1PMIA

Candida albicans phosphomannose isomerase
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
440
structure length
440
Chain Sequence
SSEKLFRIQCGYQNYDWGKIGSSSAVAQFVHNSDPSITIDETKPYAELWMGTHPSVPSKAIDLNNQTLRDLVTAKPQEYLGESIITKFGSSKELPFLFKVLSIEKVLSIQAHPDKKLGAQLHAADPKNYPDDNHKPEMAIAVTDFEGFCGFKPLDQLAKTLATVPELNEIIGQELVDEFISGIKLPAEVGSQDDVNNRKLLQKVFGKLMNTDDDVIKQQTAKLLERTDREPQVFKDIDSRLPELIQRLNKQFPNDIGLFCGCLLLNHVGLNKGEAMFLQAKDPHAYISGDIIECMAASDNVVRAGFTPKFKDVKNLVEMLTYSYESVEKQKMPLQEFPRSKGDAVKSVLYDPPIAEFSVLQTIFDKSKGGKQVIEGLNGPSIVIATNGKGTIQITGDDSTKQKIDTGYVFFVAPGSSIELTADSANQDQDFTTYRAFVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords PHOSPHOMANNOSE ISOMERASE
publication title The x-ray crystal structure of phosphomannose isomerase from Candida albicans at 1.7 angstrom resolution.
pubmed doi rcsb
total genus 137
structure length 440
sequence length 440
ec nomenclature ec 5.3.1.8: Mannose-6-phosphate isomerase.
pdb deposition date 1996-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01238 PMI_typeI Phosphomannose isomerase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.441.10 Mainly Alpha Orthogonal Bundle Phosphomannose Isomerase; domain 2 Phosphomannose Isomerase, domain 2 1pmiA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1pmiA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1pmiA03
1GQGA 3E6CC 1ZZ9A 2BEOA 3ES1A 5I0SA 1TQ5A 3E6DA 2Z2SB 5CU1A 3I59B 4HLTA 4XEZA 4QM8A 2XGXA 5FLIA 3CL1A 5BUVA 2XL9A 2QDRA 2CV6A 2HKXA 2XL7A 1ZVFA 4GULA 5KBFA 3KGLA 1UW8A 4OLLA 4AVCA 1CAVA 3EO6A 3BCWA 3C3VA 2IXJA 2UY8A 3HT2A 4MV2A 4UXAA 2OPKA 2QJVA 3LAGA 5I8TA 3RPQA 4I0AA 3FFQA 4P9GA 2Q0AA 4I3PA 1CAUA 3E6BA 1J3QA 4J1WA 4MGIE 5J7MA 2QVSB 3RZZA 4LA2A 1DGRA 1H1IA 4O9EA 4UBHA 2VPVA 3FE5A 2XLFA 1OFNA 3CF6E 4R8HA 4XFGA 4AXOA 3OGJA 4DINB 2IXLA 4IETA 2GU9A 1FXZA 5EZWA 3VHRA 3HT1A 3OCPA 1CAWB 4KL1A 5FCCA 2PHLA 2GC3A 1DGWA 2BNMA 2PAEA 3GBFA 5C6CA 4LEJA 5CADA 3TNQA 4XF3A 1LB2A 1J58A 4KWLA 3E5QA 1ZNPA 1OI6A 3FHIB 4PIXA 1ZRDA 3IWZA 1YFWA 2O8QA 4HN0A 1YLLA 2DCTA 5D1IA 1O5LA 4Q0SA 4K8FA 4L11A 4J1XA 4MGYE 5FPZA 2BNOA 4MH0E 4Q0PA 5I8SA 2FQPA 2BNNA 3BU7A 3CLPA 3H7YA 3D0JA 4Q29A 1LR5A 3ACLA 4JTOA 4BHPA 3QACA 4IEOA 5I93A 1NXMA 2ZCWA 1VJ2A 1G6NA 4AVBA 3FWEA 2K0GA 5BXXA 3WW3A 4JTNA 4AVAA 1VP6A 1Y9QA 3USSA 2GC0A 1YHFA 2GC1A 5CVRA 3LZZA 3WW4A 1CAVB 4I01A 4IESA 2KXLA 1H1MA 1HW5A 4WBBA 3U11A 1YWKA 5JCTA 4B29A 5EFUA 1ZRCA 3OTFA 4KU8A 1QY4A 4LTAA 3WW2A 4XFAA 4D7SA 4MGZE 4JVAA 1CAUB 3JZVA 2B8MA 2OZ6A 4A2UA 2QCSB 1NE6A 2CAVA 4MX3A 3HIFA 3OF1A 2PTMA 1PM7A 4XF4A 5BV6A 2PA7A 2BGCA 1UIJA 1ZZBA 2UYAA 1O3RA 3RDIA 5KHIA 2MPFA 3O14A 4PIZA 3I7DA 5LEKA 2IXCA 4EWDA 5JR7B 3SMHA 3H3UA 5E1RA 2ATFA 2GZWA 1Q3EA 1LRHA 1WA4A 4LUKA 5FPXA 5KHKA 5K8SA 4EWAA 2Q1ZB 4ONUA 3FX3A 4BYYA 4QGMA 1YFYA 2VQAA 2ET1A 1FI2A 4H7LA 3S0MA 3R6SA 3ST7A 2B5HA 3D0SA 5FLJA 3LA2A 1IPJA 1SEFA 3NKTA 1DZTA 2PYTA 4AQ2A 2WC2A 3KCCA 1OMIA 2Q30A 2P17A 4MUVA 1O3TA 3CJXA 1WGPA 4LA3A 4YYOA 1YUDA 3H9AA 3UKTA 4XFIA 4Q0QA 4QXKA 3H1YA 4KWJA 4YRDA 3BB6A 2H6CA 1RGSA 4I2OA 4ORFA 4IEVA 3ZDSA 1ZZ8A 2IC1A 4XFBA 4XF9A 4MGKE 4F8AA 5AVPA 1L3JA 3H8UA 4YARA 2QNKA 2OA2A 1RUOA 2CGPA 2CAUA 4KU7A 4NVPA 4F7ZA 2XLGA 4IEQA 1XRUA 2D40A 3CEWA 1X82A 1JUHA 4CYDA 3KGZA 3MDPA 3M70A 3M3IA 4Z07A 3N4MA 4QGNA 3LA3A 2OYZA 5HI0A 4XFFA 4TLFA 4IEZA 3E5UA 4D7TA 3H50A 2V09A 4YNIA 4WZCA 3D82A 4HMZA 2C0ZA 3ETQA 5FQ0A 3RYRA 2WFPA 1CAXA 1RUNA 4XF0A 4WVZA 3I54A 2I45A 4I02A 4IEUA 4IEXA 1SFNA 3LOIA 1I6XA 1XE7A 4N9HA 1RL3A 4IEYA 4LULA 5JSPA 1O3QA 3DN7A 5E16A 3RYPA 4XFHA 2FMYA 4YSFA 1ZZ6A 5BPXA 2H6BA 4QGLA 4X6RB 1WLTA 3RYKA 4BIFA 5J3UA 4Q0UA 1FT9A 1UIKA 3FJSA 3WW1A 4LLOA 2E9QA 5I0RA 2IXKA 4HVOA 2Q4SA 3E97A 1Q5OA 3ROUA 5C8WA 4ZU5A 3NJZA 2EVXA 4META 1DZRA 4E2QA 2ZKLA 4HSLA 1J1LA 1O7FA 4XETA 2PAMA 4MZUA 1IPKA 4QX5A 2EAAA 1NE4A 1QXRA 1EYBA 1J59A 2OZJA 1O4TA 3EHKA 3ELNA 4BH9A 1ZZ7A 3UKVA 2XLAA 2D5HA 3BALA 1GQHA 2Z69A 2HJIA 4HN1A 3U0ZA 3H7JA 1EP0A 2MNGA 4AQ6A 1J3PA 3H1MA 3EBRA 3GYDA 4QM9A 3SHRA 2B9UA 4I09A 1ZREA 3G7DA 1EY2A 3IIAA 4Q0VA 3DL3A 5LRSA 1QXJA 3EJKA 5I0UA 2UY9A 2Y0OA 3CO2A 1EPZA 5FQ0B 3IBMA 3E5XA 4KWKA 4XFCA 1CAXB 4HVQA 4ZU4A 4E2GA 1VR3A 3SCHA 1X7NA 3SCGA 1ZRRA 2GH2A 5FLHA 3S7IA 5FDBA 2PQQA 3LWCA 3DKWA 1CX4A 2O1QA 2PHDA 4FAHA 3LA7A 3PNAA 1Y3TA 3IDCB 2PFWA 3I59A 3B02A 2XHKA 1ZRFA 4JV4A 1QWRA 4FAGA 5JSOA 3DV8A 3NW4A 3NSTA 1XE8A 2EA7A 4UBGA 5LRRA 3SXWA 1PMIA 1CGPA 2XKPA 2MHFA 1YFXA 3U10A 5I0TA 3NL1A 5J48A 4HVRA 3KSCA 4X6QB 5LEJA 4IEPA 1X8EA 1O5UA 3NVCA 1RC6A 3MPBA 3EQEA 3ES4A 3BPZA 3TNPB 1NYWA 4EV0A 2GAUA 4Z82A 4FBFA 5I8YA 5KHJA 2K9ZA 4HSJA 3UKNA 3QOPA 5BY5A 1OD5A 4IERA 4HBNA 3H3ZA 4OFGA 1YFUA 1ZX5A 4E2SA 2IXHA 2F4PA 4LUMA 4IEWA 4I0BA 4RD7A 3IDBB 3H1WA 3HQXA 1O3SA 2D5FA 2H0VA 5KHHA 2N7GA 3L2HA 3MZHA 3PLQA 4PJYA 1CAWA 1I5ZA 3MYXA 1SQ4A 2D93A 4R52A 2XKOA 5F1RA 5JAXA 3RNSA 3S7EA 1UPIA 1LKNA 2ETEA 5JSRA 5KHGA 2GC2A 1U12A 3SCFA 4QMAA 1X8MA 2UYBA 4EROA 4XF1A 4PIYA 5I91A 1NZCA 2VECA 4L2NA 3KMHA 4FT8A 4HZFA 1UCXA 2ET7A 1V70A 3PVBB 4N9IA 1RTVA 4O9GA 4ZU7A 5T3NA 2BYVE 2IXIA 3FZ3A 3OD0A 4EWEA 1ZZCA 2PAKA 1Q43A 1UD1A 1J3RA
chains in the Genus database with same CATH superfamily
3WEZA 5IVFA 1E5RA 3ES1A 2GMMA 3B94A 5I0SA 5JWPA 1JZ8A 1U5IA 1TQ5A 3R4SA 1DIWA 3A0NA 4FQ4A 3VKMA 5FKCA 3E6DA 3ECQA 4B7KA 5GZGA 5LW9A 3BTXA 5CU1A 4MGTA 3I59B 2YU2A 2GP3A 4XEZA 5KWRA 1QF3A 1N1SA 1WCKA 2XGXA 3CJIA 3CL1A 3IIIA 3J7LA 2CV6A 2HKXA 2JXAA 1W6QB 2GP5A 2VZUA 5EQUA 3I2OA 4OYUA 3WNNA 4MGSA 3BOWA 4XJ9A 4R9AA 5DDJ3 1OUSA 1WLDA 1UZ0A 3KGLA 5D8AA 2JG8A 2LALA 1V9U2 3S5QA 2HYXA 5BNNC 1PVC1 1R083 1QU0A 1UMHA 1VMFA 4Q4W2 1E57A 5LA0A 2R30A 3KHCA 4JGYB 5F5QA 1FV2A 5FTTC 4W4ZA 4XBLA 4XE9A 3ZMOA 4FQZA 4ARXA 1GICA 3IN9A 5CFDC 1ND2A 1NA1A 4PLNA 3ZFEB 5L7OC 2HWB3 2P6HA 2HWD2 2JECA 4Y4RA 5EYYA 4ZXEA 1CAUA 4QT6A 1UKRA 3Q8FA 1VBD2 2VUJA 1VAKA 3JD71 3RZZA 4LA2A 1IG3A 1H1IA 5DN2A 4PQ9A 1UN1A 4UBHA 4IV3B 3SH3A 2VPVA 5AC91 3K4ZA 5EYXA 2D3SA 1QJY3 4XFGA 1V00A 3WDWA 5JOXA 1SLTA 2GU9A 3H0OA 3VBSA 4AI8A 2VVDA 2A5ZA 4N8MA 3HT1A 2VOKA 3GHMA 3BIWE 1OXCA 2ZGPA 3VBUA 1UZWA 1W8NA 4WZFA 4YVWA 2BNMA 3T4HB 4BQYA 5GLVA 4CE8A 4CXWA 1HIXA 2LROA 4XF3A 3DKQA 4XQWA 1HQWA 5EHDA 5FPAA 3E5QA 1U5XA 3D8CA 5HCHA 4INDA 4FPJA 2O8QA 1CPNA 5FIXA 3VHOA 4CXYA 4HN0A 2XVLA 5A70A 2ORXA 5L9BA 5FP8A 4K8FA 4OVEA 3NJYA 4J1XA 1QMJA 5A7WB 2B7YA 2J1EA 4DPNA 5C4WB 5FPZA 4AQSA 4FOQA 4QQLA 1VAVA 4FFIA 4TSVA 1G8WA 3W20A 3H7YA 1TVGA 3D0JA 4IUGA 3ZPYA 2DTWA 2HBTA 4AFDA 4UFKA 3L2YA 1W0NA 5FOBB 3HQUA 1LR5A 1RUE3 2VMFA 3ACLA 2FDKA 2AREA 4HANA 5F9TA 1WCSA 1I5PA 3KB5A 3ZDVA 4TTGA 1UOBA 3J26N 1HXS2 3PTYA 1XB9A 4BWOA 3P5BA 2RS51 4H2AA 1PGW1 1R093 1NY71 2J1VA 1ND3C 4UF0A 1VBA3 2DF7A 2O0OA 3VZJA 2JD4A 5BXXA 3UETA 3WW3A 3LDRA 2ZMLA 2JIJA 1LENA 3U78A 5CG8A 2Q1MA 5FZLA 1AX1A 2GC0A 5I0DA 3WV6A 1LJ7A 1UOFA 2AACA 2MEV3 4JC1A 4BK4A 3RVHA 4CDXC 3BI3A 1TNRA 5D8AB 3RSJA 2JG8B 3W58A 1B35C 3MPPG 4I01A 2P3IA 1OT5A 2WQ8A 2CDPA 3IAQA 5DZEA 1H1MA 4IGOA 3B3QE 2HWE3 3PTRB 1K42A 3ZXGA 4GQ7A 2W3JA 2BFUL 4B29A 5BNOA 4R9CA 4TYSA 1UX6A 1SLAA 4KU8A 3CIHA 1CZTA 1ZA4A 1RUG1 4QB6A 5HCBA 4KNCA 3WW2A 4D7SA 5K0UC 1PIV1 2XBO1 1CAUB 1RXGA 3CU7A 5C3PA 2RS33 2QCSB 2R063 1NE6A 2CAVA 2VNOA 4Q1RA 2JE8A 1S0GA 4UYBA 5A3WA 4E8DA 2RJKA 2PTMA 4EE2A 2QQJA 5B2GB 5BV6A 2VC9A 1HLCA 1UIJA 1ZZBA 4DXZA 1G9DA 4ATFA 1F5JA 3N36A 3POBA 4D6QA 5FO9B 4E4ZA 4PIZA 1ASJ3 5LEKA 2DU1A 3ZFFC 1LOAA 1OOPA 3H3UA 2XHNA 3VBSB 2FDIA 1ZBA1 1POV0 2OKXA 1UOGA 4ASMB 3KWVA 1HRI2 1NOVA 4Y1XA 4Y4YA 1XNTA 2XJSA 4YVWB 5KHKA 4XBNA 3POYA 1H6YA 4LJHA 2IUWA 4FO9A 1MZEA 2Q1FA 4QGMA 2VQAA 3KT1A 4V1PA 1W2AX 2ET1A 2H0BA 3WG1A 4H7LA 5F7UA 4HK8A 3HOBA 3VBOC 1JOPA 4MHRA 5FY9A 4CDQC 1ZYBA 2WS92 1BVVA 4QKNA 1RUC2 3R6SA 2W1SA 2WUHA 3K46A 2C4XA 4L0PA 5GM0A 3ST7A 1CONA 4AVSA 4AVVA 1CESA 5F5IA 5FP4A 4AAXA 3KLSA 4UI9L 4NHLA 3WG2A 5BNPA 1YJLA 1C5IA 3CJXA 5FREA 3MIGA 4LA3A 5FZFA 4XCBA 2P34A 4CCNA 4YGBA 1DQ2A 1PK6C 2ZGLA 4KG0A 3OOXA 4CPBD 5FXVA 1PX4A 1TZOA 4ZS3A 3MI8A 1V9U1 3BPSA 3PJQA 3WG4A 3BB6A 4O61A 5A3PA 5JZGC 5FP9A 5ANQA 4XTMA 4YW1A 2OQ7A 4AFBA 3AFGA 4Q27A 4Q8KA 4WM8C 2VAUA 3ENRA 4OMDA 5EV7A 2IC1A 4XFBA 2A6ZA 2R072 1A8DA 2CSGA 4XIOA 3H8UA 4PDWA 4UF0B 1H2LA 4Q8LA 2VY0A 1NQDA 2BZDA 2VW0A 3ZYJB 4AAPA 3ZOIA 1JYTA 3VZMA 1POV3 1JZ2A 1WLWA 2YB7A 2RE9A 4NVPA 1W8HA 1IS6A 4EZ4A 2WO3A 2XLGA 4RA0A 3V64A 1IKPA 1GFF2 3I4IA 3RJRA 1EV13 4XHBA 2Y34A 2BV4A 2VJXA 5C9AA 4LKSA 1JUHA 3T2OA 4CYDA 3KGZA 3I3DA 3MDPA 1LESA 3GF6A 2XXZA 1NLSA 4G3YC 1KDMA 4GMP1 4NWVA 1BVP1 5BNOB 3HD8B 3RZLA 3V56A 4CPBA 4QQPA 1JYXA 4QGNA 3GHNA 1SPPA 1RMU3 4IV1A 1CR7A 1OQEA 1TNFA 4LHLA 2C6SA 2ZGKA 3WNXA 4RL7A 4COYA 5CFCC 1PNGA 1UOJA 4QHBA 1AR83 2V09A 4AI2A 1MS4A 4OI4A 4WZCA 2IFRA 4YNIA 4GWMA 5FWEA 3TEXA 3VZLA 2D97A 2VH9A 2YFUA 3QBQA 5LASA 4BPZA 4C91A 3SH4A 2WFPA 1CIWA 2EXKA 2XJQA 4XF0A 3A22A 1G86A 3I54A 2ZACA 1SFNA 2BVBA 1W8WA 2BGPA 5JSPA 3MIFA 3MV11 3WUCA 3CKHA 1CWPA 4W8JA 2LRPA 4AG4A 1GP6A 2ZS6B 3LFMA 1UU6A 1PO23 3OBRA 1ZRIA 4GA9A 2FCVA 3NNGA 1AHSA 4YSFA 1HQNA 2WJSA 2H6BA 3VB9A 4QGLA 1SBFA 4X6RB 4QPWA 2G9GA 4CA9A 3WP4A 2WWJA 5FO7B 3RYKA 2DFBA 4BIFA 4QXCA 1O59A 1HXS1 1FT9A 3I3BA 1W3VA 5JR2A 5I0RA 2IXKA 5BNPB 4DXSA 3POFA 1BKZA 3MIDA 2Q4SA 2DUQA 3E97A 4PBPA 2VZOA 2B4KA 1C8M2 5FY4A 1CJDA 2HWC1 3WP6A 3NJZA 3OBZA 2ZX0A 4U2AA 2NYYA 2WIIB 3A0KA 2IVJA 1D2QA 1JXNA 3UJOA 1SFYA 1Y9GA 4E2QA 2GALA 1TEIA 5T54A 4Q26A 4XETA 2FZ2A 3POGA 2YBKA 3ATGA 2P1BA 5LBBA 1AR93 2VNVA 4KG8A 5ACA2 1R1A2 2FMDA 5A32B 4PDWB 1RUJ3 4WM7C 3UGHA 1QGLA 2VVFA 4YZ5A 1EUTA 2JWPA 2RR13 1RVF3 4CEYC 1DLLA 1ZBE3 2VMHA 1MS3A 3UKVA 3BALA 5LK5A 3HNYM 3W5NA 4JAAA 1YI7A 1AJOA 2ZA9A 4Y5TA 4YFWA 4HN1A 4JDNA 2PHTA 3S30A 4OHYA 2DCZA 5C9AB 2VZVA 1KS5A 1S0DA 5JIAA 3GYDA 3AYDA 3WDXA 4A44A 3ZYIB 1OBNA 3M1HA 4R9DA 1HRI1 3ZYHA 3POSA 3DYOA 3WCRA 1REEA 2XR4A 1K12A 3ILFA 1D0HA 4XUOA 1SPPB 3KCYA 4FFFA 2JG9A 1Y7BA 4OCTA 2ZJCA 4IV1B 3WY6A 4IW3A 4IE7A 3URFA 2CDOA 1AR62 5GLWA 3M8LA 1V6MA 1T6GC 2DBIA 2PHRA 3ACIA 5I0UA 2VU9A 3KF3A 1AR73 5A7QA 4D7YA 2WS91 1S2KA 3B9IA 1VBE3 3SLIA 3VDCA 4Y33A 2FDFA 4KWKA 4JDMA 1V6LA 4XAAA 1DLCA 1QNYA 2WNVA 4ZU4A 4Y24A 4IL7A 4AEDC 2R7EB 2YY1A 4OZOA 1AZDA 4NMIA 3SCGA 1NAEA 1W2TA 3BN6A 2WINB 2Y6HA 1ODNA 3M3CA 4XJZA 2YV8A 1RINA 4NIGA 1PO13 2J22A 1BK1A 4YM0A 4OI1A 5LA2A 3DPRA 1XSRA 3W21A 4GB33 4M3CA 2PHDA 3NNLA 5FYUA 1TMF3 1GNHA 4KBZA 5IVJA 3PNAA 1Y3TA 3V65A 3IDCB 4IQPA 3KCXA 3ZXJA 2RM23 1C5HA 4D94A 1QJU3 4WVMA 3U4SA 3GJBA 2NMOA 3EXUA 4AR2A 1Z7S1 5GJ6A 3C7EA 4H7MA 3OYWA 5GZCA 1F8VA 2VQTA 2BTVC 4XZPA 5FXXA 3VBRB 2VD7A 1BBT2 2E6VA 2XKPA 4HPKA 5F5AA 3AP4A 1PVXA 2YBPA 1DQ1A 5I0TA 1UY3A 4CXXA 5J48A 5IATA 4X6QB 1OQ1A 1AX0A 1O5UA 1PMJX 3NVCA 5E88A 1RC6A 5L9RA 3ZXFA 1F4HA 2WNUA 3ES4A 1QQP2 4IE6A 2FDGA 4Z2WA 5IHRA 1GMMA 3THPA 4FOVA 5E8AA 3UKNA 1OD5A 3KV5A 2V72A 2P4EA 4EYUA 4OFGA 5DUXA 2OPWA 3RZKA 1UZVA 4Q4Y2 4LUMA 4N53A 1LHWA 5E89A 2PHWA 4GALA 2XQRA 4PCRA 1AYN3 3ZMNA 4K8RB 1AVBA 4W6XA 4XUNA 4QQHA 2RS12 5FZ6A 2X05A 4V2VA 2QZ3A 1UL9A 2Y8KA 3MZHA 5CFDA 2WKKA 2WQ4A 4RFT0 2ORZA 4PJYA 1V6NA 4JKKA 4WVVA 4XJWA 5FRAA 4CSWA 2DYCA 5C33A 2D43A 3OJBA 1BK0A 5F1RA 1WD3A 1H2NA 1OF4A 1RHI1 2PXJA 1D4M2 1LKNA 1O4YA 1UMIA 2W68A 3ZR6A 5KHGA 5FYYA 3MGUA 5FZ4A 2ZTNA 4CCMA 5FZCA 1R64A 3UGGA 1W04A 3I3MA 5C3OA 2XONA 5ABJC 1UX7A 4YW2A 1VMJA 2GH8A 4OI0A 4HKWA 2WNVB 4LKDA 4FT8A 4Q4V3 1X33A 1A8MA 3BYWA 4RR3C 2FD8A 1JMUB 2W46A 1URXA 2VNGA 1MPXA 4O9GA 2OIIA 2NQYA 1HRV3 4QX1A 2A6XA 2WFF3 1KS4A 3M3QA 1YQ8A 1K5MA 2PAKA 3B5LB 1ENSA 3HN1A 3TEZA 1FOD1 2DDUA 3DPRB 3ME2A 3N7MA 4O65A 4CEWA 2BEOA 4CCEA 4I0WB 2GMPA 4M3CB 4K9SA 2DWRA 3ZSKA 4UW4A 1W0OA 3WXPA 3BTAA 2V4VA 2O14A 4JGZC 4Y5SA 4HLTA 4P08A 5ACA1 1R1A1 2EXIA 4LLFA 4QM8A 4WVMB 2CNAA 3MIBA 1BMV2 2XL7A 3ZXDA 4DIQA 1FX5A 3JD72 4A41A 3OYWB 1DF0A 4GULA 3AZYA 4TLGA 3WQ0A 4RS5C 3WF4A 1SDWA 3AVSA 1BCXA 2F4LA 4OHZA 1RUD1 2CU5A 4HPKB 1C8NA 3AZWA 2TUNA 3EO6A 4EN6B 5FPVA 3C8XA 3BCWA 2JE9A 4XAEA 3OUJA 1LTEA 5JLVA 2OQ6A 2UY8A 3PU8A 3HT2A 1G9AA 4MV2A 3CZUA 2ARBA 2WAAA 1WW6A 2WNUB 3AJZA 1ND3A 2G19A 4LNVA 1QJFA 4UFMA 4XIKA 5FBZA 4JRAA 3OEAA 2MEV2 3E6BA 4MGIE 2QVSB 3KT7A 3ZSLA 1UXZA 4PBOA 4FOWA 2ZHNA 1AR61 2AENA 1C57A 1COV2 2E51A 2PMWB 4AEMA 2G9ZA 4Q2FA 2YYOA 2F6BA 4N53B 2HWF3 2RMU3 3W59A 3LIHA 3T1LA 3VBFC 1ULCA 4EZHA 1W0PA 4M3CF 5L9VA 3ZYBA 1HJGA 1DCSA 1LODA 1FXZA 3VHRA 2D44A 5CFDB 1HX6A 1YQ2A 1I1EA 4KL1A 5K0UA 4QB2A 3VD4A 2WSVA 4Y26A 5FCCA 4CDUA 1DGWA 1EAH2 3GBFA 3VHNA 1NCQC 2WZR2 4W6YA 4LEJA 3N9LA 2AYHA 1SLIA 1FMD2 4AHZA 2C5DA 5JXIA 2D7FA 1DZQA 5LZ6A 4XILA 1Q8PA 3T4VA 1MVEA 4NHYA 4R9BA 4FXKB 4PIXA 4Z2AA 2EXHA 5F2WA 2VXJA 4TWTA 4YVSA 3W5MA 4A3XA 1YLLA 3ZFFA 1BEV3 2A70A 1PGW2 2XUMA 4FVVA 2ZKNA 1D7PM 4L11A 4JX0A 4LHNA 1GLHA 3HNMA 4L97A 2DV9A 2UWAA 4AQTA 5K4LA 1XU2A 3KHBA 3MUZ1 1RITA 3Q8CA 4P02B 4BXSV 2Y60A 2ZABA 4R4ZA 1K5MB 2Y6LA 2W92A 3BU7A 3IT8A 4RSUA 5FZEA 5F3CA 5DAPA 3GCXA 4UT5A 5HCFA 4BHPA 5C5TA 2RVAA 3VZNA 1NXMA 1ENRA 1MR5A 1VJ2A 4JCKA 1W9FA 2W1WA 1AYM3 4LITA 1G6NA 4P9JA 4HOOA 5DQ0A 5DZFA 4AVBA 4NRMA 3N7LA 4K20A 3FWEA 1AXYA 2WO1A 1UPSA 2SLIA 3M3OA 2WO7A 2ARXA 1QIQA 4JTNA 5T5PA 1PIV2 2XBO2 1Y9QA 4L9BA 3ZO0B 4BCUA 2J1AA 1YHFA 4LO8A 5DDJ1 5C5UA 4LOSA 4MVTA 3VZKA 2V4AA 2GC1A 1PK6A 3QD6A 2JDPA 1VRH2 3LZZA 4M4PA 4Q4Y1 4A4AA 4DO0A 4BA6A 2B9VA 2WWSA 3OG2A 4X8NA 2OX0A 3T2QA 2KXLA 5JZGA 3N7JA 1H8TC 4I30A 2RS11 4Q4X3 4WM8A 1HW5A 2HWB1 1MEC3 2JDMA 5DABA 1VBC3 1AUYA 1AL22 2D6PA 2GMEA 2R32A 4LK7A 3MV01 1ND3B 3HJRA 5FK7A 1H6XA 1OH4A 1DYPA 1WD4A 4JVAA 4LKEA 3KZ4C 4H14A 1RJ8A 1FPN2 4LE4A 4CU6A 3APBA 4RQPC 4A2UA 1A6CA 1SBEA 1XXNA 2C24A 2DVAA 3GZAA 2VZ1A 2C1FA 4MX3A 3TN93 1W8OA 5JIUA 1JYIA 2BOIA 4CDXB 4XF4A 4QPGC 4DY5A 2PA7A 3EB7A 4RGGA 1VALA 2CY6A 1UY4A 1G9BA 4H3WA 1ALYA 4OULA 5KHIA 1VE0A 2OS2A 2XDVA 3O14A 4LO6B 4CCJA 2IXCA 1VBB3 4O7XA 1N1YA 5TSWA 3SMHA 2VOXA 3FBYA 2ATFA 4P9IA 2VMEA 3B00A 1LRHA 1X9PA 1DFQA 4LK6A 4LUKA 1JZ4A 2X5IC 5K0UB 1QH6A 2WT0A 5T5LA 4CDUB 1YO8A 3P1IA 1S2BA 3UJQA 2DCYA 4Q1PA 5T5OA 4IE4A 3O1SA 1DGWX 1VAMA 1ULDA 1WBFA 3B7MA 4XJ8A 4BLIA 2W87A 3THCA 1QDOA 1FI2A 4C0HA 3GCWA 2WO2A 5IYYA 5FR3A 3S0MA 4QKBA 4QD2A 1YEWA 3JB8A 5H9PA 4M0NA 4UW6A 4A7KA 4AEDB 1LHNA 3LDBA 2B5HA 3D0SA 4NOTA 4YVSB 2XUEA 5FLJA 3WQBA 3LA2A 3ZFFB 2PYTA 3ZXLA 4AQ2A 1LOBA 4L92A 1W9TA 2Q30A 4QHZA 1UQXA 3K3OA 4AZZA 5HV0A 2A6VA 3H8RA 1GYKA 2JDYA 1WGPA 4BZ4A 4NWWA 4YWAA 4YYOA 1BMV1 1YUDA 1S0IA 1XYPA 3UKTA 2YBSA 4MYEA 4FTSA 2IWGB 1RUE1 3MFAA 2YMZA 3K4DA 4E27A 5FZAA 4D6SA 1YIPA 4MXWB 4X8PA 1RUF3 3T0BA 5A7SA 1QNWA 4CP1A 2KA3A 1B09A 3N9MA 4E4SA 4I2OA 2YDEA 3ZDSA 3VDDC 3HPNA 4YGCA 5BYNA 3NV2A 1UU4A 4DB5A 5JDBA 5JOYA 4YM3A 1CPMA 2F17A 1R1ZA 2OA2A 4ZS2A 3LPFA 2CGPA 2FBEA 2CAUA 2MEV1 3ILRA 3VZOA 2UWBA 1YQCA 2YG0A 2VBPA 1WW7A 4F7ZA 4OQ8A 3LEKA 1PK6B 2AEZA 1COV1 2GN3A 4AVTA 3SEEA 2GNBA 4QPIC 1SMVA 2Y0IA 3PUSA 3PIJA 2E7QA 2UURA 1K3IA 5JZGB 1VLNA 2ZGOA 1REDA 2JD9A 1GUIA 4IE0A 1S0BA 3M3IA 4XXPA 4KGQA 1NZIA 4WM8B 1UYPA 4QU2A 2XOMA 1H1AA 2VCAA 3USUA 4Z07A 3TEYA 5FYSA 5D21A 4WM7A 4LIUA 2RS31 3T2PA 1NX9A 2OYZA 1EAH1 4CEYA 4XFFA 5IW0A 2WZR1 4TLFA 4HONA 1QXPA 4QDRA 3H50A 1FMD1 4RHV2 4M3CE 3RI9A 2NMNA 3AJYA 4IE5A 4HKLA 1SACA 2Z4FA 5HCAA 1CAXA 1QJX2 1PVC3 5FZ9A 3C7FA 5KXEA 5IWFA 2YUEA 3RMYA 3LOIA 5A7PA 3BUCA 1XE7A 2Z79A 2ZX4A 2ZZJA 4IEYA 4Y5Z0 2XJTA 3J7NA 5E16A 4DEVA 1ST8A 2VW2A 2HWC2 1L7QA 1CJPA 4BQ1A 5DG2A 5BPXA 2WABA 5M0TA 1DGRN 1JHNA 3FLTA 5FPLA 1HB1A 1WLTA 1DBNA 5FY8A 4CDWC 1VBE2 1WCDJ 3I2DA 4ASLA 5AC93 5JVVA 5CEHA 3ACFA 3T09A 5J3UA 3A21A 3AB0A 3NAPC 3OGVA 4Q0UA 5IVBA 3MICA 4N43A 4FXGB 3ORJA 1UIKA 1V6JA 1IGOA 3FJSA 3H8XA 1N1TA 2E9QA 4XDPA 2V5DA 3KM5A 3ZFGA 3OGRA 4HVOA 5FPBA 1GR3A 5CA6A 5BNQA 4FFGA 3ZPOA 3WF3A 1C3HA 3C7HA 4CRQA 2CHHA 5JPMB 1IKQA 3MO4A 2WYFA 3R4DB 3OBAA 1F4AA 4META 3LIGA 1VRH1 2CGOA 2BBAA 2QBXA 2VTFA 2JICA 4G9SB 3TOJA 1C1FA 4P9XA 1SFPA 3KV6A 4HSLA 1J1LA 3AX4A 5EXOA 1DU3D 3VUOA 1KEXA 2J1TA 4AF9A 2BDRA 1IPKA 3ETPA 1GWMA 1AL21 1JBCA 1J59A 1IOAA 3S6PA 3EHKA 5LBFA 5LY2A 1RUH2 1ZZ7A 4XCAA 4YG3A 5SV5A 4BU2A 3J8F2 1FPN1 3UK9A 5JXGA 4CU9A 2D3PA 2D5HA 3K2OA 3AM2A 4COVA 1QHDA 3W9AA 3I49A 2Z69A 3SISA 3JUUA 2YPJA 1HN1A 1W9WA 1W8ZA 3V0BA 4L99A 2VE1A 1MS5A 3U0ZA 1DDLA 4JHTA 5FZ3A 2MNGA 1GWKA 2Y64A 3A23A 4AQ6A 3H1MA 3EBRA 4JGYC 3AP6A 2NLRA 2R042 4FPKA 3ZIXA 1C1LA 3N9OA 3OB8A 3USUB 1S1AA 5GKAC 3K3NA 4GJZA 4QM9A 3SHRA 4F3JA 4URTA 2JB4A 2RS53 1RMU1 3CQOA 3G7DA 3N7KA 3WQ1A 4WM7B 1EY2A 3D4KA 1W28A 4Q0VA 4M4RA 5IJRA 5LK7B 2OW4A 4CEYB 1AR81 1W03A 1DQ6A 3HAGA 2VCBA 4BDVB 2DVBA 1GQPA 3NJXA 4GIQA 2WDBA 2YGMA 4U36A 1CD3G 3I2IA 5H9RA 4BXFA 4CU7A 3G6JB 3C2UA 1QXJA 5C3QA 3EJKA 3MW3A 2VM9A 1ACCA 1SCRA 1DYKA 2UY9A 3WDTA 2VULA 2Y0OA 1EPZA 4GWJA 5FY0A 4XFCA 1CAXB 3VDBA 2RG4A 3PVOA 4HVQA 4CP2A 1NKGA 3HEIA 5A32A 2YPDA 4HXCA 4AGGA 1ZRRA 4D3WA 1Z7S2 1RUG3 2X8KA 1MQTC 5A33A 1RUI3 1DP0A 1YXWA 4AFCA 3O1PA 2W1QA 4MSVA 2BFUS 3QCWA 3RS6A 5JMOA 4B4RA 5KR7A 1ULGA 2PLV3 2PQQA 3AKRA 3DKWA 2ZGMA 5FZ7A 2VW1A 5FAXA 3U1XA 4LBKA 2KR2A 3T08A 5FMCA 1XJAA 4N43B 4TN7A 4QHOA 1SG3A 3B02A 1OVPA 1UY2A 4N7IA 1WMEA 2O8OA 2XHKA 1ZRFA 1BYHA 3ZFGB 1ZBA3 5C4WC 2DU0A 2ZGRA 1IHMA 1WUVA 5JSOA 2JIGA 3DV8A 1IQDC 3NW4A 4IDZA 4PHZA 5AVAA 5GZEA 1JZ5A 2EA7A 1Q8QA 2WRAA 2Z42A 3AL6A 5IFTA 2WN3A 1CGPA 4HG6B 4WVWA 1HJFA 4B4PA 3WVJA 3NL1A 2ID4A 3ITQA 1JOBA 4B1LA 5FO8B 5IK4A 4IEPA 1AR91 4YW5A 1EPWA 4GMP0 1OF3A 4GAZA 2HEVF 1RUJ1 1GWLA 2NM1A 1M06G 1BLZA 1HKDA 4CUAA 3BPZA 2LM3A 1RVF1 1IQAA 1TME2 3CJIC 1MACA 2GAUA 3KS7A 4J6GA 3V0AB 4FBFA 1JYWA 3B69A 1GBGA 2K9ZA 2E26A 4HSJA 1RHI2 1QDCA 1ENQA 3QOPA 4JDOA 5BY5A 4GWNA 3TEWA 2JJ6A 3LEGA 3MLJA 4NPMA 3N9NA 1YFUA 5FYCA 2Y6GA 1IS3A 2EIDA 4FPYA 1ZX5A 1KFXL 3M7AA 4LKFA 1GZWA 4Y1ZA 2JG8C 4IEWA 5D8AC 4E2SA 2PELA 4RHV1 2L9LA 4I0BA 4RD7A 3IDBB 3TB0A 4COZA 5GLZA 3H1WA 3LOBA 3WD5A 3JQWA 5CBLA 2XQXA 1V9U3 1Q8VA 5FXWA 1UMZA 2QUOA 2VBDA 2VZTA 1QJX1 3U07A 3IMNA 1LOFA 4Q4W3 2YU1A 3GDBA 2C26A 1ND2C 1NA1C 1I5ZA 1WMFA 1APNA 3JXSA 3WNLA 2DURA 1UU5A 4LOTA 5FZKA 4RN5A 3NRUA 2HWD3 5IK8A 3S7EA 5JSRA 3THTA 4Y3OA 1U12A 4GJYA 5IVYA 3VBRA 1JZ7A 3U4XA 1FOD2 3PHMA 1YJKA 1VBD3 3KD4A 3LEIA 2P2KA 4A3ZA 3HMYA 1VBE1 2BRTA 2WLQA 1CIYA 4W6WA 3VBFA 2JDHA 4K1ZA 5EJZB 4BM8A 5DXDA 1Q56A 1WCQA 3KMHA 1KGYA 3UV9A 2ET7A 3WX5A 1V70A 4NJ4A 4NIIA 3VBHC 3OUIA 4GMP3 3LSDA 5LATA 5LCWL 1JZ6A 4N9IA 3VBUC 1H4HA 1JYVA 2YGLA 4ZU7A 2VXRA 4NPRA 2VGDA 1PO11 3FZ3A 1NCQA 1WA6X 5A33B 4YG6A 3Q8EA 4FPCA 4GB31 1RUD2 1GQGA 5DUVA 4ZXKA 4TXWA 1TMF1 1KJLA 2DVFA 2FDJA 3CHXA 3OD4A 4K6BA 3VHPA 4S2FA 1TE1B 1I3HA 1OKOA 4A7ZA 2Z2SB 1QJU1 5J1XA 1ONAA 1DYOA 3CDZB 5J37A 5C8CA 4P14A 2CWSA 3O7OA 1W3XA 5FLIA 5BUVA 2VMIA 1RUH1 1W05A 2XH6A 1OKQA 2XL9A 2WZEA 2ZHLA 3J8F1 2VVEA 5EJ1B 4ZZ8A 3BKZA 4LHSA 1NCRA 5A6QA 4K3UA 5CIRA 1ZVFA 4CCLA 2BP6A 1KFUL 5APAA 5KBFA 1PMHX 2XJVA 4H55A 4OLLA 3E1F1 3WR0A 1CAVA 2OVUA 5A3OA 1HB2A 2WAOA 3HBKA 5CYYA 5F8PA 5IUQA 4RGAA 2GNDA 3VKLA 4XYXA 3DF0A 1RYYA 4KH9A 2FDHA 3J7HA 2R041 3OPTA 2QJVA 4GD4A 1HXS3 5DUUA 2QQOA 4I0AA 5FZIA 1ZA7A 5L19A 1J3QA 5J7MA 4OHXA 3VL9A 3I2JA 1XPWA 1KXGA 4O9EA 1JI6A 3ZVXA 1AYN1 2XLFA 4B8EA 1PGL1 1GZWB 2VQUA 3O1TA 2A6WA 5F6KA 5C70A 3ZSJA 1O91A 4AXOA 2DBNA 1NUKA 2IXLA 2P3YA 2OT7A 1H8TA 2XVKA 3CZJA 5A6ZA 4IETA 3TRSB 2HH9A 3PURA 2P3KA 2I07B 2Q8CA 4XPVA 5EZWA 3SKVA 2J1SA 4YW4A 3OCPA 1REFA 3AXEA 5JOWA 4LO7A 1HB4A 3JBG2 3VDAA 2PAEA 3LPGA 3TN92 3ASIA 3AYEA 3AP9A 3POIA 4SBVA 1OLQA 1JOJA 3NMBA 4GKYA 3RZGA 1LB2A 2VCCA 3O1OA 1J58A 4E8CA 1ZNPA 3FHIB 3IKWA 4OHWA 4OZXA 3VBFB 1ZRDA 1YFWA 4Q4V1 1XNKA 2DCTA 1OOPC 4S2GA 1O5LA 3PMEA 4Q0SA 3PL0A 3NNJA 2BQPA 1HRV1 1KJRA 2WFF1 1NT0A 4MGYE 1POQA 1BQPA 1HRI3 3MF6A 5DDJ2 5CKMA 1NCQB 1XNCA 4DNYA 3OGGA 3O1RA 3CLPA 5EJ3A 3PUQA 1JW6A 1R082 2EXJA 4Q29A 1MVQA 5BNNA 4LO5B 3SEPA 4IEOA 1DGLA 5I93A 5SV8A 3B9CA 4AI3A 1WW5A 4C0BA 2NZ9A 2BERA 2HWB2 3D3AA 2WS93 1F5FA 1RUC3 3ZN5A 4AEJA 1O6UA 1O8SA 5L7OA 4YW6A 5A7OA 5BNPC 2ZEXA 5C8CB 1TME1 2K0GA 5HXMA 1VP6A 1OA4A 3HNBM 1OUXA 1NCRB 3IDEA 1HN0A 1QJY2 3I3QA 4JQTA 5CVRA 2FCTA 3I8TA 5CKQA 3UL2A 3FUQA 1CAVB 4IESA 4ASKA 2J1RA 2XVGA 5F37A 1VMHA 2BVVA 5CG9A 4XUPA 3U11A 1YWKA 1OFSA 5JCTA 5EFUA 5DAQA 1YQ6A 3FL7A 4CUGA 5HV4A 4P5YA 1Y9MA 1ZRCA 1QY4A 4LTAA 4PDWC 3AK0A 4XFAA 4MGZE 2R073 3AC0A 1A34A 3JZVA 1AL0G 2OZ6A 4BOWA 4QXHA 1F35A 2P5BA 3OF1A 4BJ0A 1PM7A 4QQOA 4QPIA 5IVCA 2VZ3A 5F39A 4RYDA 2QQPA 3RDIA 2PN5A 5C9AC 2IVIB 2MPFA 5FZGA 4DS0A 1WZXA 3RRDA 1H8TB 5CNAA 3UYJA 4EWDA 3O1MA 5JR7B 2CYFA 3WP3A 2CWMA 4NHXA 1Q3EA 1WA4A 4B3NA 4KGGA 2PHUA 3N35A 4Y22A 4YGDA 5FPXA 1QOOA 2Q1ZB 1UAIA 4IV1C 4ONUA 1JU3A 2B45X 1V6KA 5FWJA 4BYYA 1RUE2 4AI9A 1D2SA 1YFYA 4Q5OA 1HDKA 4V2WA 2EIGA 3P6BA 3R05A 3ON7A 3VV1A 1HV1A 1R092 1QOSA 4RGKA 4XVHA 1VBA2 3NKTA 3POEA 3THDA 3TWIA 2WC2A 3AYCA 4UFJA 5DAWA 1SZBA 2QQNA 1EUUA 5A3MA 1OMIA 3MLKA 2VR4A 4XDQA 5FMOL 2P17A 1F9KA 1OC1A 2X5IB 1U5YA 2BUKA 3T2TA 2JX9A 2X10A 2QQVA 2YXSA 4AEKA 4EN7B 2AGSA 2DFCA 4D0QA 3BU0A 1FYUA 4Q0QA 1UZZA 4QXKA 1KRIA 5IAXA 5DAXA 3H1YA 3DECA 2GNMA 3O0WA 4CDXA 2Q5TA 4LIVA 2HEWF 3O0VA 4KWJA 2VTXJ 4OI2A 2DCKA 1B35A 2HWE2 3IAPA 2GDFA 4PQQA 3GBGA 3N9PA 4YRDA 2KD7A 3VLBB 5BNNB 2H6CA 4OUSA 3LD8A 3ZYFA 4IGPA 3AMMA 4IEVA 4KBBA 3DXUA 4ISQA 5F3GA 4NIHA 2VNRA 4AGRA 5CZKA 4XDOA 2WA4A 4XOGA 2XJUA 4F83A 3I2HA 1QH7A 5AVPA 1JUIA 4BQWA 5L7OB 3AZXA 4ISRA 4YARA 2QNKA 2RS32 2R062 4YG0A 1RUOA 3H42B 4KU7A 3VKNA 2WR9A 2QDNA 2QQIA 3MHZA 4YW3A 4BISA 4XABA 4ZZ5A 1BXHA 2W9XA 3SNMA 1C8M3 5AFEA 4FP3A 4IEQA 3BTYA 2WSUA 4M0HA 1ASJ2 5F32A 3R0RA 5A3TA 1Q8SA 2D40A 4AW7A 5J96B 1GANA 3AZZA 1H2KA 2Y6FA 5ANNA 1YCIA 2DVDA 2WT2A 1S0JA 1H8VA 4ZONA 4MOAA 3LF7A 2NPIA 3AMQA 4YPJA 1D4VB 4DZGA 3FUOA 1KD7A 2AC1A 1JYNA 3LA3A 4NPLA 3T1MA 2NP0A 3JBG1 5ACA3 1GP4A 1R1A3 3TN91 3ZXKA 1LHUA 4UFIA 2ENRA 4D7TA 1W6MB 2AR6A 1IPSA 4QPIB 2R6QA 3HR9A 3ZM8A 4EN0A 4HMZA 4MXWA 1AJKA 1MS9A 3VBOA 4GZ9A 3V0BB 4PI2A 3VGIA 2WLPA 3C7OA 4CDQA 3M2MA 2P6CA 1RUNA 3WDVA 2E7TA 4Y20A 4WVZA 1XOYA 1WKYA 2I45A 4I02A 4IEUA 2AH2A 5JPNB 1N47A 3AMPA 4LT5A 2WL1A 2EIEA 1RL3A 1O3QA 3JU9A 3DN7A 4Y22B 4XFHA 2FMYA 2JG9C 1SLCA 3K4AA 2BJSA 1ULPA 2DVGA 4FPOB 2ZEWA 3J9SA 1CZSA 2OXBA 4JZRA 3T0AA 3IMMA 1R081 4FTBA 1XQNA 3O5SA 1AR63 3J4UH 3IZOA 2IZWA 5FYVA 3VD5A 5IK7A 4AOCA 2XJPA 3ZYRA 4AK3A 4LORA 4Z92B 3LGRA 1OVSA 5FP3A 4XHXA 1Q8OA 4E9KA 1CX1A 4E4HA 3WW1A 3I97A 4LLOA 3PIGA 3SKJE 4BQ4A 4J25A 5C7GA 2RDNA 4UFLA 2XG3A 1DHKB 2ADDA 3PVEA 1Q5OA 5FZ0A 4NR1A 1LULA 1MQTA 4P9YA 1ULFA 3LQCA 1EV12 1QJY1 3BVCA 2VZPA 3LE0A 1RUF1 2RHPA 4QQ2A 3U14A 5C71A 3DPRC 3KV9A 1B35B 4QX2A 4OQ9A 2ZKLA 2ZHKA 3WF0A 5K7PA 1LU1A 3SQOA 3NNFA 2ZX1A 4PT6A 1LCLA 3WG3A 2ZGNA 2ZEZA 5A3LA 4QX5A 3AFKA 2ZMKA 2EAAA 3B93A 1QXRA 1EYBA 1RMU2 4BH9A 1O4TA 3ELNA 3LSEA 2ZAAA 1X9TA 4P9LA 1AR82 2Y6JA 4DRVA 4EJRA 4AI0A 4B1MA 2W39A 1WMDA 1XE0A 4AHYA 3S57A 1N3OA 2JE7A 5CFCA 2HJIA 1GSLA 4BE3A 1NXD1 3OPWA 4PF1A 4TZDA 1OPOA 1RB8G 1OH3A 1EP0A 4CP0A 1BBT3 3PUAA 3ZLIA 3ACHA 3TBDA 2CGNA 2K2SA 3O12A 2WNUC 3DYMA 4UW3A 5D2AA 3TYJA 4NRPA 2G1MA 2NN8A 1SLLA 1NLRA 1PO22 3MBWA 1QJEA 1ZREA 3ZKYA 3RWNA 2RDSA 1QQP3 2I74A 3JB4C 1W2UA 3FLRA 3K77A 2RJLA 3NV3A 3WP5A 1L7LA 4COWA 5E6HA 4AL9A 5LRSA 2XPJA 4XBQA 2Y26A 4N53C 3RFRA 3UGFA 1E5SA 5FZHA 2YC2A 4LXLA 3FFZA 4Q4Y3 3VBOB 4CCDA 4CDQB 3CO2A 2PHXA 2LS6A 5LB6A 1T2XA 3IBMA 5F2SA 4DUXA 1R091 1VBA1 3RJ2X 4Y20B 2RS13 3GZEA 4AWDA 4E2GA 2VOVA 5LWBA 3FHAA 2YC4A 4BK5A 5FLHA 4LBMA 4CUCA 1N3PA 5FDBA 4GH4C 4UW5A 5EIYB 1PZ7A 3AKQA 2JDZA 1D4M3 4LHKA 2C9KA 2W0XA 3VL8A 2RDRA 4EN8B 4BIOA 2VG9A 1UF2C 2HWE1 3ALQA 3LWCA 3R4UA 2WWUA 3I3EA 2B39A 4FAHA 3T3YA 3LA7A 1AR92 3LB9A 1Y43B 3CBNA 1AF9A 1VRBA 2ZGTA 3GJAA 4K1YA 5FYHA 2PFWA 1RUJ2 3VD3A 3VBHA 2RR12 1RVF2 2ZHMA 3BGAA 1ZBE2 1QWRA 2R061 2A6YA 2W52A 4FAGA 2UU8A 1H4GA 4XZUG 4QX7A 2WT1A 4NUBA 2DUPA 1MQTB 1W9SA 3NSTA 3A4UA 1K5MC 4YZ3A 3SXWA 1DQ0A 1PMIA 2ZAHA 3KQ4B 1ASJ1 1YFXA 4CEWC 3MW4A 5KXCA 1V6OA 2A75A 1XBFA 4HVRA 3KSCA 5G05L 3ZN6B 1WW4A 3HWJA 4QWNA 4HL0A 1AX2A 1UNBA 4PLOA 4NROA 3WLUA 4LBJA 1WCUA 3AMHA 1Z78A 1GV9A 3EQEA 1US3A 3TNPB 5FUIA 3U37A 4DUWA 4QX0A 2GSYA 2VUCA 1H30A 3MIHA 5GLTA 3LKJA 1E5HA 2R16A 4FI9A 4ZY9A 2J1UA 1UZYA 4QKFA 1YI9A 3H3ZA 4XC9A 3WINE 1LGCA 5J98B 4AHWA 4FOYA 5CFCB 1E5IA 4JKLA 1AR72 1J1TA 3JD73 1WLCA 3BODA 1PX3A 4BMBA 5ISLA 4FPHA 4QPYA 2ES3A 3DGTA 2PQSA 3GBWA 2R49A 3HQXA 2DTYA 1C4RA 2UWCA 1O3SA 2YC0A 2D98A 4R4XA 2D5FA 2TEPA 5KHHA 3VKFC 1T6BX 2QE3A 3DYPA 2ILMA 4QX3A 2HEYF 4AEDA 1CAWA 2BU9A 3MYXA 3SITA 4ZHNA 5FFOC 3CJIB 4R52A 3WHUA 1J84A 1FAYA 1PO12 2XKOA 1UPIA 2ETEA 1OA2A 3WQ7A 3WZ1A 1UXXX 2JDAA 1K45A 2E53A 2GC2A 3QH7A 5FYTA 1K5JA 1JZ3A 2ZGSA 2SBAA 4GB32 3SCFA 1YRZA 2UYBA 4FTEA 2XWJB 1TMF2 1COV3 4EROA 4XF1A 4PIYA 4DMIA 2E31A 3VKOA 4CZSA 2RM22 3HBZA 2VECA 1QJU2 3T30A 2VZRA 5H9QA 2VCMA 1UCXA 3KV4A 4BQ2A 1ND2B 1NA1B 2ZMNA 2ZX3A 1POV1 3IB3A 3PVBB 2D6NA 1O8PA 3AMNA 4CDUC 1AXKA 1RUI1 2R0HA 5FZ8A 3OUHA 4Z8BA 1VPHA 1W6PA 3OD0A 4S2HA 4EWEA 1EV11 1EAH3 1ZZCA 2AEYA 4DUVA 2E32A 1V6IA 2PLV1 2WZR3 4D8MA 4HKOA 2R1DA 3E6CC 5FY1A 1ZZ9A 2CTVA 3ZSEA 1FMD3 1H9WA 1U0AA 1CN1A 5CISA 3RZHA 3C7GA 5FXZA 2W94A 4QDSA 2R0FA 4YVSC 1GNZA 4GXLA 2VBBA 5JUVA 4URAA 1JYCA 4JQRA 3ZFEC 3O1UA 4NIAA 3VBHB 3N9QA 5FPUA 1BJQA 1WBLA 3VBUB 2RDQA 4PI0A 3O1VA 4KQ7A 2QDRA 3KT4A 1KITA 3GGLA 3LCPA 1DG6A 4MLOA 3OGSA 4GWIA 4OUEA 4XJUA 3GXUA 2W1UA 4IV3C 4KWUA 4C1XA 1S55A 1AYN2 1PGL2 1QKQA 1BZWA 1UW8A 3OPZA 5DPNA 4AVCA 4DRRA 4DQAA 3FLPA 4YZ2A 1LU2A 1VIWB 4YM1A 5T5JA 1RJ7A 3CMGA 4JRLA 2R1BA 3OBTA 2OUJA 1PGSA 2W47A 1F15A 3C3VA 4IGQA 4M00A 5LA1A 3PU3A 2IXJA 3ACGA 5G04L 4AYUA 1UYXA 1OLMA 2OPKA 4UXAA 3OSDA 3WNMA 4XW3A 1N3QA 3LAGA 2BWCA 1LECA 3RPQA 4AI1A 3FFQA 5I8TA 3BOPA 2HLEA 1PO21 2WYSA 4P9GA 5F6LB 5FYIA 2ZEYA 2Q0AA 4I3PA 1YYNA 2QQMA 5AFBA 4J1WA 2JDUA 5C3SA 3FC0A 1PIV3 1DGRA 2XBO3 3FE5A 5JXHA 4XQDA 1US2A 1W90A 1OFNA 4XMAA 3CF6E 4R8HA 1FNYA 1VRH3 3OGJA 2P37A 4DINB 3PVNA 2VOTA 4Q4W1 2W08A 4Q4V2 5DZGA 5ABJA 5FYBA 4K40A 3FBMA 4EQVA 1XC6A 4BMEA 1YQ5A 4Y1UA 3ZX7A 4RR3A 1HRV2 3UT0A 3WF1A 1CAWB 3N3HA 2QQUA 2WFF2 2HWD1 5FK8A 3RWKX 1AL23 2PHLA 1JS9A 2EALA 2GC3A 3M4FA 4NO4A 2ZXQA 5F5CA 5GZFA 4JKMA 1DQ5A 1H2MA 1VBD1 5C6CA 3P3NA 2JENA 1FPN3 1FV3A 5CADA 3TNQA 2VMGA 1LOGA 4FPLA 5T55A 2B46X 2WN2A 4PF5A 4KWLA 5IT6A 2VOWA 5EP9A 1OI6A 3IWZA 3GZTB 1OLRA 3HN3A 3OEBA 5F3IA 4D69A 1W6OA 5HXVA 3FMGA 1UKGA 5D1IA 4JGZA 1C28A 1IS5A 4NN0A 3HQRA 4Y1YA 4A6SA 3MUY1 4BB3A 1JODA 1OQDA 2RR11 2YROA 1UO9A 3KQRA 1ZBE1 3WNPA 3GM8A 1LEMA 5LA9A 5F3EA 3EYPA 2BNOA 4MH0E 1YIFA 3JCIA 4Q0PA 1SCSA 1W6PB 5I8SA 2FQPA 2BNNA 4RS5A 4ARYA 2YZ4A 2ZOEB 4JTOA 4CVUA 1DQ4A 4YGEA 3PUHA 3QACA 2ZCWA 3LDKA 1S0FA 1W8TA 2D6KA 2VZSA 5LBCA 1OOPB 5JI7A 1JN2P 2DCJA 5J36A 4XTPA 1LHVA 3V0AA 1GU3A 4AVAA 1CVNA 3ZSMA 1RXFA 3USSA 2FCUA 4XUQA 2BWAA 2Y6KA 2XJRA 5FKBA 3WUDA 2HWF2 2RMU2 1S4CA 2TBVA 1AR71 3RG0A 2CL2A 1P8JA 1D0GA 3JQXA 1UYZA 4GKXA 3WW4A 2JEMA 2QKDA 3WHTA 4A7YA 4ATEA 4YLZA 1ULOA 4MG2A 3WSOA 4WBBA 3MIEA 3VBSC 2E63A 1LHOA 4CP9A 2D6LX 4BQ3A 3AP5A 3OTFA 3OY8A 5FZDA 4JHZA 1MS1A 4XMIA 2EICA 1QOTA 3POWA 2EAKA 4YVWC 4P5HA 2B8MA 3IM0A 4DY3A 3WOGA 5A1LA 2JDNA 1W99A 5IVVA 1QEXA 2ZZQA 1MZ6A 3HIFA 5CKNA 3K75B 2BGCA 2UYAA 2WZPP 4LBNA 1O3RA 5B4XA 3AP7A 4HK9A 2VMDA 1BEV2 2A1XA 3I7DA 5A80A 2J7MA 5ABJB 2RM21 2ARAA 1LEDA 2QQKA 3F2ZA 4LBLA 2GZWA 5E1RA 1GP5A 4RR3B 1LOEA 3RQ0A 4YZ4A 1GOFA 1KQRA 5K8SA 4FPFA 4EWAA 3ZXEA 3FX3A 4C1WA 2ZGQA 3B01A 5CB7A 2K46A 4LE3A 1W8FA 4MADA 1AYM2 1X50A 2QQLA 3MEPA 4ZPIA 5DAVA 4ES8A 1A3KA 2ZPXA 3IPVA 4RHV3 5FYZA 1XU1A 2V73A 1G9FA 1W6OB 4LQRA 5FMBA 2HYKA 5H9SA 3A7QA 1IPJA 1SEFA 4B7EA 1DZTA 3DUIA 5JI9A 4L8QA 4JGZB 3CNAA 3KCCA 4K7JA 5FUPA 1QJX3 1BHGA 1W2OA 1GKBA 4MUVA 1O3TA 1XYOA 2WNOA 3AKTA 3H9AA 4XFIA 3RZJA 4XUTA 2VUAA 4MHUA 3WDUA 2HWC3 4RS5B 1W2NA 1I9RA 4Q4X2 4W65A 1JTZX 1MEC2 1UY1A 1RGSA 1VBC2 3ZXAC 4BQXA 1RUC1 4ORFA 5A3NA 5FV3A 4HFSA 2LW8A 3ZN4A 1ZZ8A 2WBKA 4N43C 4XF9A 4DOUA 5L36A 2E7AA 4NE9A 4MGKE 5BNOC 4QB1A 4N90A 4F8AA 1L3JA 3PUIA 2BGOA 3NO8A 3ZFGC 5HPOA 3ZYPA 4CCCA 4RQPA 4QKDA 1HV0A 5EWSA 5JXJA 2W91A 2V5YA 4ET7A 3ABZA 5KC5A 4QPGA 4ES9A 1XRUA 4CTEA 4A6OA 1VBB2 3NWKA 3CEWA 2FZ1A 5FMDA 5DMYA 1X82A 1W6NA 2Q8DA 3MFCA 3M70A 1M4WA 3FN9A 1STMA 1PZ9A 1IG0A 4QAWA 1YC61 4AFAA 2R071 4AHXA 2A73B 3M3EA 4CP9B 3N4MA 2QFEA 3OY8B 4CUBA 3HVDA 1AXZA 2X5IA 2LUWA 1WMXA 5HI0A 3K51A 3DXTA 4MGQA 1UYYA 2XWBB 2Y33A 2VZQA 3DEMA 3I2KA 1ENXA 3Q8BA 1OA3A 4RFRB 5GALA 1RUH3 4YZ1A 4BQ5A 4D6RA 4IEZA 3E5UA 3J8F3 4FCAA 1MS8A 3WNKA 1G7YA 2WNEA 3NKGA 1LOCA 2A71A 2RV9A 3D82A 4NHMA 2C0ZA 3ETQA 4OMCA 5FQ0A 5IFPA 3GNEA 3RYRA 4IXLA 1GZTA 5IAVA 3L9JT 4B4QA 3NQHA 4NAMA 4MXVA 1OURA 1FNZA 2GNTA 1IS4A 2RJ2A 1KDKA 4IEXA 4UAPA 3I2GA 1I6XA 1JU4A 4N9HA 2BBVA 2R043 1SBDA 1XYNA 4LULA 4FPEA 2JB8A 3EMRA 2G4IA 3RYPA 3WCSA 1H9PA 1ZZ6A 5DUWA 1MZFA 5LBEA 1HQLA 1PHMA 2IFWA 4LBQD 4DEQA 1XSQA 3ZKUA 1GOGA 2VUDA 4UWDA 4XQ4A 1RUF2 2EF6A 5FZBA 2J42A 4ITCA 4QU1A 4ZKTB 5IK5A 4OHVA 1YNAA 4KI5M 1HB3A 1ZM1A 3IPVB 5A7NA 2BW8A 2TNFA 3VDDA 2D6MA 4SLIA 1S0EA 1RIRA 2A7AA 1ULEA 4YM2A 3S5AA 5T50A 2ERFA 2AZ5A 2LTNA 3ROUA 1SLBA 4GH4A 5C8WA 2JG9B 4ZU5A 1CZVA 1W6MA 2EVXA 2HWF1 1Z7S3 2RMU1 3AKPA 3O0XA 3P3PA 4I3GA 2Q8EA 1DZRA 2KM2A 4M01A 3SH5A 3J7MA 4OUMA 5KXBA 3I2FA 1WWYA 2PHFA 4FP2A 5GLUA 3VD7A 3D6EA 4A42A 1OSGA 1O7FA 4N7UA 2PAMA 4HETA 5FY5A 2W2IA 4DFSA 4MZUA 3INAA 4NRQA 1NLQA 5A1FA 5ERLA 2W5FA 4FSJA 2JKBA 3NNMA 1NE4A 2OUHA 4LBQA 5T52A 2OZJA 1SDDB 3POJA 2XB6C 3PMSA 1NG0A 3ZYGA 2D6OX 4LPLA 1C8M1 2XLAA 4RQPB 4CCKA 4LMFA 2A3YA 3BTZA 3ZR5A 1GQHA 2W95A 1UWWA 4AGVA 1XNAA 4Y1VA 5JOZA 5FZ1A 4QPGB 1G9CA 3WNOA 1L7RA 3IDAA 3FHQA 1PVC2 3H7JA 3TAYA 2ZGUA 3RMXA 1BEV1 1J3PA 1W6NB 3AL5A 2A3XA 3PDQA 3H3LA 4K21A 3DCQA 1GZCA 1GNYA 1U5ZA 3PJYA 3UESA 2VTXA 2B9UA 2VMCA 4I09A 5JMCA 3NV1A 4XJAA 1OD3A 3IIAA 4YW7A 4S2DA 5A6XA 3AKSA 1GZ9A 1TME3 3DL3A 2B42B 1JHJA 2VQ0A 5FP7A 5AC92 3X29B 1RHI3 5B4NA 1O4ZA 1Y4WA 3RI8A 4CDWA 1XNDA 5FY7A 2QTWB 3KF5A 5DG1A 1AYM1 4DXRA 5FZMA 4LR4A 5FQ0B 4NIDA 1W06A 1XNBA 2WA3A 3E5XA 2Q8OA 3NAPA 3VD9A 2BPA2 4P00B 4UOJA 1LOFC 4HT1T 1VR3A 5CAZA 2QZ2A 3SCHA 4DXTA 1X7NA 5FJHA 1PM4A 4PLMA 1A78A 2G9FA 2GH2A 3S7IA 1LNSA 1PNFA 3LFIA 4W50A 3RGBA 5C3RA 3VBRC 4WV8A 2AUYA 5FZOA 3MF9A 2YFZA 3MW2A 1MZ5A 3H8OA 4FFHA 3AYAA 4QDQA 3BIEA 4Q4X1 4CCOA 1FOD3 1W39A 5KC6A 1CX4A 1MS0A 2O1QA 4XURA 1MEC1 2HBUA 1S0CA 1CQ9A 1VBC1 4A45A 1LGBA 2VL4A 3VDDB 1OLME 3I59A 5HBAA 5K9YA 1NQJA 3ZIWA 3AVRA 5A6YA 4JV4A 3NV4A 3MLLA 1VB4A 3AXDA 1W6QA 4COUA 4MO3M 2ZX2A 4GH4B 4LBOA 1XE8A 4UBGA 2JKXA 5LRRA 4EN9B 2A3WA 2MHFA 3QH6A 3UNPA 3U10A 1GOHA 3KVAA 3T0DA 1VBB1 3KVBA 1RUD3 2ADEA 4JGYA 5EPAA 5LEJA 1X8EA 2RS52 4KMQA 2E33A 3ZFEA 1NY72 2BOJA 3MPBA 2YHJA 5C8CC 3LEMA 4UFHA 4LBQB 1NYWA 1TG7A 4LO4B 3VN4A 4AFMA 4Z82A 4EV0A 2X09A 4E4DX 5I8YA 1J83A 5KHJA 3GALA 1NCRC 3QLQA 4IERA 4HBNA 2EIBA 1N1VA 2ZBJA 1IZ3A 2X29A 4IV3A 4QX8A 2IXHA 2F4PA 4QXBA 2DUOA 1BBT1 2P3JA 1JH5A 1W8UA 5FOJB 5FMOS 1UY0A 1Z0HA 5FYMA 4CEWB 4Z1VA 5A3UA 4P9WA 4YFZA 2H0VA 2C9AA 2X53S 2N7GA 3RZMA 2ARCA 2WNVC 3L2HA 1V0AA 1PZ8A 5J09A 3PLQA 1H0BA 1RUG2 1QQP1 1W9YA 1S2EA 1OPMA 1RUI2 1SQ4A 1ODMA 2D93A 2WZ8A 2JDKA 5FJKA 1F31A 4BLJA 5JAXA 3RNSA 1LAJA 1QJZA 1FATA 4XACA 3NJVA 3GZUC 2PLV2 4FPGA 2I2SA 4QMAA 1SHWB 2VO5A 1X8MA 5FUNA 2Z5WA 4CDWB 3D5OA 3WT3A 3U75A 4NAOA 5IVEA 4C90A 3ZN6A 4XXAA 5I91A 1NZCA 2GN7A 1F2NA 3NAPB 4L2NA 1VB2A 4HZFA 2WQZC 1X36A 1ZBA2 2D3RA 3WF2A 2XMLA 3Q8AA 2Y38A 2QQWA 1LGNA 5A7WA 2FHRA 4AE2A 4C8DA 1RTVA 3K48A 5C4WA 5KXDA 3AZVA 4G4FA 5T3NA 3WDYA 2BYVE 2IXIA 3F95A 5FBJA 5GZDA 5A1AA 1OHFA 5LY1A 1D4M1 3JBG3 3Q9OA 1Q43A 4CU8A 4NHKA 5L73A 5FZOB 3SC7X 1UD1A 1J3RA 3ILNA
chains in the Genus database with same CATH topology
3ES1A 2GMMA 3B94A 5I0SA 5JWPA 1U5IA 1TQ5A 3R4SA 1DIWA 3A0NA 4FQ4A 3VKMA 4B7KA 3E6DA 3ECQA 5GZGA 5CU1A 3I59B 4XEZA 5KWRA 1QF3A 1N1SA 1WCKA 2XGXA 3CJIA 3CL1A 2CV6A 2HKXA 2JXAA 1W6QB 3BOWA 4XJ9A 4R9AA 5DDJ3 5D8AA 1WLDA 3KGLA 2JG8A 2LALA 1V9U2 5BNNC 1PVC1 1R083 1QU0A 4Q4W2 1E57A 2R30A 4JGYB 5F5QA 1FV2A 5FTTC 4XBLA 4XE9A 4FQZA 5CFDC 1GICA 3IN9A 1ND2A 1NA1A 4PLNA 3ZFEB 5L7OC 2HWB3 2HWD2 2JECA 5EYYA 1CAUA 4QT6A 1UKRA 1VBD2 2VUJA 1VAKA 3JD71 3RZZA 4LA2A 1H1IA 4PQ9A 1UN1A 4UBHA 4IV3B 3SH3A 2VPVA 5AC91 5EYXA 2D3SA 1QJY3 4XFGA 1V00A 3WDWA 5JOXA 1SLTA 2GU9A 3H0OA 3VBSA 4AI8A 2VVDA 2A5ZA 3HT1A 2VOKA 3GHMA 3BIWE 2ZGPA 3VBUA 4WZFA 4YVWA 2BNMA 5GLVA 1HIXA 4XF3A 4XQWA 1HQWA 3E5QA 1U5XA 3D8CA 4INDA 4FPJA 2O8QA 1CPNA 3VHOA 4HN0A 2XVLA 4K8FA 4OVEA 4J1XA 1QMJA 2B7YA 4DPNA 5C4WB 5FPZA 4AQSA 4FOQA 4QQLA 1VAVA 4TSVA 1G8WA 3H7YA 3D0JA 3ZPYA 2DTWA 4AFDA 3L2YA 5FOBB 1LR5A 1RUE3 3ACLA 2AREA 4HANA 5F9TA 1WCSA 3KB5A 3J26N 1HXS2 3PTYA 4BWOA 2RS51 1PGW1 1R093 1NY71 1ND3C 3VZJA 1VBA3 2DF7A 2O0OA 2JD4A 5BXXA 3WW3A 2ZMLA 1LENA 5CG8A 2Q1MA 1AX1A 2GC0A 3WV6A 1LJ7A 4JC1A 2MEV3 4CDXC 1TNRA 5D8AB 3RSJA 2JG8B 3W58A 1B35C 3MPPG 4I01A 2P3IA 5DZEA 1H1MA 3B3QE 2HWE3 3ZXGA 4GQ7A 2BFUL 4B29A 5BNOA 4R9CA 4TYSA 1UX6A 1SLAA 4KU8A 5HCBA 1ZA4A 3WW2A 1RUG1 4D7SA 4KNCA 5K0UC 1PIV1 2XBO1 1CAUB 3CU7A 2RS33 2QCSB 2R063 1NE6A 2CAVA 2VNOA 4Q1RA 1S0GA 2RJKA 2PTMA 5B2GB 5BV6A 1HLCA 1UIJA 1ZZBA 4DXZA 1G9DA 4ATFA 1F5JA 3N36A 5FO9B 4E4ZA 4PIZA 1ASJ3 5LEKA 2DU1A 3ZFFC 1LOAA 1OOPA 3H3UA 3VBSB 1ZBA1 1POV0 4ASMB 1HRI2 1NOVA 4Y1XA 4Y4YA 2XJSA 4YVWB 5KHKA 4XBNA 3POYA 4FO9A 1MZEA 4QGMA 2VQAA 3KT1A 4V1PA 2ET1A 2H0BA 3WG1A 4H7LA 4HK8A 3VBOC 4CDQC 1ZYBA 2WS92 1BVVA 1RUC2 3R6SA 3ST7A 5GM0A 1CONA 4AVSA 4AVVA 1CESA 3KLSA 4NHLA 3WG2A 5BNPA 1YJLA 1C5IA 3CJXA 5FREA 3MIGA 4LA3A 2P34A 1DQ2A 1PK6C 2ZGLA 4KG0A 3MI8A 1V9U1 3WG4A 3PJQA 5JZGC 3BB6A 4XTMA 4YW1A 4AFBA 3AFGA 4Q27A 4Q8KA 4WM8C 3ENRA 5EV7A 2IC1A 4XFBA 2A6ZA 2R072 1A8DA 4XIOA 3H8UA 4PDWA 1H2LA 4Q8LA 2VY0A 1NQDA 2VW0A 3ZYJB 3VZMA 1POV3 1WLWA 2RE9A 4NVPA 1IS6A 2XLGA 4RA0A 3V64A 1IKPA 1GFF2 3I4IA 3RJRA 1EV13 4XHBA 5C9AA 1JUHA 4CYDA 3KGZA 3MDPA 1LESA 3GF6A 1NLSA 4G3YC 1KDMA 4GMP1 4NWVA 1BVP1 5BNOB 3HD8B 3V56A 4QQPA 4QGNA 3GHNA 1RMU3 4IV1A 1CR7A 1OQEA 1TNFA 4LHLA 5CFCC 2ZGKA 3WNXA 4RL7A 4COYA 1PNGA 4QHBA 1AR83 2V09A 4AI2A 1MS4A 4OI4A 4WZCA 2IFRA 4YNIA 4GWMA 3VZLA 2D97A 2VH9A 3QBQA 4BPZA 4C91A 3SH4A 2WFPA 1CIWA 2EXKA 2XJQA 4XF0A 3I54A 1G86A 2ZACA 1SFNA 2BVBA 5JSPA 3MIFA 3WUCA 4AG4A 2ZS6B 1UU6A 1PO23 3OBRA 4GA9A 4YSFA 1AHSA 1HQNA 2WJSA 2H6BA 4QGLA 1SBFA 4X6RB 2G9GA 3WP4A 5FO7B 3RYKA 2DFBA 4BIFA 1HXS1 1FT9A 5I0RA 2IXKA 5BNPB 1BKZA 3MIDA 2Q4SA 2DUQA 3E97A 4PBPA 1C8M2 1CJDA 2HWC1 3WP6A 3NJZA 4U2AA 2ZX0A 2NYYA 2WIIB 3A0KA 1D2QA 1JXNA 3UJOA 1SFYA 4E2QA 2GALA 1TEIA 5T54A 4Q26A 4XETA 2FZ2A 3ATGA 1AR93 4KG8A 5ACA2 1R1A2 2FMDA 5A32B 4PDWB 1RUJ3 4WM7C 1QGLA 2VVFA 4YZ5A 2RR13 4CEYC 1RVF3 1DLLA 1ZBE3 2VMHA 1MS3A 3UKVA 3BALA 5LK5A 4JAAA 1YI7A 1AJOA 2ZA9A 4YFWA 4HN1A 4JDNA 2PHTA 3S30A 4OHYA 2DCZA 5C9AB 1KS5A 1S0DA 5JIAA 3GYDA 3AYDA 3WDXA 3ZYIB 3M1HA 4R9DA 1HRI1 3POSA 3WCRA 1REEA 3ILFA 1D0HA 3KCYA 2JG9A 1Y7BA 2ZJCA 4IV1B 3WY6A 3URFA 1AR62 5GLWA 3M8LA 1V6MA 1T6GC 2PHRA 5I0UA 2VU9A 1AR73 4D7YA 2WS91 1S2KA 3B9IA 1VBE3 3SLIA 4KWKA 4JDMA 1V6LA 1QNYA 2WNVA 4ZU4A 4Y24A 4IL7A 4AEDC 2YY1A 1AZDA 3SCGA 2WINB 3M3CA 4XJZA 2YV8A 1RINA 1PO13 4YM0A 1BK1A 4OI1A 3DPRA 4GB33 4M3CA 2PHDA 1TMF3 1GNHA 3PNAA 1Y3TA 3V65A 3IDCB 4IQPA 3KCXA 3ZXJA 2RM23 1C5HA 4D94A 1QJU3 4WVMA 2NMOA 3EXUA 1Z7S1 5GJ6A 4H7MA 3OYWA 5GZCA 1F8VA 2BTVC 4XZPA 3VBRB 1BBT2 2E6VA 2XKPA 4HPKA 3AP4A 1PVXA 5I0TA 1DQ1A 5J48A 4X6QB 1OQ1A 1AX0A 1O5UA 3NVCA 5E88A 1RC6A 3ZXFA 2WNUA 3ES4A 1QQP2 3THPA 4FOVA 5E8AA 3UKNA 1OD5A 4OFGA 5DUXA 4Q4Y2 4LUMA 4N53A 1LHWA 5E89A 2PHWA 4GALA 4PCRA 1AYN3 3ZMNA 1AVBA 4W6XA 4QQHA 2RS12 2QZ3A 1UL9A 3MZHA 5CFDA 2WKKA 2WQ4A 4RFT0 4WVVA 4PJYA 1V6NA 4XJWA 5FRAA 2DYCA 5C33A 2D43A 3OJBA 5F1RA 1WD3A 1H2NA 1RHI1 1D4M2 1LKNA 1O4YA 2W68A 5KHGA 3MGUA 2ZTNA 5ABJC 4OI0A 4YW2A 2GH8A 4HKWA 2WNVB 4Q4V3 4FT8A 1X33A 1A8MA 4RR3C 1URXA 2VNGA 4O9GA 2OIIA 2NQYA 1HRV3 2A6XA 2WFF3 1KS4A 3M3QA 2PAKA 1K5MA 3B5LB 1ENSA 3HN1A 1FOD1 3DPRB 3ME2A 3N7MA 4CEWA 2BEOA 4I0WB 2GMPA 4M3CB 4K9SA 2DWRA 3ZSKA 4UW4A 1W0OA 3WXPA 3BTAA 4JGZC 4HLTA 5ACA1 1R1A1 2EXIA 4LLFA 4QM8A 4WVMB 2CNAA 3MIBA 1BMV2 2XL7A 3ZXDA 1FX5A 3JD72 3OYWB 1DF0A 4GULA 3AZYA 3WQ0A 4RS5C 1SDWA 1BCXA 4OHZA 1RUD1 4HPKB 1C8NA 3AZWA 2TUNA 3EO6A 4EN6B 3BCWA 2JE9A 1LTEA 5JLVA 2UY8A 3HT2A 1G9AA 4MV2A 2ARBA 1WW6A 2WNUB 3AJZA 1ND3A 4XIKA 4LNVA 5FBZA 4JRAA 2MEV2 3E6BA 4MGIE 2QVSB 3KT7A 3ZSLA 4PBOA 4FOWA 2ZHNA 1AR61 2AENA 1C57A 1COV2 2E51A 4AEMA 4Q2FA 2YYOA 2F6BA 4N53B 2HWF3 2RMU3 3W59A 3VBFC 3T1LA 1ULCA 1W0PA 4M3CF 1LODA 1FXZA 3VHRA 2D44A 5CFDB 1HX6A 1I1EA 4KL1A 5K0UA 2WSVA 4Y26A 5FCCA 4CDUA 1DGWA 1EAH2 3GBFA 3VHNA 1NCQC 2WZR2 4W6YA 4LEJA 2AYHA 1SLIA 1FMD2 4AHZA 2C5DA 2D7FA 1DZQA 4XILA 1Q8PA 1MVEA 4R9BA 4FXKB 4PIXA 2EXHA 4TWTA 4YVSA 4A3XA 1YLLA 3ZFFA 1BEV3 2A70A 1PGW2 2XUMA 4FVVA 2ZKNA 4L11A 4LHNA 1GLHA 4L97A 2DV9A 2UWAA 4AQTA 1XU2A 1RITA 2ZABA 4R4ZA 1K5MB 3BU7A 3IT8A 4RSUA 5HCFA 4BHPA 3VZNA 1NXMA 1ENRA 1MR5A 1VJ2A 4JCKA 1AYM3 1G6NA 4P9JA 5DZFA 4AVBA 3N7LA 4K20A 3FWEA 1AXYA 1UPSA 2SLIA 3M3OA 5T5PA 2ARXA 4JTNA 1PIV2 2XBO2 1Y9QA 4L9BA 3ZO0B 4BCUA 4LO8A 1YHFA 5DDJ1 4MVTA 3VZKA 2GC1A 1PK6A 3QD6A 1VRH2 3LZZA 4Q4Y1 4BA6A 5JZGA 2WWSA 4X8NA 2KXLA 3N7JA 1H8TC 4I30A 2RS11 4Q4X3 4WM8A 1HW5A 2HWB1 1MEC3 1VBC3 1AUYA 1AL22 2D6PA 2GMEA 2R32A 1ND3B 1DYPA 1WD4A 4JVAA 3KZ4C 4H14A 1RJ8A 1FPN2 4LE4A 3APBA 4RQPC 4A2UA 1A6CA 1SBEA 1XXNA 2DVAA 3GZAA 4MX3A 2C1FA 3TN93 5JIUA 1JYIA 4CDXB 4XF4A 4QPGC 4DY5A 2PA7A 4RGGA 1VALA 2CY6A 1G9BA 4H3WA 1ALYA 4OULA 5KHIA 3O14A 4LO6B 2IXCA 1VBB3 1N1YA 5TSWA 3SMHA 2VOXA 3FBYA 2ATFA 4P9IA 3B00A 1LRHA 1DFQA 4LUKA 2X5IC 5K0UB 1QH6A 2WT0A 5T5LA 4CDUB 1YO8A 1S2BA 3UJQA 2DCYA 4Q1PA 5T5OA 1DGWX 1VAMA 1ULDA 1WBFA 3B7MA 4XJ8A 4BLIA 1QDOA 1FI2A 4C0HA 3S0MA 4QD2A 4A7KA 3JB8A 5H9PA 4M0NA 4UW6A 1LHNA 4NOTA 2B5HA 3D0SA 5FLJA 4YVSB 3LA2A 3ZFFB 2PYTA 3ZXLA 4AQ2A 1LOBA 4L92A 2Q30A 2A6VA 1GYKA 1WGPA 4BZ4A 4NWWA 4YYOA 1BMV1 1YUDA 1S0IA 1XYPA 3UKTA 4MYEA 4FTSA 2IWGB 1RUE1 3MFAA 2YMZA 4E27A 1YIPA 4MXWB 4X8PA 1RUF3 4E4SA 1QNWA 4CP1A 2KA3A 1B09A 4I2OA 2YDEA 3ZDSA 3VDDC 4YGCA 5BYNA 3NV2A 1UU4A 4DB5A 5JDBA 5JOYA 4YM3A 1CPMA 1R1ZA 2OA2A 2CGPA 2FBEA 2CAUA 2MEV1 3ILRA 3VZOA 2UWBA 4F7ZA 1WW7A 1PK6B 4AVTA 1COV1 2GN3A 2GNBA 4QPIC 1SMVA 2Y0IA 2E7QA 2UURA 5JZGB 1VLNA 2ZGOA 1REDA 1S0BA 3M3IA 4XXPA 4KGQA 4WM8B 4QU2A 3USUA 1H1AA 4Z07A 4WM7A 2RS31 2OYZA 1EAH1 4CEYA 4XFFA 2WZR1 4TLFA 1QXPA 3H50A 1FMD1 4RHV2 4M3CE 3RI9A 2NMNA 3AJYA 4HKLA 1SACA 5HCAA 1CAXA 1QJX2 1PVC3 5KXEA 2YUEA 3RMYA 3LOIA 1XE7A 2Z79A 2ZX4A 2ZZJA 4IEYA 4Y5Z0 2XJTA 5E16A 2VW2A 2HWC2 1CJPA 4BQ1A 5DG2A 5BPXA 1DGRN 1JHNA 3FLTA 1WLTA 1DBNA 4CDWC 1VBE2 1WCDJ 3I2DA 4ASLA 5AC93 5JVVA 5J3UA 3AB0A 3NAPC 4Q0UA 3MICA 4N43A 4FXGB 1UIKA 1V6JA 1IGOA 3FJSA 1N1TA 2E9QA 3KM5A 3ZFGA 4HVOA 5CA6A 1GR3A 5BNQA 1C3HA 4CRQA 5JPMB 1IKQA 3R4DB 4META 1VRH1 2CGOA 2JICA 4G9SB 3TOJA 1C1FA 4P9XA 4HSLA 1J1LA 3AX4A 5EXOA 1DU3D 3VUOA 4AF9A 1IPKA 1AL21 1JBCA 1J59A 1IOAA 3S6PA 3EHKA 4Z2WA 3V0AA 1RUH2 1ZZ7A 4YG3A 5SV5A 3J8F2 1FPN1 3UK9A 2D3PA 2D5HA 3AM2A 4COVA 1QHDA 3W9AA 2Z69A 3SISA 3JUUA 2YPJA 3V0BA 4L99A 1MS5A 3U0ZA 1DDLA 2MNGA 4AQ6A 3H1MA 3EBRA 4JGYC 3AP6A 2NLRA 2R042 4FPKA 3ZIXA 1C1LA 3USUB 1S1AA 5GKAC 4QM9A 3SHRA 4F3JA 4URTA 2RS53 1RMU1 3G7DA 3N7KA 3WQ1A 4WM7B 1EY2A 3D4KA 4Q0VA 5LK7B 2OW4A 4CEYB 1AR81 1DQ6A 3HAGA 2DVBA 4GIQA 4U36A 2YGMA 1CD3G 5H9RA 3G6JB 3C2UA 1QXJA 3EJKA 3MW3A 3WDTA 1SCRA 1DYKA 2UY9A 2VULA 2Y0OA 1EPZA 4XFCA 1CAXB 3PVOA 4HVQA 4CP2A 5A32A 4AGGA 1ZRRA 4D3WA 1Z7S2 1RUG3 2X8KA 1MQTC 5A33A 1RUI3 1YXWA 4AFCA 4MSVA 2BFUS 3QCWA 3RS6A 4B4RA 1ULGA 2PLV3 2PQQA 3AKRA 3DKWA 2ZGMA 2VW1A 5FAXA 4LBKA 4N43B 3B02A 4N7IA 1WMEA 2O8OA 2XHKA 1ZRFA 1BYHA 3ZFGB 1ZBA3 5C4WC 2DU0A 2ZGRA 1IHMA 1WUVA 5JSOA 3DV8A 3NW4A 5AVAA 5GZEA 2EA7A 1Q8QA 2Z42A 1CGPA 4WVWA 4B4PA 3WVJA 3NL1A 5FO8B 5IK4A 4IEPA 1AR91 4YW5A 1EPWA 4GMP0 2HEVF 1RUJ1 2NM1A 1M06G 1HKDA 3BPZA 2LM3A 1RVF1 1IQAA 1TME2 3CJIC 1MACA 2GAUA 3KS7A 4J6GA 3V0AB 4FBFA 3B69A 1GBGA 2K9ZA 4HSJA 1RHI2 1QDCA 1ENQA 3QOPA 4JDOA 5BY5A 4GWNA 2JJ6A 3MLJA 1YFUA 1IS3A 4FPYA 4Y1ZA 1ZX5A 1KFXL 3M7AA 5D8AC 1GZWA 4E2SA 2JG8C 4IEWA 3V0BB 5CG9A 2PELA 4RHV1 4I0BA 4RD7A 4COZA 3IDBB 3TB0A 5GLZA 3H1WA 3LOBA 3WD5A 3JQWA 5CBLA 1V9U3 1Q8VA 1UMZA 2QUOA 3U07A 1QJX1 3IMNA 1LOFA 4Q4W3 1ND2C 1NA1C 1I5ZA 1WMFA 1APNA 2DURA 1UU5A 5IK8A 2HWD3 3S7EA 5JSRA 3THTA 3U4XA 1U12A 3VBRA 1FOD2 3PHMA 1YJKA 1VBD3 3KD4A 2P2KA 3HMYA 1VBE1 2WLQA 4W6WA 3VBFA 4K1ZA 4BM8A 5DXDA 1Q56A 3KMHA 3UV9A 2ET7A 3WX5A 1V70A 3VBHC 4GMP3 3LSDA 4N9IA 3VBUC 1H4HA 2YGLA 4ZU7A 2VXRA 4NPRA 2VGDA 1PO11 3FZ3A 1NCQA 5A33B 4YG6A 4FPCA 4GB31 1RUD2 1GQGA 5DUVA 4ZXKA 1TMF1 1KJLA 2DVFA 3OD4A 4K6BA 3VHPA 4S2FA 1TE1B 1I3HA 4A7ZA 2Z2SB 1QJU1 1ONAA 5J37A 5C8CA 4P14A 2CWSA 3O7OA 5FLIA 5BUVA 2VMIA 1RUH1 2XH6A 2ZHLA 1OKQA 2XL9A 3J8F1 2VVEA 1NCRA 4K3UA 5CIRA 1ZVFA 1KFUL 5KBFA 2XJVA 4H55A 4OLLA 3WR0A 1CAVA 2OVUA 5IUQA 4RGAA 2GNDA 3VKLA 4XYXA 3DF0A 4KH9A 2R041 2QJVA 1HXS3 5DUUA 4I0AA 5L19A 1J3QA 5J7MA 4OHXA 3VL9A 1KXGA 4O9EA 3ZVXA 1AYN1 2XLFA 4B8EA 1PGL1 1GZWB 2A6WA 5F6KA 3ZSJA 1O91A 4AXOA 2IXLA 2XVKA 1H8TA 4IETA 3TRSB 2P3KA 2I07B 4XPVA 5EZWA 4YW4A 3OCPA 1REFA 3AXEA 5JOWA 4LO7A 3JBG2 2PAEA 3TN92 3ASIA 3AYEA 3AP9A 4SBVA 1OLQA 1JOJA 4GKYA 1LB2A 1J58A 1ZNPA 3FHIB 3IKWA 4OHWA 4OZXA 3VBFB 1ZRDA 1YFWA 4Q4V1 1XNKA 2DCTA 1OOPC 4S2GA 1O5LA 3PMEA 4Q0SA 2BQPA 1HRV1 1KJRA 2WFF1 4MGYE 5DDJ2 1BQPA 1HRI3 3MF6A 1NCQB 1XNCA 4DNYA 3OGGA 3CLPA 5EJ3A 1JW6A 1R082 2EXJA 4Q29A 1MVQA 5BNNA 4LO5B 4IEOA 1DGLA 5I93A 5SV8A 3B9CA 4AI3A 1WW5A 4C0BA 2NZ9A 2HWB2 2WS93 1F5FA 1RUC3 3ZN5A 4AEJA 5L7OA 5BNPC 5C8CB 1TME1 2K0GA 1VP6A 1OA4A 1NCRB 3IDEA 1QJY2 5CVRA 3I8TA 3UL2A 3FUQA 1CAVB 4IESA 2XVGA 2BVVA 3U11A 1YWKA 1OFSA 5JCTA 5EFUA 1ZRCA 1QY4A 4LTAA 4PDWC 3AK0A 4XFAA 4MGZE 2R073 3JZVA 1AL0G 2OZ6A 4BOWA