1O3QA

Protein-dna recognition and dna deformation revealed in crystal structures of cap-dna complexes
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Indirect Readout of DNA Sequence at the Primary-kink Site in the CAP-DNA Complex: DNA Binding Specificity Based on Energetics of DNA Kinking
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
molecule keywords 5'-D(*AP*AP*AP*AP*AP*TP*GP*TP*GP*AP*T)-3'
total genus 62
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2003-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1o3qA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1o3qA01
3LAPA 1ON1A 3T8RA 4TLFA 2JPCA 2IXLA 2DT5A 4YSFA 4HN1A 2LF7A 1CAVA 5JSRA 4HBLA 1T39A 4G6QA 1YFHA 2VC0A 3GFMA 1ZARA 4LA2A 1U3EM 4U0WA 2HQRA 4EM2A 3COAC 2W85A 2V09A 4EJUA 5K8SA 2ZFWA 3ZMSA 2M45A 1RL3A 1VTNC 4UUVA 1JHHA 3KLOA 1JE8A 3ZQ7A 3OCPA 4B29A 4DNCA 3GXOA 1XGOA 1YFUA 1F9NA 1K79A 4H7LA 1GQGA 4XBFA 1EY2A 1V70A 3BJAA 3HQXA 2YX7A 2ZBKA 1QY4A 1IPKA 1O3QA 5CU1A 4GXOA 2YX4A 4HAMA 2PN6A 1SMYF 2HR3A 4I0AA 4G7OF 4MZUA 4IF4A 3E6CC 1KQ9A 3K1NA 4IHSA 1YFXA 1O3TA 2KRFA 2OYZA 1XGMA 2Q30A 2O8XA 2HS5A 5HLIA 4R1HA 2HQNA 3FWEA 4HA8A 4PJYA 1LDJA 2IA1A 3BPZA 1J75A 5EZWA 3H1MA 4NHJA 4ZH4F 1T6SA 4XFGA 2KJCA 3DN7A 3ISPA 2QENA 4EJVA 2ETHA 1HW5A 1QO0D 2O3FA 4QX5A 5BS6A 1Z6RA 4BHBA 1ZGAA 1QPMA 2FMYA 4H0EA 3JAMZ 3JSPA 1KGSA 3DQVC 1R7JA 2D5HA 3G73A 2ZNYA 3FMRA 1W4MA 1WRJA 3ABTA 1PUEE 3J81K 5FCCA 4A6DA 2NYXA 3VHRA 2XKPA 1CAXB 3E5XA 5ICCA 5J8CA 5JVTA 5KHGA 5IT3A 3HIFA 4A5NA 2VXZA 4P96A 3VEPA 2ZNZA 2W84A 3TKYA 3T0YA 3HRMA 3T1BA 3V8LA 2ET1A 3GUDA 2CYYA 4EWDA 3EDPA 4I09A 5JCTA 1BJAA 1X3UA 3V7SA 2GH2A 5L3BA 1G4DA 5CLSA 1B4AA 3OOPA 4UNOA 2LKPA 2E1NA 2HWVA 4ZU5A 2LNBA 1KQ0A 1P6RA 1F1ZA 2E7XA 3T5XA 4IEZA 4J1XA 3KP5A 2GZWA 2EV5A 1OMIA 2IJLA 2YU3A 4UV8A 4IEYA 3K1MA 4HF0A 3WE3A 3NVCA 4UVAA 2DCTA 2LDUA 2H6CA 1ZLKA 5LEKA 3I53A 3HHGA 3USSA 2IA0A 4BAYA 3F23A 3FX3A 4BIFA 1TTYA 4WF2A 3GYDA 3T8TA 2RQPA 1ZG5A 3GYHX 5BV6A 1J7KA 3LQRA 2KXLA 3CF6E 1JGSA 5K5OA 2V1UA 2ZKZA 1VP6A 1G3YA 1GXPA 3TNPB 1LJ9A 5L3DA 1SFUA 5DD4A 3QP5A 1CAVB 4N9IA 2PMHA 4N0BA 4AIJA 4IRHA 2W24A 1ZZ6A 1UHMA 1NYWA 3W6JB 5H6RA 4HQMA 5BXXA 4OU0A 3LSTA 1ZLJA 3H9AA 4HN0A 2QQ9A 4LMYA 4CDGA 3WU1B 2HZTA 2ZMEA 3SXYA 2PHLA 4Q4ZF 2ISYA 2PMUA 1Q43A 4Q0UA 6PAXA 3LWFA 4HX8A 2L4MA 3GW2A 4G8XA 3BROA 3MCZA 1S7AA 3LA3A 1TW2A 2DAOA 5DUIA 2QVSB 3IRQA 1PM7A 4ASNA 2OD5A 4MGYE 3H3UA 3GFLA 3MYXA 3F6OA 2MA3A 4FT8A 4YFKF 3H7JA 4EVIA 4O3MA 1J58A 5EEHA 5BOXA 1F4KA 5HOOA 3I59A 4Q48A 3D0JA 3U11A 2D1HA 4E70A 3GZ5A 1DGWA 3ML6A 3IDBB 4EM0B 1O5UA 1MJ9A 4CHUA 1YYVA 3QOPA 1FWZA 4HQEA 5ILVA 2IP2A 4CGZA 3DFGA 5J3UA 4HDUA 3FHZA 2P5KA 3NEUA 3S7EA 4BHPA 1NE6A 2DW4A 1JUHA 4M6XA 4HLTA 2Z3YA 3HTSB 1STZA 4IRIA 1U78A 2D5FA 5LGNA 2K9ZA 1ZRFA 4I98B 4UHTA 4EM1A 2BNOA 3PQKA 4MGIE 1EH8A 5BPXA 4HOBA 3B73A 3ULQB 1WWXA 3SHRA 4L9VA 1FSHA 3LZZA 1R5GA 5DCMA 2OAZA 3E6BA 4PGGA 4EWAA 2XAFA 3KETA 4LD5A 1RGSA 1W7PB 1MGTA 5LRRA 1HKSA 2EWNA 2WTEA 2J5OA 4AD9A 2DBBA 5KHIA 1J0RA 1YTYA 2WV0A 2F5EA 3E6MA 5EEGA 1ZZ7A 4RB0A 5HS7A 1EH7A 1ZGJA 2RKHA 3CEWA 1OD5A 3K2ZA 3EQEA 3FM5A 2F5FA 2ETEA 1UHWA 3OD0A 3CJNA 1ZZBA 3L2HA 1ODDA 2P4WA 4JQFA 1YUDA 3D5LA 2NS0A 1U8RA 1XN7A 4KU8A 3TGNA 1R1VA 1TW3A 2QDRA 3U1DA 3VFZA 3E5QA 1E2XA 2ZCWA 2DTRA 2HFHA 4I02A 5CADA 2Q2EA 3WTTC 4ENJA 1P4WA 1GHCA 4OMZA 2OQRA 4UV9A 2MD5A 2QCSB 3FE5A 2GC0A 4QMAA 1UCRA 1RUNA 3HSRA 2KKOA 2EK5A 1ZG1A 4A0ZA 3WTXC 4OFGA 1RTVA 1R22A 5J6XA 2UYAA 2PJPA 3HTUA 4I7HA 2P6SA 2XAQA 2FF4A 4AVCA 3KGLA 3MAJA 3KZYA 2XKOA 1LEBA 3OF1A 1BIBA 2H27A 4LTAA 4JVAA 4P9GA 3H1WA 4KYWA 1D8JA 3WG9A 2Z9OA 2Z99A 2QZ8A 2QBYA 4YNIA 1GQHA 2CW0F 4S05A 1SQ4A 1HW1A 4KA4A 4B8XA 4LGWA 4LB5A 1DZTA 4LLNA 4YIIA 4HBNA 1BC8C 2CV6A 3I64A 2B0LA 2GXBA 3ST7A 1ZNPA 2Y48A 5L3CA 2FXAA 4XFCA 3BALA 5D8LB 2O03A 4M9SA 1DPUA 1MDMB 1J59A 5DYMA 2C6YA 3Q9VA 5LGUA 1ONVA 3LQQA 1BI2A 3DF8A 2G7UA 4M72A 3QU6A 4KIGA 2NRAC 4UVCA 3M1EA 1LEAA 4L9TA 2B5HA 3WW3A 2VODA 4RGXA 5E1WA 4YRDA 3NW4A 4KN4X 4OIRF 2W25A 3R4KA 2Q0AA 1TNTA 5HVQC 1FOKA 1IZ1A 2A07F 1R36A 2FBIA 3BPVA 3GLXA 5JR3A 3EHKA 1ZZ8A 4Y17A 4IEQA 2GWRA 2L02A 5FLXK 2P7VB 2XAGA 1YO5C 1MDMA 4G7ZF 1U2WA 1MJAA 1XDSA 4UXNA 4KU7A 1FPQA 2OA2A 5BUVA 4M9XA 1QZZA 3J80Z 5FQ0A 2UWMA 3M70A 4HLYA 2FQPA 1XCBA 2D2WA 1ZH5A 2PAMA 5I91A 1BIAA 1Z6TA 2IVMA 2EB7A 2YR2A 2EFNA 3HSEA 1FX7A 2EJRA 1Y0UA 1Q3EA 3EYIA 1BI1A 3TOBA 2E7WA 3F8BA 1DUXC 2VE9A 5I93A 4Y13A 5D6EA 3ZN1A 3CUQA 5BPDA 3ECOA 3WGGA 3IIAA 3LA2A 1Q1HA 4HX4A 4LFUA 2PBIA 2AXLA 2BV6A 4Q47A 3WTVC 4IESA 5ILUA 2XRNA 3I58A 1B1BA 4XF0A 3R60A 5AIPA 1HW2A 3N4MA 2QM3A 4ZZLA 3TNQA 4AIHA 3TO9A 4ZYEA 1CF7B 5IT9K 2YPRA 3RZZA 2BBYA 1SD6A 4WK8F 2R7DA 1J3PA 1FBUA 2Q0OA 4U7BA 2FRHA 3CLOA 1FC3A 4A5MA 1L0OC 4OIOF 3GZ6A 1KYWA 4NVPA 2DLLA 3ZN0A 4CXFA 5H20A 1X8EA 4AIKA 3HSFA 1ZZ9A 2N7GA 4NQWA 2ZJ2A 4P55A 4Y15A 1KQ8A 4AXOA 2HTJA 1LDKB 3I0TA 4LK0F 1UB9A 3IKVA 5KBFA 5E8GA 5FPZA 4QXKA 5TJJA 4IETA 4RD7A 5JHUA 4ENNA 4I3PA 3FHIB 4G7HF 2WFPA 2JT1A 5F1RA 5ICFA 1AWCA 2RDPA 3FXUA 3QP6A 1LDDA 4IEOA 4LB6B 5HLGA 3M8EA 1PP7U 1FYMA 1BOAA 1BI3A 1TQPA 3FM3A 5JSPA 4Q5SF 1SFNA 5JAXA 2H0VA 2QVOA 4WXDA 2DK5A 3GVAA 2EFPA 3GF2A 1W5SA 5FLIA 4HV5A 4UBHA 2ZMEB 5FLJA 4MEXF 2UY9A 1XDUA 4O9GA 2BNNA 1FNNA 3RIRA 1ZRDA 2DQRA 4OMYA 3E5UA 4K2EA 1K6OA 1R1UA 1SFEA 5E1ZB 1IUYA 1ON2A 4Q0QA 3VODA 3VB2A 4RGUA 4Q0PA 5KHJA 3IWZA 2DO7A 5HI0A 2JTVA 2VE8A 1TLHB 1G3WA 4ESBA 1ZZCA 2IXKA 1A04A 1VJ2A 3K1PA 2HEOA 2PAEA 3P7NA 2IPQX 3V8JA 4XSXF 4N9HA 1XRUA 2JPBA 1F5TA 1V4RA 4BNCA 1KU2A 3J80K 1EPZA 3FFQA 4L5JA 4MHGA 1SAXA 1KYZA 4K8FA 2DPUA 2CSOA 3IHUA 4FHTA 3ES1A 3I71A 1XD7A 3ELKA 3K0LA 2MLGA 1CX4A 3SMHA 2FEZA 3I54A 3NJZA 5J48A 2IT0A 1Z05A 3E97A 1IN5A 2M30A 1DGRA 3HT2A 5BQTA 5A2QZ 2EFWA 5FQ0B 3V8KA 1FSEA 3GO5A 2MC3A 3GFIA 4UBGA 2UZKA 5FFZA 3RYPA 2VBYA 2IXJA 2D45A 2P17A 4FAHA 2DQLA 3M8FA 1RNLA 5E8IA 3UKVA 3ZP5A 1EH6A 5LHGA 2ZKLA 3C3WA 3E6DA 1T98A 4HVOA 3NQOA 5D5WB 3J7AO 1QQIA 5D5UB 3HOTA 1PMIA 4ENKA 2PLYA 4JTOA 2UXXA 4YIFA 3CJXA 5FDBA 2GC3A 4KWLA 1Z1DA 3B02A 3DP7A 4WZCA 3F72A 4XF9A 1H9TA 1H0MA 4ON0A 4DINB 1X8MA 4IEVA 4QM9A 4EJOA 1ZX5A 1YS6A 4QGMA 5HS9A 4OINF 5C6CA 3H7YA 4IRGA 4ZZDA 1ZREA 4KMFA 1CAUA 4FBFA 4CZZA 1OKRA 4ZYHA 3SCHA 3F3XA 2Q1ZB 5HDNA 2HTSA 3I4PA 4ETSA 2P5VA 3J81Z 3DXJF 5ICEA 1YG2A 4O6JA 4HF1A 3L9FA 4EMSA 4IEXA 3RYRA 2X0LA 1W5TA 5AIQA 4PGHA 5ICGA 3KP7A 1QXRA 3ERED 4L18B 1OI6A 3DPTA 3F8MA 3ES4A 2MBFA 2ESHA 3HOSA 5E20A 4EJTA 3KFWX 5FD5A 2GQQA 2FQ3A 4KN7X 4KT5C 2H6BA 1D5VA 2MH9A 5JSOA 4KUMA 3GFJA 3DEUA 3ACLA 4GYIA 3N97A 4LEJA 1J5YA 2BEOA 3BB6A 5IT9Z 4Z2YA 5T3NA 3HUGA 4IEWA 1QGPA 1YS7A 4IVNA 5FB2A 3KE2A 1FZPB 2L4AA 4XFFA 4PZJA 2B8MA 2O6GE 1G3SA 1Y9QA 4BHCA 3ROUA 2V1XA 4M73A 4B09A 2P5LC 1JXSA 5JI6A 1S6LA 3ZMVA 4JTNA 1CAXA 3BWGA 2XAJA 4MUVA 4XFHA 3MZYA 1O4TA 3P9KA 2I45A 2X4HA 3BU7A 1WKMA 3NL1A 3FJSA 3ZMZA 1XSXA 3O2PE 5FFXA 2VECA 4XFAA 3IC7A 3EQLF 1SMTA 4XFBA 2OZ6A 1UPIA 3CTAA 1C0WA 2PEXA 4ZU4A 4XLNF 1Q5OA 4OLLA 3SXWA 2PFBA 2QQAA 4EGYA 2M5WA 4JBAA 1CF7A 4META 3JSOA 1CAWB 3I59B 1YHFA 3MEXA 4IHTA 3QACA 4LULA 3PFIA 2E9QA 1J1LA 4M71A 4QGLA 1YLFA 3Q9SA 1LR5A 1O3SA 2L01A 3IRRA 4YARA 2V79A 4QWQA 2EA4A 4HDVA 2PG4A 2AS5F 2EV0A 3NRVA 2HJIA 2DU9A 5CVJA 4P5OA 2VOPA 3KEQA 2NAZA 1IPJA 1FP1D 1IXRC 2EFQA 4PCQA 4KWKA 5FLHA 3GX4X 3OTFA 4WWCA 2O1QA 2OZUA 2UYBA 2CAVA 1B9MA 3LAJA 3WTUC 1YW9A 4U0YA 5L3FA 2VBWA 4XETA 5DUKA 2E1CA 3CDHA 4WBBA 3RJPA 5HS8A 1YW8A 1EYBA 1BN5A 3IBMA 1G6NA 3TO6A 4WXCA 4GGGA 3H92A 5KHKA 4RGSA 3LOIA 2A5YB 1RZ4A 2HGCA 2QLZA 3C18A 3O3KA 1X7NA 1FI2A 1CAUB 3QU3A 3M3IA 3ZPLA 4FAGA 3H3ZA 4R8HA 5HLHA 4BQAA 2RNJA 4HVQA 1SD7A 3KLNA 2PHDA 4U0VA 2XUBA 1MD0A 3EYYA 4YG2F 3BZ6A 2IW5A 3HYIA 5E1RA 2FA5A 4ESJA 4U88A 1K7AA 1FYKA 3RPUA 4YYOA 2HKXA 5FLXZ 1YW7A 2VN2A 1D3YA 4KIBA 4PIXA 3KMHA 2L54A 1EV7A 3SCGA 5HDKA 5I0TA 5HDGA 3R6SA 3QRFF 5DCMB 1XCVA 4FX4A 3EJKA 4A2UA 3WW4A 2IC1A 4HVRA 1ZVFA 1IRGA 3CUQC 3C7JA 2UY8A 2GAUA 1U12A 4JV4A 3RKWA 1LRHA 1H1IA 4LK1F 3O6BB 2DI3A 3ZMTA 1PDNC 2QNKA 1V3FA 2CQKA 3RKXA 1PP8F 4MEYF 5K5RA 4EROA 5LEJA 2OQGA 2VBZA 2FNPA 1U5TA 3TO7A 3WTYC 2VONA 4MX3A 1FLIA 4A6EA 3WGIA 2A6HF 3RNSA 3HHHA 2HYFA 4MTEA 1UD1A 2OPKA 1YFWA 1U5TC 1NXMA 2JSCA 2QYOA 2GA1A 2OBPA 3SZTA 2K86A 3M7GA 2G9WA 1ULYA 2BE5F 3CO6C 1YWKA 4UXAA 4L9NA 3IWFA 3L00A 1FXZA 3U0ZA 3H1YA 3BPXA 2UXNA 2ZXJA 5D4RA 3LA7A 4D7SA 1QZYA 3WU0A 1XGNA 2STWA 2A68F 2V1DA 3CUQB 3BDDA 4LA3A 1DP7P 4MNUA 3JZVA 2LSOA 2GXGA 4E2SA 1OPCA 4D0PA 3KP6A 2L3DA 4I0BA 4HZFA 2VQAA 3QAHA 2GU9A 4MQ9F 2HDCA 1UFMA 3WE2A 1JHFA 4PIZA 3G3ZA 5DCFA 5ED4A 1TNSA 1WSUA 2XAHA 4KWJA 2R3SA 3ZMDA 5EFUA 4G6DA 3CLPA 2O0YA 3V4GA 4LUKA 1IRFA 4F7ZA 5J8FA 2Z33A 3F21A 3DKWA 4RB3C 3JTGA 2KIFA 3BP8A 5D1IA 5J7MA 2FBHA 1XSDA 2CAUA 3HRTA 1XSVA 1I5ZA 3WTWC 5JR7B 2RN7A 3EO6A 2DFIA 1R23A 4IXAA 5TRDA 4BXUA 1IXSB 4LLLA 2CWEA 1I6XA 1KU7A 2ESNA 5I0SA 2EA2A 4EGZA 2XL7A 1O57A 4HW0A 2XV4S 3E3VA 4AVAA 3RDIA 1WLTA 3WTZA 1WA4A 3ZMUA 4MQVA 4UVBA 4KICA 4E2GA 4MTDA 4RAYA 4Z07A 2TDXA 3CO7C 1KU9A 1UIKA 4XEZA 4XRFA 1BC7C 1FBQA 4KMUX 3MZHA 3C1DA 3O14A 2COMA 4L0YB 4I01A 1FT9A 3KSCA 4IERA 5L3GA 3KP3A 1RUOA 1E17A 1IN7A 1R5HA 2CO5A 1OYYA 1HSJA 2XASA 3RPQA 3G7DA 4AVBA 1XE8A 1MZBA 3TDZC 2STTA 3U10A 3MPBA 3SCFA 3LWCA 2PQQA 3NSTA 1O7LA 2RV8A 3VOEA 4GULA 3MQ0A 3LFKA 3HRSA 5E16A 1S3JA 4LG0B 3ECHA 5L3EA 4Z82A 5AVPA 3CUOA 2QUFA 4IPAA 3KEOA 3JW4A 4CICA 1CAWA 3D82A 3MWMA 4A0YA 1LB2A 2Y0MA 2XLGA 1IN8A 1LNWA 4ENMA 1HXDA 1R00A 2PQ8A 3FZ3A 5ERIA 3W6KB 3K69A 2GA2A 5BY5A 5DV5A 3AAFA 3BJ6A 3JTHA 3K9TA 5CYVA 5C8WA 1K78B 5JFRA 4OOIA 1S8NA 1IXCA 4JK1X 1GXQA 4AVPA 2V9VA 2CFXA 3D0SA 3PQJA 2MNGA 1G3TA 1J3RA 2ATFA 2XLAA 3IL2A 2WWYA 5LHIA 2K7LA 1B59A 3FMQA 3JAMK 1P2FA 1OYIA 1XE7A 4CO8A 2QJVA 3BCWA 2XLFA 5BMZA 4ONUA 1KU3A 1ZN2A 2R7FA 4RS8A 1SEFA 4HSLA 2VT2A 2O61A 1S29A 4MH0E 4E2QA 2O8QA 3U2RA 2K4JA 2A69F 2F5DA 4EJWA 2YSRA 5KK1A 4MGZE 2MPFA 5D6FA 3V7RA 2XIGA 3BOQA 2K27A 2K02A 3TDUC 1UW8A 4G94A 2PAKA 3SZPA 4DQ2A 4ZYGA 4L5IA 4EV0A 1RIOH 3TQNA 2VT3A 5BPIA 1U5TB 2HYGD 3WGHA 4L0ZB 4A0XA 4XFIA 4RGRA 4P9UA 2V6CA 1U6GA 1P92A 4R79A 2F2EA 1VR3A 2D1VA 2VPVA 1I1SA 1T0FA 1X82A 3ETQA 1J2XA 2ZO4A 1TQIA 5FPXA 2EA7A 1KA8A 2EFOA 4QM8A 1T2KA 2CGPA 1I27A 5LBQA 5DDGA 3KCCA 1S7OA 2Q4SA 1REPC 4M6YA 4Q29A 5CVRA 2HOEA 5E1XA 2PYTA 1OYWA 1FYLA 2IXCA 2Z69A 3RI4A 4XF4A 5I0UA 3MFKA 4IJAA 3F6VA 1LVAA 1WQ2A 2D93A 1XMAA 4ESFA 4GYGA 1O7FA 4P9FA 1HBXG 1QWRA 3SQNA 4LJZF 1TQ5A 2NNYA 2PFWA 5D5VB 1ZG3A 3PNAA 1K78A 2HKOA 3PLQA 3I7DA 5I0RA 1R1TA 4RB1A 1DZRA 3Q5FA 2H94A 3WW1A 4HSJA 4OIQF 1SD4A 3NKTA 4BH9A 4LLOA 4AQ6A 1H9GA 1WI9A 1ZHFA 1P4XA 1IAWA 3S0MA 2MHFA 2MH2A 3M9AA 4WX9A 3S2WA 3BJOA 3KP2A 1CGPA 4ORFA 4LUMA 3SHFA 1OFNA 1HKTA 1D8KA 3REOA 3ZDSA 3V7CA 4KNYA 2C0ZA 2P8TA 4KL1A 4QGNA 2J5PA 4QLCU 4LG0A 1FP2A 3FXRA 2PTMA 3WODF 3U9GA 4NB5A 2M1BA 2BNMA 1WGPA 4RAZA 1LQ1A 3P9CA 3F8FA 4ZYDA 2OU2A 3I5UA 2P6TA 3R0JA 3TOAA 1FBSA 4FX0A 2JZYA 3S7IA 3CO2A 2KIMA 4PIYA 5K5QA 3RKYA 5H6QA 4MV2A 5I8TA 2DK8A 3UKNA 3KZZA 5D8KB 2IXIA 2XL9A 1IF1A 1Y3TA 2ELHA 1TBXA 3SFZA 3FXQA 1BM9A 3WTSC 2KIUA 3F8NA 1XGSA 4LLGF 5I8YA 2FE3A 4HLXA 4O5VA 1USSA 2VBXA 5FD6A 5D4SA 4WVZA 4XF1A 3BY6A 3L7WA 3EETA 3OGJA 5AONA 2FU4A 5F6FA 4MGRA 5FGMA 3RYKA 1RC6A 4PDKA 2MLKA 3H8UA 2IRFG 3GWZA 4OIPF 2ADUA 4S04A 1MKMA 3FZVA 2BYVE 3DPLC 5FO5A 3PVBB 1Z91A 2A6EF 2B9UA 4X6QB 4YFNF 3KGZA 3KP4A 4HYEA 2EAAA 5E17F 2P7CB 4GO1A 5KVRA 2DPDA 1NE4A 2IXHA 3DL3A 3CL1A 2QWWA 4HMZA 1L3LA 4TV7A 1UIJA 3EUHA 2EV6A 1W7PA 2RVCA 1O5LA 4ZU7A 2RC4A 5E18F 2ACJA 2K0GA 1OR7A 4Q0SA 5A2QK 2F5CA 1QXJA 4AQ2A 1B9NA 1QNTA 1USTA 2XVCA 1IN6A 4L2NA 3DV8A 5KHHA 1NHAA 4RB2C 3RTRA 1Z7UA 2VOOA 5F64A 1ZAOA 2Y0OA 3IKTA 3FF5A 2JRTA 2M8EA 1MJBA 2PA7A 4O9EA 2FBKA 4XSZF 2OA4A 1T38A 1EP0A 2Y75A 4G9YA 1GVJA 3FMSA 3GEZA 2PI0A 1J3QA 3ELNA 5DEQA 1YQAA 4IEUA 4Q0VA 2QBYB 4U7DA 5CJ9A 2K4BA 1RI7A 3R61A 1LKNA 3IDCB 2W57A 4R52A 2Z5UA 3OV8A 4F8AA 1TQMA 2GIVA 1HQCA 4KDPA 4GCVA 4EQQA 2IA2A 3R0AA 4HF2A 5LLQA 1ZRCA 2A3SA 3HT1A 1NZCA 4BYYA 3ABUA 2Q8KA 3MDPA 2GC2A 3UKTA 2D40A 4X6RB 3C3VA 3L09A 5CVIA 3F8CA 2XGXA 1UCXA 4WCGA 2EVXA 1XMKA 5D5XB 2FNAA 4XLPF 2OZJA 1Z9CA 5DD8A 3QPTA 5K1YA 2XROA 1IN4A 4KFCA 1YFYA 4J1WA 4A12A 3EBRA 5LRSA 3QPHA 4L11A 4MGKE 1W7PD 3WW2A 2ET7A 4M74A 1YLLA 2RGVA 3HRUA 1J9IA 2H09A 1XB4A 4D7TA 2Z2SB 1I1GA 2FOKA 2KJBA 5CVVA 1SD5A 1YIOA 1AOYA 5LGTA 1H1MA 4IEPA 1DPRA 2VC1A 5I8SA 3LAGA 1QBJA 1O3RA 2GC1A 4WXHA 1SFXA 3L2CA 5LHHA 2LF8A 4L9JA 3P9IA 4XF3A 4EWEA 1IW7F 1FY7A 4I2OA 1L3JA 2FMLA 2BGCA 2ISZA 4HV6A 4CYDA 2A61A 1B6AA 1DDNA 1ZRRA 1BBYA 1HSTA 2FSWA 4KIFA 5ILSA 2CG4A 1ZYRF 5CVUA 2G7HA 2M87A 1R58A 2WC2A 3F22A 3GBFA 2XHKA 1P4AA 2NNNA 3H50A 4HX7A 4M9ZA 2F4PA 1BI0A 2QQBA 1HKQA 4YFXF 4AWXB
chains in the Genus database with same CATH superfamily
2WYFA 3LAPA 1RHI2 4YM0A 2QUOA 3AZWA 4QTRA 4TLFA 3T8RA 4GXLA 2DT5A 2W39A 4D94A 4HN1A 3GZUC 3M1HA 4QU1A 5A7QA 3WG4A 1J09A 4XQDA 2X9DA 5FY8A 4C91A 3K4MA 1NH3A 4G6QA 2VC0A 3KIOA 1G9FA 1LNSA 4P9IA 2OUMA 1U0AA 2W85A 2V09A 2ZFWA 1HQWA 2W92A 1XB9A 4IHYA 1TWHJ 4E7KA 1RL3A 4IV1B 2HWF1 1JHHA 3KLOA 1JE8A 3OCPA 4LO7A 4DNCA 3GXOA 2M2EA 4V2FA 4CP1A 1V0AA 1QGLA 2JDUA 3R05A 4XBFA 1V70A 5FAXA 3HQXA 1VQ4I 5C3RA 2YX7A 5F39A 1O3QA 3FHAA 2XR4A 4XQFA 4TWTA 1RR8C 4JKLA 1IC8A 1AX1A 3PUAA 4AIDA 1XXNA 4BL0B 3K2OA 5BNNC 1G9BA 2HQNA 3MIEA 1QOOA 3PO2J 3SISA 5DMYA 1T6SA 3ISPA 2EIMH 2KISA 2YUEA 2DF7A 4YW4A 4WV8A 4AEDB 2V9PA 5BS6A 2SBAA 4BHBA 3TRSB 1W9YA 1PGW1 3JAMZ 3TN92 3JSPA 3DQVC 3IAS2 4BEHA 4NC6A 1VQOI 2ZNYA 2E7QA 1RUI3 3ZFEB 2ARAA 3EB7A 3PDQA 3ABTA 3J81K 5FCCA 4E4SA 3E5XA 1Z0XA 5ICCA 5J8CA 3UGHA 4GKXA 2EZIA 1SFKA 4UT5A 4A5NA 2VXZA 4YM3A 3HOYJ 1UJ8A 1NCRA 4A7YA 3HRMA 3V8LA 2YMZA 1KS4A 3GUDA 2CYYA 4AYBA 1ZBA3 2VL4A 4ZTJA 3EDPA 4AFAA 1N1VA 3SEZA 4AZZA 4URAA 2BDRA 1ZELA 5F3GA 4ZS2A 1TZOA 3FXLA 1OA4A 2R7VA 2LNBA 2WUHA 2ZABA 4QPGA 2XUMA 1YI2I 3L1PA 3C2GA 2EV5A 3LSJA 4Y20A 5F6LB 3D5RC 1COV3 2PJRA 4ATEA 1CZVA 4XKVA 3K1MA 2F6BA 2XWBB 1HRV2 5JXJA 4FTSA 3AFKA 5B1BH 2ECCA 3GTJJ 5GZCA 2OPWA 2H6CA 5LEKA 3HHGA 3USSA 4AHZA 2H1KA 5J47A 1NCQB 4WF2A 2DUOA 4Y5TA 1BK1A 2VGDA 4M3CA 4OHXA 4FTHA 2CH0A 3LQRA 3GCMA 3CF6E 1JGSA 2ZKZA 4AEDA 1R6RA 1PVC2 1VP6A 2WBKA 1G3YA 1QDOA 2AUYA 5L3DA 2XXZA 3ZFFA 5F5CA 2ZGUA 1N3PA 2ZOEB 2W82A 3KQRA 5JVGF 4HPKA 4DO0A 3C7OA 4A7KA 3L2WA 2VOVA 3HGYA 1CVNA 3RZMA 2QQ9A 2CUEA 2LC2A 3E1SA 3N7KA 2ZMEA 5FYHA 5FUNA 1LUJB 4HT1T 5HV0A 2DJNA 2ZX4A 2EZHA 4RDUA 3GW2A 1XTAA 4G8XA 3BROA 1CN1A 2K2SA 2NQYA 2O8OA 2GNTA 4N90A 4Q4W2 1TW2A 2VKHA 1VB2A 5JLVA 2DAOA 4PI2A 4QKDA 3H9GA 4CA9A 1NQJA 1K83J 5JR2A 2Z1DA 2OD5A 3B9CA 3H3UA 4HKOA 1RUE2 3MYXA 3F6OA 4YFKF 4DZGA 4XDPA 3MN2A 1RVF3 3WV6A 4O3MA 3IAPA 4AEKA 5EEHA 1MBEA 2FCUA 2K9QA 4A3FJ 3TBDA 2LG4A 3RVHA 3JU9A 3VYRB 3GZ5A 4OI2A 5A7NA 2ZGMA 3ML6A 2KRHA 1V55H 1VQMI 1E0EA 4SLIA 1UYZA 1S0FA 3QWLA 1FWZA 4HQEA 1ETKA 5FXVA 1W6QA 3CP2A 3DFGA 4K3UA 2A6WA 3FHZA 1DYKA 1S1AA 4MFDA 1W2UA 2X1DA 2CV2A 3JRBA 4BY1J 3CDIA 1STZA 5HNHA 4IRIA 3A0NA 4ZONA 1TP4A 4BQNA 2DXIA 5A1AA 5LK7B 1WLWA 3JXSA 3PQKA 5IT6A 1D7PM 5BPXA 1G9AA 4JGYC 4DYQA 3I2IA 5FWEA 3ULQB 4CCDA 1FSHA 1BXHA 1X1CA 3LZZA 3P5BA 2BBVA 5DCMA 3E6BA 1R71A 2JDMA 5HNFA 1DCSA 1GZCA 2LROA 1XE0A 4A45A 2EWNA 2GN7A 2WTEA 5C44J 5KHIA 2F5EA 5A1FA 4BXSV 2VLAA 3BLYA 2RKHA 3CEWA 2ZS6B 3K2ZA 2NZ9A 2M4KA 5FTTC 3FM5A 2F5FA 4IUGA 3JREA 4JQFA 4XKCA 3WU2C 2NS0A 2R7XA 5F7UA 3UGFA 2WNUC 4CPBA 4Y1XA 5F0FA 3OYDA 1MZEA 3OYJA 3U1DA 5LA2A 3E5QA 2UWAA 1E2XA 2ZCWA 2WAQN 2VVEA 3QPLA 2R1BA 4HFSA 2HWF3 2V73A 1AYN3 3V0AA 4C1XA 1GHCA 1Z3YA 1UCRA 5HV4A 1B8IA 3RGBA 1RUNA 3ABKH 3HSRA 2X6OA 3G4SI 1OLQA 3K77A 4HL0A 4ASKA 1PGW2 1EV11 4IL6C 5J6XA 4CUGA 2I5UA 2V26A 3WQ7A 2HWB2 1S0JA 3T2OA 2PMWB 1ZBA1 1LEBA 3OF1A 2H27A 2KPMA 1XBFA 4JVAA 1V6KA 3VBOC 3I4MJ 2R043 1ULPA 2Z9OA 1UX6A 1SC7A 2Z99A 2RE9A 1YX3A 1SBFA 1UL9A 2QZ8A 3S17J 2D97A 2QBYA 4YNIA 2VO5A 4KA4A 2VOWA 4LLNA 1UG2A 1TNFA 5JZGA 1GV2A 3JRFA 3JR9A 1GLNA 4GMP3 1E5RA 4BS9A 3K3NA 4EZHA 1MZ5A 3Q0WA 4XUPA 4LBQD 5L3CA 2FXAA 3WNOA 3O12A 3KB5A 4HK9A 3J7HA 5FV3A 2A6VA 3VZKA 1H2LA 1VQ7I 2BY0A 4MHRA 5H9QA 3WF2A 1J59A 5GPCA 1HLCA 1UXXX 3DTKA 1H4HA 1XYPA 3BQYA 3LQQA 1A36A 3S32A 2ADDA 2R6QA 2G7UA 3PU8A 4M0NA 4MXVA 1X9PA 2CV1A 2NRAC 2R93J 2GNBA 1WCUA 2QBXA 2ZC2A 2VJJA 4G9SB 3VDDA 2DOEA 5EQUA 2XSJC 4JZRA 3RRDA 5E8AA 2X10A 1FOKA 1IZ1A 2CFOA 2ARCA 4II2A 1ZZ8A 4Y17A 2OUJA 3SEEA 1G8XA 1DYPA 2P7VB 3HEFA 2XAGA 1YO5C 1MDMA 4G7ZF 2E1MB 2NMNA 4KU7A 2OA2A 2W7NA 5HCFA 3A03A 4YZ1A 4LBNA 3ZN5A 2W68A 1S0DA 1Z6TA 2IVMA 3NNLA 3HSEA 2EFNA 2EJRA 4KBZA 1HRV3 3B69A 3KV6A 4BLJA 3T1MA 1KITA 2QQPA 5B66C 4LR4A 5A70A 3OGSA 2XPUA 1YQ8A 2A70A 5E79C 3ZN1A 3CUQA 5BPDA 5HXMA 3ECOA 1PIV1 3S1RJ 1JZ5A 1Q1HA 1NA1A 2Q8EA 3ZQLA 1GQPA 5J1YA 4BK5A 4LFUA 3K48A 1V6JA 3WTVC 1UWWA 4HOOA 2WO3A 4Y5SA 4CCCA 2R49A 3VHOA 4OZOA 3HUGB 1HW2A 2NYYA 4UW4A 3TNQA 1BMV2 4AIHA 5IT9K 1X3ZB 3RZZA 3P3NA 1J3PA 1FBUA 2Q0OA 2WAAA 4D6SA 3VUOA 3ZYGA 4P14A 4ZYAA 3TEYA 3GZ6A 2ZGNA 3RZJA 5H20A 1GWMA 2N7GA 3A0KA 4NQWA 3AXDA 2AXTC 4P55A 3RKQA 4OQ9A 2HQAA 3Q0UA 3I0TA 2W1UA 2R16A 1QZEA 1YYNA 3IKVA 5KBFA 5E8GA 5F0CA 5TJJA 1HF0A 2FCTA 5BNPB 4C30A 5FZ1A 2JT1A 1UELB 3N9MA 4GZ9A 2WY7Q 4Q27A 1CZTA 3M8EA 1PP7U 2F4IA 1BOAA 3OD4A 1JHNA 3FM3A 4RYDA 1R091 5DUUA 3USUA 4WXDA 3GVAA 2EFPA 1W5SA 3M2MA 3HG9A 5FLIA 5B5EC 1ONAA 3M3YJ 3CQOA 2M9HA 1XDUA 3I3LA 4Y22A 1JT6A 1FNNA 2OQ6A 5E89A 2DQRA 4OMYA 4DBRA 1FNYA 4A3ZA 3ZSLA 5E1ZB 1LHNA 1ON2A 3JRHA 1BJQA 3VB2A 4Y7NJ 4Y22B 5KHJA 1F8VA 2JE7A 5HI0A 2WY8Q 5DAVA 3SJMA 3JBG1 1EUUA 3VPRA 3K1PA 1A6QA 2ZX0A 2IPQX 2RS31 3H5NA 2HOTA 1XRUA 2YUSA 1KU2A 2LALA 1C1LA 4FPGA 4AOCA 4K8FA 1CD3G 1POV1 1XD7A 2RQQA 1MBFA 1KXGA 3BG6A 1TME3 1Y1VJ 2VJ4A 3NJZA 2CW7A 3GGLA 1VQ6I 1Z7LA 5J48A 4I0WB 4PK4A 4C2UA 2DWRA 4GQ7A 2I10A 2ZJCA 1IN5A 1X1DA 3U75A 2HU9A 4DXZA 5FQ0B 1JXNA 2E5NA 3GO5A 4UBGA 3RYPA 2VZQA 2WO2A 4EJRA 4B4RA 1JKOC 4HSRA 1RNLA 5E8IA 3UKVA 5B4NA 4NRPA 4CU6A 2XAUA 4HVOA 1T98A 3VWBA 5A80A 5D5WB 1HRI2 3DYOA 3J7AO 2W3JA 5A32A 5D5UB 3HOTA 4XHBA 4ENKA 1KONA 2BZDA 2Z4FA 4YIFA 2HVSA 1X1PA 1XSQA 1YOVB 4Y52J 1WVRA 2BWCA 5JXIA 2GC3A 1SCRA 5T52A 3AYCA 1S72I 3RJ2X 2X85A 4KWLA 3DP7A 2AC1A 3MI8A 2ZHMA 4ON0A 4UI9L 2NVQJ 1K45A 3ONQA 2WO1A 1X8MA 4QM9A 1Q8VA 2LUWA 1AYN2 4QGMA 4LKSA 3H7YA 1ZREA 2D44A 2G4IA 4FBFA 3J7MA 4CZZA 3VDDC 3SCHA 2KQRA 2Q1ZB 3F3XA 5HDNA 2OTJI 2HTSA 1YG2A 4O6JA 4ZKTB 3L9FA 4EMSA 4GWJA 2OCCH 1QXRA 4D7MA 3ERED 1WCKA 3PVOA 1OI6A 3DPTA 1JH5A 3ES4A 3Q8EA 3HOSA 3R4DB 1U5ZA 5E20A 5FZ6A 2IGOA 2VCBA 2MD0A 2FQ3A 3AL6A 3VBHB 4KT5C 2H6BA 4KUMA 2L2OA 3OGGA 1GBGA 1HKDA 4Y33A 4QKFA 1J5YA 1QJX1 2GIZA 1Z7S2 2ZXHA 4LPLA 3U07A 3O0VA 5LBBA 4IVNA 5FB2A 2D3SA 1PMHX 4S2HA 4XJ8A 4QX7A 3MPPG 1ZM1A 1G3SA 4BHCA 3PIPF 2V1XA 4K9SA 1JXSA 2JE9A 3ZMVA 1CAXA 4HKLA 3ZFGB 3GALA 3FK7A 4MUVA 4XN0A 2DA5A 3I2KA 1VBE3 2X4HA 3BU7A 4C1WA 1WKMA 1ASJ2 5C4XJ 1UAIA 5FY1A 5F5AA 5DPNA 1LGBA 1PYVA 3LNQA 3HKZA 5F27A 2P3YA 4Q4X3 3TEZA 3O2PE 1JI6A 2CU7A 2VY0A 4HXCA 1EF4A 1V00A 1FEXA 1UPIA 3JRIA 1C0WA 3V56A 2PEXA 1IJWC 3VZLA 3SXWA 5E88A 4Q4V3 3LSGA 5DDJ3 4WM7C 4YG6A 1PIV2 2R30A 2QQAA 2P0WA 1CF7A 1T2XA 4XRMA 2JA2A 5APAA 4PSXA 4FOVA 4U2AA 3LIHA 2E9QA 2Y2ZA 1J1LA 3ZFFB 4ASMB 1RINA 4D7NA 1C8M2 3B94A 1YLFA 3Q9SA 2ZGPA 3VV1A 4C2TA 5FZOB 4HDVA 4XAAA 4XN3A 3NRVA 2HJIA 2ZA9A 4P5OA 2X05A 3KEQA 2NAZA 1R092 4YVWB 3FC0A 4Q1RA 2K9LA 4NWVA 3I9V2 5FLHA 4KWKA 2WZ8A 1ENRA 5LB6A 1FTTA 4WWCA 2W1QA 2O1QA 2VKVA 3K4KA 2BP6A 4A3MJ 5FXWA 2GOXB 4MLOA 2E1CA 5LBCA 4LXLA 3RJPA 1W90A 1G6NA 3TO6A 3E7LA 2ZJQF 1R1A3 2NS8A 4CYCB 3H92A 4A6SA 1W0PA 3ZR6A 1TVGA 1VBA2 3O3KA 1C4RA 3CMMA 1FI2A 1VAKA 3ZFFC 1CAUB 3QU3A 1L7RA 3LEIA 3H3ZA 2XF6A 5TSWA 4YZ3A 4RQPB 2B63J 2HYKA 3IAM2 1SD7A 2Q1MA 3FLPA 5FWJA 5JLXA 4Y5Z0 2RJLA 3AMMA 5E1RA 3VYTB 1W6MB 2FA5A 4H4KC 2E5ZA 2X6YA 5CBLA 2BOJA 4YYOA 5FLXZ 2YHJA 1URXA 4LHLA 3OYLA 2FDGA 2EZKA 5FPBA 5IYDJ 3KMHA 2JVGA 1EV7A 3SCGA 2R7WA 5HDKA 2VZSA 5DCMB 4A4AA 1R082 2ZB9A 4ARYA 4Y26A 5D21A 1XMXA 2AEYA 3RWKX 1NTCA 5EJZB 1LRHA 3POIA 1TT5B 2XJUA 2DI3A 3ZMTA 1PDNC 1I3HA 2BVMA 2EH3A 1RUJ2 1V3FA 4YFZA 4PJMA 1BW5A 1ETYA 5DTDA 4V19K 2EXHA 2VBZA 3HWJA 1U0JA 1U5TA 3W3CA 4MX3A 4A7ZA 1EUTA 1FLIA 5A3WA 3T1LA 1MH4A 4FQZA 4YGBA 1VI0A 1OVSA 4B47A 2OC6A 2JSCA 2GA1A 2AEZA 2K86A 2GOMA 1ULYA 1YWKA 4XVHA 1QH6A 1AR73 5FY0A 1JT0A 3H1YA 5IPAA 4D7SA 4G3YC 2I8DA 4A3LJ 3WU0A 5B3SH 2XC7A 1Y4WA 2AYHA 4JGYA 2V1DA 1LE8A 4LA3A 4DZJA 4OWRB 1QXPA 2GXGA 2M0CA 1Y0NA 3WLUA 2WYSA 4E2SA 2HDWA 5LATA 4D0PA 4QX2A 3WNPA 4NAMA 1ETXA 1JHFA 5FJHA 1UMZA 3I56I 2DVBA 3ZX7A 2VULA 1WBLA 4TZDA 2XAHA 3PFYA 3LEMA 1MS3A 5GLUA 2LREA 2R0FA 4BQ5A 3CLPA 3V4GA 2W91A 5J8FA 2NXNB 4RB3C 5F3CA 2DT7B 1CPNA 4XMIA 3BP8A 4X0GA 1ULGA 5C3QA 2ERFA 4DRVA 2CAUA 3HRTA 1UOBA 3A23A 2NLRA 3AMHA 3BOWA 3N7JA 4DUVA 1WMDA 3NNJA 4N53C 2CWEA 2DMUA 2ESNA 2DODA 2XL7A 3ERMA 5ACA1 1FV2A 1U9OA 1UOJA 5EJ3A 3RZGA 1RITA 3PO3J 3IV5A 4AUXA 1WKYA 1WLTA 1SAUA 4OULA 2HNHA 4MQVA 1JGGA 4KICA 2ZX2A 4RAYA 3O0XA 5FZ0A 3ZCOA 1RRJA 4Z07A 1AL0G 3ILNA 4NPLA 1BC7C 3Q8BA 3INAA 2GMPA 4I01A 3UT0A 4WM7A 3KSCA 2R5ZA 1E17A 1V6MA 4RR3C 2LLKA 2R7EB 2XVLA 3NAPB 1PNGA 1QJU3 4INDA 4ZDLA 1JTYA 1DGRN 3SCFA 3NSTA 1O7LA 1S0GA 3VOEA 4LBMA 2DOAA 4COZA 2D98A 3HRSA 3OOUA 1MIJA 1S3JA 1YQ5A 5FK7A 3CJTB 4Z82A 5LW9A 4BDVB 5CG8A 3KEOA 4PUSA 4CICA 3D82A 1C5HA 1LB2A 3CJQB 1PZ8A 2Y0MA 2XLGA 2KHMA 5M3FJ 1LHOA 2VQHA 1R00A 2Q8DA 2XJTA 3FZ3A 4AM3A 3W6KB 5CFCA 2WZR1 1VQ8I 5FMCA 2GA2A 4C0HA 4AGVA 3JTHA 1DGLA 4I76A 1S8NA 3F0CA 1GXQA 4AVPA 2V9VA 2CFXA 3D0SA 5F08A 1G86A 1VBA1 4BCUA 2XLAA 2IGMA 3QYBA 2Y69H 1NZIA 1B59A 5EJCA 1D0XA 3VBFC 1VRH3 1ULEA 4JDOA 1XE7A 3DBLB 2XLFA 1KU3A 3SNMA 1ZR4A 4NAOA 2R7FA 2A05A 4BJ5C 2O61A 4E2QA 1A8DA 2O8QA 3U2RA 1GT0C 3HM5A 1MMNA 1XS9A 3CMAI 3ABZA 2YSRA 5C8CC 1IS3A 1SFOJ 1XOYA 3V7RA 3FFZA 3BOQA 4XUNA 2K02A 3TDUC 2PAKA 4FPCA 1HDKA 2QQWA 4QHOA 4ZDPA 3WR0A 4L5IA 1QJEA 3T2PA 5FZGA 2VNVA 3WGHA 4A0XA 3U1XA 2DYCA 3VSLA 3MF6A 2VASA 2HZDA 1D0GA 5L9VA 1Q8PA 2FDHA 1VALA 2VZUA 1AR71 1M06G 3VDDB 4R79A 2F2EA 2ZAHA 5A32B 1SVOA 3FDYA 1X82A 1J2XA 2UWCA 3VD7A 1V5EA 5IK8A 3FIWA 1V6LA 2HWB1 2UV1A 5ANQA 5DDGA 1GLHA 1RMU1 2R072 3PL0A 1REPC 1ETOA 3AJZA 1F43A 4Q29A 5CVRA 5E1XA 5C4WC 2PYTA 2LK2A 2Z69A 2E36A 2VBDA 4D6RA 2IXSA 2E1MC 3CZUA 4AWDA 3OGRA 4JX6A 5GP9A 1HBXG 1QWRA 2NNYA 2PFWA 2XGDA 5FZHA 3I7DA 2PHUA 1P9QC 1RXGA 3NARA 3Q5FA 2VMEA 1S4CA 3CCJI 1SD4A 1QOTA 3VBRA 2DFHA 1H9GA 1RUG3 1E5HA 2MH2A 4WX9A 5EYXA 4Q4V2 3OYNA 3DU5A 3SHFA 4B1RA 1D8KA 3WQ1A 1VBE1 2VG9A 5T50A 4QGNA 5FKNA 5IJRA 4QLCU 1FP2A 3FXRA 2M1BA 2BNMA 4RAZA 3P9CA 4ZYDA 2LBFB 1BHGA 1OFSA 3S7IA 2XB5A 3CO2A 5CA6A 3VDAA 4PIYA 5EF6A 1D2SA 5K5QA 2C24A 2C9KA 3UKNA 3BZCA 1RHI1 1OD3A 3KZZA 4DGWB 1T6BX 1H88C 3ZYHA 1JYXA 2X48A 1ULOA 4AGGA 3L2YA 3D8CA 1X33A 4KQ7A 3F8NA 4N8MA 3S1QJ 1V9U1 3AZVA 2FE3A 4O5VA 2VBXA 1LHUA 5DABA 4WVZA 3EPZA 3L7WA 3OGJA 1IGNA 2FZ1A 4MGRA 3WNXA 4NIHA 1RC6A 2ZGTA 3VZMA 4PDKA 2MLKA 3ZXAC 5F6KA 2L7MP 4S04A 2WA4A 4W6WA 1H6XA 5FO5A 1OLME 4RLQA 2L9VA 2KZGA 3OGVA 3D3AA 3B9IA 3MKYB 4PJLA 3HNMA 1NG6A 2ZMKA 4YFNF 3BOPA 3KGZA 1MQTA 4HYEA 1V9U3 2EAAA 4GO1A 3CL1A 3AFGA 1UIJA 1X36A 4OQ8A 2EV6A 1FOD1 4ZHNA 1O5LA 5C9AB 2ACJA 5GZDA 2Q8OA 2EIJH 1NHAA 4RB2C 4DOUA 2DYSH 2GALA 1OPMA 5KC5A 1R4NB 4BB3A 1SFPA 5F64A 4D8MA 1MS4A 2JN6A 3ASNH 2HDDA 5F04A 1N3QA 2WA0A 2R7ZJ 1FOXA 4O9EA 3ZIWA 4AK3A 4DRRA 2FBKA 2OA4A 1VBB1 4A3BJ 2B42B 1GVJA 2V4VA 5IOZA 5IVJA 3DECA 4RN5A 3ZO0B 2XJVA 1MEC1 4M4PA 2VE1A 1YQAA 4FO9A 4IEUA 5LASA 5CFCC 3VHNA 1IQAA 4MYEA 3IDCB 1QNWA 2D6LX 4R52A 1SZBA 1SDWA 3OV8A 4F8AA 1DQ0A 1TQMA 3VBHC 3VZNA 3O5SA 4CP2A 4KDPA 4GCVA 2H0BA 3HQRA 2ZGOA 4EQQA 3R0AA 3S3OA 3AKRA 5LLQA 1ZRCA 4Y1YA 4XACA 4F3JA 1NZCA 2GC2A 1UMIA 3UKTA 1A3KA 3G1LA 2MG4A 3F8CA 2CWSA 3A21A 1W99A 3WOGA 1UCXA 1AYM1 4JHZA 1XMKA 1K61A 1MMAA 5DD8A 4C9YA 1WLCA 3ZM8A 1YFYA 3G6JB 4A12A 2HOSA 5LRSA 2VZ1A 4NR1A 2ET7A 4F92B 1PJRA 4E7JA 4RAFA 2E53A 1N75A 4M74A 2RGVA 3HRUA 1R1A1 1XB4A 3B6AA 2XQRA 3DKQA 1DPRA 1PK6A 2VC1A 4LJHA 5FRNA 1FPN1 3I8TA 5FZ4A 1O3RA 4WXHA 3L2CA 3GBWA 3W20A 4XMYA 1OPOA 5IVYA 3OR2C 4DJAA 1IW7F 1RUC1 3BPSA 5GM0A 2ISZA 4EN0A 1E3PA 2GNDA 1K5JA 1DDNA 1BBYA 1HSTA 2FSWA 4WM8B 2CG4A 5CVUA 4OMCA 5FY4A 2M87A 1R58A 1I3AA 4GALA 5C9AC 2WB1A 2XHKA 4C8DA 4F52A 4M9ZA 1HKQA 4CZSA 4YFXF 1ERDA 3BIWE 3WQ0A 3I3MA 2CYFA 1ON1A 1XNDA 4B3AA 4XKBA 3GXUA 5T5JA 3GTKJ 4IX7A 2JG8A 3C7HA 3WNLA 5IFTA 1MVQA 4BACA 2FDFA 1YFHA 3GFMA 2R071 3KHBA 1ZARA 3ZKYA 1POGA 3BR5A 4AI3A 1WJEA 2M7AA 1LEDA 3EXUA 5K8SA 4EJUA 5FREA 3WP4A 1ZA4A 4UF0A 2M45A 4JDMA 1MVEA 5DUVA 1AZDA 1XGOA 1OSGA 1F9NA 1PUFB 5AFBA 5FMDA 1GQGA 1EY2A 2JRMA 4Q5OA 3QBQA 2HWB3 2LFBA 1VBB2 1QQP3 4GXOA 3WZ1A 2YX4A 4I0AA 1SMYF 2HR3A 4MZUA 3E6CC 4FPHA 1W8HA 1YFXA 2NS7A 3NV4A 5EG0A 1O3TA 2KRFA 1RUJ3 2KT0A 1XGMA 2HS5A 1MH3A 4HA8A 2XG3A 3LEGA 3BR6A 5EZWA 3MIGA 1NXD1 4ZH4F 5F2SA 1BR4A 4XFGA 2KJCA 4TTGA 3DN7A 2QENA 1HW5A 2O3FA 3K3OA 3C8XA 2HVRA 1BOBA 1RIRA 2QQJA 2WKKA 2HWE2 2BW3B 2QF7A 2D5HA 3I2DA 2A3WA 2ADEA 1PUEE 3GZAA 1CAXB 4DEVA 5JVTA 3OYKA 4LIUA 5DAQA 3SFIA 3V64A 1T56A 1LGNA 2NN8A 1MR5A 4LE4A 4A44A 4DXSA 4M00A 2X6WA 3T0YA 4B4PA 4QDSA 1FOYA 2KP6A 1HQNA 4PJ0C 2ET1A 3I2HA 4EWDA 3I3EA 1BKZA 4FVVA 4WVMA 4I09A 5JCTA 1X3UA 5L3BA 3ZOIA 4N7IA 1T33A 1G9CA 3LSPA 2ICWG 5T55A 2R0QC 1MMDA 1RUI1 2YBSA 3QOEA 4ISQA 3O1SA 2HWVA 3M3QA 1MZFA 2VC9A 1F1ZA 2L9SA 2PMZN 3JRDA 5LFAA 1JS9A 4W4ZA 1DDLA 4J1XA 4MGTA 2WS93 1Y9MA 1UHSA 4W97A 3WE3A 4UVAA 4Z8BA 3H9QA 3DKYA 2ZTNA 5FK8A 2LDUA 1UXZA 5IHRA 5E3LA 3I53A 4BAYA 1JZ3A 5ANNA 3VBHA 5JXGA 3GYDA 3T8TA 2RQPA 5BV6A 2IS4A 2A6ZA 2ARBA 4H2AA 3HJEA 2KMUA 5IVBA 1OJLA 2FMDA 5FMOL 3TNPB 5DD4A 1XNKA 1US2A 3CMGA 1CAVB 3J26N 4N9IA 2PMHA 3VBFB 4V1PA 1QJY2 4BZ4A 1ZZ6A 5H6RA 4RQPA 4HQMA 3WDUA 5HCAA 1ZLJA 1QKQA 4XRSG 3H9AA 4HN0A 3GZTB 4LMYA 4CDGA 4Q4W3 4PI0A 1G59A 3K4BA 4LBQB 4BLIA 2VI6A 4KI5M 4CDWA 1APNA 1W6QB 5DUXA 1MS0A 1Q43A 5L9BA 4QU2A 4IHWA 6PAXA 2ZZJA 3MZ8A 3GJBA 1BLZA 2VCAA 5K7HA 2ZSHB 2JDYA 4NRQA 1EKEA 5IP6A 3GCXA 3IRQA 3SYTA 5GAGJ 4ASNA 1SLAA 5GAHJ 2Y26A 4N53A 1WMFA 3GFLA 3G1OA 1QJX3 3IPVA 1UY3A 2DVGA 3ZRGA 1OF4A 2XBO2 2JMWA 5HOOA 3NAPC 1I6HJ 3D0JA 5C9AA 4GFBA 1S2BA 1OHFA 1NCQC 3HBKA 3LPGA 2LRPA 4EM0B 1OBNA 3LD8A 3QOPA 5C71A 1Y6IA 2IP2A 2YU1A 5FPAA 1UYYA 2XH6A 2VUCA 1OH4A 1BQPA 1CZSA 5FKOA 2EZLA 1JUHA 4M6XA 4HLTA 2Z3YA 2ZEWA 2JG8C 4UW5A 2WAFA 1U78A 2D5FA 5JPNB 1W0UA 2K9ZA 1DYOA 2VMGA 5IK5A 2XJRA 4GH4A 3WVJA 4JDNA 4EM1A 3O1RA 2RJKA 3HOBA 3VL9A 2Y31A 2BV4A 2E1OA 1TWAJ 1ULDA 2BHYA 1ACIA 3KETA 4NHLA 4LD5A 3M1CA 2WN3A 1RESA 3VHPA 1MGTA 5LRRA 1HKSA 2D3RA 2HEYF 1PM4A 2DBBA 1GUIA 5EZGA 2WV0A 4FP2A 4XE9A 3WP5A 5EEGA 2QDNA 4YELA 1W8WA 1ZZ7A 5LZ6A 4KT6A 3BTJA 1BMV1 3W5MA 1TWGJ 4AQTA 2F48A 2JSPA 3EQEA 4JP0A 1UHWA 2XJSA 3M4FA 2ZHNA 3L2HA 4GA9A 4JKKA 1D2QA 1YUDA 3AL5A 5A3MA 2AENA 4LBLA 1TME2 4AAPA 4KU8A 3H35A 4YW1A 3HAGA 1GZ9A 5IP9J 3MO4A 3ZXKA 3VBFA 4IV3A 5FUPA 3TN93 1JUPA 3B3QE 1TW3A 2FJ1A 1YQ2A 3TYJA 3VFZA 2WA3A 5CKTA 5BNOA 1XC5A 4XILA 2DTRA 2EICA 3HNBM 3S3NA 4I02A 4LO8A 3CCYA 3ZYBA 1COV2 3O1MA 2W87A 2F4LA 4IQJA 5IVCA 2KKOA 3W6VA 5K4LA 2EK5A 1ZG1A 3WTXC 2VQGA 4OFGA 1Y8RB 1CQTA 4DMIA 2IVJA 4NIDA 2PJPA 4HONA 1HC8A 5CFCB 1BZWA 2FF4A 4IV1C 4AVCA 3KGLA 1OOPB 3HN1A 4LTAA 2WS92 4FXKB 4P9GA 3H1WA 1D8JA 1X50A 1SQ4A 4B8XA 4YRVA 1DZTA 2ARXA 3D6EA 2RS13 1RYYA 1IPSA 5TGTA 2CWMA 2JX9A 2CW8A 5C7GA 1UY4A 3I64A 1H8TC 2JJ7A 2GXBA 2J1SA 5CFDB 1XPXA 3NQHA 1RUI2 3CJIB 4I30A 1GV9A 2Z42A 1FAYA 1WA6X 1W39A 5FFOC 1DQ2A 4PLNA 1MDMB 3Q9VA 1WW4A 4R4ZA 1E3HA 2L9RA 1ONVA 1MZ6A 4YG0A 3T2QA 2VCMA 4KIGA 2ID3A 4UVCA 3ZXLA 4CP9B 2VUDA 3IZOA 1LEAA 1H30A 3WNMA 4AI2A 4RM2A 3WW3A 3KX2A 2VODA 2TEPA 4XLCA 2W25A 3R4KA 5HVQC 3RPUD 1DFQA 2A07F 1R36A 5JR3A 3EHKA 3ZQHA 4IEQA 1Z21A 4ARXA 3SH5A 5F3EA 1MS5A 1U2WA 4YVWC 1MJAA 2G1MA 4M9XA 4BDYA 2UWMA 3DEMA 1ZBE2 2DFCA 1RUF1 1ZH5A 1G7YA 5I91A 4C0BA 2O7OA 1Y0UA 3ZKUA 1Q3EA 1PUFA 3EYIA 1BBT2 1BEV2 1T0FC 1DUXC 2DVAA 5I93A 1S2EA 1C8NA 5FY7A 5D6EA 3UKGA 3KYDB 3WCRA 3IIAA 3LA2A 5EP9A 1PGL2 1LU2A 2CGNA 2PBIA 1S7EA 2XVKA 3H8RA 4O61A 2XRNA 4MXWA 4CDUA 1SLLA 4AVZA 4N53B 5AIPA 5C5TA 1MEC3 3QYEA 2YPRA 4B44A 2SLIA 2BBYA 1W04A 3LSKA 3A01B 5CG9A 4XONA 5FYMA 2CL2A 1JYTA 5A1LA 2FRHA 1L0OC 4NVPA 3ZN0A 1X8EA 5J1UA 2PMZA 2RS32 3HSFA 3ZFGC 1ZZ9A 5C3OA 4HNVA 1YEWA 4XJ9A 1FMD3 5GKAC 3N9NA 1PO13 4E7SA 2QQ8A 4AXOA 2HTJA 4E8CA 2FZ2A 3ZFEC 2W47A 5FPZA 3WT3A 4CDXB 3BT9A 1KJLA 2CUFA 1BR1A 2LMDA 5GTIC 1YHQI 2K9SA 4ENNA 5KAFC 4I3PA 3CMEI 2WFPA 5D2AA 5F1RA 5ICFA 5J40A 4XBNA 2RDPA 3IMMA 4IEOA 4LB6B 1BI3A 1OXCA 3SEPA 1AHDP 1SFNA 2H0VA 3KV5A 2E2IJ 1VBA3 2DK5A 2WAOA 1A34A 4FFHA 2CGOA 2ZMNA 1A8MA 3AMNA 4UBHA 3IDEA 1MW7A 4O9GA 2YGMA 1HB2A 1TME1 1ZRDA 4DB5A 5FKKA 3E5UA 4K2EA 3DGTA 3OOXA 1R1UA 2E33A 4CXYA 2VNRA 4GMP1 4Q0QA 1HDPA 3B01A 1D4VB 2EQRA 2JTVA 5LCWL 3MW3A 4IO9F 1G3WA 1A04A 5IOYA 1D4M3 2PAEA 4J01A 1FTZA 3UYJA 3V8JA 1W9TA 2H8RA 3NJXA 2YFUA 4JKMA 4BNCA 1EPZA 4L5JA 3TEXA 3IHUA 2ZGSA 4XIKA 3I71A 3DU6A 2X1CA 2KIQA 3KCYA 3K0LA 3CZJA 3ASIA 3PUBA 3IH4A 4IV1A 1YRNA 3PNVA 2XUEA 4FPKA 5DUWA 4QPQA 1DGRA 3HT2A 4AW7A 5BQTA 1NLSA 5D8AA 4YGEA 2LVSA 1VIWB 3DYMA 2UZKA 3WDWA 2VBYA 2P17A 1IDZA 1SPPA 4FAHA 5FLMJ 1R1ZA 1SLBA 3M8FA 1EH6A 3BZKA 3DBHB 3C3WA 5LHGA 3NQOA 1QQIA 3VD5A 3M4OJ 4BE3A 2VBPA 5GPAA 4IXLA 3CJXA 3LEKA 2HI3A 2D5VA 1RUC2 2DURA 5A6XA 3IT8A 4XF9A 1WW7A 2LD5A 4K40A 4DINB 4OMDA 4IEVA 2WINB 3AK0A 4EJOA 5HS9A 2DTWA 4OINF 5C6CA 4FTEA 1S55A 1CAUA 4RAGA 3T0BA 3K70D 1OKRA 1W9FA 3JB4C 4BMEA 1RXFA 2XJQA 4IEJA 2ZGKA 3J81Z 3DXJF 5ICEA 1JZ2A 2BQPA 1K3IA 4R9AA 4HF1A 3N9LA 4IEXA 3K4CA 2X0LA 3HBLA 5AIQA 2D6OX 4PGHA 1QEXA 3I4NJ 5C3SA 3KP7A 1WBFA 1TMF1 5JLWA 4A3KJ 2OCEA 4DFSA 4FFIA 2YPDA 3KFWX 2D6MA 2GQQA 3RMYA 5IYYA 2NVUB 4DOZA 4LK7A 5JSOA 3UJQA 2P3JA 3GFJA 3ACLA 1W2TA 2J1TA 5FR3A 1AYM2 3RQ4A 1KD7A 3O8HA 3NRUA 4BE0A 1YI9A 3BB6A 1PVEA 4Z2YA 2TNFA 1RUH3 5T3NA 4QHBA 2WLPA 2DBIA 2JWPA 2UUZA 3BTCA 2BXYA 1DLCA 3ROUA 2P5LC 1AL22 3V0BB 3ILRA 1S6LA 1D1AA 1NLRA 3HL2A 3OSGA 2FHRA 4COVA 4XFHA 4HEA2 1O4TA 2VUAA 4UW3A 3W9AA 4NQWB 1HLVA 3NL1A 4CU9A 3ZMZA 1H4GA 2EIBA 1XSXA 3S2HJ 1QU3A 3CIHA 3K51A 2OF7A 3TWIA 1OOPC 2FUG2 2OZ6A 3CTAA 2TRTA 1XNTA 2Y38A 5IW0A 4F83A 4S2FA 5KXEA 2W00A 4NJ4A 2QQKA 4Y4YA 2JWTA 3CKHA 1LCLA 2DCYA 3NWSA 2M5WA 4MSVA 2VJ5A 2VZPA 2YXSA 5GZGA 4Q4Y2 1CAWB 1FOD3 3AX4A 3ZFEA 1TL8A 3PFIA 2Y0IA 4M71A 4YW5A 4EE2A 3G2BA 3MVPA 2VQ0A 2VXDA 2R7SA 1Q1VA 2DDUA 1F2NA 3BUCA 5L7OA 1UMQA 5EZHA 2W0XA 1GNZA 2AS5F 2WL1A 4CUBA 1VPHA 2DU9A 2KM2A 3ZXEA 4E6KG 1TE1B 2VOPA 2RDQA 1WHUA 4Z1VA 3KT7A 4XIOA 5CYYA 2EFQA 3PTRB 4OYUA 1C5IA 4NN0A 4M3CF 4IV3B 5J98B 5H9RA 3GX4X 4OVEA 4HPQA 2UYBA 5L3FA 1LEMA 2QSFX 2HYXA 1MSEC 1EAH1 1BN5A 1HCRA 1V6NA 3LOCA 1UY2A 3LOIA 2ZAAA 3RG0A 3ALQA 1PIV3 2QLZA 4ANJA 2A7AA 3CMYA 1NK3P 4RFT0 2VJIA 3ZPLA 4FAGA 4R8HA 1NKGA 4RQPC 2RNJA 4CCEA 3NWKA 2MC4A 4U0VA 2XUBA 1IKPA 4YW7A 2QTWB 3PTYA 1MNMC 3HYIA 2LYCA 3JB8A 4AVVA 3CCUI 4U88A 2A6TA 1AR93 3C2UA 2PN5A 4CDWC 5FPLA 2DMTA 4M3CB 2QSGX 1H8VA 5FBZA 3URFA 2XGCA 3HPHA 4KIBA 3MBWA 2VZTA 3UL2A 2W52A 4J25A 3ECQA 4FX4A 3VBSA 3EJKA 1I3QJ 2E34A 4A2UA 3WW4A 2IC1A 1UZ0A 2D43A 3OPZA 3RI9A 1ZVFA 5LK5A 1FV3A 4XJZA 2TCTA 1IRGA 1DG6A 1W8OA 3C7JA 2UY8A 2FX0A 1U12A 3WG3A 3O6BB 1LECA 1A6CA 2QNKA 5T5OA 3DXUA 2CMPA 1XYNA 2RVAA 2OQGA 2FNPA 4XABA 1AL21 1CWPA 3KT1A 4BQ1A 4OAYA 2VONA 3FUOA 3PIOF 3PNYA 3ACFA 3WGIA 2ELJA 4MTEA 2ZJRF 2DCJA 3L2VA 2V5YA 1S5LC 1LFUP 5FZKA 3SZTA 5E3NA 5L9RA 5EIYB 2M8GX 4YM1A 4U36A 3HOXJ 4ZJZA 4QPOA 4UXAA 4L9NA 3VBSB 1UKRA 4GH4C 2CHHA 2JD4A 2ZXJA 1MMSA 2VL8A 5D4RA 3FKIJ 2GH8A 2DYRH 3IM0A 2A68F 2JDNA 1GUUA 4CU8A 1O8SA 2Z79A 4CU7A 1VMHA 1KEXA 1DQ5A 3FBYA 1W8UA 4P9JA 2HQ5A 1I9RA 4E7HA 5FPUA 4H14A 3KP6A 4RGAA 1SDDB 2L3DA 3DBRB 4HZFA 1LOFA 5A33B 4MQ9F 2HDCA 3TMOA 3POEA 5BNPC 4PIZA 3CLQA 4LBQA 3KYLA 1YJNI 5ED4A 1TNSA 1J1TA 1DGWX 4KWJA 2ES3A 3SQOA 4CCMA 1K12A 5EFUA 1VFCA 5BNQA 3HOUJ 3DKWA 3JTGA 1NLQA 4XUTA 4QQLA 2WIIB 2B45X 3K4NA 1JUMA 3LSEA 2FBHA 4DYRA 4X8PA 4RMNA 4LNVA 3LSDA 2MW8A 3ZN6A 2Y0SA 4FCAA 1BVP1 1I5ZA 3WTWC 1DBNA 5JR7B 2RN7A 2VKEA 3HC7A 1GICA 4OUEA 2M34A 4LLLA 4JGYB 4E27A 2XV4S 3E3VA 3GLLA 4UFMA 2IS2A 3WTZA 1Q8OA 1WA4A 2BW8A 4UVBA 2K3PA 3BN6A 4DIQA 1ZR2A 1UIKA 4QKBA 1FBQA 1KZHA 2DOFA 3C1DA 3OS1A 5M5WJ 1UNBA 4Q4Y3 5J36A 3O14A 3CF5F 4O65A 3DCFA 2R7QA 4P5HA 4UY8I 2A3XA 1R5HA 2CO5A 3U4SA 1XJAA 3E1F1 2OX0A 1HSJA 3RPQA 4A3EJ 3KQ4B 4J19A 3OL3A 1Z67A 1MZBA 4PF5A 2STTA 2EILH 2ZHKA 3MPBA 3LWCA 3AL0B 2PQQA 5KR7A 1S0IA 3MQ0A 2VTXJ 1AA7A 2CQNA 3ECHA 5L3EA 3AYEA 5L7OC 5AVPA 2QUFA 1U5YA 4UYBA 2DA2A 4AHXA 3JW4A 1CAWA 4HPKB 2LR8A 3GTGJ 3HVDA 1H8TA 2DFBA 3AKQA 1GWLA 1HXDA 4JGZB 5C33A 4LT5A 4ZXEA 3K69A 4XKWA 4RA2A 3BR0A 3BJ6A 3EUKL 5C8WA 2BFUS 1O8PA 4YG3A 3LFUA 1D0YA 2W2IA 4M4RA 1DF0A 4BQYA 4HETA 2E19A 3W5NA 2WWYA 4UFHA 2K7LA 4D1QA 3JAMK 1P2FA 1OYIA 3IN9A 2ME0A 4BQOA 3AG4H 1PO11 4CO8A 5KCMA 5BMZA 5H9PA 1ZN2A 4AEJA 3F9KA 2VT2A 1P8JA 1S29A 1WCDJ 1YJLA 3MFAA 2K4JA 3NV3A 5D6FA 2XIGA 1O6UA 3A4UA 3VBOB 2K9NA 1OCCH 3SZPA 2Y6JA 3TQNA 1HA8A 3RJRA 2VT3A 5BPIA 2YPJA 3A01A 4DNYA 3OS2A 4P9UA 1VRH1 1P92A 1VR3A 1B09A 5GTHC 2VPVA 1CQ9A 1T0FA 2BJSA 3ETQA 5F9TA 5KHDA 2ZO4A 3KZ4C 5A6YA 3ZPOA 2MGQA 3HGGA 2XF5A 1RUG1 5J1RA 3KCCA 4WM8C 1B35C 2EIDA 2WFF2 3W2VA 2HOEA 3RI4A 1LOBA 1UY1A 1EA3A 1W2AX 1LVAA 4AC0A 1W3VA 3DEWA 1AR63 2WN2A 1XQNA 1O7FA 4P9FA 4FI9A 4KGQA 3ZXFA 4XIDA 2DV9A 1R1A2 4DZPA 3WW1A 2VQUA 4HSJA 4OIQF 2B7YA 4XTMA 3ZFGA 4AQ6A 3D4KA 5JOWA 4QHZA 4Z2AA 5KXBA 2WV1A 2R4GA 3WXPA 1Q8SA 4D6QA 4LUMA 4NDLA 1OFNA 1EAH2 4AEDC 3WF3A 4DY3A 1NK2P 3ZDSA 5BNPA 4KNYA 4KL1A 2J5PA 5FMBA 2IS1A 1AU7A 2PTMA 1XSRA 3IP4B 4ZXKA 3SKVA 2J1EA 1WGPA 1LQ1A 4QKNA 3F8FA 2YG0A 3I5UA 5FP3A 3I49A 1U5XA 1D1CA 3R0JA 2ENRA 2KIMA 5EYYA 3JBG3 2DUQA 2XVGA 4MV2A 4XW3A 2IFWA 2DK8A 3BCAA 3HZJA 1IF1A 3RQ0A 2GN3A 3SFZA 5JOXA 4IL7A 3MKLA 2P1BA 3OY8B 4COYA 5I8YA 3WG2A 3AC0A 5GALA 5D4SA 4BOWA 3EETA 5AONA 2HXOA 3SDGA 3H8UA 1UZZA 3ZSEA 3UJOA 4OIPF 4XICA 4D0QA 1CONA 4LBOA 1GZWB 1OVPA 4OHVA 1S9HA 1X1AA 2OPTA 4X6QB 4CDXA 3ZYIB 4EZ4A 3KP4A 3PUFA 1FMD2 4XDOA 4HMZA 1UG0A 3EUHA 4OHYA 1W7PA 4W65A 4ZU7A 2VR4A 1W8NA 4ATFA 4Z2WA 1OKQA 5FKCA 1OR7A 3X2QH 5A2QK 4NROA 3O7OA 4N43C 1B9NA 1QNTA 2XVCA 1GP6A 1R9TJ 1SVMA 3N7LA 1QJZA 5KHHA 4Y1UA 3RTRA 3CDLA 3AZXA 2HBTA 3ZYJB 1GOGA 2Y0OA 1BBT1 3FF5A 5FPVA 2WB1N 1W6MA 4MIMA 1O59A 4A3XA 2PA7A 2B9VA 3FHQA 1WZXA 1W36D 2NOGA 1VQLI 2A73B 2COBA 1EP0A 2Y75A 4XQ4A 3GEZA 1IUFA 1J3QA 5DEQA 1V5FA 5FP9A 4Q0VA 2VD7A 2DDAA 2RR12 1N3OA 1O91A 5JOYA 2K4BA 4QDQA 3SKJE 3OEAA 1AUYA 1LKNA 2W57A 2VH9A 2Q2EB 2J1RA 2NP0A 2Z5UA 3OS0A 1US3A 2LY2A 1WD4A 4CDUB 4CDQA 3DLAA 3LKJA 3RI8A 2IA2A 3LF7A 4NRMA 1LHVA 2A3SA 2V7FA 4QQ2A 3HT1A 3PMEA 2Q8KA 3MDPA 4UFKA 1F4AA 1ZRIA 2RS51 2KL4A 2G9FA 3C3VA 4NO4A 2BVVA 5CVIA 2BRTA 2EVXA 4ZZ5A 2FNAA 2OZJA 2WNUB 1ND3C 3QPTA 3AM2A 2YU2A 1ZBA2 4U87A 1F36A 4MGKE 2EF6A 1W7PD 4Y1VA 3CCRI 1KFXL 4CP9A 2ZGLA 1N1YA 4D7TA 4IOCF 3S6PA 5LGTA 1A5JA 1YQ6A 2Y30A 1UZVA 5I8SA 1JN2P 1QBJA 4MADA 1VB4A 2WSVA 2HWD2 5EXOA 4HG6B 4AFMA 5LHHA 2LF8A 4L9JA 3ILFA 4IGOA 5JOZA 5D8AB 1P7IA 3KHCA 5FY9A 3MW2A 4I2OA 5J4YA 3V0AB 5C4WB 2PHRA 4HV6A 2E35A 2Y0SN 5HLTA 5IAXA 4A69C 2IBDA 3CZ6A 2MEV2 2R7UA 1M1EB 4L5EA 3LB9A 2XWJB 1AR62 4D5FA 4A3JJ 5KXCA 4C3JJ 2JENA 2NNNA 2K40A 4HX7A 4AWXB 2OW4A 2BY1A 2RDNA 2V1NA 5EV7A 1BJZA 5DZFA 2JPCA 2QGUA 4YSFA 3JUUA 3S30A 1FMD1 2Q1FA 4NIAA 1CAVA 2OV7A 4Q8KA 3PSIA 1T39A 4K8RB 5FP4A 1K42A 1IHMA 1U3EM 4U0WA 3K10A 1S0CA 2HQRA 2AH2A 3S1NJ 3COAC 4N7UA 5C8CB 2IGNA 1VTNC 4UUVA 2JVHA 3UK9A 3ZQ7A 3VKOA 4IKFA 1YFUA 1GR3A 4QX3A 2GLOA 1K79A 5BNNA 3S15J 4E4DX 3BJAA 5FY5A 2X09A 3JBG2 4L97A 2ZBKA 1JOPA 4HAMA 3HD8B 2PN6A 3GBGA 4IF4A 1KQ9A 3K1NA 2PHTA 3U14A 1R4MB 2OYZA 2ZXQA 4R1HA 1E3OC 2W94A 1LDJA 2IA1A 1ULFA 3H1MA 4NHJA 1EPWA 4EJVA 2ETHA 4H55A 2X8KA 1R083 2PLV2 4QX0A 2YY1A 1Z6RA 1YJ9I 3S5AA 2WRAA 1ZGAA 1QPMA 3ZQGA 2FMYA 2PHWA 4XBQA 1ETWA 5GLWA 1KGSA 5A7WB 2VUMJ 4LBKA 1R7JA 2ZSIB 3G73A 5FOBB 3CCQI 2RM22 2E7AA 3FMRA 2C9AA 3OYAA 1WRJA 2B39A 1R5ID 2V72A 4A6DA 2NYXA 1VBD1 4XC9A 5KHGA 3W21A 4YGDA 1HB1A 4P96A 5IK7A 3T0DA 4BISA 3TKYA 1XNAA 4RR3B 3NO8A 2W1WA 3OUIA 4LKDA 1BJAA 2GH2A 3V7SA 3ZXSA 5F0HA 1VBE2 1G4DA 5CLSA 4QB6A 5GZEA 2NVYJ 1B4AA 4HANA 4RGKA 1G9DA 1AR92 4UNOA 5JI9A 2E1NA 4JAAA 1QIQA 1TMF3 3U78A 1P6RA 1SHWB 4IEZA 1IG0A 3KP5A 2GZWA 3PUHA 3UNPA 5CISA 2IJLA 4ES9A 1YIPA 5J3LA 1JMUB 1PZ9A 2YU3A 4UV8A 5K7ZA 1H9PA 4PLOA 2WNVC 2L7KA 2DCTA 3MIHA 3LSMA 5AC92 4NC8A 2IA0A 3AP5A 3POYA 4BIFA 3ETPA 3Q8AA 4FFFA 2XJPA 2VBBA 1WD3A 3GYHX 5EWSA 1E57A 2E31A 3ZIXA 1HV0A 3AKPA 2I2SA 2W46A 1SFUA 3PU3A 4N0BA 4AIJA 1UZWA 3RZKA 4CDQB 1NYWA 2ZMEC 3TN91 4EQVA 2J22A 2JEMA 2R7TA 2JDZA 1T95A 4OU0A 5BXXA 4AE2A 3LSTA 4DQAA 3HPGA 1VNDA 1RMU2 1FOD2 2HZTA 3RS6A 3N05A 5FYVA 2PHLA 4Q4ZF 2PMUA 2JB4A 2BWAA 4HK8A 1A78A 3FXMA 4E8DA 2LH9A 4HX8A 2P81A 4FASD 5FZ9A 1LOEA 3K75B 1S7AA 3I3QA 3JQXA 3MV11 5DUIA 2QVSB 5LA0A 2R0HA 5I0DA 1TNRA 1W5CC 1OA3A 1NY71 2P6CA 2MEV1 2MA3A 4FT8A 4CZCA 1J58A 1JHJA 3JCIA 5BOXA 1F4KA 4YFWA 4LO5B 4BBSJ 5IYCJ 2XF7A 3I59A 3OYIA 1UAAA 4Q48A 3U11A 1N1TA 1W2OA 1DGWA 3OYGA 1ACCA 1YYVA 4KJZA 3CF2A 4KITB 3VD3A 3TEDA 4CGZA 3BKZA 4HDUA 1SACA 2P5KA 1ENQA 3BG5A 3NEUA 4CE8A 1W0NA 1NE6A 1OFCX 5EDNA 4QIWN 5CEHA 1CIYA 1VQNI 5JPMB 3D5OA 1ZRFA 4I98B 4NC7A 1W06A 2BNOA 5BYNA 1ETQA 4M3GA 5SV8A 1RJ7A 2QQLA 3G1MA 3ACHA 2ZZQA 5C5UA 4BE2A 1RUF2 3LDBA 3B73A 4IE7A 5LA9A 3SHRA 1GWKA 4L9VA 2O5RA 1U5IA 4FPLA 3GTOJ 1R5GA 3I2JA 3MD2A 2OAZA 4KMQA 1LJ7A 4PGGA 4EWAA 2XAFA 1JZ8A 1NUKA 1RGSA 2DU1A 5A3LA 5A7SA 2J5OA 2RS52 4B4CA 3VB9A 4DPNA 3POFA 5FYTA 1J0RA 4AVTA 2FBEA 5FKLA 2HPMA 4BBRJ 2CDOA 5HS7A 3KT4A 2WNUA 2G9ZA 4AAXA 1OD5A 2EIEA 5FJKA 5FZBA 2ETEA 1H6YA 4K1ZA 3OD0A 3CJNA 1ZZBA 1ODDA 3LDRA 4NNJA 2RS33 1D4M1 3D5LA 2E26A 2P6HA 3DUIA 5EG0B 1SLTA 3H8XA 1DQ1A 3FBIB 1XN7A 2KD7A 3TGNA 4FE7A 1W0OA 3LMMA 1Y8QB 2V5DA 1GMMA 3VD9A 3SDBA 2OJED 1IS5A 3IAQA 3N9PA 2KFDA 2HFHA 5CADA 2Q2EA 5JZGB 2TBVA 4ENJA 1P4WA 2R7OA 4FPOB 4OMZA 2OQRA 3FE5A 4IE6A 2VNGA 4QPIB 4FP3A 3BODA 1X58A 3PUSA 2E60A 2ECBA 4A0ZA 1R22A 2R5ZB 3DLLF 3VBUA 2UYAA 3CCEI 3HTUA 1W6PA 2JDAA 3MAJA 3GJAA 1BIBA 1A35A 4F55A 1OLRA 4ISRA 5M5YJ 1YIFA 1FOWA 4XYXA 2X6XA 3GTMJ 4S05A 1HW1A 3K2AA 1AXYA 4YIIA 4HBNA 1YRNB 2DVFA 3VBOA 3GCWA 3AKSA 5A7OA 3T3YA 1B35A 2CV6A 5DXDA 2J1VA 3ST7A 3V42A 2EXIA 3W2WA 2Y48A 1QA6A 1QH7A 3MICA 2V4AA 1YITI 5DAWA 3BALA 5JZGC 2O03A 5F3IA 2VMDA 5DYMA 1IS6A 2C6YA 4AU7A 5E3MA 5LGUA 3CJRB 1X4OA 3OY9A 2YC4A 3FXJA 3TOJA 3ON7A 5J09A 4M72A 1YJWI 2QQVA 4DY5A 4EN8B 3ZGKA 1IO2A 1WJFA 3ABMH 2MEV3 2WT0A 1IV8A 1WI3A 4RGXA 2W08A 4CEWC 3NW4A 4KN4X 4OIRF 3PL8A 4M3FA 2A5ZA 3OPTA 2Q0AA 1TNTA 1F31A 3H3LA 5ACA2 4BKXA 2FBIA 1LE8B 3BPVA 3GLXA 4JGZA 2Z5WA 1F5JA 1JUSA 4XR6A 4CCOA 1YNAA 1P7JA 2L02A 5FLXK 3BTZA 2RM21 2F6CA 4RGGA 1XDSA 3PHMA 1TZLA 1MS1A 3J80Z 4HSTA 4HLYA 3DTIA 1AXZA 3J9SA 3TBIA 2FQPA 4QSHA 1XCBA 2ZKNA 1H8AC 3ZXJA 1BIAA 4V2GA 2EB7A 2YR2A 2HEVF 4IE0A 2Y8KA 2BBAA 4XRSA 1BI1A 3TOBA 4Q4X1 2RV9A 3ZR8X 2VE9A 3HPNA 4XJWA 2BGPA 1LHWA 3GNEA 1RB8G 3UNGC 2ZMLA 3WGGA 5DDJ2 5IVFA 2K5CA 2BV6A 4PBOA 4Q47A 4GAZA 3NAUA 3I58A 4LOCA 4Z6YA 3HQUA 2VB6A 3B00A 3R60A 1OUSA 3VKNA 1WH5A 2EIGA 2QM3A 1STMA 4ZYEA 2BGOA 3WCSA 4MXWB 1W3XA 2YV8A 4LOTA 2R7DA 4QPYA 4U7BA 5ABJA 2RS12 1FC3A 4QB1A 4OIOF 4EATA 1OR7C 2AR6A 4I99C 4COUA 3K70C 1H1AA 3QYFA 2WBMA 4AIKA 4QPGC 1AVBA 2ZJ2A 1GU3A 2EXKA 2DDBA 1AR82 2YGLA 3NV1A 1G8WA 1KQ8A 4OHZA 1LDKB 1WZ2A 4LK0F 2OQ7A 4FE4A 3GZEA 1DLLA 2P3IA 4IETA 3GHNA 1M4WA 4FOQA 5K0UB 5L19A 4CUCA 5JHUA 1W03A 3FHIB 4W6XA 1AWCA 2OVUA 3QP6A 3TP3A 2BOLA 3FKJA 1FYMA 2WFF1 4CYCA 4JRLA 5A6QA 3B5LB 4Q5SF 4QPWA 1V6OA 2GMEA 1X4PA 4AYUA 3HKZN 3GF2A 1CESA 1V6IA 5K7FA 1SG3A 2QQUA 2ZMEB 5FLJA 4CDQC 4MEXF 5J96B 4H3WA 1LAJA 2M0MA 2AO9A 2A3YA 2IVIB 5KNLA 1IUYA 2JKBA 4YW2A 4RGUA 4Q0PA 2CQQA 2DO7A 4Q1PA 2WWJA 2BVLA 2VE8A 2RR11 1TLHB 1DGRM 2B4KA 4ESBA 1ZZCA 3WP3A 2GP3A 3K6GA 1SBEA 3K4DA 1ND3A 4XSXF 5FZEA 4TXWA 2JPBA 3ASOH 1F5TA 5M3MJ 3O8GA 5E6HA 1APLC 1LENA 4RS5A 3J80K 1D0HA 4MHGA 1KYZA 2CSOA 3ES1A 1DU0A 3KVAA 3BG3A 2MLGA 4A93J 3OJBA 4CRQA 1DU3D 3VLBB 2BERA 1ORKA 3SMHA 2FEZA 1QJX2 3I54A 4PDWB 4LHKA 2IT0A 5T54A 4AL9A 1Z05A 2LS6A 2F4MB 1BCXA 1UO9A 4YGCA 2M30A 2JUGA 1YJKA 1HOMA 4UUSA 2HVQA 2L9NA 2EFWA 3WF4A 2ELKA 4BQ3A 3ME2A 1OLMA 3GFIA 4M0HA 2IXJA 4O7XA 2D45A 1OCPA 5FLVA 2DQLA 1GDTA 3AXEA 4GKYA 3CHXA 3S3MA 3ZP5A 3HMYA 3AG2H 2IUWA 2P5BA 2D6KA 1JKPC 4JTOA 1IDYA 2IAIA 4OAZA 1JKQC 2E7TA 2JG9B 4LLFA 5FDBA 5DZEA 4IE4A 2QKMB 1UOGA 2VZRA 3B02A 4GWIA 3CESA 4WZCA 1GZWA 3THDA 2E63A 4BY7J 1HRI1 3F72A 4F3QA 1RKWA 3A02A 5FYYA 5JMOA 1Z78A 3BG7A 1LPQA 4RHV3 3OYWB 4UFLA 2QFEA 4E7LA 1QPIA 2V4JC 3QODA 1LOCA 3MIDA 5LBEA 3WUDA 2QKLB 4ZYHA 3GTPJ 4P5YA 3OY8A 5FO9B 3I4PA 4ETSA 4CEWA 2P5VA 4D69A 5AC93 3ZLIA 1Y1WJ 2LY9A 1W5TA 5F8PA 5ICGA 4L18B 3F8MA 4BQ2A 2MBFA 3DKXA 3K4LA 5EGOA 4EJTA 1XC6A 1Z7S1 2PHXA 4KN7X 2R1DA 3DEUA 2HEWF 3AMPA 3J7NA 5A33A 1OCOH 4FQ4A 1IRXA 3BVCA 3A0HC 1QRYA 5C70A 5FO8B 2HWC2 1IV6A 3HUGA 2HYJA 4IEWA 1I5PA 3LOBA