4P5YA

Structure of cbm32-3 from a family 31 glycoside hydrolase from clostridium perfringens in complex with n-acetylgalactosamine
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
157
structure length
157
Chain Sequence
b'LYKKAGSEFALDSSKLEAIYATSEADRDYKENAVDGDENTIWHSAYQAADKLPVSITIKLDKAYDLNQIDYLPRQNSRNGHVTEYKIETSLDNENWTEVRTGNLEVNEAGNALANRGYNPIRFNTINAQYLRFTALKTLGDTNNKYASAAELVFYGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycosyl hydrolase, family 31/fibronectin type III domain pr
publication title Diverse modes of galacto-specific carbohydrate recognition by a family 31 glycoside hydrolase from Clostridium perfringens.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Sugar binding protein
total genus 37
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2014-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4p5yA00
1UMIA 1NX9A 4XUNA 2W1QA 2WAAA 1GNYA 2BGPA 2VCAA 2VR4A 3MV01 2BERA 2WAOA 1GU3A 4D8MA 1JZ2A 4RN5A 5A1AA 5CYYA 1OF4A 1UZ0A 3ETPA 3GM8A 1PX4A 1KEXA 1JYVA 1O8SA 1XPWA 2BZDA 3ACGA 3LEGA 3I3DA 3FHQA 2EICA 3UNPA 1NAEA 2QQKA 5B4XA 3OB8A 2VO5A 2VTFA 1GUIA 1ULPA 1XC6A 4XVHA 5LCWL 3I97A 3IIIA 3WNMA 2VZSA 2VM9A 3I2KA 3F2ZA 3IB3A 1W9WA 3CIHA 3PUIA 3WF0A 4MO3M 1GOGA 4XZUG 2VL4A 1UY3A 5JUVA 1GOHA 3ZM8A 3W5MA 4DEVA 1W9SA 4LQRA 1NKGA 2VZPA 1UY1A 5F7UA 2EIBA 4JKKA 2VZOA 3P6BA 4M4RA 3ECQA 3J7HA 3EYPA 1JI6A 3T0AA 3WEZA 3DYPA 5IFPA 3CDZB 3T08A 2VZ3A 4CVUA 4DUVA 5C70A 4QDQA 3A23A 2E26A 4CU9A 2VZ1A 4KI5M 3K75B 2J1VA 2J1SA 4QDSA 1GQPA 3P1IA 3T2OA 3VDAA 2Y6LA 3D3AA 2E31A 2QQIA 4M4PA 2DDUA 1GMMA 4QB1A 2VZRA 2W1UA 2ZEYA 2LW8A 4MGSA 4A6OA 4QX1A 1UX7A 1F4AA 2VQTA 3WQBA 1JZ6A 3VD5A 1PX3A 3MUZ1 3WNKA 2W91A 4MOAA 4ARYA 1W99A 3HJRA 4QPWA 5JMOA 4ET7A 2VMFA 4ZY9A 2WABA 3VD9A 4BXSV 2Y6JA 3JXSA 2WO2A 3IAPA 2QQJA 2J1TA 3LE0A 5B4NA 2L9LA 4JX0A 3CKHA 4DEQA 5I0DA 1JZ4A 5EIYB 2Y6GA 1UXXX 2R7EB 3WSOA 2LS6A 2WYSA 2W1SA 2YB7A 4UAPA 2QQOA 1L7RA 4QX0A 4OUEA 4GWJA 2PQSA 4Z2AA 3GGLA 3HOBA 1IQDC 5C7GA 1R64A 1H6YA 4A4AA 3WNNA 3EB7A 3OGVA 2WDBA 3C7EA 3C7HA 4MADA 3C7OA 1JZ8A 4XURA 3UESA 2VZTA 4KMQA 2J7MA 3T0BA 4GZ9A 5FUIA 4ZZ5A 1MPXA 1CZTA 2WZEA 3HNYM 1JU3A 1O8PA 4XUPA 4ZXEA 2JDAA 3MV11 4XUQA 4AG4A 3I2IA 4W8JA 2J1UA 4UOJA 3T09A 3CZUA 3ABZA 2W3JA 4L0PA 3K4AA 2E33A 4PQQA 1UWWA 2ZEWA 3HEIA 1XNTA 4CUBA 2V72A 1EUTA 2WO1A 2ZEZA 4QDRA 2B4KA 4CUCA 1US3A 1JYXA 3FHAA 4P02B 4A45A 2XONA 4D0QA 2YC4A 4DUXA 4JKLA 2W92A 4PT6A 2Y6KA 3THCA 1W0NA 2XOMA 3IDAA 3CZJA 3OEAA 1H6XA 2C26A 3WNLA 4KWUA 3DYMA 1PMHX 2W95A 4QB2A 4DUWA 1HN1A 2W5FA 1SDDB 1JZ7A 3I2HA 5G05L 4OYUA 1SG3A 1DYOA 1W9TA 3K46A 1OH4A 4UI9L 2DCKA 2J22A 3BN6A 4IUGA 2EIEA 4TTGA 3LEKA 1US2A 4XUOA 3NNGA 3DYOA 2W87A 1P8JA 1TVGA 4W4ZA 4ARXA 3U37A 5CZKA 2C9KA 2Z4FA 4HG6B 2QBXA 1XNAA 1CX1A 4P00B 4DXRA 3CMGA 3WF4A 2J1EA 2J1RA 1JZ3A 3E1F1 2YC2A 3K4ZA 3NQHA 3ACIA 5HXMA 2QQNA 2Y64A 5JXJA 5J1XA 3VD7A 2W94A 2W47A 1UMHA 2Y6HA 3SKJE 2J1AA 1K3IA 3OBAA 3C8XA 2ID4A 3UETA 3FL7A 4QAWA 5JXHA 1O59A 2E32A 2ORXA 3WF3A 1OD3A 3LQCA 3HNMA 5G04L 1JZ5A 1L7QA 3T2QA 4QX3A 1JYWA 4E8CA 2W1WA 1K12A 1UYZA 2EIDA 2VZQA 2VJXA 4RYDA 1WCQA 1GOFA 4OMDA 4ZZ8A 2X05A 2X10A 2VOTA 4FI9A 2VC9A 2WN2A 3MUY1 1CZVA 3I2FA 5DMYA 2WN3A 1W8OA 1NUKA 4CU6A 5C71A 3WNPA 3K77A 1ULOA 1D7PM 2C4XA 2VZUA 4P08A 2VZVA 5EJ1B 3BGAA 1J84A 4PF1A 1CZSA 3IAQA 3SKVA 3SEPA 2HYXA 3A21A 2ZEXA 4MGQA 4GWIA 1LNSA 4A41A 4A44A 3A7QA 3I2GA 2YFZA 4A3ZA 2ZXQA 1RYYA 3HN3A 2QQMA 3MO4A 2JKXA 1UYXA 4BK4A 3WF2A 3OEBA 2BGOA 1EUUA 1UYYA 4JHZA 4OMCA 4QB6A 3DECA 2DCJA 5JXIA 3T0DA 2VMCA 4XUTA 5LA2A 4CU8A 3VD3A 2V5DA 3GXUA 1JU4A 2X09A 3PUHA 2WO3A 1K45A 2OKXA 1J83A 3NJVA 1OF3A 2WBKA 4JKMA 2W46A 2CDPA 1SHWB 1KGYA 3GDBA 3C7FA 4DXTA 4E8DA 1DP0A 2QQLA 4YPJA 4BK5A 3WF1A 3ACFA 3OGRA 3THDA 2VMDA 1UY4A 1UY2A 3T2PA 4A42A 3C7GA 3NRUA 5EJZB 5HPOA 5JR2A 1BHGA 2VCBA 5DN2A 1W8NA 3I3BA 2RVAA 2JD9A 5IFTA 3W5NA 1PMJX 3LPGA 2ORZA 1DLCA 4P5YA 3K4DA 3HPNA 3A22A 2VCCA 1F4HA 3CQOA 1UXZA 5IYYA 4W50A 3MBWA 1T2XA 4BJ0A 5JXGA 4OZOA 5IJRA 4AAXA 1TG7A 4TXWA 1UY0A 4DXSA 3HNBM 2HLEA 2WQ8A 4LPLA 5DQ0A 3LPFA 2CDOA 3VD4A 2YG0A 2B9VA 3WNOA 2RJ2A 3OG2A 2VMEA 4BDVB 2WZ8A 3I2JA 1OT5A 4LHSA 2V4VA 2JE8A 1WKYA 5IHRA 3NJXA 5LA1A 2Y8KA 1K42A 2RV9A 3FN9A 4CU7A 3VDBA 2WUHA 3ACHA 3I3EA 3OGSA 5DPNA 2VQUA 2W9XA 2KD7A 1JYNA 2XQXA 5LA0A 1CIYA 3VDCA 1YQ2A 2XHNA 3LEIA 4CUAA 3SEEA 1JHJA 1I5PA 2BBAA 3AC0A 4QX2A 4LKSA 2YFUA
chains in the Genus database with same CATH superfamily
5C3OA 1QJEA 2H0VA 2ZGUA 2JDZA 3KV5A 4CCEA 3NMBA 1ND3C 2BGPA 5I0RA 1JZ2A 2E7TA 2DVDA 2WAOA 3ACLA 5I0UA 1OH3A 1Y43B 2GU9A 1K5MC 1B09A 1RUI1 1UZWA 3B69A 3K2OA 3MYXA 5FZBA 3ZVXA 4C91A 1UZ0A 1CN1A 1DF0A 3JD73 5FZAA 4FPHA 4BPZA 5ABJC 1XSQA 4LR4A 3RYPA 2B7YA 3FUOA 2X5IA 2R1DA 1S2BA 1OSGA 1PX4A 3FZ3A 1JYVA 1O8SA 2BZDA 1PIV2 3ACGA 3INAA 4GMP0 3T30A 5GLUA 4ZXKA 4Y5Z0 1U5ZA 4XFAA 2QQKA 3E5QA 4Y1VA 5F3CA 3OB8A 2AR6A 2VTFA 3FFQA 4RS5A 5FMDA 4Z1VA 3VBUC 4NHMA 1XC6A 3WNMA 2JDHA 2CU5A 5A7PA 3T4VA 4M0NA 2DVGA 5GZFA 3ZDVA 3ZIWA 5I8TA 2RS32 4RSUA 2X5IB 4FFHA 3W59A 4CDUC 3SCFA 3VKNA 4HK8A 3CIHA 4X6QB 4XIKA 3ST7A 3GHMA 1Q43A 3VBSA 2BEOA 3PUIA 3V64A 3WF0A 2E7QA 4CP1A 4IE0A 3WHUA 4BZ4A 4C1WA 3ZM8A 2RS51 2WNVC 4FTBA 4GIQA 2NM1A 2Y0IA 4MYEA 4RS5B 2CL2A 1IPJA 1OQ1A 3RWNA 4LHNA 3IT8A 1TMF2 4COUA 2CYFA 2UY8A 2VZPA 5LASA 4BYYA 2EIBA 1NXMA 1VBB3 3OPWA 5IUQA 4N7IA 1YIFA 1RUG3 3BTAA 4Q29A 1UOFA 4YW4A 4HANA 3NAPC 1C4RA 3J7HA 1VJ2A 2HWF1 3KHBA 4XACA 4XFGA 4JZRA 3VBSB 3CF6E 3T0AA 3WEZA 3U0ZA 1JOPA 3DYPA 2JDPA 5D8AC 1JYCA 4Q4V3 3T08A 5FP4A 4CVUA 1WCDJ 1BJQA 1ZZCA 2QQVA 4LBLA 3A23A 4QDQA 3TOJA 5JSOA 1I3HA 4YGEA 2DYCA 1VMHA 1UNBA 1GWLA 4QX7A 1REDA 3VL8A 1QOOA 2P3IA 4QDSA 3S30A 1GQPA 4AXOA 3Q8BA 4FXGB 4Y1UA 1PMIA 2BPA2 4LHKA 5K0UA 3P1IA 3CJIC 3J7LA 4BQ3A 3T2OA 3ITQA 1R082 4LHLA 3RZZA 2QQIA 1PO21 3GJBA 1RXGA 1H9PA 2VZRA 4GB31 4QB1A 1C28A 4IEWA 4MGSA 1DG6A 1N1TA 1UX7A 2YU2A 1G9BA 1ULGA 3BB6A 4O9EA 3RZMA 3POFA 1TE1B 1V00A 1PK6A 1LOBA 1PX3A 1ODNA 5H9QA 4M3CA 4XJWA 3ALQA 1J1TA 5K0UB 1KDKA 4YFWA 5FUNA 2JIGA 1SLAA 2EXHA 4CSWA 4YFZA 3THTA 1LKNA 3KVBA 4ZY9A 3VD9A 1ZBE3 4QPGA 2Y6JA 3NW4A 2C6SA 5A3TA 3FLPA 3IAPA 2QQJA 5FFOC 1COV1 3D6EA 2OQ7A 3OTFA 1R093 1PK6B 1QJX2 2P6HA 2ZZQA 2X8KA 5J98B 3WUCA 5CB7A 1D4M3 4M3CB 4UFIA 2ZACA 3LWCA 4I02A 5KBFA 1MVQA 1RUD3 1UXXX 2VW1A 4K21A 4GALA 1BXHA 2ZPXA 2WYSA 5IK8A 5DUUA 2W1SA 4QPGB 1RUI2 4UAPA 1ONAA 3OBZA 1UMZA 4YGBA 1BEV3 1LGBA 4E4HA 3ZSLA 3L9JT 1DBNA 4MZUA 5JCTA 5CG9A 1AR73 1PNFA 5JPMB 3HOBA 1H8VA 4HVRA 4YM2A 2GALA 2P37A 5FXZA 4IEOA 4LUMA 4V2WA 1ENQA 2IVJA 1HW5A 4EE2A 2DURA 4UT5A 1H6YA 5IK7A 3TN91 3WNNA 1RUF3 3EB7A 5IVFA 2NMOA 1FV2A 2W52A 2GMPA 3PU3A 3MW3A 1YRZA 3Q9OA 1ZVFA 4WZFA 5F3IA 4R4ZA 2WZPP 4MADA 2I74A 3D8CA 4DOUA 2Q30A 3PIGA 1G7YA 5C3PA 2AH2A 1GNZA 5FPBA 3B3QE 2VH9A 2VZTA 1BMV1 3H7JA 1CX4A 3AZWA 3H3ZA 1AR91 1WLWA 2BNNA 4LBNA 4EWEA 4KBZA 3VBRC 3NNFA 4AEDA 3KM5A 4XCBA 4UBGA 2WZEA 1NA1C 4W6WA 1W0OA 2QE3A 5CKNA 3DEMA 2IXKA 5FK8A 3MGUA 5FY7A 4YZ1A 5A3OA 4H7LA 2JDAA 1QGLA 3GF6A 1QJZA 2Z42A 2HWF2 1Q8SA 4W65A 1YQ6A 4W8JA 4XJUA 3CZUA 4BQWA 3KZ4C 4XTPA 5GZEA 2WWSA 4JRAA 5K4LA 1V0AA 4AEDB 5CNAA 1UWWA 5EZWA 1GP6A 2BOJA 2I07B 4P9GA 4UXAA 4YVSA 1VBB1 2PHLA 2JECA 4LTAA 4CUCA 4LKEA 1YFYA 5C3SA 1WW6A 2FDJA 3AM2A 4I3GA 4P02B 4XBNA 1HX6A 1SACA 4JKLA 3ZFEC 2Y6KA 3IDAA 4Q4V1 1H6XA 1OURA 4LXLA 4GMP3 1KQRA 4GB32 4KWUA 4COVA 3DYMA 4ASKA 5F6KA 4PIZA 4S2GA 1SDDB 2IFWA 4XF4A 4C0HA 1HB1A 4YVSB 3HVDA 3KQ4B 3VUOA 4LOTA 1QJFA 3ZN4A 3WQ0A 3VB9A 2IVIB 5DAWA 1OOPC 2HWE1 4UI9L 1QMJA 2DCKA 4G3YC 2OZ6A 3BN6A 4KH9A 2CV6A 1Y9QA 4RGAA 1VIWB 2DFCA 2FD8A 2EIEA 4B8EA 2YUEA 2FCUA 4YSFA 3I49A 4UWDA 1ALYA 2JG8C 2MPFA 4LJHA 2Q8DA 2QQWA 1COV2 4WVMA 1FNYA 2WSVA 4XUOA 1O3RA 1EP0A 3NNGA 2XJUA 4JVAA 2Q5TA 2D6LX 1P8JA 2W87A 3DL3A 3KMHA 1AX2A 2EXIA 5FXXA 2QUOA 3NNMA 3H8RA 2A6YA 1FX5A 3N35A 4DPNA 5FZHA 1R1A1 3LA7A 1W2OA 4CCMA 5CZKA 3SCHA 3GZAA 3PURA 1ZBE1 2QBXA 2UWBA 2JDYA 3CMGA 5C8CA 1YCIA 4WVMB 3KB5A 3RYKA 1M06G 4MUVA 3E1F1 1VBC3 5FYYA 4N7UA 3RZGA 3MIFA 3N9QA 4COZA 1RVF3 4XC9A 2QQNA 2D6PA 4EYUA 1ZZBA 5GALA 4AQ2A 2XLAA 1AYN3 5L9VA 1NXD1 3SNMA 2W47A 2Y6HA 3JD72 4FPYA 5EPAA 3S7EA 1LECA 2J1AA 4OI0A 1BEV1 1K3IA 4D7YA 4QX5A 3H3UA 1YEWA 5KXCA 3PDQA 3WW4A 1AR71 2ZAHA 4XQWA 1BMV2 4CPBD 1Z7S3 3AZXA 3WF3A 3N7KA 3BUCA 3T4HB 2BVVA 1J3RA 1GP5A 3ME2A 1W0PA 3RI8A 4CDWB 1H4GA 2EAKA 5C9AC 4ES9A 1RUF1 1X9TA 2QZ3A 2WA3A 5FUPA 4QX3A 3T2QA 4JGYA 3WQ7A 1XNKA 4QWNA 2W68A 4NPRA 1K12A 1OUSA 1UYZA 2VZQA 2VJXA 1JW6A 2XH6A 4IGOA 2YBPA 5DZFA 4N8MA 4TYSA 1GOFA 4OMDA 2VVDA 5A70A 5KHGA 3I8TA 4OLLA 5L19A 1OUXA 1YI9A 1ST8A 1O4ZA 5FZLA 4AGRA 5GLTA 4ZS2A 2PFWA 2OPWA 1ULFA 4PBPA 2DVBA 3K51A 5H9SA 1I1EA 4L8QA 1NE6A 2VAUA 3ZFGB 4JGYB 4OVEA 2N7GA 2WN2A 1Z0HA 2OQ6A 1OA3A 1VBB2 4YG3A 1QQP1 1ULEA 4FFFA 5DMYA 1UOJA 3KV4A 3ILFA 5IK4A 3UT0A 1NUKA 1NQDA 2E51A 5C71A 3PTYA 4CEWC 1D7PM 3CU7A 2VZUA 4Q4V2 1OFNA 5CKQA 3MW4A 3UYJA 4N53A 3MICA 4D6QA 5BNPA 1QF3A 3MI8A 3WR0A 3WY6A 5EJ1B 1H2NA 5FZFA 4Q1RA 3USUA 1CZSA 2JB4A 1ULDA 5LBCA 4XQ4A 1H1MA 4RQPB 4ASLA 2RM23 4M3CF 4IXLA 3ZFFC 4MGZE 1BBT1 2HYXA 4HONA 3HQUA 4AK3A 1VB2A 2NN8A 1H2MA 4GWIA 5FZEA 3WG4A 4CEYA 3DXTA 2BOIA 2IZWA 1DQ0A 5H9PA 4A44A 4GMP1 1MQTA 1ODMA 1RUOA 4OI1A 2O0OA 3A7QA 4N53B 2YFZA 5BNPB 1AL23 4LLOA 1D0GA 4CP9A 2X5IC 4HKLA 1S55A 1LHWA 4A3ZA 5DAQA 3N7JA 1CJPA 5FZ9A 4C0BA 1RYYA 5JR7B 3USUB 1S4CA 2QQMA 5FLHA 3MO4A 4HVOA 1WLDA 2KM2A 5L9RA 2ILMA 4QB6A 4QXKA 3DECA 5JIAA 2CNAA 1HIXA 2XLFA 1QNYA 5FIXA 4YARA 4RS5C 3D5OA 3E5XA 1EV13 2WS93 4QGNA 4CEYB 3USSA 4Y33A 4Q27A 1MQTB 1ZBE2 4CCNA 1VBE1 4DY5A 2FMDA 3S5QA 1NCRA 3PUHA 2GMEA 3PVOA 4CP9B 1GWKA 4KWLA 5DAXA 3VKLA 4WZCA 4XXAA 2WQ4A 4Q8KA 1J83A 5HCBA 1OF3A 4NHLA 3TNPB 4MGIE 2XWJB 4RHV3 4JKMA 5FPAA 4D3WA 2DU0A 2FZ2A 2Q1ZB 4FP2A 2BFUS 1RUD2 4MXWA 4BE3A 3LIHA 3FWEA 1V9U3 1SLCA 1DYKA 4E8DA 4OULA 4LIVA 1DP0A 2QQLA 2CGOA 4JDMA 3WF1A 1NCRB 2VNVA 1CAXA 3B94A 3POGA 4K9SA 5FPVA 3ASIA 1BEV2 4AQSA 2H0BA 5JI7A 1AF9A 1ZZ8A 2G1MA 2OXBA 2GSYA 4PF5A 4A7ZA 2ZA9A 2F4LA 2D43A 1AR72 3SMHA 1WMFA 1W8NA 1X8EA 5D21A 1UYPA 5FY8A 3W5NA 2GNBA 2VD7A 2Y6FA 4MXWB 3Q8FA 1DLCA 1Q8VA 1EAH3 4PQ9A 5KWRA 3TNQA 5T5OA 1AYN1 2DCZA 4NWWA 1RUF2 2Z79A 4MGTA 4P9YA 1CAXB 2JXAA 5K0UC 1S0IA 5IYYA 1UZVA 1A6CA 1BKZA 2VUCA 3GCXA 4BJ0A 2G9ZA 3QACA 1ZRDA 4OZOA 2GNTA 5IJRA 3HT2A 4V2VA 1L7LA 3RPQA 3FC0A 1FOD1 1KS4A 4XDOA 1NOVA 2WQ8A 2ARBA 5C4WA 4LO6B 4FPOB 2PTMA 5DUXA 4CCKA 1W6OB 3WNOA 1XNBA 5FZ1A 3MEPA 4NAMA 1NQJA 2K9ZA 4URTA 3POEA 4B1MA 1RB8G 4JV4A 4NIHA 4NJ4A 3OD0A 4CPBA 3DUIA 2BVBA 1WCKA 2BBVA 2DUPA 1W2NA 1WKYA 2B9UA 3SITA 4Y4YA 5LA1A 1ND2A 1FYUA 5D2AA 5T50A 4CU7A 2XMLA 3FE5A 2HBUA 3VZMA 5A6XA 1QDCA 2WUHA 5C4WB 4LLFA 4AW7A 2W9XA 4C1XA 1RJ7A 1UL9A 2WT2A 2DCTA 5F8PA 1JYNA 1N3QA 4CCOA 1YQ2A 4KWKA 4EV0A 1GSLA 1T6BX 3VBHA 4E4SA 1BBT2 1JHJA 1I5PA 4NHYA 1V6MA 4QX2A 3SEEA 1T2XA 5SV8A 1SCRA 1NX9A 1ND2B 3UGHA 2YZ4A 1U5IA 2VCAA 4Q26A 2A71A 3TEZA 5FPUA 1AR63 3FLRA 4I0AA 2VQAA 4RN5A 4KU8A 1GWMA 1REFA 5BUVA 5CYYA 1G9AA 1IQAA 2RM21 4HKOA 4A2UA 4FP3A 1LGNA 1IGOA 4BXFA 1NZIA 3ETPA 1IS6A 3JB4C 3GHNA 2ZHKA 2JENA 4XAEA 4Y5SA 5JAXA 3ZXFA 2AACA 1GQHA 1AHSA 1Q8QA 3M3OA 3UNPA 1POV0 3TAYA 5B4XA 3GJAA 4F83A 1IG0A 5E88A 3WT3A 4R8HA 5F32A 5FXVA 1UZZA 4YG0A 3KGLA 3WDTA 5ISLA 1C57A 1OLME 4XVHA 2HWD3 5LCWL 1FNZA 3LDBA 2RS13 3IIIA 4RGKA 1JHNA 2VZSA 4XQDA 4QXCA 3IM0A 4WVZA 3AKPA 1AR83 4H55A 4OHZA 4DO0A 2B39A 2A75A 3IB3A 4LIUA 5FBJA 4NUBA 2QZ2A 1BCXA 1EV11 1YQCA 2WS91 5AFBA 5CA6A 1W04A 1GOGA 3MIBA 3POBA 4MO3M 4XZUG 5L9BA 2EAAA 2ET7A 3O0XA 4OI2A 4XDQA 4XHBA 1O91A 3ZO0B 3WDVA 4BQ5A 2HWC3 5JSRA 3AX4A 4DRRA 5F7UA 1TNFA 2P3JA 1CQ9A 2AGSA 1VBC2 2CY6A 1SZBA 2VZOA 3LF7A 3P6BA 4RHV1 3UL2A 4CRQA 4FOYA 5IVEA 2ZGPA 4IEVA 4BHPA 2QJVA 4LT5A 1RVF2 3WLUA 1PGW2 1V9U1 5A32B 1JI6A 3DKWA 4E4ZA 2D44A 1C1LA 5IFPA 3ZIXA 4CZSA 1AYN2 2OA2A 4AI1A 1DQ6A 5ACA3 4UBHA 3ZXKA 3PJYA 4PI2A 4AYUA 4Q0UA 4FPGA 1RITA 3EXUA 4ZU5A 2E26A 4JC1A 4CDXA 3RZLA 5FYIA 1JYTA 4DZGA 4AAPA 3H50A 2VZ1A 1UQXA 3OD4A 4CTEA 1LJ7A 2YV8A 2YGMA 1JN2P 1FAYA 4H2AA 5FMOL 1WA6X 1Z7S2 1CIWA 4NR1A 4BQ1A 1PGL1 2XL7A 4FFIA 1ZNPA 2DF7A 4ZU4A 3TB0A 5JIUA 4O9GA 3HD8B 2ATFA 2PHRA 2ZAAA 1I6XA 2WR9A 5DG2A 4NIIA 4A6OA 2ZEYA 4AI2A 4BMBA 2PAKA 1MS1A 3RZHA 3AFKA 4CDXB 5FWEA 2XGXA 1HB3A 1DQ5A 2VQTA 4XILA 4Y20B 3WQBA 5K8SA 4K20A 2ADDA 2YY1A 3MUZ1 3OUHA 4QPYA 3WNKA 5T52A 4AVTA 4R52A 4WM8A 5A3LA 1VAMA 2VTXA 1ZA7A 5FZMA 4ARYA 3B93A 1HDKA 3O1PA 2JICA 4KNCA 4CEWB 5JMOA 1X8MA 4IEYA 3EQEA 1RUJ3 1C1FA 3Q8CA 5EHDA 3JQWA 4I0WB 2VPVA 3LA2A 4FFGA 1W90A 2Y26A 4PDWC 2Y38A 3AP9A 3OJBA 2B5HA 1OFSA 2P4EA 3CKHA 5A1LA 3WW3A 1DFQA 1JBCA 5KXDA 4IEPA 2XVLA 4WM8B 5A3NA 1JZ4A 5EIYB 2Y6GA 3H8OA 5KXEA 2BU9A 1AZDA 2LS6A 4CP2A 3FJSA 3D0JA 4CDQB 2P5BA 2WWJA 4QHBA 3WP5A 3UGFA 1E5RA 2YB7A 3T3YA 5LW9A 4Q4W3 1W3VA 1RXFA 5GKAC 1L7RA 2RM22 4QX0A 1GANA 3ZYFA 1CPMA 3H7YA 4GWJA 2D7FA 4YWAA 4CDWC 5LBBA 4Z2AA 1BQPA 3GGLA 5LBFA 1WBFA 1QJX1 2XJPA 1V6OA 5F6LB 5J09A 3U10A 4D7TA 1NLQA 3IN9A 1AL22 5LK7B 2MHFA 3NV2A 1DCSA 1W28A 4XFBA 4FPLA 5FYBA 3I3MA 1KITA 2WDBA 1PM7A 2GC1A 4D94A 2VOVA 4E4DX 2ARAA 4XABA 1HV1A 3C7HA 3KF3A 4R9CA 3R4DB 3PVNA 4AI9A 3O14A 4XURA 2JG9A 3UESA 4KMQA 2ZMKA 1LHVA 1F8VA 4D6SA 1EV12 2WS92 3V65A 2J7MA 1ZRIA 3ZFGC 5J48A 4GZ9A 4JGYC 5FUIA 5LRSA 1NG0A 1GBGA 1UAIA 2WNUA 3RZJA 2NYYA 1GZ9A 5FLJA 1X50A 1HB2A 3ILRA 2OUHA 1CZTA 3WCSA 2A1XA 3ZR6A 1OA4A 5CBLA 1EY2A 2RS11 3WDXA 3VZKA 5LATA 1WBLA 2XHKA 5F5AA 3LOBA 3OUJA 1AR81 3KWVA 4RHV2 1XJAA 4Y4RA 5DDJ3 2D6OX 1I5ZA 1O6UA 2WLPA 4QKBA 2CTVA 2JG9B 3A0NA 3H3LA 3ZKUA 1V9U2 1S0BA 4SBVA 3I2IA 4QHOA 3W21A 1UKRA 2ZGTA 5F3GA 1S2KA 4YM0A 2B42B 2W3JA 4UW6A 1BLZA 2WNUB 4RQPC 4B7KA 3FBMA 4AF9A 1YJKA 2HWC1 2VUJA 4NHXA 1FPN3 4Q1PA 3HEIA 1XNTA 2R0HA 1EUTA 3MPBA 2BDRA 5IT6A 2ZEZA 2B4KA 3LEMA 3PNAA 2ES3A 2QKDA 4QGLA 5DABA 4FAGA 1JYXA 4N53C 2TUNA 4AGGA 4JHTA 2HEVF 1V6IA 1LHOA 2YC4A 1PGL2 1W6MA 5K7PA 1EAH2 3THCA 3OBTA 3FHIB 1F15A 3WP4A 2XOMA 2ZGKA 3OEAA 2IUWA 2C26A 5ACA1 2CAUA 4Y1ZA 3WNLA 4KU7A 3ORJA 1W05A 1PMHX 3AKRA 4Q5OA 4M00A 1IKQA 1HN1A 4QB2A 3RJ2X 4AGVA 4FTSA 2W5FA 1JZ7A 4YW5A 1RHI3 3RSJA 1IZ3A 4CEYC 4G9SB 2ARXA 4QU2A 2Q8CA 1MQTC 2OPKA 1ZYBA 1SG3A 4P9XA 1W9TA 3BKZA 1V6KA 3UKTA 4S2HA 3S5AA 5A7QA 1U5YA 5BV6A 5EV7A 2P3YA 5FMBA 5JVVA 4IUGA 5LZ6A 2IXJA 3O1UA 1H1AA 3FFZA 2DU1A 3MF9A 1VALA 2XJRA 4ITCA 4TTGA 1WZXA 1XOYA 1US2A 1V6JA 4LULA 3AMNA 4N9HA 4Y22A 4TZDA 3AJZA 4IV1A 4EN9B 3CBNA 2BP6A 4LO7A 4M0HA 4Y1YA 1H1IA 2PXJA 2YPDA 5SV5A 4HPKA 4JTNA 1LODA 4KBBA 1URXA 4W4ZA 3KF5A 1XYOA 1R1ZA 4N43A 4K7JA 3ZSJA 3IMMA 3O1TA 3M3QA 4OHXA 1RUJ1 2Z4FA 3CJXA 3GZEA 1H4HA 4FCAA 1CX1A 2ZX2A 3BIWE 3L2HA 3V0BA 4P00B 5EYXA 1I9RA 1VBD3 3WNXA 4Y22B 3WF4A 3R4SA 2C5DA 3U78A 2J1RA 5A7OA 4I01A 3U11A 1KDMA 1C5IA 3PVBB 2B45X 4HPKB 5AC93 4PLOA 3ZSEA 4FAHA 1ZZ7A 3ACIA 4E2GA 1W6NA 4NO4A 3VHPA 1J58A 3WZ1A 1AR62 2SLIA 1MS3A 2XKPA 2OX0A 3VD7A 2UWAA 3V0BB 4F7ZA 2B8MA 2VXRA 5DUWA 5EP9A 3OBAA 1LOFC 3C8XA 3VGIA 1O3QA 1FMD3 1ZX5A 5F5CA 1J3PA 2GN3A 2XL9A 3SLIA 1W9FA 4QD2A 2AUYA 4XFIA 5FYMA 2E32A 2ORXA 1OBNA 5FY5A 4HKWA 1HXS3 4MHUA 5EYYA 3LQCA 2DBNA 2IC1A 3R6SA 3HNMA 5F1RA 5FO9B 5L7OA 3OF1A 4Y3OA 3ZYJB 1VE0A 1STMA 4H14A 3RWKX 2ZABA 1L7QA 1RJ8A 3QBQA 3WVJA 2D3SA 2HWD2 1RUE3 4OQ9A 1LHNA 2RS12 3QCWA 4E8CA 1YIPA 1XB9A 5ANNA 4XTMA 2R49A 2A5ZA 2W1WA 3VKFC 3PU8A 1AR82 4RL7A 3C3VA 3JD71 4XYXA 1GFF2 4UF0A 3LD8A 1WCQA 4DQAA 1DZQA 2YHJA 1OLRA 4UFKA 4UW3A 5CIRA 1RUC3 3AP5A 1W2UA 1HKDA 5L7OB 4W6XA 3BI3A 3WW2A 5JZGA 2HWC2 3CL1A 3KV9A 3UV9A 2WFF3 3PHMA 2JEMA 1VPHA 5IWFA 2VC9A 2WL1A 4PIYA 5CISA 4LO4B 1CZVA 1W8FA 3AXDA 4GJYA 2VOXA 5DDJ1 1W06A 4OFGA 4QM9A 4UF0B 3GZUC 3UJQA 2PAMA 3K77A 5L73A 2VXJA 2C4XA 2JB8A 5ACA2 3BOWA 2QQPA 1QDOA 3RGBA 2YPJA 5JZGB 1LENA 2OW4A 3H1YA 1J84A 4GH4A 4XEZA 4D69A 3HBZA 2RG4A 1CAWA 3UKNA 1KJRA 5FYVA 3SKVA 4PJYA 5J96B 2OIIA 4NN0A 3SEPA 1MACA 5I0SA 1IS4A 4YM3A 2PLV3 4K1YA 4LBOA 4YRDA 1RUG1 1DGWX 3H42B 2K46A 2PN5A 5E89A 4JDOA 1VAKA 5BXXA 3HN3A 4GH4B 3WD5A 3WV6A 3T1LA 1J1LA 2RE9A 2PQQA 4R9DA 4EWDA 1L3JA 1MS9A 4BK4A 1WA4A 3WF2A 2IFRA 3NV3A 1YLLA 5JOZA 2ZGOA 3T0DA 2VMCA 2WO7A 5GLWA 3SC7X 5FYZA 3JQXA 3NJYA 1FATA 2WWUA 5LA2A 5JWPA 3F95A 3ZXLA 5L36A 3DKQA 4GKXA 4TSVA 1RUJ2 1HQNA 1E57A 4AFAA 3DV8A 1VRH3 2X09A 4NE9A 3NWKA 2D40A 1DIWA 5C5UA 1B35A 4BOWA 4BLJA 1K45A 4JAAA 1VBA3 4CYDA 5GZGA 4LKFA 4FQZA 4IV3A 2VW0A 3E6BA 1HJFA 4CCCA 3FBYA 5FZCA 5T54A 2VE1A 2V4AA 3HWJA 4AWDA 5CFCA 1TEIA 3C7FA 4WV8A 4L99A 5E1RA 1DZRA 1OA2A 4L2NA 4Y26A 3O1RA 4BK5A 1KRIA 3H1MA 1VBD1 3LB9A 4NHKA 1WLTA 2VMGA 3AP7A 2W39A 2YYOA 1CESA 4Q4W2 4XAAA 2Q8EA 3VZOA 4AEJA 1B35B 1GZCA 1UY2A 1VRBA 2JIJA 2TNFA 3VBFA 3HMYA 4YW2A 3T2PA 3NRUA 3OGJA 4P9LA 4IV3B 5DN2A 1R091 5FWJA 2ZBJA 2GH8A 5IFTA 1RL3A 3VDDA 1D4M1 4CDXC 2E53A 1UZYA 2WIIB 3NKGA 4Q4Y3 5CFCB 3IZOA 3VHNA 1CD3G 2EA7A 4HSJA 4R4XA 1RUD1 4BISA 4XF9A 2HEWF 2NP0A 3CQOA 5C8CB 1FMD1 1UXZA 3ATGA 4W50A 1YXWA 3VBFB 4UFJA 3LDRA 3ZOIA 5JXGA 3ON7A 5JPNB 4URAA 3VZNA 1TG7A 3IWZA 1HXS1 2CHHA 5A1FA 5BNNA 3BU0A 1MS4A 1EPZA 1OD5A 4MLOA 3VN4A 3RG0A 3ZSMA 3VDDB 4DXSA 4E2QA 1CONA 1MEC3 4LPLA 1KJLA 1W39A 2QDNA 3BODA 3BTZA 5HCHA 1RUE1 2ZGQA 1O4YA 3BPSA 4YNIA 1RGSA 4QMAA 1VLNA 2XUEA 4WM8C 4XFHA 1S0DA 3I2JA 4BDVB 5EJ3A 3RDIA 3MLJA 4LEJA 4B3NA 1DDLA 5DDJ2 3KCCA 4TWTA 2CGNA 3AKQA 5CAZA 5FO8B 2J42A 5EWSA 4LE4A 3U1XA 4CDQC 3ES1A 3NJXA 2VNRA 1RUC1 3HR9A 5A6QA 5BNNB 4NRQA 3FN9A 3KSCA 3VDBA 3DCQA 1A3KA 1AX1A 3I3EA 3OGSA 4J25A 4XOGA 2XR4A 4JGZC 5DPNA 4PHZA 1FPN2 4C8DA 5CFDC 5LWBA 1HRI3 1QJU3 2ET1A 2VQUA 5JOYA 2KD7A 2PHFA 2XQXA 5FZOA 1K5MA 1CIYA 1UO9A 4XPVA 1YUDA 1X7NA 4IGQA 1QIQA 3LEIA 5FPZA 2Y34A 3QH7A 3IIAA 3WX5A 5ABJA 3O1VA 3AC0A 2CWSA 2YFUA 3IKWA 1RUG2 3TEWA 2EVXA 3A0KA 3MV01 4GKYA 3MFCA 4D8MA 3TYJA 3N4MA 1RMU3 5A1AA 1RHI2 5LA9A 1OF4A 2R043 5FZOB 1K5MB 1QOSA 2RHPA 3R05A 3LZZA 2PHXA 4FOWA 4HBNA 2R063 5FPXA 1ACCA 5ABJB 1ZZ9A 2PLV1 4G4FA 1OI6A 5JMCA 4AVBA 1XPWA 4LK6A 4ORFA 3LEGA 1DU3D 4YZ3A 4CDUA 3FHQA 4EZ4A 2EICA 2FDIA 2PHWA 5FLIA 4M3CE 4QXBA 1NLSA 4QU1A 2VO5A 3LGRA 1GUIA 2XKOA 4UW5A 4META 3JBG3 3THPA 4DRVA 1S1AA 2PELA 1WLCA 1CJDA 1ULPA 4JDNA 3ZMOA 1W8HA 4BM8A 3OGGA 3J9SA 3U14A 3PMEA 4NMIA 1ZRCA 2WNUC 2IXIA 5A80A 1Y4WA 4AE2A 1EYBA 3F2ZA 4Y5TA 4D7SA 3V0AA 3M3IA 3AYCA 3O12A 2OVUA 4CDUB 3NAPA 4YGDA 1UY3A 2EIGA 4XFCA 5BYNA 5D8AA 4QPIA 1VBD2 3M2MA 4L92A 4AI8A 4Q4X3 4DEVA 3VHRA 1DGWA 1ENXA 4ZKTB 2P3KA 3ZX7A 1HJGA 1UF2C 1W9SA 3KT7A 1NKGA 1REEA 1UY1A 1VBA1 4CCDA 3LCPA 4KQ7A 4JKKA 4YW6A 5J36A 2YXSA 1K5JA 3BCWA 5AC92 5GZDA 2K2SA 3UJOA 4AZZA 3VBSC 1R092 2WSUA 4LA3A 4LITA 4QX8A 1W8WA 2QNKA 4OI4A 5DXDA 4U2AA 3EYPA 1D4M2 5HBAA 3CJIA 4XETA 3CDZB 2VZ3A 3MFAA 4QM8A 5D8AB 3B9IA 4MGKE 4QPIB 4OZXA 5FZ4A 3SXWA 5C70A 1DQ2A 4CU9A 5LY1A 4YYOA 1FMD2 1CWPA 4KI5M 4XCAA 3K75B 3EBRA 2GNDA 2J1VA 1G9DA 4A6SA 1Q5OA 3SH3A 4FTEA 2DBIA 1HXS2 1VBC1 4HETA 4XJ8A 3VDAA 5A7WA 3ZLIA 2UY9A 5KXBA 3D3AA 4XXPA 1RVF1 2E31A 3WW1A 4M4PA 1PGW1 1GMMA 2DDUA 2W1UA 3VBOA 1RUE2 2LW8A 4AVSA 2ZOEB 5KHKA 3OY8A 3G6JB 2VECA 2WT1A 1JZ6A 1PVC3 2Q1MA 2R6QA 1VMJA 4MV2A 2R32A 2BYVE 1LAJA 3DPRA 4NVPA 2D93A 3LOIA 2YC0A 2W91A 4XHXA 4MOAA 1RUC2 4Z07A 3BTXA 3J7MA 3ZR5A 1MEC1 1W99A 2VG9A 2XJQA 1YWKA 3HJRA 2QQUA 1W3XA 1Y7BA 1Z7S1 2VMFA 3AMMA 3PVEA 4EN7B 4Z8BA 3QH6A 2V73A 4QGMA 4GWNA 3VBOB 4AFCA 4GQ7A 1QH7A 3JXSA 3VV1A 4MXVA 2WO2A 2PA7A 4CE8A 3CHXA 4AVVA 1W03A 2ZX4A 1PK6C 3M3CA 3E5UA 2I2SA 2L9LA 3ES4A 2CWMA 1DGRN 2VNOA 5H9RA 2FDGA 4I3PA 1OLQA 2ERFA 3DPRB 1H8TA 4YG6A 5FZ8A 3BALA 5LRRA 1UPIA 1YO8A 5A33A 1AL0G 3U75A 4L11A 4P9WA 4GD4A 1QOTA 2RJLA 4QPGC 3WG3A 3TRSB 5F2WA 1HRI1 1QJU1 5KHJA 4XJAA 2OUJA 2AZ5A 1QKQA 2XLGA 2QQOA 4ATEA 3DXUA 5EXOA 5BY5A 2QTWB 1C8M3 4KG0A 2VVEA 5FCCA 4KG8A 2O1QA 5FJKA 2BTVC 2PLV2 2HKXA 4GULA 4EN0A 3AVSA 1SFNA 2G9FA 4QKFA 1H8TB 1JXNA 2VOKA 1IQDC 2R16A 4DY3A 5A33B 5C7GA 3TEYA 2I45A 1S2EA 2XG3A 1R64A 1Q8PA 5CVRA 3KT4A 1N1VA 1RMU1 3KCYA 3KT1A 3POJA 4YZ4A 5FYHA 2A7AA 3H0OA 5C5TA 5IK5A 2VVFA 3M3EA 4R9BA 1QJY3 3AYEA 2A3WA 3C7EA 2ZS6B 1NA1A 4QKNA 1Y9MA 5APAA 4A7YA 2WKKA 1JZ8A 3B7MA 5A6YA 2PHUA 2ZZJA 1V6LA 2XDVA 1IHMA 2V5YA 4MX3A 1Q3EA 1CR7A 3VBHB 5A7NA 2F6BA 5CEHA 1VRH2 1OPMA 3JBG1 4NAOA 2VBBA 1HRV3 3HNYM 3IBMA 2A3YA 2CAVA 2W2IA 1AL21 4XUPA 4NIGA 1SLTA 4ZXEA 1VBA2 2JX9A 1RUH3 4HSLA 1MR5A 3ZYHA 5A6ZA 5KHHA 3MIDA 3NV4A 3NL1A 4QQ2A 1AVBA 5DAPA 5FZ7A 3OSDA 3RVHA 3B01A 4XUQA 4L97A 4AG4A 1W6PA 5T55A 4AFBA 2ETEA 3BU7A 2J1UA 4UOJA 4AEDC 1OXCA 4ZPIA 3ZXGA 2E33A 3B9CA 3FUQA 4OUSA 4PQQA 5FYCA 1BZWA 1SBFA 5IVBA 2F4PA 1LU2A 2Q1FA 3ZXJA 2Z69A 4XF1A 4CUBA 1S0EA 2D5HA 5FP8A 4QDRA 4HMZA 3VKMA 2KR2A 2WZR3 3P5BA 4YVWA 4OQ8A 1JYIA 2DV9A 4DUXA 1PZ7A 4MHRA 4PT6A 4Q4Y2 1W6PB 5T5LA 3N7MA 1GYKA 3LFMA 3CZJA 4U36A 2SBAA 2D6NA 1XYNA 4J1WA 1LHUA 2W95A 4YVSC 4FQ4A 4GA9A 3I2HA 4L9BA 3OPTA 3M1HA 1Z78A 4YVWB 3ZPYA 3W9AA 2GH2A 4HN1A 1DYOA 1OKQA 3AZYA 1AXKA 3NO8A 1UD1A 3M4FA 1MEC2 3OCPA 2X53S 2RS53 3TEXA 5FYSA 4AHZA 1SBEA 1EAH1 1QU0A 3POIA 5IATA 3L2YA 4CCJA 1AYM3 4TLFA 3UGGA 3ZPOA 1PVC1 5JSPA 2BWAA 4Y24A 3WP6A 3LDKA 4J1XA 2DVFA 3CNAA 2HWF3 3MLKA 4IESA 3ZN6A 1JTZX 1TVGA 1PGSA 4ARXA 3U37A 5IW0A 1B35C 5C8WA 2C9KA 3KLSA 3BIEA 5J3UA 4HG6B 1HRI2 1QJU2 1XNAA 2VULA 4ATFA 1GV9A 1WMDA 4PBOA 4IV3C 1KFXL 1TQ5A 4DXRA 3KVAA 3AYAA 3AJYA 4EN8B 3UK9A 5FXWA 5I8SA 1XYPA 4BQ2A 5CFCC 1UKGA 2YC2A 4P9IA 3W20A 1WW7A 3NQHA 2TEPA 2UYBA 3OUIA 5FYUA 3J4UH 1PO23 3OYWA 1XXNA 1YHFA 2FCTA 2D98A 5JXJA 3VBFC 4XMIA 4XZPA 4IDZA 1YQ5A 4LA2A 4X8NA 1LRHA 3I4IA 1RMU2 3D82A 1DGRA 2UYAA 3C2UA 4AR2A 1ZZ6A 4FVVA 5J1XA 1LCLA 3AP4A 4NIAA 4RD7A 5C9AA 2R042 1PHMA 1UMHA 1EPWA 1JOBA 3ZYPA 1C8M1 1UOBA 4H7MA 1GLHA 4CXYA 3KHCA 4ZU7A 3VDDC 4FXKB 4Z82A 1G9FA 4QAWA 1JOJA 3NKTA 2DFBA 5JXHA 3GNEA 1LGCA 3I54A 2FBEA 1OD3A 2QFEA 3OYWB 2VCMA 1CAUA 1O7FA 4YM1A 4K8FA 3JBG2 2YBKA 4Y1XA 5G04L 1WW4A 1VB4A 2H6CA 3AKSA 1JZ5A 2ZHNA 4GJZA 1JYWA 1AR61 5C9AB 1AUYA 1PVXA 1WUVA 1YFUA 4B4RA 5BNNC 1H2LA 4AHWA 3MIEA 1O5UA 4LUKA 4QT6A 3O0WA 1NLRA 2WA4A 3GCWA 4Q0PA 5BNOA 1X9PA 4MVTA 1FXZA 1NYWA 2A6XA 4CXXA 5KR7A 2RDQA 4QQLA 4ZHNA 3S57A 5FR3A 1Y3TA 4HZFA 4W6YA 4ZZ8A 3WDUA 1HRV1 4Q4X2 3IDCB 2X05A 2X10A 4EQVA 5FPLA 1H30A 2VOTA 4PI0A 4EZHA 1YFWA 1RC6A 3MUY1 4V1PA 2A70A 4IW3A 3B02A 3I2FA 2HWD1 4Q0QA 4TLGA 4FPCA 4XDPA 4XE9A 2R073 1W9YA 5GJ6A 3ZYBA 2HBTA 2FMYA 3PIJA 2WN3A 3AFGA 1W8OA 3OBRA 4XF0A 3T2TA 3ZFFA 3ZYRA 4CU6A 2A3XA 4P5HA 4K40A 1J3QA 1SDWA 2GP5A 5FZ6A 1LEMA 1XU2A 3H9AA 3TN93 1W2TA 2ZKNA 2VZVA 1PZ9A 1GICA 4PF1A 1N1SA 3WQ1A 2WZR1 2CGPA 4KGQA 2VGDA 2ZGRA 1UCXA 3VKOA 4YZ5A 3N36A 2FDFA 1IG3A 2WQZC 4FPFA 4LORA 2RDNA 1AR93 3A21A 5K9YA 4MGQA 3BVCA 3ZFFB 5F5IA 1F5JA 4A41A 5DAVA 1W8TA 1UX6A 1MS8A 3CO2A 5FTTC 2NZ9A 4Q2FA 5FP9A 4AQ6A 1XQNA 5BNPC 2D3PA 3ETQA 1S0CA 1HLCA 2EXKA 1ULCA 4NROA 3WDYA 1WCUA 3N9NA 2PHTA 1JUHA 2ZXQA 3I59A 1PVC2 1XE7A 1FI2A 3N7LA 5J7MA 1POV3 2BGOA 1EUUA 1UYYA 4JHZA 4OMCA 4COWA 4DXZA 3TWIA 4K1ZA 5IVVA 2DCJA 5JXIA 3HQRA 4CU8A 3R4UA 1ZM1A 3VD3A 1XBFA 2V5DA 4MSVA 4QQPA 3GXUA 1JU4A 1W6MB 2PMWB 4BIOA 3AKTA 3OPZA 3POSA 3MPPG 1AYM1 3M8LA 1KS5A 2WO3A 3I59B 2DVAA 1NT0A 2OKXA 3O1MA 2QDRA 2G19A 2JJ6A 4QKDA 1TNRA 2W08A 2WBKA 2ZCWA 1XNDA 4XBQA 5IVJA 4QPIC 2CDPA 1SHWB 1KGYA 2RMU3 4EN6B 4TN7A 1O5LA 4FOQA 4B4PA 4LBJA 2EF6A 1NCRC 4DXTA 2R30A 3E6CC 2PYTA 4YPJA 3JZVA 3THDA 2GP3A 3AZZA 1UY4A 4YW3A 1C8M2 4DMIA 4A42A 4HOOA 2P17A 4IQPA 5JR2A 2HWE3 3HT1A 4IEQA 2VCBA 1UOGA 2UURA 1YYNA 4IV1B 3SHRA 4GXLA 2JD9A 4HXCA 2JDKA 2ORZA 3LPGA 3PLQA 2LRPA 1OQDA 2V09A 2OYZA 1F2NA 3APBA 4P5YA 5F3EA 2NLRA 3K4DA 4N43B 5EFUA 2BRTA 1TME3 2VCCA 3A22A 3RJRA 1QJY2 5C33A 1F4HA 2NQYA 4UYBA 1LESA 5GM0A 1QH6A 2QCSB 2WT0A 1U12A 3CEWA 1S0GA 3AMQA 3N9OA 4Q4W1 5FMOS 2AREA 1R1A3 1G6NA 4DFSA 3QLQA 3VBOC 4AAXA 2F17A 4WVWA 1XSRA 1LEDA 4TXWA 1UN1A 1MS0A 3HNBM 4IL7A 3WINE 2BWCA 1QY4A 3AMHA 3LPFA 5FY9A 1HRV2 3VD4A 1W6NB 4N9IA 2YG0A 2B9VA 3R0RA 1O3SA 1YFXA 4QPWA 3DPRC 2RJ2A 3OG2A 2VMEA 3GBWA 4GWMA 1RUH2 4LMFA 1F35A 3WOGA 4YGCA 3J8F3 2GNMA 4HL0A 3HN1A 1JH5A 3W58A 5IHRA 3AB0A 1PO13 3WP3A 2Y8KA 2PAEA 4O65A 5C4WC 2RV9A 2XJSA 3NNLA 4O61A 4AL9A 3ACHA 5BPXA 3VHOA 2JDNA 1RUNA 1G86A 3N3HA 3A4UA 1XE0A 1A78A 5FK7A 3POYA 1H8TC 3I2OA 4MH0E 1ZREA 5A3UA 2WZR2 3M7AA 4UFLA 5LK5A 3VDCA 4IGPA 3WDWA 4S2DA 1LTEA 4CUAA 2R071 5I93A 3VL9A 2BBAA 1ND2C 3WCRA 2ZTNA 3PL0A 1QWRA 3FMGA 3JU9A 4DB5A 2E63A 5JI9A 4M01A 1O3TA 1UMIA 4XUNA 5F2SA 2C24A 2W1QA 2WAAA 1GNYA 4RR3A 4C90A 1WMXA 1G9CA 2VR4A 3UKVA 2BERA 3GBFA 1GU3A 1C8NA 1KFUL 4X6RB 1XNCA 2H6BA 2Q0AA 2IXCA 2NPIA 3K3NA 2BGCA 1J59A 4UW4A 3V56A 3J26N 1FPN1 3VBHC 5LEKA 5CKMA 4N90A 1BVP1 2O8QA 3GM8A 2RJKA 3RI9A 1KEXA 2A6ZA 1PNGA 5BNQA 4WM7A 3I3DA 2RS52 5B2GB 3I7DA 3SCGA 4KWJA 1NAEA 2DUQA 2KA3A 4RR3B 5FP3A 1LULA 3HIFA 5HCFA 3SH4A 1AYM2 1QQP3 4OUMA 4AVCA 1POQA 2ZX1A 2DWRA 3I97A 4BLIA 1BK1A 1POV1 1Q8OA 2VM9A 2VTXJ 2FDHA 3AYDA 1RHI1 2R0FA 3RQ0A 2XXZA 3I2KA 1DLLA 2D97A 3LFIA 1JODA 1W9WA 1S0FA 2BFUL 1CAWB 3ELNA 3D0SA 4E27A 4WM7B 4NOTA 4LKDA 2VL4A 3GYDA 3SH5A 5DG1A 1WGPA 5JUVA 1GOHA 5TSWA 2ZX0A 3AZVA 3W5MA 2DTYA 5F9TA 4I30A 2K0GA 1LB2A 4KL1A 1AXZA 4KGGA 4IERA 4LQRA 4Q8LA 1BBT3 2G4IA 4OCTA 2GMMA 3AK0A 1LOCA 4M4RA 5A7SA 5JOWA 2HWB3 1XE8A 1D4VB 3JUUA 3ECQA 4LBQD 5A3PA 2RMU1 3K3OA 1PO22 3B5LB 2YMZA 2BJSA 2Y60A 3IDEA 3D4KA 2Q8OA 2VMIA 2RDSA 1IS3A 1VR3A 4YVWC 3RZKA 4XFFA 4UFMA 4BB3A 4K3UA 5FOJB 1NCQA 1S0JA 5JDBA 3Q8AA 2C0ZA 4AOCA 4LE3A 2J1SA 3KQRA 1FV3A 3KD4A 3IPVA 5FREA 3POWA 5FOBB 1Y9GA 1MZ5A 4H3WA 5AC91 1VBE3 1NZCA 2Y6LA 3OOXA 5FKCA 5GZCA 4FT8A 2FCVA 5T5PA 1TME1 3NNJA 2ARCA 4ET7A 1NY71 4QX1A 4E9KA 4ISQA 3S0MA 1KD7A 5I8YA 3PMSA 4AEMA 4A7KA 1F4AA 1NCQB 4UFHA 1D2QA 1ENRA 2ZGNA 3AXEA 4PDWA 4AFMA 5IAXA 3EMRA 1PZ8A 3VD5A 1WWYA 4GAZA 3IPVB 1Q56A 4LBMA 5KC5A 3AL5A 1WCSA 5JOXA 5E16A 4XW3A 3WG1A 1MZFA 5AVAA 4BH9A 3S6PA 1OLMA 1ENSA 3E6DA 2WABA 3LSEA 1DHKB 4BXSV 2YU1A 5E8AA 3MIHA 2XJTA 1YNAA 5F39A 1QXJA 2J1TA 4P9JA 1VP6A 1JMUB 2XVKA 3J8F1 3HBKA 3LE0A 4PDWB 4JX0A 4XF3A 4CXWA 1KXGA 2R072 3AP6A 5B4NA 1A8DA 3SQOA 4DEQA 5AFEA 1PO11 2LROA 4CDWA 5I0DA 1W8ZA 4DIQA 2VBDA 3GZTB 3ZSKA 2MEV3 3TN92 2R7EB 3JCIA 3PUSA 3WSOA 1GQGA 4AI0A 1MZ6A 1HB4A 2XWBB 4Q0VA 3GALA 4HK9A 2OS2A 2WNEA 3ENRA 2WFF1 1ND3A 4JTOA 1V6NA 4K6BA 3WG2A 2IXLA 4OUEA 1AR92 5FZ0A 2PQSA 5CU1A 3TBDA 2PHDA 1FOD3 2GC0A 3O0VA 2RR13 4F3JA 2VOWA 4Z2WA 3EO6A 3IDBB 4CCLA 4DINB 4CA9A 2E7AA 5D1IA 3ZFGA 5I91A 1SFPA 5F37A 4A4AA 5C3RA 3I2DA 2YBSA 5HXVA 1GKBA 2D6KA 2D6MA 3OGVA 2WYFA 1JUIA 4FOVA 5FMCA 1ND3B 2XBO3 1OHFA 1ASJ3 4YW1A 3C7OA 3VBUA 1LU1A 4LBKA 2XUMA 3ZN5A 3PUAA 4BCUA 2X29A 1U0AA 3T0BA 4EWAA 3LSDA 4IE5A 3BOPA 3VZLA 4EJRA 4ZZ5A 2JD4A 1MPXA 2Z5WA 3U4SA 5C3QA 1MS5A 5DZEA 3RRDA 1SLIA 3NJZA 1IPKA 4RQPA 2ZMNA 1JU3A 4PLMA 4BIFA 1O8PA 5BNOC 1WD4A 3DN7A 4RFRB 1NE4A 2ZGMA 5FDBA 2WNVA 2JG9C 3MV11 2D5FA 3VBUB 2RMU2 1D2SA 5FJHA 3E97A 1ZBA3 2VUAA 3T09A 3ABZA 1YI7A 1F5FA 2FHRA 3K4AA 4L0PA 5HV0A 5M0TA 2C9AA 3K48A 3GBGA 5F5QA 2XPJA 2ZEWA 4OHYA 1VRH1 4NRMA 4OHWA 3QD6A 4HLTA 2V72A 2WO1A 1A34A 4FSJA 2HWE2 3KS7A 1QEXA 4COYA 1US3A 2HWB1 4ZONA 1RTVA 2WNVB 3FHAA 3N9LA 5GLZA 3WHTA 4ONUA 1OC1A 4A45A 2G9GA 2XONA 4D0QA 1C3HA 4K8RB 2W92A 5BNOB 4HT1T 1W0NA 4FPKA 3V0AB 5CADA 1TME2 2DUOA 3VZJA 1BK0A 1HV0A 1NY72 1ZRRA 2WJSA 3NAPB 4IEZA 4DUWA 2AC1A 1CAVA 5FZGA 2Q4SA 4Z92B 2BW8A 2JDUA 3B00A 4LO8A 5G05L 4OYUA 2A6VA 2EXJA 1R1A2 1T6GC 4LBQA 5DZGA 3FLTA 4AHXA 3K46A 3AMPA 1OH4A 2GAUA 1PIV3 5JLVA 5AVPA 1ZRFA 2J22A 2C1FA 5FY0A 3NVCA 1CPNA 4Q4Y1 5T5JA 2DCYA 5KC6A 1ZA4A 3LEKA 2JE7A 3CJIB 4BU2A 3EHKA 4D6RA 1CAVB 5DUVA 5IVCA 1A8MA 1E5SA 4CUGA 1WMEA 1PM4A 3J8F2 3MZHA 5FY1A 2VW2A 3DYOA 4LBQB 4R9AA 1HN0A 2AEZA 1UW8A 2OZJA 2LALA 1PO12 2RS33 4AFDA 4YZ2A 5FBZA 4BQ4A 1JS9A 2FZ1A 1LR5A 1VMFA 4IE7A 2LM3A 5HV4A 1HQLA 3IMNA 4PLNA 5A7WB 4IV1C 1C5HA 2LUWA 4DUVA 1SLBA 2WFF2 2J1EA 3RNSA 4RFT0 1TMF3 2WRAA 1SBDA 3SISA 4ISRA 1LOFA 1CVNA 5A3MA 2XB6C 1JZ3A 4QHZA 3G7DA 2YDEA 1IS5A 2A6WA 2WLQA 1VAVA 3K4ZA 3OY8B 4N43C 4AI3A 2MEV1 4RGGA 4IE6A 4LO5B 5HXMA 3I3QA 3JB8A 1W6OA 4ZS3A 2Y64A 2UWCA 1OVPA 1RINA 3J7NA 1X36A 3RMYA 1N1YA 1SLLA 3N9PA 4IEUA 4QQOA 2W94A 5IAVA 3KCXA 3SKJE 3ZYIB 2ID4A 2O14A 2HJIA 2R1BA 3UETA 2GC2A 2P2KA 3FL7A 5HI0A 3PUQA 3ZKYA 4F8AA 2RR11 4CP0A 1O59A 1W8UA 3H8UA 2GZWA 2BNMA 4NRPA 1YC61 2ZJCA 1XU1A 2CSGA 2AYHA 1R083 3LAGA 5FO7B 4BWOA 5FY4A 1O4TA 1UIKA 1SCSA 2E9QA 1QQP2 4FPJA 3FX3A 2XBO1 5EQUA 2BV4A 4XIOA 3NSTA 2EIDA 1ASJ1 5FZKA 3VBRA 5FZDA 2R041 4RYDA 2UU8A 2BQPA 4JCKA 2JE9A 2R061 4LOSA 3RS6A 4ES8A 2A73B 1DQ1A 2WNOA 5L7OC 4HN0A 3O1OA 2RDRA 4MGYE 1AXYA 4NPLA 2FDKA 1DYPA 2IWGB 2ADEA 1H9WA 4P14A 1YJLA 1LOGA 4QXHA 2TBVA 3Q8EA 2ZGLA 4FI9A 2WINB 2P1BA 1BVVA 4QQHA 4AVAA 1OVSA 3VBRB 5C6CA 1DZTA 2HWB2 1QNWA 3LKJA 5FV3A 1QJX3 1NA1B 1N47A 4XJZA 3MDPA 1ZBA1 2P6CA 4WVVA 5FYTA 3WNPA 4B1LA 1IKPA 5FRAA 1ULOA 1AX0A 2P34A 2Y33A 3MF6A 4FPEA 4P08A 1SQ4A 5JZGC 3ZDSA 1MVEA 3NV1A 3ZFEA 2JKBA 2ZKLA 3BGAA 5KHIA 1RUI3 1WD3A 4Q4X1 1YQ8A 4B29A 3IAQA 3RYRA 3ROUA 3WXPA 1UU4A 1V70A 2AEYA 3BPZA 3CLPA 4RR3C 4AEKA 1U5XA 1M4WA 2ZEXA 1IPSA 3MHZA 1VBE2 1LNSA 1WW5A 4MG2A 4EROA 1UU6A 3O1SA 1XRUA 3ZYGA 2ZMLA 3H1WA 5J37A 3AVRA 3I2GA 1APNA 1N3OA 1OOPA 5FP7A 1UIJA 4GH4C 4NPMA 3ZFEB 4J6GA 1MZEA 1AJKA 3DF0A 1W6QA 2JKXA 4WM7C 1UYXA 1CGPA 1SFYA 3OEBA 3X29B 5A32A 4BA6A 3BTYA 2JG8A 3U07A 5E6HA 4XMAA 2ZGSA 4SLIA 4I2OA 1PIV1 1LOAA 2QVSB 4XJ9A 2EALA 2VU9A 3DGTA 4XUTA 5FKBA 1E5IA 1SPPA 4YW7A 4BQXA 1QXPA 2KXLA 3HAGA 2GN7A 1X33A 3U4XA 1OOPB 3RFRA 2O8OA 5HCAA 2DTWA 5FZIA 5I0TA 5A3WA 3VLBB 4DS0A 4BMEA 1UU5A 1UPSA 3URFA 4B7EA 1W6QB 4Q0SA 3NJVA 2ENRA 2B46X 2RS31 2YROA 4AQTA 2JG8B 2W46A 2IXHA 1E5HA 2MEV2 1W2AX 2ZX3A 1SPPB 1GZTA 3MW2A 2YGLA 2HEYF 4YLZA 3GDBA 5FAXA 1QXRA 4FBFA 3P3PA 3T1MA 5FQ0A 2VNGA 1SEFA 4Y20A 3ACFA 1FT9A 2XQRA 3OGRA 3QOPA 5LY2A 2VMDA 2NMNA 3EJKA 2GC3A 1TMF1 3ZXDA 2AENA 4PIXA 2FQPA 2WC2A 3C7GA 4NIDA 5EJZB 5HPOA 1FOD2 2JWPA 3KV6A 2HH9A 3MLLA 1BHGA 2RR12 4HFSA 4WBBA 2OT7A 3I3BA 4XBLA 2RVAA 3KGZA 4JRLA 4ASMB 4I09A 1OMIA 1AJOA 1PMJX 1X82A 4DNYA 1RIRA 3ZN6B 2VMHA 5LBEA 1NCQC 2ZHLA 3ZXAC 2ZHMA 4IEXA 1GR3A 1G8WA 4FO9A 3HPNA 5FQ0B 5C8CC 4GB33 5GLVA 5T3NA 4IETA 4A3XA 2JDMA 2XBO2 2XJVA 3MIGA 3HQXA 4PCRA 3MBWA 4B4QA 1ASJ2 3PJQA 3LA3A 2Y0OA 4O7XA 4LNVA 3PTRB 4JQRA 5FZ3A 5LEJA 1LOEA 2MNGA 1GZWA 2GDFA 2R062 2VUDA 1TZOA 4I0BA 3ZMNA 1UY0A 5IVYA 4CDQA 4S2FA 1R081 2HLEA 1F31A 5DQ0A 1OQEA 2CDOA 2W0XA 4AHYA 5ANQA 4HVQA 1IOAA 2HYKA 2VQ0A 3AL6A 4BQYA 5CFDA 4JGZA 2LTNA 4INDA 1H2KA 2E6VA 2WZ8A 3RMXA 1F9KA 1OT5A 1COV3 2VY0A 4E2SA 1QJY1 4LHSA 1D0HA 2V4VA 1H0BA 2JE8A 3M70A 2D3RA 1GP4A 4OHVA 1SMVA 3N9MA 3ILNA 3P3NA 4IE4A 1GZWB 1N3PA 1QHDA 1ZBA2 1DGLA 3WUDA 5CG8A 2Z2SB 2WFPA 5LB6A 1K42A 1BYHA 1DQ4A 2VBPA 4JQTA 1OPOA 3O5SA 5ERLA 2XVGA 2BUKA 4CEWA 4RA0A 1HQWA 3S7IA 5CFDB 4JGZB 1CAUB 2BNOA 5LA0A 3BYWA 1GNHA 2XHNA 4NWVA 4X8PA 3H8XA 1OKOA 1RUH1 3LIGA 3O7OA 4LK7A 4LKSA 3ZXEA
chains in the Genus database with same CATH topology
1UMIA 1NX9A 4XUNA 2W1QA 2WAAA 1GNYA 2BGPA 2VCAA 2VR4A 3MV01 2BERA 2WAOA 1GU3A 4D8MA 1JZ2A 4RN5A 5A1AA 5CYYA 1OF4A 1UZ0A 3ETPA 3GM8A 1PX4A 1KEXA 1JYVA 1O8SA 1XPWA 2BZDA 3ACGA 3LEGA 3I3DA 3FHQA 2EICA 3UNPA 1NAEA 2QQKA 5B4XA 3OB8A 2VO5A 2VTFA 1GUIA 1ULPA 1XC6A 4XVHA 5LCWL 3I97A 3IIIA 3WNMA 2VZSA 2VM9A 3I2KA 3F2ZA 3IB3A 1W9WA 3CIHA 3PUIA 3WF0A 4MO3M 1GOGA 4XZUG 2VL4A 1UY3A 5JUVA 1GOHA 3ZM8A 3W5MA 4DEVA 1W9SA 4LQRA 1NKGA 2VZPA 1UY1A 5F7UA 2EIBA 4JKKA 2VZOA 3P6BA 4M4RA 3ECQA 3J7HA 3EYPA 1JI6A 3T0AA 3WEZA 3DYPA 5IFPA 3CDZB 3T08A 2VZ3A 4CVUA 4DUVA 5C70A 4QDQA 3A23A 2E26A 4CU9A 2VZ1A 4KI5M 3K75B 2J1VA 2J1SA 4QDSA 1GQPA 3P1IA 3T2OA 3VDAA 2Y6LA 3D3AA 2E31A 2QQIA 4M4PA 2DDUA 1GMMA 4QB1A 2VZRA 2W1UA 2ZEYA 2LW8A 4MGSA 4A6OA 4QX1A 1UX7A 1F4AA 2VQTA 3WQBA 1JZ6A 3VD5A 1PX3A 3MUZ1 3WNKA 2W91A 4MOAA 4ARYA 1W99A 3HJRA 4QPWA 5JMOA 4ET7A 2VMFA 4ZY9A 2WABA 3VD9A 4BXSV 2Y6JA 3JXSA 2WO2A 3IAPA 2QQJA 2J1TA 3LE0A 5B4NA 2L9LA 4JX0A 3CKHA 4DEQA 5I0DA 1JZ4A 5EIYB 2Y6GA 1UXXX 2R7EB 3WSOA 2LS6A 2WYSA 2W1SA 2YB7A 4UAPA 2QQOA 1L7RA 4QX0A 4OUEA 4GWJA 2PQSA 4Z2AA 3GGLA 3HOBA 1IQDC 5C7GA 1R64A 1H6YA 4A4AA 3WNNA 3EB7A 3OGVA 2WDBA 3C7EA 3C7HA 4MADA 3C7OA 1JZ8A 4XURA 3UESA 2VZTA 4KMQA 2J7MA 3T0BA 4GZ9A 5FUIA 4ZZ5A 1MPXA 1CZTA 2WZEA 3HNYM 1JU3A 1O8PA 4XUPA 4ZXEA 2JDAA 3MV11 4XUQA 4AG4A 3I2IA 4W8JA 2J1UA 4UOJA 3T09A 3CZUA 3ABZA 2W3JA 4L0PA 3K4AA 2E33A 4PQQA 1UWWA 2ZEWA 3HEIA 1XNTA 4CUBA 2V72A 1EUTA 2WO1A 2ZEZA 4QDRA 2B4KA 4CUCA 1US3A 1JYXA 3FHAA 4P02B 4A45A 2XONA 4D0QA 2YC4A 4DUXA 4JKLA 2W92A 4PT6A 2Y6KA 3THCA 1W0NA 2XOMA 3IDAA 3CZJA 3OEAA 1H6XA 2C26A 3WNLA 4KWUA 3DYMA 1PMHX 2W95A 4QB2A 4DUWA 1HN1A 2W5FA 1SDDB 1JZ7A 3I2HA 5G05L 4OYUA 1SG3A 1DYOA 1W9TA 3K46A 1OH4A 4UI9L 2DCKA 2J22A 3BN6A 4IUGA 2EIEA 4TTGA 3LEKA 1US2A 4XUOA 3NNGA 3DYOA 2W87A 1P8JA 1TVGA 4W4ZA 4ARXA 3U37A 5CZKA 2C9KA 2Z4FA 4HG6B 2QBXA 1XNAA 1CX1A 4P00B 4DXRA 3CMGA 3WF4A 2J1EA 2J1RA 1JZ3A 3E1F1 2YC2A 3K4ZA 3NQHA 3ACIA 5HXMA 2QQNA 2Y64A 5JXJA 5J1XA 3VD7A 2W94A 2W47A 1UMHA 2Y6HA 3SKJE 2J1AA 1K3IA 3OBAA 3C8XA 2ID4A 3UETA 3FL7A 4QAWA 5JXHA 1O59A 2E32A 2ORXA 3WF3A 1OD3A 3LQCA 3HNMA 5G04L 1JZ5A 1L7QA 3T2QA 4QX3A 1JYWA 4E8CA 2W1WA 1K12A 1UYZA 2EIDA 2VZQA 2VJXA 4RYDA 1WCQA 1GOFA 4OMDA 4ZZ8A 2X05A 2X10A 2VOTA 4FI9A 2VC9A 2WN2A 3MUY1 1CZVA 3I2FA 5DMYA 2WN3A 1W8OA 1NUKA 4CU6A 5C71A 3WNPA 3K77A 1ULOA 1D7PM 2C4XA 2VZUA 4P08A 2VZVA 5EJ1B 3BGAA 1J84A 4PF1A 1CZSA 3IAQA 3SKVA 3SEPA 2HYXA 3A21A 2ZEXA 4MGQA 4GWIA 1LNSA 4A41A 4A44A 3A7QA 3I2GA 2YFZA 4A3ZA 2ZXQA 1RYYA 3HN3A 2QQMA 3MO4A 2JKXA 1UYXA 4BK4A 3WF2A 3OEBA 2BGOA 1EUUA 1UYYA 4JHZA 4OMCA 4QB6A 3DECA 2DCJA 5JXIA 3T0DA 2VMCA 4XUTA 5LA2A 4CU8A 3VD3A 2V5DA 3GXUA 1JU4A 2X09A 3PUHA 2WO3A 1K45A 2OKXA 1J83A 3NJVA 1OF3A 2WBKA 4JKMA 2W46A 2CDPA 1SHWB 1KGYA 3GDBA 3C7FA 4DXTA 4E8DA 1DP0A 2QQLA 4YPJA 4BK5A 3WF1A 3ACFA 3OGRA 3THDA 2VMDA 1UY4A 1UY2A 3T2PA 4A42A 3C7GA 3NRUA 5EJZB 5HPOA 5JR2A 1BHGA 2VCBA 5DN2A 1W8NA 3I3BA 2RVAA 2JD9A 5IFTA 3W5NA 1PMJX 3LPGA 2ORZA 1DLCA 4P5YA 3K4DA 3HPNA 3A22A 2VCCA 1F4HA 3CQOA 1UXZA 5IYYA 4W50A 3MBWA 1T2XA 4BJ0A 5JXGA 4OZOA 5IJRA 4AAXA 1TG7A 4TXWA 1UY0A 4DXSA 3HNBM 2HLEA 2WQ8A 4LPLA 5DQ0A 3LPFA 2CDOA 3VD4A 2YG0A 2B9VA 3WNOA 2RJ2A 3OG2A 2VMEA 4BDVB 2WZ8A 3I2JA 1OT5A 4LHSA 2V4VA 2JE8A 1WKYA 5IHRA 3NJXA 5LA1A 2Y8KA 1K42A 2RV9A 3FN9A 4CU7A 3VDBA 2WUHA 3ACHA 3I3EA 3OGSA 5DPNA 2VQUA 2W9XA 2KD7A 1JYNA 2XQXA 5LA0A 1CIYA 3VDCA 1YQ2A 2XHNA 3LEIA 4CUAA 3SEEA 1JHJA 1I5PA 2BBAA 3AC0A 4QX2A 4LKSA 2YFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UMI A;  1NX9 A;  4XUN A;  2W1Q A;  2WAA A;  1GNY A;  2BGP A;  2VCA A;  2VR4 A;  3MV0 1;  2BER A;  2WAO A;  1GU3 A;  4D8M A;  1JZ2 A;  4RN5 A;  5A1A A;  5CYY A;  1OF4 A;  1UZ0 A;  3ETP A;  3GM8 A;  1PX4 A;  1KEX A;  1JYV A;  1O8S A;  1XPW A;  2BZD A;  3ACG A;  3LEG A;  3I3D A;  3FHQ A;  2EIC A;  3UNP A;  1NAE A;  2QQK A;  5B4X A;  3OB8 A;  2VO5 A;  2VTF A;  1GUI A;  1ULP A;  1XC6 A;  4XVH A;  5LCW L;  3I97 A;  3III A;  3WNM A;  2VZS A;  2VM9 A;  3I2K A;  3F2Z A;  3IB3 A;  1W9W A;  3CIH A;  3PUI A;  3WF0 A;  4MO3 M;  1GOG A;  4XZU G;  2VL4 A;  1UY3 A;  5JUV A;  1GOH A;  3ZM8 A;  3W5M A;  4DEV A;  1W9S A;  4LQR A;  1NKG A;  2VZP A;  1UY1 A;  5F7U A;  2EIB A;  4JKK A;  2VZO A;  3P6B A;  4M4R A;  3ECQ A;  3J7H A;  3EYP A;  1JI6 A;  3T0A A;  3WEZ A;  3DYP A;  5IFP A;  3CDZ B;  3T08 A;  2VZ3 A;  4CVU A;  4DUV A;  5C70 A;  4QDQ A;  3A23 A;  2E26 A;  4CU9 A;  2VZ1 A;  4KI5 M;  3K75 B;  2J1V A;  2J1S A;  4QDS A;  1GQP A;  3P1I A;  3T2O A;  3VDA A;  2Y6L A;  3D3A A;  2E31 A;  2QQI A;  4M4P A;  2DDU A;  1GMM A;  4QB1 A;  2VZR A;  2W1U A;  2ZEY A;  2LW8 A;  4MGS A;  4A6O A;  4QX1 A;  1UX7 A;  1F4A A;  2VQT A;  3WQB A;  1JZ6 A;  3VD5 A;  1PX3 A;  3MUZ 1;  3WNK A;  2W91 A;  4MOA A;  4ARY A;  1W99 A;  3HJR A;  4QPW A;  5JMO A;  4ET7 A;  2VMF A;  4ZY9 A;  2WAB A;  3VD9 A;  4BXS V;  2Y6J A;  3JXS A;  2WO2 A;  3IAP A;  2QQJ A;  2J1T A;  3LE0 A;  5B4N A;  2L9L A;  4JX0 A;  3CKH A;  4DEQ A;  5I0D A;  1JZ4 A;  5EIY B;  2Y6G A;  1UXX X;  2R7E B;  3WSO A;  2LS6 A;  2WYS A;  2W1S A;  2YB7 A;  4UAP A;  2QQO A;  1L7R A;  4QX0 A;  4OUE A;  4GWJ A;  2PQS A;  4Z2A A;  3GGL A;  3HOB A;  1IQD C;  5C7G A;  1R64 A;  1H6Y A;  4A4A A;  3WNN A;  3EB7 A;  3OGV A;  2WDB A;  3C7E A;  3C7H A;  4MAD A;  3C7O A;  1JZ8 A;  4XUR A;  3UES A;  2VZT A;  4KMQ A;  2J7M A;  3T0B A;  4GZ9 A;  5FUI A;  4ZZ5 A;  1MPX A;  1CZT A;  2WZE A;  3HNY M;  1JU3 A;  1O8P A;  4XUP A;  4ZXE A;  2JDA A;  3MV1 1;  4XUQ A;  4AG4 A;  3I2I A;  4W8J A;  2J1U A;  4UOJ A;  3T09 A;  3CZU A;  3ABZ A;  2W3J A;  4L0P A;  3K4A A;  2E33 A;  4PQQ A;  1UWW A;  2ZEW A;  3HEI A;  1XNT A;  4CUB A;  2V72 A;  1EUT A;  2WO1 A;  2ZEZ A;  4QDR A;  2B4K A;  4CUC A;  1US3 A;  1JYX A;  3FHA A;  4P02 B;  4A45 A;  2XON A;  4D0Q A;  2YC4 A;  4DUX A;  4JKL A;  2W92 A;  4PT6 A;  2Y6K A;  3THC A;  1W0N A;  2XOM A;  3IDA A;  3CZJ A;  3OEA A;  1H6X A;  2C26 A;  3WNL A;  4KWU A;  3DYM A;  1PMH X;  2W95 A;  4QB2 A;  4DUW A;  1HN1 A;  2W5F A;  1SDD B;  1JZ7 A;  3I2H A;  5G05 L;  4OYU A;  1SG3 A;  1DYO A;  1W9T A;  3K46 A;  1OH4 A;  4UI9 L;  2DCK A;  2J22 A;  3BN6 A;  4IUG A;  2EIE A;  4TTG A;  3LEK A;  1US2 A;  4XUO A;  3NNG A;  3DYO A;  2W87 A;  1P8J A;  1TVG A;  4W4Z A;  4ARX A;  3U37 A;  5CZK A;  2C9K A;  2Z4F A;  4HG6 B;  2QBX A;  1XNA A;  1CX1 A;  4P00 B;  4DXR A;  3CMG A;  3WF4 A;  2J1E A;  2J1R A;  1JZ3 A;  3E1F 1;  2YC2 A;  3K4Z A;  3NQH A;  3ACI A;  5HXM A;  2QQN A;  2Y64 A;  5JXJ A;  5J1X A;  3VD7 A;  2W94 A;  2W47 A;  1UMH A;  2Y6H A;  3SKJ E;  2J1A A;  1K3I A;  3OBA A;  3C8X A;  2ID4 A;  3UET A;  3FL7 A;  4QAW A;  5JXH A;  1O59 A;  2E32 A;  2ORX A;  3WF3 A;  1OD3 A;  3LQC A;  3HNM A;  5G04 L;  1JZ5 A;  1L7Q A;  3T2Q A;  4QX3 A;  1JYW A;  4E8C A;  2W1W A;  1K12 A;  1UYZ A;  2EID A;  2VZQ A;  2VJX A;  4RYD A;  1WCQ A;  1GOF A;  4OMD A;  4ZZ8 A;  2X05 A;  2X10 A;  2VOT A;  4FI9 A;  2VC9 A;  2WN2 A;  3MUY 1;  1CZV A;  3I2F A;  5DMY A;  2WN3 A;  1W8O A;  1NUK A;  4CU6 A;  5C71 A;  3WNP A;  3K77 A;  1ULO A;  1D7P M;  2C4X A;  2VZU A;  4P08 A;  2VZV A;  5EJ1 B;  3BGA A;  1J84 A;  4PF1 A;  1CZS A;  3IAQ A;  3SKV A;  3SEP A;  2HYX A;  3A21 A;  2ZEX A;  4MGQ A;  4GWI A;  1LNS A;  4A41 A;  4A44 A;  3A7Q A;  3I2G A;  2YFZ A;  4A3Z A;  2ZXQ A;  1RYY A;  3HN3 A;  2QQM A;  3MO4 A;  2JKX A;  1UYX A;  4BK4 A;  3WF2 A;  3OEB A;  2BGO A;  1EUU A;  1UYY A;  4JHZ A;  4OMC A;  4QB6 A;  3DEC A;  2DCJ A;  5JXI A;  3T0D A;  2VMC A;  4XUT A;  5LA2 A;  4CU8 A;  3VD3 A;  2V5D A;  3GXU A;  1JU4 A;  2X09 A;  3PUH A;  2WO3 A;  1K45 A;  2OKX A;  1J83 A;  3NJV A;  1OF3 A;  2WBK A;  4JKM A;  2W46 A;  2CDP A;  1SHW B;  1KGY A;  3GDB A;  3C7F A;  4DXT A;  4E8D A;  1DP0 A;  2QQL A;  4YPJ A;  4BK5 A;  3WF1 A;  3ACF A;  3OGR A;  3THD A;  2VMD A;  1UY4 A;  1UY2 A;  3T2P A;  4A42 A;  3C7G A;  3NRU A;  5EJZ B;  5HPO A;  5JR2 A;  1BHG A;  2VCB A;  5DN2 A;  1W8N A;  3I3B A;  2RVA A;  2JD9 A;  5IFT A;  3W5N A;  1PMJ X;  3LPG A;  2ORZ A;  1DLC A;  4P5Y A;  3K4D A;  3HPN A;  3A22 A;  2VCC A;  1F4H A;  3CQO A;  1UXZ A;  5IYY A;  4W50 A;  3MBW A;  1T2X A;  4BJ0 A;  5JXG A;  4OZO A;  5IJR A;  4AAX A;  1TG7 A;  4TXW A;  1UY0 A;  4DXS A;  3HNB M;  2HLE A;  2WQ8 A;  4LPL A;  5DQ0 A;  3LPF A;  2CDO A;  3VD4 A;  2YG0 A;  2B9V A;  3WNO A;  2RJ2 A;  3OG2 A;  2VME A;  4BDV B;  2WZ8 A;  3I2J A;  1OT5 A;  4LHS A;  2V4V A;  2JE8 A;  1WKY A;  5IHR A;  3NJX A;  5LA1 A;  2Y8K A;  1K42 A;  2RV9 A;  3FN9 A;  4CU7 A;  3VDB A;  2WUH A;  3ACH A;  3I3E A;  3OGS A;  5DPN A;  2VQU A;  2W9X A;  2KD7 A;  1JYN A;  2XQX A;  5LA0 A;  1CIY A;  3VDC A;  1YQ2 A;  2XHN A;  3LEI A;  4CUA A;  3SEE A;  1JHJ A;  1I5P A;  2BBA A;  3AC0 A;  4QX2 A;  4LKS A;  2YFU A; 
#chains in the Genus database with same CATH topology
 5C3O A;  1QJE A;  2H0V A;  2ZGU A;  2JDZ A;  3KV5 A;  4CCE A;  3NMB A;  1ND3 C;  2BGP A;  5I0R A;  1JZ2 A;  2E7T A;  2DVD A;  2WAO A;  3ACL A;  5I0U A;  1OH3 A;  1Y43 B;  2GU9 A;  1K5M C;  1B09 A;  1RUI 1;  1UZW A;  3B69 A;  3K2O A;  3MYX A;  5FZB A;  3ZVX A;  4C91 A;  1UZ0 A;  1CN1 A;  1DF0 A;  3JD7 3;  5FZA A;  4FPH A;  4BPZ A;  5ABJ C;  1XSQ A;  4LR4 A;  3RYP A;  2B7Y A;  3FUO A;  2X5I A;  2R1D A;  1S2B A;  1OSG A;  1PX4 A;  3FZ3 A;  1JYV A;  1O8S A;  2BZD A;  1PIV 2;  3ACG A;  3INA A;  4GMP 0;  3T30 A;  5GLU A;  4ZXK A;  4Y5Z 0;  1U5Z A;  4XFA A;  2QQK A;  3E5Q A;  4Y1V A;  5F3C A;  3OB8 A;  2AR6 A;  2VTF A;  3FFQ A;  4RS5 A;  5FMD A;  4Z1V A;  3VBU C;  4NHM A;  1XC6 A;  3WNM A;  2JDH A;  2CU5 A;  5A7P A;  3T4V A;  4M0N A;  2DVG A;  5GZF A;  3ZDV A;  3ZIW A;  5I8T A;  2RS3 2;  4RSU A;  2X5I B;  4FFH A;  3W59 A;  4CDU C;  3SCF A;  3VKN A;  4HK8 A;  3CIH A;  4X6Q B;  4XIK A;  3ST7 A;  3GHM A;  1Q43 A;  3VBS A;  2BEO A;  3PUI A;  3V64 A;  3WF0 A;  2E7Q A;  4CP1 A;  4IE0 A;  3WHU A;  4BZ4 A;  4C1W A;  3ZM8 A;  2RS5 1;  2WNV C;  4FTB A;  4GIQ A;  2NM1 A;  2Y0I A;  4MYE A;  4RS5 B;  2CL2 A;  1IPJ A;  1OQ1 A;  3RWN A;  4LHN A;  3IT8 A;  1TMF 2;  4COU A;  2CYF A;  2UY8 A;  2VZP A;  5LAS A;  4BYY A;  2EIB A;  1NXM A;  1VBB 3;  3OPW A;  5IUQ A;  4N7I A;  1YIF A;  1RUG 3;  3BTA A;  4Q29 A;  1UOF A;  4YW4 A;  4HAN A;  3NAP C;  1C4R A;  3J7H A;  1VJ2 A;  2HWF 1;  3KHB A;  4XAC A;  4XFG A;  4JZR A;  3VBS B;  3CF6 E;  3T0A A;  3WEZ A;  3U0Z A;  1JOP A;  3DYP A;  2JDP A;  5D8A C;  1JYC A;  4Q4V 3;  3T08 A;  5FP4 A;  4CVU A;  1WCD J;  1BJQ A;  1ZZC A;  2QQV A;  4LBL A;  3A23 A;  4QDQ A;  3TOJ A;  5JSO A;  1I3H A;  4YGE A;  2DYC A;  1VMH A;  1UNB A;  1GWL A;  4QX7 A;  1RED A;  3VL8 A;  1QOO A;  2P3I A;  4QDS A;  3S30 A;  1GQP A;  4AXO A;  3Q8B A;  4FXG B;  4Y1U A;  1PMI A;  2BPA 2;  4LHK A;  5K0U A;  3P1I A;  3CJI C;  3J7L A;  4BQ3 A;  3T2O A;  3ITQ A;  1R08 2;  4LHL A;  3RZZ A;  2QQI A;  1PO2 1;  3GJB A;  1RXG A;  1H9P A;  2VZR A;  4GB3 1;  4QB1 A;  1C28 A;  4IEW A;  4MGS A;  1DG6 A;  1N1T A;  1UX7 A;  2YU2 A;  1G9B A;  1ULG A;  3BB6 A;  4O9E A;  3RZM A;  3POF A;  1TE1 B;  1V00 A;  1PK6 A;  1LOB A;  1PX3 A;  1ODN A;  5H9Q A;  4M3C A;  4XJW A;  3ALQ A;  1J1T A;  5K0U B;  1KDK A;  4YFW A;  5FUN A;  2JIG A;  1SLA A;  2EXH A;  4CSW A;  4YFZ A;  3THT A;  1LKN A;  3KVB A;  4ZY9 A;  3VD9 A;  1ZBE 3;  4QPG A;  2Y6J A;  3NW4 A;  2C6S A;  5A3T A;  3FLP A;  3IAP A;  2QQJ A;  5FFO C;  1COV 1;  3D6E A;  2OQ7 A;  3OTF A;  1R09 3;  1PK6 B;  1QJX 2;  2P6H A;  2ZZQ A;  2X8K A;  5J98 B;  3WUC A;  5CB7 A;  1D4M 3;  4M3C B;  4UFI A;  2ZAC A;  3LWC A;  4I02 A;  5KBF A;  1MVQ A;  1RUD 3;  1UXX X;  2VW1 A;  4K21 A;  4GAL A;  1BXH A;  2ZPX A;  2WYS A;  5IK8 A;  5DUU A;  2W1S A;  4QPG B;  1RUI 2;  4UAP A;  1ONA A;  3OBZ A;  1UMZ A;  4YGB A;  1BEV 3;  1LGB A;  4E4H A;  3ZSL A;  3L9J T;  1DBN A;  4MZU A;  5JCT A;  5CG9 A;  1AR7 3;  1PNF A;  5JPM B;  3HOB A;  1H8V A;  4HVR A;  4YM2 A;  2GAL A;  2P37 A;  5FXZ A;  4IEO A;  4LUM A;  4V2W A;  1ENQ A;  2IVJ A;  1HW5 A;  4EE2 A;  2DUR A;  4UT5 A;  1H6Y A;  5IK7 A;  3TN9 1;  3WNN A;  1RUF 3;  3EB7 A;  5IVF A;  2NMO A;  1FV2 A;  2W52 A;  2GMP A;  3PU3 A;  3MW3 A;  1YRZ A;  3Q9O A;  1ZVF A;  4WZF A;  5F3I A;  4R4Z A;  2WZP P;  4MAD A;  2I74 A;  3D8C A;  4DOU A;  2Q30 A;  3PIG A;  1G7Y A;  5C3P A;  2AH2 A;  1GNZ A;  5FPB A;  3B3Q E;  2VH9 A;  2VZT A;  1BMV 1;  3H7J A;  1CX4 A;  3AZW A;  3H3Z A;  1AR9 1;  1WLW A;  2BNN A;  4LBN A;  4EWE A;  4KBZ A;  3VBR C;  3NNF A;  4AED A;  3KM5 A;  4XCB A;  4UBG A;  2WZE A;  1NA1 C;  4W6W A;  1W0O A;  2QE3 A;  5CKN A;  3DEM A;  2IXK A;  5FK8 A;  3MGU A;  5FY7 A;  4YZ1 A;  5A3O A;  4H7L A;  2JDA A;  1QGL A;  3GF6 A;  1QJZ A;  2Z42 A;  2HWF 2;  1Q8S A;  4W65 A;  1YQ6 A;  4W8J A;  4XJU A;  3CZU A;  4BQW A;  3KZ4 C;  4XTP A;  5GZE A;  2WWS A;  4JRA A;  5K4L A;  1V0A A;  4AED B;  5CNA A;  1UWW A;  5EZW A;  1GP6 A;  2BOJ A;  2I07 B;  4P9G A;  4UXA A;  4YVS A;  1VBB 1;  2PHL A;  2JEC A;  4LTA A;  4CUC A;  4LKE A;  1YFY A;  5C3S A;  1WW6 A;  2FDJ A;  3AM2 A;  4I3G A;  4P02 B;  4XBN A;  1HX6 A;  1SAC A;  4JKL A;  3ZFE C;  2Y6K A;  3IDA A;  4Q4V 1;  1H6X A;  1OUR A;  4LXL A;  4GMP 3;  1KQR A;  4GB3 2;  4KWU A;  4COV A;  3DYM A;  4ASK A;  5F6K A;  4PIZ A;  4S2G A;  1SDD B;  2IFW A;  4XF4 A;  4C0H A;  1HB1 A;  4YVS B;  3HVD A;  3KQ4 B;  3VUO A;  4LOT A;  1QJF A;  3ZN4 A;  3WQ0 A;  3VB9 A;  2IVI B;  5DAW A;  1OOP C;  2HWE 1;  4UI9 L;  1QMJ A;  2DCK A;  4G3Y C;  2OZ6 A;  3BN6 A;  4KH9 A;  2CV6 A;  1Y9Q A;  4RGA A;  1VIW B;  2DFC A;  2FD8 A;  2EIE A;  4B8E A;  2YUE A;  2FCU A;  4YSF A;  3I49 A;  4UWD A;  1ALY A;  2JG8 C;  2MPF A;  4LJH A;  2Q8D A;  2QQW A;  1COV 2;  4WVM A;  1FNY A;  2WSV A;  4XUO A;  1O3R A;  1EP0 A;  3NNG A;  2XJU A;  4JVA A;  2Q5T A;  2D6L X;  1P8J A;  2W87 A;  3DL3 A;  3KMH A;  1AX2 A;  2EXI A;  5FXX A;  2QUO A;  3NNM A;  3H8R A;  2A6Y A;  1FX5 A;  3N35 A;  4DPN A;  5FZH A;  1R1A 1;  3LA7 A;  1W2O A;  4CCM A;  5CZK A;  3SCH A;  3GZA A;  3PUR A;  1ZBE 1;  2QBX A;  2UWB A;  2JDY A;  3CMG A;  5C8C A;  1YCI A;  4WVM B;  3KB5 A;  3RYK A;  1M06 G;  4MUV A;  3E1F 1;  1VBC 3;  5FYY A;  4N7U A;  3RZG A;  3MIF A;  3N9Q A;  4COZ A;  1RVF 3;  4XC9 A;  2QQN A;  2D6P A;  4EYU A;  1ZZB A;  5GAL A;  4AQ2 A;  2XLA A;  1AYN 3;  5L9V A;  1NXD 1;  3SNM A;  2W47 A;  2Y6H A;  3JD7 2;  4FPY A;  5EPA A;  3S7E A;  1LEC A;  2J1A A;  4OI0 A;  1BEV 1;  1K3I A;  4D7Y A;  4QX5 A;  3H3U A;  1YEW A;  5KXC A;  3PDQ A;  3WW4 A;  1AR7 1;  2ZAH A;  4XQW A;  1BMV 2;  4CPB D;  1Z7S 3;  3AZX A;  3WF3 A;  3N7K A;  3BUC A;  3T4H B;  2BVV A;  1J3R A;  1GP5 A;  3ME2 A;  1W0P A;  3RI8 A;  4CDW B;  1H4G A;  2EAK A;  5C9A C;  4ES9 A;  1RUF 1;  1X9T A;  2QZ3 A;  2WA3 A;  5FUP A;  4QX3 A;  3T2Q A;  4JGY A;  3WQ7 A;  1XNK A;  4QWN A;  2W68 A;  4NPR A;  1K12 A;  1OUS A;  1UYZ A;  2VZQ A;  2VJX A;  1JW6 A;  2XH6 A;  4IGO A;  2YBP A;  5DZF A;  4N8M A;  4TYS A;  1GOF A;  4OMD A;  2VVD A;  5A70 A;  5KHG A;  3I8T A;  4OLL A;  5L19 A;  1OUX A;  1YI9 A;  1ST8 A;  1O4Z A;  5FZL A;  4AGR A;  5GLT A;  4ZS2 A;  2PFW A;  2OPW A;  1ULF A;  4PBP A;  2DVB A;  3K51 A;  5H9S A;  1I1E A;  4L8Q A;  1NE6 A;  2VAU A;  3ZFG B;  4JGY B;  4OVE A;  2N7G A;  2WN2 A;  1Z0H A;  2OQ6 A;  1OA3 A;  1VBB 2;  4YG3 A;  1QQP 1;  1ULE A;  4FFF A;  5DMY A;  1UOJ A;  3KV4 A;  3ILF A;  5IK4 A;  3UT0 A;  1NUK A;  1NQD A;  2E51 A;  5C71 A;  3PTY A;  4CEW C;  1D7P M;  3CU7 A;  2VZU A;  4Q4V 2;  1OFN A;  5CKQ A;  3MW4 A;  3UYJ A;  4N53 A;  3MIC A;  4D6Q A;  5BNP A;  1QF3 A;  3MI8 A;  3WR0 A;  3WY6 A;  5EJ1 B;  1H2N A;  5FZF A;  4Q1R A;  3USU A;  1CZS A;  2JB4 A;  1ULD A;  5LBC A;  4XQ4 A;  1H1M A;  4RQP B;  4ASL A;  2RM2 3;  4M3C F;  4IXL A;  3ZFF C;  4MGZ E;  1BBT 1;  2HYX A;  4HON A;  3HQU A;  4AK3 A;  1VB2 A;  2NN8 A;  1H2M A;  4GWI A;  5FZE A;  3WG4 A;  4CEY A;  3DXT A;  2BOI A;  2IZW A;  1DQ0 A;  5H9P A;  4A44 A;  4GMP 1;  1MQT A;  1ODM A;  1RUO A;  4OI1 A;  2O0O A;  3A7Q A;  4N53 B;  2YFZ A;  5BNP B;  1AL2 3;  4LLO A;  1D0G A;  4CP9 A;  2X5I C;  4HKL A;  1S55 A;  1LHW A;  4A3Z A;  5DAQ A;  3N7J A;  1CJP A;  5FZ9 A;  4C0B A;  1RYY A;  5JR7 B;  3USU B;  1S4C A;  2QQM A;  5FLH A;  3MO4 A;  4HVO A;  1WLD A;  2KM2 A;  5L9R A;  2ILM A;  4QB6 A;  4QXK A;  3DEC A;  5JIA A;  2CNA A;  1HIX A;  2XLF A;  1QNY A;  5FIX A;  4YAR A;  4RS5 C;  3D5O A;  3E5X A;  1EV1 3;  2WS9 3;  4QGN A;  4CEY B;  3USS A;  4Y33 A;  4Q27 A;  1MQT B;  1ZBE 2;  4CCN A;  1VBE 1;  4DY5 A;  2FMD A;  3S5Q A;  1NCR A;  3PUH A;  2GME A;  3PVO A;  4CP9 B;  1GWK A;  4KWL A;  5DAX A;  3VKL A;  4WZC A;  4XXA A;  2WQ4 A;  4Q8K A;  1J83 A;  5HCB A;  1OF3 A;  4NHL A;  3TNP B;  4MGI E;  2XWJ B;  4RHV 3;  4JKM A;  5FPA A;  4D3W A;  2DU0 A;  2FZ2 A;  2Q1Z B;  4FP2 A;  2BFU S;  1RUD 2;  4MXW A;  4BE3 A;  3LIH A;  3FWE A;  1V9U 3;  1SLC A;  1DYK A;  4E8D A;  4OUL A;  4LIV A;  1DP0 A;  2QQL A;  2CGO A;  4JDM A;  3WF1 A;  1NCR B;  2VNV A;  1CAX A;  3B94 A;  3POG A;  4K9S A;  5FPV A;  3ASI A;  1BEV 2;  4AQS A;  2H0B A;  5JI7 A;  1AF9 A;  1ZZ8 A;  2G1M A;  2OXB A;  2GSY A;  4PF5 A;  4A7Z A;  2ZA9 A;  2F4L A;  2D43 A;  1AR7 2;  3SMH A;  1WMF A;  1W8N A;  1X8E A;  5D21 A;  1UYP A;  5FY8 A;  3W5N A;  2GNB A;  2VD7 A;  2Y6F A;  4MXW B;  3Q8F A;  1DLC A;  1Q8V A;  1EAH 3;  4PQ9 A;  5KWR A;  3TNQ A;  5T5O A;  1AYN 1;  2DCZ A;  4NWW A;  1RUF 2;  2Z79 A;  4MGT A;  4P9Y A;  1CAX B;  2JXA A;  5K0U C;  1S0I A;  5IYY A;  1UZV A;  1A6C A;  1BKZ A;  2VUC A;  3GCX A;  4BJ0 A;  2G9Z A;  3QAC A;  1ZRD A;  4OZO A;  2GNT A;  5IJR A;  3HT2 A;  4V2V A;  1L7L A;  3RPQ A;  3FC0 A;  1FOD 1;  1KS4 A;  4XDO A;  1NOV A;  2WQ8 A;  2ARB A;  5C4W A;  4LO6 B;  4FPO B;  2PTM A;  5DUX A;  4CCK A;  1W6O B;  3WNO A;  1XNB A;  5FZ1 A;  3MEP A;  4NAM A;  1NQJ A;  2K9Z A;  4URT A;  3POE A;  4B1M A;  1RB8 G;  4JV4 A;  4NIH A;  4NJ4 A;  3OD0 A;  4CPB A;  3DUI A;  2BVB A;  1WCK A;  2BBV A;  2DUP A;  1W2N A;  1WKY A;  2B9U A;  3SIT A;  4Y4Y A;  5LA1 A;  1ND2 A;  1FYU A;  5D2A A;  5T50 A;  4CU7 A;  2XML A;  3FE5 A;  2HBU A;  3VZM A;  5A6X A;  1QDC A;  2WUH A;  5C4W B;  4LLF A;  4AW7 A;  2W9X A;  4C1X A;  1RJ7 A;  1UL9 A;  2WT2 A;  2DCT A;  5F8P A;  1JYN A;  1N3Q A;  4CCO A;  1YQ2 A;  4KWK A;  4EV0 A;  1GSL A;  1T6B X;  3VBH A;  4E4S A;  1BBT 2;  1JHJ A;  1I5P A;  4NHY A;  1V6M A;  4QX2 A;  3SEE A;  1T2X A;  5SV8 A;  1SCR A;  1NX9 A;  1ND2 B;  3UGH A;  2YZ4 A;  1U5I A;  2VCA A;  4Q26 A;  2A71 A;  3TEZ A;  5FPU A;  1AR6 3;  3FLR A;  4I0A A;  2VQA A;  4RN5 A;  4KU8 A;  1GWM A;  1REF A;  5BUV A;  5CYY A;  1G9A A;  1IQA A;  2RM2 1;  4HKO A;  4A2U A;  4FP3 A;  1LGN A;  1IGO A;  4BXF A;  1NZI A;  3ETP A;  1IS6 A;  3JB4 C;  3GHN A;  2ZHK A;  2JEN A;  4XAE A;  4Y5S A;  5JAX A;  3ZXF A;  2AAC A;  1GQH A;  1AHS A;  1Q8Q A;  3M3O A;  3UNP A;  1POV 0;  3TAY A;  5B4X A;  3GJA A;  4F83 A;  1IG0 A;  5E88 A;  3WT3 A;  4R8H A;  5F32 A;  5FXV A;  1UZZ A;  4YG0 A;  3KGL A;  3WDT A;  5ISL A;  1C57 A;  1OLM E;  4XVH A;  2HWD 3;  5LCW L;  1FNZ A;  3LDB A;  2RS1 3;  3III A;  4RGK A;  1JHN A;  2VZS A;  4XQD A;  4QXC A;  3IM0 A;  4WVZ A;  3AKP A;  1AR8 3;  4H55 A;  4OHZ A;  4DO0 A;  2B39 A;  2A75 A;  3IB3 A;  4LIU A;  5FBJ A;  4NUB A;  2QZ2 A;  1BCX A;  1EV1 1;  1YQC A;  2WS9 1;  5AFB A;  5CA6 A;  1W04 A;  1GOG A;  3MIB A;  3POB A;  4MO3 M;  4XZU G;  5L9B A;  2EAA A;  2ET7 A;  3O0X A;  4OI2 A;  4XDQ A;  4XHB A;  1O91 A;  3ZO0 B;  3WDV A;  4BQ5 A;  2HWC 3;  5JSR A;  3AX4 A;  4DRR A;  5F7U A;  1TNF A;  2P3J A;  1CQ9 A;  2AGS A;  1VBC 2;  2CY6 A;  1SZB A;  2VZO A;  3LF7 A;  3P6B A;  4RHV 1;  3UL2 A;  4CRQ A;  4FOY A;  5IVE A;  2ZGP A;  4IEV A;  4BHP A;  2QJV A;  4LT5 A;  1RVF 2;  3WLU A;  1PGW 2;  1V9U 1;  5A32 B;  1JI6 A;  3DKW A;  4E4Z A;  2D44 A;  1C1L A;  5IFP A;  3ZIX A;  4CZS A;  1AYN 2;  2OA2 A;  4AI1 A;  1DQ6 A;  5ACA 3;  4UBH A;  3ZXK A;  3PJY A;  4PI2 A;  4AYU A;  4Q0U A;  4FPG A;  1RIT A;  3EXU A;  4ZU5 A;  2E26 A;  4JC1 A;  4CDX A;  3RZL A;  5FYI A;  1JYT A;  4DZG A;  4AAP A;  3H50 A;  2VZ1 A;  1UQX A;  3OD4 A;  4CTE A;  1LJ7 A;  2YV8 A;  2YGM A;  1JN2 P;  1FAY A;  4H2A A;  5FMO L;  1WA6 X;  1Z7S 2;  1CIW A;  4NR1 A;  4BQ1 A;  1PGL 1;  2XL7 A;  4FFI A;  1ZNP A;  2DF7 A;  4ZU4 A;  3TB0 A;  5JIU A;  4O9G A;  3HD8 B;  2ATF A;  2PHR A;  2ZAA A;  1I6X A;  2WR9 A;  5DG2 A;  4NII A;  4A6O A;  2ZEY A;  4AI2 A;  4BMB A;  2PAK A;  1MS1 A;  3RZH A;  3AFK A;  4CDX B;  5FWE A;  2XGX A;  1HB3 A;  1DQ5 A;  2VQT A;  4XIL A;  4Y20 B;  3WQB A;  5K8S A;  4K20 A;  2ADD A;  2YY1 A;  3MUZ 1;  3OUH A;  4QPY A;  3WNK A;  5T52 A;  4AVT A;  4R52 A;  4WM8 A;  5A3L A;  1VAM A;  2VTX A;  1ZA7 A;  5FZM A;  4ARY A;  3B93 A;  1HDK A;  3O1P A;  2JIC A;  4KNC A;  4CEW B;  5JMO A;  1X8M A;  4IEY A;  3EQE A;  1RUJ 3;  1C1F A;  3Q8C A;  5EHD A;  3JQW A;  4I0W B;  2VPV A;  3LA2 A;  4FFG A;  1W90 A;  2Y26 A;  4PDW C;  2Y38 A;  3AP9 A;  3OJB A;  2B5H A;  1OFS A;  2P4E A;  3CKH A;  5A1L A;  3WW3 A;  1DFQ A;  1JBC A;  5KXD A;  4IEP A;  2XVL A;  4WM8 B;  5A3N A;  1JZ4 A;  5EIY B;  2Y6G A;  3H8O A;  5KXE A;  2BU9 A;  1AZD A;  2LS6 A;  4CP2 A;  3FJS A;  3D0J A;  4CDQ B;  2P5B A;  2WWJ A;  4QHB A;  3WP5 A;  3UGF A;  1E5R A;  2YB7 A;  3T3Y A;  5LW9 A;  4Q4W 3;  1W3V A;  1RXF A;  5GKA C;  1L7R A;  2RM2 2;  4QX0 A;  1GAN A;  3ZYF A;  1CPM A;  3H7Y A;  4GWJ A;  2D7F A;  4YWA A;  4CDW C;  5LBB A;  4Z2A A;  1BQP A;  3GGL A;  5LBF A;  1WBF A;  1QJX 1;  2XJP A;  1V6O A;  5F6L B;  5J09 A;  3U10 A;  4D7T A;  1NLQ A;  3IN9 A;  1AL2 2;  5LK7 B;  2MHF A;  3NV2 A;  1DCS A;  1W28 A;  4XFB A;  4FPL A;  5FYB A;  3I3M A;  1KIT A;  2WDB A;  1PM7 A;  2GC1 A;  4D94 A;  2VOV A;  4E4D X;  2ARA A;  4XAB A;  1HV1 A;  3C7H A;  3KF3 A;  4R9C A;  3R4D B;  3PVN A;  4AI9 A;  3O14 A;  4XUR A;  2JG9 A;  3UES A;  4KMQ A;  2ZMK A;  1LHV A;  1F8V A;  4D6S A;  1EV1 2;  2WS9 2;  3V65 A;  2J7M A;  1ZRI A;  3ZFG C;  5J48 A;  4GZ9 A;  4JGY C;  5FUI A;  5LRS A;  1NG0 A;  1GBG A;  1UAI A;  2WNU A;  3RZJ A;  2NYY A;  1GZ9 A;  5FLJ A;  1X50 A;  1HB2 A;  3ILR A;  2OUH A;  1CZT A;  3WCS A;  2A1X A;  3ZR6 A;  1OA4 A;  5CBL A;  1EY2 A;  2RS1 1;  3WDX A;  3VZK A;  5LAT A;  1WBL A;  2XHK A;  5F5A A;  3LOB A;  3OUJ A;  1AR8 1;  3KWV A;  4RHV 2;  1XJA A;  4Y4R A;  5DDJ 3;  2D6O X;  1I5Z A;  1O6U A;  2WLP A;  4QKB A;  2CTV A;  2JG9 B;  3A0N A;  3H3L A;  3ZKU A;  1V9U 2;  1S0B A;  4SBV A;  3I2I A;  4QHO A;  3W21 A;  1UKR A;  2ZGT A;  5F3G A;  1S2K A;  4YM0 A;  2B42 B;  2W3J A;  4UW6 A;  1BLZ A;  2WNU B;  4RQP C;  4B7K A;  3FBM A;  4AF9 A;  1YJK A;  2HWC 1;  2VUJ A;  4NHX A;  1FPN 3;  4Q1P A;  3HEI A;  1XNT A;  2R0H A;  1EUT A;  3MPB A;  2BDR A;  5IT6 A;  2ZEZ A;  2B4K A;  3LEM A;  3PNA A;  2ES3 A;  2QKD A;  4QGL A;  5DAB A;  4FAG A;  1JYX A;  4N53 C;  2TUN A;  4AGG A;  4JHT A;  2HEV F;  1V6I A;  1LHO A;  2YC4 A;  1PGL 2;  1W6M A;  5K7P A;  1EAH 2;  3THC A;  3OBT A;  3FHI B;  1F15 A;  3WP4 A;  2XOM A;  2ZGK A;  3OEA A;  2IUW A;  2C26 A;  5ACA 1;  2CAU A;  4Y1Z A;  3WNL A;  4KU7 A;  3ORJ A;  1W05 A;  1PMH X;  3AKR A;  4Q5O A;  4M00 A;  1IKQ A;  1HN1 A;  4QB2 A;  3RJ2 X;  4AGV A;  4FTS A;  2W5F A;  1JZ7 A;  4YW5 A;  1RHI 3;  3RSJ A;  1IZ3 A;  4CEY C;  4G9S B;  2ARX A;  4QU2 A;  2Q8C A;  1MQT C;  2OPK A;  1ZYB A;  1SG3 A;  4P9X A;  1W9T A;  3BKZ A;  1V6K A;  3UKT A;  4S2H A;  3S5A A;  5A7Q A;  1U5Y A;  5BV6 A;  5EV7 A;  2P3Y A;  5FMB A;  5JVV A;  4IUG A;  5LZ6 A;  2IXJ A;  3O1U A;  1H1A A;  3FFZ A;  2DU1 A;  3MF9 A;  1VAL A;  2XJR A;  4ITC A;  4TTG A;  1WZX A;  1XOY A;  1US2 A;  1V6J A;  4LUL A;  3AMN A;  4N9H A;  4Y22 A;  4TZD A;  3AJZ A;  4IV1 A;  4EN9 B;  3CBN A;  2BP6 A;  4LO7 A;  4M0H A;  4Y1Y A;  1H1I A;  2PXJ A;  2YPD A;  5SV5 A;  4HPK A;  4JTN A;  1LOD A;  4KBB A;  1URX A;  4W4Z A;  3KF5 A;  1XYO A;  1R1Z A;  4N43 A;  4K7J A;  3ZSJ A;  3IMM A;  3O1T A;  3M3Q A;  4OHX A;  1RUJ 1;  2Z4F A;  3CJX A;  3GZE A;  1H4H A;  4FCA A;  1CX1 A;  2ZX2 A;  3BIW E;  3L2H A;  3V0B A;  4P00 B;  5EYX A;  1I9R A;  1VBD 3;  3WNX A;  4Y22 B;  3WF4 A;  3R4S A;  2C5D A;  3U78 A;  2J1R A;  5A7O A;  4I01 A;  3U11 A;  1KDM A;  1C5I A;  3PVB B;  2B45 X;  4HPK B;  5AC9 3;  4PLO A;  3ZSE A;  4FAH A;  1ZZ7 A;  3ACI A;  4E2G A;  1W6N A;  4NO4 A;  3VHP A;  1J58 A;  3WZ1 A;  1AR6 2;  2SLI A;  1MS3 A;  2XKP A;  2OX0 A;  3VD7 A;  2UWA A;  3V0B B;  4F7Z A;  2B8M A;  2VXR A;  5DUW A;  5EP9 A;  3OBA A;  1LOF C;  3C8X A;  3VGI A;  1O3Q A;  1FMD 3;  1ZX5 A;  5F5C A;  1J3P A;  2GN3 A;  2XL9 A;  3SLI A;  1W9F A;  4QD2 A;  2AUY A;  4XFI A;  5FYM A;  2E32 A;  2ORX A;  1OBN A;  5FY5 A;  4HKW A;  1HXS 3;  4MHU A;  5EYY A;  3LQC A;  2DBN A;  2IC1 A;  3R6S A;  3HNM A;  5F1R A;  5FO9 B;  5L7O A;  3OF1 A;  4Y3O A;  3ZYJ B;  1VE0 A;  1STM A;  4H14 A;  3RWK X;  2ZAB A;  1L7Q A;  1RJ8 A;  3QBQ A;  3WVJ A;  2D3S A;  2HWD 2;  1RUE 3;  4OQ9 A;  1LHN A;  2RS1 2;  3QCW A;  4E8C A;  1YIP A;  1XB9 A;  5ANN A;  4XTM A;  2R49 A;  2A5Z A;  2W1W A;  3VKF C;  3PU8 A;  1AR8 2;  4RL7 A;  3C3V A;  3JD7 1;  4XYX A;  1GFF 2;  4UF0 A;  3LD8 A;  1WCQ A;  4DQA A;  1DZQ A;  2YHJ A;  1OLR A;  4UFK A;  4UW3 A;  5CIR A;  1RUC 3;  3AP5 A;  1W2U A;  1HKD A;  5L7O B;  4W6X A;  3BI3 A;  3WW2 A;  5JZG A;  2HWC 2;  3CL1 A;  3KV9 A;  3UV9 A;  2WFF 3;  3PHM A;  2JEM A;  1VPH A;  5IWF A;  2VC9 A;  2WL1 A;  4PIY A;  5CIS A;  4LO4 B;  1CZV A;  1W8F A;  3AXD A;  4GJY A;  2VOX A;  5DDJ 1;  1W06 A;  4OFG A;  4QM9 A;  4UF0 B;  3GZU C;  3UJQ A;  2PAM A;  3K77 A;  5L73 A;  2VXJ A;  2C4X A;  2JB8 A;  5ACA 2;  3BOW A;  2QQP A;  1QDO A;  3RGB A;  2YPJ A;  5JZG B;  1LEN A;  2OW4 A;  3H1Y A;  1J84 A;  4GH4 A;  4XEZ A;  4D69 A;  3HBZ A;  2RG4 A;  1CAW A;  3UKN A;  1KJR A;  5FYV A;  3SKV A;  4PJY A;  5J96 B;  2OII A;  4NN0 A;  3SEP A;  1MAC A;  5I0S A;  1IS4 A;  4YM3 A;  2PLV 3;  4K1Y A;  4LBO A;  4YRD A;  1RUG 1;  1DGW X;  3H42 B;  2K46 A;  2PN5 A;  5E89 A;  4JDO A;  1VAK A;  5BXX A;  3HN3 A;  4GH4 B;  3WD5 A;  3WV6 A;  3T1L A;  1J1L A;  2RE9 A;  2PQQ A;  4R9D A;  4EWD A;  1L3J A;  1MS9 A;  4BK4 A;  1WA4 A;  3WF2 A;  2IFR A;  3NV3 A;  1YLL A;  5JOZ A;  2ZGO A;  3T0D A;  2VMC A;  2WO7 A;  5GLW A;  3SC7 X;  5FYZ A;  3JQX A;  3NJY A;  1FAT A;  2WWU A;  5LA2 A;  5JWP A;  3F95 A;  3ZXL A;  5L36 A;  3DKQ A;  4GKX A;  4TSV A;  1RUJ 2;  1HQN A;  1E57 A;  4AFA A;  3DV8 A;  1VRH 3;  2X09 A;  4NE9 A;  3NWK A;  2D40 A;  1DIW A;  5C5U A;  1B35 A;  4BOW A;  4BLJ A;  1K45 A;  4JAA A;  1VBA 3;  4CYD A;  5GZG A;  4LKF A;  4FQZ A;  4IV3 A;  2VW0 A;  3E6B A;  1HJF A;  4CCC A;  3FBY A;  5FZC A;  5T54 A;  2VE1 A;  2V4A A;  3HWJ A;  4AWD A;  5CFC A;  1TEI A;  3C7F A;  4WV8 A;  4L99 A;  5E1R A;  1DZR A;  1OA2 A;  4L2N A;  4Y26 A;  3O1R A;  4BK5 A;  1KRI A;  3H1M A;  1VBD 1;  3LB9 A;  4NHK A;  1WLT A;  2VMG A;  3AP7 A;  2W39 A;  2YYO A;  1CES A;  4Q4W 2;  4XAA A;  2Q8E A;  3VZO A;  4AEJ A;  1B35 B;  1GZC A;  1UY2 A;  1VRB A;  2JIJ A;  2TNF A;  3VBF A;  3HMY A;  4YW2 A;  3T2P A;  3NRU A;  3OGJ A;  4P9L A;  4IV3 B;  5DN2 A;  1R09 1;  5FWJ A;  2ZBJ A;  2GH8 A;  5IFT A;  1RL3 A;  3VDD A;  1D4M 1;  4CDX C;  2E53 A;  1UZY A;  2WII B;  3NKG A;  4Q4Y 3;  5CFC B;  3IZO A;  3VHN A;  1CD3 G;  2EA7 A;  4HSJ A;  4R4X A;  1RUD 1;  4BIS A;  4XF9 A;  2HEW F;  2NP0 A;  3CQO A;  5C8C B;  1FMD 1;  1UXZ A;  3ATG A;  4W50 A;  1YXW A;  3VBF B;  4UFJ A;  3LDR A;  3ZOI A;  5JXG A;  3ON7 A;  5JPN B;  4URA A;  3VZN A;  1TG7 A;  3IWZ A;  1HXS 1;  2CHH A;  5A1F A;  5BNN A;  3BU0 A;  1MS4 A;  1EPZ A;  1OD5 A;  4MLO A;  3VN4 A;  3RG0 A;  3ZSM A;  3VDD B;  4DXS A;  4E2Q A;  1CON A;  1MEC 3;  4LPL A;  1KJL A;  1W39 A;  2QDN A;  3BOD A;  3BTZ A;  5HCH A;  1RUE 1;  2ZGQ A;  1O4Y A;  3BPS A;  4YNI A;  1RGS A;  4QMA A;  1VLN A;  2XUE A;  4WM8 C;  4XFH A;  1S0D A;  3I2J A;  4BDV B;  5EJ3 A;  3RDI A;  3MLJ A;  4LEJ A;  4B3N A;  1DDL A;  5DDJ 2;  3KCC A;  4TWT A;  2CGN A;  3AKQ A;  5CAZ A;  5FO8 B;  2J42 A;  5EWS A;  4LE4 A;  3U1X A;  4CDQ C;  3ES1 A;  3NJX A;  2VNR A;  1RUC 1;  3HR9 A;  5A6Q A;  5BNN B;  4NRQ A;  3FN9 A;  3KSC A;  3VDB A;  3DCQ A;  1A3K A;  1AX1 A;  3I3E A;  3OGS A;  4J25 A;  4XOG A;  2XR4 A;  4JGZ C;  5DPN A;  4PHZ A;  1FPN 2;  4C8D A;  5CFD C;  5LWB A;  1HRI 3;  1QJU 3;  2ET1 A;  2VQU A;  5JOY A;  2KD7 A;  2PHF A;  2XQX A;  5FZO A;  1K5M A;  1CIY A;  1UO9 A;  4XPV A;  1YUD A;  1X7N A;  4IGQ A;  1QIQ A;  3LEI A;  5FPZ A;  2Y34 A;  3QH7 A;  3IIA A;  3WX5 A;  5ABJ A;  3O1V A;  3AC0 A;  2CWS A;  2YFU A;  3IKW A;  1RUG 2;  3TEW A;  2EVX A;  3A0K A;  3MV0 1;  4GKY A;  3MFC A;  4D8M A;  3TYJ A;  3N4M A;  1RMU 3;  5A1A A;  1RHI 2;  5LA9 A;  1OF4 A;  2R04 3;  5FZO B;  1K5M B;  1QOS A;  2RHP A;  3R05 A;  3LZZ A;  2PHX A;  4FOW A;  4HBN A;  2R06 3;  5FPX A;  1ACC A;  5ABJ B;  1ZZ9 A;  2PLV 1;  4G4F A;  1OI6 A;  5JMC A;  4AVB A;  1XPW A;  4LK6 A;  4ORF A;  3LEG A;  1DU3 D;  4YZ3 A;  4CDU A;  3FHQ A;  4EZ4 A;  2EIC A;  2FDI A;  2PHW A;  5FLI A;  4M3C E;  4QXB A;  1NLS A;  4QU1 A;  2VO5 A;  3LGR A;  1GUI A;  2XKO A;  4UW5 A;  4MET A;  3JBG 3;  3THP A;  4DRV A;  1S1A A;  2PEL A;  1WLC A;  1CJD A;  1ULP A;  4JDN A;  3ZMO A;  1W8H A;  4BM8 A;  3OGG A;  3J9S A;  3U14 A;  3PME A;  4NMI A;  1ZRC A;  2WNU C;  2IXI A;  5A80 A;  1Y4W A;  4AE2 A;  1EYB A;  3F2Z A;  4Y5T A;  4D7S A;  3V0A A;  3M3I A;  3AYC A;  3O12 A;  2OVU A;  4CDU B;  3NAP A;  4YGD A;  1UY3 A;  2EIG A;  4XFC A;  5BYN A;  5D8A A;  4QPI A;  1VBD 2;  3M2M A;  4L92 A;  4AI8 A;  4Q4X 3;  4DEV A;  3VHR A;  1DGW A;  1ENX A;  4ZKT B;  2P3K A;  3ZX7 A;  1HJG A;  1UF2 C;  1W9S A;  3KT7 A;  1NKG A;  1REE A;  1UY1 A;  1VBA 1;  4CCD A;  3LCP A;  4KQ7 A;  4JKK A;  4YW6 A;  5J36 A;  2YXS A;  1K5J A;  3BCW A;  5AC9 2;  5GZD A;  2K2S A;  3UJO A;  4AZZ A;  3VBS C;  1R09 2;  2WSU A;  4LA3 A;  4LIT A;  4QX8 A;  1W8W A;  2QNK A;  4OI4 A;  5DXD A;  4U2A A;  3EYP A;  1D4M 2;  5HBA A;  3CJI A;  4XET A;  3CDZ B;  2VZ3 A;  3MFA A;  4QM8 A;  5D8A B;  3B9I A;  4MGK E;  4QPI B;  4OZX A;  5FZ4 A;  3SXW A;  5C70 A;  1DQ2 A;  4CU9 A;  5LY1 A;  4YYO A;  1FMD 2;  1CWP A;  4KI5 M;  4XCA A;  3K75 B;  3EBR A;  2GND A;  2J1V A;  1G9D A;  4A6S A;  1Q5O A;  3SH3 A;  4FTE A;  2DBI A;  1HXS 2;  1VBC 1;  4HET A;  4XJ8 A;  3VDA A;  5A7W A;  3ZLI A;  2UY9 A;  5KXB A;  3D3A A;  4XXP A;  1RVF 1;  2E31 A;  3WW1 A;  4M4P A;  1PGW 1;  1GMM A;  2DDU A;  2W1U A;  3VBO A;  1RUE 2;  2LW8 A;  4AVS A;  2ZOE B;  5KHK A;  3OY8 A;  3G6J B;  2VEC A;  2WT1 A;  1JZ6 A;  1PVC 3;  2Q1M A;  2R6Q A;  1VMJ A;  4MV2 A;  2R32 A;  2BYV E;  1LAJ A;  3DPR A;  4NVP A;  2D93 A;  3LOI A;  2YC0 A;  2W91 A;  4XHX A;  4MOA A;  1RUC 2;  4Z07 A;  3BTX A;  3J7M A;  3ZR5 A;  1MEC 1;  1W99 A;  2VG9 A;  2XJQ A;  1YWK A;  3HJR A;  2QQU A;  1W3X A;  1Y7B A;  1Z7S 1;  2VMF A;  3AMM A;  3PVE A;  4EN7 B;  4Z8B A;  3QH6 A;  2V73 A;  4QGM A;  4GWN A;  3VBO B;  4AFC A;  4GQ7 A;  1QH7 A;  3JXS A;  3VV1 A;  4MXV A;  2WO2 A;  2PA7 A;  4CE8 A;  3CHX A;  4AVV A;  1W03 A;  2ZX4 A;  1PK6 C;  3M3C A;  3E5U A;  2I2S A;  2L9L A;  3ES4 A;  2CWM A;  1DGR N;  2VNO A;  5H9R A;  2FDG A;  4I3P A;  1OLQ A;  2ERF A;  3DPR B;  1H8T A;  4YG6 A;  5FZ8 A;  3BAL A;  5LRR A;  1UPI A;  1YO8 A;  5A33 A;  1AL0 G;  3U75 A;  4L11 A;  4P9W A;  4GD4 A;  1QOT A;  2RJL A;  4QPG C;  3WG3 A;  3TRS B;  5F2W A;  1HRI 1;  1QJU 1;  5KHJ A;  4XJA A;  2OUJ A;  2AZ5 A;  1QKQ A;  2XLG A;  2QQO A;  4ATE A;  3DXU A;  5EXO A;  5BY5 A;  2QTW B;  1C8M 3;  4KG0 A;  2VVE A;  5FCC A;  4KG8 A;  2O1Q A;  5FJK A;  2BTV C;  2PLV 2;  2HKX A;  4GUL A;  4EN0 A;  3AVS A;  1SFN A;  2G9F A;  4QKF A;  1H8T B;  1JXN A;  2VOK A;  1IQD C;  2R16 A;  4DY3 A;  5A33 B;  5C7G A;  3TEY A;  2I45 A;  1S2E A;  2XG3 A;  1R64 A;  1Q8P A;  5CVR A;  3KT4 A;  1N1V A;  1RMU 1;  3KCY A;  3KT1 A;  3POJ A;  4YZ4 A;  5FYH A;  2A7A A;  3H0O A;  5C5T A;  5IK5 A;  2VVF A;  3M3E A;  4R9B A;  1QJY 3;  3AYE A;  2A3W A;  3C7E A;  2ZS6 B;  1NA1 A;  4QKN A;  1Y9M A;  5APA A;  4A7Y A;  2WKK A;  1JZ8 A;  3B7M A;  5A6Y A;  2PHU A;  2ZZJ A;  1V6L A;  2XDV A;  1IHM A;  2V5Y A;  4MX3 A;  1Q3E A;  1CR7 A;  3VBH B;  5A7N A;  2F6B A;  5CEH A;  1VRH 2;  1OPM A;  3JBG 1;  4NAO A;  2VBB A;  1HRV 3;  3HNY M;  3IBM A;  2A3Y A;  2CAV A;  2W2I A;  1AL2 1;  4XUP A;  4NIG A;  1SLT A;  4ZXE A;  1VBA 2;  2JX9 A;  1RUH 3;  4HSL A;  1MR5 A;  3ZYH A;  5A6Z A;  5KHH A;  3MID A;  3NV4 A;  3NL1 A;  4QQ2 A;  1AVB A;  5DAP A;  5FZ7 A;  3OSD A;  3RVH A;  3B01 A;  4XUQ A;  4L97 A;  4AG4 A;  1W6P A;  5T55 A;  4AFB A;  2ETE A;  3BU7 A;  2J1U A;  4UOJ A;  4AED C;  1OXC A;  4ZPI A;  3ZXG A;  2E33 A;  3B9C A;  3FUQ A;  4OUS A;  4PQQ A;  5FYC A;  1BZW A;  1SBF A;  5IVB A;  2F4P A;  1LU2 A;  2Q1F A;  3ZXJ A;  2Z69 A;  4XF1 A;  4CUB A;  1S0E A;  2D5H A;  5FP8 A;  4QDR A;  4HMZ A;  3VKM A;  2KR2 A;  2WZR 3;  3P5B A;  4YVW A;  4OQ8 A;  1JYI A;  2DV9 A;  4DUX A;  1PZ7 A;  4MHR A;  4PT6 A;  4Q4Y 2;  1W6P B;  5T5L A;  3N7M A;  1GYK A;  3LFM A;  3CZJ A;  4U36 A;  2SBA A;  2D6N A;  1XYN A;  4J1W A;  1LHU A;  2W95 A;  4YVS C;  4FQ4 A;  4GA9 A;  3I2H A;  4L9B A;  3OPT A;  3M1H A;  1Z78 A;  4YVW B;  3ZPY A;  3W9A A;  2GH2 A;  4HN1 A;  1DYO A;  1OKQ A;  3AZY A;  1AXK A;  3NO8 A;  1UD1 A;  3M4F A;  1MEC 2;  3OCP A;  2X53 S;  2RS5 3;  3TEX A;  5FYS A;  4AHZ A;  1SBE A;  1EAH 1;  1QU0 A;  3POI A;  5IAT A;  3L2Y A;  4CCJ A;  1AYM 3;  4TLF A;  3UGG A;  3ZPO A;  1PVC 1;  5JSP A;  2BWA A;  4Y24 A;  3WP6 A;  3LDK A;  4J1X A;  2DVF A;  3CNA A;  2HWF 3;  3MLK A;  4IES A;  3ZN6 A;  1JTZ X;  1TVG A;  1PGS A;  4ARX A;  3U37 A;  5IW0 A;  1B35 C;  5C8W A;  2C9K A;  3KLS A;  3BIE A;  5J3U A;  4HG6 B;  1HRI 2;  1QJU 2;  1XNA A;  2VUL A;  4ATF A;  1GV9 A;  1WMD A;  4PBO A;  4IV3 C;  1KFX L;  1TQ5 A;  4DXR A;  3KVA A;  3AYA A;  3AJY A;  4EN8 B;  3UK9 A;  5FXW A;  5I8S A;  1XYP A;  4BQ2 A;  5CFC C;  1UKG A;  2YC2 A;  4P9I A;  3W20 A;  1WW7 A;  3NQH A;  2TEP A;  2UYB A;  3OUI A;  5FYU A;  3J4U H;  1PO2 3;  3OYW A;  1XXN A;  1YHF A;  2FCT A;  2D98 A;  5JXJ A;  3VBF C;  4XMI A;  4XZP A;  4IDZ A;  1YQ5 A;  4LA2 A;  4X8N A;  1LRH A;  3I4I A;  1RMU 2;  3D82 A;  1DGR A;  2UYA A;  3C2U A;  4AR2 A;  1ZZ6 A;  4FVV A;  5J1X A;  1LCL A;  3AP4 A;  4NIA A;  4RD7 A;  5C9A A;  2R04 2;  1PHM A;  1UMH A;  1EPW A;  1JOB A;  3ZYP A;  1C8M 1;  1UOB A;  4H7M A;  1GLH A;  4CXY A;  3KHC A;  4ZU7 A;  3VDD C;  4FXK B;  4Z82 A;  1G9F A;  4QAW A;  1JOJ A;  3NKT A;  2DFB A;  5JXH A;  3GNE A;  1LGC A;  3I54 A;  2FBE A;  1OD3 A;  2QFE A;  3OYW B;  2VCM A;  1CAU A;  1O7F A;  4YM1 A;  4K8F A;  3JBG 2;  2YBK A;  4Y1X A;  5G04 L;  1WW4 A;  1VB4 A;  2H6C A;  3AKS A;  1JZ5 A;  2ZHN A;  4GJZ A;  1JYW A;  1AR6 1;  5C9A B;  1AUY A;  1PVX A;  1WUV A;  1YFU A;  4B4R A;  5BNN C;  1H2L A;  4AHW A;  3MIE A;  1O5U A;  4LUK A;  4QT6 A;  3O0W A;  1NLR A;  2WA4 A;  3GCW A;  4Q0P A;  5BNO A;  1X9P A;  4MVT A;  1FXZ A;  1NYW A;  2A6X A;  4CXX A;  5KR7 A;  2RDQ A;  4QQL A;  4ZHN A;  3S57 A;  5FR3 A;  1Y3T A;  4HZF A;  4W6Y A;  4ZZ8 A;  3WDU A;  1HRV 1;  4Q4X 2;  3IDC B;  2X05 A;  2X10 A;  4EQV A;  5FPL A;  1H30 A;  2VOT A;  4PI0 A;  4EZH A;  1YFW A;  1RC6 A;  3MUY 1;  4V1P A;  2A70 A;  4IW3 A;  3B02 A;  3I2F A;  2HWD 1;  4Q0Q A;  4TLG A;  4FPC A;  4XDP A;  4XE9 A;  2R07 3;  1W9Y A;  5GJ6 A;  3ZYB A;  2HBT A;  2FMY A;  3PIJ A;  2WN3 A;  3AFG A;  1W8O A;  3OBR A;  4XF0 A;  3T2T A;  3ZFF A;  3ZYR A;  4CU6 A;  2A3X A;  4P5H A;  4K40 A;  1J3Q A;  1SDW A;  2GP5 A;  5FZ6 A;  1LEM A;  1XU2 A;  3H9A A;  3TN9 3;  1W2T A;  2ZKN A;  2VZV A;  1PZ9 A;  1GIC A;  4PF1 A;  1N1S A;  3WQ1 A;  2WZR 1;  2CGP A;  4KGQ A;  2VGD A;  2ZGR A;  1UCX A;  3VKO A;  4YZ5 A;  3N36 A;  2FDF A;  1IG3 A;  2WQZ C;  4FPF A;  4LOR A;  2RDN A;  1AR9 3;  3A21 A;  5K9Y A;  4MGQ A;  3BVC A;  3ZFF B;  5F5I A;  1F5J A;  4A41 A;  5DAV A;  1W8T A;  1UX6 A;  1MS8 A;  3CO2 A;  5FTT C;  2NZ9 A;  4Q2F A;  5FP9 A;  4AQ6 A;  1XQN A;  5BNP C;  2D3P A;  3ETQ A;  1S0C A;  1HLC A;  2EXK A;  1ULC A;  4NRO A;  3WDY A;  1WCU A;  3N9N A;  2PHT A;  1JUH A;  2ZXQ A;  3I59 A;  1PVC 2;  1XE7 A;  1FI2 A;  3N7L A;  5J7M A;  1POV 3;  2BGO A;  1EUU A;  1UYY A;  4JHZ A;  4OMC A;  4COW A;  4DXZ A;  3TWI A;  4K1Z A;  5IVV A;  2DCJ A;  5JXI A;  3HQR A;  4CU8 A;  3R4U A;  1ZM1 A;  3VD3 A;  1XBF A;  2V5D A;  4MSV A;  4QQP A;  3GXU A;  1JU4 A;  1W6M B;  2PMW B;  4BIO A;  3AKT A;  3OPZ A;  3POS A;  3MPP G;  1AYM 1;  3M8L A;  1KS5 A;  2WO3 A;  3I59 B;  2DVA A;  1NT0 A;  2OKX A;  3O1M A;  2QDR A;  2G19 A;  2JJ6 A;  4QKD A;  1TNR A;  2W08 A;  2WBK A;  2ZCW A;  1XND A;  4XBQ A;  5IVJ A;  4QPI C;  2CDP A;  1SHW B;  1KGY A;  2RMU 3;  4EN6 B;  4TN7 A;  1O5L A;  4FOQ A;  4B4P A;  4LBJ A;  2EF6 A;  1NCR C;  4DXT A;  2R30 A;  3E6C C;  2PYT A;  4YPJ A;  3JZV A;  3THD A;  2GP3 A;  3AZZ A;  1UY4 A;  4YW3 A;  1C8M 2;  4DMI A;  4A42 A;  4HOO A;  2P17 A;  4IQP A;  5JR2 A;  2HWE 3;  3HT1 A;  4IEQ A;  2VCB A;  1UOG A;  2UUR A;  1YYN A;  4IV1 B;  3SHR A;  4GXL A;  2JD9 A;  4HXC A;  2JDK A;  2ORZ A;  3LPG A;  3PLQ A;  2LRP A;  1OQD A;  2V09 A;  2OYZ A;  1F2N A;  3APB A;  4P5Y A;  5F3E A;  2NLR A;  3K4D A;  4N43 B;  5EFU A;  2BRT A;  1TME 3;  2VCC A;  3A22 A;  3RJR A;  1QJY 2;  5C33 A;  1F4H A;  2NQY A;  4UYB A;  1LES A;  5GM0 A;  1QH6 A;  2QCS B;  2WT0 A;  1U12 A;  3CEW A;  1S0G A;  3AMQ A;  3N9O A;  4Q4W 1;  5FMO S;  2ARE A;  1R1A 3;  1G6N A;  4DFS A;  3QLQ A;  3VBO C;  4AAX A;  2F17 A;  4WVW A;  1XSR A;  1LED A;  4TXW A;  1UN1 A;  1MS0 A;  3HNB M;  4IL7 A;  3WIN E;  2BWC A;  1QY4 A;  3AMH A;  3LPF A;  5FY9 A;  1HRV 2;  3VD4 A;  1W6N B;  4N9I A;  2YG0 A;  2B9V A;  3R0R A;  1O3S A;  1YFX A;  4QPW A;  3DPR C;  2RJ2 A;  3OG2 A;  2VME A;  3GBW A;  4GWM A;  1RUH 2;  4LMF A;  1F35 A;  3WOG A;  4YGC A;  3J8F 3;  2GNM A;  4HL0 A;  3HN1 A;  1JH5 A;  3W58 A;  5IHR A;  3AB0 A;  1PO1 3;  3WP3 A;  2Y8K A;  2PAE A;  4O65 A;  5C4W C;  2RV9 A;  2XJS A;  3NNL A;  4O61 A;  4AL9 A;  3ACH A;  5BPX A;  3VHO A;  2JDN A;  1RUN A;  1G86 A;  3N3H A;  3A4U A;  1XE0 A;  1A78 A;  5FK7 A;  3POY A;  1H8T C;  3I2O A;  4MH0 E;  1ZRE A;  5A3U A;  2WZR 2;  3M7A A;  4UFL A;  5LK5 A;  3VDC A;  4IGP A;  3WDW A;  4S2D A;  1LTE A;  4CUA A;  2R07 1;  5I93 A;  3VL9 A;  2BBA A;  1ND2 C;  3WCR A;  2ZTN A;  3PL0 A;  1QWR A;  3FMG A;  3JU9 A;  4DB5 A;  2E63 A;  5JI9 A;  4M01 A;  1O3T A;  1UMI A;  4XUN A;  5F2S A;  2C24 A;  2W1Q A;  2WAA A;  1GNY A;  4RR3 A;  4C90 A;  1WMX A;  1G9C A;  2VR4 A;  3UKV A;  2BER A;  3GBF A;  1GU3 A;  1C8N A;  1KFU L;  4X6R B;  1XNC A;  2H6B A;  2Q0A A;  2IXC A;  2NPI A;  3K3N A;  2BGC A;  1J59 A;  4UW4 A;  3V56 A;  3J26 N;  1FPN 1;  3VBH C;  5LEK A;  5CKM A;  4N90 A;  1BVP 1;  2O8Q A;  3GM8 A;  2RJK A;  3RI9 A;  1KEX A;  2A6Z A;  1PNG A;  5BNQ A;  4WM7 A;  3I3D A;  2RS5 2;  5B2G B;  3I7D A;  3SCG A;  4KWJ A;  1NAE A;  2DUQ A;  2KA3 A;  4RR3 B;  5FP3 A;  1LUL A;  3HIF A;  5HCF A;  3SH4 A;  1AYM 2;  1QQP 3;  4OUM A;  4AVC A;  1POQ A;  2ZX1 A;  2DWR A;  3I97 A;  4BLI A;  1BK1 A;  1POV 1;  1Q8O A;  2VM9 A;  2VTX J;  2FDH A;  3AYD A;  1RHI 1;  2R0F A;  3RQ0 A;  2XXZ A;  3I2K A;  1DLL A;  2D97 A;  3LFI A;  1JOD A;  1W9W A;  1S0F A;  2BFU L;  1CAW B;  3ELN A;  3D0S A;  4E27 A;  4WM7 B;  4NOT A;  4LKD A;  2VL4 A;  3GYD A;  3SH5 A;  5DG1 A;  1WGP A;  5JUV A;  1GOH A;  5TSW A;  2ZX0 A;  3AZV A;  3W5M A;  2DTY A;  5F9T A;  4I30 A;  2K0G A;  1LB2 A;  4KL1 A;  1AXZ A;  4KGG A;  4IER A;  4LQR A;  4Q8L A;  1BBT 3;  2G4I A;  4OCT A;  2GMM A;  3AK0 A;  1LOC A;  4M4R A;  5A7S A;  5JOW A;  2HWB 3;  1XE8 A;  1D4V B;  3JUU A;  3ECQ A;  4LBQ D;  5A3P A;  2RMU 1;  3K3O A;  1PO2 2;  3B5L B;  2YMZ A;  2BJS A;  2Y60 A;  3IDE A;  3D4K A;  2Q8O A;  2VMI A;  2RDS A;  1IS3 A;  1VR3 A;  4YVW C;  3RZK A;  4XFF A;  4UFM A;  4BB3 A;  4K3U A;  5FOJ B;  1NCQ A;  1S0J A;  5JDB A;  3Q8A A;  2C0Z A;  4AOC A;  4LE3 A;  2J1S A;  3KQR A;  1FV3 A;  3KD4 A;  3IPV A;  5FRE A;  3POW A;  5FOB B;  1Y9G A;  1MZ5 A;  4H3W A;  5AC9 1;  1VBE 3;  1NZC A;  2Y6L A;  3OOX A;  5FKC A;  5GZC A;  4FT8 A;  2FCV A;  5T5P A;  1TME 1;  3NNJ A;  2ARC A;  4ET7 A;  1NY7 1;  4QX1 A;  4E9K A;  4ISQ A;  3S0M A;  1KD7 A;  5I8Y A;  3PMS A;  4AEM A;  4A7K A;  1F4A A;  1NCQ B;  4UFH A;  1D2Q A;  1ENR A;  2ZGN A;  3AXE A;  4PDW A;  4AFM A;  5IAX A;  3EMR A;  1PZ8 A;  3VD5 A;  1WWY A;  4GAZ A;  3IPV B;  1Q56 A;  4LBM A;  5KC5 A;  3AL5 A;  1WCS A;  5JOX A;  5E16 A;  4XW3 A;  3WG1 A;  1MZF A;  5AVA A;  4BH9 A;  3S6P A;  1OLM A;  1ENS A;  3E6D A;  2WAB A;  3LSE A;  1DHK B;  4BXS V;  2YU1 A;  5E8A A;  3MIH A;  2XJT A;  1YNA A;  5F39 A;  1QXJ A;  2J1T A;  4P9J A;  1VP6 A;  1JMU B;  2XVK A;  3J8F 1;  3HBK A;  3LE0 A;  4PDW B;  4JX0 A;  4XF3 A;  4CXW A;  1KXG A;  2R07 2;  3AP6 A;  5B4N A;  1A8D A;  3SQO A;  4DEQ A;  5AFE A;  1PO1 1;  2LRO A;  4CDW A;  5I0D A;  1W8Z A;  4DIQ A;  2VBD A;  3GZT B;  3ZSK A;  2MEV 3;  3TN9 2;  2R7E B;  3JCI A;  3PUS A;  3WSO A;  1GQG A;  4AI0 A;  1MZ6 A;  1HB4 A;  2XWB B;  4Q0V A;  3GAL A;  4HK9 A;  2OS2 A;  2WNE A;  3ENR A;  2WFF 1;  1ND3 A;  4JTO A;  1V6N A;  4K6B A;  3WG2 A;  2IXL A;  4OUE A;  1AR9 2;  5FZ0 A;  2PQS A;  5CU1 A;  3TBD A;  2PHD A;  1FOD 3;  2GC0 A;  3O0V A;  2RR1 3;  4F3J A;  2VOW A;  4Z2W A;  3EO6 A;  3IDB B;  4CCL A;  4DIN B;  4CA9 A;  2E7A A;  5D1I A;  3ZFG A;  5I91 A;  1SFP A;  5F37 A;  4A4A A;  5C3R A;  3I2D A;  2YBS A;  5HXV A;  1GKB A;  2D6K A;  2D6M A;  3OGV A;  2WYF A;  1JUI A;  4FOV A;  5FMC A;  1ND3 B;  2XBO 3;  1OHF A;  1ASJ 3;  4YW1 A;  3C7O A;  3VBU A;  1LU1 A;  4LBK A;  2XUM A;  3ZN5 A;  3PUA A;  4BCU A;  2X29 A;  1U0A A;  3T0B A;  4EWA A;  3LSD A;  4IE5 A;  3BOP A;  3VZL A;  4EJR A;  4ZZ5 A;  2JD4 A;  1MPX A;  2Z5W A;  3U4S A;  5C3Q A;  1MS5 A;  5DZE A;  3RRD A;  1SLI A;  3NJZ A;  1IPK A;  4RQP A;  2ZMN A;  1JU3 A;  4PLM A;  4BIF A;  1O8P A;  5BNO C;  1WD4 A;  3DN7 A;  4RFR B;  1NE4 A;  2ZGM A;  5FDB A;  2WNV A;  2JG9 C;  3MV1 1;  2D5F A;  3VBU B;  2RMU 2;  1D2S A;  5FJH A;  3E97 A;  1ZBA 3;  2VUA A;  3T09 A;  3ABZ A;  1YI7 A;  1F5F A;  2FHR A;  3K4A A;  4L0P A;  5HV0 A;  5M0T A;  2C9A A;  3K48 A;  3GBG A;  5F5Q A;  2XPJ A;  2ZEW A;  4OHY A;  1VRH 1;  4NRM A;  4OHW A;  3QD6 A;  4HLT A;  2V72 A;  2WO1 A;  1A34 A;  4FSJ A;  2HWE 2;  3KS7 A;  1QEX A;  4COY A;  1US3 A;  2HWB 1;  4ZON A;  1RTV A;  2WNV B;  3FHA A;  3N9L A;  5GLZ A;  3WHT A;  4ONU A;  1OC1 A;  4A45 A;  2G9G A;  2XON A;  4D0Q A;  1C3H A;  4K8R B;  2W92 A;  5BNO B;  4HT1 T;  1W0N A;  4FPK A;  3V0A B;  5CAD A;  1TME 2;  2DUO A;  3VZJ A;  1BK0 A;  1HV0 A;  1NY7 2;  1ZRR A;  2WJS A;  3NAP B;  4IEZ A;  4DUW A;  2AC1 A;  1CAV A;  5FZG A;  2Q4S A;  4Z92 B;  2BW8 A;  2JDU A;  3B00 A;  4LO8 A;  5G05 L;  4OYU A;  2A6V A;  2EXJ A;  1R1A 2;  1T6G C;  4LBQ A;  5DZG A;  3FLT A;  4AHX A;  3K46 A;  3AMP A;  1OH4 A;  2GAU A;  1PIV 3;  5JLV A;  5AVP A;  1ZRF A;  2J22 A;  2C1F A;  5FY0 A;  3NVC A;  1CPN A;  4Q4Y 1;  5T5J A;  2DCY A;  5KC6 A;  1ZA4 A;  3LEK A;  2JE7 A;  3CJI B;  4BU2 A;  3EHK A;  4D6R A;  1CAV B;  5DUV A;  5IVC A;  1A8M A;  1E5S A;  4CUG A;  1WME A;  1PM4 A;  3J8F 2;  3MZH A;  5FY1 A;  2VW2 A;  3DYO A;  4LBQ B;  4R9A A;  1HN0 A;  2AEZ A;  1UW8 A;  2OZJ A;  2LAL A;  1PO1 2;  2RS3 3;  4AFD A;  4YZ2 A;  5FBZ A;  4BQ4 A;  1JS9 A;  2FZ1 A;  1LR5 A;  1VMF A;  4IE7 A;  2LM3 A;  5HV4 A;  1HQL A;  3IMN A;  4PLN A;  5A7W B;  4IV1 C;  1C5H A;  2LUW A;  4DUV A;  1SLB A;  2WFF 2;  2J1E A;  3RNS A;  4RFT 0;  1TMF 3;  2WRA A;  1SBD A;  3SIS A;  4ISR A;  1LOF A;  1CVN A;  5A3M A;  2XB6 C;  1JZ3 A;  4QHZ A;  3G7D A;  2YDE A;  1IS5 A;  2A6W A;  2WLQ A;  1VAV A;  3K4Z A;  3OY8 B;  4N43 C;  4AI3 A;  2MEV 1;  4RGG A;  4IE6 A;  4LO5 B;  5HXM A;  3I3Q A;  3JB8 A;  1W6O A;  4ZS3 A;  2Y64 A;  2UWC A;  1OVP A;  1RIN A;  3J7N A;  1X36 A;  3RMY A;  1N1Y A;  1SLL A;  3N9P A;  4IEU A;  4QQO A;  2W94 A;  5IAV A;  3KCX A;  3SKJ E;  3ZYI B;  2ID4 A;  2O14 A;  2HJI A;  2R1B A;  3UET A;  2GC2 A;  2P2K A;  3FL7 A;  5HI0 A;  3PUQ A;  3ZKY A;  4F8A A;  2RR1 1;  4CP0 A;  1O59 A;  1W8U A;  3H8U A;  2GZW A;  2BNM A;  4NRP A;  1YC6 1;  2ZJC A;  1XU1 A;  2CSG A;  2AYH A;  1R08 3;  3LAG A;  5FO7 B;  4BWO A;  5FY4 A;  1O4T A;  1UIK A;  1SCS A;  2E9Q A;  1QQP 2;  4FPJ A;  3FX3 A;  2XBO 1;  5EQU A;  2BV4 A;  4XIO A;  3NST A;  2EID A;  1ASJ 1;  5FZK A;  3VBR A;  5FZD A;  2R04 1;  4RYD A;  2UU8 A;  2BQP A;  4JCK A;  2JE9 A;  2R06 1;  4LOS A;  3RS6 A;  4ES8 A;  2A73 B;  1DQ1 A;  2WNO A;  5L7O C;  4HN0 A;  3O1O A;  2RDR A;  4MGY E;  1AXY A;  4NPL A;  2FDK A;  1DYP A;  2IWG B;  2ADE A;  1H9W A;  4P14 A;  1YJL A;  1LOG A;  4QXH A;  2TBV A;  3Q8E A;  2ZGL A;  4FI9 A;  2WIN B;  2P1B A;  1BVV A;  4QQH A;  4AVA A;  1OVS A;  3VBR B;  5C6C A;  1DZT A;  2HWB 2;  1QNW A;  3LKJ A;  5FV3 A;  1QJX 3;  1NA1 B;  1N47 A;  4XJZ A;  3MDP A;  1ZBA 1;  2P6C A;  4WVV A;  5FYT A;  3WNP A;  4B1L A;  1IKP A;  5FRA A;  1ULO A;  1AX0 A;  2P34 A;  2Y33 A;  3MF6 A;  4FPE A;  4P08 A;  1SQ4 A;  5JZG C;  3ZDS A;  1MVE A;  3NV1 A;  3ZFE A;  2JKB A;  2ZKL A;  3BGA A;  5KHI A;  1RUI 3;  1WD3 A;  4Q4X 1;  1YQ8 A;  4B29 A;  3IAQ A;  3RYR A;  3ROU A;  3WXP A;  1UU4 A;  1V70 A;  2AEY A;  3BPZ A;  3CLP A;  4RR3 C;  4AEK A;  1U5X A;  1M4W A;  2ZEX A;  1IPS A;  3MHZ A;  1VBE 2;  1LNS A;  1WW5 A;  4MG2 A;  4ERO A;  1UU6 A;  3O1S A;  1XRU A;  3ZYG A;  2ZML A;  3H1W A;  5J37 A;  3AVR A;  3I2G A;  1APN A;  1N3O A;  1OOP A;  5FP7 A;  1UIJ A;  4GH4 C;  4NPM A;  3ZFE B;  4J6G A;  1MZE A;  1AJK A;  3DF0 A;  1W6Q A;  2JKX A;  4WM7 C;  1UYX A;  1CGP A;  1SFY A;  3OEB A;  3X29 B;  5A32 A;  4BA6 A;  3BTY A;  2JG8 A;  3U07 A;  5E6H A;  4XMA A;  2ZGS A;  4SLI A;  4I2O A;  1PIV 1;  1LOA A;  2QVS B;  4XJ9 A;  2EAL A;  2VU9 A;  3DGT A;  4XUT A;  5FKB A;  1E5I A;  1SPP A;  4YW7 A;  4BQX A;  1QXP A;  2KXL A;  3HAG A;  2GN7 A;  1X33 A;  3U4X A;  1OOP B;  3RFR A;  2O8O A;  5HCA A;  2DTW A;  5FZI A;  5I0T A;  5A3W A;  3VLB B;  4DS0 A;  4BME A;  1UU5 A;  1UPS A;  3URF A;  4B7E A;  1W6Q B;  4Q0S A;  3NJV A;  2ENR A;  2B46 X;  2RS3 1;  2YRO A;  4AQT A;  2JG8 B;  2W46 A;  2IXH A;  1E5H A;  2MEV 2;  1W2A X;  2ZX3 A;  1SPP B;  1GZT A;  3MW2 A;  2YGL A;  2HEY F;  4YLZ A;  3GDB A;  5FAX A;  1QXR A;  4FBF A;  3P3P A;  3T1M A;  5FQ0 A;  2VNG A;  1SEF A;  4Y20 A;  3ACF A;  1FT9 A;  2XQR A;  3OGR A;  3QOP A;  5LY2 A;  2VMD A;  2NMN A;  3EJK A;  2GC3 A;  1TMF 1;  3ZXD A;  2AEN A;  4PIX A;  2FQP A;  2WC2 A;  3C7G A;  4NID A;  5EJZ B;  5HPO A;  1FOD 2;  2JWP A;  3KV6 A;  2HH9 A;  3MLL A;  1BHG A;  2RR1 2;  4HFS A;  4WBB A;  2OT7 A;  3I3B A;  4XBL A;  2RVA A;  3KGZ A;  4JRL A;  4ASM B;  4I09 A;  1OMI A;  1AJO A;  1PMJ X;  1X82 A;  4DNY A;  1RIR A;  3ZN6 B;  2VMH A;  5LBE A;  1NCQ C;  2ZHL A;  3ZXA C;  2ZHM A;  4IEX A;  1GR3 A;  1G8W A;  4FO9 A;  3HPN A;  5FQ0 B;  5C8C C;  4GB3 3;  5GLV A;  5T3N A;  4IET A;  4A3X A;  2JDM A;  2XBO 2;  2XJV A;  3MIG A;  3HQX A;  4PCR A;  3MBW A;  4B4Q A;  1ASJ 2;  3PJQ A;  3LA3 A;  2Y0O A;  4O7X A;  4LNV A;  3PTR B;  4JQR A;  5FZ3 A;  5LEJ A;  1LOE A;  2MNG A;  1GZW A;  2GDF A;  2R06 2;  2VUD A;  1TZO A;  4I0B A;  3ZMN A;  1UY0 A;  5IVY A;  4CDQ A;  4S2F A;  1R08 1;  2HLE A;  1F31 A;  5DQ0 A;  1OQE A;  2CDO A;  2W0X A;  4AHY A;  5ANQ A;  4HVQ A;  1IOA A;  2HYK A;  2VQ0 A;  3AL6 A;  4BQY A;  5CFD A;  4JGZ A;  2LTN A;  4IND A;  1H2K A;  2E6V A;  2WZ8 A;  3RMX A;  1F9K A;  1OT5 A;  1COV 3;  2VY0 A;  4E2S A;  1QJY 1;  4LHS A;  1D0H A;  2V4V A;  1H0B A;  2JE8 A;  3M70 A;  2D3R A;  1GP4 A;  4OHV A;  1SMV A;  3N9M A;  3ILN A;  3P3N A;  4IE4 A;  1GZW B;  1N3P A;  1QHD A;  1ZBA 2;  1DGL A;  3WUD A;  5CG8 A;  2Z2S B;  2WFP A;  5LB6 A;  1K42 A;  1BYH A;  1DQ4 A;  2VBP A;  4JQT A;  1OPO A;  3O5S A;  5ERL A;  2XVG A;  2BUK A;  4CEW A;  4RA0 A;  1HQW A;  3S7I A;  5CFD B;  4JGZ B;  1CAU B;  2BNO A;  5LA0 A;  3BYW A;  1GNH A;  2XHN A;  4NWV A;  4X8P A;  3H8X A;  1OKO A;  1RUH 1;  3LIG A;  3O7O A;  4LK7 A;  4LKS A;  3ZXE A; 
#chains in the Genus database with same CATH homology
 1UMI A;  1NX9 A;  4XUN A;  2W1Q A;  2WAA A;  1GNY A;  2BGP A;  2VCA A;  2VR4 A;  3MV0 1;  2BER A;  2WAO A;  1GU3 A;  4D8M A;  1JZ2 A;  4RN5 A;  5A1A A;  5CYY A;  1OF4 A;  1UZ0 A;  3ETP A;  3GM8 A;  1PX4 A;  1KEX A;  1JYV A;  1O8S A;  1XPW A;  2BZD A;  3ACG A;  3LEG A;  3I3D A;  3FHQ A;  2EIC A;  3UNP A;  1NAE A;  2QQK A;  5B4X A;  3OB8 A;  2VO5 A;  2VTF A;  1GUI A;  1ULP A;  1XC6 A;  4XVH A;  5LCW L;  3I97 A;  3III A;  3WNM A;  2VZS A;  2VM9 A;  3I2K A;  3F2Z A;  3IB3 A;  1W9W A;  3CIH A;  3PUI A;  3WF0 A;  4MO3 M;  1GOG A;  4XZU G;  2VL4 A;  1UY3 A;  5JUV A;  1GOH A;  3ZM8 A;  3W5M A;  4DEV A;  1W9S A;  4LQR A;  1NKG A;  2VZP A;  1UY1 A;  5F7U A;  2EIB A;  4JKK A;  2VZO A;  3P6B A;  4M4R A;  3ECQ A;  3J7H A;  3EYP A;  1JI6 A;  3T0A A;  3WEZ A;  3DYP A;  5IFP A;  3CDZ B;  3T08 A;  2VZ3 A;  4CVU A;  4DUV A;  5C70 A;  4QDQ A;  3A23 A;  2E26 A;  4CU9 A;  2VZ1 A;  4KI5 M;  3K75 B;  2J1V A;  2J1S A;  4QDS A;  1GQP A;  3P1I A;  3T2O A;  3VDA A;  2Y6L A;  3D3A A;  2E31 A;  2QQI A;  4M4P A;  2DDU A;  1GMM A;  4QB1 A;  2VZR A;  2W1U A;  2ZEY A;  2LW8 A;  4MGS A;  4A6O A;  4QX1 A;  1UX7 A;  1F4A A;  2VQT A;  3WQB A;  1JZ6 A;  3VD5 A;  1PX3 A;  3MUZ 1;  3WNK A;  2W91 A;  4MOA A;  4ARY A;  1W99 A;  3HJR A;  4QPW A;  5JMO A;  4ET7 A;  2VMF A;  4ZY9 A;  2WAB A;  3VD9 A;  4BXS V;  2Y6J A;  3JXS A;  2WO2 A;  3IAP A;  2QQJ A;  2J1T A;  3LE0 A;  5B4N A;  2L9L A;  4JX0 A;  3CKH A;  4DEQ A;  5I0D A;  1JZ4 A;  5EIY B;  2Y6G A;  1UXX X;  2R7E B;  3WSO A;  2LS6 A;  2WYS A;  2W1S A;  2YB7 A;  4UAP A;  2QQO A;  1L7R A;  4QX0 A;  4OUE A;  4GWJ A;  2PQS A;  4Z2A A;  3GGL A;  3HOB A;  1IQD C;  5C7G A;  1R64 A;  1H6Y A;  4A4A A;  3WNN A;  3EB7 A;  3OGV A;  2WDB A;  3C7E A;  3C7H A;  4MAD A;  3C7O A;  1JZ8 A;  4XUR A;  3UES A;  2VZT A;  4KMQ A;  2J7M A;  3T0B A;  4GZ9 A;  5FUI A;  4ZZ5 A;  1MPX A;  1CZT A;  2WZE A;  3HNY M;  1JU3 A;  1O8P A;  4XUP A;  4ZXE A;  2JDA A;  3MV1 1;  4XUQ A;  4AG4 A;  3I2I A;  4W8J A;  2J1U A;  4UOJ A;  3T09 A;  3CZU A;  3ABZ A;  2W3J A;  4L0P A;  3K4A A;  2E33 A;  4PQQ A;  1UWW A;  2ZEW A;  3HEI A;  1XNT A;  4CUB A;  2V72 A;  1EUT A;  2WO1 A;  2ZEZ A;  4QDR A;  2B4K A;  4CUC A;  1US3 A;  1JYX A;  3FHA A;  4P02 B;  4A45 A;  2XON A;  4D0Q A;  2YC4 A;  4DUX A;  4JKL A;  2W92 A;  4PT6 A;  2Y6K A;  3THC A;  1W0N A;  2XOM A;  3IDA A;  3CZJ A;  3OEA A;  1H6X A;  2C26 A;  3WNL A;  4KWU A;  3DYM A;  1PMH X;  2W95 A;  4QB2 A;  4DUW A;  1HN1 A;  2W5F A;  1SDD B;  1JZ7 A;  3I2H A;  5G05 L;  4OYU A;  1SG3 A;  1DYO A;  1W9T A;  3K46 A;  1OH4 A;  4UI9 L;  2DCK A;  2J22 A;  3BN6 A;  4IUG A;  2EIE A;  4TTG A;  3LEK A;  1US2 A;  4XUO A;  3NNG A;  3DYO A;  2W87 A;  1P8J A;  1TVG A;  4W4Z A;  4ARX A;  3U37 A;  5CZK A;  2C9K A;  2Z4F A;  4HG6 B;  2QBX A;  1XNA A;  1CX1 A;  4P00 B;  4DXR A;  3CMG A;  3WF4 A;  2J1E A;  2J1R A;  1JZ3 A;  3E1F 1;  2YC2 A;  3K4Z A;  3NQH A;  3ACI A;  5HXM A;  2QQN A;  2Y64 A;  5JXJ A;  5J1X A;  3VD7 A;  2W94 A;  2W47 A;  1UMH A;  2Y6H A;  3SKJ E;  2J1A A;  1K3I A;  3OBA A;  3C8X A;  2ID4 A;  3UET A;  3FL7 A;  4QAW A;  5JXH A;  1O59 A;  2E32 A;  2ORX A;  3WF3 A;  1OD3 A;  3LQC A;  3HNM A;  5G04 L;  1JZ5 A;  1L7Q A;  3T2Q A;  4QX3 A;  1JYW A;  4E8C A;  2W1W A;  1K12 A;  1UYZ A;  2EID A;  2VZQ A;  2VJX A;  4RYD A;  1WCQ A;  1GOF A;  4OMD A;  4ZZ8 A;  2X05 A;  2X10 A;  2VOT A;  4FI9 A;  2VC9 A;  2WN2 A;  3MUY 1;  1CZV A;  3I2F A;  5DMY A;  2WN3 A;  1W8O A;  1NUK A;  4CU6 A;  5C71 A;  3WNP A;  3K77 A;  1ULO A;  1D7P M;  2C4X A;  2VZU A;  4P08 A;  2VZV A;  5EJ1 B;  3BGA A;  1J84 A;  4PF1 A;  1CZS A;  3IAQ A;  3SKV A;  3SEP A;  2HYX A;  3A21 A;  2ZEX A;  4MGQ A;  4GWI A;  1LNS A;  4A41 A;  4A44 A;  3A7Q A;  3I2G A;  2YFZ A;  4A3Z A;  2ZXQ A;  1RYY A;  3HN3 A;  2QQM A;  3MO4 A;  2JKX A;  1UYX A;  4BK4 A;  3WF2 A;  3OEB A;  2BGO A;  1EUU A;  1UYY A;  4JHZ A;  4OMC A;  4QB6 A;  3DEC A;  2DCJ A;  5JXI A;  3T0D A;  2VMC A;  4XUT A;  5LA2 A;  4CU8 A;  3VD3 A;  2V5D A;  3GXU A;  1JU4 A;  2X09 A;  3PUH A;  2WO3 A;  1K45 A;  2OKX A;  1J83 A;  3NJV A;  1OF3 A;  2WBK A;  4JKM A;  2W46 A;  2CDP A;  1SHW B;  1KGY A;  3GDB A;  3C7F A;  4DXT A;  4E8D A;  1DP0 A;  2QQL A;  4YPJ A;  4BK5 A;  3WF1 A;  3ACF A;  3OGR A;  3THD A;  2VMD A;  1UY4 A;  1UY2 A;  3T2P A;  4A42 A;  3C7G A;  3NRU A;  5EJZ B;  5HPO A;  5JR2 A;  1BHG A;  2VCB A;  5DN2 A;  1W8N A;  3I3B A;  2RVA A;  2JD9 A;  5IFT A;  3W5N A;  1PMJ X;  3LPG A;  2ORZ A;  1DLC A;  4P5Y A;  3K4D A;  3HPN A;  3A22 A;  2VCC A;  1F4H A;  3CQO A;  1UXZ A;  5IYY A;  4W50 A;  3MBW A;  1T2X A;  4BJ0 A;  5JXG A;  4OZO A;  5IJR A;  4AAX A;  1TG7 A;  4TXW A;  1UY0 A;  4DXS A;  3HNB M;  2HLE A;  2WQ8 A;  4LPL A;  5DQ0 A;  3LPF A;  2CDO A;  3VD4 A;  2YG0 A;  2B9V A;  3WNO A;  2RJ2 A;  3OG2 A;  2VME A;  4BDV B;  2WZ8 A;  3I2J A;  1OT5 A;  4LHS A;  2V4V A;  2JE8 A;  1WKY A;  5IHR A;  3NJX A;  5LA1 A;  2Y8K A;  1K42 A;  2RV9 A;  3FN9 A;  4CU7 A;  3VDB A;  2WUH A;  3ACH A;  3I3E A;  3OGS A;  5DPN A;  2VQU A;  2W9X A;  2KD7 A;  1JYN A;  2XQX A;  5LA0 A;  1CIY A;  3VDC A;  1YQ2 A;  2XHN A;  3LEI A;  4CUA A;  3SEE A;  1JHJ A;  1I5P A;  2BBA A;  3AC0 A;  4QX2 A;  4LKS A;  2YFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...