1O3QA

Protein-dna recognition and dna deformation revealed in crystal structures of cap-dna complexes
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
200
structure length
200
Chain Sequence
b'DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*AP*AP*AP*AP*AP*TP*GP*TP*GP*AP*T)-3'
publication title Indirect Readout of DNA Sequence at the Primary-kink Site in the CAP-DNA Complex: DNA Binding Specificity Based on Energetics of DNA Kinking
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
total genus 62
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2003-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1o3qA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1o3qA01
2NYXA 3SCHA 1HKQA 3FM5A 2Q0AA 4LULA 1BBYA 3SXYA 3OV8A 3WW4A 1NYWA 1FBUA 1TNTA 4PIYA 2Q30A 4G6DA 2A69F 2RN7A 5FQ0A 4HLXA 1BC8C 3RZZA 2FBHA 2EFNA 2OZUA 5CJ9A 5HS9A 5KHGA 3L9FA 3IWZA 4WK8F 3NJZA 1D8KA 2DPUA 1K79A 3LFKA 2FQPA 1SFNA 1A04A 2F2EA 4AIHA 2Q2EA 2HYFA 2CQKA 1BC7C 5FCCA 3F6VA 2NAZA 2ETHA 3GW2A 3ZN1A 2R3SA 4HV6A 3ELNA 2YPRA 2MLGA 5LHHA 2V1UA 1H0MA 4BH9A 3ZPLA 1GXQA 3D0JA 4A0ZA 4RGUA 4G94A 5TJJA 2CGPA 4XRFA 1SFXA 1ZVFA 3WTYC 1ZLKA 1XCVA 1MDMA 1LRHA 1FP1D 4YRDA 4DQ2A 2Z69A 3CUQB 4PZJA 5CVIA 3RJPA 4FX0A 3J81K 2DO7A 4Q0PA 2IXHA 2RV8A 3TGNA 2RC4A 1PUEE 2RGVA 3SFZA 4JTNA 4IEVA 4QXKA 3RYKA 3R61A 4P55A 2QM3A 2FU4A 1UFMA 1YW9A 4AIKA 4HYEA 5E1RA 3DFGA 4WXDA 2EV5A 5IT3A 4EGZA 1L3LA 2O6GE 4XSXF 2M87A 5JR3A 2A07F 2PAMA 1W5SA 3P7NA 4N0BA 5A2QK 3NSTA 1OD5A 1STZA 2Q8KA 2DW4A 2OD5A 5DD8A 5EFUA 1BI1A 1E2XA 3GFMA 1O5UA 2VPVA 5J3UA 2FBIA 5DCMB 2ELHA 3F8BA 4EJTA 4XF0A 1ZG3A 1G3YA 1R7JA 4A6EA 2GC3A 4HVOA 4S05A 3WU1B 3E6DA 2GXGA 5D5VB 1O3QA 1IW7F 3H1WA 4MNUA 1ZRDA 5JFRA 2IW5A 5E17F 1JHFA 5ICCA 5FPXA 3C18A 3USSA 4EMSA 5I0TA 3D82A 1LJ9A 3IDBB 2XKOA 1BI0A 3SMHA 2A5YB 2D5HA 5ILSA 5BPDA 1CAVA 3ELKA 4QX5A 3EO6A 2DFIA 1G6NA 5FLIA 3LWCA 4E2QA 2M30A 1ZARA 4HX8A 3RKXA 1Z9CA 3LAJA 3M8FA 3HIFA 2RNJA 1XGMA 4UBHA 3FM3A 2HQNA 4L11A 4OU0A 5CADA 3J80Z 2ZO4A 1H9GA 2IPQX 2EWNA 4EVIA 5ICEA 4CGZA 2XLAA 3KP6A 2EK5A 3IRQA 3ZP5A 3ABUA 4IXAA 2HZTA 1X8EA 1AWCA 1D5VA 2IXJA 2BNOA 2ZXJA 5I0UA 5ILUA 3I59B 4L9TA 3ZMUA 3KP2A 5E1WA 2HWVA 5E1ZB 1X3UA 2CO5A 1EH8A 5LEKA 1ZG1A 3QU3A 1DGRA 2BE5F 5I8YA 5BOXA 4L0YB 1V70A 5IT9Z 1W7PD 1TW3A 3ZMTA 5FLXZ 3IHUA 2DQRA 3OOPA 5I93A 2UYBA 3O2PE 1R1VA 1LDKB 3V8JA 4KT5C 2A6EF 5I8SA 2JT1A 2NNYA 4ENKA 1GQHA 3CEWA 1OMIA 2QYOA 4CYDA 1FC3A 3KP7A 3ES1A 3I53A 4KUMA 4EWAA 2IXLA 1TQMA 3MAJA 3MPBA 1ZGJA 3CO6C 2P7CB 3FFQA 2YR2A 4YSFA 2WFPA 3RKYA 1VTNC 4UXAA 2A68F 3WTZA 1PM7A 3E5UA 1U5TC 2HDCA 3T1BA 1O7FA 1U3EM 3PNAA 4IRHA 3COAC 3GLXA 3O14A 2QDRA 1CAXA 3G7DA 1TNSA 3IKTA 4UHTA 2IA1A 4WBBA 3MFKA 4NVPA 2CAVA 1J3RA 1PMIA 4X6RB 1P4XA 5JAXA 3HT1A 2ACJA 4HSJA 3RPQA 4KN4X 3D5LA 1EYBA 4F8AA 2QCSB 3S0MA 3KP4A 2E1NA 1FWZA 3FMQA 4OOIA 4BYYA 2WWYA 4XF4A 4G7HF 2V09A 2DQLA 2IC1A 1XGNA 1R5HA 5BY5A 2IXKA 4BAYA 1XE7A 4UBGA 6PAXA 4H0EA 4PCQA 1Y9QA 3TO9A 4Q0UA 1ZHFA 4HDVA 4IERA 1B9NA 1FOKA 1W5TA 5D5WB 4KDPA 5BS6A 2L01A 1HW1A 2V9VA 1U5TA 4AD9A 3HSEA 1W7PA 1IN5A 1YLFA 3PQKA 3ZMDA 1Y3TA 1NXMA 1YS7A 1O4TA 3MZHA 4MGRA 1DZTA 2B5HA 4F7ZA 1SD6A 3H7YA 1I27A 4HVQA 1XB4A 3GYHX 4HF0A 1U2WA 4B8XA 2KJBA 1RIOH 2A3SA 4IRGA 3DXJF 1HKTA 3E3VA 4HOBA 2LSOA 2CV6A 3D0SA 3HTUA 1ULYA 4QGNA 2F5EA 4LUMA 2ZJ2A 1DZRA 4IETA 4TLFA 2M8EA 1XSVA 4M74A 3J81Z 3MCZA 3ETQA 2HYGD 1O7LA 5I0RA 2VC1A 2XGXA 2Y75A 1CAWB 2IJLA 4OFGA 3CLPA 3JAMK 1NHAA 1U8RA 2L4AA 4KNYA 2XL7A 1E17A 1UCRA 3VEPA 1P6RA 3M8EA 1DPUA 1CAXB 5HS8A 1BN5A 3HUGA 1AOYA 4ZU7A 4WXCA 2P6SA 4OIQF 4EM1A 1UPIA 5A2QZ 4KIBA 3FZVA 2D2WA 3IDCB 1HW2A 3KLNA 2D40A 3F72A 4LA3A 3KP5A 1UIKA 3VB2A 4ORFA 1B9MA 3L7WA 2XUBA 3BPZA 3L2CA 2XV4S 4WX9A 2ATFA 2ZKZA 4LMYA 2CFXA 3OGJA 2HGCA 3OF1A 2DLLA 4WVZA 1WA4A 4BXUA 4YG2F 3SHFA 4FT8A 2EA2A 1Q43A 1BI2A 3OD0A 4KN7X 3C7JA 3J80K 4XFBA 3R60A 2O8QA 3CUQC 5HLGA 1J9IA 2GA1A 4Q0QA 2V1DA 4LLGF 2KKOA 3M3IA 3E5QA 3VOEA 5F1RA 2GC2A 5D6FA 1VP6A 1YQAA 1T38A 3U9GA 2VBWA 2JRTA 3CUOA 4P96A 1FNNA 2M45A 2EFOA 1NZCA 1UIJA 3H1MA 1EH6A 4JK1X 1S6LA 3CO7C 2B8MA 3KETA 1FT9A 3VFZA 5JVTA 3E97A 4WCGA 1XSDA 4GGGA 2BEOA 2EFPA 1IAWA 1OYIA 2P17A 4BHCA 1LVAA 5LRRA 4R52A 3BWGA 1ZGAA 4IVNA 5AIQA 1QQIA 5E8GA 2MPFA 4G7OF 1TTYA 2GAUA 2M5WA 2PMUA 2D45A 3U1DA 2CAUA 5LGTA 3M70A 1FPQA 1R00A 2RDPA 3G73A 1Z05A 4Z07A 1UW8A 2VBXA 3QOPA 4I0AA 1YFYA 4ZZLA 4ON0A 1O3TA 2OQRA 3CUQA 3GFIA 4HN0A 1OYYA 3EUHA 4EGYA 5EEGA 1GHCA 5FLHA 1V4RA 2NS0A 2DTRA 4ENJA 4YYOA 5F6FA 4HX4A 4CHUA 3HRSA 1KQ8A 1WKMA 4JV4A 1TW2A 5HS7A 4D0PA 1WGPA 5I91A 4MTEA 4CZZA 4M9XA 3K1NA 2KXLA 4HF2A 1IRFA 4L9NA 2RVCA 2UXXA 2P8TA 3V7SA 4AVPA 5H6QA 2XLGA 1ZLJA 4LTAA 3TOBA 1LDDA 1KA8A 5CYVA 2FF4A 4AQ6A 1Z7UA 5DCMA 3CF6E 2HEOA 5DUIA 4XFGA 1ODDA 1USTA 1BOAA 2QBYB 1ZRCA 5FFZA 1YFXA 3DPLC 4ZU5A 1IF1A 2XASA 3GVAA 2IP2A 1KU2A 5H6RA 3TDZC 5BMZA 3FWEA 2L4MA 3M7GA 4DNCA 1QZYA 3F6OA 3ULQB 1LEBA 2W84A 1J7KA 4ETSA 4S04A 4Q0VA 3I54A 4HN1A 1J1LA 5JI6A 4AVAA 4GULA 4U7BA 1YFWA 2PA7A 4RS8A 2W25A 4H7LA 3RKWA 5LRSA 5FD6A 4MEYF 3W6KB 3FXQA 3M1EA 4L9VA 4HAMA 4O6JA 4EV0A 4IPAA 4HLYA 4O3MA 3LA7A 1QBJA 1YW7A 5E16A 1XMKA 3SCFA 1YG2A 1KU9A 3H7JA 3ZDSA 4M73A 2E9QA 1QXRA 1RGSA 4ZYGA 1DUXC 2J5PA 5L3BA 5E18F 5HDKA 3RI4A 3HHHA 4KICA 3C3VA 3LOIA 2ADUA 4KWKA 5J7MA 1H1IA 2OU2A 3BPXA 2QUFA 4LA2A 4O9EA 1KYWA 1XDUA 2TDXA 1HW5A 4IEYA 2F5CA 2PG4A 3SQNA 2P5LC 5CVVA 3MWMA 4JBAA 3FX3A 3I59A 3EQLF 2FXAA 3QRFF 2PN6A 1R1UA 2NRAC 4KU7A 2VECA 1I1GA 4QM8A 2DI3A 1ZZBA 5J8CA 4BIFA 3FMSA 1MKMA 3GFLA 4KWLA 4XF1A 3QPHA 2Z3YA 2EVXA 1REPC 1K78B 2JTVA 1GXPA 4U0WA 3U11A 4A0XA 3TO6A 4HW0A 1CGPA 4U7DA 5JSRA 4MGYE 2QWWA 3QP6A 1J3QA 2P5KA 2VODA 4FAHA 5JSPA 4HF1A 1O57A 1YHFA 3V8LA 2V79A 5CVRA 1YYVA 3I0TA 1V3FA 1QY4A 3SHRA 1OKRA 3GWZA 3JAMZ 1QXJA 1U78A 4OIOF 1BI3A 1CF7B 2CSOA 4EQQA 2D93A 3WW2A 4M9SA 4Y15A 3IKVA 3NL1A 4LK0F 4R1HA 1Z91A 2B0LA 4EWDA 2X4HA 4M72A 2KJCA 1XN7A 2QENA 4HX7A 2EJRA 4HBLA 1JHHA 1SQ4A 4XLNF 1U6GA 2FNAA 3WTTC 1SMTA 3H92A 1O3RA 3UKNA 2O03A 3GYDA 4UVBA 3H8UA 3ZMSA 1RTVA 3NEUA 3PFIA 1LR5A 2X0LA 2EV0A 2K4JA 4MHGA 4D7SA 4XFIA 3N4MA 4MV2A 3HRTA 2VT3A 4FX4A 3I71A 3F8MA 4MX3A 5KHKA 4Q4ZF 3ECHA 3EBRA 3CLOA 3DP7A 3K0LA 1B6AA 2OZ6A 4CXFA 4XBFA 5K5QA 2UWMA 4RB2C 1JXSA 4O9GA 1K7AA 1HSTA 1ZRRA 5LLQA 4I3PA 3NVCA 2GU9A 4G6QA 4CO8A 2CG4A 2VE8A 2MLKA 3TKYA 4EROA 2GZWA 4PIXA 3CJXA 4YNIA 1T6SA 2ISYA 1EPZA 2BBYA 3WE2A 2KIUA 4GO1A 2BNMA 5FGMA 1Q3EA 2HQRA 4E2SA 4IEQA 4NB5A 3RYRA 5HOOA 2IT0A 1T98A 3U0ZA 3BP8A 5EZWA 2VQAA 3MEXA 1I1SA 2QZ8A 3ML6A 4Q5SF 4ZZDA 3CO2A 5FPZA 3UKTA 3IRRA 2P5VA 4U88A 2F5FA 1WSUA 1T39A 1EH7A 2ZMEA 2XVCA 2PTMA 1XSXA 4MZUA 4FAGA 1T2KA 2D1VA 3DKWA 4UXNA 3ZN0A 2ZBKA 4IRIA 1S8NA 1D8JA 2GQQA 1G3TA 2GIVA 2FSWA 1B59A 1CAWA 4PJYA 5BQTA 5T3NA 4MTDA 4IEUA 1SFEA 4MGKE 5K8SA 3WU0A 4HLTA 1RC6A 4MUVA 3V7RA 4QWQA 1C0WA 3ABTA 1XRUA 1IN8A 3QP5A 3QU6A 1UCXA 1G4DA 4KYWA 4Y17A 3MYXA 1DGWA 3FHZA 1R22A 1WWXA 4ASNA 4L0ZB 5J8FA 1F5TA 4LLOA 2FMLA 3E6CC 2DCTA 2FOKA 4OIRF 3CTAA 2Z5UA 2FRHA 2XRNA 5DCFA 2ETEA 3RNSA 4LJZF 1LEAA 1J58A 1ZZ7A 1YWKA 1FBQA 5FD5A 4BHPA 1ZREA 4FBFA 4IHSA 4CDGA 3ZQ7A 2MD5A 2V1XA 2QVSB 1BM9A 5C6CA 4BHBA 1F4KA 4RD7A 1L0OC 1S29A 4O5VA 2O0YA 2F4PA 2UZKA 5DYMA 4NHJA 2XAQA 1Q1HA 1YFHA 2HJIA 3WE3A 3R4KA 3KZYA 4WF2A 3LA3A 4IHTA 5BUVA 2VONA 2Y48A 3E5XA 1IPJA 1FZPB 3HRMA 2IA0A 4ESJA 3KGLA 1FI2A 4WWCA 2G9WA 3F23A 3PQJA 4WZCA 2ZMEB 2EB7A 3O6BB 4I7HA 2O1QA 2MHFA 2Z9OA 4IF4A 4RAYA 3VODA 5DUKA 5FFXA 2BGCA 3SZTA 3F8NA 3I64A 5LGUA 5L3EA 2IXIA 5ICGA 2F5DA 3I5UA 1SMYF 3R0JA 3ROUA 1PP8F 2YSRA 4XFFA 1S7AA 4JQFA 1I5ZA 3GZ6A 2GC0A 2ZNZA 3T5XA 2E7XA 2ISZA 1TLHB 3J7AO 4GCVA 4G8XA 3HT2A 3BY6A 3L09A 4EM2A 3FMRA 4I0BA 5TRDA 2MC3A 3G3ZA 3NRVA 5LGNA 2FQ3A 1EY2A 2XLFA 4J1WA 5FB2A 2ZFWA 5BPXA 4HZFA 3C3WA 2E1CA 5KBFA 2QBYA 1SFUA 5F64A 4KIGA 2LKPA 2IA2A 2WTEA 3V8KA 2FNPA 3WG9A 1JE8A 3EJKA 5CLSA 2P4WA 2XAHA 2PQQA 2HKOA 4QGMA 5HLIA 5EEHA 1D3YA 5JHUA 2OA2A 2W24A 4I98B 2C6YA 2ESNA 1XE8A 2OQGA 4IEXA 5DV5A 1MD0A 4ZYHA 2GXBA 3WODF 4HMZA 1X8MA 4LG0B 4RB3C 3FE5A 3LAGA 2MH2A 4Y13A 5DD4A 1JGSA 5LEJA 2ET7A 3WGGA 4KFCA 3H9AA 2E7WA 3H1YA 3BALA 4MQVA 3RPUA 3GX4X 1YTYA 1LDJA 1S7OA 3KCCA 3KMHA 4OLLA 4OMYA 2JSCA 1Z1DA 1BJAA 1MJAA 2P7VB 1O5LA 2RQPA 4NQWA 3RTRA 2IVMA 3JTHA 2PBIA 3EETA 4HDUA 2L02A 1ONVA 2VBYA 3DL3A 5K1YA 3LSTA 3ECOA 3KZZA 2H94A 1DP7P 1F9NA 3EDPA 1TQPA 3TQNA 4A12A 1LQ1A 1KYZA 3BROA 2PYTA 5KVRA 2WV0A 4P9GA 3HRUA 2DPDA 2YX4A 4G7ZF 4LEJA 5D8KB 5D5XB 3H3ZA 1B4AA 1KGSA 2GC1A 1K78A 2G7HA 2Q4SA 1SAXA 3BB6A 3KE2A 4Q29A 1FLIA 1ON2A 2XAJA 3BZ6A 4PGGA 4AQ2A 5K5RA 2ESHA 4IEPA 1YS6A 4PIZA 3V7CA 3E6BA 4IEZA 2D1HA 2VOPA 4GYIA 4X6QB 5E1XA 1MGTA 2Y0MA 4EJVA 1XD7A 3P9IA 1MJ9A 5KHIA 4EJUA 1CAUA 1CF7A 3SZPA 3L00A 3IIAA 3T8RA 2PFWA 4N9HA 3CL1A 4L18B 2EA7A 1TQIA 2H27A 2C0ZA 2AXLA 4PGHA 1HXDA 2QNKA 3K1PA 3DPTA 4LB6B 3CDHA 2MBFA 1IXRC 2O61A 3EQEA 3K2ZA 3HQXA 2QQAA 1GVJA 2DAOA 4A5NA 1OI6A 2QVOA 3QPTA 4LLNA 1UHMA 1OR7A 2JPBA 2VBZA 2HTSA 5D5UB 2DU9A 2EV6A 4U0VA 1FBSA 1HSJA 3FJSA 3HSRA 3QACA 1MJBA 2DT5A 3OTFA 3WTSC 1RI7A 4E70A 1FYKA 3NW4A 2G7UA 2DK8A 3LA2A 2MA3A 1YW8A 4Q48A 2OAZA 4LD5A 1P4AA 4BQAA 1USSA 4MQ9F 3WGIA 2QLZA 3S7IA 3FHIB 1DDNA 3IBMA 3HHGA 1RUOA 4XFAA 2BV6A 1H9TA 1ZYRF 3DF8A 2I45A 4A0YA 4P5OA 1KU3A 2LNBA 2FMYA 4I02A 1RUNA 3S7EA 2EA4A 2CW0F 3TDUC 2H6BA 5BV6A 1XMAA 3BJAA 2WC2A 1WLTA 4J1XA 2Q1ZB 1ZNPA 5ICFA 4QGLA 4Q47A 4Z82A 3Q5FA 3HTSB 2STTA 3DEUA 4FHTA 1ZZCA 5FDBA 3W6JB 4HSLA 4LB5A 5AIPA 5HI0A 1IN6A 4KA4A 4AWXB 5D6EA 5L3GA 1G3SA 1SEFA 4L9JA 2OBPA 4DINB 2AS5F 3F21A 4YFKF 4M6YA 1IXCA 3EYIA 1BIAA 2BNNA 4AIJA 4KU8A 2GWRA 1YFUA 2JPCA 1J59A 3MZYA 3IL2A 2PAKA 3JSPA 1KQ0A 3OCPA 1O3SA 2OYZA 2HFHA 1FP2A 1CX4A 1CAUB 1XGSA 2HKXA 3TO7A 1FX7A 1B1BA 3FZ3A 3RYPA 1KQ9A 2QQBA 1H1MA 3JW4A 1YUDA 3IWFA 1R36A 1IZ1A 2Q0OA 1WI9A 3LAPA 4UV8A 4LK1F 4OINF 2V6CA 5FQ0B 3HYIA 2FBKA 4AVCA 2K4BA 4MEXF 4LFUA 1X7NA 2M1BA 5I8TA 1KU7A 4LLLA 5CVUA 1RNLA 3K1MA 1R1TA 2PEXA 1P4WA 4HA8A 2CWEA 4R79A 2FA5A 3NQOA 3B73A 5L3CA 2EAAA 2QJVA 2PI0A 1U12A 2K0GA 3B02A 4META 3U10A 4MH0E 1UB9A 3ST7A 4UV9A 5JR7B 5ILVA 3BDDA 2PJPA 3F3XA 2XKPA 3H50A 5HVQC 2VXZA 2K7LA 3F22A 2YU3A 1TBXA 3EHKA 1ON1A 1S3JA 3T0YA 4ENMA 1MDMB 4KL1A 4ESBA 4XEZA 1IUYA 1OYWA 5DDGA 2Z33A 4P9UA 3WTXC 4HQMA 2B9UA 1MZBA 1RZ4A 4M9ZA 3JTGA 4GYGA 3RDIA 4D7TA 1UD1A 3DV8A 3TNPB 2UY8A 4ZH4F 4B09A 3T8TA 2XL9A 4GXOA 5FO5A 4UNOA 4I09A 4BNCA 3GUDA 4HV5A 2H6CA 3LZZA 1NE4A 2NNNA 4ZYEA 1J0RA 1IPKA 3MDPA 4ZYDA 2P6TA 2DBBA 5CU1A 4I2OA 4K2EA 3WTUC 5L3FA 5HLHA 1J3PA 1VR3A 2RKHA 4RB1A 2ET1A 3P9CA 2XAFA 1IN7A 4PDKA 4MGIE 3ISPA 3LWFA 2OA4A 2OPKA 1LNWA 3O3KA 2W85A 3GBFA 1FY7A 1HBXG 4N9IA 4HBNA 3GXOA 5H20A 2EFWA 1Z6RA 2PFBA 4R8HA 2GA2A 3KFWX 4UVCA 5ERIA 1XGOA 1Z6TA 1FSHA 2XAGA 1TQ5A 1YLLA 3KEOA 1EP0A 1CAVB 1JUHA 1QO0D 3BU7A 1FXZA 3KEQA 2PHLA 3SCGA 2KIFA 2IRFG 1ZZ9A 5HDNA 1P92A 3TOAA 4QLCU 2N7GA 3GO5A 4HQEA 5E20A 1IN4A 1LB2A 3ACLA 3WW1A 3FXUA 1Q5OA 3I7DA 1G3WA 2ZNYA 4K8FA 1X82A 4LG0A 1YIOA 5J48A 4EWEA 5ED4A 3I58A 1ZZ6A 3GEZA 3FXRA 1QNTA 3M9AA 4U0YA 4XETA 2JZYA 4LGWA 4CICA 1PDNC 5K5OA 2VC0A 3DQVC 4B29A 2HOEA 3F8CA 1K6OA 1QWRA 4LUKA 3BJ6A 3N97A 2Y0OA 3L2HA 3HOTA 2MNGA 2ZKLA 3R0AA 3KGZA 4L2NA 1LKNA 2CYYA 4AVBA 1J2XA 2KRFA 3KLOA 2R7DA 3KP3A 3KSCA 1HQCA 5L3DA 1SD5A 2H09A 2VT2A 4RGRA 3BJOA 1WRJA 4TV7A 2K27A 5E8IA 2PLYA 1SD7A 5D4SA 5J6XA 3AAFA 4XSZF 4IJAA 2FE3A 4A2UA 1R23A 1J75A 2XIGA 1DPRA 3WTVC 4XF3A 3TNQA 5JSOA 4RB0A 3IC7A 3MQ0A 3S2WA 4YFXF 1NE6A 2L54A 2K02A 3WGHA 3ZMVA 2UXNA 2EFQA 2VN2A 1UHWA 3U2RA 1XDSA 4RAZA 1QZZA 5FLJA 2MH9A 2FEZA 2OZJA 4YIIA 4XFCA 4RGXA 4ESFA 1QPMA 2KIMA 1ZG5A 2STWA 4YIFA 4EJWA 2O8XA 1YO5C 2O3FA 5AVPA 1HKSA 3HSFA 1FSEA 2PQ8A 5D8LB 3ZMZA 4IEWA 2Z99A 2W57A 3PLQA 2H0VA 1VJ2A 4XF9A 2PAEA 5LHIA 5KHJA 2Z2SB 3BCWA 2GH2A 1ZRFA 1I6XA 5D4RA 3VHRA 4OIPF 4ONUA 4RGSA 3BPVA 1XCBA 4Z2YA 4M6XA 4KWJA 3GFJA 3HOSA 3K69A 2A6HF 3JZVA 3C1DA 3NKTA 1R5GA 2PHDA 2XROA 5I0SA 3LQQA 1Y0UA 3H3UA 1OPCA 4KIFA 1PP7U 1R58A 2UYAA 2BYVE 4ZU4A 4WXHA 1OFNA 4QM9A 1ZN2A 3PVBB 4E2GA 4P9FA 4JVAA 2DK5A 2A61A 2PMHA 1T0FA 4EJOA 4KMFA 2LF7A 1SD4A 3RIRA 1U5TB 3R6SA 2IXCA 1W7PB 2COMA 2YX7A 5LBQA 1GQGA 4HVRA 3UKVA 5LHGA 3REOA 1EV7A 3CJNA 4OMZA 4UUVA 3WTWC 5C8WA 4QMAA 2D5FA 3V4GA 5IT9K 1L3JA 3P9KA 5AONA 5FLXK 1P2FA 4MGZE 4UVAA 4L5IA 2L3DA 5KHHA 2UY9A 4JTOA 5BXXA 4XLPF 5BPIA 2LF8A 3QAHA 1FYLA 4IEOA 4EM0B 2J5OA 3WW3A 1J5YA 1IXSB 4AXOA 2K86A 3LQRA 3Q9SA 3E6MA 3ES4A 3FF5A 1RL3A 3GZ5A 4XFHA 5DEQA 1W4MA 2XHKA 4Q0SA 1WQ2A 4M71A 3Q9VA 2QQ9A 3F8FA 3EYYA 3GF2A 4YFNF 3ERED 5D1IA 1ZX5A 2HR3A 3I4PA 1ZZ8A 1QGPA 3SXWA 2HTJA 1ZH5A 3DN7A 4ENNA 5CVJA 3K9TA 4KMUX 4YARA 3JSOA 2VOOA 2VE9A 4A5MA 5JCTA 4IESA 4G9YA 1ZAOA 2ZCWA 4I01A 4L5JA 1BIBA 5KK1A 2HS5A 5HDGA 1FYMA 2K9ZA 4A6DA 1F1ZA 2R7FA 3BOQA 1IRGA 2LDUA
chains in the Genus database with same CATH superfamily
2NYXA 1MS4A 1ALYA 1HKQA 3FM5A 1BBYA 5GM0A 2RREA 2HXOA 3OV8A 5F32A 3WW4A 1FBUA 3ZFFB 2LP0A 2A69F 3HG9A 4HLXA 3URFA 4BS9A 3RZZA 2YC0A 5KHGA 3IWZA 3NJZA 3FLTA 5GALA 4A45A 3T0AA 2KD7A 2HYFA 2CQKA 2P0WA 1ETYA 1JYTA 1FOWA 2R3SA 3CC7I 4LBMA 2YPRA 1P7IA 3VSLA 3ZPLA 1GXQA 3RVHA 5CFCA 2CGPA 4UAPA 2E19A 1ZLKA 2BERA 4U2AA 1IV6A 3POFA 4DQ2A 1SVLA 4UI9L 4XN0A 1ZBA3 4Q0PA 5C3RA 1DQ0A 4JTNA 3RYKA 1WMXA 4P55A 1W8TA 2EQRA 1S0BA 3HJRA 3S32A 1SCRA 3OPTA 2FJ1A 5F0FA 5EGOA 1GQPA 1LOGA 1PX3A 5FAXA 1TMF3 4RA0A 2VZOA 4EGZA 1L3LA 4AL9A 3QOEA 1D0XA 2M87A 5CIRA 3K2AA 3P7NA 2AH2A 1BBT3 3M7AA 5DD8A 1ULDA 2X5IA 5FY9A 1E2XA 4QU1A 2MFZA 2I8DA 3GM8A 4IW3A 5DCMB 2ELHA 4XF0A 4ZDPA 3SH3A 5ACA2 4F92B 4A6EA 4L5EA 1R71A 5JXJA 2GC3A 2ZKNA 4HVOA 3CCUI 4ZXKA 1XOYA 3T2PA 1AXKA 3PVOA 1LVKA 4XM3A 3ZSJA 4BPZA 3K70D 1V00A 3QLQA 1ZRDA 2G0EA 1TZOA 2EXKA 2FCVA 5FPXA 5IVFA 3JB8A 1LJ9A 3IDBB 2XKOA 1FOD1 5BNPA 3C2GA 4FOWA 3OGSA 2A5YB 4C30A 1CQ9A 1V5FA 2DFIA 1G6NA 4KMQA 2W91A 4DXTA 5IK8A 2V7FA 3GZTB 3ABMH 3RKXA 3PNTA 2JVHA 1Z9CA 3M8FA 4XORA 3S17J 4A3ZA 4EYUA 1XGMA 4YZ2A 5IFPA 4UBHA 3FM3A 2DMQA 4FPEA 1RKTA 1JUIA 3I3MA 2M9HA 3WQ0A 3OYMA 5CADA 3M1HA 1OCTC 1MVEA 4P1WA 4V2GA 4OAYA 2EWNA 4Z6YA 2XLAA 3KP6A 3PTRB 1UZYA 2EK5A 1D5VA 4CUBA 4D7YA 5ILUA 2VQLA 5T5JA 2X6WA 3OMYA 4LKSA 1BJZA 5E1ZB 2CO5A 4XURA 4ASMB 1AUYA 3WP6A 3O8HA 5DAXA 2HVSA 5CQEA 3L2UA 5IT9Z 4QXBA 1KQRA 1N1YA 3OOPA 2VZRA 5I93A 3HOYJ 3O2PE 4RQPC 3J7HA 3CHXA 3AK0A 1YQ6A 3LDBA 4N43A 2A6EF 2MEV1 5I8SA 2WA3A 4ENKA 3AJZA 4CYDA 1FC3A 3KP7A 1AR61 3ES1A 4YG6A 2IXLA 2HYXA 1DCSA 5J1RA 2O8OA 4W97A 3DPRA 2HWB1 3CO6C 2P7CB 4UWDA 3FFQA 4YSFA 4ZDOA 1W0TA 2A68F 1PM7A 4PDWC 3E5UA 3T1BA 4A7KA 4UF0A 2KZGA 4P00B 3GLXA 1CAXA 1KS5A 1TNSA 1AF9A 1W8OA 4UHTA 2X51A 2IA1A 4M01A 4XCBA 2RS12 2YFUA 1BW6A 1V9U2 1J3RA 4C0HA 1A6IA 4RMNA 3HT1A 3RPQA 1EYBA 1HC8A 4PUSA 4XACA 3OGRA 3DXTA 1YHQI 4M3DA 4W4ZA 1M06G 3T30A 4G7HF 2JDHA 1UOFA 2DQLA 3L2QA 2IC1A 1OH3A 2RDQA 2VZ1A 4H0EA 4PCQA 2QGUA 3TO9A 4AFDA 4UUSA 1UMZA 1B9NA 2IBDA 3ZXJA 2ZJPF 1HW1A 1U5TA 1LODA 4AD9A 2WQ8A 2R7WA 1W7PA 4BCUA 4QIWN 3PO3J 1QDCA 5DAWA 2FQ4A 3PQKA 3TYJA 5FPBA 2LK2A 1ETXA 3AP7A 1RUC2 1PVXA 4P9XA 2Y6FA 3W5NA 2B5HA 1SD6A 4FOVA 4CCMA 5HLTA 1YO8A 1JW6A 3GYHX 4HF0A 2KDZA 4IGPA 1U2WA 3S93A 4B8XA 3IPVB 5FZLA 1OXCA 2JIJA 5BNGA 1UY0A 3OYBA 5LD2C 1YQCA 3DXJF 1HKTA 4W6WA 4HOBA 3VD7A 5F6KA 3D0SA 2IS6A 4QGNA 4LUMA 2KDOA 1W9FA 1HKDA 4YM2A 3VYRB 1COV1 1UXZA 2A3WA 2ZGUA 4UYBA 1KONA 1HJGA 1O7LA 4P9IA 3LIHA 3C7EA 3JAMK 3SITA 1U8RA 1E17A 5CYYA 4AQTA 3CDZB 3IIIA 4GALA 3U1XA 1GV5A 3M8EA 5HS8A 3HUGA 3LL7A 4OIQF 5A70A 4EM1A 5A6ZA 3RI9A 2WAOA 1MSFC 3N7MA 4LA3A 2HWF1 1ND3C 1KDMA 3RZDJ 1JZ6A 2VLAA 3ZXAC 3L7WA 1VAMA 1O4YA 2XV4S 4WX9A 5FP3A 4XLAA 2CFXA 3OGJA 4FTEA 2HGCA 5FZHA 2R042 4BKXA 3AMMA 3OF1A 1WA4A 4BXUA 2DU0A 3W59A 2ELJA 4O65A 1RHI1 3C2HA 3OD0A 4KN7X 5DN2A 2XDVA 3J80K 3AP6A 4XFBA 2M4KA 1C57A 4ZDLA 2O8QA 4JZRA 5AC91 4RR3C 1J9IA 1S0IA 4CCLA 2KKOA 5B4NA 3M3IA 2GC2A 5D6FA 3BIWE 4BQQA 2W1WA 4LK7A 4LO7A 5F5CA 3U9GA 3LIGA 2VBWA 2DBNA 3JRIA 4C3HJ 2WZPP 1TWAJ 3IAQA 3SNMA 4IGOA 1J1TA 2EXIA 2DFCA 4LR4A 1FTTA 1CONA 3OJBA 4RYDA 1UQXA 1Y8RB 2P17A 3LSDA 3MIGA 1LVAA 4B7KA 2EPFA 1FMD1 3A0NA 4GB31 3SLIA 2LM3A 4N4OB 4R52A 4MLOA 1QEXA 4G7OF 1TTYA 1TWCJ 2D45A 2IAIA 4RGGA 2BHYA 1AKHA 2CAUA 5LGTA 3M70A 2RDPA 1Z05A 3VKLA 1JTZX 2VBXA 4LO5B 1UOGA 3LD8A 1YFYA 1I3AA 2OQRA 4F3QA 3GFIA 4UFLA 2C5DA 1GBGA 2LR8A 5EEGA 1GHCA 2VVFA 4A3XA 5JZGC 2YYOA 4YYOA 5F9TA 3HRSA 5FRNA 1LOAA 2RMU1 4AEMA 2DU1A 2DMTA 2HQ5A 2CMPA 3U1KA 2KXLA 4AZZA 4HF2A 1HIXA 3ZQIA 4D7NA 3E7LA 1RUH1 5A32B 3S14J 2B7EA 1R64A 1G9AA 3OUHA 3RZLA 2ZGOA 4AQ6A 2Y30A 3CF6E 2A5WA 1ODDA 1SG3A 1ZRCA 5HXVA 5FFZA 2ZGSA 3ZM8A 4XBLA 2AO9A 1NCQC 1RRJA 1LUJB 2E2HJ 5H6RA 5B3SH 2L4MA 1W2OA 2YV8A 3F6OA 2UWAA 5FZFA 2FD5A 3HR9A 1G9FA 1A6CA 2R0HA 2R7VA 5J98B 5JI6A 4KG8A 4U7BA 3MF6A 1CPNA 1WCKA 4UW3A 3FXQA 4FPGA 1AR62 2OVUA 2WNUB 2OPTA 1CZSA 3PMEA 3IH4A 5GP9A 1NK2P 1AR82 3K3OA 1QBJA 4WM7B 1YW7A 4BWOA 2ZGRA 5E16A 3SCFA 1KU9A 2XBO1 1JKOC 2Y60A 1RGSA 1LHNA 5LA0A 2CQXA 1QVUA 2NVUB 4PSXA 2FBEA 2OV7A 3LOIA 1QRYA 1H1IA 2OU2A 1RINA 1AYM1 5T54A 3BPXA 2NXNB 1ND2C 1PNFA 3AMQA 3LPGA 1STMA 2F5CA 3K4ZA 4Q4Y1 5CVVA 3WDWA 2ZC2A 4PJLA 4OULA 1CWPA 3O1TA 4KGGA 3GTKJ 5D8AA 3I59A 2C6SA 1IPSA 2NRAC 3AZYA 2ARXA 4YLZA 2VECA 3HBKA 5C9AA 4AHYA 1I1GA 4BEHB 1SMVA 3J7LA 3SH5A 4E6KG 2RDNA 3MUY1 1R6RA 2R7XA 3FMSA 1VBA3 1LULA 3ONQA 1C1LA 4BXXJ 4XF1A 5J40A 1A3KA 2OUMA 2EVXA 2ZSIB 1GXPA 3OS0A 5JSRA 5DABA 3MHZA 2FOWA 2QWWA 2P6HA 2E7QA 4FFFA 2P5KA 2VODA 4FAHA 1IRZA 1GDTA 4HF1A 1N47A 2WAQN 1MBJA 3I0TA 4I76A 2V5DA 1OKRA 2BHZA 1N1VA 3GWZA 3JAMZ 3K4DA 4DYQA 2AENA 2CSOA 3RMYA 3G2BA 1OLTA 4Y15A 3S3MA 4Q5OA 4Y33A 3ZYHA 4EWDA 1QNWA 3ABKH 4XMIA 1L7LA 3NNMA 1JHHA 4XLNF 1K45A 3BTCA 1VQ7I 2XJVA 5JI7A 1O3RA 2O03A 5K7ZA 2ZX2A 3H8UA 1FX5A 5FZ4A 1LR5A 1MEC1 3H35A 1CZVA 3HRTA 4NHYA 3I71A 3F8MA 1HXS3 4IUGA 3K0LA 4FQZA 5F3CA 3K4JA 1ZR4A 4RB2C 2WWUA 4BK4A 3ILNA 4PBPA 3T1LA 4D5FA 1HSTA 2M2EA 5IJRA 3CNAA 1ZRRA 4CO8A 1IGOA 2MLKA 5A7NA 1FATA 4YGCA 2VZ3A 4DFSA 3W2AA 4BQYA 5I0DA 4KISA 3WQ1A 1T08B 3VDDB 4PJ0C 4LJHA 3H42B 1NY72 1G9DA 4CUCA 5C4WC 1ZBE1 4GO1A 1Y7BA 3VUOA 2VZVA 2NLRA 3OOXA 4IEQA 3RYRA 2VNRA 2JK3A 4F93B 4P02B 3R4UA 3BP8A 5EZWA 4Y5TA 4LNVA 2R7ZJ 4CPBD 3CO2A 1QJU1 2VY0A 4YELA 3J7ZI 2XR4A 5A3MA 3IRRA 3BVCA 1IGNA 1F15A 5KAIC 4Y22B 4Q4W3 1EH7A 2ZMEA 3CJIC 2O5RA 3CLQA 3DKWA 3P5BA 1S8NA 1D8JA 2BDRA 2FDKA 2V1NA 1B59A 2IGMA 5DXDA 1CAWA 4R9AA 3OYHA 2PMWB 3VN4A 5BQTA 2ECCA 3E1F1 3N9MA 4HPQA 1FMD2 4A3FJ 1FIPA 4XUQA 4D94A 1RC6A 3P3NA 5FZ1A 1C0WA 5KR7A 2VOXA 3KT1A 2E6VA 1VALA 4LK6A 1DGWA 3ZFGB 2DURA 4FCYA 5E8AA 4Y1XA 2GNBA 1DQ6A 2DVGA 4C91A 5C4JJ 1LU2A 1XU2A 1S0EA 3A01B 3ZXLA 5J8FA 1XNAA 3RZOJ 2BUKA 1GLHA 3DXUA 3MIFA 2WUHA 5DCFA 1APNA 1LEAA 1J58A 2HNHA 1D2QA 1ZZ7A 2QQPA 1FBQA 4UFJA 1RUH2 5FLVA 3ZX7A 1TVGA 2PLV2 4C2TA 2MD5A 4SLIA 2QVSB 1BM9A 5C6CA 1GFF2 3WHCA 2X48A 4RD7A 2VTXJ 3PL0A 2ELKA 2YG0A 1S29A 1PHMA 2X10A 4OHVA 2O0YA 1RUE3 2F4PA 3IV5A 1LFBA 2CGOA 1OOPB 2I5UA 2YUEA 1JYNA 3FBMA 2QZ2A 2VONA 5BNNB 2BVLA 2F4IA 1REEA 1UY2A 3E5XA 3DTKA 2JA7J 1WHUA 1FZPB 3HRMA 2IA0A 3I4IA 3KGLA 5DDJ3 3OBAA 5FZBA 4WWCA 3F23A 1XTAA 3PQJA 4WZCA 1WCUA 1ZBA1 3TN93 1PK6B 1YRNA 4RAYA 5JHFA 3ON7A 1V6LA 1D4M2 1ASJ3 5FZDA 2JG8B 1UMQA 2BGCA 1D0GA 3AYCA 3I64A 2XBO2 2IXIA 1YC61 1TMF1 4JYKA 4QPIC 5ICGA 1W3VA 5FY1A 1VRH2 3R0JA 1T95A 4NIHA 1W05A 1PP8F 2C1FA 4XFFA 2L9VA 3L1PA 5KXCA 1POV0 2GC0A 1UU5A 1BBT1 2GNMA 1TLHB 3J7AO 1AYM2 1OLMA 4LE3A 4NHMA 3BY6A 4YM0A 3QPSA 3OBTA 1UHSA 3X29B 5LGNA 4CEYA 2XLFA 5FB2A 2E1CA 2PHTA 2VXJA 1NQDA 2QBYA 4PCRA 2LKPA 1UY4A 2R7TA 1GUIA 3MFAA 4XCAA 5CLSA 4CDWC 2PQQA 5HLIA 3EUHC 4FE7A 3POGA 3KD4A 3CF5F 2RR13 2R7RA 1QXPA 3KX2A 3V0BB 2SBAA 2WO1A 3PSFA 1H8TC 2RE9A 5IP6A 5JR2A 3EPZA 3ZYGA 1BK0A 2M3AA 4LG0B 4RB3C 3LAGA 1JGSA 1EAH3 3CJQB 1CVNA 3H1YA 3VBRC 2VMDA 1HX6A 4XN3A 2DBIA 5C8CB 4MQVA 2L5QA 2QEXI 2RVAA 5EYXA 2KFDA 5LA2A 2HXIA 4IHVA 5FR3A 1I39A 2PBIA 2HOSA 1QHDA 4NWWA 3THTA 2Y34A 2VBYA 5K1YA 1UNBA 3ECOA 2H94A 1UYXA 5FWEA 2RM22 2AUYA 3FXLA 3RZGA 3BG6A 4CUGA 1MEC2 1QU0A 2PYTA 3OYNA 5FP4A 3P6BA 4TLGA 4BJ6C 2C24A 2R1BA 3WQBA 3PUQA 4UOJA 5KHDA 1OR7C 3W6VA 3H3ZA 2GNDA 1B4AA 2GC1A 2PHWA 1X3ZB 4XBQA 2BW3B 2YFZA 1R082 1UYZA 1IQAA 3PM1A 4AQ2A 2XAJA 4PGGA 5ANNA 3IH3A 2ESHA 1YITI 3B9IA 4IEPA 5FY0A 4PIZA 2C9KA 1ZRIA 2D1HA 3Q0VA 3ILFA 3KV9A 4XAAA 4Y1YA 4YPJA 5F2WA 2B9VA 3P9IA 3CCSI 5C70A 3VBFB 3CL1A 2R93J 3S30A 4U87A 5FZ6A 4BOWA 1TQIA 4XQFA 5CFDA 3VLBB 4RLFA 2WN2A 3Q8EA 4NRQA 1JZ7A 3AG2H 3CDHA 2ERFA 1IXRC 3EQEA 3ZVXA 3H0GJ 3FXKA 3K2ZA 2EBIA 5FO8B 5DUWA 1GVJA 3CCEI 1AL23 2G9ZA 1K3IA 5JPNB 2QVOA 3ME2A 4SBVA 3M4FA 4IGQA 4AU7A 2HTSA 4MFDA 3D8CA 1NKGA 4U0VA 1FBSA 1EPWA 2EZHA 3CF2A 3FJSA 3QACA 4RA2A 3WTSC 5HNFA 3LOCA 4E70A 1FYKA 1T6GC 1AYN3 2YY1A 2G7UA 1GOFA 3AB0A 3DBHB 3LA2A 2E33A 3WX5A 4Z2WA 2MA3A 4XRSA 4ITVA 1E57A 1W0PA 1P4AA 5EJ3A 2JA6J 4CDXC 1AR73 5A1AA 3IBMA 2LS6A 3DYMA 2Y69H 2ZOEB 4QPGA 4FQGA 1QVTA 2BV6A 1SFYA 1H9TA 1ZYRF 3DF8A 4A3MJ 3PUHA 3JUUA 3KV4A 4HKLA 3ACHA 2CUEA 3BOPA 4CCOA 4I02A 1WVRA 4OQ9A 1N75A 2CW0F 5HV0A 3TDUC 5F6LB 3ZQLA 1XMAA 3QH6A 1WLTA 4LXLA 4RS5B 3WDYA 4BDYA 3S57A 4Q47A 3S1QJ 2STTA 4CP9A 1A34A 3DEUA 4Z1VA 2JSPA 4HSLA 1JZ3A 1NA1C 2XPWA 5HI0A 5D6EA 1W1WE 1ETKA 1IJWC 4NIIA 1GNHA 2X85A 4AIJA 4KU8A 2GWRA 3BTJA 1YFUA 3HC7A 2JPCA 4NMIA 5EP9A 4A3CJ 1YJWI 1LE8A 2KMUA 1O3SA 1FNYA 2HFHA 5L7OC 2DOEA 3TO7A 2JECA 3FZ3A 3RYPA 1BMV2 3ABZA 3JW4A 1H89C 2JWPA 1Z78A 2XF5A 4E8CA 3IWFA 2WKKA 4FTBA 3OS1A 3OSGA 3BR6A 1WLWA 5FK8A 3JBG2 2R92J 1E5HA 1VFCA 4GA9A 5CAZA 3LAPA 1QHGA 4AEJA 2V6CA 5FQ0B 3HYIA 2K4BA 4MEXF 5DM7F 2ZS6B 2Y33A 1H8AC 2M1BA 1UN1A 5I8TA 5EJZB 3K1MA 2Q2EB 1TMF2 1VBD3 5DZGA 5ABJB 3I56I 2B42B 4BQ4A 3KF3A 4BDZA 2B9SA 3ST7A 3B7MA 1BBT2 3LSMA 4WM8A 2DDBA 3BDDA 2J1VA 2PJPA 4QQLA 2VR4A 3HOWJ 1QQP3 1O4ZA 2K7LA 3H3VK 1CESA 1TBXA 1ON1A 1PO12 2JDZA 1R092 1MDMB 4KL1A 1FOXA 1ENXA 1YJNI 1OYWA 4QB6A 1UKGA 4BQ2A 3WTXC 4FASD 3O1OA 3AVRA 3FDYA 4M9ZA 3CJTB 3RDIA 4D7TA 2HWE3 2DDAA 2UY8A 3ZFEC 2RS33 5FO5A 4BM8A 3CCYA 5GAGJ 4ZYEA 4CRQA 3BPSA 5FO9B 3S2HJ 3O5SA 4BY1J 4KG0A 4K2EA 2RS53 5HLHA 3ZXEA 1JTYA 2RKHA 2CDPA 3PJYA 3T2QA 3IAS2 3P9CA 1DU3D 1IN7A 4PDKA 2GP5A 3JQWA 2D6KA 2QQVA 2JEMA 4EN8B 2GALA 1VIWB 2RNGA 2L7FP 1B09A 3O3KA 2W85A 5HNHA 3K46A 2FZ2A 1XC5A 1HBXG 4N9IA 1MH4A 3SDBA 3N9PA 1JYVA 3MZ8A 2ZMNA 1VQ8I 3BC8A 5LASA 2GA2A 4QAWA 1GICA 1Z6TA 4YZ4A 2VG9A 1DGWY 1QO0D 2YB7A 3HOXJ 3K10A 3SEPA 2VUJA 5E3OA 5GZCA 2JJ6A 3SCGA 4TZDA 2IRFG 5TGTA 4A69C 4QLCU 1ACCA 4ITCA 1IN4A 4Y7NJ 2R0QC 2DUOA 3ACLA 2LKXA 1MMGA 1BKZA 3FXUA 1PM4A 1W39A 2D98A 1UU4A 4XUTA 1VBC2 5FKBA 3WNNA 4BY7J 3N9NA 3MO4A 4D9JA 3BTIA 1ITYA 5KC5A 2JE8A 5ED4A 1PGL1 5IP7J 4PDWA 5C7GA 3VBOB 2BFUS 2LFBA 2DFBA 4B29A 3F8CA 4LUKA 2P37A 4IQ4A 1CJDA 3OIPA 1Z0XA 3G6JB 3LFIA 3MLKA 1RMU2 2BTVC 4L2NA 1LKNA 4YVSA 5L19A 2OTLI 5LWBA 4FSJA 2WB1A 1H0BA 3HN1A 2Y6LA 2X6OA 3PU8A 3DYOA 3PU3A 1WRJA 4TV7A 3KWVA 4FVVA 1XXNA 2CGNA 2K27A 4JX4A 2LD5A 3LFUA 3LSEA 1RB8G 1C3HA 1BW5A 2LALA 3UNPA 5IVVA 3AAFA 4XSZF 2B39A 4DZGA 3PUSA 1DPRA 1RUG3 5CA6A 3M3YJ 3MQ0A 4AVTA 1LFUP 3S2WA 4YFXF 2VO5A 3CCQI 4FXGB 4A3IJ 2UXNA 5AFEA 4BDVB 1KZHA 4RAZA 1BLZA 1U5IA 5LZ6A 1VBA1 3WR0A 1F31A 4DZPA 3N9OA 1N1SA 4YIIA 2TBVA 4RGXA 3HD8B 5J1YA 1ZG5A 1JZ5A 5FMBA 2O9LA 4EJWA 2YC2A 3DWLE 4H3WA 1T6BX 2DVDA 3RQIA 4IEWA 4QKFA 1BJQA 1IG7A 1VJ2A 2GH2A 1Y43B 1V5EA 1ZRFA 2IZWA 4M3CA 3ZQQA 1RJ7A 5JXGA 1UG0A 4Z2YA 4M6XA 3GFJA 3HOSA 3K69A 3NKTA 1MNDA 3BZKA 3LQQA 4XQ4A 3A02A 4QB1A 3SFIA 3S5AA 3CP2A 1PP7U 3EXUA 3SQOA 2LUWA 1ZN2A 5E3NA 2MABA 1DFQA 1VB2A 5FRAA 3LSKA 5L9RA 2PMHA 4LOTA 2JDMA 3VZMA 3HB9A 2XJPA 2VJ5A 3ZQCA 3OL4A 3WHBA 1GZ9A 2COMA 1WJDA 4C2UA 5LBQA 1WA6X 3GTOJ 2J1TA 1ETOA 3CJNA 2ZHKA 3AL0B 3JCIA 5DZFA 1HXS1 3WTWC 4JKLA 1VQ5I 3HNMA 4QMAA 2WO3A 3N3HA 1L3JA 3HEFA 4XVHA 2BGPA 2Y0IA 2AXTC 2LF8A 1FYLA 1WCDJ 2VZQA 2WV1A 4EM0B 4XILA 1IO2A 3CP8A 2K86A 3LQRA 3ES4A 3PJRA 2DUPA 3MFCA 2BZTA 3IMNA 4N53B 1Y1WJ 5FYVA 4Q1PA 2IVIB 1SZBA 4XPVA 3F8FA 3EYYA 3VB9A 2WO7A 4YFNF 1TWHJ 1CR7A 1ZX5A 1RIRA 3LSGA 2PHUA 2JA8J 4CXXA 2GP3A 3C7GA 1POGA 2HTJA 5CVJA 2O0OA 3RJRA 4Q4W1 5FOBB 4BGDA 4CU7A 2KIQA 1WWYA 2E26A 3IDEA 4YVWB 3VHOA 2CQNA 3K3NA 3HJEA 4JP0A 3BTXA 4XUNA 2D97A 4IOAF 5IYDJ 2M0CA 5CFCC 5CKTA 5GTHC 4G4FA 4HEA2 2R7FA 3BOQA 1KFUL 5FMDA 3KCXA 1TME2 1GZTA 1UZ0A 3JR9A 2PJRB 4W6YA 1R4MB 3SXYA 1E5IA 4B3NA 1TNTA 1OUXA 4PIYA 3GZEA 1JYIA 1BC8C 4XAEA 1W06A 2EFNA 1JU4A 4IV1C 3L9FA 4A6SA 3EMRA 1D8KA 1N1TA 4CVUA 1K79A 3LFKA 4FO9A 1A04A 2F2EA 4AIHA 4NIGA 2VUAA 5C3PA 1BC7C 5FCCA 2EXHA 2WO2A 3GW2A 2EIMH 3LMMA 4X1EA 1TNRA 2X5IC 4XDPA 4HV6A 2DVBA 4IKFA 3ELNA 3LDKA 1VBE3 2VW2A 2K9QA 3M4OJ 5GZFA 3D0JA 4A0ZA 1WLDA 1VQLI 4JX0A 4V2WA 5K0UB 5TJJA 1X19A 2LBFB 1SC7A 5FPLA 3ZN6A 1ZVFA 1XCVA 2XGEA 4XKWA 3SEQA 5FYZA 3PVNA 1FP1D 1RUE1 3MV11 2Z69A 3CUQB 3NWSA 5CVIA 3RJPA 1W8WA 4FX0A 1A8DA 3NAPB 1JHNA 4MYEA 2BBVA 3K4MA 3H0OA 2QM3A 2FU4A 1I6HJ 5BNPC 4F83A 3M8JA 4HYEA 3I2JA 1CD3G 1RESA 4WXDA 1T2XA 5DDJ1 1BR1A 3AX4A 2EV5A 2WWJA 1IQDC 3ETPA 2PAMA 1W5SA 5A2QK 3NSTA 4JGYB 3VD4A 3TN91 1AXYA 2QQUA 2DW4A 1T8IA 2OD5A 2ZXQA 5EFUA 1Q8PA 1EV13 2CHHA 5DZEA 5FY4A 1ASJ1 5FIXA 5J3UA 4TN7A 4QTRA 3F8BA 1R1A3 3EUKL 1QGLA 1ZG3A 5DAVA 3Q8CA 4FPKA 4S05A 3WU1B 5D5VB 4K20A 2HOTA 1IW7F 4MNUA 2ZXHA 5E17F 4ZYAA 1UX7A 2DOFA 3USSA 3D82A 3PL8A 1X58A 1QA6A 1QJX3 3ELKA 3USUA 4XE9A 3EO6A 1ZR2A 5FLIA 3LWCA 3VZJA 5J4VA 1V6OA 2R7SA 3WCRA 1O8SA 1G7YA 1VBA2 4LORA 4N43C 1G2HA 2IWGB 2RR11 4NC6A 1BVP1 2XH6A 2E1OA 5FK7A 2D6PA 1X1AA 3GTLJ 1U8BA 5SV5A 3LQCA 2IPQX 3HPGA 2DVAA 5ICEA 3K4KA 1EAH1 3IRQA 3ABUA 1D4VB 5JPMB 5A3NA 4Q4V3 1X8EA 2BNOA 4DEVA 2XGDA 3MD2A 3NJXA 4CTEA 4B4PA 5T55A 5FYYA 4AAXA 3KS7A 2HWVA 1X3UA 4UFIA 1EH8A 1MW7A 5LEKA 5LA9A 1ZG1A 3SZGA 1DGRA 1US2A 2BE5F 4CEWA 5FXVA 2LTNA 4L0YB 1W7PD 3ZMTA 1H4GA 3IHUA 4GDFA 1ERDA 3OIOA 4E4HA 4AGRA 2HVRA 5FZ7A 1LDKB 3V8JA 5GAHJ 5A3WA 1VBB2 4KT5C 3VDXA 2XWJB 1GQHA 2WRAA 3CEWA 1C8M3 3OEAA 3ZN5A 3QQAA 2VU9A 3D6EA 1FAYA 1JZ4A 2NVQJ 4AI3A 1ULOA 1HXS2 2WFPA 4BXSV 4UXAA 4RM2A 2ZACA 5A7QA 3WTZA 3VKFC 1PIV3 4FXKB 1U5TC 4NR1A 2GIZA 1W9TA 3PNAA 3AYEA 1B35A 2CV2A 4IRHA 3AXEA 1PGW1 2QDRA 4AIDA 3HBZA 1S55A 3OYWB 1HDPA 1C5IA 5LB6A 3MFKA 1QH6A 4NVPA 3ZXFA 5IT6A 2E5NA 5JAXA 4HSJA 3I2GA 1F43A 3S5QA 4BQXA 2DYSH 1NT0A 1WGXA 3MVPA 1G8XA 3H8OA 1AZDA 1HB4A 4BYYA 2WWYA 2BJSA 1D0ZA 3I3BA 2WNVA 2IXKA 1UXXX 2X29A 2L9RA 1XE7A 2DT7B 1HB2A 1W6MB 1AL21 1W0OA 3RS6A 4CSWA 5C3EJ 4Q4W2 4IERA 5IVYA 1EUUA 2V9VA 3GF6A 3D5OA 4IQPA 2GN7A 4CP0A 1YLFA 3VBSB 4H14A 3ZMDA 5FLMJ 1Y3TA 4DYRA 2Z5WA 1AYN1 1HRV2 5FUNA 4MGRA 1OA4A 2WNEA 2ZAAA 4DOZA 4HVQA 1R1ZA 2BXZA 4JDMA 1AR71 3BI3A 1RIOH 2A3SA 5FJKA 1T33A 3E3VA 2CV6A 2R063 4RAGA 1WJFA 1SPPB 1AX0A 2XXZA 3ZLIA 3BODA 1DZRA 2VM9A 5ANQA 1JKRC 2ORZA 1TT0A 4TLFA 2M8EA 1XSVA 3WU2C 5F04A 3DPRB 3MCZA 2HYGD 5HPOA 5I0RA 4QX0A 2VC1A 2Q8OA 1GOHA 2Y75A 2IJLA 2CWSA 3SEEA 1NHAA 2L4AA 3PHMA 1UCRA 3VEPA 2Q5TA 1BR4A 1GVDA 3GCMA 3S1NJ 1DPUA 1CAXB 4XDQA 1BN5A 1AOYA 4ZU7A 2P6SA 2QTWB 2OX0A 5A2QZ 2AC1A 4KIBA 3FZVA 3POBA 3SKJE 3I97A 3KLNA 1RUE2 1QKQA 1G86A 3FBYA 2XC7A 3KP5A 4EJRA 1Q8QA 3VKNA 4XICA 2XOMA 3VZKA 2K85A 1MS9A 1LCLA 2ZKZA 1W6QA 1I3QJ 2VJ4A 1IG0A 1NCRA 1FJLA 2FCUA 3C7JA 2Y0SA 4YZ5A 4MO3M 1JOPA 2JD4A 2NMNA 1YX5A 3ZFFA 2CY6A 2NM1A 3VOEA 2BWAA 4IX7A 1TC3C 5GLVA 5JOZA 1AA7A 3CUOA 1GP5A 2ZZQA 2EIJH 4P96A 2M45A 2EFOA 2WLPA 1NZCA 3DTEA 3BU0A 2ID6A 3UL2A 4DUVA 3VZNA 1VBD1 3QPLA 2AREA 3F2ZA 3VFZA 1W03A 3INAA 3E97A 3CCLI 4WCGA 1REDA 1RITA 3IDAA 2VZSA 5FZMA 2HWD3 1VQPI 1W9YA 4W6XA 1TP4A 4CP2A 1QQP1 1ZGAA 3JU9A 5E8GA 2O7OA 2GAUA 3U1DA 3DCFA 1YJLA 1UW8A 2V4VA 4B3XA 4DO0A 4ON0A 2P3KA 4HN0A 4XC9A 1OYYA 3EUHA 4EGYA 2HWE1 4F3JA 1V4RA 4ENJA 1UZCA 5F6FA 2RS31 2GNTA 4JV4A 1TW2A 1H8TA 2NS7A 4D8MA 4D0PA 3K4LA 2WABA 4DXSA 5I91A 4MTEA 4CZZA 4M9XA 3HUGB 4Y3OA 3OEBA 3GBWA 2RS51 3M8LA 5H6QA 1G9CA 3TOBA 1LDDA 3V56A 1JYXA 1NG0A 1YQ8A 1KA8A 1OPMA 1Z7UA 5DCMA 1AR92 2HEOA 5DUIA 5K9YA 1USTA 1YFXA 2WFF2 4II3A 3OD4A 4OHXA 2IP2A 3NNFA 4B4CA 2V73A 5BMZA 1NG6A 1DG6A 3M7GA 4TXWA 1HB1A 5CB7A 1DYOA 4B3AA 5FYHA 1AHDP 2W84A 1I3HA 4ETSA 3I54A 3IAM2 1Q8OA 1NH3A 4GULA 2Z42A 1MQTB 2ID4A 2KPMA 4RS8A 2PELA 5C9AC 3W6KB 3DF0A 3VBUC 1OA3A 1XU1A 1VAKA 5BNOB 4K40A 2YBSA 4C1XA 3LA7A 4DZJA 4K6BA 1YG2A 3H7JA 3K77A 3FFZA 2QQNA 2ZZJA 1HRI3 2J5PA 2VW1A 3ENRA 1YIJI 3C3VA 1PGW2 3A0BC 3WG7H 1AKHB 1NG7A 1K42A 1SLBA 4K7JA 1XDUA 4ZONA 5FPAA 2E71A 1YX3A 5F5QA 1SLCA 2D43A 3FX3A 3VKMA 5JVGF 1R1UA 3VDBA 4BQ1A 4ATFA 4LBLA 4COZA 3J7MA 4OCTA 4HG6B 4FOYA 1UAAA 5A1FA 1ST8A 4BIFA 3GFLA 1MBEA 5E6HA 3WG4A 4KWLA 1K78B 1S0CA 4UW5A 1BL0A 2JTVA 1HDDC 4BE2A 2WS92 1XSRA 1RUG1 5C4XJ 4MGYE 4DMIA 4AEDA 5HODA 5CVRA 2XSJC 3I3EA 1AYN2 2ZGMA 1HOMA 4CDXA 1XNBA 2X53S 2EIDA 4OIOF 1BI3A 1CF7B 2E2JJ 1UF2C 2LW8A 5FXZA 4M9SA 4UFHA 1AR72 4AUXA 1OPOA 4I6ZA 4XKBA 4R1HA 4GFBA 1U5XA 3FUQA 3OYLA 1YQ5A 2ZBJA 4Z2AA 2A6XA 4M72A 2KJCA 1UOJA 1VQ6I 2IGKA 1H2KA 3K48A 2EJRA 4HBLA 3GALA 3ZXGA 2ORXA 3JD73 4II2A 3WTTC 2WDBA 3MICA 4XBNA 1VZ0A 1NA1A 3NEUA 2R073 2WZR3 3PFIA 1LOFA 2GOMA 2EV0A 4MHGA 1JYWA 4MV2A 1X50A 4MX3A 1PMHX 5KHKA 3ECHA 4FPLA 3CLOA 3DP7A 2VASA 3I9V2 4DGWB 4COUA 3UETA 2TCTA 2OZ6A 4CXFA 2ICWG 3JRDA 1C5HA 3HQRA 3O1UA 1K7AA 2GLOA 3U75A 1SFKA 2BY3A 5D8AB 4I3PA 2GU9A 4D5CA 1JI6A 2CG4A 2J7MA 1IHMA 4EROA 4EATA 3NAUA 4OI2A 1EF4A 4IE5A 4PIXA 4YNIA 1T6SA 3I2HA 3WE2A 4COYA 2WWSA 1LHOA 4L97A 3IPVA 2Y26A 4GMP3 3N7JA 1I1SA 4MFEA 4L92A 3ML6A 4A7ZA 1PO23 1W6PB 3KB5A 2GN3A 2QKDA 3QBQA 1UAIA 4NPRA 1WD4A 2P5VA 1X4OA 3WG2A 1QDOA 2XVCA 2XUMA 2D1VA 3IB3A 4UXNA 2GQQA 1CJPA 1VQOI 1Z67A 1FV2A 5H9QA 3BN6A 5FZ9A 3UGHA 1N3QA 4MGKE 5IOYA 5K8SA 1OKOA 4HLTA 4M00A 1XS9A 1P7JA 4QWQA 1LENA 1WW7A 4AE2A 3ABTA 4GWJA 2LY2A 4HKWA 1WBFA 3KEYA 1G4DA 3D1NI 2EIEA 4KYWA 5LY2A 4C2MJ 4Y17A 1YE9A 3W3CA 2NVTJ 1RVF2 3FLPA 4M3GA 5F27A 5FOJB 2HWE2 1K5MB 2QF7A 2CRGA 3AFGA 2IEKA 1N78A 5LCWL 5F0CA 1F5TA 4NIDA 1D0YA 2DCTA 4OIRF 3CTAA 4LJZF 2W87A 1YWKA 2OUJA 2ID3A 3WDXA 2VXDA 1ZREA 4FBFA 4IHSA 1LESA 4CDGA 4CDUC 2V1XA 1Z7S2 4FTSA 3DBRB 2VD7A 1F4KA 2IS4A 1DQ4A 4O5VA 2VQUA 1OURA 3V65A 4RFRB 2H1LA 3DU5A 2XAQA 3DLAA 3OS2A 5JUVA 1N77A 2L9NA 3GJAA 4WF2A 4HNVA 1ZELA 1VBE1 2A75A 3PURA 4ANJA 2Y48A 3U78A 4ISRA 2DA6A 2WYFA 2YXSA 4LPLA 1FI2A 4OHWA 2HOAA 2XJQA 2DTZA 3MIBA 3FKIJ 2ZMEB 4JQRA 5IHRA 2EB7A 2LMDA 3LPFA 1BEV3 4DRVA 1R4NB 3LSIA 3VODA 4QB2A 5FBJA 2LYCA 3A23A 4FP3A 3F8NA 1U5YA 3D5RC 2ZEWA 2QFEA 5EZHA 2F5DA 5A6XA 3I5UA 1SMYF 2YBPA 4IV3B 4MXVA 1S7AA 4JQFA 1I5ZA 2C26A 2L2OA 3VBHB 4ASKA 5A32A 2ZNZA 1XPXA 4EZHA 3HT2A 3PIJA 2HWC3 3H5AA 1EV11 5J37A 1K61A 3FK7A 3ZO0B 4I0BA 1OCCH 3OR2C 1VQ4I 4MGTA 3NRVA 3G3ZA 4NUBA 5APAA 4BQOA 3SC7X 2FQ3A 2W82A 4M3BA 1E3OC 1EY2A 2ZFWA 1R1A1 4ES8A 1SFUA 4AAPA 5F64A 4A3GJ 2WTEA 2DODA 3ZPYA 4QD2A 4C90A 4L9BA 1WW4A 3P3PA 3FUOA 2D7FA 2FNPA 3WG9A 3EJKA 5IYBJ 2XAHA 5D2AA 4EEFG 4QGMA 5IK4A 5EEHA 4LO6B 5JHUA 2W24A 1H1AA 5JOWA 3WINE 1XE8A 3QODA 2OQGA 2JKBA 1Q8SA 4B1RA 3B01A 2C9AA 1YJ9I 3WODF 4AF9A 4HMZA 3FE5A 1QJX1 4I30A 4QQOA 2WNUA 1R49A 5LEJA 3JREA 3W2WA 3DKQA 4FETA 3TMOA 4WM7A 4JGZB 2KL4A 2JG9B 5LA1A 2YGLA 3RPUA 4OUMA 1YTYA 1LDJA 1VF9A 3FISA 5IYYA 4MG2A 3A03A 4Q27A 1PZ8A 1BJAA 2LLKA 2P7VB 4R9DA 3QYBA 3TOJA 2LH9A 2HEVF 2HYKA 3A2KA 3JTHA 4EE2A 3EETA 4HDUA 3QYFA 1ONVA 4NC8A 4Q4V1 3HMYA 3I8TA 3M07A 3OUJA 1DP7P 1UX6A 4S2GA 5CFDC 3EDPA 1TQPA 3HN3A 2DN0A 4I0WB 3TQNA 4A12A 3HXLA 4BEHA 3BROA 3PJQA 5DQ0A 3BG7A 3CESA 3BIEA 2DPDA 2YX4A 2VPLA 5D5XB 2G7HA 1NLSA 1SAXA 3BB6A 3BZ6A 4OMCA 3T2OA 4CEYB 3IAPA 5L36A 5K5RA 4LOCA 1QNYA 3P1IA 4GH4B 1ZTRA 4P9YA 1YS6A 2RDRA 3V7CA 4IEZA 3Q0UA 2VOPA 3WVJA 4X6QB 1LHVA 4XDOA 4QPQA 1SDWA 2Y6JA 2Y0MA 4EJUA 1PIV1 4QPGC 3IIAA 3BG5A 2PFWA 4N9HA 3BR5A 1YI9A 2VMFA 3KQRA 4PGHA 2QNKA 3GBGA 2XQRA 2VOWA 1OCOH 4RHV2 4AFMA 3N9QA 1IS5A 1LOBA 1UHMA 2VBZA 5D5UB 1LFPA 4YFZA 1SCSA 3ZSKA 2RJKA 3AZZA 3HSRA 4LLFA 1MJBA 5ACA3 3H5NA 3OTFA 3TBDA 1D1CA 3WZ1A 4XONA 3WY6A 1HQNA 2DK8A 1KJLA 3GTGJ 3J7NA 3ZOBA 4LD5A 1USSA 3WGIA 1I50J 2NMOA 3S7IA 2Y64A 4M0NA 5F2SA 4DY3A 3DGTA 2VJIA 3HHGA 2Y0SN 5DUVA 2B63J 1LTEA 1X1CA 1ORKA 1DDLA 1KU3A 5FMOS 5BV6A 4GD4A 4WV8A 2WC2A 3VDDA 2ECBA 4WVWA 2BOJA 4QGLA 1O6UA 3HTSB 2DUQA 2CYFA 2YBKA 4ES9A 4FHTA 5FDBA 4IV1A 4H55A 5AIPA 4JHTA 2VKHA 4E8DA 1IN6A 3HDDA 1SEFA 2WADA 1OF4A 3WF4A 2OBPA 2AS5F 3F21A 2XSDC 3RRDA 2AACA 3EYIA 5EYYA 1U5ZA 3A21A 1WD3A 2G1MA 2A6WA 2COBA 2PAKA 4N4NB 2Z1DA 1CQTA 1FP2A 4WM8C 5KCMA 4XJUA 3ASOH 2NOJB 2ZX1A 1YUDA 2ZGPA 5L9BA 1R36A 1HV1A 1IZ1A 4YW3A 2K46A 2BW8A 1WI9A 2GMMA 4XXPA 4GXLA 1PVEA 1UO9A 4OUEA 2J42A 2E1MC 1WFXA 2W95A 1X7NA 2R30A 4YW5A 1HJFA 3A01A 3GJBA 1B8IA 1NLQA 1P4WA 4HA8A 3OB8A 3U4SA 2GH8A 4R79A 3B73A 2EAAA 2PI0A 2VVDA 2L0KA 2K0GA 4META 4MH0E 2YZ4A 5FKMA 4UV9A 5G04L 5ILVA 2XKPA 5DG1A 2KQRA 4XOPA 1EV12 3JB4C 3HOUJ 3I3LA 3MGUA 3VDAA 1W8UA 2RS13 2ZGQA 1V9U3 3T0YA 1RUF3 5GLZA 1R1A2 1VB4A 3WLUA 4HRIA 4XEZA 5DDGA 2AR6A 3DEEA 2Z33A 4HQMA 2B9UA 3BYWA 1MZBA 4GYGA 5JLVA 4CP9B 2HWD1 4ZH4F 1VMJA 5T5LA 5BNNA 2H6CA 3LZZA 1NE4A 3RI8A 1SEUA 4MXWB 2NVYJ 1DGLA 5FY8A 4ZYDA 2P6TA 3HKZA 2DBBA 2AQFA 4XLEA 4HANA 4RB1A 3M3EA 1F5JA 2XAFA 2JG8A 2IFRA 2MC4A 2WNOA 3LWFA 3DCQA 4C8DA 2OPKA 1RUC3 2VMEA 3GBFA 2YGMA 2W00A 4HBNA 1WMFA 3KF5A 4Q4V2 4YVSC 4UVCA 5ERIA 2EALA 1Z0HA 4UT5A 5EDNA 1TQ5A 3LKJA 1CAVB 1JUHA 4P5YA 4AHXA 3KEQA 4RFT0 1SANA 2PHLA 1XNDA 5DAPA 4XTPA 2KIFA 5HDNA 1LU1A 2N7GA 3B93A 3GO5A 1HF0A 3V0BA 3HPHA 5JXHA 3OY8B 1Q5OA 4Q8LA 2VBDA 3I7DA 1US3A 1G3WA 3NWKA 3O12A 4LG0A 1YIOA 2CDOA 3W21A 4EWEA 4AI2A 1ZZ6A 3GEZA 3FXRA 3J26N 3OYAA 1QNTA 3WNOA 3O1VA 4HXCA 2VQHA 2JZYA 2Y9ZA 4LGWA 4CICA 4QPYA 4CA9A 2A1XA 2YPDA 1K6OA 4Y4RA 3BJ6A 5A33B 3HOTA 2ZKLA 3R0AA 2R043 3KGZA 1UY3A 3NV4A 2CYYA 1ONAA 1IS6A 4AVBA 3J7YJ 2D6NA 2KRFA 2JB8A 3KLOA 2R7DA 4QHOA 1HQCA 3I2OA 2H09A 3KIOA 4RGRA 3BJOA 1FMWA 5E8IA 2WYSA 2PLYA 3LFMA 1QJY3 2P3IA 2EIBA 1W2UA 4RSUA 1OVSA 1FNZA 3O0WA 2FE3A 1J75A 2WAFA 4NHKA 3TNQA 5JSOA 3IC7A 3WOGA 3EYPA 2HEYF 2ILMA 1LPQA 1NE6A 4XIDA 1RUJ3 1JYCA 2EFQA 2VN2A 1UHWA 1QZZA 1ZM1A 5L9VA 3S6PA 2LC2A 2FEZA 3OG2A 4XFCA 2BW3A 3VKOA 4COWA 3S1RJ 2KP6A 3RMXA 4AVSA 5JVVA 1JUMA 2H0VA 4XF9A 2PAEA 1EA3A 2HDDA 4E4SA 3VHRA 2XB6C 3E1SA 1UMHA 1AJKA 4RGSA 4A44A 3BPVA 4RQPB 4YW2A 2A6HF 5JOXA 2PHDA 3VBFA 5I0SA 3RSJA 3H3UA 4KIFA 5FZOB 3FMGA 3VYTB 3T4HB 5HCFA 2UYAA 2BYVE 3PVBB 3TW6A 4JX5A 4P9FA 4OMDA 4XXAA 2DK5A 1PGSA 1SHWB 1T0FA 3ZGKA 1SD4A 3JD71 4PDWB 1KS4A 3R6SA 4UB8C 5FROA 3LCPA 1S2KA 2YX7A 2WZEA 1JUPA 3MW2A 4HVRA 2WZR1 2R071 5ERLA 1OCRH 4O61A 1MMAA 2VVEA 4NN0A 3SISA 3HAGA 2MD0A 2D6OX 2R0FA 4UUVA 3RZJA 1CPMA 3GLLA 2D5FA 3V4GA 1JZ2A 1SAUA 3W20A 5KHHA 4JTOA 5BXXA 3QAHA 3KYDB 4PJNA 4BMEA 3RZKA 4YG3A 4QSHA 3WW3A 1ZQ3P 1J5YA 2GXAA 5J47A 5IVJA 4I3GA 1FOD2 1IXSB 2IS1A 3NV1A 3CC2I 4LKFA 5DEQA 1GZCA 1AR83 4HKOA 4Q0SA 3KHBA 4M71A 5M5YJ 5JLXA 3Q9VA 2QQ9A 3PNYA 1TL8A 3J4UH 4GMP1 4OZOA 3I4PA 1PO21 4XKCA 1N3PA 4Y1VA 3DN7A 4BB3A 4PQQA 3FK6A 3OYJA 1I9RA 2J1RA 4P08A 3JSOA 2VOOA 1JHJA 2P2KA 4M3CB 2VE9A 4A5MA 1I1EA 2J22A 4Q2FA 4IESA 1UKRA 4DUWA 3A4CA 5A3LA 4L5JA 3WNXA 2ZAHA 5KK1A 1W6NA 1FYMA 4S0HB 4A6DA 2BP6A 1OD3A 3SJMA 4LBOA 4P9LA 1IRGA 4JKMA 3SCHA 3CKHA 2CU5A 2HVQA 4QWNA 4OUSA 1BK1A 2Q30A 4G6DA 2WBKA 4EN7B 5FQ0A 4URAA 5GZGA 5JI9A 3GZAA 5HS9A 3J7AY 3WCSA 1MIJA 1OUSA 2MEV2 2Y6GA 4D6RA 1SACA 2FQPA 5EV7A 1SDDB 2Q2EA 5B66C 5ABJA 1PX4A 1KITA 1P8JA 2NAZA 5EEAA 2ETHA 2HWB2 4BQ3A 1ND3B 5EHDA 2MLGA 5LHHA 2V1UA 1H0MA 4AQSA 4E9KA 5EQUA 2Z4FA 3IN9A 4G94A 4LMFA 2ZMLA 4XRFA 4NBQA 5A7WA 3OYDA 3WTYC 1MDMA 1LGBA 4RR3B 4UFMA 3J81K 5IVBA 2RV8A 3QCWA 3TW7A 2RC4A 1PUEE 5IAVA 4QXKA 4MSVA 3VZOA 4Y52J 1POV3 5JWPA 3WEZA 2VE1A 4PLMA 4AIKA 5K4LA 1S72I 2BVBA 5E1RA 1WI3A 4PBOA 4IEJA 2ZA9A 2EINH 5FRMA 4ZXEA 3FBNB 3VBUA 4XHXA 4OI1A 4IO9F 2A07F 5JR3A 3MF9A 1OD5A 1STZA 2Q8KA 2E51A 5GKAC 2LRDA 3ORJA 1BEV1 1IS3A 1O5UA 4XK4A 1REFA 2VPVA 3FXOA 2WAEA 4EJTA 1RR7A 1G3YA 1U9NA 1H6XA 5HV4A 1ULPA 4ARYA 1SBDA 2VUCA 1MZEA 4CCEA 4DPNA 3G71I 1MBHA 1WW6A 3H1WA 1QOOA 2HWC1 2KHMA 2IW5A 5JZGB 1LOEA 4NDLA 2XJSA 4V19K 1JHFA 5ICCA 2ME0A 3C18A 4EMSA 4EN9B 1OC1A 2W48A 4WVVA 3ZQFA 3HOZJ 1QMJA 3SMHA 3TEXA 1M4WA 3AG3H 3SYTA 5BPDA 4CEWC 4QX5A 2JDUA 4HL0A 2VUMJ 4ZTJA 1COV2 4E2QA 1ZARA 2V72A 4CH7A 3FXJA 2RNJA 4L8QA 1ULGA 1OSGA 4D0QA 2E5ZA 4M3CF 1A6QA 3TB0A 2HQNA 4L11A 4XQWA 3CJRB 1ENSA 3DBLB 3J80Z 3UJOA 2ARAA 1NCQB 2C4XA 1H9GA 2IUWA 3BLYA 4K21A 1RR8C 4EVIA 2J1EA 3B6CA 2QQKA 3KVAA 1AWCA 2IXJA 2HWF2 2ZXJA 5I0UA 3VBOA 5EXOA 1QIQA 4P14A 1B35C 2HH9A 5LK5A 5E1WA 1RETA 4X6AJ 4IE6A 2LREA 2K3FA 4IHYA 3CDLA 3QU3A 3O7OA 4LBJA 4FPCA 1RHI2 5BOXA 3V0AA 1TW3A 2WINB 2DQRA 5AC92 2UYBA 3CIHA 1KXGA 2PLV3 2X09A 4X8PA 1MACA 2FD8A 3BR3A 2JKXA 4A41A 4NROA 1W8FA 2NNYA 1MNEA 2DA1A 1OMIA 4KUMA 2WT0A 2WNVC 4EWAA 5IFTA 1TQMA 4KJZA 3MAJA 2W2IA 1W9WA 1ND2B 3PIPF 2VNOA 3RG0A 2VJXA 5J3LA 3RKYA 5FZEA 1K5JA 2HZDA 2AGSA 1O7FA 4KT6A 1DQ2A 2IGOA 1RXGA 4GB32 3G6EI 1YQ2A 4BUPA 4CCKA 1WW5A 4KITB 3IKTA 1H30A 2XVLA 4XKVA 4JQTA 2UUZA 3CMYA 1BVVA 3K6GA 2BGOA 3D5LA 4CDQC 1D4M3 3S0MA 2E1NA 2LVSA 3ZPOA 1FWZA 1SLTA 1E5SA 3FMQA 4LO8A 1HCRA 1OISA 3SEZA 1NQJA 1VRH3 2RMU2 3D3AA 4ZZ8A 5BY5A 1X3WB 4BJ5C 4BAYA 3N7LA 4WVMB 5GJ6A 2YPJA 1ZHFA 2WT1A 3HPNA 4PFPA 1OQDA 1YNAA 5D5WB 3RKQA 3OIQA 1OF3A 3HSEA 2ZGTA 1IG3A 5AFBA 5ACA1 1UELB 3K51A 1GP6A 4X8NA 1C28A 1O4TA 3MZHA 1MR5A 2VCBA 3O8GA 4NRPA 4DY5A 1DZTA 2PXJA 4F7ZA 3Q8AA 2NQYA 4FCAA 3H7YA 1I27A 3H9GA 1XB4A 4DBRA 5IK7A 1AL0G 3MUZ1 4Y20B 4Q26A 2LSOA 3K2OA 1XYNA 3HTUA 1ULYA 1NCRC 2OC6A 2EZLA 5F3EA 4IETA 5IOZA 2XPUA 1Y9GA 4GWNA 4M74A 3J81Z 3VD3A 4DS0A 3ETQA 4YGEA 3WNLA 2XGXA 3ZFFC 4CDUA 3CLPA 1GU3A 2XL7A 3ALQA 3JRAA 3PFYA 3HNBM 1UPSA 2A6TA 4WXCA 1UPIA 2P6CA 3H1CA 3S2DJ 3IDCB 5C4WB 2D40A 4YVWA 2VB6A 4QPOA 4Q4Y2 3VB2A 4ORFA 1B9MA 2XUBA 5IWFA 3BPZA 1PZ7A 3L2CA 4LMYA 4PF1A 2VPRA 1X1PA 3ZQHA 4QQ2A 4DRRA 2RM23 4MOAA 3GMEA 4X0GA 3KV5A 1LJ7A 4NC7A 5JXIA 5IATA 4FT8A 2HEWF 2EA2A 1Q43A 4PI2A 3CMGA 3CJIB 1ULFA 2A6ZA 3OPWA 2PJRA 4Q0QA 1Y6IA 1PYVA 2V1DA 4LLGF 5FKLA 3AKZA 2WR9A 2WBMA 2FZ1A 5FXWA 1R083 4QX1A 5HCBA 3E5QA 2GBYA 1VP6A 1BEV2 1T38A 4YW7A 5FYMA 2JRTA 5JMOA 1FNNA 2CL2A 3H1MA 1XBFA 3C7FA 2W7NA 2B8MA 1Z21A 2FUG2 4YFWA 3MKYB 3KETA 1FT9A 3FIWA 4M3FA 1DGWX 3A4UA 3JRHA 5JVTA 2OW4A 3JRBA 1U9OA 2VBBA 2JDYA 4GGGA 2BEOA 4GJZA 2EFPA 1IAWA 1OYIA 3S3NA 1Q8VA 3O1RA 1GWKA 2HWC2 3N9LA 4QPWA 3OPZA 3HBLA 4AI9A 3BWGA 2XJRA 2W46A 2WAQA 2BOLA 4IVNA 5LW9A 5K0UA 2LBFA 4MHRA 2NYYA 2RS11 4CUAA 2PMUA 1V9U1 1WUVA 3ZIWA 1RUF1 1FPQA 1R00A 4Z07A 5F5IA 2VW0A 5A7SA 3QOPA 5E89A 4I0AA 1GANA 2OKXA 3ZR6A 3CUQA 3NAPA 2VCMA 2R7QA 1X9PA 1W99A 1PMJX 2PMZA 3UGGA 4HX4A 5FZKA 2DCEA 1WGPA 1JKQC 4XQDA 1KEXA 1TWGJ 2E2IJ 1NUKA 3K1NA 3VPRA 1GUUA 3H8RA 1KJRA 1IRFA 3CCMI 5IK5A 2P8TA 4JGYA 4GMP0 4BQWA 1LAJA 1ZLJA 3ASNH 5CYVA 3FBIB 4K1YA 4W65A 4XFGA 1JMUB 1W6QB 3U07A 3MIHA 4ET7A 5HBAA 2BV4A 4ZU5A 1RUC1 2EICA 3GVAA 2AEZA 4LBKA 1OHFA 3FC0A 3TDZC 1KRIA 2ZTNA 1QZYA 5J1XA 1RXFA 3QD6A 1H6YA 2CV0A 1ZBE2 2XHNA 4Q0VA 1MBGA 1S0DA 3OYGA 4HOOA 4QPIB 2W25A 4H7LA 5DPNA 5LRSA 1QJU2 1W6OB 4L9VA 5IVEA 4E27A 5FKCA 4EV0A 2EIGA 3A0KA 2CUZA 1JOJA 2YS9A 3UGFA 4IPAA 2XF7A 3N36A 4D6QA 1IRXA 4GRIA 3JQXA 5CPRB 1V55H 1XMKA 2CQQA 4M73A 2E9QA 1QXRA 2W47A 4ZYGA 1DUXC 5E18F 3WHUA 1BXHA 3JXSA 5HDKA 3RI4A 4KICA 1GWLA 4AEDC 3THPA 1H9WA 4KWKA 5J7MA 3AKSA 2IS2A 5IP9J 4NQWB 3JBG3 2GSYA 4HETA 1MMDA 4CDWB 4LA2A 5FPUA 3POJA 5K7PA 4BMBA 2TDXA 1IC8A 1HW5A 3SQNA 3TEZA 2P5LC 4WZFA 1V6IA 4JBAA 3PUAA 2FXAA 3QRFF 2R041 2PN6A 1H8TB 3M3CA 4ZJZA 4XRMA 3T2TA 1SLAA 1Y8QB 1L7RA 4AFAA 4A93J 4QM8A 2VKDA 2DI3A 2VL8A 1ZZBA 4AW7A 1MKMA 4TTGA 1T56A 4Y1ZA 4LBNA 1QJY1 3K4BA 3VBRB 3U11A 4A0XA 4J6GA 3PTYA 1QOSA 3UR3C 5FV3A 1PO13 1LOFC 1ENHA 3QP6A 1R093 2CQ7A 2EH3A 1RUJ1 1R9TJ 1MNMC 1O57A 5T52A 2HDWA 2V79A 2R5YB 4XOGA 5EJ1B 3BTLA 1YYVA 3BTZA 5DS9A 1V3FA 1QY4A 1H2NA 2W3JA 1W8NA 1B72A 2R5ZB 3T08A 2D93A 1UMIA 2YC4A 3C8XA 3IKVA 2GMEA 5GLUA 3FLRA 1HA8A 4YW1A 4LK0F 1Z91A 2LRPA 3OYWA 3D5SC 2X4HA 1D1BA 1XN7A 5C5TA 2XWBB 1UYYA 2BFUL 2Q8EA 4XUOA 1AX2A 4GAZA 1ZBA2 2WAAA 3LOBA 1SMTA 2M7AA 3PO2J 3UKNA 4UVBA 4KI5M 2X0LA 4FPOB 4D7SA 4XFIA 3KZIC 3K70C 3N4MA 5IAXA 3J8F3 1IDYA 2VT3A 4Q4ZF 3EBRA 1W6MA 3THCA 4Q4X3 5K5QA 2UWMA 4JKKA 1JXSA 4O9GA 3MW3A 4D3WA 2W1UA 3NVCA 4G6QA 3VBSA 4Z92B 4S2DA 4UB6C 1LEDA 2HQAA 2VE8A 1GWMA 2GZWA 3LNQA 3CJXA 2ISYA 1EPZA 2BBYA 2VZPA 2KIUA 3KZ4C 3AP9A 5BNQA 4XLFA 3ZXKA 3TP0A 4HK9A 1T98A 3MEXA 4W8JA 3WUDA 4BLIA 1FPN3 2XRLA 4ZZDA 1SPPA 1VBC3 3UKTA 3BQYA 4E7JA 1FV3A 4AEDB 2F5FA 1T39A 2WLQA 1WMEA 4MZUA 2CTVA 2WSVA 1T2KA 4CDXB 1AR81 4IRIA 1G3TA 2WIIB 4QKNA 2WY8Q 4XIOA 3NMBA 2QKLB 1WMDA 1RMU3 5GZDA 5T3NA 4RGAA 2KR2A 1S0FA 3WU0A 1RUD3 2XUEA 3ZSEA 3V7RA 3CBNA 3RZHA 5DG2A 3RZMA 3GTMJ 1RUF2 3NO8A 2OS2A 2P34A 2XF6A 4H2AA 4AG4A 4QU2A 3MYXA 3RQ4A 1EUTA 2P3YA 4JC1A 4M4RA 3LSHA 1NA1B 3FHZA 1R22A 1WWXA 4AR2A 2RQQA 4ASNA 4L0ZB 4BXFA 4UFKA 1UL9A 3PVEA 4U36A 4LLOA 1S2EA 2FMLA 3E6CC 2FOKA 2Z5UA 2XRNA 3RNSA 1XE0A 3D4KA 5H9PA 1H8VA 5L7OB 3ZQ7A 5EG0B 3IH2A 1DBNA 1YJKA 1F4AA 3M3QA 3AJYA 2HBTA 1MS8A 1L0OC 4OVEA 1PUFB 1GZWA 5FYCA 1NTCA 2UZKA