1PMIA

Candida albicans phosphomannose isomerase
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
440
structure length
440
Chain Sequence
SSEKLFRIQCGYQNYDWGKIGSSSAVAQFVHNSDPSITIDETKPYAELWMGTHPSVPSKAIDLNNQTLRDLVTAKPQEYLGESIITKFGSSKELPFLFKVLSIEKVLSIQAHPDKKLGAQLHAADPKNYPDDNHKPEMAIAVTDFEGFCGFKPLDQLAKTLATVPELNEIIGQELVDEFISGIKLPAEVGSQDDVNNRKLLQKVFGKLMNTDDDVIKQQTAKLLERTDREPQVFKDIDSRLPELIQRLNKQFPNDIGLFCGCLLLNHVGLNKGEAMFLQAKDPHAYISGDIIECMAASDNVVRAGFTPKFKDVKNLVEMLTYSYESVEKQKMPLQEFPRSKGDAVKSVLYDPPIAEFSVLQTIFDKSKGGKQVIEGLNGPSIVIATNGKGTIQITGDDSTKQKIDTGYVFFVAPGSSIELTADSANQDQDFTTYRAFVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHOMANNOSE ISOMERASE
publication title The x-ray crystal structure of phosphomannose isomerase from Candida albicans at 1.7 angstrom resolution.
pubmed doi rcsb
molecule tags Isomerase
total genus 137
structure length 440
sequence length 440
ec nomenclature ec 5.3.1.8: Mannose-6-phosphate isomerase.
pdb deposition date 1996-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01238 PMI_typeI Phosphomannose isomerase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.441.10 Mainly Alpha Orthogonal Bundle Phosphomannose Isomerase; domain 2 Phosphomannose Isomerase, domain 2 1pmiA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1pmiA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1pmiA03
1NYWA 1LKNA 2QJVA 3NSTA 4D7TA 3NW4A 4LEJA 1GQHA 2Q1ZB 4AXOA 3FX3A 3ES4A 4E2SA 1YFUA 3KGLA 2GZWA 5CU1A 5LEJA 3MZHA 3PNAA 3NVCA 1RUOA 1DZTA 3H3ZA 1RTVA 4WBBA 1ZZ6A 3U0ZA 4CYDA 2WFPA 2BNOA 1DGWA 3PLQA 2XHKA 4HSLA 3KSCA 3CO2A 3UKTA 2OPKA 3MPBA 4JTOA 5KHKA 4XFFA 1HW5A 1ZZ8A 5JR7B 4HMZA 5LRRA 1ZRFA 4Z82A 4I0BA 4TLFA 1J59A 4I02A 3E6DA 5E16A 3B02A 1O5LA 4XFCA 4JVAA 2OA2A 5FDBA 4AQ2A 2XLGA 4HLTA 2Y0OA 2I45A 4IESA 2ZKLA 3CEWA 4IEUA 3R6SA 4QGNA 3FZ3A 3IDBB 3PVBB 4LTAA 3MDPA 1CAVB 2XLFA 1I6XA 4FT8A 5I93A 1ZREA 1ZZ7A 1RL3A 3WW2A 3FFQA 1ZZBA 1CAWA 5HI0A 2OZJA 3EJKA 4I01A 4LA3A 5LRSA 1ZX5A 4EV0A 4L2NA 1J1LA 1ZZ9A 1YLLA 1ZZCA 4EWAA 3TNQA 4PIYA 3E5UA 4ZU4A 5BUVA 3FJSA 2FMYA 1J3RA 2EAAA 4EWEA 2F4PA 3OD0A 1XE8A 1U12A 4MGYE 4HN1A 3EQEA 3M70A 3SMHA 1GQGA 4XF3A 3VHRA 3USSA 4R8HA 2UYBA 5I0RA 1DZRA 4F7ZA 5I8SA 1UPIA 5I0UA 1RUNA 4D7SA 5I8TA 4XFHA 4OLLA 4FBFA 2QDRA 4XFBA 5KBFA 3GBFA 3LA2A 4MGZE 1RGSA 3ETQA 2PFWA 4E2GA 1XRUA 2ET7A 1FT9A 5FLHA 2QCSB 3BU7A 3OCPA 1G6NA 5C6CA 1V70A 2Q0AA 4LLOA 3BB6A 3U10A 1LB2A 1I5ZA 3C3VA 3FHIB 3I59B 2BNMA 1CGPA 4IEOA 4ONUA 1SFNA 1X8MA 2D40A 1UD1A 3H8UA 4NVPA 2EVXA 2MPFA 5KHGA 4I3PA 1ZRRA 4BYYA 2B9UA 4P9GA 4QX5A 4R52A 5E1RA 4YARA 3RDIA 1NE6A 3RYKA 1X7NA 5FQ0B 4A2UA 1Y9QA 2V09A 3HT2A 3I59A 4AVBA 4KWJA 4L11A 1YFWA 2E9QA 2IXKA 2PTMA 3H1YA 4N9HA 5EFUA 3OGJA 5JAXA 4LULA 4MV2A 3H1WA 3D82A 4I0AA 3E6BA 4YRDA 4B29A 2IXIA 4KL1A 1O3TA 2O8QA 2C0ZA 3ES1A 4HBNA 2EA7A 4IEVA 5FQ0A 4XFIA 5J7MA 1J3QA 4PJYA 3SCGA 3WW3A 2CAUA 4I2OA 4X6RB 4XF1A 3H3UA 3IIAA 4UXAA 3TNPB 3E5QA 5D1IA 3E5XA 3U11A 1VP6A 3LWCA 1NXMA 1EPZA 3IDCB 1Q3EA 3QOPA 4HVRA 4MH0E 3H7JA 4HN0A 2XL7A 5K8SA 4QM8A 1H1MA 4FAGA 1OMIA 3CJXA 1VJ2A 2XKPA 3BCWA 1CAWB 5KHHA 5FCCA 2PAEA 2PA7A 2DCTA 4I09A 1ZRCA 1Q43A 1NE4A 4QMAA 4XF9A 4HVOA 2GU9A 4BIFA 3I54A 4DINB 1J3PA 2IXCA 3RYRA 4BH9A 2OYZA 3RPQA 2N7GA 1VR3A 4IERA 2MHFA 2O1QA 4Q0SA 2CAVA 2XKOA 4IEWA 4QM9A 3RYPA 4WZCA 2IXLA 3KGZA 5BXXA 5T3NA 1YHFA 2K9ZA 1FI2A 4RD7A 4GULA 4MX3A 1Q5OA 1Y3TA 4XFAA 4XF4A 3LZZA 1XE7A 4UBGA 1UW8A 3ZDSA 4O9GA 2B5HA 2GC1A 4J1WA 1X82A 3SXWA 2IC1A 3ST7A 5F1RA 3EBRA 4Q0UA 3FE5A 5JSRA 4AVCA 5KHJA 1O3SA 2XLAA 5I8YA 3S7IA 2BEOA 3HQXA 5BV6A 2MNGA 2GH2A 4IETA 4MGKE 3N4MA 2GC0A 1ZRDA 3IWZA 4IEYA 1LRHA 2K0GA 3SCFA 4IEQA 3UKNA 2QVSB 3JZVA 3FWEA 2PHDA 2GC2A 3KMHA 2KXLA 4JTNA 4X6QB 1O7FA 4PIZA 4XF0A 1QXRA 1WA4A 4E2QA 1OI6A 4WVZA 4LUKA 2Q4SA 3ACLA 1UIJA 3NKTA 3QACA 1EP0A 3DN7A 2PQQA 1SQ4A 5C8WA 2D5HA 1FXZA 3CLPA 4FAHA 4IEPA 1TQ5A 2ATFA 3S7EA 1H1IA 2H6BA 4QGMA 2QNKA 1QY4A 3ROUA 5BY5A 5LEKA 4EROA 2Z69A 1WGPA 5FLJA 1O4TA 5FPXA 4YYOA 1O3RA 5CADA 3I7DA 4J1XA 3SCHA 1SEFA 3D0JA 5I0TA 1ZVFA 3H50A 4Q0QA 3H7YA 3SHRA 1PM7A 3EHKA 2VQAA 1CAUB 1JUHA 4F8AA 4Q0PA 3OF1A 2OZ6A 1QXJA 2IXHA 3BPZA 2ZCWA 4Q29A 3HIFA 4KWLA 4OFGA 2CGPA 4JV4A 4Z07A 4LUMA 1IPKA 1YWKA 2HJIA 3MYXA 4MZUA 3BALA 4META 2ETEA 1YFXA 4HZFA 1CAUA 5EZWA 3RZZA 3LA3A 2FQPA 3DV8A 3O14A 4K8FA 4ZU7A 2IXJA 4MUVA 4LA2A 1OFNA 2HKXA 3IBMA 3E6CC 1L3JA 2PHLA 4XFGA 4QXKA 5I91A 5KHIA 4HSJA 3LOIA 3DL3A 4MGIE 2PAKA 5FLIA 1ZNPA 4ORFA 5BPXA 3D0SA 3H1MA 2H0VA 4EWDA 2BYVE 3KCCA 4N9IA 2UY8A 5JCTA 1QWRA 4QGLA 4ZU5A 3NJZA 3UKVA 3WW1A 2BGCA 3WW4A 5I0SA 1X8EA 1CAXB 4HVQA 4KU7A 4AQ6A 3G7DA 4YSFA 3RNSA 1CAVA 3H9AA 1O3QA 2CV6A 1YUDA 1IPJA 2Z2SB 4UBHA 2Q30A 2UYAA 3L2HA 1CX4A 5CVRA 1CAXA 1RC6A 2VECA 5JSPA 2BNNA 3NL1A 4PIXA 2PAMA 3M3IA 2H6CA 4AVAA 1OD5A 1UIKA 1WLTA 5JSOA 5J3UA 1EY2A 3LAGA 2P17A 2XL9A 3S0MA 3E97A 1UCXA 3CF6E 2WC2A 2XGXA 3LA7A 4XEZA 5AVPA 1LR5A 3DKWA 4O9EA 3OTFA 4KWKA 2B8MA 4IEZA 2VPVA 1YFYA 2D93A 3ELNA 4BHPA 3GYDA 1DGRA 4IEXA 5FPZA 1PMIA 2GAUA 4H7LA 3CL1A 2UY9A 3HT1A 1EYBA 1O5UA 2GC3A 4KU8A 1NZCA 2PYTA 4YNIA 1J58A 3EO6A 5J48A 4XETA 4Q0VA 2ET1A 2D5FA
chains in the Genus database with same CATH superfamily
1LKNA 3HQUA 3DPRB 3LSDA 3PJQA 3U14A 4LQRA 3NSTA 4B3NA 4D7TA 5T5PA 1PO13 4GALA 4M4PA 1W2AX 3NW4A 2FMDA 3KHBA 1VBC3 4LEJA 4QX7A 4OI1A 4AF9A 3ES4A 4AXOA 4QKNA 3VDDA 2E7AA 4LHLA 1RXFA 1PX3A 2ZGTA 5IW0A 4AHYA 3PNAA 5JPMB 4OZXA 1QJY2 2QDNA 1WD4A 2XH6A 1KGYA 3ME2A 3MIEA 3ZKUA 2ZJCA 3H3ZA 1RTVA 4WBBA 1ENSA 3U0ZA 1NG0A 4K20A 1LCLA 1MS9A 4FOQA 1F2NA 5HPOA 5LY1A 3VD5A 3MGUA 4JTOA 1AL23 1HW5A 1N1VA 4CP0A 3LF7A 4RS5C 4NWWA 4DOUA 4YZ1A 5LRRA 5FYSA 3J9SA 3JCIA 3OOXA 5KXCA 4I0BA 5EWSA 3D6EA 3ZMNA 3WNNA 2WAAA 1RMU2 3GZEA 2CGNA 4AVVA 2XQRA 4Z8BA 4COUA 4WM7A 2W92A 4XJWA 2J1VA 5DDJ3 2RV9A 3OJBA 4LKDA 3WQ7A 3S5QA 4XFCA 3MLLA 1MS0A 5AC91 4BB3A 1A8MA 4N90A 2E26A 4AQ2A 3POFA 2R071 4LORA 3BOPA 1NA1C 2I45A 2MEV1 4IESA 2W1UA 1PK6C 4ISRA 1AL21 1Q8QA 4IEUA 3ZSEA 5CIRA 4QGNA 3OB8A 4LE3A 3IDBB 1BMV2 2PHUA 2AC1A 4LTAA 1RUE3 1X9TA 3MDPA 2EF6A 1H8TA 1OF4A 5H9RA 4R9AA 2WNVA 3B9IA 1ULDA 4ASMB 4BIOA 5IFPA 2XG3A 2OPWA 2JG9C 2F17A 4LO6B 1ZZBA 1Z7S3 2HYXA 5K7PA 3GBGA 3EJKA 3MIDA 3VV1A 2GSYA 1SFPA 4Q4W2 1ZX5A 1D0HA 4UFMA 5FUIA 2Y8KA 2WZEA 5HV4A 5GLUA 5D8AC 1ZZ9A 4C8DA 2ORZA 3ZFGC 4CCOA 3O1SA 4FXKB 1YNAA 2BDRA 4QQ2A 4AVTA 1UYPA 1NLQA 1RUE1 4XXPA 4YVWA 4EWEA 1KD7A 1WCSA 4Y3OA 1SCSA 2F4PA 1EAH3 4KGQA 4CXXA 2XJRA 5BNPC 1AF9A 3M3QA 4N7IA 3VBHA 3O1TA 2X8KA 5E88A 5FPLA 4CP1A 3HBKA 3EQEA 1MQTC 1Q56A 1V9U1 1LJ7A 3SMHA 2DCKA 2JDKA 4XILA 4FSJA 5IFTA 3I3DA 1US3A 2Q1MA 3POGA 3T0BA 4XCAA 1UY4A 3B7MA 4P08A 5I0RA 1MZEA 1Q8VA 2GN3A 1LENA 2VUDA 2G9GA 5I8SA 3VBOC 4AYUA 4XJ8A 1UPIA 4QKDA 2P3IA 2UU8A 1YQ2A 3HWJA 2YMZA 4FP2A 2WO1A 4QDSA 4D7SA 5I8TA 3ZN6B 4BPZA 4OCTA 1F35A 4Q27A 2HBUA 3WG4A 4FBFA 2QDRA 1S55A 1WD3A 4NR1A 4FPFA 4ZPIA 4BZ4A 2GH8A 2TBVA 3LA2A 5FOBB 4V1PA 4E2GA 4XHBA 4CDXB 2DTYA 4LBMA 2CDPA 1FV3A 2ILMA 3MIBA 4YGBA 1UL9A 2KA3A 5F8PA 4IV3A 3JB8A 1G6NA 2DV9A 2G19A 2Q5TA 4YVSB 3BB6A 3IDEA 4K7JA 3RI9A 1I5ZA 3FHIB 3AMPA 4GWNA 1S2EA 5JXIA 4OYUA 2D40A 5CNAA 2PN5A 5CA6A 5FZ4A 1PGSA 2J42A 2DVAA 4NVPA 5KHGA 3K75B 2YBPA 1POV0 3GCWA 5ABJA 3U78A 2B9UA 4LKFA 2VZQA 4NRMA 1R1A3 3THCA 3RYKA 1W39A 4IGPA 1X7NA 3A4UA 4A2UA 1Y9QA 3HT2A 5L7OA 1DF0A 4XYXA 3VD4A 1CJDA 4KWJA 1UX7A 1XB9A 3C8XA 4N9HA 4XUOA 3KS7A 1DP0A 3OGJA 1SBFA 1WMXA 5IVVA 1HB3A 2WNOA 4EQVA 2X05A 4URAA 1CESA 5C70A 2G9FA 4YZ4A 1C8M2 1U0AA 2C6SA 3JD72 3UGGA 1O3TA 1JYNA 1WW7A 3PVNA 3FLRA 2Y38A 1D4VB 1J3QA 3H8OA 3IIIA 3OPZA 1H6XA 3WW3A 4C91A 2GP3A 1YQCA 1R1A1 4XF1A 1XNDA 5F39A 5F3GA 2WINB 4E8DA 1V6JA 5FXZA 3DPRC 2CWSA 4NE9A 3LFMA 3ZSMA 2VCMA 1Q3EA 4JGZB 2YPDA 5FYZA 1H1MA 1OPMA 3AVRA 1OMIA 3PUIA 3ZX7A 4JX0A 1VJ2A 2RR13 3WXPA 4HK9A 4DUVA 4Q4X3 4PLNA 1DBNA 2FHRA 3BCWA 1CR7A 1MR5A 4QXBA 5ACA3 1ZRCA 1Q43A 3QH6A 1NAEA 5H9SA 1FX5A 4MHUA 3F2ZA 5GLVA 5EJ1B 4XMAA 1HB2A 5FP7A 1W8ZA 3VKMA 4XF9A 3ZXJA 1FAYA 2DVGA 1KQRA 2GU9A 4IE6A 1KITA 1GANA 1WZXA 1QQP1 5DAWA 5FK7A 4QHOA 3T08A 3I2GA 1DDLA 5FO8B 2DBIA 5KXDA 5A3UA 1IPSA 2WZR2 5KWRA 2Y6HA 5IVEA 1J84A 3WP5A 4CEWA 4IERA 1WUVA 4K6BA 1O4YA 4Q0SA 2R043 5DAQA 4QM9A 1OLQA 2LROA 1LHNA 2AYHA 1LOFA 2IXLA 5BXXA 4ITCA 4KG8A 1MEC1 5T3NA 4TZDA 1NCQA 2HLEA 3ILFA 5DZEA 3MV01 2Y6GA 2OQ7A 4RHV3 3U37A 4CCNA 1W6MA 2VMCA 4LMFA 1Y3TA 1N1YA 2P37A 1W0NA 1XE7A 4LKSA 5C8CA 2FDGA 4D0QA 2RS52 1XBFA 4BQ4A 5E8AA 3KV9A 4XJZA 2IC1A 4IGQA 2NZ9A 4PBOA 4CRQA 5CAZA 5FY0A 1PGW2 4M00A 1QJY3 3EBRA 2JIGA 1UYZA 1L7QA 2WJSA 3R4DB 2UURA 3OYWB 1HN1A 4AGVA 1FNYA 2GDFA 4AVCA 5KHJA 3Q8BA 4JQRA 5FY1A 5I8YA 1QJFA 1ULPA 1D4M3 2JD9A 5DPNA 5FZOB 5JOXA 2WO7A 3CJIA 3OEBA 3T09A 4AI2A 1ENQA 1UMZA 2YXSA 3IB3A 2BERA 4MGKE 1H2NA 5SV5A 1G9BA 2XB6C 1YO8A 4Z2AA 3M3CA 3IWZA 4IEYA 1LRHA 5CG9A 2VUAA 3TBDA 5GKAC 1LHUA 3CQOA 4D7YA 1K42A 4AQSA 4WM8B 1RUH1 2DBNA 3UNPA 3S5AA 4XURA 2ZHLA 1HV0A 4XZPA 4QPWA 2JDAA 5JI9A 3WF3A 1OPOA 3W9AA 4JTNA 4YGEA 1BZWA 4CUAA 1O7FA 1GU3A 2DUOA 4HT1T 3GJBA 1D4M1 3OY8A 3QBQA 5KXEA 2PLV2 2RHPA 1GWLA 3PUHA 4DNYA 3S6PA 1QJX3 3W5MA 3L2YA 3S57A 3ZIWA 1S0BA 3ACLA 1SLAA 3K4ZA 3QACA 4H14A 1EP0A 4KBBA 3ZMOA 4BQYA 3OBTA 4MXWB 3M4FA 1F15A 1UZZA 5C8WA 2VW2A 3PIGA 4BA6A 2XVLA 1ZBE1 5GM0A 4FAHA 4MXVA 3GJAA 3SC7X 4IEPA 1TQ5A 2WN2A 3S7EA 3B00A 3RQ0A 4CDXC 4GJYA 5IWFA 4QGMA 4M3CB 2QNKA 2ZMLA 4BMBA 3J8F3 3U75A 4D6RA 4Q4W3 4NAOA 5BY5A 3EYPA 3KQRA 2XWJB 5LY2A 1TMF3 1BXHA 3ZYIB 4K1YA 2XJUA 4J6GA 3WY6A 5FPXA 1OVSA 4YYOA 3T0AA 2GMMA 4TTGA 2FD8A 2D98A 3VL8A 3WCSA 1JZ2A 2QBXA 3R0RA 5FZBA 4GMP1 1SEFA 4UWDA 5FP3A 5DG1A 3UETA 1COV2 3H50A 3EHKA 4QX1A 1HRI2 3OUJA 5EQUA 5FYVA 4Y4RA 1AJKA 1OFSA 1CAUB 3LDRA 5FFOC 4F8AA 2K2SA 3R4SA 4AFCA 4QD2A 1V6KA 4GKYA 2IXHA 2VMIA 2ZHKA 1DQ4A 3BPZA 5C5UA 1QJZA 2QQVA 4BDVB 3GHNA 3O1MA 4KWLA 5FPAA 3N7JA 1TMF1 3M3OA 2CGPA 2EXJA 1V6OA 4AFBA 1WW4A 1ZRIA 5A3WA 5K0UB 3VHNA 3KVAA 4L92A 2W47A 2CTVA 1H9WA 2YY1A 3HNBM 4M3CE 4QB2A 4C0HA 3IPVB 2VW0A 4BQ5A 4YM1A 3NO8A 4YW5A 2A3WA 2LRPA 5BNNB 1D2SA 4CEYA 2ZMKA 2JG8A 4Z92B 2FQPA 3PTYA 1SDWA 3TYJA 4K8FA 4ZU7A 2C5DA 4LO5B 3IBMA 5FR3A 4JRAA 5KHIA 4G3YC 4FQ4A 3RZKA 1YQ6A 2FDJA 3THPA 4Y20B 1O59A 3LOIA 3DL3A 4MGIE 1UN1A 2HWD1 2VVEA 2PQSA 3POYA 2D6NA 4CCEA 4D3WA 5M0TA 1C5IA 3VBRA 1IG0A 1VBC2 1GWKA 3H1MA 3WNMA 1ZM1A 4NHYA 2BYVE 2VTXA 2X10A 4IV1B 2R063 1TNRA 4XAEA 1ASJ1 1W06A 1RUI3 4GXLA 1K5MB 1XNTA 2B39A 2OQ6A 5AC92 5JCTA 4YM0A 3ZXKA 2WT1A 4DUWA 1QNWA 3NJZA 3VBFB 3VZMA 3WV6A 5I0SA 2R072 1DQ0A 4XABA 4KU7A 3M3EA 2MEV2 3POIA 4XW3A 3EMRA 5JMOA 1ND2A 1AL22 1V6NA 2ZS6B 4M4RA 2YFZA 3G7DA 1AHSA 3VZOA 1O3QA 5GZEA 5FZDA 3FBMA 2DCZA 2Y33A 3SISA 1ULOA 4PBPA 4UBHA 1S0EA 3PUSA 4XXAA 5FZMA 1IKQA 4ET7A 3WDYA 2DCJA 2UYAA 3L2HA 2GP5A 3MO4A 5DDJ2 5T54A 2R061 4UF0A 1RC6A 4P9JA 4XIKA 4RR3A 4LPLA 4Y22A 4JKKA 4PIXA 1XE0A 2O8OA 1VPHA 2WWSA 2PAMA 3AVSA 5CKQA 5A33A 1EUUA 2H6CA 3RWKX 5FY5A 1RUF1 1CONA 1OD5A 2AENA 5IUQA 5GLTA 1UPSA 3JBG1 1C3HA 1K45A 1LTEA 1R64A 2G4IA 3KT4A 4B1LA 5C9AC 2DF7A 5J3UA 1EY2A 2RM21 2XL9A 2CGOA 2ZGNA 4IE4A 2JB4A 2WWUA 1UCXA 1RUE2 2W52A 1T6GC 3NWKA 5HXMA 3ZIXA 4A42A 2PHFA 4RN5A 4GIQA 1LHOA 4YG0A 1UX6A 4C90A 2EICA 2D3PA 3LPFA 2JECA 1NCRA 1GZWA 1W6NB 4ARYA 2A5ZA 4RFRB 1JBCA 2BFUS 2VPVA 1V9U2 1WCQA 2D93A 4AFAA 1JU4A 4CU7A 3DXTA 3AJZA 4IEXA 1GZ9A 4IE5A 2EIDA 5FPZA 3DXUA 4H7LA 3RZMA 2BVBA 3CL1A 1QOSA 4AEDB 2VBDA 1RINA 4CDUC 1EYBA 1O5UA 3OGRA 4FPEA 2A71A 5IAVA 5CB7A 1A3KA 3KV6A 4B8EA 4EZ4A 2Q8EA 3PL0A 5A7NA 2AUYA 2SLIA 4GB31 5T52A 1EAH2 2BV4A 3BYWA 1OH4A 2VMFA 5FYIA 5A1AA 2QE3A 4WM8C 1JOPA 4COZA 1NYWA 4CA9A 5FZKA 4JGYA 5HXVA 2ZGLA 4ZXKA 2HWB3 4Z2WA 5A1FA 1CPNA 4FO9A 5J37A 2VUJA 3RFRA 2XJPA 3KT1A 5FOJB 3O1OA 2Q1ZB 3KD4A 1WW5A 3USUA 3KGLA 5CU1A 5A7WB 1DU3D 1KFXL 5KC5A 4BLIA 5LW9A 1PVC1 3AB0A 2ZEYA 1RB8G 1SPPA 3T1LA 5A7PA 4MGSA 1RUOA 1WKYA 1QNYA 3JU9A 2FDFA 1IKPA 2QQJA 4WM7B 3V0AB 5GZFA 3WOGA 2RJKA 2NM1A 3VBUA 5CFDB 5A3NA 2BNOA 2RS53 3PLQA 3VDAA 2XHKA 2ZABA 3KSCA 3CO2A 3UKTA 4ZHNA 3MPBA 1VAMA 4MVTA 1TG7A 1URXA 4BMEA 3HPNA 1R1ZA 1JOBA 5JR7B 1XU1A 2KM2A 4FVVA 3AL6A 1ZRFA 2VMEA 2WWJA 2RMU1 4XQ4A 3I2HA 4UI9L 1C57A 3VKNA 4QX0A 4I02A 3E6DA 1BQPA 4YPJA 4COWA 4A3ZA 1OUSA 3B02A 2VZPA 1OA3A 4CCDA 2WNVB 1CD3G 3LOBA 4JVAA 4QKBA 4INDA 1NQJA 1JTZX 2JB8A 2OA2A 4P02B 2VC9A 1GLHA 4Q2FA 4XTPA 3IAQA 4HLTA 3BOWA 3WCRA 1S0GA 1WMFA 4L97A 5IYYA 4P9LA 5J1XA 2JICA 2JKBA 1MS8A 3FZ3A 4I0WB 1YRZA 1R1A2 1DG6A 2E7QA 1CAVB 2ID4A 4RSUA 4JCKA 2V4AA 1I6XA 4FT8A 2BJSA 2D6OX 2LUWA 2R0HA 4IUGA 4LBQD 2YV8A 3WLUA 2ZHNA 1AXZA 1H8VA 2J1TA 1SFYA 2NLRA 3FFQA 3OPWA 3WW2A 4YVWB 4DIQA 5K0UC 3PJYA 4YG3A 4WV8A 1VLNA 4O7XA 1JU3A 1W2TA 1L7LA 1CAWA 1GQPA 2JEMA 4M0NA 2OZJA 5GALA 5HI0A 5IT6A 1IQDC 5LRSA 4LK6A 5L19A 2CL2A 3LGRA 4NPLA 1J1LA 5BNNC 2QKDA 4A3XA 4QX2A 2IFWA 1PZ9A 1YJLA 1YLLA 2DWRA 2JDZA 1B09A 5HCBA 4CDQB 1KDMA 3MF6A 3TNQA 5F7UA 4PIYA 3E5UA 1JZ3A 5BUVA 2KD7A 1GNZA 1LOGA 2DCYA 3FJSA 1J3RA 5EHDA 1G8WA 3J7HA 3JUUA 5DABA 2DU0A 4A6SA 4CCMA 1QQP2 3OD0A 1XE8A 4Q5OA 4NIIA 2JD4A 5JWPA 4P9XA 1GICA 4SBVA 3M70A 1OOPB 1GQGA 4CPBD 1JS9A 3TN91 4LBQB 4XF3A 3WDTA 4IV1C 2O14A 3LCPA 4S2HA 1K5MC 4NROA 1XNCA 4Q4X2 1UU4A 3VBFC 1DZRA 3WNXA 2R16A 1RUC3 1COV3 4IV3B 2DDUA 4CSWA 5FREA 2XVGA 2XWBB 1HQNA 2J1SA 1HRI3 1MEC2 2Z42A 5I0UA 1N47A 1KFUL 3VD7A 1UU6A 4Y5SA 1POQA 5BNOB 4I30A 1VB2A 3GZAA 3U11A 3RG0A 4JDMA 2DTWA 4RQPA 2JDYA 1IS4A 1YQ8A 2W3JA 2D3RA 4Y1ZA 2WDBA 1AXKA 4N53A 3O1VA 1O8SA 2DVBA 3DGTA 3PMEA 5FPBA 2YC4A 4A41A 5FZGA 3VHPA 3ZR5A 3APBA 1RGSA 3ETQA 1F31A 4RGGA 1DZQA 2W68A 2ET7A 3OBZA 3IT8A 5FLHA 4CCJA 3BU7A 2HEVF 3I2IA 3X29B 2XONA 1HRV1 1UZ0A 1V70A 2Y0IA 2VCAA 4LLOA 1NLSA 1VE0A 3AP5A 4W8JA 3SEPA 2E63A 1RUC1 5FMCA 3ZSKA 2YBSA 4IEOA 5FPUA 1FPN1 2XJSA 4OZOA 4YG6A 2C26A 1XYPA 1H4HA 2RS33 4BXSV 3BIEA 4HPKA 1PIV1 3ZFEB 2RJLA 5GZDA 1N3OA 4LBOA 4AEKA 4CP9B 3BKZA 4QX8A 2EVXA 1W6PA 2VMGA 5J98B 3UL2A 5IK5A 1CIWA 4QPIA 4OUMA 4QX5A 2X5IA 1BLZA 3RDIA 1IS5A 2IWGB 2Q8DA 5IK8A 3M7AA 4XQDA 4MO3M 5FO9B 3I59A 3A0NA 3SKJE 3AZWA 4L11A 4X8PA 1ND3B 2PTMA 4MYEA 1RUH2 4QPGC 5EFUA 5AC93 5DN2A 5JAXA 3H8RA 1VALA 4LULA 3NAPA 4AEDC 3VL9A 3LDBA 2E7TA 4MV2A 3H1WA 1S0CA 5FUPA 2PXJA 3ZYBA 2R073 3E6BA 2VBBA 4YRDA 4E4SA 2RS31 1D4M2 3BTXA 2MEV3 2IXIA 1U5ZA 1WCDJ 1VRH1 2O8QA 3ES1A 5J09A 1FMD1 2BZDA 1X9PA 2EA7A 3INAA 3PU8A 4HBNA 4PF5A 1X50A 4XFIA 4PJYA 5FZ7A 5JIAA 4AVSA 4RL7A 2QUOA 3OUHA 1W6OA 2CAUA 3KQ4B 4MOAA 4I2OA 5TSWA 3H3UA 3IIAA 4UXAA 1LU1A 1ZBE2 2WSUA 2B42B 1SHWB 1VP6A 3E5QA 4XVHA 4RS5A 5FJKA 3SEEA 2BRTA 1D2QA 5LA0A 2B7YA 1MS3A 1JOJA 3I2KA 3W20A 4F83A 3WHUA 3HVDA 3PVEA 2XL7A 3N9MA 3N7KA 1MZFA 2VQ0A 3TB0A 2FZ1A 3C7GA 3WDWA 2A6XA 2XKPA 3I3MA 1QJX2 2I2SA 5FCCA 2PA7A 1JMUB 4CEWB 5CFDC 3FHQA 1NA1A 1S2KA 1NE4A 1PK6A 4KWUA 3R4UA 3B69A 3VN4A 4HVOA 4K9SA 4E4ZA 2E51A 3AZYA 1SBEA 1NCQB 2QQOA 3I54A 3D5OA 4DINB 1V9U3 5FO7B 4LK7A 1A6CA 3AZZA 3RYRA 5FTTC 2OYZA 3J8F2 2N7GA 3AZXA 3I3BA 1W8WA 4B4PA 2GNDA 1LHWA 4U36A 2JG9A 3CU7A 1TMF2 4Q8LA 3V64A 2CAVA 4IEWA 3RYPA 1OLME 4WZCA 3VKLA 1CN1A 3KGZA 1RVF3 1MVEA 3MICA 3QD6A 4UW3A 3BUCA 5LASA 4LT5A 5EYXA 1YEWA 5F9TA 1R081 1J83A 2Y64A 3W59A 1JZ6A 5D8AA 2EIGA 1FI2A 2K9ZA 3ZFGA 2ADDA 4GH4B 5JZGC 4XF4A 3GNEA 3LZZA 4M0HA 5F5QA 5B4XA 1BK0A 1UW8A 3CJIB 1E5HA 4QAWA 4QX3A 3ZDSA 4B4QA 5BNPA 3ALQA 4XDOA 4J1WA 1X33A 4YVWC 5FP8A 1MQTA 2HWD2 3I2FA 5F5AA 1K3IA 3AJYA 1XU2A 5F1RA 1W6QB 3ZYRA 5F2SA 3JB4C 4Y5Z0 2ARBA 3NNLA 4P00B 3LEIA 1RVF1 4AI1A 4BCUA 1O3SA 3C7OA 4LOTA 1ASJ2 3BIWE 4Y1UA 3N9LA 5IATA 3VBOA 1KDKA 3VDCA 2ZX3A 3VZLA 2WQ4A 3WQBA 5DMYA 4CDQC 2ZEZA 5BV6A 4JKMA 1QEXA 2MNGA 2GH2A 2AZ5A 2RS11 3BGAA 3K4AA 4IETA 4TWTA 3DYOA 1I9RA 2I07B 4LHSA 3N4MA 1U5XA 2VZUA 2GC0A 1QJEA 1PNFA 1ZRDA 3MIGA 2K0GA 3P6BA 4OHVA 1Y9GA 3O0XA 3GM8A 4IEQA 4A7KA 3AYDA 2D3SA 3MW4A 1OOPC 2WZ8A 5CYYA 1PZ8A 4L8QA 1Y9MA 3FWEA 2WL1A 1GYKA 2PHDA 3LSEA 3DEMA 4OQ8A 2R062 5JVVA 4PIZA 1ULFA 1QXRA 1RUI2 2AR6A 5FYBA 4IV3C 1BK1A 1OQDA 5C5TA 2VNGA 3KWVA 1FOD1 3NKTA 3SQOA 1RUF2 2RDRA 3MLJA 3ZO0B 2VOVA 3RS6A 5E89A 1AR63 3S30A 1GZCA 3VZJA 1IHMA 3QCWA 2WSVA 2RE9A 2RM22 2UWCA 4K8RB 4LBKA 1REFA 2QQLA 3THDA 2A6VA 2D6PA 4GWJA 3FUOA 4DFSA 1JYTA 3NV4A 4G4FA 1H6YA 4OHZA 3VZNA 3ZN4A 1QY4A 1YXWA 4GQ7A 1ALYA 2J1RA 3VBSC 2C1FA 4FOWA 4Y26A 5F3IA 1UF2C 1UOBA 1YC61 2OW4A 1F9KA 2QTWB 3OPTA 2V4VA 3RMYA 1WGPA 4XCBA 4UOJA 4R4XA 1O3RA 1TE1B 4WVMA 2LS6A 3A21A 3ZFEC 4ARXA 4FTBA 5A7SA 2QZ3A 5FYYA 4IE7A 1AR61 2J1EA 1XXNA 1QQP3 1DCSA 4Q0QA 2Z79A 3H7YA 3SHRA 1WCUA 1PM7A 2GNTA 2YGMA 1TEIA 4LBLA 2VCCA 2J22A 2VQAA 4GB32 3DPRA 4E4HA 2OZ6A 4AHXA 2ARAA 1C1FA 1ND3C 2JG8B 1H1AA 1LULA 3HIFA 3RZLA 2ZX4A 4Q1PA 1VIWB 4Q4Y1 4OUSA 1BHGA 4Z07A 3ZFFB 3PHMA 3WINE 1UAIA 3ZPYA 3AZVA 4K40A 1MEC3 2RDQA 3VZKA 4ATEA 2B4KA 1PVC2 4XUNA 4UFKA 1YFXA 4HZFA 1XNBA 1I1EA 4XDQA 4YFZA 1JXNA 2IUWA 4QQPA 5EZWA 1LGCA 4XDPA 4ZZ8A 1AR93 3LA3A 2ZGOA 1ZA7A 2JIJA 1VBE1 3GGLA 4W6WA 3SH5A 1A34A 4XUQA 3O14A 3M2MA 1Y43B 4LA2A 1OFNA 4EN8B 1GNHA 4JAAA 4QKFA 3E6CC 1L3JA 4FPHA 4QXKA 5IK7A 4HSJA 1PHMA 5FBJA 2FCVA 5GLZA 4YW2A 4D6QA 2HWB2 5FLIA 1ZNPA 4ORFA 2RMU2 3LPGA 3D0SA 4QU1A 1DFQA 2EXHA 5A7OA 5A3PA 3KCCA 2B46X 5JXHA 1QWRA 1YQ5A 4LXLA 1EV11 3VB9A 2P3KA 1BVP1 1EPWA 1REDA 2ORXA 2TNFA 4ZU5A 3UKVA 1AXYA 4CCLA 2ZZQA 4KG0A 4BQ3A 1AR91 4BQ1A 4LBNA 4JHTA 3GHMA 2A1XA 3KCYA 3K4DA 3N9PA 4ISQA 1BEV1 1CJPA 1ZBA1 5GZGA 3RNSA 3VDDB 1JODA 5FYCA 2CV6A 3WZ1A 3O0WA 1RUH3 5SV8A 1QJU1 1O6UA 1XSRA 1HLCA 4FPGA 2WS93 4KMQA 2XVKA 2W5FA 1LEMA 4CZSA 1A8DA 3WNPA 2VQUA 5LCWL 2HYKA 1ENXA 2GMPA 3LDKA 2SBAA 4OMDA 1CX4A 1W9WA 2XDVA 1CAXA 5A7QA 5T55A 4HKOA 2W39A 3WD5A 4C1XA 2W2IA 5A1LA 1WWYA 3V0BB 5DAVA 3Q9OA 3VUOA 4CXYA 2P1BA 4S2FA 1AR73 1DIWA 1JUIA 1ULGA 4PF1A 4FPLA 3B5LB 5K4LA 1W9FA 2AEYA 3NNMA 1ZBE3 5FMBA 4GH4C 4L0PA 5LK7B 3MIHA 3LAGA 4CU9A 1OVPA 2ZEXA 4YW7A 3CF6E 2WS91 2WC2A 4NHLA 2XGXA 3WP3A 2YUEA 1SCRA 1UZYA 2EXKA 1CWPA 4XEZA 1XNAA 3OTFA 4KWKA 2HWF3 4CUGA 1KRIA 3IDAA 4UW4A 1CZTA 4TYSA 3TN92 4BHPA 1UZVA 4LHNA 5FV3A 2J7MA 3V65A 2GAUA 1AR71 1DGWX 3WNOA 3AKPA 1GKBA 1J1TA 2UY9A 3HT1A 5DUVA 1QDOA 1N1SA 1OBNA 3JXSA 1OA4A 3AK0A 4GMP3 3WP4A 3K77A 2JX9A 5J96B 3GF6A 2Z5WA 2PYTA 3FN9A 3AKSA 2YYOA 1NY71 4K1ZA 2IVJA 1SPPB 5J48A 2DUQA 4TLGA 4HKWA 2VCBA 4XBNA 3NNJA 3AYEA 4UFJA 5FRAA 1H30A 4YVSC 4ES9A 1OXCA 4CDXA 5BNQA 3AKTA 2HWF1 4EE2A 2VOXA 2VZOA 2VMDA 3BU0A 4AHWA 4GAZA 4CE8A 3ZLIA 1JYCA 2YPJA 1UYYA 5FY8A 1YFUA 2BUKA 2YU2A 3O1UA 1HRV2 1S2BA 3UK9A 4AK3A 3PVOA 2VZ3A 4KQ7A 4V2VA 1AX1A 3ZYPA 1RUC2 1DZTA 3T2TA 2Q1FA 5JUVA 1IS3A 2VY0A 2BTVC 4NAMA 4XAAA 1LECA 2PHTA 2VU9A 5CKNA 2WBKA 1PIV2 1TVGA 4CYDA 2WFPA 4HSLA 3SITA 4BQWA 3ETPA 2OPKA 4Y33A 3WR0A 3DYPA 1ZZ8A 2ZGQA 2HWD3 1UO9A 1ONAA 4HANA 4COYA 4IXLA 1MACA 3K3OA 4Z82A 5FY9A 4TLFA 4Y24A 3ZVXA 1M06G 1ODMA 2OVUA 4FCAA 2YFUA 1ASJ3 1AYM1 3ON7A 4AEMA 1UY2A 1O5LA 1H0BA 1S0DA 3N7MA 1NKGA 1F8VA 1RIRA 1UWWA 5FDBA 2BBVA 3TEWA 2RS32 3KV4A 1W99A 2Y0OA 3CMGA 4BXFA 1VRH2 1I3HA 2ZKLA 1FMD2 2VOTA 3P3NA 2C9KA 2WQZC 2RJ2A 5A3MA 4JGZC 2BQPA 1LGBA 5FYTA 1BYHA 1GBGA 1AX2A 3PVBB 3PMSA 4QDQA 2JG8C 2WA4A 4KH9A 3J26N 3ACHA 3SH3A 5IAXA 2WT0A 2HEWF 5CFCB 5GLWA 4AI8A 1QH6A 2W91A 1ZZ7A 4JC1A 4NMIA 1RL3A 1B35A 3NV1A 5LBEA 2ZZJA 3F95A 1LU2A 3ZFFC 3AXEA 3PURA 2WYSA 3SKVA 3R05A 3WDUA 3HOBA 1AUYA 5F5CA 1FYUA 4YZ3A 5FZ9A 2VTXJ 1RUF3 4EV0A 5A32A 3CBNA 1XNKA 1QOOA 4L2NA 1TZOA 2JDNA 3JBG3 3LFIA 3AMHA 4XC9A 2RM23 2RDNA 2VZVA 1ZZCA 1AR81 2XUMA 1GV9A 3CNAA 2A7AA 3MUZ1 1WBFA 4AG4A 2QQMA 2EAAA 2ZGRA 4AZZA 2XR4A 3KF3A 4ZZ5A 3TOJA 4MGYE 5DUWA 5BNOA 5ANNA 5FY7A 2VTFA 4XZUG 2ENRA 4WVVA 4LE4A 4RQPB 2JDHA 2DU1A 1LOEA 5IVYA 1MS5A 4R8HA 3A22A 1E57A 2BP6A 2UYBA 1PO23 3LEKA 4S2DA 2R49A 4COVA 4CUCA 2J1UA 1RUD1 1ENRA 4N8MA 1D7PM 3ACGA 4CP2A 3MF9A 1U5YA 4RYDA 1SLIA 1W8TA 2DVDA 4GMP0 4MHRA 4CDWB 2CNAA 2WNUB 3T3YA 1MVQA 1R082 4AQTA 4DO0A 4GB33 4XFHA 4AFMA 5C9AA 1WA6X 5C4WB 2R32A 4AAXA 3OGSA 4PDWB 5DXDA 1HB4A 4EN0A 1RXGA 4HPKB 1S4CA 1W0PA 3EB7A 3MI8A 4FPJA 4MGZE 5EJ3A 5K9YA 1XRUA 4XMIA 1OQEA 4QDRA 4A45A 4BM8A 5LA1A 4QPIB 2QCSB 4FPKA 3DCQA 1PVC3 1PO21 4MLOA 1UOGA 2X5IB 3H3LA 3OYWA 5C6CA 3VD9A 2JWPA 3C3VA 3I59B 3WUCA 2BNMA 3FBYA 5FZOA 4MG2A 5CISA 2R1BA 1RVF2 4ONUA 1N1TA 1X8MA 4Y1YA 4CDUA 1XYOA 4UT5A 1GP6A 1TNFA 3THTA 1YYNA 4YW4A 3WNKA 5AFEA 1Q8OA 4HFSA 5ANQA 1ODNA 1C8M1 3GXUA 3NAPB 5A6XA 3TEXA 1TME1 1UY1A 5H9QA 3ZR6A 4I3PA 2RS12 2OX0A 4DXZA 5DAPA 2GALA 1Z78A 4P9GA 3GCXA 4R52A 2CHHA 2RMU3 3T2PA 2V09A 2WRAA 4AVBA 2ERFA 1ULCA 1DQ1A 1W6OB 2P3JA 1YFWA 5B2GB 1VMFA 3H1YA 1W90A 5JDBA 2A3YA 4HETA 3HNYM 3DKQA 3J4UH 4ASLA 1V6MA 1JYVA 3PUQA 5D2AA 4BE3A 2XBO1 3D82A 4Q26A 4DZGA 4I0AA 4EZHA 4P9IA 5FZHA 2AREA 2NMNA 4AI0A 4KL1A 2D7FA 1QIQA 2BBAA 2C0ZA 4MXWA 3UGFA 4EYUA 4IEVA 5FQ0A 1FOD2 1CPMA 4B7KA 4DRRA 1XPWA 4D69A 5HCHA 3O1RA 3MUY1 4WZFA 3TEZA 1IQAA 4N43A 3TNPB 2P6HA 2Y60A 5IVFA 1NXMA 1UMIA 2CYFA 3GZUC 1W2OA 4LJHA 5F6LB 1PK6B 1H8TB 2R6QA 2GMEA 4GD4A 4HVRA 2WA3A 4MH0E 3H7JA 5G04L 1LODA 5K8SA 5A80A 3CJXA 5A3OA 1GFF2 1XJAA 1JZ4A 4YLZA 4FQZA 5FZAA 5KHHA 4DRVA 2PAEA 5T50A 3ZDVA 2X09A 2YDEA 4MADA 1NQDA 3POJA 1BBT3 2DCTA 5B4NA 4Y1VA 4IW3A 5F6KA 2VD7A 4QMAA 1AR62 3UV9A 1HQLA 1KXGA 4P5YA 2VBPA 4BIFA 2P5BA 2XJVA 2Y26A 3MW3A 1J3PA 2IXCA 3TN93 4P14A 5FMOL 3VD3A 5A3LA 3FUQA 3RPQA 3ZM8A 3VBHB 1VR3A 4FPYA 2RG4A 5ERLA 5FPVA 1CVNA 3FFZA 4EN9B 4GWIA 5K0UA 2MHFA 3I3QA 3N7LA 3ZN5A 4Q4Y2 5BNPB 2XKOA 5LBCA 4NIGA 3A7QA 4UFLA 1DGRN 1JHNA 3IPVA 1BBT1 1WLWA 2VVFA 1QHDA 2WO3A 5BNNA 3ZYFA 1YHFA 2AH2A 4H2AA 3W5NA 4RD7A 1T2XA 1W9SA 4OI0A 2VW1A 5C3QA 1S0FA 1Q5OA 1VBE2 3VBOB 5FUNA 4UBGA 1UNBA 3BN6A 4O9GA 5F3EA 5CFCC 4OULA 1JW6A 1S0IA 3KV5A 4JDNA 4W65A 2GC1A 1KJLA 1W8OA 1HRV3 4OVEA 3SXWA 1R093 4IV1A 3I49A 1VBD3 4AFDA 1FPN3 1K5MA 1V00A 3IN9A 2V5DA 1US2A 5EV7A 4LNVA 1C8NA 1W04A 1PIV3 3DUIA 3ITQA 3OUIA 2RVAA 4L9BA 5C3PA 1EV12 2ZACA 3POSA 3RRDA 1RUG1 2BEOA 1HJGA 3ECQA 1AR92 1G9CA 4BU2A 2VZRA 2YBKA 3K46A 3PDQA 1MS1A 3N9QA 1DLCA 1RUJ1 2JKXA 1BEV2 3SCFA 1C5HA 2D6KA 1ZBA2 2ZA9A 1AYN3 3Q8CA 5DUXA 4FP3A 2BVVA 4OQ9A 2WABA 4YM3A 1BJQA 1HJFA 1W8FA 2VMHA 1OHFA 2F6BA 3FLTA 4RQPC 1LOAA 3UKNA 5L7OB 1R091 3WQ1A 1VBD1 4ZKTB 2ZX2A 1W3XA 1DLLA 2GC2A 1JI6A 2HWE1 3RZJA 3KMHA 2KXLA 2VVDA 1WA4A 1VRH3 3OGGA 1FMD3 3C7EA 3T2QA 2XUEA 3GZTB 3J7MA 1DGLA 1VAKA 5FXXA 1OI6A 4CDWC 5I0DA 4LHKA 2WNUC 5FZ0A 2FDKA 2Q4SA 1D0GA 2WFF1 1UIJA 2A3XA 4OI2A 5EXOA 3DN7A 1O8PA 3J7LA 4QU2A 1SQ4A 1IGOA 2QQUA 4WVWA 3MLKA 5C4WC 1W2NA 2FDHA 2A70A 2BOJA 3K2OA 4PDWC 2AEZA 1A78A 1AYN1 3DF0A 4QHZA 2JE7A 1MPXA 2ATFA 1H1IA 1HB1A 4OHXA 2EALA 2WS92 5HBAA 1VBB1 3MFAA 1W6NA 2H6BA 4QQOA 4XIOA 1Y4WA 4M3CF 5FBZA 4A7ZA 3RGBA 1CQ9A 4QPGA 3ROUA 5LEKA 4EROA 5F37A 4YM2A 4XJ9A 2VM9A 3ZSJA 3ZXLA 3AP6A 4AEDA 2Z69A 5HCAA 3MHZA 2E53A 2ADEA 5FLJA 3KLSA 1O4TA 1AR72 3AL5A 3FL7A 3NAPC 3CHXA 4OHWA 1SLLA 3OD4A 4PQ9A 4AHZA 5CADA 3I7DA 4J1XA 2D6MA 3SCHA 2XOMA 4E8CA 3D0JA 3AC0A 3PUAA 4NPRA 5IVJA 1JZ7A 3BTYA 5DZGA 4DEQA 3MIFA 1S1AA 1NY72 1VBA1 2HH9A 4R4ZA 1W8UA 5A6YA 5EIYB 2PHXA 1JUHA 3WEZA 5FWEA 1K12A 4Q0PA 5J36A 1OUXA 2BGPA 1POV3 4AOCA 1IG3A 4A6OA 2HWF2 4XQWA 2OS2A 2VULA 2ZCWA 1I5PA 4Q29A 5FXVA 1NLRA 2WZPP 2W46A 5JOZA 3SH4A 2YB7A 4L99A 3I8TA 4WM7C 5A7WA 1NZIA 3WDXA 1HX6A 3POBA 3NQHA 4ZY9A 4YWAA 3RVHA 4JV4A 5JPNB 1PO11 4LUMA 1G9FA 2HJIA 1VBC1 5EYYA 3IM0A 1R083 3ABZA 3BALA 4YGCA 4META 2ETEA 2YHJA 3V0AA 2ZX1A 1KS5A 1WLCA 4Y4YA 5CFDA 2VR4A 2ZGMA 3RZZA 5C71A 5KXBA 1L7RA 2W1SA 4C0BA 3DV8A 3CKHA 3LB9A 2IZWA 2EIEA 2IXJA 2PMWB 1W6MB 4HL0A 4MUVA 2HKXA 4FI9A 4NHKA 1M4WA 1POV1 2PHLA 3LEMA 1RJ7A 3OG2A 1H8TC 2Q8OA 2J1AA 2WNVC 4LLFA 5C8CB 4OMCA 2JDPA 1SMVA 1UMHA 3NJYA 4HKLA 4X8NA 2E31A 3BTAA 5BPXA 3WSOA 5LK5A 2NN8A 4BJ0A 5IVCA 1DHKB 3T4VA 4EWDA 2R30A 3DYMA 1AYM2 1RHI3 3CZUA 2JXAA 5DDJ1 2UY8A 3B9CA 1NUKA 1H2LA 4QGLA 1GR3A 2P34A 2RS13 2WQ8A 2BGCA 3HJRA 2G1MA 2VAUA 3KT7A 4RA0A 1CAXB 3SLIA 4HVQA 5KR7A 5T5LA 3VGIA 3ZSLA 5JZGA 1MS4A 2JENA 5FP4A 1CAVA 4DB5A 2PHWA 1C1LA 1LNSA 1UZWA 2W1WA 1YUDA 3VBHC 1BKZA 3K3NA 1FV2A 2Q30A 5FYHA 2BWCA 5T5OA 1RHI1 5CVRA 4R9DA 4YZ5A 2VECA 5JSPA 2XJQA 2ZOEB 1BVVA 2ZEWA 3NL1A 1FOD3 1W8NA 1ZA4A 1KEXA 1Z7S1 3OY8B 1P8JA 4U2AA 3M3IA 5JMCA 1G86A 2XQXA 4LIUA 2DFBA 3N36A 4ZXEA 4CDQA 1CIYA 1SACA 3GALA 4DMIA 1IZ3A 5CG8A 1WLTA 5HV0A 2ZAAA 4IE0A 1UXXX 5JSOA 1AR82 2P17A 2W1QA 3E97A 3HD8B 3ORJA 4UFIA 5L9RA 3S0MA 3C7FA 1H9PA 2QQIA 3T1MA 4EN6B 1OOPA 1LR5A 3DKWA 4PHZA 2OT7A 4YW6A 1JZ5A 1CX1A 4LBQA 1EAH1 4QB6A 1W2UA 4IEZA 3ILRA 1YFYA 4DQAA 3ELNA 3NV2A 3GYDA 3CDZB 4ZONA 4M01A 1PMIA 4NJ4A 1VRBA 3U1XA 1PMJX 2D44A 1RUD2 3JBG2 1NT0A 4UFHA 3EXUA 1WMEA 2GC3A 4KU8A 5LB6A 1NZCA 4YNIA 1Q8PA 1J58A 4CU6A 1W03A 4JKLA 4NIHA 5ABJC 5DUUA 2W95A 3ZPOA 3ZXEA 4B1MA 4Q4V3 2VUCA 2XJTA 3B01A 4PI2A 4W6YA 2CWMA 4XETA 5FKCA 5GJ6A 4Q0VA 2ET1A 1UU5A 5L7OC 2D5FA 2JDUA 2QJVA 2OUJA 5JLVA 4Q4Y3 3Q8FA 2ZX0A 2OIIA 4IGOA 4CPBA 2K46A 3VBSA 2E6VA 1GQHA 3ASIA 3FX3A 4QPYA 4E2SA 2VNRA 4BLJA 1PO22 2GZWA 3BPSA 5LEJA 5IHRA 5CKMA 5F5IA 2HWC3 3MZHA 1F4AA 4IDZA 4YFWA 3P3PA 3N9NA 3NVCA 3O7OA 4UAPA 5LA2A 3ZFEA 1DYKA 3D3AA 2XPJA 4CP9A 1XYNA 1VBE3 1ZZ6A 2W9XA 2FCUA 4KI5M 4NUBA 1OA2A 1F4HA 4TXWA 5LBBA 4O61A 2ZXQA 2WAOA 2ZBJA 1SLBA 2A75A 1DGWA 1TME2 4CEYB 4Q4V1 5KHKA 4AL9A 3I2OA 1OURA 4XFFA 5JIUA 1G9DA 1PMHX 1SZBA 3N35A 3MBWA 3AMMA 4HMZA 2XXZA 3ENRA 3LIHA 1ND3A 4FFFA 4DS0A 5L36A 1HV1A 5IJRA 3ZXAC 4UW6A 1J59A 5FAXA 1HN0A 4AAPA 1HXS3 5F2WA 5E16A 3VBRB 2HWC1 1EV13 3I2DA 5CEHA 1HDKA 4NIAA 5APAA 2XBO2 1C4RA 3K51A 1UOFA 4NHMA 2XLGA 3G6JB 3WX5A 4ATFA 1B35B 3ACFA 4EJRA 1QMJA 1GP5A 1E5RA 5IVBA 1JHJA 1BEV3 2UWBA 2ZGKA 3CEWA 1ZBA3 3T4HB 2DYCA 3QLQA 4P9YA 3R6SA 1WW6A 3HN3A 4JQTA 5A32B 1QJU3 2VZ1A 1DQ6A 4SLIA 3WNLA 1ND2B 1OLMA 1W8HA 4DUXA 3TAYA 4NN0A 2E32A 4XE9A 3VDBA 3MFCA 2XLFA 1SLCA 2H0BA 1QF3A 5I93A 4F3JA 1GSLA 4JZRA 1HXS1 1ZREA 3I2JA 3BVCA 4CVUA 1PZ7A 1MZ5A 4CEWC 4LO4B 1W0OA 3M1HA 1WBLA 1VAVA 2GNBA 4UF0B 5EJZB 3HR9A 5FZIA 4K21A 3AKQA 4I01A 5FP9A 3VHOA 4LA3A 4CXWA 3IMNA 5IK4A 4HK8A 1LOFC 2RR11 4DEVA 4RR3B 3HMYA 4Q1RA 4Q4X1 4Y22B 2HEYF 1NCQC 2BOIA 2YG0A 3UJQA 5C3OA 1PM4A 5A33B 5JOYA 1UKGA 1V0AA 2V73A 2Y6JA 1V6IA 1E5IA 5EPAA 1OKOA 5FZCA 1PVXA 5FZLA 4EWAA 4ZU4A 5ACA1 5C33A 1GOHA 1JYXA 1PGL1 2EAKA 3U4XA 2W87A 2FMYA 5C8CC 4XUTA 4B4RA 2BWAA 2FZ2A 1U12A 2W08A 4S2GA 3H42B 3O5SA 4LO7A 3OEAA 3AM2A 4HN1A 1SLTA 4LIVA 5C9AB 5JXJA 4Y1XA 1Q8SA 3VHRA 1NCRB 1GZWB 4R9BA 3USSA 4AGRA 4OI4A 5F32A 5FYUA 5FY4A 4FOVA 3B94A 2C4XA 3HQRA 4LITA 2WKKA 2Y34A 1LHVA 4DY5A 1YCIA 2R041 4F7ZA 4FTEA 2D6LX 5FXWA 1BBT2 4G9SB 5A6QA 5HCFA 3CJIC 4NPMA 1FNZA 5FMDA 1LAJA 1RUNA 1N3PA 1Z0HA 4W4ZA 2WNEA 4GH4A 1PX4A 2VGDA 4QXCA 3LE0A 4BQ2A 4OLLA 3AYCA 4XFBA 4CDUB 5FYMA 3IKWA 4RHV1 5KBFA 2EIBA 1HIXA 3KM5A 3GBFA 2ARXA 4ASKA 1CZVA 2PFWA 4MGQA 4NIDA 4XUPA 5AFBA 4E9KA 2VZTA 5LA9A 4GWMA 5L9VA 2QQNA 4JGYB 3P5BA 1FT9A 1RMU3 1S0JA 1W6QA 1WLDA 3ZYHA 3OCPA 4BISA 2Q0AA 3U10A 2VXJA 4XBQA 4YW3A 3ZN6A 1ULEA 1W3VA 2E33A 2VO5A 3AFKA 3B3QE 3USUB 1CGPA 1QJY1 3W58A 1SFNA 2FBEA 1OQ1A 3IAPA 4P9WA 5LZ6A 1QDCA 1RUG2 3NJVA 3PIJA 1UD1A 3H8UA 2MPFA 3PTRB 1K5JA 3LQCA 1ZRRA 3VBUB 4BYYA 3T0DA 4FFHA 2XMLA 4H7MA 5E1RA 1RUJ2 4YARA 1NE6A 3K48A 4RGAA 4YVSA 5FQ0B 2QQWA 1QH7A 2R0FA 5JR2A 3NRUA 4HXCA 1RMU1 1LGNA 1AYM3 5D21A 3KHCA 2E9QA 2IXKA 3RI8A 4HG6B 2DURA 3RMXA 1R092 4N43B 4V2WA 1F5FA 1VBD2 3BODA 4FFIA 2P4EA 1FPN2 2HWE2 2ZAHA 1GOGA 2VG9A 4NOTA 4RGKA 3WF4A 1W9TA 3PU3A 1QOTA 3OSDA 5FZ6A 2BW8A 5E6HA 2ARCA 2C24A 4B29A 5C3SA 3B93A 1O91A 3U4SA 1UY3A 3WP6A 5ISLA 5CZKA 5J7MA 2WFF2 1QJX1 1Y7BA 2PHRA 3KCXA 3OGVA 3SCGA 4KNCA 4W6XA 4AGGA 1BMV1 3ATGA 4Z1VA 4X6RB 2ZGSA 3NNFA 2FDIA 3C2UA 1YIFA 4JRLA 1STMA 2Q8CA 1AYN2 2VXRA 3E5XA 2DUPA 3POWA 3LWCA 5D1IA 2OKXA 2P6CA 3AMNA 1EPZA 1HQWA 3IDCB 1VBB2 1QKQA 3QOPA 4HN0A 3UT0A 3LKJA 3HN1A 4QM8A 4FAGA 4PT6A 1ACCA 3J8F1 5L73A 2WN3A 2HBTA 5A6ZA 2NP0A 3AYAA 2BPA2 4Q4W1 2DVFA 1OKQA 2LALA 1XSQA 2KR2A 4TSVA 3ZKYA 4D94A 2QFEA 3QH7A 5FZFA 5C7GA 1CAWB 4GKXA 2RDSA 4TN7A 1OLRA 2CY6A 1W05A 3ILNA 4K3UA 1AR83 3O0VA 3U07A 2R1DA 4I09A 5GZCA 2VNVA 4CEYC 3TEYA 3WUDA 5G05L 1AJOA 5EP9A 2QQPA 2A6WA 5FWJA 3Q8AA 4JGZA 4QB1A 4BQXA 5F3CA 3M8LA 5FMOS 3AXDA 5JI7A 4OHYA 1VBA2 3LEGA 3RJRA 4IQPA 3O1PA 4DXRA 1AX0A 1CZSA 3KB5A 4BH9A 1VMHA 2EXIA 3VBRC 4W50A 4PI0A 3ZFFA 3FC0A 1RUD3 2VQTA 3FHAA 3JQXA 4JHZA 4Y5TA 1FATA 2O1QA 4B7EA 1VB4A 5C3RA 1V6LA 3RSJA 1PO12 2ZPXA 3WVJA 1B35C 1JN2P 4YW1A 5JOWA 1IOAA 3SNMA 1OD3A 5JXGA 4AWDA 5AVAA 2WYFA 4H55A 3P1IA 4FPOB 4GULA 1H4GA 4AW7A 2WUHA 4DXTA 4YZ2A 3WDVA 1N3QA 1ND2C 4XHXA 4MX3A 4BK4A 2LW8A 3AP7A 4XFAA 3KVBA 3LD8A 1SG3A 4AE2A 2X29A 3RZGA 4N53B 3POEA 4FPCA 5L9BA 3D8CA 4O65A 5FZ3A 5LWBA 2B5HA 2JJ6A 5DG2A 3WHTA 1REEA 1X82A 4LOSA 1SDDB 5DQ0A 3RZHA 1OH3A 3AP4A 1GNYA 4XOGA 5T5JA 4FXGB 3T30A 5BNOC 2NYYA 2WIIB 3ST7A 4Q0UA 3FE5A 1UXZA 3BTZA 5JSRA 1LOBA 1LOCA 3OBRA 4RR3C 3VKOA 1VMJA 1T6BX 2XLAA 2ZMNA 4QQLA 4LR4A 1C8M3 1XOYA 2P2KA 2IVIB 2WLQA 2WO2A 1TME3 3JD73 1RUI1 4N7UA 5DZFA 3S7IA 1G7YA 3HQXA 3NNGA 1AVBA 3WG3A 2GNMA 1OSGA 4QXHA 2Y6LA 4XBLA 3UESA 1W6PB 1OF3A 4LO8A 2VE1A 1UQXA 2A73B 3CIHA 1UY0A 2VOWA 2CU5A 2YZ4A 3A23A 1QGLA 4XACA 2GN7A 4A44A 2ES3A 2JE9A 1NCRC 2QVSB 2V5YA 1RYYA 3DECA 4FOYA 3JZVA 3WF2A 2NMOA 2XBO3 4C1WA 1W28A 2L9LA 2CDOA 2YC0A 1E5SA 4GZ9A 4NHXA 1RHI2 4X6QB 1PNGA 3V0BA 1BCXA 4XF0A 2YU1A 1LEDA 4A7YA 3JD71 4LBJA 4E2QA 4HOOA 3GBWA 3HAGA 4PLMA 5FZ1A 4QPGB 4WVZA 1UYXA 1YJKA 3C7HA 4R9CA 4LUKA 1Z7S2 2VJXA 3O12A 1LESA 2PQQA 4E4DX 2D5HA 1FXZA 1H2KA 4WM8A 4FTSA 4AI9A 3CLPA 4AR2A 4EN7B 5LATA 3URFA 4FFGA 2BU9A 1GMMA 5ABJB 4A4AA 1YI7A 4XTMA 5LBFA 3BI3A 4BK5A 2NQYA 4LKEA 4JGYC 4QHBA 4RS5B 2G9ZA 5FKBA 2OXBA 2ZTNA 1WMDA 3Q8EA 1F5JA 2WZR3 4RFT0 4NWVA 3H8XA 5H9PA 1KS4A 3KZ4C 3NMBA 4I3GA 4IL7A 4AEJA 1AZDA 3VBUC 4M3CA 1NA1B 5I0TA 1ZVFA 2W0XA 3I97A 1GP4A 1UKRA 2JDMA 3UJOA 4P5HA 4CCKA 3WT3A 3VKFC 3UGHA 3AFGA 3MEPA 3NV3A 3OF1A 3ZXFA 1WCKA 4UYBA 3IZOA 1QXJA 1RJ8A 1GZTA 2WZR1 3MV11 3T2OA 3RJ2X 4N43C 4XJAA 1H2MA 3VLBB 1YI9A 2A6YA 4OFGA 1IS6A 3WG2A 2HWB1 2VZSA 2VL4A 3WG1A 1DYPA 2YGLA 2JG9B 1IPKA 1YWKA 3MYXA 4MZUA 2B9VA 4PLOA 4DXSA 2D43A 1DYOA 4GA9A 4CU8A 4ZS2A 1CAUA 2PELA 1NX9A 3RWNA 1RITA 5D8AB 4XJUA 3L9JT 3CZJA 1AL0G 1QU0A 1O4ZA 2YROA 3ZFGB 4D6SA 2X53S 2OUHA 2ZGUA 1MZ6A 1LB2A 5FZEA 4Q4V2 2RS51 2VH9A 2ZKNA 4NO4A 4UW5A 4XFGA 3D4KA 5I91A 4J25A 4JDOA 3FMGA 3N3HA 3H0OA 3WF1A 2PAKA 4OUEA 1NOVA 3HEIA 3VDDC 2A6ZA 1PGW1 1UOJA 5JZGB 1MQTB 3NKGA 3WQ0A 2H0VA 4PQQA 3JQWA 4NRQA 2HWC2 4DY3A 2FCTA 1JZ8A 3HBZA 4N9IA 1RUG3 4D8MA 4KGGA 2YC2A 2AACA 2PLV3 3WF0A 1JYWA 3WW1A 4XPVA 3WW4A 2AGSA 1OT5A 1X8EA 4Y20A 2D97A 1ST8A 2CSGA 1DQ2A 1RUJ3 2QQKA 1DQ5A 4GJZA 1GWMA 4CTEA 2VNOA 3W21A 4AQ6A 1C28A 4YSFA 4Q8KA 3H9AA 2NPIA 2IFRA 4KBZA 1GOFA 1NXD1 3MW2A 3ZXGA 5CFCA 1KJRA 2UWAA 1XQNA 1APNA 2P3YA 1IPJA 2Z2SB 3J7NA 2HWE3 4DPNA 5A70A 5BYNA 3GDBA 5FZ8A 1ZYBA 1YIPA 1HXS2 3VBFA 1GUIA 5KC6A 4PCRA 3AP9A 2WR9A 3A0KA 4H3WA 4MSVA 2BNNA 4ES8A 1XC6A 2PLV1 3AKRA 3HNMA 4QQHA 2BGOA 2WFF3 2O0OA 1JYIA 3V56A 2RR12 4BWOA 4AVAA 2WLPA 2VOKA 3FLPA 4QT6A 3I3EA 4BOWA 5CBLA 1UIKA 2B45X 3LIGA 1QJU2 3IMMA 2F4LA 1VBB3 2R7EB 4N53C 5ACA2 2QZ2A 4YGDA 3ZXDA 1PGL2 2Y6KA 1SBDA 3LA7A 4ZS3A 1W9YA 3AMQA 5AVPA 3I4IA 5FK8A 4O9EA 4E27A 2TEPA 2B8MA 4QWNA 4MGTA 2LTNA 5A3TA 1HKDA 3ZYJB 1DGRA 1OC1A 2V72A 2WT2A 2Y6FA 2ZHMA 2BFUL 3TRSB 3ZYGA 2W94A 4CUBA 3AX4A 2I74A 2LM3A 3KF5A 3N9OA 3ACIA 3UYJA 4HONA 4CDWA 2WNUA 2R042 3MPPG 3VBSB 4WVMB 5FIXA 1COV1 1VBA3 2ZGPA 4AI3A 5DAXA 5C4WA 3E1F1 1HRI1 5FJHA 4URTA 2C9AA 4PDWA 2DFCA 2JE8A 3EO6A 1QXPA 1JH5A 4NRPA 4QPIC 2TUNA 3OBAA 1G9AA 2X5IC 2Z4FA 1EUTA 4RHV2 3TWIA 1U5IA 2XHNA 4CCCA 3ZOIA 3NJXA 1X36A
chains in the Genus database with same CATH topology
1LKNA 3DPRB 3LSDA 3PJQA 3NSTA 4B3NA 4D7TA 5T5PA 1PO13 4GALA 4AF9A 3NW4A 2FMDA 4LEJA 1VBC3 4OI1A 4AXOA 3ES4A 2E7AA 4LHLA 2ZGTA 4AHYA 3PNAA 5JPMB 4OZXA 1QJY2 2QDNA 1WD4A 2XH6A 3ME2A 3MIEA 2ZJCA 3H3ZA 1RTVA 4WBBA 1ENSA 3U0ZA 1NG0A 4K20A 1LCLA 1MS9A 4FOQA 1F2NA 3MGUA 4JTOA 1AL23 1HW5A 1N1VA 4CP0A 4RS5C 4NWWA 4DOUA 4YZ1A 5LRRA 3J9SA 3JCIA 5KXCA 4I0BA 5EWSA 3D6EA 3ZMNA 1RMU2 4AVVA 2CGNA 4Z8BA 4COUA 4WM7A 4XJWA 5DDJ3 3OJBA 3WQ7A 4XFCA 3MLLA 1MS0A 5AC91 1A8MA 4N90A 4AQ2A 2R071 3BOPA 1NA1C 2I45A 2MEV1 4IESA 1PK6C 4ISRA 1AL21 1Q8QA 4IEUA 3ZSEA 5CIRA 4QGNA 4LE3A 3IDBB 1BMV2 2PHUA 4LTAA 1RUE3 3MDPA 5H9RA 2EF6A 1H8TA 4R9AA 2WNVA 3B9IA 1ULDA 4ASMB 4BIOA 2XG3A 2JG9C 4LO6B 1ZZBA 1Z7S3 5K7PA 3GBGA 3EJKA 3MIDA 3VV1A 2GSYA 4Q4W2 1ZX5A 1D0HA 5GLUA 5D8AC 1ZZ9A 3ZFGC 4FXKB 1YNAA 4QQ2A 4AVTA 1RUE1 4XXPA 4YVWA 4EWEA 1KD7A 1WCSA 1SCSA 2F4PA 1EAH3 4KGQA 2XJRA 5BNPC 1AF9A 3M3QA 4N7IA 3VBHA 2X8KA 5E88A 4CP1A 3EQEA 1MQTC 1Q56A 1V9U1 1LJ7A 3SMHA 2DCKA 4XILA 2Q1MA 3B7MA 5I0RA 1MZEA 1Q8VA 2GN3A 1LENA 2G9GA 5I8SA 3VBOC 4AYUA 4XJ8A 1UPIA 2P3IA 2UU8A 3HWJA 4FP2A 2YMZA 4D7SA 5I8TA 3ZN6B 4BPZA 4Q27A 3WG4A 4FBFA 2QDRA 1S55A 1WD3A 4NR1A 4FPFA 4BZ4A 2GH8A 2TBVA 3LA2A 5FOBB 4V1PA 4E2GA 4XHBA 4CDXB 2DTYA 4LBMA 3MIBA 1FV3A 2ILMA 4YGBA 1UL9A 2KA3A 4IV3A 3JB8A 1G6NA 2DV9A 2Q5TA 4YVSB 3BB6A 3IDEA 4K7JA 3RI9A 1I5ZA 3FHIB 3AMPA 4GWNA 2D40A 5CNAA 2PN5A 5CA6A 1PGSA 2DVAA 4NVPA 5KHGA 5ABJA 1POV0 2B9UA 1R1A3 3RYKA 1W39A 1X7NA 3A4UA 4A2UA 1Y9QA 3HT2A 5L7OA 1DF0A 4XYXA 1CJDA 4KWJA 4N9HA 3KS7A 3OGJA 1SBFA 1CESA 2G9FA 4YZ4A 1C8M2 1U0AA 3JD72 1O3TA 1WW7A 3PVNA 3FLRA 2Y38A 1D4VB 1J3QA 3OPZA 3WW3A 4C91A 1R1A1 4XF1A 1XNDA 2WINB 1V6JA 3DPRC 2CWSA 3ZSMA 1Q3EA 4JGZB 1H1MA 1OPMA 1OMIA 3ZX7A 1VJ2A 2RR13 3WXPA 4HK9A 4Q4X3 4PLNA 1DBNA 2FHRA 3BCWA 1CR7A 1MR5A 5ACA3 1ZRCA 1Q43A 3QH6A 5H9SA 1FX5A 5GLVA 3ZXJA 4XMAA 3VKMA 4XF9A 1FAYA 2DVGA 1KQRA 2GU9A 1KITA 1GANA 1QQP1 1DDLA 5FO8B 5KXDA 2WZR2 5KWRA 3WP5A 4CEWA 4IERA 1WUVA 4K6BA 1O4YA 4Q0SA 2R043 4QM9A 1OLQA 1LHNA 2AYHA 1LOFA 2IXLA 5BXXA 4ITCA 4KG8A 1MEC1 5T3NA 4TZDA 1NCQA 3ILFA 5DZEA 4RHV3 1W6MA 1Y3TA 1N1YA 2P37A 1XE7A 5C8CA 2RS52 5E8AA 4XJZA 2IC1A 2NZ9A 4PBOA 4CRQA 5CAZA 1PGW2 4M00A 1QJY3 3EBRA 2WJSA 3R4DB 2UURA 3OYWB 4AGVA 1FNYA 2GDFA 4AVCA 5KHJA 4JQRA 5I8YA 5JOXA 1D4M3 3CJIA 4AI2A 1ENQA 1UMZA 2YXSA 4MGKE 1H2NA 5SV5A 1G9BA 2XB6C 1YO8A 3M3CA 3IWZA 4IEYA 1LRHA 5CG9A 2VUAA 3TBDA 5GKAC 1LHUA 4D7YA 4AQSA 4WM8B 1RUH1 2ZHLA 1HV0A 4XZPA 5JI9A 1OPOA 3W9AA 4JTNA 4YGEA 1BZWA 1O7FA 2DUOA 4HT1T 1D4M1 3OY8A 3QBQA 5KXEA 2PLV2 2RHPA 4DNYA 3S6PA 1QJX3 3L2YA 3ZIWA 1S0BA 3ACLA 1SLAA 4KBBA 3QACA 4H14A 1EP0A 3ZMOA 3OBTA 4MXWB 3M4FA 1UZZA 5C8WA 2VW2A 4BA6A 2XVLA 1ZBE1 5GM0A 4FAHA 4MXVA 4IEPA 1TQ5A 3S7EA 3B00A 3RQ0A 4CDXC 4QGMA 4M3CB 2QNKA 2ZMLA 4BMBA 3J8F3 4Q4W3 5BY5A 3KQRA 2XWJB 1TMF3 1BXHA 3ZYIB 4K1YA 2XJUA 4J6GA 3WY6A 5FPXA 4YYOA 2GMMA 2D98A 3VL8A 3WCSA 3R0RA 4GMP1 1SEFA 5DG1A 1COV2 3H50A 3EHKA 1HRI2 1AJKA 1OFSA 1CAUB 5FFOC 4F8AA 2K2SA 3R4SA 4AFCA 4QD2A 1V6KA 4GKYA 2IXHA 2VMIA 2ZHKA 1DQ4A 3BPZA 1QJZA 3GHNA 4KWLA 3N7JA 1TMF1 3M3OA 2CGPA 2EXJA 1V6OA 4AFBA 1WW4A 5K0UB 3VHNA 4L92A 4C0HA 2CTVA 1H9WA 2YY1A 4M3CE 3IPVB 2VW0A 4YM1A 3NO8A 4YW5A 2A3WA 5BNNB 1D2SA 4CEYA 2ZMKA 2JG8A 4Z92B 2FQPA 3PTYA 1SDWA 3TYJA 4K8FA 4ZU7A 2C5DA 4LO5B 3IBMA 4JRAA 5KHIA 4G3YC 4FQ4A 3THPA 4Y20B 3LOIA 3DL3A 4MGIE 1UN1A 2HWD1 2VVEA 3POYA 2D6NA 4D3WA 1C5IA 3VBRA 1VBC2 3H1MA 1ZM1A 2BYVE 4IV1B 2R063 1TNRA 1ASJ1 1RUI3 4GXLA 1K5MB 2B39A 5JCTA 5AC92 4YM0A 3ZXKA 2WT1A 1QNWA 3NJZA 3VBFB 3VZMA 3WV6A 5I0SA 2R072 1DQ0A 4KU7A 3M3EA 2MEV2 4XW3A 1ND2A 1AL22 1V6NA 2ZS6B 3G7DA 1AHSA 3VZOA 1O3QA 5GZEA 3FBMA 2DCZA 3SISA 4PBPA 4UBHA 1S0EA 4XXAA 1IKQA 3WDYA 2DCJA 2UYAA 3L2HA 5DDJ2 5T54A 2R061 1RC6A 4P9JA 4XIKA 4RR3A 4Y22A 4PIXA 2WWSA 2O8OA 3VDDA 2PAMA 5A33A 2H6CA 1RUF1 1CONA 1OD5A 2AENA 5IUQA 5GLTA 1UPSA 3JBG1 1C3HA 1LTEA 3KT4A 2G4IA 5C9AC 2DF7A 5J3UA 1EY2A 2RM21 2XL9A 2CGOA 2ZGNA 5JPNB 1UCXA 1RUE2 2W52A 1T6GC 3NWKA 3ZIXA 2PHFA 4GIQA 1LHOA 4YG0A 1UX6A 4C90A 2D3PA 2JECA 1NCRA 1GZWA 1W6NB 2A5ZA 1JBCA 2BFUS 2VPVA 1V9U2 2D93A 4AFAA 3AJZA 4IEXA 1GZ9A 5FPZA 4H7LA 2BVBA 3CL1A 1QOSA 4AEDB 1RINA 4CDUC 1EYBA 1O5UA 4FPEA 2A71A 5CB7A 1A3KA 4B8EA 2AUYA 2SLIA 4GB31 5T52A 1EAH2 2QE3A 4WM8C 4COZA 1NYWA 4JGYA 5HXVA 2ZGLA 4ZXKA 2HWB3 4Z2WA 5J37A 1CPNA 4FO9A 2VUJA 2XJPA 3KT1A 5FOJB 2Q1ZB 3KD4A 1WW5A 3USUA 3KGLA 5CU1A 1DU3D 1KFXL 5KC5A 4BLIA 1PVC1 3AB0A 1RB8G 3T1LA 1RUOA 1QNYA 3JU9A 1IKPA 4WM7B 3V0AB 5GZFA 3WOGA 2RJKA 2NM1A 3VBUA 5CFDB 2BNOA 2RS53 3PLQA 2XHKA 2ZABA 3KSCA 3CO2A 3UKTA 3MPBA 1VAMA 4MVTA 1URXA 4BMEA 1R1ZA 5JR7B 1XU1A 2KM2A 4FVVA 1ZRFA 2RMU1 4XQ4A 1C57A 3VKNA 4I02A 3E6DA 1BQPA 4COWA 3B02A 1OA3A 2WNVB 1CD3G 3LOBA 4JVAA 4INDA 1NQJA 1JTZX 2OA2A 1GLHA 4Q2FA 4XTPA 4HLTA 3BOWA 3WCRA 1S0GA 1WMFA 4L97A 4P9LA 2JICA 2JKBA 1MS8A 3FZ3A 4I0WB 1YRZA 1R1A2 1DG6A 2E7QA 1CAVB 4RSUA 4JCKA 1I6XA 4FT8A 2D6OX 2LUWA 2R0HA 4LBQD 3WLUA 2YV8A 2ZHNA 1AXZA 1H8VA 2NLRA 1SFYA 3FFQA 3WW2A 4YVWB 5K0UC 3PJYA 4YG3A 4WV8A 1VLNA 1CAWA 2JEMA 4M0NA 5GALA 2OZJA 5HI0A 5IT6A 5LRSA 5L19A 2CL2A 3LGRA 1J1LA 5BNNC 2QKDA 4A3XA 2IFWA 1PZ9A 1YJLA 1YLLA 2DWRA 2JDZA 1B09A 5HCBA 4CDQB 1KDMA 3MF6A 3TNQA 4PIYA 3E5UA 5BUVA 1GNZA 1LOGA 2DCYA 3FJSA 1J3RA 1G8WA 3JUUA 2DU0A 1QQP2 3OD0A 1XE8A 2JD4A 5JWPA 4P9XA 1GICA 4SBVA 3M70A 1OOPB 1GQGA 3TN91 4LBQB 4XF3A 3WDTA 4IV1C 3LCPA 4S2HA 1K5MC 1XNCA 4Q4X2 1UU4A 3VBFC 1DZRA 3WNXA 2R16A 1RUC3 1COV3 4IV3B 5FREA 2XVGA 2XWBB 1HQNA 5I0UA 1HRI3 1MEC2 2Z42A 1N47A 1KFUL 1UU6A 4I30A 1VB2A 3GZAA 3RG0A 4JDMA 2DTWA 4RQPA 2NP0A 1IS4A 2D3RA 4Y1ZA 4N53A 1AXKA 2DVBA 3DGTA 3PMEA 3VHPA 3APBA 1RGSA 3ETQA 1F31A 4RGGA 1DZQA 2W68A 2ET7A 3IT8A 5FLHA 3BU7A 2HEVF 1HRV1 1V70A 2Y0IA 4LLOA 1NLSA 3AP5A 2E63A 1RUC1 3ZSKA 4IEOA 1FPN1 2XJSA 4YG6A 1XYPA 1H4HA 2RS33 4HPKA 1PIV1 3ZFEB 2RJLA 5GZDA 1N3OA 4LBOA 4AEKA 2EVXA 1W6PA 2VMGA 5J98B 3UL2A 5IK5A 1CIWA 4QPIA 4OUMA 4QX5A 2X5IA 3RDIA 1IS5A 2IWGB 5IK8A 3M7AA 4XQDA 5FO9B 3I59A 3A0NA 3AZWA 4L11A 4X8PA 1ND3B 2PTMA 4MYEA 1RUH2 4QPGC 5EFUA 5AC93 5JAXA 1VALA 4LULA 3NAPA 4AEDC 3VL9A 2E7TA 4MV2A 3H1WA 1S0CA 2R073 3E6BA 4YRDA 4E4SA 2RS31 1D4M2 2MEV3 2IXIA 1U5ZA 1WCDJ 1VRH1 2O8QA 3ES1A 5J09A 1FMD1 2EA7A 3INAA 4HBNA 4PF5A 4XFIA 1X50A 5JIAA 4PJYA 4AVSA 4RL7A 2QUOA 1W6OA 2CAUA 4I2OA 5TSWA 3H3UA 3IIAA 4UXAA 1LU1A 1ZBE2 2WSUA 2B42B 3E5QA 1VP6A 3U11A 4RS5A 1D2QA 2B7YA 1MS3A 1JOJA 4F83A 3WHUA 3PVEA 2XL7A 3N7KA 1MZFA 2VQ0A 3TB0A 2FZ1A 3WDWA 2A6XA 2XKPA 1QJX2 2I2SA 5FCCA 2PA7A 4CEWB 5CFDC 1NA1A 1S2KA 1NE4A 1PK6A 3R4UA 3B69A 3VN4A 4HVOA 4K9SA 4E4ZA 2E51A 3AZYA 1SBEA 1NCQB 3I54A 4DINB 3D5OA 1V9U3 5FO7B 1A6CA 3AZZA 3RYRA 5FTTC 2OYZA 3J8F2 2N7GA 3AZXA 4B4PA 2GNDA 1LHWA 4U36A 2JG9A 3CU7A 1TMF2 4Q8LA 3V64A 2CAVA 4IEWA 3RYPA 4WZCA 3VKLA 1CN1A 3KGZA 1RVF3 1MVEA 3MICA 3QD6A 4UW3A 4LT5A 5EYXA 5F9TA 1R081 3W59A 5D8AA 2EIGA 1FI2A 2K9ZA 3ZFGA 4GH4B 5JZGC 4XF4A 3GNEA 3LZZA 4M0HA 5F5QA 1UW8A 3ZDSA 3CJIB 4B4QA 5BNPA 3ALQA 4J1WA 1X33A 4YVWC 1MQTA 2HWD2 3AJYA 1XU2A 5F1RA 1W6QB 3ZYRA 3JB4C 4Y5Z0 2ARBA 1RVF1 4AI1A 4BCUA 1O3SA 1ASJ2 3BIWE 4Y1UA 3VBOA 1KDKA 2ZX3A 3VZLA 2WQ4A 4CDQC 5BV6A 2MNGA 2GH2A 2AZ5A 2RS11 4IETA 4TWTA 1I9RA 2I07B 3N4MA 1U5XA 2GC0A 1PNFA 1ZRDA 3MIGA 2K0GA 4OHVA 3O0XA 4IEQA 4A7KA 3AYDA 2D3SA 3MW4A 1OOPC 1PZ8A 4L8QA 3FWEA 2WL1A 1GYKA 2PHDA 3LSEA 2R062 5JVVA 4PIZA 1ULFA 1QXRA 1RUI2 2AR6A 4IV3C 1BK1A 1OQDA 2VNGA 1FOD1 3NKTA 1RUF2 3MLJA 3ZO0B 2VOVA 3RS6A 5E89A 1AR63 3S30A 1GZCA 3VZJA 1IHMA 3QCWA 2WSVA 2RE9A 2RM22 2UWCA 4LBKA 1REFA 2A6VA 2D6PA 4DFSA 3FUOA 3NV4A 4G4FA 4OHZA 3VZNA 3ZN4A 1QY4A 1YXWA 4GQ7A 1ALYA 3VBSC 2C1FA 4FOWA 4Y26A 1UF2C 2OW4A 1F9KA 3RMYA 1WGPA 4R4XA 1O3RA 1TE1B 4WVMA 4FTBA 3ZFEC 2QZ3A 1AR61 1XXNA 1QQP3 4Q0QA 2Z79A 3H7YA 3SHRA 1PM7A 2GNTA 2YGMA 1TEIA 4LBLA 2VQAA 4GB32 3DPRA 2OZ6A 4AHXA 1C1FA 1ND3C 2JG8B 1H1AA 1LULA 3HIFA 2ZX4A 4Q1PA 1VIWB 4Q4Y1 4OUSA 3ZFFB 4Z07A 3PHMA 3WINE 1UAIA 3ZPYA 3AZVA 4K40A 1MEC3 3VZKA 4ATEA 1PVC2 1YFXA 4HZFA 1XNBA 1I1EA 4XDQA 4YFZA 1JXNA 4QQPA 5EZWA 1LGCA 1AR93 3LA3A 2ZGOA 4W6WA 3SH5A 1VBE1 3O14A 3M2MA 1Y43B 4LA2A 1OFNA 4EN8B 1GNHA 4JAAA 3E6CC 1L3JA 4FPHA 4QXKA 5IK7A 4HSJA 1PHMA 5GLZA 4YW2A 2HWB2 5FLIA 1ZNPA 4ORFA 2RMU2 3D0SA 1DFQA 2EXHA 3KCCA 2B46X 1QWRA 1EV11 2P3KA 1BVP1 1EPWA 1REDA 2TNFA 4ZU5A 4FSJA 3UKVA 1AXYA 2ZZQA 4KG0A 1AR91 4BQ1A 4LBNA 3GHMA 3KCYA 4ISQA 1BEV1 1CJPA 1ZBA1 5GZGA 3RNSA 3VDDB 2CV6A 3WZ1A 3O0WA 1RUH3 5SV8A 1QJU1 1HLCA 4FPGA 2WS93 2XVKA 1LEMA 4CZSA 1A8DA 2HYKA 1ENXA 2GMPA 2SBAA 1CX4A 1CAXA 5T55A 4HKOA 2W39A 3WD5A 4C1XA 3V0BB 3Q9OA 3VUOA 4S2FA 1AR73 1DIWA 1JUIA 1ULGA 4FPLA 3B5LB 1ZBE3 4GH4C 5LK7B 3MIHA 3LAGA 3CF6E 2WS91 2WC2A 4NHLA 2XGXA 3WP3A 2YUEA 1SCRA 1UZYA 2EXKA 4XEZA 3OTFA 4KWKA 2HWF3 1KRIA 4UW4A 4TYSA 3TN92 4BHPA 4LHNA 3V65A 2GAUA 1AR71 1DGWX 3AKPA 1GKBA 1J1TA 2UY9A 3HT1A 5DUVA 1QDOA 1N1SA 1OA4A 3AK0A 4GMP3 3WP4A 2JX9A 5J96B 3GF6A 2Z5WA 2PYTA 3AKSA 2YYOA 1NY71 4K1ZA 5J48A 2DUQA 4HKWA 4XBNA 3AYEA 5FRAA 1H30A 4YVSC 4ES9A 4CDXA 5BNQA 3AKTA 2HWF1 2VOXA 4AHWA 1JYCA 2YPJA 1YFUA 2BUKA 1HRV2 1S2BA 3UK9A 4AK3A 3PVOA 4KQ7A 1AX1A 3ZYPA 1RUC2 1DZTA 3T2TA 1IS3A 2VY0A 2BTVC 1LECA 2PHTA 2VU9A 1PIV2 4CYDA 2WFPA 4HSLA 3SITA 2OPKA 3WR0A 1ZZ8A 2ZGQA 2HWD3 1ONAA 4HANA 4COYA 4IXLA 1MACA 4Z82A 4TLFA 4Y24A 3ZVXA 1M06G 2OVUA 4FCAA 1ASJ3 1AYM1 4AEMA 1O5LA 1H0BA 1S0DA 3N7MA 1F8VA 1RIRA 5FDBA 2BBVA 2RS32 2Y0OA 1VRH2 1I3HA 2ZKLA 1FMD2 3P3NA 2WQZC 5A3MA 4JGZC 2BQPA 1LGBA 1BYHA 1GBGA 1AX2A 3PVBB 3PMSA 2JG8C 2WA4A 4KH9A 3J26N 3SH3A 2WT0A 2HEWF 5CFCB 5GLWA 4AI8A 1QH6A 1ZZ7A 4JC1A 1RL3A 1B35A 3NV1A 3ZFFC 2ZZJA 1LU2A 3AXEA 3WDUA 3R05A 1AUYA 1FYUA 4YZ3A 1RUF3 4EV0A 5A32A 1XNKA 1QOOA 4L2NA 3JBG3 3AMHA 2RM23 1ZZCA 1AR81 2XUMA 1GV9A 3CNAA 2A7AA 1WBFA 4AG4A 2EAAA 2ZGRA 3TOJA 4MGYE 5DUWA 5BNOA 2ENRA 4WVVA 4LE4A 4RQPB 2DU1A 1LOEA 1MS5A 4R8HA 1E57A 2UYBA 4COVA 1PO23 4S2DA 2R49A 1RUD1 1ENRA 4CP2A 3MF9A 1U5YA 1SLIA 2DVDA 4GMP0 4CDWB 2CNAA 2WNUB 1MVQA 1R082 4AQTA 4GB33 4XFHA 4AFMA 5C9AA 5C4WB 2R32A 4PDWB 5DXDA 4EN0A 4HPKB 3MI8A 1W0PA 4FPJA 4MGZE 5EJ3A 5K9YA 1XRUA 4XMIA