1O3QA

Protein-dna recognition and dna deformation revealed in crystal structures of cap-dna complexes
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Indirect Readout of DNA Sequence at the Primary-kink Site in the CAP-DNA Complex: DNA Binding Specificity Based on Energetics of DNA Kinking
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
molecule keywords 5'-D(*AP*AP*AP*AP*AP*TP*GP*TP*GP*AP*T)-3'
total genus 62
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2003-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1o3qA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1o3qA01
4HZFA 4L2NA 4ENNA 4MUVA 3U1DA 2KIMA 1HW1A 4FT8A 1JHHA 5HS9A 3CUQB 2STTA 1ZZ6A 4BHPA 4YG2F 1YW9A 4IVNA 4MTDA 5KBFA 3HT2A 1EV7A 2B5HA 2P7CB 3C7JA 1U78A 2WC2A 3NKTA 4M71A 1J1LA 4E70A 4PGGA 2YX7A 2TDXA 3FM3A 4I02A 1LQ1A 4XF0A 2ZFWA 3M7GA 4MGRA 3E6DA 2VC1A 4CDGA 1YTYA 3K1MA 4HQEA 3UKVA 3BROA 5DCMB 1FOKA 4BQAA 5CYVA 3TGNA 4YFNF 4MEXF 2EVXA 2XL9A 4WXHA 2VOPA 1MJAA 3EYIA 4MGYE 5E18F 1O3QA 3ROUA 3NQOA 3I64A 1USSA 3VHRA 3NVCA 3ZP5A 2BNOA 1L0OC 4EJWA 4HOBA 4BAYA 5LGUA 2O1QA 4O3MA 2GWRA 5ILVA 3KGLA 4AXOA 4BNCA 2RGVA 4G9YA 4EGZA 4L18B 1XDUA 1R58A 1RNLA 4FAHA 3F8BA 2IXLA 4MQ9F 4IEYA 1HW5A 5HI0A 4XFBA 1X3UA 1BI0A 2EA2A 4UV8A 1S7OA 1SFXA 4P9UA 4HAMA 4ESBA 3NW4A 3HTSB 1QQIA 2FOKA 3F8MA 3ULQB 1P92A 5LBQA 2L3DA 2RDPA 5HS7A 2ETHA 2VBWA 2KKOA 2PFBA 3SCGA 1SEFA 3H7YA 4M73A 4ZYDA 1YQAA 4FX4A 1ZAOA 5ED4A 2W85A 3RI4A 4CXFA 1B59A 3MZHA 4ZU4A 3KGZA 5HLIA 3LZZA 4IESA 3EJKA 2CAVA 2MH2A 4Q48A 1ZG1A 1H1MA 2KIUA 1V3FA 3DPLC 5CLSA 1EH8A 5CVJA 2FRHA 1FP2A 2FEZA 4R52A 3R4KA 1OPCA 1J9IA 3RKYA 3OV8A 2NNNA 3CLOA 2CV6A 4HF1A 1DPRA 1J59A 4LA2A 2HEOA 3GWZA 5ICEA 1LEBA 1KU9A 3SHFA 1KQ8A 1SAXA 3QP5A 2DAOA 4LG0A 3NJZA 3KFWX 2XUBA 3U11A 4P55A 2HS5A 4QXKA 2E7WA 2PBIA 1CAVB 1CX4A 2ADUA 4Z07A 5A2QK 3D5LA 5BPDA 3REOA 1LR5A 3JTHA 1LB2A 3H8UA 4QLCU 2A6EF 3O14A 4OLLA 2YX4A 4Q0PA 2E1NA 2XV4S 3ELNA 3TO6A 2GH2A 2V9VA 4XFIA 5IT9Z 4KT5C 3G7DA 2Z99A 4ZZDA 1R00A 4IERA 4OOIA 5E20A 2KRFA 1IN7A 2M30A 4HBLA 5L3CA 4WXCA 1WGPA 3EHKA 3WTZA 3I54A 2NNYA 3NEUA 3DEUA 3GVAA 4HV6A 4H0EA 3JZVA 5D1IA 3H50A 1CF7B 4ONUA 5J6XA 1IUYA 5AIQA 4O6JA 4ON0A 2QCSB 2OPKA 4I2OA 4G6QA 1YIOA 4I01A 4U0YA 5FQ0A 5AVPA 2BEOA 4RS8A 1I5ZA 4KU8A 1ZZ7A 4HX7A 4AD9A 5H20A 5ERIA 1OYWA 4L9TA 2VPVA 3IHUA 5FFXA 4HSJA 2VBXA 1YYVA 3J80K 2QDRA 1Z1DA 2A07F 1NXMA 2P17A 5FPXA 2HJIA 1P4AA 3D0JA 1XSDA 2VODA 4RB0A 1TW3A 1T39A 4IRIA 1QZZA 2G9WA 4A5MA 1E2XA 4FX0A 1QXJA 2IPQX 2PAMA 4EWDA 5CADA 2IJLA 5JAXA 1R22A 2FBIA 2GZWA 1XN7A 3V4GA 1OKRA 1ZNPA 1YHFA 3C1DA 4M9ZA 2WV0A 3WG9A 4LB5A 3H3ZA 1RIOH 4XBFA 5E1XA 1IAWA 5KHIA 4AIHA 4ZZLA 5E8IA 2GU9A 5FPZA 4ETSA 2GIVA 4P5OA 4XEZA 3LAPA 1KA8A 2O0YA 1BN5A 4QGNA 1SFUA 3LWFA 5J48A 5FFZA 2DCTA 2XAHA 2QLZA 1BI2A 4HV5A 1YFXA 1T0FA 1JXSA 2HTJA 4YIFA 2EFQA 1FSHA 2ZNYA 1F4KA 2PI0A 1SQ4A 1R7JA 1RUNA 4I0AA 4G8XA 2FNAA 3JAMZ 5KHJA 4MGIE 3LAJA 1ZZBA 1IXSB 4Q29A 4Q0QA 2HWVA 3CTAA 2Q0OA 2F5EA 4JTOA 2K0GA 2A6HF 5KHHA 4YSFA 2EWNA 4X6RB 1R36A 1PDNC 4MHGA 5JFRA 1FBQA 3FJSA 2FNPA 1O5LA 2K4JA 4Q5SF 2XL7A 2XROA 4LGWA 4E2SA 3HIFA 3FZ3A 4KUMA 4ESJA 1G4DA 4N9IA 2EFOA 2HR3A 1Y0UA 2BYVE 1GQGA 2CAUA 5JI6A 2CQKA 1ZN2A 3WGIA 2GQQA 2WWYA 3FE5A 4ENJA 4N0BA 3PQJA 3R0JA 1OYIA 5E1WA 5I0UA 1I6XA 3IC7A 3IDBB 3FXRA 4GULA 4A0XA 2A68F 5BY5A 5DEQA 4LTAA 2IT0A 5AIPA 3T1BA 3B02A 5J8CA 1BJAA 1S6LA 1SMYF 1R5HA 3KEQA 3ES1A 2G7UA 2GC3A 3GZ5A 3G73A 5F6FA 3MWMA 2HGCA 1XE7A 2PYTA 3U10A 1NE4A 4HN1A 1O3SA 4I98B 1PMIA 3V8KA 3E97A 3GZ6A 4X6QB 3GXOA 1ZRRA 4GYIA 3WTYC 5FLXK 3I7DA 1QXRA 1P2FA 4Y13A 4EGYA 2B8MA 5FLXZ 2FBHA 1CAXB 2QBYA 4G6DA 3HHHA 4K8FA 3F8FA 3N97A 1SFEA 4XFFA 2VT2A 3RYPA 4O5VA 3FHIB 4LB6B 1NHAA 3LQQA 2ELHA 4IETA 3L2HA 1A04A 4CHUA 2PQ8A 3KETA 2OAZA 5I0TA 1YW7A 4NHJA 4BIFA 3BU7A 1IN6A 4PDKA 1DZTA 1ON1A 1RZ4A 3MCZA 1G3TA 3ZMVA 4HF0A 4RAZA 1YWKA 4A5NA 3WW1A 3BPVA 2QM3A 4EWAA 1GVJA 3T0YA 4L5IA 3V8JA 3DKWA 4P9FA 2QQBA 5I8YA 2LF8A 3DF8A 3H1YA 4QMAA 3Q9SA 4ENMA 2QWWA 2ET7A 2EA4A 5J7MA 1OR7A 2GA2A 3RPUA 3H1MA 2DU9A 2IA0A 4B8XA 2EV6A 2Q8KA 1YUDA 4Y15A 4B09A 4ZYEA 3QAHA 4BXUA 4B29A 4KN4X 1FZPB 2H27A 4JK1X 4WF2A 3ACLA 3P9KA 4PIYA 1J7KA 4EMSA 3LAGA 2MH9A 4I3PA 2HKXA 4MGZE 1ON2A 3KE2A 2DPUA 4L9NA 2P8TA 3KZYA 3G3ZA 5LGTA 5JR3A 1UHMA 2ISYA 4U7DA 1R1VA 4S04A 2ZKLA 3F8CA 4KMUX 1DGWA 1Z7UA 1EH6A 1K79A 1WKMA 5FLJA 3F22A 2JT1A 4MZUA 4ZH4F 3OD0A 4MTEA 1XB4A 1GXQA 1GQHA 3M8EA 3F23A 4MH0E 2IC1A 1X7NA 3BPZA 3U0ZA 2XAFA 1IXRC 3LA3A 2IP2A 2P6TA 3JSOA 2F2EA 3UKNA 2JZYA 3WW3A 4UBHA 5FCCA 2PJPA 5JSRA 3KP7A 4QGLA 4S05A 2EJRA 4M9SA 5HLGA 4IF4A 4KL1A 5ICGA 5E17F 5JSPA 1MJ9A 3MYXA 5HDNA 1O3RA 4CO8A 5BPXA 3I58A 1PM7A 3QPHA 3DFGA 3MDPA 2JSCA 5E1ZB 5BMZA 1L3LA 4XETA 1QZYA 3DP7A 2DQRA 1LJ9A 3BP8A 1WRJA 3ZMTA 2VE8A 2XHKA 2L54A 2VOOA 1KU7A 1P4XA 3MEXA 1U6GA 5DDGA 3CEWA 2O61A 4IHSA 3I0TA 5ICCA 5LHIA 3FFQA 4A6DA 4AVPA 1YFUA 3I5UA 4AVBA 2ZBKA 2FBKA 5DCMA 4EM2A 3IWZA 4HX4A 4Z82A 2QNKA 4AIJA 2CFXA 1ZGJA 1IF1A 2J5OA 1X8EA 2IXHA 1WQ2A 4Q47A 1XGSA 1YFYA 1HKQA 1WA4A 1LKNA 1FT9A 1FC3A 1U5TC 1BI1A 3GEZA 3LSTA 1D3YA 1Q3EA 2K27A 4CICA 3GYDA 3M8FA 4MNUA 4QWQA 1P4WA 2V79A 5HLHA 2L01A 4AWXB 2ZMEA 2BV6A 3U2RA 2XVCA 3FXQA 4MV2A 2Q30A 3COAC 4IEZA 1B9MA 1MJBA 3SQNA 2D2WA 4XF9A 2CWEA 1H1IA 2V1UA 2LSOA 5F1RA 3K9TA 4RB2C 2F5CA 2STWA 4EJVA 4LLGF 1LDDA 4RGSA 4F8AA 1CAWB 1UPIA 1DDNA 1LNWA 1Z91A 4XSZF 2H6BA 3J81K 4IJAA 2PQQA 3S7IA 4K2EA 3QACA 2GA1A 2HFHA 4P9GA 4WX9A 3CL1A 5KK1A 3RJPA 3VEPA 3T5XA 5C6CA 2IXCA 1O3TA 3WW2A 3MPBA 2MPFA 4FAGA 2W57A 1U2WA 2RQPA 4L9JA 3MAJA 1ZGAA 2GC2A 1ZLJA 2PG4A 4EJUA 3HRSA 3F21A 2FMYA 1FI2A 4NQWA 5FLHA 3EQLF 3H1WA 3ZQ7A 1OI6A 1IN8A 3ZDSA 2VE9A 3QRFF 1BC8C 2XKPA 1IXCA 3KP5A 2H0VA 2M5WA 1KQ0A 3I53A 1K78B 2O8QA 3FHZA 3KMHA 4HA8A 2RV8A 5FGMA 4XFCA 4O9EA 1SD7A 4ZU5A 3FX3A 1JGSA 1KU3A 4L5JA 1B4AA 1ZYRF 4U0WA 3L7WA 2VONA 1XCVA 3TNQA 4RB1A 2KXLA 3S0MA 4RAYA 4LULA 5EZWA 1TBXA 1HSTA 1T38A 4A0ZA 4PIZA 1VP6A 3RNSA 1J0RA 5F64A 4MGKE 1USTA 1YFHA 3M9AA 2CSOA 2QVSB 3OF1A 3TDZC 1UB9A 3WTXC 3EYYA 2OZJA 3IRQA 3SZPA 1RL3A 2Z33A 2UY9A 4R79A 6PAXA 1CAUA 1DGRA 1R1TA 1XMAA 2F5DA 3J81Z 5LEKA 1ZHFA 4QX5A 4XF1A 5CVRA 4I7HA 5BV6A 1L3JA 3QOPA 4A0YA 1KQ9A 3DV8A 4M6YA 4BYYA 2P5LC 3EUHA 3GO5A 3WGGA 2Y75A 5IT3A 1FPQA 3EETA 3KEOA 1Y3TA 3HT1A 1MDMA 2MD5A 3ZMSA 3R0AA 1FSEA 4IHTA 2MBFA 1ZRCA 2K4BA 4BH9A 2XIGA 3B73A 2WTEA 1EH7A 1KYWA 4UNOA 3LWCA 4FHTA 4MEYF 3BCWA 2CO5A 1I1GA 4OIPF 5I0RA 1GHCA 1W5TA 4RGUA 1U3EM 3ECOA 1TQIA 4Q0UA 4Q0VA 2HQRA 2HQNA 3KP2A 2IXJA 3F3XA 3V7SA 1U5TB 5LEJA 3BZ6A 2XRNA 2Z2SB 5LHGA 2Q2EA 1QO0D 2OQGA 1J3RA 1YO5C 1C0WA 2D5HA 2FSWA 2VECA 1FNNA 3EQEA 2NRAC 2FQ3A 1HSJA 4PZJA 2EFPA 4M9XA 1MD0A 3VODA 5CJ9A 2P5VA 4J1XA 1ZG3A 3JSPA 2RKHA 2JPBA 5LLQA 3FZVA 2D40A 2O03A 3WW4A 4HW0A 3GFMA 1Q5OA 4HF2A 2FU4A 1BIBA 4KWKA 2IW5A 2MHFA 4HBNA 4PIXA 3V7CA 2CG4A 4HVOA 1YFWA 3ST7A 4YRDA 1PP7U 1ZRDA 3EBRA 2AXLA 2NS0A 3C18A 2BNNA 4TLFA 2DQLA 1G3SA 4XFAA 4PCQA 2HYGD 3NRVA 1EPZA 4EWEA 1ZH5A 5K8SA 1ZZ9A 3L9FA 5L3DA 1Z6RA 1FBSA 3PQKA 3TO7A 4WK8F 2FF4A 5HVQC 2FMLA 2ESNA 2K9ZA 5DUIA 1WWXA 2QUFA 1ZREA 1UW8A 1MDMB 5DD8A 1IW7F 1TTYA 4UVBA 4KU7A 3IKVA 2ZJ2A 2DPDA 2PMUA 4GYGA 4XLNF 3LA7A 2A61A 2LNBA 3QPTA 1LRHA 1K6OA 3QP6A 5I91A 2QYOA 5DD4A 5BUVA 4GCVA 3K0LA 4KWJA 2V1XA 1EYBA 4YNIA 2VQAA 4TV7A 2D45A 5D6FA 1H0MA 5IT9K 2B9UA 2ET1A 1ZLKA 3HOSA 3RYRA 3GUDA 4EM1A 4L9VA 4Q0SA 1PUEE 4CYDA 2EAAA 2PAKA 1TW2A 2FXAA 4ORFA 4E2GA 3I59A 4U7BA 3M1EA 3WTUC 3TKYA 2Z69A 5EEHA 4IPAA 2H09A 5L3BA 4IRGA 1ZX5A 2F5FA 1O57A 3Q9VA 2JRTA 1SD6A 3ABUA 2GAUA 3HHGA 3ECHA 2DTRA 3HOTA 4U0VA 2EK5A 1XGOA 3HRTA 4JQFA 1W4MA 3DQVC 5K5RA 2RC4A 4HDUA 5J3UA 3W6KB 3CUQC 3PFIA 4LMYA 2OD5A 3CDHA 1HBXG 4KFCA 3PNAA 4OU0A 2DBBA 2HOEA 4QGMA 1TNSA 1OD5A 1IRFA 3ERED 2QZ8A 1NZCA 2XAJA 5AONA 4LLOA 1PP8F 1X82A 5HOOA 1J5YA 2QENA 4EV0A 1XD7A 1QNTA 3BDDA 2R7FA 4H7LA 3KLNA 1HXDA 3P9CA 4ENKA 4D0PA 3WTTC 4JTNA 2IA1A 3BPXA 3RIRA 2P5KA 2Z5UA 4G94A 3GFIA 2ETEA 2EFWA 2H94A 4EJOA 5E16A 3RZZA 2PA7A 4UHTA 2PN6A 2N7GA 1WLTA 2RN7A 2MC3A 1RUOA 2EV5A 2Q4SA 3S7EA 3GBFA 2DW4A 4YFXF 5L3GA 2DK5A 3M3IA 2Y0OA 2NYXA 1TQPA 2KJCA 3FF5A 2KJBA 1K7AA 3CLPA 3R60A 3HRMA 2EFNA 1ZVFA 3E6CC 2F4PA 2ACJA 5I8SA 4KNYA 4ESFA 4QM8A 1F1ZA 1H9TA 1ULYA 4ZYGA 1AWCA 3CJXA 3BOQA 1UHWA 2Z3YA 4Z2YA 4LJZF 4OIOF 2ZO4A 4EQQA 4O9GA 2GC0A 5HDGA 3HYIA 2Q1ZB 1D8JA 2DK8A 2HKOA 3OTFA 1KYZA 3LQRA 2A3SA 2UY8A 3GF2A 2PTMA 3SHRA 1R23A 5FDBA 1MGTA 3BJAA 4XF4A 1DPUA 3ISPA 3OOPA 1BIAA 5K1YA 2VXZA 3WU1B 3E6MA 2BNMA 4L11A 2QQ9A 4L0YB 2E1CA 4YIIA 2UYBA 3R6SA 4PGHA 1QY4A 1UCRA 2M8EA 3CO7C 3NSTA 2RNJA 3EO6A 3BB6A 3LFKA 1U8RA 5D8LB 3GYHX 1T2KA 3FM5A 2UXXA 1YG2A 4YYOA 4LUMA 2QQAA 3F6VA 1ZZCA 5D5VB 5BOXA 4ZYHA 1O7LA 4UV9A 2MNGA 2QVOA 2CGPA 2GC1A 3S2WA 4KICA 5I93A 5EEGA 5JSOA 3K1NA 2D1VA 3RPQA 2R3SA 2W84A 4BHBA 5CU1A 2X4HA 2Z9OA 5KHGA 4KIFA 4IEQA 2QBYB 3ES4A 1BBYA 4A12A 4CGZA 2XLGA 4HVQA 1LDJA 4JV4A 1TQMA 2PHLA 4LK1F 2ZKZA 4KWLA 2Y0MA 3PLQA 1XMKA 3HRUA 1BM9A 3UKTA 1UFMA 5CVVA 3ZMUA 3TQNA 4F7ZA 3BY6A 3P9IA 5BPIA 2VN2A 4LD5A 5HDKA 2E7XA 3TOAA 3I71A 1DUXC 3GFJA 2UWMA 3SXYA 3JTGA 2I45A 4IEUA 1XDSA 1UIJA 4MQVA 1I1SA 1CGPA 1BI3A 1W7PA 2ZXJA 2Y48A 4OFGA 1FYLA 4AVAA 2C6YA 4IEPA 4HQMA 2PMHA 4YARA 3CF6E 3HQXA 3JW4A 1Z6TA 4ZU7A 1HQCA 2NAZA 3ABTA 2K02A 1XSXA 1RTVA 5D6EA 1CAWA 5ILUA 1BOAA 1MZBA 2DI3A 3IDCB 5ICFA 1QGPA 1W5SA 3SXWA 1B1BA 1W7PB 1I27A 1RGSA 1CF7A 2Q0AA 3VFZA 1V70A 4J1WA 1OYYA 4LLLA 3KZZA 4XFHA 5JR7B 1FXZA 2OA4A 3C3VA 3TNPB 1O4TA 3DL3A 1V4RA 1J2XA 3BALA 2W25A 2YPRA 1YS7A 4IEOA 1FBUA 1XRUA 2M1BA 3LA2A 3I59B 3QU3A 1HW2A 2CYYA 2PLYA 5BXXA 1QPMA 1YLFA 4N9HA 5HS8A 1D5VA 4MX3A 3KSCA 4OIQF 5D5UB 3J7AO 5ILSA 4UXAA 4IEWA 4U88A 3R61A 3OGJA 4JBAA 3ELKA 5H6QA 3IRRA 2MLGA 4P96A 2HTSA 5BQTA 3Q5FA 2X0LA 4HLXA 5TRDA 3V7RA 3H3UA 3IIAA 3H9AA 5E1RA 2ZNZA 1R1UA 1UD1A 4G7HF 3CJNA 4XRFA 4HX8A 2KIFA 5JCTA 3SMHA 1F9NA 3IBMA 1QBJA 1ZZ8A 2K7LA 2D93A 3GW2A 2B0LA 1R5GA 2O3FA 1T98A 4LK0F 5D4SA 4M72A 2OQRA 2OZUA 2PHDA 1CAVA 3CO6C 2YR2A 5T3NA 2FA5A 3F6OA 1DP7P 5FLIA 2L4AA 3WGHA 4NVPA 3FMRA 1BC7C 3HTUA 2L4MA 3E6BA 3SFZA 4GO1A 4M6XA 3DPTA 1VR3A 2VC0A 3E5XA 4A2UA 2M87A 1NE6A 3MZYA 3O2PE 1X8MA 4WBBA 4IXAA 3RKWA 3IKTA 1XGNA 1FWZA 2BGCA 4DINB 3K2ZA 2EA7A 2BE5F 2D1HA 3CUOA 3PVBB 1IZ1A 3IL2A 2XGXA 3WU0A 2HDCA 2XLAA 2VBZA 3I4PA 5FB2A 3HUGA 1WSUA 4QM9A 5H6RA 4DQ2A 2ZCWA 2PAEA 4UXNA 3D0SA 1JE8A 4IEVA 3TO9A 1IPJA 4WXDA 3KP3A 3F72A 3BJ6A 2V6CA 3AAFA 2MLKA 1ODDA 5FD6A 2ESHA 3RYKA 4HMZA 1WI9A 5DYMA 4YFKF 2G7HA 4PJYA 1U12A 5D8KB 2COMA 4D7SA 1T6SA 5I8TA 1FLIA 2QJVA 2OBPA 2PEXA 3H92A 5L3EA 4E2QA 4R8HA 4RGRA 1KU2A 1S7AA 5I0SA 3U9GA 5KHKA 4EJTA 2K86A 2XASA 3P7NA 2EB7A 4KIBA 1KGSA 5JHUA 2P7VB 1TLHB 1H9GA 3W6JB 5TJJA 3OCPA 2H6CA 4OMYA 2IA2A 5K5OA 4JVAA 4R1HA 1ONVA 3CO2A 5LHHA 4RD7A 5K5QA 3ETQA 2FQPA 1U5TA 5DCFA 1ZARA 3ZN0A 2ATFA 4LFUA 3ZN1A 4EROA 2GXGA 4UUVA 2P6SA 2WFPA 4WWCA 2IRFG 2DLLA 1J3PA 2UXNA 1LEAA 1O7FA 3MFKA 1S29A 3DXJF 4Y17A 2V09A 4AIKA 4META 1QWRA 2IXIA 4LUKA 5LRRA 1TNTA 2DT5A 1HKSA 5A2QZ 1J58A 4G7OF 1FP1D 5FD5A 1S3JA 4HVRA 3GLXA 4A6EA 4Q4ZF 4IRHA 3T8TA 4HYEA 4ASNA 2C0ZA 1P6RA 1O5UA 4HLYA 4XSXF 1Z05A 1SMTA 3E5QA 1J75A 1SD4A 2GXBA 5BS6A 2J5PA 5D4RA 4IEXA 3TOBA 1CAUB 4RB3C 3KCCA 3QU6A 3RDIA 3T8RA 1Q1HA 2M45A 2YSRA 1VTNC 4NB5A 3O6BB 2XKOA 4XLPF 1REPC 2VT3A 2V1DA 5KVRA 3WE2A 3F8NA 3H7JA 3FXUA 4UVAA 4OINF 5FQ0B 3L09A 1JHFA 1YS6A 1S8NA 1B6AA 2W24A 3KLOA 4KN7X 1VJ2A 3DN7A 5CVUA 4FBFA 4L0ZB 3FMQA 4CZZA 1LVAA 1Z9CA 1FY7A 4BHCA 3D82A 2PFWA 2AS5F 1E17A 2VBYA 4RGXA 2BBYA 3WTVC 4HN0A 3WE3A 3RTRA 3KP6A 3MQ0A 3ML6A 4G7ZF 2P4WA 1OFNA 4D7TA 1FX7A 4AQ2A 2OYZA 3USSA 3IWFA 4WVZA 4XFGA 2IXKA 1ZG5A 3M70A 2OZ6A 3J80Z 1AOYA 4KA4A 1EY2A 5D5XB 1UCXA 3NL1A 3HSRA 1STZA 4DNCA 3BJOA 3E5UA 1G3YA 3O3KA 1Y9QA 4KDPA 4AVCA 5C8WA 3GFLA 2UZKA 1ZRFA 1G6NA 2EV0A 3WTWC 2IVMA 1IN4A 4AQ6A 5L3FA 2FE3A 4UVCA 3ZMDA 3SCFA 1IPKA 4HDVA 1SD5A 4LG0B 2XLFA 1YW8A 1G3WA 2D5FA 2A69F 1RC6A 3GX4X 3TDUC 2UYAA 2LKPA 2O6GE 1XGMA 1NYWA 1DZRA 4GXOA 3K69A 4GGGA 1MKMA 2ISZA 3SCHA 4OIRF 5DV5A 4HLTA 1W7PD 2ZMEB 4KYWA 1CAXA 2DFIA 4KIGA 4XF3A 2L02A 1UIKA 2A5YB 1HKTA 4WCGA 4M74A 2CW0F 5JVTA 1D8KA 5J8FA 4HSLA 2HYFA 4EVIA 5LGNA 1EP0A 2O8XA 4LLNA 1OMIA 3K1PA 2RVCA 1LDKB 4KMFA 1SFNA 3E3VA 2MA3A 4OMZA 5E8GA 3VOEA 1IRGA 4I0BA 4LEJA 2OA2A 4EM0B 1FYKA 2XAQA 1FYMA 4WZCA 1GXPA 3FWEA 1JUHA 3ZPLA 3WTSC 2OU2A 2XAGA 1RI7A 1XCBA 2LF7A 5FO5A 3LOIA 3RKXA 2DO7A 5DUKA 1XSVA 1XE8A 1YLLA 3HSEA 3WODF 1F5TA 1IN5A 3SZTA 2E9QA 3L2CA 3VB2A 1J3QA 1TQ5A 1Q43A 4I09A 3CUQA 5CVIA 5LRSA 3HSFA 4UBGA 2R7DA 3L00A 1K78A 2LDUA 2JTVA 3N4MA 3C3WA 2HZTA 4LA3A 2JPCA 1B9NA 2YU3A 3FMSA 3V8LA 5EFUA 3JAMK 5D5WB 3ZMZA 3KP4A 3EDPA 3BWGA
chains in the Genus database with same CATH superfamily
4HZFA 5D8AC 4HETA 4MGTA 4HANA 1HW1A 2HXIA 5DTDA 1VBB1 5HS9A 3CC4I 1UZ0A 4GWNA 1GV2A 2X5IC 2VBBA 4IVNA 5KBFA 2CY6A 1NLSA 3HT2A 3N7KA 2B5HA 2P7CB 2HDDA 4YW3A 1U78A 1QHHD 2WC2A 2R7TA 4YIRX 1J1LA 2WNVB 3RJRA 4PGGA 1UN1A 2YX7A 3ASOH 2TDXA 3ZR6A 3FM3A 4IE7A 4XF0A 2E35A 3T4HB 1GP6A 3E6DA 5DZGA 3ZN6B 4CDGA 1IJWC 3K1MA 2R7EB 3BROA 5CQGA 3HOZJ 4XOGA 1FOKA 5CYVA 2PX9A 5F27A 1C8M1 3TGNA 1HDDC 2XHNA 3I2FA 2EVXA 4DOZA 3INAA 1MJAA 4MGYE 5DDJ3 2DMQA 3I64A 2VZQA 2EIJH 4WM7B 1X58A 3ZP5A 2BNOA 1L0OC 1GMMA 4EJWA 1RRJA 3S1QJ 2L9RA 2VNVA 1VRBA 4RGKA 3AL0C 2FUG2 5C9AB 4BNCA 4E4ZA 3POIA 5EJ1B 3I55I 4NE9A 5C3EJ 4CEYA 5J09A 3VBSB 2X1CA 2LYCA 1SPPB 1RNLA 1POQA 4N53A 5A32B 4IEJA 1SFXA 3DLLF 4ESBA 4BXXJ 3HTSB 2FOKA 2R0HA 1P92A 5LBQA 3VBHA 2L3DA 2VQ0A 4DY5A 4BK5A 3SCGA 4O7XA 4ZYDA 3IAPA 3IAM2 5ED4A 5B3SH 1IGOA 1S0CA 4ZU4A 1B8IA 5CFCB 1YX3A 3HZJA 5CB7A 3FXJA 4IESA 4GH4C 1W3XA 2MH2A 1ZG1A 2Y0SA 2PMZN 1H1MA 3K3NA 2W94A 2ZMNA 2FEZA 4Z8BA 1ASJ1 5AVAA 4OAZA 2W46A 4Q1RA 2NNNA 1CD3G 1DPRA 3LOBA 5ICEA 1VBC1 3Q8CA 3QP5A 4LG0A 3NJZA 3KFWX 4E7ZA 4QXKA 1SDWA 2ZX4A 2PBIA 5A3PA 1WW5A 4Z07A 4RLQA 3GCMA 1YJ9I 5B4XA 1DBNA 3REOA 3MGUA 1AR91 1JKRC 3K77A 2E1NA 4YVSA 3M3EA 1WZ2A 2NLRA 2V9VA 5KNLA 4XFIA 4D6SA 1HXS2 2OT7A 3KCXA 5E3OA 4IERA 2KRFA 2Y8KA 2O5RA 3GNEA 3RZJA 4W4ZA 2WNVA 1V6KA 2HEWF 3AYCA 3A0KA 3AB0A 4CP9A 4WM7A 1IS4A 3I54A 2BZDA 2BHYA 2NNYA 4I99C 3OGRA 3DEUA 3GVAA 4C3HJ 3H50A 3N3HA 1ZQ3P 2O7OA 5AIQA 1AX1A 3AKSA 1YIOA 1XNDA 3GXUA 1XBFA 5FQ0A 3JQXA 2BEOA 4IQ4A 1LOAA 5LATA 3NAPA 1ZZ7A 2KISA 4L9TA 2VPVA 5FFXA 5GAEJ 2VBXA 2RAEA 3J8F1 3DGTA 5LK7B 2QDRA 5FP8A 2A07F 1NXMA 3GDBA 3VBFC 4ANJA 2F6CA 3G6EI 4J6GA 2VODA 3HAGA 4IRIA 4C91A 4ARXA 4ES8A 1NCQB 2IPQX 1HLCA 3D6EA 5EYXA 2E1MC 3C1DA 3WF0A 4LB5A 4GB33 4JDNA 4BE2A 4XBFA 1VE0A 4QXBA 5E1XA 1IAWA 4XCAA 2RE9A 1FV3A 1JU3A 4XL9A 5E8IA 2GU9A 1WCKA 2GIVA 2V5DA 3LAPA 4QGNA 2QZ2A 1AXZA 2O0OA 1JT0A 3P3NA 2A6ZA 3BTJA 1BI2A 2VZRA 2VPRA 1HIXA 2ZZQA 1CJPA 1NZIA 4P9XA 1QH6A 4PFOA 1HRV3 1YFXA 3SH3A 4CDWB 2ZGMA 4JHZA 4YIFA 5F9TA 2EFQA 1FSHA 3ZXLA 1F4KA 4BB3A 4CU8A 2R7XA 1KQRA 1O59A 4XE9A 2L5QA 5CYYA 3AP5A 1TT0A 4C2MJ 5D21A 1GSLA 1AA7A 1YI7A 2ES3A 2JDMA 3NV3A 4CPBD 2JKBA 2Q0OA 4JTOA 2CUFA 1J1TA 1QDCA 4XC9A 4YSFA 1UZYA 2RG4A 1UYYA 1R36A 3IPVA 1FBQA 2X53S 1V5FA 3ILFA 2K9NA 2K4JA 1OCTC 3WOGA 1L7LA 2KZGA 3LSDA 3FXKA 4UAPA 4C2UA 4W65A 1RC9A 3UGFA 1VQ5I 1ZN2A 1LNSA 2WWYA 1SFOJ 2DWRA 5IUQA 2GNDA 2JUCA 2JIJA 4IGOA 3SKJE 1XS9A 1GFF2 2YS9A 5BY5A 3MW4A 1Y56A 2JUGA 4IE0A 1BJAA 1PK6A 3AKQA 1FPN3 2GM4A 1HLVA 2WZR2 1H8VA 2VMHA 1OD3A 3MIEA 2PYTA 3U10A 3ASIA 3VBRA 5GM0A 4GYIA 3PL0A 3WTYC 2YFUA 4XUPA 5ANNA 3I7DA 4C0HA 5FLXZ 3CJTB 2I2SA 3BG9A 3WDVA 2VT2A 1U0AA 1NHAA 1VQ7I 2QKMB 4IETA 2ICWG 2PQ8A 4JGZC 2OAZA 5GZGA 2RJKA 3ZDVA 5LWBA 1JOPA 4NHJA 5F32A 3POSA 3JR9A 1IKPA 1RZ4A 5FZ6A 3MCZA 3ZMVA 3FDYA 5CFCC 3WW1A 3JRDA 1AKHA 4L5IA 3DKWA 1O91A 2QQBA 2I74A 1IDYA 3MFCA 2WBMA 3DF8A 2R061 2ET7A 2DA2A 4MHRA 4UB8C 4FPFA 2DU9A 2IA0A 2EV6A 3FIWA 2Q8KA 4ZYEA 1X19A 5FPUA 2QCOA 4KN4X 3T0BA 1FZPB 3ACLA 1Z3YA 4QDRA 4CEWA 2WKKA 3C8XA 1RUF1 1I3AA 3A4UA 3RI9A 5JR2A 4IZZA 1UHMA 1LKXA 3AXDA 5FTTC 1R1VA 4TWTA 3F8CA 1UU5A 1Y6IA 1DGWA 4EZ4A 1Z7UA 1WKMA 5FBJA 1AYN1 3OD0A 2LY9A 1GXQA 3N05A 3EMRA 3FUQA 3BG3A 2JD4A 1Z77A 2YG0A 3E1F1 1ULFA 1D5YA 1IXRC 3LA3A 1MVQA 3OWTA 3B9IA 1DIWA 2F2EA 5GADJ 2JZYA 3BR6A 2PJPA 2WS91 5JSRA 3ZYFA 2WYSA 4RHV2 1C57A 4M9SA 5ICGA 1MJ9A 2PXJA 2R30A 4CO8A 3I58A 1PM7A 3DFGA 3MDPA 2X85A 4FASD 1L3LA 3H5NA 1EKEA 2LUWA 3AK0A 4XOTA 2QUOA 1R4NB 1WRJA 3ZMTA 4FXKB 4QPYA 1R6RA 1HF0A 4S2DA 5JMCA 1GICA 3OY8A 5BNOA 4BS9A 2EIEA 1EUTA 5DDGA 3CEWA 2IFRA 3D4KA 3DPRA 3H8OA 2O61A 4IHSA 4B3XA 1S55A 3FFQA 4AVPA 4QX8A 3MF9A 4G12A 5FY4A 5T55A 4LHSA 3IWZA 3AYEA 3A01B 4AIJA 2WWUA 2CFXA 3LFUA 2IXHA 4XUOA 2BGOA 4NUBA 1R5ID 2DDUA 4YZ5A 4OWRB 1FC3A 5M5YJ 1V9U3 1BI1A 5JHFA 4IXLA 2K27A 2ZSIB 2WR9A 4XLCA 1I5PA 3WT3A 1RHI3 4JX6A 4S2GA 2B7EA 3AP6A 5LB6A 1NAEA 3GJBA 5L73A 3WUDA 1ZELA 2ZXWH 3VD5A 5A7NA 4IEZA 3LEMA 2X51A 3SQNA 1RUE2 2ENRA 2X1EA 1S2EA 4XF9A 2CWEA 4IOAF 2LSOA 5F2SA 4H7MA 2JA2A 3ZOIA 4EJVA 1G9DA 2ELJA 1LDDA 2VPLA 3GHNA 1UPIA 2ORZA 1Z91A 2H6BA 1C5IA 2HNHA 4V1PA 1B8IB 3KD4A 3QACA 3NAUA 2HFHA 2WO3A 2ZJPF 1YYNA 2BY1A 4WX9A 1XU2A 3VEPA 4S2FA 5J47A 3T5XA 2OXBA 5C4WA 2WZEA 4CCMA 1UKGA 2MEV2 2LBFA 1QOOA 1TWHJ 4N43A 2W57A 2GXAA 3MAJA 2GP3A 2XWBB 2ZEXA 1ZLJA 4EJUA 4IV1C 3HRSA 4FP2A 1OOPB 2E7QA 3RZMA 3H1WA 3VDDC 4AYBA 1OI6A 5K7ZA 2VJIA 3MHZA 4YGBA 2IAIA 1IS3A 1S0GA 3MN2A 1HJGA 1K78B 5ANQA 3KMHA 1B35C 4XKVA 1U8BA 2FJ1A 1RHI2 1DU0A 1OLTA 4IHYA 5CKQA 5FREA 1GVDA 1B4AA 2YROA 5C4XJ 1BYHA 3AKPA 1U0JA 2Y6JA 2GP5A 1SLAA 4RB1A 3W21A 4P1WA 5EZWA 3QD6A 5B1AH 1RUC3 3GZAA 3PMSA 4NHYA 3WZ1A 1UXXX 1T38A 4AEMA 3HOXJ 2BVVA 4RFT0 1XNCA 4FOVA 4OHYA 4IW3A 3RNSA 1WD3A 2VZ3A 4OMDA 5FRMA 2OQ6A 2QQLA 5FZIA 1APNA 2QVSB 3TW6A 1UB9A 4M3CE 3PMEA 2WINB 1DF0A 2HOSA 3WF4A 5LBBA 1QJU3 3LEIA 4UF0B 5HBAA 2UY9A 1VFCA 3VDDA 1ASJ3 5EZGA 1SFPA 1R1TA 1XMAA 4XMIA 5EJ3A 1VBC2 3WNMA 3I56I 4QX3A 1L3JA 1DYOA 2FZ2A 2P5LC 2XBO3 1MS9A 2KQRA 2ME0A 3ZMSA 1AR82 5FPVA 4IHTA 4CYCB 1ZRCA 3PVEA 1YRNA 2Q2EB 1KGYA 1EH7A 1KYWA 3S30A 1PVXA 4EN8B 2XVKA 5BNPC 4FPOB 3LWCA 3AP4A 4XJUA 4OIPF 1X36A 1VMFA 1WLCA 3UT0A 2GNMA 1U3EM 3ECOA 1QF3A 3AL0B 3P6BA 4FCYA 4Q0VA 4YG6A 4M3BA 3F3XA 1U5TB 1LTEA 2VL8A 2W48A 2BW3A 2Z2SB 2QSHX 5LHGA 1RXGA 5ACA2 1QO0D 1ULCA 2OQGA 1UOFA 4HKLA 3JRHA 5FKKA 3EQEA 2CW7A 2EFPA 1MD0A 3VODA 5FMCA 2KDZA 3VBRB 3PIPF 1QHDA 4OQ8A 1VI0A 2CS3A 3N35A 2MHFA 4PIXA 3ACFA 1WUVA 3IMNA 2YV8A 1N1YA 4II2A 4XDQA 1ZRDA 2BNNA 3QOEA 4N4NB 2JG9A 4N8MA 2BUKA 4TLFA 4H2AA 4MLOA 4AIDA 1HA8A 4QXHA 1RUE3 1MNMC 4QKBA 4MADA 4XMAA 1ZZ9A 3L9FA 5C3PA 2WB1N 4XILA 3PQKA 3TO7A 3I2KA 3BUCA 5FZ7A 2VO5A 4P00B 1JH5A 5AC91 4XJAA 2ESNA 4A3ZA 2DTWA 4AFDA 2R49A 2QUFA 1ULEA 3U21A 5FIXA 1MDMB 5DD8A 4GD4A 4KU7A 4EATA 4XLNF 2VXRA 3LA7A 1SCRA 3IB3A 2W1QA 3QPTA 1LRHA 5I91A 2VNOA 3BTYA 1RMU1 4E7KA 5DD4A 3R4DB 5BUVA 5M0TA 4GCVA 1UWWA 1AX0A 1MH3A 1OVPA 3HL2A 4FPYA 1EYBA 3AG1H 5D6FA 2ET1A 4Y24A 1ZLKA 3B01A 4Q0SA 4L9VA 1UY0A 3MLKA 2EAAA 4MG2A 5LA9A 4ASLA 4E2GA 5DABA 2E34A 1MEC1 1I9RA 4U7BA 2WY8Q 5A3UA 3H42B 3JBG1 5JWPA 1KD7A 1ZBA2 1C4RA 3LSHA 3E1SA 3JUUA 1ZX5A 1A6QA 3DXUA 1SD6A 1AR71 4GMP3 3HHGA 3ZQHA 3ECHA 1W0NA 2ZOEB 1HDKA 3O12A 4YVWC 1OJLA 1JI8A 4A41A 1NA1C 2LALA 3W6KB 4IKFA 1GP5A 3AMPA 3OOUA 3L2VA 2HOEA 2C24A 2CWMA 4A3CJ 3VKNA 2XAJA 2V1NA 4DB5A 1PP8F 2NOJB 5HOOA 2G19A 2QENA 4IUGA 4XLEA 4H7LA 2R7FA 1HXDA 3FUOA 2VU9A 4ENKA 2VVEA 3WTTC 3X2QH 3S14J 4W8JA 4QSHA 2IA1A 3BPXA 4XRSA 3GFIA 1I3HA 4LNVA 4OMCA 2GSYA 3PJQA 2PN6A 3ZLIA 4RMNA 4A3MJ 2RN7A 4AEKA 5FPBA 1XYPA 4Y1YA 2VD7A 1QGLA 2B39A 2DW4A 2NS7A 4BQ1A 1PO22 3O1PA 4A3DJ 3VZOA 3M3IA 5GZDA 1H30A 1TQPA 2KJCA 2RV9A 5A6XA 1K7AA 3HRMA 3CDLA 4PLMA 1MSEC 4S0HB 1WMDA 4QM8A 3EB7A 1UY4A 2J1AA 1KRIA 1AWCA 1RUJ1 2EIDA 2X9DA 4A7ZA 1TP4A 4Q4X1 1JUSA 3POGA 4RR3C 2ZEYA 5FKLA 3VN4A 2Q1ZB 4DY3A 5FMBA 5DMYA 2FHRA 4DGWB 2DK8A 1BBT3 3OTFA 3T1MA 3GF2A 2PTMA 2WN3A 2QEXI 3AC0A 1CONA 4XORA 1QQP2 3ZQFA 5FP3A 5IK5A 4P02B 3OOPA 3DYOA 3WU1B 2XB6C 1OISA 4L11A 1AR63 4M01A 5F7UA 4L0YB 2KT0A 1DCSA 4UFLA 2NOGA 1U5XA 4PGHA 1UCRA 1QJZA 2JN6A 3VBOC 2NQYA 3BB6A 3LFKA 3M07A 5GLZA 2MD0A 3MPPG 5D8LB 1HV1A 1T2KA 1XC5A 3G2BA 3ZGKA 4F3QA 1IQAA 4CDUA 4YYOA 4LUMA 5LA0A 2XF7A 4AI0A 1TWAJ 2MNGA 2CGPA 2GC1A 2Q8DA 3OSGA 2OUMA 5EEGA 5JSOA 2XPUA 3PIJA 1F9KA 4GH4A 4RHV1 2R3SA 2AEYA 3B3QE 2C6SA 3BN6A 4IEQA 3ES4A 3CQZJ 3I8TA 2XLGA 4HVQA 4PLOA 4UUSA 3T2TA 4NHKA 1PZ9A 2ZKZA 2XQRA 1REEA 1XMKA 5IP9J 5FR3A 1UFMA 4BJ6C 1SC7A 3TQNA 1S2BA 4O61A 3V64A 4NPLA 4C8DA 2LKSA 3C7FA 3NWSA 3T0DA 2L2OA 3QYFA 1KFUL 1AL22 4XBLA 3X29B 1F31A 1ETXA 3MICA 3JTGA 1JTYA 4IEUA 1EPWA 2QA4I 4XCBA 4OHXA 5JVGF 2XONA 3FXLA 2Y48A 4OFGA 1SDDB 1HB2A 4OZOA 5FWEA 5L19A 3A03A 4IGPA 4YARA 2FDFA 3JW4A 2XPVA 2VB6A 1D0HA 2ZGKA 1HQCA 4LHKA 3ZYBA 2K02A 1W6MA 4YVWA 5EV7A 5D6EA 1O4YA 1CAWA 5ILUA 1X1CA 3F9KA 1OCCH 3VBUC 4LKFA 3AZZA 3LGRA 3SXWA 1B1BA 5HNHA 3M3YJ 1RGSA 1YO8A 1CF7A 3VFZA 4J1WA 3M3OA 3HNMA 2W5FA 2A75A 3CDIA 2FQ4A 1UJ8A 2OA4A 2F6BA 3TNPB 1O4TA 4Q26A 3QQAA 1TL8A 5HLTA 1J2XA 3BALA 2W25A 3OEBA 5A7WA 3WVJA 1HN0A 2VJJA 3LA2A 3QU3A 2QQUA 1A35A 2E5NA 5FK8A 1YLFA 4AC0A 1DU3D 3HNYM 3KSCA 5ILSA 3K4AA 4CCDA 3R61A 4AYUA 2HWB3 2DMUA 2ZC2A 1MPXA 2J7MA 3ELKA 3JD72 1K42A 2EF6A 5C71A 3BQZA 1SLTA 1QIQA 1QRYA 5JZGC 2HTSA 3TN92 4XKBA 2E5ZA 2W3JA 3ZFFA 4FPJA 4HLXA 1K4SA 2CSGA 1GOHA 3IIAA 2DUQA 5E1RA 2ZNZA 5A3MA 2F4MB 1UD1A 4EYUA 4G7HF 5HCAA 4HX8A 4HNTA 1TNRA 1POV3 1MMGA 1F9NA 3IBMA 4QD2A 3SMHA 5ABJB 2HYJA 2D93A 2IS6A 2O3FA 4BQOA 1LECA 2OQ7A 4UW6A 1SBEA 1UU6A 3SKVA 3M7AA 2EIKH 2FA5A 4FCAA 2DCZA 1R082 3D5OA 4QX7A 3T09A 3HTUA 3E6BA 1V6NA 4JRAA 4A45A 5IP6A 3DTEA 2VTFA 4BISA 1QNYA 1N25A 4P08A 4BOWA 1X8MA 3AFKA 2OPTA 4XJZA 5C44J 1XGNA 1OCOH 2VOTA 3LFIA 2EA7A 3HBLA 4N53C 2VGDA 2XLAA 3RZKA 2VBZA 2M8GX 3WV6A 2BY2A 2ZCWA 2ZX1A 4IEVA 3ABKH 1IPJA 4WXDA 2MFZA 3KP3A 5FZ1A 1ODDA 5FD6A 4DXZA 3RYKA 3CESA 4YZ4A 3DCQA 3W2VA 4PJYA 1WJCA 1U12A 2EXIA 1OPOA 2ELKA 1IC8A 2VW0A 2OBPA 2PEXA 4R8HA 3MW3A 4RGRA 1U9OA 1KU2A 1EAH1 5KHKA 4HK9A 3KYDB 1JOBA 3FBMA 2K86A 3LCPA 4HL0A 1X50A 1VQ8I 4KIBA 2P7VB 1TLHB 2WWSA 4GALA 1JKQC 3NWTA 3CNAA 3OCPA 4R1HA 1Q56A 4Z6YA 4RD7A 5K5QA 3VSLA 1H2MA 2FQPA 1FIAA 2LY2A 3WSOA 3I97A 2ERFA 5JI7A 5DCFA 1IG3A 5BNQA 2LTPA 4PK4A 4LPLA 1SBFA 3RCOA 4EROA 5ACA1 2R7UA 4OI0A 2R7QA 2QQPA 3CJIC 3POYA 1C8M3 2P37A 4WVMA 4CA0A 1LEAA 2R92J 3AG4H 3RI8A 3LEKA 5IK4A 5KHDA 5DPNA 1REDA 3H0GJ 2E6VA 2IXIA 4LUKA 2DV9A 2DT5A 5F39A 2AO9A 5C8CB 2ZTNA 1J58A 5FD5A 5IHRA 4HVRA 3GLXA 4Q4ZF 4D7MA 1O5UA 1Z05A 3E5QA 1YIFA 1UX7A 4IQJA 3CQOA 1VB4A 2VW2A 3OYGA 1SD4A 4HSRA 2J5PA 4IEXA 1Z21A 2IBDA 2CV1A 3KCYA 2Q1MA 2M45A 3O6BB 1NK3P 2GN3A 5KVRA 2YBKA 5IVFA 1POV1 3TEYA 2V6EA 3H7JA 2YHJA 4CCNA 3SITA 3TEXA 3Q9OA 2JB4A 1S8NA 4DEQA 3KPHA 2B9SA 4LKSA 2JX9A 3WP5A 3WG1A 1ODNA 3FMQA 2AREA 3V0AA 1PX3A 5JXHA 1LVAA 3HC7A 4F55A 2PLV1 3RZHA 3D82A 2PMWB 1E17A 5J4YA 5DZEA 1V54H 3WTVC 3EYPA 3U1XA 4DFSA 3ML6A 1K4TA 2QQOA 1FIPA 1I6HJ 3WG2A 4Y22A 3OOXA 1IG7A 4GJZA 1GZTA 2A05A 1NX9A 2WADA 3M70A 4GMP1 4BQ5A 3ME2A 1EY2A 1UCXA 3HSRA 1ZYBA 2Y6KA 4DNCA 3BJOA 1LCLA 2YY1A 3O3KA 4KDPA 4AVCA 1PZ8A 4XRMA 4JYKA 1G6NA 4D6RA 2DODA 2DURA 1H8TC 4BBSJ 5L3FA 1GLNA 3MIDA 4UVCA 3S1MJ 1IRXA 2BU9A 1SD5A 4PJJA 4LG0B 3WLUA 1SFKA 3AYAA 1HB4A 1YW8A 1G3WA 2AYHA 2D5FA 1RC6A 2UYAA 2O6GE 4FFGA 4KWUA 5KXBA 2DVBA 3K69A 1MKMA 1DYPA 4OUSA 1S0BA 3ZFGA 3LF7A 1W03A 4KYWA 4HG2A 4Q5OA 2V4JC 3K4MA 4M0HA 4RA0A 4HSLA 2HYFA 3LFMA 5LGNA 1EP0A 3WEZA 2BY3A 4M3CF 2VNGA 2H1LA 1T6BX 3VD3A 1K6YA 2W82A 4KMFA 2UURA 3WQ0A 2DFFA 2MA3A 4DO0A 3CCLI 5FKMA 1DQ2A 1ZBA1 4NRMA 4I0BA 1XYOA 4LEJA 2OA2A 4EM0B 1FYKA 2XAQA 4QXCA 2P4EA 3V0AB 2X10A 4L8QA 2Q5TA 1JUHA 1MS4A 2VQCA 2XAGA 2XH6A 5FO5A 4LIUA 3HOWJ 1MEC3 1F5TA 1MW7A 1IN5A 4FETA 1LHOA 3SZTA 5EQUA 3VB2A 2RDRA 3PTRB 3L2UA 4K20A 5AFBA 1BEV2 3CUQA 1R1A2 3GZTB 3FL7A 4A7KA 5E3NA 2C1FA 2ZGSA 5EJZB 2JPCA 2YU3A 1FOWA 5GAHJ 3CC7I 3B6CA 2V73A 3ZMZA 2VCBA 1VBA1 4CCEA 5C8CA 1PO11 2OUJA 4ENNA 4K1YA 1WZXA 3L1PA 5SV8A 2ZGRA 1JHHA 3LKJA 4L5EA 2ZMKA 4BHPA 3RGBA 1PO21 4YG2F 4R9AA 4MTDA 2ECCA 1E5HA 2W00A 2R071 4E7LA 3ZQIA 4M71A 1N77A 5GJ6A 3DU6A 3KV4A 1B72B 5A7OA 2R043 4CEWB 1OQDA 4I02A 1CR7A 2HQ5A 2ZS6B 2WA3A 4M4PA 4K40A 3K70C 4NR1A 3UKVA 5DCMB 4FPGA 4YFNF 1IV6A 3FBNB 2K5CA 2AEZA 2VOPA 4PDWC 4YWAA 3DBHB 5FZLA 1YRNB 1LFPA 2A6TA 3Q8FA 3ZQLA 1O3QA 2D6LX 2HWC2 2ZJQF 1QQP1 4BMBA 5KAFC 3NVCA 1QJY3 2XGDA 1L7RA 1UNBA 3JCIA 5A6YA 4QU2A 2TBVA 3AFGA 1JJ6C 1YI2I 4HKOA 1OFSA 5ILVA 1QHGA 4G9SB 2E51A 2WAFA 4LBMA 4AXOA 5CFDC 3S3NA 5JUVA 3LDBA 1E3HA 4G9YA 4PF5A 1JYIA 4JGYB 2WDBA 3AVSA 2H8WA 1HW5A 3NRUA 1X3UA 4EN0A 1SEUA 4UV8A 4CVUA 4ZTJA 1MZFA 1MS0A 4LORA 5T5LA 2MYSA 3G71I 2M7BA 3NJXA 3WD5A 2MW8A 3F8MA 3ULQB 3RSJA 2HWD2 4BMEA 2RR11 2VUAA 2G9ZA 4RYDA 3ZSMA 2LBFB 1BL0A 2ETHA 3FLPA 4XXAA 4H55A 4GB32 4FX4A 1SLBA 2QFEA 2Q8OA 3M3CA 4NHXA 2Q8EA 3V56A 3EJKA 2XUEA 1JJ8C 2FDIA 3L2QA 2CAVA 2PQSA 3SLIA 5F0FA 5CLSA 1EH8A 5CVJA 5FOJB 1FP2A 4R52A 4BJTA 1OPCA 4GWJA 2CV6A 3UESA 1PGSA 4E8DA 4IO9F 4HF1A 2BWAA 4JP0A 1J59A 1YCIA 3I2DA 2HEOA 1KQ8A 1LEBA 2XUBA 3UV9A 4B4CA 3U11A 2HS5A 2E7WA 3D5LA 3JTHA 2W92A 1EUUA 1CN1A 2GALA 2A6EF 3O14A 4Q0PA 3ASNH 2J1UA 2GH2A 2DVDA 4QQPA 4IQPA 2Z99A 4ZZDA 1R00A 3I3DA 5JZGB 5DAPA 3LE0A 5L3CA 4XVHA 1V55H 4WXCA 1Y8QB 3VBFB 3S2DJ 2VASA 1W6OA 1W8WA 1XU1A 1WGPA 3PO2J 3WTZA 3NEUA 1HOMA 1XXNA 5FYBA 4H0EA 3JZVA 3GLLA 2OTLI 1CF7B 5J6XA 1IUYA 1NK2P 3QLQA 4BACA 4O6JA 3J7LA 1Y1WJ 2QCSB 4XK4A 3HM5A 4G6QA 2OX0A 4LQRA 2ADEA 2E1MB 3MVPA 5IAXA 3ZXEA 4HX7A 3VLBB 1RITA 1MBHA 5H20A 5ERIA 4GDFA 2YPJA 1PMHX 1JZ4A 4HSJA 5BNOC 1Z1DA 4SBVA 1O8SA 5C4WB 1P7IA 2HJIA 1OFCX 2EZIA 3I4NJ 4IDZA 1Q1VA 1R9TJ 2JG9C 5FZ9A 2G9WA 4A5MA 1E2XA 1N1TA 4FX0A 1OPMA 2ZACA 5LBCA 1PHMA 5CADA 4MXWB 5JAXA 4JGYA 3WCRA 1ZNPA 1XN7A 3PVNA 5DZFA 1UYPA 1FV2A 4ZZLA 4P5OA 1BK1A 2QDNA 1YC61 2DUPA 2O0YA 4QQLA 2DCTA 2JA8J 2XAHA 1KS5A 1ETOA 1UF2C 3FKIJ 1GWMA 5GP9A 1MS3A 1JXSA 3A23A 3M1HA 2VJ5A 1WJBA 4KG0A 1NCRC 5FUNA 5M5WJ 1R7JA 3KYLA 1X2NA 3T2QA 3JAMZ 3S8PA 5KHJA 3UJOA 4MGIE 4QB2A 3O1OA 3LAJA 3ILRA 1IXSB 1W8FA 4AVTA 4Q29A 4Q0QA 3BR0A 1W8ZA 5ABJC 1MQTA 1UPSA 2F5EA 2HWF1 1UY1A 2A6HF 1Y7BA 5KHHA 3VZKA 3KHBA 3VYRB 4QTRA 5JFRA 1ZK8A 5BNNA 3Q0WA 1CZTA 3N9LA 1S7EA 1COV3 3OYWA 4Q5SF 3NNLA 3RJ2X 3ZFEB 3ITQA 3K4DA 4LGWA 3FZ3A 3OG2A 3S57A 4XYXA 2EFOA 2WNUA 4BIOA 5JI6A 3KHCA 3OYKA 3FE5A 4ENJA 4N0BA 3AL5A 3R0JA 4YW6A 1GBGA 5FMOS 1SG3A 3N9OA 5CEHA 3FHAA 4P9YA 1W9FA 3CCUI 2R7WA 3FXRA 1ETYA 2CU7A 4LTAA 2IT0A 5AIPA 3WG3A 3T1BA 2DFHA 4PJLA 4R9BA 3T0AA 3U4XA 1S6LA 3KVBA 1SMYF 2XBO2 3KEQA 1OA2A 1ZA4A 4Q4W3 4HT1T 1ODMA 4N7UA 4LKDA 3TEWA 2GC3A 2NN8A 1D4M1 3FISA 3GZ5A 1YJWI 3G73A 5DM7F 2WYFA 1RINA 1NE4A 3ZOBA 5HNFA 1PMIA 3V8KA 4OVEA 3GXOA 5FZEA 4BLJA 1VZ0A 1ZRRA 3MIHA 1QXRA 3MBWA 1US2A 1P2FA 4Y13A 4EGYA 4G6DA 3WG4A 1XYNA 5J36A 4BE3A 2GNTA 4K8FA 4BDZA 3F8FA 1OT5A 3AL6A 3FHIB 4O5VA 1AR92 4LKEA 1COV1 2E7AA 1A04A 4CHUA 1GNHA 1UMIA 1ETQA 3VHNA 1JUMA 3H8RA 4NIDA 4BIFA 3BU7A 1PVC1 3VBHB 1SMVA 4XAAA 5CNAA 2ZPXA 4GFBA 3NMBA 1KEXA 4RAZA 1YWKA 3ZKYA 4YVSC 2OC6A 1R4MB 3GTOJ 3A02A 1MQTB 2VMIA 4ENMA 2QWWA 2EA4A 5J7MA 3B6AA 3OYWB 4GQ7A 4QX2A 1JHNA 3B9CA 3QAHA 2WV1A 2QZ3A 4A3EJ 3F2ZA 3NJYA 4WF2A 1CIWA 2DFCA 3POWA 1VLNA 4CUCA 2MH9A 4I3PA 3ORJA 1ON2A 4CUGA 5FKOA 3ZQCA 3TBIA 5A80A 1HV0A 3DLAA 2P8TA 3I2JA 4QPGC 2ISYA 4UFMA 4HK8A 2ZKLA 1LJ7A 4KMUX 1AVBA 5F3IA 1EH6A 1K79A 1XTAA 2IS4A 4E9KA 2VMGA 3F22A 1CZVA 1AHDP 4AEJA 5A1FA 4MZUA 4LR4A 1XB4A 1GQHA 3TP3A 3F23A 3S5QA 4MH0E 1JYNA 1UU4A 2IC1A 2ZX0A 3HR9A 1XSRA 1WJEA 3DWLE 2XAFA 5A6QA 1F2NA 1ND2C 2P6TA 1KZHA 3BVCA 4FTHA 4UBHA 2IEKA 5FFOC 2EJRA 3J8F3 2B63J 3WX5A 4OCTA 5BPXA 1CPNA 3S1RJ 3O1TA 1C28A 2JSCA 2W87A 4COYA 5E1ZB 5BMZA 1A31A 3QCWA 3IH4A 1QZYA 2GOMA 2YMZA 3PSIA 4QPWA 1YIJI 2RS52 2QGUA 3BP8A 2JG9B 2XHKA 2DFEA 5FYSA 5IT6A 1BEV1 5DUXA 4CCOA 3UKGA 1KU7A 4YPJA 5J4VA 4RFRB 1BMV2 2WLQA 2RS33 2FCTA 4COWA 2VUDA 2BBAA 3S3MA 4AVBA 3Q0UA 4JOMA 1H4HA 2FBKA 3Q0VA 4C90A 4XQWA 3KQ4B 1A6IA 4LE3A 2W1OA 3ERMA 1W9SA 2M34A 3GTQJ 4Q47A 1YFYA 4MFEA 4E4SA 1LKNA 1WJFA 3GEZA 1WBLA 3OUHA 1K61A 5FP7A 3LSTA 3KM5A 4XIDA 1D3YA 1VBC3 4CICA 3GYDA 5EGOA 2NVXJ 2V4AA 1W2AX 5IVEA 2XJSA 1P4WA 5HLHA 1VBA3 4DZPA 2XVCA 3FXQA 4MV2A 2Q30A 4LBNA 1G59A 4A3KJ 3VDCA 2DA7A 2V1UA 1X9PA 4LOCA 1HRV1 4DNYA 3C7GA 4PF1A 2F5CA 2STWA 4P5YA 3ZKUA 2VKVA 4CDUC 4A3IJ 1LNWA 1MBKA 4XSZF 1SHWB 4M4RA 4IJAA 4ITCA 2GNBA 3S7IA 4AHYA 2GA1A 5FBZA 3WF2A 2UWCA 4Y20B 2WY7Q 3CL1A 3GZEA 5KK1A 1IS6A 3EUHC 2BBVA 1WJ5A 2IXCA 4CXYA 1PO12 3T30A 5L7OB 4M3FA 1ZGAA 2GC2A 4QB6A 3ZYJB 2BQPA 3KF3A 1GZCA 1IN8A 2VE9A 3QRFF 1BC8C 4TSVA 4BXSV 3BG5A 3I53A 4OHWA 2OCEA 4B7KA 3ZXDA 4NWWA 4HA8A 5A33B 4RM3A 5FRNA 1A5JA 4ZU5A 4B44A 3VHOA 4B48A 4C1XA 4I3GA 1JGSA 4FSJA 3FMGA 2R7SA 3L7WA 4AVVA 2K3FA 3S0MA 4RAYA 1OOPA 2E63A 5FO9B 4JKKA 4PIZA 3PHMA 1J09A 2E71A 2ZABA 3CU7A 4Q4X3 1VP6A 3OSDA 4DEVA 5F64A 4D6QA 1USTA 1YFHA 3M9AA 5JXGA 3OF1A 3TDZC 1RIRA 1C3HA 1ENXA 2CQXA 2CUZA 3SZPA 1RL3A 3K4KA 1V6MA 2B7YA 5EJCA 6PAXA 1CAUA 3CIHA 3OBAA 4NNJA 3J81Z 5LEKA 1ZHFA 3FK7A 2ZGPA 4XF1A 4DXTA 5FY9A 5CVRA 1VQ9I 4A0YA 3MKLA 1KQ9A 1Z3XA 5A3WA 4CDQB 4E7HA 5J96B 1TT5B 3A4CA 2VXDA 3WGGA 3WU2C 1FPQA 3JRAA 4CH7A 3HT1A 1UY3A 3KV9A 2A73B 2GN7A 3ABMH 3KX2A 3RFRA 2XIGA 3B73A 3OD4A 5HV0A 2WTEA 4UNOA 4NHMA 1Y0NA 3O0VA 2FDJA 1LAJA 2HWD1 2ZEWA 1W36D 3SH4A 3JCUC 1IS5A 3EXUA 4C30A 4XQFA 2P34A 4MO3M 1GHCA 4RGUA 1QJY2 3MZ8A 1HQNA 2CTVA 4DRVA 1FNZA 2HQNA 3KP2A 3K75B 2XJTA 2D98A 3BZ6A 2XRNA 1SPPA 2OF7A 1R083 3ZYIB 2Q2EA 2DTYA 3T2PA 2QKLB 5CFCA 1J3RA 2JG8C 1W6QA 1PZ7A 4E6KG 1YO5C 1C0WA 1F4HA 5K4LA 2NRAC 4XDOA 4PZJA 4M9XA 2NMOA 5CJ9A 4J1XA 1ZG3A 2OUHA 1Q5OA 3KT1A 3AZVA 4QU1A 4BZ4A 3S6PA 4BQQA 1BIBA 2DMNA 4Z92B 3VDBA 2CG4A 2VY0A 1YFWA 1KFXL 4NWVA 3ST7A 4YRDA 4HOOA 2BFUS 2DQLA 1G3SA 2D97A 1VMHA 4A69C 4XFAA 1F5JA 3VL9A 1RUG2 1EPZA 2AR6A 1RUI1 1ALYA 5K8SA 5C3OA 3IIIA 5L3DA 2VMEA 1Z6RA 1PK6C 1RUJ3 4COVA 1OOPC 5GZEA 4UFJA 4XUNA 1Y1VJ 4FPLA 9ANTA 4UFHA 1UW8A 4Y4YA 4YW1A 1IW7F 1TTYA 3KQRA 3NAPB 3IKVA 2DPDA 2PMUA 3WP6A 2A61A 1H8AC 1K6OA 3QP6A 4XQ4A 1FX5A 2BDRA 1JI6A 3PNYA 3K2OA 3HGYA 3KVAA 1DLLA 3K0LA 4KWJA 3DYPA 3RZOJ 3K51A 2HWF2 4YNIA 5IT9K 2B9UA 1H0MA 2AGSA 4YVSB 2Z42A 3RYRA 2PMZA 4Y7NJ 4AL9A 3Q3SA 1A3KA 3EUKL 3CZUA 5T52A 4BEHA 4X0GA 4DUWA 2W4SA 1S0JA 3KWVA 2CFOA 3M1EA 1BXHA 4IGQA 1F4AA 5EEHA 4KBBA 3SEZA 1M06G 3ZFEC 2JRTA 2GAUA 2M4GA 1WCSA 2X6WA 4DBRA 1RETA 3VKFC 4JQFA 2OS2A 2Y6FA 2QKDA 1NCQA 5K5RA 2RC4A 3NKGA 3A2KA 3BTZA 2K46A 4LMYA 3PFIA 1HBXG 3PNAA 3LDKA 2QQMA 4FOWA 3OYDA 2BTVC 1IRFA 3ERED 1D4M2 3W3CA 1X1DA 4OULA 3BDDA 2R7VA 1G86A 4B3AA 2VR4A 4G94A 2EFWA 2H94A 3KZIC 2JE8A 1KXGA 2PA7A 5F3GA 1WLTA 2JICA 2R5YB 3M4FA 3AP7A 2J1TA 1RUOA 3S7EA 4CUBA 4YFXF 2D44A 5E8AA 2J1VA 1REFA 1W6MB 2ILMA 5FPAA 4MVTA 1W3VA 3FF5A 2D7FA 3ZN4A 3CLPA 4JC1A 2ZZJA 2TCTA 1WW6A 1H9TA 3M4OJ 1D0XA 3ZFGC 3BTXA 1UHWA 2ZFUA 3LPGA 4Z2YA 2UV1A 2XBO1 2ZGTA 3PNTA 1AYM2 2GC0A 5JIAA 5HDGA 4NMIA 1D8JA 3GTGJ 1N1VA 1KYZA 1PX4A 1O4ZA 1V9U2 4IE5A 2UY8A 4CUAA 2A6WA 1W9TA 4I6ZA 5FDBA 1DQ0A 1MGTA 3BJAA 4YM0A 4XF4A 3LDRA 2X6YA 4UFKA 5KXCA 4HNVA 4TN7A 4DOUA 2V4VA 1LHWA 4ZDOA 1SAUA 4NC8A 1W6NB 4FQ4A 3IAQA 3DYMA 4QHZA 1RUD3 1QY4A 4XLHA 2X8KA 3NSTA 4FISA 4C3JJ 1U8RA 3AJZA 3GYHX 2UXXA 4E27A 2BOJA 3JBG3 3ZR5A 2R4GA 3S2WA 4KICA 5ISLA 5I93A 2WFF2 1JYWA 3K1NA 1LOEA 1PVEA 2XRLA 4MXVA 1WMFA 2RVAA 4XUQA 2DMPA 2W84A 2BXYA 1V6IA 5AC92 1T0FC 3OBRA 2D6KA 4CGZA 1YQ8A 1LDJA 4JV4A 1TQMA 1OSGA 3E0JB 3AZYA 2XPJA 4DRRA 3PLQA 3B69A 1ND3A 2WL1A 1AR93 4F7ZA 1Z7LA 4M3CB 3OGVA 4LD5A 2RJLA 4E7JA 2E7XA 1AR73 5DAXA 4D94A 4AGVA 4XICA 1DUXC 3GFJA 2UWMA 5E3LA 3SXYA 5EPAA 1TE1B 4NDLA 1UIJA 4MQVA 1I1SA 4DJAA 1W7PA 2ZXJA 3PVOA 4AVAA 1RUC2 4IEPA 2PMHA 2R0QC 1S2KA 1W8UA 3GALA 3HQXA 2NAZA 3ABTA 1RTVA 1UQXA 1DQ6A 2ZHKA 1N75A 2ZHMA 2F48A 1RUD1 3LD8A 3N7MA 5ICFA 1QGPA 1AX2A 1W5SA 2CU5A 1YJNI 4XZPA 1X9TA 3LB9A 2W08A 1BJZA 1CPMA 1MH4A 2IGMA 1HRV2 3DL3A 3OS1A 3TEDA 1YS7A 1YXWA 2L9LA 5ERLA 1JZ8A 4W97A 5D8AB 4NIAA 5A7WB 2VNRA 4FFFA 3BTCA 1VAKA 1BZWA 4CZCA 3JRBA 4N9HA 5HS8A 3T1LA 2XSDC 2Q8CA 1TC3C 3ZCOA 1GQPA 5CQEA 5DAWA 4U88A 1RJ8A 2E2HJ 3BOWA 3OGJA 1BA5A 4JBAA 5H6QA 1B09A 4P96A 4K7JA 4FE7A 1HXS3 1V5GA 1DHKB 1NTCA 3V7RA 3H0OA 2XJQA 1XQNA 3H9AA 1HRI1 4B1LA 2CQQA 1LFBA 1OA3A 3OUJA 1LPQA 1R1UA 2JKXA 5FZ4A 3CJNA 5C5UA 4HG6B 3TB0A 5JCTA 4JX0A 2ZAHA 2XWJB 3DPRB 5CPRB 1Y8RB 2KIQA 5IWFA 2B0LA 4I76A 1CWPA 5D4SA 5CFDB 1E5IA 3HPNA 3BLYA 3CO6C 4MO7A 4LHNA 5FLIA 2P6CA 2VZOA 3M1CA 4F3JA 4NVPA 1ULDA 3CCSI 3AMQA 3SFZA 1RJ7A 4BQ2A 2XDVA 3B7MA 4QKFA 5FLVA 3DPTA 5C9AC 2BY0A 5IK7A 3RRDA 3PIOF 4A2UA 2J1SA 1NE6A 1QJX2 3RKWA 3K3OA 3IKTA 2VQHA 2CGNA 4DINB 3K2ZA 4A3JJ 3HPGA 2W39A 4RBOA 3AXEA 1IZ1A 3IL2A 2HDCA 4EJRA 2LOOA 1BVVA 5FB2A 1WSUA 3PJYA 2HVSA 2OTJI 1S5LC 3VDAA 1J83A 1H2LA 4NIGA 2VCAA 3BCAA 4RAFA 1HB1A 3F72A 3AAFA 2V6CA 3B94A 1XSQA 4QPIA 2MLKA 1AUYA 2VCCA 2SLIA 4CDUB 2OV7A 1JTZX 4D7SA 2O8KA 2W1SA 4K1ZA 1FYUA 2QJVA 3H92A 1UY2A 4E2QA 4Q4V3 1D0ZA 3NAPC 5I0SA 2ZXHA 1CJDA 1AZDA 4EJTA 3G1OA 4BU2A 5E3MA 2XASA 3P7NA 2EB7A 3RG0A 2CQNA 1H9GA 5FMDA 5TJJA 2ZMEC 1BBT1 3K4CA 5KR7A 3POJA 2ZB9A 1JGGA 5FP4A 4OMYA 3OYJA 2ZGQA 2IA2A 4JVAA 2XSJC 5LHHA 2RM21 1OBNA 1GV5A 4OUMA 2YGLA 3ETQA 1ULPA 4G3YC 5EHDA 4YLZA 5LK5A 3ZN0A 4LFUA 3DECA 2VVFA 4WWCA 2IRFG 1OLRA 3UNGC 4YM3A 1O7FA 1S29A 2LC2A 1UOBA 3WDWA 4Z2WA 1QWRA 5T54A 1HKSA 5A2QZ 1QNWA 1FP1D 2BERA 5IK8A 2BHZA 2NVQJ 4GKXA 5FRAA 4A6EA 3T8TA 4HYEA 2JDYA 1LUJB 1TG7A 1SMTA 3K6GA 5LCWL 1CQTA 4RQPB 1DGWX 1OLMA 4Q4Y1 5CIRA 4XW3A 1RXFA 4HRIA 2VI6A 2GXBA 3CD6I 4C2TA 2JA5J 5D4RA 1C8NA 2FMDA 3GZNB 1CAUB 4LO4B 4YG0A 4RB3C 4Q27A 4XLFA 2OVUA 1ENSA 3O1RA 3QU6A 2A6VA 2D3PA 4ZHNA 1YE9A 2ECBA 2YSRA 2D43A 4XLPF 2DOEA 2VT3A 4DW6A 2H0BA 1DYKA 3F8NA 1WGXA 3AJYA 3FXUA 4UVAA 4QPIB 3R4UA 2DA4A 5FQ0B 3L09A 4FPEA 1JHFA 2W24A 1B6AA 4KN7X 3ENRA 3THTA 2Z1DA 3DN7A 4CU6A 4FBFA 4CZZA 1UMQA 2YBSA 1Z9CA 4X6AJ 3WHCA 2AS5F 1GWKA 3AP9A 3C7OA 3WNKA 3MMYB 4HN0A 2BOLA 2BBYA 3JD71 3WE3A 3K4NA 4XIOA 3MQ0A 4G7ZF 1VRH1 2A6XA 1FX7A 1VBB2 2IS2A 3P1IA 1K83J 2DA5A 4PUSA 1W8HA 4YW4A 1WMXA 3VZLA 4XURA 4LMFA 4PJMA 3USUA 1OR7C 1V5EA 1AL23 1G3YA 2E36A 2XVLA 3OYEA 1XX5A 4CDXC 1OH3A 4WM7C 2IVMA 1IN4A 4OYUA 1PUFA 1W04A 4F93B 3NNFA 2F5VA 3ABLH 4LLFA 4Q4V1 4UW4A 3APBA 2M0MA 2PJRB 2XLFA 4QPQA 3AMMA 2HWB1 2LKPA 1FAYA 1QZEA 1XGMA 1NYWA 1DZRA 4LBQD 2CH0A 1NQDA 2YC4A 4GGGA 2BRTA 2DXIA 4OIRF 3GTJJ 3D3AA 1CAXA 2DFIA 1QA6A 4XF3A 2L02A 3K48A 4D3WA 1UIKA 3V0BB 2A5YB 4IL7A 2R1BA 4WCGA 4M74A 1NH3A 4WVWA 4MFDA 2EH3A 5J8FA 4EVIA 2XGEA 2E60A 2OPWA 4LLNA 3K1PA 1E57A 1W6NA 2EPFA 4JDMA 1AJOA 1I39A 3ZX7A 5BNGA 1R49A 2XF5A 3N9QA 5EDNA 5B66C 2V9KA 4DZGA 4WZCA 2L7FP 3OYAA 3RWNA 1MMAA 1GXPA 3FWEA 4D9JA 4BJ5C 2P0WA 3ZPLA 2VZPA 3HN3A 1GLHA 1RI7A 2LF7A 3D1NI 4MYEA 2ME6A 2MC4A 2JDZA 3HBKA 2C9KA 1XE8A 1VQ4I 3VBUB 1U5YA 3CCVI 2PN5A 2WQZC 1PM4A 4ASMB 5H9QA 5CVIA 5LRSA 3HSFA 5CKMA 5A33A 2LDUA 2JTVA 3S3OA 3RZLA 3USUB 5FYIA 4CEWC 5K7PA 5HXVA 3WUCA 4AFBA 1HQWA 3JAMK 5D5WB 3KP4A 1ULGA 4XTPA 2KPMA 1GT0C 4L2NA 1PUFB 3UGGA 4TZDA 2HXOA 3U1DA 2KIMA 1JUIA 2JRMA 2Z4FA 1HXS1 3PJRA 4LOTA 4XN3A 5JLXA 3BZKA 2WZPP 1PGW1 1EV7A 1I1EA 3C7JA 1TZOA 1DDLA 2JA6J 4YRVA 3NKTA 3LL7A 2AQEA 4E70A 4YGEA 1H4GA 1X1AA 3IZOA 3M7GA 2LD5A 3BT9A 4HQEA 1NT0A 1XNTA 1BW6A 4BQAA 3TN93 1QU3A 2X5IA 4A3FJ 2XL9A 4D5CA 2H1KA 3H9JA 3EYIA 1P8JA 2CL2A 2ID6A 3VBSA 5FYVA 5E18F 5FY1A 1KS4A 3PUFA 2IVJA 3ROUA 1VRH3 3VHRA 2PLV2 1W90A 3ZYGA 2TRTA 2RJ2A 2Y60A 4HOBA 3GTKJ 4BAYA 4MOAA 1A36A 3QPSA 1W2TA 5GLWA 3IUOA 2I8DA 5E6HA 1XNAA 4D5FA 4XMYA 2ID4A 2RGVA 5A7PA 1RUC1 3R05A 4EGZA 4QQHA 1Y9GA 2JENA 4L18B 1R58A 3F8BA 2IXLA 3V42A 4IEYA 4Y1UA 4A44A 5HI0A 3O1MA 4CP9B 4K9SA 2WFF1 3KLSA 4P9UA 4AI3A 2G1MA 3VSKA 1RUD2 4DZJA 4XQDA 4IV1A 1TME3 4AEDA 1N47A 2QQWA 2KKOA 1ZBA3 2PFBA 1SEFA 3H7YA 4M73A 1PMJX 2Z5WA 1ZAOA 2I10A 2W85A 4XONA 3RI4A 4P14A 1RB8G 1B59A 5EG0A 1W8TA 4D69A 3KGZA 4QDSA 3SJMA 1UYXA 2PJRA 2VMDA 3WDXA 1KONA 2KDOA 4K3UA 5FZHA 2KIUA 3W5NA 3DPLC 2LK2A 2P1BA 2FRHA 5ABJA 1UZVA 2W95A 1G9BA 3RKYA 3CLOA 1N3QA 1FMD2 1DGRN 1KU9A 1APLC 1ORKA 3WF3A 4DXRA 5F5AA 3DEWA 1CAVB 2ADUA 5A2QK 4TYSA 1GUIA 5DQ0A 5BPDA 4P9WA 3RQ4A 3H8UA 3J7AY 3C2BA 2YX4A 2XV4S 3ESWB 3ELNA 1F8VA 3TO6A 4XR6A 5IT9Z 4KT5C 1CX1A 1D2QA 4BE1A 3OPTA 5E20A 4R9CA 2M30A 2BZTA 2WFF3 4HBLA 2R073 1YJLA 5JPNB 2OCCH 3EHKA 3WQ1A 2VUCA 5E79C 4RDUA 4ONUA 2ZKNA 5ACA3 2K85A 2WSUA 3MI8A 2OPKA 2EIGA 1P9QC 1M4WA 2X5IB 4I01A 5AVPA 2OJED 4RS8A 2RHPA 1C8M2 2HQAA 1I5ZA 4KU8A 5FYMA 4AHZA 3TOJA 2JDHA 1ONAA 1OYWA 2A70A 5GZFA 3KF5A 5J1UA 3J80K 5FKCA 1DP0A 1S0DA 3ZSEA 4CRQA 4A3LJ 3G6JB 1P4AA 2XJVA 2TEPA 3D0JA 1VBA2 2VCMA 1SBDA 2MGQA 2ZJCA 3WQBA 2WN2A 4JHTA 1LENA 2OW4A 4N43B 2PAMA 2M0CA 4EWDA 2LM3A 2GZWA 3V4GA 1OKRA 2HVQA 1YHFA 5TISC 1YQ2A 3WG9A 2BVLA 1SACA 1RIOH 2BJSA 1KDMA 2LKXA 3O8GA 2WJSA 4NPRA 1D0GA 2W1WA 4N4OB 3I2OA 5FPZA 4JZRA 2K9SA 2FOWA 2H8RA 1KA8A 2VZVA 3BIWE 1BN5A 5FZ3A 3LWFA 2WAQA 5J48A 2QLZA 2R062 4AQTA 4ZZ5A 3DEEA 4OHZA 4XDPA 3I49A 2ZA9A 2ZAAA 1T0FA 1ZKGA 4E8CA 2EBIA 5EEAA 2ZNYA 2RR13 1RUNA 3AKZA 4I0AA 4UI9L 4G8XA 1QJX1 5H9RA 1DLCA 4WVMB 2KD7A 4ZKTB 5EZHA 4ZY9A 1W2UA 1W6OB 4XAEA 4O65A 3K10A 3OIQA 2HWVA 4N90A 2YC2A 4HEA2 2K0GA 4A3GJ 4FQGA 3MIGA 2EWNA 3WDUA 5JOZA 5FZFA 4X6RB 1LGCA 1PDNC 2HLEA 2FNPA 1ENRA 3A7QA 1DGWY 2XROA 3VZNA 3MW2A 4E2SA 4KUMA 4Y22B 4ESJA 1SZBA 5F37A 4N9IA 2HR3A 2BYVE 1A8DA 3OGSA 2CQKA 2Z79A 3WGIA 2WS92 1LEMA 3PQJA 3NV4A 3H35A 4HFSA 1E3PA 1OYIA 4AW7A 2ARCA 5E1WA 1RR8C 1I6XA 2ZEZA 3IC7A 3S17J 4FTBA 4YW5A 4PJNA 4XOPA 4GB31 4GULA 2YUEA 5DEQA 4AVZA 3VBRC 2EZLA 4MHUA 3QYEA 1F43A 2VBDA 2DYRH 3ES1A 2G7UA 1F5FA 3MWMA 1XE7A 5LW9A 1HX6A 4HN1A 1W6QB 2XF6A 1JUPA 4AI8A 3GZ6A 4X6QB 3KS7A 3WR0A 3TYJA 1BOBA 2LR8A 1PNFA 3OL4A 2B8MA 3PFYA 1H88C 3MLJA 2QBYA 5DUVA 1VQ6I 5C3RA 3N97A 4URAA 1SFEA 4XFFA 3RYPA 3G4SI 5FZOA 4LB6B 3LQQA 4RA2A 2KRCA 3ZQQA 2ELHA 2WNEA 3NNJA 1UELB 4NRQA 3I4MJ 3ZPOA 5HV4A 2W91A 4AE2A 1US3A 3N9PA 1EV13 3PIGA 1GUUA 3NARA 5IJRA 1MBFA 1IN6A 4PDKA 1DZTA 1ON1A 4ZJZA 2CV0A 1S0EA 2AXTC 3A1YA 3V65A 2EAKA 1G3TA 2P3YA 2WQ8A 4HF0A 5IPAA 5FJHA 5FZAA 3BPVA 4QKDA 4EWAA 3V8JA 1NCQC 4P9FA 2O8OA 2JG8A 2LF8A 2HWD3 4QMAA 3T2OA 5BNNB 2GA2A 1YUDA 3K2AA 4G4FA 3EPZA 4KNCA 4OI1A 4ATFA 4JQRA 3CP2A 1FPN2 4B29A 2YBPA 4UY8I 4M3CA 2H27A 4JK1X 2CV2A 5IVJA 4PIYA 3P9KA 5TGTA 4EMSA 5JZGA 1AL0G 4PHZA 5FZCA 4W50A 1Y39A 3CJRB 4PLNA 4B47A 5LGTA 4U7DA 4W6XA 3CHXA 3NWKA 3JD73 4LE4A 1H6XA 3FLTA 2BVBA 2WABA 5J40A 1S72I 4ZH4F 1GNZA 3HOBA 4J01A 3M8EA 1X7NA 3BPZA 1R091 1NA1B 4QB1A 3U0ZA 2WAAA 2GMEA 1URXA 2W52A 2IP2A 1RHI1 5H2FC 1HC8A 3UKNA 3PDQA 4YGCA 3KP7A 4AQSA 4S05A 4ZXEA 1IRZA 3KIOA 1K5JA 4PSWA 3BU0A 3HQRA 4AAPA 5I0DA 1W06A 2QSGX 2HWB2 4K21A 4XETA 3H5AA 3DP7A 2AZ5A 2DQRA 3BG7A 5GKAC 2VE8A 3S32A 4M3EA 2L54A 2VOOA 1P4XA 3AKTA 4BUPA 2XUMA 3I0TA 5ICCA 5BNPB 4C3IJ 4A6DA 2WRAA 1YFUA 2DCEA 2CW8A 2ZBKA 5FJKA 5DCMA 4Z82A 2WIIB 2QNKA 2YPDA 4CE8A 3HKZA 1X33A 1ZGJA 1IF1A 1AYN3 3CCEI 2J5OA 5FZKA 4CXWA 5HXMA 2AACA 1HKQA 2DVGA 2KL4A 2EQRA 1PGW2 1Q3EA 4PQQA 1BVP1 3WP3A 4MNUA 4QWQA 2LRPA 3Q8AA 2V79A 5IOYA 2L01A 4AWXB 2LS6A 1GYKA 2WAOA 3U2RA 4A6OA 1LOFC 4CDWA 4XZUG 1SLLA 2D2WA 5L7OC 4V2WA 1VF9A 1PGL1 4R9DA 3K9TA 4RB2C 4LLGF 4RGSA 4F8AA 5J1XA 1W28A 4Y5SA 1DDNA 5FYTA 4XBNA 2QQJA 3NJVA 3U78A 2DJIA 3PUIA 4A3BJ 2K2SA 4XXPA 4P9GA 3OYHA 4OZXA 4BPZA 2JQ7A 4OUEA 1MNDA 1RUF2 3QH7A 3WNOA 3FHNA 4PJ0C 1OCRH 3OR2C 5C6CA 3WW2A 1NLQA 4CXXA 2EICA 3MEPA 1WCDJ 2RQPA 3H3LA 1XE0A 5JIUA 2DT6A 5FY0A 4AWDA 3F21A 2CNAA 2FMYA 4UT5A 3R0RA 2ARXA 1JYTA 2CGOA 2XKPA 3KP5A 1KQ0A 2JDKA 5FZGA 4BK4A 2O8QA 4I0WB 2RV8A 4HNUA 3C2GA 1SD7A 3GBWA 4JGYC 3FX3A 4UF0A 3MV01 4L5JA 1TMF1 5FV3A 1HRI3 4FPKA 2VONA 3QWLA 1XCVA 3WXPA 3ETPA 3VBFA 2KXLA 4KISA 1TBXA 4HPKB 3HNBM 1T2XA 1IQDC 4A0ZA 1WBFA 1C1LA 4MGKE 4E4DX 2CSOA 3BTLA 5B1BH 4CCJA 5HCFA 3EYYA 2OZJA 2BXZA 5FXVA 5C4JJ 1RMU2 1AXKA 4XHBA 2XAUA 3ZN6A 4PDWA 2F5DA 1Z67A 1POV0 4JKLA 4RSUA 4QX5A 4YZ2A 2JA7J 3CZJA 5BV6A 1IOAA 1EF4A 2VC9A 4NHLA 3OIOA 4A7YA 4M6YA 1LGBA 4FTSA 1NY72 3HEFA 3UGHA 1UL9A 4BEHB 1VMJA 4EN9B 1Y3TA 3JBG2 4U36A 1WLDA 4NAOA 4XM3A 2V26A 4RQPA 2Y6HA 2MBFA 3UL2A 2CMPA 3LMMA 4BH9A 1NA1A 3OB8A 1AR72 3I3LA 2DBIA 1I1GA 5I0RA 2PLV3 2DBNA 1W5TA 5L7OA 1A8MA 2VL4A 1RUE1 4JAAA 2WBKA 1TQIA 4Q0UA 2DCJA 2HQRA 2IXJA 3BC8A 2XXZA 5FUPA 4KBZA 4CCLA 5KC5A 4TTGA 3DXTA 4UUSB 2Y30A 4LO8A 3BGAA 3SH5A 1BQPA 2CJJA 3HGGA 5FUIA 1FNNA 4BDVB 3C2HA 4FP3A 1BMV1 2FQ3A 1RMU3 2TNFA 2P5VA 3QYBA 3JSPA 2JPBA 5LLQA 2LROA 3FZVA 4HW0A 4LOSA 4HF2A 2X48A 2FU4A 1GU3A 4NQWB 2JK3A 3KB5A 3OL3A 3U07A 2Y6LA 4RR3A 2R5YA 2IS1A 3AZWA 2NS0A 4CEYC 1GZWB 2VM9A 4KQ7A 3ZVXA 4IL6C 3KZ4C 5L9VA 3LEGA 4PCQA 4LG3A 3IAS2 2HYGD 3NRVA 1G8WA 5DG2A 3DU5A 2LG4A 4LK7A 1S4CA 2BWCA 2VZ1A 3BYWA 2VW1A 3AYDA 5A70A 1AXYA 4GWMA 1FBSA 1MVEA 3SZGA 3ZXAC 4KG8A 5HVQC 3TRSB 2NVYJ 2YU2A 3ZSJA 1RVF3 3F95A 1AJKA 1W6PA 1MS8A 1ZGWA 1N1SA 2K9ZA 1WMEA 1WWXA 1ZREA 2JECA 3HD8B 3VBOB 1OVSA 3ACGA 1F35A 2ZJ2A 4GYGA 4XHXA 4B3NA 2TUNA 1ND2A 2DN0A 2LNBA 2MEV3