1O3QA

Protein-dna recognition and dna deformation revealed in crystal structures of cap-dna complexes
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Indirect Readout of DNA Sequence at the Primary-kink Site in the CAP-DNA Complex: DNA Binding Specificity Based on Energetics of DNA Kinking
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
molecule keywords 5'-D(*AP*AP*AP*AP*AP*TP*GP*TP*GP*AP*T)-3'
total genus 62
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2003-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1o3qA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1o3qA01
1FXZA 3JW4A 4LK0F 1X82A 2CQKA 3QPTA 2XLGA 4R52A 1H1IA 3SZPA 5EEHA 1G3TA 2W25A 1U5TA 4YSFA 3CUQB 1FZPB 4QMAA 3WTZA 1FBSA 4HDVA 5H6QA 3GO5A 5HDNA 3HQXA 2TDXA 3HT1A 3MAJA 4EVIA 4YRDA 2IXLA 3RKWA 5I0UA 5I8SA 1TBXA 2JTVA 2E1NA 5JI6A 2LF8A 3BJAA 1DPRA 1TQIA 5FPXA 3DFGA 4U88A 2FU4A 2XASA 2EAAA 4Z2YA 5FB2A 4GCVA 4ENJA 4JVAA 3CO2A 3FWEA 4QGNA 5ICEA 3DKWA 1L3LA 5ICGA 4PIZA 4IEXA 1ZHFA 1V3FA 1S7OA 3C3WA 5E17F 4FX0A 1RL3A 1RUNA 2FOKA 2Q0OA 4TV7A 4DQ2A 2WTEA 2OPKA 3U9GA 4S04A 2GC2A 4I02A 4MUVA 3ACLA 4GO1A 3CUQA 2DTRA 1OR7A 3CJNA 4I0AA 2PI0A 1V70A 2A3SA 1WWXA 1X7NA 4IEOA 2UY8A 2JSCA 3VB2A 1P4WA 3DF8A 4LTAA 1FBQA 3EHKA 5HLGA 4ZU4A 4AQ6A 3Q9SA 4MTEA 3G73A 1FI2A 2QQAA 2M45A 3EQLF 2PAMA 4UNOA 4LGWA 1LB2A 1Q5OA 4XFGA 3V8LA 3HOTA 2PLYA 1XSVA 3RZZA 4QX5A 3ZMSA 2P5LC 4UHTA 3W6JB 1IXSB 3T0YA 3WW3A 1YW7A 3FMSA 5BXXA 3I7DA 5E20A 4R79A 1K7AA 2OBPA 3V8KA 2IRFG 5E16A 3LWCA 3UKNA 4YNIA 3U0ZA 4NB5A 1XB4A 3FE5A 4HA8A 2UWMA 2D93A 1CF7B 3RPUA 4E2GA 2PTMA 1FYLA 3M8EA 3MQ0A 3IKVA 3IWFA 2WFPA 3H1MA 3U1DA 5LEKA 2PG4A 1WKMA 3ST7A 3WTYC 2D1HA 5E1ZB 3HTSB 1ONVA 3MPBA 4XF3A 3CUOA 2XAFA 4IETA 4DNCA 3HRTA 2Z5UA 5LRRA 1AWCA 4M74A 4QGMA 2MHFA 3FFQA 4HN0A 2QM3A 5FLXZ 3WW1A 3KSCA 2B0LA 5HS8A 2QWWA 3QOPA 1IXCA 2DBBA 1ZG5A 2H94A 4XF0A 1DGRA 2JPBA 4KIGA 4G7ZF 4N9HA 3M9AA 3FX3A 1VR3A 4ZYGA 2FA5A 2W84A 3ES1A 1B9MA 3NRVA 1LDDA 1DGWA 1KYZA 1YHFA 4IESA 1IPKA 3KEQA 1UPIA 3WU1B 1W5TA 3O6BB 1ZZ8A 4I0BA 1U2WA 3TOAA 1XDUA 3H1WA 2P17A 4AXOA 5JSOA 4JK1X 1NE4A 3BP8A 4RGXA 4ON0A 1TQ5A 2QYOA 5TRDA 3IBMA 5H6RA 2ZFWA 2HDCA 2F4PA 3SHFA 2P6SA 4QWQA 1YWKA 4UXAA 5HS9A 1YQAA 3MZHA 5E1WA 5K1YA 1J3QA 2R3SA 3R6SA 3CLOA 4BQAA 5CLSA 4N0BA 3O14A 4Y15A 2IXHA 3ZN1A 1H9TA 3NL1A 3S7EA 3HHHA 2QCSB 2QQBA 5AVPA 1EPZA 1R7JA 4YFKF 2ISZA 1FP2A 4IVNA 1OPCA 4ZU5A 1D8JA 5FQ0A 1UHMA 4U7DA 2XLFA 2PQ8A 2H6BA 5A2QK 4M73A 1UB9A 2CW0F 1I5ZA 1E2XA 1T38A 2NYXA 4YFXF 3QP6A 1FYMA 4HSJA 4U7BA 4IRGA 4L5JA 3V7RA 2XHKA 5FLJA 1CAUB 3B73A 3E5UA 4KN4X 4QLCU 1ZLJA 2Z99A 5JR7B 5LBQA 4P9GA 2KKOA 3H3UA 3IWZA 2G7HA 1GQGA 2ISYA 3EYIA 4MX3A 3QPHA 5AIQA 4RB2C 3TNPB 5JCTA 3DQVC 3TGNA 2IXKA 2M87A 5E1RA 4AVCA 3MEXA 4ZYHA 5LLQA 2QENA 4MTDA 1KYWA 2DK5A 3KZYA 4ZYDA 4RAYA 3C3VA 2O8QA 2V09A 4I98B 1LVAA 2X4HA 2XLAA 2JPCA 1G3SA 5FD6A 3WODF 3SCHA 3P9CA 1OD5A 2YR2A 4I09A 4HX7A 5L3CA 4P5OA 4BH9A 2L3DA 4EGZA 4RD7A 1O7FA 3WTVC 3BWGA 3ZMDA 2FRHA 2KJCA 3FMRA 4LUKA 4KMUX 2K27A 3D5LA 1FYKA 3LAJA 2PEXA 1QXJA 1J0RA 2Q0AA 1K6OA 1TW2A 3NSTA 2Y48A 1P4XA 2YX4A 3RIRA 6PAXA 1SD4A 4LD5A 3WGHA 3KETA 4M6XA 1XGOA 4HV5A 4LA2A 1X8MA 1W5SA 4EWDA 2Q4SA 5K5OA 4LA3A 2K4JA 2RQPA 1HSTA 5DDGA 1XGSA 2ELHA 4OLLA 3FM5A 4G6QA 3WW4A 4JQFA 3JTHA 4EJUA 2HFHA 3CUQC 4IRHA 3ZPLA 2HGCA 2GXGA 3HSFA 3GX4X 1HKTA 5BUVA 5KK1A 2WWYA 2OQRA 5AIPA 3S2WA 3LWFA 2XKPA 4EM0B 5HLHA 1S8NA 3KZZA 2EV6A 5JAXA 3HT2A 1ZG1A 4L11A 4XBFA 4AD9A 4ESJA 1W4MA 3T8TA 4BIFA 2XVCA 1WI9A 3NEUA 2H09A 1XE8A 3LQQA 4E2SA 2HTSA 1EP0A 3H3ZA 2IXIA 1EY2A 1EH7A 5I8TA 4MHGA 3E3VA 1O3QA 4ESFA 1XE7A 2DCTA 4EJOA 1QO0D 5CU1A 2UXNA 3Q5FA 3H1YA 5J48A 3IDBB 4LB5A 3TKYA 2CAVA 3AAFA 4R1HA 2FBHA 4YIIA 3GVAA 3REOA 4BHCA 2CAUA 4L5IA 4HF2A 3J81Z 3GZ6A 2G9WA 2MNGA 4QM9A 5DUKA 2F2EA 2OZUA 1O5UA 3EJKA 4LJZF 2Z3YA 3E6BA 4Q5SF 2XL9A 3K69A 2IXJA 2A69F 2HQNA 4META 4Q48A 1O4TA 4D7SA 1IN4A 3VHRA 2O6GE 1TW3A 2FMYA 2VC0A 5I0SA 2NNYA 1OMIA 1D3YA 5KHKA 2GZWA 4TLFA 3RTRA 4BHBA 3GFJA 1O5LA 1UFMA 5E8GA 2CSOA 3H50A 1PP7U 2XAQA 3TO6A 1BI1A 3PFIA 2O0YA 3VEPA 1PUEE 4EROA 1XSDA 2ZJ2A 1F9NA 2D45A 1J1LA 2H0VA 4EM2A 3F72A 2L54A 2K86A 3ZDSA 1BIBA 1PP8F 5L3BA 3FXRA 5FCCA 5J8FA 4ORFA 1YW8A 4AIKA 3VODA 4UUVA 2FNAA 1ZGAA 4JTNA 3I58A 4HLTA 2V9VA 1JUHA 3TDUC 2D2WA 3GUDA 2RDPA 2UY9A 2MA3A 2V1UA 4MQVA 2DLLA 5JFRA 1QXRA 1Z6TA 3CLPA 2M8EA 3WE2A 4IEVA 1QZZA 4OFGA 3KFWX 2H27A 2IW5A 3WGIA 2HYGD 1IRFA 4HV6A 1K78A 5DD4A 4CYDA 4RAZA 3E6CC 4PDKA 1Y3TA 2VE9A 4FBFA 2MBFA 1T2KA 4XRFA 3OV8A 4ZYEA 2HKXA 2EK5A 4CGZA 1Z91A 2EA2A 5F64A 4KT5C 2DU9A 4YYOA 3V8JA 4MNUA 1R1VA 1P4AA 1KU3A 2QDRA 2EWNA 1HBXG 4L18B 5DEQA 4BXUA 1R1UA 2EFPA 3BOQA 4L0YB 3GLXA 1FBUA 1DDNA 3PNAA 1P6RA 3I59B 2XROA 1RTVA 3IIAA 1MGTA 2ZKZA 1XCVA 1IXRC 1BOAA 2RNJA 2ZCWA 1JE8A 1H1MA 1UCXA 3HIFA 1IAWA 2A61A 4HX8A 4P9UA 3R60A 5D8KB 4MZUA 5IT9Z 2FQ3A 4ENKA 1LQ1A 1KGSA 2F5FA 2XAGA 4OMZA 3F8MA 2PJPA 1QQIA 2ESNA 4XFHA 3QU3A 1FY7A 1IN8A 2A07F 2W24A 4CDGA 4EJVA 3KGLA 3P7NA 3FMQA 1PM7A 4QGLA 1S6LA 2MH9A 3LFKA 4IF4A 3V4GA 5TJJA 3WU0A 3SCGA 2O3FA 4LLLA 1U5TB 1ZN2A 4PGHA 2CYYA 3H9AA 4D7TA 4IEYA 2B8MA 4M9ZA 3R61A 1ZZ7A 4RB1A 3J81K 4A6DA 2PN6A 2HYFA 5K8SA 4ZZDA 2OU2A 1I27A 4WX9A 2ZMEA 4MV2A 1IN5A 3P9KA 2NNNA 2EFQA 1S3JA 4OIRF 4ENNA 5I0RA 2VN2A 4KYWA 3QRFF 1I6XA 4KWJA 2LF7A 2DT5A 3C1DA 1L0OC 1IN6A 1USTA 4IJAA 1FP1D 3LAGA 3ML6A 3GEZA 1LDJA 2CG4A 2F5EA 1CAVB 3KP7A 4UV9A 4EJWA 5C6CA 5D4SA 3JAMK 4EWEA 4LUMA 5DCMA 1FPQA 4XF9A 4L9NA 3VFZA 1T39A 4HAMA 2FNPA 2UZKA 4FAGA 1ZRDA 3U10A 4ENMA 2XAHA 4GYGA 2C0ZA 4A2UA 3L9FA 4R8HA 4XSZF 3BROA 1TLHB 2VXZA 4FX4A 3LA3A 3GWZA 3ZQ7A 4B8XA 2L4MA 1KQ0A 3HRMA 4EV0A 4L9VA 2ZO4A 3IRRA 2EFWA 1QWRA 5JSRA 2UXXA 3FZVA 3QACA 4HLYA 4PCQA 3T5XA 2BE5F 4ONUA 1U8RA 1ZLKA 3PVBB 3BPXA 4LB6B 4KU7A 3GFMA 2DFIA 3BB6A 4HX4A 1IZ1A 5FDBA 3LAPA 1S7AA 1J9IA 3OTFA 4UVBA 1XGMA 3E6DA 2NS0A 2QZ8A 3R0JA 4A0YA 4YIFA 2GA1A 2BV6A 4H0EA 2PQQA 1ZG3A 5CVIA 4P9FA 4CXFA 2GU9A 2D1VA 4PZJA 2QJVA 3RYKA 4NHJA 3M7GA 1CF7A 1ZZ6A 4Z07A 3WG9A 3KE2A 5JR3A 5BPDA 3SZTA 2VT2A 1YW9A 2DI3A 3ISPA 3MFKA 3KMHA 2ATFA 3CJXA 3ELNA 1MJ9A 2IVMA 3ECOA 2BEOA 1YFWA 4MGZE 1CAWA 2IPQX 3H92A 5CJ9A 2OAZA 1PDNC 4KUMA 3WE3A 4MGRA 3D0JA 5I91A 2D5HA 3HTUA 3CO7C 2EV0A 3F8BA 3I0TA 1RNLA 5H20A 2Q1ZB 2EFOA 1YFYA 3I5UA 4UVCA 4OU0A 4RB0A 2QVOA 4Q0SA 1KU9A 3B02A 1BM9A 2CO5A 1ZZ9A 3M1EA 2VOOA 1J75A 1Q1HA 5KHGA 3OOPA 2VBXA 1T98A 5D1IA 2UYAA 3WGGA 1LEAA 3VOEA 4EJTA 3KP2A 4HDUA 4JV4A 4LK1F 5D4RA 3R0AA 2OYZA 3GYHX 3GFLA 2Q8KA 2GXBA 4OIQF 4Z82A 5FLHA 1F4KA 2IA2A 3HOSA 1LKNA 4GULA 5JHUA 4IHTA 3DPLC 3RYPA 5FLXK 5C8WA 1G3WA 2V79A 3F22A 1JXSA 5L3GA 1MJAA 1WSUA 4IERA 2ESHA 2HKOA 3MCZA 3M8FA 1DZRA 1CAVA 2NAZA 5KHJA 1NYWA 1UCRA 1WQ2A 3JAMZ 2D5FA 2ACJA 2E7WA 1ZARA 4L0ZB 2WC2A 1ZX5A 3UKTA 2F5DA 3BCWA 3SMHA 5EFUA 2VECA 5LRSA 3J80K 1TNTA 3RYRA 1SFXA 5DV5A 4ZZLA 2LSOA 3EDPA 2L01A 3V7SA 2GQQA 3DXJF 3ABUA 5EZWA 4HF0A 1JHHA 4PIXA 1BI3A 1FOKA 3RJPA 1R58A 2DK8A 1A04A 1WLTA 2VBWA 3HHGA 5CVVA 4FHTA 1JGSA 2PHDA 3HRUA 2HTJA 3COAC 4AIHA 1NE6A 2DQRA 1LNWA 2YPRA 1MDMB 4G8XA 2K7LA 3CO6C 2JZYA 3F8NA 2F5CA 2FF4A 5DYMA 2FSWA 3IHUA 1CAXA 4NQWA 4YFNF 2J5OA 2IXCA 2PAEA 5HDKA 2STWA 1YIOA 3EYYA 3TO9A 3GFIA 5E8IA 4D0PA 3CL1A 2LDUA 1YLFA 5BQTA 1O7LA 4Q0PA 4BHPA 1ZYRF 3TO7A 1XSXA 1B1BA 4OINF 3TQNA 4RS8A 2RN7A 3FZ3A 1SD7A 3BPZA 3UKVA 2R7FA 1ZH5A 4IEWA 2Q2EA 2C6YA 1I1GA 4K8FA 2E9QA 3G3ZA 4S05A 1HW5A 1Q43A 4WF2A 4WXCA 1E17A 2O61A 2HQRA 2YU3A 3FF5A 1H0MA 3GYDA 2EFNA 2HEOA 2GC3A 3N97A 2V1DA 2WV0A 4O5VA 1HKQA 1VP6A 3QP5A 4AVAA 3DL3A 2YSRA 3FHIB 3E5XA 4CO8A 3W6KB 1FSEA 1IUYA 5IT3A 2V1XA 4UXNA 3CTAA 3KLOA 5T3NA 3DEUA 5ILUA 5FGMA 1LRHA 1SMYF 4DINB 1YS7A 2EB7A 1OFNA 1T6SA 2DPDA 1U6GA 1GQHA 2AXLA 1JHFA 3C18A 2XKOA 4GGGA 2OA4A 1HQCA 4HQEA 4QXKA 1T0FA 1R5GA 3FHZA 4HVOA 2QBYA 2RKHA 4IPAA 4OIPF 4WBBA 5K5RA 1Y9QA 3WW2A 4IHSA 2BNOA 3ZMUA 5DD8A 1J2XA 4A0ZA 3F3XA 4QM8A 3NJZA 3NW4A 3IC7A 4A12A 1RC6A 3N4MA 2IP2A 1FLIA 3L2HA 2P5VA 3H7YA 3MDPA 4XFCA 4XFIA 5KHIA 4G94A 2M30A 5D5XB 2MLGA 4ZU7A 2V6CA 2VQAA 3F8CA 3L09A 3DN7A 1KQ9A 5EEGA 2GIVA 2KIMA 2L4AA 4HBNA 3Q9VA 1XD7A 3KP6A 2GC1A 4LG0A 4EMSA 2W85A 5ICFA 2GA2A 2QVSB 1V4RA 5LGNA 4IRIA 4RGUA 2PA7A 2VODA 1TNSA 5E18F 3SXWA 3I54A 4Q47A 5LGUA 3HYIA 5ERIA 3GW2A 4P55A 2RC4A 4PJYA 2P7CB 2ZNZA 3DV8A 2FQPA 3EQEA 2PMUA 1KU7A 1J5YA 5LHGA 5JVTA 1J59A 1LEBA 2CFXA 2BBYA 3WTWC 2HJIA 1W7PB 2JRTA 3ZMVA 1ZNPA 1SAXA 1B4AA 5J6XA 3ELKA 1TTYA 1ZGJA 2P6TA 5KVRA 4GYIA 3JSPA 5CADA 3RKYA 1L3JA 1UIKA 2FMLA 2P4WA 5K5QA 4LFUA 4KL1A 4FAHA 3RKXA 2ADUA 3E6MA 2Z2SB 3S7IA 1R5HA 1BC7C 2VE8A 4KNYA 2RV8A 4U0VA 3HSEA 2QLZA 1XN7A 3GF2A 2COMA 5IT9K 4JTOA 3F6OA 1XMKA 4WVZA 1B59A 1K78B 3JZVA 4EGYA 2DPUA 1QZYA 2Z33A 2EVXA 3SFZA 3H7JA 3NVCA 4HOBA 4G6DA 1Z7UA 1REPC 2Q30A 3NQOA 2E7XA 2PHLA 4BNCA 3EBRA 5JSPA 4L9TA 4HYEA 3I53A 2IT0A 1C0WA 3OGJA 4I7HA 4OOIA 5HS7A 1W7PA 3MZYA 4HLXA 1U5TC 2FXAA 1R23A 3LZZA 1BBYA 1R22A 2QQ9A 1YYVA 1R00A 1IPJA 3OCPA 1UW8A 2I45A 3FXQA 2EJRA 5BPXA 1NHAA 4XLNF 4RGRA 2J5PA 1XCBA 1XGNA 4ASNA 1FT9A 2P8TA 4XFAA 3BJOA 1TQMA 2K4BA 1MDMA 1LDKB 2O8XA 3HRSA 4L2NA 2VC1A 2L02A 5HVQC 4Q4ZF 1O3RA 3ULQB 1H9GA 1YFUA 1J3RA 1IN7A 1KU2A 1XRUA 1ZREA 1U78A 5FPZA 2ZBKA 5ICCA 1K79A 4K2EA 4HZFA 3K9TA 3V7CA 3QU6A 4A6EA 2VOPA 4I01A 4WK8F 1MZBA 1SFEA 4MGKE 5CYVA 3BDDA 2ET7A 2OZ6A 4Y17A 2XV4S 4O9EA 5BOXA 5KBFA 2P7VB 5ILSA 1YS6A 3FXUA 1CAUA 2CWEA 2VBYA 3KP4A 2LKPA 2M1BA 3FJSA 4HQMA 1LJ9A 5I8YA 2EV5A 1KA8A 4CZZA 3I64A 2W57A 2OZJA 4IEPA 1HSJA 1BIAA 2FE3A 2UYBA 1ON1A 2O1QA 5HDGA 4WCGA 5D5WB 2PBIA 4UVAA 4A0XA 1FNNA 5D5VB 1RIOH 4AWXB 4ESBA 3ZMTA 3LA2A 3M70A 2XUBA 4ZH4F 1USSA 2B5HA 5BY5A 2A5YB 3U11A 1J7KA 4CHUA 1CAXB 2A6HF 1KQ8A 2KIUA 2FEZA 2ETHA 4Q29A 3IL2A 2Y75A 2N7GA 2BGCA 5LHHA 1VJ2A 2STTA 1BN5A 1MJBA 3ZN0A 5A2QZ 3WTUC 2DO7A 1G4DA 3CEWA 3KCCA 3BZ6A 5F1RA 2IA1A 4RB3C 5CVJA 3L00A 3E5QA 2A6EF 3FM3A 5DUIA 2XRNA 1U12A 3S0MA 3PQJA 4MGIE 2ZNYA 5LGTA 4Q0UA 2PAKA 1SFNA 3BALA 1Z05A 2PMHA 2LNBA 4KU8A 3ETQA 3G7DA 4Q0VA 4KIFA 4CICA 4GXOA 3EETA 2D40A 4X6QB 5D8LB 4EWAA 3TOBA 1RGSA 1X3UA 3JTGA 2MH2A 1VTNC 1D5VA 5FO5A 4KDPA 2NRAC 1SEFA 4OMYA 2IC1A 5E1XA 4LLOA 2RGVA 4LLNA 1IW7F 1IRGA 3WTSC 3L2CA 4FT8A 1UHWA 4HMZA 4XSXF 1QY4A 5L3FA 2GWRA 4M9XA 3I71A 2BYVE 3BPVA 4J1XA 4U0YA 1R1TA 3O3KA 1XMAA 1W7PD 4HSLA 4AIJA 2MC3A 4MGYE 3J80Z 3IKTA 4IEUA 4HW0A 2BNNA 1AOYA 3F6VA 5J7MA 1B6AA 4WXHA 1S29A 1SFUA 1SQ4A 2OA2A 3OF1A 2Z9OA 3EUHA 1SD6A 1I1SA 2HR3A 5FLIA 3IRQA 3K1NA 5HOOA 1B9NA 1EH6A 3GZ5A 1ZRRA 4Y13A 3KP5A 1MD0A 3RPQA 2HS5A 3SHRA 1DUXC 4UBGA 1NXMA 1F1ZA 4F7ZA 2VBZA 5CVUA 4LULA 1Y0UA 1TQPA 3BY6A 1DZTA 2HZTA 2XAJA 1PMIA 2ZMEB 1HW2A 1YTYA 1EV7A 4H7LA 2PYTA 4I3PA 4BAYA 1OI6A 1O3TA 2A68F 1YLLA 4B29A 3QAHA 2DAOA 1CAWB 2X0LA 3H8UA 3KLNA 3CF6E 4WXDA 5FFXA 3CDHA 2AS5F 1STZA 4M72A 4XFBA 1RUOA 5CVRA 4G7HF 4J1WA 3SQNA 3USSA 3GXOA 3HSRA 3O2PE 1GXPA 2QBYB 4N9IA 5DCFA 4HN1A 1R36A 3LA7A 2O03A 5FQ0B 2QUFA 1NZCA 1IF1A 3KGZA 2ZXJA 4YG2F 1LR5A 2ZKLA 3OD0A 4RGSA 5HLIA 5KHHA 5F6FA 2K0GA 3K0LA 4A5NA 2VONA 4F8AA 2BNMA 2ET1A 4MH0E 1HKSA 2PFBA 1YFXA 3M3IA 3F8FA 4KA4A 1GHCA 4P96A 3ZMZA 2KXLA 5ILVA 2EA4A 4PGGA 4HVQA 1Q3EA 3C7JA 1WGPA 2VPVA 3TNQA 2XIGA 3LSTA 1QGPA 4UV8A 3ABTA 2GC0A 4E2QA 4JBAA 4O9GA 5BMZA 2K9ZA 2E1CA 2Y0MA 2DW4A 1BC8C 2XL7A 3NKTA 2OD5A 3GBFA 1RI7A 2IA0A 4UBHA 4LG0B 1HXDA 3ERED 4O3MA 1BJAA 2K02A 1YO5C 2M5WA 2JT1A 4MEYF 3RI4A 5LEJA 2MPFA 2KJBA 1UIJA 4IEQA 3F23A 4A5MA 3IDCB 3ZP5A 1G3YA 2CGPA 2HWVA 2MD5A 1Z9CA 4KWKA 2QNKA 2HOEA 4WWCA 3RDIA 1BI0A 1J3PA 4PIYA 4AQ2A 5FFZA 3ROUA 4XFFA 2MLKA 3LQRA 1FX7A 3T1BA 3D82A 3KEOA 1ZRCA 1U3EM 4AVBA 5D6EA 4KN7X 1ZVFA 3WTTC 4M9SA 1SD5A 4OIOF 4HVRA 2Z69A 5D6FA 1F5TA 2G7UA 3HUGA 1EYBA 1MKMA 3P9IA 4WZCA 3E97A 4X6RB 3K2ZA 4YARA 4O6JA 1P2FA 1SMTA 1ZZCA 3L7WA 3MWMA 5I93A 2ETEA 1J58A 3KP3A 3SCFA 5J8CA 1YUDA 2CV6A 5FD5A 4HBLA 3D0SA 3MYXA 2VT3A 3RNSA 1ZRFA 5L3DA 4LEJA 4EQQA 5BV6A 3K1PA 4KMFA 1OYIA 1Z6RA 1CGPA 2XGXA 4M6YA 4G7OF 1RZ4A 4G9YA 2R7DA 3LOIA 2YX7A 4I2OA 3DP7A 5L3EA 1WRJA 4EM1A 4KIBA 3WTXC 4MQ9F 4U0WA 3ES4A 3PQKA 4IXAA 1DP7P 4XF1A 1ZAOA 2KIFA 3I59A 4KFCA 3JSOA 3TDZC 3BU7A 2IJLA 4XLPF 3SXYA 3U2RA 5J3UA 2FBIA 2EA7A 3F21A 4LLGF 1X8EA 4NVPA 1HW1A 1WA4A 2KRFA 2B9UA 1BI2A 3R4KA 4M71A 4HF1A 5D5UB 4LMYA 4MEXF 4KICA 5BS6A 3BJ6A 3J7AO 1DPUA 1D8KA 1EH8A 2OQGA 5BPIA 2Y0OA 3T8RA 4IEZA 1GVJA 1Z1DA 3DPTA 3PLQA 1UD1A 5HI0A 5I0TA 1OKRA 1XDSA 4BYYA 5DCMB 1ODDA 4B09A 4Q0QA 4E70A 1QBJA 4XETA 5ED4A 1O3SA 3EO6A 2PFWA 2RVCA 3I4PA 1QPMA 4ETSA 1OYYA 1FWZA 3ECHA 1CX4A 1ON2A 4L9JA 2H6CA 2DQLA 3K1MA 1YG2A 1FC3A 5AONA 1YFHA 5LHIA 2P5KA 1ZZBA 1G6NA 1QNTA 1ULYA 4AVPA 1GXQA 2GH2A 4XEZA 1P92A 4XF4A 2GAUA 1OYWA 1FSHA 4KWLA 2FBKA 1O57A
chains in the Genus database with same CATH superfamily
3HBZA 3GZUC 4AEJA 4LK0F 1W6MA 4DBQA 1R4NB 2ZXHA 4AWDA 1COV3 1YQCA 3OGGA 2YY1A 1OFCX 1J1TA 3FXLA 2NXNB 5J37A 5B1AH 2DJIA 1P9QC 4KGGA 5HDNA 3HQXA 4BU2A 3OWTA 3RI9A 4ES9A 2IXLA 1F4AA 2A1XA 4GZ9A 5I0UA 3KM5A 4K1ZA 3CIHA 3PIJA 2YUSA 3BJAA 1DPRA 3LDKA 3ZXAC 3CCYA 1A6IA 2Y26A 4PIZA 1S7OA 1VQ6I 2R7EB 3LKJA 4GXLA 3KT4A 3QPLA 1RL3A 1JHNA 1RUNA 2FOKA 2OPKA 3NKGA 1VQLI 2WKKA 1AKHB 4Y1XA 4I02A 3ASIA 3VKMA 2W1UA 2K40A 4XKWA 4GO1A 1OR7A 4YWAA 1G9DA 2VY0A 2PI0A 4RM2A 1V70A 3TMOA 3B69A 1WWXA 3ZIWA 3OGSA 4WZFA 3WF2A 1P4WA 5M5YJ 2KZGA 1W9YA 1XU2A 2W82A 1FBQA 5HLGA 1LECA 2QQAA 2M45A 2HWF2 1O6UA 3VL9A 4LGWA 3FKIJ 4XFGA 3V8LA 4FISA 2X9DA 4HEA2 2XPUA 2WFF2 4TWTA 1IXSB 2JG8B 1JN2P 4KBBA 2EXHA 2JVHA 3ZN4A 3O1SA 1UX7A 2VOXA 2OBPA 5C4JJ 3ZPOA 2VIXA 2Y60A 2RMU2 3U4SA 4YNIA 3BN6A 3VBFB 1ZELA 1QRYA 3FHAA 1CZTA 2D93A 3VWBA 4K9SA 1NG7A 3WQ0A 1S2KA 3IWFA 3ESWB 3AVSA 4NHKA 1RUG3 3ST7A 4XCBA 2D1HA 4XJAA 2BZDA 5C3EJ 2Z1DA 2KD7A 1UN1A 2EZLA 4IETA 3O1PA 1DGWX 5CG8A 2GALA 3MIBA 2R1BA 5FOBB 3AXEA 5LRRA 4QGMA 5C3OA 1TT5B 2MHFA 2QM3A 5FLXZ 4XORA 1AUYA 2WN2A 3NRUA 2QWWA 5J98B 1COV2 2WYSA 2DBBA 5APAA 3MFAA 2VPLA 5DUUA 5JPNB 1H30A 3IN9A 4G7ZF 4NJ4A 1X33A 3DBHB 3ES1A 2R7UA 4OULA 4YIRX 1LDDA 2VL4A 1YHFA 1IPKA 3KEQA 3WU1B 1ZZ8A 2R7QA 5KC6A 4AXOA 3V0BA 1NY71 1NE4A 3BP8A 3RZLA 2QSGX 3S30A 2E2IJ 5H6RA 2HDCA 3THPA 5FKCA 3LSEA 2P6SA 5B1BH 2J1VA 4HL0A 1YQAA 5E1WA 4G3YC 5K1YA 1MQTC 3R6SA 4YGEA 5EGOA 3AG1H 1YX5A 4B4RA 4N0BA 3AXDA 1E5HA 5A33A 2E1MB 2LRPA 4QPIC 5J36A 3DLLF 5LBEA 3R0RA 1BK0A 5KAIC 2GNMA 3S3MA 1N75A 2M7AA 1PK6A 3I4NJ 2YBKA 2VQ0A 5KHDA 3EB7A 1HXS2 5C3PA 5FQ0A 2J1TA 1CWPA 5J47A 5A7NA 3UK9A 5LA9A 2CW0F 2P2KA 1I5ZA 2NYXA 5L9VA 2VKEA 1FYMA 4IRGA 4IQJA 4QPIB 2E32A 4PJ0C 1V6IA 1MMSA 1MBJA 3CU7A 3LIGA 4NHLA 1PO12 4P9GA 1GQGA 1BMV2 4UF0A 4CDQA 3QPHA 2VQHA 1Y9GA 3DQVC 3TGNA 4CDWB 1CJPA 2BERA 2QENA 4MTDA 4NC8A 2DA2A 4XOGA 1B35A 5L7OA 1VAKA 2HOAA 3H9GA 5IATA 4I98B 4D94A 3POGA 2EIGA 4ISRA 2JPCA 1W3VA 3PVEA 3KF3A 5FYMA 2WBKA 5FD6A 1QJFA 5HPOA 3P9CA 3OYJA 4C3JJ 2VBBA 4CP2A 2LVSA 4EGZA 3BG5A 1D4VB 3BWGA 2FRHA 2KJCA 1CN1A 1D2SA 1HJFA 3TRSB 1JUIA 2PEXA 5A6QA 4AEMA 2Q0AA 3NSTA 2QQKA 2Y48A 1A6CA 1P4XA 5FO8B 1X1CA 3RZOJ 1WI3A 1TMF1 2B9VA 4LD5A 3WGHA 5CFDB 3QOEA 1GZTA 4DOUA 2D43A 3DEMA 1X8MA 4EWDA 2Q4SA 4LA3A 1K6YA 2K4JA 4RS5A 2BUKA 1XGSA 2W08A 3OYHA 2ELHA 4OLLA 4RGKA 4JQFA 3JTHA 5FZ9A 1B09A 1KJRA 2AQEA 2R93J 1HKTA 2UUZA 1VRH1 2OQRA 1GANA 1RUF1 2XKPA 3NNFA 2JA2A 5HLHA 1PO23 1REDA 2PMWB 5IW0A 2EV6A 3RWNA 3FHNA 1BQPA 1LHVA 4L11A 4ZPIA 3VBUA 4XBFA 5SV8A 2ZXIA 2CW8A 1IV6A 3CMGA 3T8TA 4RMNA 1TT0A 4DZPA 4IEJA 1WI9A 5FZ1A 2XF7A 1F5FA 2H09A 1WLWA 2LKXA 2EINH 1IG0A 1S0FA 3H3ZA 3UETA 2DVAA 3M1HA 1RUI1 5I8TA 2IGOA 2WA0A 5FUNA 2F6BA 2UU8A 1OH3A 1YQ8A 2ZXQA 4A3KJ 3V0AB 3AYDA 3Q5FA 4II2A 4AFMA 2A6TA 3T2TA 5HV0A 3K70C 2ZGSA 1RUC1 4R1HA 2OW4A 3WG1A 3GVAA 1ZBE3 3REOA 3SEQA 2ICWG 1AX0A 2CAUA 5JUVA 2Q8EA 1W9WA 2VXRA 4Q8KA 2TBVA 2F2EA 1WLCA 4K21A 1WJFA 3EJKA 4CH7A 4IHVA 2A69F 2R7XA 1AR61 2QF7A 2F4LA 1RUG2 1IN4A 3QWLA 2DOFA 4EEFG 1RUH3 2FMYA 1W0UA 2PLV2 4CP0A 2E1MC 1W1WE 4TTGA 3WG4A 2Q1FA 4FO9A 3CCQI 4BQXA 4TLFA 2EIDA 4RAGA 1VQKI 3GFJA 1UFMA 5E8GA 4PSWA 2XAQA 2XGEA 4NE9A 5EJ3A 3PFIA 1GNHA 4EROA 1V5EA 1XSDA 2ZJ2A 4CPBA 1J1LA 1LOGA 3MD2A 2JVGA 2ZSHB 3LQCA 4A42A 3LD8A 3FXRA 5J8FA 1YW8A 3VODA 4JTNA 3DPRB 3GHNA 2VOTA 3G6JB 4MQVA 1QXRA 1XNDA 1Z6TA 1N47A 3GTLJ 2OTLI 3G4SI 3O0WA 4ATFA 4IEVA 5A33B 3RZHA 1OISA 4OFGA 2H27A 4HNUA 4RL7A 5FYSA 5GP9A 1ZBA3 2VCBA 2AGSA 2WQZC 4QX8A 2BOIA 1ZRIA 1WCMJ 2O8OA 3ABKH 1G2HA 5JDBA 5DAWA 1Z91A 4WVVA 4NN0A 1R1VA 4A3JJ 4ZYAA 3W6VA 3VDAA 4YGDA 5FRNA 3GLXA 1FBUA 3OPZA 4BA6A 3R4UA 4AI8A 1DDNA 1P6RA 3IIAA 5IVYA 5CQGA 4A3XA 5T5PA 1ETXA 1D0GA 3OYGA 2ZCWA 5FTTC 1W9SA 1IAWA 4FOYA 4HX8A 4P9UA 5DMYA 5K7ZA 1TP4A 2CHHA 3M07A 5IT9Z 2FQ3A 1TWHJ 3RMXA 3MIFA 1AJOA 2PJPA 2ESNA 5C71A 1IN8A 1M4WA 1W8NA 2A07F 4EJVA 3KGLA 3P7NA 3EMRA 3AC0A 1PM7A 3RZMA 3V4GA 3WU0A 3SCGA 1QQP1 1U5TB 2ZGKA 4PGHA 2CYYA 3OJBA 3BR1A 1WKYA 2BVVA 1QJU2 2B8MA 3R61A 4IW3A 1TC3C 3VD7A 4AW7A 2SLIA 4ZZDA 2ZMEA 4MV2A 5IK5A 2LYCA 3M3OA 5FROA 5I0RA 3O7OA 4LBLA 2VN2A 1I6XA 4KWJA 2LF7A 1HB3A 3AKQA 5GADJ 1G9BA 4IJAA 1QU0A 4LKEA 3JRFA 3C2BA 3ML6A 2WZR1 2F5EA 2YB7A 4UV9A 1YRNA 3LE0A 4QPQA 3JAMK 5EJ1B 4EWEA 2VKDA 4LUMA 2WZR2 1HQLA 4FPFA 2CUJA 1RJ8A 2WINB 4HAMA 1Y56A 2UZKA 2JA6J 4XJ9A 4LR4A 4XW3A 4YW5A 5IAVA 2WAAA 2VXZA 1K5JA 3GWZA 2IS4A 1C4RA 2ZHLA 4IE5A 4L9VA 2ZX4A 3IRRA 1IS3A 1QWRA 2V4JC 5JSRA 2UXXA 4HLYA 1Q8SA 4PCQA 1HC8A 4NRPA 1W6QA 4XABA 2XC7A 1ZLKA 3PVBB 3VZMA 2KDZA 3AMNA 3BPXA 2B7YA 5CFDA 3GTMJ 1H8TB 3AP5A 5FDBA 3LAPA 1J9IA 3WX5A 4AR2A 1W28A 2O9LA 1YIPA 2QQ8A 4QXHA 4XXPA 1ULFA 1IS4A 2GU9A 3I2HA 4PZJA 1NKGA 3NMBA 2QQJA 4ARXA 2QJVA 3L2QA 5D8AC 3PIOF 4S2FA 2ZEYA 1Z7S1 4Z07A 4CEWA 1W0TA 2X5IA 4AGVA 3W5NA 3EUKL 4COWA 4IV1A 4EZHA 3SZTA 3ISPA 3KMHA 5E89A 5F0HA 2D6MA 1NQJA 2DA7A 1SLCA 5IFPA 3ECOA 2Y64A 3HOZJ 1FOD1 2VULA 1YFWA 4MGZE 3PDQA 4PJLA 1CAWA 1V6KA 2IPQX 2ZACA 3OG2A 5A7SA 2OAZA 2PX9A 3HC7A 1MQTA 4L0PA 1PK6B 2EV0A 1RNLA 5H20A 4QKNA 3A22A 1PK6C 3PVOA 1QJU3 2QVOA 5AFBA 3B02A 3KYDB 1BM9A 4DIQA 1J75A 5JI9A 1UKGA 2MW8A 3FC0A 2UYAA 3VOEA 3VDDB 3R0AA 2A3XA 3GFLA 2Q8KA 5JZGA 1D5YA 1SEUA 4OIQF 1FATA 2RDSA 2HWE2 5JIUA 4XLHA 5GLZA 1HJGA 4GULA 5FY5A 1FIAA 3RYPA 3ZFFB 3POIA 1ST8A 1G3WA 3IV5A 5FK8A 1WSUA 2GLOA 3MVPA 2ESHA 2HKOA 3VPRA 1PJRA 4G6TB 2OT7A 1ASJ3 5GZFA 1SPPB 2V4VA 3IP4B 1UCRA 5TISC 4XLAA 4YELA 1H8TC 1X4PA 1HKDA 2D5FA 1S0IA 3UKTA 5K7HA 2BY2A 1W5CC 4Q4X2 1O8PA 3LSIA 2WWUA 5FMCA 5DV5A 4Q27A 3EDPA 4Q4X1 1S2BA 3FKJA 1VAMA 2ZPXA 5HXMA 3DXJF 1VMJA 4XYXA 5JZGC 1TL8A 1BI3A 1CQTA 3VYTB 2HWC1 2UWAA 4PBOA 5HXVA 1H4GA 4JZRA 4FHTA 1JGSA 1RMU2 2HTJA 4AE2A 4AIHA 4G8XA 2K7LA 4EJRA 2F5CA 5DYMA 5CFDC 4BEHA 2VH9A 5C4WB 2J5OA 2IXCA 3V56A 1YNAA 3TP3A 3EYYA 1ZYBA 4MGQA 1K45A 2C24A 4D0PA 4PSXA 2R7ZJ 3BG7A 1XYOA 2Z4FA 4BHPA 1ZYRF 4NO4A 3TO7A 3KS7A 4BQNA 2VZSA 1US3A 1SD7A 3RZGA 1NLQA 2R7FA 5DDJ1 1I1EA 3RMYA 4K8FA 2WAQA 1HW5A 3CDIA 1E17A 4RQPC 1Y8RB 2O61A 3GYDA 1OJLA 1PHMA 1Y1WJ 5FZMA 2GC3A 2WV0A 3ZSKA 2VE1A 1V5GA 4IGOA 3E5XA 3W6KB 2VUAA 3FL7A 2K9SA 4Y4RA 2JDNA 2RS33 3AP9A 1UY0A 5JIAA 1ND3C 2L5QA 1SMYF 4DINB 2EQRA 1DP3A 3CMMA 2DPDA 3AX4A 2QE3A 3MN2A 1D2QA 3KD4A 1MZEA 1E0EA 2ZGTA 2RKHA 1JZ3A 2LOOA 3WW2A 3BYWA 1H8VA 3KQRA 4BXSV 5DD8A 4BKXA 4BDYA 3HEIA 1LGBA 3WD5A 1QVTA 3MBWA 4QD2A 4QM8A 3VBHB 4A12A 4IX7A 3NQHA 1FLIA 4YW7A 4XFIA 3H7YA 4CSWA 3WSOA 4G94A 2VVFA 3WR0A 2VQAA 3L09A 3S17J 1ULOA 4F52A 4HBNA 3W59A 3Q9VA 2GC1A 4LG0A 4EMSA 2W85A 2RS52 1UJ8A 5FY7A 1AR82 2QVSB 5F39A 4BQYA 1I5PA 5LGNA 3I49A 4IRIA 5K7FA 2VODA 5E18F 3SXWA 3NV4A 3JRIA 2VW1A 2QBXA 2MABA 2VQUA 3RVHA 3HYIA 4P55A 2RC4A 3FLTA 2WFF3 2JQ7A 4CYCA 2PMUA 3RGBA 1J5YA 3ZMNA 3ILFA 2BBYA 3WTWC 3A1YA 4LBNA 1W7PB 3EUAA 5EJZB 1B4AA 5J6XA 1TTYA 5BNOC 5KVRA 5FKBA 3JSPA 5CADA 3RKYA 3AFGA 1BBT3 1L3JA 1JUPA 2YDEA 4LITA 1BYHA 5FZFA 5IWFA 3BR5A 1Y43B 2NQYA 4N43B 4KL1A 3ZFGB 1KJLA 3CJIC 5FZDA 2Z2SB 3S7IA 1MBHA 4UT5A 2KZVA 1F43A 4U0VA 3KCYA 4Q4V2 3BC8A 2QLZA 4MYEA 5EG0A 4P08A 2RM22 4JTOA 3F6OA 4Q4V1 3GCWA 4WVZA 1B59A 1W6NA 1F9KA 3VBOA 4EGYA 4KG0A 2HLEA 1JYTA 1EAH2 1QZYA 2Z33A 4LO4B 4YM3A 1JKRC 4M4PA 3JD72 4XJ8A 3NVCA 1TWFJ 3P5BA 2E33A 4G6DA 1REPC 2E7XA 3KLSA 1I50J 3ZM8A 2LD5A 4BNCA 4E4HA 4HYEA 3DECA 3I53A 2IT0A 2XJUA 4AYBA 5C9AB 4UI9L 5DXDA 1MIJA 3S1RJ 3I3MA 1POV3 3KZIC 2NYYA 1C28A 1W9FA 1YYVA 2D98A 3OCPA 4CZCA 1N3QA 1UW8A 5JXIA 3DKQA 4DB5A 4MXWA 1IGNA 1XGNA 3VYUB 3FXMA 5DM7F 2P8TA 1IQDC 5JR2A 2UURA 1MDMA 4C8DA 3HRSA 4BZ4A 4L2NA 5HVQC 3QQAA 1YFUA 1PVC2 2K9MA 1XRUA 1QJY3 1VQMI 4IHXA 4YVSA 1WD3A 4BB3A 2ZZQA 3BI3A 3PNYA 4YW1A 3J7YJ 4K2EA 4HZFA 3K9TA 3G1OA 2VAUA 4A6EA 3F95A 2QKDA 3TEXA 5A7PA 3Q8CA 4I01A 4QX3A 1WW7A 3POSA 3WXPA 3KHCA 4PI2A 1VQ7I 3VHNA 2ET7A 1MS8A 1Y1VJ 1B72A 4EN0A 4Y17A 3N36A 2D6LX 1RVF2 2D97A 2P7VB 2L7KA 4FP3A 3KP4A 2LKPA 1K61A 5CZKA 3OIPA 5FZGA 2A6ZA 1LJ9A 3MW2A 2DODA 1IS5A 4S2GA 1ENSA 1BCXA 1O4YA 4YZ2A 1A3KA 1ZR4A 1HSJA 4GJZA 5BNPB 1DYOA 1JTZX 2UYBA 3H9QA 1YE9A 3JXSA 5HDGA 1O4ZA 1SMVA 2WB1A 1Z7S3 3W2VA 5D5WB 2ZHNA 4UVAA 2HNHA 5D5VB 1RIOH 3HXLA 4GB33 1IKPA 4RLFA 3M70A 2XUBA 4AFBA 2YGLA 1XC6A 3I8TA 4CU9A 1JJ6C 4QTRA 4QU1A 3OOXA 3W2AA 4NC6A 1J7KA 1CAXB 2A6HF 1W0OA 2ETHA 4Q29A 2BOJA 4IV1B 1VF9A 2STTA 3ZN0A 2DO7A 1G4DA 1YC61 1NA1C 4TYSA 2IA1A 5FZHA 1H6XA 3E5QA 4JX4A 2A6EF 3H0GJ 3M2MA 4UFLA 5HCBA 2JN6A 4M3DA 4FETA 3BALA 4B7EA 1B8IA 1GR3A 2LNBA 2E7QA 2YG0A 4KIFA 4CICA 3IH2A 2D40A 3B01A 2WWJA 3TOBA 1W8FA 3CHXA 1QJEA 3OEAA 4BLJA 1VTNC 2Y38A 3T0AA 5FO5A 4KDPA 2DCEA 1WMXA 2D7FA 2X6YA 2DA1A 4XJZA 2ARCA 3KCXA 3GBGA 5H9QA 1AR73 4LLNA 1UHWA 3PU8A 3H35A 1IDYA 4NAMA 3ZYGA 5L3FA 5L9BA 4AHWA 3MUY1 1BBT1 5GAGJ 3I71A 3BPVA 4A3EJ 3D4KA 4U0YA 1Y8QB 1XPWA 1PVEA 1W3XA 4HSLA 2Y8KA 1E5RA 3AG3H 3BCAA 2LH9A 4IEUA 4N7IA 1GQPA 1US2A 5J7MA 5A1LA 2FCUA 3QYBA 3LDRA 3QODA 4WXHA 1H6YA 4S0HB 5EXOA 3B6AA 3KPHA 1GOFA 3T1MA 1SD6A 2ZJPF 3IRQA 3VZOA 3J8F3 3CCMI 3TBDA 3JQXA 1EH6A 3FHQA 2ZX1A 3PUFA 1GZ9A 3SHRA 5M3MJ 2IFWA 2P6CA 3NWSA 1NXMA 4F7ZA 1XNKA 1HW2A 1S72I 4BCUA 3M3EA 3ZKYA 4OAZA 1EV7A 2DFHA 4I3PA 1WJEA 4NC7A 1RUD1 4UFHA 2AZ5A 1XYPA 4BAYA 4IGPA 2X0LA 2L9LA 1FPN1 1TG7A 3KLNA 2O14A 1PGL2 3PTRB 2VU9A 4WXDA 2D5VA 4PF1A 4Q4V3 2X10A 5A32B 2YFZA 5FKOA 2UV1A 1UY3A 3MF6A 1STZA 2Y34A 5LASA 4YEJA 3B5LB 4M72A 4G7HF 4BY7J 3USSA 1NA1B 2E2HJ 1NOVA 1I6HJ 1VBD1 1K5MB 4N9IA 5DCFA 2VMDA 3VBSB 4QHOA 4YVWB 5F08A 5T52A 1X1AA 2QUFA 3KGZA 1LR5A 1UPSA 1MEC1 1O4XA 5GTIC 4RGGA 1X1DA 4BM8A 4MLOA 4XLFA 2NVXJ 3O1UA 2CNAA 3WP5A 3VLBB 2R5YA 3K0LA 2VONA 1QQP3 3NJXA 4MH0E 1X4OA 4URAA 5A7WB 4P96A 3ZMZA 2KXLA 1HQNA 5ILVA 4CXXA 1IPSA 3ASOH 1LENA 2EA4A 4PGGA 1FMD3 2HOTA 3TNQA 4JDOA 1NA1A 3LSTA 3ABTA 4JBAA 5BMZA 3J7LA 1YX3A 1R49A 1YJLA 3PJRA 2K9ZA 3LOBA 2Y0MA 3GTOJ 1PZ9A 3NKTA 2ZJQF 1RI7A 4UBHA 2ILMA 4YVSB 1R091 3ERED 2WA4A 1MMNA 2XG3A 5FY1A 2R063 2M5WA 3JREA 2VVDA 2JT1A 4RYDA 2VTXA 3BTCA 4Z8BA 3GXUA 4FE7A 4V2GA 1CIYA 4A5MA 1PVC3 3IDCB 1PGW2 2XSJC 2L7MP 2HWVA 1Z9CA 4KWKA 2TEPA 3DPRA 4WWCA 2FCTA 1J3PA 3DXTA 2A3YA 3HBKA 3S6PA 3PSFA 1S0JA 2WS93 3DXUA 3LQRA 3NWTA 5IVJA 1ZRCA 4ANJA 1V55H 4W1UA 5J09A 2R7WA 1G9FA 3WTTC 3EUHC 3S5QA 2WO2A 3HUGA 3FUOA 2LY9A 3T30A 4WZCA 3E97A 1LOFA 2VKHA 4EATA 1D0ZA 4HXCA 4ZKTB 1G59A 1PO11 3MWMA 2DBIA 3A02A 4LKDA 3SCFA 2AH2A 5FD5A 4HBLA 5DG1A 5FV3A 3MYXA 3OR2C 2C9KA 3BQYA 4OHWA 3Q8BA 3SEZA 4EQQA 3POJA 3K1PA 4FTSA 4KMFA 1Q8PA 1SDDB 4G7OF 2R7DA 4JDMA 1WRJA 1ZA4A 2YS9A 4H4KC 2UWCA 1MSFC 3ES4A 3DTIA 4IXAA 5CNAA 5A3UA 2Y6FA 2VMGA 1UMIA 1G86A 3P6BA 4P9JA 2EXIA 4CA0A 4XQWA 5FPAA 2JIJA 3PNVA 5FZ3A 4XQFA 3LFIA 2FBIA 4MHRA 4F91B 3H8RA 1HW1A 3GBWA 3MKZA 1WMEA 1V6OA 2B9UA 2GNBA 2VNRA 4HETA 3R4KA 4M71A 2V5DA 3KHBA 3AMHA 2EXKA 4MEXF 4KICA 3BJ6A 1QDCA 1DPUA 1D8KA 1EH8A 2OQGA 3M3QA 3FN9A 3OPWA 3O1TA 1UU4A 3PLQA 1ACIA 1FV2A 1XDSA 4BYYA 5DCMB 4B09A 1NT0A 1QBJA 5ED4A 5FMDA 1YRNB 3IUOA 5C3RA 1QPMA 3BR3A 1OYYA 4JGYC 1CX4A 5IK4A 4Q4Y3 3WOGA 4A3IJ 3FBMA 1MVEA 4LQRA 5EIYB 5FYCA 2BBVA 5AONA 1DGWY 2VZUA 1BEV1 5HODA 3S5AA 1LNSA 4AVPA 1GXQA 4LT5A 2ELJA 2PHFA 2ID3A 2VM9A 1FXZA 4FPHA 3VD4A 1FNZA 2FCVA 4R52A 3SZPA 2FQ4A 1G3TA 2W25A 1KGYA 3IAS2 2Y9ZA 1WZXA 3CUQB 4QMAA 2WL1A 4HDVA 1RUD3 3HOBA 1JHJA 5A3PA 3OMYA 3WZ1A 4JX6A 4LO7A 3WUDA 2TDXA 3MAJA 3OYDA 4YRDA 5F2SA 3RKWA 5I8SA 2JTVA 2E1NA 2X6XA 5F0CA 3HOYJ 3AKTA 3FXJA 5FPXA 1TQIA 1UY4A 4U88A 3AFHA 2FU4A 2PLV1 1N78A 2ZX0A 2XASA 2WO1A 3HJEA 3CO2A 3FWEA 4QGNA 5ICEA 2FDKA 4AI2A 4IEXA 1TWCJ 2P0WA 4HT1T 2Q8DA 5E17F 4OUEA 4IQPA 3K4JA 5LK5A 1RC9A 3MHZA 2Q0OA 1RHI1 2BW8A 3U9GA 3L9JT 4G9SB 3N9QA 2OF7A 4MUVA 3ACLA 3CP2A 1LULA 5FYHA 3C7EA 1OLMA 3CUQA 3CJNA 2CWMA 4PDWA 3RQ0A 3H9JA 2XR4A 5F1JA 3DF8A 1PM4A 2VNVA 3TAYA 2L0KA 1AVBA 5DUWA 4ZU4A 4AQ6A 3O0VA 3LFUA 1FI2A 1N1YA 4UNOA 5F7UA 1WH7A 1IOAA 2PLYA 3ZSEA 2LTPA 4E27A 2P5LC 4B43A 4WVMA 2RR13 1ZA7A 1NUKA 3ZXFA 2QQMA 5FP7A 3TN92 4ASLA 2GBYA 5E16A 3UKNA 3PURA 4CU6A 4X8PA 2DMTA 4XACA 2R4GA 1KDKA 3Q8FA 4JRLA 4A7ZA 4YVWC 1CF7B 1RUG1 3JQWA 2AHQA 1S9HA 2A6VA 1EF4A 4E2GA 2M7BA 4HSTA 1FYLA 4ZHNA 1RINA 3K2OA 3MQ0A 3H1MA 1NCQB 4Q1RA 4Y1UA 3LSKA 2PG4A 3J9SA 3ZVXA 2VPRA 2XBO3 4E7JA 3HTSB 1TME2 4XF3A 4B1MA 2DUQA 5ACA2 4GWIA 3HKZA 3OL3A 2E31A 2LM3A 3VBOC 2DTWA 2WAEA 3WCSA 2VZ3A 1M1EB 5FRAA 4HN0A 3WW1A 3P5JA 1UL9A 4LO8A 4AHZA 4QX0A 4QX2A 4B8EA 5IOZA 1ZG5A 1FOD3 1W2TA 4XF0A 2R043 5C5TA 4C1XA 3I3QA 1HRV2 1OSGA 2VMFA 2FA5A 3PSIA 4NIAA 5B4NA 4RSUA 4ABZA 4IESA 2CSGA 2OV7A 1W5TA 4XQ4A 4AYUA 3O6BB 2LMDA 1RUE1 3TOAA 1XDUA 3H1WA 5CISA 2DMUA 2GP3A 5A6ZA 2WZ8A 3I97A 4U87A 2ZFWA 3RQIA 3HJRA 3SHFA 1EV11 4QWQA 1YWKA 2ZMKA 3ASNH 2D44A 4Z2AA 3ZN6B 2IVJA 5J1RA 1WFXA 1J3QA 4RHV2 2PHTA 1EV12 3CLOA 4BQAA 5CLSA 2D3SA 4Y15A 5FZIA 4Z1VA 2IXHA 4CU7A 5A6YA 3NL1A 3S7EA 4QPOA 3J4UH 2QQBA 3KF5A 3ZRGA 4YFKF 2ISZA 1NH3A 4IVNA 4KH9A 1D8JA 1UHMA 2PQ8A 1TMF2 2QEXI 2H6BA 4CA9A 4M73A 4RAFA 3U78A 1T38A 4BE1A 3QP6A 2ZGOA 1RKWA 2DBNA 2WT1A 3OS0A 5J4VA 2XHKA 4P02B 2XJQA 3HPNA 5FLJA 4A93J 1A31A 3E5UA 3WLUA 3UNGC 3B3QE 2X05A 3IWZA 1HV0A 3CC7I 3EYIA 1R083 5JCTA 5E1RA 2IXKA 2M87A 3OSFA 4AVCA 2VQLA 2H1KA 3MEXA 5EPAA 4AEKA 1UWWA 1VPHA 1KYWA 2XF5A 3KZYA 3H5RA 3BTAA 4BQ5A 3EXUA 4XRSA 2O8QA 2V09A 4RQPB 4MSVA 4ARYA 1R4MB 2NM1A 2DCJA 1JTYA 1OD5A 2YR2A 3GGLA 5L3CA 2XBO2 2LP0A 4ATEA 3MF9A 3HOVJ 4BH9A 1O7FA 3WTVC 4N53C 3ZMDA 4GH4A 4LUKA 3D5LA 1RUJ3 3LAJA 1NG0A 1XX5A 1SLIA 3H36A 1C8M3 3VBSC 5FWEA 1QMJA 2ES3A 3ZO0B 1HQWA 1SD4A 3N9MA 1IG3A 3L2VA 2VOKA 4K20A 3ZQIA 2CUFA 2WT0A 4M6XA 1JOPA 2Y30A 4W6XA 4LA2A 1MBEA 5FMBA 1KRIA 2KT0A 2HWD1 3UESA 3WQ7A 3HKZN 2B9SA 5FUPA 3CMAI 5CFCA 2RQPA 4RFRB 1HDKA 1HRV3 2HWD2 1HSTA 1NCRC 1UG0A 5EYYA 3HGYA 3FM5A 4G6QA 3VYSB 3WW4A 1BJZA 2PHWA 1ZM1A 5T54A 2DA5A 4C90A 3JU9A 3CUQC 2HGCA 5D8AA 5FXWA 5KK1A 4IOAF 1W8TA 4D9JA 2P5BA 1AKHA 1AL22 2V73A 2LREA 1S8NA 1OF4A 1C1LA 2BWCA 3Q8EA 4Y20A 3DKXA 3SZGA 5JLVA 1EV13 3UGGA 1LKXA 3WNPA 4XCAA 5K0UB 4PQQA 3LQQA 4GMP0 4E2SA 1EP0A 2R7TA 1UZVA 2QKLB 2IXIA 1EH7A 5M0TA 2TRTA 1AZDA 4MHGA 3SISA 3WHUA 3RSJA 1SACA 3RI8A 1O3QA 1PMJX 4KMQA 2DCTA 4DMIA 2JD4A 1QO0D 2UXNA 1UZWA 3WQ1A 5J48A 2M9HA 3IDBB 5FREA 3H3LA 3TKYA 4RLQA 1Q8OA 2CAVA 5F27A 3TW6A 5FZBA 2B46X 2JE7A 3LOCA 3JR9A 1YYNA 4CCJA 9ANTA 5DAXA 5DUKA 4JAAA 3AKRA 1QJY2 1UZZA 1UY1A 4CP9B 4KITB 1O5UA 4LJZF 3E6BA 3UKGA 2XL9A 4XUNA 4EYUA 4Q48A 3RJ2X 1O4TA 1XTAA 4D7SA 1T56A 1YIFA 4XPVA 1W05A 3OYLA 2VC0A 2NNYA 3OYNA 1OMIA 3HPHA 3CJIB 2KMUA 3K46A 5DUXA 5KHKA 2Y0SA 2DFEA 1O5LA 4C9YA 2Y0SN 2CSOA 5FRMA 3TO6A 3Q3SA 1PUEE 5DDJ2 1F9NA 4HNTA 3U75A 4NIIA 1K42A 5H9PA 2AREA 3DEEA 2ZGRA 4FP2A 4YM0A 2XQXA 4UUVA 4HLTA 2V9VA 5FPVA 2RDPA 3CESA 2UY9A 2MA3A 2V1UA 2W48A 3N3HA 3FUQA 2H8RA 4QXCA 3AKPA 2DUPA 3WE2A 2DMQA 3KFWX 2XVGA 2COBA 5EEAA 4HV6A 1WCSA 3AMPA 2SBAA 1K78A 3GJAA 2BY1A 1AL23 4CYDA 5FY8A 4PDKA 2VI6A 2ERFA 2VE9A 4FBFA 2M0CA 3RQ4A 4C30A 4TZDA 2RS11 5EF6A 4QPIA 2VMCA 3ZN5A 4ZYEA 1HB1A 2HKXA 3M8JA 2EA2A 1W6PB 2DU9A 1NCQC 3HB9A 2EWNA 3JRDA 4L18B 5DEQA 1SG3A 1UOBA 3N35A 1CPNA 5A7WA 2BU9A 5SV5A 1R1UA 2EFPA 2E63A 4LOCA 3LSDA 3PUHA 3GTGJ 5JVVA 4FQZA 4OCTA 5H2FC 1XCVA 2DVBA 1IXRC 1W6PA 3M3YJ 3OOUA 1JE8A 3DF0A 1UCXA 3HIFA 1XMXA 1AR93 4BDZA 3R60A 4II3A 3FFZA 1VBB3 5FBZA 1LQ1A 3EYPA 2XAGA 4YW2A 2JG8C 1VBE3 3T1LA 1QQIA 1IGOA 1W2AX 4CDGA 2VLAA 3P3PA 1X50A 4Q26A 4A44A 3LFKA 1ULPA 2VC9A 5TJJA 2O3FA 4LLLA 5EDNA 1Z77A 4XUOA 1ZTRA 4D7TA 1OVSA 1JYVA 4M9ZA 2WAQN 3J81K 5C44J 3Q8AA 2Y6KA 3H0OA 5K8SA 1OH4A 3P9KA 2EFQA 1S3JA 4OIRF 4Y5TA 3LSPA 4RS5B 4A4AA 3QRFF 1RUJ2 2ZB9A 1USTA 2JKBA 1HDDC 3LAGA 3U1KA 5EWSA 4FOQA 5BNNC 1XE0A 2B4KA 1EUUA 5FZKA 3KEYA 3NV1A 1VRBA 2WADA 4MO3M 4BDVB 1FPQA 4XRSG 4XF9A 1T39A 2FNPA 2XF6A 5F6KA 1LHNA 1HXS3 2XAHA 3OGRA 3LF7A 1DQ1A 3VB9A 4FX4A 3VDXA 1UNBA 3LB9A 2CV0A 2P4EA 4V2FA 2C26A 1K83J 3A2KA 2ZO4A 5LY1A 3I55I 4I0WB 5A1AA 4LO5B 3FZVA 4JRAA 3ZFEB 1RUH1 2V7FA 2EICA 3IH3A 4QB2A 2DU1A 4KU7A 1RUF3 3BB6A 1AYM3 1IZ1A 1PO21 2CUEA 3VZKA 1QHHD 5L73A 2BTVC 2QZ8A 2XOMA 3ILNA 3TB0A 2GMMA 2XJVA 1E3PA 1UY2A 2PQQA 1FMD2 3IH4A 5CVIA 4CXFA 2D1VA 4DBRA 3NJVA 4NHJA 3M7GA 3K6GA 3CCJI 1CF7A 5TSWA 1W6OA 1V9U3 3RWKX 3MFCA 3WG9A 4N7UA 2DA6A 5BPDA 2EIMH 2XXZA 2DI3A 4P9YA 2GH8A 4PLMA 2ZAAA 4XMYA 1FIPA 3CJXA 2VW2A 3T2PA 2KHMA 4RDUA 4INDA 1UOFA 3J7MA 4U2AA 2LW8A 1VBE2 5LCWL 3H92A 4KUMA 1Y39A 4CYCB 5I91A 3HTUA 1IC8A 5FPUA 2LG4A 2EFOA 4B3XA 1T33A 3I5UA 1VMFA 2R32A 1AR63 2WNVB 2HWC2 4Q0SA 1WH5A 1JGGA 1RVF1 3MO4A 1H8AC 2LC2A 5C8CA 3ACIA 5D1IA 5ABJA 3T0DA 3WGGA 1LEAA 2ORXA 1F36A 4Y7NJ 4LK1F 4CCNA 4NAOA 1AX1A 4YZ4A 4XM3A 2JIGA 2VZQA 1VALA 3WVJA 4E4DX 1XXNA 1F4KA 5LY2A 4CP1A 5ABJB 1JH5A 2MGQA 1BVP1 5C8WA 4P9IA 5JLXA 4FVVA 5L3GA 3M4OJ 2RREA 4IERA 3VHOA 1CAVA 1PIV1 2NAZA 4BIOA 5KHJA 1E57A 2ZEXA 3I2GA 2W0XA 1MNDA 2W1SA 1WQ2A 1DHKB 2A7AA 4B47A 2E7WA 2WLQA 1ZARA 2WC2A 3O0XA 3BCWA 2O0OA 4BJ0A 3CNAA 4ZZLA 2VJ4A 2AEZA 2LSOA 4MVTA 3V7SA 2GQQA 2RS13 4N53A 2P1BA 1W39A 4CDUB 1ALYA 4HF0A 3CCRI 2ZX2A 1DG6A 4PIXA 2W46A 1GNZA 1R58A 3WDTA 1WLTA 2VBWA 3K3NA 5CVVA 4ZY9A 5C8CB 4XVHA 2ZHMA 1QVUA 2R7VA 1SVOA 1NE6A 1X36A 2DQRA 1LNWA 3D5OA 4MGTA 3ZN6A 2JZYA 1NCRA 3RZKA 3VYRB 2FF4A 4MG2A 1K12A 3IHUA 4YFNF 2HZDA 3HGGA 3GFIA 1OHFA 3CF2A 1AR92 3GTJJ 5BQTA 1YLFA 3GDBA 4MXVA 2HPIA 4Q0PA 3ZFFA 3CLQA 3CJIA 1XSXA 5FZ0A 1B1BA 2VR4A 4XDPA 3OBAA 5LZ6A 3UKVA 5FXXA 1ZH5A 4IEWA 2ZGLA 2DMNA 2C6YA 3LPFA 3G3ZA 3S57A 2VGDA 2RS51 3V0BB 1JS9A 2HQRA 5F3IA 3SKJE 1AR81 4YM2A 4M3CB 4AI1A 5A1FA 3N97A 4KT6A 4Y26A 4GMP3 4BJTA 3ACGA 1AU7A 4OAYA 5IT3A 2K46A 2RS53 3DBRB 1KS4A 2XSDC 1RUD2 4BS9A 4XKCA 1T6SA 4BOWA 4B3AA 3H5AA 2WJSA 4HQEA 4QXKA 3T0BA 3MKWB 1T0FA 5IVCA 2QBYA 5DZGA 5C8CC 1F8VA 5DN2A 2Z5WA 3ZXGA 2QZ2A 1OVPA 3NJZA 3NW4A 2KP6A 4B1LA 4B44A 5A32A 1OR7C 2IP2A 2P5VA 1XNCA 3I56I 1D4M1 5D5XB 3C2HA 2MLGA 4ZU7A 2M4KA 4HNVA 2V6CA 1MBKA 5LW9A 3F8CA 4XTMA 1QOSA 3DN7A 3PIGA 5EEGA 1H0BA 2GIVA 2KIMA 3BTJA 4UW6A 5ICFA 1TWGJ 3AZVA 5A3TA 5FLMJ 1X2MA 1FOYA 1AF9A 5FP3A 2NVQJ 1TNSA 1CZVA 4IE7A 4DQAA 3I54A 1UU6A 5ERIA 1EPWA 4PJYA 3HM5A 5ABJC 1W6QB 2FQPA 1LEBA 2RMU1 1MS3A 2AC1A 1MMAA 3JRCA 2JRTA 3ZMVA 4U36A 1T6GC 1SAXA 1NAEA 2YU9J 1ZGJA 2P6TA 2QTWB 1KQRA 3PUIA 4PLOA 2VL8A 4HK9A 4GH4C 4FTEA 5LA1A 1JYXA 3HQUA 2FMLA 2P4WA 1VQOI 4EN8B 4FAHA 3NV3A 3E6MA 1J09A 3MEPA 3AZXA 3ZSMA 4XLCA 3GF2A 1PGW1 2VZTA 1UOGA 3HL2A 1V6JA 4ZZ8A 4D7YA 3POFA 3W58A 3JZVA 2ORZA 1GV2A 2DPUA 4LBMA 1TWAJ 3ABMH 2HWC3 2A6YA 3Q9OA 4Q2FA 3H7JA 4JHZA 2YYOA 4BXXJ 1DU3D 1Z7UA 4DS0A 4G12A 3K70D 4CE8A 2QFEA 5BNOB 1QDOA 3KZ4C 4QAWA 4BBSJ 1OT5A 2V9PA 1W8UA 3IZOA 1S4CA 3OGJA 5JXGA 2VUMJ 4BY1J 4I7HA 1ETKA 5HS7A 1W7PA 4HLXA 1IDZA 3LZZA 1FEXA 2QQ9A 5FP8A 3U1XA 2BDRA 4C2TA 2K5CA 2Y9YA 3L2WA 5B66C 5BPXA 1IRZA 5FZ7A 1JYNA 2DCYA 1YQ5A 4XN3A 1XCBA 1FT9A 2JE9A 4COUA 1LEMA 1TZOA 1PUFB 5FUIA 3AG4H 1TQMA 4NIHA 2O8XA 2NS7A 3SH3A 3WNOA 4Q4ZF 1LVKA 3ULQB 1H9GA 1MEC3 3RZDJ 4IE4A 1D0HA 4D1QA 1YJWI 2BXZA 1WVRA 3KT7A 5JVGF 1TMF3 3I3BA 3I2OA 4F55A 3IKWA 3J7ZI 1OKQA 3ECQA 5IAXA 3ZXEA 3T2OA 3ZSLA 3ZSJA 4DZGA 2WYFA 4NWVA 2OZ6A 2HH9A 4A7KA 3THCA 4BMBA 2XV4S 4O9EA 1SLAA 5KBFA 4YG6A 3ALQA 2F6CA 5ILSA 4I6ZA 2X1EA 3SJMA 1CAUA 2CWEA 4AK3A 1GSLA 2F17A 4HQMA 5FO7B 2EV5A 1KA8A 1DGRM 1GICA 4BXFA 4YRVA 3ZIXA 4A0XA 3WNMA 3GZAA 4AWXB 3ZMTA 4JKMA 1MSEC 2H1LA 2NOGA 3LA2A 2F4IA 1JYWA 3GLLA 1USSA 4Y22B 2FDIA 4NNJA 3BR2A 4G4FA 4CHUA 5CA6A 4XLEA 2AACA 3ABLH 3IL2A 2Y75A 2N7GA 2BGCA 5LHHA 1K5MC 1GUUA 1BN5A 1MJBA 5A2QZ 1W36C 4C3IJ 3SDGA 3PL8A 5L9RA 4EN7B 3S0MA 3AL0B 3NO8A 4LBKA 5FR3A 2QQOA 4Q0UA 1SFNA 3APBA 1W9TA 1APLC 1DFQA 4CTEA 4KU8A 4B1RA 1WJDA 1OCCH 2E2JJ 1W6NB 2C5DA 4X6QB 3IM0A 5D8LB 4EWAA 1RUE3 1RMU3 1RGSA 3RKQA 2ZMEC 1X3UA 2HQAA 4PFOA 5JZGB 1GDTA 1D5VA 4KNCA 4GH4B 1UHSA 2O7OA 4ZDLA 1IW7F 1IRGA 2LBFB 2JDPA 4EQVA 2CWSA 4FT8A 2RJKA 3PJQA 3NAPC 4UOJA 2CU7A 2JDZA 4MFDA 1NLSA 5B5EC 2KLOA 3U37A 2E5NA 1KFXL 4CDQB 1JT0A 2EXJA 3I3LA 3D1NI 4J1XA 3MKYB 1H2MA 1BLZA 1MEC2 2NLRA 4BQOA 4AIJA 2MC3A 3HAGA 3OS1A 5F9TA 2QQNA 3J80Z 2R5ZB 2BNNA 2OIIA 5KWRA 4L92A 4ZDOA 1B6AA 2R7RA 5FMOS 5DQ0A 2ZJCA 2C1FA 1S29A 1SFUA 1SQ4A 3VD3A 3EUHA 2HR3A 1WMDA 1MH4A 3AP7A 3K1NA 3ZOIA 1B9NA 5FAXA 1ZRRA 4Y13A 5EYXA 3AFKA 4UWDA 1DUXC 2YMZA 3ONQA 4FPYA 3ZLIA 4AAPA 1QNWA 2HZTA 1H9PA 2KA3A 1PMIA 4ZTJA 4UUSB 2OKXA 2PYTA 5LB6A 3INAA 4GALA 2VCCA 1OI6A 5GJ6A 4DUXA 3BCBA 4XJUA 2A68F 1YLLA 3WDYA 2DAOA 1CAWB 3CJRB 1JZ6A 3WG7H 3H8UA 4RR3B 2OPTA 2Y69H 3CCLI 4MFEA 3UL2A 2VUCA 3O5SA 3I3EA 4OI2A 2DVGA 2K3FA 3VZNA 1HRI2 1RUOA 4J1WA 3HSRA 2HEWF 2W95A 3KV4A 2QBYB 4QDRA 2P3JA 4FPOB 4M3CF 1HRI1 3CD6I 2E7AA 1R36A 1VZ0A 4HN1A 3OBTA 4ASKA 1NZCA 1MS4A 1IF1A 1OCRH 5CKQA 2ZXJA 2DYRH 1ZBA1 5M5WJ 1REFA 5F0FA 4RGSA 4W6YA 4E4ZA 3KX2A 3HNMA 1AR83 1RITA 4YG3A 4A5NA 2BNMA 4XOTA 2ET1A 2ZXWH 1GHCA 2WS92 5A7QA 3UR3C 5F3GA 1HRV1 3ZDVA 4HPQA 3K3OA 2Y6JA 1WGPA 2W68A 2ME6A 2OUJA 1YO8A 3DBLB 3K4NA 4BQ1A 2WN3A 2VJIA 4UV8A 2GC0A 2WY8Q 4BQ4A 5FZEA 3BZKA 4I99C 1QGLA 4MO7A 2DW4A 1ETYA 1BC8C 2GOMA 1GZCA 3OY9A 4UF0B 3E1SA 2E5ZA 2K02A 4YGCA 5CKMA 1BVVA 4MEYF 4AU7A 1YJ9I 1UIJA 1Q56A 4IZZA 5F37A 4XIKA 1G3YA 1KDMA 2VUJA 2HU9A 2R0HA 4RFT0 3O8HA 3H42B 3RDIA 2PXJA 4PIYA 4BK5A 2G0EA 1SLTA 3OIOA 2JEMA 1LU2A 1Y7BA 4BGDA 1DQ4A 1MZFA 3R4DB 3G1LA 3ATGA 4C1WA 4AVBA 5D6EA 4KN7X 1MQTB 3S14J 4M9SA 4OIOF 2LLKA 2Z69A 1Z67A 1F5TA 4AQTA 2CGNA 3P9IA 4X6RB 1OFSA 2E26A 3K2ZA 3OUHA 3TN93 2DTYA 3TEWA 2WRAA 4HFSA 3ZOBA 3OYWB 2OQ6A 3MIGA 3L7WA 2ETEA 1J58A 5DS9A 5F6LB 2M3AA 4AUXA 2HYXA 2ZX3A 4V2VA 3LGRA 3TEYA 5IYBJ 2EPFA 3FLPA 4GWJA 1I39A 3UT0A 3WF3A 1ACCA 3TP0A 5FIXA 2J1RA 3AZYA 4NHYA 4R4ZA 2GMEA 3M4FA 2HVRA 2GNDA 4I76A 4M6YA 2AEYA 4RHV1 3CMEI 3B94A 1RZ4A 3LOIA 2YX7A 4I2OA 3BG6A 5L3EA 3J7NA 3WTXC 1HN1A 2GNTA 2OUMA 4XF1A 4W8JA 1SDWA 1XNAA 2KIFA 3I59A 5AFEA 1X9PA 5J4YA 3BU7A 3D6EA 3MLKA 1E5IA 3IB3A 1WCQA 3SXYA 5T50A 3U2RA 1RUC2 2IS2A 4OUSA 4A6OA 4M3CA 2EA7A 4LORA 1FYUA 1FOD2 3VGIA 2QA4I 4QB6A 4NVPA 3WNLA 2EF6A 3USUB 1BI2A 4AHYA 4HF1A 1MS0A 2OS2A 4B4QA 3S3OA 4I3GA 1AHDP 1IUFA 5CEHA 2ZKNA 2XGDA 2BJSA 4P00B 4AL9A 2V1NA 2QKMB 2ME0A 2Y6LA 3T8RA 4IEZA 3T4VA 1UD1A 5AC91 1CZSA 4Q1PA 1XG1A 1ORKA 1XNBA 3OIQA 1Z3YA 4Q0QA 1JMUB 4XETA 1QXPA 3Q0WA 2CQNA 2PFWA 2RVCA 3SC7X 3IPVA 1REEA 1RXGA 4XK4A 4NWWA 3ECHA 1WCDJ 2H6CA 2DQLA 3K4KA 1JODA 2XDVA 1SVMA 3AL6A 1YFHA 5DPNA 1D1AA 2OX0A 2PLV3 1ZZBA 3FBYA 1G6NA 2V72A 4XEZA 1KFUL 3BTLA 2GAUA 3A21A 4KWLA 2ADDA 1JUSA 4GDFA 1O57A 2I07B 1SAUA 1NK2P 1X82A 2CQKA 3QPTA 3VV1A 4K7JA 1H1IA 1CESA 5EEHA 2QQIA 3WCRA 1ETVA 1U5TA 5IPAA 3LNQA 3X29B 4YSFA 1QHDA 2V9KA 2IUWA 3WTZA 1FBSA 4M3EA 2HEVF 2R1DA 1GOHA 5H6QA 2TNFA 1OLRA 1POV1 4M0HA 2MC4A 3DU5A 1AYN2 4XQDA 5A7OA 1VFCA 3ABZA 3HT1A 4EVIA 1RKTA 1BL0A 1W0NA 2ZGPA 5FP4A 2V6EA 3DUIA 5JI6A 2LF8A 3JRBA 3S1QJ 4BK4A 3DFGA 1HDPA 3ZQGA 3HDDA 5ERLA 2EAAA 4ENJA 5FB2A 3FXOA 4JVAA 1OA4A 4AFAA 5C33A 2Z16A 1RHI3 5F5AA 3OY8B 5L36A 5FY0A 4DEQA 5J3LA 1ZHFA 4NHMA 3C3WA 5FZ4A 3LL7A 4FX0A 5JHFA 2W87A 1HV1A 4URTA 4S04A 2GC2A 2AQFA 2DTRA 3WHBA 5LATA 2A3SA 2JA8J 3A01A 2FD5A 1X7NA 3CMYA 3GNEA 1XPXA 2UY8A 2JSCA 4FTHA 5L7OB 4XNFA 3HMYA 3Q9SA 2PAMA 1OBNA 5T55A 4GA9A 4E9KA 5ACA3 1XSVA 4QX5A 1Z0XA 5FJHA 1ETOA 4V1PA 3KYLA 3T0YA 4QHBA 3WW3A 1OURA 1YW7A 2J42A 4LBQD 1Y9MA 5BXXA 3I7DA 5E20A 4R79A 1STMA 1TNRA 3V8KA 2CQ7A 2IRFG 3K48A 4BPZA 4MOAA 3LWCA 3R05A 3NARA 3U0ZA 1SFKA 2RS12 2RMU3 1XB4A 3FE5A 3M3CA 2UWMA 3FBNB 1O59A 2PTMA 2A3WA 2EBIA 4QU2A 1H88C 3M8EA 1GP6A 3VKNA 2CW7A 2WFPA 3U1DA 3HD8B 1DGLA 1WKMA 2JX9A 4O61A 3WG2A 4FQ4A 4QQOA 1HIXA 3CQOA 1DZQA 3C7OA 3CKHA 2WSUA 4AQSA 5LBBA 5CB7A 3CUOA 3AKZA 4A3GJ 1HB2A 1JU4A 5IOYA 3LEGA 2W5FA 3GHMA 3KB5A 2HVQA 5F5QA 2Z5UA 2QUOA 2L9NA 3ZQHA 4JKKA 4AF9A 1AWCA 1C57A 5GLWA 1W8ZA 1IQAA 3KV9A 2B0LA 4H2AA 3QOPA 5LFAA 2JPBA 3KV5A 5B2GB 1HX6A 3ZX7A 2B45X 3FX3A 3A0KA 1AYN3 1OCPA 3NRVA 1KYZA 2G1MA 1UU5A 3OYAA 1WW5A 1U2WA 1V00A 4PT6A 5JSOA 4JK1X 2IS6A 3S8PA 3HOXJ 1R1ZA 1TQ5A 4Y33A 3NNLA 1N3OA 2F4PA 2WQ4A 3PO3J 4UXAA 1X19A 1YI9A 2X8KA 3BOPA 1VBA2 1UF2C 2IZWA 5DZFA 2DFFA 4XHXA 4ET7A 4ES8A 1VBA1 3VBUB 1H9TA 3HHHA 2QCSB 4UUSA 3MIEA 5AVPA 1LGCA 1EPZA 1S5LC 1R7JA 2E51A 2BHZA 3P1IA 2X85A 2M4GA 1S0BA 1OPCA 4ZU5A 2ZFUA 4S2DA 1VQ4I 4U7DA 3IAPA 5A2QK 5BNPA 2CU5A 5H9SA 5KXCA 1JYCA 3KIOA 3AMMA 5IK7A 4K8RB 4HSJA 3VBFC 1AHSA 4L5JA 4LJHA 4M3GA 1MVQA 2R041 1JTXA 5AC93 1CAUB 3KVBA 3GZTB 3B73A 4KN4X 3LIHA 4XONA 2DOEA 1ZLJA 2Z99A 5JR7B 3T2QA 4AG4A 1JKPC 3H3UA 4M3BA 2BGOA 1O91A 4MX3A 5AIQA 3TNPB 3VDBA 1VBC2 3E1F1 3THDA 4TLGA 4ZYHA 2N8GA 5LLQA 2I74A 1NLRA 5CIRA 2XUEA 4RAYA 2VJJA 2HDDA 3C3VA 4E8CA 4XZUG 3RS6A 2X53S 1GV5A 1LVAA 2X4HA 4FFHA 1G3SA 5J1XA 2X5IB 2EZHA 3SCHA 5BNPC 4HX7A 4P5OA 2ZJRF 4RD7A 2PELA 1MS1A 4KMUX 1FYKA 1J0RA 3UNPA 1K6OA 1TW2A 3OYWA 2OVUA 5D21A 2YX4A 1VBE1 6PAXA 2KR2A 5FYBA 2TCTA 1YCIA 3ZQLA 1H8TA 3V0AA 2E71A 2YROA 1W5SA 1K3IA 1FOWA 1W90A 1X58A 2WY7Q 3A4UA 3JD71 2A71A 2PQSA 4RGAA 2VVEA 2HFHA 2IVIB 2KL4A 2AXTC 3KVAA 4DXRA 1KITA 3ZPLA 2GXGA 3GX4X 5BUVA 1IKQA 2WWYA 4HKWA 5AIPA 3S2WA 1IG7A 3NAPA 3LWFA 1PO22 3WG3A 2V5YA 1X1BA 2NMNA 2XPJA 2CH0A 3KZZA 4ITCA 3HT2A 1ZG1A 3KV6A 4AEDA 1W4MA 2XPWA 4BIFA 2W3JA 1OCZH 2BPA2 3V64A 4Z6YA 4FE4A 2LY1A 5FZAA 2PN5A 4LK7A 2HDWA 4Q4Y2 5KNLA 1WGXA 3AVRA 3E3VA 1GYKA 4YFWA 4ESFA 5FY9A 4EJOA 3H1YA 3J7AY 4KJZA 4LB5A 3AAFA 4XILA 3I3DA 4UFJA 1EA3A 4PJJA 2HQ5A 1GT0C 1ZBE2 1WJAA 3J81Z 2VG9A 2WV1A 3GZ6A 2MNGA 2KM2A 1RR7A 5C3SA 3IDEA 4GMP1 4C91A 2JK3A 3OD4A 3CZUA 2ELKA 2M2EA 3A4CA 2HQNA 1VQPI 1PVXA 4META 3AL0C 3N9PA 4GB31 3VZJA 2O6GE 3VDCA 1CONA 2JRMA 1U5IA 4DPNA 2DT6A 4N8MA 5I0SA 1D3YA 2GZWA 4AYBN 2LTNA 1JYIA 1QF3A 3CCEI 1W99A 4HPKA 3OUIA 2YU1A 3H50A 1MMGA 1PP7U 3WF4A 3M1CA 3HVDA 3VEPA 2LK2A 1AR91 2CS3A 5HNHA 1IHMA 2L54A 4F92B 2R49A 3J8F1 4GD4A 3ZDSA 4COVA 1BIBA 1PP8F 2HWB3 3D8CA 1NQDA 5FCCA 4WV8A 4AIKA 1QOTA 3T08A 3RFRA 3I58A 4X6AJ 1B35C 2D2WA 3GUDA 3HNBM 4A41A 5JFRA 3CLPA 2NVTJ 2WO7A 4H7MA 3OYKA 5BNNA 5FPBA 1F5JA 5EYRA 3W5MA 1LOFC 3BG3A 3CQZJ 5BNGA 5E3OA 4JGZB 2W1QA 4NBQA 5DD4A 2R6QA 4BJ5C 4RAZA 1DP0A 1DBNA 1Y3TA 1I3QJ 2YC0A 3LSRA 2MBFA 1T2KA 2MG4A 1H4HA 5E6HA 2VKVA 4XRFA 3OV8A 1RUJ1 5F64A 4KT5C 4YYOA 3BIWE 4MNUA 1KU3A 4TN7A 3A0NA 5DABA 2LUWA 1FPN2 2CV1A 1X3WB 5GPAA 4L0YB 2F5VA 3I59B 2XROA 1RTVA 1G7YA 4N4NB 4OHYA 5BNNB 1BOAA 2RNJA 1BBT2 4A3FJ 2A61A 5D8KB 2ZGNA 4Q8LA 3ZKUA 1AL0G 2XPVA 1KGSA 1LPQA 5FKMA 2I2SA 3HPGA 4OMZA 3F8MA 2P3KA 4XFHA 3QU3A 1FY7A 2IEKA 1LE8A 5A3NA 2A6XA 3BOWA 4QGLA 4Y5SA 2MH9A 4IF4A 1T6BX 1DQ2A 1R081 4NPRA 2MD0A 3H9AA 4D6QA 4DYQA 4IEYA 3PIPF 3C8XA 4WM8C 2BP6A 4A6DA 2PN6A 4OHXA 2HYFA 2CFOA 2OU2A 4LHKA 1RIRA 2NNNA 4NIGA 4ENNA 5IHRA 1ETWA 1WCUA 2QCOA 4R9CA 1L0OC 4WM7A 1FP1D 1DLLA 1OPOA 4Y1VA 2CG4A 5F2WA 1CAVB 4PBPA 2DFBA 4Z2WA 5C6CA 1CIWA 5D4SA 5DCMA 3GALA 3HOUJ 2W4SA 2R5ZA 2PJRA 4FAGA 1ZRDA 2HWB2 3U10A 4ENMA 4OVEA 1Z3XA 2ZEWA 4GYGA 2C0ZA 4R8HA 4N43C 2VCAA 4JDNA 4LHSA 5FJKA 4L99A 2GOXB 2EIEA 2L4MA 4EV0A 1WUVA 3J26N 1LHUA 3GTKJ 2JENA 3T5XA 1JZ5A 2WNUB 3OEBA 5LBFA 1U8RA 3IMNA 4LB6B 3GFMA 4HX4A 3OB8A 1S7AA 1H89C 1VI0A 4UVBA 4NMIA 1XGMA 3E6DA 2NS0A 1VRH3 3R0JA 5IYYA 3BTXA 2HBUA 4YIFA 3RJRA 2GA1A 3K75B 1TZLA 1ZG3A 2RDNA 2WBMA 4BACA 4P9FA 2CL2A 1WBFA 4Y20B 3VDDA 3GZEA 1N77A 4KG8A 3RYKA 2QQUA 1XS9A 2OC6A 1ZZ6A 2WR9A 2RE9A 3NAPB 1RVF3 3MI8A 1XJAA 4N4OB 5C4WA 2EIKH 2WNVA 3WDVA 4X8NA 3A01B 1FTZA 1DQ5A 2PHRA 2ATFA 3ELNA 1GKBA 1C8M2 3ZQFA 3CCSI 1V6MA 2VMHA 3S1MJ 2QQPA 1UXZA 4CP9A 3SEPA 2MSYA 4YG0A 2BEOA 4CDUA 1C8M1 3SDBA 4QXBA 1G9CA 2ZMNA 3WV6A 3QBQA 2O8KA 1UYXA 1PDNC 3AB0A 3WE3A 4R4XA 4MGRA 3D0JA 3VBRA 3ZR8X 2D5HA 1ZGWA 3CO7C 1JZ4A 1YFYA 2J1EA 2CRGA 4OU0A 4RB0A 4FPKA 1KU9A 2RNGA 4QB1A 2EALA 2CO5A 3M1EA 1JUMA 2VOOA 1BOBA 2BV4A 1LCLA 1OOPC 4CXWA 1SANA 2VBXA 5FP9A 3LCPA 2CYFA 4D69A 4EJTA 4HDUA 5FYZA 1QA6A 5LWBA 3HOWJ 3N7LA 3GYHX 2GXBA 2HWE3 4Z82A 5FLHA 4MIMA 3SKVA 4CU8A 2IA2A 3HOSA 1ETQA 3OR1C 4IHTA 1R9TJ 5FLXK 4QKFA 1RESA 2R0FA 2AR6A 3F22A 5IUQA 1JXSA 2EZKA 3TEZA 4PJNA 1QHGA 4P1WA 3M8FA 1DZRA 3O1MA 3VSKA 3RPUD 4UY8I 4BQWA 3K77A 4CDQC 4JC1A 1U5XA 2ACJA 1HN0A 3JB8A 5HCFA 4P5HA 1APNA 3B6CA 2Y31A 1LU1A 2VECA 5CFCB 5LRSA 1UELB 3J80K 5C3QA 4QSHA 1E5SA 4Q4X3 1TNTA 1T0FC 4LPLA 1SFXA 3VBRB 2ENRA 1AA7A 1GU3A 4ZS3A 4CUCA 3L2YA 2VUDA 1X2NA 1EKEA