A;  2CWM A;  2A3X A;  1XPW A;  3NWK A;  4ZZ8 A;  1D2S A;  2GN7 A;  2P1B A;  3D0J A;  4B4P A;  4XAB A;  1RUC 1;  2VU9 A;  1JI6 A;  1H1A A;  4AGG A;  1NG0 A;  2CWS A;  2QQJ A;  4UFH A;  4XQ4 A;  3AP6 A;  5FRE A;  2OQ7 A;  5GZG A;  4LBK A;  4LIU A;  4M0H A;  3FLT A;  4LO5 B;  1IG0 A;  4XIO A;  1MS0 A;  3KT7 A;  1JMU B;  1YJL A;  4CP1 A;  2FMD A;  1DCS A;  2UWA A;  2XPJ A;  3ZXK A;  1YO8 A;  1EAH 2;  2R0H A;  2VQ0 A;  2C1F A;  5LCW L;  2VW2 A;  2A6V A;  3WDV A;  3R0R A;  1VAK A;  2O8Q A;  3PNA A;  4EN0 A;  5BY5 A;  2FDH A;  4N43 A;  5JDB A;  2JD4 A;  1SBF A;  4XJU A;  3ZFE C;  5DAB A;  4FPK A;  4N7U A;  5FPB A;  1GLH A;  2WNU B;  5ACA 1;  2WZE A;  3WW3 A;  4DXZ A;  1MZ5 A;  1Z78 A;  4Q4Y 1;  1SLI A;  4YVW B;  4CU8 A;  2WQ8 A;  1KFX L;  3OEA A;  4N90 A;  1REF A;  4JQT A;  3UJO A;  3VL9 A;  4BYY A;  5J09 A;  2ZHK A;  3ZKY A;  4IE4 A;  4CUG A;  1QH7 A;  1FOD 1;  1GWK A;  1NUK A;  4BM8 A;  3OTF A;  1GNH A;  4MGY E;  2VXJ A;  4XUN A;  3RZZ A;  3ENR A;  5DQ0 A;  2VZR A;  4ARY A;  1W9F A;  3L2Y A;  4GB3 3;  2VY0 A;  1HB4 A;  1MZF A;  1HB2 A;  1I5P A;  2WNU A;  5TSW A;  2XUM A;  2JDZ A;  2WLP A;  5JXJ A;  4OUL A;  2VQU A;  3CEW A;  5LY1 A;  2ZHL A;  1DQ4 A;  1R1Z A;  1MQT B;  4Q8L A;  4F3J A;  4QU1 A;  3VBS A;  4FPO B;  2P3K A;  5D21 A;  1ND2 B;  3NJX A;  2GU9 A;  4AFA A;  4LBQ A;  1Y7B A;  4E2G A;  4K1Y A;  5A6Y A;  4I01 A;  3B7M A;  1S1A A;  4TLF A;  4GB3 1;  5C3S A;  2IFW A;  5C8C B;  2W52 A;  3ES4 A;  2IXH A;  2V4V A;  4QDR A;  3WUC A;  5F6K A;  4FQ4 A;  1J3P A;  1F15 A;  4FTS A;  1URX A;  5FKC A;  1HN1 A;  3OB8 A;  1KFU L;  1OA2 A;  2PHT A;  2QQK A;  4I0A A;  3N7M A;  1OC1 A;  1GOH A;  2CV6 A;  3IDA A;  1HRI 1;  3FJS A;  1AVB A;  4AQ6 A;  3H1Y A;  3CO2 A;  2VBP A;  2JDM A;  1JUH A;  3OEB A;  1RUJ 2;  1NOV A;  3CKH A;  4ISR A;  4UFL A;  3MIF A;  2XHN A;  4XJ9 A;  2Q1M A;  4XFG A;  4LKF A;  3S30 A;  4FOV A;  3W20 A;  4GQ7 A;  1K45 A;  5A32 A;  1LEM A;  1OXC A;  4KU8 A;  4HOO A;  1UWW A;  3WF0 A;  1LES A;  3A21 A;  1PIV 1;  1YWK A;  4X6R B;  5DUW A;  3ZN5 A;  3AMH A;  1OI6 A;  4FPE A;  3U75 A;  2VEC A;  1R1A 3;  3SHR A;  3PIJ A;  5EYY A;  1HXS 2;  5KHH A;  1XND A;  5FAX A;  3ZLI A;  5FO8 B;  4NIG A;  3POJ A;  1LAJ A;  4QQP A;  1LED A;  4YM0 A;  3POI A;  1COV 3;  4GWM A;  4KBZ A;  3CJI A;  4TTG A;  3HNY M;  2VBD A;  5D8A B;  2ZGK A;  1ND3 C;  4IV1 A;  3DKQ A;  3ZSK A;  4GJY A;  3ES1 A;  3UNP A;  3H3Z A;  1DYO A;  5FZO A;  5A7W B;  4Q0Q A;  3ZDS A;  1BQP A;  2BWC A;  3C2U A;  1R1A 1;  3MV1 1;  4RHV 2;  3ZFF C;  1PNF A;  3O0X A;  1H9W A;  2YG0 A;  1QJZ A;  1PMJ X;  1NXD 1;  2AUY A;  3GCW A;  1VRH 2;  3NV1 A;  4OYU A;  1COV 1;  4OHY A;  4JGZ B;  4K1Z A;  3VUO A;  1TMF 2;  1H2M A;  3ZXA C;  4PI0 A;  3ZYR A;  1JN2 P;  2DCY A;  1BZW A;  1ZBA 2;  1WA6 X;  1ZYB A;  3E5U A;  5FLJ A;  1QNY A;  3VHO A;  1AYM 3;  3V0A B;  2ZX3 A;  1HB3 A;  1GSL A;  4MGS A;  5C9A B;  2OQ6 A;  1VBA 2;  1U5Z A;  4V2V A;  4SBV A;  2A6X A;  4CXW A;  5FMO L;  2RJK A;  2PHF A;  2O0O A;  4HKO A;  4IE0 A;  1WD4 A;  2HJI A;  2Y26 A;  3UKT A;  4CCE A;  1OPO A;  4QB2 A;  4FFI A;  2D5F A;  2JJ6 A;  3LSE A;  2DUP A;  2LM3 A;  2RJ2 A;  3MLK A;  1OOP C;  1YQ6 A;  5F7U A;  4XC9 A;  1NZI A;  4R9D A;  2PHD A;  1AYM 1;  1LEC A;  2C9A A;  2RDN A;  2Z4F A;  3AK0 A;  1YYN A;  1B09 A;  1QOS A;  3CF6 E;  4HZF A;  4B1L A;  4OCT A;  1CON A;  3DN7 A;  5HV4 A;  2JEM A;  4FPH A;  4M01 A;  4H2A A;  4K20 A;  3HQX A;  4HT1 T;  2Z79 A;  4N53 B;  2WNO A;  5IJR A;  1LOE A;  2YC4 A;  3H1W A;  4Q0P A;  3ZM8 A;  4UBG A;  2IXI A;  4Q4W 1;  3GDB A;  5A1F A;  3K4Z A;  3HWJ A;  4BHP A;  1Z7S 3;  4PBO A;  4YGE A;  1OKQ A;  1V00 A;  3M3O A;  3MIG A;  5AVA A;  5BNO A;  1W8H A;  3N36 A;  1NLR A;  1WW5 A;  5FPX A;  3ACH A;  5E89 A;  1O3S A;  2J1V A;  4JTO A;  4QWN A;  4NPL A;  4BQ1 A;  2FHR A;  1UAI A;  4IND A;  4MXW B;  4XAA A;  2ARC A;  3TBD A;  4XBQ A;  1UZV A;  4NIH A;  1QQP 2;  4J25 A;  3VZL A;  2CDO A;  1GNY A;  4AYU A;  1Z7S 1;  1J3Q A;  1KQR A;  3DYM A;  1GZT A;  4C91 A;  3KHC A;  2EIB A;  3Q8F A;  3C3V A;  1UF2 C;  3KS7 A;  5L7O B;  5A3W A;  5IVB A;  2JG8 A;  1RYY A;  1QEX A;  1OD3 A;  2WZR 1;  4QT6 A;  5DZG A;  3VKO A;  4AVC A;  1F4A A;  2D6N A;  2PAM A;  5FYB A;  3EMR A;  4BZ4 A;  3BTY A;  4Z07 A;  2DVF A;  2VMG A;  4RS5 C;  3AYC A;  2CAU A;  1YFX A;  3TYJ A;  1FPN 2;  3I54 A;  4FO9 A;  2NN8 A;  4NOT A;  5DUX A;  2CGP A;  2Y6L A;  5IUQ A;  5KHI A;  4A3X A;  1W9S A;  3V64 A;  4JKM A;  3ZSE A;  5C8W A;  2ZMK A;  3RWN A;  1RXG A;  4XYX A;  1B35 C;  5CVR A;  5B4N A;  4JHZ A;  1N1T A;  4BMB A;  3OGR A;  4ZY9 A;  4AVS A;  5I8T A;  2D3P A;  4Q29 A;  4RYD A;  2DUQ A;  4IEO A;  2GC0 A;  1TME 3;  1OA3 A;  1UCX A;  1JTZ X;  4YVS B;  1XNK A;  4UW5 A;  4P9J A;  1H2L A;  4AE2 A;  2Y6K A;  1KDM A;  5FBZ A;  4UFI A;  1NY7 2;  3LF7 A;  4WM7 B;  3IWZ A;  1LB2 A;  3IAP A;  3WDW A;  5FO9 B;  2HWB 2;  2YBP A;  2VD7 A;  3DEM A;  3ROU A;  4PDW B;  1SBE A;  3KF3 A;  1N1V A;  1V9U 1;  2XXZ A;  1LNS A;  1QNW A;  3HN3 A;  4UF0 A;  4A42 A;  4MYE A;  5AVP A;  2EVX A;  4LMF A;  2RS5 3;  5C5U A;  4DUW A;  3GJB A;  4UXA A;  4CZS A;  5FK8 A;  2ARE A;  5DAQ A;  3IB3 A;  2ERF A;  1NCR A;  4Q1R A;  5GZF A;  2JG9 A;  4IES A;  1QJE A;  1RVF 2;  2FDJ A;  3ZXL A;  2YZ4 A;  3ZXG A;  2QJV A;  4XE9 A;  1C3H A;  3ZN6 B;  1IOA A;  4QGN A;  4S2G A;  1DQ1 A;  3MFA A;  3C7E A;  1XNA A;  2XR4 A;  1LJ7 A;  4OI1 A;  1RUH 1;  4WVM A;  1HRV 1;  2RS5 1;  4RGA A;  2WNV B;  1PNG A;  2VUJ A;  3IN9 A;  3WW4 A;  4CP9 B;  3ACF A;  4DEQ A;  2DUR A;  2WS9 3;  1QJY 2;  2H6C A;  3EJK A;  3ZO0 B;  2XL9 A;  1UXZ A;  4WVW A;  2QQN A;  3EQE A;  3HR9 A;  4LQR A;  1QXR A;  5H9R A;  4CDW C;  4XJ8 A;  1AR8 2;  4JV4 A;  4JGY A;  5JZG B;  2DBN A;  4KU7 A;  4FOW A;  2GSY A;  1EPW A;  1WMX A;  3LFM A;  5CFD B;  2HWC 1;  1GP4 A;  1RHI 2;  3U37 A;  2BRT A;  3O14 A;  4TSV A;  3ZPO A;  2ZZQ A;  3KWV A;  1ASJ 2;  2C6S A;  5C3P A;  2GMM A;  3RZK A;  2E7Q A;  2Y6G A;  4AQ2 A;  1UOG A;  3GGL A;  3K46 A;  4Y5T A;  4LO4 B;  1IKQ A;  3DXU A;  4QPW A;  2GP3 A;  3ZSL A;  5I0D A;  2ZAH A;  4RA0 A;  1O5U A;  3LDK A;  1D4M 1;  1VBB 3;  5A6Q A;  1D7P M;  2J1R A;  3MLL A;  3NAP B;  4C1X A;  3ZFE A;  5JWP A;  5JSO A;  2ILM A;  4O65 A;  5EHD A;  4KGG A;  5EJZ B;  2ZS6 B;  2A75 A;  2PYT A;  2XJP A;  4RR3 C;  2YC0 A;  2ZGU A;  4Y22 B;  3S5A A;  5FMB A;  2D3R A;  3PLQ A;  4CXX A;  4YM1 A;  5FPU A;  3S6P A;  2GP5 A;  4HKL A;  3VZJ A;  4HSJ A;  2E31 A;  3WNP A;  3NW4 A;  4IEU A;  4CCO A;  3NJY A;  5A3U A;  4KBB A;  2VNG A;  2GND A;  3IDC B;  1W6P B;  4HK8 A;  1ST8 A;  2WKK A;  2WNE A;  3AP7 A;  3QH7 A;  5LB6 A;  3W58 A;  5LA1 A;  1F4H A;  3VZO A;  3KZ4 C;  1PHM A;  1LCL A;  1PGL 1;  5A3N A;  5ABJ C;  1CES A;  3V65 A;  1PGW 2;  2R49 A;  1FMD 3;  4DZG A;  2XB6 C;  2W0X A;  3VBH B;  2BQP A;  2VZP A;  1V6N A;  4L11 A;  1GQG A;  4IUG A;  5FP3 A;  1HJF A;  1HV0 A;  2IZW A;  3A0N A;  3ZVX A;  3RZL A;  3I97 A;  1ZX5 A;  3SH5 A;  2VW1 A;  2HWF 1;  3D4K A;  5A33 A;  2XL7 A;  2Y0I A;  3JU9 A;  2ARA A;  3PIG A;  2YU2 A;  1XOY A;  4L99 A;  3ZKU A;  4YGD A;  1D4V B;  4P9I A;  5IK4 A;  3H7Y A;  1NCQ B;  1DGR A;  1FMD 1;  4WVZ A;  3WCR A;  3DYO A;  2X53 S;  3RZJ A;  1W28 A;  3HOB A;  4CDQ B;  1YIF A;  4NO4 A;  1KJR A;  4Q4X 3;  3VBU B;  2ZGO A;  2FDG A;  2RS1 3;  3MFC A;  1X82 A;  5D2A A;  4DEV A;  4EN6 B;  1G7Y A;  3K48 A;  5C3O A;  3USU B;  1S2K A;  4M0N A;  1BEV 3;  1KD7 A;  2VAU A;  1LOF C;  2W92 A;  4KH9 A;  5DZF A;  4X8P A;  2HYX A;  4JZR A;  3NL1 A;  2DCT A;  4XET A;  5A70 A;  2FD8 A;  2Y33 A;  2XLA A;  5FCC A;  2HWD 3;  3PUH A;  4A6O A;  1V6L A;  3PME A;  3ZYH A;  1JZ4 A;  4GJZ A;  4NRO A;  1HB1 A;  1SHW B;  3E6B A;  2FZ1 A;  1ND3 A;  1TVG A;  3MBW A;  4QX7 A;  1Q8V A;  1R08 2;  4XAC A;  5E1R A;  4AFC A;  1ZRF A;  1GYK A;  5JI9 A;  4RQP B;  1YLL A;  1AYN 2;  5FXV A;  4W65 A;  1ZZ7 A;  3PUR A;  3RDI A;  1BK1 A;  1JOB A;  3ZFF A;  5FLH A;  1RUO A;  1ULF A;  2DVA A;  4KG8 A;  3BU7 A;  2BNO A;  3MV0 1;  2I45 A;  2ZHN A;  1RUE 3;  3BYW A;  5G05 L;  2D40 A;  4QXB A;  4ZPI A;  4D6R A;  2QDN A;  3H8R A;  2G9F A;  2YC2 A;  3FLP A;  4GXL A;  3BI3 A;  3AMM A;  2Y0O A;  4LA2 A;  5F5I A;  1YQ5 A;  4ARX A;  3AP9 A;  1WCK A;  3VBR C;  1UY2 A;  3JD7 2;  1WW4 A;  4CEW B;  4D69 A;  4Y20 A;  2JD9 A;  4S2D A;  5C7G A;  2ZKL A;  1DBN A;  1MR5 A;  1RUE 1;  4XMI A;  4LK6 A;  3BOW A;  4WZF A;  1ZRI A;  3CJX A;  4A6S A;  1CN1 A;  1K5M C;  1RIN A;  1YRZ A;  2B42 B;  4OZX A;  5I8Y A;  5KXD A;  1OOP A;  3O1M A;  3PVO A;  4R9B A;  1JW6 A;  2LAL A;  3JQW A;  1SG3 A;  2RHP A;  4R52 A;  3H7J A;  3IMM A;  1YXW A;  1RMU 2;  1U5I A;  3G6J B;  3J8F 3;  2RMU 1;  4XW3 A;  4D6Q A;  1WZX A;  4S2H A;  4XF0 A;  2ETE A;  1AR6 1;  5FTT C;  4K3U A;  4P5H A;  2P4E A;  2BJS A;  2ZAC A;  3BOD A;  3GCX A;  2K0G A;  3SH4 A;  1IKP A;  4C0B A;  2QQP A;  4AL9 A;  3F2Z A;  5FKB A;  3WX5 A;  5JOW A;  1G6N A;  4NWV A;  2P6H A;  4QHO A;  5GM0 A;  1UY0 A;  2WLQ A;  3AZW A;  4B7E A;  3S0M A;  5JI7 A;  3NNF A;  2WQ4 A;  1JS9 A;  4EJR A;  4DUV A;  4U2A A;  2BGC A;  3J8F 1;  2XON A;  3THP A;  3ECQ A;  3NV2 A;  5GJ6 A;  2PLV 3;  2WSV A;  3SC7 X;  1CAV A;  4AFM A;  1UPS A;  3PVE A;  5LA0 A;  1AR9 3;  2D6M A;  1C8M 3;  2JDP A;  1DG6 A;  4HL0 A;  3TN9 3;  4C90 A;  3BUC A;  1C8N A;  2GNM A;  3K4D A;  1S0D A;  1KJL A;  4CCC A;  1UZW A;  3H9A A;  2X5I C;  3I59 B;  1PO1 3;  2J1T A;  3QH6 A;  1W2N A;  4TZD A;  1W0O A;  3HN1 A;  3M1H A;  5D1I A;  3INA A;  1UMI A;  4OVE A;  4DUX A;  1AXZ A;  1B35 B;  5JCT A;  3OF1 A;  4PLO A;  2VO5 A;  1MS5 A;  2BNN A;  2QQU A;  2DBI A;  2WWU A;  3WW1 A;  5IVV A;  3S5Q A;  1NXM A;  5FK7 A;  2PLV 1;  1RUD 2;  2X8K A;  3NKG A;  1Q8P A;  4Y4R A;  4RS5 A;  4ASM B;  1QDC A;  4UT5 A;  4V2W A;  3H42 B;  3HT2 A;  2UYB A;  2VCA A;  4BA6 A;  3P1I A;  4KGQ A;  3ZXE A;  1PO1 1;  1F35 A;  1VBD 3;  2AEN A;  3U1X A;  4Q4V 1;  5LBB A;  3THT A;  1B35 A;  5JOY A;  1UYX A;  3FUO A;  1VIW B;  4QKD A;  4CUA A;  5CFC C;  2WAO A;  4XPV A;  1NLQ A;  3VBO C;  2D5H A;  2XOM A;  4XJA A;  2ZMN A;  2A7A A;  2J22 A;  4AVA A;  1ACC A;  1HIX A;  5HI0 A;  5FXW A;  4P9W A;  4JX0 A;  1CAW A;  4NHM A;  3IBM A;  4YZ4 A;  3TOJ A;  1JZ3 A;  1W6Q A;  5C33 A;  1YEW A;  2VMH A;  4Z2A A;  3AC0 A;  3DPR A;  2ZGM A;  3I2F A;  5LA2 A;  3ACL A;  1V6J A;  2VOX A;  1IZ3 A;  3M3Q A;  4YWA A;  2PHW A;  1DQ2 A;  2HWE 3;  2Z2S B;  4AED C;  3ZYI B;  4DMI A;  5J96 B;  5IAT A;  1GZW B;  3H3L A;  1IS3 A;  4W8J A;  2RV9 A;  3HT1 A;  1W6O B;  2RM2 3;  1JYN A;  2BFU S;  4CEY C;  1AZD A;  1S0G A;  2AGS A;  3PUA A;  5IAV A;  1W8F A;  1WCD J;  1BLZ A;  2XLF A;  3VBF B;  2VZO A;  3X29 B;  1VMH A;  1XYN A;  4QX1 A;  4XAE A;  4HKW A;  2YDE A;  1ONA A;  3NVC A;  4K7J A;  3FHQ A;  5DAV A;  1GBG A;  4YW2 A;  3V56 A;  5F6L B;  2Q1F A;  4BJ0 A;  3AZZ A;  4K21 A;  3RQ0 A;  2RS3 2;  1X33 A;  3BPS A;  2YU1 A;  3OYW A;  3MW4 A;  3POS A;  2Q8D A;  2WO1 A;  4N9H A;  3OPW A;  4DB5 A;  1IPJ A;  2VPV A;  2YGL A;  4K8R B;  4NN0 A;  4BDV B;  4U36 A;  4K8F A;  4E4S A;  3FFQ A;  4CDW A;  3UYJ A;  4IL7 A;  4EZ4 A;  1VB2 A;  5HCB A;  1GWM A;  3KM5 A;  1W6M A;  2PAE A;  4JHT A;  1NQJ A;  2OYZ A;  2FCU A;  2JDN A;  3U14 A;  1AX1 A;  4GMP 3;  4YRD A;  3AYE A;  3OOX A;  3RYR A;  4MGQ A;  4GH4 C;  1UXX X;  1OT5 A;  1OFN A;  2XBO 3;  3HQR A;  3N4M A;  1ZZ6 A;  3OGG A;  2Y34 A;  3K51 A;  4O9G A;  3QBQ A;  2O1Q A;  1FV3 A;  2XJS A;  3IAQ A;  5A80 A;  3WDU A;  5JAX A;  3W21 A;  3VHR A;  4LE3 A;  1BBT 1;  1DQ0 A;  2AYH A;  1YUD A;  3M70 A;  4X8N A;  2ZGT A;  4MVT A;  4R4X A;  2FZ2 A;  1JXN A;  1PX4 A;  1DU3 D;  1XYO A;  3LSD A;  1VE0 A;  1UX6 A;  4A41 A;  4FOY A;  4GMP 1;  4AGV A;  3O1V A;  5FP9 A;  4AEM A;  3VKN A;  3FWE A;  1RUG 3;  1SPP A;  4RR3 A;  3PUQ A;  2R7E B;  5JPM B;  3RZH A;  2RR1 1;  5K0U B;  4QDQ A;  2WWJ A;  2A73 B;  3UKV A;  1F2N A;  2R06 2;  4LBQ D;  1SLB A;  4LIT A;  1PK6 C;  1SDD B;  4R8H A;  2XKO A;  3AL6 A;  3JUU A;  2MNG A;  4NVP A;  2NP0 A;  3TNP B;  4UYB A;  5ABJ B;  1WCS A;  2BER A;  3AZY A;  1QJX 2;  5I8S A;  1UL9 A;  3HBZ A;  2C9K A;  2NQY A;  4CXY A;  3AL5 A;  5FJK A;  2F6B A;  1GMM A;  1VBE 2;  4DRR A;  1WME A;  3WEZ A;  1FV2 A;  4AEK A;  4BQ3 A;  2QBX A;  5E6H A;  3AKR A;  4EN9 B;  1WLT A;  2DYC A;  4GAL A;  2X05 A;  5FYH A;  4CDX B;  3JBG 1;  2MPF A;  4OQ8 A;  4FTB A;  3OPZ A;  4LKE A;  2JB4 A;  4QKB A;  4Y4Y A;  4ORF A;  1QWR A;  4E8C A;  3LFI A;  4OFG A;  4YG6 A;  5JXI A;  1LOA A;  2QE3 A;  4QKN A;  1W2O A;  5HCH A;  3OGJ A;  4HSL A;  1SLA A;  4QHB A;  2V4A A;  3UGF A;  3O1T A;  1RUF 3;  4QX2 A;  1I1E A;  2Q30 A;  4QQH A;  5LK7 B;  3LCP A;  1MS9 A;  1SCS A;  3T0B A;  4UAP A;  4HAN A;  3B5L B;  2GC2 A;  4OI0 A;  4XDQ A;  4M4R A;  4Y1Z A;  4RGG A;  5FZ4 A;  3J4U H;  3PVN A;  1A3K A;  1LHW A;  2YMZ A;  5EP9 A;  5FUI A;  5F9T A;  2BWA A;  5JSR A;  3FBY A;  1RIR A;  3POW A;  1Q8O A;  4JGY C;  4OHW A;  1W2A X;  1JZ8 A;  2JWP A;  4TLG A;  1OLM E;  4N43 B;  2DCK A;  3KCX A;  4D0Q A;  5KXC A;  2OZ6 A;  4ZZ5 A;  1SLL A;  2XJT A;  3K75 B;  5GLT A;  1RUI 1;  1EUT A;  2DU1 A;  4OHX A;  4J1X A;  4UBH A;  4YW1 A;  3RI8 A;  4H55 A;  2UUR A;  4COZ A;  4E2Q A;  5A3O A;  2JE9 A;  4LHK A;  2FCT A;  2H6B A;  4MHR A;  3SQO A;  1LOF A;  3WG2 A;  5ANN A;  5ACA 2;  1AL0 G;  2WFF 3;  2XUE A;  4LUL A;  4Q4Y 2;  1QKQ A;  4Q0V A;  3AKP A;  4UOJ A;  2VMD A;  1OFS A;  2NPI A;  1G9D A;  1Q8S A;  2ZGP A;  1OA4 A;  1FOD 2;  5FO7 B;  2Q4S A;  2BPA 2;  1E5S A;  4COU A;  5C71 A;  1G8W A;  5CEH A;  3VHP A;  4IEV A;  3KV4 A;  2D7F A;  3FZ3 A;  3OBZ A;  2D6K A;  4FQZ A;  4LTA A;  5EWS A;  5LBC A;  5IVC A;  4ASL A;  5J3U A;  1C1L A;  4BPZ A;  2WBK A;  1QU0 A;  3M2M A;  4NRP A;  1GP5 A;  3WUD A;  3AMN A;  3FBM A;  4MET A;  3VBS B;  4K40 A;  2P3I A;  1YC6 1;  3CIH A;  4IET A;  1IS6 A;  5E88 A;  3V0B A;  1BHG A;  4LBQ B;  1EAH 3;  4D6S A;  3I2I A;  2Z5W A;  1O8S A;  1VR3 A;  4MXV A;  2JDH A;  1Y4W A;  4PI2 A;  3ST7 A;  4XFI A;  2XQX A;  3FUQ A;  1W6N A;  1XNT A;  2XWB B;  3L9J T;  4NID A;  3A7Q A;  1XSR A;  4LE4 A;  5BNN C;  1IS5 A;  4I0B A;  4XDP A;  4GB3 2;  1OH4 A;  4WBB A;  1NA1 C;  2EXJ A;  3K77 A;  1OVS A;  1X9T A;  2WDB A;  3VBR A;  5A1A A;  1DGW X;  3K2O A;  5CAZ A;  5BUV A;  5CKQ A;  3NJV A;  2J7M A;  3AKQ A;  1YCI A;  2WN2 A;  3UET A;  4Z2W A;  2DDU A;  5KHG A;  4LOR A;  5FYU A;  4DRV A;  5FPV A;  1HRI 2;  2DFC A;  3EBR A;  3CU7 A;  2C5D A;  1NT0 A;  4WM8 C;  4L0P A;  4IER A;  1D0G A;  3VDB A;  2PTM A;  3GZA A;  1K5M A;  2W46 A;  4XXA A;  3MW2 A;  4XCB A;  1WCQ A;  2LUW A;  4FT8 A;  4XZP A;  2JEN A;  5A32 B;  1TG7 A;  3WF3 A;  3J9S A;  1W05 A;  3ITQ A;  4QHZ A;  5HPO A;  4A7K A;  1AF9 A;  4EWD A;  1MZE A;  1OD5 A;  1POV 3;  5CYY A;  1DGW A;  1PIV 2;  4N8M A;  3WSO A;  5T5O A;  1DZQ A;  2ATF A;  3CZJ A;  3SKJ E;  1DYP A;  3AVR A;  4HN0 A;  3IDB B;  3CJI B;  5FZL A;  4I30 A;  3I49 A;  1A78 A;  3BTZ A;  1J84 A;  1HW5 A;  5JOZ A;  1PVC 3;  4IV1 B;  2XJQ A;  1CAU A;  4QX8 A;  3PHM A;  5FZO B;  1PZ9 A;  3WDY A;  4K9S A;  4D7T A;  2OA2 A;  4FP3 A;  1POV 1;  1YNA A;  3GJA A;  2VCB A;  4CCD A;  1A8M A;  4LO8 A;  3NNG A;  1GWL A;  1UX7 A;  1IS4 A;  3SCF A;  5C4W C;  4UWD A;  4CCK A;  1R1A 2;  4BQ4 A;  3SEP A;  4AI8 A;  2X5I A;  4DY3 A;  4QM9 A;  5KR7 A;  1RUJ 3;  3LIG A;  3BTA A;  1COV 2;  1PVC 1;  3WDX A;  3NO8 A;  1H4G A;  3MID A;  4J1W A;  1OKO A;  4QXC A;  1LOB A;  2BGO A;  4ZU7 A;  4XTP A;  3NQH A;  4HLT A;  1GNZ A;  2WC2 A;  2ZGQ A;  2OX0 A;  1WW6 A;  3HD8 B;  4R9A A;  1LU1 A;  1QJU 3;  1AR7 2;  1ZVF A;  1TZO A;  3T4H B;  3ZPY A;  2QZ3 A;  1ZNP A;  2P34 A;  1HXS 3;  3O12 A;  1S0F A;  1D2Q A;  1G86 A;  2CGN A;  2VXR A;  4XZU G;  2AH2 A;  1MEC 2;  3ZFG A;  5LZ6 A;  2ARX A;  3HNB M;  2V5Y A;  1ENX A;  5CFC A;  3FLR A;  1QOT A;  2Q8E A;  4G9S B;  1ODM A;  5F5A A;  5L9R A;  3VBO A;  1SFY A;  4DIN B;  4LBM A;  3WHT A;  3I3Q A;  1PM7 A;  2ET1 A;  2OPW A;  2PMW B;  2YFU A;  1DIW A;  1QJU 1;  4BQY A;  3SMH A;  1RXF A;  2GME A;  3PVB B;  1HXS 1;  4XIK A;  1QDO A;  2RE9 A;  3VKF C;  4MV2 A;  2Y6J A;  1VRH 3;  4E9K A;  1N3P A;  2LS6 A;  1TMF 3;  3J26 N;  2PQS A;  1IQD C;  1CX4 A;  4HON A;  4QPI C;  1Y43 B;  4QAW A;  4XTM A;  3WW2 A;  4AED A;  3L2H A;  4Q4W 2;  1ZBA 3;  3RWK X;  4CCJ A;  5F37 A;  5F1R A;  5A7Q A;  5FP8 A;  2ORZ A;  5BNO B;  3D8C A;  3IPV A;  2WT1 A;  4Z82 A;  1ZRE A;  1BMV 1;  1TQ5 A;  1NZC A;  3LEG A;  4CEY A;  5FQ0 A;  2VME A;  1Q8Q A;  3OY8 A;  1ULG A;  1VLN A;  1VBA 3;  3PJQ A;  1CGP A;  1MS4 A;  1BKZ A;  5DG2 A;  2V09 A;  2E6V A;  3WHU A;  3WF2 A;  2TUN A;  2VQT A;  1MS3 A;  3WOG A;  5IVJ A;  1W03 A;  2PHL A;  2WO2 A;  1ZA4 A;  5T5L A;  4IEX A;  3T09 A;  2BV4 A;  4A44 A;  3BTX A;  4LUK A;  5FYV A;  3T0A A;  1Z7S 2;  2OZJ A;  4KG0 A;  3R6S A;  3VKM A;  4AW7 A;  4ZHN A;  4IV3 C;  5F5C A;  2JG8 B;  2R0F A;  4QX3 A;  4YG3 A;  1S55 A;  1L3J A;  4AVT A;  4MX3 A;  4YW7 A;  2WZR 2;  4XIL A;  3D82 A;  2QNK A;  5FPL A;  3VD4 A;  1IHM A;  1W9W A;  1XC6 A;  1CJD A;  2DF7 A;  1CZV A;  4FTE A;  3MO4 A;  4H7M A;  4XOG A;  1NYW A;  5IVY A;  5EQU A;  2GNT A;  2ZEX A;  4Y3O A;  2D43 A;  5J37 A;  2GC3 A;  2VNR A;  3KSC A;  3M8L A;  4GH4 A;  2ZX0 A;  2WYS A;  1EPZ A;  1C1F A;  1J58 A;  4IDZ A;  2A3W A;  1JUI A;  2YPD A;  1FNY A;  1MS8 A;  2PQQ A;  1RGS A;  4CU6 A;  4QU2 A;  2E7A A;  5FIX A;  4NAO A;  1SBD A;  2VOT A;  4OHV A;  2P5B A;  3VHN A;  1XU1 A;  3GBW A;  4FVV A;  4ZKT B;  1LTE A;  1G9B A;  1UY3 A;  1FAT A;  1V6I A;  1S0E A;  3NKT A;  5DDJ 2;  3ZYB A;  4NJ4 A;  4PT6 A;  4UF0 B;  4WVV A;  4IEY A;  1V9U 2;  2ET7 A;  3J7N A;  3WV6 A;  2GH8 A;  1T6B X;  2CU5 A;  3O5S A;  3PL0 A;  1NCR B;  2JG9 B;  2JIJ A;  1PK6 A;  2ZAB A;  3BN6 A;  3W5M A;  1GFF 2;  1FPN 3;  3E1F 1;  1WUV A;  2SBA A;  1QJF A;  1ZZ9 A;  3OUI A;  4P02 B;  4E4Z A;  3DPR C;  2WR9 A;  4FCA A;  2LW8 A;  3HPN A;  5FMO S;  2Q1Z B;  4HN1 A;  1LHU A;  1LOC A;  2P3J A;  3NV3 A;  4RGK A;  4O7X A;  4WVM B;  1TME 1;  2DCZ A;  4HXC A;  3RMX A;  1RUH 2;  2A6Y A;  1HRV 2;  4M00 A;  1BJQ A;  5FP7 A;  2W3J A;  1I3H A;  5IK8 A;  4KL1 A;  2RG4 A;  3G7D A;  4ISQ A;  4BB3 A;  1VAM A;  3RMY A;  4FPF A;  3AJZ A;  4Y1X A;  4YW5 A;  4C8D A;  1FPN 1;  2D97 A;  2ZTN A;  1WW7 A;  2NLR A;  4LHS A;  5A3P A;  2V5D A;  5LRS A;  3TEZ A;  1E5I A;  2VTX J;  4JGY B;  2QVS B;  2HWB 3;  2K46 A;  4XFB A;  1YIP A;  4YPJ A;  2D98 A;  3AMP A;  2HWC 2;  3RJ2 X;  1SDW A;  1ULD A;  4GZ9 A;  4ZS2 A;  2YY1 A;  1W2T A;  5A7N A;  2ZX4 A;  3RYP A;  2GAL A;  2ZA9 A;  1AL2 2;  3AP5 A;  1Y9M A;  1H8T A;  2QQV A;  3T2T A;  1JH5 A;  2C26 A;  2GH2 A;  3I2D A;  4HMZ A;  2YXS A;  1LRH A;  2D3S A;  1RVF 3;  4NHY A;  5FZ6 A;  5FUN A;  4O61 A;  2R04 2;  4YZ3 A;  1D4M 2;  1MS1 A;  4Q27 A;  3CZU A;  5HV0 A;  3ZFE B;  4CDU C;  1J83 A;  4MHU A;  2EXI A;  3DYP A;  1F5J A;  1K5J A;  2E26 A;  2WS9 1;  4FPL A;  4BU2 A;  4QD2 A;  3DCQ A;  4MAD A;  3W9A A;  1UYZ A;  3ASI A;  1W0N A;  1CVN A;  2OXB A;  2Y60 A;  2PA7 A;  1LOD A;  1IPK A;  5ERL A;  5J7M A;  4Q26 A;  5KC5 A;  4FAG A;  2G9Z A;  5FYS A;  4COV A;  3KCY A;  2Y8K A;  5DUU A;  4LXL A;  4PLN A;  4L9B A;  3OD0 A;  4YFW A;  1AR8 3;  1XSQ A;  2QTW B;  4UW6 A;  1S2E A;  3BCW A;  3POG A;  4XF3 A;  4BME A;  5FPZ A;  1D0H A;  2VTF A;  1RHI 3;  4XF4 A;  4YAR A;  3KLS A;  3AKT A;  1VJ2 A;  5KXB A;  1U5Y A;  1ASJ 3;  4E2S A;  3TEY A;  2XJV A;  3TWI A;  1UOB A;  3N7L A;  3E97 A;  5FZD A;  5LK5 A;  1XJA A;  2YBS A;  3BB6 A;  2A6W A;  3VDD C;  4A7Y A;  3WLU A;  1P8J A;  1UNB A;  2AEY A;  2VCM A;  1VBB 1;  5CA6 A;  1PGL 2;  4AVV A;  4FP2 A;  5FRA A;  5BNN A;  2R1D A;  5FDB A;  1WA4 A;  1RHI 1;  3GBF A;  3CHX A;  5L36 A;  2BVB A;  1NA1 A;  4GMP 0;  4XQW A;  5DXD A;  1ASJ 1;  2RJL A;  5AC9 2;  2BVV A;  4QPG A;  2JE8 A;  5A33 B;  2F17 A;  3NV4 A;  2E9Q A;  2HWF 2;  2JDK A;  2ES3 A;  2EXK A;  4G3Y C;  1GQH A;  1MVQ A;  3M4F A;  2EIE A;  2EXH A;  1EYB A;  4WM8 A;  1N47 A;  4I3P A;  1OSG A;  1DGR N;  1L7R A;  4OLL A;  5FXZ A;  3RZM A;  1GP6 A;  3P3P A;  1OLQ A;  5CAD A;  4MLO A;  3LEK A;  4P9L A;  3N7K A;  4Q1P A;  2X29 A;  1N1S A;  3CNA A;  3MLJ A;  1EV1 2;  4QX0 A;  2B39 A;  1H1I A;  3ETQ A;  4CSW A;  3WNN A;  4CPB D;  1PZ7 A;  2QQI A;  3DGT A;  5B4X A;  3LE0 A;  2WWS A;  4JDO A;  2QUO A;  3EHK A;  3S7I A;  2ZXQ A;  4N7I A;  1E57 A;  5IW0 A;  1KRI A;  3KV5 A;  2R32 A;  2CNA A;  2CAV A;  5LBF A;  4AHY A;  1CZT A;  2XKP A;  4I3G A;  1ND3 B;  4LR4 A;  5FZK A;  4FBF A;  1RC6 A;  1OF3 A;  5FZ7 A;  2OPK A;  3WG3 A;  4B8E A;  1JZ2 A;  3Q8A A;  3A22 A;  5APA A;  3W59 A;  2EF6 A;  1APN A;  4PQQ A;  4AQS A;  3ZFF B;  4PF1 A;  5C4W A;  1R09 3;  2BBV A;  3MPB A;  2R6Q A;  3HIF A;  2WO7 A;  4M3C F;  3WNO A;  2TEP A;  3ZX7 A;  4AI3 A;  3T1M A;  4DIQ A;  1ULC A;  1V6K A;  2W9X A;  2ZAA A;  5BNP C;  1O8P A;  3WVJ A;  2DFB A;  4A7Z A;  4Q4X 1;  1AXY A;  4B4R A;  2RS1 1;  3ZDV A;  4AOC A;  2GZW A;  5F8P A;  1HQN A;  4XDO A;  1KIT A;  2CDP A;  1BEV 1;  2C0Z A;  3VKL A;  3O1P A;  2BOJ A;  1BYH A;  1R09 1;  4Y20 B;  2HWD 1;  4DXT A;  3ATG A;  4LHL A;  4OHZ A;  1N3Q A;  4B7K A;  4Q8K A;  4CVU A;  3AKS A;  1DZR A;  3T2P A;  4GWI A;  3DEC A;  5FZ0 A;  1R64 A;  1RUE 2;  3LDR A;  4IW3 A;  3ZIW A;  2EIG A;  2RVA A;  5CBL A;  3LOI A;  2MEV 2;  1X50 A;  1OOP B;  4KNC A;  5K8S A;  1FYU A;  1R08 3;  3OCP A;  2VVF A;  3QOP A;  4B4Q A;  1SFP A;  2VM9 A;  4NHX A;  1AYN 3;  2RMU 2;  3GBG A;  4ERO A;  1JBC A;  1AR6 2;  1STM A;  2C24 A;  3PU8 A;  1XE7 A;  2XML A;  1AXK A;  4XCA A;  4EN8 B;  1YQC A;  2VC9 A;  2HEV F;  3BKZ A;  1VAL A;  3KGL A;  4PF5 A;  1UD1 A;  4QPI A;  4J6G A;  2QDR A;  2A71 A;  2KXL A;  3B93 A;  4DXS A;  2RDQ A;  4AXO A;  5F3E A;  1CIY A;  3H8U A;  3N35 A;  5FZ3 A;  1OMI A;  3JD7 3;  1CAV B;  3O1O A;  4MO3 M;  1BVV A;  5FPA A;  3T1L A;  4EQV A;  1W06 A;  4YVW C;  5FP4 A;  2WRA A;  2A70 A;  2AZ5 A;  4Z1V A;  3H0O A;  3VV1 A;  2BGP A;  4LBJ A;  3WXP A;  4AZZ A;  4FPG A;  5CNA A;  1Q43 A;  2A3Y A;  1HJG A;  3PTR B;  3R4U A;  2PN5 A;  4HVQ A;  5CZK A;  5LY2 A;  5FFO C;  5FYZ A;  4C0H A;  2P3Y A;  4IE7 A;  4IV3 A;  2BP6 A;  3NST A;  5EJ3 A;  5F5Q A;  4JKL A;  5L73 A;  2ZEY A;  1RMU 3;  2HEY F;  2PLV 2;  3OBT A;  4P9G A;  4RS5 B;  2VZS A;  1MQT C;  4D3W A;  3LWC A;  1ND2 C;  3AYD A;  2BUK A;  5T5J A;  3AYA A;  2GMP A;  4NHK A;  3O0W A;  1DGL A;  3OBA A;  3ELN A;  3OGV A;  3JXS A;  4BQX A;  1PO1 2;  1SLT A;  1SMV A;  3D6E A;  2YBK A;  5C8C C;  4Q4V 2;  4XFH A;  4BXS V;  1SLC A;  3LAG A;  3JZV A;  3NRU A;  5FOJ B;  1WLD A;  5EPA A;  3T3Y A;  1UZY A;  1AR9 1;  1C8M 1;  4FPY A;  1PMI A;  3TN9 1;  5A6Z A;  1POV 0;  3I8T A;  4Y5Z 0;  5C3Q A;  1CAW B;  1W6Q B;  2IFR A;  2LRP A;  2J1A A;  3C7G A;  4KWK A;  3TNQ A;  4AQT A;  2DWR A;  2W1W A;  1PM4 A;  3VLB B;  2BEO A;  3ACI A;  2IXJ A;  2OW4 A;  3DPR B;  2E51 A;  3ZFG C;  1AJO A;  1OUS A;  4LPL A;  4PIX A;  2ZGS A;  1IPS A;  1MPX A;  2VQA A;  4IEP A;  4PBP A;  3RRD A;  4XXP A;  3S7E A;  1HQL A;  4ASK A;  3WF1 A;  4JKK A;  4PCR A;  3RI9 A;  3ZR6 A;  3AB0 A;  4BQ5 A;  4KQ7 A;  5FY7 A;  2UY9 A;  2WAB A;  3R4D B;  1RUD 3;  2Q8O A;  1LGN A;  1UOF A;  3I4I A;  5A6X A;  2Y38 A;  1O5L A;  5A7P A;  2B45 X;  3I7D A;  5FYT A;  1FAY A;  5LBE A;  4NIA A;  3VGI A;  4CUC A;  2JIG A;  1LGC A;  4NR1 A;  5FY4 A;  1VBD 1;  4YZ1 A;  4AHW A;  1XB9 A;  1GU3 A;  3I3B A;  4ATF A;  3N3H A;  2R07 2;  3B3Q E;  3HNM A;  5D8A C;  1RB8 G;  4IE6 A;  3LB9 A;  2XQR A;  4QPY A;  4JVA A;  2XVL A;  3FX3 A;  3OYW B;  2G19 A;  4NRQ A;  2ENR A;  5JXH A;  1OVP A;  5LA9 A;  1LU2 A;  1O91 A;  5IVE A;  4AGR A;  5KWR A;  4QQ2 A;  5IAX A;  1O3Q A;  2W87 A;  2PXJ A;  4MGK E;  1S0J A;  3WF4 A;  3AXE A;  1W3X A;  3BOP A;  4AI9 A;  4CDW B;  3Q8E A;  4DXR A;  5HCA A;  4XF1 A;  4JGZ C;  2HWE 1;  1KDK A;  4OMC A;  1W6M B;  5FZC A;  3RGB A;  3U4S A;  3PU3 A;  5SV8 A;  1JYW A;  1ZZB A;  2RM2 1;  3EO6 A;  3N9N A;  1ZRR A;  2H0V A;  2R30 A;  5CKM A;  4Q0U A;  5BPX A;  1UYP A;  2XJU A;  4LOT A;  3I3E A;  2Y6F A;  2P37 A;  1JYX A;  5T52 A;  5C9A C;  1KS4 A;  4YW4 A;  1ZBE 2;  4PJY A;  3JB8 A;  4B29 A;  1ULO A;  3WP3 A;  4UW3 A;  1BBT 2;  1PO2 3;  3PUI A;  5A1L A;  1GOG A;  1X8M A;  4NHL A;  2JDA A;  4CDU A;  4R4Z A;  1O3T A;  4IGO A;  1JYC A;  2EAA A;  1SPP B;  1UY1 A;  3GZT B;  2ZBJ A;  1SFN A;  4RN5 A;  1W04 A;  2OII A;  4FXG B;  4RR3 B;  3WNK A;  4E8D A;  4MZU A;  2GDF A;  2DVD A;  1CJP A;  2RR1 2;  2VG9 A;  3C7O A;  1VBC 2;  3UKN A;  2O14 A;  2B9V A;  5FZE A;  5FZB A;  2ZGR A;  4P00 B;  1F9K A;  1OBN A;  1PO2 1;  3AZX A;  5IFP A;  4N53 C;  5FWJ A;  2ZCW A;  1O7F A;  3D3A A;  3OPT A;  3IT8 A;  3VZK A;  4AWD A;  5HXM A;  5L9B A;  1O4T A;  4ONU A;  3SKV A;  2WT0 A;  4ZXK A;  1UPI A;  2FQP A;  2XBO 1;  3DL3 A;  3WIN E;  1U12 A;  3B9C A;  1E5H A;  2QQM A;  1JU4 A;  1WMD A;  3VDD A;  3WQ7 A;  1ZRD A;  2W2I A;  1T6G C;  3JBG 2;  4QXK A;  2PAK A;  2ZX1 A;  3N7J A;  3W5N A;  4COY A;  4ES9 A;  1H9P A;  4YZ5 A;  3N9L A;  3GXU A;  3NJZ A;  3URF A;  1RUG 1;  3ZIX A;  2NMO A;  3JB4 C;  4YGC A;  2MHF A;  3AVS A;  3ZYG A;  3FL7 A;  5L7O C;  1JYV A;  1DLL A;  3FFZ A;  3AMQ A;  1WLC A;  3HVD A;  2VL4 A;  4JQR A;  4MUV A;  4LBN A;  1A6C A;  4OI2 A;  3AJY A;  2R06 3;  3SH3 A;  4BLJ A;  1CZS A;  3I2J A;  4DOU A;  2W47 A;  1FI2 A;  1LHV A;  4DPN A;  5IVF A;  1QJX 3;  3C7F A;  2ZEW A;  2JE7 A;  3B9I A;  4FI9 A;  1RUC 2;  1Z0H A;  4JRA A;  3UGH A;  2VVE A;  3LA3 A;  5A7O A;  4L92 A;  1VBE 3;  2C4X A;  1RUI 2;  4CCN A;  5EIY B;  1J3R A;  5SV5 A;  3QD6 A;  4UFM A;  2UWB A;  4FXK B;  4XF9 A;  1T2X A;  3LEM A;  1H8T C;  2EA7 A;  4W50 A;  3TEW A;  1UZ0 A;  1XU2 A;  5F3C A;  2JB8 A;  4M3C A;  4YVS C;  5FUP A;  1UYY A;  1Q3E A;  2WJS A;  3J7H A;  4Z92 B;  5AFE A;  2YRO A;  4WM7 C;  1CAX B;  1UOJ A;  3ALQ A;  4HPK A;  4W6W A;  1RUF 1;  2VOW A;  5BXX A;  4GWN A;  4XUQ A;  3RS6 A;  4PDW C;  4FFF A;  1DYK A;  4UW4 A;  3III A;  4PHZ A;  1ENS A;  1REE A;  4LA3 A;  2WL1 A;  2FDI A;  4RFT 0;  1YHF A;  1BXH A;  2YUE A;  2JDU A;  3MW3 A;  3LGR A;  2RDS A;  5LW9 A;  1QIQ A;  3KD4 A;  1IGO A;  4YFZ A;  3IZO A;  1HQW A;  1NE6 A;  1SEF A;  5T3N A;  3V0B B;  2GAU A;  3AFG A;  3KMH A;  5CU1 A;  5BNP A;  3QCW A;  2XJR A;  4GA9 A;  4YM3 A;  1CAX A;  2D44 A;  3Q8B A;  4GAZ A;  1W6N B;  2OUJ A;  1YI9 A;  5H9S A;  1Q56 A;  4JC1 A;  2W68 A;  2OUH A;  3NNM A;  5H9Q A;  5FZA A;  2AC1 A;  1S4C A;  3VBR B;  4MOA A;  3VD9 A;  3MF6 A;  2WNV C;  4HG6 B;  3SXW A;  2WFF 1;  4IGQ A;  5ACA 3;  4Q4Y 3;  1UZZ A;  2SLI A;  3ME2 A;  4CE8 A;  2CHH A;  3VN4 A;  3B02 A;  1FOD 3;  4C1W A;  1AX0 A;  1K5M B;  1LGB A;  2VH9 A;  2UY8 A;  2W5F A;  3P5B A;  1DZT A;  4MH0 E;  4NWW A;  3TB0 A;  5CIS A;  4CTE A;  1RTV A;  2D93 A;  2DUO A;  5JZG C;  5CFD C;  3SIT A;  1EUU A;  3ZMN A;  2ZJC A;  3WP4 A;  2IXL A;  4QPG C;  3P6B A;  3SNM A;  4MSV A;  4AI1 A;  5JUV A;  3N9O A;  3PUS A;  4EYU A;  2ADE A;  4Y24 A;  1C4R A;  4Y1V A;  4OQ9 A;  2E63 A;  4BIF A;  1EAH 1;  2TNF A;  4OMD A;  3MHZ A;  2F4P A;  3A23 A;  3AFK A;  4BE3 A;  3ILN A;  3M3C A;  1NQD A;  3KT4 A;  1U5X A;  4NII A;  1JOJ A;  3QAC A;  4CP2 A;  1CAU B;  2DV9 A;  3NAP C;  3KT1 A;  1I9R A;  1HKD A;  1VB4 A;  2JX9 A;  1UW8 A;  3THD A;  1XNB A;  1MAC A;  4LNV A;  4TXW A;  5KHK A;  4ET7 A;  1J59 A;  4YVW A;  4IEZ A;  4GD4 A;  3ZOI A;  3HEI A;  1SZB A;  4AFD A;  4CP0 A;  1N3O A;  2X5I B;  1HRI 3;  4XQD A;  5FZF A;  5EZW A;  2JIC A;  1XYP A;  4HBN A;  2DCJ A;  4NPR A;  1WWY A;  4BH9 A;  1BK0 A;  1YI7 A;  4XEZ A;  2VNO A;  5A3T A;  5BV6 A;  2EAK A;  5IHR A;  1PVC 2;  1W90 A;  1CR7 A;  1S2B A;  4JTN A;  4XHB A;  4ZXE A;  1XNC A;  4E4D X;  3GHM A;  2H0B A;  5DG1 A;  3N9P A;  5FBJ A;  5IK5 A;  5I0T A;  3BPZ A;  1MQT A;  1PIV 3;  3KQ4 B;  1G9A A;  5J36 A;  1W8W A;  1ND2 A;  1H6X A;  3LIH A;  5HCF A;  4EZH A;  4QGM A;  5FV3 A;  3UT0 A;  4XJW A;  4CYD A;  2O8O A;  1DF0 A;  3OG2 A;  5GLU A;  1SQ4 A;  3ZFG B;  4P08 A;  3WNL A;  2Z69 A;  2CGO A;  2XH6 A;  2Y64 A;  4D94 A;  3VBH C;  5C8C A;  3SEE A;  3ZN4 A;  5CFC B;  1W8U A;  1HV1 A;  3VBO B;  1IG3 A;  2IVI B;  2KD7 A;  1JHJ A;  3HJR A;  3KVA A;  2BBA A;  1LKN A;  4GKY A;  3UES A;  2QKD A;  1QJU 2;  5C6C A;  2YV8 A;  1LUL A;  1QMJ A;  1RUJ 1;  1UKG A;  5FMD A;  2IWG B;  4LEJ A;  1UKR A;  2K2S A;  1NCQ C;  4GWJ A;  4LO7 A;  2D6P A;  1YFW A;  2E7T A;  2IXK A;  2D6O X;  4AED B;  4Q5O A;  4CDQ C;  4Z8B A;  3VBU C;  3I2H A;  1CWP A;  3D5O A;  1F5F A;  3WT3 A;  1AYM 2;  3MIB A;  1UU5 A;  2CL2 A;  3IPV B;  3GM8 A;  3LPF A;  4ZU5 A;  2Q8C A;  5K7P A;  4CEY B;  2E53 A;  2WSU A;  5FQ0 B;  3OY8 B;  3CLP A;  4RHV 3;  3U11 A;  1BMV 2;  5FR3 A;  3OJB A;  3RVH A;  2VTX A;  4QXH A;  4A2U A;  1AR7 3;  4XJZ A;  1M06 G;  5GKA C;  4AAP A;  3WQ1 A;  2VMF A;  3BAL A;  1NE4 A;  1C5H A;  1FX5 A;  4I0W B;  4AHX A;  3U0Z A;  3B01 A;  1MEC 3;  3SLI A;  1OPM A;  2VMI A;  5D8A A;  3BIW E;  1DQ6 A;  3NNJ A;  3POB A;  3AZV A;  5F3I A;  2W95 A;  5J98 B;  5FY0 A;  1QH6 A;  1UY4 A;  1FNZ A;  4RQP C;  3KCC A;  4PIY A;  1A34 A;  2BZD A;  1OUR A;  1PX3 A;  4OUM A;  1Q5O A;  3DUI A;  1U0A A;  4RHV 1;  5A7W A;  4KMQ A;  1GV9 A;  4YNI A;  5KXE A;  5I0R A;  1AR7 1;  1IQA A;  2VZT A;  5FZG A;  1VRH 1;  3ZSJ A;  4PLM A;  1M4W A;  2DVG A;  1TMF 1;  2A6Z A;  3MI8 A;  3B69 A;  1MEC 1;  1NLS A;  4FPC A;  4JGZ A;  4LO6 B;  4XFF A;  5EJ1 B;  5FZI A;  5GLZ A;  5JMO A;  4JDM A;  2XHK A;  1ULP A;  1ZBA 1;  2VR4 A;  1UIJ A;  4W6Y A;  4P5Y A;  2J1E A;  1YJK A;  2WA3 A;  4Q4W 3;  3VDC A;  4KI5 M;  1ZA7 A;  5BNQ A;  4GH4 B;  1JOD A;  2QQW A;  1DLC A;  1VBA 1;  4P9X A;  3FHI B;  4CEW C;  3V0A A;  2FMY A;  1EY2 A;  5C9A A;  5IK7 A;  3WY6 A;  3MUZ 1;  3VL8 A;  5K9Y A;  4YZ2 A;  3WNM A;  2WZP P;  2GC1 A;  1UIK A;  4Q0S A;  3RZG A;  3RNS A;  1CD3 G;  1W9T A;  3VZN A;  4FFH A;  5IFT A;  2CY6 A;  4QB6 A;  2VE1 A;  4BK4 A;  3MYX A;  2IC1 A;  3WQ0 A;  4EWA A;  3HAG A;  1RJ8 A;  1TE1 B;  3ABZ A;  1W8O A;  1HDK A;  4YGB A;  3KHB A;  4Y1U A;  3S57 A;  1GQP A;  4I2O A;  3E5Q A;  4HVO A;  1ENR A;  2WZR 3;  1PK6 B;  5GZC A;  5I0U A;  1KXG A;  5DAP A;  3UGG A;  1QQP 3;  3GNE A;  1AHS A;  4N53 A;  4ZON A;  3WZ1 A;  5FY5 A;  3T2Q A;  5DMY A;  4CCL A;  2XG3 A;  4YLZ A;  1PVX A;  2PEL A;  1S0I A;  1UN1 A;  2QCS B;  2ZGL A;  3ILF A;  1O59 A;  2QZ2 A;  1DQ5 A;  1H2N A;  3LDB A;  1TME 2;  3APB A;  4MGI E;  2P6C A;  3M3E A;  2LTN A;  5A7S A;  1OLM A;  3POF A;  3FC0 A;  4L2N A;  4IGP A;  1WMF A;  4AF9 A;  2I07 B;  3BGA A;  5ISL A;  2TBV A;  3J7M A;  4MXW A;  1QQP 1;  3UV9 A;  1RUN A;  3N9M A;  3ZXD A;  5IT6 A;  1WCU A;  3PMS A;  4IXL A;  5HXV A;  5DDJ 3;  2XDV A;  1QXP A;  1YQ8 A;  3DXT A;  3UJQ A;  1RJ7 A;  5FY9 A;  5J1X A;  5L7O A;  1AUY A;  1C5I A;  1MZ6 A;  1V9U 3;  1WD3 A;  2RS5 2;  3CQO A;  2JKB A;  4P14 A;  2NYY A;  3GAL A;  3CBN A;  1H8T B;  5LEJ A;  1UQX A;  4CU9 A;  1L7Q A;  2CSG A;  1VAV A;  3AX4 A;  2A1X A;  3HMY A;  4QQO A;  3R05 A;  1DFQ A;  1GAN A;  5T5P A;  2FDK A;  4LHN A;  5DDJ 1;  5FXX A;  1WBF A;  1OH3 A;  4LOS A;  5GZD A;  1UMZ A;  3J7L A;  3PTY A;  3SIS A;  3U07 A;  1H4H A;  2EIC A;  1RUH 3;  2WS9 2;  1HRV 3;  2JDY A;  2XGX A;  5JSP A;  3I3M A;  1JOP A;  2EAL A;  1K12 A;  3BVC A;  3MGU A;  4AI2 A;  3MEP A;  4CU7 A;  4YVS A;  4FAH A;  4A4A A;  4X6Q B;  4WV8 A;  1NY7 1;  1UU4 A;  4Y1Y A;  5F2W A;  4MG2 A;  4AR2 A;  1A8D A;  4YSF A;  1E5R A;  2HWB 1;  2V72 A;  4WM7 A;  5F3G A;  3M7A A;  2AR6 A;  2E33 A;  3WNX A;  1Y9Q A;  4HFS A;  3BU0 A;  3EXU A;  4PDW A;  4S2F A;  5E8A A;  3OD4 A;  1VRB A;  3ZSM A;  5C3R A;  2ZML A;  3LEI A;  1X7N A;  4Y5S A;  4CA9 A;  2HWC 3;  1LHN A;  3T30 A;  1QJY 3;  3C8X A;  1AL2 3;  4CRQ A;  3U10 A;  2F4L A;  5LRR A;  1RVF 1;  4B1M A;  2RDR A;  4LK7 A;  3T4V A;  4CCM A;  1DHK B;  3VBF C;  3R4S A;  1PZ8 A;  5B2G B;  4XFC A;  3MPP G;  3OBR A;  2BW8 A;  3ZN6 A;  2R04 3;  1I6X A;  3O1U A;  1VBB 2;  4IEQ A;  2W1Q A;  1D4M 3;  3B94 A;  3F95 A;  5BNN B;  1V0A A;  2HKX A;  2ZHM A;  4UI9 L;  5DZE A;  1NA1 B;  3AXD A;  5FYI A;  1H30 A;  5K4L A;  1QJY 1;  2WNV A;  4QPG B;  4QX5 A;  4BXF A;  5EV7 A;  4CP9 A;  1AL2 1;  5LAT A;  1TNF A;  2BTV C;  2KA3 A;  2VUL A;  1W2U A;  3E5X A;  2I74 A;  4E4H A;  2VZ3 A;  3MUY 1;  3GZE A;  2PHU A;  4RD7 A;  1AR8 1;  4WM8 B;  2HYK A;  3JCI A;  3LA2 A;  2R04 1;  2FBE A;  3KV6 A;  2JKX A;  4YW3 A;  5M0T A;  1F8V A;  2ZOE B;  5JXG A;  3A0K A;  5JZG A;  4AFB A;  1FT9 A;  1OLR A;  4Y26 A;  5CFD A;  1BVP 1;  2XWJ B;  2X09 A;  1C57 A;  4H3W A;  2P17 A;  2X10 A;  1OUX A;  5FZH A;  5JIA A;  3VDA A;  3ETP A;  1LR5 A;  1XE8 A;  2I2S A;  3VD3 A;  3OUJ A;  3UL2 A;  4DFS A;  5FYC A;  3ZYF A;  3O1S A;  4DQA A;  1JYI A;  1FMD 2;  2ZZJ A;  2HBU A;  2QQO A;  3NNL A;  1SAC A;  4XUO A;  4EWE A;  3NAP A;  1X36 A;  2OS2 A;  4QQL A;  2ZGN A;  5FZ8 A;  2DTW A;  1V6M A;  2PHR A;  5AC9 3;  3ON7 A;  4UFJ A;  3H1M A;  1W8N A;  2HLE A;  4NPM A;  5C4W B;  2HWF 3;  3MIE A;  4R9C A;  5K0U C;  1GZ9 A;  5G04 L;  4QKF A;  4Y22 A;  1I5Z A;  2A5Z A;  3ACG A;  2B9U A;  2YPJ A;  1XRU A;  3T0D A;  4AEJ A; 
#chains in the Genus database with same CATH homology
 2WBK A;  2WZ8 A;  3FN9 A;  3CIH A;  4QDS A;  2CDO A;  1GNY A;  1BHG A;  4A45 A;  4CUB A;  5JXH A;  3I2I A;  1O8S A;  2W87 A;  3DYM A;  2XQX A;  2EIB A;  1XNT A;  3WF4 A;  4W4Z A;  3A7Q A;  4DXR A;  1RYY A;  1OD3 A;  1OH4 A;  2VZQ A;  1F4A A;  3K77 A;  4OMC A;  2WDB A;  5A1A A;  3WQB A;  1JYW A;  3NJV A;  3CMG A;  3VD5 A;  2J7M A;  2ZEZ A;  2Y6L A;  2WN2 A;  3UET A;  2DDU A;  1W9S A;  4JKM A;  3I3E A;  1JYX A;  5B4N A;  4L0P A;  4JHZ A;  3VDB A;  2ORX A;  2W46 A;  3OGR A;  4ZY9 A;  5DPN A;  1WCQ A;  4RYD A;  1ULO A;  3WF3 A;  1TG7 A;  3PUI A;  1GOG A;  5HPO A;  2JDA A;  3I3D A;  3C7H A;  2Y6K A;  5CYY A;  1CX1 A;  1JZ5 A;  1UY1 A;  4RN5 A;  3WSO A;  3IAP A;  4E8D A;  3WNK A;  3CZJ A;  3SKJ E;  3C7O A;  1GUI A;  1LNS A;  1US2 A;  3FHA A;  3HN3 A;  2B9V A;  4A42 A;  1J84 A;  4P00 B;  3THC A;  4DUW A;  5IFP A;  2Y6H A;  3IB3 A;  3D3A A;  5HXM A;  3OGS A;  1NX9 A;  2VCB A;  3SKV A;  3NNG A;  1UX7 A;  2YB7 A;  3SEP A;  2QQM A;  1JU4 A;  3C7E A;  1XNA A;  4M4P A;  2J1S A;  4D8M A;  3ACF A;  4DEQ A;  3W5N A;  1UXZ A;  2BGO A;  3GXU A;  3NQH A;  2QQN A;  4LQR A;  3FL7 A;  1JYV A;  4LKS A;  2VL4 A;  1CZS A;  3I2J A;  4XZU G;  3U37 A;  2W47 A;  3HNB M;  3C7F A;  2ZEW A;  4FI9 A;  2Y6G A;  3GGL A;  3K46 A;  2YFU A;  2C4X A;  4QPW A;  5EIY B;  5I0D A;  1T2X A;  1PMH X;  1D7P M;  4W50 A;  2B4K A;  2J1R A;  1UZ0 A;  2Y6J A;  3K4A A;  2WN3 A;  1UYY A;  2VZV A;  2LS6 A;  5IYY A;  2PQS A;  1IQD C;  5EJZ B;  3J7H A;  4QAW A;  4AAX A;  2QQL A;  4OUE A;  2ORZ A;  4XUQ A;  1NKG A;  3III A;  3LEG A;  2VME A;  5DN2 A;  2VZU A;  2E31 A;  2W94 A;  3WNP A;  3WF2 A;  2VQT A;  4A3Z A;  2WAA A;  2WO2 A;  4KWU A;  3T09 A;  4A44 A;  3T0A A;  3LPG A;  4QX3 A;  2EID A;  5LA1 A;  1F4H A;  4XUT A;  3T08 A;  4XUP A;  4MOA A;  3VD9 A;  4HG6 B;  3VD4 A;  1W9W A;  1XC6 A;  1KGY A;  1US3 A;  3CDZ B;  2VZP A;  1CZV A;  3MO4 A;  4IUG A;  3I97 A;  2ZEX A;  2W5F A;  2WYS A;  1EUU A;  3P6B A;  2VCC A;  5JUV A;  4CU6 A;  3DYO A;  2YFZ A;  1H6Y A;  2VOT A;  3HOB A;  4OMD A;  1UY3 A;  3A23 A;  4DEV A;  4PT6 A;  3EYP A;  2ID4 A;  2W92 A;  4AG4 A;  2HYX A;  3T2O A;  2J1U A;  4A6O A;  3PUH A;  1YQ2 A;  3THD A;  1JZ4 A;  1SHW B;  1JZ7 A;  4TXW A;  3BN6 A;  4ET7 A;  3W5M A;  3E1F 1;  1UMH A;  2VMC A;  4P02 B;  1NAE A;  1TVG A;  3MBW A;  3HEI A;  2LW8 A;  3HPN A;  2DCJ A;  5IHR A;  2W3J A;  3MV0 1;  4ZXE A;  1GOF A;  5G05 L;  4LHS A;  2V5D A;  4QB1 A;  2OKX A;  2YC2 A;  1H6X A;  4ARX A;  3OG2 A;  4OZO A;  2VJX A;  1UY2 A;  4YPJ A;  4P08 A;  2VZ1 A;  3WNL A;  2E32 A;  2W91 A;  2Y64 A;  2JD9 A;  4GZ9 A;  5C7G A;  1OF4 A;  3SEE A;  1KEX A;  1K3I A;  3I2G A;  2C26 A;  3EB7 A;  2KD7 A;  1JHJ A;  3HJR A;  2BBA A;  2WUH A;  3UES A;  2W1U A;  1SG3 A;  3CZU A;  1JZ6 A;  1J83 A;  4GWJ A;  3DYP A;  2E26 A;  1JU3 A;  3VD7 A;  4MAD A;  4BK5 A;  1UYZ A;  1W0N A;  3I2H A;  5JR2 A;  1K42 A;  3LPF A;  3GM8 A;  3F2Z A;  1UY0 A;  2Y8K A;  4DUV A;  2VMF A;  1WKY A;  2XON A;  3ECQ A;  2VTF A;  1W99 A;  5LA0 A;  2WO3 A;  1DP0 A;  2W95 A;  3K4D A;  4XVH A;  1UY4 A;  2BZD A;  1PX3 A;  4XUR A;  2J1T A;  2W1S A;  1P8J A;  4KMQ A;  1UMI A;  4DUX A;  2VZT A;  3I2K A;  5C70 A;  2VO5 A;  3LQC A;  5JMO A;  5EJ1 B;  2L9L A;  1ULP A;  2VR4 A;  4P5Y A;  2J1E A;  2JE8 A;  1XPW A;  4ZZ8 A;  2VCA A;  3VDC A;  4KI5 M;  3P1I A;  1JI6 A;  1DLC A;  2QQJ A;  2EIE A;  1UYX A;  1L7R A;  3MUZ 1;  4CUA A;  2WAO A;  3WNM A;  2XOM A;  3LEK A;  2J22 A;  1W9T A;  5IFT A;  5LCW L;  4QB6 A;  4BK4 A;  4QX0 A;  4JX0 A;  3WNN A;  1JZ3 A;  2QQI A;  5B4X A;  3ABZ A;  3AC0 A;  1W8O A;  3LE0 A;  4Z2A A;  3I2F A;  5LA2 A;  1GQP A;  2ZXQ A;  2WZE A;  4W8J A;  1CZT A;  4CU8 A;  2WQ8 A;  3OEA A;  2RV9 A;  1OF3 A;  1JZ2 A;  1JYN A;  3T2Q A;  3A22 A;  5DMY A;  1NUK A;  4XUN A;  4PQQ A;  2VZO A;  5DQ0 A;  4PF1 A;  2VZR A;  4QX1 A;  1O59 A;  4ARY A;  3WNO A;  3FHQ A;  1I5P A;  4BJ0 A;  5JXJ A;  2W9X A;  1O8P A;  2VQU A;  3BGA A;  3NJX A;  2WO1 A;  2CDP A;  4BDV B;  5J1X A;  4DXT A;  3CQO A;  2V4V A;  4QDR A;  4CVU A;  3T2P A;  4GWI A;  3DEC A;  4CU9 A;  1L7Q A;  1R64 A;  1HN1 A;  3OB8 A;  2QQK A;  2RVA A;  1GOH A;  4MGQ A;  3IDA A;  1UXX X;  1OT5 A;  3OEB A;  2VM9 A;  3CKH A;  3IAQ A;  2XHN A;  2EIC A;  1K45 A;  1PX4 A;  1UWW A;  1K12 A;  3WF0 A;  4A41 A;  3A21 A;  4CU7 A;  2VC9 A;  4A4A A;  4DXS A;  2V72 A;  2R7E B;  2E33 A;  1CIY A;  4QDQ A;  4TTG A;  1SDD B;  3LEI A;  3HNY M;  4MO3 M;  2BER A;  3UNP A;  1DYO A;  3C8X A;  2BGP A;  2C9K A;  1GMM A;  5CZK A;  3MV1 1;  3WEZ A;  2YG0 A;  2QBX A;  1PMJ X;  2W1Q A;  4OYU A;  2X05 A;  4JKL A;  4UI9 L;  2ZEY A;  2VZS A;  4E8C A;  5JXI A;  3OBA A;  4QX2 A;  3OGV A;  3JXS A;  2VZ3 A;  3MUY 1;  4MGS A;  3T0B A;  2JKX A;  4UAP A;  4BXS V;  3NRU A;  5JXG A;  4QB2 A;  4M4R A;  2X09 A;  5FUI A;  5F7U A;  2X10 A;  2RJ2 A;  3VDA A;  1JZ8 A;  2J1A A;  3ETP A;  3C7G A;  2DCK A;  2W1W A;  3VD3 A;  4D0Q A;  3ACI A;  2Z4F A;  4ZZ5 A;  3K75 B;  1EUT A;  4LPL A;  1MPX A;  3WF1 A;  4JKK A;  2QQO A;  4XUO A;  2WAB A;  4UOJ A;  3ZM8 A;  5IJR A;  2VMD A;  2YC4 A;  3GDB A;  3K4Z A;  4CUC A;  1W8N A;  2HLE A;  5C71 A;  5G04 L;  1GU3 A;  3I3B A;  3ACG A;  3T0D A;  3ACH A;  3HNM A;  2J1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...