1PMIA

Candida albicans phosphomannose isomerase
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
440
structure length
440
Chain Sequence
SSEKLFRIQCGYQNYDWGKIGSSSAVAQFVHNSDPSITIDETKPYAELWMGTHPSVPSKAIDLNNQTLRDLVTAKPQEYLGESIITKFGSSKELPFLFKVLSIEKVLSIQAHPDKKLGAQLHAADPKNYPDDNHKPEMAIAVTDFEGFCGFKPLDQLAKTLATVPELNEIIGQELVDEFISGIKLPAEVGSQDDVNNRKLLQKVFGKLMNTDDDVIKQQTAKLLERTDREPQVFKDIDSRLPELIQRLNKQFPNDIGLFCGCLLLNHVGLNKGEAMFLQAKDPHAYISGDIIECMAASDNVVRAGFTPKFKDVKNLVEMLTYSYESVEKQKMPLQEFPRSKGDAVKSVLYDPPIAEFSVLQTIFDKSKGGKQVIEGLNGPSIVIATNGKGTIQITGDDSTKQKIDTGYVFFVAPGSSIELTADSANQDQDFTTYRAFVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The x-ray crystal structure of phosphomannose isomerase from Candida albicans at 1.7 angstrom resolution.
pubmed doi rcsb
molecule tags Isomerase
molecule keywords PHOSPHOMANNOSE ISOMERASE
total genus 137
structure length 440
sequence length 440
ec nomenclature ec 5.3.1.8: Mannose-6-phosphate isomerase.
pdb deposition date 1996-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01238 PMI_typeI Phosphomannose isomerase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.441.10 Mainly Alpha Orthogonal Bundle Phosphomannose Isomerase; domain 2 Phosphomannose Isomerase, domain 2 1pmiA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1pmiA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1pmiA03
4IEZA 4KL1A 4MH0E 4XF1A 3B02A 3H7YA 5E16A 4I09A 3H3UA 2F4PA 1LKNA 3FZ3A 4D7SA 4LULA 5KHIA 4ZU5A 4K8FA 1DGWA 2QCSB 4NVPA 4EWEA 1O3TA 2K0GA 5FQ0B 1ZZ6A 3SMHA 4MZUA 5JCTA 4CYDA 5BXXA 4XFCA 5FLHA 2QDRA 3NL1A 5JSRA 3E5UA 5J3UA 1GQGA 3NJZA 1O3RA 4D7TA 3LZZA 4JTOA 3FX3A 3BU7A 3UKVA 1Q5OA 1UIKA 2BEOA 1YFXA 3TNPB 4BYYA 2PAEA 2ATFA 4ORFA 3H1MA 4IERA 2VQAA 4H7LA 4P9GA 4OLLA 2XHKA 2ET1A 4E2SA 1CAUA 4Q0QA 5I8YA 1YLLA 4HMZA 2IC1A 3PLQA 1O5UA 3U11A 3USSA 4Q0PA 3EQEA 3LA3A 1JUHA 3WW1A 5J7MA 1X82A 5JSOA 3HT2A 1CGPA 3RDIA 3H3ZA 1QXJA 4QX5A 1EP0A 5JSPA 4XF4A 5I0UA 4UBHA 2XL9A 4O9EA 3IBMA 4XF0A 2ET7A 3SCHA 1FI2A 4HN0A 2V09A 3TNQA 2GC1A 3NW4A 4FAHA 5I8SA 2XLFA 2XKOA 1YFWA 4I01A 3WW2A 4MGYE 2H6CA 4AXOA 4LUKA 4BH9A 2OA2A 2I45A 3ST7A 2PFWA 5EFUA 1ZRDA 4R52A 4XFAA 1UIJA 3IIAA 4ZU4A 5FCCA 1LRHA 2P17A 3D0JA 2VECA 1OMIA 1X8MA 1DZTA 2ZKLA 3S0MA 2GU9A 3M3IA 1Q43A 4HSLA 4AQ6A 3DKWA 4IEQA 3IWZA 2UYBA 2IXHA 4YSFA 4LTAA 2UY9A 5LRRA 3EBRA 5D1IA 1LR5A 2EA7A 2XLAA 4EWDA 1DGRA 1X8EA 3S7IA 3CEWA 2UY8A 4I02A 3IDCB 2IXLA 1GQHA 2PHDA 4AVCA 1PM7A 1CAUB 3E6CC 1ZZ8A 5T3NA 1J58A 3MDPA 2GC3A 4MGKE 2VPVA 3GYDA 5FLJA 4XETA 3BALA 4IEUA 2BNNA 5FLIA 4WVZA 2MPFA 2IXIA 5C8WA 2D40A 2KXLA 3LA7A 4I3PA 4XFBA 4JTNA 3CJXA 2HJIA 3OTFA 4O9GA 4WBBA 2Q0AA 2H0VA 3I59B 5CVRA 5FDBA 1NE6A 1X7NA 1EPZA 3JZVA 4BIFA 4J1WA 2GH2A 1ZRCA 5FQ0A 1H1MA 4X6QB 2PTMA 4OFGA 2Z69A 1CAWA 1OFNA 5LRSA 1O4TA 1UPIA 1QXRA 3BCWA 1RUOA 4ONUA 4HN1A 3D0SA 3ETQA 5LEJA 3UKTA 1RUNA 3CO2A 1Y3TA 4RD7A 5BV6A 3H1WA 3QOPA 3BB6A 3PNAA 1RGSA 1RC6A 4HBNA 4JV4A 3H50A 1CAVB 1YUDA 4ZU7A 3U0ZA 3NKTA 1J3RA 3BPZA 3ES1A 4AVAA 3D82A 1H1IA 3L2HA 5E1RA 4F8AA 4EROA 3WW3A 4MV2A 3I54A 4A2UA 2EAAA 3H1YA 2CGPA 1VR3A 3R6SA 5CADA 2EVXA 4I2OA 3ELNA 1ZRRA 4B29A 4N9HA 4E2QA 1YFUA 1ZVFA 1ZZ9A 4MUVA 5AVPA 4QGLA 2MNGA 3QACA 1J3QA 1L3JA 4N9IA 1DZRA 1U12A 3CF6E 3LAGA 3LA2A 1QWRA 1CAXA 2ZCWA 2OZJA 4QGNA 1V70A 3VHRA 1ZNPA 3SCGA 2UYAA 2O1QA 2QNKA 3G7DA 2Q1ZB 3IDBB 1SEFA 1YWKA 3SXWA 4PJYA 4IEYA 2PA7A 4LA3A 2CAVA 2FMYA 3MPBA 4XFIA 1SQ4A 3GBFA 3KMHA 3H9AA 1Y9QA 3KGLA 4HZFA 4LLOA 1ZZ7A 4LUMA 4HVQA 5I0RA 1NYWA 4IEXA 4EWAA 2CAUA 5EZWA 4KWJA 3SHRA 2GZWA 3FFQA 4LA2A 3NSTA 3FE5A 5JAXA 4FT8A 1ZREA 1XE7A 4Q0SA 2Z2SB 2PAMA 4IEPA 1HW5A 3WW4A 3OF1A 1ZZBA 1OD5A 4XFGA 3OD0A 1EY2A 2O8QA 2WC2A 2D93A 4QM9A 4IETA 1CAWB 1J3PA 4PIZA 1Q3EA 1CAXB 3E6DA 4Q0UA 2BYVE 4QMAA 1NE4A 2B5HA 4Z82A 5I0TA 3HIFA 3RYKA 2QJVA 1UW8A 3H7JA 3E6BA 3O14A 5BPXA 3DL3A 4XF3A 3N4MA 2CV6A 2OZ6A 5I0SA 2Q4SA 4LEJA 2IXKA 4META 5K8SA 1FXZA 4WZCA 4I0AA 1SFNA 2GC2A 5JR7B 1YFYA 2K9ZA 4QGMA 4MGIE 2D5FA 3ES4A 5KHGA 3EO6A 3LOIA 3HQXA 4X6RB 2H6BA 1IPJA 1J1LA 5FPXA 4HVRA 4R8HA 3ROUA 2IXJA 1CX4A 3C3VA 2XKPA 5KHJA 2PHLA 3EHKA 4YRDA 5I91A 1O3SA 4YARA 3FJSA 3KCCA 4JVAA 2C0ZA 3DV8A 2Y0OA 1CAVA 4I0BA 4XEZA 4UBGA 5CU1A 3UKNA 4KWLA 3HT1A 4TLFA 4XFFA 1I6XA 1NXMA 1RTVA 5HI0A 2DCTA 5LEKA 5I8TA 3M70A 5F1RA 3OGJA 5KHHA 3RPQA 3LWCA 4AQ2A 3PVBB 4IESA 2B8MA 4UXAA 3MZHA 5BUVA 4HVOA 4J1XA 2PQQA 5KBFA 5C6CA 4FBFA 1PMIA 3SCFA 3ACLA 1TQ5A 1WA4A 2XL7A 2OYZA 3RYRA 1ZX5A 3OCPA 2OPKA 4XF9A 1I5ZA 1UCXA 4PIYA 4Q0VA 3S7EA 1FT9A 4FAGA 4Z07A 1IPKA 1ZRFA 1WGPA 1YHFA 4QXKA 3ZDSA 2BNMA 4KU8A 2PYTA 4HLTA 1OI6A 2XLGA 3DN7A 3FHIB 3H8UA 4XFHA 1WLTA 5I93A 5J48A 3I7DA 4AVBA 3E5QA 1ZZCA 4QM8A 4E2GA 2GC0A 1XRUA 5BY5A 3RZZA 3I59A 4GULA 4YNIA 3KGZA 2BNOA 3CLPA 1UD1A 3E5XA 2FQPA 2ETEA 2PAKA 3FWEA 3MYXA 4IEWA 1G6NA 1O5LA 2Q30A 3NVCA 5FPZA 3E97A 4YYOA 3RYPA 1O3QA 2IXCA 2GAUA 2HKXA 4L11A 4MGZE 2N7GA 1EYBA 4L2NA 4HSJA 3EJKA 3KSCA 4IEOA 2BGCA 3U10A 4PIXA 1VJ2A 2QVSB 1XE8A 4Q29A 2D5HA 2E9QA 2B9UA 4MX3A 4IEVA 1J59A 1RL3A 4F7ZA 2XGXA 1O7FA 3RNSA 1NZCA 4EV0A 5KHKA 4BHPA 1VP6A 2WFPA 1QY4A 4KWKA 1LB2A 2MHFA 4KU7A 3CL1A 4DINB
chains in the Genus database with same CATH superfamily
4TYSA 1DLLA 2P3JA 4IEZA 4CSWA 4KL1A 1U5IA 2XBO1 4XF1A 2B7YA 2VBBA 3AM2A 3W5NA 1AJKA 4AFMA 4I09A 1SHWB 3VDDC 5FPBA 1TE1B 2HWD3 4NJ4A 1FMD3 3S6PA 1OH4A 1HKDA 3TN91 4D7SA 1XXNA 4GH4A 2XJQA 3E1F1 1GZCA 2R062 3GHMA 1IZ3A 1Q8VA 2ZEZA 3KVBA 3UGGA 5IFTA 3WNMA 1ND3A 1JYXA 1RB8G 1JZ2A 1UO9A 1ZZ6A 3WD5A 3ZFEB 5DAPA 4JGYC 1IG3A 4XFCA 3ZOIA 1SPPB 1HQWA 5EWSA 4YZ4A 5T52A 1BJQA 4L97A 4QQOA 4SLIA 3NNMA 1VBE3 2FDFA 1PMHX 1ZBE2 1UMHA 2VBPA 4D7TA 3UKVA 3BU7A 2AENA 2A5ZA 4UWDA 1G8WA 2D97A 1C1FA 5FPAA 2JWPA 1T2XA 1YFXA 2VVFA 1HRI3 3AP5A 2EXKA 3H1MA 5LATA 1SPPA 1RMU3 5DZFA 1UY1A 5ANQA 4XE9A 1NLQA 3NAPC 1FPN1 5JI7A 1H0BA 2Q8EA 1Q8PA 4BQ5A 1C8M3 1CR7A 2XHKA 4BDVB 3JD71 3WF1A 4UT5A 5FJHA 4EZ4A 1CAUA 4QPYA 2Z79A 5FO9B 4PHZA 2VR4A 4RFRB 4W6WA 1OUSA 4Y20B 3J7HA 3PLQA 1O5UA 4S2GA 3U11A 3ZXEA 5E8AA 3ZO0B 3OYWA 4Q0PA 1GNYA 3ZFFB 3ZVXA 2NPIA 3FBMA 3ZFGB 3ZYBA 4LO6B 3U78A 2FD8A 2Q8OA 1TME1 5B4NA 2V4AA 1ALYA 5FYSA 5JSOA 4AEKA 1POV0 4Q4X3 5JLVA 2ARBA 1CGPA 2DCJA 3UJOA 4TTGA 2DF7A 2RDNA 1Z7S1 3IBMA 5FYIA 5F5AA 4FOWA 4Q4W2 1XU1A 2V72A 4DY5A 2ET7A 1TG7A 3BN6A 4HN0A 4NHXA 2VNRA 4M0HA 1UY3A 4FFGA 2Q1FA 2GC1A 2Z5WA 3VBOA 2AYHA 2ZHLA 3NW4A 4FQ4A 3UJQA 5I8SA 4OUMA 5B4XA 4DUXA 3RZMA 4CCDA 2RDSA 3M3OA 1QQP3 2RS32 3R0RA 4MGYE 4N43B 4QX7A 2RV9A 1RUE2 5T5OA 4BH9A 2OA2A 2I45A 3IZOA 4ZKTB 1DQ6A 5EFUA 2XBO2 4NPLA 4N90A 4R52A 1VBD2 1XE0A 3BTXA 3FLTA 3MIHA 4AYUA 4G4FA 5JMOA 1U0AA 4GB31 5A7PA 2VGDA 2VECA 1BEV3 1MS3A 2Z4FA 4G9SB 3S0MA 3N9OA 1QH6A 4QPGC 5DAWA 4CEYC 3EXUA 5BNNC 1JXNA 4AQ6A 2W47A 3SISA 1J84A 4QHZA 3A4UA 1HDKA 3I3EA 5A7QA 3U4XA 4BXSV 3NJXA 3C7HA 4NRPA 1NCRC 1LR5A 2AC1A 4OZOA 3WP3A 3V0BB 2WWSA 4IGOA 4QPGA 4D6SA 4CEYA 1NCRB 1X8EA 3S7IA 3CEWA 5FZDA 3BOPA 4AR2A 4CUCA 5BNNA 2YY1A 5F37A 4I02A 4WZFA 1MS4A 3GCWA 2DWRA 4GWJA 4QXCA 2PHDA 1MS0A 3ZKYA 1UWWA 3B9IA 1PM7A 4M3CF 4NWVA 4WVWA 4XJ8A 4CPBD 1AYN2 1IS4A 2WLQA 3AYAA 1QJU3 2D3PA 2JECA 4W4ZA 5F8PA 2EAKA 3CZJA 4PLMA 4Y22B 3TBDA 3GYDA 1L7LA 1DLCA 1OF4A 1UXZA 1UXXX 1MR5A 1ULCA 1LGNA 1LU1A 1ZRIA 3GDBA 4L8QA 4CCJA 4URTA 4JZRA 2FZ1A 5FZ1A 4AF9A 5A6YA 3NMBA 1MPXA 2GDFA 2JDKA 2TBVA 2Y6FA 2HLEA 5IVEA 2BNNA 5EJ1B 1N3QA 2GALA 2MPFA 3I3QA 4HPKB 4L92A 2JG8A 2RS53 3BODA 3LA7A 1W9TA 3WNOA 2BV4A 3GCXA 4I3PA 2X5IB 4XTPA 4P9YA 4FCAA 2FCUA 3I2HA 4Y5TA 4CP9B 5AFBA 2CWSA 2ZHMA 3KCYA 3DEMA 1AR63 4Q1RA 5A1AA 1MACA 5CVRA 1V00A 1BZWA 3OGRA 5EQUA 5FDBA 4LK6A 3PIGA 3GXUA 3MI8A 5FUIA 2V73A 1NKGA 2ZABA 4XMAA 4J6GA 4BCUA 2GNBA 4J1WA 1W6OB 2RS13 1KFUL 4FP2A 4BQ2A 4ZS3A 4HPKA 2P34A 5FYVA 1WMXA 4B4QA 2VO5A 2RM21 3NNJA 4LO8A 2PTMA 3U4SA 3IIIA 2ZZQA 3RGBA 4YG6A 1TMF2 4YG0A 1CAWA 1VB2A 5HBAA 3BKZA 1DQ2A 5FR3A 2DVBA 2E53A 4COYA 3BCWA 3JBG2 1V6LA 5C9AC 4ONUA 4K9SA 2A6YA 1DZQA 4QXHA 5LZ6A 3Q8CA 2QQPA 3UKTA 1RUNA 4RD7A 4NRQA 4QB1A 3JD72 1VMFA 4B8EA 2ZBJA 4WVVA 2WO2A 2OUHA 2YU2A 2XXZA 4XBLA 2VZSA 1OQEA 2VW1A 1POQA 4N43A 3UETA 1LEMA 2CL2A 3ES1A 4KMQA 4W6YA 3WP6A 2QQKA 1DDLA 1CZTA 3D82A 1UYPA 4BB3A 3CDZB 5B2GB 4MV2A 3I54A 1QOOA 1QEXA 1BKZA 4YFZA 4CEWA 2DDUA 5BNPB 1AYM1 2ORZA 4P9WA 4Y4RA 1WCDJ 2WO7A 4AVVA 2D6PA 2RR13 3VZJA 2VE1A 2YC2A 3D4KA 3INAA 1KFXL 3TB0A 2YXSA 2VZUA 3ELNA 5F5CA 2V5DA 5AVAA 4CDXA 1NA1A 3LKJA 4GMP0 3WNLA 1MS9A 5KXBA 5AVPA 4XBNA 4CPBA 3POFA 3N36A 3O0VA 1UPSA 4ZXKA 3U07A 3H8XA 1GICA 1XBFA 1L3JA 4DXZA 4N9IA 3NQHA 5C4WC 1U12A 2WZPP 4QHBA 3RI9A 5KXDA 3O1PA 4HKLA 3LA2A 4LHSA 3ITQA 4K40A 3PJQA 3VDDB 2OZJA 1V70A 2VW0A 3GBGA 3SCGA 1DG6A 3B00A 3NO8A 5GM0A 1Y9GA 3IDBB 4LOSA 3NRUA 4Q4W3 1LODA 3VN4A 5ABJC 4PJYA 2D43A 4IEYA 4XQWA 4IV3A 3MPBA 4YG3A 4XTMA 5JI9A 5SV8A 3THDA 5A3NA 2DVDA 2W08A 4HETA 1S0DA 1EAH1 4GZ9A 3V0AB 3GNEA 1FYUA 4LUMA 2XPJA 1ZZ7A 1FOD2 1QJEA 5D8AA 2A3XA 5C3OA 5DDJ3 5EZWA 1GANA 1HXS1 4BISA 2VVDA 5JXJA 2AEYA 2BZDA 1H2KA 1T6GC 1ND2C 1RITA 2GP5A 2GZWA 3FFQA 1NUKA 1S2BA 3MGUA 4IV3C 5A7SA 4CP0A 1XE7A 2W1UA 1ULGA 3KT4A 4NPRA 4Q4X2 5DDJ2 1HW5A 1XNCA 3OEBA 1PZ9A 1GV9A 3JBG1 1IQDC 2VQUA 1S0BA 2XJUA 3P6BA 4FPKA 1H9PA 4EN6B 3V0AA 2GN3A 1TMF1 2WC2A 5GJ6A 4DEVA 4ES8A 2WNVB 5EHDA 3VD5A 2BW8A 4RSUA 4LE4A 4JDMA 2C1FA 2W52A 1CAWB 3O0WA 1RVF2 1Q3EA 5F5IA 1DCSA 1XNBA 2YBSA 4Q0UA 5J98B 5LBBA 3WZ1A 1NQDA 5FZAA 2ZX4A 2ENRA 2VCCA 3ZLIA 3L9JT 5EV7A 1UZVA 3BI3A 2QJVA 3AKQA 1DBNA 2PHRA 1SFYA 3H7JA 5LB6A 4FI9A 1C8NA 2WFF1 2NN8A 3VDDA 2W1WA 3FHQA 4XIOA 4RGGA 3CMGA 1AYM2 1JHNA 1F2NA 1KJRA 3N4MA 2CV6A 1C57A 3W58A 1KJLA 3OBZA 5DXDA 2Q4SA 1S0EA 1UNBA 2IXKA 1MS5A 2VNVA 5K8SA 4WZCA 3AP9A 1S2EA 4CXWA 4ZXEA 2ZX0A 2GMPA 2K2SA 1SFNA 3SKVA 1VIWB 2W91A 3PUIA 4ZPIA 1A3KA 2K9ZA 2XB6C 3VD3A 2DUPA 3M8LA 4O7XA 2VUAA 4E4ZA 4OI4A 3JB8A 1OBNA 2BRTA 5C4WB 5J1XA 2GNMA 2OQ6A 2VUJA 3BGAA 4LJHA 2ZHKA 2WYFA 1GP4A 1PO11 3AMNA 1NG0A 1XOYA 1SLTA 3WNNA 5FPXA 3N9MA 1XYNA 1XSQA 2R071 2FBEA 1ASJ3 4AWDA 3I3MA 3TRSB 2C6SA 3C3VA 2XKPA 4AHZA 4KH9A 3EHKA 1F35A 4YRDA 5KHJA 5F3CA 2QUOA 1DQ1A 3GZUC 1AZDA 3I3DA 1QHDA 3KCCA 3SEPA 2QQVA 3DV8A 1AR91 1OLME 3HQUA 5GZFA 3KM5A 2HBTA 4NOTA 4EZHA 5A70A 1V6NA 1I5PA 2HWB1 3RRDA 3ZYGA 4UBGA 4JRAA 4XJZA 4ITCA 1IG0A 4EQVA 3HT1A 4O65A 5FP3A 1Q8OA 1JOBA 4Q4Y2 4GJZA 1JYWA 1RTVA 3IN9A 5LEKA 1H6YA 5I8TA 2R6QA 1WMDA 3HAGA 2WSVA 2JG9C 1R1A1 3K51A 3MICA 5FPLA 5DMYA 1PIV2 2BOJA 3OBAA 5FIXA 1NCQA 3KT7A 3G6JB 2ZKNA 3J9SA 3POSA 4AFCA 4J1XA 3HR9A 3NAPB 2PQQA 3GF6A 5KBFA 3ZR6A 4LLFA 3BIEA 2RS31 4IL7A 2RJKA 3VBRA 2QQJA 3ZSJA 1MZ6A 4ISRA 4LITA 1TQ5A 3VUOA 1YQ5A 5FZGA 3WF2A 1KQRA 4BQWA 3RYRA 3VBOC 1GSLA 2VMIA 3PUAA 1NCQC 1ZX5A 3WUDA 2FDHA 4RHV2 1I5ZA 4MSVA 4YW6A 2VOTA 4PIYA 2VC9A 2BU9A 2Q8DA 4ES9A 1FT9A 1I1EA 2GMMA 1XJAA 4BU2A 4Z07A 2A6ZA 1IPKA 1MQTA 1R082 3WEZA 5L7OC 2BWAA 3M7AA 2W3JA 3VKOA 5AC91 4JQTA 3B94A 2BNMA 4KU8A 4PBPA 1XNDA 3SQOA 1GZTA 4GAZA 3WDVA 1RUD2 1D0GA 2WZ8A 5J48A 3TEZA 3H42B 1W3VA 2ZEXA 2Q5TA 4QPGB 3I7DA 2BJSA 4AI3A 3ACHA 5KWRA 1POV3 1URXA 1K5MA 1TVGA 1ZZCA 4QM8A 2GNDA 2GC0A 4AI0A 4BQYA 3RZZA 4E2GA 2D3SA 3CQOA 4D3WA 3THCA 3AB0A 2HWF3 4P9XA 3VV1A 4BE3A 4QKNA 4NROA 3E5XA 4YVSA 2E33A 4DRRA 3MYXA 4IEWA 4D94A 5A3PA 1O5LA 1ZA7A 2ZZJA 1RUF1 3NVCA 3DUIA 3C7EA 1NQJA 2JJ6A 1IOAA 4FOYA 1UX7A 4GWNA 4YYOA 1O3QA 3HOBA 5HXMA 4XJAA 2JE8A 2NZ9A 2VL4A 1GZWA 1RXFA 4L2NA 4HSJA 3ON7A 1OLMA 1X9TA 1W8UA 1ZBE1 2R1BA 3EJKA 1BBT3 2P6HA 3KSCA 2JD9A 2FCTA 3NJYA 4FOVA 4Y5SA 5LY2A 3VKFC 3VB9A 4XDQA 4XILA 4LBQA 2WNUC 2V5YA 1S0CA 1XE8A 1OKQA 4Q29A 1KS5A 5A1FA 1SCRA 3JUUA 4XUNA 2B9UA 4IEVA 2BVBA 1U5ZA 2C4XA 2WNUB 3IMNA 3MLKA 4LQRA 4OQ8A 3RNSA 1GQPA 3ZMNA 2AZ5A 5FK7A 3AKRA 3H8OA 4OMCA 2G9ZA 4OQ9A 3RFRA 1FPN2 1JZ4A 1VP6A 4CEYB 1JI6A 2P1BA 4FFFA 2DVAA 3IPVB 3MIFA 3ORJA 4KWKA 5FYHA 3PIJA 1DP0A 4M4PA 2YFUA 3PU3A 1GP5A 5HXVA 4COZA 5IATA 1SZBA 1H2LA 2VCMA 2VXJA 3S30A 3OPTA 3ZSEA 1ND2B 1OKOA 2YB7A 1CZSA 5GLVA 1VRH1 2RS52 3O1UA 1QDCA 5E16A 2VTXJ 3PUHA 2IFWA 2MEV3 4YGDA 1LKNA 3IT8A 1QOTA 1UU6A 1VMHA 4AI9A 4YW3A 5FZFA 1DGRN 1WCKA 4FPCA 3IKWA 4RS5B 1HJFA 4HK9A 3UGHA 2QCSB 3KB5A 4NVPA 4AI1A 3LSDA 1P8JA 5FQ0B 3I49A 1AYN3 2VOWA 1JH5A 3FLRA 3J26N 3UNPA 1HB1A 1LEDA 2XWJB 5JCTA 5IK4A 4Y26A 4FTSA 4PDWC 2Y60A 1AR82 3WV6A 1SDWA 5A32A 2ZS6B 5F3EA 3PVEA 4UFLA 1LHNA 4TLGA 5JSRA 1W39A 4ZY9A 4UW4A 2PMWB 3J8F1 2UWBA 2B46X 1RMU1 2QZ2A 2WL1A 5F6LB 2HWF2 1O91A 5IT6A 2C5DA 1Q5OA 5T50A 1ACCA 3JD73 3MLLA 3ZN4A 3TEXA 5A6QA 4HONA 3VBRC 4PDWA 3P3PA 1R1A2 1SBEA 2PAEA 1W3XA 4QPIB 4CTEA 4IV1B 2GH8A 1F4AA 4RR3C 1PGW2 3HQRA 3A7QA 5IVYA 1VBA2 1L7QA 4UW6A 1APNA 3AL5A 5A3TA 4P9GA 4CDQC 4OLLA 3JU9A 4Z1VA 1AVBA 1RUC2 5CFCC 2BERA 1LOCA 1O8SA 1WLCA 3H0OA 4Y20A 1ULPA 5JXIA 2VMHA 4IXLA 1RVF1 1N47A 3D5OA 1YLLA 2R0FA 3OY8B 4RHV1 4BQ4A 2IC1A 2BBVA 2CWMA 1Q8QA 3IAPA 2B45X 4DEQA 3TEYA 1A78A 2OX0A 5SV5A 3USSA 3EQEA 3LB9A 3LDKA 4BWOA 3MFCA 1PO23 5C4WA 1US2A 2WINB 3PU8A 4OHVA 4QX5A 1EP0A 5JSPA 4XF4A 4JHTA 3THTA 1SLCA 1NXD1 2DTYA 4FXGB 3W5MA 3MUZ1 1X50A 4Y5Z0 3USUB 4KGQA 4AQTA 2E32A 2XJTA 3NV2A 4OZXA 5FZ9A 4GIQA 3M4FA 5A80A 1Z0HA 3UL2A 2V09A 1PGW1 1B35A 4YVWC 1FOD1 5KC5A 2WN2A 4FAHA 1W8HA 2VZ1A 4WM8A 4CCNA 2XLFA 2XKOA 4YZ3A 3RG0A 1BBT2 3WW2A 3POEA 4K7JA 1IKPA 4YW4A 1V6MA 1BEV1 2XJPA 4IV1C 4XIKA 5JDBA 1JZ7A 4NIGA 1W8WA 3ST7A 4W6XA 4ZZ5A 4BK5A 2WYSA 4XHBA 1JYVA 3FUOA 1RUI3 3ZSLA 4QT6A 3N7KA 3O0XA 4D0QA 4P5YA 5J09A 3FN9A 4QWNA 4ZU4A 2P17A 1V9U3 2HEYF 1B35B 1OMIA 2J1AA 3BYWA 2CDPA 3RZHA 3QBQA 2JKXA 1AX1A 2GU9A 1SG3A 3M3IA 3RVHA 5KC6A 4GMP1 1NZIA 5FY8A 1F5JA 4UAPA 4MXVA 2WAAA 2YDEA 3VD9A 4IEQA 2UYBA 1UZ0A 1G7YA 2IXHA 5T5LA 4LTAA 2ADDA 4FPYA 2EXHA 2ILMA 1VLNA 2UY9A 5LRRA 4XURA 4U2AA 3RWNA 1R093 3CU7A 5LK7B 1AL21 2EA7A 5ANNA 4URAA 5M0TA 1QJU1 5A33B 2X09A 1H8VA 1QJX1 1B09A 1PK6B 1WZXA 2XONA 2YBPA 4JGZB 1YI7A 1NA1B 4QX1A 1RMU2 1G9DA 1YRZA 3VHOA 2LROA 1KGYA 1W0NA 2ZX2A 4UFJA 3UK9A 5BNNB 3PVNA 3E6CC 1RUC3 4DZGA 4CP2A 1ZBA2 5FKCA 2RS51 4D6RA 2D6MA 2R0HA 5FZLA 2P3IA 4FPFA 2VMEA 2VPVA 4JKMA 4LORA 4XETA 1XC6A 5CKMA 5FLJA 4CDXB 3ZXAC 4AGGA 3BTZA 1W9FA 3LPFA 3ACFA 3NKGA 2WNOA 3ZDVA 2J1EA 4O61A 1HRV2 3NNGA 1PX4A 3QCWA 4SBVA 4WVZA 5C8WA 1W2AX 2LTNA 4LXLA 4ASKA 1QJZA 1AJOA 1DQ0A 2JG9B 4KG0A 1KITA 3HJRA 1VBD1 3P5BA 2E51A 4O9GA 3MV11 4NUBA 1W6QA 2WS93 2HYXA 2H0VA 1MEC2 2RM23 3I59B 4DOUA 1RXGA 3J7LA 4JGZA 3WY6A 3JZVA 4QPWA 4BIFA 4BQXA 5LY1A 3ZX7A 4B4RA 1SCSA 5IK8A 5FQ0A 1OT5A 1N3OA 2VMCA 3B01A 4A6OA 3EMRA 1QNYA 1A8DA 4HANA 5DQ0A 5ISLA 3OUIA 1COV3 3AXDA 4LHKA 1HLCA 1QH7A 2XJVA 4PDWB 4WV8A 2FDIA 1AR73 1GFF2 2VZ3A 4FFHA 5F5QA 5GZCA 1O4TA 2G19A 1AX2A 2Y0IA 5IJRA 1UPIA 2VTXA 4R4XA 4LO7A 1OQ1A 4B1LA 1W6PA 2QQIA 4EYUA 4X8PA 4CU8A 3ETQA 3L2YA 4LKDA 3CO2A 1Y3TA 2W5FA 4CCMA 5BV6A 1UZZA 2LUWA 1W2OA 3BB6A 2E6VA 4ZS2A 3PNAA 1RGSA 2VH9A 4NAMA 4JV4A 2VUCA 1UL9A 1UX6A 3H50A 3KV4A 1YUDA 2YPDA 5FOBB 2CNAA 1RUF2 3JB4C 2JG8B 1HB4A 1EPWA 5A3UA 1HQLA 3N7LA 4AVAA 1PVC2 1H1IA 3L2HA 5E1RA 5F2SA 2B4KA 3SKJE 4A41A 3OUHA 4GXLA 4EROA 3WW3A 3V64A 3VZLA 1D4M1 5FMBA 2G4IA 4IE5A 1OC1A 4EN9B 4FTEA 1RUE3 1OA4A 4KQ7A 4A4AA 2EAAA 4YWAA 3H1YA 2BOIA 4NIAA 4XUQA 3NWKA 4AHXA 5KR7A 4BMEA 4QX2A 1UKGA 1VR3A 3VGIA 3R6SA 5CADA 1AXYA 1PMJX 2Y34A 2K46A 4LO5B 5IUQA 4I2OA 1DHKB 1NLSA 1D2QA 1ONAA 1ODMA 3M3CA 2WRAA 4N53A 1YFUA 1Y7BA 1C5IA 2D44A 3OGGA 3WG4A 2OPWA 1OPMA 2BGOA 3BTAA 4XJ9A 5JWPA 4UOJA 5DAQA 3ZFEA 2MNGA 2A6XA 1LOGA 3WNXA 4RGKA 3RQ0A 1J3QA 1YJLA 5FMOL 5JOWA 2UURA 5ACA1 1DZRA 4HXCA 4OHZA 1G9FA 4CU6A 1BYHA 4CCCA 1GUIA 4UF0B 3FUQA 1UU5A 2DUOA 2ZCWA 1QJY3 4QGNA 1C28A 1SLBA 3HN3A 3URFA 3VHRA 2O1QA 1D4M2 5DUXA 4OYUA 1RUD3 4I3GA 3VL8A 1BK0A 1NY71 3BUCA 1GWKA 4QPIA 3SXWA 4YW2A 4I30A 2QE3A 4E4HA 2CAVA 4YVSC 4GWIA 4XFIA 1F8VA 5FXVA 1K45A 3KMHA 2ZEYA 1AL0G 5EPAA 1WW5A 1EV11 1WD4A 2R043 5DG1A 1I9RA 2I2SA 1Y9QA 2HWC1 4HZFA 4HVQA 5I0RA 3Q8FA 1YYNA 3JBG3 1NYWA 3K4DA 4IEXA 2CAUA 3A21A 3AMHA 2JDMA 4P5HA 4LKFA 4NHYA 5H9PA 4AVTA 3VKMA 1SLLA 4M4RA 3I4IA 5C7GA 5JMCA 5CISA 4LA2A 3NSTA 3VL9A 3WQ7A 4FT8A 1ZREA 1QNWA 1KD7A 1YNAA 4YGEA 1RUG2 3Q8EA 2R30A 2Z2SB 4UW5A 5EYYA 5A3OA 4UYBA 4LBLA 4Q4V1 5IVVA 4DRVA 1AR92 2I07B 3OD0A 3QH6A 1C5HA 1GBGA 3PUSA 2PHTA 2D93A 2WN3A 5GLTA 4MOAA 1R1ZA 3N9PA 4YM2A 5A6XA 4OI0A 4BIOA 3W9AA 1RUJ1 2JDYA 1OOPB 1CAXB 3WF3A 4Q4Y3 5FO7B 4LNVA 3ZR5A 2WJSA 4KGGA 3ZMOA 4KI5M 1PGL2 1QXPA 4DIQA 4OMDA 2Y6JA 3O5SA 3C8XA 3RYKA 2WAOA 4ET7A 1REEA 4BLIA 1W05A 3E6BA 3V0BA 1CPNA 5CA6A 1S1AA 5DAVA 3OJBA 1S0JA 2WQ4A 4A42A 1JUIA 2BWCA 2OZ6A 5E89A 4AEJA 2WKKA 2UWCA 3KWVA 2WT2A 1QMJA 1RHI3 1WD3A 4LO4B 1FXZA 1LENA 3T0BA 4DUWA 2CY6A 1JZ8A 4DXTA 2GC2A 3OGSA 5FP9A 1YFYA 1ND3C 4YM3A 1DGWX 5IFPA 4UFMA 1DU3D 2D5FA 1BCXA 2DU0A 2DYCA 3ES4A 5L9BA 5KHGA 3LOBA 3EO6A 4YPJA 4Y33A 1AHSA 1LGCA 1W8OA 2H6BA 3C2UA 3DGTA 4R8HA 4Z8BA 3ZIWA 5LA1A 2RDQA 2HWB3 2XUMA 3Q8AA 3KLSA 1FATA 1W6OA 4JCKA 4CU9A 4D6QA 4RL7A 2WWUA 3OEAA 4RS5C 4YM0A 3VBUA 3AYEA 3VHPA 1O3SA 4DB5A 1YQ8A 4NHKA 5CG8A 4LBMA 5A6ZA 4NE9A 5GZEA 4RR3A 4A7YA 2XVGA 3RJRA 2JIJA 4I0BA 2JDPA 4GH4C 1QJX2 5CU1A 1REFA 2JB8A 5C9AA 4N53C 5LASA 4RS5A 3VBUC 2EXJA 4KNCA 1OSGA 1X33A 2VULA 1SACA 2E31A 4XFFA 4R9CA 5F7UA 1I6XA 1OA3A 1Z78A 3PTRB 5FY7A 5FZCA 4LMFA 3KQ4B 2XQXA 4HT1T 2RVAA 3OGJA 4TSVA 1QJU2 5KHHA 2F4LA 2ZGLA 2Y8KA 2G1MA 3AP4A 4IESA 5FAXA 2EIGA 2ZHNA 4A3XA 2JDHA 4AFBA 5BUVA 2AREA 1K5JA 3AP6A 3OY8A 4QKFA 3WNPA 5ABJB 1SBFA 2BFUS 2ZGOA 3IB3A 3JCIA 3SCFA 2ARXA 4A45A 4OHWA 1W28A 1RUH3 1XPWA 4QAWA 1ZYBA 3ZN6A 3AFKA 1WA4A 5CKQA 4NN0A 4GKYA 3ZXLA 2RJ2A 2WA4A 5JZGA 3KF5A 3AZZA 2J22A 5FZIA 1UCXA 3DPRA 1WW4A 2HEVF 2V4VA 1WLDA 3LGRA 4Q0VA 1D0HA 2DBNA 4MADA 4YW7A 4FAGA 2B9VA 2WABA 3KF3A 4YLZA 1YQ6A 5FPUA 1L7RA 1WGPA 5FREA 5L9VA 2P3YA 1POV1 4QXKA 3WG3A 3ZDSA 2C9KA 2VCAA 4TXWA 2PYTA 4LPLA 4NO4A 2XLGA 3DN7A 4D69A 3DPRC 1AR83 4XFHA 4PI0A 4ASMB 3WNKA 2XBO3 4JDNA 2EALA 4QU2A 4U36A 5LA2A 3NNFA 3GZAA 2C24A 5L9RA 3E5QA 4AHYA 1WCQA 4CUGA 5BY5A 1VBC3 4BM8A 1VE0A 3WQ0A 4LIVA 3FMGA 2RJLA 2JIGA 1BEV2 1M4WA 3CLPA 1V0AA 3T3YA 2WLPA 1WW6A 3FWEA 3O1TA 4ZONA 5FKBA 2CU5A 1PO12 4RQPB 1QU0A 2Q30A 3AMQA 3FFZA 5HCHA 1PIV1 4QD2A 3RYPA 1PK6C 1WA6X 2ZGKA 3O1RA 1EYBA 1OOPA 5GZGA 1AF9A 1W04A 2BGCA 3ZYRA 3UGFA 4BOWA 2ZAAA 5JXHA 2ZGSA 1VBE1 4PIXA 2YFZA 5HCBA 2F17A 1H6XA 4OI2A 3ACIA 3I2KA 2E9QA 3GM8A 5C3SA 1QDOA 3I3BA 4IW3A 2HWD2 4F7ZA 2XGXA 1ST8A 4LBQD 5D8AB 2QKDA 2OKXA 2FZ2A 1K5MB 1GR3A 1NZCA 2NLRA 1J83A 1YCIA 4BHPA 1OD3A 2OQ7A 3POYA 2WFPA 5IWFA 1GYKA 3POJA 4AHWA 4MYEA 5HV4A 3T2TA 2VOKA 4CCKA 2MEV1 5FMDA 2YG0A 3C7GA 4KU7A 2JG8C 4LR4A 2BBAA 1R64A 3ACGA 3CL1A 3VBFC 3WCSA 4LOTA 4KBZA 2VOXA 3SH3A 5ACA2 3WXPA 1W06A 4NR1A 1RJ8A 5DG2A 4AI8A 4MH0E 3VZMA 4BJ0A 2RDRA 4P9LA 1C4RA 2JXAA 4B1MA 3H7YA 4AOCA 5FZ7A 4Y24A 2F4PA 4C8DA 3FZ3A 1RUH2 3APBA 3M3EA 2Y33A 4TZDA 5JVVA 4K8FA 2CGOA 4W8JA 5DPNA 3WHTA 5A3LA 5DUVA 1DGWA 2VNGA 3QLQA 4L0PA 5CFDC 1LU2A 1Z7S3 2K0GA 3HPNA 3J8F3 3KS7A 1HRI2 3AYDA 5BNQA 3SMHA 4ARXA 2W39A 4IGQA 5BXXA 3Q9OA 1REDA 2F6BA 3VBHB 2QDRA 3ZFGC 4D8MA 1YIPA 1EAH2 2Q1MA 1Q8SA 3ETPA 2NQYA 1LAJA 3NL1A 2ZMNA 3E5UA 3VBOB 5J3UA 4FTBA 1O3RA 2YPJA 3LZZA 4JTOA 4CCOA 2PHXA 3FX3A 5EIYB 5FY0A 3WOGA 4K3UA 1UIKA 5FZOA 3WF4A 2BEOA 4M3CB 3TNPB 4G3YC 4DMIA 5FZKA 2ATFA 1JU4A 4ORFA 1R092 2GSYA 4FXKB 4N43C 5FMOS 4IERA 4GB33 4FSJA 1W8TA 2YC0A 4A3ZA 1LECA 4H7LA 3T0DA 1NT0A 4QB6A 1K3IA 4R9AA 5LA0A 4XUPA 4XQ4A 1N1SA 1IPSA 3DYOA 4Q0QA 4IE7A 4QX3A 3ZXKA 5IVFA 3GJAA 1VRBA 4M0NA 4YZ2A 4HMZA 3AK0A 5C33A 1X9PA 3VLBB 4A6SA 1DYOA 5IAXA 4UI9L 3PUQA 4B7KA 3DYPA 1IS6A 4Q8LA 3LA3A 4AFAA 4F3JA 1JUHA 1JZ6A 2AR6A 1BLZA 3WW1A 4PQQA 5C71A 3A23A 1X82A 3UV9A 1G86A 1CIYA 4E4DX 2D7FA 1F15A 2O8OA 3RDIA 2P4EA 3B3QE 1QXJA 3H3ZA 3U1XA 1NX9A 3ZYHA 2ZACA 4XDOA 1BVP1 4UBHA 1BMV1 4IQPA 1SBDA 2ZXQA 1PNGA 1Y9MA 2ZA9A 5LBCA 4AE2A 4MG2A 3GZTB 3K77A 1R081 4KWUA 2VZTA 3OB8A 4IE0A 1HJGA 4Y1ZA 1JZ5A 4Q4W1 4JX0A 5IAVA 4NIIA 1W6MB 3LEIA 5CKNA 3F95A 4H2AA 1BHGA 3BU0A 1OFSA 1YFWA 3PDQA 4COVA 1ENQA 3MO4A 1V9U1 3DECA 4MXWB 1VAMA 5FP4A 4PQ9A 5FYZA 4GMP3 5L7OA 5AFEA 3B69A 3KT1A 1HRI1 3OD4A 1LOFC 1HQNA 3WG2A 3O12A 3D0JA 1QIQA 5K4LA 1FPN3 2WNEA 1X8MA 1DZTA 2VAUA 1C1LA 2A1XA 3WX5A 2FDKA 4CP1A 1CVNA 1RUG3 2RS11 1UMZA 1QJX3 5A7OA 2VVEA 4LE3A 1PZ7A 1CONA 4QDQA 3SH5A 2LALA 3IWZA 4GWMA 2QQMA 4YSFA 4JHZA 4QDSA 3MW4A 3EBRA 5FO8B 1PK6A 2KM2A 1MVQA 2D6LX 3VBFA 3A22A 2XLAA 4N7UA 4EWDA 1GWMA 2R042 4AW7A 2UY8A 3RZGA 4PT6A 4DQAA 1GQHA 1JYTA 4JAAA 3OUJA 4QHOA 4AVCA 2WZR3 5CIRA 1CAUB 3ZYFA 3MHZA 5G04L 2FHRA 2WQ8A 3BPSA 1VBB3 3MDPA 5D8AC 2FMDA 2GC3A 1DF0A 3VKLA 4ATEA 2D3RA 2R072 3ZIXA 4N53B 3BALA 1JODA 4XBQA 3RS6A 3GHNA 3I2DA 1O59A 1QQP1 2AEZA 2O0OA 3LEMA 2KXLA 1W8FA 4C1XA 4RQPA 4XFBA 3WUCA 2WDBA 3S5AA 1PVC1 1V6JA 4JTNA 4MXWA 4P9IA 5DUUA 1H30A 1W9YA 5F2WA 4YW5A 4CEWB 2W92A 2ERFA 2HJIA 2ARCA 4FPGA 4WBBA 5C8CC 4Y3OA 1W9SA 5GKAC 3U37A 3VBHA 1NE6A 1X7NA 2VQTA 3J4UH 5FZBA 1EPZA 2Y6HA 2TEPA 1AR71 3D6EA 1W2UA 3OOXA 5E88A 1RINA 1LOEA 1O8PA 1NOVA 3J7MA 2J1UA 3OBTA 4FP3A 4S2HA 2NMOA 5FZ4A 5CBLA 1ZRCA 3RWKX 5L36A 4NIHA 5L73A 5JIAA 1YQ2A 2QQNA 2Y38A 4X6QB 3RI8A 4XVHA 3NAPA 3RJ2X 3T2OA 3KHCA 2NYYA 1LHOA 3WVJA 1O4YA 4NMIA 4M00A 3VBHC 5FPVA 2E63A 2XWBB 2BVVA 3MUY1 5LRSA 3GALA 3AP7A 4E27A 1QXRA 1PNFA 4XAAA 5BNPA 1RUOA 1V9U2 1JBCA 3D0SA 3PURA 5LEJA 2ZEWA 4LBJA 3POGA 1HV0A 3I2FA 3QOPA 5FV3A 3WSOA 4CCLA 5LCWL 3A0KA 4HBNA 4MHRA 4AGVA 1RUE1 1ENRA 1RHI2 2ZMKA 1UU4A 1AX0A 3LD8A 4ZU7A 2ZJCA 3U0ZA 4B7EA 2DU1A 5FP8A 2I74A 1IKQA 2Q8CA 4JDOA 1UYXA 4PBOA 2O14A 4CVUA 5FZ0A 4K1YA 2ZGUA 4F8AA 2DUQA 3W20A 5FZEA 3ZXFA 2AACA 2ES3A 3DXTA 1HRV1 1N1TA 4IUGA 4CP9A 3P3NA 4LBQB 4K1ZA 4A2UA 3O1OA 3K3OA 5K7PA 2PLV1 4CDUC 2D6OX 3OBRA 4H14A 3I2JA 4LKEA 5LA9A 1FV2A 1UOJA 5ACA3 1PO22 3FLPA 2P3KA 3I2GA 2PHWA 4B29A 4YVWB 5IVJA 2OVUA 3AYCA 2WS92 4DS0A 4K8RB 4E2QA 4MUVA 2OUJA 1JMUB 1S4CA 5C9AB 5GLZA 3K3NA 1TMF3 1QJY1 1US3A 3DXUA 4QGLA 1YC61 2A3YA 3PHMA 5HPOA 3QACA 4UFKA 1GMMA 1V6KA 2YC4A 5LWBA 2G9GA 3O7OA 1JOJA 4BZ4A 3CF6E 5ABJA 1MQTC 4D7YA 2AUYA 3LAGA 4GH4B 1W6MA 2RG4A 3OPZA 2ZOEB 1LTEA 1NA1C 4DFSA 1H2MA 4QQPA 5E6HA 3TWIA 3ZPOA 3N35A 1HX6A 3NJVA 4PF5A 3WQBA 3B9CA 3VHNA 2QNKA 3USUA 2WFF3 2IVJA 2HWC3 2ZGQA 3AZVA 4CE8A 1F4HA 2HWE2 1EUUA 3O1SA 5C5UA 3M2MA 5C8CB 2GP3A 2UWAA 3H8RA 4XABA 2FMYA 2ZGRA 1SQ4A 1YXWA 1H8TB 4RFT0 2ZX3A 5BNOB 3QH7A 4RYDA 5CNAA 2OS2A 3KGLA 4JKLA 3DPRB 2LM3A 4W65A 1CQ9A 1UOBA 4H3WA 3WG1A 1OOPC 4KWJA 2DVFA 4TN7A 5F6KA 5F39A 1LHVA 3FE5A 4CXXA 3RZJA 3OSDA 3VBFB 1QF3A 5FY5A 2R073 4IEPA 3WW4A 4CXYA 1ASJ1 2GNTA 5HCAA 1TNRA 1OD5A 2D98A 2WR9A 2W87A 1XYPA 5IK7A 1EY2A 2WZEA 5FMCA 3BTYA 1JS9A 4F83A 1K5MC 1HN1A 2Y26A 4LKSA 5FUPA 1HB2A 2FDJA 1ENXA 2ZGMA 4NRMA 2VZOA 1MZFA 4INDA 1J3PA 4PIZA 3I8TA 3E6DA 4QMAA 4XC9A 2SBAA 3R4SA 1LULA 1A6CA 1SMVA 2DFCA 4AGRA 2B5HA 4Z82A 5I0TA 4DUVA 2DCYA 3HIFA 1OVSA 4P00B 1RHI1 3ENRA 1KS4A 1UW8A 3OYWB 3O14A 1AXKA 2A71A 3SLIA 1EUTA 3UT0A 5FP7A 5BPXA 2J1VA 5DAXA 5EJZB 1ULEA 2QQOA 2PN5A 3PMEA 1I3HA 5FWJA 5IYYA 1NY72 2ADEA 4XF3A 3Q8BA 3S57A 4JQRA 4KBBA 5I0SA 1GP6A 3N7JA 4LEJA 4RQPC 3I2IA 1OH3A 2JE9A 5FZMA 2RS33 5JPMB 4HK8A 1EAH3 1VBC2 2IUWA 2W46A 2Y6KA 4I0AA 1EV12 2HBUA 4M01A 2C26A 4LK7A 4QXBA 2BP6A 4LT5A 4MGIE 2E26A 2QDNA 3EYPA 4K6BA 5BNOC 3LOIA 3HQXA 5CZKA 4QDRA 3HD8B 4QX8A 3KD4A 1W03A 5A7WB 1IQAA 4OUEA 3MIDA 4HVRA 4XJWA 4ATFA 4B4PA 1S0GA 2JX9A 4ASLA 2ARAA 2QZ3A 1CX4A 1LOAA 5FYCA 5C3PA 2PHLA 3J7NA 4HKWA 2JENA 4QKBA 5GLWA 4GKXA 1VBA3 3VDAA 4YARA 1U5XA 2BQPA 5AC93 4JVAA 5EJ3A 3T4VA 1W6QB 2A3WA 2C0ZA 2CTVA 3CBNA 2EXIA 3KCXA 1E5RA 3PTYA 3M3QA 1NCQB 5FUNA 1HN0A 3VDCA 1A8MA 3WR0A 5A33A 1CAVA 4FO9A 4XEZA 3UKNA 3MIBA 1CWPA 1DFQA 1UY0A 2PHFA 2VBDA 3AMMA 5A7NA 4CDXC 4KWLA 5LBFA 4IE4A 4R9DA 4CUBA 3HN1A 1GLHA 3ZYJB 1YJKA 1NXMA 2XQRA 5HI0A 2RMU1 1TEIA 2DURA 2NMNA 2HWF1 2ZGTA 1NAEA 1SDDB 3M70A 4YFWA 1ULDA 5F1RA 4XCBA 1W99A 2RR12 2RE9A 2W0XA 2YMZA 5FZ6A 3PVBB 1HXS2 4XUOA 2WT1A 1A34A 1HV1A 3MZHA 2X8KA 3C7FA 4HVOA 2PELA 4P14A 1CZVA 4XDPA 1OLQA 3ZPYA 4UFHA 3U14A 1KDKA 3RMXA 1XQNA 2XVKA 5F32A 5FK8A 3VKNA 1ZBA3 4FBFA 3HMYA 1ZBE3 2JEMA 3ACLA 3PJYA 3TEWA 2JG9A 1C8M2 1MS8A 2W1QA 2XL7A 2BUKA 1Q56A 1IHMA 3OCPA 4XF9A 5FXXA 2KD7A 1LHUA 4I0WB 1OQDA 2RS12 3ILRA 3S7EA 3OG2A 4WM8C 2XG3A 1JU3A 2R063 2A7AA 4HL0A 4Y1YA 1WWYA 2WWJA 2YUEA 3VZNA 2JKBA 1MEC1 3O1VA 1ND2A 1VBE2 2ZAHA 4BQ1A 5JPNB 2B42B 4E9KA 1VBC1 1AR93 1JZ3A 1FNYA 1Z7S2 2GN7A 3RMYA 4CDWB 2JD4A 3W21A 4GJYA 4LBOA 1VRH3 2QBXA 4YM1A 1UZYA 5FXZA 2BGPA 4AVBA 1PIV3 5A3MA 1UYZA 2XOMA 3IMMA 4QPIC 4DO0A 2IWGB 5HCFA 4GULA 4YNIA 4BQ3A 1N3PA 1S2KA 1UD1A 4QQ2A 2FQPA 3WHUA 1NCRA 1R1A3 2VNOA 3BOWA 1ZA4A 2R1DA 1FMD2 1G6NA 1RYYA 1H8TA 2XDVA 3E97A 2L9LA 1S0FA 3LPGA 5I0DA 4IV1A 5DZGA 1YIFA 2EF6A 3T1LA 2IXCA 3T1MA 3TYJA 1JOPA 2HKXA 4R9BA 3O1MA 2XMLA 4WM7C 3R4DB 2QFEA 4IEOA 2BTVC 3VBSC 2DCZA 2HWE1 3KV5A 3U10A 2VU9A 5L7OB 4BXFA 2VMDA 1VJ2A 4E8CA 1WCSA 4B3NA 1OURA 1K42A 4OHXA 1OHFA 1TZOA 4MX3A 1PGL1 1RL3A 5IHRA 1H4GA 1BMV2 1O7FA 4GA9A 2A73B 5F3IA 1WW7A 3AKTA 5KXEA 1GU3A 4AEDB 4EV0A 5KHKA 3S5QA 1DYKA 4RN5A 4BLJA 4GALA 5BNOA 1QY4A 3VBRB 4QKDA 5TSWA 5FOJB 1LB2A 2MHFA 5IW0A 2DFBA 3B5LB 4N7IA 4DINB 5C8CA 2JDAA 3LFIA 5FYTA 1RVF3 4RHV3 1VPHA 3B02A 3RSJA 1V6OA 4PI2A 3H3UA 3WINE 3AKPA 3FC0A 1W0PA 4CCEA 3DF0A 4JRLA 3WQ1A 4LULA 5KHIA 3IDAA 5LK5A 4ZU5A 5JZGB 1W9WA 2XJSA 4UFIA 1T6BX 4XQDA 3TN92 1CIWA 4EWEA 1PX3A 4WVMB 4LHLA 1O3TA 3ZYIB 3KVAA 1W8NA 2W1SA 4AAPA 1W6NB 2HWD1 1FMD1 2D6NA 3KV6A 3LIGA 4IGPA 4MZUA 4Q26A 4CYDA 1ND3B 4BK4A 4FPJA 3TN93 4L9BA 4Z92B 4LIUA 4P9JA 5FLHA 4EJRA 2WT0A 2TUNA 3V65A 1FOD3 3FBYA 1BBT1 4A7ZA 5C70A 3MF9A 3MFAA 2XH6A 2YROA 4EN0A 1GQGA 1SFPA 3NJZA 4PLNA 3CHXA 4Y1UA 4JGZC 3GJBA 1LJ7A 4DY3A 3WLUA 5CFDB 4W50A 1RUI1 1QKQA 2VOVA 4BYYA 5K0UB 1GOHA 5GALA 3VDBA 1PGSA 3WCRA 2JDZA 3MLJA 3JQWA 3LDBA 5CFCB 3THPA 2JDNA 2VQAA 1FV3A 4CEWC 4Y22A 5FYUA 2W94A 4Q5OA 4Y1XA 2ET1A 2OIIA 1XSRA 1VB4A 4E2SA 3CZUA 4X8NA 5I8YA 4H55A 4Q4V2 3D8CA 5FXWA 5EYXA 1H4HA 1E5IA 3ME2A 2X5IA 2VZRA 3ILFA 1C8M1 2XJRA 4AK3A 5H9SA 1AL23 3GGLA 2W2IA 1R083 3AJYA 3T0AA 3ZM8A 3AXEA 5CFCA 5J7MA 2Y6GA 2J1SA 4XUTA 3HT2A 4C91A 5DZEA 4R4ZA 1G9CA 2VJXA 5I0UA 1AYN1 1LESA 2XL9A 2Y6LA 4O9EA 2DCKA 2ZPXA 4QB2A 1VALA 4FPHA 4XF0A 3SCHA 1FI2A 2XUEA 4OI1A 2WA3A 1WBFA 1TME3 2FCVA 3HNMA 3TNQA 3AX4A 4Q4X1 2YU1A 4OUSA 2CDOA 5EP9A 3SC7X 3AZXA 4I01A 5GLUA 2H6CA 3LSEA 5FZHA 2W68A 2J1RA 3AVSA 4LUKA 4AXOA 2XVLA 2IVIB 5JOYA 2UU8A 2VZVA 4CDUB 2PFWA 4FQZA 4XAEA 4WM7A 1JN2P 5FY1A 3ZXDA 1FNZA 4COWA 1ZRDA 1RUG1 4XFAA 5T5JA 1Y4WA 1BK1A 1CESA 1UIJA 1B35C 5G05L 4YVWA 5FY9A 3M1HA 3POBA 4AFDA 2WNUA 3IIAA 3MF6A 1S55A 1LRHA 5FCCA 4L99A 4MGQA 2VTFA 5CAZA 1TME2 2VMGA 1J1TA 2ZKLA 4Y1VA 3ZSKA 4GB32 1WMFA 3NNLA 1Q43A 2Y64A 4HSLA 3CIHA 1CN1A 2HH9A 3DKWA 3V56A 1WLWA 2J7MA 4YZ1A 3KZ4C 4UF0A 1PZ8A 3JXSA 3ZXGA 1CPMA 1GNHA 1H8TC 2WZR1 4NAOA 3R4UA 2ZTNA 1COV1 4XYXA 4NIDA 4CZSA 4EN7B 3I97A 3AZYA 1RUI2 5D1IA 4YGCA 1YEWA 1VBB1 2WO3A 3N9LA 4YGBA 1DGRA 5C3RA 3QD6A 3HBZA 4FVVA 1CJDA 5JOZA 4WVMA 1PO21 4QQLA 2NM1A 3VBSA 4AAXA 1HB3A 2IXLA 3IDCB 5JIUA 3K46A 4J25A 3WDXA 2VW2A 1F31A 3K4ZA 3NV1A 3IM0A 1W6PB 2E7QA 1W0OA 1ZZ8A 3MV01 3TAYA 5T3NA 4DNYA 1CX1A 4RA0A 1J58A 1DYPA 4MGKE 3HWJA 2JICA 3U75A 5JXGA 1PVC3 2D6KA 3BIWE 4RGAA 2QQLA 5F3GA 5JR2A 3CKHA 2VY0A 3T2PA 1GWLA 5JOXA 4IEUA 2Z42A 5FLIA 3MBWA 2ZX1A 4XJUA 5FZ8A 4C90A 1D4M3 2IXIA 2D40A 3ZN6B 5CYYA 1SLAA 2EIBA 3CJXA 2PHUA 3FL7A 4CU7A 3OTFA 1YQCA 3DCQA 2QTWB 3ZN5A 2Q0AA 3SNMA 1MZEA 1F9KA 2YBKA 3VBSB 5LW9A 1OLRA 4FPOB 2VG9A 2GH2A 1COV2 5H9QA 3ZKUA 2WIIB 3CJIC 3NV4A 1YI9A 3AJZA 1H1MA 1OPOA 4ZZ8A 3UESA 1WMEA 1AR61 3ZFFC 3ASIA 4OFGA 3SEEA 5FBZA 4Z2WA 2WQZC 1R091 2Z69A 2KR2A 3K2OA 2J42A 5CFDA 2AH2A 4XOGA 4AVSA 1AUYA 1OFNA 1UOFA 4QQHA 3LF7A 3VD7A 3W59A 4JGYA 4MGTA 1N1YA 1UOGA 5DUWA 4HN1A 5J37A 1W2NA 3DKQA 3SITA 1UMIA 2QQUA 2VD7A 3H1WA 1RUC1 3ZXJA 5KXCA 2NP0A 2VCBA 1RC6A 3D3AA 1HRV3 4FFIA 5K0UC 1CAVB 2R32A 2PLV3 3NKTA 1J3RA 2HWC2 1LOBA 3BPZA 1EV13 4KG8A 1XB9A 4NHMA 1ENSA 4P02B 2PQSA 3ATGA 4WM8B 4BA6A 4C0HA 5CB7A 4CDQA 5C3QA 4OHYA 3MW3A 2X29A 2RMU2 4E8DA 2JB4A 4Q1PA 1MQTB 5LBEA 2TNFA 3WDTA 4IE6A 1AL22 2CGPA 1VBD3 1VAVA 1WKYA 3CJIB 3WT3A 2WS91 1GZWB 2EVXA 4XMIA 4QX0A 4M3CA 4V2WA 4BMBA 1DQ4A 1ZRRA 4XZPA 3KQRA 4N9HA 4Q4V3 2DVGA 2H0BA 1ZVFA 1AYM3 4IDZA 1RIRA 1ZZ9A 4Y4YA 4E4SA 2EICA 1JHJA 2RHPA 1WUVA 2ID4A 2RR11 4N8MA 3MIGA 1OXCA 1W2TA 1G9BA 3VZKA 1D7PM 3AL6A 1KXGA 5FRAA 4EE2A 3A0NA 3PVOA 2HYKA 4ISQA 1NLRA 1UF2C 4OCTA 1G9AA 1PVXA 2ZMLA 5T54A 1O4ZA 1Y43B 1QWRA 5D21A 2R49A 1CAXA 3ALQA 3JQXA 3LEKA 3K48A 3OPWA 4AEDC 3SH4A 1VRH2 3OGVA 1UYYA 4LBKA 5FZ3A 5H9RA 1ZNPA 5J96B 2UYAA 4ZHNA 3ZFEC 1UN1A 1TNFA 3G7DA 3CNAA 4IV3B 2XR4A 2Q1ZB 4JKKA 1SEFA 2E7AA 2A6VA 1YWKA 1BVVA 2YYOA 4AI2A 1QJFA 1KDMA 3ABZA 2P2KA 2PA7A 2A75A 3BVCA 3MW2A 2LW8A 4LA3A 5APAA 1MVEA 3GBFA 2R16A 5L19A 1LGBA 3WDUA 4XCAA 1N1VA 2DTWA 1UZWA 4A7KA 1MS1A 2YZ4A 3H9AA 4CDWC 4LLOA 2MEV2 1SLIA 5T5PA 1HIXA 4UW3A 3R05A 5A32B 4EWAA 1D2SA 2ORXA 1STMA 3GZEA 4OVEA 5IVCA 3SHRA 5ERLA 4MGSA 1ULFA 3LE0A 4LHNA 4HFSA 3LFMA 4XPVA 4AQSA 5JAXA 4C0BA 4C1WA 4Q0SA 2JDUA 2PAMA 1M06G 3OF1A 4HG6B 1ZZBA 3K4AA 4CDWA 1H9WA 2CGNA 4XFGA 1AR62 4Q2FA 4NHLA 5DDJ1 1HXS3 3HNYM 2O8QA 1XNAA 1GOFA 1BQPA 2P5BA 2QQWA 4DXRA 4QM9A 2C9AA 4XHXA 4AL9A 2ZGPA 4IETA 2VMFA 1LHWA 2BFUL 5IVBA 2LRPA 2WNVA 4XXAA 3LQCA 3WDYA 3AFGA 5A1LA 2BYVE 1WBLA 4NWWA 2LS6A 4JC1A 1QQP2 5HV0A 1QGLA 1LCLA 1NE4A 4H7MA 5FFOC 1C3HA 5GZDA 3AMPA 3WP4A 4S2DA 1W6NA 1RUD1 1IS5A 1OF3A 2OXBA 1BXHA 2X53S 4EN8B 2YHJA 3DL3A 1E5SA 3PL0A 3POWA 3POIA 4MLOA 4PCRA 2CHHA 3MEPA 3VBUB 4TWTA 3KHBA 4META 2J1TA 1CD3G 1GOGA 1QOSA 4CRQA 3AKSA 2R041 4V1PA 2WO1A 5FTTC 1FX5A 1DIWA 5BYNA 4HKOA 4HOOA 5JR7B 1YO8A 5FYBA 4GD4A 4QU1A 4QGMA 2ZGNA 1VBA1 5FJKA 2FDGA 1VAKA 2PXJA 3X29B 1ASJ2 3AVRA 4YW1A 3CJIA 5FY4A 4X6RB 1JTZX 1U5YA 4S2FA 1IPJA 1J1LA 4CA9A 3WF0A 3ZFFA 3ROUA 2IXJA 1DGLA 3GBWA 5I91A 4XZUG 3FJSA 2OT7A 1D4VB 1XNKA 2B39A 1E57A 3N9QA 1PO13 2Y0OA 1JW6A 4M3CE 2RMU3 2EIEA 4MHUA 3IAQA 3RZKA 2WUHA 1AR81 5F9TA 1H1AA 1ODNA 4CUAA 1RUJ3 4Q8KA 5D2AA 3B7MA 1X36A 5BNPC 4Q4Y1 5T55A 2BDRA 4XXPA 2WBKA 1UKRA 4TLFA 1FAYA 1JYNA 5K0UA 2PLV2 2YGLA 1F5FA 3LEGA 2AGSA 3H3LA 5FYMA 3VD4A 5CG9A 3N7MA 1KRIA 2DCTA 1ZM1A 2G9FA 4NPMA 5JUVA 1ZBA1 3IPVA 3ZFGA 2X5IC 3VZOA 1VBB2 2OW4A 2WSUA 2KA3A 2VZQA 3RPQA 3LWCA 4AQ2A 3NV3A 3T2QA 4PLOA 1DQ5A 1OVPA 2B8MA 4RR3B 4UXAA 3P1IA 4AEDA 5K9YA 2X05A 2VUDA 3ILNA 5C6CA 4GQ7A 2VZPA 1PMIA 1UY4A 3HBKA 1QJY2 1O6UA 2VXRA 3HVDA 5A3WA 4K20A 4CDUA 3TOJA 1IGOA 1MZ5A 1XNTA 2R061 4XW3A 3B93A 5A7WA 2OYZA 1RJ7A 1MEC3 1V6IA 2OPKA 2P37A 4OULA 4YZ5A 1UAIA 2WZR2 1UY2A 2CYFA 2P6CA 2VQ0A 4JGYB 5FZOB 4ARYA 1WCUA 1XYOA 1GZ9A 1AXZA 3LIHA 4DPNA 4K21A 3ZYPA 5CEHA 1ZRFA 3I2OA 1JYIA 4AEMA 1ULOA 1YHFA 1OUXA 5JZGC 4FPEA 4CDQB 3AC0A 1OI6A 3FHIB 3ECQA 2WFF2 4HLTA 3H8UA 1OA2A 5DABA 3ZSMA 5AC92 3RZLA 2RM22 4BPZA 1WLTA 2VM9A 2JE7A 3LDRA 3MPPG 5FYYA 5I93A 2IFRA 4LBNA 4MO3M 4WM7B 3T09A 4Q27A 3UYJA 4YVSB 3T4HB 3DYMA 1K12A 3N3HA 1XRUA 2GMEA 3I59A 1H2NA 3K75B 3N9NA 2W95A 2X10A 2BNOA 3F2ZA 1CJPA 3KGZA 2W9XA 3PMSA 4A44A 2ETEA 3MIEA 2PAKA 2HWE3 4AG4A 2A6WA 2DBIA 2YGMA 3C7OA 2IZWA 2R7EB 1LNSA 5FPZA 1S0IA 4XACA 4Z2AA 5J36A 5IK5A 2YV8A 1KEXA 4PF1A 1RUJ2 1XU2A 2DV9A 2GAUA 1PM4A 4L11A 4MGZE 2N7GA 1E5HA 3WP5A 3T30A 4DXSA 3T08A 3J8F2 3IDEA 1RUH1 3AZWA 2SLIA 3LCPA 5FWEA 1GKBA 2HEWF 2E7TA 4FOQA 4FPLA 1AR72 1LOFA 1RUF3 2QVSB 4COUA 2CSGA 4V2VA 2D5HA 3HNBM 3HEIA 2BPA2 2A70A 1J59A 4MVTA 5FBJA 1W90A 4AZZA 2WNVC 1W8ZA 1IS3A 4P08A 1VMJA 3EB7A 3WDWA 2HWB2 1PHMA 3FHAA 1UQXA 2EIDA 5C5TA 3KV9A 2XHNA 5DN2A 1GNZA 1JYCA 5EXOA
chains in the Genus database with same CATH topology
4TYSA 1DLLA 2P3JA 4IEZA 4KL1A 1U5IA 2XBO1 4XF1A 2B7YA 3AM2A 1AJKA 4AFMA 4I09A 3VDDC 1TE1B 2HWD3 1FMD3 3S6PA 3TN91 1HKDA 4D7SA 1XXNA 4GH4A 2XJQA 1GZCA 2R062 3GHMA 1IZ3A 1Q8VA 1RB8G 1ND3A 1ZZ6A 3WD5A 3ZFEB 4JGYC 4XFCA 1HQWA 5EWSA 4YZ4A 5T52A 1BJQA 4L97A 4QQOA 4SLIA 1VBE3 1ZBE2 4D7TA 3UKVA 3BU7A 2AENA 2A5ZA 1G8WA 2D97A 1C1FA 1YFXA 2VVFA 1HRI3 3AP5A 2EXKA 3H1MA 5DZFA 1RMU3 4XE9A 3NAPC 1FPN1 5JI7A 1H0BA 1Q8PA 1C8M3 1CR7A 2XHKA 3JD71 1CAUA 4QPYA 2Z79A 5FO9B 4W6WA 4Y20B 3PLQA 1O5UA 4S2GA 3U11A 3ZXEA 5E8AA 3ZO0B 3OYWA 4Q0PA 3ZFFB 3ZVXA 2NPIA 3FBMA 3ZFGB 4LO6B 2Q8OA 1TME1 1ALYA 5JSOA 4AEKA 1POV0 4Q4X3 5JLVA 2ARBA 1CGPA 2DCJA 3UJOA 2DF7A 1Z7S1 3IBMA 4FOWA 4Q4W2 1XU1A 4DY5A 2ET7A 4HN0A 2VNRA 4M0HA 2GC1A 2Z5WA 3VBOA 2AYHA 2ZHLA 3NW4A 4FQ4A 3UJQA 5I8SA 4OUMA 3M3OA 3R0RA 1QQP3 2RS32 4MGYE 4N43B 1RUE2 5T5OA 4BH9A 2OA2A 2I45A 4ZKTB 1DQ6A 5EFUA 2XBO2 4N90A 4R52A 1VBD2 3FLTA 3MIHA 4AYUA 4G4FA 1U0AA 4GB31 2VGDA 2VECA 1BEV3 1MS3A 4G9SB 3S0MA 1QH6A 4QPGC 4CEYC 3EXUA 5BNNC 1JXNA 4AQ6A 3SISA 3A4UA 1HDKA 3U4XA 1NCRC 1LR5A 3WP3A 3V0BB 2WWSA 4QPGA 4CEYA 1NCRB 1X8EA 3S7IA 3CEWA 3BOPA 5BNNA 2YY1A 4I02A 4WZFA 1MS4A 2DWRA 2PHDA 1MS0A 3B9IA 4M3CF 1PM7A 4WVWA 4NWVA 4XJ8A 1AYN2 1IS4A 2WLQA 3AYAA 1QJU3 2D3PA 2JECA 2EAKA 4PLMA 4Y22B 3TBDA 3GYDA 4Q4W3 1MR5A 1ULCA 1LGNA 1LU1A 4L8QA 4URTA 2FZ1A 4AF9A 2GDFA 2TBVA 2BNNA 1N3QA 2GALA 2MPFA 4HPKB 4L92A 2JG8A 2RS53 3BODA 3LA7A 4I3PA 2X5IB 4XTPA 4P9YA 4FCAA 5AFBA 2CWSA 2ZHMA 3KCYA 1AR63 4Q1RA 1MACA 5CVRA 1V00A 1BZWA 5FDBA 4BCUA 3MI8A 2V73A 2ZABA 4XMAA 4J6GA 2GNBA 4J1WA 1W6OB 2RS13 1KFUL 4FP2A 4HPKA 2P34A 4B4QA 2RM21 4LO8A 2PTMA 2ZZQA 4YG6A 1TMF2 4YG0A 1CAWA 1VB2A 5HBAA 1DQ2A 2DVBA 2E53A 4COYA 3BCWA 3JBG2 1V6LA 5C9AC 4ONUA 4K9SA 2A6YA 1DZQA 2QQPA 3UKTA 1RUNA 4RD7A 3JD72 4B8EA 2ZBJA 4WVVA 2OUHA 4XBLA 1OQEA 2VW1A 4N43A 3WP6A 1LEMA 2CL2A 3ES1A 4W6YA 1DDLA 3D82A 5B2GB 4MV2A 3I54A 1QOOA 1BKZA 4YFZA 4CEWA 5BNPB 1AYM1 4P9WA 1WCDJ 4AVVA 2D6PA 2RR13 3VZJA 3D4KA 3INAA 1KFXL 3TB0A 2YXSA 3ELNA 5AVAA 4CDXA 1NA1A 3LKJA 4GMP0 1MS9A 5KXBA 5AVPA 4XBNA 3N36A 3O0VA 1UPSA 4ZXKA 3U07A 1GICA 1L3JA 4DXZA 4N9IA 5C4WC 1U12A 2WZPP 4QHBA 3RI9A 5KXDA 4HKLA 3LA2A 4K40A 3PJQA 3VDDB 2OZJA 1V70A 2VW0A 3GBGA 3SCGA 1DG6A 3B00A 3NO8A 5GM0A 3IDBB 1LODA 3VN4A 5ABJC 4PJYA 2D43A 4IEYA 4XQWA 4IV3A 3MPBA 4YG3A 4XTMA 5JI9A 5SV8A 2DVDA 2W08A 4HETA 1S0DA 1EAH1 3V0AB 3GNEA 1FYUA 4LUMA 2XPJA 1ZZ7A 1FOD2 5D8AA 2A3XA 5DDJ3 5EZWA 1GANA 1HXS1 2VVDA 1H2KA 1T6GC 1ND2C 1RITA 2GZWA 3FFQA 3MGUA 1S2BA 4IV3C 4CP0A 1XE7A 1ULGA 3KT4A 4NPRA 4Q4X2 5DDJ2 1HW5A 1XNCA 1PZ9A 1GV9A 3JBG1 1S0BA 2XJUA 4FPKA 1H9PA 4EN6B 3V0AA 2GN3A 1TMF1 2WC2A 5GJ6A 4ES8A 2WNVB 2BW8A 4RSUA 4LE4A 4JDMA 2C1FA 2W52A 1CAWB 3O0WA 1RVF2 1Q3EA 1XNBA 4Q0UA 5J98B 3WZ1A 1NQDA 2ZX4A 2ENRA 3L9JT 5EV7A 2QJVA 3AKQA 1DBNA 2PHRA 1SFYA 3H7JA 1C8NA 2WFF1 2NN8A 3VDDA 4XIOA 4RGGA 1AYM2 1JHNA 1F2NA 1KJRA 3N4MA 2CV6A 1C57A 3W58A 1KJLA 5DXDA 2Q4SA 1S0EA 2IXKA 1MS5A 5K8SA 4WZCA 3AP9A 2ZX0A 2GMPA 2K2SA 1SFNA 1VIWB 3WXPA 1A3KA 2K9ZA 2XB6C 2DUPA 3M8LA 2VUAA 4E4ZA 4OI4A 3JB8A 5C4WB 2GNMA 2VUJA 2ZHKA 1PO11 3AMNA 1NG0A 1SLTA 5FPXA 1XYNA 2R071 2FBEA 1ASJ3 4AWDA 3TRSB 3C3VA 2XKPA 4AHZA 4KH9A 3EHKA 4YRDA 5KHJA 2QUOA 1DQ1A 3GZUC 1AZDA 3KCCA 1QHDA 3DV8A 1AR91 5GZFA 3KM5A 4NOTA 1V6NA 2HWB1 3RRDA 3ZYGA 4UBGA 4JRAA 4XJZA 4ITCA 3HT1A 1Q8OA 4Q4Y2 1RTVA 3IN9A 5LEKA 5I8TA 2R6QA 1WMDA 3HAGA 2WSVA 2JG9C 1R1A1 3K51A 3MICA 1PIV2 1NCQA 3KT7A 3G6JB 2ZKNA 3J9SA 3POSA 4AFCA 4J1XA 3HR9A 3NAPB 2PQQA 3GF6A 5KBFA 4LLFA 2RS31 4IL7A 2RJKA 3VBRA 3ZSJA 1MZ6A 4ISRA 1TQ5A 3VUOA 1KQRA 3RYRA 3VBOC 1GSLA 2VMIA 3WUDA 1NCQC 1ZX5A 4RHV2 1I5ZA 4MSVA 4PIYA 4ES9A 1I1EA 1FT9A 2GMMA 4Z07A 2A6ZA 1IPKA 1MQTA 1R082 5L7OC 2BWAA 3M7AA 3VKOA 5AC91 3B94A 2BNMA 4KU8A 4PBPA 1XNDA 3WDVA 1RUD2 1D0GA 5J48A 2Q5TA 4QPGB 3I7DA 4AI3A 5KWRA 1POV3 1URXA 1K5MA 1ZZCA 4QM8A 2GNDA 2GC0A 4AI0A 4E2GA 3RZZA 2D3SA 4D3WA 3AB0A 2HWF3 4P9XA 3VV1A 4BE3A 4YVSA 3E5XA 4DRRA 3MYXA 4IEWA 4D94A 1O5LA 2ZZJA 1RUF1 3NVCA 3DUIA 1NQJA 2JJ6A 1IOAA 4FOYA 4GWNA 4YYOA 1O3QA 4XJAA 2NZ9A 1GZWA 4L2NA 4HSJA 1ZBE1 2R1BA 3EJKA 1BBT3 3KSCA 4FOVA 4BMEA 3VKFC 4XDQA 4XILA 4LBQA 2WNUC 2V5YA 1S0CA 1XE8A 1OKQA 4Q29A 1KS5A 1SCRA 3JUUA 2B9UA 4IEVA 2BVBA 1U5ZA 2WNUB 3IMNA 3MLKA 3RNSA 3ZMNA 2AZ5A 3AKRA 1FPN2 1VP6A 4CEYB 2DVAA 3IPVB 3MIFA 4KWKA 4COZA 5HXVA 3ZSEA 1H2LA 3S30A 1ND2B 5GLVA 1VRH1 2RS52 1QDCA 5E16A 2IFWA 2MEV3 4YGDA 1LKNA 3IT8A 1QOTA 1UU6A 4YW3A 1DGRN 1WCKA 4FPCA 3IKWA 4RS5B 4HK9A 2QCSB 3KB5A 4NVPA 4AI1A 3LSDA 5FQ0B 1AYN3 2VOWA 1JH5A 3FLRA 3J26N 1LEDA 2XWJB 5JCTA 5IK4A 4Y26A 4FTSA 4PDWC 1AR82 3WV6A 1SDWA 5A32A 2ZS6B 3PVEA 1LHNA 5JSRA 1W39A 4UW4A 3J8F1 2UWBA 2B46X 1RMU1 2QZ2A 2WL1A 5F6LB 2HWF2 1O91A 5IT6A 2C5DA 1Q5OA 5T50A 3JD73 3MLLA 3ZN4A 3VBRC 4PDWA 3P3PA 1R1A2 1SBEA 2PAEA 4CTEA 4QPIB 4IV1B 2GH8A 4RR3C 1PGW2 1VBA2 4UW6A 1APNA 4P9GA 4CDQC 4OLLA 3JU9A 4Z1VA 1AVBA 1RUC2 5CFCC 1LOCA 1WLCA 3H0OA 4Y20A 2VMHA 4IXLA 1RVF1 1N47A 3D5OA 1YLLA 2R0FA 3OY8B 4RHV1 2IC1A 2BBVA 2CWMA 1Q8QA 2B45X 1A78A 5SV5A 3USSA 3EQEA 3LB9A 4BWOA 3MFCA 1PO23 5C4WA 2WINB 4OHVA 4QX5A 1EP0A 5JSPA 4XF4A 3THTA 1SLCA 1NXD1 2DTYA 4FXGB 4AQTA 1X50A 4Y5Z0 3USUB 4KGQA 4OZXA 2XJTA 3NV2A 4GIQA 3M4FA 1Z0HA 3UL2A 2V09A 1PGW1 1B35A 4YVWC 1FOD1 5KC5A 4FAHA 4WM8A 2XLFA 2XKOA 4YZ3A 3RG0A 1BBT2 3WW2A 4K7JA 1IKPA 4YW4A 1V6MA 1BEV1 2XJPA 4IV1C 4XIKA 5JDBA 3ST7A 4W6XA 4XHBA 3FUOA 1RUI3 3ZSLA 4QT6A 3N7KA 3O0XA 5J09A 4ZU4A 2P17A 1V9U3 2HEYF 1B35B 1OMIA 3QBQA 1AX1A 2GU9A 3M3IA 5KC6A 4GMP1 1F5JA 4MXVA 2YDEA 4IEQA 2UYBA 1G7YA 2IXHA 5T5LA 4LTAA 4FPYA 2EXHA 2ILMA 1VLNA 2UY9A 5LRRA 3RWNA 4U2AA 5LK7B 1R093 3CU7A 1AL21 2EA7A 1QJU1 5A33B 1H8VA 1QJX1 1B09A 1PK6B 4JGZB 1YI7A 1NA1B 1G9DA 1RMU2 1YRZA 3VHOA 2ZX2A 3UK9A 5BNNB 3PVNA 3E6CC 1RUC3 4DZGA 4CP2A 1ZBA2 2RS51 2D6MA 2R0HA 2P3IA 4FPFA 2VPVA 5FLJA 4XETA 4CDXB 3ZXAC 4AGGA 3NKGA 1HRV2 3QCWA 4SBVA 4WVZA 5C8WA 2LTNA 1QJZA 1AJOA 1DQ0A 2JG9B 4KG0A 1KITA 1VBD1 2E51A 4O9GA 1W6QA 2WS93 2H0VA 1MEC2 2RM23 3I59B 4DOUA 4JGZA 3WY6A 3JZVA 4BIFA 3ZX7A 4B4RA 1SCSA 5IK8A 5FQ0A 1N3OA 3B01A 1QNYA 1A8DA 4HANA 1COV3 3AXDA 4LHKA 1HLCA 1QH7A 2XJVA 4PDWB 4WV8A 1AR73 1GFF2 5F5QA 5GZCA 1O4TA 1AX2A 2Y0IA 1UPIA 4R4XA 4LO7A 1OQ1A 1W6PA 4X8PA 3ETQA 3L2YA 3CO2A 1Y3TA 5BV6A 1UZZA 2LUWA 3BB6A 2E6VA 3PNAA 1RGSA 2VH9A 4JV4A 1UL9A 1UX6A 3H50A 1YUDA 5FOBB 2CNAA 1RUF2 3JB4C 2JG8B 1EPWA 1HQLA 3N7LA 4AVAA 1PVC2 1H1IA 3L2HA 5E1RA 4GXLA 4EROA 3WW3A 3V64A 3VZLA 1D4M1 2G4IA 4FTEA 4EN9B 1RUE3 1OA4A 4KQ7A 2EAAA 3H1YA 4AHXA 3NWKA 1UKGA 1VR3A 3VGIA 3R6SA 5CADA 1AXYA 5IUQA 4LO5B 4I2OA 1DHKB 1NLSA 1D2QA 1ONAA 3M3CA 4N53A 1YFUA 1Y7BA 1C5IA 2D44A 3OGGA 3WG4A 1OPMA 3BTAA 4XJ9A 5JWPA 3ZFEA 2MNGA 2A6XA 1LOGA 3WNXA 3RQ0A 5JOWA 1J3QA 1YJLA 5FMOL 2UURA 5ACA1 1DZRA 4OHZA 1G9FA 1BYHA 3FUQA 1UU5A 2DUOA 2ZCWA 1QJY3 4QGNA 1C28A 1SLBA 3URFA 3VHRA 2O1QA 1D4M2 5DUXA 1RUD3 4I3GA 3VL8A 1NY71 4QPIA 3SXWA 4YW2A 4I30A 2QE3A 2CAVA 4YVSC 4XFIA 1F8VA 3KMHA 1AL0G 1WW5A 1EV11 1WD4A 2R043 5DG1A 1I9RA 2I2SA 1Y9QA 2HWC1 4HZFA 4HVQA 5I0RA 1YYNA 3JBG3 1NYWA 4IEXA 2CAUA 3AMHA 4P5HA 5H9PA 4AVTA 3VKMA 1SLLA 3I4IA 5JMCA 4LA2A 3NSTA 3VL9A 3WQ7A 4FT8A 1ZREA 1QNWA 1KD7A 1YNAA 4YGEA 1RUG2 2R30A 2Z2SB 4UW5A 5EYYA 4LBLA 4Q4V1 4DRVA 1AR92 2I07B 3OD0A 3QH6A 1C5HA 1GBGA 2PHTA 2D93A 5GLTA 1R1ZA 4YM2A 4OI0A 4BIOA 3W9AA 1RUJ1 1OOPB 1CAXB 4Q4Y3 5FO7B 4LNVA 2WJSA 4KGGA 3ZMOA 1PGL2 1QXPA 3O5SA 3RYKA 1REEA 4BLIA 3E6BA 3V0BA 1CPNA 5CA6A 1S1AA 3OJBA 1S0JA 2WQ4A 1JUIA 2BWCA 2OZ6A 5E89A 4AEJA 2WKKA 2UWCA 2WT2A 1QMJA 1RHI3 1WD3A 4LO4B 1FXZA 1LENA 2CY6A 2GC2A 1YFYA 1ND3C 4YM3A 1DGWX 1DU3D 2D5FA 1BCXA 2DU0A 2DYCA 3ES4A 3LOBA 5KHGA 3EO6A 1AHSA 1LGCA 2H6BA 3C2UA 3DGTA 4R8HA 4Z8BA 3ZIWA 2HWB3 2XUMA 3KLSA 1FATA 1W6OA 4JCKA 4RL7A 4RS5C 4YM0A 3VBUA 3VHPA 1O3SA 3AYEA 4DB5A 4NHKA 5CG8A 4LBMA 5GZEA 4RR3A 4A7YA 2XVGA 3RJRA 4I0BA 4GH4C 1QJX2 5CU1A 1REFA 5C9AA 4N53C 4RS5A 3VBUC 2EXJA 4KNCA 1OSGA 1X33A 2VULA 1SACA 4XFFA 4R9CA 1I6XA 1OA3A 1Z78A 4HT1T 3OGJA 4TSVA 1QJU2 5KHHA 2ZGLA 4IESA 3AP4A 5FAXA 4A3XA 2EIGA 2ZHNA 4AFBA 5BUVA 2AREA 3AP6A 3OY8A 5ABJB 1SBFA 2BFUS 2ZGOA 3JCIA 3SCFA 2ARXA 4OHWA 1RUH3 1ZYBA 3ZN6A 3AFKA 1WA4A 4NN0A 4GKYA 3ZXLA 2WA4A 5JZGA 3AZZA 1UCXA 3DPRA 1WW4A 2HEVF 3LGRA 1WLDA 4Q0VA 1D0HA 4FAGA 4YLZA 1WGPA 5FREA 1POV1 4QXKA 3WG3A 3ZDSA 2PYTA 4NO4A 2XLGA 3DN7A 4D69A 3DPRC 1AR83 4XFHA 4ASMB 2XBO3 4JDNA 2EALA 4QU2A 4U36A 3GZAA 3E5QA 4AHYA 5BY5A 1VBC3 4BM8A 3WQ0A 3FMGA 2RJLA 1BEV2 1M4WA 3CLPA 2WLPA 1WW6A 3FWEA 1PO12 4RQPB 1QU0A 2Q30A 3AMQA 3FFZA 1PIV1 4QD2A 3RYPA 1PK6C 2ZGKA 1EYBA 1OOPA 5GZGA 1AF9A 2BGCA 3ZYRA 4BOWA 2ZAAA 2ZGSA 1VBE1 4PIXA 5HCBA 4OI2A 2E9QA 1QDOA 2HWD2 4F7ZA 2XGXA 4LBQD 5D8AB 2QKDA 2FZ2A 1K5MB 1GR3A 1NZCA 2NLRA 1YCIA 4BHPA 3POYA 2WFPA 1GYKA 4AHWA 4MYEA 3T2TA 2VOKA 2MEV1 4KU7A 2JG8C 4LR4A 3CL1A 3VBFC 3WCSA 2VOXA 3SH3A 5ACA2 4AI8A 4NR1A 1RJ8A 5DG2A 4MH0E 3VZMA 4P9LA 1C4RA 2JXAA 3H7YA 4Y24A 2F4PA 3FZ3A 1RUH2 3APBA 3M3EA 4TZDA 5JVVA 4K8FA 2CGOA 5A3LA 3WHTA 5DUVA 1DGWA 2VNGA 3QLQA 5CFDC 1LU2A 1Z7S3 2K0GA 3J8F3 5BNQA 3KS7A 1HRI2 3AYDA 3SMHA 2W39A 5BXXA 3Q9OA 1REDA 2F6BA 3VBHB 2QDRA 3ZFGC 1YIPA 1EAH2 2Q1MA 1Q8SA 2NQYA 3NL1A 2ZMNA 3E5UA 3VBOB 5J3UA 4FTBA 1O3RA 2YPJA 3LZZA 4JTOA 2PHXA 3FX3A 3WOGA 4K3UA 1UIKA 2BEOA 4M3CB 3TNPB 4G3YC 4DMIA 2ATFA 4ORFA 1R092 2GSYA 4FXKB 4N43C 5FMOS 4IERA 4GB33 4FSJA 2YC0A 1LECA 4H7LA 4R9AA 4XQ4A 1N1SA 4Q0QA 3ZXKA 4M0NA 4YZ2A 4HMZA 3AK0A 5C33A 3VLBB 4B7KA 1IS6A 4Q8LA 3LA3A 4AFAA 4F3JA 1JUHA 2AR6A 3WW1A 1X82A 3UV9A 1G86A 4E4DX 2D7FA 2O8OA 3RDIA 3B3QE 1QXJA 3H3ZA 2ZACA 1BVP1 4UBHA 1BMV1 4IQPA 1SBDA 1PNGA 2ZA9A 4AE2A 3GZTB 1R081 4Y1ZA 4Q4W1 1W6MB 1OFSA 1YFWA 4COVA 1ENQA 1V9U1 4MXWB 1VAMA 4PQ9A 4GMP3 5L7OA 5AFEA 3B69A 3KT1A 1HRI1 3OD4A 1LOFC 1HQNA 3WG2A 3O12A 3D0JA 1FPN3 2WNEA 1X8MA 1DZTA 1C1LA 3WX5A 4CP1A 1CVNA 1RUG3 2RS11 1UMZA 1QJX3 2VVEA 4LE3A 1PZ7A 1CONA 3SH5A 2LALA 3IWZA 4GWMA 4YSFA 3MW4A 3EBRA 5FO8B 1PK6A 2KM2A 1MVQA 2D6LX 3VBFA 4N7UA 2XLAA 4EWDA 2R042 4AW7A 2UY8A 4DQAA 1GQHA 4JAAA 4AVCA 2WZR3 5CIRA 1CAUB 2FHRA 1VBB3 3MDPA 5D8AC 2FMDA 2GC3A 1DF0A 3VKLA 4ATE