4P5YA

Structure of cbm32-3 from a family 31 glycoside hydrolase from clostridium perfringens in complex with n-acetylgalactosamine
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
157
structure length
157
Chain Sequence
LYKKAGSEFALDSSKLEAIYATSEADRDYKENAVDGDENTIWHSAYQAADKLPVSITIKLDKAYDLNQIDYLPRQNSRNGHVTEYKIETSLDNENWTEVRTGNLEVNEAGNALANRGYNPIRFNTINAQYLRFTALKTLGDTNNKYASAAELVFYGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diverse modes of galacto-specific carbohydrate recognition by a family 31 glycoside hydrolase from Clostridium perfringens.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Sugar binding protein
molecule keywords Glycosyl hydrolase, family 31/fibronectin type III domain pr
total genus 37
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2014-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4p5yA00
1GNYA 3FHAA 1JYNA 4FI9A 2QQKA 5G05L 1JZ8A 4GZ9A 1T2XA 3I3EA 3ACIA 2VL4A 3CMGA 4DEVA 4UI9L 2J1AA 3NRUA 2HYXA 2YG0A 1CZTA 4DEQA 4HG6B 1UXXX 4P00B 2J7MA 2CDOA 4QX0A 2ZEZA 1JZ7A 4XUQA 5LA2A 2J1EA 3WNNA 4AAXA 5HPOA 1UY1A 1BHGA 2BZDA 4BXSV 3A22A 2VZVA 4BK4A 2WO2A 4ZZ8A 2VMDA 2W9XA 3VDAA 3I3BA 1PMJX 2B4KA 3DECA 3WNPA 1K12A 2Y6HA 3VD4A 3CDZB 5A1AA 1PX4A 3VD7A 3CIHA 5C70A 2J1TA 1UX7A 3I2IA 2RJ2A 3A7QA 2W1UA 2B9VA 2VMCA 3K46A 4E8CA 3JXSA 2EIBA 4BK5A 2VM9A 3UETA 3K75B 5JMOA 1GOFA 4M4PA 5B4NA 4ZZ5A 4DXRA 4QDRA 4BDVB 4ET7A 1PMHX 1RYYA 2YB7A 4P08A 1XNAA 3FL7A 1O8PA 4TTGA 4CUBA 1EUTA 2L9LA 3VD9A 4CU7A 3WNMA 4A42A 3MO4A 2JD9A 4CU8A 2JDAA 1NX9A 4P5YA 3U37A 3CQOA 3MV11 4QPWA 2LS6A 1ULOA 3GM8A 2WQ8A 2ZEYA 2VQUA 4QB6A 5JXJA 4JKLA 1NAEA 1UY4A 4XUPA 5JXGA 3MV01 4CU6A 2XONA 4PF1A 3D3AA 1IQDC 3C7GA 5CYYA 1K45A 2ID4A 2W46A 1JU4A 2QQLA 2ZXQA 4XUTA 4LPLA 4ARYA 2X09A 5LCWL 3K4ZA 1UY0A 3T08A 2VMFA 4OMDA 5C7GA 3VD3A 2ZEXA 1UWWA 3UESA 3WSOA 2JKXA 4D8MA 5C71A 3HOBA 3C7OA 3T2OA 3BN6A 3OGSA 4MADA 3I3DA 1US3A 4A3ZA 2QQJA 3P1IA 5IYYA 2XOMA 2VCCA 1ULPA 2VZ1A 2WAAA 3SKVA 4CU9A 5IFTA 3HN3A 3I2HA 3SEPA 1GUIA 1UMHA 4UAPA 4ARXA 4L0PA 1UMIA 1NKGA 2W1QA 1YQ2A 3ECQA 4GWIA 3GXUA 1R64A 3OEAA 1W9SA 2VCBA 3OG2A 2BERA 5LA0A 2VO5A 2YC2A 1JYWA 3C7FA 3W5NA 1GU3A 3I97A 4KI5M 4DUWA 1NUKA 1LNSA 3LEKA 3ZM8A 3OEBA 5CZKA 3F2ZA 2YC4A 3EYPA 3P6BA 3HJRA 4ZXEA 2WO3A 3OGVA 2EIEA 4P02B 2EIDA 2WZ8A 1XC6A 2WYSA 3UNPA 1WKYA 3NQHA 3T0DA 2VC9A 2E31A 3ETPA 1CZVA 1K3IA 4MO3M 4QB2A 5JXHA 2WO1A 3MUY1 3T2QA 4Z2AA 1SDDB 3I2FA 1GQPA 3IAPA 1F4AA 1JI6A 3VDCA 1CIYA 3I2KA 3WNLA 2W91A 3SEEA 3ACGA 2V72A 4CUCA 5FUIA 3OGRA 1SG3A 3WQBA 3LPFA 4DXTA 3PUIA 2Y6LA 2VZ3A 4MOAA 5EIYB 1WCQA 2RVAA 4OYUA 2VZRA 2XHNA 3LPGA 4XZUG 3K4AA 1OH4A 1I5PA 1XPWA 3DYMA 3I2JA 2QQMA 4JKKA 3BGAA 4UOJA 2VZPA 1JZ5A 5JUVA 5EJZB 2HLEA 3I2GA 2J1RA 2BGOA 2VZUA 1GOGA 2Y6GA 2QBXA 4W4ZA 3C7HA 2ORZA 3C8XA 2ZEWA 1OF4A 4RN5A 2VJXA 2VMEA 1XNTA 1GMMA 1PX3A 2Y6JA 4KWUA 4E8DA 2Y64A 3J7HA 5I0DA 2QQOA 1GOHA 2E32A 2ORXA 2WN2A 4LKSA 2X05A 1UYYA 1O8SA 4W50A 3MBWA 5LA1A 4OUEA 2J1UA 3NJVA 1UYZA 1W99A 3AC0A 1UYXA 4QDSA 4QX1A 5JXIA 1L7RA 3A23A 4JKMA 4W8JA 2WAOA 3C7EA 2BBAA 3T09A 3WF3A 1UY3A 2VZOA 4DXSA 1CX1A 3EB7A 2VZSA 3CZJA 2R7EB 2W47A 2V4VA 4DUVA 2VZTA 2WZEA 2J22A 4A44A 1W8NA 1JU3A 2BGPA 2J1VA 1W9TA 4XUNA 2DCJA 1US2A 3VD5A 4KMQA 5IJRA 4D0QA 4TXWA 4RYDA 2Z4FA 1UY2A 1OT5A 2KD7A 2E33A 2DDUA 4MGSA 2W5FA 3WF1A 4QX2A 4BJ0A 2C26A 3WEZA 4OZOA 1JZ6A 2VOTA 2W3JA 1P8JA 3SKJE 3LE0A 3HNMA 2RV9A 5IFPA 2WDBA 3T0BA 1DLCA 1JZ3A 4IUGA 2VTFA 2QQNA 3T2PA 4MGQA 1H6YA 3K4DA 3PUHA 1L7QA 2XQXA 3HPNA 3OBAA 2W92A 3WF4A 2EICA 3ACHA 3ACFA 2Y6KA 4XUOA 3WF0A 4A4AA 2X10A 2JE8A 3CZUA 5DQ0A 1F4HA 4LQRA 1DYOA 1JHJA 3OB8A 4CUAA 4LHSA 1UXZA 3IDAA 2OKXA 5DN2A 4M4RA 2W87A 3FHQA 1OD3A 1KEXA 2C9KA 2WUHA 1TVGA 4PQQA 2WBKA 5IHRA 5J1XA 4AG4A 5F7UA 1SHWB 2W94A 1TG7A 1D7PM 1JYXA 1OF3A 1W9WA 1UZ0A 3A21A 3IAQA 4A41A 1JZ4A 3IIIA 4YPJA 3NNGA 2LW8A 4JX0A 4QB1A 4CVUA 3HEIA 1W0NA 4A45A 3GGLA 2DCKA 4GWJA 2YFZA 3WNKA 3CKHA 3W5MA 2VR4A 4XURA 3GDBA 2V5DA 1DP0A 3IB3A 1JZ2A 2W1SA 4OMCA 1K42A 1KGYA 3THDA 4ZY9A 5DPNA 2PQSA 3THCA 3T0AA 3HNBM 3DYOA 4QDQA 3HNYM 5B4XA 4DUXA 5EJ1B 3LEGA 1W8OA 2J1SA 2QQIA 4XVHA 2W1WA 3LQCA 3WNOA 2WABA 5HXMA 2VZQA 2VQTA 5DMYA 3WF2A 4QX3A 2VCAA 1JYVA 1J84A 3E1F1 1CZSA 1O59A 2E26A 3DYPA 4QAWA 1J83A 2Y8KA 3FN9A 5G04L 1HN1A 4JHZA 3VDBA 2CDPA 3NJXA 3K77A 3MUZ1 4PT6A 2C4XA 5JR2A 1EUUA 3ABZA 3LEIA 2YFUA 1H6XA 4A6OA 2WN3A 1MPXA 2W95A
chains in the Genus database with same CATH superfamily
4NWWA 1SBEA 3TB0A 1JYNA 4FI9A 1HQLA 4AHZA 2PLV3 1MQTB 3WCSA 1FMD1 4GZ9A 3TNQA 3I3EA 4XHXA 5BYNA 2NQYA 1XSQA 3N9NA 3ZYPA 1W8HA 2OUJA 3S7IA 1SLAA 4UI9L 4OZXA 1XXNA 3N9QA 3M7AA 5LA9A 3WCRA 1ZM1A 2GDFA 4CEYA 2VULA 2GP3A 4CCJA 3NRUA 2HYXA 1OXCA 4LT5A 4XW3A 1QMJA 1ZVFA 1CZTA 2CYFA 4MGIE 1OD5A 1RUD3 4CP9A 4HZFA 5FCCA 2J7MA 4K20A 1OA4A 1YQ5A 2A6VA 1JOJA 3WG3A 2JICA 2KM2A 3UGGA 5IVFA 1POV1 4QM9A 2A5ZA 1JZ7A 1NA1C 1AR92 4K7JA 1MS3A 4AEDB 3WNNA 1UZVA 2OW4A 2FBEA 4B4PA 4LO8A 2GMEA 4QXKA 1C8NA 1WA6X 1YI7A 2A73B 4LR4A 4AWDA 1K5MA 5KHIA 3VBSA 3UKTA 3AVRA 3AMQA 3A22A 2HWD1 2PN5A 1BEV1 1PK6C 5LZ6A 2VZVA 4Y3OA 4BLIA 4CZSA 1ACCA 1VAVA 3AP9A 1PHMA 3I3BA 5FK8A 1PMJX 5FPAA 1O3TA 3ZMOA 4QPGA 1QQP1 1X7NA 3H7YA 1RVF3 4F7ZA 3CDZB 4XJUA 2IFRA 4JGZC 2WQ4A 2HH9A 2I07B 4YFWA 2EXHA 4LBQA 3P3NA 1JBCA 2ZKLA 4YFZA 5C70A 1WMFA 5FPVA 2B8MA 3A7QA 3DKQA 2BDRA 4TYSA 3VBUA 1XE8A 1OOPB 2CHHA 4WVMA 1KJLA 3PUSA 4CPBD 5JZGB 3AK0A 4E8CA 1PM4A 2EIBA 3JXSA 5HI0A 2VM9A 4O61A 4JHTA 3ZN5A 1ONAA 4NWVA 4FTBA 3J7MA 2VXRA 5FY8A 4M4PA 5FWEA 5JLVA 3K3OA 2EAAA 3J7LA 3VBUC 4DXRA 2WYFA 2XUEA 2Y0OA 5A3NA 4M3CE 4QDRA 1PIV3 3APBA 4LE4A 1DZRA 1LJ7A 5ABJC 1CESA 2YB7A 1W05A 4XAEA 5LATA 2WWUA 3CJIA 1AJKA 3FL7A 3WINE 4KNCA 4XC9A 3OJBA 1YXWA 1PVC1 1AL0G 2L9LA 4TSVA 3ZSKA 4CU7A 4IV3A 4PJYA 3LGRA 1R1A1 3FHIB 2VECA 4Q8LA 4XBLA 5SV8A 4ITCA 1ASJ2 1NLQA 4Q0PA 3WQ7A 5CADA 1UD1A 5EPAA 3ZYFA 3RZZA 3WD5A 1X82A 2VNGA 1NX9A 1LU1A 3ZIWA 2HBTA 4QPWA 3MV11 4DFSA 2DUOA 1WW5A 4YM1A 5FYIA 1PO11 4M3CF 4RQPC 1YO8A 1H2KA 1NAEA 2OZJA 2QTWB 1RVF1 4Z92B 1HLCA 5IVEA 4COYA 2D44A 3HMYA 5CYYA 4YNIA 4L9BA 1N1YA 1QXRA 2LRPA 5A80A 3Q8BA 2QQLA 5J37A 5CAZA 4XUTA 4UBHA 2IVIB 3D8CA 3T08A 4BH9A 4FTSA 2WFF3 3BPSA 3WDYA 3ZFGB 5IWFA 1QJX2 1UWWA 3RJ2X 5JI7A 3ZN4A 4MVTA 3ZFFB 4WVVA 1M06G 4LA2A 5C71A 3C7OA 4AL9A 4YW1A 4BOWA 1I5ZA 3OGSA 3JBG2 3PU8A 2EA7A 1TE1B 1US3A 3VZNA 1VAKA 4COZA 2X29A 5C3QA 5FPZA 3A4UA 3N3HA 1AR72 1S0JA 4OI1A 4AVVA 1W8WA 1C4RA 1ULPA 2ZGLA 2VZ1A 1S0BA 3PUQA 3SKVA 4D3WA 1UOBA 1O91A 1WZXA 2WNVA 4RR3B 1HRI3 5IFTA 2RS33 4BE3A 5HCHA 1ODMA 5IK8A 3ZYHA 4QGNA 4QGMA 5A6QA 1H8VA 2CAUA 1XSRA 3B9CA 4UAPA 3B5LB 1BK0A 4QMAA 1G9FA 1PO22 1SMVA 2VPVA 3J7NA 4HKOA 4ZS3A 3RZKA 4LKDA 5FMCA 4E2QA 1VPHA 1NKGA 2DUPA 2BGCA 3ECQA 5FMDA 5GM0A 4E4SA 3KV6A 3C3VA 3ZN6B 3M8LA 5BNOB 4QQOA 4SBVA 1C3HA 3LSDA 3THTA 4CEYB 1W9SA 5LBEA 3OG2A 3RG0A 3K51A 5LA0A 1ZBA1 2P6CA 3PU3A 4Y1XA 3ZXKA 2GNMA 4E4HA 3C7FA 5D8AA 5C4WC 1BEV2 3SH4A 1IHMA 4GB32 1DGLA 4IV1A 2CSGA 4AF9A 4AVBA 4WV8A 1PM7A 1LNSA 3E5QA 5A7SA 4CCDA 4FQZA 1VBB2 4YGCA 3Q9OA 1EPZA 1CQ9A 1YIFA 2YC4A 4JC1A 3O0WA 1ZBE3 3WXPA 3NKTA 3ZPYA 2GH8A 4P9IA 4IESA 3WP6A 3FX3A 5C6CA 4YARA 3OBRA 2QUOA 2VOXA 1ZRDA 2WZ8A 2ZGQA 3PIJA 4LIVA 1W06A 2PLV1 4NR1A 5CEHA 3FE5A 1V6IA 1WKYA 3ZFEA 1GQHA 4IV3B 1POV3 2E31A 4MHRA 4Q1RA 1B35A 1QKQA 4UW6A 1C8M2 2YBKA 3PLQA 4XJWA 1PIV1 3U07A 2QJVA 2JJ6A 4JVAA 2IFWA 4LIUA 1GLHA 2NZ9A 5JXHA 3HBKA 3MUY1 1L3JA 1LOFC 4KQ7A 1RITA 4L8QA 5L7OC 1MZ6A 1CIWA 1F4AA 4LO6B 2JIGA 3S6PA 2XJUA 1JI6A 2EVXA 3VDCA 4A7ZA 4C1WA 2IXHA 4S2HA 2JECA 4QM8A 2R1BA 5EJ3A 4N53C 4LUMA 4YZ1A 2E51A 2VH9A 2W91A 4WVWA 3SEEA 3WNLA 3ACGA 4AQ2A 3O0XA 4ZS2A 3W20A 4XCAA 3SLIA 3MPPG 5FUNA 1OLQA 1LEMA 3LOIA 4P14A 5ERLA 1VBA1 5FLJA 2P37A 4LBJA 2GNBA 3VHPA 3PMEA 5DZEA 5F3IA 4Q4X1 2XLGA 5DUXA 3M4FA 1PO13 1GR3A 1NE6A 2QDNA 2F4PA 3H3UA 4DXTA 3ALQA 3KQRA 4HKLA 1UIJA 4JGYA 3H7JA 1OHFA 2Y6LA 4Y22A 2AREA 2VZ3A 4MGTA 5CKQA 4KWJA 3WG2A 3U75A 5FOBB 4G4FA 2VZRA 5IAVA 3AYAA 4XZUG 5KHKA 2ZX4A 1VP6A 1OUSA 5LASA 1I5PA 1XYPA 3DYMA 3I2JA 3BGAA 5ABJA 1CAUB 1GZ9A 3AYEA 3MIEA 4QPYA 4BQYA 1QY4A 1RUJ2 1SLIA 2UWCA 5GZFA 2BFUL 2XR4A 3BI3A 4Y26A 2DVAA 4W6YA 2VZUA 4LO4B 3ZXDA 1NCRC 1Y9QA 3CO2A 1GOGA 3MFCA 2QBXA 1HB1A 1RUF2 3KVAA 4FOVA 4QD2A 5JOWA 2CWSA 2D7FA 2JG9C 2Q8EA 5T54A 4ZU5A 2PA7A 3N36A 1S0IA 2H0VA 1UOGA 4N53A 5DG2A 4H7LA 1FPN1 3POEA 1V6OA 1LOEA 5FKCA 2Y64A 1NLRA 1DZTA 3PVEA 1RUJ3 2Y0IA 4QPGB 2AH2A 1GOHA 2E32A 3LA7A 3N7LA 4LKSA 3WOGA 5FRAA 1UYYA 3OOXA 4RSUA 1IS3A 1LU2A 4W50A 3H1YA 4NPRA 4Y5SA 4QHZA 1SLTA 3AM2A 1DQ0A 2WFF2 4LULA 1AYM3 4K21A 5FK7A 4OHZA 4QPIC 2GC2A 4IW3A 1COV1 1W99A 5L9VA 1MS8A 4UF0A 2OYZA 5GZCA 2JG8C 1F5FA 1Z7S3 1E5IA 2LUWA 5JXIA 2WQZC 4B7EA 3AKPA 3VBSC 2WAOA 1W3XA 5H9QA 4EN6B 2BBAA 4FTEA 5FZ1A 5F1RA 2BUKA 3EB7A 3OPTA 3T3YA 1RIRA 1Z0HA 2B7YA 2DFCA 4XJAA 2V4VA 4COVA 1WBLA 2WZEA 3DL3A 5T5PA 1ZBE1 5CISA 3PVOA 4XDOA 1AYN2 2J1VA 1VB4A 2RS11 2WT1A 3FFQA 4NROA 4XUNA 1UU5A 5IJRA 2R49A 4D0QA 2PLV2 1AXKA 4RYDA 2W08A 5FLHA 2Z4FA 3IM0A 5IVVA 2AEYA 4AAPA 1NXD1 1HDKA 1VRBA 3KF5A 3ELNA 2Q4SA 3ZKYA 4R9BA 2ZGSA 1CD3G 2KD7A 5LB6A 4NHMA 2XJQA 2VMGA 3WVJA 2QQWA 4DMIA 5CG8A 2ADDA 4XIKA 5A32A 1W0PA 3E6DA 4FPYA 4QX2A 4BJ0A 1FNYA 3ENRA 5J3UA 2QNKA 3WDVA 3WEZA 5GZGA 1TME2 4TLGA 4YVSA 2BYVE 5FXVA 1OUXA 4QHOA 3VBFA 1H2MA 1F35A 1RUH2 2XDVA 2W3JA 1OQDA 1DHKB 4AQ6A 5CFCB 1ZA7A 3N7MA 2YC0A 5F5IA 3IZOA 5FUPA 4Q0SA 1H8TB 1D4VB 3CEWA 2WDBA 1RUC3 2W39A 4XFGA 1DLCA 1DZQA 4BQWA 4IUGA 3UJOA 2HWB1 2VTFA 1T6BX 2TEPA 1FNZA 2ZHNA 4LJHA 3TEXA 3JZVA 1I3HA 4N90A 5E88A 4XMAA 1GWKA 1VBE3 2D93A 4GD4A 3VHNA 3ES4A 1BZWA 1R082 1QQP2 2AYHA 4R8HA 4CDWA 5I8TA 4GXLA 4I3GA 4QX7A 3I59B 4Q4X2 2WL1A 1V6LA 1A78A 3ACFA 2EALA 3TWIA 2C1FA 2FDJA 2V4AA 3LIGA 2O8QA 4LBQB 3NNMA 2X10A 5FJHA 2A1XA 2JE8A 3CZUA 4CDWB 3AXDA 1F4HA 2RJLA 3T2TA 1JHJA 4NUBA 3GJAA 1IS4A 1UXZA 3IDAA 3WR0A 2GSYA 3AZVA 2HYKA 3M3QA 2WKKA 2YGMA 2WZR1 4M4RA 5KC6A 1QWRA 2NP0A 4QKBA 2WUHA 5IVYA 4IEYA 3MIBA 4RS5B 4XFAA 4WM8C 4XDPA 3S5AA 4AG4A 1W2AX 1IG0A 3R4SA 4K40A 4P9LA 5FJKA 4CA9A 1OPMA 4UT5A 3C2UA 4XYXA 2PYTA 2VTXJ 1D7PM 3CJIC 5KXCA 1YFUA 2RS32 4AI9A 1LOCA 1MR5A 4E2GA 3A21A 4MH0E 5D21A 5FWJA 5CKNA 3ZYJB 4GWMA 1HQNA 4JGZB 1ND2C 4YPJA 1R1A2 3SNMA 5HCAA 1NCQC 4FPOB 3PUAA 4CXYA 1PZ9A 4UW4A 1F9KA 1W0NA 2ET1A 1QJFA 4D69A 1SCRA 4F3JA 1NOVA 4Q4Y2 4K1ZA 2ZTNA 2YFZA 2CL2A 4BWOA 4NRPA 3W5MA 4Q4Y1 3RI8A 1SLCA 5A7OA 2VR4A 4XURA 1OOPC 2XUMA 3N4MA 4XCBA 2V5DA 3IB3A 4IV1B 2JG9A 2G9FA 2WA3A 1K42A 2BFUS 2ZX3A 5DPNA 1PGSA 5SV5A 2E9QA 1DQ5A 1ND2A 2RS13 3T0AA 3DYOA 4Q0UA 3PIGA 4LBOA 4ONUA 3KT7A 5EYXA 3VBUB 3KF3A 4FFGA 2W1WA 1LHNA 1NQDA 4N43B 3WNOA 5HXMA 1HRV1 1PK6A 4L92A 4ZU7A 1QJU1 2YU2A 3OGGA 5FZMA 2BBVA 1LESA 5FZCA 4YZ4A 2VMHA 3GZAA 2A3XA 4QAWA 1VB2A 2Y8KA 5A7NA 4UW3A 1R1A3 2P6HA 3FN9A 3OUHA 5GKAC 1FI2A 3AL5A 5G04L 4AFDA 1WLCA 4RFT0 2R1DA 3BUCA 3ZLIA 5C3PA 2BP6A 1XJAA 1NXMA 1R1ZA 1T6GC 2VUCA 3VDBA 4FPKA 1QEXA 3NJXA 2ZZQA 4PBPA 4QWNA 3TEWA 2WA4A 3LKJA 3AKTA 1EUUA 3ABZA 5APAA 2IWGB 1LENA 1H6XA 4A6OA 4M0HA 3IWZA 1KDMA 2RDNA 4ZU4A 1GNYA 3FHAA 3FLRA 1GNHA 2ZABA 3VBRC 1KDKA 2VU9A 2E63A 2VUAA 2QQKA 1RVF2 2XJRA 5G05L 5A3UA 1JZ8A 1T2XA 2A6XA 2H6BA 3ACIA 4R9DA 1W6QA 1PO12 1W6NA 4OHXA 1LOFA 1Z7S1 1CJDA 4COWA 2EXIA 5A6ZA 1ULEA 3V0BA 1ZRCA 2J1AA 4UFLA 1DFQA 4Q4Y3 4WZFA 2VVEA 5C9AB 4I3PA 2PFWA 2I74A 5FY5A 4JQRA 4BHPA 4GB33 1W6QB 1UZWA 1STMA 2E7AA 2MEV1 2WR9A 4LLOA 3X29B 4NHXA 1VALA 2CDOA 5CFCA 3H8XA 3WV6A 4YVSC 5AFBA 2UYAA 4YW6A 5J36A 2ZEZA 1BBT2 1AR73 1LHWA 1HRI1 4IGOA 4XUQA 3VBOB 2J1EA 2OIIA 4PCRA 1Y9GA 5T50A 3FJSA 5A6XA 1V9U3 4PQ9A 1BHGA 5EXOA 1JYTA 1ZRRA 3NNLA 3WQ1A 4QQHA 4V2WA 4AYUA 3ZMNA 1B35B 2KXLA 2N7GA 2W9XA 3VZJA 3VDAA 2B4KA 3WNPA 1MZFA 2C6SA 1RB8G 1AR91 1K12A 1WLWA 1D4M2 3VD4A 1AHSA 3U4XA 3WW4A 2G1MA 3VBHA 5DUWA 5BNOC 4YW5A 4B4RA 4OFGA 4G9SB 3VGIA 3WDWA 5T55A 3LF7A 1MS0A 5D2AA 4R9AA 5BNPA 3LCPA 2J1TA 1UX7A 4NIHA 2RJ2A 1C8M1 1G8WA 2B39A 3D6EA 3MDPA 2Z69A 2W2IA 3LFMA 5GLUA 4AVSA 1BVP1 2AUYA 1LRHA 3SQOA 1CAXB 4B4QA 1MS1A 2OVUA 3ACLA 4AXOA 2VMCA 4CPBA 4BK5A 3ES1A 1W8ZA 1AF9A 2R30A 5A3MA 5FZEA 3TAYA 2WLPA 3USUB 4C0HA 2D6OX 1H1IA 4B1LA 3MICA 1AL22 4GKYA 1YJKA 5L9RA 2ZMKA 1YCIA 3OF1A 4Q26A 1TNFA 4CXXA 4ZZ5A 4PIYA 1REDA 1LTEA 1AVBA 4B3NA 4BDVB 4KWLA 3NO8A 1JOBA 1O4TA 4LXLA 3ATGA 1QJZA 3URFA 4BQ3A 4ET7A 1G9AA 3QH7A 1ZNPA 5K0UA 4CRQA 5EV7A 4ASMB 1MEC1 2BOJA 4O9GA 2OZ6A 2ES3A 2WWJA 4FXGB 4P9GA 3TN92 1OURA 1VBC3 3CLPA 4CUBA 4TTGA 1OBNA 4LITA 2I2SA 1EUTA 5FMOL 4ZONA 2OS2A 1AR63 1N1VA 1JOPA 2JD9A 3D5OA 3KZ4C 3NKGA 4FAGA 1RMU2 2QCSB 4CU8A 1V9U1 2RM21 3VKLA 4P9XA 3LWCA 5FMOS 5K4LA 2WS91 3HR9A 1YC61 4N7UA 4U36A 3ME2A 3M3OA 1OC1A 4NHYA 1D2SA 1ULOA 2R0HA 2ZKNA 3GM8A 1KS5A 2ZEYA 4QB6A 5L73A 2Q8CA 3VL8A 3ZVXA 5JXJA 5CG9A 4XUPA 4CU6A 2XONA 1W6PA 3D3AA 4W6WA 1X9TA 1K45A 2D43A 3EXUA 2BVVA 3OY8B 4MGKE 4M3CB 4UWDA 1BVVA 3ZXAC 2W46A 1XU2A 2ZGRA 1JU4A 1ZZBA 5FREA 4LPLA 4AEMA 2JDMA 2X09A 2Q0AA 5LCWL 3K4ZA 2VMFA 3KCXA 3NAPB 4BQ4A 3KB5A 1RUNA 2A3WA 5C7GA 1LHUA 1ENQA 1MEC2 4AEJA 4OI4A 3WSOA 3RRDA 1RL3A 4Q4W2 4NO4A 3TEYA 3LZZA 3J4UH 5FYYA 4D6QA 3T2OA 2X5IB 2X53S 3BN6A 4UXAA 4QU2A 3A0NA 4AVCA 4A3ZA 1UKRA 5FZFA 1ENRA 2BNNA 2CNAA 2R071 3GZUC 5GJ6A 5BPXA 3V64A 5FBZA 2XGXA 3RZGA 2WAAA 1EAH3 1PGW1 5H9SA 4FPHA 1RUG2 4HETA 1CVNA 1S0FA 1S0DA 1S0EA 3DXTA 4CU9A 2PHWA 2ZHKA 3PURA 1IPSA 4XMIA 3L2YA 4WM7B 1F15A 1OQ1A 1RUD1 4XAAA 4ARXA 3FUOA 1C8M3 1RUI1 1SACA 5DDJ2 2YGLA 2XJSA 4JGZA 4N8MA 2V09A 2XKPA 3UJQA 2I45A 2ILMA 5JIUA 2RR11 3DUIA 3GXUA 4NMIA 2OQ7A 3MEPA 4XF3A 1R64A 1UIKA 2IZWA 1D4M1 4CP0A 3VZLA 1O3QA 1REEA 1RXFA 2DUQA 3MFAA 3GHNA 4AFBA 1OVSA 2E6VA 4RQPB 1DBNA 3ILRA 1JYWA 2ZMNA 2PHXA 3V65A 1GU3A 4R9CA 1QOSA 4Q2FA 1N3PA 4D6SA 2FCVA 1XBFA 1NCRA 3LEKA 3I4IA 2CTVA 5DAXA 3ZFEB 4BISA 2FDKA 4IEPA 5CZKA 5F39A 3P6BA 3S0MA 1BBT1 3FLPA 4ZXEA 1NY71 2PQQA 4ASLA 2VQ0A 4CDXB 4OCTA 5C4WA 5M0TA 3R4UA 2ARXA 2BQPA 2GAUA 2GP5A 4CDQA 1W2NA 1SFPA 2NMOA 1H9WA 2WYSA 3ZR6A 3AP6A 4HVRA 4Q0QA 1ND3C 2A3YA 3VKNA 1QH6A 2LM3A 3N9MA 4A3XA 5LY1A 4K8FA 1KJRA 1GKBA 3BALA 4COUA 4Q4W3 1V6NA 3BPZA 2P1BA 1AUYA 4CCEA 2GU9A 1WUVA 3I3QA 4YYOA 4Z2AA 4HN1A 1LOBA 1O3SA 1GQPA 5HBAA 3AZXA 3IAPA 1BEV3 4I02A 4AR2A 3AJYA 3MF6A 1MS9A 4NRQA 5F2SA 2Q1MA 3B93A 4ES9A 5BNNB 3BTZA 1Q8SA 5K0UC 3BVCA 2JENA 3EQEA 3LAGA 2J42A 2YZ4A 4IGQA 3ZXEA 3JQWA 3WHUA 4CUCA 4IQPA 3ZR5A 4FSJA 2QQVA 2WSUA 3TN93 1YNAA 4YM3A 4F8AA 2VNVA 2Q30A 3O12A 5FP8A 3W59A 1H8TC 3J9SA 4Z07A 3SISA 1X9PA 2OA2A 1VMFA 3U1XA 3WQ0A 3AFGA 4ASKA 5I8YA 3VL9A 1S2BA 1A6CA 4OULA 2FMDA 5H9PA 4LOTA 1JTZX 2X5IA 1W90A 2ZHMA 3LPGA 2D40A 1GSLA 4FPCA 2JE7A 5IVJA 5FAXA 5L19A 3Q8CA 5IVCA 5DDJ1 4CP1A 2VZPA 5ANNA 4KGQA 3L9JT 5FKBA 1BCXA 1UL9A 2HLEA 4XJ9A 3HN1A 4A7KA 3I2GA 4IE4A 1WWYA 1HB4A 3ILFA 4CEWC 2HWB3 1ZYBA 4PI0A 3ZDVA 1AR82 1MZEA 4WM7A 3UK9A 4C91A 1TMF2 3C7HA 3JB8A 4RFRB 2R061 5ABJB 5F3GA 5AVPA 1LHVA 4I30A 2R072 2RR13 5I93A 4RN5A 2HWC1 3LFIA 4A2UA 2VJXA 4YVWB 4HN0A 2VMEA 4HVOA 5FZLA 1GMMA 1UPSA 5FZGA 5BNOA 2FDFA 1PX3A 3RSJA 5AC93 4META 2Q5TA 4KWUA 5F32A 5FMBA 3J7HA 1O4ZA 1MS5A 1C1FA 3V0AA 1DYKA 4FP2A 1LGBA 2G9ZA 2OX0A 2ZMLA 3UGFA 4N53B 4EWEA 4Q8KA 5A6YA 4Z8BA 5LA1A 4N43A 1W03A 1AYN1 2JE9A 2J1UA 3NJVA 4RL7A 5B2GB 1BBT3 1A34A 1G9CA 2NM1A 1UYXA 3JU9A 2FCUA 2RS31 1L7RA 2XH6A 4YW2A 3AYDA 1A8DA 2CAVA 4LHLA 1CWPA 2IC1A 4HXCA 5E1RA 5FR3A 2CWMA 1ULCA 3AX4A 3T09A 5FYZA 1UY3A 2VZOA 4DXSA 3RS6A 4L97A 5T5LA 2D3RA 4AK3A 1IOAA 2G4IA 2NMNA 3MIFA 2DYCA 1V6MA 2W47A 4HK8A 3ZYGA 4FT8A 4CCMA 4DUVA 2VZTA 1S2EA 1YIPA 1COV2 2R16A 3OD0A 4A44A 1F2NA 3ZFFC 2BV4A 1N47A 1UO9A 1US2A 2ZOEB 3VD5A 2BVBA 5ISLA 3WY6A 1JMUB 1GANA 2K9ZA 2GNDA 2R0FA 1G86A 4QKNA 4DZGA 3PMSA 1UY2A 2C24A 1U5IA 2QQUA 5DAWA 3KSCA 3T1MA 1EV11 2DURA 4QXBA 3UT0A 4HT1T 5L7OA 5JOYA 3SCGA 3LEMA 2OPKA 1SFNA 3CNAA 1FPN3 2FCTA 1QHDA 3LSEA 1EAH1 5B4XA 3WP5A 2DV9A 4EN0A 4IL7A 3GJBA 3IDCB 1P8JA 3HQUA 2OPWA 3SKJE 1UW8A 1DGWA 2DFBA 4PDWC 2A6YA 1V6KA 3HNMA 2PTMA 2RV9A 2RJKA 3HT2A 4QT6A 3VBOA 3ZSJA 5JIAA 1CAUA 2SLIA 1DCSA 2XHKA 2JG8B 3P5BA 5FIXA 3T4HB 5IK7A 4PI2A 2IXJA 4FPJA 4MGQA 1TME1 5DUUA 2ZS6B 1QDOA 1OMIA 1Z7S2 3K4DA 3PVBB 3PUHA 4FFIA 3ROUA 4I0WB 3VBSB 5J98B 1NY72 4Y1UA 1L7QA 1O7FA 1KRIA 4FFFA 1OLMA 5FZBA 1B09A 4MV2A 4YGBA 2CU5A 5JMCA 3WF4A 1UX6A 1RINA 1DQ2A 4Q5OA 1J59A 3WF0A 4CE8A 4OQ8A 2GN3A 4A4AA 4BXFA 3MLLA 4IE5A 5FP3A 4PBOA 4CYDA 5C9AC 2YBSA 3VKOA 4LQRA 5HV4A 5ACA3 4C1XA 2HWD3 4LHSA 3THPA 4OI0A 2VW2A 4BYYA 4XE9A 2ZGKA 1H0BA 3RDIA 3AKSA 2GH2A 2W87A 3NWKA 2RS12 1OD3A 3O1VA 2Y34A 5L7OB 4MHUA 2C9KA 5I91A 1TVGA 2MEV2 5LWBA 1W8FA 1PO21 5FZKA 3OPWA 4EROA 3UYJA 3AMPA 5A3LA 1C57A 3J8F1 5F7UA 5CFDA 5J1XA 2ZGPA 4QXCA 3W21A 1O3RA 3ZN6A 3B94A 2HEWF 1RHI3 1W6OB 3LIHA 2ZGMA 5F2WA 4Y4YA 3U14A 1OF3A 4Q4X3 1ZZ7A 2RS52 5JPNB 1VBE1 1K5MC 2QFEA 1GFF2 3NL1A 1RUG3 1UZ0A 4AGVA 4YGDA 2BTVC 2HBUA 1LHOA 1UMZA 1GYKA 2A70A 1FOD1 2R041 3NNGA 1GP4A 2LW8A 4JX0A 5JPMB 4XQDA 3NNJA 4Y4RA 4B29A 1XB9A 3HEIA 3ASIA 3BODA 4QU1A 4CDXA 3AP4A 1FT9A 4F83A 3W58A 1HV1A 4NAMA 1TQ5A 1AX1A 3H9AA 5D8AB 4QQLA 1DQ4A 1QNWA 2GMMA 1DP0A 2D6KA 4XZPA 1JZ2A 4UFJA 2W1SA 4OMCA 1KGYA 3THDA 2JDHA 1CAVB 1WMXA 3IBMA 5BNPB 3THCA 1RUE2 2UYBA 1EPWA 2FD8A 4E9KA 3POIA 2XLFA 3OY8A 4CDWC 2RS53 4GJYA 2P34A 1A3KA 5EJ1B 1W8OA 2J1SA 1UQXA 2QQIA 1CAXA 2ET7A 2JG9B 1KXGA 3O0VA 3LQCA 4XVHA 5D1IA 5AFEA 5I0RA 1SBFA 3LB9A 5JZGA 4CDUA 3AKQA 3N9PA 3UGHA 3WP4A 4FBFA 4HPKB 1JYVA 1J84A 1UN1A 2ZGOA 2VE1A 3MYXA 2ARAA 4Q1PA 1S0CA 3HQXA 2OQ6A 4NJ4A 4CDUB 3ZXGA 1HN1A 4JHZA 2RM23 3RWKX 4EN8B 4KBBA 4AFCA 4BQXA 3OTFA 4H2AA 5J09A 3K77A 3W9AA 4GH4B 1GP6A 1YI9A 4D94A 2RG4A 3IMMA 4LNVA 2ZAHA 4CCLA 3KHBA 5J7MA 4OI2A 2WN3A 1FXZA 4W4ZA 1RUH3 5CVRA 1AR61 1UOJA 2WZPP 3DPRC 1TME3 4XFFA 1W9FA 4H55A 3T4VA 4RGAA 5C9AA 1ULDA 2VGDA 4JZRA 1NT0A 2Y38A 5HV0A 4CP9B 3CMGA 3ZFGC 4AI1A 4DEVA 2ZCWA 4GQ7A 2EXKA 4NIDA 4ISRA 1UAIA 1DLLA 2W68A 4Y1YA 3D4KA 2YG0A 2G9GA 4BIFA 3ZXFA 5CFDB 3WDTA 1UXXX 2FHRA 4DRVA 5LBFA 2X5IC 5FYMA 1S4CA 1VBD1 4FXKB 1HJGA 3T1LA 2KA3A 4MUVA 1BLZA 1VE0A 2HWE1 1HW5A 3CJXA 5LA2A 1JN2P 5LRSA 4XBNA 2PXJA 1H4GA 2VVDA 5HPOA 5F6LB 3E97A 2RDQA 1GZCA 5FYTA 5FYBA 3B9IA 4AGRA 5KXBA 2BZDA 3VUOA 2VUJA 4YVWA 1CGPA 4BXSV 1Q8PA 4PLNA 1Q5OA 4BK4A 4ZZ8A 3G6JB 5FYSA 2IXLA 2VMDA 3RFRA 3DECA 2V5YA 2Y6HA 2D5HA 4JCKA 5A1AA 3V56A 1RJ7A 1PX4A 1C1LA 4AZZA 4YZ3A 5LEJA 1D0GA 3MLJA 1CAWA 1RHI2 4XXAA 3PTYA 3CIHA 3VD7A 5A7WB 4CP2A 4EE2A 2W0XA 2WNUA 2XVLA 3H1WA 3MW2A 4GMP1 2W1UA 4N9HA 4PLMA 1NG0A 4DPNA 3F95A 5C8WA 4GAZA 1RUC1 3K46A 4JGYC 3UETA 1PVXA 3WDXA 3GHMA 5GLVA 1AZDA 5FZAA 5FBJA 1GOFA 3UV9A 4AHXA 1Y43B 2C9AA 1AXYA 1WD4A 1W8TA 4AFMA 3ORJA 1BYHA 4XQWA 1ND3B 4LHKA 1NZIA 2B5HA 2B45X 4GB31 1PMHX 4EZ4A 2WC2A 2ZBJA 5T3NA 1WLTA 4CCNA 2YPJA 3O1TA 1XNAA 4HFSA 4HK9A 4RS5C 4WM8B 2B9UA 2AC1A 2WLQA 3AZYA 4H7MA 3E5UA 1BMV1 1J3QA 2R32A 4KBZA 5GLTA 1IS5A 4IE6A 5A3WA 1JODA 3TYJA 1TMF3 4XOGA 5FFOC 1EY2A 3WDUA 1B35C 2JKBA 1JH5A 4E2SA 3VHOA 1QNYA 2PHRA 1FOD3 1H1AA 1UZYA 2E7QA 2PHUA 3CQOA 4P5YA 3U37A 5IVBA 5A33A 3O7OA 2P3JA 4BZ4A 1G9DA 2WQ8A 4X8NA 2VQUA 4JKLA 3M3CA 3VBFB 4LO5B 2GC3A 3VKMA 1UU4A 1MVQA 3MV01 1IQDC 3J26N 3C7GA 5C8CC 2UU8A 1I9RA 4J6GA 3EO6A 1AR62 3ST7A 1VAMA 2WSVA 3GALA 4B1MA 3DXUA 1MQTC 1C5HA 2ZXQA 4QQ2A 4MG2A 1NLSA 4Y20A 2Y60A 5JVVA 2PHLA 4IV1C 4OMDA 2O14A 3BKZA 2DU1A 2WNEA 3IKWA 2YUEA 4JRLA 3TN91 3ZSLA 4BQ5A 5A3PA 3VD3A 1DF0A 2ZEXA 4XXPA 3UESA 2JKXA 4D8MA 3ZO0B 3HOBA 5K7PA 2BW8A 4Y20B 4AHWA 1OKQA 4MADA 1LOAA 4Q4V3 3I3DA 1OA2A 2RHPA 3PJYA 2VD7A 2K0GA 1AL23 5J48A 2QQJA 3KD4A 3P1IA 3ZSMA 4AI3A 3PJQA 2XOMA 4D7YA 1YQ6A 1D2QA 4L99A 2VCCA 4URAA 1OFNA 4HANA 1COV3 4HOOA 3ZYBA 1RUF3 1SEFA 1WCSA 4OUMA 1Q8QA 1AYM2 5J96B 2P5BA 4FFHA 1QH7A 2MNGA 1NZCA 3HN3A 4QKDA 3I2HA 4V2VA 4HSJA 4XF4A 1WCDJ 3SH5A 2P3YA 4CXWA 4EQVA 1RUJ1 2JXAA 2QQPA 4CEWA 4L0PA 3WUCA 5I0SA 3FUQA 2MEV3 4ZPIA 3H8OA 1UMIA 2VVFA 3GBWA 2ERFA 1YQ2A 2W1QA 2ENRA 3EJKA 3UKVA 4XIOA 4TZDA 1OH3A 4I2OA 3AZZA 5LRRA 5FO9B 5JSRA 1GZTA 3LD8A 1PGL1 4OHVA 1YHFA 5JR7B 2VCBA 5A32B 2BERA 4QGLA 2VO5A 2YC2A 1IQAA 3VBRB 3ZXJA 2VW0A 3W5NA 1YQ8A 1J3PA 1OI6A 3I97A 4IDZA 4MSVA 1VBA3 3L2HA 4CDQB 1NUKA 1CPNA 3JCIA 4DUWA 2D5FA 3MW4A 3TRSB 2PAMA 1GP5A 4Z2WA 3EYPA 3VDDC 3ITQA 3BU7A 1QU0A 1W3VA 5E89A 4GIQA 5FY9A 1WGPA 2WO3A 3NAPC 1YFYA 2EIEA 4YW4A 1GZWB 2D6MA 4I09A 3S30A 2MHFA 4FQ4A 3S57A 4M00A 1TZOA 4NAOA 1QJY2 2DCYA 3T0DA 3EBRA 1S55A 2LALA 2ZX2A 4P5HA 1XE0A 3ETPA 1GNZA 4YZ5A 4FP3A 3AKRA 1K3IA 2B46X 4MO3M 2Z79A 3I59A 4Q4V1 1A8MA 3HVDA 4IERA 4K9SA 1UZZA 3LDRA 3POYA 1SDDB 3I2FA 2OUHA 1Y3TA 5A1FA 3AMMA 1EAH2 3HD8B 2G19A 3JD73 1PGW2 1Q43A 1HV0A 3PL0A 4HPKA 3RMYA 2V72A 3VB9A 1QIQA 2HWD2 2TNFA 3KHCA 5IUQA 1AJOA 2HKXA 1LODA 2VCMA 1CONA 3AYCA 5FUIA 3H0OA 4ORFA 2AEZA 4R52A 4LKEA 4YG3A 3WQBA 5A70A 1PVC3 5KBFA 3PUIA 3BTAA 4V1PA 1N1TA 1V00A 3D82A 5CNAA 4YG0A 3AB0A 5CA6A 3MPBA 1WCQA 3MZHA 2A6ZA 2RVAA 1GBGA 1OPOA 2LROA 4J25A 4UBGA 5AVAA 2XHNA 4O7XA 1BKZA 3K4AA 1OH4A 4DIQA 3B01A 4LO7A 4WBBA 5FPBA 1LULA 4JKKA 4CUGA 2R062 1FV3A 1AXZA 1NCQA 3KCYA 2XJTA 4W65A 1QOOA 4YGEA 5BNQA 5JUVA 1JZ5A 2DF7A 1W2TA 5F8PA 5FZ9A 2NLRA 5CB7A 1KFUL 2FQPA 3POFA 4D6RA 2D98A 2QVSB 2Y6GA 1FMD2 1LGNA 4JDOA 5GALA 4B7KA 3GBGA 4DS0A 1I1EA 3BTXA 2ZEWA 5LW9A 2RDSA 1OF4A 5CU1A 3IPVB 4KU8A 3SC7X 1IGOA 4CSWA 1NE4A 2BOIA 3O1OA 1LB2A 5CKMA 5DABA 1PVC2 3DEMA 3OYWB 3BOPA 4AQTA 2VW1A 4MZUA 5I0DA 1JUHA 4XTMA 2QQOA 4LLFA 4YLZA 2DVFA 1W04A 1YQCA 2HWF3 2X05A 4OLLA 1RTVA 2ARBA 1JUIA 3N9LA 4NPLA 4AEDA 1X8EA 1K5JA 3MBWA 2HWC2 4OUEA 3OYWA 3MIGA 3SHRA 3SXWA 5KHJA 1XNKA 1UYZA 1K5MB 3M3IA 2H0BA 3AC0A 3V0AB 2C5DA 4MXVA 2GNTA 4QDSA 3PDQA 4KWKA 2R043 1VBE2 4JKMA 1AR83 4W8JA 3MF9A 5DDJ3 3IMNA 4CEYC 5KXEA 5FXZA 1HIXA 4JDMA 4L2NA 1LGCA 3RZHA 2ADEA 2AZ5A 1DQ6A 1PNFA 4GA9A 3VDDA 2BJSA 3CZJA 3KVBA 2A7AA 3NSTA 5FPLA 3ZXLA 2O0OA 2R7EB 4XQ4A 1CAWB 4GULA 4LTAA 1YUDA 3CF6E 4FOQA 2J22A 2Z2SB 3B02A 3POSA 4J1WA 1JU3A 5LEKA 1HXS1 5FZIA 1XQNA 3D0SA 1W9TA 1OOPA 1SPPA 3BYWA 2XVKA 2DCJA 3H42B 4UYBA 3GNEA 2Q8DA 3SCFA 3WUDA 3Q8AA 4CEWB 4EZHA 3FLTA 4QX5A 3AMHA 3DN7A 3QD6A 2H6CA 3PNAA 4LK6A 1VBC2 1J1TA 1OT5A 3O1MA 1VBA2 4HKWA 1ZREA 3R4DB 4HL0A 2TBVA 5IAXA 1CPMA 3ETQA 1FOD2 1Z78A 5I8SA 4BLJA 4YVWC 4O9EA 2ZHLA 5FY4A 4MGSA 1NA1B 3M3EA 3CL1A 3WF1A 4DQAA 2DVGA 3DPRA 4JDNA 5FZ7A 5IT6A 5IK5A 3OSDA 4KG8A 3JD71 2C26A 4BCUA 2RS51 3OPZA 4EV0A 5C5UA 5FY7A 1PK6B 4C8DA 2QE3A 2BWCA 3BOWA 4LBLA 4AQSA 4MGZE 4QXHA 1N3QA 1TNRA 1LKNA 1VIWB 1TEIA 3MLKA 2BNMA 4BQ2A 4XFIA 5JI9A 4R4ZA 1O5LA 5F3EA 3K2OA 5DG1A 2YDEA 2QQNA 4OVEA 1S2KA 4I0AA 3VZKA 1JHNA 1ENXA 1REFA 2XQXA 4QQPA 1L7LA 1X50A 3HPNA 1C5IA 2D6LX 2WO7A 2JDZA 2W92A 3OBAA 3VBHC 1D4M3 5EQUA 1W6PB 1W8UA 1ZRIA 2WNOA 4NIIA 4AW7A 2JB8A 1UNBA 1KQRA 5JZGC 4LE3A 2A71A 4XUOA 1EV13 1UF2C 4LBNA 4XF1A 5FZ4A 5FZHA 4N9IA 4Y1VA 1X33A 1GWLA 3TBDA 3I7DA 2Q1ZB 4Q4W1 3OB8A 4CUAA 5CFDC 2OKXA 4M0NA 4XF0A 4QKFA 4W6XA 4MXWB 1QF3A 4AE2A 1LCLA 5KWRA 5FZ6A 3VBOC 1KEXA 2MPFA 2SBAA 5K9YA 1VBD2 2P3IA 3GYDA 3M1HA 4Q4V2 5T5JA 1SQ4A 2WBKA 1H9PA 1W2OA 1MS4A 1N3OA 4KG0A 4HBNA 4Y1ZA 3AMNA 1C28A 1DG6A 2X8KA 1QGLA 4H3WA 4RHV1 1DGRN 1UYPA 5I0UA 1XYNA 3TOJA 4HMZA 4B8EA 1JYXA 1JS9A 2YMZA 4PIXA 1LAJA 4KL1A 4CCCA 2XWJB 4LORA 4P9JA 3IAQA 4A41A 3NV4A 1VBB1 2WFPA 4FPEA 4PDWB 3JBG1 5FQ0A 2HWF2 3E5XA 2BEOA 2ZA9A 5DAVA 4CVUA 3TEZA 4XJ8A 4EWDA 4C0BA 3MIDA 4GWJA 3WNKA 4XEZA 1G7YA 1VMJA 4PDWA 4FOWA 1IKPA 4Q29A 5F5AA 2WNUC 4XABA 3VKFC 3WP3A 2CV6A 3O1UA 2B42B 2R042 4ZY9A 2PQSA 3MGUA 2JDNA 3HNBM 2P3KA 3P3PA 2ETEA 2VG9A 3LEGA 2HWC3 5FZOB 1V70A 1XU1A 3S7EA 3AJZA 4WZCA 4OQ9A 2DCZA 3ZX7A 1HRV2 2VZQA 4RHV2 3FZ3A 3K3NA 4BU2A 2RMU3 4YRDA 4AHYA 2WS93 5DMYA 3WF2A 4AEDC 1V9U2 1MEC3 4NPMA 1EYBA 3KT1A 4AEKA 2DBIA 3VZMA 1APNA 1CZSA 1BJQA 2JX9A 3DYPA 3I54A 2A6WA 4QPIA 3LA3A 3DF0A 3RQ0A 3KM5A 1M4WA 1RMU1 2FZ1A 4GH4A 3R0RA 2JEMA 2NYYA 3QBQA 3J8F3 4I0BA 2EXJA 1NQJA 3G7DA 3GCXA 3DCQA 3INAA 1BMV2 5LBBA 4WM8A 2PMWB 4RHV3 4PT6A 3VLBB 5C3SA 3S5QA 3RYPA 2ATFA 2C4XA 5JR2A 2XMLA 5F5CA 2PAKA 3LEIA 4LEJA 4Y5Z0 3RZJA 2HWF1 2YFUA 4YM2A 1SCSA 1D0HA 5LK7B 2W95A 3TNPB 3V0BB 3MHZA 1DQ1A 1YRZA 5TSWA 4RD7A 3HBZA 5FYVA 1TMF1 3SITA 2ZGTA 1ZBA3 3RZMA 3HT1A 2YY1A 4XFHA 2VL4A 4PF5A 3IIAA 3K48A 4NIAA 2PHTA 2UY8A 2WS92 5D8AC 2BU9A 2QKDA 1LECA 4URTA 4S2DA 1VR3A 1WMDA 4IGPA 4PLOA 4DEQA 1H30A 1F31A 2WT2A 4HG6B 2XBO2 4GJZA 2ZACA 4P00B 1IS6A 3EHKA 4GWNA 3U10A 2XWBB 3NV2A 4LK7A 3NAPA 2F17A 4IE7A 4QX0A 1CR7A 3VN4A 3N7KA 2EAKA 1ZZCA 3HQRA 3I8TA 3CBNA 4Q27A 3ZYIB 3ZPOA 1ULFA 5ACA2 4K1YA 2GMPA 1F5JA 4E4DX 2WINB 2RMU1 4AAXA 1UY1A 2Y6FA 4WM7C 2FDHA 4DOUA 1PZ7A 2RMU2 3D0JA 3BIEA 5DZFA 5ACA1 1QJY3 4J1XA 5EZWA 1AL21 4CDUC 2WO2A 1E5HA 1WW6A 4K3UA 5FO7B 2IXCA 3BTYA 4AFAA 4Y24A 3O5SA 3B00A 2D97A 1W6MA 4EJRA 2FZ2A 5FQ0B 4ATEA 3OBTA 1IZ3A 3RWNA 1ZZ8A 1J58A 4WVMB 1VBB3 2XBO1 2RDRA 1ZBE2 4IEWA 3GF6A 1ND2B 3OGJA 1DYPA 3POWA 3NVCA 4UFMA 5JOXA 1RUD2 3I2IA 5L9BA 1U0AA 5FZOA 5HXVA 1XNCA 3ZFEC 1QJU2 4FVVA 2B9VA 3O1RA 1E5SA 1QJX3 4CDQC 1XNDA 1XNBA 3I49A 4CDXC 1RUG1 4Z1VA 3VDDB 3K75B 2DVBA 3VHRA 5JMOA 4RQPA 4LBKA 2YYOA 4P9WA 2GN7A 1AR71 5B4NA 4JTNA 5FYHA 2XQRA 1W6OA 3U4SA 3AFKA 2YHJA 3DKWA 5JAXA 1O4YA 2WFF1 1U5ZA 2AGSA 4DXZA 1RYYA 4NIGA 1HRI2 2UURA 4N43C 4P08A 4Z82A 4XF9A 1JYIA 1QJU3 3E6BA 1V6JA 5F9TA 1O8PA 1R093 5FYCA 2VOVA 5BNNC 3VD9A 1ND3A 1VJ2A 1Y7BA 1UPIA 1RGSA 2WWSA 1XOYA 5FV3A 2LTNA 3WNMA 4A42A 5K0UB 3MO4A 4RGGA 1SBDA 1FMD3 4GALA 1H8TA 2D3PA 2JDAA 1OVPA 2EF6A 1DIWA 1VRH3 1DU3D 1X36A 3PHMA 1PO23 4O65A 5DUVA 1HRV3 3ZIXA 1ZA4A 2WNVC 2LS6A 1QXPA 3N7JA 3JUUA 4ATFA 4DRRA 3E6CC 1UY4A 2XJVA 1SZBA 4X8PA 5JXGA 4NE9A 2CY6A 4PF1A 5BUVA 5ANQA 3OUJA 5EFUA 4DB5A 3RGBA 1LOGA 3J8F2 2ID4A 4OUSA 3SMHA 4D7SA 2DWRA 4UW5A 1RUE1 3LDBA 4N7IA 2JG8A 4ARYA 5LBCA 5C3RA 3SCHA 1UY0A 3Q8FA 3RZLA 1OSGA 4JQTA 4HVQA 1CX4A 5C5TA 1DGRA 2YU1A 1BXHA 5A7QA 5FO8B 4S2GA 2A75A 2XG3A 5KXDA 3GZTB 2JWPA 4JGYB 2GC1A 2JDUA 2WJSA 1H1MA 3Q8EA 4DY3A 1POV0 1KFXL 3B69A 4LMFA 4XETA 1F8VA 2VMIA 1ALYA 1WMEA 3KV4A 3WX5A 3I2DA 2HJIA 5IYYA 5JCTA 1FAYA 5FP7A 4X6QB 1FV2A 4ZKTB 3ZKUA 2UWBA 5GZEA 4ZHNA 3OD4A 4RGKA 3I2OA 1HB2A 3ON7A 1YLLA 1WCUA 3RYKA 3B3QE 3QH6A 3SEPA 5CIRA 1GUIA 1UMHA 3HWJA 4FPLA 1ZRFA 1Q56A 3T30A 1URXA 4RS5A 1VBD3 2UWAA 3FFZA 3M2MA 5BXXA 5LY2A 3FWEA 3KS7A 4AGGA 4AI2A 4FPGA 3NJZA 1XYOA 2BRTA 2E7TA 4JRAA 1UKGA 5GLWA 2VY0A 4GWIA 5A3TA 5IATA 1RUH1 3RJRA 4KH9A 3OEAA 1IPKA 4LHNA 2VBBA 3ILNA 5GLZA 2P2KA 3JD72 2XBO3 5EWSA 4GMP0 1GQGA 2Y33A 3DPRB 3USUA 4BQ1A 4DNYA 3RYRA 3R6SA 4KI5M 4EWAA 4H14A 1HKDA 1CAVA 3ZM8A 3KGLA 4BIOA 3OEBA 5FYUA 1MACA 1YYNA 2F6BA 2QDRA 3F2ZA 1R081 4SLIA 4BMEA 3HJRA 1RUE3 3WLUA 5C3OA 4FOYA 1UOFA 4K6BA 3OGVA 5BV6A 3N35A 2YBPA 3DV8A 3LOBA 4P02B 5FXXA 2EIDA 4IEOA 3U78A 4YZ2A 1XC6A 1W0OA 4FAHA 2W52A 3UNPA 1NCRB 5HCBA 3NQHA 2VC9A 2K46A 4UFHA 5FPXA 4I01A 1HXS2 3O14A 4IETA 1PZ8A 2ZJCA 3WT3A 2HWB2 3I3MA 1WA4A 1CZVA 2VTXA 2XLAA 5JOZA 1Y4WA 1OQEA 2JDKA 4QB2A 5AC92 2FDGA 1G9BA 4INDA 2PELA 2WO1A 5FXWA 2XJPA 5E16A 3T2QA 1W28A 5A33B 3NMBA 1QJY1 4QPGC 1KITA 2P17A 3KV5A 1CIYA 4BB3A 4L11A 4X6RB 3OBZA 3I2KA 2FDIA 4C90A 3O1SA 1KS4A 4NHKA 2DU0A 3HAGA 1N1SA 1XE7A 3KQ4B 3NV1A 4QPIB 4LBMA 4S2FA 2IXIA 3HIFA 2ZPXA 3AVSA 1R092 5C8CA 4JTOA 5KHHA 5DZGA 5BNNA 1EV12 1NA1A 3PVNA 3WW1A 3OGRA 3WZ1A 4CCOA 1SG3A 5A1LA 1UU6A 4AVTA 4IEVA 2HWE2 3LPFA 3PTRB 1JW6A 4GMP3 3FMGA 3UL2A 2NN8A 4MOAA 4P9YA 2ZGNA 5EIYB 4IEZA 1AYN3 2GZWA 2XKOA 4DO0A 2AR6A 1VLNA 2PAEA 4OYUA 5IW0A 4JAAA 3ZDSA 1OLME 4XJZA 1YFWA 1W2UA 4HONA 1XPWA 2AACA 2QQMA 1WW7A 4UOJA 3H8RA 4Y22B 3H3LA 3QCWA 4IEUA 4LA3A 4KU7A 5GZDA 5EJZB 1DDLA 3RNSA 1QJEA 2J1RA 3BIWE 4ZXKA 2BGOA 1S1AA 1Q8OA 1FATA 3DGTA 4FPFA 3ZYRA 2JDYA 3KV9A 2ZX1A 4MX3A 3RMXA 3AP7A 3VV1A 1U12A 2JD4A 2OT7A 1ASJ3 1E5RA 2YXSA 5FY1A 4XTPA 3RVHA 2ORZA 3C8XA 1HN0A 2FMYA 5FY0A 1WW4A 4HLTA 4RR3C 4OHYA 1XNTA 2K2SA 2KR2A 1ZZ9A 2Y6JA 3KWVA 4E8DA 1J1LA 2UY9A 5E8AA 1HX6A 3AXEA 2ORXA 1W6MB 2WN2A 2HEYF 3AP5A 1ENSA 2R6QA 3AZWA 3IPVA 4NVPA 4EYUA 4TWTA 1O8SA 2DBNA 4YW3A 5FZ8A 1R091 4AOCA 5JSOA 1FPN2 4A7YA 3RPQA 3KMHA 1RUF1 5A3OA 1I6XA 1ZX5A 1HJFA 1SLBA 1Y9MA 4QX1A 4RA0A 3FBMA 2WT0A 3A23A 2DTWA 2HEVF 3JBG3 5C4WB 2YV8A 1U5XA 2TUNA 4EN7B 2PHFA 5JSPA 5E6HA 3M70A 3WW2A 2Z5WA 1RUC2 3WG4A 3C7EA 3WF3A 1QDCA 4MLOA 1CX1A 1U5YA 2DTYA 4M01A 2VZSA 1KD7A 3H8UA 3GZEA 4KGGA 4XILA 4LUKA 4QHBA 3CU7A 1PIV2 1R083 5JDBA 3KLSA 2WNUB 1W8NA 1W9YA 2BGPA 5BNPC 4E4ZA 1GWMA 1AX0A 1JYCA 1BK1A 4KMQA 1QXJA 2WZR3 4IV3C 1S0GA 3H50A 1OKOA 3IT8A 2XL7A 4IXLA 1MZ5A 4TXWA 1MQTA 4TN7A 4UFIA 4CCKA 1Q8VA 5A7PA 2XXZA 5T5OA 4ES8A 5F3CA 4R4XA 2ZX0A 4YVSB 3NV3A 2E53A 2E33A 1PMIA 2DDUA 2C0ZA 4QX8A 1LEDA 2W5FA 5L36A 5KR7A 1GICA 1RMU3 5DXDA 5K8SA 3VBRA 3CJIB 4EN9B 1ZBA2 1YFXA 1AR81 1WBFA 3AL6A 4FO9A 4IE0A 4ISQA 1IG3A 2XB6C 4WVZA 4OZOA 2BPA2 4XFCA 2VOTA 2WRAA 1JZ6A 1MVEA 1X8MA 3KT4A 3OCPA 4GH4C 4Y5TA 4XACA 2VUDA 2Y26A 3LE0A 3WW3A 3BCWA 3RI9A 5IFPA 3T0BA 4NN0A 2BWAA 1WCKA 1NYWA 1NCQB 5LK5A 1PNGA 3QOPA 3ZOIA 1RHI1 1AR93 1JZ3A 3A0KA 5FTTC 1H4HA 3T2PA 3POGA 1ULGA 2IVJA 1YEWA 1H6YA 2AENA 2WZR2 3ZFGA 1OLRA 1XRUA 2XL9A 2Q8OA 2YPDA 5FZ0A 2XPJA 3UKNA 4XHBA 1G6NA 5FDBA 3O1PA 1EP0A 1ST8A 2O8OA 4TLFA 2EICA 3ACHA 3B7MA 1OFSA 2JB4A 4JV4A 2BNOA 3FC0A 1W39A 2Y6KA 4A6SA 4YM0A 3OUIA 4MXWA 2CGPA 1AX2A 1RC6A 2Z42A 1VBC1 2NPIA 4U2AA 2DVDA 3POJA 3IDEA 1OA3A 5DQ0A 5A7WA 1DYOA 1O6UA 3GCWA 3NW4A 2R063 4HSLA 2ZAAA 2WIIB 2VNRA 2VXJA 5DN2A 5FZ3A 2O1QA 3IDBB 3FHQA 3ZFFA 5C33A 1LR5A 3VZOA 5F37A 5T52A 1FYUA 3KGZA 3FBYA 1JXNA 2CGNA 4PQQA 5AC91 1IPJA 2HWE3 2RE9A 4UF0B 4BPZA 3U0ZA 5IHRA 1O5UA 2IXKA 3LDKA 1SHWB 2ARCA 4YG6A 1BQPA 1ODNA 1RXGA 1RUI2 2PHDA 2W94A 5DAPA 1TG7A 3USSA 5FPUA 4YWAA 3BU0A 1WLDA 2YROA 2CGOA 5FOJB 5CBLA 5DAQA 2D6NA 1W9WA 2V73A 3JB4C 3MW3A 1QQP3 1AYM1 4YSFA 1YWKA 1SLLA 5BY5A 3QLQA 4NRMA 4LOSA 2RM22 2VBDA 2VOKA 3NJYA 4IEQA 2VOWA 3U11A 5JWPA 3MI8A 2GALA 2JIJA 3CHXA 1QOTA 3IIIA 4CTEA 1JZ4A 3SH3A 4LBQD 3KCCA 1CN1A 1SFYA 4GKXA 2ZZJA 1SPPB 2JDPA 4QB1A 1POQA 4AI8A 1V0AA 2QZ3A 2VNOA 2XVGA 4A45A 3GGLA 2DCKA 4NHLA 4E27A 1UCXA 1H2LA 2EIGA 3N9OA 1GZWA 1HQWA 1VRH2 3CKHA 5KC5A 5KHGA 1PGL2 3MIHA 3LA2A 1QJX1 2GC0A 3NNFA 4D7TA 3GDBA 5FLIA 2QZ2A 3VBHB 4AI0A 2R073 2RR12 1GV9A 4MYEA 3WHTA 5FP4A 1YJLA 1FX5A 4YW7A 1IKQA 3IN9A 2Q1FA 1J3RA 1VMHA 3R05A 3EMRA 3HNYM 4G3YC 4QDQA 3BB6A 5FZDA 5EYYA 2ZGUA 4PIZA 4M3CA 2VQAA 5I0TA 4DUXA 4XBQA 2WABA 2OXBA 1RJ8A 1WD3A 2VQTA 1HB3A 3JQXA 4XFBA 5H9RA 1DGWX 4MGYE 4QX3A 1Q3EA 2VCAA 2D3SA 4OHWA 1H2NA 3QACA 2IUWA 5EHDA 3E1F1 4LKFA 4DINB 1O59A 1HXS3 3GBFA 2E26A 4Y33A 1ZZ6A 2VBPA 3ZSEA 1J83A 1CJPA 4IEXA 4UFKA 1ASJ1 5C8CB 2F4LA 5EP9A 4AVAA 4XDQA 5HCFA 4PHZA 5CFCC 4Q0VA 2DCTA 4K8RB 5FP9A 3WNXA 2CDPA 2VAUA 3H1MA 4FCAA 5F6KA 1VRH1 4NOTA 1E57A 3WG1A 3MUZ1 1RUI3 2P4EA 3H3ZA 4BA6A 4BMBA 1RUOA 3VBFC 5IK4A 2WNVB 4RR3A 1W6NB 4BM8A 4DY5A 3POBA 5F5QA 1SDWA 2D6PA 4XPVA 1MPXA
chains in the Genus database with same CATH topology
1GNYA 3FHAA 1JYNA 4FI9A 2QQKA 5G05L 1JZ8A 4GZ9A 1T2XA 3I3EA 3ACIA 2VL4A 3CMGA 4DEVA 4UI9L 2J1AA 3NRUA 2HYXA 2YG0A 1CZTA 4DEQA 4HG6B 1UXXX 4P00B 2J7MA 2CDOA 4QX0A 2ZEZA 1JZ7A 4XUQA 5LA2A 2J1EA 3WNNA 4AAXA 5HPOA 1UY1A 1BHGA 2BZDA 4BXSV 3A22A 2VZVA 4BK4A 2WO2A 4ZZ8A 2VMDA 2W9XA 3VDAA 3I3BA 1PMJX 2B4KA 3DECA 3WNPA 1K12A 2Y6HA 3VD4A 3CDZB 5A1AA 1PX4A 3VD7A 3CIHA 5C70A 2J1TA 1UX7A 3I2IA 2RJ2A 3A7QA 2W1UA 2B9VA 2VMCA 3K46A 4E8CA 3JXSA 2EIBA 4BK5A 2VM9A 3UETA 3K75B 5JMOA 1GOFA 4M4PA 5B4NA 4ZZ5A 4DXRA 4QDRA 4BDVB 4ET7A 1PMHX 1RYYA 2YB7A 4P08A 1XNAA 3FL7A 1O8PA 4TTGA 4CUBA 1EUTA 2L9LA 3VD9A 4CU7A 3WNMA 4A42A 3MO4A 2JD9A 4CU8A 2JDAA 1NX9A 4P5YA 3U37A 3CQOA 3MV11 4QPWA 2LS6A 1ULOA 3GM8A 2WQ8A 2ZEYA 2VQUA 4QB6A 5JXJA 4JKLA 1NAEA 1UY4A 4XUPA 5JXGA 3MV01 4CU6A 2XONA 4PF1A 3D3AA 1IQDC 3C7GA 5CYYA 1K45A 2ID4A 2W46A 1JU4A 2QQLA 2ZXQA 4XUTA 4LPLA 4ARYA 2X09A 5LCWL 3K4ZA 1UY0A 3T08A 2VMFA 4OMDA 5C7GA 3VD3A 2ZEXA 1UWWA 3UESA 3WSOA 2JKXA 4D8MA 5C71A 3HOBA 3C7OA 3T2OA 3BN6A 3OGSA 4MADA 3I3DA 1US3A 4A3ZA 2QQJA 3P1IA 5IYYA 2XOMA 2VCCA 1ULPA 2VZ1A 2WAAA 3SKVA 4CU9A 5IFTA 3HN3A 3I2HA 3SEPA 1GUIA 1UMHA 4UAPA 4ARXA 4L0PA 1UMIA 1NKGA 2W1QA 1YQ2A 3ECQA 4GWIA 3GXUA 1R64A 3OEAA 1W9SA 2VCBA 3OG2A 2BERA 5LA0A 2VO5A 2YC2A 1JYWA 3C7FA 3W5NA 1GU3A 3I97A 4KI5M 4DUWA 1NUKA 1LNSA 3LEKA 3ZM8A 3OEBA 5CZKA 3F2ZA 2YC4A 3EYPA 3P6BA 3HJRA 4ZXEA 2WO3A 3OGVA 2EIEA 4P02B 2EIDA 2WZ8A 1XC6A 2WYSA 3UNPA 1WKYA 3NQHA 3T0DA 2VC9A 2E31A 3ETPA 1CZVA 1K3IA 4MO3M 4QB2A 5JXHA 2WO1A 3MUY1 3T2QA 4Z2AA 1SDDB 3I2FA 1GQPA 3IAPA 1F4AA 1JI6A 3VDCA 1CIYA 3I2KA 3WNLA 2W91A 3SEEA 3ACGA 2V72A 4CUCA 5FUIA 3OGRA 1SG3A 3WQBA 3LPFA 4DXTA 3PUIA 2Y6LA 2VZ3A 4MOAA 5EIYB 1WCQA 2RVAA 4OYUA 2VZRA 2XHNA 3LPGA 4XZUG 3K4AA 1OH4A 1I5PA 1XPWA 3DYMA 3I2JA 2QQMA 4JKKA 3BGAA 4UOJA 2VZPA 1JZ5A 5JUVA 5EJZB 2HLEA 3I2GA 2J1RA 2BGOA 2VZUA 1GOGA 2Y6GA 2QBXA 4W4ZA 3C7HA 2ORZA 3C8XA 2ZEWA 1OF4A 4RN5A 2VJXA 2VMEA 1XNTA 1GMMA 1PX3A 2Y6JA 4KWUA 4E8DA 2Y64A 3J7HA 5I0DA 2QQOA 1GOHA 2E32A 2ORXA 2WN2A 4LKSA 2X05A 1UYYA 1O8SA 4W50A 3MBWA 5LA1A 4OUEA 2J1UA 3NJVA 1UYZA 1W99A 3AC0A 1UYXA 4QDSA 4QX1A 5JXIA 1L7RA 3A23A 4JKMA 4W8JA 2WAOA 3C7EA 2BBAA 3T09A 3WF3A 1UY3A 2VZOA 4DXSA 1CX1A 3EB7A 2VZSA 3CZJA 2R7EB 2W47A 2V4VA 4DUVA 2VZTA 2WZEA 2J22A 4A44A 1W8NA 1JU3A 2BGPA 2J1VA 1W9TA 4XUNA 2DCJA 1US2A 3VD5A 4KMQA 5IJRA 4D0QA 4TXWA 4RYDA 2Z4FA 1UY2A 1OT5A 2KD7A 2E33A 2DDUA 4MGSA 2W5FA 3WF1A 4QX2A 4BJ0A 2C26A 3WEZA 4OZOA 1JZ6A 2VOTA 2W3JA 1P8JA 3SKJE 3LE0A 3HNMA 2RV9A 5IFPA 2WDBA 3T0BA 1DLCA 1JZ3A 4IUGA 2VTFA 2QQNA 3T2PA 4MGQA 1H6YA 3K4DA 3PUHA 1L7QA 2XQXA 3HPNA 3OBAA 2W92A 3WF4A 2EICA 3ACHA 3ACFA 2Y6KA 4XUOA 3WF0A 4A4AA 2X10A 2JE8A 3CZUA 5DQ0A 1F4HA 4LQRA 1DYOA 1JHJA 3OB8A 4CUAA 4LHSA 1UXZA 3IDAA 2OKXA 5DN2A 4M4RA 2W87A 3FHQA 1OD3A 1KEXA 2C9KA 2WUHA 1TVGA 4PQQA 2WBKA 5IHRA 5J1XA 4AG4A 5F7UA 1SHWB 2W94A 1TG7A 1D7PM 1JYXA 1OF3A 1W9WA 1UZ0A 3A21A 3IAQA 4A41A 1JZ4A 3IIIA 4YPJA 3NNGA 2LW8A 4JX0A 4QB1A 4CVUA 3HEIA 1W0NA 4A45A 3GGLA 2DCKA 4GWJA 2YFZA 3WNKA 3CKHA 3W5MA 2VR4A 4XURA 3GDBA 2V5DA 1DP0A 3IB3A 1JZ2A 2W1SA 4OMCA 1K42A 1KGYA 3THDA 4ZY9A 5DPNA 2PQSA 3THCA 3T0AA 3HNBM 3DYOA 4QDQA 3HNYM 5B4XA 4DUXA 5EJ1B 3LEGA 1W8OA 2J1SA 2QQIA 4XVHA 2W1WA 3LQCA 3WNOA 2WABA 5HXMA 2VZQA 2VQTA 5DMYA 3WF2A 4QX3A 2VCAA 1JYVA 1J84A 3E1F1 1CZSA 1O59A 2E26A 3DYPA 4QAWA 1J83A 2Y8KA 3FN9A 5G04L 1HN1A 4JHZA 3VDBA 2CDPA 3NJXA 3K77A 3MUZ1 4PT6A 2C4XA 5JR2A 1EUUA 3ABZA 3LEIA 2YFUA 1H6XA 4A6OA 2WN3A 1MPXA 2W95A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GNY A;  3FHA A;  1JYN A;  4FI9 A;  2QQK A;  5G05 L;  1JZ8 A;  4GZ9 A;  1T2X A;  3I3E A;  3ACI A;  2VL4 A;  3CMG A;  4DEV A;  4UI9 L;  2J1A A;  3NRU A;  2HYX A;  2YG0 A;  1CZT A;  4DEQ A;  4HG6 B;  1UXX X;  4P00 B;  2J7M A;  2CDO A;  4QX0 A;  2ZEZ A;  1JZ7 A;  4XUQ A;  5LA2 A;  2J1E A;  3WNN A;  4AAX A;  5HPO A;  1UY1 A;  1BHG A;  2BZD A;  4BXS V;  3A22 A;  2VZV A;  4BK4 A;  2WO2 A;  4ZZ8 A;  2VMD A;  2W9X A;  3VDA A;  3I3B A;  1PMJ X;  2B4K A;  3DEC A;  3WNP A;  1K12 A;  2Y6H A;  3VD4 A;  3CDZ B;  5A1A A;  1PX4 A;  3VD7 A;  3CIH A;  5C70 A;  2J1T A;  1UX7 A;  3I2I A;  2RJ2 A;  3A7Q A;  2W1U A;  2B9V A;  2VMC A;  3K46 A;  4E8C A;  3JXS A;  2EIB A;  4BK5 A;  2VM9 A;  3UET A;  3K75 B;  5JMO A;  1GOF A;  4M4P A;  5B4N A;  4ZZ5 A;  4DXR A;  4QDR A;  4BDV B;  4ET7 A;  1PMH X;  1RYY A;  2YB7 A;  4P08 A;  1XNA A;  3FL7 A;  1O8P A;  4TTG A;  4CUB A;  1EUT A;  2L9L A;  3VD9 A;  4CU7 A;  3WNM A;  4A42 A;  3MO4 A;  2JD9 A;  4CU8 A;  2JDA A;  1NX9 A;  4P5Y A;  3U37 A;  3CQO A;  3MV1 1;  4QPW A;  2LS6 A;  1ULO A;  3GM8 A;  2WQ8 A;  2ZEY A;  2VQU A;  4QB6 A;  5JXJ A;  4JKL A;  1NAE A;  1UY4 A;  4XUP A;  5JXG A;  3MV0 1;  4CU6 A;  2XON A;  4PF1 A;  3D3A A;  1IQD C;  3C7G A;  5CYY A;  1K45 A;  2ID4 A;  2W46 A;  1JU4 A;  2QQL A;  2ZXQ A;  4XUT A;  4LPL A;  4ARY A;  2X09 A;  5LCW L;  3K4Z A;  1UY0 A;  3T08 A;  2VMF A;  4OMD A;  5C7G A;  3VD3 A;  2ZEX A;  1UWW A;  3UES A;  3WSO A;  2JKX A;  4D8M A;  5C71 A;  3HOB A;  3C7O A;  3T2O A;  3BN6 A;  3OGS A;  4MAD A;  3I3D A;  1US3 A;  4A3Z A;  2QQJ A;  3P1I A;  5IYY A;  2XOM A;  2VCC A;  1ULP A;  2VZ1 A;  2WAA A;  3SKV A;  4CU9 A;  5IFT A;  3HN3 A;  3I2H A;  3SEP A;  1GUI A;  1UMH A;  4UAP A;  4ARX A;  4L0P A;  1UMI A;  1NKG A;  2W1Q A;  1YQ2 A;  3ECQ A;  4GWI A;  3GXU A;  1R64 A;  3OEA A;  1W9S A;  2VCB A;  3OG2 A;  2BER A;  5LA0 A;  2VO5 A;  2YC2 A;  1JYW A;  3C7F A;  3W5N A;  1GU3 A;  3I97 A;  4KI5 M;  4DUW A;  1NUK A;  1LNS A;  3LEK A;  3ZM8 A;  3OEB A;  5CZK A;  3F2Z A;  2YC4 A;  3EYP A;  3P6B A;  3HJR A;  4ZXE A;  2WO3 A;  3OGV A;  2EIE A;  4P02 B;  2EID A;  2WZ8 A;  1XC6 A;  2WYS A;  3UNP A;  1WKY A;  3NQH A;  3T0D A;  2VC9 A;  2E31 A;  3ETP A;  1CZV A;  1K3I A;  4MO3 M;  4QB2 A;  5JXH A;  2WO1 A;  3MUY 1;  3T2Q A;  4Z2A A;  1SDD B;  3I2F A;  1GQP A;  3IAP A;  1F4A A;  1JI6 A;  3VDC A;  1CIY A;  3I2K A;  3WNL A;  2W91 A;  3SEE A;  3ACG A;  2V72 A;  4CUC A;  5FUI A;  3OGR A;  1SG3 A;  3WQB A;  3LPF A;  4DXT A;  3PUI A;  2Y6L A;  2VZ3 A;  4MOA A;  5EIY B;  1WCQ A;  2RVA A;  4OYU A;  2VZR A;  2XHN A;  3LPG A;  4XZU G;  3K4A A;  1OH4 A;  1I5P A;  1XPW A;  3DYM A;  3I2J A;  2QQM A;  4JKK A;  3BGA A;  4UOJ A;  2VZP A;  1JZ5 A;  5JUV A;  5EJZ B;  2HLE A;  3I2G A;  2J1R A;  2BGO A;  2VZU A;  1GOG A;  2Y6G A;  2QBX A;  4W4Z A;  3C7H A;  2ORZ A;  3C8X A;  2ZEW A;  1OF4 A;  4RN5 A;  2VJX A;  2VME A;  1XNT A;  1GMM A;  1PX3 A;  2Y6J A;  4KWU A;  4E8D A;  2Y64 A;  3J7H A;  5I0D A;  2QQO A;  1GOH A;  2E32 A;  2ORX A;  2WN2 A;  4LKS A;  2X05 A;  1UYY A;  1O8S A;  4W50 A;  3MBW A;  5LA1 A;  4OUE A;  2J1U A;  3NJV A;  1UYZ A;  1W99 A;  3AC0 A;  1UYX A;  4QDS A;  4QX1 A;  5JXI A;  1L7R A;  3A23 A;  4JKM A;  4W8J A;  2WAO A;  3C7E A;  2BBA A;  3T09 A;  3WF3 A;  1UY3 A;  2VZO A;  4DXS A;  1CX1 A;  3EB7 A;  2VZS A;  3CZJ A;  2R7E B;  2W47 A;  2V4V A;  4DUV A;  2VZT A;  2WZE A;  2J22 A;  4A44 A;  1W8N A;  1JU3 A;  2BGP A;  2J1V A;  1W9T A;  4XUN A;  2DCJ A;  1US2 A;  3VD5 A;  4KMQ A;  5IJR A;  4D0Q A;  4TXW A;  4RYD A;  2Z4F A;  1UY2 A;  1OT5 A;  2KD7 A;  2E33 A;  2DDU A;  4MGS A;  2W5F A;  3WF1 A;  4QX2 A;  4BJ0 A;  2C26 A;  3WEZ A;  4OZO A;  1JZ6 A;  2VOT A;  2W3J A;  1P8J A;  3SKJ E;  3LE0 A;  3HNM A;  2RV9 A;  5IFP A;  2WDB A;  3T0B A;  1DLC A;  1JZ3 A;  4IUG A;  2VTF A;  2QQN A;  3T2P A;  4MGQ A;  1H6Y A;  3K4D A;  3PUH A;  1L7Q A;  2XQX A;  3HPN A;  3OBA A;  2W92 A;  3WF4 A;  2EIC A;  3ACH A;  3ACF A;  2Y6K A;  4XUO A;  3WF0 A;  4A4A A;  2X10 A;  2JE8 A;  3CZU A;  5DQ0 A;  1F4H A;  4LQR A;  1DYO A;  1JHJ A;  3OB8 A;  4CUA A;  4LHS A;  1UXZ A;  3IDA A;  2OKX A;  5DN2 A;  4M4R A;  2W87 A;  3FHQ A;  1OD3 A;  1KEX A;  2C9K A;  2WUH A;  1TVG A;  4PQQ A;  2WBK A;  5IHR A;  5J1X A;  4AG4 A;  5F7U A;  1SHW B;  2W94 A;  1TG7 A;  1D7P M;  1JYX A;  1OF3 A;  1W9W A;  1UZ0 A;  3A21 A;  3IAQ A;  4A41 A;  1JZ4 A;  3III A;  4YPJ A;  3NNG A;  2LW8 A;  4JX0 A;  4QB1 A;  4CVU A;  3HEI A;  1W0N A;  4A45 A;  3GGL A;  2DCK A;  4GWJ A;  2YFZ A;  3WNK A;  3CKH A;  3W5M A;  2VR4 A;  4XUR A;  3GDB A;  2V5D A;  1DP0 A;  3IB3 A;  1JZ2 A;  2W1S A;  4OMC A;  1K42 A;  1KGY A;  3THD A;  4ZY9 A;  5DPN A;  2PQS A;  3THC A;  3T0A A;  3HNB M;  3DYO A;  4QDQ A;  3HNY M;  5B4X A;  4DUX A;  5EJ1 B;  3LEG A;  1W8O A;  2J1S A;  2QQI A;  4XVH A;  2W1W A;  3LQC A;  3WNO A;  2WAB A;  5HXM A;  2VZQ A;  2VQT A;  5DMY A;  3WF2 A;  4QX3 A;  2VCA A;  1JYV A;  1J84 A;  3E1F 1;  1CZS A;  1O59 A;  2E26 A;  3DYP A;  4QAW A;  1J83 A;  2Y8K A;  3FN9 A;  5G04 L;  1HN1 A;  4JHZ A;  3VDB A;  2CDP A;  3NJX A;  3K77 A;  3MUZ 1;  4PT6 A;  2C4X A;  5JR2 A;  1EUU A;  3ABZ A;  3LEI A;  2YFU A;  1H6X A;  4A6O A;  2WN3 A;  1MPX A;  2W95 A; 
#chains in the Genus database with same CATH topology
 4NWW A;  1SBE A;  3TB0 A;  1JYN A;  4FI9 A;  1HQL A;  4AHZ A;  2PLV 3;  1MQT B;  3WCS A;  1FMD 1;  4GZ9 A;  3TNQ A;  3I3E A;  4XHX A;  5BYN A;  2NQY A;  1XSQ A;  3N9N A;  3ZYP A;  1W8H A;  2OUJ A;  3S7I A;  1SLA A;  4UI9 L;  4OZX A;  1XXN A;  3N9Q A;  3M7A A;  5LA9 A;  3WCR A;  1ZM1 A;  2GDF A;  4CEY A;  2VUL A;  2GP3 A;  4CCJ A;  3NRU A;  2HYX A;  1OXC A;  4LT5 A;  4XW3 A;  1QMJ A;  1ZVF A;  1CZT A;  2CYF A;  4MGI E;  1OD5 A;  1RUD 3;  4CP9 A;  4HZF A;  5FCC A;  2J7M A;  4K20 A;  1OA4 A;  1YQ5 A;  2A6V A;  1JOJ A;  3WG3 A;  2JIC A;  2KM2 A;  3UGG A;  5IVF A;  1POV 1;  4QM9 A;  2A5Z A;  1JZ7 A;  1NA1 C;  1AR9 2;  4K7J A;  1MS3 A;  4AED B;  3WNN A;  1UZV A;  2OW4 A;  2FBE A;  4B4P A;  4LO8 A;  2GME A;  4QXK A;  1C8N A;  1WA6 X;  1YI7 A;  2A73 B;  4LR4 A;  4AWD A;  1K5M A;  5KHI A;  3VBS A;  3UKT A;  3AVR A;  3AMQ A;  3A22 A;  2HWD 1;  2PN5 A;  1BEV 1;  1PK6 C;  5LZ6 A;  2VZV A;  4Y3O A;  4BLI A;  4CZS A;  1ACC A;  1VAV A;  3AP9 A;  1PHM A;  3I3B A;  5FK8 A;  1PMJ X;  5FPA A;  1O3T A;  3ZMO A;  4QPG A;  1QQP 1;  1X7N A;  3H7Y A;  1RVF 3;  4F7Z A;  3CDZ B;  4XJU A;  2IFR A;  4JGZ C;  2WQ4 A;  2HH9 A;  2I07 B;  4YFW A;  2EXH A;  4LBQ A;  3P3N A;  1JBC A;  2ZKL A;  4YFZ A;  5C70 A;  1WMF A;  5FPV A;  2B8M A;  3A7Q A;  3DKQ A;  2BDR A;  4TYS A;  3VBU A;  1XE8 A;  1OOP B;  2CHH A;  4WVM A;  1KJL A;  3PUS A;  4CPB D;  5JZG B;  3AK0 A;  4E8C A;  1PM4 A;  2EIB A;  3JXS A;  5HI0 A;  2VM9 A;  4O61 A;  4JHT A;  3ZN5 A;  1ONA A;  4NWV A;  4FTB A;  3J7M A;  2VXR A;  5FY8 A;  4M4P A;  5FWE A;  5JLV A;  3K3O A;  2EAA A;  3J7L A;  3VBU C;  4DXR A;  2WYF A;  2XUE A;  2Y0O A;  5A3N A;  4M3C E;  4QDR A;  1PIV 3;  3APB A;  4LE4 A;  1DZR A;  1LJ7 A;  5ABJ C;  1CES A;  2YB7 A;  1W05 A;  4XAE A;  5LAT A;  2WWU A;  3CJI A;  1AJK A;  3FL7 A;  3WIN E;  4KNC A;  4XC9 A;  3OJB A;  1YXW A;  1PVC 1;  1AL0 G;  2L9L A;  4TSV A;  3ZSK A;  4CU7 A;  4IV3 A;  4PJY A;  3LGR A;  1R1A 1;  3FHI B;  2VEC A;  4Q8L A;  4XBL A;  5SV8 A;  4ITC A;  1ASJ 2;  1NLQ A;  4Q0P A;  3WQ7 A;  5CAD A;  1UD1 A;  5EPA A;  3ZYF A;  3RZZ A;  3WD5 A;  1X82 A;  2VNG A;  1NX9 A;  1LU1 A;  3ZIW A;  2HBT A;  4QPW A;  3MV1 1;  4DFS A;  2DUO A;  1WW5 A;  4YM1 A;  5FYI A;  1PO1 1;  4M3C F;  4RQP C;  1YO8 A;  1H2K A;  1NAE A;  2OZJ A;  2QTW B;  1RVF 1;  4Z92 B;  1HLC A;  5IVE A;  4COY A;  2D44 A;  3HMY A;  5CYY A;  4YNI A;  4L9B A;  1N1Y A;  1QXR A;  2LRP A;  5A80 A;  3Q8B A;  2QQL A;  5J37 A;  5CAZ A;  4XUT A;  4UBH A;  2IVI B;  3D8C A;  3T08 A;  4BH9 A;  4FTS A;  2WFF 3;  3BPS A;  3WDY A;  3ZFG B;  5IWF A;  1QJX 2;  1UWW A;  3RJ2 X;  5JI7 A;  3ZN4 A;  4MVT A;  3ZFF B;  4WVV A;  1M06 G;  4LA2 A;  5C71 A;  3C7O A;  4AL9 A;  4YW1 A;  4BOW A;  1I5Z A;  3OGS A;  3JBG 2;  3PU8 A;  2EA7 A;  1TE1 B;  1US3 A;  3VZN A;  1VAK A;  4COZ A;  2X29 A;  5C3Q A;  5FPZ A;  3A4U A;  3N3H A;  1AR7 2;  1S0J A;  4OI1 A;  4AVV A;  1W8W A;  1C4R A;  1ULP A;  2ZGL A;  2VZ1 A;  1S0B A;  3PUQ A;  3SKV A;  4D3W A;  1UOB A;  1O91 A;  1WZX A;  2WNV A;  4RR3 B;  1HRI 3;  5IFT A;  2RS3 3;  4BE3 A;  5HCH A;  1ODM A;  5IK8 A;  3ZYH A;  4QGN A;  4QGM A;  5A6Q A;  1H8V A;  2CAU A;  1XSR A;  3B9C A;  4UAP A;  3B5L B;  1BK0 A;  4QMA A;  1G9F A;  1PO2 2;  1SMV A;  2VPV A;  3J7N A;  4HKO A;  4ZS3 A;  3RZK A;  4LKD A;  5FMC A;  4E2Q A;  1VPH A;  1NKG A;  2DUP A;  2BGC A;  3ECQ A;  5FMD A;  5GM0 A;  4E4S A;  3KV6 A;  3C3V A;  3ZN6 B;  3M8L A;  5BNO B;  4QQO A;  4SBV A;  1C3H A;  3LSD A;  3THT A;  4CEY B;  1W9S A;  5LBE A;  3OG2 A;  3RG0 A;  3K51 A;  5LA0 A;  1ZBA 1;  2P6C A;  3PU3 A;  4Y1X A;  3ZXK A;  2GNM A;  4E4H A;  3C7F A;  5D8A A;  5C4W C;  1BEV 2;  3SH4 A;  1IHM A;  4GB3 2;  1DGL A;  4IV1 A;  2CSG A;  4AF9 A;  4AVB A;  4WV8 A;  1PM7 A;  1LNS A;  3E5Q A;  5A7S A;  4CCD A;  4FQZ A;  1VBB 2;  4YGC A;  3Q9O A;  1EPZ A;  1CQ9 A;  1YIF A;  2YC4 A;  4JC1 A;  3O0W A;  1ZBE 3;  3WXP A;  3NKT A;  3ZPY A;  2GH8 A;  4P9I A;  4IES A;  3WP6 A;  3FX3 A;  5C6C A;  4YAR A;  3OBR A;  2QUO A;  2VOX A;  1ZRD A;  2WZ8 A;  2ZGQ A;  3PIJ A;  4LIV A;  1W06 A;  2PLV 1;  4NR1 A;  5CEH A;  3FE5 A;  1V6I A;  1WKY A;  3ZFE A;  1GQH A;  4IV3 B;  1POV 3;  2E31 A;  4MHR A;  4Q1R A;  1B35 A;  1QKQ A;  4UW6 A;  1C8M 2;  2YBK A;  3PLQ A;  4XJW A;  1PIV 1;  3U07 A;  2QJV A;  2JJ6 A;  4JVA A;  2IFW A;  4LIU A;  1GLH A;  2NZ9 A;  5JXH A;  3HBK A;  3MUY 1;  1L3J A;  1LOF C;  4KQ7 A;  1RIT A;  4L8Q A;  5L7O C;  1MZ6 A;  1CIW A;  1F4A A;  4LO6 B;  2JIG A;  3S6P A;  2XJU A;  1JI6 A;  2EVX A;  3VDC A;  4A7Z A;  4C1W A;  2IXH A;  4S2H A;  2JEC A;  4QM8 A;  2R1B A;  5EJ3 A;  4N53 C;  4LUM A;  4YZ1 A;  2E51 A;  2VH9 A;  2W91 A;  4WVW A;  3SEE A;  3WNL A;  3ACG A;  4AQ2 A;  3O0X A;  4ZS2 A;  3W20 A;  4XCA A;  3SLI A;  3MPP G;  5FUN A;  1OLQ A;  1LEM A;  3LOI A;  4P14 A;  5ERL A;  1VBA 1;  5FLJ A;  2P37 A;  4LBJ A;  2GNB A;  3VHP A;  3PME A;  5DZE A;  5F3I A;  4Q4X 1;  2XLG A;  5DUX A;  3M4F A;  1PO1 3;  1GR3 A;  1NE6 A;  2QDN A;  2F4P A;  3H3U A;  4DXT A;  3ALQ A;  3KQR A;  4HKL A;  1UIJ A;  4JGY A;  3H7J A;  1OHF A;  2Y6L A;  4Y22 A;  2ARE A;  2VZ3 A;  4MGT A;  5CKQ A;  4KWJ A;  3WG2 A;  3U75 A;  5FOB B;  4G4F A;  2VZR A;  5IAV A;  3AYA A;  4XZU G;  5KHK A;  2ZX4 A;  1VP6 A;  1OUS A;  5LAS A;  1I5P A;  1XYP A;  3DYM A;  3I2J A;  3BGA A;  5ABJ A;  1CAU B;  1GZ9 A;  3AYE A;  3MIE A;  4QPY A;  4BQY A;  1QY4 A;  1RUJ 2;  1SLI A;  2UWC A;  5GZF A;  2BFU L;  2XR4 A;  3BI3 A;  4Y26 A;  2DVA A;  4W6Y A;  2VZU A;  4LO4 B;  3ZXD A;  1NCR C;  1Y9Q A;  3CO2 A;  1GOG A;  3MFC A;  2QBX A;  1HB1 A;  1RUF 2;  3KVA A;  4FOV A;  4QD2 A;  5JOW A;  2CWS A;  2D7F A;  2JG9 C;  2Q8E A;  5T54 A;  4ZU5 A;  2PA7 A;  3N36 A;  1S0I A;  2H0V A;  1UOG A;  4N53 A;  5DG2 A;  4H7L A;  1FPN 1;  3POE A;  1V6O A;  1LOE A;  5FKC A;  2Y64 A;  1NLR A;  1DZT A;  3PVE A;  1RUJ 3;  2Y0I A;  4QPG B;  2AH2 A;  1GOH A;  2E32 A;  3LA7 A;  3N7L A;  4LKS A;  3WOG A;  5FRA A;  1UYY A;  3OOX A;  4RSU A;  1IS3 A;  1LU2 A;  4W50 A;  3H1Y A;  4NPR A;  4Y5S A;  4QHZ A;  1SLT A;  3AM2 A;  1DQ0 A;  2WFF 2;  4LUL A;  1AYM 3;  4K21 A;  5FK7 A;  4OHZ A;  4QPI C;  2GC2 A;  4IW3 A;  1COV 1;  1W99 A;  5L9V A;  1MS8 A;  4UF0 A;  2OYZ A;  5GZC A;  2JG8 C;  1F5F A;  1Z7S 3;  1E5I A;  2LUW A;  5JXI A;  2WQZ C;  4B7E A;  3AKP A;  3VBS C;  2WAO A;  1W3X A;  5H9Q A;  4EN6 B;  2BBA A;  4FTE A;  5FZ1 A;  5F1R A;  2BUK A;  3EB7 A;  3OPT A;  3T3Y A;  1RIR A;  1Z0H A;  2B7Y A;  2DFC A;  4XJA A;  2V4V A;  4COV A;  1WBL A;  2WZE A;  3DL3 A;  5T5P A;  1ZBE 1;  5CIS A;  3PVO A;  4XDO A;  1AYN 2;  2J1V A;  1VB4 A;  2RS1 1;  2WT1 A;  3FFQ A;  4NRO A;  4XUN A;  1UU5 A;  5IJR A;  2R49 A;  4D0Q A;  2PLV 2;  1AXK A;  4RYD A;  2W08 A;  5FLH A;  2Z4F A;  3IM0 A;  5IVV A;  2AEY A;  4AAP A;  1NXD 1;  1HDK A;  1VRB A;  3KF5 A;  3ELN A;  2Q4S A;  3ZKY A;  4R9B A;  2ZGS A;  1CD3 G;  2KD7 A;  5LB6 A;  4NHM A;  2XJQ A;  2VMG A;  3WVJ A;  2QQW A;  4DMI A;  5CG8 A;  2ADD A;  4XIK A;  5A32 A;  1W0P A;  3E6D A;  4FPY A;  4QX2 A;  4BJ0 A;  1FNY A;  3ENR A;  5J3U A;  2QNK A;  3WDV A;  3WEZ A;  5GZG A;  1TME 2;  4TLG A;  4YVS A;  2BYV E;  5FXV A;  1OUX A;  4QHO A;  3VBF A;  1H2M A;  1F35 A;  1RUH 2;  2XDV A;  2W3J A;  1OQD A;  1DHK B;  4AQ6 A;  5CFC B;  1ZA7 A;  3N7M A;  2YC0 A;  5F5I A;  3IZO A;  5FUP A;  4Q0S A;  1H8T B;  1D4V B;  3CEW A;  2WDB A;  1RUC 3;  2W39 A;  4XFG A;  1DLC A;  1DZQ A;  4BQW A;  4IUG A;  3UJO A;  2HWB 1;  2VTF A;  1T6B X;  2TEP A;  1FNZ A;  2ZHN A;  4LJH A;  3TEX A;  3JZV A;  1I3H A;  4N90 A;  5E88 A;  4XMA A;  1GWK A;  1VBE 3;  2D93 A;  4GD4 A;  3VHN A;  3ES4 A;  1BZW A;  1R08 2;  1QQP 2;  2AYH A;  4R8H A;  4CDW A;  5I8T A;  4GXL A;  4I3G A;  4QX7 A;  3I59 B;  4Q4X 2;  2WL1 A;  1V6L A;  1A78 A;  3ACF A;  2EAL A;  3TWI A;  2C1F A;  2FDJ A;  2V4A A;  3LIG A;  2O8Q A;  4LBQ B;  3NNM A;  2X10 A;  5FJH A;  2A1X A;  2JE8 A;  3CZU A;  4CDW B;  3AXD A;  1F4H A;  2RJL A;  3T2T A;  1JHJ A;  4NUB A;  3GJA A;  1IS4 A;  1UXZ A;  3IDA A;  3WR0 A;  2GSY A;  3AZV A;  2HYK A;  3M3Q A;  2WKK A;  2YGM A;  2WZR 1;  4M4R A;  5KC6 A;  1QWR A;  2NP0 A;  4QKB A;  2WUH A;  5IVY A;  4IEY A;  3MIB A;  4RS5 B;  4XFA A;  4WM8 C;  4XDP A;  3S5A A;  4AG4 A;  1W2A X;  1IG0 A;  3R4S A;  4K40 A;  4P9L A;  5FJK A;  4CA9 A;  1OPM A;  4UT5 A;  3C2U A;  4XYX A;  2PYT A;  2VTX J;  1D7P M;  3CJI C;  5KXC A;  1YFU A;  2RS3 2;  4AI9 A;  1LOC A;  1MR5 A;  4E2G A;  3A21 A;  4MH0 E;  5D21 A;  5FWJ A;  5CKN A;  3ZYJ B;  4GWM A;  1HQN A;  4JGZ B;  1ND2 C;  4YPJ A;  1R1A 2;  3SNM A;  5HCA A;  1NCQ C;  4FPO B;  3PUA A;  4CXY A;  1PZ9 A;  4UW4 A;  1F9K A;  1W0N A;  2ET1 A;  1QJF A;  4D69 A;  1SCR A;  4F3J A;  1NOV A;  4Q4Y 2;  4K1Z A;  2ZTN A;  2YFZ A;  2CL2 A;  4BWO A;  4NRP A;  3W5M A;  4Q4Y 1;  3RI8 A;  1SLC A;  5A7O A;  2VR4 A;  4XUR A;  1OOP C;  2XUM A;  3N4M A;  4XCB A;  2V5D A;  3IB3 A;  4IV1 B;  2JG9 A;  2G9F A;  2WA3 A;  1K42 A;  2BFU S;  2ZX3 A;  5DPN A;  1PGS A;  5SV5 A;  2E9Q A;  1DQ5 A;  1ND2 A;  2RS1 3;  3T0A A;  3DYO A;  4Q0U A;  3PIG A;  4LBO A;  4ONU A;  3KT7 A;  5EYX A;  3VBU B;  3KF3 A;  4FFG A;  2W1W A;  1LHN A;  1NQD A;  4N43 B;  3WNO A;  5HXM A;  1HRV 1;  1PK6 A;  4L92 A;  4ZU7 A;  1QJU 1;  2YU2 A;  3OGG A;  5FZM A;  2BBV A;  1LES A;  5FZC A;  4YZ4 A;  2VMH A;  3GZA A;  2A3X A;  4QAW A;  1VB2 A;  2Y8K A;  5A7N A;  4UW3 A;  1R1A 3;  2P6H A;  3FN9 A;  3OUH A;  5GKA C;  1FI2 A;  3AL5 A;  5G04 L;  4AFD A;  1WLC A;  4RFT 0;  2R1D A;  3BUC A;  3ZLI A;  5C3P A;  2BP6 A;  1XJA A;  1NXM A;  1R1Z A;  1T6G C;  2VUC A;  3VDB A;  4FPK A;  1QEX A;  3NJX A;  2ZZQ A;  4PBP A;  4QWN A;  3TEW A;  2WA4 A;  3LKJ A;  3AKT A;  1EUU A;  3ABZ A;  5APA A;  2IWG B;  1LEN A;  1H6X A;  4A6O A;  4M0H A;  3IWZ A;  1KDM A;  2RDN A;  4ZU4 A;  1GNY A;  3FHA A;  3FLR A;  1GNH A;  2ZAB A;  3VBR C;  1KDK A;  2VU9 A;  2E63 A;  2VUA A;  2QQK A;  1RVF 2;  2XJR A;  5G05 L;  5A3U A;  1JZ8 A;  1T2X A;  2A6X A;  2H6B A;  3ACI A;  4R9D A;  1W6Q A;  1PO1 2;  1W6N A;  4OHX A;  1LOF A;  1Z7S 1;  1CJD A;  4COW A;  2EXI A;  5A6Z A;  1ULE A;  3V0B A;  1ZRC A;  2J1A A;  4UFL A;  1DFQ A;  4Q4Y 3;  4WZF A;  2VVE A;  5C9A B;  4I3P A;  2PFW A;  2I74 A;  5FY5 A;  4JQR A;  4BHP A;  4GB3 3;  1W6Q B;  1UZW A;  1STM A;  2E7A A;  2MEV 1;  2WR9 A;  4LLO A;  3X29 B;  4NHX A;  1VAL A;  2CDO A;  5CFC A;  3H8X A;  3WV6 A;  4YVS C;  5AFB A;  2UYA A;  4YW6 A;  5J36 A;  2ZEZ A;  1BBT 2;  1AR7 3;  1LHW A;  1HRI 1;  4IGO A;  4XUQ A;  3VBO B;  2J1E A;  2OII A;  4PCR A;  1Y9G A;  5T50 A;  3FJS A;  5A6X A;  1V9U 3;  4PQ9 A;  1BHG A;  5EXO A;  1JYT A;  1ZRR A;  3NNL A;  3WQ1 A;  4QQH A;  4V2W A;  4AYU A;  3ZMN A;  1B35 B;  2KXL A;  2N7G A;  2W9X A;  3VZJ A;  3VDA A;  2B4K A;  3WNP A;  1MZF A;  2C6S A;  1RB8 G;  1AR9 1;  1K12 A;  1WLW A;  1D4M 2;  3VD4 A;  1AHS A;  3U4X A;  3WW4 A;  2G1M A;  3VBH A;  5DUW A;  5BNO C;  4YW5 A;  4B4R A;  4OFG A;  4G9S B;  3VGI A;  3WDW A;  5T55 A;  3LF7 A;  1MS0 A;  5D2A A;  4R9A A;  5BNP A;  3LCP A;  2J1T A;  1UX7 A;  4NIH A;  2RJ2 A;  1C8M 1;  1G8W A;  2B39 A;  3D6E A;  3MDP A;  2Z69 A;  2W2I A;  3LFM A;  5GLU A;  4AVS A;  1BVP 1;  2AUY A;  1LRH A;  3SQO A;  1CAX B;  4B4Q A;  1MS1 A;  2OVU A;  3ACL A;  4AXO A;  2VMC A;  4CPB A;  4BK5 A;  3ES1 A;  1W8Z A;  1AF9 A;  2R30 A;  5A3M A;  5FZE A;  3TAY A;  2WLP A;  3USU B;  4C0H A;  2D6O X;  1H1I A;  4B1L A;  3MIC A;  1AL2 2;  4GKY A;  1YJK A;  5L9R A;  2ZMK A;  1YCI A;  3OF1 A;  4Q26 A;  1TNF A;  4CXX A;  4ZZ5 A;  4PIY A;  1RED A;  1LTE A;  1AVB A;  4B3N A;  4BDV B;  4KWL A;  3NO8 A;  1JOB A;  1O4T A;  4LXL A;  3ATG A;  1QJZ A;  3URF A;  4BQ3 A;  4ET7 A;  1G9A A;  3QH7 A;  1ZNP A;  5K0U A;  4CRQ A;  5EV7 A;  4ASM B;  1MEC 1;  2BOJ A;  4O9G A;  2OZ6 A;  2ES3 A;  2WWJ A;  4FXG B;  4P9G A;  3TN9 2;  1OUR A;  1VBC 3;  3CLP A;  4CUB A;  4TTG A;  1OBN A;  4LIT A;  2I2S A;  1EUT A;  5FMO L;  4ZON A;  2OS2 A;  1AR6 3;  1N1V A;  1JOP A;  2JD9 A;  3D5O A;  3KZ4 C;  3NKG A;  4FAG A;  1RMU 2;  2QCS B;  4CU8 A;  1V9U 1;  2RM2 1;  3VKL A;  4P9X A;  3LWC A;  5FMO S;  5K4L A;  2WS9 1;  3HR9 A;  1YC6 1;  4N7U A;  4U36 A;  3ME2 A;  3M3O A;  1OC1 A;  4NHY A;  1D2S A;  1ULO A;  2R0H A;  2ZKN A;  3GM8 A;  1KS5 A;  2ZEY A;  4QB6 A;  5L73 A;  2Q8C A;  3VL8 A;  3ZVX A;  5JXJ A;  5CG9 A;  4XUP A;  4CU6 A;  2XON A;  1W6P A;  3D3A A;  4W6W A;  1X9T A;  1K45 A;  2D43 A;  3EXU A;  2BVV A;  3OY8 B;  4MGK E;  4M3C B;  4UWD A;  1BVV A;  3ZXA C;  2W46 A;  1XU2 A;  2ZGR A;  1JU4 A;  1ZZB A;  5FRE A;  4LPL A;  4AEM A;  2JDM A;  2X09 A;  2Q0A A;  5LCW L;  3K4Z A;  2VMF A;  3KCX A;  3NAP B;  4BQ4 A;  3KB5 A;  1RUN A;  2A3W A;  5C7G A;  1LHU A;  1ENQ A;  1MEC 2;  4AEJ A;  4OI4 A;  3WSO A;  3RRD A;  1RL3 A;  4Q4W 2;  4NO4 A;  3TEY A;  3LZZ A;  3J4U H;  5FYY A;  4D6Q A;  3T2O A;  2X5I B;  2X53 S;  3BN6 A;  4UXA A;  4QU2 A;  3A0N A;  4AVC A;  4A3Z A;  1UKR A;  5FZF A;  1ENR A;  2BNN A;  2CNA A;  2R07 1;  3GZU C;  5GJ6 A;  5BPX A;  3V64 A;  5FBZ A;  2XGX A;  3RZG A;  2WAA A;  1EAH 3;  1PGW 1;  5H9S A;  4FPH A;  1RUG 2;  4HET A;  1CVN A;  1S0F A;  1S0D A;  1S0E A;  3DXT A;  4CU9 A;  2PHW A;  2ZHK A;  3PUR A;  1IPS A;  4XMI A;  3L2Y A;  4WM7 B;  1F15 A;  1OQ1 A;  1RUD 1;  4XAA A;  4ARX A;  3FUO A;  1C8M 3;  1RUI 1;  1SAC A;  5DDJ 2;  2YGL A;  2XJS A;  4JGZ A;  4N8M A;  2V09 A;  2XKP A;  3UJQ A;  2I45 A;  2ILM A;  5JIU A;  2RR1 1;  3DUI A;  3GXU A;  4NMI A;  2OQ7 A;  3MEP A;  4XF3 A;  1R64 A;  1UIK A;  2IZW A;  1D4M 1;  4CP0 A;  3VZL A;  1O3Q A;  1REE A;  1RXF A;  2DUQ A;  3MFA A;  3GHN A;  4AFB A;  1OVS A;  2E6V A;  4RQP B;  1DBN A;  3ILR A;  1JYW A;  2ZMN A;  2PHX A;  3V65 A;  1GU3 A;  4R9C A;  1QOS A;  4Q2F A;  1N3P A;  4D6S A;  2FCV A;  1XBF A;  1NCR A;  3LEK A;  3I4I A;  2CTV A;  5DAX A;  3ZFE B;  4BIS A;  2FDK A;  4IEP A;  5CZK A;  5F39 A;  3P6B A;  3S0M A;  1BBT 1;  3FLP A;  4ZXE A;  1NY7 1;  2PQQ A;  4ASL A;  2VQ0 A;  4CDX B;  4OCT A;  5C4W A;  5M0T A;  3R4U A;  2ARX A;  2BQP A;  2GAU A;  2GP5 A;  4CDQ A;  1W2N A;  1SFP A;  2NMO A;  1H9W A;  2WYS A;  3ZR6 A;  3AP6 A;  4HVR A;  4Q0Q A;  1ND3 C;  2A3Y A;  3VKN A;  1QH6 A;  2LM3 A;  3N9M A;  4A3X A;  5LY1 A;  4K8F A;  1KJR A;  1GKB A;  3BAL A;  4COU A;  4Q4W 3;  1V6N A;  3BPZ A;  2P1B A;  1AUY A;  4CCE A;  2GU9 A;  1WUV A;  3I3Q A;  4YYO A;  4Z2A A;  4HN1 A;  1LOB A;  1O3S A;  1GQP A;  5HBA A;  3AZX A;  3IAP A;  1BEV 3;  4I02 A;  4AR2 A;  3AJY A;  3MF6 A;  1MS9 A;  4NRQ A;  5F2S A;  2Q1M A;  3B93 A;  4ES9 A;  5BNN B;  3BTZ A;  1Q8S A;  5K0U C;  3BVC A;  2JEN A;  3EQE A;  3LAG A;  2J42 A;  2YZ4 A;  4IGQ A;  3ZXE A;  3JQW A;  3WHU A;  4CUC A;  4IQP A;  3ZR5 A;  4FSJ A;  2QQV A;  2WSU A;  3TN9 3;  1YNA A;  4YM3 A;  4F8A A;  2VNV A;  2Q30 A;  3O12 A;  5FP8 A;  3W59 A;  1H8T C;  3J9S A;  4Z07 A;  3SIS A;  1X9P A;  2OA2 A;  1VMF A;  3U1X A;  3WQ0 A;  3AFG A;  4ASK A;  5I8Y A;  3VL9 A;  1S2B A;  1A6C A;  4OUL A;  2FMD A;  5H9P A;  4LOT A;  1JTZ X;  2X5I A;  1W90 A;  2ZHM A;  3LPG A;  2D40 A;  1GSL A;  4FPC A;  2JE7 A;  5IVJ A;  5FAX A;  5L19 A;  3Q8C A;  5IVC A;  5DDJ 1;  4CP1 A;  2VZP A;  5ANN A;  4KGQ A;  3L9J T;  5FKB A;  1BCX A;  1UL9 A;  2HLE A;  4XJ9 A;  3HN1 A;  4A7K A;  3I2G A;  4IE4 A;  1WWY A;  1HB4 A;  3ILF A;  4CEW C;  2HWB 3;  1ZYB A;  4PI0 A;  3ZDV A;  1AR8 2;  1MZE A;  4WM7 A;  3UK9 A;  4C91 A;  1TMF 2;  3C7H A;  3JB8 A;  4RFR B;  2R06 1;  5ABJ B;  5F3G A;  5AVP A;  1LHV A;  4I30 A;  2R07 2;  2RR1 3;  5I93 A;  4RN5 A;  2HWC 1;  3LFI A;  4A2U A;  2VJX A;  4YVW B;  4HN0 A;  2VME A;  4HVO A;  5FZL A;  1GMM A;  1UPS A;  5FZG A;  5BNO A;  2FDF A;  1PX3 A;  3RSJ A;  5AC9 3;  4MET A;  2Q5T A;  4KWU A;  5F32 A;  5FMB A;  3J7H A;  1O4Z A;  1MS5 A;  1C1F A;  3V0A A;  1DYK A;  4FP2 A;  1LGB A;  2G9Z A;  2OX0 A;  2ZML A;  3UGF A;  4N53 B;  4EWE A;  4Q8K A;  5A6Y A;  4Z8B A;  5LA1 A;  4N43 A;  1W03 A;  1AYN 1;  2JE9 A;  2J1U A;  3NJV A;  4RL7 A;  5B2G B;  1BBT 3;  1A34 A;  1G9C A;  2NM1 A;  1UYX A;  3JU9 A;  2FCU A;  2RS3 1;  1L7R A;  2XH6 A;  4YW2 A;  3AYD A;  1A8D A;  2CAV A;  4LHL A;  1CWP A;  2IC1 A;  4HXC A;  5E1R A;  5FR3 A;  2CWM A;  1ULC A;  3AX4 A;  3T09 A;  5FYZ A;  1UY3 A;  2VZO A;  4DXS A;  3RS6 A;  4L97 A;  5T5L A;  2D3R A;  4AK3 A;  1IOA A;  2G4I A;  2NMN A;  3MIF A;  2DYC A;  1V6M A;  2W47 A;  4HK8 A;  3ZYG A;  4FT8 A;  4CCM A;  4DUV A;  2VZT A;  1S2E A;  1YIP A;  1COV 2;  2R16 A;  3OD0 A;  4A44 A;  1F2N A;  3ZFF C;  2BV4 A;  1N47 A;  1UO9 A;  1US2 A;  2ZOE B;  3VD5 A;  2BVB A;  5ISL A;  3WY6 A;  1JMU B;  1GAN A;  2K9Z A;  2GND A;  2R0F A;  1G86 A;  4QKN A;  4DZG A;  3PMS A;  1UY2 A;  2C24 A;  1U5I A;  2QQU A;  5DAW A;  3KSC A;  3T1M A;  1EV1 1;  2DUR A;  4QXB A;  3UT0 A;  4HT1 T;  5L7O A;  5JOY A;  3SCG A;  3LEM A;  2OPK A;  1SFN A;  3CNA A;  1FPN 3;  2FCT A;  1QHD A;  3LSE A;  1EAH 1;  5B4X A;  3WP5 A;  2DV9 A;  4EN0 A;  4IL7 A;  3GJB A;  3IDC B;  1P8J A;  3HQU A;  2OPW A;  3SKJ E;  1UW8 A;  1DGW A;  2DFB A;  4PDW C;  2A6Y A;  1V6K A;  3HNM A;  2PTM A;  2RV9 A;  2RJK A;  3HT2 A;  4QT6 A;  3VBO A;  3ZSJ A;  5JIA A;  1CAU A;  2SLI A;  1DCS A;  2XHK A;  2JG8 B;  3P5B A;  5FIX A;  3T4H B;  5IK7 A;  4PI2 A;  2IXJ A;  4FPJ A;  4MGQ A;  1TME 1;  5DUU A;  2ZS6 B;  1QDO A;  1OMI A;  1Z7S 2;  3K4D A;  3PVB B;  3PUH A;  4FFI A;  3ROU A;  4I0W B;  3VBS B;  5J98 B;  1NY7 2;  4Y1U A;  1L7Q A;  1O7F A;  1KRI A;  4FFF A;  1OLM A;  5FZB A;  1B09 A;  4MV2 A;  4YGB A;  2CU5 A;  5JMC A;  3WF4 A;  1UX6 A;  1RIN A;  1DQ2 A;  4Q5O A;  1J59 A;  3WF0 A;  4CE8 A;  4OQ8 A;  2GN3 A;  4A4A A;  4BXF A;  3MLL A;  4IE5 A;  5FP3 A;  4PBO A;  4CYD A;  5C9A C;  2YBS A;  3VKO A;  4LQR A;  5HV4 A;  5ACA 3;  4C1X A;  2HWD 3;  4LHS A;  3THP A;  4OI0 A;  2VW2 A;  4BYY A;  4XE9 A;  2ZGK A;  1H0B A;  3RDI A;  3AKS A;  2GH2 A;  2W87 A;  3NWK A;  2RS1 2;  1OD3 A;  3O1V A;  2Y34 A;  5L7O B;  4MHU A;  2C9K A;  5I91 A;  1TVG A;  2MEV 2;  5LWB A;  1W8F A;  1PO2 1;  5FZK A;  3OPW A;  4ERO A;  3UYJ A;  3AMP A;  5A3L A;  1C57 A;  3J8F 1;  5F7U A;  5CFD A;  5J1X A;  2ZGP A;  4QXC A;  3W21 A;  1O3R A;  3ZN6 A;  3B94 A;  2HEW F;  1RHI 3;  1W6O B;  3LIH A;  2ZGM A;  5F2W A;  4Y4Y A;  3U14 A;  1OF3 A;  4Q4X 3;  1ZZ7 A;  2RS5 2;  5JPN B;  1VBE 1;  1K5M C;  2QFE A;  1GFF 2;  3NL1 A;  1RUG 3;  1UZ0 A;  4AGV A;  4YGD A;  2BTV C;  2HBU A;  1LHO A;  1UMZ A;  1GYK A;  2A70 A;  1FOD 1;  2R04 1;  3NNG A;  1GP4 A;  2LW8 A;  4JX0 A;  5JPM B;  4XQD A;  3NNJ A;  4Y4R A;  4B29 A;  1XB9 A;  3HEI A;  3ASI A;  3BOD A;  4QU1 A;  4CDX A;  3AP4 A;  1FT9 A;  4F83 A;  3W58 A;  1HV1 A;  4NAM A;  1TQ5 A;  1AX1 A;  3H9A A;  5D8A B;  4QQL A;  1DQ4 A;  1QNW A;  2GMM A;  1DP0 A;  2D6K A;  4XZP A;  1JZ2 A;  4UFJ A;  2W1S A;  4OMC A;  1KGY A;  3THD A;  2JDH A;  1CAV B;  1WMX A;  3IBM A;  5BNP B;  3THC A;  1RUE 2;  2UYB A;  1EPW A;  2FD8 A;  4E9K A;  3POI A;  2XLF A;  3OY8 A;  4CDW C;  2RS5 3;  4GJY A;  2P34 A;  1A3K A;  5EJ1 B;  1W8O A;  2J1S A;  1UQX A;  2QQI A;  1CAX A;  2ET7 A;  2JG9 B;  1KXG A;  3O0V A;  3LQC A;  4XVH A;  5D1I A;  5AFE A;  5I0R A;  1SBF A;  3LB9 A;  5JZG A;  4CDU A;  3AKQ A;  3N9P A;  3UGH A;  3WP4 A;  4FBF A;  4HPK B;  1JYV A;  1J84 A;  1UN1 A;  2ZGO A;  2VE1 A;  3MYX A;  2ARA A;  4Q1P A;  1S0C A;  3HQX A;  2OQ6 A;  4NJ4 A;  4CDU B;  3ZXG A;  1HN1 A;  4JHZ A;  2RM2 3;  3RWK X;  4EN8 B;  4KBB A;  4AFC A;  4BQX A;  3OTF A;  4H2A A;  5J09 A;  3K77 A;  3W9A A;  4GH4 B;  1GP6 A;  1YI9 A;  4D94 A;  2RG4 A;  3IMM A;  4LNV A;  2ZAH A;  4CCL A;  3KHB A;  5J7M A;  4OI2 A;  2WN3 A;  1FXZ A;  4W4Z A;  1RUH 3;  5CVR A;  1AR6 1;  1UOJ A;  2WZP P;  3DPR C;  1TME 3;  4XFF A;  1W9F A;  4H55 A;  3T4V A;  4RGA A;  5C9A A;  1ULD A;  2VGD A;  4JZR A;  1NT0 A;  2Y38 A;  5HV0 A;  4CP9 B;  3CMG A;  3ZFG C;  4AI1 A;  4DEV A;  2ZCW A;  4GQ7 A;  2EXK A;  4NID A;  4ISR A;  1UAI A;  1DLL A;  2W68 A;  4Y1Y A;  3D4K A;  2YG0 A;  2G9G A;  4BIF A;  3ZXF A;  5CFD B;  3WDT A;  1UXX X;  2FHR A;  4DRV A;  5LBF A;  2X5I C;  5FYM A;  1S4C A;  1VBD 1;  4FXK B;  1HJG A;  3T1L A;  2KA3 A;  4MUV A;  1BLZ A;  1VE0 A;  2HWE 1;  1HW5 A;  3CJX A;  5LA2 A;  1JN2 P;  5LRS A;  4XBN A;  2PXJ A;  1H4G A;  2VVD A;  5HPO A;  5F6L B;  3E97 A;  2RDQ A;  1GZC A;  5FYT A;  5FYB A;  3B9I A;  4AGR A;  5KXB A;  2BZD A;  3VUO A;  2VUJ A;  4YVW A;  1CGP A;  4BXS V;  1Q8P A;  4PLN A;  1Q5O A;  4BK4 A;  4ZZ8 A;  3G6J B;  5FYS A;  2IXL A;  2VMD A;  3RFR A;  3DEC A;  2V5Y A;  2Y6H A;  2D5H A;  4JCK A;  5A1A A;  3V56 A;  1RJ7 A;  1PX4 A;  1C1L A;  4AZZ A;  4YZ3 A;  5LEJ A;  1D0G A;  3MLJ A;  1CAW A;  1RHI 2;  4XXA A;  3PTY A;  3CIH A;  3VD7 A;  5A7W B;  4CP2 A;  4EE2 A;  2W0X A;  2WNU A;  2XVL A;  3H1W A;  3MW2 A;  4GMP 1;  2W1U A;  4N9H A;  4PLM A;  1NG0 A;  4DPN A;  3F95 A;  5C8W A;  4GAZ A;  1RUC 1;  3K46 A;  4JGY C;  3UET A;  1PVX A;  3WDX A;  3GHM A;  5GLV A;  1AZD A;  5FZA A;  5FBJ A;  1GOF A;  3UV9 A;  4AHX A;  1Y43 B;  2C9A A;  1AXY A;  1WD4 A;  1W8T A;  4AFM A;  3ORJ A;  1BYH A;  4XQW A;  1ND3 B;  4LHK A;  1NZI A;  2B5H A;  2B45 X;  4GB3 1;  1PMH X;  4EZ4 A;  2WC2 A;  2ZBJ A;  5T3N A;  1WLT A;  4CCN A;  2YPJ A;  3O1T A;  1XNA A;  4HFS A;  4HK9 A;  4RS5 C;  4WM8 B;  2B9U A;  2AC1 A;  2WLQ A;  3AZY A;  4H7M A;  3E5U A;  1BMV 1;  1J3Q A;  2R32 A;  4KBZ A;  5GLT A;  1IS5 A;  4IE6 A;  5A3W A;  1JOD A;  3TYJ A;  1TMF 3;  4XOG A;  5FFO C;  1EY2 A;  3WDU A;  1B35 C;  2JKB A;  1JH5 A;  4E2S A;  3VHO A;  1QNY A;  2PHR A;  1FOD 3;  1H1A A;  1UZY A;  2E7Q A;  2PHU A;  3CQO A;  4P5Y A;  3U37 A;  5IVB A;  5A33 A;  3O7O A;  2P3J A;  4BZ4 A;  1G9D A;  2WQ8 A;  4X8N A;  2VQU A;  4JKL A;  3M3C A;  3VBF B;  4LO5 B;  2GC3 A;  3VKM A;  1UU4 A;  1MVQ A;  3MV0 1;  1IQD C;  3J26 N;  3C7G A;  5C8C C;  2UU8 A;  1I9R A;  4J6G A;  3EO6 A;  1AR6 2;  3ST7 A;  1VAM A;  2WSV A;  3GAL A;  4B1M A;  3DXU A;  1MQT C;  1C5H A;  2ZXQ A;  4QQ2 A;  4MG2 A;  1NLS A;  4Y20 A;  2Y60 A;  5JVV A;  2PHL A;  4IV1 C;  4OMD A;  2O14 A;  3BKZ A;  2DU1 A;  2WNE A;  3IKW A;  2YUE A;  4JRL A;  3TN9 1;  3ZSL A;  4BQ5 A;  5A3P A;  3VD3 A;  1DF0 A;  2ZEX A;  4XXP A;  3UES A;  2JKX A;  4D8M A;  3ZO0 B;  3HOB A;  5K7P A;  2BW8 A;  4Y20 B;  4AHW A;  1OKQ A;  4MAD A;  1LOA A;  4Q4V 3;  3I3D A;  1OA2 A;  2RHP A;  3PJY A;  2VD7 A;  2K0G A;  1AL2 3;  5J48 A;  2QQJ A;  3KD4 A;  3P1I A;  3ZSM A;  4AI3 A;  3PJQ A;  2XOM A;  4D7Y A;  1YQ6 A;  1D2Q A;  4L99 A;  2VCC A;  4URA A;  1OFN A;  4HAN A;  1COV 3;  4HOO A;  3ZYB A;  1RUF 3;  1SEF A;  1WCS A;  4OUM A;  1Q8Q A;  1AYM 2;  5J96 B;  2P5B A;  4FFH A;  1QH7 A;  2MNG A;  1NZC A;  3HN3 A;  4QKD A;  3I2H A;  4V2V A;  4HSJ A;  4XF4 A;  1WCD J;  3SH5 A;  2P3Y A;  4CXW A;  4EQV A;  1RUJ 1;  2JXA A;  2QQP A;  4CEW A;  4L0P A;  3WUC A;  5I0S A;  3FUQ A;  2MEV 3;  4ZPI A;  3H8O A;  1UMI A;  2VVF A;  3GBW A;  2ERF A;  1YQ2 A;  2W1Q A;  2ENR A;  3EJK A;  3UKV A;  4XIO A;  4TZD A;  1OH3 A;  4I2O A;  3AZZ A;  5LRR A;  5FO9 B;  5JSR A;  1GZT A;  3LD8 A;  1PGL 1;  4OHV A;  1YHF A;  5JR7 B;  2VCB A;  5A32 B;  2BER A;  4QGL A;  2VO5 A;  2YC2 A;  1IQA A;  3VBR B;  3ZXJ A;  2VW0 A;  3W5N A;  1YQ8 A;  1J3P A;  1OI6 A;  3I97 A;  4IDZ A;  4MSV A;  1VBA 3;  3L2H A;  4CDQ B;  1NUK A;  1CPN A;  3JCI A;  4DUW A;  2D5F A;  3MW4 A;  3TRS B;  2PAM A;  1GP5 A;  4Z2W A;  3EYP A;  3VDD C;  3ITQ A;  3BU7 A;  1QU0 A;  1W3V A;  5E89 A;  4GIQ A;  5FY9 A;  1WGP A;  2WO3 A;  3NAP C;  1YFY A;  2EIE A;  4YW4 A;  1GZW B;  2D6M A;  4I09 A;  3S30 A;  2MHF A;  4FQ4 A;  3S57 A;  4M00 A;  1TZO A;  4NAO A;  1QJY 2;  2DCY A;  3T0D A;  3EBR A;  1S55 A;  2LAL A;  2ZX2 A;  4P5H A;  1XE0 A;  3ETP A;  1GNZ A;  4YZ5 A;  4FP3 A;  3AKR A;  1K3I A;  2B46 X;  4MO3 M;  2Z79 A;  3I59 A;  4Q4V 1;  1A8M A;  3HVD A;  4IER A;  4K9S A;  1UZZ A;  3LDR A;  3POY A;  1SDD B;  3I2F A;  2OUH A;  1Y3T A;  5A1F A;  3AMM A;  1EAH 2;  3HD8 B;  2G19 A;  3JD7 3;  1PGW 2;  1Q43 A;  1HV0 A;  3PL0 A;  4HPK A;  3RMY A;  2V72 A;  3VB9 A;  1QIQ A;  2HWD 2;  2TNF A;  3KHC A;  5IUQ A;  1AJO A;  2HKX A;  1LOD A;  2VCM A;  1CON A;  3AYC A;  5FUI A;  3H0O A;  4ORF A;  2AEZ A;  4R52 A;  4LKE A;  4YG3 A;  3WQB A;  5A70 A;  1PVC 3;  5KBF A;  3PUI A;  3BTA A;  4V1P A;  1N1T A;  1V00 A;  3D82 A;  5CNA A;  4YG0 A;  3AB0 A;  5CA6 A;  3MPB A;  1WCQ A;  3MZH A;  2A6Z A;  2RVA A;  1GBG A;  1OPO A;  2LRO A;  4J25 A;  4UBG A;  5AVA A;  2XHN A;  4O7X A;  1BKZ A;  3K4A A;  1OH4 A;  4DIQ A;  3B01 A;  4LO7 A;  4WBB A;  5FPB A;  1LUL A;  4JKK A;  4CUG A;  2R06 2;  1FV3 A;  1AXZ A;  1NCQ A;  3KCY A;  2XJT A;  4W65 A;  1QOO A;  4YGE A;  5BNQ A;  5JUV A;  1JZ5 A;  2DF7 A;  1W2T A;  5F8P A;  5FZ9 A;  2NLR A;  5CB7 A;  1KFU L;  2FQP A;  3POF A;  4D6R A;  2D98 A;  2QVS B;  2Y6G A;  1FMD 2;  1LGN A;  4JDO A;  5GAL A;  4B7K A;  3GBG A;  4DS0 A;  1I1E A;  3BTX A;  2ZEW A;  5LW9 A;  2RDS A;  1OF4 A;  5CU1 A;  3IPV B;  4KU8 A;  3SC7 X;  1IGO A;  4CSW A;  1NE4 A;  2BOI A;  3O1O A;  1LB2 A;  5CKM A;  5DAB A;  1PVC 2;  3DEM A;  3OYW B;  3BOP A;  4AQT A;  2VW1 A;  4MZU A;  5I0D A;  1JUH A;  4XTM A;  2QQO A;  4LLF A;  4YLZ A;  2DVF A;  1W04 A;  1YQC A;  2HWF 3;  2X05 A;  4OLL A;  1RTV A;  2ARB A;  1JUI A;  3N9L A;  4NPL A;  4AED A;  1X8E A;  1K5J A;  3MBW A;  2HWC 2;  4OUE A;  3OYW A;  3MIG A;  3SHR A;  3SXW A;  5KHJ A;  1XNK A;  1UYZ A;  1K5M B;  3M3I A;  2H0B A;  3AC0 A;  3V0A B;  2C5D A;  4MXV A;  2GNT A;  4QDS A;  3PDQ A;  4KWK A;  2R04 3;  1VBE 2;  4JKM A;  1AR8 3;  4W8J A;  3MF9 A;  5DDJ 3;  3IMN A;  4CEY C;  5KXE A;  5FXZ A;  1HIX A;  4JDM A;  4L2N A;  1LGC A;  3RZH A;  2ADE A;  2AZ5 A;  1DQ6 A;  1PNF A;  4GA9 A;  3VDD A;  2BJS A;  3CZJ A;  3KVB A;  2A7A A;  3NST A;  5FPL A;  3ZXL A;  2O0O A;  2R7E B;  4XQ4 A;  1CAW B;  4GUL A;  4LTA A;  1YUD A;  3CF6 E;  4FOQ A;  2J22 A;  2Z2S B;  3B02 A;  3POS A;  4J1W A;  1JU3 A;  5LEK A;  1HXS 1;  5FZI A;  1XQN A;  3D0S A;  1W9T A;  1OOP A;  1SPP A;  3BYW A;  2XVK A;  2DCJ A;  3H42 B;  4UYB A;  3GNE A;  2Q8D A;  3SCF A;  3WUD A;  3Q8A A;  4CEW B;  4EZH A;  3FLT A;  4QX5 A;  3AMH A;  3DN7 A;  3QD6 A;  2H6C A;  3PNA A;  4LK6 A;  1VBC 2;  1J1T A;  1OT5 A;  3O1M A;  1VBA 2;  4HKW A;  1ZRE A;  3R4D B;  4HL0 A;  2TBV A;  5IAX A;  1CPM A;  3ETQ A;  1FOD 2;  1Z78 A;  5I8S A;  4BLJ A;  4YVW C;  4O9E A;  2ZHL A;  5FY4 A;  4MGS A;  1NA1 B;  3M3E A;  3CL1 A;  3WF1 A;  4DQA A;  2DVG A;  3DPR A;  4JDN A;  5FZ7 A;  5IT6 A;  5IK5 A;  3OSD A;  4KG8 A;  3JD7 1;  2C26 A;  4BCU A;  2RS5 1;  3OPZ A;  4EV0 A;  5C5U A;  5FY7 A;  1PK6 B;  4C8D A;  2QE3 A;  2BWC A;  3BOW A;  4LBL A;  4AQS A;  4MGZ E;  4QXH A;  1N3Q A;  1TNR A;  1LKN A;  1VIW B;  1TEI A;  3MLK A;  2BNM A;  4BQ2 A;  4XFI A;  5JI9 A;  4R4Z A;  1O5L A;  5F3E A;  3K2O A;  5DG1 A;  2YDE A;  2QQN A;  4OVE A;  1S2K A;  4I0A A;  3VZK A;  1JHN A;  1ENX A;  1REF A;  2XQX A;  4QQP A;  1L7L A;  1X50 A;  3HPN A;  1C5I A;  2D6L X;  2WO7 A;  2JDZ A;  2W92 A;  3OBA A;  3VBH C;  1D4M 3;  5EQU A;  1W6P B;  1W8U A;  1ZRI A;  2WNO A;  4NII A;  4AW7 A;  2JB8 A;  1UNB A;  1KQR A;  5JZG C;  4LE3 A;  2A71 A;  4XUO A;  1EV1 3;  1UF2 C;  4LBN A;  4XF1 A;  5FZ4 A;  5FZH A;  4N9I A;  4Y1V A;  1X33 A;  1GWL A;  3TBD A;  3I7D A;  2Q1Z B;  4Q4W 1;  3OB8 A;  4CUA A;  5CFD C;  2OKX A;  4M0N A;  4XF0 A;  4QKF A;  4W6X A;  4MXW B;  1QF3 A;  4AE2 A;  1LCL A;  5KWR A;  5FZ6 A;  3VBO C;  1KEX A;  2MPF A;  2SBA A;  5K9Y A;  1VBD 2;  2P3I A;  3GYD A;  3M1H A;  4Q4V 2;  5T5J A;  1SQ4 A;  2WBK A;  1H9P A;  1W2O A;  1MS4 A;  1N3O A;  4KG0 A;  4HBN A;  4Y1Z A;  3AMN A;  1C28 A;  1DG6 A;  2X8K A;  1QGL A;  4H3W A;  4RHV 1;  1DGR N;  1UYP A;  5I0U A;  1XYN A;  3TOJ A;  4HMZ A;  4B8E A;  1JYX A;  1JS9 A;  2YMZ A;  4PIX A;  1LAJ A;  4KL1 A;  4CCC A;  2XWJ B;  4LOR A;  4P9J A;  3IAQ A;  4A41 A;  3NV4 A;  1VBB 1;  2WFP A;  4FPE A;  4PDW B;  3JBG 1;  5FQ0 A;  2HWF 2;  3E5X A;  2BEO A;  2ZA9 A;  5DAV A;  4CVU A;  3TEZ A;  4XJ8 A;  4EWD A;  4C0B A;  3MID A;  4GWJ A;  3WNK A;  4XEZ A;  1G7Y A;  1VMJ A;  4PDW A;  4FOW A;  1IKP A;  4Q29 A;  5F5A A;  2WNU C;  4XAB A;  3VKF C;  3WP3 A;  2CV6 A;  3O1U A;  2B42 B;  2R04 2;  4ZY9 A;  2PQS A;  3MGU A;  2JDN A;  3HNB M;  2P3K A;  3P3P A;  2ETE A;  2VG9 A;  3LEG A;  2HWC 3;  5FZO B;  1V70 A;  1XU1 A;  3S7E A;  3AJZ A;  4WZC A;  4OQ9 A;  2DCZ A;  3ZX7 A;  1HRV 2;  2VZQ A;  4RHV 2;  3FZ3 A;  3K3N A;  4BU2 A;  2RMU 3;  4YRD A;  4AHY A;  2WS9 3;  5DMY A;  3WF2 A;  4AED C;  1V9U 2;  1MEC 3;  4NPM A;  1EYB A;  3KT1 A;  4AEK A;  2DBI A;  3VZM A;  1APN A;  1CZS A;  1BJQ A;  2JX9 A;  3DYP A;  3I54 A;  2A6W A;  4QPI A;  3LA3 A;  3DF0 A;  3RQ0 A;  3KM5 A;  1M4W A;  1RMU 1;  2FZ1 A;  4GH4 A;  3R0R A;  2JEM A;  2NYY A;  3QBQ A;  3J8F 3;  4I0B A;  2EXJ A;  1NQJ A;  3G7D A;  3GCX A;  3DCQ A;  3INA A;  1BMV 2;  5LBB A;  4WM8 A;  2PMW B;  4RHV 3;  4PT6 A;  3VLB B;  5C3S A;  3S5Q A;  3RYP A;  2ATF A;  2C4X A;  5JR2 A;  2XML A;  5F5C A;  2PAK A;  3LEI A;  4LEJ A;  4Y5Z 0;  3RZJ A;  2HWF 1;  2YFU A;  4YM2 A;  1SCS A;  1D0H A;  5LK7 B;  2W95 A;  3TNP B;  3V0B B;  3MHZ A;  1DQ1 A;  1YRZ A;  5TSW A;  4RD7 A;  3HBZ A;  5FYV A;  1TMF 1;  3SIT A;  2ZGT A;  1ZBA 3;  3RZM A;  3HT1 A;  2YY1 A;  4XFH A;  2VL4 A;  4PF5 A;  3IIA A;  3K48 A;  4NIA A;  2PHT A;  2UY8 A;  2WS9 2;  5D8A C;  2BU9 A;  2QKD A;  1LEC A;  4URT A;  4S2D A;  1VR3 A;  1WMD A;  4IGP A;  4PLO A;  4DEQ A;  1H30 A;  1F31 A;  2WT2 A;  4HG6 B;  2XBO 2;  4GJZ A;  2ZAC A;  4P00 B;  1IS6 A;  3EHK A;  4GWN A;  3U10 A;  2XWB B;  3NV2 A;  4LK7 A;  3NAP A;  2F17 A;  4IE7 A;  4QX0 A;  1CR7 A;  3VN4 A;  3N7K A;  2EAK A;  1ZZC A;  3HQR A;  3I8T A;  3CBN A;  4Q27 A;  3ZYI B;  3ZPO A;  1ULF A;  5ACA 2;  4K1Y A;  2GMP A;  1F5J A;  4E4D X;  2WIN B;  2RMU 1;  4AAX A;  1UY1 A;  2Y6F A;  4WM7 C;  2FDH A;  4DOU A;  1PZ7 A;  2RMU 2;  3D0J A;  3BIE A;  5DZF A;  5ACA 1;  1QJY 3;  4J1X A;  5EZW A;  1AL2 1;  4CDU C;  2WO2 A;  1E5H A;  1WW6 A;  4K3U A;  5FO7 B;  2IXC A;  3BTY A;  4AFA A;  4Y24 A;  3O5S A;  3B00 A;  2D97 A;  1W6M A;  4EJR A;  2FZ2 A;  5FQ0 B;  4ATE A;  3OBT A;  1IZ3 A;  3RWN A;  1ZZ8 A;  1J58 A;  4WVM B;  1VBB 3;  2XBO 1;  2RDR A;  1ZBE 2;  4IEW A;  3GF6 A;  1ND2 B;  3OGJ A;  1DYP A;  3POW A;  3NVC A;  4UFM A;  5JOX A;  1RUD 2;  3I2I A;  5L9B A;  1U0A A;  5FZO A;  5HXV A;  1XNC A;  3ZFE C;  1QJU 2;  4FVV A;  2B9V A;  3O1R A;  1E5S A;  1QJX 3;  4CDQ C;  1XND A;  1XNB A;  3I49 A;  4CDX C;  1RUG 1;  4Z1V A;  3VDD B;  3K75 B;  2DVB A;  3VHR A;  5JMO A;  4RQP A;  4LBK A;  2YYO A;  4P9W A;  2GN7 A;  1AR7 1;  5B4N A;  4JTN A;  5FYH A;  2XQR A;  1W6O A;  3U4S A;  3AFK A;  2YHJ A;  3DKW A;  5JAX A;  1O4Y A;  2WFF 1;  1U5Z A;  2AGS A;  4DXZ A;  1RYY A;  4NIG A;  1HRI 2;  2UUR A;  4N43 C;  4P08 A;  4Z82 A;  4XF9 A;  1JYI A;  1QJU 3;  3E6B A;  1V6J A;  5F9T A;  1O8P A;  1R09 3;  5FYC A;  2VOV A;  5BNN C;  3VD9 A;  1ND3 A;  1VJ2 A;  1Y7B A;  1UPI A;  1RGS A;  2WWS A;  1XOY A;  5FV3 A;  2LTN A;  3WNM A;  4A42 A;  5K0U B;  3MO4 A;  4RGG A;  1SBD A;  1FMD 3;  4GAL A;  1H8T A;  2D3P A;  2JDA A;  1OVP A;  2EF6 A;  1DIW A;  1VRH 3;  1DU3 D;  1X36 A;  3PHM A;  1PO2 3;  4O65 A;  5DUV A;  1HRV 3;  3ZIX A;  1ZA4 A;  2WNV C;  2LS6 A;  1QXP A;  3N7J A;  3JUU A;  4ATF A;  4DRR A;  3E6C C;  1UY4 A;  2XJV A;  1SZB A;  4X8P A;  5JXG A;  4NE9 A;  2CY6 A;  4PF1 A;  5BUV A;  5ANQ A;  3OUJ A;  5EFU A;  4DB5 A;  3RGB A;  1LOG A;  3J8F 2;  2ID4 A;  4OUS A;  3SMH A;  4D7S A;  2DWR A;  4UW5 A;  1RUE 1;  3LDB A;  4N7I A;  2JG8 A;  4ARY A;  5LBC A;  5C3R A;  3SCH A;  1UY0 A;  3Q8F A;  3RZL A;  1OSG A;  4JQT A;  4HVQ A;  1CX4 A;  5C5T A;  1DGR A;  2YU1 A;  1BXH A;  5A7Q A;  5FO8 B;  4S2G A;  2A75 A;  2XG3 A;  5KXD A;  3GZT B;  2JWP A;  4JGY B;  2GC1 A;  2JDU A;  2WJS A;  1H1M A;  3Q8E A;  4DY3 A;  1POV 0;  1KFX L;  3B69 A;  4LMF A;  4XET A;  1F8V A;  2VMI A;  1ALY A;  1WME A;  3KV4 A;  3WX5 A;  3I2D A;  2HJI A;  5IYY A;  5JCT A;  1FAY A;  5FP7 A;  4X6Q B;  1FV2 A;  4ZKT B;  3ZKU A;  2UWB A;  5GZE A;  4ZHN A;  3OD4 A;  4RGK A;  3I2O A;  1HB2 A;  3ON7 A;  1YLL A;  1WCU A;  3RYK A;  3B3Q E;  3QH6 A;  3SEP A;  5CIR A;  1GUI A;  1UMH A;  3HWJ A;  4FPL A;  1ZRF A;  1Q56 A;  3T30 A;  1URX A;  4RS5 A;  1VBD 3;  2UWA A;  3FFZ A;  3M2M A;  5BXX A;  5LY2 A;  3FWE A;  3KS7 A;  4AGG A;  4AI2 A;  4FPG A;  3NJZ A;  1XYO A;  2BRT A;  2E7T A;  4JRA A;  1UKG A;  5GLW A;  2VY0 A;  4GWI A;  5A3T A;  5IAT A;  1RUH 1;  3RJR A;  4KH9 A;  3OEA A;  1IPK A;  4LHN A;  2VBB A;  3ILN A;  5GLZ A;  2P2K A;  3JD7 2;  2XBO 3;  5EWS A;  4GMP 0;  1GQG A;  2Y33 A;  3DPR B;  3USU A;  4BQ1 A;  4DNY A;  3RYR A;  3R6S A;  4KI5 M;  4EWA A;  4H14 A;  1HKD A;  1CAV A;  3ZM8 A;  3KGL A;  4BIO A;  3OEB A;  5FYU A;  1MAC A;  1YYN A;  2F6B A;  2QDR A;  3F2Z A;  1R08 1;  4SLI A;  4BME A;  3HJR A;  1RUE 3;  3WLU A;  5C3O A;  4FOY A;  1UOF A;  4K6B A;  3OGV A;  5BV6 A;  3N35 A;  2YBP A;  3DV8 A;  3LOB A;  4P02 B;  5FXX A;  2EID A;  4IEO A;  3U78 A;  4YZ2 A;  1XC6 A;  1W0O A;  4FAH A;  2W52 A;  3UNP A;  1NCR B;  5HCB A;  3NQH A;  2VC9 A;  2K46 A;  4UFH A;  5FPX A;  4I01 A;  1HXS 2;  3O14 A;  4IET A;  1PZ8 A;  2ZJC A;  3WT3 A;  2HWB 2;  3I3M A;  1WA4 A;  1CZV A;  2VTX A;  2XLA A;  5JOZ A;  1Y4W A;  1OQE A;  2JDK A;  4QB2 A;  5AC9 2;  2FDG A;  1G9B A;  4IND A;  2PEL A;  2WO1 A;  5FXW A;  2XJP A;  5E16 A;  3T2Q A;  1W28 A;  5A33 B;  3NMB A;  1QJY 1;  4QPG C;  1KIT A;  2P17 A;  3KV5 A;  1CIY A;  4BB3 A;  4L11 A;  4X6R B;  3OBZ A;  3I2K A;  2FDI A;  4C90 A;  3O1S A;  1KS4 A;  4NHK A;  2DU0 A;  3HAG A;  1N1S A;  1XE7 A;  3KQ4 B;  3NV1 A;  4QPI B;  4LBM A;  4S2F A;  2IXI A;  3HIF A;  2ZPX A;  3AVS A;  1R09 2;  5C8C A;  4JTO A;  5KHH A;  5DZG A;  5BNN A;  1EV1 2;  1NA1 A;  3PVN A;  3WW1 A;  3OGR A;  3WZ1 A;  4CCO A;  1SG3 A;  5A1L A;  1UU6 A;  4AVT A;  4IEV A;  2HWE 2;  3LPF A;  3PTR B;  1JW6 A;  4GMP 3;  3FMG A;  3UL2 A;  2NN8 A;  4MOA A;  4P9Y A;  2ZGN A;  5EIY B;  4IEZ A;  1AYN 3;  2GZW A;  2XKO A;  4DO0 A;  2AR6 A;  1VLN A;  2PAE A;  4OYU A;  5IW0 A;  4JAA A;  3ZDS A;  1OLM E;  4XJZ A;  1YFW A;  1W2U A;  4HON A;  1XPW A;  2AAC A;  2QQM A;  1WW7 A;  4UOJ A;  3H8R A;  4Y22 B;  3H3L A;  3QCW A;  4IEU A;  4LA3 A;  4KU7 A;  5GZD A;  5EJZ B;  1DDL A;  3RNS A;  1QJE A;  2J1R A;  3BIW E;  4ZXK A;  2BGO A;  1S1A A;  1Q8O A;  1FAT A;  3DGT A;  4FPF A;  3ZYR A;  2JDY A;  3KV9 A;  2ZX1 A;  4MX3 A;  3RMX A;  3AP7 A;  3VV1 A;  1U12 A;  2JD4 A;  2OT7 A;  1ASJ 3;  1E5R A;  2YXS A;  5FY1 A;  4XTP A;  3RVH A;  2ORZ A;  3C8X A;  1HN0 A;  2FMY A;  5FY0 A;  1WW4 A;  4HLT A;  4RR3 C;  4OHY A;  1XNT A;  2K2S A;  2KR2 A;  1ZZ9 A;  2Y6J A;  3KWV A;  4E8D A;  1J1L A;  2UY9 A;  5E8A A;  1HX6 A;  3AXE A;  2ORX A;  1W6M B;  2WN2 A;  2HEY F;  3AP5 A;  1ENS A;  2R6Q A;  3AZW A;  3IPV A;  4NVP A;  4EYU A;  4TWT A;  1O8S A;  2DBN A;  4YW3 A;  5FZ8 A;  1R09 1;  4AOC A;  5JSO A;  1FPN 2;  4A7Y A;  3RPQ A;  3KMH A;  1RUF 1;  5A3O A;  1I6X A;  1ZX5 A;  1HJF A;  1SLB A;  1Y9M A;  4QX1 A;  4RA0 A;  3FBM A;  2WT0 A;  3A23 A;  2DTW A;  2HEV F;  3JBG 3;  5C4W B;  2YV8 A;  1U5X A;  2TUN A;  4EN7 B;  2PHF A;  5JSP A;  5E6H A;  3M70 A;  3WW2 A;  2Z5W A;  1RUC 2;  3WG4 A;  3C7E A;  3WF3 A;  1QDC A;  4MLO A;  1CX1 A;  1U5Y A;  2DTY A;  4M01 A;  2VZS A;  1KD7 A;  3H8U A;  3GZE A;  4KGG A;  4XIL A;  4LUK A;  4QHB A;  3CU7 A;  1PIV 2;  1R08 3;  5JDB A;  3KLS A;  2WNU B;  1W8N A;  1W9Y A;  2BGP A;  5BNP C;  4E4Z A;  1GWM A;  1AX0 A;  1JYC A;  1BK1 A;  4KMQ A;  1QXJ A;  2WZR 3;  4IV3 C;  1S0G A;  3H50 A;  1OKO A;  3IT8 A;  2XL7 A;  4IXL A;  1MZ5 A;  4TXW A;  1MQT A;  4TN7 A;  4UFI A;  4CCK A;  1Q8V A;  5A7P A;  2XXZ A;  5T5O A;  4ES8 A;  5F3C A;  4R4X A;  2ZX0 A;  4YVS B;  3NV3 A;  2E53 A;  2E33 A;  1PMI A;  2DDU A;  2C0Z A;  4QX8 A;  1LED A;  2W5F A;  5L36 A;  5KR7 A;  1GIC A;  1RMU 3;  5DXD A;  5K8S A;  3VBR A;  3CJI B;  4EN9 B;  1ZBA 2;  1YFX A;  1AR8 1;  1WBF A;  3AL6 A;  4FO9 A;  4IE0 A;  4ISQ A;  1IG3 A;  2XB6 C;  4WVZ A;  4OZO A;  2BPA 2;  4XFC A;  2VOT A;  2WRA A;  1JZ6 A;  1MVE A;  1X8M A;  3KT4 A;  3OCP A;  4GH4 C;  4Y5T A;  4XAC A;  2VUD A;  2Y26 A;  3LE0 A;  3WW3 A;  3BCW A;  3RI9 A;  5IFP A;  3T0B A;  4NN0 A;  2BWA A;  1WCK A;  1NYW A;  1NCQ B;  5LK5 A;  1PNG A;  3QOP A;  3ZOI A;  1RHI 1;  1AR9 3;  1JZ3 A;  3A0K A;  5FTT C;  1H4H A;  3T2P A;  3POG A;  1ULG A;  2IVJ A;  1YEW A;  1H6Y A;  2AEN A;  2WZR 2;  3ZFG A;  1OLR A;  1XRU A;  2XL9 A;  2Q8O A;  2YPD A;  5FZ0 A;  2XPJ A;  3UKN A;  4XHB A;  1G6N A;  5FDB A;  3O1P A;  1EP0 A;  1ST8 A;  2O8O A;  4TLF A;  2EIC A;  3ACH A;  3B7M A;  1OFS A;  2JB4 A;  4JV4 A;  2BNO A;  3FC0 A;  1W39 A;  2Y6K A;  4A6S A;  4YM0 A;  3OUI A;  4MXW A;  2CGP A;  1AX2 A;  1RC6 A;  2Z42 A;  1VBC 1;  2NPI A;  4U2A A;  2DVD A;  3POJ A;  3IDE A;  1OA3 A;  5DQ0 A;  5A7W A;  1DYO A;  1O6U A;  3GCW A;  3NW4 A;  2R06 3;  4HSL A;  2ZAA A;  2WII B;  2VNR A;  2VXJ A;  5DN2 A;  5FZ3 A;  2O1Q A;  3IDB B;  3FHQ A;  3ZFF A;  5C33 A;  1LR5 A;  3VZO A;  5F37 A;  5T52 A;  1FYU A;  3KGZ A;  3FBY A;  1JXN A;  2CGN A;  4PQQ A;  5AC9 1;  1IPJ A;  2HWE 3;  2RE9 A;  4UF0 B;  4BPZ A;  3U0Z A;  5IHR A;  1O5U A;  2IXK A;  3LDK A;  1SHW B;  2ARC A;  4YG6 A;  1BQP A;  1ODN A;  1RXG A;  1RUI 2;  2PHD A;  2W94 A;  5DAP A;  1TG7 A;  3USS A;  5FPU A;  4YWA A;  3BU0 A;  1WLD A;  2YRO A;  2CGO A;  5FOJ B;  5CBL A;  5DAQ A;  2D6N A;  1W9W A;  2V73 A;  3JB4 C;  3MW3 A;  1QQP 3;  1AYM 1;  4YSF A;  1YWK A;  1SLL A;  5BY5 A;  3QLQ A;  4NRM A;  4LOS A;  2RM2 2;  2VBD A;  2VOK A;  3NJY A;  4IEQ A;  2VOW A;  3U11 A;  5JWP A;  3MI8 A;  2GAL A;  2JIJ A;  3CHX A;  1QOT A;  3III A;  4CTE A;  1JZ4 A;  3SH3 A;  4LBQ D;  3KCC A;  1CN1 A;  1SFY A;  4GKX A;  2ZZJ A;  1SPP B;  2JDP A;  4QB1 A;  1POQ A;  4AI8 A;  1V0A A;  2QZ3 A;  2VNO A;  2XVG A;  4A45 A;  3GGL A;  2DCK A;  4NHL A;  4E27 A;  1UCX A;  1H2L A;  2EIG A;  3N9O A;  1GZW A;  1HQW A;  1VRH 2;  3CKH A;  5KC5 A;  5KHG A;  1PGL 2;  3MIH A;  3LA2 A;  1QJX 1;  2GC0 A;  3NNF A;  4D7T A;  3GDB A;  5FLI A;  2QZ2 A;  3VBH B;  4AI0 A;  2R07 3;  2RR1 2;  1GV9 A;  4MYE A;  3WHT A;  5FP4 A;  1YJL A;  1FX5 A;  4YW7 A;  1IKQ A;  3IN9 A;  2Q1F A;  1J3R A;  1VMH A;  3R05 A;  3EMR A;  3HNY M;  4G3Y C;  4QDQ A;  3BB6 A;  5FZD A;  5EYY A;  2ZGU A;  4PIZ A;  4M3C A;  2VQA A;  5I0T A;  4DUX A;  4XBQ A;  2WAB A;  2OXB A;  1RJ8 A;  1WD3 A;  2VQT A;  1HB3 A;  3JQX A;  4XFB A;  5H9R A;  1DGW X;  4MGY E;  4QX3 A;  1Q3E A;  2VCA A;  2D3S A;  4OHW A;  1H2N A;  3QAC A;  2IUW A;  5EHD A;  3E1F 1;  4LKF A;  4DIN B;  1O59 A;  1HXS 3;  3GBF A;  2E26 A;  4Y33 A;  1ZZ6 A;  2VBP A;  3ZSE A;  1J83 A;  1CJP A;  4IEX A;  4UFK A;  1ASJ 1;  5C8C B;  2F4L A;  5EP9 A;  4AVA A;  4XDQ A;  5HCF A;  4PHZ A;  5CFC C;  4Q0V A;  2DCT A;  4K8R B;  5FP9 A;  3WNX A;  2CDP A;  2VAU A;  3H1M A;  4FCA A;  5F6K A;  1VRH 1;  4NOT A;  1E57 A;  3WG1 A;  3MUZ 1;  1RUI 3;  2P4E A;  3H3Z A;  4BA6 A;  4BMB A;  1RUO A;  3VBF C;  5IK4 A;  2WNV B;  4RR3 A;  1W6N B;  4BM8 A;  4DY5 A;  3POB A;  5F5Q A;  1SDW A;  2D6P A;  4XPV A;  1MPX A; 
#chains in the Genus database with same CATH homology
 1GNY A;  3FHA A;  1JYN A;  4FI9 A;  2QQK A;  5G05 L;  1JZ8 A;  4GZ9 A;  1T2X A;  3I3E A;  3ACI A;  2VL4 A;  3CMG A;  4DEV A;  4UI9 L;  2J1A A;  3NRU A;  2HYX A;  2YG0 A;  1CZT A;  4DEQ A;  4HG6 B;  1UXX X;  4P00 B;  2J7M A;  2CDO A;  4QX0 A;  2ZEZ A;  1JZ7 A;  4XUQ A;  5LA2 A;  2J1E A;  3WNN A;  4AAX A;  5HPO A;  1UY1 A;  1BHG A;  2BZD A;  4BXS V;  3A22 A;  2VZV A;  4BK4 A;  2WO2 A;  4ZZ8 A;  2VMD A;  2W9X A;  3VDA A;  3I3B A;  1PMJ X;  2B4K A;  3DEC A;  3WNP A;  1K12 A;  2Y6H A;  3VD4 A;  3CDZ B;  5A1A A;  1PX4 A;  3VD7 A;  3CIH A;  5C70 A;  2J1T A;  1UX7 A;  3I2I A;  2RJ2 A;  3A7Q A;  2W1U A;  2B9V A;  2VMC A;  3K46 A;  4E8C A;  3JXS A;  2EIB A;  4BK5 A;  2VM9 A;  3UET A;  3K75 B;  5JMO A;  1GOF A;  4M4P A;  5B4N A;  4ZZ5 A;  4DXR A;  4QDR A;  4BDV B;  4ET7 A;  1PMH X;  1RYY A;  2YB7 A;  4P08 A;  1XNA A;  3FL7 A;  1O8P A;  4TTG A;  4CUB A;  1EUT A;  2L9L A;  3VD9 A;  4CU7 A;  3WNM A;  4A42 A;  3MO4 A;  2JD9 A;  4CU8 A;  2JDA A;  1NX9 A;  4P5Y A;  3U37 A;  3CQO A;  3MV1 1;  4QPW A;  2LS6 A;  1ULO A;  3GM8 A;  2WQ8 A;  2ZEY A;  2VQU A;  4QB6 A;  5JXJ A;  4JKL A;  1NAE A;  1UY4 A;  4XUP A;  5JXG A;  3MV0 1;  4CU6 A;  2XON A;  4PF1 A;  3D3A A;  1IQD C;  3C7G A;  5CYY A;  1K45 A;  2ID4 A;  2W46 A;  1JU4 A;  2QQL A;  2ZXQ A;  4XUT A;  4LPL A;  4ARY A;  2X09 A;  5LCW L;  3K4Z A;  1UY0 A;  3T08 A;  2VMF A;  4OMD A;  5C7G A;  3VD3 A;  2ZEX A;  1UWW A;  3UES A;  3WSO A;  2JKX A;  4D8M A;  5C71 A;  3HOB A;  3C7O A;  3T2O A;  3BN6 A;  3OGS A;  4MAD A;  3I3D A;  1US3 A;  4A3Z A;  2QQJ A;  3P1I A;  5IYY A;  2XOM A;  2VCC A;  1ULP A;  2VZ1 A;  2WAA A;  3SKV A;  4CU9 A;  5IFT A;  3HN3 A;  3I2H A;  3SEP A;  1GUI A;  1UMH A;  4UAP A;  4ARX A;  4L0P A;  1UMI A;  1NKG A;  2W1Q A;  1YQ2 A;  3ECQ A;  4GWI A;  3GXU A;  1R64 A;  3OEA A;  1W9S A;  2VCB A;  3OG2 A;  2BER A;  5LA0 A;  2VO5 A;  2YC2 A;  1JYW A;  3C7F A;  3W5N A;  1GU3 A;  3I97 A;  4KI5 M;  4DUW A;  1NUK A;  1LNS A;  3LEK A;  3ZM8 A;  3OEB A;  5CZK A;  3F2Z A;  2YC4 A;  3EYP A;  3P6B A;  3HJR A;  4ZXE A;  2WO3 A;  3OGV A;  2EIE A;  4P02 B;  2EID A;  2WZ8 A;  1XC6 A;  2WYS A;  3UNP A;  1WKY A;  3NQH A;  3T0D A;  2VC9 A;  2E31 A;  3ETP A;  1CZV A;  1K3I A;  4MO3 M;  4QB2 A;  5JXH A;  2WO1 A;  3MUY 1;  3T2Q A;  4Z2A A;  1SDD B;  3I2F A;  1GQP A;  3IAP A;  1F4A A;  1JI6 A;  3VDC A;  1CIY A;  3I2K A;  3WNL A;  2W91 A;  3SEE A;  3ACG A;  2V72 A;  4CUC A;  5FUI A;  3OGR A;  1SG3 A;  3WQB A;  3LPF A;  4DXT A;  3PUI A;  2Y6L A;  2VZ3 A;  4MOA A;  5EIY B;  1WCQ A;  2RVA A;  4OYU A;  2VZR A;  2XHN A;  3LPG A;  4XZU G;  3K4A A;  1OH4 A;  1I5P A;  1XPW A;  3DYM A;  3I2J A;  2QQM A;  4JKK A;  3BGA A;  4UOJ A;  2VZP A;  1JZ5 A;  5JUV A;  5EJZ B;  2HLE A;  3I2G A;  2J1R A;  2BGO A;  2VZU A;  1GOG A;  2Y6G A;  2QBX A;  4W4Z A;  3C7H A;  2ORZ A;  3C8X A;  2ZEW A;  1OF4 A;  4RN5 A;  2VJX A;  2VME A;  1XNT A;  1GMM A;  1PX3 A;  2Y6J A;  4KWU A;  4E8D A;  2Y64 A;  3J7H A;  5I0D A;  2QQO A;  1GOH A;  2E32 A;  2ORX A;  2WN2 A;  4LKS A;  2X05 A;  1UYY A;  1O8S A;  4W50 A;  3MBW A;  5LA1 A;  4OUE A;  2J1U A;  3NJV A;  1UYZ A;  1W99 A;  3AC0 A;  1UYX A;  4QDS A;  4QX1 A;  5JXI A;  1L7R A;  3A23 A;  4JKM A;  4W8J A;  2WAO A;  3C7E A;  2BBA A;  3T09 A;  3WF3 A;  1UY3 A;  2VZO A;  4DXS A;  1CX1 A;  3EB7 A;  2VZS A;  3CZJ A;  2R7E B;  2W47 A;  2V4V A;  4DUV A;  2VZT A;  2WZE A;  2J22 A;  4A44 A;  1W8N A;  1JU3 A;  2BGP A;  2J1V A;  1W9T A;  4XUN A;  2DCJ A;  1US2 A;  3VD5 A;  4KMQ A;  5IJR A;  4D0Q A;  4TXW A;  4RYD A;  2Z4F A;  1UY2 A;  1OT5 A;  2KD7 A;  2E33 A;  2DDU A;  4MGS A;  2W5F A;  3WF1 A;  4QX2 A;  4BJ0 A;  2C26 A;  3WEZ A;  4OZO A;  1JZ6 A;  2VOT A;  2W3J A;  1P8J A;  3SKJ E;  3LE0 A;  3HNM A;  2RV9 A;  5IFP A;  2WDB A;  3T0B A;  1DLC A;  1JZ3 A;  4IUG A;  2VTF A;  2QQN A;  3T2P A;  4MGQ A;  1H6Y A;  3K4D A;  3PUH A;  1L7Q A;  2XQX A;  3HPN A;  3OBA A;  2W92 A;  3WF4 A;  2EIC A;  3ACH A;  3ACF A;  2Y6K A;  4XUO A;  3WF0 A;  4A4A A;  2X10 A;  2JE8 A;  3CZU A;  5DQ0 A;  1F4H A;  4LQR A;  1DYO A;  1JHJ A;  3OB8 A;  4CUA A;  4LHS A;  1UXZ A;  3IDA A;  2OKX A;  5DN2 A;  4M4R A;  2W87 A;  3FHQ A;  1OD3 A;  1KEX A;  2C9K A;  2WUH A;  1TVG A;  4PQQ A;  2WBK A;  5IHR A;  5J1X A;  4AG4 A;  5F7U A;  1SHW B;  2W94 A;  1TG7 A;  1D7P M;  1JYX A;  1OF3 A;  1W9W A;  1UZ0 A;  3A21 A;  3IAQ A;  4A41 A;  1JZ4 A;  3III A;  4YPJ A;  3NNG A;  2LW8 A;  4JX0 A;  4QB1 A;  4CVU A;  3HEI A;  1W0N A;  4A45 A;  3GGL A;  2DCK A;  4GWJ A;  2YFZ A;  3WNK A;  3CKH A;  3W5M A;  2VR4 A;  4XUR A;  3GDB A;  2V5D A;  1DP0 A;  3IB3 A;  1JZ2 A;  2W1S A;  4OMC A;  1K42 A;  1KGY A;  3THD A;  4ZY9 A;  5DPN A;  2PQS A;  3THC A;  3T0A A;  3HNB M;  3DYO A;  4QDQ A;  3HNY M;  5B4X A;  4DUX A;  5EJ1 B;  3LEG A;  1W8O A;  2J1S A;  2QQI A;  4XVH A;  2W1W A;  3LQC A;  3WNO A;  2WAB A;  5HXM A;  2VZQ A;  2VQT A;  5DMY A;  3WF2 A;  4QX3 A;  2VCA A;  1JYV A;  1J84 A;  3E1F 1;  1CZS A;  1O59 A;  2E26 A;  3DYP A;  4QAW A;  1J83 A;  2Y8K A;  3FN9 A;  5G04 L;  1HN1 A;  4JHZ A;  3VDB A;  2CDP A;  3NJX A;  3K77 A;  3MUZ 1;  4PT6 A;  2C4X A;  5JR2 A;  1EUU A;  3ABZ A;  3LEI A;  2YFU A;  1H6X A;  4A6O A;  2WN3 A;  1MPX A;  2W95 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...