1O3QA

Protein-dna recognition and dna deformation revealed in crystal structures of cap-dna complexes
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*AP*AP*AP*AP*AP*TP*GP*TP*GP*AP*T)-3'
publication title Indirect Readout of DNA Sequence at the Primary-kink Site in the CAP-DNA Complex: DNA Binding Specificity Based on Energetics of DNA Kinking
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
total genus 62
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2003-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1o3qA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1o3qA01
1ZVFA 5I93A 1TNTA 1R00A 4CO8A 4X6QB 1K6OA 1L0OC 1R5GA 2KIFA 3FJSA 1YW9A 4XBFA 5C6CA 3FMQA 1QZZA 5CVIA 1BBYA 2ZMEB 1W7PA 5K5QA 1YIOA 2JPCA 2WC2A 1TQIA 4QXKA 3J80Z 2FEZA 4KU8A 3B73A 1K78A 2HYGD 2CYYA 2ETHA 3F3XA 5D5VB 3QAHA 3UKNA 1ON2A 3GX4X 2CV6A 2YX4A 2K0GA 5FLXZ 4R52A 2K7LA 2RN7A 2WTEA 4MEYF 1CX4A 4LULA 3TDUC 1XD7A 3T0YA 2VOOA 3F8BA 4HYEA 3BCWA 3E6CC 4E70A 2DPDA 3H1YA 4YFNF 5JCTA 4HV6A 2DO7A 2QZ8A 3O2PE 2FMLA 1K7AA 1UPIA 1JHHA 2Z2SB 3GO5A 4M9SA 1NE4A 4M72A 4LEJA 1MDMB 1GVJA 1T38A 2PFWA 4XETA 4FT8A 3KETA 4YNIA 3I4PA 2XGXA 1STZA 3BROA 5HI0A 2DLLA 4O9EA 1TW2A 3HSRA 1RZ4A 5K8SA 1FLIA 1RL3A 3FFQA 2G7HA 2Q2EA 3DF8A 4R1HA 2EV0A 3K0LA 1SFEA 1S7OA 4ETSA 2ET1A 4NB5A 5CVJA 4WBBA 5L3GA 4HF0A 2H09A 4J1XA 3ZN0A 2L01A 1FBSA 1EH6A 2GQQA 1JHFA 2ZJ2A 2RVCA 4RB2C 2O6GE 3JW4A 2O8QA 1DZRA 1QQIA 4IRGA 2OYZA 4P9FA 1R36A 1YW7A 3I5UA 5L3EA 3JAMZ 1LQ1A 3HRTA 4KMFA 4XSZF 4LG0A 4IERA 1IPJA 4EM2A 4ZYGA 1QXJA 2HEOA 3KP6A 1YFWA 3BPVA 2EK5A 2VXZA 4HOBA 3ZMVA 1WQ2A 3W6KB 5HOOA 1KA8A 3TNPB 1J7KA 2V9VA 4P5OA 2CAVA 5K5RA 2XAHA 4JVAA 4PGHA 1NE6A 1ZZ6A 5D8KB 5KHGA 4M6YA 4A6DA 5FD5A 3RKYA 3F8MA 3BB6A 3F6VA 5BV6A 4ENKA 1A04A 1OI6A 2KJBA 4LD5A 4BQAA 5E16A 3WE3A 1C0WA 2ISZA 2BNOA 3FMSA 3P9CA 1I6XA 3ZQ7A 2L3DA 1ZRRA 4XF0A 1UCXA 2EFNA 3CUOA 2ZBKA 3MYXA 3M3IA 4OIOF 5D1IA 3MQ0A 1HW5A 4AIHA 3ML6A 2FBKA 4KIFA 2XVCA 5I0TA 3D0SA 1IXCA 1W7PD 3F23A 1ZN2A 1LDKB 4IEXA 1QGPA 4YARA 3WG9A 2ACJA 2G9WA 4L9NA 2QBYB 4R8HA 2VC1A 1G3WA 3V7RA 4F8AA 5KHJA 1J58A 3E5UA 2P17A 3H3UA 3E5QA 2KRFA 2CG4A 4O3MA 5CVRA 5FQ0A 4KA4A 2HJIA 4WCGA 5ILUA 4HZFA 5JR7B 3OOPA 3BJOA 5D8LB 3CL1A 3DN7A 2XKPA 2FMYA 2EA7A 4AQ6A 4HV5A 4PGGA 2E7XA 5K5OA 3UKVA 3F72A 1O7LA 2QJVA 3RYRA 2PHLA 3IBMA 5DCMA 3EO6A 2NRAC 3T8TA 3M70A 1O3RA 3U0ZA 2DK8A 2XUBA 2FA5A 5IT3A 5LRSA 5JSPA 2KJCA 1V70A 1ZX5A 3ES1A 1J1LA 1RUNA 3QACA 1G4DA 3MFKA 2QVSB 1Y0UA 2MBFA 2P6TA 2PEXA 4RB3C 3BPZA 3OF1A 4BAYA 4IEUA 3QPHA 1Z6TA 2HQNA 3LA2A 4ZU5A 3MZHA 2ZNYA 4PCQA 4N9IA 5D5UB 3O6BB 1CAUB 4Q48A 4G7HF 4B8XA 3HHGA 3TDZC 2P8TA 3EYYA 4I02A 4JBAA 3E3VA 5E1ZB 1PDNC 2YU3A 1SD4A 2MH2A 2EFOA 4HSJA 1H9TA 2GU9A 3LSTA 5DEQA 1LB2A 3L7WA 4AVPA 2HS5A 2Z69A 4AVBA 2O03A 5L3BA 4KWLA 1FOKA 4Q0QA 3PLQA 4GGGA 1PM7A 4IEVA 5FPXA 5E17F 4OIRF 3HOSA 1FYLA 2PAEA 4KN7X 1LR5A 2CW0F 2JRTA 1BJAA 3ZMZA 1TLHB 4RB1A 3DP7A 4HN1A 4QX5A 4MHGA 2QVOA 3F6OA 1IN5A 2X4HA 4BHPA 4OU0A 4U7BA 4CXFA 1K78B 3BJ6A 3TKYA 1XCBA 2F2EA 3K2ZA 5CU1A 5ICFA 2A68F 2IXLA 1SAXA 1R1TA 3V7SA 2F5DA 1S3JA 4HVRA 1SD6A 1HW1A 1XSDA 1YS6A 4OFGA 4XF4A 1SFXA 4RB0A 3V7CA 4LA2A 4CHUA 2Z33A 4EJWA 1MZBA 1G3SA 1WRJA 1FPQA 1YO5C 1RNLA 3IC7A 5HLIA 3RKWA 4G7ZF 3DPLC 1OPCA 5H6RA 4OMYA 4JK1X 3GWZA 3WU1B 1R5HA 4BHCA 3WTTC 2KKOA 1HKQA 4BH9A 3GFJA 4IPAA 3Q5FA 4UVAA 4UNOA 4YFXF 4RD7A 3BOQA 3U2RA 5AVPA 5CVUA 1U5TA 5FFXA 4M71A 2BNMA 5J48A 5FD6A 3WTZA 2FSWA 3ST7A 2EA2A 5ERIA 5HVQC 4UXNA 2QQ9A 2PMUA 4Q0PA 3PQKA 4AWXB 1O3QA 3SCHA 4XLNF 4ONUA 1P4AA 1Z1DA 3HUGA 1V4RA 4D7TA 2OBPA 3ZMUA 1NHAA 4Z82A 1JXSA 4D0PA 1XMAA 5JFRA 1U8RA 4LG0B 3KZYA 1KQ8A 5FPZA 3LWFA 4HW0A 2VC0A 1AOYA 1Z91A 2E1CA 1UD1A 3WGGA 1X82A 3WW3A 2IA2A 3REOA 6PAXA 4XEZA 1KU7A 5HLHA 2XASA 2PFBA 2IXKA 3C18A 3RI4A 2P6SA 2PJPA 4EWAA 4IF4A 5CVVA 4WK8F 4L5JA 5H6QA 4KWJA 3IRQA 1LEAA 3HSEA 2QWWA 5E1WA 4MGYE 2D1HA 4HMZA 2XV4S 1VJ2A 5HS8A 2VE8A 2B8MA 5KHKA 2FF4A 3DPTA 4G7OF 1BM9A 3P7NA 3KMHA 1ZZ9A 2UWMA 3KSCA 4KDPA 2C0ZA 5D6EA 4YSFA 5IT9Z 4HVOA 1R1VA 3QP6A 1CAWA 1R58A 2VT3A 4EJOA 4IETA 1I27A 1CF7A 1ZH5A 1LRHA 4N9HA 1G3TA 3DV8A 1TQ5A 3K1PA 2M8EA 3ROUA 2JTVA 4IESA 3GFLA 2IVMA 2LDUA 1P6RA 1T0FA 5ICGA 4HLYA 4IRHA 2Y0MA 4META 3SXYA 5FCCA 1MJBA 2H6BA 5JHUA 1GQHA 1FBUA 4Z07A 4KIBA 4RGUA 4GCVA 1R1UA 1IN6A 5FQ0B 1UB9A 2FU4A 3WW4A 1EH7A 2Z99A 2IJLA 4Q0VA 4AQ2A 4XSXF 4NHJA 1ZLJA 3J80K 2A5YB 4FAHA 3CF6E 2IC1A 3I58A 5TJJA 5HDNA 1ZNPA 2PAKA 3DFGA 4A0XA 1DUXC 4G94A 4LLNA 1Q5OA 5DCMB 5JAXA 3WTXC 4L18B 2COMA 2D2WA 3DKWA 4MTEA 3GVAA 3L9FA 3CO6C 4Q0SA 1Q1HA 1J2XA 3HYIA 4EJVA 2PBIA 3M9AA 3RNSA 4KUMA 3J81Z 3EJKA 2XL9A 3U1DA 5FFZA 3CJXA 1DPRA 1Z05A 2GZWA 2VONA 3DL3A 3SHRA 2QCSB 2NYXA 4A5MA 3B02A 3O14A 3VODA 3GYHX 2VBZA 3ABTA 3WE2A 2N7GA 4LTAA 3KGLA 1JGSA 3ULQB 2O3FA 4Q0UA 3RZZA 4M74A 1X3UA 3ZMDA 4XF3A 4CYDA 3LAPA 2MA3A 3HOTA 1EP0A 4HBNA 3KLOA 1FSEA 5HDGA 2DPUA 3K69A 1D8KA 4YFKF 5FDBA 1MD0A 4OIQF 1PP8F 3GF2A 2HGCA 1Q43A 2H94A 3R0JA 4OOIA 5L3DA 1ULYA 2GAUA 5I8YA 4ZYHA 5I0RA 1EV7A 2VE9A 2EFQA 1Z6RA 5LHGA 4PDKA 4UXAA 3VEPA 4EMSA 2HWVA 2FQPA 1WA4A 1FYMA 3OV8A 1FWZA 4G6DA 5BOXA 3EYIA 5EEHA 3L09A 3R0AA 1YS7A 3TQNA 5E20A 4EWEA 1XDUA 3GEZA 3FMRA 4KWKA 2R3SA 3PQJA 2A61A 2D5FA 2MH9A 2QDRA 5KVRA 5LBQA 5LRRA 2F5FA 2L02A 3S7EA 2R7FA 2IA0A 1ZG5A 2A07F 4MH0E 3VHRA 1BI0A 3OGJA 4IEOA 4ENNA 2GXGA 3P9IA 1QWRA 4MGRA 1S7AA 2P7VB 5F64A 3NQOA 4FAGA 2GC3A 5D5WB 5DV5A 4IHSA 1RC6A 2PG4A 1ZGAA 1UIJA 1ODDA 4PJYA 2VBYA 4X6RB 4U0WA 2P5VA 2FQ3A 4HSLA 3KGZA 1UHMA 2BBYA 1P4WA 1ZGJA 2PN6A 2M45A 4KL1A 3F8NA 1YUDA 4XFCA 4ON0A 5CLSA 3SFZA 2AS5F 5JR3A 5E8IA 5I0SA 4UBGA 3GFIA 3ELNA 1EPZA 4PIYA 1RTVA 3KP4A 2V6CA 1SFNA 1I5ZA 1S8NA 2STTA 1DGRA 1HKTA 5KHHA 2PQQA 3WTVC 2QUFA 4P96A 3H3ZA 3IHUA 2OQGA 1J3RA 4ENMA 1OYIA 4QGLA 4AVAA 1RIOH 2V79A 1J0RA 4LLLA 3TO9A 5D5XB 2H6CA 3NVCA 2EFPA 4FHTA 4KYWA 1DPUA 3IRRA 5ED4A 1O3SA 4E2GA 2EAAA 1XE8A 3WGHA 2A69F 5BQTA 1E17A 1X8MA 4HX4A 1ON1A 4P9UA 2ELHA 3Q9VA 2YR2A 4UVBA 2MD5A 4EGYA 4Q47A 4HA8A 3L2HA 3P9KA 3SHFA 1LNWA 1HQCA 4LUMA 3BPXA 3TO7A 3C1DA 1QZYA 4QGNA 1W5TA 1W4MA 3F8CA 4IHTA 2IW5A 4LK1F 2EWNA 3BALA 3SQNA 4XF1A 2RC4A 2PI0A 2Q1ZB 3MCZA 1ZAOA 5HLGA 1OD5A 1USTA 4K2EA 4FBFA 3WTSC 1QY4A 2ADUA 3R61A 3KP3A 3SCFA 3IKTA 4A12A 2JT1A 2XLGA 5L3CA 2OZ6A 2W24A 1FT9A 2JPBA 1MJ9A 3JZVA 3FZVA 4WVZA 2P5LC 2XIGA 1YYVA 4LFUA 1V3FA 2ZO4A 2FNPA 3BY6A 3OTFA 1FYKA 1OR7A 3C3WA 2OPKA 4NVPA 4QLCU 3EDPA 2XAFA 3MWMA 2B9UA 4IEZA 5I8SA 4PZJA 4S05A 1IPKA 3GXOA 4XF9A 1T98A 4M9XA 1BC8C 1IUYA 4E2QA 2CGPA 2O0YA 3NW4A 3WGIA 4B09A 4PIZA 3QP5A 4ZZDA 4U88A 4G9YA 5H20A 3WTUC 3S7IA 4P55A 1ZZ8A 4RAZA 3DQVC 2HYFA 1XGNA 1Y9QA 4UHTA 1ZG1A 2VBXA 4S04A 2PMHA 3BDDA 3N97A 1YLFA 1ZARA 4WZCA 5J7MA 4HDVA 4L0ZB 1WKMA 3T8RA 2EV6A 4GULA 2XL7A 3JSOA 4HQEA 4ORFA 4IJAA 4MV2A 1B4AA 5F6FA 1NZCA 2V09A 3D0JA 1LVAA 4K8FA 1G6NA 3E6BA 4F7ZA 3ZP5A 1U78A 3KLNA 1W7PB 3WTYC 5I91A 4WWCA 2IXIA 2FOKA 5ILVA 4MEXF 3KCCA 4JQFA 2UYBA 3I0TA 2K02A 1D8JA 1OKRA 4QMAA 3ECOA 4O5VA 2D1VA 2FBHA 1LDDA 4AXOA 1ZRDA 2QQAA 1MDMA 4MTDA 2GC0A 1ZHFA 2Q8KA 1BIAA 4HX7A 4ZZLA 1XGOA 1F9NA 3H7JA 1YFYA 1IN7A 4XFBA 4I0AA 4YRDA 1UHWA 2Y75A 3WW1A 4BXUA 3CEWA 1NXMA 1J75A 4OLLA 3E5XA 4A6EA 2DU9A 4HQMA 2DBBA 4EGZA 4EWDA 4LLGF 1BN5A 3HHHA 4FX4A 4DQ2A 1ZZCA 4UV9A 1IN4A 4ZU7A 1TNSA 1HKSA 2XAQA 2B0LA 3D5LA 3H7YA 4JTOA 3ZDSA 1LJ9A 3VFZA 5JSOA 3MZYA 3GFMA 3ISPA 3J7AO 3JSPA 4HF2A 4HX8A 4O6JA 3W6JB 1VR3A 4L0YB 4IEQA 3HTUA 4XFFA 1I1SA 2OAZA 4KU7A 1J3PA 3EHKA 1YW8A 1H9GA 2B5HA 5E1XA 3FXQA 4FX0A 2C6YA 5F1RA 2PYTA 5LEKA 3OCPA 5FLJA 1J59A 2E7WA 4MQVA 1YHFA 3EETA 3NSTA 4DNCA 3M7GA 2EA4A 4HVQA 1MGTA 3RDIA 2F4PA 2G7UA 3FX3A 5A2QZ 1SQ4A 1VP6A 2J5PA 2OQRA 1SD7A 4NQWA 3F8FA 3R4KA 2ZXJA 3H8UA 3CUQA 4EM1A 3IDCB 1SMYF 1SFUA 3CLOA 2FE3A 1S29A 3BWGA 3LQRA 1UW8A 1DP7P 3VB2A 1PUEE 3FZ3A 4JTNA 2K86A 3AAFA 2VT2A 1WSUA 2D93A 2Z5UA 3CLPA 3V8JA 2ZKLA 3LAJA 2QM3A 1ZRFA 3S0MA 2A6HF 2STWA 2PLYA 1SMTA 4EJTA 3ZN1A 2BYVE 2BNNA 2HTSA 3TOBA 3DXJF 3V8KA 5L3FA 5JI6A 2RGVA 4RGRA 2QENA 2DW4A 2XLAA 4P9GA 3DEUA 3MEXA 2WFPA 1WGPA 2XHKA 3U10A 3V8LA 2MNGA 2DCTA 3ERED 1B9MA 5FLHA 4M73A 2HOEA 3WODF 1P2FA 2P4WA 1T2KA 2LSOA 1Z7UA 2DI3A 2BEOA 1RGSA 2CSOA 3QRFF 2YPRA 3HQXA 3ES4A 1XGSA 3H9AA 1NYWA 2RDPA 1CAVA 3LFKA 3TOAA 3KP5A 1YG2A 2ESHA 4I09A 2FXAA 3GLXA 4IVNA 1B6AA 5BPXA 3C7JA 1KQ9A 3I7DA 1ZYRF 2UY9A 2XAJA 2RKHA 4EQQA 3CO7C 1F4KA 3UKTA 1SEFA 3IWZA 3K1NA 5AONA 1T39A 1ZREA 1O5UA 3FXRA 1IN8A 1UIKA 3LA7A 5DD8A 5ICCA 3I54A 3H92A 2ET7A 5DCFA 1GQGA 2UY8A 4A0YA 4AIJA 2VOPA 1HSTA 2MLKA 1P92A 1CAUA 5FLXK 2Z3YA 1EY2A 2DTRA 2VPVA 3SXWA 1XE7A 3MAJA 2XRNA 4AD9A 2IXCA 5D6FA 3NJZA 4CZZA 2IXJA 1QXRA 2PQ8A 2QQBA 3GYDA 3NKTA 2PTMA 1OYWA 4O9GA 1KYZA 4EROA 3N4MA 1W5SA 2FNAA 4XRFA 2D5HA 1MKMA 1FI2A 2NS0A 2OA2A 2VQAA 3HRSA 2RQPA 3FWEA 2IRFG 3RTRA 5LLQA 4HBLA 3KE2A 5DDGA 2D40A 5AIPA 2HDCA 3QU6A 1P4XA 5LGTA 1IRGA 3GZ6A 2MLGA 4A0ZA 3ETQA 4RGSA 1XN7A 2L4AA 2I45A 1ZRCA 1FP1D 4EVIA 4L2NA 4LB6B 5T3NA 1KGSA 3H1MA 2LF8A 3T1BA 2PA7A 1T6SA 2GC2A 5BPIA 2W25A 4QWQA 1U5TC 1ZZBA 5K1YA 1IF1A 4MZUA 4U0VA 2LKPA 1G3YA 2HKOA 5J6XA 3ZMSA 3JAMK 3CO2A 5AIQA 4XFIA 5EZWA 3NEUA 1J3QA 5HS7A 1BI3A 3FM3A 2QYOA 1XRUA 2IPQX 5FLIA 4B29A 5JSRA 3H50A 2PAMA 4ASNA 2Q0OA 2X0LA 1LKNA 1Y3TA 1OFNA 3CUQC 2D45A 4OMZA 3G7DA 2M30A 4U0YA 2DT5A 3ZMTA 1F5TA 4BHBA 1FSHA 2DQRA 5EFUA 1BOAA 1KU9A 5HDKA 4I7HA 1O5LA 4YIIA 2OZJA 3HIFA 3TGNA 5JVTA 4KNYA 3EBRA 4Y17A 2M1BA 3NL1A 4ESBA 1FBQA 1WI9A 1XB4A 4OIPF 4ZU4A 5E18F 1R7JA 4EM0B 5FGMA 1S6LA 3CJNA 3QPTA 4QM8A 1YFXA 4L9TA 3BJAA 4CGZA 2E1NA 2Y0OA 3I59A 2IP2A 2UXXA 2ESNA 2XROA 4KICA 5I8TA 1U5TB 3ZPLA 4M9ZA 4Q4ZF 4ZYEA 3M8EA 3ACLA 4TLFA 1USSA 3RYKA 3SZTA 1RI7A 4Q5SF 2VN2A 3JTHA 4WXCA 2CQKA 2BV6A 5BUVA 4YIFA 1TTYA 1FNNA 3F21A 2GWRA 1PP7U 3V4GA 2VBWA 5KHIA 1B59A 1IAWA 1QPMA 3L2CA 4LJZF 3S2WA 3CUQB 3CTAA 1XSXA 2FRHA 3KP7A 4ZH4F 4R79A 5LGNA 1H1IA 2UZKA 3T5XA 3KEOA 1O4TA 4HLXA 2WV0A 4LMYA 5C8WA 2HZTA 4WX9A 4MQ9F 2H0VA 3BZ6A 3WTWC 2K4JA 5CADA 1O57A 2KXLA 2O1QA 2LNBA 3U9GA 3SCGA 4Z2YA 1QO0D 4AIKA 2HFHA 4Y13A 2RV8A 1D3YA 1R23A 2J5OA 1DZTA 2EJRA 1KU3A 5LGUA 4ENJA 4GO1A 1IXRC 3KP2A 2XAGA 4EV0A 3IIAA 4HLTA 4PIXA 5BMZA 5J8FA 5DYMA 3SMHA 1I1GA 3EUHA 5CJ9A 3LZZA 4G8XA 2LF7A 4E2SA 3VOEA 2HQRA 2A3SA 3RPQA 3IKVA 1ZLKA 1CAWB 3R6SA 3I53A 2XLFA 4IXAA 5DUIA 1CF7B 4AVCA 4I2OA 3L00A 2P7CB 2GXBA 1CAVB 3WW2A 1CAXA 5ICEA 1X7NA 4QM9A 2XKOA 4MGKE 4KMUX 5KK1A 1FY7A 4BIFA 5KBFA 1JE8A 5E1RA 1Z9CA 1PMIA 3FM5A 5I0UA 3ELKA 4WXDA 1GXPA 1H1MA 3LOIA 3JTGA 2Y48A 4RAYA 3HTSB 4GYGA 2ZMEA 3TO6A 2IT0A 4RS8A 3K9TA 4MUVA 4MX3A 4GYIA 4HDUA 1XSVA 4UVCA 1U3EM 2W57A 3G73A 2HKXA 4JV4A 3KEQA 4I0BA 1BI2A 3HT1A 3ECHA 1R22A 4D7SA 1TQPA 1KU2A 4L9VA 1MJAA 4MGZE 3QU3A 3FHIB 4MGIE 2OA4A 5CYVA 2F5EA 2IXHA 3IDBB 5EEGA 4KIGA 1YWKA 2KIUA 4IEPA 3FE5A 3OD0A 3R60A 4OINF 1B9NA 5J3UA 4U7DA 2HTJA 1E2XA 3LWCA 4ZYDA 3O3KA 1DDNA 4XLPF 2NAZA 3CDHA 3I71A 5TRDA 3FHZA 2CAUA 4UV8A 3GW2A 3NRVA 2DAOA 4N0BA 4CDGA 1H0MA 5BXXA 4CICA 4QGMA 2R7DA 5LEJA 1XDSA 1JUHA 4LA3A 2CO5A 2M5WA 4LUKA 1SD5A 2EFWA 1HSJA 3E6DA 2H27A 3G3ZA 2K27A 3M1EA 3E6MA 1YFUA 4J1WA 2DFIA 4Y15A 1QNTA 5A2QK 1X8EA 2ETEA 1FP2A 1UCRA 2VECA 2L4MA 2UXNA 4GXOA 5D4RA 2A6EF 2K4BA 2NNYA 4BYYA 3KFWX 3TNQA 4Q29A 3EQLF 3PFIA 4HF1A 3HRMA 3FF5A 4M6XA 1HXDA 2GA1A 4WXHA 1CGPA 3PVBB 5ILSA 1AWCA 1FXZA 1K79A 4KN4X 3IL2A 4I3PA 1B1BA 2MC3A 4IRIA 2BE5F 2MHFA 2DQLA 4EJUA 2OZUA 5BY5A 2WWYA 1FC3A 4UBHA 1FZPB 3H1WA 1LDJA 4KT5C 1ZG3A 1VTNC 2W84A 2ISYA 1ZZ7A 3EQEA 5LHIA 3USSA 4TV7A 3C3VA 4DINB 2JSCA 1BI1A 4L11A 1KYWA 2P5KA 1GXQA 2ZFWA 3LQQA 3PNAA 2Q30A 2HR3A 1YFHA 1TW3A 5BPDA 2IA1A 3RJPA 3IWFA 5IT9K 1Q3EA 4IEYA 1ONVA 1J9IA 1OMIA 2YX7A 1RUOA 1XMKA 1J5YA 3D82A 2TDXA 4WF2A 3ABUA 5DUKA 3BU7A 4LLOA 2O61A 3I59B 3E97A 1F1ZA 1BIBA 3LAGA 1WWXA 2QLZA 4I01A 2EV5A 1HBXG 3F22A 2E9QA 1U2WA 3RKXA 2MPFA 1REPC 2BGCA 3MPBA 1EYBA 2YSRA 2QBYA 4XFHA 3KZZA 4A5NA 4UUVA 3RIRA 3I64A 5LHHA 2Q0AA 4XFAA 4RGXA 2Z9OA 1O3TA 2K9ZA 1KQ0A 5BS6A 2F5CA 2EVXA 2GH2A 3HT2A 4LGWA 3RPUA 1D5VA 4IEWA 2W85A 1OYYA 4ESFA 2ATFA 3BP8A 2AXLA 1L3JA 1IXSB 3GBFA 3FXUA 2V1XA 1QBJA 3SZPA 4H0EA 1LEBA 1TQMA 4BNCA 3WU0A 1U6GA 2ZCWA 3U11A 5FB2A 2CWEA 2NNNA 2ZKZA 4LB5A 4XFGA 3J81K 1EH8A 1DGWA 1YQAA 1FX7A 2UYAA 1U12A 1IRFA 2OD5A 1HW2A 2CFXA 4H7LA 2JZYA 2QNKA 2GIVA 3Q9SA 2Q4SA 2FBIA 4MNUA 2V1DA 3HRUA 5D4SA 1BC7C 3RYPA 2GA2A 3HSFA 3QOPA 4I98B 4HN0A 5HS9A 4ESJA 2RNJA 4KFCA 1TBXA 2DK5A 5E8GA 2VODA 2M87A 4HAMA 1IW7F 3MDPA 1O7FA 1XGMA 1UFMA 1GHCA 2GC1A 1L3LA 1YLLA 3COAC 4LK0F 2EB7A 3GZ5A 2O8XA 2PHDA 3K1MA 1IZ1A 4YG2F 5J8CA 4L5IA 1CAXB 2OU2A 2V1UA 2ZNZA 3M8FA 5DD4A 1YTYA 4YYOA 3LA3A 4A2UA 2KIMA 1WLTA 3GUDA 1XCVA 5FO5A 4L9JA 4G6QA 2L54A
chains in the Genus database with same CATH superfamily
4PJMA 2Q5TA 2E26A 3BGAA 4AFDA 3DPRC 2ID6A 4X6QB 1L0OC 4YGCA 3S1NJ 3Q8FA 3AKSA 2XQRA 1OCCH 2QQVA 3SEPA 5FTTC 2VCCA 1BBYA 1H0BA 4BMBA 2WO2A 3H0OA 3ZSEA 2XGEA 2JPCA 2WC2A 1TQIA 2HYKA 2NPIA 4MIMA 2FEZA 1CVNA 2AREA 5H2FC 3F3XA 3H36A 3AKPA 2JECA 2ZJQF 3V65A 2X1CA 2JG9C 4R52A 3CCEI 5ISLA 2VMHA 2WTEA 4MEYF 1MMSA 4LULA 3TDUC 3AP9A 2VOOA 3E6CC 2DPDA 3ZQLA 1EUTA 3PJYA 3N35A 4PI0A 1S0GA 1DBNA 5KXCA 4HV6A 3S2HJ 2QZ8A 3O2PE 1UPIA 4IHVA 1JHHA 1HXS2 2Z2SB 4JGZC 3WDTA 1T38A 4FT8A 3KETA 3BROA 3ZR6A 5K0UB 4ZJZA 2DLLA 1HOMA 1FLIA 4KG0A 1W0TA 2ET1A 4WBBA 1IV6A 2H09A 4QPIA 3TN92 5C33A 4ATFA 3GZEA 4A69C 1JHFA 5JLWA 2NN8A 1XOYA 4RB2C 4NRPA 2XJTA 1DZRA 1O4ZA 1W6QB 1R36A 3AVRA 2ZHLA 3VKOA 3GCXA 3JAMZ 1RB8G 3L9JT 4A3DJ 4IERA 1QXJA 1N77A 2EPFA 1JS9A 4RFT0 3M3CA 2EK5A 5FO9B 4HOBA 1KA8A 1YXWA 2F48A 1WJFA 1S2EA 5K5RA 1UX6A 2XAHA 4JVAA 2P6CA 3V0BA 3CCSI 2DU1A 4OHYA 3JD72 2D3PA 3BI3A 5D8KB 2YBSA 3WF1A 4BQYA 2AENA 4FPFA 5B1AH 5FD5A 3U07A 4HEA2 3BB6A 3F6VA 3G1MA 5BV6A 4LD5A 4XVHA 3H5NA 5L9RA 3WDUA 3AMMA 2EIKH 4Y33A 1OC1A 2DYCA 4A3MJ 2J1TA 2L9NA 4LLFA 4XF0A 2EFNA 1XE0A 2XMLA 5FY8A 1AX2A 4A3LJ 4AIHA 2PMZA 2ADDA 2XVCA 2EINH 3DUIA 2JA2A 2R32A 1IXCA 4GXLA 1ENQA 3F23A 1ZN2A 4Q5OA 1RKTA 3VZLA 3DTKA 4LO8A 1QJEA 2G9WA 5JUVA 4R8HA 2VC1A 2V72A 1DGWY 1ALYA 1H88C 2K40A 5BNQA 2GMEA 3ZN4A 5CVRA 5FQ0A 4FFHA 4KA4A 3QYFA 5JR7B 3OOPA 1ULCA 4LO5B 5FY5A 1UAIA 2XKPA 3OR2C 3ZMNA 2IGNA 3I2KA 2VI6A 3HOUJ 4JKMA 1DYPA 4XBLA 3ZDVA 3X29B 4TN7A 1BW5A 5EGOA 3OL3A 2XVLA 2YHJA 1JKRC 2DK8A 3HOBA 2XSDC 1NLRA 5JSPA 5GADJ 1F15A 1CIWA 1HRI1 1JZ7A 1PX4A 4CSWA 1H8TA 2R49A 1G4DA 3NNGA 3OIQA 3MFKA 1Y0UA 2HOSA 1FOYA 3ZYHA 4Q4X1 3BPZA 4BAYA 3A23A 2XJRA 2GOMA 4RN5A 3CKHA 2COBA 5D5UB 1VBE1 4B1MA 1CAUB 5GAEJ 4G7HF 2RM22 4B8XA 3HHGA 1HJFA 3EYYA 1AYM3 3BR5A 3E3VA 5E1ZB 1PDNC 1DCSA 2YU3A 4W65A 1WBFA 2BY2A 2XXZA 4AHYA 1MS5A 4KGQA 3AZZA 2CQNA 3UNPA 1H9TA 3RZJA 1VBC1 5DEQA 1LB2A 3L7WA 2NLRA 5L3BA 4GH4C 2BVVA 4URTA 2PHWA 2NXNB 1PM7A 4QAWA 2FDGA 4IEVA 4CDWA 4XKWA 1VQ4I 4CEYC 5E17F 4Y22B 4OIRF 4DZPA 3HOSA 1RUG1 1LR5A 3IMNA 1VRH1 2QQJA 1RUI3 1SFPA 5JMOA 2WT2A 4HG2A 2O5RA 1FTTA 3A0BC 4CXFA 3TKYA 2F2EA 2WAQA 4W4ZA 3ACHA 4Y1ZA 2IGOA 1S3JA 4FOQA 4HVRA 4QB6A 4CYCA 4E4DX 3HGYA 2LK2A 5E79C 1YS6A 4JHZA 4C3HJ 1SFXA 5FYUA 5LB6A 3W20A 2NP0A 1WRJA 1VAKA 2NQYA 4NDLA 1RNLA 2ZB9A 3ME2A 2WY7Q 1R9TJ 2HXIA 1BW6A 4YRVA 1MZFA 3GWZA 3WTTC 1HKQA 3GFJA 4UVAA 4UNOA 3BOQA 3FC0A 5CVUA 5J48A 5JOXA 4FCYA 2AQFA 3CMGA 3WTZA 3LDKA 2VUMJ 1N1SA 5HVQC 4UXNA 4QPIB 2QQ9A 3ZFFB 1QJX3 3M2MA 1W6NA 3OYGA 1RR7A 2YZ4A 4UW4A 1Z1DA 4YVSA 1LAJA 2R073 3AZXA 2QGUA 2X51A 1GWLA 3ZMUA 4IE0A 1DU0A 1NHAA 2JN6A 3AMHA 4BJTA 2A6YA 2WNVA 3ZYGA 2G0EA 2Y64A 3FKIJ 4DY5A 1EV13 3LWFA 4II3A 3IAQA 1VQ7I 3ZSLA 5KXDA 2NM1A 4XEZA 1KU7A 3GTMJ 5D2AA 2XASA 3V0BB 2PFBA 3RI4A 3VBHC 5DUUA 5CVVA 4WK8F 2BJSA 5DZEA 1RUF2 3ACFA 3L2YA 4KWJA 4TTGA 1LEAA 2LLKA 3HSEA 1LKXA 4PJJA 4Y26A 4AE2A 1V00A 4KI5M 2XV4S 4V2WA 5FWJA 2YC2A 3GF6A 2FF4A 4AYBN 3EXUA 1C8M1 3W6VA 2K9LA 1BM9A 3KMHA 1W99A 1WJEA 3LL7A 1ZZ9A 4X8PA 1PUFB 4OUMA 4KDPA 1N78A 5JOYA 5D6EA 2FD8A 4Q27A 2ZGRA 4YSFA 5IT9Z 3CU7A 4AIDA 2M4GA 4YM3A 4KJZA 4IETA 1NK3P 3HBKA 1G3TA 1RVF3 3VDDA 2M8EA 2JTVA 2IVMA 4OAZA 5FLMJ 3HQRA 5LASA 1P6RA 1T0FA 4IRHA 4QPOA 2JB8A 1MJBA 1UYYA 4ZY9A 1FBUA 4Z07A 5GZCA 2D7FA 4BY1J 4KIBA 1XYOA 1R1UA 3LFIA 5FQ0B 2FU4A 4DZGA 4Y24A 4XK4A 5FPVA 3MBWA 3OUHA 2IJLA 4Q0VA 3ABMH 4AQ2A 4XSXF 4NHJA 4JQRA 1ZLJA 4HSRA 3RZKA 1NAEA 2W7NA 2A5YB 1I3AA 1LOFA 4R4ZA 2YDEA 1ZNPA 4IE6A 2CV1A 3HOWJ 3SJMA 1S0JA 3WTXC 4BQ4A 4ZS2A 5GALA 4QSHA 4MTEA 3L9FA 3HYIA 3SISA 5EGOB 1W0OA 3M9AA 3SKJE 2K9MA 5A7WA 1RIRA 2OUJA 3I56I 2WSUA 5KAIC 4A5MA 3ABTA 5JHFA 1JUIA 1UPSA 4A93J 4CDXC 1XYPA 2VZQA 3L2QA 5LWBA 3RZZA 4K6BA 4J6GA 3LQCA 3GALA 1GLHA 2LS6A 2K5CA 2JA5J 3LAPA 2WO7A 2P0WA 4BQ5A 1DIWA 3EUAA 4HKOA 3MD2A 5DN2A 5GZEA 1XG1A 4EZHA 1EP0A 3KLOA 1KFUL 1U8BA 1JW6A 4C1XA 3D8CA 2FDKA 2X6XA 1MD0A 4OIQF 4CDUC 4OOIA 5GPCA 3FHQA 2DT6A 4DPNA 2GAUA 5J4VA 2EFQA 2VBBA 2Y0SA 1OUSA 2HWVA 4CDWB 3OV8A 4IQPA 3BR6A 2FDIA 4M0NA 3EYIA 3L09A 1Q8VA 2FBEA 5FZDA 2R7ZJ 3WLUA 3KT4A 2AEZA 2BVBA 1WJAA 2ZHMA 2MH9A 3B93A 4ARYA 2VW0A 3FFZA 3ZXAC 2E19A 5LRRA 2HWE1 4XOPA 4YFZA 2A07F 1BI0A 1F31A 1W6MB 3HN1A 1QWRA 1TMF3 1ORKA 2ZGLA 4MLOA 3ZYBA 2A3WA 3WOGA 2ZEYA 1UOJA 1ODDA 1ETWA 4PJYA 1DYKA 2P5VA 5J1UA 1SLBA 2R041 4HSLA 2RR13 3KGZA 1OOPB 1WVRA 4KG8A 1N47A 3OR1C 2VGDA 3THPA 2M45A 1W2UA 3F8NA 1YUDA 2AS5F 5E8IA 2XVGA 5CG8A 3ELNA 2VOKA 2IGKA 1EPZA 1KONA 1AHSA 1W6NB 5K4LA 4C2TA 3N9MA 1UELB 2HLEA 2PQQA 1YX3A 2QUFA 2J1SA 4P96A 3H3ZA 1K42A 1GWMA 4FOVA 4YVSB 5T5JA 4ENMA 1ENRA 1K4SA 1OLME 4QGLA 2EZHA 4JX6A 4LLLA 2VMDA 5C3PA 5F6LB 2CNAA 4FHTA 2QEXI 1DPUA 3IRRA 4ABZA 2F4IA 4E2GA 1GYKA 2A69F 4UUTA 1SFKA 4P9UA 2V5DA 3CF2A 3MIEA 1VBD3 3AL0B 5CFCA 3L2HA 1LNWA 3DEWA 4BY7J 1W39A 5FKOA 2HYJA 4QGNA 2IWGB 5T5PA 4XMIA 1D4M3 5K7PA 3VZOA 3BALA 4JKKA 4D9JA 2BV4A 2RC4A 2E2IJ 4W6WA 4JC1A 1ZAOA 1ETXA 5F39A 1VE0A 4YZ2A 1USTA 4KGGA 3WTSC 3PUIA 2FCUA 2Y6FA 3SCFA 3IKTA 1AR83 5L9BA 2XLGA 1LTEA 2W24A 3VKFC 4XBNA 4NBQA 1AHDP 2ZMNA 3PSFA 1FTZA 2FZ2A 3VDDB 4LFUA 2HYXA 5A70A 4A3KJ 5FMCA 2CHHA 3NWSA 1UNBA 2HWB1 5E3OA 2XF7A 4LBMA 1BBT3 2BWAA 2CDOA 3MWMA 4AVZA 5I8SA 1IPKA 3GXOA 1T98A 4E2QA 4NMIA 4ZONA 4Q4W2 5HCHA 1SLCA 4GB33 4B09A 1BJZA 4YVWC 1GQPA 5IP7J 2HYFA 1V9U2 1XGNA 5A3WA 2D6KA 2E31A 3CF5F 2VBXA 3HNBM 3MLJA 1AYM1 2EIJH 3BDDA 3N97A 1YLFA 4AM3A 3THDA 1ZARA 5J7MA 2RNGA 5FRAA 5FPUA 4MV2A 1NZCA 2IZWA 4XLFA 2V09A 5FREA 1U9OA 4K8FA 5SV5A 1GP5A 3PIJA 3IIIA 4DRRA 5A7WB 5JI7A 1XPXA 4UY8I 4KMQA 3WTYC 4B7EA 2FOKA 4PJ0C 2MEV3 1HCRA 2UYBA 2DJIA 1TNFA 2VD7A 1YIPA 1FV3A 3ECOA 1FMWA 2FBHA 4O5VA 4AXOA 3BG3A 4MTDA 1ZHFA 2Q8KA 1DGRN 3MIBA 1RUI1 1M4WA 3KPHA 4HX7A 5LA2A 3H7JA 1IN7A 1PVXA 1SPPA 4K1YA 4BXUA 4LHKA 1NXMA 1NG7A 1Z78A 5A7SA 2XJSA 4Q4X2 4GKXA 5HCBA 2VTXA 4QKFA 4EGZA 3RMYA 2DA6A 4IHYA 2DDBA 1DGWX 3ILFA 1IN4A 2R7OA 3AL5A 2B0LA 3WHBA 3LSMA 1W8HA 4BE1A 3MZYA 2L7KA 2PJRB 2DBIA 1VR3A 4OI2A 5FV3A 3RVHA 2EZIA 1RUC3 4XFFA 1I1SA 2Q2EB 3M7AA 5B1BH 3WQ0A 4PQ9A 3VZMA 1J3PA 5GAGJ 4WV8A 1YW8A 1H9GA 3ZN6A 1OCRH 2JG9A 3DBLB 5DAPA 5F1RA 3G6JB 1NG0A 2RG4A 4Q8LA 2PYTA 4AAPA 2X5IA 4AEDB 5LEKA 1QH6A 5FLJA 4LBQD 1J59A 2E7WA 4MQVA 1YHFA 3EETA 1R092 4QXBA 1IG0A 1KJRA 3RDIA 2M4KA 4DXRA 2G7UA 5C3EJ 2HVSA 5A2QZ 1VP6A 4LO7A 2OQRA 2XF6A 2A73B 1V6LA 3F8FA 4ZDOA 4AF9A 2ZXJA 4D3WA 2W94A 4EM1A 1DGLA 2R071 3IDCB 1Z3YA 2ZSIB 3DBRB 1A36A 1NA1B 4P9YA 2ZACA 1DP7P 3FZ3A 2VT2A 4COVA 4Q4V3 1OQEA 1PJRA 3RZGA 4FPCA 5IUQA 2QQLA 2ZKLA 2VJJA 2PLYA 3CDLA 1SMTA 4PLNA 3K48A 4S0HB 2EXHA 4MVTA 2BNNA 3K4NA 1K5MA 1U5IA 1E0EA 5JZGC 1IS5A 2F6CA 2A71A 2HVQA 3DEUA 3MEXA 3J7ZI 1UJ8A 4FE7A 2KR2A 3U10A 3V8LA 1BXHA 2MNGA 4M73A 3RZLA 3WODF 3CDIA 1HIXA 2UWCA 1G86A 2OJED 2LSOA 1UY1A 1Z7UA 2YFZA 2AR6A 4P9JA 2BEOA 4OULA 3B9IA 3WHTA 3HQXA 1XGSA 1PYVA 3AMQA 3KP5A 1YG2A 5JXIA 3T0AA 1WHUA 3DEMA 1JYTA 4HOOA 3GLXA 4IVNA 5CFCB 3ITQA 1B6AA 1D7PM 1QHHD 3EUKL 2VC9A 1KQ9A 1ZYRF 4UW3A 1DQ5A 2ZKNA 1FMVA 2JSPA 2WWSA 3PTYA 1O8SA 4XORA 5AONA 1IS3A 1T39A 1UZVA 4U36A 3RJ2X 3AZYA 1IN8A 3UGHA 3LA7A 3I54A 3AKRA 3S6PA 3OGGA 1GMMA 1AJKA 4A0YA 3WNNA 4AIJA 3DECA 3WZ1A 4ET7A 3GCWA 3NAPC 3AX4A 5FLXK 2Z3YA 2VPVA 3B00A 1IJWC 2XWBB 4PI2A 4CZZA 2GNDA 1QXRA 2QQBA 4LNVA 3GYDA 5FY4A 1KYZA 4EROA 5FZMA 1LEMA 2QQWA 1RPWA 5DG1A 2NS0A 3RQ4A 3FWEA 3DKQA 5LLQA 4HBLA 4BJ5C 3PNVA 4KITB 2C9KA 5EP9A 3OL4A 5FOBB 1IRGA 2RMU3 2PHUA 3ETQA 1XXNA 4R9CA 1FP1D 5T3NA 3MHZA 4W1UA 3WNXA 1H6XA 2PA7A 3ZYPA 1CZVA 4QWQA 4D6SA 3I9V2 4D7YA 4Q1PA 2CMPA 1ZZBA 4BQ3A 3ZXKA 4MZUA 3HMYA 2VZSA 3WNMA 1LENA 3CO2A 3QCWA 5EZWA 3DYOA 4HK9A 4JDMA 2DU0A 1LFBA 2WS93 4XXPA 4PSXA 5HS7A 3HVDA 3AP6A 3QD6A 1BI3A 5J1XA 3ZPYA 1MSEC 2E63A 3SH5A 1XRUA 2LMDA 1AL0G 3W2WA 4B29A 2YY1A 1Y3TA 5F3EA 1LFPA 3KT1A 2R7UA 5IFPA 1HA8A 2KFDA 1F5TA 4QKDA 4BHBA 1SPPB 3J7MA 2ID4A 2RJLA 4QIWN 1WH5A 1HB1A 4XM3A 4C0HA 4M00A 3QODA 5HDKA 1JZ5A 1OURA 2F4LA 2DMTA 4YIIA 2J7MA 4XRSA 2M1BA 3IAM2 4ESBA 4D1QA 1XB4A 4ZU4A 1B35B 2GLOA 5E18F 2VAUA 3VL9A 1S6LA 3PMSA 4QM8A 4FPLA 2CQXA 3CCUI 3BQZA 3OIPA 3MMYB 1PM4A 1UY2A 2VG9A 4KICA 5I8TA 3CESA 3AFKA 3RFRA 1U5TB 3ZPLA 3WY6A 4NE9A 4M9ZA 2RR11 3O1TA 2Y31A 5ABJC 3M8EA 3ZN6B 1USSA 4BQ1A 2H8WA 2ARBA 3SZTA 4Q5SF 4JDNA 2X5IB 1KRIA 1BR4A 5LD2C 1ETVA 1OHFA 2C26A 4QQLA 5BUVA 1WBLA 4CPBA 3MIHA 1UMZA 2A3XA 2VBWA 3ZO0B 3BTIA 2R16A 4OQ8A 1B59A 1BEV3 1E5RA 3VHOA 2BPA2 1C8NA 1D2QA 4YG6A 1E5SA 4ZHNA 5IYBJ 5LGNA 5L7OA 4UT5A 4NHMA 3OYMA 3WU2C 1AZDA 2WV0A 4XACA 2VNOA 3CZ6A 1O57A 3H9JA 3WSOA 1ZYBA 2O1QA 4OVEA 2X1EA 3AMPA 3U9GA 3TW6A 3SCGA 4AIKA 2HFHA 3U75A 1K5MB 1MNEA 3SQOA 2EJRA 1ZK8A 2YPJA 5LGUA 4ENJA 3UL2A 1IXRC 2R042 5BNNB 5DYMA 4NIGA 1D4M1 4OI0A 3SMHA 1I1GA 3Q0WA 2HI3A 2A3SA 3FXKA 1W0NA 5T55A 1ZLKA 3VBUA 3IPVA 3AFGA 1H2NA 4KISA 3A03A 2GXBA 1QDOA 3WW2A 1QH7A 1X7NA 4AFBA 5DM7F 2Q1MA 4ARXA 3IH4A 2XKOA 1POV1 4KMUX 3LSEA 5GJ6A 5IK7A 2OX0A 3QBQA 3VBSB 5E8AA 3NJVA 5EDNA 3ELKA 4WXDA 3BODA 2X85A 3KS7A 3LDBA 4KQ7A 1ND2C 3JTGA 4GMP1 3JBG3 3FKJA 2DVGA 3LEMA 1WLCA 3HTSB 3POSA 3TO6A 4ISRA 3K9TA 1APLC 4N43B 4YELA 1BR2A 4MX3A 1XSVA 3OUJA 2W57A 2HKXA 3C7OA 5ANNA 2MG4A 1VMFA 5HPOA 1MBGA 4L9VA 1AL23 3QU3A 3AXDA 2Z79A 3JRAA 5CYVA 2F5EA 3ON7A 2IS1A 2WLQA 4N53B 4BS9A 3H9GA 3FUQA 3I2JA 1UMQA 3UR3C 3GTQJ 5A33B 2KIUA 1YI9A 3OEBA 5DMYA 2K85A 4HG6B 1YHQI 3THCA 4DQAA 5CQEA 3H5AA 2HTJA 4XLPF 2NAZA 3FHZA 2CAUA 3OBAA 5BNPA 5FXWA 5DAXA 3GW2A 4GJZA 4WM8B 3NRVA 3W5NA 1SLIA 1LOGA 4N0BA 2MEV1 1ETYA 3L2RA 2JDAA 1XDSA 2CRGA 4N4OB 3CMYA 4FVVA 1RITA 1FOD3 5FROA 4LUKA 2EFWA 3E6DA 2H27A 4MO3M 1YFUA 3E6MA 2VASA 1YJNI 3RG0A 3TEZA 2XDVA 4Y15A 5A2QK 2NVQJ 1GZ9A 5FO7B 2ZEXA 4GXOA 1NKGA 3LOBA 2NNYA 5DUVA 4Q29A 4CDXA 3HRMA 4MO7A 1UWWA 1CGPA 3VYUB 2MD0A 2PQSA 5ILSA 3DU5A 1TL8A 1AWCA 3K4ZA 4DYQA 5CKQA 1SFOJ 2RHPA 1AYM2 1Q8SA 2GNMA 2YPDA 1YO8A 4F93B 2QQKA 3GJAA 1RUC1 5DS9A 5BY5A 5FJHA 3ZR5A 5F37A 1OLQA 2WWYA 1LDJA 4KT5C 4CDUA 1IGOA 1VTNC 2W84A 3EQEA 4LO4B 1MZ6A 3GDBA 3FL7A 4TV7A 2O0OA 4DINB 5IVBA 2ZFWA 1WMXA 1XC6A 3HB9A 1RKWA 2HR3A 4NIHA 1TW3A 4R9DA 5BPDA 2IS4A 1RUI2 5CB7A 4BA6A 4IEYA 2W87A 2E5NA 2G9GA 1Q1VA 1XMKA 3NNJA 3IAS2 3BU7A 3LPGA 1UG2A 3E97A 1F1ZA 4XL9A 4TYSA 2QLZA 3BTLA 4M6VA 1SFYA 1OPMA 1Z0HA 3AMNA 4Q4V1 3A0KA 2BOJA 4BJ0A 1F5FA 4E4SA 5FYTA 2Y38A 4BQQA 2HEVF 4DEVA 5FYIA 2EIGA 1POV0 2OS2A 2J1VA 3ABKH 5KC5A 1MS0A 4RS5C 3PURA 2DMQA 4XFAA 4RGXA 2Z9OA 4P08A 5FRMA 3JUUA 3MLLA 4LGWA 3AG3H 3GJBA 5FXZA 4GMP0 2DFEA 3GBGA 3MGUA 5L7OB 2ATFA 1L3JA 2AXLA 4JP0A 1LGBA 3OOXA 2MW8A 5FY1A 5IK8A 4D7NA 2OTLI 4BNCA 3WU0A 1QJX2 1U6GA 5FB2A 2ZKZA 4AGRA 1QJU3 3J7YJ 3K70C 4GKYA 1HW2A 3I3BA 2R072 3O1RA 2GIVA 3ABLH 2ZABA 2V1DA 5D4SA 2PHXA 2BZTA 3ABZA 5HXMA 3QOPA 4I98B 4HN0A 5IHRA 5AFBA 1IRXA 3DWLE 2ECBA 2VODA 4CXYA 4ZZ5A 3T2TA 3H8OA 1WCKA 4Y5SA 1L3LA 3ZIXA 3TYJA 4P9IA 3VBUB 2V6EA 3D1NI 4AW7A 3NO8A 3R4UA 4AFCA 1VZ0A 3K1MA 1IZ1A 3LSHA 4DY3A 2OU2A 2V1UA 1NQDA 2RS11 2VE1A 1IC8A 1V6KA 4A2UA 1XNTA 1XCVA 1Y7BA 2DVFA 3PUSA 1R00A 4CO8A 3U1XA 1R5GA 2KIFA 3FJSA 4XBFA 5C6CA 3FMQA 5CVIA 1NQJA 1W7PA 5J37A 1BA5A 4QXKA 5F0CA 3J80Z 2RMU1 2WO3A 3B73A 1K78A 1RVF2 2HYGD 3K4DA 2CYYA 1AYN3 1VAVA 3A7QA 3JXSA 1NY72 5LA9A 5D5VB 5EZGA 3E1SA 4L99A 3UKNA 1AR93 2TUNA 1H9WA 4R4XA 2K0GA 1UYXA 2RN7A 3ASNH 1GOFA 3BCWA 4XXAA 1URXA 1JUSA 3OGRA 2E34A 3BLYA 4Q4Y3 2LR8A 2DO7A 2FMLA 1K7AA 4QPWA 2WS91 2VJIA 4M9SA 1NE4A 1GZTA 3WX5A 1W03A 1GVJA 5BNPB 4YNIA 1HN1A 4DMIA 5HI0A 1TW2A 3AXEA 1RZ4A 5K8SA 4BMEA 3K0LA 3RPUD 1S7OA 3S1QJ 2HOTA 4H7MA 4NB5A 5CVJA 4XCAA 2YG0A 2Z42A 4FQGA 3ZN0A 4B1RA 2HQ5A 2GBYA 3B5LB 3WR0A 1YYNA 1LOCA 2AACA 2ZJ2A 2RVCA 3AM2A 2O6GE 2H1LA 4PQQA 4YW1A 5HXVA 3JW4A 3CCQI 1WCSA 4PLMA 1QQIA 1BHGA 4P9FA 2WA0A 5LA0A 4XSZF 1GBGA 5FYYA 4HNTA 3OUIA 4BXSV 3A0NA 4P5YA 3BPVA 2YC4A 3W6KB 4P5OA 3QOEA 3POBA 2JE7A 3B6CA 3FBYA 1CQ9A 4XHXA 1NE6A 5KHGA 2VW1A 3S32A 5EEAA 3G2BA 1A6CA 4AAXA 2YUSA 4ENKA 2OVUA 4UW6A 1IDYA 3T0DA 2CQ7A 2HWD3 3LNQA 4XE9A 2NOGA 2ISZA 2Q8CA 5C9AC 3IV5A 2L3DA 3NWTA 3OEAA 1UCXA 1G59A 4GWNA 5IVYA 4OIOF 3PO2J 1XB9A 1A5JA 4FSJA 2GIZA 4NOTA 1H9PA 5I0TA 4UB6C 4A45A 3DEEA 4RA0A 4IEXA 1TMF2 1ODNA 1PO21 1OBNA 4BCUA 4XIDA 5KHJA 5FZ9A 3W9AA 3ASOH 4OZOA 3H3UA 1YQ2A 2CG4A 4O3MA 1V55H 4FTBA 1WCQA 3OS1A 1ZBA3 4HZFA 2RR12 3WNKA 4XDQA 3CL1A 1LULA 3DN7A 2R7TA 2EA7A 1GKBA 4AQ6A 1DHKB 1O4XA 5FP3A 3F72A 1N25A 1W04A 4AQSA 3IBMA 3JRDA 5JZGA 5E3MA 2CV2A 4AG4A 1O3RA 4SBVA 2FA5A 4ZXEA 4DBQA 4NNJA 4DNYA 3OB8A 2VO5A 1V70A 3ES1A 1LGNA 2QQMA 1RUE3 4NC8A 2ZA9A 3I97A 1RUNA 4NIDA 4JCKA 1ULFA 2QVSB 2MBFA 4XUOA 2P6TA 3H42B 1RUH3 3QPHA 3N7MA 2FCVA 1Z6TA 2JE8A 2ZNYA 4PCQA 1U0JA 1JYWA 1VBD2 4Q48A 4K3UA 2NVXJ 1AX0A 2QZ3A 1PNGA 3RWKX 4COWA 1OLTA 2EFOA 1IQAA 2LP0A 4P1WA 1RR8C 5IK5A 2VLAA 1K4TA 3LSTA 3H9QA 3HDDA 3C7FA 2JG8A 3N36A 1AL21 1PMJX 4AVPA 2O03A 5E88A 1D4M2 1RUD3 3ZXFA 2RS33 2JB4A 4Q0QA 2RS51 3B9CA 5EV7A 3MPPG 5M5YJ 2IS6A 4RHV3 4ZTFA 5FMOS 4QPIC 3ZFFC 4EN9B 1C4RA 1JU4A 1J09A 1FPN3 1ULOA 2PAEA 1KGYA 4KN7X 5A6QA 1J84A 2JRTA 1TLHB 4QX3A 3DP7A 4HN1A 4QX5A 4RGKA 2OXBA 4PK4A 1AA7A 4DUWA 1IN5A 4OU0A 5F0FA 4MXWA 5FZ6A 1K78B 1CESA 2JENA 5CU1A 3UV9A 1R4MB 1ASJ1 1QEXA 4C3JJ 3M1CA 1VQLI 1QU0A 1SD6A 1NX9A 5B4XA 1S0DA 3V7CA 4HPKA 2Z33A 5A3LA 5JXGA 1MZBA 3RMXA 1G3SA 1AUYA 1U5ZA 5AVAA 1TP4A 3PJQA 5IVCA 4GB32 2BP6A 5HLIA 2YU2A 3RKWA 3OGSA 1OPCA 4IHXA 4JK1X 4ZPIA 4JOMA 1R5HA 2TRTA 4BUPA 2X05A 4LMFA 4YFXF 2XBO3 2ZMKA 5CYYA 2LY1A 5LBEA 5FFXA 2BNMA 1WJCA 5FD6A 4YZ3A 4YW4A 4HRIA 2O8KA 4FPKA 1WI3A 4CEWA 3WG4A 2E1MB 2PMUA 3JU9A 2EIMH 4AWXB 3SCHA 3U1KA 4XLNF 1DP0A 1V5FA 4D94A 5A6YA 2MEV2 5APAA 5IPAA 1QVUA 2XPJA 1JXSA 1XMAA 3LSRA 3AKZA 3WF4A 2DURA 3KZYA 2BFUS 3MFAA 2X6WA 3UT0A 1QRYA 2VC0A 1AOYA 1YEWA 3S8PA 2RQQA 4L9BA 2WRAA 3REOA 6PAXA 1W28A 5FMBA 2P6SA 2PJPA 4QX0A 5C3QA 4Y4YA 4DOUA 5H6QA 5EG0A 3IRQA 1IGNA 4GA9A 2W1UA 2HU9A 4HMZA 5HS8A 5T5OA 3FHNA 3VBRB 3MN2A 5EXOA 2M0CA 1RUC2 1MW7A 4K9SA 1MSFC 4YIRX 3F2ZA 1OKOA 2DCKA 3VGIA 2C0ZA 3WG2A 2JIGA 1H8TC 5HLTA 4HVOA 3QP6A 1CAWA 4BL0B 2ELKA 1ZH5A 5FFOC 3DV8A 4DYCA 3J9SA 4Z1VA 1QJU1 5KHDA 5ICGA 4HLYA 3R05A 2XJPA 4M3EA 3T4HB 2FCTA 5FCCA 1UMHA 1GVDA 1GQHA 4OAYA 3ZN5A 3HQUA 2DN0A 1C1FA 5CKNA 1IN6A 3CCJI 1D5YA 3WW4A 4CE8A 1W3XA 1W1WE 4Q4V2 3O1PA 2K9QA 1O6UA 3J80K 3ALQA 4FAHA 1LE8A 4CDWC 1OISA 5HDNA 5EJ1B 3DFGA 3CZUA 3MEPA 5E6HA 4OHXA 5JAXA 2X6YA 4L18B 1JYCA 3DKWA 2PLV3 3CO6C 2ZBJA 3RNSA 4MFDA 4D8MA 4UFLA 3J81Z 2E7AA 3U1DA 5FFZA 2I10A 3VBOB 2GZWA 2VONA 3SHRA 1OH3A 3LGRA 1CR7A 2XRLA 2VBZA 3CP2A 2HDWA 5CZKA 3ILRA 1MS9A 2N7GA 4QPGA 3TN91 5L36A 3K46A 3G4SI 3THTA 3ULQB 1JMUB 5IK4A 3O1OA 4LBNA 3BG6A 4PF5A 4AHXA 2WY8Q 4M74A 2Y6KA 3MW4A 5IT6A 3ZMDA 5CISA 1RINA 3AKQA 1C5HA 3UGGA 1YJKA 2V4JC 5DDJ3 1AYN1 1OOPC 4A3XA 1WCUA 2Z4FA 5F9TA 1D8KA 4YFKF 4NIAA 5LK5A 1LHUA 1AR91 5A1FA 2BHYA 2A6TA 5L3DA 1ULYA 2H1KA 3O0WA 1EV7A 4BQXA 4B3NA 3PSIA 4UXAA 4YW3A 2WNUA 2FDHA 3I2DA 4BE0A 2Y9ZA 2FQPA 1RYYA 1GOHA 2WB1A 1FWZA 4FP2A 5FLVA 3OY8A 4YVSC 2C9AA 2WIIB 1YS7A 1ST8A 1EKEA 2ZGNA 4YPJA 3DKXA 3FMRA 1JI8A 2R3SA 4OYUA 2E1OA 2EZLA 4A3JJ 2ZJRF 3ZSKA 4LBOA 2FD5A 2F5FA 3DGTA 1ZG5A 1W9FA 4MH0E 4QWNA 2UWAA 2GXGA 4BBRJ 2B4KA 4NAOA 2IUWA 2JDHA 5F64A 4XQ4A 3AL0C 1C1LA 2ZXHA 1GNYA 1LFUP 4M0HA 4FPGA 4IHSA 2RMU2 1EA3A 3CCMI 4U0WA 2DXIA 2ZEWA 4P00B 3U21A 1S2KA 3F95A 2JE9A 2E60A 3ZQFA 1G8WA 2BBYA 2JDYA 1ZGJA 2F4MB 1VALA 2J22A 3CCVI 3C2UA 3FXJA 2VL4A 3HGGA 3OYBA 3OY9A 1DFQA 4ON0A 2ZSHB 5I0SA 4CEWB 3E7LA 2R5ZB 2L7FP 4PIYA 1RTVA 1GU3A 1O4YA 2V6CA 2DCJA 2HWF1 2WS92 3ZFGB 4AVTA 5HCAA 1D1AA 1HKTA 1MMGA 5KWRA 3WTVC 1VQNI 2OQGA 5LA1A 3VDDC 2VNRA 2XUMA 4AVAA 4COYA 1RIOH 2V79A 1KS5A 1T0FC 5D5XB 2HWD1 2H6CA 3SEEA 1TEIA 1NCRB 2P2KA 1SBDA 4ZDLA 1QQP3 2WKKA 2GP3A 1O3SA 4RA2A 2EAAA 4S2HA 1G7YA 3WGHA 1X8MA 5CFDA 1RMU3 3NV4A 5FKNA 4XNFA 2W1QA 2ELHA 3LEKA 2DA1A 4OHZA 1XBFA 4GJYA 4Q47A 1M1EB 4RBOA 1JTYA 1UAAA 3P9KA 1W9WA 1ZBE3 4LE4A 1LOFC 4XDPA 3RJRA 1LOAA 3C1DA 2WQZC 4BPZA 2BW8A 1G9CA 1R49A 2IVJA 4LK1F 1JGGA 3S3NA 2Q1ZB 4RM2A 3A22A 3Q3SA 3ZVXA 1ZBA1 4K2EA 1YOVB 1QY4A 2VQGA 2J1AA 3RCOA 4IDZA 2VXJA 1HLVA 3W21A 1LUJB 1BJQA 3BTAA 3GBWA 1AF9A 4OI1A 4NHXA 5CQGA 1FT9A 4K21A 1MJ9A 2K3FA 4WVZA 3ZKUA 1V3FA 1BEV2 1XNKA 2VNVA 1OR7A 3C3WA 1W9TA 4HNUA 2OPKA 1BLZA 3OOUA 3FLTA 4QLCU 4OMCA 5F8PA 1W8FA 4XF9A 4M9XA 3I3LA 1FIAA 1IUYA 3HL2A 1RUE1 2O0YA 3UK9A 2EZKA 4QX2A 3ERMA 3WGIA 1YX5A 4PIZA 5JPNB 4XN0A 4U88A 4BQOA 1PO22 4P55A 1ZZ8A 3DQVC 1K12A 5B66C 1ZG1A 3GZTB 1GUIA 2W91A 4DFSA 3GGLA 2PMHA 2WJSA 1T95A 4WZCA 4L0ZB 2EV6A 3WF0A 2XL7A 4HQEA 4IJAA 5FYMA 3D0JA 3BU0A 5C4XJ 4AEDC 1RUD1 4RQPA 2QA4I 1HF0A 3PDQA 1GR3A 5EQUA 3ETPA 2VKEA 1UZYA 4RHV1 5FYCA 1NT0A 5F5CA 3BCAA 2IXIA 1HDPA 5ILVA 4MEXF 3LIGA 4QPGB 3I0TA 2K02A 4OMDA 4E27A 1FPN1 2Q1FA 1OKRA 3ZFEA 3A01A 1BIAA 3PL0A 4QDQA 5K0UA 2GP5A 5KNLA 4XFBA 1NA1C 4JX5A 4I0AA 5FYBA 4J19A 4YRDA 3H8XA 2YFUA 3S5AA 3WW1A 1J75A 2Y34A 1BL0A 2UUZA 4NAMA 4OLLA 3UKGA 1R71A 3JBG2 2DBBA 4EWDA 4LLGF 1OA4A 4XAAA 5F3IA 4RLQA 4DQ2A 3OPWA 3L2UA 2DFHA 2B45X 2WNUB 2W5FA 2PMWB 3ZDSA 1LJ9A 5J98B 4HK8A 1PZ8A 2DODA 3GFMA 3KIOA 2P1BA 3JSPA 4HF2A 4HX8A 1YNAA 4L0YB 3IDEA 3HTUA 1ND3B 3FISA 1QNYA 1EJ9A 3LDRA 1AL22 4I30A 4GH4B 2M2EA 4B48A 1WW6A 2R0HA 2B5HA 2JA8J 1Y56A 4FX0A 2RS52 2W1OA 2D6OX 4V2GA 3LCPA 2KL4A 3OYHA 1POGA 3NSTA 4DNCA 3M7GA 4HVQA 4HSTA 2F4PA 3QH6A 3FX3A 2P34A 4E4HA 4BDZA 2GXAA 3M3QA 2J5PA 4YG0A 1SD7A 5CFCC 3CUQA 1VBB3 3O1UA 1SMYF 1NH3A 5JIUA 3CLOA 2FE3A 1S29A 3BWGA 3SH4A 3ZXGA 3VB2A 2VQUA 4JTNA 2K86A 3VD7A 3MKZA 1PO13 1L7QA 2Z5UA 2CYFA 3KHBA 3D6EA 1HRV3 1ZRFA 3PUAA 3S0MA 2A6HF 4RLFA 2STWA 3WUCA 4Y1UA 3ZQIA 4QHBA 5H9RA 2X29A 4EJTA 1YQ8A 4XJAA 2R063 3DXJF 3V8KA 5L3FA 2DUPA 3FXMA 1UO9A 4XJZA 4QXHA 2RGVA 1XNDA 4DO0A 4XN3A 3ZSMA 3VDCA 2XR4A 4NC7A 2VZPA 4M3CF 5FKBA 1P2FA 4ES9A 4XQWA 2X48A 3N9LA 4JHTA 3KF3A 1PGL1 1RGSA 1T08B 3ZSJA 5JLXA 3ES4A 4OZXA 5DAVA 1Y9GA 3CC2I 3VSKA 4QHZA 1NYWA 2ZS6B 3H3LA 5CFDB 3LFKA 3TOAA 3TWIA 3S30A 1QU3A 2BVLA 3ZPOA 4I09A 2RJ2A 1Z67A 5L9VA 2M9HA 1VRBA 4CU6A 3WP5A 5BPXA 1JBCA 2VCAA 4AVVA 1OA2A 2XAJA 4EQQA 1U5YA 3K1NA 1O5UA 4LHLA 1UIKA 4CUGA 3AYCA 5FY9A 1QHDA 2A1XA 2IS2A 2VCBA 2MLKA 1CAUA 3U4XA 2ZGKA 1EY2A 3SXWA 1XE7A 3EPZA 5GTIC 2LY2A 4B7KA 2PTMA 1OYWA 2BDRA 3KCXA 4JX0A 4AI3A 2G9FA 4LORA 5JOZA 2WWJA 2FNAA 1FI2A 2V5YA 1YQCA 2YV8A 2IRFG 4A7ZA 4XCBA 3J26N 1WD4A 4Y22A 2D40A 5AIPA 2JDMA 2OIIA 1MH4A 5LGTA 1PIV3 3ZMOA 3LE0A 2MLGA 2YMZA 2J42A 4IE7A 4M3BA 1B35C 2L4AA 1ZRCA 1SMVA 2ILMA 1CZSA 4LB6B 4YW5A 5HV4A 1QJU2 1T6BX 1LOBA 4CP9A 2LF8A 5A1AA 5FUPA 2E35A 2YC0A 5K9YA 5FYSA 3CMMA 2JDNA 1U5TC 3CIHA 1ZA7A 4MFEA 3MFCA 2EIDA 2HKOA 4FTSA 2L7MP 3ZMSA 5FBJA 2HPIA 1HJGA 2X5IC 1DLCA 4RQPB 3NEUA 4QDRA 5C44J 3LSPA 3T30A 3IP4B 1ITYA 4LO6B 2IPQX 1QXPA 4PUSA 3H50A 4FOYA 4CP0A 1GDTA 3ZFEB 2JA6J 4ASNA 3A01B 3HOXJ 2M30A 5A1LA 1DLLA 2W39A 5H9PA 4IV3A 2DQRA 4ISQA 2XUEA 2KLOA 2KISA 5CG9A 2ORZA 1ETOA 5A7NA 4I7HA 1O5LA 5J96B 3ZFFA 5JVTA 2ARXA 5FKKA 3JB8A 2P3YA 4RL7A 2BBVA 1WI9A 4IGQA 1Z21A 2Y6JA 1IQDC 3JRCA 1R7JA 1K5MC 3CJIA 3CJNA 4Z2WA 2JD9A 1D1CA 4CGZA 1AYN2 1XSRA 2UXXA 2EIBA 4QXCA 5BNNC 5FWEA 3BTJA 2AH2A 3BTYA 3OYCA 1AR92 4A3ZA 4LT5A 4G9SB 3MUZ1 2VTXJ 1MH3A 2DUOA 2QSGX 2WL1A 1RI7A 2WZR3 4X1EA 1LEDA 1X50A 4FOWA 4WXCA 3MKLA 3OSGA 4D5CA 4YIFA 4FQZA 4LOSA 2GWRA 4AZZA 3NJYA 1GP4A 4Q4Y2 5GLVA 4XIOA 1R1A3 3MVPA 5KHIA 1OQ1A 3GCMA 4ZTJA 3CUQB 3VBSC 1WLDA 1XSXA 2FRHA 1XTAA 3KP7A 1B8IB 1WZ2A 1PUFA 4AVSA 4WVMA 2CU5A 4DOZA 1OUXA 1TG7A 3K2AA 4LMYA 2HZTA 4WX9A 5IVFA 3OS2A 4E7LA 3WTWC 2CFOA 2K4JA 4N43C 2LRPA 3ZYRA 4Q4W1 3LOCA 5A80A 1TME3 4JKLA 4XJUA 5HCFA 1D3YA 4XIKA 4BKXA 3IN9A 1DZTA 1ZBE1 2Q8OA 4FTHA 4HT1T 1X58A 4GO1A 3AC0A 1QJY3 1V9U1 2A70A 3KP2A 4N53C 2XAGA 4EV0A 2CDPA 2WYSA 4PIXA 1ETQA 2KA3A 5J36A 5CJ9A 4FPHA 2LF7A 1POQA 2HQRA 3K2OA 3RPQA 2I07B 3H35A 1EUUA 2PHFA 3WV6A 4ITCA 1CF7B 5HODA 4CU9A 5E89A 3CDZB 2HWF2 2EIEA 1UU6A 4I2OA 2B46X 3L00A 3M8LA 1A8MA 3BC8A 4QTRA 2R93J 4WM8C 3DKYA 4QM9A 4GD4A 4Z6YA 4L0PA 3KX2A 2RVAA 5FJKA 3RQ0A 2BOLA 3AJZA 1Z9CA 1PMIA 4CDQA 4CTEA 2HWD2 5I0UA 4C8DA 4F3JA 1W9YA 2DYSH 1RUJ1 3JRIA 1GXPA 2K9NA 2WT1A 4CCOA 4NR1A 2VQ0A 4RAYA 2VM9A 4XJWA 2HWC3 4GYGA 1XQNA 4HDUA 5CKTA 1W8OA 3KQ4B 3IB3A 3SLIA 1BI2A 3HT1A 3ECHA 5F0HA 1R22A 1OF3A 3TW7A 2UU8A 1TQPA 3NQHA 1VQ8I 2OA4A 3HJEA 2IXHA 1FMD3 2Y8KA 3CJQB 2R7VA 5EEGA 1W2TA 1NK2P 5EHDA 4M3CB 5B5EC 4IEPA 1CPMA 2VQCA 1E5HA 1ZBA2 1B72B 2OPTA 4UB8C 1AR73 2LVSA 1YITI 1TT5B 2DWRA 5F08A 3IH3A 1SCRA 4CPBD 3CDHA 4IUGA 3I71A 1R091 4UV8A 5T5LA 1MMNA 4OCTA 4CDGA 5BXXA 2L0KA 4CICA 3PNTA 4QGMA 5JVGF 1KZHA 4LA3A 2E36A 4ANJA 3ZXSA 4CP9B 2LKSA 2D97A 2P5BA 1SD5A 1XS9A 2XJUA 2WFF1 3VWBA 1GV5A 1TWCJ 2D43A 2QQ8A 1RUE2 4YVWB 3RZHA 1W6MA 2K4BA 3TNQA 1RUH2 3PFIA 4RGAA 3BT9A 2BERA 4MADA 3PVBB 2HDDA 4C91A 3QPSA 3NMBA 4F52A 1FXZA 1EAH3 1K79A 3B94A 4KN4X 3IL2A 4PF1A 3TBIA 1IHMA 4EJUA 1OOPA 2HQAA 3JR9A 5L7OC 1FC3A 2XAUA 3H1WA 4IV3B 1RUD2 3OS0A 2RS32 1I5PA 1ZZ7A 5LHIA 2IAIA 2WZPP 4QPQA 3I2OA 4RHV2 4L11A 5EYRA 2P5KA 5F2WA 3LQQA 3GTGJ 2LROA 3PNAA 2DCYA 2BBAA 1FPN2 1ACCA 1YFHA 3C7EA 4IE4A 2IA1A 2QKLB 1HB2A 1YIFA 1E3PA 1PVEA 2QSFX 4FQ4A 3K4AA 3CJIB 3PU8A 5GTHC 3WDXA 1J5YA 1VBB1 5BYNA 1ULDA 2O61A 1BIBA 1H2MA 2EV5A 3BR2A 1Y8RB 4D6QA 3OSFA 2HXOA 1HBXG 2E9QA 1HRV1 2RDSA 1T33A 3VBUC 2YGLA 2Y2ZA 1EYBA 1DU6A 1SAUA 2YSRA 2QBYA 4CZSA 2R061 1J83A 2A6WA 2AO9A 1LPQA 1JTZX 1H4GA 1JKPC 1AU7A 1KQ0A 2R7QA 3WXPA 2ZGOA 2I5UA 1Q56A 1D1BA 2E7QA 3VD3A 3RSJA 4XLCA 2XQXA 1US3A 1UY3A 3BP8A 3GTKJ 1IXSB 2WZ8A 4H55A 4WVMB 3WQ1A 5JIAA 1ZRIA 1NTCA 2KMUA 1TQMA 2OC6A 2H0BA 2C4XA 1PHMA 1V6OA 2CWEA 2V9KA 4IQJA 1UMIA 2OD5A 1JT6A 1RETA 4L97A 2CFXA 1MEC1 1X33A 3VDXA 3Q9SA 4NPMA 2VMEA 2FBIA 5DTDA 1X4OA 1F35A 4I76A 1BC7C 3N9QA 4Q8KA 3RYPA 1S0BA 3BIWE 3WNOA 4XTMA 2W08A 1VLNA 4KFCA 5E8GA 4LBQB 2VPLA 1IW7F 4NJ4A 2PXJA 3MDPA 2YROA 1XGMA 1UFMA 1YLLA 1GP6A 1BZWA 2WQ4A 4LK0F 1R4NB 3RWNA 3GZ5A 3G71I 1A8DA 3WCSA 3KVAA 2O8XA 3O8GA 1LOEA 1FJLA 4RAGA 3M3EA 5BNPC 4AGVA 4YG2F 3DXUA 4CCJA 4RM3A 2ZNZA 3M8FA 4YYOA 2DA3A 1WW7A 2KIMA 4W6XA 3OYKA 3I2FA 5CA6A 4L9JA 4CDQB 2KHMA 3PNYA 4Y7NJ 1ZVFA 1PGL2 4DW6A 1TNTA 4ZXKA 3VBFA 4AK3A 3ZQHA 4PCRA 4C3IJ 2XB6C 2LH9A 3CLQA 4IGPA 1QZZA 4FCAA 3VKLA 1DQ0A 3CBNA 1LESA 1S4CA 1QMJA 1YRZA 3LSJA 4JDOA 4BGDA 1PIV1 4KU8A 1HDDC 2KT0A 2BXZA 2ETHA 3SDGA 2YU9J 2ARCA 2ID3A 1ON2A 3SYTA 5CIRA 2VVFA 2YX4A 5FLXZ 2W1SA 1T8IA 5IW0A 3IT8A 5A3NA 3DBHB 3T0YA 1KS4A 3HOVJ 3V64A 3POFA 2V73A 2VW2A 1JZ6A 1MS4A 2GOXB 2VY0A 3ZLIA 1Y1WJ 3GO5A 4M72A 4LEJA 1MDMB 2PFWA 4XETA 4DYRA 4M3GA 1STZA 3AYEA 2PJRA 3FFQA 2Q2EA 3DF8A 5FPLA 2PLV2 2V9PA 3ZQQA 1SFEA 3BG5A 4ETSA 2X8KA 5L3GA 4UF0B 1JZ3A 4CP1A 3HD8B 4AEDA 4FXGB 2XGCA 4YW6A 5JMCA 1FBSA 1YJ9I 2GQQA 1NUKA 3O8HA 2ZXQA 2O8QA 4NHYA 4B43A 2OYZA 4CUBA 3I5UA 4A44A 4KMFA 1RESA 1FAYA 2VXRA 4YWAA 1SLLA 1NCQA 2D6PA 5F7UA 5L19A 2HEOA 3KP6A 4CUAA 1NA1A 1YFWA 5FZFA 2V9VA 3ZKYA 4B3XA 4PGHA 3T1LA 4CCCA 4HXCA 1LODA 4LOCA 4M6YA 4A6DA 5IYYA 2JICA 1ZGWA 3GZUC 4CU8A 3SZGA 4NQWB 2YU1A 4W50A 3WE3A 1C0WA 2DDUA 1R1A1 3FMSA 3P9CA 3GM8A 1ZRRA 1NG6A 4PLOA 2KRHA 5DABA 3OYAA 3MYXA 2DMPA 3O7OA 1SBEA 3MQ0A 1JHJA 3IAPA 2D44A 4AUXA 1FNYA 5A3OA 3BIEA 4KIFA 5IYDJ 3D0SA 3Q8EA 1HV1A 1W7PD 1ENHA 5A7OA 3ACGA 1LDKB 3T4VA 3OSDA 4NPLA 2IEKA 4PFPA 3WG9A 2ACJA 1W05A 3CNAA 5A6XA 3BR0A 4L9NA 4RMNA 2QBYB 1TME1 1G3WA 3ZXLA 3VHPA 1J58A 4WVWA 2D3SA 1BOBA 2HOAA 3F0CA 5C3RA 1TWAJ 1MVEA 4B4QA 3H3VK 1G9FA 4ASLA 5JDBA 5ABJB 1G9BA 1UF2C 2HJIA 1QJY1 5ILUA 3BTXA 1OCZH 5FZLA 2LC2A 2K46A 3PMEA 4PFOA 4QHOA 1JUPA 3OBRA 4C90A 1TC3C 4B4RA 5TSWA 5FZEA 5FZIA 4PGGA 2JVHA 2E7XA 3UKVA 3S1MJ 3VPRA 1O7LA 2QJVA 2VUCA 3RYRA 1IO2A 3EO6A 3TL4X 1PVC3 4QQHA 3T8TA 1HRI3 1MVQA 1OCTC 2DOFA 4W97A 5DQ0A 1UOBA 2ZZQA 2XUBA 4XUNA 4N90A 3SEQA 1F4AA 3JQWA 4XKVA 2R7SA 4JGYA 3GMEA 1J1LA 3W2VA 3QACA 3OJBA 1VBE3 2Y69H 4EATA 2JQ7A 1JJ6C 4Y3OA 1QQP2 1JKOC 1GFF2 4IZZA 3OF1A 5K7FA 2ZX0A 4IEUA 4E9KA 5CPRB 4MHUA 1WW4A 4CA9A 1XSQA 4ZU5A 1RMU2 3MZHA 3HBLA 2XPUA 5FP7A 2P3IA 1I3HA 1SVOA 1X1BA 1KITA 1VBC3 1XU2A 2P8TA 3TDZC 4JBAA 1ZBE2 1OCOH 1SD4A 4AYBA 4JX4A 1XYNA 4EQVA 1UKGA 4HSJA 2GMMA 2R7WA 2AZ5A 2E33A 4PBOA 4XZUG 2HS5A 4AVBA 2V4AA 2F5VA 4YGEA 1FMD1 4G12A 2QZ2A 3S15J 1RUG3 1VRH3 3PLQA 3HKZA 3UETA 2E1MC 5C4WA 3VBFB 5FPXA 3TOJA 4QB2A 3SC7X 2VMFA 5GLWA 1Z3XA 4QX8A 1FYLA 1X2MA 5FXXA 3VZKA 1XC5A 3ZMZA 4NPRA 2C5DA 2ME0A 1QDCA 3BKZA 4MHGA 3F6OA 3S3OA 2X4HA 1LHWA 4BHPA 1BMV2 4TWTA 1BQPA 3BJ6A 3K2ZA 4XBQA 4BBSJ 1RUJ2 5ICFA 1ND2B 1JZ4A 1TE1B 4XJ8A 1SAXA 1OPOA 1R1TA 3WNPA 3V7SA 1H1AA 4RDUA 5DG2A 1HW1A 3L1PA 1XSDA 1OFSA 1IKPA 5J47A 4FFIA 2RREA 1HQWA 4CHUA 2CUJA 3QWLA 3B3QE 3CJTB 5GP9A 2PMZN 4UFMA 1YO5C 4I0WB 1B35A 4G7ZF 1ONAA 4PJLA 1M06G 4UUSA 2YB7A 1W06A 2GN3A 2JX9A 5FXVA 3DPLC 5H6RA 4JRAA 4OMYA 3E0JB 4Q1RA 1VPHA 4BHCA 3ZOBA 2KKOA 4BH9A 1EAH1 5FZBA 4RD7A 2DOEA 1U5TA 4LK7A 1W36C 5I0DA 4AU7A 3OYDA 3Q0UA 4JQTA 4K7JA 3ST7A 5FZ7A 5ERIA 4JYKA 2A7AA 1DQUA 5FZ0A 2TEPA 2R92J 5M3MJ 3LFMA 3FLRA 4CA0A 1O3QA 5K7HA 1MACA 3HUGA 2LW8A 1QJX1 2OBPA 3BTCA 2QSHX 2WYFA 3FBMA 5L73A 4HL0A 1NCQB 1A78A 3R4SA 2WFF2 1KQ8A 3CHXA 5C71A 1UD1A 4AWDA 2MFZA 3WGGA 4DS0A 5HV0A 2IA2A 3HOYJ 1KD7A 3C18A 5JXHA 5HBAA 1EV11 1OLRA 4EWAA 4IF4A 1ZR4A 1C8M3 3MLKA 3I2IA 4PHZA 1IS4A 5F1JA 2L9RA 1JYIA 5E1WA 4MGYE 2D1HA 1VJ2A 1W8ZA 2Y33A 1CJPA 3VD9A 2VE8A 5KHKA 3DPTA 3MICA 3VV1A 1GANA 5BNNA 3P7NA 4XYXA 4XURA 1PGW1 5EWSA 3KSCA 1I50J 4HKWA 1R5ID 1R1VA 3WEZA 5FYZA 2E71A 1I27A 2DMNA 2I8DA 3L2WA 1JOPA 3Q9OA 3DTEA 1G2HA 4Y20B 1Z0XA 3K1PA 4ITVA 1QZEA 1O91A 5BNOA 2LDUA 3PUBA 4RR3A 2Y0MA 4META 3JRBA 5FZHA 2H6BA 5JHUA 1VBB2 2GALA 1RVF1 4LHSA 3VBSA 3M8JA 3DPUA 4XILA 1NY71 3S93A 2JG8C 3AG1H 1WW5A 2WAQN 5IAVA 1UB9A 1T56A 1EH7A 3PM1A 5FBZA 3NJXA 4OUEA 1PO12 4AI8A 1REFA 2FUG2 4ZYAA 1HRV2 1OJLA 2VZ3A 3DCFA 4N43A 2IC1A 3I58A 3GTPJ 5TJJA 2HVRA 1RHI3 2R062 4A0XA 1X4PA 4G94A 1GSLA 2NVYJ 2OF7A 2MGQA 2COMA 2D2WA 2XJVA 2L9VA 1H6YA 4N7IA 4BU2A 4Q0SA 4B4PA 5JI9A 4E7JA 4EJVA 3W58A 2PBIA 4N53A 1O59A 1YCIA 1C3HA 4KUMA 3EJKA 4X6AJ 1TWHJ 3HBZA 2XL9A 1VNDA 4M01A 4LG3A 5A33A 2CL2A 3LIHA 1GNHA 9ANTA 4JGYB 3CJXA 3POGA 1NLSA 1Z05A 2X1DA 3B02A 3VODA 5ACA3 2L5QA 4LTAA 3KGLA 1JGSA 1VI0A 4HKLA 4WM8A 2EXKA 1X3UA 4XF3A 4WVVA 4XQFA 3R4DB 3ZQCA 1MEC2 2NS7A 4CYDA 4EYUA 2MA3A 4ES8A 4LBJA 5GAHJ 1U9NA 4HBNA 4V2VA 1N1TA 4K1ZA 1FSEA 4TXWA 2R5YB 4XOGA 3RQIA 3AZVA 3IDAA 3C8XA 1Q43A 3R0JA 5HNHA 3J7HA 5I8YA 2VE9A 4CEWC 5FPBA 2SBAA 4EMSA 5C4WB 2D98A 2WR9A 3SFIA 1WA4A 1FYMA 3APBA 5TISC 1W3VA 3ZFGC 2L2OA 2HZDA 4G6DA 5IVEA 3R0AA 3TP0A 4YZ5A 3K4KA 4XUPA 1N1VA 3NNLA 4EWEA 1XDUA 2HWE3 3GEZA 2WAFA 5DZGA 4KWKA 3PQJA 5H9QA 2A61A 2VL8A 3VSLA 1E3OC 1NCRC 2QDRA 4UI9L 4L8QA 5LBQA 3PHMA 1P8JA 4XABA 2VOXA 2QBXA 4YZ4A 1R083 3VHRA 4IEOA 4ENNA 3H1CA 3O1SA 4BOWA 5GKAC 3BZKA 1S7AA 3LB9A 2P7VB 4FAGA 3MKWB 5D5WB 2R043 5DV5A 1X36A 1RC6A 2PG4A 3LD8A 1ZGAA 2FDJA 1PIV2 5A3TA 1UIJA 3I4IA 2AUYA 2VBYA 1TMF1 4UUSB 4YW2A 3I4NJ 4PDWA 2FQ3A 3VKNA 4NN0A 1P4WA 5IWFA 3HPHA 3MF6A 2PN6A 4A7KA 4IV1B 3B7MA 2LYCA 3TAYA 5CLSA 4AL9A 1PK6A 4G6TB 5JR3A 1SG3A 2X10A 1JH5A 1MMDA 4ZDPA 3GFIA 1KFXL 3GHMA 2AXTC 4XJ9A 4E8DA 1SFNA 1I5ZA 1S8NA 2STTA 1DGRA 1W8UA 3HUGB 3IHUA 5E3NA 1J3RA 1WWYA 1D0ZA 1OYIA 4RFRB 3RGBA 3TO9A 2ES3A 3HAGA 5FUNA 3ZXEA 4AC0A 3NVCA 3VZNA 2XPWA 1V6MA 4KYWA 3KQRA 5ED4A 2D6MA 1CWPA 2VULA 2Y26A 2WINB 1WUVA 1MQTA 3RS6A 3Q9VA 2XOMA 3HWJA 2BHZA 2MD5A 4EGYA 4NO4A 4UYBA 2XONA 4GDFA 1D0YA 4W6YA 2CWMA 1CX1A 3BPXA 5DAQA 2B63J 2VMIA 1VBD1 1N3PA 1NLQA 1FOWA 4G3YC 4AFMA 4IW3A 3F8CA 4IHTA 2IW5A 4LKEA 1WGXA 2VKVA 3SQNA 2V1NA 2Q8EA 4QB1A 5DUWA 4O65A 3V0AA 1DQ4A 5FZOB 4U87A 2DVBA 3C2BA 3HC7A 4V19K 2DFBA 2NMNA 2ADUA 2WDBA 1S9HA 3HEFA 3AK0A 2WZR2 3R61A 3KP3A 2OCCH 1W2OA 3K10A 4A12A 2JT1A 1CN1A 4QPGC 5L3CA 2OZ6A 2Y0SN 3FIWA 2HWB3 5JLVA 2JPBA 2ARAA 2IFWA 5C9AB 1Q8OA 5A32A 3DTIA 1R1A2 2XIGA 1PVC1 5BNOB 2ZO4A 2A5WA 1AR81 4RR3B 1FYKA 3D5RC 2WZEA 3EDPA 2B9UA 4IEZA 4PZJA 4S05A 4AYUA 1YQ6A 2NZ9A 3MI8A 3JCIA 2CGPA 4XUQA 4HNVA 3SH3A 3AYAA 1BBT1 3JRFA 4B3AA 4G9YA 4R9BA 5GZGA 3WTUC 2FX0A 4LBKA 4YW7A 4AEMA 2WNUC 3WF2A 4MHRA 5FMDA 1TME2 1Y9QA 3KHCA 2Z1DA 4UHTA 4GB31 4Z8BA 1AKHB 2AHQA 1ND3C 4FASD 4HDVA 3KB5A 1KEXA 4GULA 3JSOA 5F5QA 1QJY2 </