1O3QA

Protein-dna recognition and dna deformation revealed in crystal structures of cap-dna complexes
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*AP*AP*AP*AP*AP*TP*GP*TP*GP*AP*T)-3'
publication title Indirect Readout of DNA Sequence at the Primary-kink Site in the CAP-DNA Complex: DNA Binding Specificity Based on Energetics of DNA Kinking
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
total genus 62
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2003-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1o3qA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1o3qA01
4OFGA 4AIHA 1XCVA 2KIMA 2PJPA 4I3PA 3MWMA 1FXZA 2IA0A 1HKQA 3R0JA 2FBIA 2FF4A 4L18B 4YFNF 1NE4A 2QDRA 3RIRA 4LUMA 3HRTA 2MC3A 2IA2A 1REPC 3KEQA 1G3WA 2ELHA 3ZMTA 3KZYA 2BGCA 4D0PA 3EQLF 4Q4ZF 3LAPA 2Z5UA 5DCMB 3M8FA 4ZU4A 2VE8A 2H09A 1SEFA 1YFXA 5EEHA 4Q0SA 1NE6A 1QBJA 2Z69A 1Y9QA 4I0AA 2PEXA 2Q4SA 3MZYA 4L0ZB 1XD7A 1YFUA 1S7AA 4EM1A 4IRHA 1J2XA 3WTUC 3MPBA 1I6XA 3U10A 3WE3A 1T38A 4KIBA 3Q9SA 4YG2F 5JAXA 3FX3A 4META 3VFZA 1TQMA 1V3FA 3F8FA 4LD5A 1ZZ8A 3WW1A 2YX7A 3H8UA 5FLXZ 3USSA 4U0VA 1I5ZA 1YHFA 3GYDA 3C1DA 3BZ6A 3T5XA 2JTVA 4UBGA 3U11A 5D5WB 4M9XA 4O6JA 4HX7A 3MQ0A 3FZ3A 4IEWA 2VODA 2JRTA 5E1RA 1ZH5A 5LEJA 2HQRA 4HVOA 4ESJA 2K9ZA 2MNGA 4AVAA 4L9TA 3SHFA 5LGTA 1RZ4A 5E8GA 3KLNA 2O0YA 3OTFA 3QU3A 3BWGA 4IHTA 3NQOA 4EGYA 1I1SA 1O7LA 4LLNA 1IRGA 1XRUA 2JPBA 3KMHA 3LWFA 1AWCA 1ZN2A 4KIGA 4OINF 2DK8A 3NKTA 3L7WA 2MBFA 2CFXA 1UIKA 3QPTA 4KICA 2PMHA 5ICFA 3V8LA 1WI9A 5AIQA 5ERIA 1YO5C 3QPHA 1QZZA 1OYWA 2QZ8A 2W25A 4GGGA 4E2GA 4UV8A 4OMYA 2CAVA 3TO6A 5HI0A 4IJAA 3SHRA 3F8CA 3MYXA 3JSPA 4J1WA 5I91A 3H9AA 4EWAA 2A6EF 3R6SA 3FJSA 1YQAA 2RGVA 2D1HA 5IT9Z 4I7HA 1FOKA 4Q29A 3PVBB 4GYIA 2XIGA 4LEJA 2RV8A 5FLIA 5HLHA 1TNTA 3CO6C 5FB2A 2HDCA 4NB5A 3ZQ7A 1Q1HA 6PAXA 1YUDA 3OF1A 2STWA 1O3TA 3OOPA 3WTSC 2PQQA 3Q9VA 4KDPA 1YG2A 1IN6A 4LA2A 2Q0OA 2QBYA 5HVQC 1ZLJA 4KMFA 4E2QA 4H0EA 3CUOA 2ZKLA 1GQGA 3E6MA 2NNYA 4I09A 2F5DA 1CAWA 5CJ9A 1W5SA 5H20A 2P7CB 2BYVE 4XF9A 1CAVB 1D8JA 2C0ZA 4WWCA 4MEYF 4BHCA 2EV5A 4UVAA 2XL7A 3F8NA 4L2NA 2ZMEB 4PJYA 2UY8A 1FSEA 4EM0B 3PFIA 1J9IA 4MGKE 3V7CA 3J80Z 2CAUA 3SZPA 1S29A 2O8XA 3T8RA 1LQ1A 4ENKA 1DPUA 4MGRA 2G9WA 3EDPA 4MNUA 4WK8F 3UKNA 1ZYRF 4TLFA 2XKOA 2E1CA 1IN8A 2IXHA 3E5QA 5BPXA 3SCGA 1S8NA 4HAMA 3REOA 4UXAA 4IVNA 3COAC 5I8SA 4WXCA 4HMZA 3IDCB 5DEQA 4Q48A 4CZZA 1J58A 2PA7A 1TW2A 2GA1A 2EWNA 4E70A 5LHHA 3EYYA 2L54A 5KVRA 4YRDA 5HDNA 3ECOA 3CUQA 4ESBA 2FQPA 1R1VA 3KEOA 4BHPA 1XGMA 2P7VB 3DF8A 2OAZA 2Q1ZB 3S2WA 3ZPLA 2K4JA 4IEZA 2DTRA 2CV6A 5D8LB 1NZCA 4HVRA 5I0RA 2LF8A 1RUNA 1DP7P 5DUKA 3KSCA 1ZGJA 3WTTC 1YS7A 5L3CA 3B02A 1R58A 4QM9A 1PDNC 4UNOA 1R36A 1H9TA 5AONA 4PIYA 5L3GA 3GFMA 3MAJA 1EH8A 4PCQA 1TQPA 4OU0A 1U2WA 3HHGA 3ACLA 1LDJA 1LDDA 4OIPF 1OKRA 3LSTA 4TV7A 1BC7C 2M87A 4R79A 2IT0A 2A5YB 3O2PE 4A12A 1ZAOA 1T6SA 1BC8C 4RAZA 2YR2A 3M7GA 1UHWA 4GCVA 2ISZA 3F22A 2EAAA 1MDMB 4CYDA 3BB6A 3G73A 2KIFA 1FYKA 3IRRA 2RDPA 4MTDA 2Z33A 2VPVA 5J8FA 1YFWA 2HOEA 3HIFA 5FGMA 1TLHB 1GXQA 3DPLC 2RNJA 1O3SA 4JTOA 2QVSB 2HGCA 3FWEA 3QP6A 5CVJA 2E1NA 5E8IA 3U2RA 1BIBA 3P9IA 3DKWA 4ASNA 1ON2A 1L0OC 5LRRA 1WSUA 3FXRA 2ZNYA 2V6CA 4LLOA 3GYHX 2BNNA 4HVQA 2ETEA 4HSJA 1SMYF 4RGRA 3C18A 2LDUA 4D7SA 3TNPB 2VXZA 2QLZA 3ZMVA 1QO0D 2MA3A 1ZZBA 3UKVA 4G6DA 1FWZA 1B9NA 5CVRA 1KU3A 4U0WA 1NXMA 3QP5A 1O4TA 3QOPA 1IXSB 5F6FA 5TRDA 5KHHA 3RKXA 4AVCA 2IA1A 5LHGA 4MEXF 2XAFA 5FD6A 1QQIA 2FNPA 3U0ZA 3BPVA 4LG0B 1MZBA 4IEUA 3H7YA 3IDBB 5DCMA 4YIFA 3PLQA 5KHJA 3K2ZA 1XE7A 1WGPA 3EBRA 1D8KA 2K0GA 5BPDA 2BV6A 1E17A 3RJPA 1Z6TA 3PQJA 2HKOA 5CVIA 1U3EM 1OFNA 2OQGA 1DGWA 4QGMA 2UXNA 2IXJA 2VT2A 2ETHA 3J7AO 3I54A 1GXPA 1WQ2A 3F72A 4IF4A 1HSJA 1CF7A 4AIJA 1B1BA 3KE2A 1RGSA 3KP4A 2ZCWA 4A6EA 4UVBA 4KNYA 1HQCA 3O3KA 1KA8A 2VOPA 1V70A 3RKWA 1Y0UA 4XFGA 4M6XA 4RAYA 2GIVA 5CU1A 2A68F 3PNAA 1BI3A 1ZARA 1IN4A 1Z7UA 2DW4A 4P96A 2WTEA 3ABTA 3BPZA 4JQFA 4KWKA 1P4AA 4HLYA 2VT3A 1ZRCA 4ZZLA 4R8HA 3CF6E 5DD4A 1GQHA 2ISYA 4HA8A 1BI1A 3GLXA 4K8FA 1JHHA 1XMKA 3S7IA 2HS5A 1UB9A 2HFHA 2O1QA 3WU1B 2EFPA 1WRJA 4M72A 3C3VA 5KHIA 3WTWC 3HT1A 4ZH4F 1X8MA 2OYZA 5KHGA 4BYYA 2YPRA 2OQRA 1YW8A 4MGYE 4CGZA 4UV9A 2Z9OA 2VN2A 2C6YA 4RGXA 4D7TA 3LA3A 3VB2A 4NHJA 2ZNZA 4EWEA 4HN1A 5D5VB 4AXOA 2CQKA 2KRFA 5ED4A 4WVZA 2OA4A 4XFAA 2FXAA 2BEOA 4I01A 4ONUA 2F5CA 4G94A 2KJCA 2A07F 1I1GA 3C7JA 5HS9A 3GW2A 1EP0A 3B73A 1RI7A 1SFXA 2OZ6A 4PDKA 3D82A 5CADA 3W6KB 2V09A 4BIFA 5EEGA 3RTRA 4YYOA 3GVAA 4AQ6A 3I59B 3FMRA 3IC7A 5DYMA 4G7ZF 1YTYA 1ZLKA 3GZ5A 4QX5A 3H1YA 2IVMA 4LLLA 1J3PA 2UYBA 2HYGD 5I0TA 1LNWA 2XAGA 1FX7A 1PMIA 3FF5A 3NSTA 1ZRDA 2HYFA 5E16A 4UVCA 5HS8A 5KHKA 2HTJA 5LLQA 3H92A 4Q0QA 5JSPA 3EJKA 4LLGF 2JZYA 1IW7F 3DV8A 1WA4A 4ORFA 2O3FA 2M5WA 3I58A 3I7DA 1P4WA 5BS6A 4BAYA 4FX4A 3N4MA 2HWVA 3P7NA 4HF1A 1CAXA 3BJAA 4IEQA 5F1RA 1XGOA 2LNBA 5FQ0B 3KGLA 2E9QA 2PAKA 1FI2A 3KGZA 3SZTA 1CAVA 5FLHA 5ILVA 3W6JB 4WXDA 2D5HA 5DDGA 2FA5A 2XKPA 4HX4A 4IHSA 4KU8A 2ZMEA 2M30A 4KA4A 3RPQA 2UY9A 3SXWA 5CYVA 2HTSA 2P6TA 4PGGA 1G4DA 4IEPA 4MV2A 5I93A 2WV0A 2OA2A 1ON1A 3WGIA 3RZZA 1XDSA 3DQVC 3H50A 3AAFA 4FT8A 3BPXA 3TDUC 4EJTA 3BDDA 3LAJA 4MZUA 4P9GA 2L4MA 3D0SA 1BIAA 4I02A 1T2KA 5JSRA 4CHUA 4XF4A 3R4KA 3ZMZA 2D40A 2Z99A 2QENA 4RB3C 4QMAA 2X4HA 4KN7X 1ULYA 1R23A 1J1LA 2VOOA 1IRFA 2HEOA 4HBLA 2WFPA 1QXRA 2L4AA 2DI3A 1SD5A 2XUBA 2GC3A 2EFNA 2MPFA 2OD5A 2DPDA 1HBXG 3TDZC 1W7PD 5FO5A 4JTNA 5A2QZ 3BALA 4UBHA 4QGNA 1D5VA 1R00A 3ABUA 3IBMA 2EV6A 5FPZA 2PG4A 5JHUA 1KGSA 2DLLA 4MQ9F 4OIRF 1Q3EA 2KIUA 3T1BA 3H1MA 1DZTA 4N0BA 1KU7A 5K5OA 3L00A 5JCTA 2PFBA 5DUIA 2DFIA 3S7EA 4CDGA 3ES1A 4IEOA 4BH9A 5E17F 2PAMA 4O9EA 5H6QA 4XFCA 4AWXB 2EFQA 1SAXA 2H94A 1S6LA 3I0TA 3I71A 1YLFA 5JFRA 4ENJA 2FOKA 3R0AA 1S3JA 3JAMK 3FHZA 4KU7A 3IWZA 5L3DA 3FMQA 1MDMA 1ZG3A 5D6FA 1EYBA 1MJAA 1K79A 2OBPA 1HW2A 1J0RA 3K0LA 1QNTA 3WU0A 1BI2A 2L3DA 2MH2A 1KU9A 3HHHA 3WG9A 1KQ9A 2XL9A 3V8JA 1P2FA 2Z3YA 4LJZF 1DPRA 1PP8F 2RC4A 2P5LC 1B59A 2VBXA 3WGGA 4Z82A 4U7BA 4L9NA 2RVCA 4O5VA 4Q47A 5CLSA 1P92A 5D5UB 4AIKA 2V1XA 3MZHA 3HQXA 1F1ZA 3SQNA 5KBFA 4HZFA 4XF3A 1KU2A 3R61A 3J81K 3QRFF 3KP2A 2GQQA 5FDBA 5E20A 1X3UA 3M3IA 1J3QA 5ILSA 4Q5SF 1T39A 5D5XB 3MEXA 2VE9A 3QACA 4P9UA 2VBYA 1F9NA 4HLTA 1IXCA 4R1HA 3FHIB 4NQWA 4A0YA 3RNSA 1QZYA 5FD5A 1FYMA 2B5HA 3TQNA 3FE5A 4N9IA 4LG0A 4HSLA 1W5TA 5JR3A 4KMUX 3I64A 3TKYA 4EGZA 2KJBA 4PZJA 3KETA 5I8YA 3BJ6A 5D8KB 2W57A 1ZVFA 3EO6A 1Z1DA 5BY5A 4G8XA 2NYXA 4EROA 2A6HF 4Z2YA 3BROA 4Y15A 5BOXA 4HOBA 3EETA 5LGUA 2ZXJA 1YFHA 2GXGA 2FQ3A 1PUEE 1UW8A 2J5OA 3PQKA 2DBBA 3NVCA 2UWMA 4FBFA 3T0YA 4DQ2A 5E1XA 3R60A 3I53A 2JSCA 4OIOF 4LA3A 4FAGA 2FBKA 5F64A 4EJWA 2PTMA 2TDXA 1EV7A 3L2CA 4ETSA 3KCCA 3O14A 1KYZA 3HTSB 2UZKA 3WTVC 3LWCA 3CO7C 1G3SA 2FNAA 2K7LA 2OPKA 3D0JA 2YU3A 2XAQA 1RL3A 2VQAA 2CG4A 2QVOA 4RS8A 4B09A 5FCCA 2XAJA 3ES4A 3VHRA 2N7GA 4XFHA 5C6CA 3M9AA 5K5RA 2ACJA 2XLFA 4ZU5A 3GWZA 4M73A 2IXIA 2IW5A 5K1YA 2XROA 1YS6A 2X0LA 1FP1D 4PGHA 1Z6RA 4XLPF 4NVPA 3HRSA 1BOAA 1ZRRA 2F5FA 3LFKA 1BBYA 1U12A 2HZTA 3SCFA 1IXRC 2CO5A 1YYVA 1LRHA 3K1PA 4S04A 2K02A 3WE2A 2QBYB 5L3EA 1QWRA 2VECA 3E6CC 5DD8A 2QCSB 1T98A 1D3YA 1RNLA 1IPJA 1CAWB 1CX4A 1TTYA 2VC1A 3L09A 5K5QA 3OCPA 2Y0MA 3RKYA 4ZU7A 3RDIA 1USTA 3H3ZA 4L9VA 3E5XA 1CAUB 1HW5A 4P55A 3GXOA 4S05A 4OLLA 4CO8A 1AOYA 1B9MA 3NRVA 4EJUA 2DQLA 3JSOA 3CUQC 1O5UA 3ULQB 5TJJA 1ZZ9A 2OU2A 3L9FA 2FMLA 2B9UA 1KQ0A 1Z05A 4MQVA 1K78B 4GYGA 1NHAA 4O9GA 5FLXK 4QGLA 3BJOA 4UUVA 4IESA 3MCZA 2QM3A 1G3YA 2IPQX 2Q0AA 3I5UA 2H27A 4P5OA 3F23A 4M74A 2F4PA 3BU7A 3CUQB 3LA7A 4XBFA 3J81Z 4QXKA 1OD5A 1YW9A 2JT1A 2D45A 3HT2A 2V9VA 2GAUA 2LSOA 2D1VA 2HQNA 5FFZA 2EFWA 1XCBA 2Z2SB 2PHDA 2A3SA 2PMUA 4LB5A 1QXJA 2QYOA 1UFMA 4R52A 2ADUA 1J75A 1H1MA 5FQ0A 2ATFA 5ICEA 5HOOA 1DGRA 2R3SA 2F2EA 1SD7A 3LA2A 3GUDA 2NRAC 4Q0PA 2QNKA 2G7UA 2EB7A 1NYWA 5LEKA 5ICCA 5AIPA 5JR7B 3HUGA 2FRHA 1FBQA 3NEUA 2QUFA 1WLTA 1FT9A 4AVPA 2AXLA 1S7OA 5BUVA 1G3TA 4K2EA 4U88A 3JTHA 4X6RB 5FFXA 4PIXA 1F5TA 4Y13A 1X7NA 2QQAA 2OZUA 1UD1A 1ZZCA 1ZZ7A 1QGPA 2B0LA 1Q43A 2Y75A 2GC2A 5C8WA 1Q5OA 1VP6A 2EJRA 3WW4A 1U5TC 3DEUA 4ZYHA 2D2WA 1ZX5A 2JPCA 1R22A 3E6DA 3WGHA 4IEYA 4YSFA 1IPKA 1LVAA 2IXCA 3KLOA 4G7OF 1IUYA 3UKTA 5D1IA 2M45A 3JW4A 4UXNA 3RYPA 4QLCU 2PFWA 5J48A 3P9KA 1O57A 3K69A 5J7MA 3V7RA 2DU9A 1OR7A 5L3BA 3VOEA 4Z07A 1O5LA 1XDUA 2DT5A 5D4RA 1LB2A 1L3LA 4XF1A 5T3NA 2FBHA 4WX9A 3CDHA 2DPUA 3BY6A 1U78A 1IAWA 1U5TB 3SMHA 3F8BA 4XSZF 1Z91A 3DL3A 1A04A 4KWJA 3IHUA 2PBIA 4G6QA 1H9GA 3FXUA 2XASA 5HDKA 5LBQA 4O3MA 4LB6B 3MDPA 2RKHA 1FY7A 1J5YA 4F8AA 1LEBA 1XGNA 5BV6A 4YFXF 1B4AA 5D6EA 4WZCA 2XAHA 1PP7U 3OD0A 2DQRA 3G3ZA 3WW3A 2IC1A 2OZJA 4IETA 2V79A 2XV4S 2ZKZA 3LQQA 4MTEA 4Q0VA 4WBBA 4BNCA 2CWEA 2BNMA 3D5LA 4IRGA 1GHCA 2IXKA 2XRNA 1FLIA 5JSOA 4A0XA 4JV4A 1YIOA 1PM7A 3J80K 5LHIA 1XSXA 4JK1X 3E5UA 1MJ9A 2K86A 1R7JA 2P5VA 4KYWA 5J8CA 5I8TA 2AS5F 1XSDA 1P6RA 3F3XA 4KUMA 3SFZA 1FYLA 3KZZA 1LDKB 4FHTA 1HKSA 4J1XA 2HKXA 3HTUA 2O03A 1SD4A 1HW1A 5FPXA 1UPIA 2EA4A 1HXDA 5E18F 4I2OA 4OOIA 3ST7A 3TO7A 4UHTA 4N9HA 2XLAA 1FBSA 2D5FA 3ISPA 1Z9CA 1U6GA 2W85A 3TOBA 3RYRA 1CF7B 1J59A 3KP5A 2F5EA 2D93A 1B6AA 4IPAA 2COMA 3EHKA 4E2SA 4AVBA 5CVVA 5HLGA 2FMYA 1YWKA 1JHFA 2W84A 1BM9A 2GA2A 2MD5A 3GO5A 2A69F 3GX4X 3SCHA 3LOIA 2WC2A 5I0SA 4HF2A 2XHKA 2GC1A 2RQPA 1ZRFA 2V1DA 1SFUA 1DUXC 5J6XA 3TNQA 4RB1A 2PHLA 3U1DA 2IJLA 2STTA 4EJVA 1USSA 3TOAA 2I45A 1O3QA 4X6QB 2GXBA 2ZJ2A 4MH0E 1XSVA 2GH2A 2VC0A 4KN4X 4YNIA 3V4GA 2VBZA 5K8SA 3HOTA 2A61A 1OI6A 4LFUA 1O3RA 4XFFA 2DK5A 3HRUA 3MFKA 4KWLA 1U8RA 4MX3A 4ZYEA 3KP3A 4RB0A 3DN7A 1HSTA 2LF7A 5FLJA 1E2XA 3DFGA 3KFWX 5LGNA 3WODF 3HRMA 1STZA 2EV0A 4PIZA 3GF2A 2Q30A 4A5MA 2L01A 2XVCA 3ECHA 1K7AA 4ZYDA 2B8MA 2O8QA 1R1UA 3DXJF 2GC0A 5I0UA 3OV8A 3JTGA 1KYWA 4IRIA 1RIOH 1W7PB 1K6OA 2EFOA 5E1WA 1XMAA 4H7LA 3E97A 3F21A 2NNNA 2O6GE 4XF0A 2QQ9A 3QU6A 4IEVA 2GWRA 1I27A 5BMZA 4RD7A 2MHFA 3RI4A 1ZNPA 3GFJA 2P8TA 3K1MA 1YLLA 3CO2A 2YSRA 4KL1A 4EVIA 4ENNA 5JI6A 1FSHA 3FM5A 1VR3A 4DINB 4EJOA 2WWYA 1XN7A 1DZRA 2CSOA 4HF0A 5ILUA 2CGPA 4YARA 3LZZA 4G7HF 3LAGA 3NJZA 4GO1A 3RPUA 2ZO4A 4OMZA 3ELNA 2VONA 3IWFA 4FAHA 2G7HA 2IRFG 1UHMA 3H7JA 4EM2A 1CAXB 4EWDA 1GVJA 2ESHA 1W4MA 3LQRA 4AD9A 2QWWA 5KK1A 4BXUA 3BOQA 4M71A 1SD6A 3ZN0A 1OYIA 1EH7A 3IL2A 2PYTA 1CAUA 2BE5F 1MKMA 3IKVA 3K9TA 1TNSA 1SQ4A 4RB2C 4M6YA 2MLKA 2K27A 3WTZA 3WTYC 2E7XA 2PLYA 5HS7A 3GBFA 3E3VA 4LMYA 1ZHFA 3ZDSA 4HN0A 2L02A 5HLIA 1K78A 5J3UA 1SMTA 2MH9A 1LEAA 1J7KA 1LR5A 4QWQA 3CEWA 4F7ZA 2VBWA 1FNNA 2P17A 4ENMA 2UXXA 4LK1F 3G7DA 3ZN1A 1ZZ6A 5BQTA 2M8EA 2DCTA 2GZWA 2J5PA 3KP6A 1R5GA 1MGTA 4XETA 1IZ1A 2BBYA 4ESFA 4KIFA 2W24A 4Q0UA 4KFCA 4I0BA 4EV0A 1FPQA 3GZ6A 1R1TA 1SFEA 2KKOA 4LGWA 2P5KA 2O61A 4XLNF 3ROUA 3TO9A 1F4KA 3JZVA 3FMSA 2EVXA 1UCXA 4I98B 3CJNA 2ZBKA 5D4SA 5E1ZB 3WTXC 4WXHA 2PAEA 4L11A 1LKNA 3FM3A 1IF1A 2H6BA 3IIAA 2XLGA 1J3RA 3CTAA 3VEPA 2YX4A 4HQEA 4U7DA 3ZP5A 4XFBA 4MGIE 1FBUA 1ZG5A 1YFYA 1HKTA 2EA2A 3F6OA 3I4PA 5L3FA 1SFNA 4G9YA 3ML6A 4CXFA 2BNOA 2IP2A 5EZWA 2R7DA 3VODA 3NW4A 2LKPA 5DCFA 3WW2A 1QY4A 2E7WA 4MGZE 3DPTA 1ZREA 4EMSA 3TGNA 2P4WA 1QPMA 1O7FA 1R5HA 1UCRA 1CGPA 4HYEA 3FZVA 1MD0A 4XEZA 1U5TA 4BHBA 4QM8A 1JUHA 1XGSA 1RUOA 3Q5FA 5AVPA 4Y17A 3F6VA 1FZPB 4OIQF 5JVTA 3BP8A 3HOSA 1WKMA 4YIIA 2M1BA 1EY2A 3JAMZ 4LULA 5EFUA 3ETQA 3F8MA 1C0WA 4L5JA 5LRSA 1EH6A 1H0MA 3I59A 5ICGA 3S0MA 3O6BB 3IRQA 1TQ5A 2Y48A 4L0YB 3HSFA 2H6CA 2HJIA 1WWXA 2DO7A 1DDNA 2NAZA 3HSRA 2H0VA 4BQAA 5IT3A 3SXYA 2XGXA 5DV5A 4FX0A 3BCWA 4HDVA 2MLGA 3H3UA 4A2UA 1VTNC 4M9ZA 3EQEA 1MJBA 2V1UA 4HLXA 2P6SA 2QJVA 3ERED 1BJAA 4AQ2A 4IXAA 3EYIA 1V4RA 3E6BA 1G6NA 3KP7A 4JBAA 5H6RA 4ZYGA 1FP2A 4L9JA 1RTVA 4LK0F 4MHGA 3IKTA 3M8EA 3CL1A 2EK5A 4B29A 1OMIA 1OPCA 4XFIA 4HDUA 2ET1A 3M1EA 3ZMDA 4ZZDA 1JGSA 4JVAA 3HYIA 1H1IA 4B8XA 3P9CA 5BPIA 1L3JA 1TW3A 2DAOA 3DP7A 4HV5A 4HX8A 2HR3A 4HBNA 2FSWA 1FC3A 4EQQA 2CYYA 1LJ9A 2NS0A 2FE3A 1ZGAA 3ZMUA 4LTAA 4WCGA 1UIJA 2Q8KA 4KT5C 1OYYA 1IN5A 3V7SA 3OGJA 4LUKA 5A2QK 4CICA 3T8TA 3M70A 4RGUA 3C3WA 3FFQA 1T0FA 1ZG1A 1ONVA 4GULA 2K4BA 3L2HA 1Y3TA 2ZFWA 1KQ8A 2CW0F 1XB4A 4XRFA 1BN5A 3CJXA 2FU4A 4IERA 4HQMA 4HV6A 4A0ZA 3EUHA 3U9GA 1X8EA 4DNCA 1VJ2A 2RN7A 3V8KA 1RC6A 3N97A 5BXXA 4HW0A 2PI0A 5IT9K 2Q2EA 2ET7A 3GFLA 4XSXF 2UYAA 4YFKF 1X82A 2ESNA 2FEZA 2Y0OA 3QAHA 5CVUA 3GFIA 2EA7A 4L5IA 3ZMSA 4RGSA 1TQIA 2KXLA 4MUVA 4A5NA 4M9SA 5HDGA 1TBXA 1YW7A 3ELKA 3RYKA 1ODDA 4U0YA 3H1WA 2GU9A 4P9FA 4A6DA 2R7FA 3K1NA 1JE8A 1EPZA 4WF2A 1BI0A 2PQ8A 1XE8A 1P4XA 4IEXA 3HSEA 2PN6A 3FXQA 4ON0A 1IN7A 3CLOA 1JXSA 3NL1A 2IXLA 3CLPA 4GXOA 3GEZA 1W7PA 2QQBA
chains in the Genus database with same CATH superfamily
2A71A 3MWMA 3JRHA 5FKNA 3CMGA 4FTBA 3ZFFA 3UYJA 1RKTA 2PMZN 2XXZA 4Q4W3 1GOHA 1QQP1 1RMU2 2OPWA 1XX5A 3HRTA 4FP2A 3T2OA 1SBFA 1PZ8A 2DCYA 2ZHNA 1W2NA 2R041 3BTIA 4UUSA 3C7GA 4N53A 4D0PA 4LORA 5DCMB 1M4WA 5ABJA 1SEFA 4IDZA 3LGRA 1S0BA 3N3HA 5EEHA 1D1BA 1WBFA 4HKWA 2K9QA 1CQTA 1FV2A 1XD7A 1S7AA 4D3WA 2R49A 1CPNA 4XURA 2C9AA 1AJOA 2ZGPA 2BY0A 1UG2A 3I2JA 1JOPA 4DXZA 3NWSA 3WE3A 1WCUA 1T38A 4QKBA 5JAXA 3FX3A 4META 1V3FA 1E3PA 5DMYA 1GOFA 2YX7A 3USSA 2WQ8A 1QDCA 3U11A 5D5WB 4BUPA 2FHRA 4DNYA 4RS5C 4O6JA 3IMMA 1YQ8A 3POWA 1QRYA 5IFTA 4FOQA 3CHXA 2RS13 2JRTA 1ZA7A 2EXIA 1OISA 1ZH5A 1SLCA 3VYRB 2HYXA 3RSJA 4I99C 1OR7C 3MLLA 4V1PA 4Y1ZA 4ESJA 3JBG1 4NWVA 1QJY3 4M3CF 4AVAA 4L9TA 3SHFA 2F4MB 3I2OA 3LSHA 3IDAA 5A1LA 3NQOA 4EGYA 1I1SA 1I3AA 3WZ1A 3DPRA 3U4XA 1AWCA 3NKTA 4KIGA 4CCJA 2MBFA 1UIKA 3CC2I 2P2KA 4BIOA 1KDKA 3BIEA 4CDUB 3I3QA 1KS4A 5ERIA 4Y1VA 3L2RA 3WG3A 3W5NA 1QZZA 2JKXA 1OYWA 2ZJCA 1NUKA 4UV8A 4M3CE 2GM4A 3NAPB 5JI9A 3PURA 3AMMA 1UN1A 5I91A 4EWAA 2PLV1 1UOJA 4N4OB 3QD6A 2X29A 4K21A 1QPIA 1WJBA 3TN91 5C71A 3ZYRA 3JQXA 3K70C 1UZ0A 2XJUA 3VDCA 5IAVA 4BEHA 2XIGA 4XE9A 3BTZA 5GLUA 3S57A 3WF2A 1A5JA 1Q1HA 6PAXA 1YUDA 4D6RA 1TT5B 3OF1A 3VZMA 2BWAA 1O3TA 1JS9A 3K2AA 2HWC3 2ZS6B 1N78A 3HL2A 2PQQA 1LHNA 1YEWA 2V26A 4KITB 3W3CA 4CYCB 2QBYA 5HVQC 4AFAA 3VD3A 4E2QA 3CUOA 2ZTNA 1GQGA 1LNSA 5I0DA 3E6MA 1AX1A 4BLJA 2J7MA 2BOJA 1D8JA 1UOBA 2IFWA 2KL4A 1R1A1 1XS9A 1D5YA 4UVAA 1YITI 3I4IA 2ZMEB 1QGLA 4Q5OA 2UY8A 3THCA 3PFIA 1J9IA 4MGKE 4R4ZA 5BNOC 2XOMA 1LQ1A 3M1HA 3DTKA 2BTVC 1DPUA 2G9WA 1VBD2 2HEWF 4URTA 2W95A 2JG9B 5C8CB 1R4MB 1JKQC 3CDZB 4M4RA 3SCGA 4X8PA 4HAMA 1BW5A 4UXAA 3COAC 5FROA 4WXCA 2JX9A 2XPWA 1C8NA 1OVPA 4Q48A 4CZZA 1CN1A 2PA7A 1NY71 2EWNA 4E70A 3EYYA 2W4SA 3OYIA 2L54A 1ULOA 2ZX3A 3PDQA 1AL21 2FCTA 4DXSA 3WQ0A 3H5AA 4FTHA 3FK6A 3AKTA 3KEOA 1XGMA 2P7VB 3LSEA 2DODA 2JEMA 2ERFA 1R64A 4IEZA 1JI8A 2VULA 4UW4A 3LCPA 3RWNA 4HXCA 3OYFA 3DWLE 1Q8VA 3VUOA 2WNVB 3I4MJ 3B02A 4QM9A 3FIWA 2YPDA 2QQ8A 1R36A 4C2TA 1H9TA 5AONA 5ANNA 4PIYA 1JZ8A 2MEV2 4NN0A 1TQPA 3C7FA 4DUXA 4X0GA 2AXTC 4U87A 4JRLA 1LDDA 4OIPF 1JHJA 2IZWA 2M87A 2XGDA 3H3LA 1ZAOA 1T6SA 1D0HA 3VDBA 4ASMB 3AYDA 2FMDA 5FO8B 5CFDC 5M0TA 1OQYA 4CYDA 2VZ1A 2EH3A 1FYKA 1AR61 5J8FA 2WZ8A 2X05A 3WT3A 1TLHB 4MHUA 5ACA2 1MQTB 1HDKA 2RNJA 3QP6A 3ACIA 4NPMA 2EPFA 4E6KG 2WR9A 4DO0A 4HL0A 2JVHA 3W9AA 2WJSA 2R071 1WSUA 3FXRA 1NTCA 2V6CA 2WZR1 3JD72 4O65A 1HV0A 3J8F2 3GYHX 4HVQA 3HJRA 1SMYF 3C18A 3TNPB 1H0BA 1SZBA 5FY4A 1OBNA 5DAVA 5GZEA 4AZZA 2XJRA 2HBUA 2E51A 3QOPA 4LE3A 2V5YA 4AK3A 5KHHA 4AVCA 4NQWB 1A8MA 2XAFA 5FD6A 5EJ3A 5FKLA 1QQIA 4XLHA 1AKHA 3MN2A 4LG0B 3HOWJ 4AVVA 5A33B 1MZBA 2D6MA 5F2WA 2X9DA 1ZBA3 4IEUA 1PK6C 5A6QA 5FXWA 4J6GA 2EXKA 3JR9A 3EBRA 4Q4W1 4Q8LA 3ZMOA 3MEPA 3GZUC 1OF3A 4QD2A 1GZ9A 1E17A 1TZLA 2FBEA 1VQ9I 4D94A 5CVIA 1ULCA 2WINB 1TWGJ 3AB0A 1UMZA 2ETHA 1OOPC 2ZHLA 3BKZA 4FE4A 2EIMH 4CEYB 3S3OA 4IF4A 1H8AC 1O8PA 3AL5A 3OYAA 2KD7A 1X1DA 2ZCWA 1HQCA 2W1SA 2VOPA 2D98A 1T6GC 1V70A 4UFMA 2XF5A 4XFGA 5LWBA 4RAYA 2A68F 2GMEA 5FZIA 4D6QA 4WM7A 2DJNA 1IN4A 3RQ0A 3JB8A 1Z7UA 1XXNA 2DW4A 2WTEA 1LHOA 4RSUA 3BG7A 4LBMA 1HQLA 4AFDA 4CUBA 2QGUA 4R8HA 2ILMA 2KM2A 5JLXA 1ENSA 5FZAA 1ND2C 1A6QA 5JZGC 3URFA 2ZMNA 3VHPA 5FZ7A 1DZQA 4QPIC 5B1BH 3HT1A 3MI8A 4BQYA 3H9GA 4PQ9A 2COBA 2R7VA 2RS11 3NWTA 1WJ5A 4UV9A 1JODA 2QQLA 4RGXA 4D7TA 1G9BA 4ZJZA 4AEDC 3LL7A 2AC1A 3X2QH 5D5VB 4AXOA 4Q4Y3 3ASIA 2ZSIB 1QJY1 5F3IA 4GXLA 4BQ1A 2KRHA 2E19A 1AR93 2FXAA 2JICA 1WCSA 3J26N 4I01A 2F5CA 5A32A 3C7JA 1WFXA 3A01B 1K45A 3N7LA 1RI7A 3BR3A 4ES9A 3KZ4C 4PDKA 3VBFC 2V09A 4BIFA 5CADA 4Z1VA 3K51A 4FASD 4IE0A 1ZLKA 2LY9A 1JI6A 4KJZA 4E8CA 1NCQC 1SLIA 1UHSA 2CW8A 1BBT3 5C5TA 2OW4A 3V42A 1OCPA 5I0TA 1P9QC 1PMIA 2DDBA 3ABLH 2DFEA 2KRCA 2HYFA 1V5GA 1G8WA 2RR13 3BCBA 4V2FA 3H42B 3P5JA 4XTPA 2E1MB 4Q0QA 5JSPA 4RGKA 3I58A 5B4NA 5BS6A 1OURA 1VBA3 4QX2A 3N4MA 2HWVA 3P7NA 1YJKA 1GV5A 4OCTA 2HU9A 3SZGA 4RR3A 5FO7B 3SKJE 1ACCA 5D21A 2HWC1 1BW6A 3KYLA 1JUSA 1XG1A 4WV8A 5DDGA 3V0BA 5IVYA 1WA6X 5CKTA 1W8NA 2IWGB 2M30A 4KA4A 3RPQA 3AL0C 1NA1A 3SXWA 1POQA 4IZZA 3D5OA 5CYVA 4PLOA 3GNEA 2HTSA 1D4M3 2CUEA 5DM6F 1G4DA 1E5RA 4XPVA 5KXBA 5DAWA 3FXMA 1ON1A 4ZC3A 3S15J 1EJ9A 4WM8C 2VJIA 2AO9A 3AAFA 3BPXA 1YJWI 2VNVA 4EJTA 3BDDA 3LAJA 4MZUA 3I2HA 1AR82 3D0SA 3OYWB 5FP3A 4BKXA 1BIAA 1R4NB 3EPZA 1T2KA 4BE0A 2X1CA 1SPPB 1ULDA 3N9MA 4HEA2 1DG6A 5FYTA 3ZMZA 4XJUA 2Z99A 2PHTA 2QENA 3S1NJ 5ERLA 2HWF2 2D3PA 3OS1A 3AYCA 1W05A 2VOOA 1IRFA 2DVAA 3W2VA 4HBLA 2XUBA 1VQ4I 1UY2A 2BVBA 3LSRA 2OD5A 2YMZA 3LSDA 3CNAA 3ZLIA 1Y39A 3S17J 1VQNI 3H1CA 1UY3A 2CV1A 3PU3A 2XUEA 2W68A 3S2DJ 2JDYA 3IPVA 1D5VA 1R00A 3IBMA 2IGOA 3BR0A 4MQ9F 1NX9A 3CP2A 3T1BA 4BQ3A 1DZTA 1UMQA 3CCMI 1KU7A 3PNVA 4P5YA 2M4KA 2DFIA 4JQRA 2JG8C 3VBOA 4O9EA 3EUKL 1IS3A 5JWPA 2VNRA 2VI6A 3OY8B 4H7MA 1S6LA 4XQ4A 3WUCA 1YLFA 4OQ8A 3AP6A 4B3XA 1HDDC 4LBKA 3HDDA 4KU7A 5L3DA 1NLQA 1MDMA 1ZG3A 2GP5A 1EYBA 1MJAA 3OB8A 5FO9B 1UYXA 3RKQA 3V0AB 2RNGA 2L3DA 4D7NA 2WNUA 3TB0A 4AG4A 3IAS2 3CJIC 4LJZF 1ETYA 1DPRA 2P5LC 2IEKA 3WGGA 4ANJA 4Z82A 4Y3OA 1EAH3 3OYDA 1UOFA 4URAA 2H1LA 5D5UB 1ND3A 2V1XA 5JMCA 3HQXA 2LC2A 2WL1A 3N7JA 2Q8OA 3WCRA 5KBFA 3T4VA 3DKYA 3AVSA 2WADA 1MVEA 1TC3C 1MMAA 2WBKA 1KU2A 3R61A 3J81K 5GAHJ 2GP3A 5E20A 1X3UA 3ZQHA 4GA9A 5HCFA 2W1OA 3M3IA 2ZGQA 1GU3A 1J3QA 4ZS2A 5ILSA 1QQP2 4NIHA 4IGOA 1JKOC 2WWUA 4F93B 4PLMA 3CU7A 4LBQB 2VE9A 1BCXA 4XACA 5L73A 2R042 2OVUA 2HOTA 3DYPA 1F9NA 2EF6A 3BN6A 4HLTA 4XJ9A 1HIXA 4UT5A 1G8XA 2X6YA 5FD5A 1H4HA 1FYMA 3B6CA 1GV2A 3TQNA 3FE5A 1VAMA 5FZ4A 5FZ1A 4HSLA 3K4BA 5JR3A 3I64A 4HKLA 3RJ2X 5DZGA 1G9FA 2HNHA 5D8KB 1RUF3 2W3JA 3SDGA 1T6BX 2CDOA 5BY5A 2NYXA 1BKZA 4CCKA 2RAEA 1QOOA 5C3PA 4JGZA 3BROA 4QPGA 1IS6A 4HOBA 1RUJ3 4AFMA 3NV2A 4TWTA 2L5QA 1MBHA 2FQ3A 2E35A 1ZBA1 1JW6A 1LOBA 5F32A 2XBO3 3QCWA 5E1XA 1TT0A 1N25A 5F64A 4EJWA 5GZFA 4NPLA 1E3OC 1EV7A 4LO6B 1UF2C 4ETSA 3RMXA 4R4XA 4BBSJ 2VKHA 1KYZA 2UZKA 2PHRA 5IVJA 3OR1C 2ADEA 1VQLI 1G3SA 3HB9A 2WA3A 3MW4A 2M0MA 3CCLI 2XAQA 2XWBB 1RL3A 1HRV3 2CUFA 4QX1A 3ZPOA 3JBG2 4B09A 4CEWC 2L9SA 1GKBA 2XAJA 2BERA 1O4YA 4LK6A 2ACJA 2XLFA 4M73A 2NPIA 1JT6A 2IXIA 1JZ4A 4PSWA 4M3CA 3LF7A 2O9LA 1OLRA 2VZQA 3A0KA 4CCEA 2X0LA 4FPOB 1FP1D 3ZXSA 4MO7A 1QEXA 3HRSA 2F5FA 2XGEA 3T2PA 2R7TA 1U12A 2HZTA 4YVWB 1DDLA 1IS4A 4DY5A 3M8LA 3LSIA 5F6KA 5JOWA 3PO2J 2VECA 5DD8A 2QCSB 3Q8FA 2JD4A 4ZZ5A 2NLRA 1IPJA 1K12A 2PLV2 5LASA 1CX4A 1TTYA 1XSRA 2BBAA 3L09A 5K5QA 1RITA 3TN92 4ZU7A 3POSA 3RDIA 1IRXA 3ASNH 3FDYA 2CGOA 1HW5A 5C44J 4OI1A 5KCMA 4Q4Y1 1B9MA 3NRVA 4EJUA 3PVOA 4CDQA 2WY8Q 1AR91 2Y33A 1KQ0A 1Z05A 3DBRB 1D1AA 5L7OC 1APLC 1PNGA 3I2FA 4GWMA 3PUIA 4QPWA 4YRVA 2IPQX 3ZYIB 2VQUA 4AHYA 1MW7A 3C8XA 4GH4C 3WQBA 1BBT1 1S55A 5C4WB 2KISA 3GF6A 5DUVA 3HT2A 1GP6A 5FRNA 4TXWA 4HT1T 1S0EA 2HQNA 3ETPA 3LSMA 4YGDA 2D3SA 2RR11 4YELA 1ENRA 5ICEA 3ZXEA 4L8QA 3LA2A 2BRTA 4YZ1A 4QIWN 1UXXX 3OYMA 1FYUA 1GV9A 3VPRA 1NYWA 1XNCA 2YC0A 5ICCA 2X5IB 1AX2A 1VBA1 5FYMA 4R9AA 3RZHA 1FBQA 3NEUA 4II2A 3CF5F 3D6EA 3D8CA 2TEPA 4X6RB 5FFXA 1ZTRA 2VJ5A 4MGQA 1X3WB 3FL7A 1XYPA 1WBLA 1NY72 1S0FA 1ULEA 3HC7A 1AL22 1ZZCA 2BPA2 1QGPA 1O4XA 1VBC3 4II3A 1VP6A 3WW4A 4ZYHA 3ZKUA 5E79C 3MV11 5SV5A 1LOEA 1D4M1 1R22A 3E6DA 4YSFA 1MNDA 3KLOA 2EQRA 4OMCA 5D1IA 3QH7A 3JW4A 1B09A 5FY8A 3O8GA 1HN1A 1U5YA 2PFWA 2VZ3A 3P9KA 5DM7F 1V9U3 1MMDA 5GJ6A 3V7RA 3H9JA 1MPXA 1TG7A 1WH7A 4Z07A 3BVCA 4CDUA 1O5LA 5DUWA 4XF1A 5EYRA 2W39A 2FBHA 3CDHA 2DPUA 3BY6A 4XSZF 3DL3A 5DAPA 1RPWA 4Y1XA 3PHMA 1WJDA 4G6QA 1DYKA 2A75A 1H9GA 4XKVA 4A41A 4O3MA 4FFIA 5FMDA 5GLVA 1IDZA 1LEBA 3ZYHA 5BV6A 4YFXF 5D6EA 3K2OA 2DQRA 1SAUA 2BW3B 9ANTA 2DUOA 3PM1A 5EPAA 3OS2A 2V79A 5F8PA 1AR62 3Q0UA 4WBBA 3VKOA 4BNCA 4XUNA 2WLQA 1RETA 1S2KA 1AYM2 2DA4A 1CVNA 4P08A 1OH4A 2RMU3 2ZFUA 1QH6A 1FLIA 2HXOA 1RR7A 3J80K 4LPLA 1E57A 2V73A 1ERDA 5LHIA 3F9KA 2K86A 1R7JA 2P5VA 4KYWA 4JKMA 4CYCA 5DTDA 2R072 3F3XA 3SFZA 3DGTA 2CNAA 2JA5J 5A6ZA 5L9VA 1S0CA 1NOVA 2E5NA 3RWKX 1UPIA 2OXBA 4JHTA 2YG0A 2A6TA 4OOIA 4LMFA 3VBHA 1N1TA 3ISPA 2G9ZA 1JZ3A 2E2HJ 2GNMA 1LHWA 1J59A 3TEDA 3EHKA 1EAH1 4IGQA 2JG9A 1JHFA 5C8CA 5FAXA 4XDOA 2GA2A 3GO5A 3L2QA 3CCYA 5E3OA 3OOXA 5I0SA 2JDPA 1UJ8A 1NQJA 2V1DA 4MXWB 1XNDA 3GBGA 3OIOA 4DB5A 3MD2A 3TW7A 2DYRH 4Q4W2 1YOVB 1NLSA 3TOAA 4X6QB 2ZGSA 2GXBA 5M5YJ 1OCCH 1PVC3 4KN4X 4YNIA 2VBZA 5H9RA 2A61A 2CFOA 4XFFA 2ZXWH 5C3EJ 2IS2A 5GLWA 5FV3A 3NV4A 4MX3A 3TMOA 3HWJA 3DN7A 3S2HJ 4HK9A 5A3LA 2QQPA 2LF7A 2WNVA 2VZTA 4CSWA 3AXEA 3KFWX 1MMGA 5LGNA 1ASJ2 3IDEA 5CBLA 3HRMA 5CFCB 4PIZA 2QDNA 1P7JA 1RUF1 3ECHA 3OGVA 1DU3D 1QOTA 4N53C 1RIOH 1RUJ1 3ACGA 2R5ZB 2EFOA 2EINH 5E1WA 4H7LA 3W20A 5FYBA 4CDXB 4DYCA 3JRGA 2LVSA 4XF0A 2AEZA 2VKVA 3QU6A 5BNNC 4B4QA 3KWVA 2GWRA 2XBO1 3RI4A 4YVSC 3V56A 2G19A 1AYN3 1W36D 3ZCOA 4A3DJ 5CNAA 2RDNA 1IO2A 4YGCA 2M3AA 4XK4A 5JI6A 4Z92B 2RS12 1VR3A 2WSVA 3RZOJ 2R30A 2EAKA 2WWYA 1W03A 4HF0A 3ILNA 2Q8CA 4K40A 3LZZA 1HRV1 1JMUB 2ZZQA 3QYFA 2A5ZA 4OVEA 1SMVA 1JZ2A 3NJZA 1QJY2 3RPUA 4OMZA 1K5MB 2QKMB 3N9LA 2IRFG 1K4SA 4C3JJ 4FTEA 2PMZA 1GVJA 1UYYA 2ESHA 2A7AA 4AD9A 5K9YA 3M1CA 4AQSA 1SD6A 3WDYA 2XJVA 1K42A 3ZN0A 5F5QA 5T54A 1EH7A 4C1WA 2ZHKA 4A7KA 2VTXJ 3T0DA 3OSDA 4JGYB 3WP3A 4L5EA 1BMV2 4RM2A 2PLYA 4DQAA 5HS7A 1OQDA 2VG9A 1B35C 1D7PM 4BE2A 3WNXA 1FNZA 4HN0A 1C5HA 5HLIA 1K78A 2MH9A 4KH9A 3HMYA 1LR5A 4QWQA 3BR1A 4F7ZA 3D5RC 1DP3A 3ORJA 1FNNA 1SVOA 2BU9A 5CAZA 4DBQA 5FRAA 3KP6A 1MGTA 2AQEA 2L0KA 3BQYA 4ESFA 1W6QB 1BVP1 2HWC2 3Q9OA 1GT0C 5K0UA 4AVTA 4AFBA 4EV0A 3U1KA 2KKOA 2P5KA 4PJNA 3TO9A 3KEYA 2HI3A 2V6EA 5F08A 4PK4A 1JOJA 3ABZA 1YQCA 3JZVA 5DXDA 4RBOA 4I98B 3UR3C 1E3HA 1NKGA 4A7YA 3WTXC 2DJIA 3KCYA 2QZ2A 2E32A 1IF1A 4RM3A 2V4AA 1MVQA 3QOEA 3K4KA 4QKDA 5IYDJ 4NWWA 3P5BA 1X2NA 3I97A 3W21A 1V6NA 1ZYBA 2GNTA 3F6OA 4GKYA 3I4PA 1R083 2QE3A 3QBQA 2OIIA 4Q2FA 1PM4A 3I3LA 1COV3 2X8KA 1PVEA 2KLOA 5EZWA 2R7DA 2LKPA 4MYEA 2B4KA 2LG4A 1QY4A 5HNFA 4EMSA 4Y24A 3NNLA 1UYPA 1QU0A 1QPMA 1O7FA 1R5HA 1UCRA 1VBC1 3ZSKA 4HYEA 4P9XA 4WVWA 3GLLA 2QQNA 1U5TA 1RUOA 4NNJA 5J4VA 4HNVA 4INDA 5AVPA 3IH2A 2LBFB 3F6VA 5DG2A 4OYUA 3BP8A 1WKMA 5EFUA 4N7UA 5A3WA 3ETQA 3P3PA 3F8MA 1C0WA 4L5JA 1V9U1 2ZXIA 5H9QA 3IKWA 5LRSA 4CCNA 4XUTA 3AJZA 5ICGA 1VBE3 4IHWA 3HSFA 1FJLA 2KIQA 1KEXA 4W65A 3L1PA 2NAZA 3HSRA 2H0VA 4D6SA 3KYCB 1WW6A 4G6TB 3SXYA 5FPAA 5DV5A 5FMCA 3RZLA 2DMPA 4LO8A 4M9ZA 2ZX1A 3EQEA 2V1UA 5FXVA 2JQ7A 3GMEA 3SITA 1HXS2 2J1VA 2ME6A 2ZX2A 4AFCA 5A6YA 1LFPA 2NQYA 1W8HA 3E6BA 4FPFA 3VDDB 2HVSA 3S16J 2B45X 2RMU1 3WUDA 2EK5A 1BEV3 3VKLA 4NAMA 1OPCA 3C2HA 2A6YA 3ZMDA 1AL0G 4RAFA 3TEYA 4FISA 1PX3A 3D1NI 5BPIA 3O1PA 4HX8A 4HBNA 1QOSA 4KG0A 1LJ9A 2KZVA 4CCCA 4MGSA 2KMUA 4Q1PA 3PJRA 1UIJA 2M2EA 2OQ7A 5HNHA 3K3OA 1OYYA 4P9IA 4CP1A 2TNFA 4CICA 3AKRA 4QT6A 3OYWA 1SFKA 1WJEA 1ZG1A 2OT7A 2ZFWA 3FUQA 1FV3A 4CXXA 4IE4A 2FU4A 3H9QA 1F4AA 2XONA 2MYSA 4XLAA 4NBQA 1VJ2A 2RN7A 3V8KA 2WAEA 4IOAF 2Y0IA 3N97A 5IT9K 1WWYA 4M3EA 2EALA 2QSGX 5JXHA 4XSXF 2WO7A 2UYAA 4YFKF 1ZBA2 2DUQA 3ZYGA 2AR6A 2Y0OA 1PJRA 3NMBA 4RGSA 3POGA 2KXLA 5D8AA 4B7EA 4M9SA 5HDGA 3HBLA 4UFJA 5A6XA 1ODDA 4A6DA 4RQPC 3QODA 1RUG2 3GTQJ 4WF2A 4PQQA 4E4SA 4P14A 1PVC1 2VZVA 3ZFEA 4LOCA 3AKQA 1P4XA 4N43A 4KBBA 1IN7A 4W50A 3T0AA 3F8BA 5KC5A 1W7PA 4OFGA 4AIHA 4ATFA 2PJPA 4I3PA 4QPYA 5FKMA 5LA2A 3TP3A 3OY8A 4RLFA 2FF4A 4L18B 2YPJA 4YFNF 1NE4A 3O1VA 4LUMA 1J09A 1G3WA 2E33A 3ZMTA 1MS9A 1V0AA 2BGCA 2VQ0A 2UV1A 2V7FA 2Z5UA 1ONAA 2VE8A 3B3QE 5FPLA 1YIFA 2H09A 1R093 2RDSA 3IH3A 1SCSA 4Q0SA 2AH2A 3I55I 2NN8A 2VZSA 4A4AA 1AYN1 3KQ4B 2UWCA 2YS9A 2LTPA 2BOIA 1PYVA 3LPGA 4E7KA 3LD8A 2ZSHB 2Z5WA 4KIBA 4BQOA 3Q9SA 4YG2F 1YQ6A 3VFZA 3F8FA 4Q4Y2 1ZZ8A 3WW1A 2O7OA 3H8UA 1TZOA 4U0VA 4F92B 3B94A 5C3QA 3C1DA 3BPSA 4LBQA 4HG6B 2JTVA 2Y0SN 2ZEZA 4XILA 2VASA 3MQ0A 3K3NA 3BG5A 4IEWA 3FXKA 2BJSA 3BZKA 4UW3A 1US3A 5JXGA 3J9SA 1XNAA 5IOYA 1BBT2 4BOWA 3HPNA 2MNGA 4ASLA 5LGTA 4PDWA 5E8GA 4XUPA 4RS5B 5GZDA 3OTFA 1R49A 1CZSA 5J1YA 2E5ZA 1XRUA 2RR12 4M6VA 2JPBA 4LK7A 3LWFA 4OINF 2D97A 3HOBA 4CZSA 2CFXA 3QPTA 4KICA 2A6XA 4HNTA 1V5EA 3W2WA 2VMFA 3V8LA 4JKKA 5A7WB 3H3VK 1MEC2 3ZRGA 1XYNA 3CDLA 3OYNA 2FQ4A 1VBA2 2M8GX 2QZ8A 2W25A 4GGGA 1PUFA 3TO6A 2C1FA 5HI0A 3SHRA 3SKVA 5TISC 1W5CC 4AU7A 3H9AA 5KR7A 3S93A 3NQHA 4AAPA 3JRFA 1GWLA 3L9JT 1QHGA 3WINE 3FJSA 1YQAA 2RGVA 5FXXA 4I7HA 4Q29A 3PVBB 1W36C 1D4M2 3VV1A 2K9SA 4L99A 1LTEA 3CO6C 3N7KA 5FB2A 2HDCA 4NB5A 5T52A 2B42B 2STWA 5FZEA 3QYEA 3GCXA 3WTSC 4KDPA 2R063 1IN6A 3JRDA 3VKMA 3O0XA 3ABMH 4ZHNA 5FJ8J 4YIRX 4LA2A 3AP4A 4MG2A 1ZLJA 2DA5A 1UZYA 1BR2A 1R081 2VD7A 2KPMA 4Q27A 2MW8A 4I09A 2F5DA 5CJ9A 1GANA 3T1LA 2CWSA 2J42A 3LFIA 2LM3A 5GADJ 1COV1 1JYWA 4CTEA 1GSLA 1PIV3 4CDWC 2C0ZA 2C5DA 1H1AA 5FZBA 3RZMA 2CL2A 2EV5A 3F8NA 4Q4V2 2YDEA 4EM0B 5F5CA 4I3GA 3J80Z 1S29A 1WKYA 4JRAA 1Y9MA 4MGRA 1OVSA 3EDPA 4MNUA 2XQXA 2Q5TA 3ALQA 1FOD3 2QBXA 3AM2A 4TLFA 5FZCA 4Z2WA 5BPXA 1S8NA 2X51A 2AQFA 3REOA 2L9RA 1KXGA 4IVNA 1RUD2 4XKWA 2WAAA 1O4ZA 1VBE1 1TW2A 3JXSA 3RCOA 5BNOB 2WQ4A 5HDNA 4J00A 3ECOA 1UKRA 1O91A 2R93J 4BQ2A 1SC7A 5C4WA 3OSFA 4LT5A 2K4JA 2CV6A 1JTXA 3ZYFA 2BVVA 4RL7A 1RR8C 4BACA 5EQUA 3OPWA 1AZDA 2CJJA 5IPAA 1HJGA 3OPZA 1R58A 4H14A 1EAH2 1SANA 3FBIB 5IFPA 3BYWA 4AOCA 4LIVA 2EIGA 3GFMA 3MAJA 3KVAA 2XG3A 4PFOA 1BEV1 3LSTA 3ZYJB 2IT0A 1U5XA 4A12A 3HQRA 5EJ1B 2YR2A 3FXLA 4S2GA 3M7GA 1GOGA 4GCVA 2VLAA 3T2TA 3F22A 4KBZA 3RPUD 5F1JA 1YQ2A 2MGQA 3G73A 2K2SA 5GP9A 1C28A 1Z0HA 2Z33A 2VPVA 1GXQA 3DPLC 1S1AA 1WJCA 3KCXA 1O3SA 2GNDA 2RDQA 1HCRA 5CVJA 2E1NA 5E8IA 4ZTJA 4S0HB 5CFDB 4XZUG 3DKWA 2L7KA 1N1SA 4ASNA 1NQDA 3GZNB 1RUF2 1ON2A 4M3BA 1L0OC 1W9TA 3M3CA 1DIWA 2ZNYA 3J7HA 2DFFA 2RVAA 1RUJ2 1XPWA 2P1BA 3OEBA 2BBVA 4HSJA 4RGRA 3O5SA 5IHRA 2XJTA 4GJZA 2QLZA 3VKFC 1QO0D 3ZMVA 2WSUA 2D3RA 1FWZA 1B9NA 4XOTA 4UF0B 2XRLA 1SDWA 1IXSB 3UJQA 2VC9A 1RUC2 4J01A 4JGZC 4QPGC 2IA1A 4MEXF 3BUCA 1FMD3 3U0ZA 1HRV2 5HPOA 1QJU3 3ABKH 4LNVA 1ZR4A 3IDBB 4WVMA 4YIFA 3PLQA 3ZN5A 1SFYA 1EPWA 5F3CA 1WGPA 2RS32 2NVYJ 3ZDVA 1C1FA 1UWWA 3TBDA 4BXFA 2JB4A 2R0FA 1JZ7A 5F27A 1JUIA 2CUZA 5IT6A 2Y38A 1ZM1A 2BUKA 3INAA 2OQGA 2IXJA 3LDRA 2VT2A 1KJRA 2EIJH 1PK6B 4BY7J 3F72A 1HSJA 2LP0A 5FUIA 1RJ8A 4JKLA 3FLTA 2LK2A 4A6EA 4BDYA 3WEZA 3O3KA 3RKWA 1D4VB 2K9MA 2O8KA 3K4LA 3U4SA 2GIVA 3DEMA 3PNAA 1BI3A 1UAIA 3TWIA 3VDAA 2GNBA 2Y34A 3ABTA 3BOWA 4D1QA 4JQFA 1EUUA 4HLYA 1N1YA 3UL2A 5IK8A 3CF6E 4FETA 1BI1A 1LOCA 5DDJ3 3GLXA 1U0AA 2OUJA 2HS5A 1UB9A 5FZOA 3WU1B 5AC93 1WRJA 1XTAA 4M72A 5KHIA 2BY3A 4WZFA 1ORKA 1X8MA 5IK7A 2YPRA 1D2QA 1YW8A 4ZY9A 2C6YA 1FPN3 2VJ4A 3KB5A 3PFYA 4EWEA 5JZGB 1S0JA 4GWNA 4CDQC 5CQGA 2V1NA 3BR5A 1ETKA 4WVZA 1DQ5A 4G12A 4QPIB 3OYJA 4QXBA 4ONUA 2CW7A 4ZPIA 2KJCA 5CG8A 3CZJA 2GMMA 5HS9A 3O7OA 3GW2A 1G7YA 3LFMA 1SFXA 1Y0NA 2OZ6A 1VAVA 3D82A 4JZRA 1RUI2 2ZEWA 3PNYA 3LOCA 2ZHMA 3GVAA 4AQ6A 5DYMA 4AEDB 1DFQA 5IVCA 3NAUA 2P5BA 1RUH3 2ZEYA 3HBZA 1LHVA 1J3PA 5KXEA 2HEVF 1NG7A 1IJWC 5HXVA 1VB4A 1LNWA 4GIQA 1FX7A 3VBFB 5E16A 1T56A 1LGNA 1C1LA 3MO4A 1W0NA 4UVCA 2VQCA 2VE1A 3BG3A 2BQPA 5KHKA 1KONA 2HTJA 3OUJA 4EQVA 4YM2A 1VBC2 1NCQB 3DV8A 1U5ZA 4P9LA 1CJPA 1WA4A 2ZABA 1P4WA 1BHGA 1RKWA 1WMEA 3HM5A 4DOUA 3AZYA 3BJAA 1V9U2 3BTXA 1XGOA 2B63J 2NMOA 3KGLA 1FI2A 1KRIA 4NRMA 4LLFA 3IUOA 5J36A 2WO2A 2BFUL 1CAVA 1I6HJ 4E7LA 5FLHA 5ILVA 3FUOA 2D5HA 2R061 2XKPA 3M8JA 4HX4A 4IHSA 1T0FC 4Y52J 1NCRC 2CSGA 4V2VA 4HSRA 3VHNA 5EP9A 4PGGA 5C4JJ 1JTZX 1VLNA 2BHZA 4IEPA 1V6KA 2Y6HA 4DOZA 4E7HA 3DTIA 2OA2A 4HNUA 2IFRA 2QKDA 4LKDA 4C0BA 1PIV1 4IV3A 3LNQA 4IL7A 2L4MA 1QZEA 1VMHA 4MOAA 1VBB3 4LR4A 1QKQA 1OFSA 3AL0B 4I02A 2XVLA 4KI5M 5JSRA 4YZ2A 4XF4A 5DN2A 2P6HA 1W8TA 4S2FA 3ZFGC 2JXAA 4AHWA 3FBMA 4RB3C 4QMAA 1FOD1 2F48A 1J1LA 1MMSA 1W6QA 4KQ7A 4WM8B 1QXRA 1JU4A 3HOUJ 2EFNA 4LO4B 1WCDJ 4SLIA 2BGOA 2DPDA 3FISA 1HBXG 4DXTA 1W7PD 4PF5A 1GNZA 3VBRC 2WT2A 3BTLA 3IP4B 5F5AA 4P9WA 2PG4A 5JHUA 3AXDA 4OIRF 4GFBA 2KIUA 3H1MA 1REDA 3SEQA 1SEUA 1KFXL 4BPZA 3L00A 2W91A 5DUIA 4LOTA 4OI4A 3ES1A 4BH9A 2HQAA 3PNTA 5C4XJ 1M1EB 3RZKA 4AWXB 1C5IA 4DW6A 1QF3A 2H94A 3I71A 3I0TA 3S6PA 4ENJA 3VD5A 3JAMK 3FHZA 3FMQA 3KHBA 5D6FA 1REEA 2F4IA 1K79A 2YBPA 4A3MJ 1HW2A 1MZFA 5IVEA 3VBHC 3WU0A 2MH2A 2JG8B 1OCOH 1TWCJ 4OZXA 2XL9A 2Z3YA 3O1OA 3DEEA 4FSJA 4U7BA 4FO9A 1WD3A 4L9NA 1PVC2 4LBQD 4O5VA 4CCOA 2LBFA 1P92A 1EV13 1OA3A 2D6KA 3LOBA 2HZDA 1RESA 1NAEA 4HZFA 1SACA 4GJYA 1K4TA 3CJIB 5E6HA 3QRFF 3V64A 5FDBA 1RXFA 1K61A 5GTHC 3LFUA 2E6VA 5L19A 3VZKA 3ZGKA 2WT0A 5D5XB 3GM8A 1DHKB 3PUSA 2SLIA 5HLTA 1XNKA 1CR7A 3HNBM 3BLYA 4MXVA 3VBSA 3FLRA 4AEJA 1MZ6A 5ISLA 4QB6A 2XQRA 4MADA 4FTSA 4BXXJ 3PVEA 1ACIA 1VQPI 3KETA 5I8YA 1TWFJ 1ZELA 5M5XJ 2KHMA 3JCUC 1HRI2 1ITYA 1FOYA 1QJX3 1OD3A 4EROA 1Z0XA 4QHOA 4OAYA 1SLTA 1W6MA 2K5CA 4Y15A 5BOXA 3N7MA 4A3CJ 1FMD1 2DA6A 5LGUA 3J7ZI 2VZPA 5T5JA 3PVNA 1DGWY 2CWMA 2VXJA 2VXRA 3T0BA 1PUEE 3PMSA 2J5OA 3PQKA 2DBBA 3TW6A 3NVCA 5LB6A 4RFT0 4GB33 3I53A 3DLLF 1Y4WA 4LA3A 4A69C 2FBKA 2TDXA 3UNGC 2UUZA 4K7JA 4O7XA 3HTSB 2UU8A 1H8VA 1SCRA 1DCSA 3GCMA 2OPKA 2YU3A 2VVFA 2ZAAA 2P37A 4N90A 4CP2A 4B4RA 3AFKA 5L36A 2CQQA 1GWKA 4IKFA 3MIDA 4BZ4A 5FCCA 2N7GA 1H9WA 3GWZA 2VOKA 2IW5A 5K1YA 4JQTA 3SISA 2XROA 2GBYA 3F0CA 1YS6A 3ECQA 4L0PA 1U5IA 3PIOF 4IQ4A 4PGHA 5IK5A 3ZN6B 4XLPF 1A6IA 3I3DA 1BBYA 5FYHA 5J4YA 4CEWB 2CO5A 3WVJA 3BIWE 4S04A 3WE2A 2BP6A 5DDJ1 4XN0A 2DBNA 1G9CA 2N8GA 4AI9A 1H9PA 5HCBA 3WDTA 1RNLA 3GTOJ 5AC91 2JJ7A 1Q56A 4C90A 4D7MA 2V9KA 4AIDA 3HOVJ 5FZ0A 3RKYA 1USTA 3H3ZA 3E5XA 1CAUB 1FPN1 4P55A 1E5SA 4FFGA 2PHWA 4TN7A 4OLLA 4L9BA 4XHXA 5IP6A 5IYBJ 2DQLA 4I76A 3GALA 3JSOA 3CUQC 1Z21A 4XHBA 2R7WA 1DF0A 2IAIA 3ULQB 5TJJA 3CCEI 3OBRA 3OJBA 4X6AJ 3OIPA 5K0UC 4MQVA 3OPTA 1F4HA 2MG4A 4O9GA 2B9SA 3JU9A 4UUVA 4IESA 4BDVB 3Q8EA 4UAPA 5FZ9A 2WFF3 4ZDPA 1RUH1 1R082 1SHWB 3BU7A 4S2HA 3LA7A 4XBFA 5KWRA 3IV5A 3I2KA 3S3MA 1OD5A 3KLSA 4Y22A 1COV2 3QQAA 2EFWA 2D1VA 4NDLA 1WW7A 1XCBA 3H0OA 5L7OB 4UB6C 4DMIA 1QXJA 3BTAA 1UFMA 2R4GA 5FQ0A 5HOOA 5C33A 2R3SA 4HPQA 4MFEA 1W0OA 4YW4A 5FRMA 2NRAC 1ALYA 2VJJA 3LEMA 3CCRI 3EUAA 5LEKA 3H5RA 5JR7B 3IAQA 2FRHA 4C9YA 2QUFA 5FP7A 1X1BA 4QPQA 3DTEA 3JTHA 2AUYA 4DRRA 3I8TA 1VBE2 4AHZA 5DAQA 4YW1A 1Q8QA 2QQAA 1OLME 1UD1A 2ARAA 2GN7A 2DT7B 2DA3A 1OFCX 2XF7A 1U5TC 3KV6A 2Z42A 1SBDA 3WG7H 3ZMNA 1IPKA 1LVAA 2E71A 1TNRA 1IUYA 3WXPA 1W0PA 3TOJA 1Q8OA 2ZMLA 3O1RA 5J48A 2EXHA 1VB2A 2XPVA 3K69A 2DDAA 2DU9A 4AYUA 2WS93 3DU6A 1A35A 2NOGA 1OR7A 3G2BA 3OYBA 1GDTA 1VBB1 5A7WA 3AL6A 3VLBB 4Q8KA 4EN8B 3SMHA 3AZZA 4QQOA 3CMEI 5J98B 1A04A 3IHUA 1ZRIA 4XKCA 2UWAA 3L2VA 3MDPA 1BEV2 2RKHA 1W8FA 5A1FA 3HKZN 1FY7A 1J5YA 2D6OX 4DZPA 1I50J 4IHVA 3HEFA 4GAZA 2F6BA 3WW3A 2KQRA 2CTVA 1IUFA 2OZJA 1XU2A 2XV4S 1X36A 2OQ6A 2JE7A 1SG3A 2P81A 3N36A 4FFFA 2J22A 2JN6A 1MBJA 3D5LA 1W6NA 1L7RA 2XRNA 3OS0A 1WI3A 1JJ6C 5JSOA 4JV4A 1XSXA 3E5UA 3OBTA 2WYSA 5J8CA 5HXMA 2NVXJ 1UPSA 2JK3A 5FXZA 2YB7A 2DWRA 2FDFA 3VL8A 1FYLA 5FY7A 3KZZA 3H0GJ 4L92A 2PHUA 2X10A 2HKXA 1YRNB 2ZX4A 3HTUA 2O03A 3HGGA 3GGLA 2EA4A 5E18F 5C3RA 1FBSA 4ISQA 2WAFA 3AC0A 1KD7A 1NG0A 1CF7B 1JTYA 1GQPA 5FLMJ 3GHMA 3SYTA 2JDHA 2D93A 5GALA 3SC7X 2A3XA 4XN3A 1B6AA 4IPAA 4AUXA 5CVVA 4RAGA 3ILFA 2FMYA 2DA7A 3S3NA 5A70A 1VIWB 3GX4X 3SCHA 4PJ0C 1PNFA 1LEDA 5FJHA 4HF2A 3WP6A 2XHKA 2GC1A 2RQPA 1ZRFA 1HKDA 1RYYA 2FJ1A 1WJFA 2WZEA 3WQ1A 5LATA 5J6XA 4HOOA 1VRH2 1IGOA 4NOTA 3S1MJ 5D8AC 4F3JA 4IXLA 2STTA 2ZJRF 1O3QA 2Q8EA 2ZJ2A 2XSJC 1X1AA 3ENRA 2GH2A 3ZFEC 3MPPG 5K8SA 2VNGA 3HOTA 4LFUA 4N43C 1O3RA 3HRUA 1U8RA 4ZYEA 5EJCA 3BU0A 2CY6A 3POFA 1LE8B 1E2XA 3DFGA 2ORXA 1KS5A 1STZA 4XORA 2WUHA 2EV0A 4J25A 2A73B 3GF2A 1UXZA 1B8IB 1W9FA 5FP9A 4CUAA 2W1UA 1CESA 1QJX1 4HANA 4ZXKA 4UYBA 5F0FA 2LFBA 3DXJF 1Z7S2 4E4HA 3I9V2 2GC0A 5I0UA 1KYWA 3PIPF 4OUMA 4QWNA 3K4NA 1K6OA 1LULA 5JVGF 4GRIA 3M4FA 1Y8RB 2O6GE 4YLZA 5EXOA 3LSGA 4IEVA 2BY2A 1VI0A 4GB31 5BMZA 2ZC2A 2WWSA 1QVUA 1W6PB 2VUJA 1K83J 3B69A 4NMIA 3K1MA 4BISA 3WD5A 4UUSB 4KISA 3CO2A 4EVIA 3HNMA 4N53B 1FSHA 4YZ4A 2CHHA 3NV3A 4DINB 5ABJB 1XN7A 3LKJA 2FDKA 1YQ5A 1ZGWA 2CGPA 5LBBA 2V4JC 4YARA 4UY8I 1N3OA 2EZHA 5BNNB 5CFDA 3AKSA 5JR2A 1PO12 4GO1A 4YVSB 4DS0A 5FYVA 2ZO4A 2MEV3 3KQRA 2XC7A 4FAHA 3FK7A 1Y7BA 1BYHA 2EIDA 3H7JA 4YFZA 3WOGA 3MZ8A 5FBJA 4EWDA 3CCJI 2DFBA 4CA0A 1W4MA 1W28A 4BXUA 3GBWA 4LO7A 4BJ6C 4UI9L 4JDOA 1YI2I 3IL2A 1W9YA 4IEJA 2M0CA 2PYTA 2BE5F 1MKMA 2I07B 5HV0A 4UF0A 1WLDA 4FPJA 3NWKA 2BZTA 5C7GA 1TNSA 3K4JA 5EZGA 2MLKA 3MKWB 1JZ5A 4BXSV 5ACA3 2ZGTA 3MIGA 1F15A 3ZDSA 3ZVXA 3BZCA 5J3UA 1G9AA 1N77A 4COZA 1J7KA 2VBWA 3OIQA 4LK1F 1ZZ6A 4E8DA 4XONA 5BQTA 3HEIA 1B35B 1Y1VJ 2YYOA 4FQ4A 4I0BA 2Y0SA 1FPQA 2R062 2YC4A 1PK6A 4W97A 4OZOA 2Y6FA 2O61A 1TWHJ 2WFF1 3ROUA 3S30A 4XIOA 1D0GA 4QB1A 3AJYA 4Y4RA 1UCXA 3CCQI 1WMFA 1OF4A 1Y1WJ 4TSVA 1URXA 1PIV2 4L11A 1OOPA 2XLGA 3CTAA 1AX0A 4HQEA 4Z2AA 1D0YA 1MH4A 3VBUC 1O8SA 4BEHB 4MGIE 3OR2C 3K6GA 1HKTA 1VE0A 1WHUA 1ETVA 4UFIA 1IKPA 2BNOA 3TP0A 1W2AX 5EG0B 1H8TC 1R1ZA 1SVLA 3A4CA 5DCFA 3WW2A 2RQQA 1HV1A 1ZREA 1C57A 1ND2A 5JZGA 1WPKA 1WW5A 2R32A 2XR4A 2HWB2 4O61A 3HJEA 5LA1A 1MD0A 2JDNA 3Q8AA 4FXGB 4BHBA 1JUHA 3H35A 1XGSA 2FZ2A 1CIWA 3CQZJ 4JX4A 3R4DB 2BY1A 5JVTA 3HOSA 4RFRB 1EY2A 3JAMZ 5FPBA 2CMPA 3TYJA 5FFOC 2RHPA 2WS91 3AZXA 4AEDA 4IHXA 5A7NA 3O6BB 5A7QA 4DRVA 1UY4A 1OA2A 5A3MA 3AG2H 2NP0A 3SEZA 2DO7A 2RJ2A 1DDNA 5LBEA 5EEAA 2W52A 2VCBA 2XAUA 3KV5A 1GLNA 2K40A 2XGXA 4XKBA 2L7ZA 1TNFA 4XCBA 2ZB9A 4FX0A 1WZ2A 5C9AC 1VTNC 1KDMA 1MJBA 4HLXA 4OMDA 4XUQA 3LIHA 4F3QA 2P6SA 1EA3A 5JIAA 3LEIA 2EBIA 1WCQA 3DYMA 2YC2A 2Z16A 1H30A 3DXUA 1GLHA 3C2BA 2R5YB 1G6NA 4OI0A 1H88C 5J3LA 2O8OA 4UFHA 3WCSA 5H6RA 1LGBA 3HVDA 1V5FA 1RTVA 4LK0F 4RN5A 2IUWA 4MHGA 2CH0A 3IKTA 4EJRA 4B29A 3S1RJ 2DMTA 4XFIA 3THDA 1QVTA 4XABA 4M0HA 1MS5A 4G3YC 4LHLA 4AI1A 5CG9A 1W3XA 3P9CA 2WQZC 3UNPA 4IW3A 3VWBA 1UY0A 4HV5A 3T3YA 5FMOL 3NKGA 1FC3A 1JYTA 4EQQA 2JA2A 5B5EC 4GMP3 2NS0A 2FE3A 4C3IJ 5KNLA 4D8MA 4WCGA 2WKKA 3DCFA 4KT5C 2RG4A 3V7SA 1POV3 4N4NB 5A2QK 3OSGA 4Y20B 1WLWA 4NHMA 3C3WA 3VYTB 5TSWA 1ONVA 2JDKA 3L2HA 2ID6A 2ZGLA 1H4GA 5FYIA 2CW0F 1XB4A 4AR2A 4EN0A 4QPOA 5E89A 3CJXA 1A3KA 1F5FA 4HQMA 5KXDA 3SJMA 1X8EA 3EUHA 1S72I 1GVDA 4HW0A 2PI0A 3CMMA 2Q2EA 2ET7A 1VMJA 2DVFA 5E3LA 1Y8QB 1X82A 2R0HA 2DTYA 4H3WA 3GFIA 4COVA 4QX3A 4MUVA 2P3IA 5C5UA 2GOXB 3D5SC 3O0WA 4PCRA 1FTTA 3FKJA 2D6PA 5A3UA 1YJ9I 1X1PA 3H1WA 2WO3A 3K1NA 1JE8A 2I5UA 3SNMA 4XMYA 3AMHA 2FD8A 5FZ6A 4YW5A 2PQ8A 1BXHA 1W90A 1XE8A 4IEXA 1U0JA 4JHZA 3HQUA 3S8PA 4I30A 3CC4I 1GMMA 4K9SA 4XZPA 4ON0A 2UWBA 3CLOA 1JXSA 3NL1A 1W0UA 1AR83 3QWLA 3CLPA 5CIRA 2BOLA 5KHDA 1FXZA 2IA0A 2FBIA 4RQPB 3H8RA 5A7SA 2HWF3 4BQ4A 2QDRA 3RIRA 3A4UA 2MC3A 2IA2A 1REPC 3KEQA 1AKHB 1W6OA 2LROA 2ELHA 2OV7A 1MS0A 3KZYA 2E63A 2GXAA 2R16A 2ECBA 4YM3A 4CZCA 1BJQA 3M8FA 1IC8A 5DDJ2 2C26A 1FMVA 3BC8A 3L2YA 3ONQA 3VZNA 3HOYJ 4I0AA 2LD5A 1Y9QA 2PEXA 3BTCA 3OL4A 2E31A 3BGAA 3MZYA 2QFEA 4L0ZB 1YFUA 1WH5A 4EM1A 3B7MA 2A1XA 1IQAA 3WTUC 3MPBA 1I6XA 4FI9A 3CJIA 4N8MA 3U10A 3ZQCA 1RUE2 3J7YJ 4W6WA 1TQMA 2H0BA 4LD5A 4A3JJ 3OMYA 2LYCA 3PO3J 1I5ZA 2MEV1 2HWE3 3BZ6A 1J1TA 4FPCA 1VF9A 2NOJB 3T5XA 3B6AA 2YUEA 2VW2A 3WDWA 4M9XA 1CZVA 3U75A 3VHOA 4FVVA 4OHYA 5LEJA 2KA3A 3G71I 2VOWA 2DCEA 4HVOA 4K6BA 4COWA 5CKNA 4E7ZA 4CCLA 4C2MJ 2QZ3A 3LE0A 1WCMJ 1LOFA 3SH5A 2Z4FA 2O0YA 1O7LA 3JQWA 1C3HA 3K4CA 3KMHA 1DGLA 4B7KA 4NHXA 1ZN2A 5FWEA 2M9HA 2E1OA 2X85A 1FATA 1F8VA 2W87A 5FKCA 4DXRA 2PN5A 2VTXA 5ICFA 1OLMA 4NHLA 5CKQA 1WI9A 3R0RA 2VKEA 4XJAA 1YO5C 3QPHA 2WRAA 2IVJA 4E2GA 1RHI3 4OMYA 1W8ZA 3MICA 4XLFA 3TBIA 4IJAA 3IH4A 3ZSEA 1SLAA 3F8CA 4J1WA 3JUUA 2FOWA 3USUA 1A8DA 4NRPA 2A6EF 2EILH 3R6SA 1ZKGA 2D1HA 1FOKA 4ARXA 3T30A 4M3GA 2ELJA 2LTNA 4NRQA 5HLHA 1TNTA 1APNA 2YU1A 1JN2P 3ZQ7A 3GZAA 5FREA 2X09A 3OOPA 5FK8A 1VBB2 5AFEA 4NJ4A 4JOMA 2Q0OA 1S7EA 2QKLB 1GFF2 4H0EA 5JXIA 3MGUA 2CQXA 4CRQA 2NNYA 1V6MA 5DUUA 1W5SA 1AHDP 1SVMA 1PHMA 5EWSA 4BQ5A 4IV3C 3HPGA 2LR8A 2CQ7A 2QQUA 1TMF3 4WWCA 4MEYF 2BDRA 3M3EA 4BHCA 2Q1MA 4LJHA 3PSFA 3IZOA 3ON7A 1W1WE 3M2MA 1UX7A 3V7CA 3M3OA 2CAUA 2O8XA 1M06G 4ENKA 1GBGA 3SH4A 3AP5A 2HYJA 4WK8F 2XKOA 3BR2A 2VH9A 3PIGA 1IN8A 4CDWB 2QQJA 4PI2A 1CD3G 4AYBN 1WD4A 3W5MA 4HMZA 3POBA 1Y6IA 1MZEA 2GA1A 4V2WA 5JOZA 2HQ5A 5LHHA 4EN9B 5KVRA 4YRDA 5F2SA 3X29B 1TVGA 4PFPA 2FQPA 2OF7A 2VBBA 4BHPA 4EZ4A 1HF0A 3DF8A 2OAZA 2Q8DA 2DTZA 2WAQN 3S2WA 2JRMA 3LSKA 5F0HA 1ZR2A 5L7OA 5SV8A 4XVHA 4M3DA 4HVRA 5I0RA 5EDNA 2LF8A 1W8UA 4A45A 1SLBA 5DAXA 5DUKA 1PGW1 2WABA 3KSCA 1ZGJA 2RJKA 5IWFA 3WTTC 1YS7A 4V2GA 5L3CA 5DABA 4M4PA 4GH4A 2V4VA 1DQ6A 1IQDC 2W48A 2R6QA 3SH3A 4PCQA 3Q0VA 1HJFA 1A6CA 3CESA 3LMMA 4G9SB 2AACA 4A3LJ 2H8WA 1U2WA 1IG3A 1O59A 1V6IA 4D0QA 4AEMA 1OKRA 4TV7A 1BC7C 4R79A 1UMHA 3CCSI 3HOXJ 2WY7Q 4YFWA 1BC8C 4PJMA 2ZEXA 1UHWA 4FPHA 2OCCH 2ISZA 2VQGA 1MDMB 3BB6A 4QX7A 1RB8G 3IRRA 4OULA 1LFBA 4GMP1 1X33A 1UX6A 2HOEA 4L97A 4DJAA 2OUMA 3HIFA 1MIJA 5FGMA 2Y26A 1RC9A 4QHBA 3Q0WA 1POV1 4JTOA 4Y5Z0 3FWEA 1UU6A 2ZACA 3RZDJ 3U2RA 1BIBA 3WY6A 4B1LA 2ZGKA 2MFZA 3CQOA 3AYAA 4F52A 3J4UH 4RHV3 2QF7A 2ZGOA 2ETEA 4CU9A 3VBSC 2VQLA 2LDUA 3S32A 2QQWA 4D7SA 4JX6A 2IS6A 2VXZA 3RQ4A 2MA3A 3N9OA 2VGDA 2VU9A 3UKVA 3CJRB 2W1QA 4IV1A 5CVRA 3FHQA 4E7IA 4HSTA 4U0WA 1NXMA 2K3FA 2WYFA 2HPMA 1IGNA 5F6FA 3RKXA 2VBPA 3KX2A 2MC4A 5GLTA 4AVZA 1YI9A 2FNPA 4A3EJ 3MFCA 1LAJA 4XQDA 1T8IA 1AR81 4ZZ8A 3H7YA 1YX3A 1QHDA 2OTLI 5CPRB 5DCMA 3K2ZA 1XE7A 3SEPA 5JVVA 2HWF1 2K0GA 2QQMA 5BPDA 4JGZB 3OY9A 4QPGB 1YRNA 2BV6A 2Y31A 2XGCA 2BWCA 1S2BA 3PQJA 3VZLA 1WMDA 2HKOA 2YFZA 1OFNA 1DGWA 4QGMA 2UXNA 5BNPC 5IOZA 1JU3A 3J7AO 1R1A2 4CP0A 1CF7A 4AIJA 1B1BA 1HDPA 3KE2A 1GWMA 1RGSA 1ZBE3 1XYOA 5FUPA 4BL0B 2WAOA 3S14J 1Y0UA 4OUEA 1AYM3 3T2QA 2J1RA 1V00A 3L2WA 3BPZA 4KWKA 2NM1A 5FY1A 5EGOB 1C4RA 3WF4A 5DD4A 1GQHA 2ISYA 4HA8A 2DT6A 1AR73 2VUCA 2Z79A 1JHHA 1XMKA 2DMQA 2HWE1 2O1QA 2EFPA 1VFCA 3ZQLA 1I3HA 3WTWC 2P4EA 1UZWA 4ZH4F 4WVVA 2IBDA 4UFLA 1Z3YA 5KHGA 2HYKA 2JDAA 4LQRA 2OQRA 4MGYE 2VN2A 2WFF2 3VB2A 1JT0A 4NHJA 2ZNZA 1LE8A 2E53A 3FBYA 4GALA 4HN1A 4AC0A 3A22A 4X8NA 3KF3A 2KRFA 3DYOA 2OA4A 5EF6A 3GJAA 3NNGA 1I1GA 3NAPA 1EP0A 3B73A 1A34A 1LECA 2PJRB 3W6KB 1MBFA 1YIPA 3RTRA 4MHRA 1I9RA 4G7ZF 3IC7A 1YTYA 3H0DA 2WT1A 3GZ5A 1NH3A 3PJQA 4QX5A 1CONA 3H1YA 3GJBA 2ENRA 1W6PA 4CDQB 5GPAA 2IVMA 2AHQA 3PMEA 4OQ9A 4Y5TA 4XAEA 4JX0A 1FIAA 3OWTA 2B7YA 3JRIA 2OC6A 1RHI1 5J1XA 5GTIC 3B01A 2B39A 2XAGA 1ZRDA 2AENA 4EYUA 5HS8A 3HOZJ 5BNNA 4GZ9A 1C8M3 1ASJ3 2JDZA 1JYVA 3EJKA 4LLGF 2JZYA 2WBMA 4YVSA 1IW7F 3ZSJA 3ERMA 4OHVA 5CA6A 5FY9A 2O3FA 2M5WA 3OYEA 3O8HA 4BAYA 4FX4A 4TTGA 5J09A 4HF1A 2VMHA 2WZR2 4IEQA 5F1RA 4NHYA 5A3TA 2WS92 3HPHA 4JP0A 3KGZA 3W6JB 1I39A 2FA5A 4AEKA 4TZDA 2ZMEA 5IVBA 5A3OA 1B72B 1IS5A 2P6TA 4NIDA 2OS2A 2DN0A 1N3PA 1F43A 1BK0A 4MV2A 2WV0A 2DMUA 3WGIA 1OA4A 5GZCA 1XDSA 3DQVC 3H50A 1TMF1 1BQPA 4FT8A 2NMNA 4ABZA 2QUOA 3AK0A 1WLCA 4BJ0A 1RINA 1NCRB 1FTZA 4QQHA 3LSPA 1AU7A 1K6YA 4KG8A 2C9KA 4KN7X 1HOMA 4XUOA 1R23A 1UY1A 1B35A 2DOEA 3MVPA 1J84A 2M34A 2BVMA 2DYCA 4N7IA 5KC6A 3A0NA 2L4AA 1SD5A 2GC3A 5DUXA 2HLEA 5IVVA 3TDZC 2W7NA 3KVBA 1PGL1 2QA4I 5FO5A 3W2AA 2HPIA 4JTNA 4ITCA 5A2QZ 3BALA 4IE6A 4XNFA 3AFGA 3ZFGB 4UBHA 4QGNA 3ZFFC 4XIKA 2EV6A 1KFUL 2LOOA 2XVKA 2DLLA 4N0BA 2A5WA 1F36A 1FAYA 3ME2A 1OCZH 5JCTA 4NC7A 4CDGA 4DPNA 5FPUA 3UV9A 1ST8A 5E17F 1HQWA 5FOJB 2PAMA 5ABJC 4XFCA 2ECCA 2W9XA 3VBRB 1SAXA 3PL8A 1MACA 4OHXA 2Y30A 2ZMKA 1S3JA 2I2SA 2X53S 3OD4A 3W58A 5EG0A 2UURA 1J0RA 4E4DX 3QLQA 1BI2A 1TME3 2YROA 3WG9A 2ZAHA 3IAM2 2QSFX 1KQ9A 1MQTA 1DQ2A 4DUWA 5LY1A 3ESWB 3HKZA 1PP8F 2RC4A 2VBXA 3KM5A 3PUFA 4RA2A 5CYYA 4HRIA 2XSDC 5L9RA 2RVCA 4R9BA 2DBIA 2DVDA 5GZGA 5CLSA 1AA7A 1H89C 3WX5A 4IGPA 3CJTB 4AGGA 3MZHA 3RZGA 2ZXQA 3VBHB 3ZR6A 5FZ8A 3FMGA 1JH5A 2QTWB 3GTPJ 4FPGA 4JYKA 4PBOA 4Q5SF 1GNYA 4NIAA 3MEXA 1Q8SA 3QACA 4BK5A 4P9UA 3P3NA 4RHV1 3ZSMA 1WUVA 4BQXA 4LBJA 1R71A 4YZ3A 3NJXA 4XJZA 5IJRA 4NQWA 1WMXA 4A0YA 3DPRC 1QZYA 3HBKA 4XQFA 4B44A 4N9IA 4B1MA 2XPUA 4LG0A 1VQ5I 5A33A 2HXIA 1LGCA 1CX1A 3TKYA 2KJBA 4ZYAA 4PZJA 2XUMA 1K3IA 2KZGA 3BJ6A 2R5YA 2ZJPF 2W57A 3NO8A 2GLOA 1ETXA 4G8XA 1VQ7I 5H9SA 4FP3A 3PUBA </