4P5YA

Structure of cbm32-3 from a family 31 glycoside hydrolase from clostridium perfringens in complex with n-acetylgalactosamine
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
157
structure length
157
Chain Sequence
LYKKAGSEFALDSSKLEAIYATSEADRDYKENAVDGDENTIWHSAYQAADKLPVSITIKLDKAYDLNQIDYLPRQNSRNGHVTEYKIETSLDNENWTEVRTGNLEVNEAGNALANRGYNPIRFNTINAQYLRFTALKTLGDTNNKYASAAELVFYGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycosyl hydrolase, family 31/fibronectin type III domain pr
publication title Diverse modes of galacto-specific carbohydrate recognition by a family 31 glycoside hydrolase from Clostridium perfringens.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Sugar binding protein
total genus 37
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2014-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4p5yA00
3VDCA 4CVUA 5C71A 1UWWA 3PUIA 1YQ2A 5G05L 3K75B 4CUBA 1WCQA 2YG0A 3HJRA 1KEXA 2WO2A 4JHZA 5A1AA 2VZSA 2VJXA 4HG6B 2J1TA 1CIYA 2VOTA 2ZEZA 1W8NA 1NUKA 3GGLA 5EIYB 2WO1A 1F4HA 2CDPA 3CMGA 4DXRA 3EB7A 3T2PA 5DN2A 4QX3A 5LA0A 3CZJA 3DECA 1PMHX 3FHAA 2VZ3A 4BDVB 2JKXA 3A7QA 1JZ8A 2VZOA 2WQ8A 2X10A 3ACIA 2YFUA 3WF0A 3W5NA 3HOBA 4XUQA 4RN5A 3CKHA 1J83A 3ACHA 1CX1A 5DPNA 2Y6GA 1OF4A 1D7PM 5EJZB 5CYYA 2W91A 4OYUA 2B4KA 1US2A 1SG3A 4XUTA 3DYOA 2VC9A 4XVHA 3C7HA 1UZ0A 4QPWA 3K46A 1UY2A 1ULOA 3WNLA 4DEVA 4QAWA 5B4XA 3NJXA 2Y64A 1L7RA 3SKVA 2WDBA 5HXMA 4UAPA 2J1SA 4YPJA 3I2HA 5B4NA 3EYPA 1DP0A 3OG2A 3IDAA 2C9KA 3FN9A 2WAAA 3U37A 4W8JA 4DUWA 4QDSA 1GOFA 1JZ5A 2J1AA 5IYYA 3ACFA 3LQCA 3A22A 2Y6JA 3MBWA 3NRUA 4D8MA 1HN1A 3OEBA 3VD3A 4W50A 1CZSA 3OGSA 2EIEA 2VL4A 3I3BA 2VCBA 4CU7A 5JXIA 1EUUA 4A45A 3ECQA 1LNSA 1O8PA 4A42A 3T09A 3CQOA 5JUVA 2HYXA 1CZTA 2WABA 2V4VA 3WNNA 3MUY1 3DYPA 3HNYM 4A4AA 2V72A 1OT5A 3HEIA 4AAXA 1UY3A 4OMDA 4QDQA 4CUAA 1JYXA 2W5FA 1H6YA 5G04L 3THCA 1UX7A 3T0DA 2VZTA 4GWJA 3ABZA 3IAQA 4DUXA 3LEIA 3CZUA 1JHJA 3ACGA 1JZ4A 2WUHA 5C7GA 2BGPA 2W1QA 3CDZB 4XURA 4OZOA 4L0PA 5JXJA 2XQXA 3LE0A 5FUIA 2VR4A 5JR2A 3I2GA 3VD4A 3MUZ1 4QX2A 1US3A 1W9WA 3IIIA 3I2JA 4BK4A 1JZ2A 2WN3A 4A3ZA 4E8CA 1UY4A 3WF3A 2EICA 2W95A 2ORXA 3C7OA 2WN2A 2OKXA 3K4DA 5LA1A 5JXHA 1O59A 2VM9A 3F2ZA 4M4PA 1GQPA 2V5DA 1UYYA 3IAPA 5DQ0A 2LS6A 3C7GA 4ZXEA 3ETPA 4TTGA 4P02B 4A41A 4AG4A 2VZ1A 3MV01 1GOHA 4RYDA 4PQQA 5JMOA 1ULPA 1W9TA 2QQJA 2QQOA 1JYNA 1GNYA 4ET7A 2WAOA 2ZEWA 4P5YA 2QQLA 4PT6A 1XC6A 3UNPA 4MADA 2VMFA 3OGRA 4MGQA 3MO4A 3VD5A 1UY0A 1MPXA 1OD3A 2VZUA 4JKMA 3DYMA 3AC0A 3E1F1 3HPNA 5DMYA 1NKGA 4CU8A 2ORZA 4OUEA 2L9LA 2QQNA 3I97A 4XUOA 1GMMA 4ARYA 3LEKA 1W8OA 2VQTA 2E33A 4MOAA 4BXSV 1W99A 3OB8A 1GUIA 1JI6A 4DUVA 2VTFA 1JU4A 2VZRA 3SEEA 3NNGA 2C4XA 2QQKA 4ZZ8A 1RYYA 2VMCA 5IFTA 3CIHA 4E8DA 3WQBA 3WSOA 3WNOA 2E31A 3BN6A 2W92A 5F7UA 3GM8A 3VDBA 1XPWA 1GU3A 4KMQA 1K12A 2ID4A 4PF1A 3SEPA 2PQSA 4BK5A 4QB2A 1XNAA 4W4ZA 1JYVA 5HPOA 3FHQA 4A44A 1L7QA 2W94A 2DCKA 2VCCA 2E26A 2C26A 3A21A 4XUNA 1UMIA 4XUPA 2ZEXA 3HN3A 3BGAA 1I5PA 4UOJA 2LW8A 1UYZA 3T0BA 3K4ZA 2Z4FA 5J1XA 1K42A 4ZZ5A 4OMCA 3C7FA 2WO3A 4M4RA 4GWIA 4LHSA 3I3EA 4LQRA 3GDBA 2XOMA 2VZQA 3FL7A 1DYOA 3T08A 2X09A 4CU6A 1W0NA 3ZM8A 4JX0A 3I2KA 1H6XA 2RVAA 3UESA 5I0DA 2J1VA 2E32A 4GZ9A 1IQDC 1SHWB 3T2OA 2VMEA 2DDUA 2BBAA 4JKLA 4A6OA 3GXUA 3C8XA 3WF4A 1UY1A 3IB3A 3WEZA 4P00B 2Y8KA 1W9SA 3THDA 2J1RA 5IFPA 1BHGA 3K77A 4QB1A 2X05A 4KWUA 4CUCA 4MGSA 3HNBM 1R64A 2CDOA 4TXWA 4FI9A 4QB6A 2XONA 3I2FA 1JZ3A 1OF3A 4P08A 3HNMA 2JDAA 2QQMA 3UETA 3LPGA 3LPFA 3WNKA 2VQUA 2XHNA 3J7HA 3VD7A 5C70A 3WF1A 1UYXA 2J1UA 1O8SA 2YC2A 1WKYA 3LEGA 4KI5M 3NJVA 2QQIA 2W1WA 2BGOA 2YB7A 5LCWL 2Y6LA 4QDRA 2JE8A 4D0QA 2RJ2A 2KD7A 2EIBA 4LKSA 2QBXA 3SKJE 4QX0A 2VMDA 4ARXA 1SDDB 2RV9A 2BZDA 2HLEA 3K4AA 1XNTA 4DXSA 2Y6HA 3OGVA 2WZ8A 2J22A 3WNPA 3PUHA 2WYSA 1P8JA 4ZY9A 4MO3M 4XZUG 2J1EA 3OEAA 1K3IA 4JKKA 2VO5A 1PX3A 2R7EB 4DEQA 3W5MA 1TG7A 5IHRA 4DXTA 2WBKA 1UXXX 3P1IA 4CU9A 2ZXQA 3MV11 2W46A 3WNMA 2DCJA 1NAEA 1J84A 1NX9A 1DLCA 1CZVA 4IUGA 2W1UA 3WF2A 3VDAA 2J7MA 3VD9A 1JZ6A 2VCAA 1OH4A 4BJ0A 1EUTA 3I2IA 3P6BA 1GOGA 4QX1A 1UXZA 1TVGA 2YFZA 2W87A 2ZEYA 5JXGA 4UI9L 3C7EA 3I3DA 3T0AA 2EIDA 2W1SA 1PX4A 2BERA 2WZEA 1JU3A 1JYWA 2W9XA 1T2XA 2Y6KA 2VZVA 1JZ7A 5EJ1B 3A23A 1F4AA 4Z2AA 5CZKA 2B9VA 3OBAA 4LPLA 1UMHA 1K45A 5IJRA 2W47A 3D3AA 3JXSA 1PMJX 2W3JA 2YC4A 3NQHA 5LA2A 3T2QA 2VZPA 1KGYA 2JD9A
chains in the Genus database with same CATH superfamily
2WZR1 4CVUA 1FI2A 1UWWA 1YJKA 2YDEA 3JZVA 3N7KA 4MZUA 4K20A 4ZKTB 5LBEA 4CUBA 1M06G 1RL3A 2PQQA 2WNEA 5DAQA 5J48A 2E51A 1DQ5A 2BWCA 2BRTA 4QX7A 3AFKA 4Q4X3 2IVJA 3NJZA 5A1AA 2VZSA 2CY6A 2VQAA 1D4M3 4CEYC 1ULFA 3LA2A 4PI2A 1CAWA 3J7MA 1G7YA 4ZONA 2VECA 2GP3A 3MIFA 4XFAA 5FYYA 1RUH3 3OOXA 5FXXA 2D3SA 2JDYA 3JQWA 3R6SA 3DECA 4LO7A 3UGGA 1CAWB 2PHDA 2XR4A 2ZABA 4XIKA 3DXUA 4IE7A 1XE7A 2R072 1PO22 2UYAA 5FWEA 4B7KA 2X10A 4PLNA 4RHV3 5CNAA 5C33A 4Y20B 1QXJA 3AZYA 5A7OA 1OOPA 4RGGA 2XJRA 1VBD3 3HOBA 4XE9A 2Y38A 5F5IA 4XUQA 1LJ7A 3CKHA 4FPGA 4E27A 2CGPA 4F8AA 1CX1A 1AR93 3Q8AA 4Y1YA 3ZFEA 1RUI2 3LA3A 1IS6A 1QJFA 4FFFA 1IQAA 1DGWA 3RJ2X 3TEYA 3AP9A 4YZ5A 2NP0A 2QJVA 4Z92B 1WMFA 5EJZB 5CYYA 2Z2SB 2GDFA 5FZOA 3AX4A 3RG0A 4DPNA 1LOFC 1US2A 1SG3A 1ZA4A 2DTWA 3B9IA 4UW3A 3BB6A 4OHWA 4XUTA 3OGGA 5FP3A 3MF6A 5K7PA 1H8TB 1JYCA 3K46A 1G9DA 4YVWB 1N1VA 2A1XA 3ETQA 2QCSB 4NHMA 5FZOB 3PMSA 3NJXA 4E4SA 2RMU3 5GLUA 1L7RA 1R1A1 3QLQA 3SKVA 3IMNA 3LFIA 2WT0A 2RM21 3DL3A 1ENRA 2V73A 4QGMA 4YSFA 2XPJA 3S7IA 4YPJA 1QJU1 2ZGTA 2ZBJA 5BNNC 2NM1A 5C3PA 1D4M2 5CFDA 4D69A 2LM3A 1DP0A 3OCPA 1JYIA 3N36A 5IVYA 4IEYA 1G9AA 2VUAA 3FN9A 4OHVA 3KQRA 2WAAA 5FKCA 1QHDA 1S2KA 4Q27A 3N9NA 1OKOA 4NOTA 4AI8A 5CFDB 2J1AA 4JC1A 5KXEA 1RUH2 2QZ3A 2GH2A 3A22A 2YROA 3IDEA 2ET7A 3TYJA 4ITCA 1TQ5A 1S0BA 2Y6JA 3MBWA 3ZYJB 1VBB1 3ES1A 1S55A 4OCTA 4AI3A 3O5SA 5FUNA 3SC7X 2PLV3 4RS5C 3TWIA 2VL4A 2VCBA 3POSA 4RHV2 1SCRA 4IE4A 4K7JA 4K1ZA 1I5ZA 4JTNA 3ZSJA 1VBD2 3POFA 1POV0 4QPGA 3WG1A 3M3QA 1C8M3 4R8HA 3S30A 3ZYPA 1LNSA 1O8PA 2FCUA 2K2SA 3PVEA 4A42A 3TEWA 1AR92 1JTZX 1RXFA 4LO4B 3BTZA 3AYEA 1AYN1 2V4VA 3CNAA 1N3PA 3WNNA 3O0WA 4MHRA 3EHKA 3MUY1 2UURA 4QPGB 1TMF1 3D0JA 2WNVC 4AAXA 2FDGA 2ZCWA 4KNCA 3BOPA 4FPYA 4ZU5A 1XU2A 3FLTA 4PCRA 3PUQA 5FV3A 2Z42A 3CLPA 1JODA 5JVVA 1HB4A 2W5FA 4RQPC 1H6YA 1O4YA 1R091 1UX7A 2VZTA 1LRHA 1QOTA 2VOVA 4GWJA 2ZGNA 4QPIC 4JRAA 2JEMA 1MS1A 4PBOA 4AE2A 2TUNA 4DUXA 4RR3C 5JSRA 1PO13 2RMU2 5JIAA 1UKRA 3LEIA 3ZXJA 3MYXA 4JGZC 3N9PA 4XFCA 5IVEA 1JZ4A 3ITQA 1X33A 1X82A 3CDZB 4CEYA 5L19A 1YLLA 4NRMA 5JXJA 4BYYA 4PJYA 1BYHA 3ZMNA 3FHIB 2NQYA 4UBGA 2PHFA 1VB4A 1G8WA 4Q26A 1H8VA 3NVCA 5JDBA 3H8RA 4GKYA 5CB7A 3MUZ1 4QX2A 2ZJCA 4CEYB 5E8AA 3SCFA 1GZWA 3OUJA 4A3ZA 4E8CA 3N4MA 2JG9C 1OQ1A 1ZA7A 4XBNA 3C7OA 2W95A 2ORXA 3NAPB 5EXOA 1UIJA 4JCKA 4ORFA 3K4DA 2OKXA 4F83A 1WA4A 1CJDA 2H6BA 2Q1ZB 4FPJA 1O59A 2BW8A 1ULCA 1ENQA 2IFWA 5A7WB 4Z07A 1CQ9A 1F2NA 2MEV1 2Q5TA 5FIXA 5FY0A 4YW6A 1NXMA 1QY4A 1AR81 3HN1A 1UYYA 4N43C 2RDSA 5EYXA 3I54A 3BTYA 1C8M2 3ETPA 3LCPA 4UFIA 1FX5A 4LITA 1E5HA 2VXJA 2WFF1 2YPDA 2E7TA 1PK6C 4BQ5A 1FNYA 2A73B 4Y1ZA 2BFUL 1LOFA 3UKTA 2WAOA 1W2OA 2ZEWA 4P5YA 1AX1A 1VALA 2UWBA 4XFGA 2YYOA 4ZXKA 1XC6A 2GC0A 3A4UA 3OGRA 3MO4A 4X8PA 2TEPA 5GZDA 1U5YA 4Y5SA 1XB9A 2VZUA 4AZZA 1AUYA 1DYPA 2HH9A 1RGSA 1XBFA 3S57A 2D6LX 1PO12 1VRH1 3AC0A 4PLOA 5BNNA 1C5HA 5F5AA 5DMYA 3M3OA 4FTEA 2WSVA 1K5MB 2QQNA 4XUOA 4ES9A 1QOOA 1RUOA 1OHFA 2XGXA 4ARYA 1A78A 2B7YA 1QWRA 2R043 3LEKA 1W8OA 4UXAA 3VBRB 2VQTA 2E33A 1MZFA 4Q4V3 4BQYA 3OB8A 3J7NA 1JI6A 1ND2B 1HQWA 4NPLA 1VMFA 2VZRA 5FP4A 4XHXA 3SEEA 3PUSA 2Z69A 4J1WA 2XG3A 1RYYA 1V6JA 4QXKA 5GJ6A 3TOJA 4AVTA 5IFTA 2XB6C 4RS5A 5LK7B 1XXNA 3E5XA 4XJ9A 2HWD2 3IWZA 1Y4WA 3KQ4B 4UF0B 3UJOA 4Q0VA 5LZ6A 1H2KA 5FXWA 3BN6A 3WW3A 3VBSC 4YG6A 4FAHA 5BNOB 3ZSMA 1K12A 3KV5A 2BVVA 4BCUA 4XACA 1SMVA 4FFIA 1OPOA 4XIOA 3QBQA 4W4ZA 4KH9A 4N53C 3TN91 4N90A 3FHQA 3VN4A 2WNVA 3ALQA 1AX0A 3KT1A 4OUSA 3OUIA 3KCCA 1ACCA 2DCKA 2E26A 2HWC1 2FMDA 1RUG1 1UX6A 1REFA 3FWEA 4RQPA 4AHZA 1EP0A 3PLQA 3TBDA 5A6ZA 3WDWA 5FO8B 3VBUC 1N47A 4QPIA 5LY1A 2JG8B 2LW8A 1YNAA 3QOPA 4RR3A 5FKBA 1VAMA 4NHYA 1C4RA 4LULA 4A7KA 4HK9A 1KXGA 3POEA 1OLQA 4HBNA 1WGPA 3UKNA 3VZJA 4CPBD 2A3XA 4M4RA 4YW4A 4GWIA 4LHSA 5J96B 3I3EA 5FYUA 4RR3B 4WVZA 1EAH1 1VBC2 2VZQA 5F2WA 2DUQA 5F3CA 3OJBA 2VTXJ 4XAEA 1ZNPA 3FL7A 3MW4A 5IVFA 4ZPIA 5KHGA 2R042 4MGTA 4INDA 1W0NA 2JE9A 3I8TA 4OI4A 3SH3A 4Q4V2 2JG9A 1GNHA 3I2KA 2ZHMA 2GN3A 3J8F3 2J1VA 5FYHA 2Y26A 1ZZ8A 4GZ9A 1BKZA 2ZHLA 4XDQA 5DDJ3 5IUQA 3VUOA 2VMEA 4H7LA 4IE0A 3ST7A 3JCIA 4ZS2A 1YC61 2JG9B 1PM7A 2WT2A 2F6BA 2XJTA 3IM0A 4Q0UA 4GJYA 3WF4A 4DOUA 1A34A 2WL1A 4H3WA 3WEZA 3OSDA 4P9WA 4N43A 2VUJA 5FZGA 2J1RA 5A7QA 1WMXA 1O91A 3H1WA 3K77A 5A33A 2X05A 4KWUA 3FE5A 4IW3A 4CP0A 3O1OA 2OVUA 1CAXB 3HQRA 4MGSA 2PHUA 2RM23 3T1LA 4L2NA 4QXBA 3GYDA 1PK6A 2CDOA 2EF6A 3NNLA 4N43B 4TXWA 5HV4A 4BH9A 3VKLA 4QB6A 3IKWA 5A33B 2ERFA 3G6JB 4Q0SA 3I2FA 1SLLA 4M00A 1W6QA 2WNUC 2WO7A 4LUMA 5K4LA 3AYAA 5ERLA 2C6SA 1GBGA 4XDPA 1JZ3A 1PK6B 2ZHNA 1DGLA 1YFXA 4FQZA 4PF5A 5DUUA 1JHNA 3HNMA 3UETA 5A80A 1X36A 3B3QE 1FPN3 3LPGA 3GZEA 4NE9A 3WNKA 5KHKA 4TYSA 2ZAHA 4AHYA 4N9HA 1AHSA 2R0HA 1VBB3 2WKKA 3VBHB 4G9SB 3G7DA 3IDBB 4NIGA 2C1FA 1OQEA 1UO9A 3LEGA 3AJZA 3OD4A 2K46A 3O0VA 4FOVA 1ND3B 2IXLA 4LE4A 2W1WA 1TE1B 4HT1T 2XVLA 2ZMLA 3L2HA 4E4ZA 2FD8A 4WM8B 4I30A 1BVVA 1AYN3 1W8FA 3F95A 2CWSA 3U78A 3WW2A 3J8F2 5F8PA 1SLIA 1DLLA 2QTWB 1TMF3 3LAGA 5JLVA 5DDJ2 3VZKA 4R4ZA 1HV0A 3KV6A 3NJYA 1H0BA 3KGZA 3ZDSA 3J4UH 4ARXA 1JOBA 1IZ3A 2HLEA 3VBSA 4IGOA 2WIIB 1RUE1 5T52A 2J22A 1R093 1VAKA 1NA1B 4FFHA 1UN1A 5A3OA 5LEKA 4GULA 3CU7A 2RJKA 1W6OA 2JWPA 4QGNA 4N53A 4MXVA 1K3IA 3ENRA 4RGKA 1NQDA 1EV13 2RM22 3BYWA 2VXRA 3M4FA 2VO5A 3MGUA 5FP9A 2OIIA 5FYVA 5TSWA 5C5UA 1MR5A 5FMDA 1AXZA 1ZZCA 5LBBA 2A70A 3WINE 4AEMA 1HRI1 5FK7A 4N53B 3KGLA 2NZ9A 3LB9A 3FJSA 1DZQA 3IN9A 2X5IC 1UAIA 4A7YA 1AYM1 3VBUA 5IVBA 2ATFA 3NNMA 4QQPA 1VBA3 3MLJA 5FMOL 4B4RA 2R30A 3WDTA 1JOJA 3PU3A 3PVNA 1O5LA 4I0WB 1FPN2 3ATGA 1UZVA 4NHLA 4URTA 5KC6A 4IUGA 1COV1 5CAZA 3KCYA 3VBUB 2BGCA 2D93A 2J7MA 5GALA 1NOVA 2HWF1 2YGMA 1LR5A 2OA2A 3D8CA 1VBB2 5L73A 3POGA 1XE8A 3GBFA 2Q1MA 2VCAA 1W28A 4IV3C 3WW4A 4OHYA 3KD4A 1DDLA 1SLCA 4Q1RA 5FZ6A 5J98B 3WXPA 1AR83 2CSGA 5FPVA 1S0FA 1QH6A 1IG3A 4D6RA 1YUDA 5FBJA 4NHXA 2BFUS 1JXNA 5CADA 2W87A 2D6NA 3VHNA 2WFF3 1PMIA 1V0AA 4UI9L 3LOIA 1AYN2 1UL9A 1R081 5IAXA 3OY8B 4YG0A 1J1TA 4A6SA 2BERA 3W20A 4M0NA 3ILNA 3N3HA 1JYWA 4K21A 4WVVA 3K3OA 4Y4RA 1T2XA 4LA2A 3ZN5A 4WVWA 1CPMA 1SLAA 1VRBA 2LUWA 4X8NA 1FV3A 4QPYA 1VBE1 1X7NA 4HONA 2B42B 4OUMA 1R092 5A3WA 4CDQC 3NV2A 5F3IA 2V4AA 3MICA 4UBHA 5CZKA 1SLBA 3WD5A 1VRH3 3R0RA 4LOSA 4XHBA 2W47A 4XILA 3D3AA 2Y33A 4EYUA 1EV12 2K9ZA 3OPTA 2FQPA 1MZEA 1PMJX 2IXIA 3B94A 2W3JA 2RDQA 4LT5A 2WNUA 4W6YA 4JHTA 1RB8G 5LA2A 3OBTA 1X8MA 3POIA 1BZWA 1ULEA 1D4VB 1VR3A 1Z7S1 3AK0A 4K40A 1OA2A 2WS91 5A7NA 2VNOA 1VBA2 3ON7A 1AJKA 4WM7B 1LU1A 1YQ2A 5EV7A 2WNUB 4B29A 4K8FA 1APNA 3VBFC 4B7EA 4EN6B 2AGSA 4COUA 5BY5A 5APAA 2DBIA 2YG0A 3HJRA 4XW3A 3ZSEA 3IT8A 4C0HA 5A32A 2YMZA 4Y24A 4TLFA 3WLUA 4XC9A 3LOBA 4L11A 4DY3A 1OURA 2I45A 3T1MA 5GLZA 3S0MA 2BP6A 2FCTA 1AR82 1MEC1 1W8NA 2K0GA 1NUKA 1QJY2 2WT1A 3GGLA 3HWJA 4P9LA 4UT5A 3SH4A 5EIYB 1OXCA 1QJX3 3TN93 2E7QA 2Q4SA 4QX3A 4AWDA 2ZX1A 2CGNA 1CX4A 3AP6A 3VBOB 1FT9A 2WFF2 2WR9A 4MHUA 4UYBA 4ZU4A 4CP9A 5HV0A 2G9ZA 3FHAA 2VZ3A 1LHVA 5ACA3 1XSRA 4XFFA 2GN7A 2HWC3 5I93A 1RUG3 2EALA 3ZXDA 4NIIA 3O1RA 4NIAA 2OQ7A 2ZAAA 4JTOA 2XVKA 3VB9A 2DU1A 1FMD1 3WF0A 4AYUA 1GNZA 4CP9B 3W5NA 1J59A 2DVAA 5FZ8A 1ALYA 1LODA 1XNDA 4UFJA 5FJKA 4YW7A 4Q8KA 1QJZA 4EZ4A 1YQ5A 1LOGA 1YI9A 4RGAA 5DPNA 1OF4A 4L92A 4M3CF 3PJQA 1RUC1 1VRH2 1MVQA 1WMDA 3UK9A 1D0GA 4MSVA 4V2WA 4F7ZA 5K9YA 3I59A 4IETA 4S2GA 1HN0A 1XE0A 1EAH3 4LHLA 5F6LB 4AHXA 1V6OA 2ZGLA 4OYUA 2X5IA 4LMFA 5BPXA 2P34A 1RUJ3 5L9RA 1X9TA 1RHI1 2E53A 2QNKA 2VC9A 4XVHA 3C7HA 1UZ0A 2R32A 2SBAA 4QPWA 1UY2A 1OFNA 1ULOA 3I59B 3RJRA 2YXSA 2DURA 4QAWA 1W6PA 1XNKA 3K48A 1H8TC 4GAZA 4YVWC 1PGW2 4Z1VA 3N7JA 2WDBA 1M4WA 3DPRB 4TN7A 2E63A 1W6MA 2UWCA 4LJHA 4WZCA 4IV3A 4SLIA 2VH9A 3MZHA 5JZGB 4QKNA 4MLOA 1W6PB 5T5PA 3EYPA 3PU8A 4GJZA 3KWVA 4OHXA 5BNPC 2JENA 5KR7A 4NMIA 3NV1A 2HKXA 3IDAA 2C9KA 4IGQA 4IV3B 3U37A 1ZZBA 1JZ5A 4N7IA 1QJX2 3TN92 3H0OA 1QU0A 3ZXAC 2DU0A 5LBFA 5ACA2 4TLGA 3LDKA 1S0GA 1ZBA1 1HN1A 1A6CA 2HWC2 3OEBA 1QXPA 2JX9A 3M3IA 3MPBA 1CZSA 1JUHA 3POBA 4CE8A 1S0DA 3V0BB 2ZZQA 4GMP0 3O1MA 1RVF2 4IEQA 3NMBA 1PIV1 3LZZA 3AYDA 2DFBA 3QD6A 4JAAA 3UJQA 4A45A 3VL8A 4CDQA 1BBT1 1UU4A 2I07B 3WT3A 1JH5A 3ZYHA 4BM8A 1DHKB 2CAUA 3AJYA 3V0AA 4QHBA 2BEOA 3RZHA 3T09A 3CQOA 1W05A 2PXJA 4COWA 2ZKNA 3DEMA 2EAKA 2H0VA 3GALA 4CDQB 1VPHA 2GMMA 4IL7A 4IESA 1BEV3 3V0AB 4OMDA 4QDQA 1JYXA 5E16A 1EAH2 1O5UA 4BIFA 1QDOA 3ASIA 2C0ZA 1RUJ2 3ZYRA 2QZ2A 3FMGA 2H6CA 5DAPA 1LB2A 3VBFA 3MLLA 5A1LA 3ABZA 2JDHA 1F15A 3H50A 2P6CA 5DABA 1SBDA 3O1PA 1JHJA 3ACGA 4M01A 4COZA 2BGPA 5C7GA 3VBFB 1K5JA 3I2DA 4OZOA 1Q8QA 4C91A 2VUCA 1GZCA 1RUE3 5I0RA 5FUIA 2VR4A 1XQNA 1OMIA 5JR2A 2DVBA 1QGLA 5H9QA 1RITA 5J37A 1QH7A 3VD4A 3ORJA 3PNAA 3B00A 4BK4A 1JZ2A 5D2AA 3GBWA 2WN3A 2O1QA 1DZTA 2OQ6A 3H7JA 2B39A 4FAGA 1NG0A 1UY4A 3PVOA 4A2UA 1YCIA 2DVFA 3R4UA 3CHXA 1JOPA 2A6YA 5FMOS 1FOD1 1KFUL 2WN2A 3AZVA 2O8QA 5LA1A 4L8QA 1DFQA 1VP6A 3NAPC 4R4XA 1AYM3 4LIVA 4L97A 2W0XA 4MGKE 4Y20A 1L7LA 5BYNA 2OYZA 1WCUA 1I3HA 2ENRA 5FLHA 2YC0A 5DQ0A 5F6KA 1HRV1 1DGWX 4GH4B 1F5FA 4BWOA 4UFMA 3C7GA 5ABJC 3H9AA 2GC3A 2EXKA 3W9AA 1H9PA 2PYTA 5T5LA 3ZYFA 2HWF3 5JPMB 4TTGA 4LKDA 2VZ1A 3WR0A 3MV01 3M2MA 1RUF3 2PHXA 4AEDC 2OX0A 2QQJA 4CCJA 1W3VA 4PIXA 1U0AA 1BEV2 2JXAA 4CDWB 2VPVA 4RD7A 1H30A 4MADA 4D7TA 4GMP1 2VVEA 4MGQA 1GKBA 2CV6A 1H8TA 1UY0A 1MPXA 4HN1A 1OD3A 2W08A 4YVWA 1O4ZA 4JKMA 1R083 3DYMA 2JICA 3HQUA 3KF5A 2PAEA 5E88A 5CKNA 5F9TA 4Q0QA 2XJPA 2PMWB 5DG2A 5FPZA 2VMIA 3T2TA 3DV8A 4AL9A 5L7OC 3E1F1 4FPFA 1EPZA 1STMA 2PHRA 3WUCA 2AR6A 3RWKX 3M7AA 4OUEA 2L9LA 5BNPA 2DWRA 4KL1A 1VIWB 2VNGA 1RUE2 1YIFA 1CGPA 1K5MC 2JD4A 4DIQA 1J1LA 1W99A 1OPMA 4Q29A 4R52A 3VBRC 4C8DA 4FTBA 4Q4X2 4FSJA 4AI1A 1JU4A 5BNPB 2D40A 3WG4A 1ND2C 2MNGA 1IS4A 2OPWA 3MHZA 4ZZ8A 4B8EA 4BPZA 1KS4A 3D0SA 4Y22A 4YVSB 2QE3A 1LGCA 5C9AC 5GZGA 3M1HA 3MIHA 1IPKA 3ZX7A 2IC1A 1Z7S3 2PAMA 1AYM2 3AYCA 2DF7A 4HVOA 1HB3A 1BXHA 1XJAA 2BBVA 5FYIA 1ZX5A 5F7UA 4N7UA 4XJWA 3WDYA 3POYA 3URFA 3AVSA 3GM8A 4Y22B 4E4HA 1KJLA 1WLCA 3SEPA 1SBEA 1Q3EA 3UV9A 2C9AA 4LLOA 3CBNA 4PHZA 5BNOC 1QXRA 5C8CC 4GKXA 2JDZA 4KG8A 3MIEA 4DO0A 1HW5A 4LO6B 5HPOA 1PNGA 2PHLA 5E1RA 3B5LB 4Q4W1 3CF6E 4JDMA 5H9RA 3ZN4A 4DRRA 5F5CA 1UOGA 1L7QA 1RUF2 4W65A 1PGSA 5LATA 3HBKA 4HZFA 2I2SA 1MS0A 2Y0IA 3ZR5A 3H3LA 1QQP1 5FQ0B 3AFGA 4I01A 4KU7A 3FUOA 4UOJA 2J42A 1UYZA 4UFLA 3SCHA 1UPIA 3AMMA 2JG8C 4XJUA 2LRPA 5J1XA 4CDXB 2N7GA 1O3RA 3C7FA 3RRDA 3T3YA 3P3PA 4MX3A 2Q8DA 2D3PA 1FMD3 1N1SA 3O7OA 4LQRA 1F35A 1W9YA 5FXVA 5FWJA 5DUXA 3BKZA 1YFYA 4RA0A 5EP9A 4YYOA 2X09A 3T4VA 2AUYA 3WY6A 1RMU1 3BPSA 3ES4A 1RUC3 1U5XA 1H6XA 2RVAA 5FYMA 3UESA 1WD3A 1G9BA 1IQDC 2ZGPA 4BQ4A 1SHWB 3T2OA 4Z82A 4AK3A 2XUEA 3IMMA 3LSEA 3NAPA 2BBAA 5A3UA 3I3MA 4OI2A 3GXUA 2YV8A 1RHI3 4CSWA 1C1LA 4JDOA 4DNYA 2O0OA 4KBBA 3IB3A 4AI2A 1Z7S2 3K51A 5A7WA 1W9SA 4CPBA 3THDA 4PLMA 4R9CA 4AI9A 4YZ3A 1BHGA 3DKQA 4P9XA 4QB1A 2P37A 5ABJA 2GC1A 4TZDA 2DCTA 4YFZA 4C1WA 2W52A 1QJEA 4YGCA 1GYKA 4B4QA 4AEDA 3QACA 5DXDA 5HBAA 1S2EA 2PLV2 5EJ3A 4Z2WA 1PZ9A 4LE3A 5ABJB 4FPLA 5AC93 4XFHA 1UIKA 1IHMA 2G9GA 5SV5A 2A75A 5FZ9A 4P9IA 1PVXA 4K1YA 2RS51 4YM0A 5D8AC 1OBNA 4AEDB 4P08A 4KWLA 3ZMOA 3ZXFA 1LECA 2IXKA 2QQMA 3N9OA 3LPFA 5EYYA 3DUIA 4LUKA 5H9SA 2XHNA 1YQ8A 4WZFA 1REDA 4LBQB 3J7HA 2VVFA 3PUAA 4BMBA 3EXUA 5C3RA 5L7OA 2JDNA 1ZBA3 3WF1A 1TEIA 4CUGA 2D6KA 1OLMA 4U2AA 4XAAA 4CXXA 2YC2A 4Y1UA 4XZPA 1PIV3 4UFKA 1FMD2 2P3YA 3AMQA 3RNSA 3VBHC 4P9GA 1BBT3 1HB1A 1F5JA 1K5MA 2PELA 2GNDA 3OPZA 3ZKUA 3AKSA 4E2GA 5L7OB 1POV1 1URXA 2BWAA 2HWB3 2QQIA 3UGFA 3KZ4C 5K0UC 1SCSA 4HKWA 2BGOA 2WSUA 4Y33A 3VBRA 3ZIWA 1ND3C 3MW2A 4FPKA 5LCWL 4AXOA 2Y6LA 2CWMA 4HSLA 5ANQA 1RUC2 1ND2A 1AR61 5LEJA 4WM8C 3I2OA 3AMHA 1Q43A 5E6HA 3THTA 5JOYA 5C9AA 4XYXA 4LKSA 1BK1A 2EXJA 2QBXA 4GA9A 5B2GB 1O4TA 2VMDA 4AW7A 3SCGA 2RV9A 1RHI2 3ZPOA 2BZDA 4YGBA 3VZNA 3K4AA 1SPPA 4UF0A 2E9QA 1YWKA 3SXWA 3WNPA 5C9AB 3N9QA 2O14A 4HFSA 3BU7A 4ZY9A 5BNOA 2ZGRA 3KCXA 4GXLA 4DQAA 2C24A 5C8CA 5CEHA 2BOJA 4AFBA 1NA1C 3OEAA 4JKKA 3ZN6B 1NLQA 4CCOA 2ARAA 1SPPB 1SQ4A 3WOGA 3IZOA 2WZR3 2VUDA 3L2YA 4CCEA 4XEZA 4DEQA 1SFYA 4Y5Z0 5F2SA 1YQCA 5C8CB 1TG7A 2A6ZA 5IK4A 1AVBA 4AGGA 4LA3A 5AC92 1LKNA 4I09A 4DXTA 1AR71 1AL0G 4BMEA 3EQEA 2FDJA 3O1VA 4UW5A 3W58A 3L9JT 1DYKA 1Y43B 4YM1A 5LY2A 1BMV2 2DBNA 3WNMA 3FUQA 3VKOA 2JG8A 1NX9A 1UD1A 4EWEA 1O3TA 1FYUA 1F8VA 1FOD3 1CZVA 1V6LA 4EWDA 4YARA 1ZZ7A 2UWAA 1MQTC 3EJKA 4XBQA 1QOSA 1S0CA 3VDDB 3VD9A 1ZBA2 1OFSA 2GSYA 5A3MA 1RUD1 2XDVA 5BV6A 1N1YA 1YFUA 2Q8CA 1RXGA 1BVP1 3AZXA 2YUEA 3VHRA 5C8WA 5F37A 3PIGA 1OI6A 1BBT2 4RSUA 4WVMB 2PAKA 4CZSA 4QX1A 3ROUA 2HWB2 1Q8OA 2YFZA 5DZEA 1ZVFA 1C8NA 2ZEYA 3POJA 4HMZA 5JXGA 5FMBA 3I49A 1TME1 3GJAA 2OXBA 5DZGA 1V9U1 1DQ0A 5A3NA 4P5HA 2B8MA 2EIDA 2W1SA 3B93A 4QXHA 4BXFA 1OVPA 2W9XA 1NY71 4DMIA 2GH8A 1WCKA 4BU2A 1ZREA 4GMP3 5EJ1B 4LR4A 2FBEA 4LBQD 5LWBA 2FZ1A 3TNQA 5FPBA 2PN5A 5KHIA 4Z2AA 1WW4A 1J3PA 1W2AX 1KDMA 2B9VA 2VD7A 5I8SA 3I4IA 1I6XA 3OBAA 1AXYA 1UMHA 1CAXA 2HEVF 3JXSA 5FBZA 4WBBA 1ODNA 3NSTA 4AI0A 4AGRA 5IATA 2WZR2 2YC4A 3R4DB 1PVC1 1H2NA 2DCYA 3NQHA 1Y7BA 3FC0A 4MVTA 3WDXA 2MPFA 2VNVA 2AC1A 1R1A3 1YRZA 2ILMA 3GBGA 4H7MA 5D8AA 2VZPA 4KU8A 2IUWA 1N3OA 1TNFA 2D5FA 2HWE1 1QJU3 4PQ9A 4IV1B 5G05L 3DN7A 3LDRA 4WM7C 1LHUA 1WCQA 2YZ4A 5D8AB 4YW1A 3HR9A 3AMNA 4NJ4A 4AGVA 3VBHA 2Y34A 2J1TA 3GZTB 5FY9A 1BK0A 1FNZA 4QGLA 1W90A 3MF9A 5K0UA 1TNRA 4LNVA 2VOTA 5FZHA 5IK8A 2ZEZA 4XOGA 1V70A 2P1BA 1ND3A 3N7MA 4QQOA 1F4HA 3MFAA 4S2FA 4W6WA 3ZYGA 4EJRA 3CMGA 4B3NA 4DXRA 3RFRA 3EB7A 3T2PA 5T50A 4WM8A 1WCSA 3CZJA 1PMHX 5K0UB 4A7ZA 1QEXA 2Y6FA 2YPJA 1DF0A 1NZCA 2JKXA 3U11A 2WA4A 3VBOC 2D6OX 2WNOA 2ETEA 2WQZC 1WLWA 1WMEA 2FDHA 5T3NA 2H0BA 3LWCA 2GU9A 1NYWA 3ZFFB 1QQP3 4I2OA 1ASJ1 3ZXLA 1QIQA 1LU2A 3ZXGA 1PO21 1S0JA 4RN5A 1AXKA 3N9LA 1NA1A 2CL2A 4JVAA 5FZDA 2Y6GA 4HN0A 2ZMNA 2R1DA 1WUVA 1BCXA 1D7PM 1ENSA 2R061 2VBDA 3HMYA 3I3QA 1S2BA 3HT1A 1NXD1 3N9MA 4NAMA 2P6HA 2QUOA 4ASKA 2WYFA 3D82A 4CCMA 4LKFA 2GMEA 4NIDA 5F32A 5D21A 1W3XA 1CPNA 2B4KA 2CTVA 3MW3A 3H42B 1R1A2 3ZFGB 3DYOA 4NPMA 3ZKYA 5L9VA 2XLAA 1XYPA 3K2OA 1PNFA 1RMU3 2IFRA 4XFBA 4MG2A 1Q8SA 1QJU2 3PDQA 3P5BA 2DUOA 1MQTA 5F5QA 3NWKA 4DZGA 4YWAA 5FQ0A 5HXMA 5DAXA 2P3KA 5DUWA 4UAPA 3S6PA 4XDOA 3DPRC 5DG1A 1SACA 2HEYF 3RVHA 1GLHA 1MQTB 4RFT0 5JZGC 1Q56A 1ENXA 3U1XA 5I8TA 1T6GC 3BCWA 3OG2A 2ET1A 2RJLA 4GB31 5F3GA 3U0ZA 2JE7A 2VW2A 1HV1A 4W8JA 4C0BA 1GWMA 2BQPA 4DUWA 1GOFA 5CFCC 3NL1A 1D4M1 5JOZA 5JOWA 4K8RB 1VLNA 3R05A 3RZZA 4Y4YA 3RMXA 2MEV3 2TBVA 4Q0PA 3VZLA 5IK5A 3PTYA 2B46X 3OY8A 4ES8A 3NRUA 2XVGA 4W50A 3NKTA 2Y60A 1RUH1 2EIEA 3I3BA 3QCWA 4QM8A 1RC6A 1Y9GA 1WBLA 1QQP2 5JXIA 1EUUA 3ECQA 3WV6A 1W0OA 1OLME 2QQUA 2HJIA 2XMLA 2EA7A 4BQ2A 2A71A 2GMPA 1TMF2 1SDWA 1W04A 3J9SA 3NW4A 1KFXL 3P3NA 4CCLA 4RHV1 5JUVA 2D3RA 1YXWA 1SBFA 2WABA 2HEWF 2XH6A 4FPOB 5FDBA 3B01A 4GIQA 1MACA 3MEPA 4IGPA 2VNRA 1MS8A 3AZZA 1IGOA 3DYPA 3HNYM 4Q2FA 4ZU7A 4CUAA 2F4PA 1AR91 1GWKA 5FPXA 1NCRB 1POV3 2AEZA 4JQTA 1Z78A 2A6VA 2BTVC 1CN1A 4M3CB 3ZXKA 2VE1A 1ST8A 5GLWA 3I7DA 1LEMA 1RMU2 1IPSA 3THCA 3T0DA 3TNPB 1DGRA 2ZGUA 1AR63 3KLSA 2ZGSA 2XHKA 2ZPXA 4QM9A 4WM7A 4YG3A 4AR2A 4E2QA 2D7FA 4DB5A 5FZ4A 3BIEA 3CZUA 3WX5A 3FLRA 4OVEA 4MXWB 4H2AA 4AF9A 1LHNA 3AL6A 1H4HA 2W1QA 2F4LA 3MFCA 4L0PA 4HPKB 2XQXA 3LE0A 2A3WA 2WWSA 3KS7A 4Q8LA 2G1MA 4XMIA 3I2GA 1WW6A 4OFGA 3ZIXA 4XF9A 1OA3A 5A70A 3I2JA 4R9AA 2X53S 2ZS6B 5KHHA 4EROA 5FO7B 1HJGA 1J3RA 3D6EA 1X8EA 2IVIB 1FV2A 4QKBA 4N9IA 3WF3A 3ACLA 2EICA 2MEV2 4QWNA 1LOBA 1LHOA 3N7LA 3VBOA 4S2HA 4ATFA 4J25A 5HXVA 5JXHA 2VM9A 3FFQA 4CA9A 4M4PA 4UW6A 4XTPA 1GQPA 2XJVA 4YZ1A 1AZDA 2QQVA 3J26N 4FFGA 3ZDVA 4AQ2A 4OHZA 3HD8B 5GZEA 2LS6A 4ZXEA 4BQ3A 1JW6A 2IZWA 4A41A 4GH4C 4JQRA 4AG4A 1YYNA 3CO2A 3RZLA 5FZAA 4RYDA 1GOHA 1BJQA 5FY1A 3SITA 1N1TA 1ULPA 5FPAA 1JYNA 5A3TA 5FZMA 4ET7A 3AKPA 3AKTA 2BYVE 1AX2A 4IEXA 2QQLA 2AACA 3IDCB 3GCWA 2AENA 2RG4A 4B1LA 5A3PA 4YZ2A 3UNPA 4F3JA 4AHWA 4OI0A 2KA3A 2ADEA 5ANNA 2ZGOA 1AL21 4Y3OA 4CRQA 5F1RA 1D0HA 1TME3 3BOWA 4CDWC 1V9U3 3E6DA 1WD4A 4LO5B 4X6QB 5EFUA 5JAXA 2CHHA 2ADDA 3UGHA 2A7AA 1EY2A 2YU1A 3E97A 3DPRA 1U5IA 4MGIE 3M8LA 4UFHA 4X6RB 4XF1A 3ZSKA 4CTEA 1IKQA 1LGNA 4CU8A 5JZGA 2ARCA 1MS9A 3I97A 3WDUA 1ULDA 3PL0A 3AL5A 3QH7A 4LBLA 1PO11 4FXKB 1GMMA 5C3QA 1LTEA 5FZLA 1WW7A 4H14A 5CFCA 3FFZA 4HLTA 4NWWA 2P3JA 3H8OA 2HYKA 4HKOA 5LRRA 1D2QA 4YGEA 2ZGMA 2P3IA 2VTFA 3PHMA 1V6NA 2GALA 3TEZA 5AFEA 4ASMB 4XCAA 2XBO1 1ZZ9A 3C3VA 1G86A 5CFCB 1GZ9A 2WZPP 1D2SA 2VMCA 3Q8FA 3HT2A 5IT6A 4OULA 4QKFA 3GJBA 4AFDA 1CESA 3LD8A 4YVSC 3NO8A 3V0BA 2OT7A 4CCNA 2E31A 2HWE3 3KHBA 3PMEA 1QDCA 5HCAA 5J09A 5CKMA 1WLTA 2W92A 4BIOA 2NN8A 1LGBA 4XFIA 3ZLIA 3VDBA 1GP4A 1GU3A 2NMNA 3POWA 4PF1A 5FUPA 3D5OA 4XPVA 5FFOC 2HWD1 4FT8A 2PQSA 2DFCA 4LK6A 4TWTA 5FYZA 1XNAA 4QXCA 1RINA 1RUG2 4YM2A 4BK5A 1E5SA 2CAVA 4EN0A 1KRIA 2ARBA 3ZVXA 1PZ7A 4A44A 4LBMA 1GFF2 5BXXA 1PGL1 2YBSA 5C4WC 1VB2A 3A21A 5FXZA 1DQ1A 3RDIA 5FYTA 1UMIA 4Y1VA 2RDNA 2AREA 2ZEXA 2ZZJA 3HN3A 1FXZA 1NT0A 1I5PA 2BNMA 3BGAA 4LK7A 3K4ZA 3GHMA 2Z4FA 1TME2 1GWLA 2UY9A 1V9U2 4ATEA 3B69A 1RJ7A 1HXS1 3H3ZA 5AVPA 1K42A 5FR3A 4FQ4A 1CONA 4QX5A 4CDXC 3O1TA 3WP6A 3KB5A 3RZMA 1NCQB 1NZIA 1O6UA 4HVRA 1ASJ3 1W8HA 2GC2A 2OZ6A 2XKOA 3GDBA 2VU9A 2G4IA 5C3OA 1RJ8A 2XOMA 4MGYE 5FY5A 5JI7A 2PFWA 4XABA 2D43A 2RR11 5K8SA 2OUHA 4CU6A 2WWJA 2R063 4ISQA 1W0PA 5IK7A 5FYCA 4QQLA 5I0DA 1GICA 2E32A 1VBC1 1POQA 2FMYA 2ES3A 4RFRB 3B7MA 4XQDA 4COYA 4E9KA 1J3QA 1FATA 2R041 3D4KA 4Q5OA 4HVQA 5L36A 1SZBA 3MLKA 2JECA 1ZYBA 4Q4V1 4JKLA 1HQLA 3VZMA 4AEJA 1SFPA 1MZ6A 2D97A 1UY1A 4FXGB 2OW4A 2WLPA 4P00B 1W8UA 2Y8KA 4QU1A 4XMAA 4DFSA 2HWE2 3E6BA 3J7LA 1GSLA 4Q1PA 3UT0A 1VMHA 4PI0A 4YNIA 1HRI3 2LTNA 2NLRA 4V1PA 2ZGQA 4GH4A 4XXAA 3BIWE 1AF9A 3LEMA 3HNBM 5JOXA 2QFEA 1VJ2A 4AFAA 2BUKA 3CJXA 4LKEA 4FI9A 2EAAA 4CDUC 2XONA 1XSQA 1YI7A 1Q5OA 3RPQA 1COV3 1VE0A 4HK8A 4GB33 1Y9QA 5E89A 1GANA 2Q8EA 1NQJA 1KD7A 1S1AA 3LIGA 4JZRA 4LBKA 2JDAA 4CDWA 2I74A 3BPZA 1GP6A 3DF0A 3LIHA 3AXDA 3KSCA 2VQUA 2Q8OA 5JIUA 1QKQA 4GD4A 3PTRB 4UWDA 4AVVA 1UOBA 3NV4A 4IE6A 4Y1XA 4YZ4A 4GWMA 2J1UA 2VGDA 1WA6X 2WRAA 4E2SA 5BUVA 2FHRA 4IDZA 2OZJA 1N3QA 1WKYA 4S2DA 1ASJ2 3BU0A 1YEWA 4LOTA 2RS31 3NJVA 4M3CE 2D44A 2QKDA 2GNTA 2YB7A 2R062 3NV3A 2YGLA 5DAWA 1Y3TA 3BI3A 2ZX4A 4FPCA 1VBE3 1UOJA 2RJ2A 2KD7A 2EIBA 2ZGKA 3SKJE 3X29B 4EZHA 2D5HA 4YVSA 1SDDB 4QD2A 3J8F1 4QMAA 5JPNB 1OOPB 3TRSB 3INAA 3BODA 3OGVA 2WZ8A 4YFWA 5DDJ1 3PUHA 1HB2A 4AQSA 3KMHA 4QHZA 3SH5A 1OSGA 5ISLA 4MO3M 2J1EA 1XYOA 3JU9A 3ZFEB 2FCVA 1HRI2 5I0TA 3DXTA 4G3YC 5C3SA 2VBPA 1LAJA 4Q4Y1 1CAUA 3THPA 1PX3A 1UMZA 3LSDA 4O65A 1SFNA 2WS93 5T5OA 2XUMA 2BJSA 4CP2A 5C4WA 2WLQA 5I91A 1JS9A 3GNEA 4HXCA 1A8DA 4HOOA 5FOJB 4KWJA 1COV2 3E5UA 4DXZA 1CAUB 4GB32 3VKMA 3P1IA 4CU9A 2ZXQA 2HWF2 2W46A 2JDMA 3SHRA 2DCJA 3CL1A 1J84A 4OI1A 4O7XA 3RGBA 4IEVA 3FLPA 4MGZE 5L9BA 1B09A 1RIRA 2VOKA 3VKFC 5SV8A 2W1UA 1MEC3 3WF2A 4CDXA 1KQRA 1VMJA 3N35A 1JZ6A 5A1FA 1FPN1 1YFWA 4BQWA 5FZKA 5FLJA 3VDDC 4BJ0A 3T30A 2JJ6A 1LOEA 1YO8A 3O0XA 3KVBA 4L99A 2XJUA 4QQ2A 5FTTC 5KBFA 1R082 2HBTA 4EQVA 5J3UA 5IVJA 1C3HA 4EV0A 1OKQA 4FTSA 4B1MA 3CJIC 1I1EA 5EWSA 3C7EA 3T0AA 4HL0A 3NKGA 3USUA 4J1XA 1PX4A 1VBE2 4DY5A 1ZBE1 4W6XA 1DGRN 3M70A 3U10A 5IVCA 1S0EA 1W6NA 2Y6KA 4KG0A 4MYEA 1ZRCA 5FYBA 3JQXA 5FZEA 2YHJA 1UZWA 1AL23 5KWRA 3A23A 5CVRA 3USUB 1C28A 1JMUB 2PTMA 3RSJA 4AQ6A 5FRAA 3H3UA 1GZTA 1WLDA 1W6NB 2X8KA 4FOQA 1K45A 4LPLA 3RZJA 2D6PA 2AH2A 2IXCA 2A6WA 4IEUA 4TSVA 1CR7A 5C5TA 4CDUA 3WZ1A 3OF1A 3S5AA 2WS92 4CCKA 3JBG1 4YGDA 3T2QA 3FBYA 1EV11 3OTFA 2JD9A 2P17A 1YQ6A 3VDCA 3GHNA 4CDUB 5C71A 3PUIA 4XXPA 1V00A 5A6YA 4EN9B 1GP5A 3K75B 5KXDA 5LASA 2XBO3 4LBJA 2FDFA 2OUJA 4NN0A 3TAYA 2NYYA 4IV1C 1ZRDA 2R1BA 4LBQA 1UOFA 1KEXA 1MEC2 1VBA1 2WO2A 2XJQA 4JHZA 5C6CA 3BVCA 2VJXA 4D6SA 4HG6B 1ODMA 1S0IA 3FBMA 1H1AA 1J58A 5CU1A 1CIYA 2XXZA 1KJRA 4NROA 3AP4A 5EQUA 3GZAA 5FY4A 2WO1A 2HWD3 2BPA2 3MIDA 2CDPA 1GZWB 4V2VA 3GCXA 3V65A 2A6XA 1IPJA 5DN2A 5LA0A 2KR2A 1F9KA 2EXHA 1WWYA 3FX3A 1ZRFA 1AJOA 5FK8A 1QJY1 4BDVB 3A7QA 3S5QA 1JZ8A 1CIWA 4XBLA 1SEFA 2VZOA 1XU1A 2WQ8A 2G19A 3VGIA 2XJSA 3ZYIB 1UYPA 3ACIA 2YFUA 3AZWA 4NVPA 2XL9A 5JWPA 1AL22 4K6BA 2OPKA 1B35C 4QKDA 3ZFFC 4ASLA 5A6QA 4BLIA 1J83A 2CGOA 1H1IA 1W03A 3ACHA 5FYSA 1HXS3 5DZFA 4CYDA 2YY1A 4XJZA 3RYRA 4J6GA 4HETA 5JR7B 4D6QA 4YW3A 3U4SA 3ZN6A 2UU8A 4IEOA 1HDKA 3SQOA 4GALA 4PBPA 4AFCA 3ZOIA 5GZCA 4I3GA 4BA6A 4OZXA 2DYCA 2W91A 1DCSA 4META 2RR13 3RQ0A 1SLTA 4IEPA 3UL2A 2VOWA 3RWNA 1XYNA 2WC2A 1RTVA 3WUDA 4PDWC 3WNLA 3ZFGC 5FP7A 4DEVA 1NLSA 1VBC3 3IIAA 3LGRA 5I0UA 5B4XA 2WINB 5FP8A 2Y64A 3K3NA 1MS4A 5FZ3A 3WCRA 2XBO2 3ME2A 2XKPA 3VHOA 5BNNB 4DS0A 2J1SA 4JV4A 1DQ2A 1DZRA 1E5RA 3A0KA 3VDDA 2HBUA 3I2HA 4BZ4A 1OQDA 2W2IA 1DU3D 2ZX3A 4D94A 4G4FA 1PGW1 5B4NA 2YU2A 3OD0A 3WW1A 2WWUA 3IBMA 3H8UA 2RS11 5A7PA 3KT4A 3EBRA 1UCXA 2DVDA 2F17A 2IXHA 3OUHA 4WVMA 4L9BA 3CJIA 4QDSA 2QQWA 1H9WA 3Q8EA 5FAXA 4BQXA 1MZ5A 3ACFA 5IYYA 3LQCA 1V6IA 1PIV2 1UZYA 1Y9MA 5FPLA 5I8YA 5FZFA 5CG9A 1IKPA 1HRV3 4RS5B 4D8MA 1PGL2 1RUNA 4D7SA 3VD3A 3CJIB 1QJX1 4YLZA 1HIXA 4LLFA 2BNNA 5F3EA 3OGSA 1UZZA 2VAUA 1JUIA 2PHTA 4LHKA 1IS5A 5T54A 3NNFA 4CU7A 3M3EA 5FZ0A 5ACA1 5FY8A 2Z5WA 2R0FA 5LB6A 1W9FA 3JB8A 1Q8PA 4BB3A 1RVF1 1G6NA 4N8MA 1HXS2 1PHMA 3R4SA 2HYXA 1CZTA 2WNVB 2SLIA 3ILFA 3PURA 5CIRA 4E4DX 2ZX2A 2VQ0A 4A4AA 2V72A 4EN7B 1OT5A 4LEJA 3HEIA 4JGZA 1UY3A 2RS33 5FO9B 1OLRA 4AVAA 3BTAA 4RQPB 4NRQA 4NWVA 1EPWA 2RR12 4QPIB 4QHOA 4P9YA 4NR1A 1NCRC 4XJ8A 1TZOA 2G9FA 2LALA 3HQXA 5G04L 5FLIA 3NNJA 3IAQA 4JGZB 4IV1A 2B5HA 4AOCA 3Q8BA 1RUJ1 2IWGB 3QH6A 3JD71 4IEZA 1OUXA 4NAOA 5AVAA 5CA6A 4Y26A 4R9BA 3B9CA 2WUHA 1W06A 4XURA 4CEWC 2JIJA 2B9UA 4NRPA 4D7YA 1ZZ6A 3MIGA 1BLZA 3WVJA 1WBFA 4K9SA 4HKLA 1C57A 1FOD2 1US3A 1W8ZA 3VLBB 1W9WA 3IIIA 3VD5A 3AVRA 4U36A 3AKQA 3O1SA 4Q4Y3 5JSPA 5LRSA 5FZIA 2EVXA 2YBKA 1HJFA 3E5QA 3VKNA 3W59A 2Q0AA 4XCBA 1HRV2 2GAUA 4MUVA 3RZKA 3F2ZA 2JB4A 3E6CC 5F39A 3SLIA 1L3JA 3ZFFA 2LROA 1B35A 1U12A 5CG8A 4Q4W3 1O3QA 4AVBA 4ISRA 4Y5TA 2V5DA 3IAPA 5GM0A 2XWBB 3HIFA 5M0TA 4YW2A 4XF4A 5J36A 1JN2P 4URAA 4P02B 1E5IA 4O9GA 3V64A 4LORA 4NO4A 1B35B 4C90A 4PQQA 2RDRA 2VULA 4BOWA 2TNFA 5IW0A 5JMOA 3DCQA 1W6QB 1W9TA 2QQOA 2R071 4SBVA 1GNYA 5KC5A 2E7AA 5GKAC 2XWJB 3OPWA 2RS32 1XOYA 4D3WA 4MH0E 1ZRRA 2WA3A 4PDWA 4PT6A 1O3SA 1F31A 3ZFGA 2BV4A 2VMFA 2IXJA 4OQ9A 1NE6A 3O14A 4I0AA 5IAVA 1BEV1 2GP5A 5LBCA 1H2MA 3RS6A 1GV9A 2NMOA 2ARXA 2ZTNA 1RUI1 2R16A 4PDWB 1ZBE3 1OA4A 4FP3A 1T6BX 4C1XA 3HPNA 1KDKA 1NKGA 4WV8A 5LA9A 2ORZA 2NPIA 3H8XA 5FZCA 3U75A 3WP4A 3ZYBA 3UYJA 3ZPYA 2W39A 4FOWA 4BXSV 4MOAA 5FZ7A 1V6KA 2BDRA 4KQ7A 5IVVA 1GUIA 1OD5A 1UKGA 4LTAA 4DUVA 1LOCA 3RI8A 2JB8A 4Q4Y2 5A7SA 2DUPA 5D1IA 1BQPA 3CEWA 2RE9A 2VTXA 2C4XA 2QQKA 3NNGA 2FZ2A 4P14A 4CCDA 3LF7A 3JBG3 3CIHA 2P4EA 2VG9A 4Q4X1 1UW8A 3U14A 3VBSB 1REEA 1ZRIA 4FOYA 3ZR6A 4E8DA 2XLGA 3WQBA 3MPPG 3WSOA 3BALA 3WNOA 3MIBA 3EO6A 4QT6A 5EPAA 4Q4W2 4XJAA 1UQXA 1W6OB 1XPWA 4KMQA 3GZUC 2ID4A 3H7YA 3A0NA 3APBA 3AXEA 4AAPA 5DUVA 4QB2A 5C4WB 5H9PA 3HAGA 2DVGA 4OLLA 1JYVA 1JYTA 2RS53 2JDUA 4AVCA 5CISA 4KBZA 5EHDA 3AMPA 2MHFA 4NPRA 4IXLA 4P9JA 4H55A 4COVA 1EYBA 1QNYA 2W94A 3KV4A 3BTXA 2VCCA 4GQ7A 2C26A 1IS3A 4BE3A 3USSA 2VW0A 2RHPA 4XUNA 1LEDA 1NCRA 4XUPA 3KM5A 1OC1A 3AKRA 3DKWA 4FPEA 2EIGA 1RUF1 4FVVA 4M3CA 5FPUA 4ZS3A 4ZHNA 1VBD1 4AQTA 3T0BA 2DCZA 1ULGA 5BNQA 3WG2A 2UYBA 4EE2A 3T4HB 1QJY3 4MV2A 3C2UA 3SMHA 4IQPA 3WNXA 4ZZ5A 4OMCA 3SNMA 1ZBE2 2JDKA 4CEWA 2BVBA 2WO3A 3ILRA 4HSJA 4I0BA 4ONUA 4MXWA 4AFMA 3S7EA 3HBZA 3W21A 2ZACA 3LFMA 4HPKA 1LENA 4DRVA 4CP1A 2XLFA 2BU9A 1PM4A 1NCQC 3JB4C 4LXLA 3AP7A 1OUSA 3WQ1A 4NUBA 1DYOA 1CJPA 1H2LA 4O9EA 3T08A 3WP3A 2C5DA 2VY0A 4CEWB 2E6VA 1WZXA 3ZM8A 4JX0A 4IE5A 2GZWA 4JRLA 5EZWA 2AYHA 4JGYC 3EMRA 4IERA 4K3UA 2D6MA 3VHPA 5FZBA 2WFPA 2RMU1 3M3CA 1QF3A 1ONAA 2DDUA 4NHKA 2KXLA 3AB0A 1H1MA 1DQ6A 1C1FA 1U5ZA 4O61A 3WDVA 3JBG2 4A6OA 3U4XA 3C8XA 4LBNA 1CWPA 1Z0HA 4CXWA 1UNBA 1UPSA 5JSOA 2FDKA 1G9FA 4BQ1A 3ZO0B 4PIYA 1KITA 5FY7A 4KGQA 5KXBA 3KVAA 1H4GA 5IFPA 1GR3A 1W8TA 2CYFA 1HKDA 2ZOEB 2XQRA 3IPVA 4CUCA 2PA7A 4LIUA 3V56A 1AR73 2Q30A 1C5IA 1CAVA 1R64A 2BOIA 4XF0A 4OQ8A 3UKVA 2RS52 1V6MA 4LBOA 4BISA 2P2KA 3VL9A 5FCCA 3U07A 3OBRA 5KXCA 3WQ0A 3IPVB 2KM2A 2RS13 4Z8BA 4NIHA 3O12A 5I0SA 4XETA 4JDNA 1CAVB 2WQ4A 2PLV1 4QU2A 1OF3A 5FZ1A 2VBBA 1RUD3 3RYPA 3WP5A 4GWNA 1C8M1 1UF2C 2B45X 3KF3A 3RYKA 3VD7A 5C70A 5A32B 4A3XA 1UYXA 1NLRA 3ZXEA 2QVSB 1LESA 1S4CA 4R9DA 1OH3A 3BUCA 3H1MA 1IOAA 1O8SA 1YHFA 4LHNA 3WCSA 3MDPA 1CVNA 2VMGA 1ZM1A 4BHPA 4KI5M 5J7MA 5T55A 2JKBA 5FREA 4XQ4A 3WHUA 1IG0A 1AR62 4LO8A 5GZFA 5JCTA 1JBCA 4B4PA 5AFBA 1RVF3 3FZ3A 4I02A 1CD3G 2A3YA 4AVSA 3LDBA 2XL7A 2DV9A 5T5JA 4QDRA 3OBZA 1HQNA 2JE8A 2ZX0A 1E57A 4D0QA 2V5YA 3VV1A 3PIJA 5HI0A 5HCBA 5A3LA 4QX0A 2X29A 5FJHA 3ZSLA 5JI9A 1MVEA 5LK5A 2V09A 2QQPA 1KS5A 2GNMA 5CKQA 5CBLA 1W2TA 1XNTA 1XNCA 2Y6HA 4DXSA 5DAVA 5HCFA 2OS2A 4EN8B 1OOPC 1W2NA 1PVC3 2WYSA 1P8JA 1X50A 2EXIA 4XZUG 3MI8A 1MS5A 3JD73 3LKJA 1XNBA 4XQWA 2UY8A 4PIZA 2R6QA 2Z79A 3PJYA 3Q8CA 3ZFEC 1AR72 2FDIA 2R7EB 4FO9A 2BNOA 3KHCA 5GLTA 3W5MA 1Q8VA 4XTMA 4CXYA 1GQGA 5A6XA 2X5IB 2DTYA 5IHRA 3RZGA 1W2UA 4KGGA 2YBPA 2ZHKA 2RS12 4BLJA 2WBKA 1UXXX 5JMCA 1LHWA 3LA7A 1WCDJ 3KT7A 5KHJA 1LOAA 3MV11 3JUUA 3WQ7A 5FOBB 3DGTA 1RUD2 1I9RA 1NAEA 1R1ZA 1UU6A 5GLVA 3Q9OA 5AC91 1LULA 1DLCA 2O8OA 1W6MB 3OGJA 3KV9A 1DBNA 3VDAA 1MS3A 4FPHA 1BMV1 1XRUA 1HLCA 2W68A 1W39A 4FP2A 1W8WA 1O7FA 5IWFA 3TB0A 2Q1FA 1OH4A 4KWKA 2P5BA 1VAVA 1HX6A 1EUTA 3VZOA 1NCQA 1QNWA 3HVDA 4QQHA 3I2IA 4UW4A 2CNAA 2A5ZA 4XF3A 4YM3A 5CFDC 3OYWA 3P6BA 1GOGA 1G9CA 1GQHA 3AP5A 2JIGA 1UXZA 1DG6A 1TVGA 2QDRA 4JGYA 1NY72 4I3PA 5HCHA 4RL7A 4CCCA 1NE4A 2VCMA 2R49A 3I3DA 1QMJA 2D98A 3O1UA 3OYWB 2GNBA 2R073 2AZ5A 1PO23 2HWB1 4FCAA 2WZEA 1A8MA 1JU3A 1UU5A 4JGYB 4YW5A 2VMHA 2JDPA 2VZVA 3WG3A 3GF6A 3PVBB 1JZ7A 1DQ4A 5LW9A 4HANA 1F4AA 2PHWA 2WJSA 4YRDA 4M0HA 1PVC2 3TEXA 1OVSA 4QPGC 2ZA9A 4IEWA 4FBFA 1RUI3 2CU5A 2QDNA 3JD72 1YJLA 3H1YA 1LCLA 1YIPA 2VOXA 5IJRA 3WHTA 3RI9A 3B02A 1FAYA 5FMCA 4AEKA 4DINB 1DIWA 4QX8A 3AM2A 1WW5A 3RMYA 3ELNA 1X9PA 2VW1A 1A3KA 2ZKLA 2VVDA 4EWAA 3SISA 2ZMKA 1PZ8A 2Y0OA 2AEYA 1KGYA
chains in the Genus database with same CATH topology
3VDCA 4CVUA 5C71A 1UWWA 3PUIA 1YQ2A 5G05L 3K75B 4CUBA 1WCQA 2YG0A 3HJRA 1KEXA 2WO2A 4JHZA 5A1AA 2VZSA 2VJXA 4HG6B 2J1TA 1CIYA 2VOTA 2ZEZA 1W8NA 1NUKA 3GGLA 5EIYB 2WO1A 1F4HA 2CDPA 3CMGA 4DXRA 3EB7A 3T2PA 5DN2A 4QX3A 5LA0A 3CZJA 3DECA 1PMHX 3FHAA 2VZ3A 4BDVB 2JKXA 3A7QA 1JZ8A 2VZOA 2WQ8A 2X10A 3ACIA 2YFUA 3WF0A 3W5NA 3HOBA 4XUQA 4RN5A 3CKHA 1J83A 3ACHA 1CX1A 5DPNA 2Y6GA 1OF4A 1D7PM 5EJZB 5CYYA 2W91A 4OYUA 2B4KA 1US2A 1SG3A 4XUTA 3DYOA 2VC9A 4XVHA 3C7HA 1UZ0A 4QPWA 3K46A 1UY2A 1ULOA 3WNLA 4DEVA 4QAWA 5B4XA 3NJXA 2Y64A 1L7RA 3SKVA 2WDBA 5HXMA 4UAPA 2J1SA 4YPJA 3I2HA 5B4NA 3EYPA 1DP0A 3OG2A 3IDAA 2C9KA 3FN9A 2WAAA 3U37A 4W8JA 4DUWA 4QDSA 1GOFA 1JZ5A 2J1AA 5IYYA 3ACFA 3LQCA 3A22A 2Y6JA 3MBWA 3NRUA 4D8MA 1HN1A 3OEBA 3VD3A 4W50A 1CZSA 3OGSA 2EIEA 2VL4A 3I3BA 2VCBA 4CU7A 5JXIA 1EUUA 4A45A 3ECQA 1LNSA 1O8PA 4A42A 3T09A 3CQOA 5JUVA 2HYXA 1CZTA 2WABA 2V4VA 3WNNA 3MUY1 3DYPA 3HNYM 4A4AA 2V72A 1OT5A 3HEIA 4AAXA 1UY3A 4OMDA 4QDQA 4CUAA 1JYXA 2W5FA 1H6YA 5G04L 3THCA 1UX7A 3T0DA 2VZTA 4GWJA 3ABZA 3IAQA 4DUXA 3LEIA 3CZUA 1JHJA 3ACGA 1JZ4A 2WUHA 5C7GA 2BGPA 2W1QA 3CDZB 4XURA 4OZOA 4L0PA 5JXJA 2XQXA 3LE0A 5FUIA 2VR4A 5JR2A 3I2GA 3VD4A 3MUZ1 4QX2A 1US3A 1W9WA 3IIIA 3I2JA 4BK4A 1JZ2A 2WN3A 4A3ZA 4E8CA 1UY4A 3WF3A 2EICA 2W95A 2ORXA 3C7OA 2WN2A 2OKXA 3K4DA 5LA1A 5JXHA 1O59A 2VM9A 3F2ZA 4M4PA 1GQPA 2V5DA 1UYYA 3IAPA 5DQ0A 2LS6A 3C7GA 4ZXEA 3ETPA 4TTGA 4P02B 4A41A 4AG4A 2VZ1A 3MV01 1GOHA 4RYDA 4PQQA 5JMOA 1ULPA 1W9TA 2QQJA 2QQOA 1JYNA 1GNYA 4ET7A 2WAOA 2ZEWA 4P5YA 2QQLA 4PT6A 1XC6A 3UNPA 4MADA 2VMFA 3OGRA 4MGQA 3MO4A 3VD5A 1UY0A 1MPXA 1OD3A 2VZUA 4JKMA 3DYMA 3AC0A 3E1F1 3HPNA 5DMYA 1NKGA 4CU8A 2ORZA 4OUEA 2L9LA 2QQNA 3I97A 4XUOA 1GMMA 4ARYA 3LEKA 1W8OA 2VQTA 2E33A 4MOAA 4BXSV 1W99A 3OB8A 1GUIA 1JI6A 4DUVA 2VTFA 1JU4A 2VZRA 3SEEA 3NNGA 2C4XA 2QQKA 4ZZ8A 1RYYA 2VMCA 5IFTA 3CIHA 4E8DA 3WQBA 3WSOA 3WNOA 2E31A 3BN6A 2W92A 5F7UA 3GM8A 3VDBA 1XPWA 1GU3A 4KMQA 1K12A 2ID4A 4PF1A 3SEPA 2PQSA 4BK5A 4QB2A 1XNAA 4W4ZA 1JYVA 5HPOA 3FHQA 4A44A 1L7QA 2W94A 2DCKA 2VCCA 2E26A 2C26A 3A21A 4XUNA 1UMIA 4XUPA 2ZEXA 3HN3A 3BGAA 1I5PA 4UOJA 2LW8A 1UYZA 3T0BA 3K4ZA 2Z4FA 5J1XA 1K42A 4ZZ5A 4OMCA 3C7FA 2WO3A 4M4RA 4GWIA 4LHSA 3I3EA 4LQRA 3GDBA 2XOMA 2VZQA 3FL7A 1DYOA 3T08A 2X09A 4CU6A 1W0NA 3ZM8A 4JX0A 3I2KA 1H6XA 2RVAA 3UESA 5I0DA 2J1VA 2E32A 4GZ9A 1IQDC 1SHWB 3T2OA 2VMEA 2DDUA 2BBAA 4JKLA 4A6OA 3GXUA 3C8XA 3WF4A 1UY1A 3IB3A 3WEZA 4P00B 2Y8KA 1W9SA 3THDA 2J1RA 5IFPA 1BHGA 3K77A 4QB1A 2X05A 4KWUA 4CUCA 4MGSA 3HNBM 1R64A 2CDOA 4TXWA 4FI9A 4QB6A 2XONA 3I2FA 1JZ3A 1OF3A 4P08A 3HNMA 2JDAA 2QQMA 3UETA 3LPGA 3LPFA 3WNKA 2VQUA 2XHNA 3J7HA 3VD7A 5C70A 3WF1A 1UYXA 2J1UA 1O8SA 2YC2A 1WKYA 3LEGA 4KI5M 3NJVA 2QQIA 2W1WA 2BGOA 2YB7A 5LCWL 2Y6LA 4QDRA 2JE8A 4D0QA 2RJ2A 2KD7A 2EIBA 4LKSA 2QBXA 3SKJE 4QX0A 2VMDA 4ARXA 1SDDB 2RV9A 2BZDA 2HLEA 3K4AA 1XNTA 4DXSA 2Y6HA 3OGVA 2WZ8A 2J22A 3WNPA 3PUHA 2WYSA 1P8JA 4ZY9A 4MO3M 4XZUG 2J1EA 3OEAA 1K3IA 4JKKA 2VO5A 1PX3A 2R7EB 4DEQA 3W5MA 1TG7A 5IHRA 4DXTA 2WBKA 1UXXX 3P1IA 4CU9A 2ZXQA 3MV11 2W46A 3WNMA 2DCJA 1NAEA 1J84A 1NX9A 1DLCA 1CZVA 4IUGA 2W1UA 3WF2A 3VDAA 2J7MA 3VD9A 1JZ6A 2VCAA 1OH4A 4BJ0A 1EUTA 3I2IA 3P6BA 1GOGA 4QX1A 1UXZA 1TVGA 2YFZA 2W87A 2ZEYA 5JXGA 4UI9L 3C7EA 3I3DA 3T0AA 2EIDA 2W1SA 1PX4A 2BERA 2WZEA 1JU3A 1JYWA 2W9XA 1T2XA 2Y6KA 2VZVA 1JZ7A 5EJ1B 3A23A 1F4AA 4Z2AA 5CZKA 2B9VA 3OBAA 4LPLA 1UMHA 1K45A 5IJRA 2W47A 3D3AA 3JXSA 1PMJX 2W3JA 2YC4A 3NQHA 5LA2A 3T2QA 2VZPA 1KGYA 2JD9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VDC A;  4CVU A;  5C71 A;  1UWW A;  3PUI A;  1YQ2 A;  5G05 L;  3K75 B;  4CUB A;  1WCQ A;  2YG0 A;  3HJR A;  1KEX A;  2WO2 A;  4JHZ A;  5A1A A;  2VZS A;  2VJX A;  4HG6 B;  2J1T A;  1CIY A;  2VOT A;  2ZEZ A;  1W8N A;  1NUK A;  3GGL A;  5EIY B;  2WO1 A;  1F4H A;  2CDP A;  3CMG A;  4DXR A;  3EB7 A;  3T2P A;  5DN2 A;  4QX3 A;  5LA0 A;  3CZJ A;  3DEC A;  1PMH X;  3FHA A;  2VZ3 A;  4BDV B;  2JKX A;  3A7Q A;  1JZ8 A;  2VZO A;  2WQ8 A;  2X10 A;  3ACI A;  2YFU A;  3WF0 A;  3W5N A;  3HOB A;  4XUQ A;  4RN5 A;  3CKH A;  1J83 A;  3ACH A;  1CX1 A;  5DPN A;  2Y6G A;  1OF4 A;  1D7P M;  5EJZ B;  5CYY A;  2W91 A;  4OYU A;  2B4K A;  1US2 A;  1SG3 A;  4XUT A;  3DYO A;  2VC9 A;  4XVH A;  3C7H A;  1UZ0 A;  4QPW A;  3K46 A;  1UY2 A;  1ULO A;  3WNL A;  4DEV A;  4QAW A;  5B4X A;  3NJX A;  2Y64 A;  1L7R A;  3SKV A;  2WDB A;  5HXM A;  4UAP A;  2J1S A;  4YPJ A;  3I2H A;  5B4N A;  3EYP A;  1DP0 A;  3OG2 A;  3IDA A;  2C9K A;  3FN9 A;  2WAA A;  3U37 A;  4W8J A;  4DUW A;  4QDS A;  1GOF A;  1JZ5 A;  2J1A A;  5IYY A;  3ACF A;  3LQC A;  3A22 A;  2Y6J A;  3MBW A;  3NRU A;  4D8M A;  1HN1 A;  3OEB A;  3VD3 A;  4W50 A;  1CZS A;  3OGS A;  2EIE A;  2VL4 A;  3I3B A;  2VCB A;  4CU7 A;  5JXI A;  1EUU A;  4A45 A;  3ECQ A;  1LNS A;  1O8P A;  4A42 A;  3T09 A;  3CQO A;  5JUV A;  2HYX A;  1CZT A;  2WAB A;  2V4V A;  3WNN A;  3MUY 1;  3DYP A;  3HNY M;  4A4A A;  2V72 A;  1OT5 A;  3HEI A;  4AAX A;  1UY3 A;  4OMD A;  4QDQ A;  4CUA A;  1JYX A;  2W5F A;  1H6Y A;  5G04 L;  3THC A;  1UX7 A;  3T0D A;  2VZT A;  4GWJ A;  3ABZ A;  3IAQ A;  4DUX A;  3LEI A;  3CZU A;  1JHJ A;  3ACG A;  1JZ4 A;  2WUH A;  5C7G A;  2BGP A;  2W1Q A;  3CDZ B;  4XUR A;  4OZO A;  4L0P A;  5JXJ A;  2XQX A;  3LE0 A;  5FUI A;  2VR4 A;  5JR2 A;  3I2G A;  3VD4 A;  3MUZ 1;  4QX2 A;  1US3 A;  1W9W A;  3III A;  3I2J A;  4BK4 A;  1JZ2 A;  2WN3 A;  4A3Z A;  4E8C A;  1UY4 A;  3WF3 A;  2EIC A;  2W95 A;  2ORX A;  3C7O A;  2WN2 A;  2OKX A;  3K4D A;  5LA1 A;  5JXH A;  1O59 A;  2VM9 A;  3F2Z A;  4M4P A;  1GQP A;  2V5D A;  1UYY A;  3IAP A;  5DQ0 A;  2LS6 A;  3C7G A;  4ZXE A;  3ETP A;  4TTG A;  4P02 B;  4A41 A;  4AG4 A;  2VZ1 A;  3MV0 1;  1GOH A;  4RYD A;  4PQQ A;  5JMO A;  1ULP A;  1W9T A;  2QQJ A;  2QQO A;  1JYN A;  1GNY A;  4ET7 A;  2WAO A;  2ZEW A;  4P5Y A;  2QQL A;  4PT6 A;  1XC6 A;  3UNP A;  4MAD A;  2VMF A;  3OGR A;  4MGQ A;  3MO4 A;  3VD5 A;  1UY0 A;  1MPX A;  1OD3 A;  2VZU A;  4JKM A;  3DYM A;  3AC0 A;  3E1F 1;  3HPN A;  5DMY A;  1NKG A;  4CU8 A;  2ORZ A;  4OUE A;  2L9L A;  2QQN A;  3I97 A;  4XUO A;  1GMM A;  4ARY A;  3LEK A;  1W8O A;  2VQT A;  2E33 A;  4MOA A;  4BXS V;  1W99 A;  3OB8 A;  1GUI A;  1JI6 A;  4DUV A;  2VTF A;  1JU4 A;  2VZR A;  3SEE A;  3NNG A;  2C4X A;  2QQK A;  4ZZ8 A;  1RYY A;  2VMC A;  5IFT A;  3CIH A;  4E8D A;  3WQB A;  3WSO A;  3WNO A;  2E31 A;  3BN6 A;  2W92 A;  5F7U A;  3GM8 A;  3VDB A;  1XPW A;  1GU3 A;  4KMQ A;  1K12 A;  2ID4 A;  4PF1 A;  3SEP A;  2PQS A;  4BK5 A;  4QB2 A;  1XNA A;  4W4Z A;  1JYV A;  5HPO A;  3FHQ A;  4A44 A;  1L7Q A;  2W94 A;  2DCK A;  2VCC A;  2E26 A;  2C26 A;  3A21 A;  4XUN A;  1UMI A;  4XUP A;  2ZEX A;  3HN3 A;  3BGA A;  1I5P A;  4UOJ A;  2LW8 A;  1UYZ A;  3T0B A;  3K4Z A;  2Z4F A;  5J1X A;  1K42 A;  4ZZ5 A;  4OMC A;  3C7F A;  2WO3 A;  4M4R A;  4GWI A;  4LHS A;  3I3E A;  4LQR A;  3GDB A;  2XOM A;  2VZQ A;  3FL7 A;  1DYO A;  3T08 A;  2X09 A;  4CU6 A;  1W0N A;  3ZM8 A;  4JX0 A;  3I2K A;  1H6X A;  2RVA A;  3UES A;  5I0D A;  2J1V A;  2E32 A;  4GZ9 A;  1IQD C;  1SHW B;  3T2O A;  2VME A;  2DDU A;  2BBA A;  4JKL A;  4A6O A;  3GXU A;  3C8X A;  3WF4 A;  1UY1 A;  3IB3 A;  3WEZ A;  4P00 B;  2Y8K A;  1W9S A;  3THD A;  2J1R A;  5IFP A;  1BHG A;  3K77 A;  4QB1 A;  2X05 A;  4KWU A;  4CUC A;  4MGS A;  3HNB M;  1R64 A;  2CDO A;  4TXW A;  4FI9 A;  4QB6 A;  2XON A;  3I2F A;  1JZ3 A;  1OF3 A;  4P08 A;  3HNM A;  2JDA A;  2QQM A;  3UET A;  3LPG A;  3LPF A;  3WNK A;  2VQU A;  2XHN A;  3J7H A;  3VD7 A;  5C70 A;  3WF1 A;  1UYX A;  2J1U A;  1O8S A;  2YC2 A;  1WKY A;  3LEG A;  4KI5 M;  3NJV A;  2QQI A;  2W1W A;  2BGO A;  2YB7 A;  5LCW L;  2Y6L A;  4QDR A;  2JE8 A;  4D0Q A;  2RJ2 A;  2KD7 A;  2EIB A;  4LKS A;  2QBX A;  3SKJ E;  4QX0 A;  2VMD A;  4ARX A;  1SDD B;  2RV9 A;  2BZD A;  2HLE A;  3K4A A;  1XNT A;  4DXS A;  2Y6H A;  3OGV A;  2WZ8 A;  2J22 A;  3WNP A;  3PUH A;  2WYS A;  1P8J A;  4ZY9 A;  4MO3 M;  4XZU G;  2J1E A;  3OEA A;  1K3I A;  4JKK A;  2VO5 A;  1PX3 A;  2R7E B;  4DEQ A;  3W5M A;  1TG7 A;  5IHR A;  4DXT A;  2WBK A;  1UXX X;  3P1I A;  4CU9 A;  2ZXQ A;  3MV1 1;  2W46 A;  3WNM A;  2DCJ A;  1NAE A;  1J84 A;  1NX9 A;  1DLC A;  1CZV A;  4IUG A;  2W1U A;  3WF2 A;  3VDA A;  2J7M A;  3VD9 A;  1JZ6 A;  2VCA A;  1OH4 A;  4BJ0 A;  1EUT A;  3I2I A;  3P6B A;  1GOG A;  4QX1 A;  1UXZ A;  1TVG A;  2YFZ A;  2W87 A;  2ZEY A;  5JXG A;  4UI9 L;  3C7E A;  3I3D A;  3T0A A;  2EID A;  2W1S A;  1PX4 A;  2BER A;  2WZE A;  1JU3 A;  1JYW A;  2W9X A;  1T2X A;  2Y6K A;  2VZV A;  1JZ7 A;  5EJ1 B;  3A23 A;  1F4A A;  4Z2A A;  5CZK A;  2B9V A;  3OBA A;  4LPL A;  1UMH A;  1K45 A;  5IJR A;  2W47 A;  3D3A A;  3JXS A;  1PMJ X;  2W3J A;  2YC4 A;  3NQH A;  5LA2 A;  3T2Q A;  2VZP A;  1KGY A;  2JD9 A; 
#chains in the Genus database with same CATH topology
 2WZR 1;  4CVU A;  1FI2 A;  1UWW A;  1YJK A;  2YDE A;  3JZV A;  3N7K A;  4MZU A;  4K20 A;  4ZKT B;  5LBE A;  4CUB A;  1M06 G;  1RL3 A;  2PQQ A;  2WNE A;  5DAQ A;  5J48 A;  2E51 A;  1DQ5 A;  2BWC A;  2BRT A;  4QX7 A;  3AFK A;  4Q4X 3;  2IVJ A;  3NJZ A;  5A1A A;  2VZS A;  2CY6 A;  2VQA A;  1D4M 3;  4CEY C;  1ULF A;  3LA2 A;  4PI2 A;  1CAW A;  3J7M A;  1G7Y A;  4ZON A;  2VEC A;  2GP3 A;  3MIF A;  4XFA A;  5FYY A;  1RUH 3;  3OOX A;  5FXX A;  2D3S A;  2JDY A;  3JQW A;  3R6S A;  3DEC A;  4LO7 A;  3UGG A;  1CAW B;  2PHD A;  2XR4 A;  2ZAB A;  4XIK A;  3DXU A;  4IE7 A;  1XE7 A;  2R07 2;  1PO2 2;  2UYA A;  5FWE A;  4B7K A;  2X10 A;  4PLN A;  4RHV 3;  5CNA A;  5C33 A;  4Y20 B;  1QXJ A;  3AZY A;  5A7O A;  1OOP A;  4RGG A;  2XJR A;  1VBD 3;  3HOB A;  4XE9 A;  2Y38 A;  5F5I A;  4XUQ A;  1LJ7 A;  3CKH A;  4FPG A;  4E27 A;  2CGP A;  4F8A A;  1CX1 A;  1AR9 3;  3Q8A A;  4Y1Y A;  3ZFE A;  1RUI 2;  3LA3 A;  1IS6 A;  1QJF A;  4FFF A;  1IQA A;  1DGW A;  3RJ2 X;  3TEY A;  3AP9 A;  4YZ5 A;  2NP0 A;  2QJV A;  4Z92 B;  1WMF A;  5EJZ B;  5CYY A;  2Z2S B;  2GDF A;  5FZO A;  3AX4 A;  3RG0 A;  4DPN A;  1LOF C;  1US2 A;  1SG3 A;  1ZA4 A;  2DTW A;  3B9I A;  4UW3 A;  3BB6 A;  4OHW A;  4XUT A;  3OGG A;  5FP3 A;  3MF6 A;  5K7P A;  1H8T B;  1JYC A;  3K46 A;  1G9D A;  4YVW B;  1N1V A;  2A1X A;  3ETQ A;  2QCS B;  4NHM A;  5FZO B;  3PMS A;  3NJX A;  4E4S A;  2RMU 3;  5GLU A;  1L7R A;  1R1A 1;  3QLQ A;  3SKV A;  3IMN A;  3LFI A;  2WT0 A;  2RM2 1;  3DL3 A;  1ENR A;  2V73 A;  4QGM A;  4YSF A;  2XPJ A;  3S7I A;  4YPJ A;  1QJU 1;  2ZGT A;  2ZBJ A;  5BNN C;  2NM1 A;  5C3P A;  1D4M 2;  5CFD A;  4D69 A;  2LM3 A;  1DP0 A;  3OCP A;  1JYI A;  3N36 A;  5IVY A;  4IEY A;  1G9A A;  2VUA A;  3FN9 A;  4OHV A;  3KQR A;  2WAA A;  5FKC A;  1QHD A;  1S2K A;  4Q27 A;  3N9N A;  1OKO A;  4NOT A;  4AI8 A;  5CFD B;  2J1A A;  4JC1 A;  5KXE A;  1RUH 2;  2QZ3 A;  2GH2 A;  3A22 A;  2YRO A;  3IDE A;  2ET7 A;  3TYJ A;  4ITC A;  1TQ5 A;  1S0B A;  2Y6J A;  3MBW A;  3ZYJ B;  1VBB 1;  3ES1 A;  1S55 A;  4OCT A;  4AI3 A;  3O5S A;  5FUN A;  3SC7 X;  2PLV 3;  4RS5 C;  3TWI A;  2VL4 A;  2VCB A;  3POS A;  4RHV 2;  1SCR A;  4IE4 A;  4K7J A;  4K1Z A;  1I5Z A;  4JTN A;  3ZSJ A;  1VBD 2;  3POF A;  1POV 0;  4QPG A;  3WG1 A;  3M3Q A;  1C8M 3;  4R8H A;  3S30 A;  3ZYP A;  1LNS A;  1O8P A;  2FCU A;  2K2S A;  3PVE A;  4A42 A;  3TEW A;  1AR9 2;  1JTZ X;  1RXF A;  4LO4 B;  3BTZ A;  3AYE A;  1AYN 1;  2V4V A;  3CNA A;  1N3P A;  3WNN A;  3O0W A;  4MHR A;  3EHK A;  3MUY 1;  2UUR A;  4QPG B;  1TMF 1;  3D0J A;  2WNV C;  4AAX A;  2FDG A;  2ZCW A;  4KNC A;  3BOP A;  4FPY A;  4ZU5 A;  1XU2 A;  3FLT A;  4PCR A;  3PUQ A;  5FV3 A;  2Z42 A;  3CLP A;  1JOD A;  5JVV A;  1HB4 A;  2W5F A;  4RQP C;  1H6Y A;  1O4Y A;  1R09 1;  1UX7 A;  2VZT A;  1LRH A;  1QOT A;  2VOV A;  4GWJ A;  2ZGN A;  4QPI C;  4JRA A;  2JEM A;  1MS1 A;  4PBO A;  4AE2 A;  2TUN A;  4DUX A;  4RR3 C;  5JSR A;  1PO1 3;  2RMU 2;  5JIA A;  1UKR A;  3LEI A;  3ZXJ A;  3MYX A;  4JGZ C;  3N9P A;  4XFC A;  5IVE A;  1JZ4 A;  3ITQ A;  1X33 A;  1X82 A;  3CDZ B;  4CEY A;  5L19 A;  1YLL A;  4NRM A;  5JXJ A;  4BYY A;  4PJY A;  1BYH A;  3ZMN A;  3FHI B;  2NQY A;  4UBG A;  2PHF A;  1VB4 A;  1G8W A;  4Q26 A;  1H8V A;  3NVC A;  5JDB A;  3H8R A;  4GKY A;  5CB7 A;  3MUZ 1;  4QX2 A;  2ZJC A;  4CEY B;  5E8A A;  3SCF A;  1GZW A;  3OUJ A;  4A3Z A;  4E8C A;  3N4M A;  2JG9 C;  1OQ1 A;  1ZA7 A;  4XBN A;  3C7O A;  2W95 A;  2ORX A;  3NAP B;  5EXO A;  1UIJ A;  4JCK A;  4ORF A;  3K4D A;  2OKX A;  4F83 A;  1WA4 A;  1CJD A;  2H6B A;  2Q1Z B;  4FPJ A;  1O59 A;  2BW8 A;  1ULC A;  1ENQ A;  2IFW A;  5A7W B;  4Z07 A;  1CQ9 A;  1F2N A;  2MEV 1;  2Q5T A;  5FIX A;  5FY0 A;  4YW6 A;  1NXM A;  1QY4 A;  1AR8 1;  3HN1 A;  1UYY A;  4N43 C;  2RDS A;  5EYX A;  3I54 A;  3BTY A;  1C8M 2;  3ETP A;  3LCP A;  4UFI A;  1FX5 A;  4LIT A;  1E5H A;  2VXJ A;  2WFF 1;  2YPD A;  2E7T A;  1PK6 C;  4BQ5 A;  1FNY A;  2A73 B;  4Y1Z A;  2BFU L;  1LOF A;  3UKT A;  2WAO A;  1W2O A;  2ZEW A;  4P5Y A;  1AX1 A;  1VAL A;  2UWB A;  4XFG A;  2YYO A;  4ZXK A;  1XC6 A;  2GC0 A;  3A4U A;  3OGR A;  3MO4 A;  4X8P A;  2TEP A;  5GZD A;  1U5Y A;  4Y5S A;  1XB9 A;  2VZU A;  4AZZ A;  1AUY A;  1DYP A;  2HH9 A;  1RGS A;  1XBF A;  3S57 A;  2D6L X;  1PO1 2;  1VRH 1;  3AC0 A;  4PLO A;  5BNN A;  1C5H A;  5F5A A;  5DMY A;  3M3O A;  4FTE A;  2WSV A;  1K5M B;  2QQN A;  4XUO A;  4ES9 A;  1QOO A;  1RUO A;  1OHF A;  2XGX A;  4ARY A;  1A78 A;  2B7Y A;  1QWR A;  2R04 3;  3LEK A;  1W8O A;  4UXA A;  3VBR B;  2VQT A;  2E33 A;  1MZF A;  4Q4V 3;  4BQY A;  3OB8 A;  3J7N A;  1JI6 A;  1ND2 B;  1HQW A;  4NPL A;  1VMF A;  2VZR A;  5FP4 A;  4XHX A;  3SEE A;  3PUS A;  2Z69 A;  4J1W A;  2XG3 A;  1RYY A;  1V6J A;  4QXK A;  5GJ6 A;  3TOJ A;  4AVT A;  5IFT A;  2XB6 C;  4RS5 A;  5LK7 B;  1XXN A;  3E5X A;  4XJ9 A;  2HWD 2;  3IWZ A;  1Y4W A;  3KQ4 B;  4UF0 B;  3UJO A;  4Q0V A;  5LZ6 A;  1H2K A;  5FXW A;  3BN6 A;  3WW3 A;  3VBS C;  4YG6 A;  4FAH A;  5BNO B;  3ZSM A;  1K12 A;  3KV5 A;  2BVV A;  4BCU A;  4XAC A;  1SMV A;  4FFI A;  1OPO A;  4XIO A;  3QBQ A;  4W4Z A;  4KH9 A;  4N53 C;  3TN9 1;  4N90 A;  3FHQ A;  3VN4 A;  2WNV A;  3ALQ A;  1AX0 A;  3KT1 A;  4OUS A;  3OUI A;  3KCC A;  1ACC A;  2DCK A;  2E26 A;  2HWC 1;  2FMD A;  1RUG 1;  1UX6 A;  1REF A;  3FWE A;  4RQP A;  4AHZ A;  1EP0 A;  3PLQ A;  3TBD A;  5A6Z A;  3WDW A;  5FO8 B;  3VBU C;  1N47 A;  4QPI A;  5LY1 A;  2JG8 B;  2LW8 A;  1YNA A;  3QOP A;  4RR3 A;  5FKB A;  1VAM A;  4NHY A;  1C4R A;  4LUL A;  4A7K A;  4HK9 A;  1KXG A;  3POE A;  1OLQ A;  4HBN A;  1WGP A;  3UKN A;  3VZJ A;  4CPB D;  2A3X A;  4M4R A;  4YW4 A;  4GWI A;  4LHS A;  5J96 B;  3I3E A;  5FYU A;  4RR3 B;  4WVZ A;  1EAH 1;  1VBC 2;  2VZQ A;  5F2W A;  2DUQ A;  5F3C A;  3OJB A;  2VTX J;  4XAE A;  1ZNP A;  3FL7 A;  3MW4 A;  5IVF A;  4ZPI A;  5KHG A;  2R04 2;  4MGT A;  4IND A;  1W0N A;  2JE9 A;  3I8T A;  4OI4 A;  3SH3 A;  4Q4V 2;  2JG9 A;  1GNH A;  3I2K A;  2ZHM A;  2GN3 A;  3J8F 3;  2J1V A;  5FYH A;  2Y26 A;  1ZZ8 A;  4GZ9 A;  1BKZ A;  2ZHL A;  4XDQ A;  5DDJ 3;  5IUQ A;  3VUO A;  2VME A;  4H7L A;  4IE0 A;  3ST7 A;  3JCI A;  4ZS2 A;  1YC6 1;  2JG9 B;  1PM7 A;  2WT2 A;  2F6B A;  2XJT A;  3IM0 A;  4Q0U A;  4GJY A;  3WF4 A;  4DOU A;  1A34 A;  2WL1 A;  4H3W A;  3WEZ A;  3OSD A;  4P9W A;  4N43 A;  2VUJ A;  5FZG A;  2J1R A;  5A7Q A;  1WMX A;  1O91 A;  3H1W A;  3K77 A;  5A33 A;  2X05 A;  4KWU A;  3FE5 A;  4IW3 A;  4CP0 A;  3O1O A;  2OVU A;  1CAX B;  3HQR A;  4MGS A;  2PHU A;  2RM2 3;  3T1L A;  4L2N A;  4QXB A;  3GYD A;  1PK6 A;  2CDO A;  2EF6 A;  3NNL A;  4N43 B;  4TXW A;  5HV4 A;  4BH9 A;  3VKL A;  4QB6 A;  3IKW A;  5A33 B;  2ERF A;  3G6J B;  4Q0S A;  3I2F A;  1SLL A;  4M00 A;  1W6Q A;  2WNU C;  2WO7 A;  4LUM A;  5K4L A;  3AYA A;  5ERL A;  2C6S A;  1GBG A;  4XDP A;  1JZ3 A;  1PK6 B;  2ZHN A;  1DGL A;  1YFX A;  4FQZ A;  4PF5 A;  5DUU A;  1JHN A;  3HNM A;  3UET A;  5A80 A;  1X36 A;  3B3Q E;  1FPN 3;  3LPG A;  3GZE A;  4NE9 A;  3WNK A;  5KHK A;  4TYS A;  2ZAH A;  4AHY A;  4N9H A;  1AHS A;  2R0H A;  1VBB 3;  2WKK A;  3VBH B;  4G9S B;  3G7D A;  3IDB B;  4NIG A;  2C1F A;  1OQE A;  1UO9 A;  3LEG A;  3AJZ A;  3OD4 A;  2K46 A;  3O0V A;  4FOV A;  1ND3 B;  2IXL A;  4LE4 A;  2W1W A;  1TE1 B;  4HT1 T;  2XVL A;  2ZML A;  3L2H A;  4E4Z A;  2FD8 A;  4WM8 B;  4I30 A;  1BVV A;  1AYN 3;  1W8F A;  3F95 A;  2CWS A;  3U78 A;  3WW2 A;  3J8F 2;  5F8P A;  1SLI A;  1DLL A;  2QTW B;  1TMF 3;  3LAG A;  5JLV A;  5DDJ 2;  3VZK A;  4R4Z A;  1HV0 A;  3KV6 A;  3NJY A;  1H0B A;  3KGZ A;  3ZDS A;  3J4U H;  4ARX A;  1JOB A;  1IZ3 A;  2HLE A;  3VBS A;  4IGO A;  2WII B;  1RUE 1;  5T52 A;  2J22 A;  1R09 3;  1VAK A;  1NA1 B;  4FFH A;  1UN1 A;  5A3O A;  5LEK A;  4GUL A;  3CU7 A;  2RJK A;  1W6O A;  2JWP A;  4QGN A;  4N53 A;  4MXV A;  1K3I A;  3ENR A;  4RGK A;  1NQD A;  1EV1 3;  2RM2 2;  3BYW A;  2VXR A;  3M4F A;  2VO5 A;  3MGU A;  5FP9 A;  2OII A;  5FYV A;  5TSW A;  5C5U A;  1MR5 A;  5FMD A;  1AXZ A;  1ZZC A;  5LBB A;  2A70 A;  3WIN E;  4AEM A;  1HRI 1;  5FK7 A;  4N53 B;  3KGL A;  2NZ9 A;  3LB9 A;  3FJS A;  1DZQ A;  3IN9 A;  2X5I C;  1UAI A;  4A7Y A;  1AYM 1;  3VBU A;  5IVB A;  2ATF A;  3NNM A;  4QQP A;  1VBA 3;  3MLJ A;  5FMO L;  4B4R A;  2R30 A;  3WDT A;  1JOJ A;  3PU3 A;  3PVN A;  1O5L A;  4I0W B;  1FPN 2;  3ATG A;  1UZV A;  4NHL A;  4URT A;  5KC6 A;  4IUG A;  1COV 1;  5CAZ A;  3KCY A;  3VBU B;  2BGC A;  2D93 A;  2J7M A;  5GAL A;  1NOV A;  2HWF 1;  2YGM A;  1LR5 A;  2OA2 A;  3D8C A;  1VBB 2;  5L73 A;  3POG A;  1XE8 A;  3GBF A;  2Q1M A;  2VCA A;  1W28 A;  4IV3 C;  3WW4 A;  4OHY A;  3KD4 A;  1DDL A;  1SLC A;  4Q1R A;  5FZ6 A;  5J98 B;  3WXP A;  1AR8 3;  2CSG A;  5FPV A;  1S0F A;  1QH6 A;  1IG3 A;  4D6R A;  1YUD A;  5FBJ A;  4NHX A;  2BFU S;  1JXN A;  5CAD A;  2W87 A;  2D6N A;  3VHN A;  2WFF 3;  1PMI A;  1V0A A;  4UI9 L;  3LOI A;  1AYN 2;  1UL9 A;  1R08 1;  5IAX A;  3OY8 B;  4YG0 A;  1J1T A;  4A6S A;  2BER A;  3W20 A;  4M0N A;  3ILN A;  3N3H A;  1JYW A;  4K21 A;  4WVV A;  3K3O A;  4Y4R A;  1T2X A;  4LA2 A;  3ZN5 A;  4WVW A;  1CPM A;  1SLA A;  1VRB A;  2LUW A;  4X8N A;  1FV3 A;  4QPY A;  1VBE 1;  1X7N A;  4HON A;  2B42 B;  4OUM A;  1R09 2;  5A3W A;  4CDQ C;  3NV2 A;  5F3I A;  2V4A A;  3MIC A;  4UBH A;  5CZK A;  1SLB A;  3WD5 A;  1VRH 3;  3R0R A;  4LOS A;  4XHB A;  2W47 A;  4XIL A;  3D3A A;  2Y33 A;  4EYU A;  1EV1 2;  2K9Z A;  3OPT A;  2FQP A;  1MZE A;  1PMJ X;  2IXI A;  3B94 A;  2W3J A;  2RDQ A;  4LT5 A;  2WNU A;  4W6Y A;  4JHT A;  1RB8 G;  5LA2 A;  3OBT A;  1X8M A;  3POI A;  1BZW A;  1ULE A;  1D4V B;  1VR3 A;  1Z7S 1;  3AK0 A;  4K40 A;  1OA2 A;  2WS9 1;  5A7N A;  2VNO A;  1VBA 2;  3ON7 A;  1AJK A;  4WM7 B;  1LU1 A;  1YQ2 A;  5EV7 A;  2WNU B;  4B29 A;  4K8F A;  1APN A;  3VBF C;  4B7E A;  4EN6 B;  2AGS A;  4COU A;  5BY5 A;  5APA A;  2DBI A;  2YG0 A;  3HJR A;  4XW3 A;  3ZSE A;  3IT8 A;  4C0H A;  5A32 A;  2YMZ A;  4Y24 A;  4TLF A;  3WLU A;  4XC9 A;  3LOB A;  4L11 A;  4DY3 A;  1OUR A;  2I45 A;  3T1M A;  5GLZ A;  3S0M A;  2BP6 A;  2FCT A;  1AR8 2;  1MEC 1;  1W8N A;  2K0G A;  1NUK A;  1QJY 2;  2WT1 A;  3GGL A;  3HWJ A;  4P9L A;  4UT5 A;  3SH4 A;  5EIY B;  1OXC A;  1QJX 3;  3TN9 3;  2E7Q A;  2Q4S A;  4QX3 A;  4AWD A;  2ZX1 A;  2CGN A;  1CX4 A;  3AP6 A;  3VBO B;  1FT9 A;  2WFF 2;  2WR9 A;  4MHU A;  4UYB A;  4ZU4 A;  4CP9 A;  5HV0 A;  2G9Z A;  3FHA A;  2VZ3 A;  1LHV A;  5ACA 3;  1XSR A;  4XFF A;  2GN7 A;  2HWC 3;  5I93 A;  1RUG 3;  2EAL A;  3ZXD A;  4NII A;  3O1R A;  4NIA A;  2OQ7 A;  2ZAA A;  4JTO A;  2XVK A;  3VB9 A;  2DU1 A;  1FMD 1;  3WF0 A;  4AYU A;  1GNZ A;  4CP9 B;  3W5N A;  1J59 A;  2DVA A;  5FZ8 A;  1ALY A;  1LOD A;  1XND A;  4UFJ A;  5FJK A;  4YW7 A;  4Q8K A;  1QJZ A;  4EZ4 A;  1YQ5 A;  1LOG A;  1YI9 A;  4RGA A;  5DPN A;  1OF4 A;  4L92 A;  4M3C F;  3PJQ A;  1RUC 1;  1VRH 2;  1MVQ A;  1WMD A;  3UK9 A;  1D0G A;  4MSV A;  4V2W A;  4F7Z A;  5K9Y A;  3I59 A;  4IET A;  4S2G A;  1HN0 A;  1XE0 A;  1EAH 3;  4LHL A;  5F6L B;  4AHX A;  1V6O A;  2ZGL A;  4OYU A;  2X5I A;  4LMF A;  5BPX A;  2P34 A;  1RUJ 3;  5L9R A;  1X9T A;  1RHI 1;  2E53 A;  2QNK A;  2VC9 A;  4XVH A;  3C7H A;  1UZ0 A;  2R32 A;  2SBA A;  4QPW A;  1UY2 A;  1OFN A;  1ULO A;  3I59 B;  3RJR A;  2YXS A;  2DUR A;  4QAW A;  1W6P A;  1XNK A;  3K48 A;  1H8T C;  4GAZ A;  4YVW C;  1PGW 2;  4Z1V A;  3N7J A;  2WDB A;  1M4W A;  3DPR B;  4TN7 A;  2E63 A;  1W6M A;  2UWC A;  4LJH A;  4WZC A;  4IV3 A;  4SLI A;  2VH9 A;  3MZH A;  5JZG B;  4QKN A;  4MLO A;  1W6P B;  5T5P A;  3EYP A;  3PU8 A;  4GJZ A;  3KWV A;  4OHX A;  5BNP C;  2JEN A;  5KR7 A;  4NMI A;  3NV1 A;  2HKX A;  3IDA A;  2C9K A;  4IGQ A;  4IV3 B;  3U37 A;  1ZZB A;  1JZ5 A;  4N7I A;  1QJX 2;  3TN9 2;  3H0O A;  1QU0 A;  3ZXA C;  2DU0 A;  5LBF A;  5ACA 2;  4TLG A;  3LDK A;  1S0G A;  1ZBA 1;  1HN1 A;  1A6C A;  2HWC 2;  3OEB A;  1QXP A;  2JX9 A;  3M3I A;  3MPB A;  1CZS A;  1JUH A;  3POB A;  4CE8 A;  1S0D A;  3V0B B;  2ZZQ A;  4GMP 0;  3O1M A;  1RVF 2;  4IEQ A;  3NMB A;  1PIV 1;  3LZZ A;  3AYD A;  2DFB A;  3QD6 A;  4JAA A;  3UJQ A;  4A45 A;  3VL8 A;  4CDQ A;  1BBT 1;  1UU4 A;  2I07 B;  3WT3 A;  1JH5 A;  3ZYH A;  4BM8 A;  1DHK B;  2CAU A;  3AJY A;  3V0A A;  4QHB A;  2BEO A;  3RZH A;  3T09 A;  3CQO A;  1W05 A;  2PXJ A;  4COW A;  2ZKN A;  3DEM A;  2EAK A;  2H0V A;  3GAL A;  4CDQ B;  1VPH A;  2GMM A;  4IL7 A;  4IES A;  1BEV 3;  3V0A B;  4OMD A;  4QDQ A;  1JYX A;  5E16 A;  1EAH 2;  1O5U A;  4BIF A;  1QDO A;  3ASI A;  2C0Z A;  1RUJ 2;  3ZYR A;  2QZ2 A;  3FMG A;  2H6C A;  5DAP A;  1LB2 A;  3VBF A;  3MLL A;  5A1L A;  3ABZ A;  2JDH A;  1F15 A;  3H50 A;  2P6C A;  5DAB A;  1SBD A;  3O1P A;  1JHJ A;  3ACG A;  4M01 A;  4COZ A;  2BGP A;  5C7G A;  3VBF B;  1K5J A;  3I2D A;  4OZO A;  1Q8Q A;  4C91 A;  2VUC A;  1GZC A;  1RUE 3;  5I0R A;  5FUI A;  2VR4 A;  1XQN A;  1OMI A;  5JR2 A;  2DVB A;  1QGL A;  5H9Q A;  1RIT A;  5J37 A;  1QH7 A;  3VD4 A;  3ORJ A;  3PNA A;  3B00 A;  4BK4 A;  1JZ2 A;  5D2A A;  3GBW A;  2WN3 A;  2O1Q A;  1DZT A;  2OQ6 A;  3H7J A;  2B39 A;  4FAG A;  1NG0 A;  1UY4 A;  3PVO A;  4A2U A;  1YCI A;  2DVF A;  3R4U A;  3CHX A;  1JOP A;  2A6Y A;  5FMO S;  1FOD 1;  1KFU L;  2WN2 A;  3AZV A;  2O8Q A;  5LA1 A;  4L8Q A;  1DFQ A;  1VP6 A;  3NAP C;  4R4X A;  1AYM 3;  4LIV A;  4L97 A;  2W0X A;  4MGK E;  4Y20 A;  1L7L A;  5BYN A;  2OYZ A;  1WCU A;  1I3H A;  2ENR A;  5FLH A;  2YC0 A;  5DQ0 A;  5F6K A;  1HRV 1;  1DGW X;  4GH4 B;  1F5F A;  4BWO A;  4UFM A;  3C7G A;  5ABJ C;  3H9A A;  2GC3 A;  2EXK A;  3W9A A;  1H9P A;  2PYT A;  5T5L A;  3ZYF A;  2HWF 3;  5JPM B;  4TTG A;  4LKD A;  2VZ1 A;  3WR0 A;  3MV0 1;  3M2M A;  1RUF 3;  2PHX A;  4AED C;  2OX0 A;  2QQJ A;  4CCJ A;  1W3V A;  4PIX A;  1U0A A;  1BEV 2;  2JXA A;  4CDW B;  2VPV A;  4RD7 A;  1H30 A;  4MAD A;  4D7T A;  4GMP 1;  2VVE A;  4MGQ A;  1GKB A;  2CV6 A;  1H8T A;  1UY0 A;  1MPX A;  4HN1 A;  1OD3 A;  2W08 A;  4YVW A;  1O4Z A;  4JKM A;  1R08 3;  3DYM A;  2JIC A;  3HQU A;  3KF5 A;  2PAE A;  5E88 A;  5CKN A;  5F9T A;  4Q0Q A;  2XJP A;  2PMW B;  5DG2 A;  5FPZ A;  2VMI A;  3T2T A;  3DV8 A;  4AL9 A;  5L7O C;  3E1F 1;  4FPF A;  1EPZ A;  1STM A;  2PHR A;  3WUC A;  2AR6 A;  3RWK X;  3M7A A;  4OUE A;  2L9L A;  5BNP A;  2DWR A;  4KL1 A;  1VIW B;  2VNG A;  1RUE 2;  1YIF A;  1CGP A;  1K5M C;  2JD4 A;  4DIQ A;  1J1L A;  1W99 A;  1OPM A;  4Q29 A;  4R52 A;  3VBR C;  4C8D A;  4FTB A;  4Q4X 2;  4FSJ A;  4AI1 A;  1JU4 A;  5BNP B;  2D40 A;  3WG4 A;  1ND2 C;  2MNG A;  1IS4 A;  2OPW A;  3MHZ A;  4ZZ8 A;  4B8E A;  4BPZ A;  1KS4 A;  3D0S A;  4Y22 A;  4YVS B;  2QE3 A;  1LGC A;  5C9A C;  5GZG A;  3M1H A;  3MIH A;  1IPK A;  3ZX7 A;  2IC1 A;  1Z7S 3;  2PAM A;  1AYM 2;  3AYC A;  2DF7 A;  4HVO A;  1HB3 A;  1BXH A;  1XJA A;  2BBV A;  5FYI A;  1ZX5 A;  5F7U A;  4N7U A;  4XJW A;  3WDY A;  3POY A;  3URF A;  3AVS A;  3GM8 A;  4Y22 B;  4E4H A;  1KJL A;  1WLC A;  3SEP A;  1SBE A;  1Q3E A;  3UV9 A;  2C9A A;  4LLO A;  3CBN A;  4PHZ A;  5BNO C;  1QXR A;  5C8C C;  4GKX A;  2JDZ A;  4KG8 A;  3MIE A;  4DO0 A;  1HW5 A;  4LO6 B;  5HPO A;  1PNG A;  2PHL A;  5E1R A;  3B5L B;  4Q4W 1;  3CF6 E;  4JDM A;  5H9R A;  3ZN4 A;  4DRR A;  5F5C A;  1UOG A;  1L7Q A;  1RUF 2;  4W65 A;  1PGS A;  5LAT A;  3HBK A;  4HZF A;  2I2S A;  1MS0 A;  2Y0I A;  3ZR5 A;  3H3L A;  1QQP 1;  5FQ0 B;  3AFG A;  4I01 A;  4KU7 A;  3FUO A;  4UOJ A;  2J42 A;  1UYZ A;  4UFL A;  3SCH A;  1UPI A;  3AMM A;  2JG8 C;  4XJU A;  2LRP A;  5J1X A;  4CDX B;  2N7G A;  1O3R A;  3C7F A;  3RRD A;  3T3Y A;  3P3P A;  4MX3 A;  2Q8D A;  2D3P A;  1FMD 3;  1N1S A;  3O7O A;  4LQR A;  1F35 A;  1W9Y A;  5FXV A;  5FWJ A;  5DUX A;  3BKZ A;  1YFY A;  4RA0 A;  5EP9 A;  4YYO A;  2X09 A;  3T4V A;  2AUY A;  3WY6 A;  1RMU 1;  3BPS A;  3ES4 A;  1RUC 3;  1U5X A;  1H6X A;  2RVA A;  5FYM A;  3UES A;  1WD3 A;  1G9B A;  1IQD C;  2ZGP A;  4BQ4 A;  1SHW B;  3T2O A;  4Z82 A;  4AK3 A;  2XUE A;  3IMM A;  3LSE A;  3NAP A;  2BBA A;  5A3U A;  3I3M A;  4OI2 A;  3GXU A;  2YV8 A;  1RHI 3;  4CSW A;  1C1L A;  4JDO A;  4DNY A;  2O0O A;  4KBB A;  3IB3 A;  4AI2 A;  1Z7S 2;  3K51 A;  5A7W A;  1W9S A;  4CPB A;  3THD A;  4PLM A;  4R9C A;  4AI9 A;  4YZ3 A;  1BHG A;  3DKQ A;  4P9X A;  4QB1 A;  2P37 A;  5ABJ A;  2GC1 A;  4TZD A;  2DCT A;  4YFZ A;  4C1W A;  2W52 A;  1QJE A;  4YGC A;  1GYK A;  4B4Q A;  4AED A;  3QAC A;  5DXD A;  5HBA A;  1S2E A;  2PLV 2;  5EJ3 A;  4Z2W A;  1PZ9 A;  4LE3 A;  5ABJ B;  4FPL A;  5AC9 3;  4XFH A;  1UIK A;  1IHM A;  2G9G A;  5SV5 A;  2A75 A;  5FZ9 A;  4P9I A;  1PVX A;  4K1Y A;  2RS5 1;  4YM0 A;  5D8A C;  1OBN A;  4AED B;  4P08 A;  4KWL A;  3ZMO A;  3ZXF A;  1LEC A;  2IXK A;  2QQM A;  3N9O A;  3LPF A;  5EYY A;  3DUI A;  4LUK A;  5H9S A;  2XHN A;  1YQ8 A;  4WZF A;  1RED A;  4LBQ B;  3J7H A;  2VVF A;  3PUA A;  4BMB A;  3EXU A;  5C3R A;  5L7O A;  2JDN A;  1ZBA 3;  3WF1 A;  1TEI A;  4CUG A;  2D6K A;  1OLM A;  4U2A A;  4XAA A;  4CXX A;  2YC2 A;  4Y1U A;  4XZP A;  1PIV 3;  4UFK A;  1FMD 2;  2P3Y A;  3AMQ A;  3RNS A;  3VBH C;  4P9G A;  1BBT 3;  1HB1 A;  1F5J A;  1K5M A;  2PEL A;  2GND A;  3OPZ A;  3ZKU A;  3AKS A;  4E2G A;  5L7O B;  1POV 1;  1URX A;  2BWA A;  2HWB 3;  2QQI A;  3UGF A;  3KZ4 C;  5K0U C;  1SCS A;  4HKW A;  2BGO A;  2WSU A;  4Y33 A;  3VBR A;  3ZIW A;  1ND3 C;  3MW2 A;  4FPK A;  5LCW L;  4AXO A;  2Y6L A;  2CWM A;  4HSL A;  5ANQ A;  1RUC 2;  1ND2 A;  1AR6 1;  5LEJ A;  4WM8 C;  3I2O A;  3AMH A;  1Q43 A;  5E6H A;  3THT A;  5JOY A;  5C9A A;  4XYX A;  4LKS A;  1BK1 A;  2EXJ A;  2QBX A;  4GA9 A;  5B2G B;  1O4T A;  2VMD A;  4AW7 A;  3SCG A;  2RV9 A;  1RHI 2;  3ZPO A;  2BZD A;  4YGB A;  3VZN A;  3K4A A;  1SPP A;  4UF0 A;  2E9Q A;  1YWK A;  3SXW A;  3WNP A;  5C9A B;  3N9Q A;  2O14 A;  4HFS A;  3BU7 A;  4ZY9 A;  5BNO A;  2ZGR A;  3KCX A;  4GXL A;  4DQA A;  2C24 A;  5C8C A;  5CEH A;  2BOJ A;  4AFB A;  1NA1 C;  3OEA A;  4JKK A;  3ZN6 B;  1NLQ A;  4CCO A;  2ARA A;  1SPP B;  1SQ4 A;  3WOG A;  3IZO A;  2WZR 3;  2VUD A;  3L2Y A;  4CCE A;  4XEZ A;  4DEQ A;  1SFY A;  4Y5Z 0;  5F2S A;  1YQC A;  5C8C B;  1TG7 A;  2A6Z A;  5IK4 A;  1AVB A;  4AGG A;  4LA3 A;  5AC9 2;  1LKN A;  4I09 A;  4DXT A;  1AR7 1;  1AL0 G;  4BME A;  3EQE A;  2FDJ A;  3O1V A;  4UW5 A;  3W58 A;  3L9J T;  1DYK A;  1Y43 B;  4YM1 A;  5LY2 A;  1BMV 2;  2DBN A;  3WNM A;  3FUQ A;  3VKO A;  2JG8 A;  1NX9 A;  1UD1 A;  4EWE A;  1O3T A;  1FYU A;  1F8V A;  1FOD 3;  1CZV A;  1V6L A;  4EWD A;  4YAR A;  1ZZ7 A;  2UWA A;  1MQT C;  3EJK A;  4XBQ A;  1QOS A;  1S0C A;  3VDD B;  3VD9 A;  1ZBA 2;  1OFS A;  2GSY A;  5A3M A;  1RUD 1;  2XDV A;  5BV6 A;  1N1Y A;  1YFU A;  2Q8C A;  1RXG A;  1BVP 1;  3AZX A;  2YUE A;  3VHR A;  5C8W A;  5F37 A;  3PIG A;  1OI6 A;  1BBT 2;  4RSU A;  4WVM B;  2PAK A;  4CZS A;  4QX1 A;  3ROU A;  2HWB 2;  1Q8O A;  2YFZ A;  5DZE A;  1ZVF A;  1C8N A;  2ZEY A;  3POJ A;  4HMZ A;  5JXG A;  5FMB A;  3I49 A;  1TME 1;  3GJA A;  2OXB A;  5DZG A;  1V9U 1;  1DQ0 A;  5A3N A;  4P5H A;  2B8M A;  2EID A;  2W1S A;  3B93 A;  4QXH A;  4BXF A;  1OVP A;  2W9X A;  1NY7 1;  4DMI A;  2GH8 A;  1WCK A;  4BU2 A;  1ZRE A;  4GMP 3;  5EJ1 B;  4LR4 A;  2FBE A;  4LBQ D;  5LWB A;  2FZ1 A;  3TNQ A;  5FPB A;  2PN5 A;  5KHI A;  4Z2A A;  1WW4 A;  1J3P A;  1W2A X;  1KDM A;  2B9V A;  2VD7 A;  5I8S A;  3I4I A;  1I6X A;  3OBA A;  1AXY A;  1UMH A;  1CAX A;  2HEV F;  3JXS A;  5FBZ A;  4WBB A;  1ODN A;  3NST A;  4AI0 A;  4AGR A;  5IAT A;  2WZR 2;  2YC4 A;  3R4D B;  1PVC 1;  1H2N A;  2DCY A;  3NQH A;  1Y7B A;  3FC0 A;  4MVT A;  3WDX A;  2MPF A;  2VNV A;  2AC1 A;  1R1A 3;  1YRZ A;  2ILM A;  3GBG A;  4H7M A;  5D8A A;  2VZP A;  4KU8 A;  2IUW A;  1N3O A;  1TNF A;  2D5F A;  2HWE 1;  1QJU 3;  4PQ9 A;  4IV1 B;  5G05 L;  3DN7 A;  3LDR A;  4WM7 C;  1LHU A;  1WCQ A;  2YZ4 A;  5D8A B;  4YW1 A;  3HR9 A;  3AMN A;  4NJ4 A;  4AGV A;  3VBH A;  2Y34 A;  2J1T A;  3GZT B;  5FY9 A;  1BK0 A;  1FNZ A;  4QGL A;  1W90 A;  3MF9 A;  5K0U A;  1TNR A;  4LNV A;  2VOT A;  5FZH A;  5IK8 A;  2ZEZ A;  4XOG A;  1V70 A;  2P1B A;  1ND3 A;  3N7M A;  4QQO A;  1F4H A;  3MFA A;  4S2F A;  4W6W A;  3ZYG A;  4EJR A;  3CMG A;  4B3N A;  4DXR A;  3RFR A;  3EB7 A;  3T2P A;  5T50 A;  4WM8 A;  1WCS A;  3CZJ A;  1PMH X;  5K0U B;  4A7Z A;  1QEX A;  2Y6F A;  2YPJ A;  1DF0 A;  1NZC A;  2JKX A;  3U11 A;  2WA4 A;  3VBO C;  2D6O X;  2WNO A;  2ETE A;  2WQZ C;  1WLW A;  1WME A;  2FDH A;  5T3N A;  2H0B A;  3LWC A;  2GU9 A;  1NYW A;  3ZFF B;  1QQP 3;  4I2O A;  1ASJ 1;  3ZXL A;  1QIQ A;  1LU2 A;  3ZXG A;  1PO2 1;  1S0J A;  4RN5 A;  1AXK A;  3N9L A;  1NA1 A;  2CL2 A;  4JVA A;  5FZD A;  2Y6G A;  4HN0 A;  2ZMN A;  2R1D A;  1WUV A;  1BCX A;  1D7P M;  1ENS A;  2R06 1;  2VBD A;  3HMY A;  3I3Q A;  1S2B A;  3HT1 A;  1NXD 1;  3N9M A;  4NAM A;  2P6H A;  2QUO A;  4ASK A;  2WYF A;  3D82 A;  4CCM A;  4LKF A;  2GME A;  4NID A;  5F32 A;  5D21 A;  1W3X A;  1CPN A;  2B4K A;  2CTV A;  3MW3 A;  3H42 B;  1R1A 2;  3ZFG B;  3DYO A;  4NPM A;  3ZKY A;  5L9V A;  2XLA A;  1XYP A;  3K2O A;  1PNF A;  1RMU 3;  2IFR A;  4XFB A;  4MG2 A;  1Q8S A;  1QJU 2;  3PDQ A;  3P5B A;  2DUO A;  1MQT A;  5F5Q A;  3NWK A;  4DZG A;  4YWA A;  5FQ0 A;  5HXM A;  5DAX A;  2P3K A;  5DUW A;  4UAP A;  3S6P A;  4XDO A;  3DPR C;  5DG1 A;  1SAC A;  2HEY F;  3RVH A;  1GLH A;  1MQT B;  4RFT 0;  5JZG C;  1Q56 A;  1ENX A;  3U1X A;  5I8T A;  1T6G C;  3BCW A;  3OG2 A;  2ET1 A;  2RJL A;  4GB3 1;  5F3G A;  3U0Z A;  2JE7 A;  2VW2 A;  1HV1 A;  4W8J A;  4C0B A;  1GWM A;  2BQP A;  4DUW A;  1GOF A;  5CFC C;  3NL1 A;  1D4M 1;  5JOZ A;  5JOW A;  4K8R B;  1VLN A;  3R05 A;  3RZZ A;  4Y4Y A;  3RMX A;  2MEV 3;  2TBV A;  4Q0P A;  3VZL A;  5IK5 A;  3PTY A;  2B46 X;  3OY8 A;  4ES8 A;  3NRU A;  2XVG A;  4W50 A;  3NKT A;  2Y60 A;  1RUH 1;  2EIE A;  3I3B A;  3QCW A;  4QM8 A;  1RC6 A;  1Y9G A;  1WBL A;  1QQP 2;  5JXI A;  1EUU A;  3ECQ A;  3WV6 A;  1W0O A;  1OLM E;  2QQU A;  2HJI A;  2XML A;  2EA7 A;  4BQ2 A;  2A71 A;  2GMP A;  1TMF 2;  1SDW A;  1W04 A;  3J9S A;  3NW4 A;  1KFX L;  3P3N A;  4CCL A;  4RHV 1;  5JUV A;  2D3R A;  1YXW A;  1SBF A;  2WAB A;  2HEW F;  2XH6 A;  4FPO B;  5FDB A;  3B01 A;  4GIQ A;  1MAC A;  3MEP A;  4IGP A;  2VNR A;  1MS8 A;  3AZZ A;  1IGO A;  3DYP A;  3HNY M;  4Q2F A;  4ZU7 A;  4CUA A;  2F4P A;  1AR9 1;  1GWK A;  5FPX A;  1NCR B;  1POV 3;  2AEZ A;  4JQT A;  1Z78 A;  2A6V A;  2BTV C;  1CN1 A;  4M3C B;  3ZXK A;  2VE1 A;  1ST8 A;  5GLW A;  3I7D A;  1LEM A;  1RMU 2;  1IPS A;  3THC A;  3T0D A;  3TNP B;  1DGR A;  2ZGU A;  1AR6 3;  3KLS A;  2ZGS A;  2XHK A;  2ZPX A;  4QM9 A;  4WM7 A;  4YG3 A;  4AR2 A;  4E2Q A;  2D7F A;  4DB5 A;  5FZ4 A;  3BIE A;  3CZU A;  3WX5 A;  3FLR A;  4OVE A;  4MXW B;  4H2A A;  4AF9 A;  1LHN A;  3AL6 A;  1H4H A;  2W1Q A;  2F4L A;  3MFC A;  4L0P A;  4HPK B;  2XQX A;  3LE0 A;  2A3W A;  2WWS A;  3KS7 A;  4Q8L A;  2G1M A;  4XMI A;  3I2G A;  1WW6 A;  4OFG A;  3ZIX A;  4XF9 A;  1OA3 A;  5A70 A;  3I2J A;  4R9A A;  2X53 S;  2ZS6 B;  5KHH A;  4ERO A;  5FO7 B;  1HJG A;  1J3R A;  3D6E A;  1X8E A;  2IVI B;  1FV2 A;  4QKB A;  4N9I A;  3WF3 A;  3ACL A;  2EIC A;  2MEV 2;  4QWN A;  1LOB A;  1LHO A;  3N7L A;  3VBO A;  4S2H A;  4ATF A;  4J25 A;  5HXV A;  5JXH A;  2VM9 A;  3FFQ A;  4CA9 A;  4M4P A;  4UW6 A;  4XTP A;  1GQP A;  2XJV A;  4YZ1 A;  1AZD A;  2QQV A;  3J26 N;  4FFG A;  3ZDV A;  4AQ2 A;  4OHZ A;  3HD8 B;  5GZE A;  2LS6 A;  4ZXE A;  4BQ3 A;  1JW6 A;  2IZW A;  4A41 A;  4GH4 C;  4JQR A;  4AG4 A;  1YYN A;  3CO2 A;  3RZL A;  5FZA A;  4RYD A;  1GOH A;  1BJQ A;  5FY1 A;  3SIT A;  1N1T A;  1ULP A;  5FPA A;  1JYN A;  5A3T A;  5FZM A;  4ET7 A;  3AKP A;  3AKT A;  2BYV E;  1AX2 A;  4IEX A;  2QQL A;  2AAC A;  3IDC B;  3GCW A;  2AEN A;  2RG4 A;  4B1L A;  5A3P A;  4YZ2 A;  3UNP A;  4F3J A;  4AHW A;  4OI0 A;  2KA3 A;  2ADE A;  5ANN A;  2ZGO A;  1AL2 1;  4Y3O A;  4CRQ A;  5F1R A;  1D0H A;  1TME 3;  3BOW A;  4CDW C;  1V9U 3;  3E6D A;  1WD4 A;  4LO5 B;  4X6Q B;  5EFU A;  5JAX A;  2CHH A;  2ADD A;  3UGH A;  2A7A A;  1EY2 A;  2YU1 A;  3E97 A;  3DPR A;  1U5I A;  4MGI E;  3M8L A;  4UFH A;  4X6R B;  4XF1 A;  3ZSK A;  4CTE A;  1IKQ A;  1LGN A;  4CU8 A;  5JZG A;  2ARC A;  1MS9 A;  3I97 A;  3WDU A;  1ULD A;  3PL0 A;  3AL5 A;  3QH7 A;  4LBL A;  1PO1 1;  4FXK B;  1GMM A;  5C3Q A;  1LTE A;  5FZL A;  1WW7 A;  4H14 A;  5CFC A;  3FFZ A;  4HLT A;  4NWW A;  2P3J A;  3H8O A;  2HYK A;  4HKO A;  5LRR A;  1D2Q A;  4YGE A;  2ZGM A;  2P3I A;  2VTF A;  3PHM A;  1V6N A;  2GAL A;  3TEZ A;  5AFE A;  4ASM B;  4XCA A;  2XBO 1;  1ZZ9 A;  3C3V A;  1G86 A;  5CFC B;  1GZ9 A;  2WZP P;  1D2S A;  2VMC A;  3Q8F A;  3HT2 A;  5IT6 A;  4OUL A;  4QKF A;  3GJB A;  4AFD A;  1CES A;  3LD8 A;  4YVS C;  3NO8 A;  3V0B A;  2OT7 A;  4CCN A;  2E31 A;  2HWE 3;  3KHB A;  3PME A;  1QDC A;  5HCA A;  5J09 A;  5CKM A;  1WLT A;  2W92 A;  4BIO A;  2NN8 A;  1LGB A;  4XFI A;  3ZLI A;  3VDB A;  1GP4 A;  1GU3 A;  2NMN A;  3POW A;  4PF1 A;  5FUP A;  3D5O A;  4XPV A;  5FFO C;  2HWD 1;  4FT8 A;  2PQS A;  2DFC A;  4LK6 A;  4TWT A;  5FYZ A;  1XNA A;  4QXC A;  1RIN A;  1RUG 2;  4YM2 A;  4BK5 A;  1E5S A;  2CAV A;  4EN0 A;  1KRI A;  2ARB A;  3ZVX A;  1PZ7 A;  4A44 A;  4LBM A;  1GFF 2;  5BXX A;  1PGL 1;  2YBS A;  5C4W C;  1VB2 A;  3A21 A;  5FXZ A;  1DQ1 A;  3RDI A;  5FYT A;  1UMI A;  4Y1V A;  2RDN A;  2ARE A;  2ZEX A;  2ZZJ A;  3HN3 A;  1FXZ A;  1NT0 A;  1I5P A;  2BNM A;  3BGA A;  4LK7 A;  3K4Z A;  3GHM A;  2Z4F A;  1TME 2;  1GWL A;  2UY9 A;  1V9U 2;  4ATE A;  3B69 A;  1RJ7 A;  1HXS 1;  3H3Z A;  5AVP A;  1K42 A;  5FR3 A;  4FQ4 A;  1CON A;  4QX5 A;  4CDX C;  3O1T A;  3WP6 A;  3KB5 A;  3RZM A;  1NCQ B;  1NZI A;  1O6U A;  4HVR A;  1ASJ 3;  1W8H A;  2GC2 A;  2OZ6 A;  2XKO A;  3GDB A;  2VU9 A;  2G4I A;  5C3O A;  1RJ8 A;  2XOM A;  4MGY E;  5FY5 A;  5JI7 A;  2PFW A;  4XAB A;  2D43 A;  2RR1 1;  5K8S A;  2OUH A;  4CU6 A;  2WWJ A;  2R06 3;  4ISQ A;  1W0P A;  5IK7 A;  5FYC A;  4QQL A;  5I0D A;  1GIC A;  2E32 A;  1VBC 1;  1POQ A;  2FMY A;  2ES3 A;  4RFR B;  3B7M A;  4XQD A;  4COY A;  4E9K A;  1J3Q A;  1FAT A;  2R04 1;  3D4K A;  4Q5O A;  4HVQ A;  5L36 A;  1SZB A;  3MLK A;  2JEC A;  1ZYB A;  4Q4V 1;  4JKL A;  1HQL A;  3VZM A;  4AEJ A;  1SFP A;  1MZ6 A;  2D97 A;  1UY1 A;  4FXG B;  2OW4 A;  2WLP A;  4P00 B;  1W8U A;  2Y8K A;  4QU1 A;  4XMA A;  4DFS A;  2HWE 2;  3E6B A;  3J7L A;  1GSL A;  4Q1P A;  3UT0 A;  1VMH A;  4PI0 A;  4YNI A;  1HRI 3;  2LTN A;  2NLR A;  4V1P A;  2ZGQ A;  4GH4 A;  4XXA A;  3BIW E;  1AF9 A;  3LEM A;  3HNB M;  5JOX A;  2QFE A;  1VJ2 A;  4AFA A;  2BUK A;  3CJX A;  4LKE A;  4FI9 A;  2EAA A;  4CDU C;  2XON A;  1XSQ A;  1YI7 A;  1Q5O A;  3RPQ A;  1COV 3;  1VE0 A;  4HK8 A;  4GB3 3;  1Y9Q A;  5E89 A;  1GAN A;  2Q8E A;  1NQJ A;  1KD7 A;  1S1A A;  3LIG A;  4JZR A;  4LBK A;  2JDA A;  4CDW A;  2I74 A;  3BPZ A;  1GP6 A;  3DF0 A;  3LIH A;  3AXD A;  3KSC A;  2VQU A;  2Q8O A;  5JIU A;  1QKQ A;  4GD4 A;  3PTR B;  4UWD A;  4AVV A;  1UOB A;  3NV4 A;  4IE6 A;  4Y1X A;  4YZ4 A;  4GWM A;  2J1U A;  2VGD A;  1WA6 X;  2WRA A;  4E2S A;  5BUV A;  2FHR A;  4IDZ A;  2OZJ A;  1N3Q A;  1WKY A;  4S2D A;  1ASJ 2;  3BU0 A;  1YEW A;  4LOT A;  2RS3 1;  3NJV A;  4M3C E;  2D44 A;  2QKD A;  2GNT A;  2YB7 A;  2R06 2;  3NV3 A;  2YGL A;  5DAW A;  1Y3T A;  3BI3 A;  2ZX4 A;  4FPC A;  1VBE 3;  1UOJ A;  2RJ2 A;  2KD7 A;  2EIB A;  2ZGK A;  3SKJ E;  3X29 B;  4EZH A;  2D5H A;  4YVS A;  1SDD B;  4QD2 A;  3J8F 1;  4QMA A;  5JPN B;  1OOP B;  3TRS B;  3INA A;  3BOD A;  3OGV A;  2WZ8 A;  4YFW A;  5DDJ 1;  3PUH A;  1HB2 A;  4AQS A;  3KMH A;  4QHZ A;  3SH5 A;  1OSG A;  5ISL A;  4MO3 M;  2J1E A;  1XYO A;  3JU9 A;  3ZFE B;  2FCV A;  1HRI 2;  5I0T A;  3DXT A;  4G3Y C;  5C3S A;  2VBP A;  1LAJ A;  4Q4Y 1;  1CAU A;  3THP A;  1PX3 A;  1UMZ A;  3LSD A;  4O65 A;  1SFN A;  2WS9 3;  5T5O A;  2XUM A;  2BJS A;  4CP2 A;  5C4W A;  2WLQ A;  5I91 A;  1JS9 A;  3GNE A;  4HXC A;  1A8D A;  4HOO A;  5FOJ B;  4KWJ A;  1COV 2;  3E5U A;  4DXZ A;  1CAU B;  4GB3 2;  3VKM A;  3P1I A;  4CU9 A;  2ZXQ A;  2HWF 2;  2W46 A;  2JDM A;  3SHR A;  2DCJ A;  3CL1 A;  1J84 A;  4OI1 A;  4O7X A;  3RGB A;  4IEV A;  3FLP A;  4MGZ E;  5L9B A;  1B09 A;  1RIR A;  2VOK A;  3VKF C;  5SV8 A;  2W1U A;  1MEC 3;  3WF2 A;  4CDX A;  1KQR A;  1VMJ A;  3N35 A;  1JZ6 A;  5A1F A;  1FPN 1;  1YFW A;  4BQW A;  5FZK A;  5FLJ A;  3VDD C;  4BJ0 A;  3T30 A;  2JJ6 A;  1LOE A;  1YO8 A;  3O0X A;  3KVB A;  4L99 A;  2XJU A;  4QQ2 A;  5FTT C;  5KBF A;  1R08 2;  2HBT A;  4EQV A;  5J3U A;  5IVJ A;  1C3H A;  4EV0 A;  1OKQ A;  4FTS A;  4B1M A;  3CJI C;  1I1E A;  5EWS A;  3C7E A;  3T0A A;  4HL0 A;  3NKG A;  3USU A;  4J1X A;  1PX4 A;  1VBE 2;  4DY5 A;  1ZBE 1;  4W6X A;  1DGR N;  3M70 A;  3U10 A;  5IVC A;  1S0E A;  1W6N A;  2Y6K A;  4KG0 A;  4MYE A;  1ZRC A;  5FYB A;  3JQX A;  5FZE A;  2YHJ A;  1UZW A;  1AL2 3;  5KWR A;  3A23 A;  5CVR A;  3USU B;  1C28 A;  1JMU B;  2PTM A;  3RSJ A;  4AQ6 A;  5FRA A;  3H3U A;  1GZT A;  1WLD A;  1W6N B;  2X8K A;  4FOQ A;  1K45 A;  4LPL A;  3RZJ A;  2D6P A;  2AH2 A;  2IXC A;  2A6W A;  4IEU A;  4TSV A;  1CR7 A;  5C5T A;  4CDU A;  3WZ1 A;  3OF1 A;  3S5A A;  2WS9 2;  4CCK A;  3JBG 1;  4YGD A;  3T2Q A;  3FBY A;  1EV1 1;  3OTF A;  2JD9 A;  2P17 A;  1YQ6 A;  3VDC A;  3GHN A;  4CDU B;  5C71 A;  3PUI A;  4XXP A;  1V00 A;  5A6Y A;  4EN9 B;  1GP5 A;  3K75 B;  5KXD A;  5LAS A;  2XBO 3;  4LBJ A;  2FDF A;  2OUJ A;  4NN0 A;  3TAY A;  2NYY A;  4IV1 C;  1ZRD A;  2R1B A;  4LBQ A;  1UOF A;  1KEX A;  1MEC 2;  1VBA 1;  2WO2 A;  2XJQ A;  4JHZ A;  5C6C A;  3BVC A;  2VJX A;  4D6S A;  4HG6 B;  1ODM A;  1S0I A;  3FBM A;  1H1A A;  1J58 A;  5CU1 A;  1CIY A;  2XXZ A;  1KJR A;  4NRO A;  3AP4 A;  5EQU A;  3GZA A;  5FY4 A;  2WO1 A;  2HWD 3;  2BPA 2;  3MID A;  2CDP A;  1GZW B;  4V2V A;  3GCX A;  3V65 A;  2A6X A;  1IPJ A;  5DN2 A;  5LA0 A;  2KR2 A;  1F9K A;  2EXH A;  1WWY A;  3FX3 A;  1ZRF A;  1AJO A;  5FK8 A;  1QJY 1;  4BDV B;  3A7Q A;  3S5Q A;  1JZ8 A;  1CIW A;  4XBL A;  1SEF A;  2VZO A;  1XU1 A;  2WQ8 A;  2G19 A;  3VGI A;  2XJS A;  3ZYI B;  1UYP A;  3ACI A;  2YFU A;  3AZW A;  4NVP A;  2XL9 A;  5JWP A;  1AL2 2;  4K6B A;  2OPK A;  1B35 C;  4QKD A;  3ZFF C;  4ASL A;  5A6Q A;  4BLI A;  1J83 A;  2CGO A;  1H1I A;  1W03 A;  3ACH A;  5FYS A;  1HXS 3;  5DZF A;  4CYD A;  2YY1 A;  4XJZ A;  3RYR A;  4J6G A;  4HET A;  5JR7 B;  4D6Q A;  4YW3 A;  3U4S A;  3ZN6 A;  2UU8 A;  4IEO A;  1HDK A;  3SQO A;  4GAL A;  4PBP A;  4AFC A;  3ZOI A;  5GZC A;  4I3G A;  4BA6 A;  4OZX A;  2DYC A;  2W91 A;  1DCS A;  4MET A;  2RR1 3;  3RQ0 A;  1SLT A;  4IEP A;  3UL2 A;  2VOW A;  3RWN A;  1XYN A;  2WC2 A;  1RTV A;  3WUD A;  4PDW C;  3WNL A;  3ZFG C;  5FP7 A;  4DEV A;  1NLS A;  1VBC 3;  3IIA A;  3LGR A;  5I0U A;  5B4X A;  2WIN B;  5FP8 A;  2Y64 A;  3K3N A;  1MS4 A;  5FZ3 A;  3WCR A;  2XBO 2;  3ME2 A;  2XKP A;  3VHO A;  5BNN B;  4DS0 A;  2J1S A;  4JV4 A;  1DQ2 A;  1DZR A;  1E5R A;  3A0K A;  3VDD A;  2HBU A;  3I2H A;  4BZ4 A;  1OQD A;  2W2I A;  1DU3 D;  2ZX3 A;  4D94 A;  4G4F A;  1PGW 1;  5B4N A;  2YU2 A;  3OD0 A;  3WW1 A;  2WWU A;  3IBM A;  3H8U A;  2RS1 1;  5A7P A;  3KT4 A;  3EBR A;  1UCX A;  2DVD A;  2F17 A;  2IXH A;  3OUH A;  4WVM A;  4L9B A;  3CJI A;  4QDS A;  2QQW A;  1H9W A;  3Q8E A;  5FAX A;  4BQX A;  1MZ5 A;  3ACF A;  5IYY A;  3LQC A;  1V6I A;  1PIV 2;  1UZY A;  1Y9M A;  5FPL A;  5I8Y A;  5FZF A;  5CG9 A;  1IKP A;  1HRV 3;  4RS5 B;  4D8M A;  1PGL 2;  1RUN A;  4D7S A;  3VD3 A;  3CJI B;  1QJX 1;  4YLZ A;  1HIX A;  4LLF A;  2BNN A;  5F3E A;  3OGS A;  1UZZ A;  2VAU A;  1JUI A;  2PHT A;  4LHK A;  1IS5 A;  5T54 A;  3NNF A;  4CU7 A;  3M3E A;  5FZ0 A;  5ACA 1;  5FY8 A;  2Z5W A;  2R0F A;  5LB6 A;  1W9F A;  3JB8 A;  1Q8P A;  4BB3 A;  1RVF 1;  1G6N A;  4N8M A;  1HXS 2;  1PHM A;  3R4S A;  2HYX A;  1CZT A;  2WNV B;  2SLI A;  3ILF A;  3PUR A;  5CIR A;  4E4D X;  2ZX2 A;  2VQ0 A;  4A4A A;  2V72 A;  4EN7 B;  1OT5 A;  4LEJ A;  3HEI A;  4JGZ A;  1UY3 A;  2RS3 3;  5FO9 B;  1OLR A;  4AVA A;  3BTA A;  4RQP B;  4NRQ A;  4NWV A;  1EPW A;  2RR1 2;  4QPI B;  4QHO A;  4P9Y A;  4NR1 A;  1NCR C;  4XJ8 A;  1TZO A;  2G9F A;  2LAL A;  3HQX A;  5G04 L;  5FLI A;  3NNJ A;  3IAQ A;  4JGZ B;  4IV1 A;  2B5H A;  4AOC A;  3Q8B A;  1RUJ 1;  2IWG B;  3QH6 A;  3JD7 1;  4IEZ A;  1OUX A;  4NAO A;  5AVA A;  5CA6 A;  4Y26 A;  4R9B A;  3B9C A;  2WUH A;  1W06 A;  4XUR A;  4CEW C;  2JIJ A;  2B9U A;  4NRP A;  4D7Y A;  1ZZ6 A;  3MIG A;  1BLZ A;  3WVJ A;  1WBF A;  4K9S A;  4HKL A;  1C57 A;  1FOD 2;  1US3 A;  1W8Z A;  3VLB B;  1W9W A;  3III A;  3VD5 A;  3AVR A;  4U36 A;  3AKQ A;  3O1S A;  4Q4Y 3;  5JSP A;  5LRS A;  5FZI A;  2EVX A;  2YBK A;  1HJF A;  3E5Q A;  3VKN A;  3W59 A;  2Q0A A;  4XCB A;  1HRV 2;  2GAU A;  4MUV A;  3RZK A;  3F2Z A;  2JB4 A;  3E6C C;  5F39 A;  3SLI A;  1L3J A;  3ZFF A;  2LRO A;  1B35 A;  1U12 A;  5CG8 A;  4Q4W 3;  1O3Q A;  4AVB A;  4ISR A;  4Y5T A;  2V5D A;  3IAP A;  5GM0 A;  2XWB B;  3HIF A;  5M0T A;  4YW2 A;  4XF4 A;  5J36 A;  1JN2 P;  4URA A;  4P02 B;  1E5I A;  4O9G A;  3V64 A;  4LOR A;  4NO4 A;  1B35 B;  4C90 A;  4PQQ A;  2RDR A;  2VUL A;  4BOW A;  2TNF A;  5IW0 A;  5JMO A;  3DCQ A;  1W6Q B;  1W9T A;  2QQO A;  2R07 1;  4SBV A;  1GNY A;  5KC5 A;  2E7A A;  5GKA C;  2XWJ B;  3OPW A;  2RS3 2;  1XOY A;  4D3W A;  4MH0 E;  1ZRR A;  2WA3 A;  4PDW A;  4PT6 A;  1O3S A;  1F31 A;  3ZFG A;  2BV4 A;  2VMF A;  2IXJ A;  4OQ9 A;  1NE6 A;  3O14 A;  4I0A A;  5IAV A;  1BEV 1;  2GP5 A;  5LBC A;  1H2M A;  3RS6 A;  1GV9 A;  2NMO A;  2ARX A;  2ZTN A;  1RUI 1;  2R16 A;  4PDW B;  1ZBE 3;  1OA4 A;  4FP3 A;  1T6B X;  4C1X A;  3HPN A;  1KDK A;  1NKG A;  4WV8 A;  5LA9 A;  2ORZ A;  2NPI A;  3H8X A;  5FZC A;  3U75 A;  3WP4 A;  3ZYB A;  3UYJ A;  3ZPY A;  2W39 A;  4FOW A;  4BXS V;  4MOA A;  5FZ7 A;  1V6K A;  2BDR A;  4KQ7 A;  5IVV A;  1GUI A;  1OD5 A;  1UKG A;  4LTA A;  4DUV A;  1LOC A;  3RI8 A;  2JB8 A;  4Q4Y 2;  5A7S A;  2DUP A;  5D1I A;  1BQP A;  3CEW A;  2RE9 A;  2VTX A;  2C4X A;  2QQK A;  3NNG A;  2FZ2 A;  4P14 A;  4CCD A;  3LF7 A;  3JBG 3;  3CIH A;  2P4E A;  2VG9 A;  4Q4X 1;  1UW8 A;  3U14 A;  3VBS B;  1REE A;  1ZRI A;  4FOY A;  3ZR6 A;  4E8D A;  2XLG A;  3WQB A;  3MPP G;  3WSO A;  3BAL A;  3WNO A;  3MIB A;  3EO6 A;  4QT6 A;  5EPA A;  4Q4W 2;  4XJA A;  1UQX A;  1W6O B;  1XPW A;  4KMQ A;  3GZU C;  2ID4 A;  3H7Y A;  3A0N A;  3APB A;  3AXE A;  4AAP A;  5DUV A;  4QB2 A;  5C4W B;  5H9P A;  3HAG A;  2DVG A;  4OLL A;  1JYV A;  1JYT A;  2RS5 3;  2JDU A;  4AVC A;  5CIS A;  4KBZ A;  5EHD A;  3AMP A;  2MHF A;  4NPR A;  4IXL A;  4P9J A;  4H55 A;  4COV A;  1EYB A;  1QNY A;  2W94 A;  3KV4 A;  3BTX A;  2VCC A;  4GQ7 A;  2C26 A;  1IS3 A;  4BE3 A;  3USS A;  2VW0 A;  2RHP A;  4XUN A;  1LED A;  1NCR A;  4XUP A;  3KM5 A;  1OC1 A;  3AKR A;  3DKW A;  4FPE A;  2EIG A;  1RUF 1;  4FVV A;  4M3C A;  5FPU A;  4ZS3 A;  4ZHN A;  1VBD 1;  4AQT A;  3T0B A;  2DCZ A;  1ULG A;  5BNQ A;  3WG2 A;  2UYB A;  4EE2 A;  3T4H B;  1QJY 3;  4MV2 A;  3C2U A;  3SMH A;  4IQP A;  3WNX A;  4ZZ5 A;  4OMC A;  3SNM A;  1ZBE 2;  2JDK A;  4CEW A;  2BVB A;  2WO3 A;  3ILR A;  4HSJ A;  4I0B A;  4ONU A;  4MXW A;  4AFM A;  3S7E A;  3HBZ A;  3W21 A;  2ZAC A;  3LFM A;  4HPK A;  1LEN A;  4DRV A;  4CP1 A;  2XLF A;  2BU9 A;  1PM4 A;  1NCQ C;  3JB4 C;  4LXL A;  3AP7 A;  1OUS A;  3WQ1 A;  4NUB A;  1DYO A;  1CJP A;  1H2L A;  4O9E A;  3T08 A;  3WP3 A;  2C5D A;  2VY0 A;  4CEW B;  2E6V A;  1WZX A;  3ZM8 A;  4JX0 A;  4IE5 A;  2GZW A;  4JRL A;  5EZW A;  2AYH A;  4JGY C;  3EMR A;  4IER A;  4K3U A;  2D6M A;  3VHP A;  5FZB A;  2WFP A;  2RMU 1;  3M3C A;  1QF3 A;  1ONA A;  2DDU A;  4NHK A;  2KXL A;  3AB0 A;  1H1M A;  1DQ6 A;  1C1F A;  1U5Z A;  4O61 A;  3WDV A;  3JBG 2;  4A6O A;  3U4X A;  3C8X A;  4LBN A;  1CWP A;  1Z0H A;  4CXW A;  1UNB A;  1UPS A;  5JSO A;  2FDK A;  1G9F A;  4BQ1 A;  3ZO0 B;  4PIY A;  1KIT A;  5FY7 A;  4KGQ A;  5KXB A;  3KVA A;  1H4G A;  5IFP A;  1GR3 A;  1W8T A;  2CYF A;  1HKD A;  2ZOE B;  2XQR A;  3IPV A;  4CUC A;  2PA7 A;  4LIU A;  3V56 A;  1AR7 3;  2Q30 A;  1C5I A;  1CAV A;  1R64 A;  2BOI A;  4XF0 A;  4OQ8 A;  3UKV A;  2RS5 2;  1V6M A;  4LBO A;  4BIS A;  2P2K A;  3VL9 A;  5FCC A;  3U07 A;  3OBR A;  5KXC A;  3WQ0 A;  3IPV B;  2KM2 A;  2RS1 3;  4Z8B A;  4NIH A;  3O12 A;  5I0S A;  4XET A;  4JDN A;  1CAV B;  2WQ4 A;  2PLV 1;  4QU2 A;  1OF3 A;  5FZ1 A;  2VBB A;  1RUD 3;  3RYP A;  3WP5 A;  4GWN A;  1C8M 1;  1UF2 C;  2B45 X;  3KF3 A;  3RYK A;  3VD7 A;  5C70 A;  5A32 B;  4A3X A;  1UYX A;  1NLR A;  3ZXE A;  2QVS B;  1LES A;  1S4C A;  4R9D A;  1OH3 A;  3BUC A;  3H1M A;  1IOA A;  1O8S A;  1YHF A;  4LHN A;  3WCS A;  3MDP A;  1CVN A;  2VMG A;  1ZM1 A;  4BHP A;  4KI5 M;  5J7M A;  5T55 A;  2JKB A;  5FRE A;  4XQ4 A;  3WHU A;  1IG0 A;  1AR6 2;  4LO8 A;  5GZF A;  5JCT A;  1JBC A;  4B4P A;  5AFB A;  1RVF 3;  3FZ3 A;  4I02 A;  1CD3 G;  2A3Y A;  4AVS A;  3LDB A;  2XL7 A;  2DV9 A;  5T5J A;  4QDR A;  3OBZ A;  1HQN A;  2JE8 A;  2ZX0 A;  1E57 A;  4D0Q A;  2V5Y A;  3VV1 A;  3PIJ A;  5HI0 A;  5HCB A;  5A3L A;  4QX0 A;  2X29 A;  5FJH A;  3ZSL A;  5JI9 A;  1MVE A;  5LK5 A;  2V09 A;  2QQP A;  1KS5 A;  2GNM A;  5CKQ A;  5CBL A;  1W2T A;  1XNT A;  1XNC A;  2Y6H A;  4DXS A;  5DAV A;  5HCF A;  2OS2 A;  4EN8 B;  1OOP C;  1W2N A;  1PVC 3;  2WYS A;  1P8J A;  1X50 A;  2EXI A;  4XZU G;  3MI8 A;  1MS5 A;  3JD7 3;  3LKJ A;  1XNB A;  4XQW A;  2UY8 A;  4PIZ A;  2R6Q A;  2Z79 A;  3PJY A;  3Q8C A;  3ZFE C;  1AR7 2;  2FDI A;  2R7E B;  4FO9 A;  2BNO A;  3KHC A;  5GLT A;  3W5M A;  1Q8V A;  4XTM A;  4CXY A;  1GQG A;  5A6X A;  2X5I B;  2DTY A;  5IHR A;  3RZG A;  1W2U A;  4KGG A;  2YBP A;  2ZHK A;  2RS1 2;  4BLJ A;  2WBK A;  1UXX X;  5JMC A;  1LHW A;  3LA7 A;  1WCD J;  3KT7 A;  5KHJ A;  1LOA A;  3MV1 1;  3JUU A;  3WQ7 A;  5FOB B;  3DGT A;  1RUD 2;  1I9R A;  1NAE A;  1R1Z A;  1UU6 A;  5GLV A;  3Q9O A;  5AC9 1;  1LUL A;  1DLC A;  2O8O A;  1W6M B;  3OGJ A;  3KV9 A;  1DBN A;  3VDA A;  1MS3 A;  4FPH A;  1BMV 1;  1XRU A;  1HLC A;  2W68 A;  1W39 A;  4FP2 A;  1W8W A;  1O7F A;  5IWF A;  3TB0 A;  2Q1F A;  1OH4 A;  4KWK A;  2P5B A;  1VAV A;  1HX6 A;  1EUT A;  3VZO A;  1NCQ A;  1QNW A;  3HVD A;  4QQH A;  3I2I A;  4UW4 A;  2CNA A;  2A5Z A;  4XF3 A;  4YM3 A;  5CFD C;  3OYW A;  3P6B A;  1GOG A;  1G9C A;  1GQH A;  3AP5 A;  2JIG A;  1UXZ A;  1DG6 A;  1TVG A;  2QDR A;  4JGY A;  1NY7 2;  4I3P A;  5HCH A;  4RL7 A;  4CCC A;  1NE4 A;  2VCM A;  2R49 A;  3I3D A;  1QMJ A;  2D98 A;  3O1U A;  3OYW B;  2GNB A;  2R07 3;  2AZ5 A;  1PO2 3;  2HWB 1;  4FCA A;  2WZE A;  1A8M A;  1JU3 A;  1UU5 A;  4JGY B;  4YW5 A;  2VMH A;  2JDP A;  2VZV A;  3WG3 A;  3GF6 A;  3PVB B;  1JZ7 A;  1DQ4 A;  5LW9 A;  4HAN A;  1F4A A;  2PHW A;  2WJS A;  4YRD A;  4M0H A;  1PVC 2;  3TEX A;  1OVS A;  4QPG C;  2ZA9 A;  4IEW A;  4FBF A;  1RUI 3;  2CU5 A;  2QDN A;  3JD7 2;  1YJL A;  3H1Y A;  1LCL A;  1YIP A;  2VOX A;  5IJR A;  3WHT A;  3RI9 A;  3B02 A;  1FAY A;  5FMC A;  4AEK A;  4DIN B;  1DIW A;  4QX8 A;  3AM2 A;  1WW5 A;  3RMY A;  3ELN A;  1X9P A;  2VW1 A;  1A3K A;  2ZKL A;  2VVD A;  4EWA A;  3SIS A;  2ZMK A;  1PZ8 A;  2Y0O A;  2AEY A;  1KGY A; 
#chains in the Genus database with same CATH homology
 3VDC A;  4CVU A;  5C71 A;  1UWW A;  3PUI A;  1YQ2 A;  5G05 L;  3K75 B;  4CUB A;  1WCQ A;  2YG0 A;  3HJR A;  1KEX A;  2WO2 A;  4JHZ A;  5A1A A;  2VZS A;  2VJX A;  4HG6 B;  2J1T A;  1CIY A;  2VOT A;  2ZEZ A;  1W8N A;  1NUK A;  3GGL A;  5EIY B;  2WO1 A;  1F4H A;  2CDP A;  3CMG A;  4DXR A;  3EB7 A;  3T2P A;  5DN2 A;  4QX3 A;  5LA0 A;  3CZJ A;  3DEC A;  1PMH X;  3FHA A;  2VZ3 A;  4BDV B;  2JKX A;  3A7Q A;  1JZ8 A;  2VZO A;  2WQ8 A;  2X10 A;  3ACI A;  2YFU A;  3WF0 A;  3W5N A;  3HOB A;  4XUQ A;  4RN5 A;  3CKH A;  1J83 A;  3ACH A;  1CX1 A;  5DPN A;  2Y6G A;  1OF4 A;  1D7P M;  5EJZ B;  5CYY A;  2W91 A;  4OYU A;  2B4K A;  1US2 A;  1SG3 A;  4XUT A;  3DYO A;  2VC9 A;  4XVH A;  3C7H A;  1UZ0 A;  4QPW A;  3K46 A;  1UY2 A;  1ULO A;  3WNL A;  4DEV A;  4QAW A;  5B4X A;  3NJX A;  2Y64 A;  1L7R A;  3SKV A;  2WDB A;  5HXM A;  4UAP A;  2J1S A;  4YPJ A;  3I2H A;  5B4N A;  3EYP A;  1DP0 A;  3OG2 A;  3IDA A;  2C9K A;  3FN9 A;  2WAA A;  3U37 A;  4W8J A;  4DUW A;  4QDS A;  1GOF A;  1JZ5 A;  2J1A A;  5IYY A;  3ACF A;  3LQC A;  3A22 A;  2Y6J A;  3MBW A;  3NRU A;  4D8M A;  1HN1 A;  3OEB A;  3VD3 A;  4W50 A;  1CZS A;  3OGS A;  2EIE A;  2VL4 A;  3I3B A;  2VCB A;  4CU7 A;  5JXI A;  1EUU A;  4A45 A;  3ECQ A;  1LNS A;  1O8P A;  4A42 A;  3T09 A;  3CQO A;  5JUV A;  2HYX A;  1CZT A;  2WAB A;  2V4V A;  3WNN A;  3MUY 1;  3DYP A;  3HNY M;  4A4A A;  2V72 A;  1OT5 A;  3HEI A;  4AAX A;  1UY3 A;  4OMD A;  4QDQ A;  4CUA A;  1JYX A;  2W5F A;  1H6Y A;  5G04 L;  3THC A;  1UX7 A;  3T0D A;  2VZT A;  4GWJ A;  3ABZ A;  3IAQ A;  4DUX A;  3LEI A;  3CZU A;  1JHJ A;  3ACG A;  1JZ4 A;  2WUH A;  5C7G A;  2BGP A;  2W1Q A;  3CDZ B;  4XUR A;  4OZO A;  4L0P A;  5JXJ A;  2XQX A;  3LE0 A;  5FUI A;  2VR4 A;  5JR2 A;  3I2G A;  3VD4 A;  3MUZ 1;  4QX2 A;  1US3 A;  1W9W A;  3III A;  3I2J A;  4BK4 A;  1JZ2 A;  2WN3 A;  4A3Z A;  4E8C A;  1UY4 A;  3WF3 A;  2EIC A;  2W95 A;  2ORX A;  3C7O A;  2WN2 A;  2OKX A;  3K4D A;  5LA1 A;  5JXH A;  1O59 A;  2VM9 A;  3F2Z A;  4M4P A;  1GQP A;  2V5D A;  1UYY A;  3IAP A;  5DQ0 A;  2LS6 A;  3C7G A;  4ZXE A;  3ETP A;  4TTG A;  4P02 B;  4A41 A;  4AG4 A;  2VZ1 A;  3MV0 1;  1GOH A;  4RYD A;  4PQQ A;  5JMO A;  1ULP A;  1W9T A;  2QQJ A;  2QQO A;  1JYN A;  1GNY A;  4ET7 A;  2WAO A;  2ZEW A;  4P5Y A;  2QQL A;  4PT6 A;  1XC6 A;  3UNP A;  4MAD A;  2VMF A;  3OGR A;  4MGQ A;  3MO4 A;  3VD5 A;  1UY0 A;  1MPX A;  1OD3 A;  2VZU A;  4JKM A;  3DYM A;  3AC0 A;  3E1F 1;  3HPN A;  5DMY A;  1NKG A;  4CU8 A;  2ORZ A;  4OUE A;  2L9L A;  2QQN A;  3I97 A;  4XUO A;  1GMM A;  4ARY A;  3LEK A;  1W8O A;  2VQT A;  2E33 A;  4MOA A;  4BXS V;  1W99 A;  3OB8 A;  1GUI A;  1JI6 A;  4DUV A;  2VTF A;  1JU4 A;  2VZR A;  3SEE A;  3NNG A;  2C4X A;  2QQK A;  4ZZ8 A;  1RYY A;  2VMC A;  5IFT A;  3CIH A;  4E8D A;  3WQB A;  3WSO A;  3WNO A;  2E31 A;  3BN6 A;  2W92 A;  5F7U A;  3GM8 A;  3VDB A;  1XPW A;  1GU3 A;  4KMQ A;  1K12 A;  2ID4 A;  4PF1 A;  3SEP A;  2PQS A;  4BK5 A;  4QB2 A;  1XNA A;  4W4Z A;  1JYV A;  5HPO A;  3FHQ A;  4A44 A;  1L7Q A;  2W94 A;  2DCK A;  2VCC A;  2E26 A;  2C26 A;  3A21 A;  4XUN A;  1UMI A;  4XUP A;  2ZEX A;  3HN3 A;  3BGA A;  1I5P A;  4UOJ A;  2LW8 A;  1UYZ A;  3T0B A;  3K4Z A;  2Z4F A;  5J1X A;  1K42 A;  4ZZ5 A;  4OMC A;  3C7F A;  2WO3 A;  4M4R A;  4GWI A;  4LHS A;  3I3E A;  4LQR A;  3GDB A;  2XOM A;  2VZQ A;  3FL7 A;  1DYO A;  3T08 A;  2X09 A;  4CU6 A;  1W0N A;  3ZM8 A;  4JX0 A;  3I2K A;  1H6X A;  2RVA A;  3UES A;  5I0D A;  2J1V A;  2E32 A;  4GZ9 A;  1IQD C;  1SHW B;  3T2O A;  2VME A;  2DDU A;  2BBA A;  4JKL A;  4A6O A;  3GXU A;  3C8X A;  3WF4 A;  1UY1 A;  3IB3 A;  3WEZ A;  4P00 B;  2Y8K A;  1W9S A;  3THD A;  2J1R A;  5IFP A;  1BHG A;  3K77 A;  4QB1 A;  2X05 A;  4KWU A;  4CUC A;  4MGS A;  3HNB M;  1R64 A;  2CDO A;  4TXW A;  4FI9 A;  4QB6 A;  2XON A;  3I2F A;  1JZ3 A;  1OF3 A;  4P08 A;  3HNM A;  2JDA A;  2QQM A;  3UET A;  3LPG A;  3LPF A;  3WNK A;  2VQU A;  2XHN A;  3J7H A;  3VD7 A;  5C70 A;  3WF1 A;  1UYX A;  2J1U A;  1O8S A;  2YC2 A;  1WKY A;  3LEG A;  4KI5 M;  3NJV A;  2QQI A;  2W1W A;  2BGO A;  2YB7 A;  5LCW L;  2Y6L A;  4QDR A;  2JE8 A;  4D0Q A;  2RJ2 A;  2KD7 A;  2EIB A;  4LKS A;  2QBX A;  3SKJ E;  4QX0 A;  2VMD A;  4ARX A;  1SDD B;  2RV9 A;  2BZD A;  2HLE A;  3K4A A;  1XNT A;  4DXS A;  2Y6H A;  3OGV A;  2WZ8 A;  2J22 A;  3WNP A;  3PUH A;  2WYS A;  1P8J A;  4ZY9 A;  4MO3 M;  4XZU G;  2J1E A;  3OEA A;  1K3I A;  4JKK A;  2VO5 A;  1PX3 A;  2R7E B;  4DEQ A;  3W5M A;  1TG7 A;  5IHR A;  4DXT A;  2WBK A;  1UXX X;  3P1I A;  4CU9 A;  2ZXQ A;  3MV1 1;  2W46 A;  3WNM A;  2DCJ A;  1NAE A;  1J84 A;  1NX9 A;  1DLC A;  1CZV A;  4IUG A;  2W1U A;  3WF2 A;  3VDA A;  2J7M A;  3VD9 A;  1JZ6 A;  2VCA A;  1OH4 A;  4BJ0 A;  1EUT A;  3I2I A;  3P6B A;  1GOG A;  4QX1 A;  1UXZ A;  1TVG A;  2YFZ A;  2W87 A;  2ZEY A;  5JXG A;  4UI9 L;  3C7E A;  3I3D A;  3T0A A;  2EID A;  2W1S A;  1PX4 A;  2BER A;  2WZE A;  1JU3 A;  1JYW A;  2W9X A;  1T2X A;  2Y6K A;  2VZV A;  1JZ7 A;  5EJ1 B;  3A23 A;  1F4A A;  4Z2A A;  5CZK A;  2B9V A;  3OBA A;  4LPL A;  1UMH A;  1K45 A;  5IJR A;  2W47 A;  3D3A A;  3JXS A;  1PMJ X;  2W3J A;  2YC4 A;  3NQH A;  5LA2 A;  3T2Q A;  2VZP A;  1KGY A;  2JD9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...