4P5YA

Structure of cbm32-3 from a family 31 glycoside hydrolase from clostridium perfringens in complex with n-acetylgalactosamine
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
157
structure length
157
Chain Sequence
LYKKAGSEFALDSSKLEAIYATSEADRDYKENAVDGDENTIWHSAYQAADKLPVSITIKLDKAYDLNQIDYLPRQNSRNGHVTEYKIETSLDNENWTEVRTGNLEVNEAGNALANRGYNPIRFNTINAQYLRFTALKTLGDTNNKYASAAELVFYGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diverse modes of galacto-specific carbohydrate recognition by a family 31 glycoside hydrolase from Clostridium perfringens.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Sugar binding protein
molecule keywords Glycosyl hydrolase, family 31/fibronectin type III domain pr
total genus 37
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2014-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4p5yA00
1GOFA 1OF4A 1W9SA 2VCBA 4A44A 2L9LA 4QPWA 2W92A 3WQBA 4GZ9A 2VMDA 1J83A 2B4KA 2QQJA 2QQLA 2E33A 4MGSA 3JXSA 4W4ZA 2J22A 3WSOA 3FN9A 4OYUA 5F7UA 2WO1A 3MV11 5EIYB 4DUXA 4XUOA 2VQTA 3HOBA 2W95A 1JZ3A 1UZ0A 1PX3A 5G04L 5LA2A 3WNMA 2BGPA 1BHGA 4LPLA 2C9KA 4M4PA 4RN5A 2VMFA 2QQNA 1K3IA 3BN6A 3I3DA 2E31A 1WCQA 4OUEA 5IFTA 2W1UA 3OG2A 3WNLA 4A6OA 3HN3A 3OEAA 4PT6A 3VDCA 4JKMA 2VJXA 4A42A 2VCCA 3GDBA 2W5FA 3BGAA 3FHQA 4AAXA 3HNBM 4KMQA 1XC6A 1XPWA 4W50A 2WN3A 3C7GA 2BBAA 2LS6A 1OT5A 2CDPA 4QAWA 3T08A 1JYNA 3VD7A 4DXTA 4ZZ8A 3ABZA 1JZ7A 2VZ3A 2W94A 1NUKA 4QX3A 1K42A 5JXGA 3LQCA 4ET7A 1W8OA 1US3A 3SKVA 3U37A 3WNPA 3VD9A 1F4HA 2Y6KA 1UYYA 4P5YA 3CDZB 2VM9A 2QBXA 2ZEZA 1JZ2A 2R7EB 3I3BA 3WNNA 3DYPA 4DUVA 3MBWA 1JZ5A 1JU4A 2WN2A 3ACFA 1R64A 3GXUA 3K4DA 2RJ2A 1UWWA 2EIEA 2Y8KA 3C7FA 2BGOA 3CMGA 2Y64A 4JKLA 2WBKA 2VZSA 3AC0A 1GNYA 1PMHX 3OGSA 2LW8A 1JZ4A 1KEXA 3OGRA 1GQPA 1OD3A 1ULPA 2W9XA 1UXZA 2YB7A 3SEEA 3T0BA 4QB1A 1JYVA 1US2A 2J1SA 2RV9A 5CZKA 3THCA 2C4XA 4DXSA 4KI5M 4M4RA 4E8CA 3LE0A 3OB8A 2ORXA 2VOTA 1UY0A 4YPJA 2BZDA 3HNYM 3WF4A 5EJ1B 2W87A 4MOAA 4LKSA 5C7GA 4HG6B 2VZRA 1SG3A 5DQ0A 2WQ8A 3MUZ1 2VC9A 3VDBA 3LEGA 2V5DA 2JKXA 2V72A 1CZTA 4FI9A 3HJRA 1UY2A 1UXXX 4ZY9A 3MUY1 5JUVA 3I2IA 2WAAA 3GGLA 2QQIA 4P00B 2E32A 4BK5A 4A3ZA 2DCKA 2WAOA 3IAPA 1CZSA 3CIHA 4E8DA 1WKYA 3C7HA 3IIIA 3IB3A 1GU3A 4DUWA 5FUIA 3NRUA 2C26A 4CUBA 4BK4A 2W46A 3HEIA 3C7EA 4OMCA 3OGVA 3SEPA 1SHWB 4XUQA 5IHRA 4P02B 3OEBA 4QB6A 3C8XA 3NJXA 1NAEA 2VZQA 3EYPA 5DN2A 2J7MA 2W47A 3A21A 2W1WA 3LEKA 2YC4A 5LA0A 5CYYA 3T0DA 4KWUA 5LCWL 5EJZB 3WF1A 2WYSA 3HNMA 3W5NA 5G05L 3IDAA 3A7QA 3CQOA 3VD3A 2JE8A 3NQHA 1EUUA 5IYYA 2HLEA 3CZUA 3ACHA 2CDOA 3VD4A 3I3EA 1SDDB 4XUTA 1RYYA 4GWJA 1YQ2A 2ZXQA 5B4XA 3THDA 3LEIA 2VTFA 4RYDA 4UI9L 3T09A 3WNKA 4W8JA 1JZ8A 1JZ6A 4XURA 5C71A 4CU7A 5A1AA 4IUGA 4BXSV 4JHZA 2J1AA 3PUHA 4LQRA 2WO2A 2JDAA 5JR2A 3WNOA 4D0QA 1O8PA 4OZOA 5IFPA 1J84A 2YFZA 1GOGA 1UMHA 2PQSA 1D7PM 2VQUA 2VZ1A 4QX0A 3DECA 4DEVA 5IJRA 4ZZ5A 1JHJA 1XNAA 3K4AA 2RVAA 4QB2A 4XUPA 1UX7A 2VMCA 1JU3A 3F2ZA 4L0PA 3DYMA 2X05A 3VDAA 2QQMA 1K12A 1CIYA 2XOMA 1UMIA 5HXMA 3GM8A 3UNPA 1O59A 2BERA 2WZEA 3I2FA 4P08A 2YFUA 4A45A 2Y6LA 1PMJX 5C70A 2VO5A 2J1VA 1UY3A 2J1EA 2VZVA 1DLCA 3DYOA 3ACGA 4DXRA 1H6YA 2XHNA 2Y6GA 4XZUG 1L7QA 2E26A 5LA1A 2EICA 1MPXA 3CZJA 2QQOA 2OKXA 5I0DA 1F4AA 3I2KA 3EB7A 4QX2A 3K77A 1CX1A 3WF2A 1UYZA 4UOJA 2ZEWA 2W1QA 4AG4A 1EUTA 3SKJE 1P8JA 1O8SA 4A4AA 2VMEA 2V4VA 4JKKA 4GWIA 2KD7A 3I2GA 1GUIA 1TVGA 1XNTA 3I2HA 1DP0A 2VZOA 5J1XA 2VR4A 4OMDA 5B4NA 1DYOA 1OF3A 5HPOA 4XVHA 3UETA 3ZM8A 2W1SA 2XQXA 2ZEYA 3K4ZA 3T2OA 1W8NA 2Y6HA 3UESA 2YC2A 5JXIA 2DDUA 2ORZA 2WABA 3T2PA 4CUCA 1JI6A 3WF0A 4ARXA 2EIDA 1ULOA 5DPNA 1H6XA 3W5MA 3D3AA 3I2JA 3J7HA 2YG0A 1LNSA 2VZTA 1W9WA 1NX9A 2Z4FA 2J1UA 3K75B 4QDRA 3NNGA 4QDQA 2WZ8A 2HYXA 4DEQA 2Y6JA 3VD5A 4MADA 1GMMA 1JYXA 2X09A 3HPNA 4MO3M 5DMYA 2VZPA 3PUIA 2DCJA 1IQDC 3ETPA 2W3JA 3FL7A 4MGQA 4BDVB 1KGYA 1L7RA 2VL4A 3OBAA 1JYWA 4ARYA 5JXHA 3MO4A 1CZVA 1OH4A 3WF3A 4D8MA 4JX0A 3K46A 3P6BA 2XONA 3A22A 1W9TA 1HN1A 3I97A 3C7OA 1UY1A 3FHAA 4TTGA 2B9VA 4CU6A 3E1F1 1T2XA 4TXWA 1W0NA 4UAPA 3WEZA 2WUHA 3LPFA 4QDSA 3IAQA 2ID4A 3NJVA 1PX4A 2WO3A 4CVUA 5JXJA 3MV01 1TG7A 2QQKA 3ACIA 4Z2AA 4BJ0A 5JMOA 4XUNA 1W99A 4CUAA 2JD9A 2J1RA 4ZXEA 3T2QA 3CKHA 1GOHA 2VZUA 4PF1A 4CU8A 3T0AA 4CU9A 2EIBA 2X10A 4QX1A 3ECQA 3LPGA 2W91A 1NKGA 1I5PA 2ZEXA 3P1IA 2J1TA 1UYXA 4LHSA 1K45A 2WDBA 4PQQA 1UY4A 4A41A 2VCAA 3A23A
chains in the Genus database with same CATH superfamily
1ONAA 3JD71 4AK3A 1COV2 4QPIB 5LK5A 1X9TA 3JB8A 4QPGC 2DF7A 4GZ9A 1GANA 1RUJ3 2QFEA 4YW2A 1PIV1 1QHDA 2XJVA 4HBNA 4BQ5A 3AZWA 5GZFA 1RUNA 4AFMA 2XG3A 1AL22 4N43B 2D3PA 1W6NB 2GAUA 4HN1A 1QH6A 4X6RB 4MGSA 4AGGA 1AX0A 3N35A 4P9JA 5LRRA 1EV12 2VW2A 2RMU3 3FN9A 4N7UA 4OYUA 5CIRA 2Q8OA 2ZGRA 1MVEA 4DUXA 5J7MA 3JU9A 1HX6A 4QX5A 4XUOA 4ISRA 3LSEA 4CZSA 4CCMA 3KT1A 1U5YA 1GWMA 3T1MA 4COZA 4Z2WA 4MXVA 1YQ8A 3CJIA 2RS32 5FK7A 3DXTA 1VBA2 3TEWA 3WNMA 3IWZA 2BGPA 4QWNA 1WMXA 3KGLA 1SCSA 3GHNA 4M4PA 4KNCA 1OHFA 5KHHA 3MLKA 4CCLA 1D4M1 3K3OA 1JW6A 1C8M1 1G9BA 2GP5A 1V6OA 4OHZA 5K9YA 2PELA 4QHBA 2CYFA 2XL7A 1PK6A 2E31A 3A0NA 1WCQA 4HONA 3NAPC 3GYDA 4XIKA 3VBHA 4XJZA 1WBFA 1LCLA 3DPRB 4YM1A 4YWAA 3OG2A 4A6OA 4R8HA 4CDUC 3UKVA 5AFBA 1CR7A 2VNVA 3GBGA 4K8RB 5CA6A 2VJXA 1GLHA 2WQ4A 1S0DA 1R083 1CGPA 2ILMA 3S6PA 2PXJA 2VCCA 5FY7A 1W9YA 2Z5WA 4AAXA 3ZSLA 2DVGA 4KMQA 4AFDA 4KWLA 1IGOA 1EY2A 1NLQA 1XC6A 2EXJA 2PHDA 4N53C 4XJAA 3ZR6A 3C7GA 2CGPA 2BBAA 5FY9A 1MVQA 1OT5A 1JYNA 5FY4A 3LAGA 3BI3A 3ON7A 1G9CA 4Y5TA 2HWF1 3ABZA 4MGKE 1RUI3 1D2QA 4LA2A 4NMIA 3H3LA 4I01A 4IV1C 3KD4A 2D6OX 3LA7A 2Z2SB 1RL3A 4CDWB 4W65A 4ET7A 4UFJA 1YFWA 3B5LB 3BTAA 4YGDA 4IV1A 1REEA 2NZ9A 1UYYA 1YQ6A 2CL2A 1QOOA 3WUDA 4C1XA 1S0JA 3CDZB 4I3GA 4P9IA 2VM9A 1DQ5A 2CAVA 1LU1A 3D82A 4CEWB 1CX4A 2QBXA 4EWEA 4P9WA 1O5UA 3CL1A 3O5SA 1QJY2 3POIA 3MBWA 4LBQA 1DQ4A 1JZ5A 2XPJA 3N3HA 5AC93 4HPKA 4JVAA 5C3RA 4AVTA 5JOYA 3J8F1 2EXHA 1YQCA 3RZMA 4CEWC 1UWWA 1RUD2 2EIEA 5LW9A 2ZGQA 2BGOA 3TOJA 2QKDA 3CMGA 4FOYA 2ZGPA 4YZ4A 3Q8EA 5IVYA 2Y64A 2WSVA 4XILA 4IEZA 1FX5A 1PO12 4NPLA 4Y5Z0 5DZEA 2ZHNA 1UXZA 1FMD3 4QQOA 3NAPA 2BP6A 2FBEA 1MQTA 5F5CA 1JYVA 4YG3A 2J1SA 1I6XA 3JQXA 1IS5A 1OQDA 4HK9A 5HV4A 3ME2A 3ZKUA 2QDNA 1J1LA 1HDKA 1FT9A 5FO7B 4E8CA 3OBZA 1OVSA 3E5XA 5A6XA 4P9LA 1IQAA 1QXJA 5LK7B 2BZDA 1IS6A 1Y43B 5EJ1B 1YCIA 1SBFA 5JAXA 5C7GA 1AR63 4LKSA 5H9PA 3PLQA 4AI2A 1OD5A 4IE4A 4LITA 2VVEA 3POEA 4CDWC 1ZZ6A 2YC0A 2FD8A 4OUSA 4Q0SA 4FFIA 1D4M3 4RS5B 1JN2P 2VC9A 3NMBA 1LJ7A 5JDBA 3B00A 3UGHA 1LGBA 5A3UA 4AL9A 5JLVA 4JAAA 2V5DA 1AR82 1CZTA 4LO6B 3VHNA 1N1YA 4FT8A 4N53B 4RQPA 3ZXEA 1UXXX 3IPVA 3KM5A 4ZY9A 4JQTA 5BNNB 3VL9A 1BEV1 2WAAA 2JDYA 4P9GA 3D6EA 4RR3B 1LB2A 3AFGA 1GZWB 1EYBA 4K9SA 1RUD3 3HVDA 1QY4A 2A5ZA 2NN8A 2QZ2A 4HETA 2YROA 5C8CC 5BNOC 3DL3A 2DCKA 2RHPA 2WAOA 2Q30A 4HFSA 2WFF1 4Q0VA 5FZBA 1AUYA 1V9U3 1WKYA 1Z7S3 2PLV1 2R1BA 1F9KA 1EPWA 3GJBA 3N9LA 2JECA 5E6HA 3VN4A 4NHKA 5GLTA 1GU3A 3PMSA 1J58A 5FLJA 5JCTA 2C26A 4I0AA 4N9IA 4ORFA 2ZGOA 3VBSC 1L3JA 3HEIA 3GZEA 3ZDSA 4CCDA 1S2KA 4OMCA 2HWE1 2ZGSA 2MEV1 4P5HA 1O3TA 3M3EA 4W6XA 4P02B 4XUQA 2WWSA 4AI0A 1RUOA 5A33A 4G3YC 1NAEA 2VZQA 3CU7A 1FOD3 3EYPA 1JODA 1YJLA 2VUDA 1AL23 3WDVA 4CDXA 2W47A 4P14A 4MHRA 2WNVC 4BQ1A 2YC4A 3MIBA 1RMU2 1ZBA1 4I30A 3URFA 3K3NA 1OBNA 3BU7A 3LCPA 5LA0A 1ULCA 5LBCA 5LCWL 3HNMA 3W5NA 5FYIA 5T5PA 3ZXAC 3IDAA 3NO8A 2HWD2 4PHZA 1QXPA 4FQZA 3RYKA 3AXDA 2UWCA 4YZ5A 2TNFA 1W6QA 1CQ9A 5FP3A 1TME3 4Q4X2 2RM21 5GALA 5IW0A 3DUIA 1JXNA 4LBOA 4XJ9A 3WDWA 1BZWA 1DYKA 1NA1B 1TME2 3OOXA 3VD4A 2FZ2A 4J1XA 1JOJA 2R1DA 4XC9A 1DU3D 2XKPA 3IN9A 3VBHB 1VJ2A 2QNKA 2Q1FA 2ZXQA 5CKMA 3AL6A 4FPKA 2WZR1 4UI9L 3T09A 3ZXKA 1KD7A 4JGZC 1TMF1 1HRV1 5KWRA 2IXKA 1XRUA 5C71A 4CU7A 2C9AA 4IUGA 2VOKA 2JXAA 3ZIXA 4LK6A 5HCAA 4WVMB 2J1AA 4LUKA 4YFZA 5IT6A 4LKFA 2WO2A 3IIAA 1OOPB 2ETEA 1CWPA 5FPZA 3QH6A 4R9DA 5DXDA 1AR83 1LKNA 2GN3A 2Y0OA 1O8PA 5C8CA 2XB6C 4DFSA 5FR3A 4XPVA 1RVF1 1E5SA 3O1UA 1R1A2 4YVSA 1Q8PA 2RS33 5LRSA 1RUF1 3RWNA 4GQ7A 1MEC1 3ZMOA 4LBNA 5LBFA 3HIFA 5HBAA 1B35C 5FBZA 2NP0A 4DRVA 4CCJA 4QU1A 1FPN1 2H0BA 1LOFC 1W6PB 4XQWA 5L9BA 2GU9A 5IJRA 1YI7A 2CU5A 3N7KA 1RUJ1 4KBBA 2RS13 2RDNA 4XOGA 3AVRA 4PLNA 1PM4A 4GA9A 3VBUB 1PM7A 3BOPA 4LTAA 1MS8A 3ZFEC 1QEXA 2WS91 1UAIA 1VALA 1W6MA 2ZKLA 3SNMA 2ZKNA 5D1IA 5FYHA 5CFCB 2BUKA 4XF0A 1YEWA 3AKSA 4XFFA 3N4MA 4GAZA 5KXCA 2VCMA 1O3QA 4YGEA 1LOEA 2XWBB 4BM8A 3MIGA 3UNPA 3N9QA 1O59A 1U5IA 4YW6A 3VHRA 3VB9A 4HMZA 2FCUA 2YBSA 3KGZA 4AHYA 1QF3A 1YNAA 1JHNA 2R0HA 5ACA3 4RQPB 4H2AA 4PIYA 1IG3A 1H9WA 3PIJA 4WVWA 2A6YA 2VZVA 3WDUA 4RR3A 1MS0A 1OLME 3ACGA 3J7MA 1Y4WA 4ZHNA 3KQRA 1J59A 4URAA 2OZ6A 2OW4A 4FP2A 2C0ZA 3VBRB 4DY3A 5F5IA 1H6YA 3UT0A 3KF5A 1YQ5A 2HWE2 3JZVA 3BVCA 4XZUG 4JQRA 4IESA 4Y4YA 3MPBA 4YW4A 1RUG1 1Q8QA 5LA1A 1UNBA 4K40A 4HZFA 4UW4A 2BQPA 3HQXA 1UO9A 1QDOA 3CZJA 5IVEA 4IEPA 4RGGA 1GZ9A 1DQ1A 4BZ4A 4QPIA 3EB7A 4FOQA 1VBC3 4AGRA 1BXHA 4GMP0 1OSGA 4UOJA 1IPKA 2W1QA 4FFHA 4QGLA 4WM7C 5CB7A 4ATEA 4EN7B 5BNQA 3V65A 1W6MB 1ZZBA 3H3UA 3POJA 3ZVXA 4AHWA 5JPMB 3JUUA 4NIGA 4OHYA 2JD4A 5LB6A 4JKKA 5T50A 2H6BA 1JOBA 2YU1A 2WL1A 3ITQA 4PCRA 1TNRA 2VVDA 3FHIB 5D8AB 5FZ9A 3I2HA 1NE4A 1EV13 3ZX7A 3X29B 3SISA 4NE9A 3PDQA 5LBEA 1AF9A 1DP0A 1W05A 2VZOA 4OMDA 1OKQA 3PVBB 3J7NA 2XMLA 4QPGB 4D6SA 3MW4A 3UETA 1RUE1 1W8FA 1YRZA 2XJPA 1PGL2 4CDUA 2LUWA 4JV4A 5F3IA 1ZA7A 1DGRN 1TNFA 2DVDA 4NIAA 5FAXA 3ZFGC 4ATFA 2VOWA 2WR9A 1VBB1 2ZEYA 5J09A 3K4ZA 3VBUC 2RDSA 1QJFA 2R6QA 1XE8A 1LHUA 4HLTA 3USSA 1OLMA 2YC2A 3N36A 1H4HA 1NZIA 1OMIA 3T2PA 1AR72 4CUCA 1WW5A 4YM0A 3CBNA 5I93A 5J36A 2ZHLA 3RYPA 2GNTA 3RSJA 1QKQA 5HCFA 2J42A 5FZHA 4BLIA 1W90A 3MF9A 4ES9A 1VBB2 4PLOA 1UKRA 5DPNA 3QOPA 2BNMA 3GCXA 2Q4SA 1H6XA 2OUHA 2Y34A 4Y3OA 3FUOA 2RMU2 3D3AA 3I2JA 5A7WA 2DCZA 3SHRA 2YG0A 4COWA 1LNSA 3PUSA 2VZTA 3Q9OA 1PVXA 1W9WA 1D4VB 2VG9A 1NX9A 3J8F2 1XOYA 4AWDA 4BYYA 3N7LA 2ZMNA 2EXIA 5F3EA 4K8FA 5IVVA 1BKZA 4AE2A 4QDRA 1UZYA 2ET1A 4NHXA 2ARAA 3IMNA 5KHGA 2WZ8A 1JH5A 2HYXA 4DEQA 2UU8A 1BK0A 3VKLA 4TYSA 3AVSA 1G8WA 5D8AC 4RHV2 3GNEA 5L9RA 2WWJA 1ZNPA 1WBLA 4MADA 1JYXA 3GZAA 1G86A 5DMYA 1PNFA 1VBC1 2C24A 2VZPA 3FX3A 2VUJA 4HK8A 5J37A 1H8TA 5F1RA 2W3JA 3FL7A 2GC2A 1KFUL 3NV1A 5IAVA 5ABJA 3V0BB 1CAUA 2LTNA 3ZFFA 4FPOB 2OX0A 4PF5A 5EPAA 1A6CA 4ARYA 3MO4A 3VBHC 1Q56A 1OH4A 1QNYA 3WF3A 4QKNA 3O7OA 1A8MA 3LD8A 2KR2A 1UYPA 1A3KA 3K46A 3TEYA 5CG9A 1W9TA 1IPSA 2EAKA 5FZ7A 3ZYRA 5A3MA 3I97A 5BY5A 3I2OA 3C7OA 5FZ3A 4LBQD 4AQTA 1XNBA 4WBBA 2YPDA 4YNIA 1NLRA 4CU6A 1I1EA 3T2TA 5GJ6A 4TXWA 2XH6A 2IUWA 2WUHA 2X5IB 4LXLA 4QDSA 3IAQA 1AX2A 1J3QA 1QU0A 3NNFA 4GH4A 5JXJA 3O1RA 3MV01 4RGKA 3M3CA 1Z0HA 3ST7A 1DIWA 2GMEA 5FQ0A 1W8HA 4BJ0A 5JMOA 5IATA 4MHUA 1ND2A 3AMHA 2ZBJA 5CBLA 2GP3A 1DG6A 5BV6A 1AYN3 3AZYA 3WW1A 4OQ9A 3T0AA 2PHLA 2ZHMA 4O65A 4QX1A 4RL7A 4GMP1 3AMMA 4IEOA 4Q4V2 5A32B 3P3NA 4YSFA 5I0SA 4QPYA 2D6KA 1T6GC 2H6CA 1NKGA 4FP3A 4EZHA 1VRH1 1AR73 1X8MA 2E7AA 3KHBA 4RHV1 4CEYA 1UYXA 4LHKA 1JMUB 1JYIA 1K45A 2WDBA 4BIFA 3RI9A 2BU9A 5CFDA 1GV9A 3OGGA 1RUC2 5CEHA 2WFF3 3AX4A 3H1YA 3SH5A 3KB5A 3ZXFA 4QGNA 5CVRA 2EA7A 4GXLA 3EHKA 4CPBD 1Z7S2 1GOFA 5APAA 4FBFA 3RZLA 5FYVA 1OF4A 1W9SA 2VCBA 1Q8VA 4V2WA 5BNNA 3SCGA 2L9LA 1MS3A 4YG0A 3WQBA 2VXJA 5JOXA 3DV8A 2CWSA 4I3PA 3MZHA 1RITA 4LO4B 4NWVA 2Y60A 4PBPA 1NZCA 4OHXA 5CAZA 2B4KA 2QQJA 3MIHA 4O9GA 4OULA 5FOBB 4Q4V3 2E33A 3JXSA 2NQYA 3JD72 3CEWA 4W4ZA 1SLTA 1AR71 5I0TA 3S7IA 2GMPA 1LAJA 3KV9A 3WCSA 1RHI2 1YLLA 3CJIB 4GMP3 5EIYB 3NV3A 4YZ1A 1WCUA 4IW3A 1APNA 4CE8A 5FY5A 4AI3A 4ZU7A 2QZ3A 3PMEA 2NPIA 2W95A 2V73A 1PGW1 4AVSA 4D94A 3S30A 3LB9A 5LA2A 1W8TA 1IKPA 4PIXA 5DUWA 1YIPA 1TME1 5JIAA 1BHGA 5KR7A 4L92A 2PTMA 1U5ZA 4NAOA 4BQ4A 3U07A 4EWAA 1RB8G 3W58A 2FDFA 2EXKA 4MUVA 4RN5A 2DWRA 3VKFC 4X8PA 4EE2A 3AJZA 2DTWA 3A0KA 3LF7A 4LO7A 1YC61 2HKXA 3EBRA 4S2GA 3SH4A 2AACA 3WNXA 4AFBA 2P6CA 2R32A 3IZOA 4IV3C 3VBOA 4TSVA 1L7LA 4EN8B 2W1UA 3R4UA 3WHTA 5DZGA 3UJQA 3WNLA 1OC1A 1N3PA 4PT6A 1HKDA 1LULA 1DZTA 2HWC2 1VBA3 1Q8SA 2ARCA 1C1FA 5HCBA 4A42A 5D2AA 4H7LA 2XJTA 2MEV2 2W5FA 3FHQA 5FZCA 3RMYA 1YUDA 4YG6A 5A32A 2QTWB 1CAUB 5GLVA 3TB0A 3ZFFB 1JBCA 4W50A 3PUQA 3J4UH 3M3IA 5DUXA 1CAWB 1W9FA 3FMGA 2CDPA 3M8LA 2V4AA 1NT0A 3ES1A 4IEYA 5FZOB 3VD7A 4BWOA 4YYOA 4ZZ8A 4FO9A 3FC0A 1RJ7A 2XVLA 4WM7A 2P5BA 2VULA 5JXGA 3P3PA 2AC1A 1AR91 3LQCA 2GH2A 3RQ0A 2X5IA 3I2DA 5FXWA 4Y1UA 1W8UA 3QBQA 3SKVA 3WNPA 3ZR5A 4XDOA 1XE0A 2Y6KA 1KQRA 2P17A 2F6BA 4P5YA 2XWJB 1W8WA 5FO9B 3AM2A 3GHMA 2RDRA 3M3QA 1ZA4A 3G6JB 4W6WA 1JZ2A 4UW3A 3CLPA 5SV5A 2I2SA 4M01A 4LBLA 2EF6A 2UURA 1AL0G 4Y24A 1W8ZA 4DXZA 3B9CA 1XJAA 4E4SA 5A1FA 4K6BA 2CTVA 1XSRA 1XU1A 1R64A 1OVPA 2RJ2A 4JC1A 2X8KA 2K2SA 4L9BA 4XDPA 2Y8KA 3C7FA 4LOSA 2JG8A 3OY8A 2DUPA 4Y22A 1OFSA 1DGWX 4XF3A 5K8SA 4IXLA 5FCCA 2D40A 5D21A 3OGRA 1V0AA 2W9XA 3WP3A 4EYUA 5GLWA 1H2MA 3THCA 1UF2C 4XJWA 5ERLA 2PHRA 5K0UC 1FPN2 1NLSA 3MW2A 4YGBA 1SFPA 1S0FA 5T54A 4GALA 3V0AB 1XE7A 3OB8A 1MEC2 3LGRA 1UY0A 4GH4B 1G9AA 3CF6E 3RZHA 1SEFA 3WD5A 1BK1A 2ZX0A 1POV0 1ZVFA 3IM0A 2XLAA 1LRHA 1RVF2 2Y33A 3KLSA 3DF0A 3L2YA 1EAH2 1MS5A 3SQOA 5AFEA 4FPLA 5GZCA 5L19A 2JB4A 2W68A 2ZACA 3AZZA 4NRMA 5FZ0A 2VZRA 3H7JA 4CSWA 3WINE 2WQ8A 2ARBA 4HL0A 1SPPA 5EYYA 3WP5A 3MUZ1 5I91A 4DY5A 3NJYA 3MFCA 2Z42A 4OFGA 3VKMA 3LEGA 3UESA 1QJY1 4FPCA 2V72A 1E57A 2R072 3B3QE 5DG1A 2I07B 1UY2A 3MICA 4HT1T 2IXLA 3IDEA 1IZ3A 2ZX3A 3MUY1 4BQYA 3I2IA 4AW7A 2VOXA 2IVIB 4Q4V1 1XNDA 1SLAA 4P00B 3SH3A 5C8WA 2OT7A 3QCWA 3ROUA 1O4TA 4Y5SA 4K3UA 4PDWB 4A3ZA 2WO7A 3HAGA 1V6IA 5C9AA 4Y20A 4HSLA 5FZKA 2D3RA 5LATA 5L9VA 1AHSA 3IB3A 2E9QA 1REDA 1MQTB 3DXUA 3HT2A 4JGZA 4PIZA 1WLDA 5FUIA 5FYUA 3VBFA 2LM3A 3ZO0B 2W46A 1ULGA 3DPRC 1BCXA 2VQAA 5L7OC 1V6LA 5CKQA 2B7YA 1XYNA 2E63A 1LTEA 5IHRA 3VKNA 4QB6A 3C8XA 1ULEA 4Q27A 3KF3A 2JE9A 4B8EA 5FWEA 2J7MA 4KQ7A 1AXZA 1WA4A 3A21A 4BB3A 4KU8A 3JD73 4NPRA 2NYYA 1VBB3 4QMAA 4KWKA 4BHPA 2ZGLA 2VPVA 3OD4A 3PVNA 3DCQA 4M0NA 1J3PA 1NQDA 4NOTA 3T0DA 5A33B 5EJZB 1QJX1 2WYSA 3H9AA 4ITCA 4EV0A 5IK5A 4MSVA 2JDNA 2P6HA 5G05L 1H9PA 1LOFA 4GKXA 4DRRA 1BLZA 3VD3A 2JE8A 4GIQA 1AYM1 2HLEA 3ACHA 2CDOA 2F4LA 1VBA1 1Y9GA 3I3EA 2OPWA 4KU7A 3SLIA 2FHRA 2ZX2A 4XMIA 1FPN3 2ZS6B 4GJYA 1UCXA 3ELNA 1O6UA 3O0XA 4LKEA 3RWKX 3THDA 4A7ZA 1DGWA 1W6OB 4RYDA 1OOPC 1UZVA 2ZMLA 1C57A 1JYTA 1C5IA 1JZ8A 1XNKA 4Q8KA 4N7IA 1JZ6A 5GLUA 4XURA 2X5IC 3O1OA 4JHZA 4Y20B 4M3CE 1HB4A 3PJQA 1BBT1 2B9UA 3JBG1 3PUHA 4LQRA 5L36A 5CNAA 3RVHA 1KJLA 3QACA 4BQXA 5K7PA 2VQ0A 2YHJA 1J84A 2OS2A 2YFZA 4R9BA 2DV9A 4ES8A 4AI8A 1PZ9A 4MV2A 5F6KA 4P9YA 1RXGA 1DF0A 2A73B 2QDRA 4YGCA 4Q0PA 3THPA 3ZXDA 3N7JA 4LEJA 5EHDA 2VZ1A 4Y1VA 1FNZA 3LZZA 2GNDA 1FATA 1FMD1 1ZZ7A 5M0TA 3K2OA 3KQ4B 4ZZ5A 1POQA 4XF1A 1G7YA 2XXZA 4QQLA 4WV8A 4I2OA 2QJVA 1M4WA 1UX7A 2CNAA 3KV5A 3OUHA 3POBA 4HKLA 4UW6A 4XAEA 1OQ1A 2HWB1 3T30A 3KT4A 2CHHA 4UFKA 3RGBA 4BXFA 1ASJ2 1POV1 1GNZA 2UYAA 1QDCA 2CAUA 3VDDA 1ZBE2 3RFRA 4AAPA 3BOWA 3KVAA 3VUOA 1H4GA 2PAEA 1VBD3 2GH8A 4K7JA 4QXCA 1KJRA 3VDDC 3ZYIB 4AEDA 1PVC3 3UK9A 4A45A 1RVF3 4Q8LA 1QJX2 2XUEA 3U4SA 2IFRA 2PHFA 1PMJX 5C70A 1PIV3 3KCYA 3EMRA 1WLTA 3AZVA 3WVJA 1WCKA 2J1VA 4WVVA 1UY3A 2PHXA 5BNOA 1CAVB 4OHVA 3FJSA 1OH3A 1XYOA 2D5FA 3E6DA 4XFIA 3BYWA 4AQ6A 4IEQA 2D6PA 4CCKA 3I3MA 3W20A 1SPPB 1CAXA 1L7QA 1RUF3 2Y0IA 4BPZA 4EQVA 3I59B 4HVOA 4E4HA 3U1XA 1S1AA 2R062 1POV3 2XQRA 2EICA 3VLBB 4FAGA 3BB6A 4SLIA 5ACA2 1VMHA 4NHMA 1NG0A 4MVTA 1RINA 4QX2A 5LASA 1J3RA 2RJKA 3ALQA 1I5ZA 3NKTA 4XQ4A 3WQ1A 2WLPA 2G1MA 5KC6A 2VBPA 3AP9A 5FYCA 2HWD3 1EUTA 3FFQA 4LK7A 1OKOA 3NW4A 2Y26A 5HXVA 3WW2A 1RUH2 4ZS2A 3U11A 2DCYA 2VMEA 3U75A 2V4VA 1O4ZA 2LALA 1UL9A 2ADEA 2HEYF 5DUVA 4COUA 1HIXA 1AJKA 4ZPIA 2BFUL 3WUCA 1KDMA 4Q5OA 4Z8BA 4JCKA 4EN0A 1MZ5A 2ADDA 5CADA 2WIIB 1W6QB 3ZXGA 1OF3A 4XVHA 3KSCA 1BBT3 3JBG3 2B42B 2NMOA 2BVBA 1QMJA 3I7DA 4JRAA 2WZPP 1LOAA 3O1PA 1OA3A 2W1SA 2F4PA 3LFIA 2ZZJA 3WP6A 5FUPA 4URTA 4BU2A 5EXOA 2DTYA 3T2OA 1YXWA 4OI2A 2JEMA 3B7MA 1OPOA 5F39A 3ZLIA 3PU3A 1LOGA 1MZ6A 1JS9A 1NCQB 1PGSA 2DDUA 4Q4Y1 2WABA 4WVMA 3AP5A 4EN6B 5L7OA 4FTSA 3DPRA 1JI6A 1GNHA 3LOIA 4JDMA 4JRLA 2RR13 1W39A 4XCBA 1VRH3 3HWJA 1ULOA 4IE7A 5FPUA 4NN0A 4EJRA 1HJGA 1W2AX 3W59A 4NHYA 1CD3G 4XTMA 3J7HA 4LKDA 4UFIA 1Q43A 3AYAA 5DAQA 5T55A 4DIQA 2UWBA 4N90A 1ACCA 4HXCA 3WZ1A 5A1LA 4AVBA 2BFUS 2BVVA 2JJ6A 3OTFA 2ZPXA 5IVFA 2WT2A 3I4IA 1AR61 3AYEA 4XBQA 4RGAA 2WINB 3RS6A 5FXZA 4XF9A 4Q4W2 4AHZA 2D43A 2EIGA 2RS11 3CNAA 3KCXA 4JHTA 3UYJA 2JIJA 5FY8A 5GZGA 3AK0A 1RUI1 4ZU5A 3ZSMA 4HKOA 4AGVA 4QX7A 4QXBA 1RUH1 5CKNA 2BRTA 2VOVA 5CFCA 1GMMA 3VBOB 1ULDA 1XU2A 4XXPA 2TBVA 3H3ZA 1AR92 1GQGA 3WT3A 4A2UA 3PUIA 4XYXA 1LENA 3TEXA 2RM22 4Q4X1 2XJRA 4MGQA 4AEDB 3H8XA 1N1TA 3BPZA 4BDVB 1DYPA 4WZCA 2HWD1 2UY8A 1YIFA 5GM0A 1QQP1 1OI6A 5J98B 4DO0A 1R081 5JXHA 4CP0A 1W6PA 1DDLA 3AP6A 5GZDA 1CIWA 1X8EA 4D8MA 1PK6C 3B94A 4JX0A 1TQ5A 2HEVF 5ANQA 4HPKB 4AVCA 4FPYA 3P6BA 1RMU1 3Q8CA 1CAVA 2IXCA 3LDBA 2YGLA 3JCIA 4QX8A 1HN1A 2VBDA 3R6SA 3D8CA 2YPJA 4UF0B 3M70A 2G4IA 4GKYA 3FHAA 4JTOA 3N9OA 4PQ9A 1QJX3 1S55A 1OXCA 4UAPA 2PQQA 1Y3TA 2VNGA 1PHMA 4F8AA 3VBUA 2BWCA 5A3NA 1GR3A 2UWAA 2WO3A 1S0GA 3D0SA 5A7PA 3PUAA 3B02A 5K0UB 1QOSA 1TG7A 4IERA 3R4DB 4HSJA 5DG2A 1S0IA 3H42B 3VDDB 4XUNA 4QXHA 1RGSA 2J1RA 4UW5A 4Y1ZA 2FZ1A 3CKHA 1GOHA 5FPVA 1W3XA 5KHJA 4CU9A 3VBFB 5I8SA 2EIBA 3AMQA 4MYEA 2X10A 1ZBE1 2D6MA 3ECQA 1UU4A 2WA4A 5JIUA 1HV0A 3LPGA 5JR7B 1HXS1 2W91A 1I5PA 2EAAA 2HBTA 1UOFA 1PGW2 2JG9C 4LHSA 3WDYA 4YZ3A 2KA3A 3ILRA 4LHNA 5KHIA 2R041 2RS12 4MGZE 1AR81 3LOBA 1VE0A 4IL7A 3AKPA 4RFT0 5BNPB 4A41A 4META 5FIXA 2RJLA 1AR62 1MS9A 5C9AC 4BQWA 4DZGA 4CP2A 4R52A 4YVWA 4LHLA 2HWF3 3V56A 2E7TA 4NWWA 4FVVA 4RA0A 4A44A 2I45A 5BNPA 2WNUB 3MW3A 5A7QA 4QPWA 2YU2A 4QKDA 3RNSA 3MDPA 4NO4A 4CDUB 1H1IA 2ZCWA 4ZONA 1ZBE3 1SLBA 3CJXA 1G6NA 4L99A 3VZNA 4KGGA 3ZKYA 2J22A 2ATFA 2DUOA 1JYCA 1RUC1 2WO1A 3VHPA 5FXXA 4D7TA 5A6YA 3MV11 2VU9A 1NCQC 4Q4Y3 1ODMA 2ZGUA 4LBMA 2D97A 4B7EA 5EWSA 2GC3A 4IEVA 4BH9A 5I0DA 2WNVB 1V6MA 3DEMA 2BNOA 2D6NA 2A3YA 3RJ2X 3IMMA 1AZDA 1PK6B 1X7NA 2WC2A 3MIEA 5AVPA 1IG0A 1ZYBA 2P3JA 4LPLA 2QQPA 1VAMA 3RZZA 1PVC2 3O1VA 3KMHA 3OPTA 4DOUA 2A7AA 2QQNA 1MZEA 4NAMA 1K3IA 1U0AA 3TEZA 5C4WC 2FDHA 4OUEA 1YHFA 4JTNA 5A3PA 5IFTA 4CCNA 2O8QA 3OEAA 4JKMA 3UKNA 4FQ4A 1ZZCA 2QQUA 5JSPA 3ZPOA 4DQAA 3O14A 2WNUC 3MGUA 4NRPA 5L7OB 1B35A 2NMNA 1WW4A 2ZTNA 3ETQA 1X82A 3GDBA 3PTYA 4S2DA 5F2SA 3HNBM 3WHUA 4BOWA 4CDXB 4EROA 5FYMA 2BOIA 1XPWA 1W0PA 2WN3A 2XGXA 5LEJA 3O1MA 4QHZA 2LS6A 1AXYA 4ONUA 5FY1A 3OCPA 5BNPC 1SMVA 3MYXA 3T4VA 5IK7A 1JZ7A 2JG9B 2VZ3A 2A1XA 1RHI3 2W94A 1NUKA 3FBYA 4QX3A 5CFDB 5E16A 4XJUA 3J26N 3HQUA 3ZDVA 1W8OA 1US3A 2GZWA 3LEMA 3WG2A 1F4HA 2AUYA 5DDJ2 5C5TA 4FSJA 2JG9A 5FXVA 3RG0A 2RR11 2V5YA 2WSUA 5F8PA 4FTBA 3LFMA 3WG3A 1TZOA 4LMFA 3SITA 3POGA 4Z07A 3I3BA 5FZ1A 1ST8A 2ES3A 3DYPA 4IEUA 5GKAC 2UYBA 2ZHKA 4NPMA 3WG1A 3KS7A 3QD6A 2O8OA 1JU4A 1H8TB 1N47A 1HQLA 4K21A 4XBNA 5LBBA 4MGIE 1PVC1 3ZN5A 4BQ3A 2AENA 3K4DA 5FJKA 5A80A 1C3HA 5JZGC 1AXKA 2RS31 4OI1A 5BUVA 5HCHA 1NCRA 1W06A 2HWB2 4BMEA 1WD3A 1DHKB 4V2VA 4JKLA 2WBKA 1ZREA 1PMHX 1F15A 1C1LA 3AC0A 2LW8A 1UIKA 1KEXA 1CJPA 1GQPA 1OD3A 1RXFA 1SACA 2YB7A 3GJAA 4LE3A 1S0CA 2C1FA 4QM9A 3SEEA 3T0BA 1US2A 2IC1A 5FZEA 5H9SA 4LLOA 2D98A 2RV9A 5CZKA 2GMMA 5F2WA 2VY0A 1CESA 1YI9A 4CDXC 1AYN2 1JUIA 2WA3A 4C0BA 2YXSA 3W21A 3GALA 5KHKA 1E5RA 2WWUA 1S0EA 5E89A 2VOTA 1EPZA 1H1MA 1UKGA 2CWMA 2JIGA 1N3QA 4H7MA 2Z79A 4RS5C 4XFHA 3HNYM 1PIV2 3H8UA 4UXAA 2OQ6A 4YPJA 3OJBA 2PAMA 2W87A 2ZOEB 5BPXA 3VBFC 1C5HA 4E4DX 1ENXA 3I49A 4HG6B 3HN1A 1SG3A 1E5IA 5E1RA 5DQ0A 2Q1ZB 4O7XA 2D7FA 5FYTA 5JOZA 1WW6A 2BV4A 1ENQA 5H9QA 2CSGA 1VBE3 3VDBA 2AZ5A 4IDZA 1QH7A 3U4XA 1PO22 4AOCA 2NLRA 2JKXA 4FXKB 4LO5B 4FI9A 4C1WA 1MZFA 3HJRA 4TWTA 2ZJCA 4XXAA 4D7YA 3ZYFA 3GF6A 2PN5A 1HXS3 4MG2A 5FMDA 4Y26A 5FLHA 5JUVA 4Q1PA 1DFQA 4LR4A 2Q8EA 1HXS2 4B3NA 4M3CA 3UGFA 3ZSJA 3GGLA 2QQIA 3ILFA 1YFUA 4R4XA 4NIIA 4NIHA 5FV3A 4XQDA 5C4WB 1OA2A 4BK5A 1MS4A 3LSDA 2XJUA 2OZJA 3B69A 1RUC3 5IVBA 1MS1A 4WVZA 1CZSA 3CIHA 2DBIA 3B01A 3VHOA 4CTEA 2BBVA 3IT8A 4FFFA 2JENA 4K20A 1QOTA 4DUWA 2W0XA 3O1TA 4CUBA 3KWVA 2R49A 3KVBA 3GZUC 5FREA 3TN91 1QJY3 2WYFA 3ZSKA 1YWKA 2ZX1A 4KG0A 3IDCB 4Q4W3 1SHWB 2C5DA 2O1QA 3NL1A 4XFBA 4XFGA 4CXXA 3NJXA 2IXHA 2AEZA 5DN2A 4TZDA 1K5MA 2VGDA 4EN9B 2DFBA 4L8QA 2D3SA 1LHOA 2W1WA 4XDQA 3LEKA 5T5LA 3ZFGA 1HQNA 1ND2C 3TWIA 4B4PA 2BNNA 1S2BA 1NCRB 1YFYA 4XF4A 1UMZA 2WRAA 1ENRA 1NA1C 1IKQA 1NCQA 5FZFA 3WQ0A 5E8AA 1VBE2 4ZU4A 5AVAA 5FYBA 4EZ4A 2GNBA 5FJHA 3A7QA 3AP7A 3CQOA 4F83A 4LOTA 2P37A 1PNGA 2XBO3 3BCWA 4AI1A 1H30A 1GBGA 4E2GA 5IYYA 4N43C 3RI8A 1VBD2 2XBO2 3ZXLA 1RJ8A 2EVXA 2MEV3 4HOOA 2XLFA 3IDBB 2LROA 4ZXKA 4CA9A 1RYYA 2WNEA 4GWJA 2DVAA 3WW3A 3H50A 5B4XA 1W2NA 4LBKA 3AZXA 2D6LX 2VTFA 1CPNA 4M00A 3T4HB 1F5FA 4ZKTB 2BJSA 3N9MA 4YW3A 5JI7A 1UQXA 4UBHA 4YVWC 1BMV2 3RPQA 4TN7A 5A1AA 5JMCA 1PZ8A 3OPWA 1F5JA 5HI0A 2FMYA 1SBDA 4LA3A 2Y38A 1F31A 1OURA 1J1TA 2P4EA 4D0QA 4BIOA 4CEYC 4AR2A 3GBFA 1YO8A 2A70A 5CFCC 2FCVA 3U14A 5D8AA 2VQUA 3PURA 5A7WB 2E53A 3D0JA 4QX0A 3ZN4A 1KFXL 3AP4A 3AB0A 3DECA 3OBRA 4Q4Y2 5F5AA 5EYXA 1XNAA 3V0AA 3Q8AA 1CN1A 4CUGA 2YBPA 5IK4A 2RVAA 3MLJA 4OZXA 4XUPA 4GH4C 2FDIA 5K4LA 1Q5OA 4I0BA 4QT6A 3VBOC 3F2ZA 1S4CA 2AREA 4L0PA 2JDMA 2G9GA 3H8OA 4B4QA 2B39A 4UWDA 4PJYA 2HWE3 3RDIA 3VDAA 2QQMA 1K12A 1LHVA 4NROA 1OLQA 2NM1A 4AEKA 2XOMA 3TNQA 1UMIA 3WR0A 4IE6A 1D0HA 3FFZA 4MLOA 2GNMA 5HXMA 2BERA 3WXPA 2WZEA 4OUMA 4BA6A 2YFUA 3MLLA 1BVVA 3SCHA 3AMPA 4KGQA 2VECA 2XDVA 2Y6LA 4FCAA 4BMBA 5KXEA 3J7LA 1SQ4A 3ATGA 5FMCA 5JWPA 4U36A 5JVVA 1ZBA2 2A6WA 2VO5A 4P9XA 3IPVB 4DS0A 1NCRC 2J1EA 4GWNA 2RS53 3GBWA 1KS4A 4XE9A 1DLCA 4N9HA 1S2EA 3VZJA 1STMA 3NNJA 1C28A 1KITA 3RMXA 1V6JA 2XHNA 2Y6GA 3VZLA 1XYPA 3HD8B 3ZYHA 4IETA 3ZYGA 3ILNA 2R073 2Q8DA 5C9AB 1UD1A 4YRDA 1KS5A 1HRI3 1WGPA 5TSWA 4GD4A 2W52A 4E2QA 2GDFA 3ENRA 4UFHA 4X6QB 1FOD2 3ZM8A 1MPXA 2PLV2 2OKXA 4AXOA 2VVFA 2P1BA 1F4AA 1ND2B 5F6LB 5FZMA 2QE3A 4NIDA 3V0BA 1UYZA 2HBUA 1KXGA 2IVJA 1VBC2 4QKFA 4IV3B 1ZRIA 2UY9A 2ZEWA 2RE9A 3LDRA 4UYBA 3SKJE 4LO8A 4AG4A 4RFRB 4AF9A 2DUQA 1QIQA 2JICA 5F37A 1MR5A 3S5QA 3BALA 3VZOA 1OA4A 1Y9MA 4HN0A 1W0OA 1JTZX 2JDPA 4LBJA 1E5HA 3M2MA 4FXGB 3UV9A 3LDKA 3MHZA 3OUJA 4GWIA 2KD7A 1PO21 2R063 3MFAA 3OD0A 3R05A 1GUIA 4JDNA 1R091 4A6SA 2ERFA 3HT1A 5J1XA 2VR4A 1DYOA 2WNUA 2E51A 2HWB3 1AYM3 3A4UA 3OPZA 5HV0A 5DAVA 4Q2FA 1YJKA 5CU1A 1FV2A 2RS52 1LEMA 2XR4A 1BJQA 3N9PA 2XQXA 3NV4A 4Q29A 5ANNA 3BU0A 2VTXA 1OLRA 1N1VA 1H2LA 1UZWA 4RD7A 4K1YA 1W6NA 2G9ZA 1NY72 3UKTA 5A3WA 1AYN1 5JXIA 1H1AA 3FWEA 3WW4A 3E6CC 2FDKA 5EP9A 4UF0A 4KWJA 1YYNA 3WF0A 3IKWA 1QWRA 2VW0A 2B5HA 4ARXA 2WFPA 3OUIA 2RS51 2BEOA 4INDA 3ZXJA 2R043 3K51A 1LGCA 2PA7A 1SFNA 1Z7S1 2GSYA 4FPFA 4FPJA 4M0HA 2Z4FA 4GB31 5F3CA 2D5HA 2J1UA 2A6ZA 1WUVA 4WM7B 2B8MA 3K75B 1PO13 4FPEA 3BIEA 4LT5A 2MPFA 1XNCA 1U12A 1UOJA 3VZKA 1YFXA 5FP9A 4QHOA 1SFYA 4W6YA 2Y6JA 1UOBA 3NJZA 1W28A 3K48A 3PVOA 2IXJA 4BLJA 1ZZ8A 3C3VA 3NSTA 4RHV3 1Y9QA 1WCDJ 4MO3M 5A6QA 4RR3C 1AYM2 5FZ6A 5A7SA 4AEMA 2DCJA 1IQDC 3J9SA 4YLZA 1NQJA 1KGYA 1UIJA 3LIGA 2OVUA 5FZIA 1JYWA 1C8M3 2PMWB 4COYA 1ENSA 4FFGA 1VRBA 4KBZA 2QUOA 4LIVA 5FFOC 5FPLA 4Y1YA 4CP9A 2O0OA 4LORA 1O7FA 3A22A 4AEDC 1EP0A 2TUNA 4ZS3A 1G9FA 3G7DA 1UY1A 4QKBA 1VB4A 5FY0A 2P3YA 4TTGA 2B9VA 4WM8A 3E1F1 1REFA 3WLUA 3O12A 1AJOA 4IEXA 1HB1A 3WEZA 1QJU2 3HBZA 3LPFA 3WDXA 3IBMA 4IGOA 4G9SB 4N8MA 5KXBA 2VH9A 2P3KA 3APBA 5FQ0B 4B7KA 1MACA 4PDWC 4CEWA 4E9KA 1W99A 4J1WA 1C8M2 1ND3A 3SC7X 2XKOA 3T2QA 1A8DA 5DAWA 4CU8A 1IPJA 4XHBA 1VLNA 4DPNA 5BNOB 1HJFA 1SLIA 4MXWA 4IGQA 2VNRA 3ZIWA 1UPIA 2HH9A 4YARA 3GCWA 2JX9A 3P1IA 3OGJA 2BWAA 2IXIA 4R4ZA 4CYDA 4FAHA 1HRI1 4NHLA 2Q5TA 2R071 4PQQA 1SDWA 1UY4A 2BW8A 2X29A 2Q0AA 2VCAA 2DFCA 4Q0QA 4B1MA 4C90A 2BGCA 2FDGA 1NYWA 2PHTA 3FZ3A 3A23A 1EV11 1ZRDA 3TYJA 5JI9A 2XJQA 4CP9B 2TEPA 4LLFA 3WG4A 1U5XA 5EQUA 2Q1MA 1RUF2 2W92A 2PHWA 2KM2A 5T5OA 2A71A 2VMDA 1J83A 2D93A 1LEDA 3OSDA 3N9NA 1HV1A 4CDQC 2OUJA 4LBQB 3BUCA 2QQLA 4XBLA 1T6BX 3WP4A 3OF1A 3WSOA 5F7UA 1WCSA 1ZRRA 3QH7A 4WZFA 1X9PA 4D6QA 1Y7BA 1BMV1 4OI0A 2JWPA 5C6CA 2VQTA 1LECA 1LOBA 1LODA 1GSLA 1COV3 3ES4A 3HOBA 4I0WB 1D2SA 4CDWA 3VKOA 4XTPA 2VD7A 5J3UA 1JZ3A 1UZ0A 1PX3A 5G04L 1PGL1 3S57A 3E6BA 2ARXA 1RUE2 1HLCA 2KXLA 5C4WA 4MGYE 2XBO1 3TBDA 1D0GA 2DCTA 1O91A 2JDUA 4IE5A 4M3CB 4Y4RA 4YW1A 3WQ7A 3WX5A 5GLZA 2C9KA 1WLWA 4GULA 4YW5A 5GZEA 1GYKA 2MHFA 4DB5A 1R092 3BTZA 5KXDA 4D3WA 4G4FA 5I0RA 2VMFA 2DVFA 3ZMNA 1F35A 1VBE1 3CJIC 3BN6A 3I3DA 3AFKA 1MQTC 3H7YA 2BTVC 3FUQA 3HR9A 3PIGA 5JZGB 3GZTB 1CJDA 1H2KA 2VAUA 3NKGA 4R9CA 1HB3A 1H0BA 3RJRA 2AR6A 2HEWF 2XHKA 1WLCA 3HN3A 1GP6A 1VIWB 4K1ZA 3TRSB 4AQSA 2ET7A 3VDCA 3D4KA 5I8YA 4Z82A 1XXNA 5ABJB 1LESA 1DZRA 5ACA1 3BGAA 4JDOA 1W2TA 3WDTA 4D6RA 1FOD1 2X53S 1WA6X 3VL8A 3UL2A 3RZGA 1ZX5A 4CDQA 5EFUA 3LWCA 1I3HA 4LE4A 2XLGA 2AH2A 2PFWA 3KT7A 1VMFA 1RUG2 4FOWA 1VAKA 2A3WA 1SCRA 1W3VA 3MF6A 3PU8A 4OI4A 4QAWA 3T08A 3DGTA 2CGNA 3ZN6B 5FBJA 4B29A 4DXTA 4AFCA 4L11A 1W2UA 2ZZQA 4UFLA 3BKZA 2MNGA 3U0ZA 4QQHA 2E6VA 3D5OA 1K42A 2VMGA 2VW1A 2HWC1 1A78A 4HKWA 1RC6A 3VD9A 3U37A 2P34A 1BEV2 5FUNA 4YW7A 5FZ8A 4B4RA 3AMNA 2CGOA 1JUHA 3DKQA 3PVEA 5FPBA 2Q8CA 3AKQA 3S0MA 4LULA 3RZJA 2F17A 1QGLA 2ZEZA 4QD2A 2R7EB 3WNNA 4N53A 4DUVA 2V09A 4N43A 4BQ2A 3UGGA 2YYOA 2JDKA 2WN2A 4IEWA 3ACFA 4J25A 2XJSA 3WOGA 3USUB 5FZDA 3GXUA 5FZLA 1F8VA 1LHWA 5IWFA 1NXD1 4PDWA 4CP1A 2OA2A 3OGSA 1GNYA 1NOVA 2CV6A 2VZSA 2WS93 2QVSB 3MIDA 4AVVA 4DINB 1JZ4A 4UFMA 1SZBA 5FYYA 1ULPA 3NV2A 3WV6A 2B45X 4QB1A 1BEV3 4LIUA 3S5AA 1RUJ2 1ZM1A 2GN7A 5JPNB 4XAAA 1WMFA 2C4XA 1O3SA 4DXSA 3BTXA 3T3YA 4KI5M 4M4RA 3LKJA 3LE0A 4OHWA 2ORXA 4H14A 3NAPB 1R093 2BYVE 2OYZA 3VBSA 4BCUA 3WF4A 4D69A 1FXZA 4PI0A 1W6OA 4QU2A 1ALYA 3EQEA 3EO6A 4MOAA 1R1A1 1ZBA3 5EZWA 5F32A 1V6NA 3RRDA 5FDBA 3AYDA 4C91A 3M7AA 1FYUA 1FI2A 2CY6A 2I74A 1IS4A 2JDZA 2HWC3 2ZGMA 5ABJC 2OXBA 4PBOA 1KRIA 2ZX4A 2YGMA 3PTRB 4YFWA 1DQ6A 4XMAA 3MEPA 4L97A 4UBGA 4XCAA 4CCCA 3JQWA 4Q1RA 3EJKA 4XETA 3E5QA 1TMF2 2Z69A 2GALA 4CEYB 2H0VA 1HRI2 1FV3A 1Q3EA 5DABA 2RR12 4RQPC 1VRH2 1RIRA 5DDJ1 4F3JA 4QGMA 4LUMA 1ZZ9A 2VNOA 3TNPB 3L9JT 1TEIA 1VBD1 1VAVA 2AEYA 1DZQA 2E32A 4H3WA 1WW7A 4YVWB 1C4RA 3KCCA 4Y22B 2E7QA 1QJU3 3NNMA 3IAPA 2RM23 2EALA 4E8DA 3AKRA 5KC5A 2HWF2 4ASLA 3OYWA 5C3QA 3C7HA 5T5JA 5CFDC 1O4YA 5A7NA 3IIIA 4I02A 4HVQA 1LOCA 3AKTA 3CO2A 2C6SA 3FLTA 4JGYC 5C3OA 3NRUA 4J6GA 1N1SA 4MZUA 1OOPA 4BK4A 5DUUA 2A6XA 3AXEA 1QJU1 3AJYA 3C7EA 3OGVA 3QLQA 5F3GA 3H8RA 3SEPA 4IGPA 1MEC3 2PAKA 3OEBA 3M4FA 3M3OA 5FKBA 5FP7A 5A6ZA 2ZAHA 4OVEA 1W04A 2ZGKA 2D44A 3JB4C 5EJ3A 5I8TA 3ZYBA 4OLLA 3TN92 4Y33A 1NXMA 1S0BA 1WWYA 4MGTA 1X50A 1UOGA 1BVP1 2QQVA 5KBFA 5CYYA 5DAPA 4KWUA 5BXXA 1RTVA 1NA1A 3KZ4C 4CDQB 3WF1A 1N3OA 3INAA 1H8VA 2IWGB 3CHXA 3ZFEB 2WFF2 5FZOA 3ZPYA 1CPMA 4CXYA 1D4M2 3WY6A 3NNLA 2ZGNA 5FP8A 2WZR3 4QQ2A 3NQHA 1EUUA 2K46A 5LY1A 1AX1A 1RUE3 1W2OA 3CZUA 1R1A3 4PI2A 2VMHA 3KHCA 5A3OA 1ASJ1 1SDDB 1M06G 4KL1A 4GJZA 1DLLA 4XUTA 4QPGA 1OPMA 1YQ2A 5FZ4A 4C0HA 5BNNC 3LEIA 3R4SA 1RMU3 3RYRA 3M1HA 5FWJA 2ZGTA 2WT1A 3WNKA 4V1PA 4TLGA 4W8JA 2FDJA 1XB9A 3J8F3 4AEJA 4XEZA 1IOAA 1GQHA 4BXSV 5LEKA 2B46X 2VBBA 1V00A 3ZFFC 1BYHA 3MPPG 4AI9A 4Z1VA 4XFAA 1FMD2 1B35B 2ZAAA 4GB32 5JSRA 1ZRCA 2GC0A 2JDAA 5JR2A 3POFA 3U78A 3WNOA 2YBKA 3ZOIA 5C3PA 4OZOA 2RMU1 3SXWA 5IFPA 2WQZC 3B93A 3NVCA 5F5QA 1X33A 5J48A 1PZ7A 4S2HA 1GOGA 4COVA 2BDRA 3BPSA 4YZ2A 2OQ7A 1UMHA 2PQSA 1DQ2A 1D7PM 2WJSA 5E88A 1COV1 4DNYA 5C33A 3T1LA 4QQPA 4AHXA 1GZWA 4F7ZA 4GWMA 1BBT2 3JBG2 2DURA 1G9DA 3E97A 4DEVA 1NY71 1JHJA 2A75A 1GFF2 2HJIA 1QQP3 1H2NA 1SBEA 3K4AA 1JOPA 3OBTA 4QB2A 5LY2A 2R042 3B9IA 4JGYB 1PO11 4B1LA 2Y6FA 3TAYA 2VMCA 2WNOA 5H9RA 1B09A 1JU3A 3USUA 3VV1A 1WMEA 3VBSB 3L2HA 3E5UA 4GB33 3DYMA 5EV7A 4XABA 1K5MC 1RUD1 4WM8B 5FPAA 2X05A 2K9ZA 4RS5A 1CIYA 1RUH3 4XACA 4XW3A 5T3NA 4YM2A 5LA9A 3GM8A 2LRPA 2VUCA 2RDQA 3ASIA 3PNAA 3RZKA 1AR93 4MXWB 3I2FA 4P08A 4E27A 3FE5A 2R30A 5FRAA 3AL5A 4LNVA 4ISQA 3O0WA 4QM8A 1ND3B 1V9U1 2PLV3 2XL9A 2OIIA 1CAXB 4AFAA 2AYHA 1NE6A 2XVKA 5DDJ3 1XQNA 1CONA 1H8TC 2JG8C 5FZGA 2ZMKA 1OQEA 1Q8OA 2A6VA 1WD4A 3POYA 3DYOA 3O1SA 3FLRA 4DXRA 4MX3A 2QCSB 2VUAA 3ACLA 1VPHA 1LHNA 2DU1A 1IS3A 2DU0A 2W2IA 3POSA 2E26A 2YZ4A 4E4ZA 5JOWA 3H1MA 3MI8A 4YVSC 1KDKA 5FOJB 5IUQA 1UW8A 5FTTC 4EWDA 2G19A 2VXRA 1FAYA 1VMJA 2A3XA 4JGZB 5FP4A 3WCRA 2ZABA 3VBRA 3BODA 4A7KA 2QQOA 1QQP2 1HB2A 3KV4A 5FMOS 1DBNA 5FKCA 4CXWA 3PL0A 2BOJA 1C8NA 3I2KA 3K77A 1CX1A 3I59A 1DQ0A 3WF2A 1XSQA 3I54A 3ZYPA 1DGRA 3V64A 1OUXA 1V70A 2VTXJ 2R16A 2YMZA 3LA2A 4XZPA 1P8JA 2P3IA 2IFWA 3H1WA 3EXUA 3I8TA 4O61A 5T52A 2DYCA 1O8SA 3VZMA 4A4AA 1ZRFA 5FK8A 5CISA 2SLIA 2WLQA 1HRV3 4NRQA 4Q26A 2JDHA 4FPGA 5C3SA 5I0UA 3I2GA 2BPA2 1TVGA 1DGLA 1VB2A 1XNTA 3FLPA 4IQPA 1F2NA 1HQWA 5A3TA 4C8DA 1A34A 2K0GA 1UU6A 3TN93 3O0VA 2FCTA 4BE3A 4U2AA 1QJZA 4KH9A 1GP4A 3W9AA 5B2GB 5B4NA 5ISLA 1SLLA 1W03A 5BYNA 1ND3C 5HPOA 2YDEA 3BTYA 4XJ8A 1EAH1 1X36A 2IZWA 1O3RA 1Z78A 2WS92 4Y1XA 5DZFA 1ODNA 4CRQA 1TE1B 4FOVA 5JZGA 5IVCA 4NUBA 3LA3A 4S2FA 4O9EA 4PLMA 4AYUA 4CCOA 1XBFA 4MH0E 4ASKA 5FYSA 1W8NA 1LGNA 1UPSA 2PHUA 2PYTA 2Y6HA 2JE7A 3PHMA 1K5MB 2ORZA 3Q8FA 4QXKA 4I09A 4Q4X3 4WM8C 5A7OA 3THTA 2AGSA 4ASMB 3H0OA 1AL21 1VP6A 1CVNA 2DBNA 2EIDA 3POWA 5C8CB 5FO8B 2VE1A 4HANA 4FTEA 3W5MA 1CAWA 5LWBA 1I9RA 3OYWB 4AVAA 3ZN6A 5IK8A 1GWLA 1SLCA 3ZFEA 1GZCA 4XIOA 2O14A 1UN1A 2ENRA 5IAXA 2W39A 3Q8BA 2N7GA 3LIHA 4H55A 4QPIC 4R9AA 3DN7A 2R0FA 2JKBA 1O5LA 1TMF3 3VBRC 5J96B 1URXA 1QNWA 3C2UA 1HRV2 3NNGA 1GICA 1OUSA 1LU2A 4IE0A 3N7MA 4QDQA 1QXRA 4IV1B 3MIFA 4YM3A 5FPXA 2YUEA 2WZR2 4E2SA 5AC92 2XVGA 4XFCA 1WZXA 3P5BA 3VD5A 3S7EA 1GWKA 5FMOL 5FMBA 2X09A 3HPNA 3ZFGB 4YVSB 2QQWA 1DCSA 4M3CF 4NR1A 3U10A 3ETPA 4JZRA 5A70A 1V6KA 1L7RA 3FBMA 4AQ2A 2VL4A 1ULFA 2FMDA 3OBAA 4IV3A 4SBVA 5IVJA 4NJ4A 1CZVA 1ASJ3 2JG8B 1PO23 2R061 3SCFA 5SV8A 4CPBA 5A3LA 5LZ6A 5FYZA 4UT5A 4TLFA 5JSOA 2XONA 2WT0A 3I3QA 5F9TA 3AYCA 1LR5A 4OCTA 3R0RA 5K0UA 3OY8B 1T2XA 3UJOA 2RG4A 1W0NA 2P2KA 3DKWA 1RUG3 5DAXA 4FPHA 4Q0UA 1QJEA 2GC1A 5FLIA 4LJHA 2ID4A 3NJVA 1PX4A 1V9U2 4CVUA 3ORJA 4RSUA 1PMIA 2QQKA 3ACIA 4Z2AA 3PJYA 2G9FA 1R082 2ZA9A 1HW5A 1UX6A 1GZTA 2YY1A 4CUAA 2JD9A 4KG8A 4ZXEA 4Z92B 1UZZA 1UU5A 1OFNA 2WNVA 2OPKA 2VZUA 3VGIA 3ZSEA 4NVPA 4PF1A 5CG8A 3KV6A 5FZAA 2FQPA 3ZYJB 3F95A 1GKBA 2WKKA 2YV8A 1GP5A 2JB8A 1R1ZA 2HYKA 2SBAA 4A3XA 4A7YA 2ZEXA 4OQ8A 4BISA 2VMIA 2J1TA 1RUI2 2W08A 5AC91 3HQRA 1EAH3 1HN0A 4DMIA 5C5UA 1K5JA 3HBKA 1AVBA 4HVRA 4L2NA 4Q4W1 1BQPA 1FNYA 3HMYA 1WMDA 2DVBA 1VR3A 3NWKA 4JGYA 4X8NA 4CCEA 4D7SA 3BIWE 4XHXA 4AZZA 1RHI1 1IHMA 5L73A 3SMHA 2XUMA
chains in the Genus database with same CATH topology
1GOFA 1OF4A 1W9SA 2VCBA 4A44A 2L9LA 4QPWA 2W92A 3WQBA 4GZ9A 2VMDA 1J83A 2B4KA 2QQJA 2QQLA 2E33A 4MGSA 3JXSA 4W4ZA 2J22A 3WSOA 3FN9A 4OYUA 5F7UA 2WO1A 3MV11 5EIYB 4DUXA 4XUOA 2VQTA 3HOBA 2W95A 1JZ3A 1UZ0A 1PX3A 5G04L 5LA2A 3WNMA 2BGPA 1BHGA 4LPLA 2C9KA 4M4PA 4RN5A 2VMFA 2QQNA 1K3IA 3BN6A 3I3DA 2E31A 1WCQA 4OUEA 5IFTA 2W1UA 3OG2A 3WNLA 4A6OA 3HN3A 3OEAA 4PT6A 3VDCA 4JKMA 2VJXA 4A42A 2VCCA 3GDBA 2W5FA 3BGAA 3FHQA 4AAXA 3HNBM 4KMQA 1XC6A 1XPWA 4W50A 2WN3A 3C7GA 2BBAA 2LS6A 1OT5A 2CDPA 4QAWA 3T08A 1JYNA 3VD7A 4DXTA 4ZZ8A 3ABZA 1JZ7A 2VZ3A 2W94A 1NUKA 4QX3A 1K42A 5JXGA 3LQCA 4ET7A 1W8OA 1US3A 3SKVA 3U37A 3WNPA 3VD9A 1F4HA 2Y6KA 1UYYA 4P5YA 3CDZB 2VM9A 2QBXA 2ZEZA 1JZ2A 2R7EB 3I3BA 3WNNA 3DYPA 4DUVA 3MBWA 1JZ5A 1JU4A 2WN2A 3ACFA 1R64A 3GXUA 3K4DA 2RJ2A 1UWWA 2EIEA 2Y8KA 3C7FA 2BGOA 3CMGA 2Y64A 4JKLA 2WBKA 2VZSA 3AC0A 1GNYA 1PMHX 3OGSA 2LW8A 1JZ4A 1KEXA 3OGRA 1GQPA 1OD3A 1ULPA 2W9XA 1UXZA 2YB7A 3SEEA 3T0BA 4QB1A 1JYVA 1US2A 2J1SA 2RV9A 5CZKA 3THCA 2C4XA 4DXSA 4KI5M 4M4RA 4E8CA 3LE0A 3OB8A 2ORXA 2VOTA 1UY0A 4YPJA 2BZDA 3HNYM 3WF4A 5EJ1B 2W87A 4MOAA 4LKSA 5C7GA 4HG6B 2VZRA 1SG3A 5DQ0A 2WQ8A 3MUZ1 2VC9A 3VDBA 3LEGA 2V5DA 2JKXA 2V72A 1CZTA 4FI9A 3HJRA 1UY2A 1UXXX 4ZY9A 3MUY1 5JUVA 3I2IA 2WAAA 3GGLA 2QQIA 4P00B 2E32A 4BK5A 4A3ZA 2DCKA 2WAOA 3IAPA 1CZSA 3CIHA 4E8DA 1WKYA 3C7HA 3IIIA 3IB3A 1GU3A 4DUWA 5FUIA 3NRUA 2C26A 4CUBA 4BK4A 2W46A 3HEIA 3C7EA 4OMCA 3OGVA 3SEPA 1SHWB 4XUQA 5IHRA 4P02B 3OEBA 4QB6A 3C8XA 3NJXA 1NAEA 2VZQA 3EYPA 5DN2A 2J7MA 2W47A 3A21A 2W1WA 3LEKA 2YC4A 5LA0A 5CYYA 3T0DA 4KWUA 5LCWL 5EJZB 3WF1A 2WYSA 3HNMA 3W5NA 5G05L 3IDAA 3A7QA 3CQOA 3VD3A 2JE8A 3NQHA 1EUUA 5IYYA 2HLEA 3CZUA 3ACHA 2CDOA 3VD4A 3I3EA 1SDDB 4XUTA 1RYYA 4GWJA 1YQ2A 2ZXQA 5B4XA 3THDA 3LEIA 2VTFA 4RYDA 4UI9L 3T09A 3WNKA 4W8JA 1JZ8A 1JZ6A 4XURA 5C71A 4CU7A 5A1AA 4IUGA 4BXSV 4JHZA 2J1AA 3PUHA 4LQRA 2WO2A 2JDAA 5JR2A 3WNOA 4D0QA 1O8PA 4OZOA 5IFPA 1J84A 2YFZA 1GOGA 1UMHA 2PQSA 1D7PM 2VQUA 2VZ1A 4QX0A 3DECA 4DEVA 5IJRA 4ZZ5A 1JHJA 1XNAA 3K4AA 2RVAA 4QB2A 4XUPA 1UX7A 2VMCA 1JU3A 3F2ZA 4L0PA 3DYMA 2X05A 3VDAA 2QQMA 1K12A 1CIYA 2XOMA 1UMIA 5HXMA 3GM8A 3UNPA 1O59A 2BERA 2WZEA 3I2FA 4P08A 2YFUA 4A45A 2Y6LA 1PMJX 5C70A 2VO5A 2J1VA 1UY3A 2J1EA 2VZVA 1DLCA 3DYOA 3ACGA 4DXRA 1H6YA 2XHNA 2Y6GA 4XZUG 1L7QA 2E26A 5LA1A 2EICA 1MPXA 3CZJA 2QQOA 2OKXA 5I0DA 1F4AA 3I2KA 3EB7A 4QX2A 3K77A 1CX1A 3WF2A 1UYZA 4UOJA 2ZEWA 2W1QA 4AG4A 1EUTA 3SKJE 1P8JA 1O8SA 4A4AA 2VMEA 2V4VA 4JKKA 4GWIA 2KD7A 3I2GA 1GUIA 1TVGA 1XNTA 3I2HA 1DP0A 2VZOA 5J1XA 2VR4A 4OMDA 5B4NA 1DYOA 1OF3A 5HPOA 4XVHA 3UETA 3ZM8A 2W1SA 2XQXA 2ZEYA 3K4ZA 3T2OA 1W8NA 2Y6HA 3UESA 2YC2A 5JXIA 2DDUA 2ORZA 2WABA 3T2PA 4CUCA 1JI6A 3WF0A 4ARXA 2EIDA 1ULOA 5DPNA 1H6XA 3W5MA 3D3AA 3I2JA 3J7HA 2YG0A 1LNSA 2VZTA 1W9WA 1NX9A 2Z4FA 2J1UA 3K75B 4QDRA 3NNGA 4QDQA 2WZ8A 2HYXA 4DEQA 2Y6JA 3VD5A 4MADA 1GMMA 1JYXA 2X09A 3HPNA 4MO3M 5DMYA 2VZPA 3PUIA 2DCJA 1IQDC 3ETPA 2W3JA 3FL7A 4MGQA 4BDVB 1KGYA 1L7RA 2VL4A 3OBAA 1JYWA 4ARYA 5JXHA 3MO4A 1CZVA 1OH4A 3WF3A 4D8MA 4JX0A 3K46A 3P6BA 2XONA 3A22A 1W9TA 1HN1A 3I97A 3C7OA 1UY1A 3FHAA 4TTGA 2B9VA 4CU6A 3E1F1 1T2XA 4TXWA 1W0NA 4UAPA 3WEZA 2WUHA 3LPFA 4QDSA 3IAQA 2ID4A 3NJVA 1PX4A 2WO3A 4CVUA 5JXJA 3MV01 1TG7A 2QQKA 3ACIA 4Z2AA 4BJ0A 5JMOA 4XUNA 1W99A 4CUAA 2JD9A 2J1RA 4ZXEA 3T2QA 3CKHA 1GOHA 2VZUA 4PF1A 4CU8A 3T0AA 4CU9A 2EIBA 2X10A 4QX1A 3ECQA 3LPGA 2W91A 1NKGA 1I5PA 2ZEXA 3P1IA 2J1TA 1UYXA 4LHSA 1K45A 2WDBA 4PQQA 1UY4A 4A41A 2VCAA 3A23A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GOF A;  1OF4 A;  1W9S A;  2VCB A;  4A44 A;  2L9L A;  4QPW A;  2W92 A;  3WQB A;  4GZ9 A;  2VMD A;  1J83 A;  2B4K A;  2QQJ A;  2QQL A;  2E33 A;  4MGS A;  3JXS A;  4W4Z A;  2J22 A;  3WSO A;  3FN9 A;  4OYU A;  5F7U A;  2WO1 A;  3MV1 1;  5EIY B;  4DUX A;  4XUO A;  2VQT A;  3HOB A;  2W95 A;  1JZ3 A;  1UZ0 A;  1PX3 A;  5G04 L;  5LA2 A;  3WNM A;  2BGP A;  1BHG A;  4LPL A;  2C9K A;  4M4P A;  4RN5 A;  2VMF A;  2QQN A;  1K3I A;  3BN6 A;  3I3D A;  2E31 A;  1WCQ A;  4OUE A;  5IFT A;  2W1U A;  3OG2 A;  3WNL A;  4A6O A;  3HN3 A;  3OEA A;  4PT6 A;  3VDC A;  4JKM A;  2VJX A;  4A42 A;  2VCC A;  3GDB A;  2W5F A;  3BGA A;  3FHQ A;  4AAX A;  3HNB M;  4KMQ A;  1XC6 A;  1XPW A;  4W50 A;  2WN3 A;  3C7G A;  2BBA A;  2LS6 A;  1OT5 A;  2CDP A;  4QAW A;  3T08 A;  1JYN A;  3VD7 A;  4DXT A;  4ZZ8 A;  3ABZ A;  1JZ7 A;  2VZ3 A;  2W94 A;  1NUK A;  4QX3 A;  1K42 A;  5JXG A;  3LQC A;  4ET7 A;  1W8O A;  1US3 A;  3SKV A;  3U37 A;  3WNP A;  3VD9 A;  1F4H A;  2Y6K A;  1UYY A;  4P5Y A;  3CDZ B;  2VM9 A;  2QBX A;  2ZEZ A;  1JZ2 A;  2R7E B;  3I3B A;  3WNN A;  3DYP A;  4DUV A;  3MBW A;  1JZ5 A;  1JU4 A;  2WN2 A;  3ACF A;  1R64 A;  3GXU A;  3K4D A;  2RJ2 A;  1UWW A;  2EIE A;  2Y8K A;  3C7F A;  2BGO A;  3CMG A;  2Y64 A;  4JKL A;  2WBK A;  2VZS A;  3AC0 A;  1GNY A;  1PMH X;  3OGS A;  2LW8 A;  1JZ4 A;  1KEX A;  3OGR A;  1GQP A;  1OD3 A;  1ULP A;  2W9X A;  1UXZ A;  2YB7 A;  3SEE A;  3T0B A;  4QB1 A;  1JYV A;  1US2 A;  2J1S A;  2RV9 A;  5CZK A;  3THC A;  2C4X A;  4DXS A;  4KI5 M;  4M4R A;  4E8C A;  3LE0 A;  3OB8 A;  2ORX A;  2VOT A;  1UY0 A;  4YPJ A;  2BZD A;  3HNY M;  3WF4 A;  5EJ1 B;  2W87 A;  4MOA A;  4LKS A;  5C7G A;  4HG6 B;  2VZR A;  1SG3 A;  5DQ0 A;  2WQ8 A;  3MUZ 1;  2VC9 A;  3VDB A;  3LEG A;  2V5D A;  2JKX A;  2V72 A;  1CZT A;  4FI9 A;  3HJR A;  1UY2 A;  1UXX X;  4ZY9 A;  3MUY 1;  5JUV A;  3I2I A;  2WAA A;  3GGL A;  2QQI A;  4P00 B;  2E32 A;  4BK5 A;  4A3Z A;  2DCK A;  2WAO A;  3IAP A;  1CZS A;  3CIH A;  4E8D A;  1WKY A;  3C7H A;  3III A;  3IB3 A;  1GU3 A;  4DUW A;  5FUI A;  3NRU A;  2C26 A;  4CUB A;  4BK4 A;  2W46 A;  3HEI A;  3C7E A;  4OMC A;  3OGV A;  3SEP A;  1SHW B;  4XUQ A;  5IHR A;  4P02 B;  3OEB A;  4QB6 A;  3C8X A;  3NJX A;  1NAE A;  2VZQ A;  3EYP A;  5DN2 A;  2J7M A;  2W47 A;  3A21 A;  2W1W A;  3LEK A;  2YC4 A;  5LA0 A;  5CYY A;  3T0D A;  4KWU A;  5LCW L;  5EJZ B;  3WF1 A;  2WYS A;  3HNM A;  3W5N A;  5G05 L;  3IDA A;  3A7Q A;  3CQO A;  3VD3 A;  2JE8 A;  3NQH A;  1EUU A;  5IYY A;  2HLE A;  3CZU A;  3ACH A;  2CDO A;  3VD4 A;  3I3E A;  1SDD B;  4XUT A;  1RYY A;  4GWJ A;  1YQ2 A;  2ZXQ A;  5B4X A;  3THD A;  3LEI A;  2VTF A;  4RYD A;  4UI9 L;  3T09 A;  3WNK A;  4W8J A;  1JZ8 A;  1JZ6 A;  4XUR A;  5C71 A;  4CU7 A;  5A1A A;  4IUG A;  4BXS V;  4JHZ A;  2J1A A;  3PUH A;  4LQR A;  2WO2 A;  2JDA A;  5JR2 A;  3WNO A;  4D0Q A;  1O8P A;  4OZO A;  5IFP A;  1J84 A;  2YFZ A;  1GOG A;  1UMH A;  2PQS A;  1D7P M;  2VQU A;  2VZ1 A;  4QX0 A;  3DEC A;  4DEV A;  5IJR A;  4ZZ5 A;  1JHJ A;  1XNA A;  3K4A A;  2RVA A;  4QB2 A;  4XUP A;  1UX7 A;  2VMC A;  1JU3 A;  3F2Z A;  4L0P A;  3DYM A;  2X05 A;  3VDA A;  2QQM A;  1K12 A;  1CIY A;  2XOM A;  1UMI A;  5HXM A;  3GM8 A;  3UNP A;  1O59 A;  2BER A;  2WZE A;  3I2F A;  4P08 A;  2YFU A;  4A45 A;  2Y6L A;  1PMJ X;  5C70 A;  2VO5 A;  2J1V A;  1UY3 A;  2J1E A;  2VZV A;  1DLC A;  3DYO A;  3ACG A;  4DXR A;  1H6Y A;  2XHN A;  2Y6G A;  4XZU G;  1L7Q A;  2E26 A;  5LA1 A;  2EIC A;  1MPX A;  3CZJ A;  2QQO A;  2OKX A;  5I0D A;  1F4A A;  3I2K A;  3EB7 A;  4QX2 A;  3K77 A;  1CX1 A;  3WF2 A;  1UYZ A;  4UOJ A;  2ZEW A;  2W1Q A;  4AG4 A;  1EUT A;  3SKJ E;  1P8J A;  1O8S A;  4A4A A;  2VME A;  2V4V A;  4JKK A;  4GWI A;  2KD7 A;  3I2G A;  1GUI A;  1TVG A;  1XNT A;  3I2H A;  1DP0 A;  2VZO A;  5J1X A;  2VR4 A;  4OMD A;  5B4N A;  1DYO A;  1OF3 A;  5HPO A;  4XVH A;  3UET A;  3ZM8 A;  2W1S A;  2XQX A;  2ZEY A;  3K4Z A;  3T2O A;  1W8N A;  2Y6H A;  3UES A;  2YC2 A;  5JXI A;  2DDU A;  2ORZ A;  2WAB A;  3T2P A;  4CUC A;  1JI6 A;  3WF0 A;  4ARX A;  2EID A;  1ULO A;  5DPN A;  1H6X A;  3W5M A;  3D3A A;  3I2J A;  3J7H A;  2YG0 A;  1LNS A;  2VZT A;  1W9W A;  1NX9 A;  2Z4F A;  2J1U A;  3K75 B;  4QDR A;  3NNG A;  4QDQ A;  2WZ8 A;  2HYX A;  4DEQ A;  2Y6J A;  3VD5 A;  4MAD A;  1GMM A;  1JYX A;  2X09 A;  3HPN A;  4MO3 M;  5DMY A;  2VZP A;  3PUI A;  2DCJ A;  1IQD C;  3ETP A;  2W3J A;  3FL7 A;  4MGQ A;  4BDV B;  1KGY A;  1L7R A;  2VL4 A;  3OBA A;  1JYW A;  4ARY A;  5JXH A;  3MO4 A;  1CZV A;  1OH4 A;  3WF3 A;  4D8M A;  4JX0 A;  3K46 A;  3P6B A;  2XON A;  3A22 A;  1W9T A;  1HN1 A;  3I97 A;  3C7O A;  1UY1 A;  3FHA A;  4TTG A;  2B9V A;  4CU6 A;  3E1F 1;  1T2X A;  4TXW A;  1W0N A;  4UAP A;  3WEZ A;  2WUH A;  3LPF A;  4QDS A;  3IAQ A;  2ID4 A;  3NJV A;  1PX4 A;  2WO3 A;  4CVU A;  5JXJ A;  3MV0 1;  1TG7 A;  2QQK A;  3ACI A;  4Z2A A;  4BJ0 A;  5JMO A;  4XUN A;  1W99 A;  4CUA A;  2JD9 A;  2J1R A;  4ZXE A;  3T2Q A;  3CKH A;  1GOH A;  2VZU A;  4PF1 A;  4CU8 A;  3T0A A;  4CU9 A;  2EIB A;  2X10 A;  4QX1 A;  3ECQ A;  3LPG A;  2W91 A;  1NKG A;  1I5P A;  2ZEX A;  3P1I A;  2J1T A;  1UYX A;  4LHS A;  1K45 A;  2WDB A;  4PQQ A;  1UY4 A;  4A41 A;  2VCA A;  3A23 A; 
#chains in the Genus database with same CATH topology
 1ONA A;  3JD7 1;  4AK3 A;  1COV 2;  4QPI B;  5LK5 A;  1X9T A;  3JB8 A;  4QPG C;  2DF7 A;  4GZ9 A;  1GAN A;  1RUJ 3;  2QFE A;  4YW2 A;  1PIV 1;  1QHD A;  2XJV A;  4HBN A;  4BQ5 A;  3AZW A;  5GZF A;  1RUN A;  4AFM A;  2XG3 A;  1AL2 2;  4N43 B;  2D3P A;  1W6N B;  2GAU A;  4HN1 A;  1QH6 A;  4X6R B;  4MGS A;  4AGG A;  1AX0 A;  3N35 A;  4P9J A;  5LRR A;  1EV1 2;  2VW2 A;  2RMU 3;  3FN9 A;  4N7U A;  4OYU A;  5CIR A;  2Q8O A;  2ZGR A;  1MVE A;  4DUX A;  5J7M A;  3JU9 A;  1HX6 A;  4QX5 A;  4XUO A;  4ISR A;  3LSE A;  4CZS A;  4CCM A;  3KT1 A;  1U5Y A;  1GWM A;  3T1M A;  4COZ A;  4Z2W A;  4MXV A;  1YQ8 A;  3CJI A;  2RS3 2;  5FK7 A;  3DXT A;  1VBA 2;  3TEW A;  3WNM A;  3IWZ A;  2BGP A;  4QWN A;  1WMX A;  3KGL A;  1SCS A;  3GHN A;  4M4P A;  4KNC A;  1OHF A;  5KHH A;  3MLK A;  4CCL A;  1D4M 1;  3K3O A;  1JW6 A;  1C8M 1;  1G9B A;  2GP5 A;  1V6O A;  4OHZ A;  5K9Y A;  2PEL A;  4QHB A;  2CYF A;  2XL7 A;  1PK6 A;  2E31 A;  3A0N A;  1WCQ A;  4HON A;  3NAP C;  3GYD A;  4XIK A;  3VBH A;  4XJZ A;  1WBF A;  1LCL A;  3DPR B;  4YM1 A;  4YWA A;  3OG2 A;  4A6O A;  4R8H A;  4CDU C;  3UKV A;  5AFB A;  1CR7 A;  2VNV A;  3GBG A;  4K8R B;  5CA6 A;  2VJX A;  1GLH A;  2WQ4 A;  1S0D A;  1R08 3;  1CGP A;  2ILM A;  3S6P A;  2PXJ A;  2VCC A;  5FY7 A;  1W9Y A;  2Z5W A;  4AAX A;  3ZSL A;  2DVG A;  4KMQ A;  4AFD A;  4KWL A;  1IGO A;  1EY2 A;  1NLQ A;  1XC6 A;  2EXJ A;  2PHD A;  4N53 C;  4XJA A;  3ZR6 A;  3C7G A;  2CGP A;  2BBA A;  5FY9 A;  1MVQ A;  1OT5 A;  1JYN A;  5FY4 A;  3LAG A;  3BI3 A;  3ON7 A;  1G9C A;  4Y5T A;  2HWF 1;  3ABZ A;  4MGK E;  1RUI 3;  1D2Q A;  4LA2 A;  4NMI A;  3H3L A;  4I01 A;  4IV1 C;  3KD4 A;  2D6O X;  3LA7 A;  2Z2S B;  1RL3 A;  4CDW B;  4W65 A;  4ET7 A;  4UFJ A;  1YFW A;  3B5L B;  3BTA A;  4YGD A;  4IV1 A;  1REE A;  2NZ9 A;  1UYY A;  1YQ6 A;  2CL2 A;  1QOO A;  3WUD A;  4C1X A;  1S0J A;  3CDZ B;  4I3G A;  4P9I A;  2VM9 A;  1DQ5 A;  2CAV A;  1LU1 A;  3D82 A;  4CEW B;  1CX4 A;  2QBX A;  4EWE A;  4P9W A;  1O5U A;  3CL1 A;  3O5S A;  1QJY 2;  3POI A;  3MBW A;  4LBQ A;  1DQ4 A;  1JZ5 A;  2XPJ A;  3N3H A;  5AC9 3;  4HPK A;  4JVA A;  5C3R A;  4AVT A;  5JOY A;  3J8F 1;  2EXH A;  1YQC A;  3RZM A;  4CEW C;  1UWW A;  1RUD 2;  2EIE A;  5LW9 A;  2ZGQ A;  2BGO A;  3TOJ A;  2QKD A;  3CMG A;  4FOY A;  2ZGP A;  4YZ4 A;  3Q8E A;  5IVY A;  2Y64 A;  2WSV A;  4XIL A;  4IEZ A;  1FX5 A;  1PO1 2;  4NPL A;  4Y5Z 0;  5DZE A;  2ZHN A;  1UXZ A;  1FMD 3;  4QQO A;  3NAP A;  2BP6 A;  2FBE A;  1MQT A;  5F5C A;  1JYV A;  4YG3 A;  2J1S A;  1I6X A;  3JQX A;  1IS5 A;  1OQD A;  4HK9 A;  5HV4 A;  3ME2 A;  3ZKU A;  2QDN A;  1J1L A;  1HDK A;  1FT9 A;  5FO7 B;  4E8C A;  3OBZ A;  1OVS A;  3E5X A;  5A6X A;  4P9L A;  1IQA A;  1QXJ A;  5LK7 B;  2BZD A;  1IS6 A;  1Y43 B;  5EJ1 B;  1YCI A;  1SBF A;  5JAX A;  5C7G A;  1AR6 3;  4LKS A;  5H9P A;  3PLQ A;  4AI2 A;  1OD5 A;  4IE4 A;  4LIT A;  2VVE A;  3POE A;  4CDW C;  1ZZ6 A;  2YC0 A;  2FD8 A;  4OUS A;  4Q0S A;  4FFI A;  1D4M 3;  4RS5 B;  1JN2 P;  2VC9 A;  3NMB A;  1LJ7 A;  5JDB A;  3B00 A;  3UGH A;  1LGB A;  5A3U A;  4AL9 A;  5JLV A;  4JAA A;  2V5D A;  1AR8 2;  1CZT A;  4LO6 B;  3VHN A;  1N1Y A;  4FT8 A;  4N53 B;  4RQP A;  3ZXE A;  1UXX X;  3IPV A;  3KM5 A;  4ZY9 A;  4JQT A;  5BNN B;  3VL9 A;  1BEV 1;  2WAA A;  2JDY A;  4P9G A;  3D6E A;  4RR3 B;  1LB2 A;  3AFG A;  1GZW B;  1EYB A;  4K9S A;  1RUD 3;  3HVD A;  1QY4 A;  2A5Z A;  2NN8 A;  2QZ2 A;  4HET A;  2YRO A;  5C8C C;  5BNO C;  3DL3 A;  2DCK A;  2RHP A;  2WAO A;  2Q30 A;  4HFS A;  2WFF 1;  4Q0V A;  5FZB A;  1AUY A;  1V9U 3;  1WKY A;  1Z7S 3;  2PLV 1;  2R1B A;  1F9K A;  1EPW A;  3GJB A;  3N9L A;  2JEC A;  5E6H A;  3VN4 A;  4NHK A;  5GLT A;  1GU3 A;  3PMS A;  1J58 A;  5FLJ A;  5JCT A;  2C26 A;  4I0A A;  4N9I A;  4ORF A;  2ZGO A;  3VBS C;  1L3J A;  3HEI A;  3GZE A;  3ZDS A;  4CCD A;  1S2K A;  4OMC A;  2HWE 1;  2ZGS A;  2MEV 1;  4P5H A;  1O3T A;  3M3E A;  4W6X A;  4P02 B;  4XUQ A;  2WWS A;  4AI0 A;  1RUO A;  5A33 A;  4G3Y C;  1NAE A;  2VZQ A;  3CU7 A;  1FOD 3;  3EYP A;  1JOD A;  1YJL A;  2VUD A;  1AL2 3;  3WDV A;  4CDX A;  2W47 A;  4P14 A;  4MHR A;  2WNV C;  4BQ1 A;  2YC4 A;  3MIB A;  1RMU 2;  1ZBA 1;  4I30 A;  3URF A;  3K3N A;  1OBN A;  3BU7 A;  3LCP A;  5LA0 A;  1ULC A;  5LBC A;  5LCW L;  3HNM A;  3W5N A;  5FYI A;  5T5P A;  3ZXA C;  3IDA A;  3NO8 A;  2HWD 2;  4PHZ A;  1QXP A;  4FQZ A;  3RYK A;  3AXD A;  2UWC A;  4YZ5 A;  2TNF A;  1W6Q A;  1CQ9 A;  5FP3 A;  1TME 3;  4Q4X 2;  2RM2 1;  5GAL A;  5IW0 A;  3DUI A;  1JXN A;  4LBO A;  4XJ9 A;  3WDW A;  1BZW A;  1DYK A;  1NA1 B;  1TME 2;  3OOX A;  3VD4 A;  2FZ2 A;  4J1X A;  1JOJ A;  2R1D A;  4XC9 A;  1DU3 D;  2XKP A;  3IN9 A;  3VBH B;  1VJ2 A;  2QNK A;  2Q1F A;  2ZXQ A;  5CKM A;  3AL6 A;  4FPK A;  2WZR 1;  4UI9 L;  3T09 A;  3ZXK A;  1KD7 A;  4JGZ C;  1TMF 1;  1HRV 1;  5KWR A;  2IXK A;  1XRU A;  5C71 A;  4CU7 A;  2C9A A;  4IUG A;  2VOK A;  2JXA A;  3ZIX A;  4LK6 A;  5HCA A;  4WVM B;  2J1A A;  4LUK A;  4YFZ A;  5IT6 A;  4LKF A;  2WO2 A;  3IIA A;  1OOP B;  2ETE A;  1CWP A;  5FPZ A;  3QH6 A;  4R9D A;  5DXD A;  1AR8 3;  1LKN A;  2GN3 A;  2Y0O A;  1O8P A;  5C8C A;  2XB6 C;  4DFS A;  5FR3 A;  4XPV A;  1RVF 1;  1E5S A;  3O1U A;  1R1A 2;  4YVS A;  1Q8P A;  2RS3 3;  5LRS A;  1RUF 1;  3RWN A;  4GQ7 A;  1MEC 1;  3ZMO A;  4LBN A;  5LBF A;  3HIF A;  5HBA A;  1B35 C;  5FBZ A;  2NP0 A;  4DRV A;  4CCJ A;  4QU1 A;  1FPN 1;  2H0B A;  1LOF C;  1W6P B;  4XQW A;  5L9B A;  2GU9 A;  5IJR A;  1YI7 A;  2CU5 A;  3N7K A;  1RUJ 1;  4KBB A;  2RS1 3;  2RDN A;  4XOG A;  3AVR A;  4PLN A;  1PM4 A;  4GA9 A;  3VBU B;  1PM7 A;  3BOP A;  4LTA A;  1MS8 A;  3ZFE C;  1QEX A;  2WS9 1;  1UAI A;  1VAL A;  1W6M A;  2ZKL A;  3SNM A;  2ZKN A;  5D1I A;  5FYH A;  5CFC B;  2BUK A;  4XF0 A;  1YEW A;  3AKS A;  4XFF A;  3N4M A;  4GAZ A;  5KXC A;  2VCM A;  1O3Q A;  4YGE A;  1LOE A;  2XWB B;  4BM8 A;  3MIG A;  3UNP A;  3N9Q A;  1O59 A;  1U5I A;  4YW6 A;  3VHR A;  3VB9 A;  4HMZ A;  2FCU A;  2YBS A;  3KGZ A;  4AHY A;  1QF3 A;  1YNA A;  1JHN A;  2R0H A;  5ACA 3;  4RQP B;  4H2A A;  4PIY A;  1IG3 A;  1H9W A;  3PIJ A;  4WVW A;  2A6Y A;  2VZV A;  3WDU A;  4RR3 A;  1MS0 A;  1OLM E;  3ACG A;  3J7M A;  1Y4W A;  4ZHN A;  3KQR A;  1J59 A;  4URA A;  2OZ6 A;  2OW4 A;  4FP2 A;  2C0Z A;  3VBR B;  4DY3 A;  5F5I A;  1H6Y A;  3UT0 A;  3KF5 A;  1YQ5 A;  2HWE 2;  3JZV A;  3BVC A;  4XZU G;  4JQR A;  4IES A;  4Y4Y A;  3MPB A;  4YW4 A;  1RUG 1;  1Q8Q A;  5LA1 A;  1UNB A;  4K40 A;  4HZF A;  4UW4 A;  2BQP A;  3HQX A;  1UO9 A;  1QDO A;  3CZJ A;  5IVE A;  4IEP A;  4RGG A;  1GZ9 A;  1DQ1 A;  4BZ4 A;  4QPI A;  3EB7 A;  4FOQ A;  1VBC 3;  4AGR A;  1BXH A;  4GMP 0;  1OSG A;  4UOJ A;  1IPK A;  2W1Q A;  4FFH A;  4QGL A;  4WM7 C;  5CB7 A;  4ATE A;  4EN7 B;  5BNQ A;  3V65 A;  1W6M B;  1ZZB A;  3H3U A;  3POJ A;  3ZVX A;  4AHW A;  5JPM B;  3JUU A;  4NIG A;  4OHY A;  2JD4 A;  5LB6 A;  4JKK A;  5T50 A;  2H6B A;  1JOB A;  2YU1 A;  2WL1 A;  3ITQ A;  4PCR A;  1TNR A;  2VVD A;  3FHI B;  5D8A B;  5FZ9 A;  3I2H A;  1NE4 A;  1EV1 3;  3ZX7 A;  3X29 B;  3SIS A;  4NE9 A;  3PDQ A;  5LBE A;  1AF9 A;  1DP0 A;  1W05 A;  2VZO A;  4OMD A;  1OKQ A;  3PVB B;  3J7N A;  2XML A;  4QPG B;  4D6S A;  3MW4 A;  3UET A;  1RUE 1;  1W8F A;  1YRZ A;  2XJP A;  1PGL 2;  4CDU A;  2LUW A;  4JV4 A;  5F3I A;  1ZA7 A;  1DGR N;  1TNF A;  2DVD A;  4NIA A;  5FAX A;  3ZFG C;  4ATF A;  2VOW A;  2WR9 A;  1VBB 1;  2ZEY A;  5J09 A;  3K4Z A;  3VBU C;  2RDS A;  1QJF A;  2R6Q A;  1XE8 A;  1LHU A;  4HLT A;  3USS A;  1OLM A;  2YC2 A;  3N36 A;  1H4H A;  1NZI A;  1OMI A;  3T2P A;  1AR7 2;  4CUC A;  1WW5 A;  4YM0 A;  3CBN A;  5I93 A;  5J36 A;  2ZHL A;  3RYP A;  2GNT A;  3RSJ A;  1QKQ A;  5HCF A;  2J42 A;  5FZH A;  4BLI A;  1W90 A;  3MF9 A;  4ES9 A;  1VBB 2;  4PLO A;  1UKR A;  5DPN A;  3QOP A;  2BNM A;  3GCX A;  2Q4S A;  1H6X A;  2OUH A;  2Y34 A;  4Y3O A;  3FUO A;  2RMU 2;  3D3A A;  3I2J A;  5A7W A;  2DCZ A;  3SHR A;  2YG0 A;  4COW A;  1LNS A;  3PUS A;  2VZT A;  3Q9O A;  1PVX A;  1W9W A;  1D4V B;  2VG9 A;  1NX9 A;  3J8F 2;  1XOY A;  4AWD A;  4BYY A;  3N7L A;  2ZMN A;  2EXI A;  5F3E A;  4K8F A;  5IVV A;  1BKZ A;  4AE2 A;  4QDR A;  1UZY A;  2ET1 A;  4NHX A;  2ARA A;  3IMN A;  5KHG A;  2WZ8 A;  1JH5 A;  2HYX A;  4DEQ A;  2UU8 A;  1BK0 A;  3VKL A;  4TYS A;  3AVS A;  1G8W A;  5D8A C;  4RHV 2;  3GNE A;  5L9R A;  2WWJ A;  1ZNP A;  1WBL A;  4MAD A;  1JYX A;  3GZA A;  1G86 A;  5DMY A;  1PNF A;  1VBC 1;  2C24 A;  2VZP A;  3FX3 A;  2VUJ A;  4HK8 A;  5J37 A;  1H8T A;  5F1R A;  2W3J A;  3FL7 A;  2GC2 A;  1KFU L;  3NV1 A;  5IAV A;  5ABJ A;  3V0B B;  1CAU A;  2LTN A;  3ZFF A;  4FPO B;  2OX0 A;  4PF5 A;  5EPA A;  1A6C A;  4ARY A;  3MO4 A;  3VBH C;  1Q56 A;  1OH4 A;  1QNY A;  3WF3 A;  4QKN A;  3O7O A;  1A8M A;  3LD8 A;  2KR2 A;  1UYP A;  1A3K A;  3K46 A;  3TEY A;  5CG9 A;  1W9T A;  1IPS A;  2EAK A;  5FZ7 A;  3ZYR A;  5A3M A;  3I97 A;  5BY5 A;  3I2O A;  3C7O A;  5FZ3 A;  4LBQ D;  4AQT A;  1XNB A;  4WBB A;  2YPD A;  4YNI A;  1NLR A;  4CU6 A;  1I1E A;  3T2T A;  5GJ6 A;  4TXW A;  2XH6 A;  2IUW A;  2WUH A;  2X5I B;  4LXL A;  4QDS A;  3IAQ A;  1AX2 A;  1J3Q A;  1QU0 A;  3NNF A;  4GH4 A;  5JXJ A;  3O1R A;  3MV0 1;  4RGK A;  3M3C A;  1Z0H A;  3ST7 A;  1DIW A;  2GME A;  5FQ0 A;  1W8H A;  4BJ0 A;  5JMO A;  5IAT A;  4MHU A;  1ND2 A;  3AMH A;  2ZBJ A;  5CBL A;  2GP3 A;  1DG6 A;  5BV6 A;  1AYN 3;  3AZY A;  3WW1 A;  4OQ9 A;  3T0A A;  2PHL A;  2ZHM A;  4O65 A;  4QX1 A;  4RL7 A;  4GMP 1;  3AMM A;  4IEO A;  4Q4V 2;  5A32 B;  3P3N A;  4YSF A;  5I0S A;  4QPY A;  2D6K A;  1T6G C;  2H6C A;  1NKG A;  4FP3 A;  4EZH A;  1VRH 1;  1AR7 3;  1X8M A;  2E7A A;  3KHB A;  4RHV 1;  4CEY A;  1UYX A;  4LHK A;  1JMU B;  1JYI A;  1K45 A;  2WDB A;  4BIF A;  3RI9 A;  2BU9 A;  5CFD A;  1GV9 A;  3OGG A;  1RUC 2;  5CEH A;  2WFF 3;  3AX4 A;  3H1Y A;  3SH5 A;  3KB5 A;  3ZXF A;  4QGN A;  5CVR A;  2EA7 A;  4GXL A;  3EHK A;  4CPB D;  1Z7S 2;  1GOF A;  5APA A;  4FBF A;  3RZL A;  5FYV A;  1OF4 A;  1W9S A;  2VCB A;  1Q8V A;  4V2W A;  5BNN A;  3SCG A;  2L9L A;  1MS3 A;  4YG0 A;  3WQB A;  2VXJ A;  5JOX A;  3DV8 A;  2CWS A;  4I3P A;  3MZH A;  1RIT A;  4LO4 B;  4NWV A;  2Y60 A;  4PBP A;  1NZC A;  4OHX A;  5CAZ A;  2B4K A;  2QQJ A;  3MIH A;  4O9G A;  4OUL A;  5FOB B;  4Q4V 3;  2E33 A;  3JXS A;  2NQY A;  3JD7 2;  3CEW A;  4W4Z A;  1SLT A;  1AR7 1;  5I0T A;  3S7I A;  2GMP A;  1LAJ A;  3KV9 A;  3WCS A;  1RHI 2;  1YLL A;  3CJI B;  4GMP 3;  5EIY B;  3NV3 A;  4YZ1 A;  1WCU A;  4IW3 A;  1APN A;  4CE8 A;  5FY5 A;  4AI3 A;  4ZU7 A;  2QZ3 A;  3PME A;  2NPI A;  2W95 A;  2V73 A;  1PGW 1;  4AVS A;  4D94 A;  3S30 A;  3LB9 A;  5LA2 A;  1W8T A;  1IKP A;  4PIX A;  5DUW A;  1YIP A;  1TME 1;  5JIA A;  1BHG A;  5KR7 A;  4L92 A;  2PTM A;  1U5Z A;  4NAO A;  4BQ4 A;  3U07 A;  4EWA A;  1RB8 G;  3W58 A;  2FDF A;  2EXK A;  4MUV A;  4RN5 A;  2DWR A;  3VKF C;  4X8P A;  4EE2 A;  3AJZ A;  2DTW A;  3A0K A;  3LF7 A;  4LO7 A;  1YC6 1;  2HKX A;  3EBR A;  4S2G A;  3SH4 A;  2AAC A;  3WNX A;  4AFB A;  2P6C A;  2R32 A;  3IZO A;  4IV3 C;  3VBO A;  4TSV A;  1L7L A;  4EN8 B;  2W1U A;  3R4U A;  3WHT A;  5DZG A;  3UJQ A;  3WNL A;  1OC1 A;  1N3P A;  4PT6 A;  1HKD A;  1LUL A;  1DZT A;  2HWC 2;  1VBA 3;  1Q8S A;  2ARC A;  1C1F A;  5HCB A;  4A42 A;  5D2A A;  4H7L A;  2XJT A;  2MEV 2;  2W5F A;  3FHQ A;  5FZC A;  3RMY A;  1YUD A;  4YG6 A;  5A32 A;  2QTW B;  1CAU B;  5GLV A;  3TB0 A;  3ZFF B;  1JBC A;  4W50 A;  3PUQ A;  3J4U H;  3M3I A;  5DUX A;  1CAW B;  1W9F A;  3FMG A;  2CDP A;  3M8L A;  2V4A A;  1NT0 A;  3ES1 A;  4IEY A;  5FZO B;  3VD7 A;  4BWO A;  4YYO A;  4ZZ8 A;  4FO9 A;  3FC0 A;  1RJ7 A;  2XVL A;  4WM7 A;  2P5B A;  2VUL A;  5JXG A;  3P3P A;  2AC1 A;  1AR9 1;  3LQC A;  2GH2 A;  3RQ0 A;  2X5I A;  3I2D A;  5FXW A;  4Y1U A;  1W8U A;  3QBQ A;  3SKV A;  3WNP A;  3ZR5 A;  4XDO A;  1XE0 A;  2Y6K A;  1KQR A;  2P17 A;  2F6B A;  4P5Y A;  2XWJ B;  1W8W A;  5FO9 B;  3AM2 A;  3GHM A;  2RDR A;  3M3Q A;  1ZA4 A;  3G6J B;  4W6W A;  1JZ2 A;  4UW3 A;  3CLP A;  5SV5 A;  2I2S A;  4M01 A;  4LBL A;  2EF6 A;  2UUR A;  1AL0 G;  4Y24 A;  1W8Z A;  4DXZ A;  3B9C A;  1XJA A;  4E4S A;  5A1F A;  4K6B A;  2CTV A;  1XSR A;  1XU1 A;  1R64 A;  1OVP A;  2RJ2 A;  4JC1 A;  2X8K A;  2K2S A;  4L9B A;  4XDP A;  2Y8K A;  3C7F A;  4LOS A;  2JG8 A;  3OY8 A;  2DUP A;  4Y22 A;  1OFS A;  1DGW X;  4XF3 A;  5K8S A;  4IXL A;  5FCC A;  2D40 A;  5D21 A;  3OGR A;  1V0A A;  2W9X A;  3WP3 A;  4EYU A;  5GLW A;  1H2M A;  3THC A;  1UF2 C;  4XJW A;  5ERL A;  2PHR A;  5K0U C;  1FPN 2;  1NLS A;  3MW2 A;  4YGB A;  1SFP A;  1S0F A;  5T54 A;  4GAL A;  3V0A B;  1XE7 A;  3OB8 A;  1MEC 2;  3LGR A;  1UY0 A;  4GH4 B;  1G9A A;  3CF6 E;  3RZH A;  1SEF A;  3WD5 A;  1BK1 A;  2ZX0 A;  1POV 0;  1ZVF A;  3IM0 A;  2XLA A;  1LRH A;  1RVF 2;  2Y33 A;  3KLS A;  3DF0 A;  3L2Y A;  1EAH 2;  1MS5 A;  3SQO A;  5AFE A;  4FPL A;  5GZC A;  5L19 A;  2JB4 A;  2W68 A;  2ZAC A;  3AZZ A;  4NRM A;  5FZ0 A;  2VZR A;  3H7J A;  4CSW A;  3WIN E;  2WQ8 A;  2ARB A;  4HL0 A;  1SPP A;  5EYY A;  3WP5 A;  3MUZ 1;  5I91 A;  4DY5 A;  3NJY A;  3MFC A;  2Z42 A;  4OFG A;  3VKM A;  3LEG A;  3UES A;  1QJY 1;  4FPC A;  2V72 A;  1E57 A;  2R07 2;  3B3Q E;  5DG1 A;  2I07 B;  1UY2 A;  3MIC A;  4HT1 T;  2IXL A;  3IDE A;  1IZ3 A;  2ZX3 A;  3MUY 1;  4BQY A;  3I2I A;  4AW7 A;  2VOX A;  2IVI B;  4Q4V 1;  1XND A;  1SLA A;  4P00 B;  3SH3 A;  5C8W A;  2OT7 A;  3QCW A;  3ROU A;  1O4T A;  4Y5S A;  4K3U A;  4PDW B;  4A3Z A;  2WO7 A;  3HAG A;  1V6I A;  5C9A A;  4Y20 A;  4HSL A;  5FZK A;  2D3R A;  5LAT A;  5L9V A;  1AHS A;  3IB3 A;  2E9Q A;  1RED A;  1MQT B;  3DXU A;  3HT2 A;  4JGZ A;  4PIZ A;  1WLD A;  5FUI A;  5FYU A;  3VBF A;  2LM3 A;  3ZO0 B;  2W46 A;  1ULG A;  3DPR C;  1BCX A;  2VQA A;  5L7O C;  1V6L A;  5CKQ A;  2B7Y A;  1XYN A;  2E63 A;  1LTE A;  5IHR A;  3VKN A;  4QB6 A;  3C8X A;  1ULE A;  4Q27 A;  3KF3 A;  2JE9 A;  4B8E A;  5FWE A;  2J7M A;  4KQ7 A;  1AXZ A;  1WA4 A;  3A21 A;  4BB3 A;  4KU8 A;  3JD7 3;  4NPR A;  2NYY A;  1VBB 3;  4QMA A;  4KWK A;  4BHP A;  2ZGL A;  2VPV A;  3OD4 A;  3PVN A;  3DCQ A;  4M0N A;  1J3P A;  1NQD A;  4NOT A;  3T0D A;  5A33 B;  5EJZ B;  1QJX 1;  2WYS A;  3H9A A;  4ITC A;  4EV0 A;  5IK5 A;  4MSV A;  2JDN A;  2P6H A;  5G05 L;  1H9P A;  1LOF A;  4GKX A;  4DRR A;  1BLZ A;  3VD3 A;  2JE8 A;  4GIQ A;  1AYM 1;  2HLE A;  3ACH A;  2CDO A;  2F4L A;  1VBA 1;  1Y9G A;  3I3E A;  2OPW A;  4KU7 A;  3SLI A;  2FHR A;  2ZX2 A;  4XMI A;  1FPN 3;  2ZS6 B;  4GJY A;  1UCX A;  3ELN A;  1O6U A;  3O0X A;  4LKE A;  3RWK X;  3THD A;  4A7Z A;  1DGW A;  1W6O B;  4RYD A;  1OOP C;  1UZV A;  2ZML A;  1C57 A;  1JYT A;  1C5I A;  1JZ8 A;  1XNK A;  4Q8K A;  4N7I A;  1JZ6 A;  5GLU A;  4XUR A;  2X5I C;  3O1O A;  4JHZ A;  4Y20 B;  4M3C E;  1HB4 A;  3PJQ A;  1BBT 1;  2B9U A;  3JBG 1;  3PUH A;  4LQR A;  5L36 A;  5CNA A;  3RVH A;  1KJL A;  3QAC A;  4BQX A;  5K7P A;  2VQ0 A;  2YHJ A;  1J84 A;  2OS2 A;  2YFZ A;  4R9B A;  2DV9 A;  4ES8 A;  4AI8 A;  1PZ9 A;  4MV2 A;  5F6K A;  4P9Y A;  1RXG A;  1DF0 A;  2A73 B;  2QDR A;  4YGC A;  4Q0P A;  3THP A;  3ZXD A;  3N7J A;  4LEJ A;  5EHD A;  2VZ1 A;  4Y1V A;  1FNZ A;  3LZZ A;  2GND A;  1FAT A;  1FMD 1;  1ZZ7 A;  5M0T A;  3K2O A;  3KQ4 B;  4ZZ5 A;  1POQ A;  4XF1 A;  1G7Y A;  2XXZ A;  4QQL A;  4WV8 A;  4I2O A;  2QJV A;  1M4W A;  1UX7 A;  2CNA A;  3KV5 A;  3OUH A;  3POB A;  4HKL A;  4UW6 A;  4XAE A;  1OQ1 A;  2HWB 1;  3T30 A;  3KT4 A;  2CHH A;  4UFK A;  3RGB A;  4BXF A;  1ASJ 2;  1POV 1;  1GNZ A;  2UYA A;  1QDC A;  2CAU A;  3VDD A;  1ZBE 2;  3RFR A;  4AAP A;  3BOW A;  3KVA A;  3VUO A;  1H4G A;  2PAE A;  1VBD 3;  2GH8 A;  4K7J A;  4QXC A;  1KJR A;  3VDD C;  3ZYI B;  4AED A;  1PVC 3;  3UK9 A;  4A45 A;  1RVF 3;  4Q8L A;  1QJX 2;  2XUE A;  3U4S A;  2IFR A;  2PHF A;  1PMJ X;  5C70 A;  1PIV 3;  3KCY A;  3EMR A;  1WLT A;  3AZV A;  3WVJ A;  1WCK A;  2J1V A;  4WVV A;  1UY3 A;  2PHX A;  5BNO A;  1CAV B;  4OHV A;  3FJS A;  1OH3 A;  1XYO A;  2D5F A;  3E6D A;  4XFI A;  3BYW A;  4AQ6 A;  4IEQ A;  2D6P A;  4CCK A;  3I3M A;  3W20 A;  1SPP B;  1CAX A;  1L7Q A;  1RUF 3;  2Y0I A;  4BPZ A;  4EQV A;  3I59 B;  4HVO A;  4E4H A;  3U1X A;  1S1A A;  2R06 2;  1POV 3;  2XQR A;  2EIC A;  3VLB B;  4FAG A;  3BB6 A;  4SLI A;  5ACA 2;  1VMH A;  4NHM A;  1NG0 A;  4MVT A;  1RIN A;  4QX2 A;  5LAS A;  1J3R A;  2RJK A;  3ALQ A;  1I5Z A;  3NKT A;  4XQ4 A;  3WQ1 A;  2WLP A;  2G1M A;  5KC6 A;  2VBP A;  3AP9 A;  5FYC A;  2HWD 3;  1EUT A;  3FFQ A;  4LK7 A;  1OKO A;  3NW4 A;  2Y26 A;  5HXV A;  3WW2 A;  1RUH 2;  4ZS2 A;  3U11 A;  2DCY A;  2VME A;  3U75 A;  2V4V A;  1O4Z A;  2LAL A;  1UL9 A;  2ADE A;  2HEY F;  5DUV A;  4COU A;  1HIX A;  1AJK A;  4ZPI A;  2BFU L;  3WUC A;  1KDM A;  4Q5O A;  4Z8B A;  4JCK A;  4EN0 A;  1MZ5 A;  2ADD A;  5CAD A;  2WII B;  1W6Q B;  3ZXG A;  1OF3 A;  4XVH A;  3KSC A;  1BBT 3;  3JBG 3;  2B42 B;  2NMO A;  2BVB A;  1QMJ A;  3I7D A;  4JRA A;  2WZP P;  1LOA A;  3O1P A;  1OA3 A;  2W1S A;  2F4P A;  3LFI A;  2ZZJ A;  3WP6 A;  5FUP A;  4URT A;  4BU2 A;  5EXO A;  2DTY A;  3T2O A;  1YXW A;  4OI2 A;  2JEM A;  3B7M A;  1OPO A;  5F39 A;  3ZLI A;  3PU3 A;  1LOG A;  1MZ6 A;  1JS9 A;  1NCQ B;  1PGS A;  2DDU A;  4Q4Y 1;  2WAB A;  4WVM A;  3AP5 A;  4EN6 B;  5L7O A;  4FTS A;  3DPR A;  1JI6 A;  1GNH A;  3LOI A;  4JDM A;  4JRL A;  2RR1 3;  1W39 A;  4XCB A;  1VRH 3;  3HWJ A;  1ULO A;  4IE7 A;  5FPU A;  4NN0 A;  4EJR A;  1HJG A;  1W2A X;  3W59 A;  4NHY A;  1CD3 G;  4XTM A;  3J7H A;  4LKD A;  4UFI A;  1Q43 A;  3AYA A;  5DAQ A;  5T55 A;  4DIQ A;  2UWB A;  4N90 A;  1ACC A;  4HXC A;  3WZ1 A;  5A1L A;  4AVB A;  2BFU S;  2BVV A;  2JJ6 A;  3OTF A;  2ZPX A;  5IVF A;  2WT2 A;  3I4I A;  1AR6 1;  3AYE A;  4XBQ A;  4RGA A;  2WIN B;  3RS6 A;  5FXZ A;  4XF9 A;  4Q4W 2;  4AHZ A;  2D43 A;  2EIG A;  2RS1 1;  3CNA A;  3KCX A;  4JHT A;  3UYJ A;  2JIJ A;  5FY8 A;  5GZG A;  3AK0 A;  1RUI 1;  4ZU5 A;  3ZSM A;  4HKO A;  4AGV A;  4QX7 A;  4QXB A;  1RUH 1;  5CKN A;  2BRT A;  2VOV A;  5CFC A;  1GMM A;  3VBO B;  1ULD A;  1XU2 A;  4XXP A;  2TBV A;  3H3Z A;  1AR9 2;  1GQG A;  3WT3 A;  4A2U A;  3PUI A;  4XYX A;  1LEN A;  3TEX A;  2RM2 2;  4Q4X 1;  2XJR A;  4MGQ A;  4AED B;  3H8X A;  1N1T A;  3BPZ A;  4BDV B;  1DYP A;  4WZC A;  2HWD 1;  2UY8 A;  1YIF A;  5GM0 A;  1QQP 1;  1OI6 A;  5J98 B;  4DO0 A;  1R08 1;  5JXH A;  4CP0 A;  1W6P A;  1DDL A;  3AP6 A;  5GZD A;  1CIW A;  1X8E A;  4D8M A;  1PK6 C;  3B94 A;  4JX0 A;  1TQ5 A;  2HEV F;  5ANQ A;  4HPK B;  4AVC A;  4FPY A;  3P6B A;  1RMU 1;  3Q8C A;  1CAV A;  2IXC A;  3LDB A;  2YGL A;  3JCI A;  4QX8 A;  1HN1 A;  2VBD A;  3R6S A;  3D8C A;  2YPJ A;  4UF0 B;  3M70 A;  2G4I A;  4GKY A;  3FHA A;  4JTO A;  3N9O A;  4PQ9 A;  1QJX 3;  1S55 A;  1OXC A;  4UAP A;  2PQQ A;  1Y3T A;  2VNG A;  1PHM A;  4F8A A;  3VBU A;  2BWC A;  5A3N A;  1GR3 A;  2UWA A;  2WO3 A;  1S0G A;  3D0S A;  5A7P A;  3PUA A;  3B02 A;  5K0U B;  1QOS A;  1TG7 A;  4IER A;  3R4D B;  4HSJ A;  5DG2 A;  1S0I A;  3H42 B;  3VDD B;  4XUN A;  4QXH A;  1RGS A;  2J1R A;  4UW5 A;  4Y1Z A;  2FZ1 A;  3CKH A;  1GOH A;  5FPV A;  1W3X A;  5KHJ A;  4CU9 A;  3VBF B;  5I8S A;  2EIB A;  3AMQ A;  4MYE A;  2X10 A;  1ZBE 1;  2D6M A;  3ECQ A;  1UU4 A;  2WA4 A;  5JIU A;  1HV0 A;  3LPG A;  5JR7 B;  1HXS 1;  2W91 A;  1I5P A;  2EAA A;  2HBT A;  1UOF A;  1PGW 2;  2JG9 C;  4LHS A;  3WDY A;  4YZ3 A;  2KA3 A;  3ILR A;  4LHN A;  5KHI A;  2R04 1;  2RS1 2;  4MGZ E;  1AR8 1;  3LOB A;  1VE0 A;  4IL7 A;  3AKP A;  4RFT 0;  5BNP B;  4A41 A;  4MET A;  5FIX A;  2RJL A;  1AR6 2;  1MS9 A;  5C9A C;  4BQW A;  4DZG A;  4CP2 A;  4R52 A;  4YVW A;  4LHL A;  2HWF 3;  3V56 A;  2E7T A;  4NWW A;  4FVV A;  4RA0 A;  4A44 A;  2I45 A;  5BNP A;  2WNU B;  3MW3 A;  5A7Q A;  4QPW A;  2YU2 A;  4QKD A;  3RNS A;  3MDP A;  4NO4 A;  4CDU B;  1H1I A;  2ZCW A;  4ZON A;  1ZBE 3;  1SLB A;  3CJX A;  1G6N A;  4L99 A;  3VZN A;  4KGG A;  3ZKY A;  2J22 A;  2ATF A;  2DUO A;  1JYC A;  1RUC 1;  2WO1 A;  3VHP A;  5FXX A;  4D7T A;  5A6Y A;  3MV1 1;  2VU9 A;  1NCQ C;  4Q4Y 3;  1ODM A;  2ZGU A;  4LBM A;  2D97 A;  4B7E A;  5EWS A;  2GC3 A;  4IEV A;  4BH9 A;  5I0D A;  2WNV B;  1V6M A;  3DEM A;  2BNO A;  2D6N A;  2A3Y A;  3RJ2 X;  3IMM A;  1AZD A;  1PK6 B;  1X7N A;  2WC2 A;  3MIE A;  5AVP A;  1IG0 A;  1ZYB A;  2P3J A;  4LPL A;  2QQP A;  1VAM A;  3RZZ A;  1PVC 2;  3O1V A;  3KMH A;  3OPT A;  4DOU A;  2A7A A;  2QQN A;  1MZE A;  4NAM A;  1K3I A;  1U0A A;  3TEZ A;  5C4W C;  2FDH A;  4OUE A;  1YHF A;  4JTN A;  5A3P A;  5IFT A;  4CCN A;  2O8Q A;  3OEA A;  4JKM A;  3UKN A;  4FQ4 A;  1ZZC A;  2QQU A;  5JSP A;  3ZPO A;  4DQA A;  3O14 A;  2WNU C;  3MGU A;  4NRP A;  5L7O B;  1B35 A;  2NMN A;  1WW4 A;  2ZTN A;  3ETQ A;  1X82 A;  3GDB A;  3PTY A;  4S2D A;  5F2S A;  3HNB M;  3WHU A;  4BOW A;  4CDX B;  4ERO A;  5FYM A;  2BOI A;  1XPW A;  1W0P A;  2WN3 A;  2XGX A;  5LEJ A;  3O1M A;  4QHZ A;  2LS6 A;  1AXY A;  4ONU A;  5FY1 A;  3OCP A;  5BNP C;  1SMV A;  3MYX A;  3T4V A;  5IK7 A;  1JZ7 A;  2JG9 B;  2VZ3 A;  2A1X A;  1RHI 3;  2W94 A;  1NUK A;  3FBY A;  4QX3 A;  5CFD B;  5E16 A;  4XJU A;  3J26 N;  3HQU A;  3ZDV A;  1W8O A;  1US3 A;  2GZW A;  3LEM A;  3WG2 A;  1F4H A;  2AUY A;  5DDJ 2;  5C5T A;  4FSJ A;  2JG9 A;  5FXV A;  3RG0 A;  2RR1 1;  2V5Y A;  2WSU A;  5F8P A;  4FTB A;  3LFM A;  3WG3 A;  1TZO A;  4LMF A;  3SIT A;  3POG A;  4Z07 A;  3I3B A;  5FZ1 A;  1ST8 A;  2ES3 A;  3DYP A;  4IEU A;  5GKA C;  2UYB A;  2ZHK A;  4NPM A;  3WG1 A;  3KS7 A;  3QD6 A;  2O8O A;  1JU4 A;  1H8T B;  1N47 A;  1HQL A;  4K21 A;  4XBN A;  5LBB A;  4MGI E;  1PVC 1;  3ZN5 A;  4BQ3 A;  2AEN A;  3K4D A;  5FJK A;  5A80 A;  1C3H A;  5JZG C;  1AXK A;  2RS3 1;  4OI1 A;  5BUV A;  5HCH A;  1NCR A;  1W06 A;  2HWB 2;  4BME A;  1WD3 A;  1DHK B;  4V2V A;  4JKL A;  2WBK A;  1ZRE A;  1PMH X;  1F15 A;  1C1L A;  3AC0 A;  2LW8 A;  1UIK A;  1KEX A;  1CJP A;  1GQP A;  1OD3 A;  1RXF A;  1SAC A;  2YB7 A;  3GJA A;  4LE3 A;  1S0C A;  2C1F A;  4QM9 A;  3SEE A;  3T0B A;  1US2 A;  2IC1 A;  5FZE A;  5H9S A;  4LLO A;  2D98 A;  2RV9 A;  5CZK A;  2GMM A;  5F2W A;  2VY0 A;  1CES A;  1YI9 A;  4CDX C;  1AYN 2;  1JUI A;  2WA3 A;  4C0B A;  2YXS A;  3W21 A;  3GAL A;  5KHK A;  1E5R A;  2WWU A;  1S0E A;  5E89 A;  2VOT A;  1EPZ A;  1H1M A;  1UKG A;  2CWM A;  2JIG A;  1N3Q A;  4H7M A;  2Z79 A;  4RS5 C;  4XFH A;  3HNY M;  1PIV 2;  3H8U A;  4UXA A;  2OQ6 A;  4YPJ A;  3OJB A;  2PAM A;  2W87 A;  2ZOE B;  5BPX A;  3VBF C;  1C5H A;  4E4D X;  1ENX A;  3I49 A;  4HG6 B;  3HN1 A;  1SG3 A;  1E5I A;  5E1R A;  5DQ0 A;  2Q1Z B;  4O7X A;  2D7F A;  5FYT A;  5JOZ A;  1WW6 A;  2BV4 A;  1ENQ A;  5H9Q A;  2CSG A;  1VBE 3;  3VDB A;  2AZ5 A;  4IDZ A;  1QH7 A;  3U4X A;  1PO2 2;  4AOC A;  2NLR A;  2JKX A;  4FXK B;  4LO5 B;  4FI9 A;  4C1W A;  1MZF A;  3HJR A;  4TWT A;  2ZJC A;  4XXA A;  4D7Y A;  3ZYF A;  3GF6 A;  2PN5 A;  1HXS 3;  4MG2 A;  5FMD A;  4Y26 A;  5FLH A;  5JUV A;  4Q1P A;  1DFQ A;  4LR4 A;  2Q8E A;  1HXS 2;  4B3N A;  4M3C A;  3UGF A;  3ZSJ A;  3GGL A;  2QQI A;  3ILF A;  1YFU A;  4R4X A;  4NII A;  4NIH A;  5FV3 A;  4XQD A;  5C4W B;  1OA2 A;  4BK5 A;  1MS4 A;  3LSD A;  2XJU A;  2OZJ A;  3B69 A;  1RUC 3;  5IVB A;  1MS1 A;  4WVZ A;  1CZS A;  3CIH A;  2DBI A;  3B01 A;  3VHO A;  4CTE A;  2BBV A;  3IT8 A;  4FFF A;  2JEN A;  4K20 A;  1QOT A;  4DUW A;  2W0X A;  3O1T A;  4CUB A;  3KWV A;  2R49 A;  3KVB A;  3GZU C;  5FRE A;  3TN9 1;  1QJY 3;  2WYF A;  3ZSK A;  1YWK A;  2ZX1 A;  4KG0 A;  3IDC B;  4Q4W 3;  1SHW B;  2C5D A;  2O1Q A;  3NL1 A;  4XFB A;  4XFG A;  4CXX A;  3NJX A;  2IXH A;  2AEZ A;  5DN2 A;  4TZD A;  1K5M A;  2VGD A;  4EN9 B;  2DFB A;  4L8Q A;  2D3S A;  1LHO A;  2W1W A;  4XDQ A;  3LEK A;  5T5L A;  3ZFG A;  1HQN A;  1ND2 C;  3TWI A;  4B4P A;  2BNN A;  1S2B A;  1NCR B;  1YFY A;  4XF4 A;  1UMZ A;  2WRA A;  1ENR A;  1NA1 C;  1IKQ A;  1NCQ A;  5FZF A;  3WQ0 A;  5E8A A;  1VBE 2;  4ZU4 A;  5AVA A;  5FYB A;  4EZ4 A;  2GNB A;  5FJH A;  3A7Q A;  3AP7 A;  3CQO A;  4F83 A;  4LOT A;  2P37 A;  1PNG A;  2XBO 3;  3BCW A;  4AI1 A;  1H30 A;  1GBG A;  4E2G A;  5IYY A;  4N43 C;  3RI8 A;  1VBD 2;  2XBO 2;  3ZXL A;  1RJ8 A;  2EVX A;  2MEV 3;  4HOO A;  2XLF A;  3IDB B;  2LRO A;  4ZXK A;  4CA9 A;  1RYY A;  2WNE A;  4GWJ A;  2DVA A;  3WW3 A;  3H50 A;  5B4X A;  1W2N A;  4LBK A;  3AZX A;  2D6L X;  2VTF A;  1CPN A;  4M00 A;  3T4H B;  1F5F A;  4ZKT B;  2BJS A;  3N9M A;  4YW3 A;  5JI7 A;  1UQX A;  4UBH A;  4YVW C;  1BMV 2;  3RPQ A;  4TN7 A;  5A1A A;  5JMC A;  1PZ8 A;  3OPW A;  1F5J A;  5HI0 A;  2FMY A;  1SBD A;  4LA3 A;  2Y38 A;  1F31 A;  1OUR A;  1J1T A;  2P4E A;  4D0Q A;  4BIO A;  4CEY C;  4AR2 A;  3GBF A;  1YO8 A;  2A70 A;  5CFC C;  2FCV A;  3U14 A;  5D8A A;  2VQU A;  3PUR A;  5A7W B;  2E53 A;  3D0J A;  4QX0 A;  3ZN4 A;  1KFX L;  3AP4 A;  3AB0 A;  3DEC A;  3OBR A;  4Q4Y 2;  5F5A A;  5EYX A;  1XNA A;  3V0A A;  3Q8A A;  1CN1 A;  4CUG A;  2YBP A;  5IK4 A;  2RVA A;  3MLJ A;  4OZX A;  4XUP A;  4GH4 C;  2FDI A;  5K4L A;  1Q5O A;  4I0B A;  4QT6 A;  3VBO C;  3F2Z A;  1S4C A;  2ARE A;  4L0P A;  2JDM A;  2G9G A;  3H8O A;  4B4Q A;  2B39 A;  4UWD A;  4PJY A;  2HWE 3;  3RDI A;  3VDA A;  2QQM A;  1K12 A;  1LHV A;  4NRO A;  1OLQ A;  2NM1 A;  4AEK A;  2XOM A;  3TNQ A;  1UMI A;  3WR0 A;  4IE6 A;  1D0H A;  3FFZ A;  4MLO A;  2GNM A;  5HXM A;  2BER A;  3WXP A;  2WZE A;  4OUM A;  4BA6 A;  2YFU A;  3MLL A;  1BVV A;  3SCH A;  3AMP A;  4KGQ A;  2VEC A;  2XDV A;  2Y6L A;  4FCA A;  4BMB A;  5KXE A;  3J7L A;  1SQ4 A;  3ATG A;  5FMC A;  5JWP A;  4U36 A;  5JVV A;  1ZBA 2;  2A6W A;  2VO5 A;  4P9X A;  3IPV B;  4DS0 A;  1NCR C;  2J1E A;  4GWN A;  2RS5 3;  3GBW A;  1KS4 A;  4XE9 A;  1DLC A;  4N9H A;  1S2E A;  3VZJ A;  1STM A;  3NNJ A;  1C28 A;  1KIT A;  3RMX A;  1V6J A;  2XHN A;  2Y6G A;  3VZL A;  1XYP A;  3HD8 B;  3ZYH A;  4IET A;  3ZYG A;  3ILN A;  2R07 3;  2Q8D A;  5C9A B;  1UD1 A;  4YRD A;  1KS5 A;  1HRI 3;  1WGP A;  5TSW A;  4GD4 A;  2W52 A;  4E2Q A;  2GDF A;  3ENR A;  4UFH A;  4X6Q B;  1FOD 2;  3ZM8 A;  1MPX A;  2PLV 2;  2OKX A;  4AXO A;  2VVF A;  2P1B A;  1F4A A;  1ND2 B;  5F6L B;  5FZM A;  2QE3 A;  4NID A;  3V0B A;  1UYZ A;  2HBU A;  1KXG A;  2IVJ A;  1VBC 2;  4QKF A;  4IV3 B;  1ZRI A;  2UY9 A;  2ZEW A;  2RE9 A;  3LDR A;  4UYB A;  3SKJ E;  4LO8 A;  4AG4 A;  4RFR B;  4AF9 A;  2DUQ A;  1QIQ A;  2JIC A;  5F37 A;  1MR5 A;  3S5Q A;  3BAL A;  3VZO A;  1OA4 A;  1Y9M A;  4HN0 A;  1W0O A;  1JTZ X;  2JDP A;  4LBJ A;  1E5H A;  3M2M A;  4FXG B;  3UV9 A;  3LDK A;  3MHZ A;  3OUJ A;  4GWI A;  2KD7 A;  1PO2 1;  2R06 3;  3MFA A;  3OD0 A;  3R05 A;  1GUI A;  4JDN A;  1R09 1;  4A6S A;  2ERF A;  3HT1 A;  5J1X A;  2VR4 A;  1DYO A;  2WNU A;  2E51 A;  2HWB 3;  1AYM 3;  3A4U A;  3OPZ A;  5HV0 A;  5DAV A;  4Q2F A;  1YJK A;  5CU1 A;  1FV2 A;  2RS5 2;  1LEM A;  2XR4 A;  1BJQ A;  3N9P A;  2XQX A;  3NV4 A;  4Q29 A;  5ANN A;  3BU0 A;  2VTX A;  1OLR A;  1N1V A;  1H2L A;  1UZW A;  4RD7 A;  4K1Y A;  1W6N A;  2G9Z A;  1NY7 2;  3UKT A;  5A3W A;  1AYN 1;  5JXI A;  1H1A A;  3FWE A;  3WW4 A;  3E6C C;  2FDK A;  5EP9 A;  4UF0 A;  4KWJ A;  1YYN A;  3WF0 A;  3IKW A;  1QWR A;  2VW0 A;  2B5H A;  4ARX A;  2WFP A;  3OUI A;  2RS5 1;  2BEO A;  4IND A;  3ZXJ A;  2R04 3;  3K51 A;  1LGC A;  2PA7 A;  1SFN A;  1Z7S 1;  2GSY A;  4FPF A;  4FPJ A;  4M0H A;  2Z4F A;  4GB3 1;  5F3C A;  2D5H A;  2J1U A;  2A6Z A;  1WUV A;  4WM7 B;  2B8M A;  3K75 B;  1PO1 3;  4FPE A;  3BIE A;  4LT5 A;  2MPF A;  1XNC A;  1U12 A;  1UOJ A;  3VZK A;  1YFX A;  5FP9 A;  4QHO A;  1SFY A;  4W6Y A;  2Y6J A;  1UOB A;  3NJZ A;  1W28 A;  3K48 A;  3PVO A;  2IXJ A;  4BLJ A;  1ZZ8 A;  3C3V A;  3NST A;  4RHV 3;  1Y9Q A;  1WCD J;  4MO3 M;  5A6Q A;  4RR3 C;  1AYM 2;  5FZ6 A;  5A7S A;  4AEM A;  2DCJ A;  1IQD C;  3J9S A;  4YLZ A;  1NQJ A;  1KGY A;  1UIJ A;  3LIG A;  2OVU A;  5FZI A;  1JYW A;  1C8M 3;  2PMW B;  4COY A;  1ENS A;  4FFG A;  1VRB A;  4KBZ A;  2QUO A;  4LIV A;  5FFO C;  5FPL A;  4Y1Y A;  4CP9 A;  2O0O A;  4LOR A;  1O7F A;  3A22 A;  4AED C;  1EP0 A;  2TUN A;  4ZS3 A;  1G9F A;  3G7D A;  1UY1 A;  4QKB A;  1VB4 A;  5FY0 A;  2P3Y A;  4TTG A;  2B9V A;  4WM8 A;  3E1F 1;  1REF A;  3WLU A;  3O12 A;  1AJO A;  4IEX A;  1HB1 A;  3WEZ A;  1QJU 2;  3HBZ A;  3LPF A;  3WDX A;  3IBM A;  4IGO A;  4G9S B;  4N8M A;  5KXB A;  2VH9 A;  2P3K A;  3APB A;  5FQ0 B;  4B7K A;  1MAC A;  4PDW C;  4CEW A;  4E9K A;  1W99 A;  4J1W A;  1C8M 2;  1ND3 A;  3SC7 X;  2XKO A;  3T2Q A;  1A8D A;  5DAW A;  4CU8 A;  1IPJ A;  4XHB A;  1VLN A;  4DPN A;  5BNO B;  1HJF A;  1SLI A;  4MXW A;  4IGQ A;  2VNR A;  3ZIW A;  1UPI A;  2HH9 A;  4YAR A;  3GCW A;  2JX9 A;  3P1I A;  3OGJ A;  2BWA A;  2IXI A;  4R4Z A;  4CYD A;  4FAH A;  1HRI 1;  4NHL A;  2Q5T A;  2R07 1;  4PQQ A;  1SDW A;  1UY4 A;  2BW8 A;  2X29 A;  2Q0A A;  2VCA A;  2DFC A;  4Q0Q A;  4B1M A;  4C90 A;  2BGC A;  2FDG A;  1NYW A;  2PHT A;  3FZ3 A;  3A23 A;  1EV1 1;  1ZRD A;  3TYJ A;  5JI9 A;  2XJQ A;  4CP9 B;  2TEP A;  4LLF A;  3WG4 A;  1U5X A;  5EQU A;  2Q1M A;  1RUF 2;  2W92 A;  2PHW A;  2KM2 A;  5T5O A;  2A71 A;  2VMD A;  1J83 A;  2D93 A;  1LED A;  3OSD A;  3N9N A;  1HV1 A;  4CDQ C;  2OUJ A;  4LBQ B;  3BUC A;  2QQL A;  4XBL A;  1T6B X;  3WP4 A;  3OF1 A;  3WSO A;  5F7U A;  1WCS A;  1ZRR A;  3QH7 A;  4WZF A;  1X9P A;  4D6Q A;  1Y7B A;  1BMV 1;  4OI0 A;  2JWP A;  5C6C A;  2VQT A;  1LEC A;  1LOB A;  1LOD A;  1GSL A;  1COV 3;  3ES4 A;  3HOB A;  4I0W B;  1D2S A;  4CDW A;  3VKO A;  4XTP A;  2VD7 A;  5J3U A;  1JZ3 A;  1UZ0 A;  1PX3 A;  5G04 L;  1PGL 1;  3S57 A;  3E6B A;  2ARX A;  1RUE 2;  1HLC A;  2KXL A;  5C4W A;  4MGY E;  2XBO 1;  3TBD A;  1D0G A;  2DCT A;  1O91 A;  2JDU A;  4IE5 A;  4M3C B;  4Y4R A;  4YW1 A;  3WQ7 A;  3WX5 A;  5GLZ A;  2C9K A;  1WLW A;  4GUL A;  4YW5 A;  5GZE A;  1GYK A;  2MHF A;  4DB5 A;  1R09 2;  3BTZ A;  5KXD A;  4D3W A;  4G4F A;  5I0R A;  2VMF A;  2DVF A;  3ZMN A;  1F35 A;  1VBE 1;  3CJI C;  3BN6 A;  3I3D A;  3AFK A;  1MQT C;  3H7Y A;  2BTV C;  3FUQ A;  3HR9 A;  3PIG A;  5JZG B;  3GZT B;  1CJD A;  1H2K A;  2VAU A;  3NKG A;  4R9C A;  1HB3 A;  1H0B A;  3RJR A;  2AR6 A;  2HEW F;  2XHK A;  1WLC A;  3HN3 A;  1GP6 A;  1VIW B;  4K1Z A;  3TRS B;  4AQS A;  2ET7 A;  3VDC A;  3D4K A;  5I8Y A;  4Z82 A;  1XXN A;  5ABJ B;  1LES A;  1DZR A;  5ACA 1;  3BGA A;  4JDO A;  1W2T A;  3WDT A;  4D6R A;  1FOD 1;  2X53 S;  1WA6 X;  3VL8 A;  3UL2 A;  3RZG A;  1ZX5 A;  4CDQ A;  5EFU A;  3LWC A;  1I3H A;  4LE4 A;  2XLG A;  2AH2 A;  2PFW A;  3KT7 A;  1VMF A;  1RUG 2;  4FOW A;  1VAK A;  2A3W A;  1SCR A;  1W3V A;  3MF6 A;  3PU8 A;  4OI4 A;  4QAW A;  3T08 A;  3DGT A;  2CGN A;  3ZN6 B;  5FBJ A;  4B29 A;  4DXT A;  4AFC A;  4L11 A;  1W2U A;  2ZZQ A;  4UFL A;  3BKZ A;  2MNG A;  3U0Z A;  4QQH A;  2E6V A;  3D5O A;  1K42 A;  2VMG A;  2VW1 A;  2HWC 1;  1A78 A;  4HKW A;  1RC6 A;  3VD9 A;  3U37 A;  2P34 A;  1BEV 2;  5FUN A;  4YW7 A;  5FZ8 A;  4B4R A;  3AMN A;  2CGO A;  1JUH A;  3DKQ A;  3PVE A;  5FPB A;  2Q8C A;  3AKQ A;  3S0M A;  4LUL A;  3RZJ A;  2F17 A;  1QGL A;  2ZEZ A;  4QD2 A;  2R7E B;  3WNN A;  4N53 A;  4DUV A;  2V09 A;  4N43 A;  4BQ2 A;  3UGG A;  2YYO A;  2JDK A;  2WN2 A;  4IEW A;  3ACF A;  4J25 A;  2XJS A;  3WOG A;  3USU B;  5FZD A;  3GXU A;  5FZL A;  1F8V A;  1LHW A;  5IWF A;  1NXD 1;  4PDW A;  4CP1 A;  2OA2 A;  3OGS A;  1GNY A;  1NOV A;  2CV6 A;  2VZS A;  2WS9 3;  2QVS B;  3MID A;  4AVV A;  4DIN B;  1JZ4 A;  4UFM A;  1SZB A;  5FYY A;  1ULP A;  3NV2 A;  3WV6 A;  2B45 X;  4QB1 A;  1BEV 3;  4LIU A;  3S5A A;  1RUJ 2;  1ZM1 A;  2GN7 A;  5JPN B;  4XAA A;  1WMF A;  2C4X A;  1O3S A;  4DXS A;  3BTX A;  3T3Y A;  4KI5 M;  4M4R A;  3LKJ A;  3LE0 A;  4OHW A;  2ORX A;  4H14 A;  3NAP B;  1R09 3;  2BYV E;  2OYZ A;  3VBS A;  4BCU A;  3WF4 A;  4D69 A;  1FXZ A;  4PI0 A;  1W6O A;  4QU2 A;  1ALY A;  3EQE A;  3EO6 A;  4MOA A;  1R1A 1;  1ZBA 3;  5EZW A;  5F32 A;  1V6N A;  3RRD A;  5FDB A;  3AYD A;  4C91 A;  3M7A A;  1FYU A;  1FI2 A;  2CY6 A;  2I74 A;  1IS4 A;  2JDZ A;  2HWC 3;  2ZGM A;  5ABJ C;  2OXB A;  4PBO A;  1KRI A;  2ZX4 A;  2YGM A;  3PTR B;  4YFW A;  1DQ6 A;  4XMA A;  3MEP A;  4L97 A;  4UBG A;  4XCA A;  4CCC A;  3JQW A;  4Q1R A;  3EJK A;  4XET A;  3E5Q A;  1TMF 2;  2Z69 A;  2GAL A;  4CEY B;  2H0V A;  1HRI 2;  1FV3 A;  1Q3E A;  5DAB A;  2RR1 2;  4RQP C;  1VRH 2;  1RIR A;  5DDJ 1;  4F3J A;  4QGM A;  4LUM A;  1ZZ9 A;  2VNO A;  3TNP B;  3L9J T;  1TEI A;  1VBD 1;  1VAV A;  2AEY A;  1DZQ A;  2E32 A;  4H3W A;  1WW7 A;  4YVW B;  1C4R A;  3KCC A;  4Y22 B;  2E7Q A;  1QJU 3;  3NNM A;  3IAP A;  2RM2 3;  2EAL A;  4E8D A;  3AKR A;  5KC5 A;  2HWF 2;  4ASL A;  3OYW A;  5C3Q A;  3C7H A;  5T5J A;  5CFD C;  1O4Y A;  5A7N A;  3III A;  4I02 A;  4HVQ A;  1LOC A;  3AKT A;  3CO2 A;  2C6S A;  3FLT A;  4JGY C;  5C3O A;  3NRU A;  4J6G A;  1N1S A;  4MZU A;  1OOP A;  4BK4 A;  5DUU A;  2A6X A;  3AXE A;  1QJU 1;  3AJY A;  3C7E A;  3OGV A;  3QLQ A;  5F3G A;  3H8R A;  3SEP A;  4IGP A;  1MEC 3;  2PAK A;  3OEB A;  3M4F A;  3M3O A;  5FKB A;  5FP7 A;  5A6Z A;  2ZAH A;  4OVE A;  1W04 A;  2ZGK A;  2D44 A;  3JB4 C;  5EJ3 A;  5I8T A;  3ZYB A;  4OLL A;  3TN9 2;  4Y33 A;  1NXM A;  1S0B A;  1WWY A;  4MGT A;  1X50 A;  1UOG A;  1BVP 1;  2QQV A;  5KBF A;  5CYY A;  5DAP A;  4KWU A;  5BXX A;  1RTV A;  1NA1 A;  3KZ4 C;  4CDQ B;  3WF1 A;  1N3O A;  3INA A;  1H8V A;  2IWG B;  3CHX A;  3ZFE B;  2WFF 2;  5FZO A;  3ZPY A;  1CPM A;  4CXY A;  1D4M 2;  3WY6 A;  3NNL A;  2ZGN A;  5FP8 A;  2WZR 3;  4QQ2 A;  3NQH A;  1EUU A;  2K46 A;  5LY1 A;  1AX1 A;  1RUE 3;  1W2O A;  3CZU A;  1R1A 3;  4PI2 A;  2VMH A;  3KHC A;  5A3O A;  1ASJ 1;  1SDD B;  1M06 G;  4KL1 A;  4GJZ A;  1DLL A;  4XUT A;  4QPG A;  1OPM A;  1YQ2 A;  5FZ4 A;  4C0H A;  5BNN C;  3LEI A;  3R4S A;  1RMU 3;  3RYR A;  3M1H A;  5FWJ A;  2ZGT A;  2WT1 A;  3WNK A;  4V1P A;  4TLG A;  4W8J A;  2FDJ A;  1XB9 A;  3J8F 3;  4AEJ A;  4XEZ A;  1IOA A;  1GQH A;  4BXS V;  5LEK A;  2B46 X;  2VBB A;  1V00 A;  3ZFF C;  1BYH A;  3MPP G;  4AI9 A;  4Z1V A;  4XFA A;  1FMD 2;  1B35 B;  2ZAA A;  4GB3 2;  5JSR A;  1ZRC A;  2GC0 A;  2JDA A;  5JR2 A;  3POF A;  3U78 A;  3WNO A;  2YBK A;  3ZOI A;  5C3P A;  4OZO A;  2RMU 1;  3SXW A;  5IFP A;  2WQZ C;  3B93 A;  3NVC A;  5F5Q A;  1X33 A;  5J48 A;  1PZ7 A;  4S2H A;  1GOG A;  4COV A;  2BDR A;  3BPS A;  4YZ2 A;  2OQ7 A;  1UMH A;  2PQS A;  1DQ2 A;  1D7P M;  2WJS A;  5E88 A;  1COV 1;  4DNY A;  5C33 A;  3T1L A;  4QQP A;  4AHX A;  1GZW A;  4F7Z A;  4GWM A;  1BBT 2;  3JBG 2;  2DUR A;  1G9D A;  3E97 A;  4DEV A;  1NY7 1;  1JHJ A;  2A75 A;  1GFF 2;  2HJI A;  1QQP 3;  1H2N A;  1SBE A;  3K4A A;  1JOP A;  3OBT A;  4QB2 A;  5LY2 A;  2R04 2;  3B9I A;  4JGY B;  1PO1 1;  4B1L A;  2Y6F A;  3TAY A;  2VMC A;  2WNO A;  5H9R A;  1B09 A;  1JU3 A;  3USU A;  3VV1 A;  1WME A;  3VBS B;  3L2H A;  3E5U A;  4GB3 3;  3DYM A;  5EV7 A;  4XAB A;  1K5M C;  1RUD 1;  4WM8 B;  5FPA A;  2X05 A;  2K9Z A;  4RS5 A;  1CIY A;  1RUH 3;  4XAC A;  4XW3 A;  5T3N A;  4YM2 A;  5LA9 A;  3GM8 A;  2LRP A;  2VUC A;  2RDQ A;  3ASI A;  3PNA A;  3RZK A;  1AR9 3;  4MXW B;  3I2F A;  4P08 A;  4E27 A;  3FE5 A;  2R30 A;  5FRA A;  3AL5 A;  4LNV A;  4ISQ A;  3O0W A;  4QM8 A;  1ND3 B;  1V9U 1;  2PLV 3;  2XL9 A;  2OII A;  1CAX B;  4AFA A;  2AYH A;  1NE6 A;  2XVK A;  5DDJ 3;  1XQN A;  1CON A;  1H8T C;  2JG8 C;  5FZG A;  2ZMK A;  1OQE A;  1Q8O A;  2A6V A;  1WD4 A;  3POY A;  3DYO A;  3O1S A;  3FLR A;  4DXR A;  4MX3 A;  2QCS B;  2VUA A;  3ACL A;  1VPH A;  1LHN A;  2DU1 A;  1IS3 A;  2DU0 A;  2W2I A;  3POS A;  2E26 A;  2YZ4 A;  4E4Z A;  5JOW A;  3H1M A;  3MI8 A;  4YVS C;  1KDK A;  5FOJ B;  5IUQ A;  1UW8 A;  5FTT C;  4EWD A;  2G19 A;  2VXR A;  1FAY A;  1VMJ A;  2A3X A;  4JGZ B;  5FP4 A;  3WCR A;  2ZAB A;  3VBR A;  3BOD A;  4A7K A;  2QQO A;  1QQP 2;  1HB2 A;  3KV4 A;  5FMO S;  1DBN A;  5FKC A;  4CXW A;  3PL0 A;  2BOJ A;  1C8N A;  3I2K A;  3K77 A;  1CX1 A;  3I59 A;  1DQ0 A;  3WF2 A;  1XSQ A;  3I54 A;  3ZYP A;  1DGR A;  3V64 A;  1OUX A;  1V70 A;  2VTX J;  2R16 A;  2YMZ A;  3LA2 A;  4XZP A;  1P8J A;  2P3I A;  2IFW A;  3H1W A;  3EXU A;  3I8T A;  4O61 A;  5T52 A;  2DYC A;  1O8S A;  3VZM A;  4A4A A;  1ZRF A;  5FK8 A;  5CIS A;  2SLI A;  2WLQ A;  1HRV 3;  4NRQ A;  4Q26 A;  2JDH A;  4FPG A;  5C3S A;  5I0U A;  3I2G A;  2BPA 2;  1TVG A;  1DGL A;  1VB2 A;  1XNT A;  3FLP A;  4IQP A;  1F2N A;  1HQW A;  5A3T A;  4C8D A;  1A34 A;  2K0G A;  1UU6 A;  3TN9 3;  3O0V A;  2FCT A;  4BE3 A;  4U2A A;  1QJZ A;  4KH9 A;  1GP4 A;  3W9A A;  5B2G B;  5B4N A;  5ISL A;  1SLL A;  1W03 A;  5BYN A;  1ND3 C;  5HPO A;  2YDE A;  3BTY A;  4XJ8 A;  1EAH 1;  1X36 A;  2IZW A;  1O3R A;  1Z78 A;  2WS9 2;  4Y1X A;  5DZF A;  1ODN A;  4CRQ A;  1TE1 B;  4FOV A;  5JZG A;  5IVC A;  4NUB A;  3LA3 A;  4S2F A;  4O9E A;  4PLM A;  4AYU A;  4CCO A;  1XBF A;  4MH0 E;  4ASK A;  5FYS A;  1W8N A;  1LGN A;  1UPS A;  2PHU A;  2PYT A;  2Y6H A;  2JE7 A;  3PHM A;  1K5M B;  2ORZ A;  3Q8F A;  4QXK A;  4I09 A;  4Q4X 3;  4WM8 C;  5A7O A;  3THT A;  2AGS A;  4ASM B;  3H0O A;  1AL2 1;  1VP6 A;  1CVN A;  2DBN A;  2EID A;  3POW A;  5C8C B;  5FO8 B;  2VE1 A;  4HAN A;  4FTE A;  3W5M A;  1CAW A;  5LWB A;  1I9R A;  3OYW B;  4AVA A;  3ZN6 A;  5IK8 A;  1GWL A;  1SLC A;  3ZFE A;  1GZC A;  4XIO A;  2O14 A;  1UN1 A;  2ENR A;  5IAX A;  2W39 A;  3Q8B A;  2N7G A;  3LIH A;  4H55 A;  4QPI C;  4R9A A;  3DN7 A;  2R0F A;  2JKB A;  1O5L A;  1TMF 3;  3VBR C;  5J96 B;  1URX A;  1QNW A;  3C2U A;  1HRV 2;  3NNG A;  1GIC A;  1OUS A;  1LU2 A;  4IE0 A;  3N7M A;  4QDQ A;  1QXR A;  4IV1 B;  3MIF A;  4YM3 A;  5FPX A;  2YUE A;  2WZR 2;  4E2S A;  5AC9 2;  2XVG A;  4XFC A;  1WZX A;  3P5B A;  3VD5 A;  3S7E A;  1GWK A;  5FMO L;  5FMB A;  2X09 A;  3HPN A;  3ZFG B;  4YVS B;  2QQW A;  1DCS A;  4M3C F;  4NR1 A;  3U10 A;  3ETP A;  4JZR A;  5A70 A;  1V6K A;  1L7R A;  3FBM A;  4AQ2 A;  2VL4 A;  1ULF A;  2FMD A;  3OBA A;  4IV3 A;  4SBV A;  5IVJ A;  4NJ4 A;  1CZV A;  1ASJ 3;  2JG8 B;  1PO2 3;  2R06 1;  3SCF A;  5SV8 A;  4CPB A;  5A3L A;  5LZ6 A;  5FYZ A;  4UT5 A;  4TLF A;  5JSO A;  2XON A;  2WT0 A;  3I3Q A;  5F9T A;  3AYC A;  1LR5 A;  4OCT A;  3R0R A;  5K0U A;  3OY8 B;  1T2X A;  3UJO A;  2RG4 A;  1W0N A;  2P2K A;  3DKW A;  1RUG 3;  5DAX A;  4FPH A;  4Q0U A;  1QJE A;  2GC1 A;  5FLI A;  4LJH A;  2ID4 A;  3NJV A;  1PX4 A;  1V9U 2;  4CVU A;  3ORJ A;  4RSU A;  1PMI A;  2QQK A;  3ACI A;  4Z2A A;  3PJY A;  2G9F A;  1R08 2;  2ZA9 A;  1HW5 A;  1UX6 A;  1GZT A;  2YY1 A;  4CUA A;  2JD9 A;  4KG8 A;  4ZXE A;  4Z92 B;  1UZZ A;  1UU5 A;  1OFN A;  2WNV A;  2OPK A;  2VZU A;  3VGI A;  3ZSE A;  4NVP A;  4PF1 A;  5CG8 A;  3KV6 A;  5FZA A;  2FQP A;  3ZYJ B;  3F95 A;  1GKB A;  2WKK A;  2YV8 A;  1GP5 A;  2JB8 A;  1R1Z A;  2HYK A;  2SBA A;  4A3X A;  4A7Y A;  2ZEX A;  4OQ8 A;  4BIS A;  2VMI A;  2J1T A;  1RUI 2;  2W08 A;  5AC9 1;  3HQR A;  1EAH 3;  1HN0 A;  4DMI A;  5C5U A;  1K5J A;  3HBK A;  1AVB A;  4HVR A;  4L2N A;  4Q4W 1;  1BQP A;  1FNY A;  3HMY A;  1WMD A;  2DVB A;  1VR3 A;  3NWK A;  4JGY A;  4X8N A;  4CCE A;  4D7S A;  3BIW E;  4XHX A;  4AZZ A;  1RHI 1;  1IHM A;  5L73 A;  3SMH A;  2XUM A; 
#chains in the Genus database with same CATH homology
 1GOF A;  1OF4 A;  1W9S A;  2VCB A;  4A44 A;  2L9L A;  4QPW A;  2W92 A;  3WQB A;  4GZ9 A;  2VMD A;  1J83 A;  2B4K A;  2QQJ A;  2QQL A;  2E33 A;  4MGS A;  3JXS A;  4W4Z A;  2J22 A;  3WSO A;  3FN9 A;  4OYU A;  5F7U A;  2WO1 A;  3MV1 1;  5EIY B;  4DUX A;  4XUO A;  2VQT A;  3HOB A;  2W95 A;  1JZ3 A;  1UZ0 A;  1PX3 A;  5G04 L;  5LA2 A;  3WNM A;  2BGP A;  1BHG A;  4LPL A;  2C9K A;  4M4P A;  4RN5 A;  2VMF A;  2QQN A;  1K3I A;  3BN6 A;  3I3D A;  2E31 A;  1WCQ A;  4OUE A;  5IFT A;  2W1U A;  3OG2 A;  3WNL A;  4A6O A;  3HN3 A;  3OEA A;  4PT6 A;  3VDC A;  4JKM A;  2VJX A;  4A42 A;  2VCC A;  3GDB A;  2W5F A;  3BGA A;  3FHQ A;  4AAX A;  3HNB M;  4KMQ A;  1XC6 A;  1XPW A;  4W50 A;  2WN3 A;  3C7G A;  2BBA A;  2LS6 A;  1OT5 A;  2CDP A;  4QAW A;  3T08 A;  1JYN A;  3VD7 A;  4DXT A;  4ZZ8 A;  3ABZ A;  1JZ7 A;  2VZ3 A;  2W94 A;  1NUK A;  4QX3 A;  1K42 A;  5JXG A;  3LQC A;  4ET7 A;  1W8O A;  1US3 A;  3SKV A;  3U37 A;  3WNP A;  3VD9 A;  1F4H A;  2Y6K A;  1UYY A;  4P5Y A;  3CDZ B;  2VM9 A;  2QBX A;  2ZEZ A;  1JZ2 A;  2R7E B;  3I3B A;  3WNN A;  3DYP A;  4DUV A;  3MBW A;  1JZ5 A;  1JU4 A;  2WN2 A;  3ACF A;  1R64 A;  3GXU A;  3K4D A;  2RJ2 A;  1UWW A;  2EIE A;  2Y8K A;  3C7F A;  2BGO A;  3CMG A;  2Y64 A;  4JKL A;  2WBK A;  2VZS A;  3AC0 A;  1GNY A;  1PMH X;  3OGS A;  2LW8 A;  1JZ4 A;  1KEX A;  3OGR A;  1GQP A;  1OD3 A;  1ULP A;  2W9X A;  1UXZ A;  2YB7 A;  3SEE A;  3T0B A;  4QB1 A;  1JYV A;  1US2 A;  2J1S A;  2RV9 A;  5CZK A;  3THC A;  2C4X A;  4DXS A;  4KI5 M;  4M4R A;  4E8C A;  3LE0 A;  3OB8 A;  2ORX A;  2VOT A;  1UY0 A;  4YPJ A;  2BZD A;  3HNY M;  3WF4 A;  5EJ1 B;  2W87 A;  4MOA A;  4LKS A;  5C7G A;  4HG6 B;  2VZR A;  1SG3 A;  5DQ0 A;  2WQ8 A;  3MUZ 1;  2VC9 A;  3VDB A;  3LEG A;  2V5D A;  2JKX A;  2V72 A;  1CZT A;  4FI9 A;  3HJR A;  1UY2 A;  1UXX X;  4ZY9 A;  3MUY 1;  5JUV A;  3I2I A;  2WAA A;  3GGL A;  2QQI A;  4P00 B;  2E32 A;  4BK5 A;  4A3Z A;  2DCK A;  2WAO A;  3IAP A;  1CZS A;  3CIH A;  4E8D A;  1WKY A;  3C7H A;  3III A;  3IB3 A;  1GU3 A;  4DUW A;  5FUI A;  3NRU A;  2C26 A;  4CUB A;  4BK4 A;  2W46 A;  3HEI A;  3C7E A;  4OMC A;  3OGV A;  3SEP A;  1SHW B;  4XUQ A;  5IHR A;  4P02 B;  3OEB A;  4QB6 A;  3C8X A;  3NJX A;  1NAE A;  2VZQ A;  3EYP A;  5DN2 A;  2J7M A;  2W47 A;  3A21 A;  2W1W A;  3LEK A;  2YC4 A;  5LA0 A;  5CYY A;  3T0D A;  4KWU A;  5LCW L;  5EJZ B;  3WF1 A;  2WYS A;  3HNM A;  3W5N A;  5G05 L;  3IDA A;  3A7Q A;  3CQO A;  3VD3 A;  2JE8 A;  3NQH A;  1EUU A;  5IYY A;  2HLE A;  3CZU A;  3ACH A;  2CDO A;  3VD4 A;  3I3E A;  1SDD B;  4XUT A;  1RYY A;  4GWJ A;  1YQ2 A;  2ZXQ A;  5B4X A;  3THD A;  3LEI A;  2VTF A;  4RYD A;  4UI9 L;  3T09 A;  3WNK A;  4W8J A;  1JZ8 A;  1JZ6 A;  4XUR A;  5C71 A;  4CU7 A;  5A1A A;  4IUG A;  4BXS V;  4JHZ A;  2J1A A;  3PUH A;  4LQR A;  2WO2 A;  2JDA A;  5JR2 A;  3WNO A;  4D0Q A;  1O8P A;  4OZO A;  5IFP A;  1J84 A;  2YFZ A;  1GOG A;  1UMH A;  2PQS A;  1D7P M;  2VQU A;  2VZ1 A;  4QX0 A;  3DEC A;  4DEV A;  5IJR A;  4ZZ5 A;  1JHJ A;  1XNA A;  3K4A A;  2RVA A;  4QB2 A;  4XUP A;  1UX7 A;  2VMC A;  1JU3 A;  3F2Z A;  4L0P A;  3DYM A;  2X05 A;  3VDA A;  2QQM A;  1K12 A;  1CIY A;  2XOM A;  1UMI A;  5HXM A;  3GM8 A;  3UNP A;  1O59 A;  2BER A;  2WZE A;  3I2F A;  4P08 A;  2YFU A;  4A45 A;  2Y6L A;  1PMJ X;  5C70 A;  2VO5 A;  2J1V A;  1UY3 A;  2J1E A;  2VZV A;  1DLC A;  3DYO A;  3ACG A;  4DXR A;  1H6Y A;  2XHN A;  2Y6G A;  4XZU G;  1L7Q A;  2E26 A;  5LA1 A;  2EIC A;  1MPX A;  3CZJ A;  2QQO A;  2OKX A;  5I0D A;  1F4A A;  3I2K A;  3EB7 A;  4QX2 A;  3K77 A;  1CX1 A;  3WF2 A;  1UYZ A;  4UOJ A;  2ZEW A;  2W1Q A;  4AG4 A;  1EUT A;  3SKJ E;  1P8J A;  1O8S A;  4A4A A;  2VME A;  2V4V A;  4JKK A;  4GWI A;  2KD7 A;  3I2G A;  1GUI A;  1TVG A;  1XNT A;  3I2H A;  1DP0 A;  2VZO A;  5J1X A;  2VR4 A;  4OMD A;  5B4N A;  1DYO A;  1OF3 A;  5HPO A;  4XVH A;  3UET A;  3ZM8 A;  2W1S A;  2XQX A;  2ZEY A;  3K4Z A;  3T2O A;  1W8N A;  2Y6H A;  3UES A;  2YC2 A;  5JXI A;  2DDU A;  2ORZ A;  2WAB A;  3T2P A;  4CUC A;  1JI6 A;  3WF0 A;  4ARX A;  2EID A;  1ULO A;  5DPN A;  1H6X A;  3W5M A;  3D3A A;  3I2J A;  3J7H A;  2YG0 A;  1LNS A;  2VZT A;  1W9W A;  1NX9 A;  2Z4F A;  2J1U A;  3K75 B;  4QDR A;  3NNG A;  4QDQ A;  2WZ8 A;  2HYX A;  4DEQ A;  2Y6J A;  3VD5 A;  4MAD A;  1GMM A;  1JYX A;  2X09 A;  3HPN A;  4MO3 M;  5DMY A;  2VZP A;  3PUI A;  2DCJ A;  1IQD C;  3ETP A;  2W3J A;  3FL7 A;  4MGQ A;  4BDV B;  1KGY A;  1L7R A;  2VL4 A;  3OBA A;  1JYW A;  4ARY A;  5JXH A;  3MO4 A;  1CZV A;  1OH4 A;  3WF3 A;  4D8M A;  4JX0 A;  3K46 A;  3P6B A;  2XON A;  3A22 A;  1W9T A;  1HN1 A;  3I97 A;  3C7O A;  1UY1 A;  3FHA A;  4TTG A;  2B9V A;  4CU6 A;  3E1F 1;  1T2X A;  4TXW A;  1W0N A;  4UAP A;  3WEZ A;  2WUH A;  3LPF A;  4QDS A;  3IAQ A;  2ID4 A;  3NJV A;  1PX4 A;  2WO3 A;  4CVU A;  5JXJ A;  3MV0 1;  1TG7 A;  2QQK A;  3ACI A;  4Z2A A;  4BJ0 A;  5JMO A;  4XUN A;  1W99 A;  4CUA A;  2JD9 A;  2J1R A;  4ZXE A;  3T2Q A;  3CKH A;  1GOH A;  2VZU A;  4PF1 A;  4CU8 A;  3T0A A;  4CU9 A;  2EIB A;  2X10 A;  4QX1 A;  3ECQ A;  3LPG A;  2W91 A;  1NKG A;  1I5P A;  2ZEX A;  3P1I A;  2J1T A;  1UYX A;  4LHS A;  1K45 A;  2WDB A;  4PQQ A;  1UY4 A;  4A41 A;  2VCA A;  3A23 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...