1O3QA

Protein-dna recognition and dna deformation revealed in crystal structures of cap-dna complexes
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation/dna
molecule keywords 5'-D(*AP*AP*AP*AP*AP*TP*GP*TP*GP*AP*T)-3'
publication title Indirect Readout of DNA Sequence at the Primary-kink Site in the CAP-DNA Complex: DNA Binding Specificity Based on Energetics of DNA Kinking
pubmed doi rcsb
source organism Escherichia coli
total genus 62
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2003-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1o3qA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1o3qA01
1U8RA 3DF8A 1CAXB 1YLLA 3WGHA 2EA2A 4XSXF 4HOBA 1BI3A 3FFQA 4XFBA 1BIBA 1R22A 2XAQA 1T98A 1STZA 2BGCA 5BQTA 3L00A 1IN8A 3DQVC 1HSTA 1U5TC 5KHGA 2RKHA 2FQPA 2OZUA 2E1CA 3NJZA 4E70A 3LAPA 4WF2A 1ZRCA 1W4MA 3D0JA 5LLQA 1LQ1A 5F6FA 4IEPA 2P5KA 5E18F 3JAMK 2BV6A 3BPZA 3FMRA 3GVAA 2C0ZA 3IHUA 3S0MA 1Z7UA 4WXDA 1HSJA 5CADA 3GW2A 2MLKA 2VXZA 3HHHA 1B4AA 4MEXF 1Z05A 2XV4S 2O03A 2ZXJA 3K69A 4HVRA 1OD5A 4IF4A 1RC6A 4HA8A 3MQ0A 3KLNA 5I0RA 1G3SA 1XGNA 3WTWC 4X6RB 2FF4A 2CW0F 2XAHA 5D8KB 4EV0A 4G6QA 2VBYA 4L0ZB 4OMYA 2XROA 3P9IA 5KHHA 4MQ9F 5E1WA 4DQ2A 2QBYA 1YO5C 3JTHA 3R4KA 1SAXA 3U1DA 3QACA 4AQ2A 4MGRA 4Q0SA 3FXQA 4I0AA 1ZRRA 5TRDA 4G9YA 3ML6A 2UY9A 4FAGA 5TJJA 3T0YA 1KYWA 3P9CA 4OINF 2LNBA 4HDUA 3F8MA 4XF9A 2IXHA 4JBAA 3V4GA 3BJ6A 5FDBA 1S7OA 3ZMDA 3TKYA 2IJLA 4OIPF 2FMLA 1XGSA 2XL7A 5BV6A 4MTEA 3KP2A 1E17A 3GBFA 5BPDA 1GQHA 2D5FA 2W24A 2VECA 3BP8A 1RNLA 4IETA 1WI9A 2D40A 3EYYA 1CAWB 4PIYA 2OA4A 1UHMA 2CFXA 2FMYA 1ZRDA 1BM9A 3MPBA 4QX5A 5J8CA 1GQGA 4LG0A 2AXLA 1MGTA 4IHSA 4PZJA 1S29A 2EFNA 5EZWA 5EEHA 3EHKA 1VJ2A 4M73A 2PAEA 2Q0AA 2EA4A 3ZMZA 1C0WA 1RUNA 1BI0A 5BXXA 2D5HA 1YYVA 3VEPA 2QQAA 4ENKA 1TBXA 1ON1A 1FX7A 1NHAA 5ICGA 5H6RA 2ET1A 3RI4A 1R58A 1J3QA 3EYIA 5KHJA 2MPFA 1P4AA 4IEVA 1P6RA 1T39A 2QVOA 3LZZA 3HRMA 4UVBA 2PFWA 4MZUA 4UVCA 3OV8A 1SFEA 4BH9A 2XIGA 4IRGA 2ETEA 3CJXA 4AIHA 1Z6RA 5EEGA 3TOBA 2STWA 1R36A 4EGYA 2IXIA 3K1PA 1QXRA 1YFUA 3H9AA 5LHGA 3L2HA 4HSLA 3ULQB 4UXAA 3WW4A 3LWFA 4XFGA 1OR7A 3GFIA 4LB6B 4WVZA 3WTXC 1XDUA 1QXJA 5JR3A 1XSVA 2PAKA 1FSHA 3MDPA 4L18B 2RV8A 2IVMA 3RYRA 1YS6A 1SD7A 4AWXB 4Y17A 1PM7A 1XSDA 2RGVA 2GQQA 5KBFA 4G8XA 1R00A 4KWKA 2HWVA 1RTVA 3I59A 4U88A 4HX8A 3ZDSA 3E6CC 2IXKA 2A61A 4EJWA 2A68F 4HVOA 2JPCA 1XDSA 1I1GA 1XMKA 1IRFA 3UKTA 4PJYA 4EM0B 4XLNF 3REOA 4FX4A 3FXUA 1XGMA 1T6SA 1O57A 1GXPA 4Q0UA 4L5IA 4CO8A 1FBQA 3ZN1A 5D5UB 1CAVA 5A2QZ 2GWRA 3F6OA 1WKMA 2AS5F 4OOIA 2WWYA 1QY4A 3KP5A 3MYXA 4I09A 1IF1A 4HN0A 1HW1A 2VPVA 3R60A 5BY5A 3GLXA 4H0EA 1U2WA 2NS0A 2E9QA 1QZZA 2XAJA 3NSTA 4AIJA 1UPIA 4QM8A 3ZP5A 2HGCA 5LHIA 2YSRA 3QRFF 2IA0A 3N4MA 5LGTA 1FYKA 1WA4A 1WRJA 3ES1A 1FSEA 1TNSA 4YIIA 2Z3YA 3EDPA 2DAOA 2COMA 3IWZA 3GFMA 2GXBA 4G94A 5ILUA 1U12A 2EV6A 4XEZA 5ICFA 4U7BA 5FLXK 2HQNA 3L7WA 5HOOA 4LLGF 1KA8A 2V1DA 4Y13A 2OA2A 5FD5A 4BXUA 5J7MA 4ENMA 2ESNA 3H50A 2PQQA 2Z5UA 2KXLA 4RGUA 5HLIA 4YFXF 2YR2A 2Q8KA 1ON2A 4KIGA 3R6SA 4D7SA 2P7CB 5E1RA 2DCTA 2YX7A 1O3RA 2IXJA 1R5HA 4IJAA 5DUIA 5BPIA 5L3FA 5FQ0B 4YG2F 5JI6A 1LVAA 1WLTA 2QCSB 2EB7A 1XSXA 2FU4A 3TNQA 3RIRA 4GYIA 2Q4SA 3RKWA 1BIAA 1FXZA 3J7AO 3O2PE 3BPXA 2HZTA 5FCCA 1FYMA 3KGZA 4LLNA 3OCPA 4CICA 3Q9VA 1SFUA 3E6MA 4ZYEA 4ORFA 2UWMA 1L3JA 1W5TA 1J1LA 1YQAA 2MH2A 3QPHA 3CUQB 3IIAA 1T38A 1DDNA 5H6QA 3F22A 4AQ6A 4U0WA 3RYPA 1YW9A 4MV2A 2CQKA 2V1UA 4EMSA 4JV4A 5FFXA 2K02A 2YPRA 3HRTA 4QXKA 2E7XA 1AWCA 2G9WA 3RJPA 1GHCA 1QPMA 4HLXA 3RNSA 2CSOA 1P92A 3F72A 4HDVA 3TNPB 1J58A 5KHKA 1BOAA 5DCFA 1Q5OA 4KN7X 4P55A 1BI1A 3TO6A 4MGIE 2M1BA 2ISZA 3U11A 4QLCU 3FZ3A 1R1TA 3LWCA 3U9GA 3H3ZA 4RAYA 3KGLA 2QZ8A 1ZLJA 1MDMB 2PMHA 4R79A 1ZZBA 2FEZA 3HT2A 1CX4A 1GVJA 2QWWA 3IWFA 2HFHA 4HYEA 3HUGA 3KZYA 2M87A 2NNNA 2W57A 1IXCA 2IT0A 4ENJA 2D93A 4EJVA 1VTNC 4OIRF 3BJAA 4LB5A 4LA3A 2R3SA 1ZYRF 1H0MA 1SQ4A 5LRRA 1V3FA 1NE4A 2EAAA 2L02A 5BMZA 4F7ZA 1EPZA 3QOPA 2HTJA 4WK8F 3HTSB 4FAHA 5AVPA 1FBSA 3V8JA 4AVAA 1HW5A 4RAZA 2DQRA 5DEQA 4AD9A 3QP5A 3ECOA 2A5YB 3ZMVA 2EFWA 2XHKA 4KYWA 1YHFA 3NEUA 3C18A 2MLGA 1CGPA 3EO6A 2IC1A 3M3IA 1YG2A 4ZZDA 4DNCA 1XCBA 3I58A 3T8RA 2EA7A 4HN1A 4KMUX 1FZPB 3K1NA 3IRRA 2FQ3A 3PNAA 2FRHA 4WX9A 2IW5A 3TO9A 2EFOA 1MJ9A 2MD5A 2IXCA 3T5XA 4PIZA 1IPKA 5HS8A 1XMAA 4EWEA 1PP8F 1RI7A 4AIKA 5FPZA 3VB2A 5CVVA 4RB0A 2TDXA 4M71A 2Z2SB 2M5WA 3K0LA 1U78A 4ENNA 4B8XA 1LEBA 2MBFA 1Y0UA 1I27A 1U5TB 2QJVA 4I0BA 5D6FA 4Z2YA 3H7JA 1FLIA 3F6VA 3HOTA 3WW2A 1Q1HA 3ISPA 1YS7A 4E2GA 1X82A 3WTVC 2VBZA 4XFCA 4HLYA 3F23A 1LDJA 3OOPA 3GYHX 2F5CA 1IRGA 5KVRA 2RVCA 4YSFA 1F9NA 4L5JA 1LNWA 2P5VA 2ATFA 5DCMB 4L2NA 1I5ZA 2M45A 4RB3C 2GC1A 1Q43A 2FBHA 1LB2A 4QGLA 1TQPA 1IN4A 2O6GE 3G3ZA 2BNMA 3OGJA 4LUMA 2H0VA 4XFHA 2PFBA 2O61A 3RPUA 3RTRA 5FGMA 2KIUA 4LK0F 2K7LA 1XN7A 2KKOA 4ZYGA 1NZCA 3GFLA 3H3UA 4S04A 1ZGAA 5E8GA 1WGPA 2UYAA 3WGIA 4M9XA 3ZMUA 4UBHA 2XKOA 2PJPA 4OU0A 2V1XA 2NYXA 2RQPA 2EFQA 3K9TA 1KU9A 2F2EA 1O5LA 3WE3A 2A3SA 3HOSA 1I1SA 1ZVFA 3MFKA 1JUHA 1DGWA 1S3JA 4HQMA 2XLFA 1UD1A 3VOEA 4G6DA 1UCRA 1YIOA 3RPQA 1Z6TA 2H6CA 3ABTA 5KHIA 2BNNA 4TV7A 5J3UA 1FI2A 3TDZC 4JK1X 1HKSA 2GC3A 5KK1A 4KMFA 5D8LB 5HI0A 2YU3A 5E20A 5I8YA 2K9ZA 2PA7A 5I0SA 3U10A 3D82A 1MZBA 3ROUA 1O3TA 2XKPA 2J5OA 4OMZA 1EYBA 3KETA 4IEZA 4ZH4F 2QQ9A 3KE2A 1K78B 2BNOA 5DD4A 3PQJA 2FNAA 1W5SA 3CUQA 2Y48A 3LQRA 2V79A 3JAMZ 2L01A 3LAGA 2D1HA 5L3EA 1DP7P 4MUVA 2JPBA 5J8FA 1XE8A 4LULA 3NW4A 3BPVA 3WGGA 1BBYA 3SQNA 3WTZA 3ES4A 3ELKA 4EM1A 3OF1A 4A5NA 5HLHA 1DUXC 2ZNZA 4OIQF 2QDRA 3FHZA 4IEXA 4I98B 5FLIA 4X6QB 4FBFA 5ED4A 1KU3A 5ERIA 5FD6A 5C6CA 2VONA 1KU2A 1PDNC 4E2SA 2ETHA 2E7WA 1FYLA 3SZPA 2FOKA 5HVQC 1JE8A 3IBMA 1QZYA 1W7PB 1QNTA 4GYGA 5CVUA 2HKOA 2VODA 3TDUC 5I93A 2DO7A 5ILVA 4UNOA 2UXXA 3GWZA 3CF6E 1X8EA 3H8UA 4QMAA 3E6BA 3WTSC 1LJ9A 3TQNA 5DUKA 2A6EF 1BC7C 1TQ5A 2XLAA 2ET7A 1USTA 2OQRA 1Y3TA 1SD5A 1CF7B 3CO2A 2D45A 4OFGA 5A2QK 2DBBA 5I0TA 2EVXA 4BQAA 1RUOA 2RC4A 2DK5A 2VBXA 2ZCWA 1S7AA 1EY2A 2P6TA 4BIFA 1ZZ8A 4KDPA 3WW3A 3DFGA 1ZHFA 3E5XA 3GF2A 1Y9QA 1ZG5A 3HQXA 3T8TA 4D0PA 2MC3A 4NHJA 4P9FA 3F3XA 5E1XA 2DFIA 3HHGA 4Q5SF 1NE6A 4J1XA 4ZU5A 2P17A 3LSTA 1KQ0A 2DLLA 2MHFA 2BEOA 2CWEA 1P4WA 4HQEA 3USSA 3CJNA 1SEFA 4I3PA 4GXOA 2PHDA 2ZMEA 4O9EA 3CUOA 1HKQA 4IEUA 4Q0VA 1KQ8A 1H9GA 2N7GA 3C3VA 2OYZA 4HW0A 4IXAA 4A2UA 2P4WA 3SCHA 2HYFA 1ZX5A 3JSOA 5IT9K 4META 4DINB 4PGGA 1KU7A 3F8BA 4RGXA 1L0OC 1FP1D 3M8FA 2V09A 4M9ZA 3FM5A 1L3LA 1XE7A 3OTFA 3FXRA 2PG4A 4XF4A 5CVJA 3V7SA 3NQOA 4RS8A 4A12A 1LRHA 1X3UA 3PLQA 3SXYA 4L9NA 2NRAC 3WE2A 1J75A 4EWAA 1CAXA 1OKRA 3VHRA 3ELNA 3M8EA 1W7PD 1B6AA 4ESBA 5K8SA 3P9KA 2ZBKA 1ZAOA 4BNCA 3IDCB 4MGYE 4Q0PA 2DK8A 1OMIA 4KA4A 4UVAA 2V9VA 4U0YA 2Z99A 4KIBA 4P9UA 4WCGA 1YWKA 5D5XB 1JHFA 3N97A 2VE9A 2H6BA 4CGZA 1BC8C 3KSCA 4MH0E 4K2EA 1MJBA 5EFUA 5JSPA 3BOQA 2WTEA 4MNUA 4EGZA 3E3VA 3J81Z 3H1WA 1VR3A 2DPUA 3JTGA 4IRHA 3UKNA 4KWJA 4ASNA 4HF1A 1SD4A 3I7DA 2X4HA 3J80K 2OZJA 3BCWA 4A5MA 3KMHA 2L4AA 3ZN0A 3FX3A 4M6XA 3C7JA 1R1UA 2F5FA 3U2RA 4WBBA 2STTA 2QBYB 3FF5A 3ZPLA 4IEYA 5E1ZB 4B09A 4Q29A 5D4RA 4M72A 4MX3A 1IZ1A 1FP2A 1J0RA 1WSUA 3CEWA 1TLHB 3ZQ7A 5HS9A 2HOEA 1G3YA 2VC0A 2F4PA 3IDBB 3F8FA 3QPTA 1V4RA 1F5TA 1PP7U 5HLGA 2EK5A 1ZGJA 3ERED 1R7JA 4HX7A 4Q48A 3MZYA 1K6OA 2QYOA 3LA7A 4L9VA 3HRSA 1XCVA 2OZ6A 4N0BA 4TLFA 4ZU4A 5LEKA 5J6XA 1ZLKA 2XRNA 5FLJA 2ZNYA 4YARA 1K78A 3WTTC 5FLXZ 1VP6A 1J59A 4KNYA 5JHUA 3QP6A 1BI2A 1J7KA 1CAWA 4WXHA 4LG0B 2D1VA 2ESHA 2M8EA 4HBLA 1G3WA 2MH9A 1FT9A 3CUQC 5BOXA 2LKPA 2PAMA 3T1BA 4ONUA 3R61A 1AOYA 2Q1ZB 3D5LA 3KZZA 2GXGA 1LR5A 1YFWA 4YYOA 5JCTA 3KFWX 4HV6A 3KLOA 3CO7C 5T3NA 4KU7A 3CLPA 1T0FA 4YFKF 3EUHA 2A6HF 3CLOA 3U0ZA 5JFRA 2PQ8A 2OAZA 2DQLA 2KRFA 5CYVA 4WXCA 3ZMSA 4AVPA 3H1MA 3M9AA 4ON0A 4KFCA 2FSWA 3WODF 2VT2A 5FB2A 1ZG1A 3F8NA 3LA3A 2OU2A 2IRFG 2PLYA 2BYVE 5CVRA 4EQQA 4Z07A 1CF7A 2HR3A 3SXWA 4QWQA 3DKWA 4J1WA 5DD8A 2GH2A 3RYKA 4AXOA 4XLPF 2EJRA 3BDDA 1FY7A 3D0SA 4G7OF 1ZN2A 1ZZCA 3E97A 4KUMA 2K4JA 2CGPA 1D3YA 3CTAA 5ICEA 3I54A 4HBNA 3BY6A 1FBUA 3GEZA 5LGUA 5CU1A 2H27A 4UUVA 1OI6A 2ZKLA 3GX4X 2GC2A 3GYDA 2WC2A 2MA3A 4NQWA 3ACLA 3MAJA 3P7NA 4LEJA 5D5WB 3WTYC 2ELHA 2EFPA 3O6BB 3RZZA 4PIXA 3I59B 5CLSA 1JXSA 4M74A 2G7UA 2QVSB 4XFAA 4LFUA 4IEQA 2HS5A 4RGSA 3GO5A 4ETSA 1ZG3A 2QLZA 1ZZ7A 2QQBA 2M30A 5AIPA 2HTSA 3RDIA 4IRIA 1ULYA 2Y0MA 1P2FA 5FFZA 2X0LA 3I4PA 2JSCA 2R7FA 1REPC 1R5GA 1CAVB 3DEUA 3IRQA 5K5OA 5LBQA 3DL3A 3SCGA 5FPXA 2XUBA 4EWDA 4XFFA 2EWNA 5J48A 1F1ZA 1HXDA 3HSRA 3F21A 5K5QA 4WWCA 3HTUA 2XGXA 5LGNA 1RL3A 4XETA 2GU9A 1ZNPA 1QO0D 2UY8A 3I53A 3R0AA 2Q0OA 3MEXA 4JTNA 3I71A 3DPTA 1CAUB 4GCVA 1K7AA 4A6DA 2NNYA 5K1YA 3B02A 2F5EA 5BUVA 4YFNF 1EP0A 4MHGA 1GXQA 1WWXA 1U6GA 4BHCA 1DZRA 2L4MA 3I64A 1DGRA 1TW3A 1JHHA 2V6CA 4KN4X 4ZYDA 2RDPA 4XFIA 1UCXA 2IA1A 1IN7A 2CAUA 1OPCA 1TW2A 3C3WA 1RZ4A 4UV8A 3Q5FA 1FOKA 4O6JA 3JZVA 1IPJA 2VOOA 4KT5C 2JTVA 2ADUA 4PDKA 3HIFA 4A0YA 5C8WA 2W25A 2B9UA 4K8FA 2F5DA 1R1VA 3DP7A 2DTRA 2CYYA 3CDHA 2L3DA 5IT3A 4I02A 2XAFA 2P8TA 1EH7A 2QENA 1KQ9A 5LRSA 1OYYA 2PYTA 1P4XA 1BJAA 1V70A 1H9TA 2WV0A 2QM3A 1RGSA 2WFPA 4ZU7A 3TO7A 3FJSA 1KGSA 4UHTA 3V7CA 3ETQA 4QGMA 1UIKA 2A07F 2XLGA 1E2XA 5FQ0A 5L3CA 4MEYF 3PQKA 4I2OA 5FLHA 2MNGA 1D5VA 4N9IA 4HZFA 5JVTA 3GUDA 1UHWA 5E8IA 2B0LA 2O0YA 2IPQX 4PCQA 4KL1A 2JZYA 2Z69A 3KEQA 2PI0A 2EV5A 3SMHA 4LJZF 3M70A 3AAFA 4L0YB 3SCFA 2OQGA 2Q2EA 3FMQA 4B29A 2JRTA 3E5UA 4MTDA 2W84A 3C1DA 3KEOA 5E17F 1YW8A 1U3EM 1O7LA 3EQLF 3EETA 5I8TA 4U7DA 2CG4A 5CVIA 2Y75A 4N9HA 5D1IA 1RIOH 4UXNA 2BBYA 3NVCA 2RNJA 3B73A 3UKVA 4IESA 1KYZA 2K4BA 1HW2A 1SD6A 1UB9A 5HDKA 1J2XA 1QBJA 1LKNA 2QNKA 4S05A 1B9MA 3NKTA 3LA2A 4M6YA 3IKVA 4I01A 4KICA 2UZKA 4NVPA 3E5QA 1R23A 2GA1A 2OBPA 1X7NA 5I0UA 1FNNA 2HDCA 2GIVA 4L9TA 1YTYA 3NL1A 2DU9A 2ZJ2A 3EBRA 2EV0A 4XSZF 1UIJA 2LDUA 4UV9A 1TQIA 1B9NA 1MDMA 4CYDA 1PMIA 1O3QA 3K2ZA 2DT5A 4PGHA 5BPXA 2VN2A 3QU3A 3WTUC 2VOPA 4IEOA 1IXRC 3ZMTA 3MCZA 1A04A 5JR7B 1ZARA 2DI3A 5D5VB 3RKYA 5DYMA 4CZZA 1JGSA 1MJAA 4JVAA 2XASA 5AONA 2C6YA 4H7LA 5L3BA 2CAVA 4I7HA 3S2WA 3KCCA 2B5HA 6PAXA 4A0XA 5LEJA 4D7TA 2Z9OA 4OLLA 3L09A 4P96A 4WZCA 5L3DA 2Y0OA 4O9GA 4NB5A 4P9GA 4GULA 1SFXA 1F4KA 3QU6A 2VBWA 5L3GA 4G7HF 4BHPA 3H1YA 4AVCA 5D4SA 4RGRA 4XBFA 3PVBB 1J5YA 1T2KA 1OYIA 4BYYA 2GC0A 3M1EA 2XL9A 2PN6A 1YUDA 4HVQA 5JAXA 1QGPA 3CO6C 3J81K 5FO5A 4CHUA 1X8MA 4EJOA 4XF3A 4YNIA 4FT8A 2LSOA 4Q47A 1UW8A 4HMZA 3JW4A 3TGNA 2B8MA 4R52A 1FWZA 4EROA 2DW4A 4JTOA 1MKMA 1S8NA 3M7GA 2CV6A 5JSOA 2HQRA 4KWLA 2RN7A 1H1IA 3G73A 1NXMA 2O8QA 3IL2A 1D8KA 2OD5A 1U5TA 4M9SA 1J3PA 1EH6A 4LGWA 4IPAA 3KP6A 4UBGA 3PFIA 3Q9SA 5ICCA 4HV5A 3MZHA 1XGOA 1H1MA 1EH8A 3BWGA 4O3MA 3LOIA 1FC3A 2QUFA 3ECHA 1YFXA 2FNPA 1CAUA 2PBIA 4Z82A 4EVIA 3VFZA 4XF1A 4BHBA 1WQ2A 2IA2A 4L11A 3IKTA 3KP7A 1OYWA 5DCMA 4A0ZA 3I5UA 2VC1A 4L9JA 3O3KA 3SZTA 4IEWA 3NRVA 2OPKA 2IP2A 3QAHA 4MGZE 1IN5A 3EJKA 3VODA 1O4TA 1Z91A 3WU0A 3JSPA 1I6XA 5I8SA 2K27A 4FX0A 4ZYHA 1G3TA 4KIFA 2Z33A 2PTMA 1J9IA 1MD0A 2O8XA 3CL1A 4F8AA 4ZZLA 2PEXA 3OD0A 2FA5A 5DV5A 5IT9Z 4EJUA 1B1BA 3DV8A 1PUEE 2VT3A 5H20A 2G7HA 2O1QA 5HDNA 4RB2C 4GGGA 3FE5A 1D8JA 2HKXA 4HLTA 1EV7A 4YRDA 5F1RA 1ODDA 2LF8A 2YX4A 1TNTA 5JSRA 4O5VA 2XVCA 2KIFA 3SHFA 4LUKA 3MWMA 2JT1A 3ST7A 2D2WA 2E1NA 3FWEA 5D6EA 1HBXG 4ESJA 3W6JB 3COAC 5K5RA 3V8LA 3L9FA 1NYWA 3FMSA 1ONVA 3KP3A 2FE3A 1IUYA 2FXAA 3BU7A 1HQCA 3O14A 1XD7A 1XRUA 5E16A 1TQMA 5I91A 5AIQA 2HEOA 2FBIA 2ISYA 4HF2A 1OFNA 1FPQA 4RB1A 3SFZA 1BN5A 2KJCA 2P6SA 2I45A 2UYBA 4IERA 3L2CA 3TOAA 4LTAA 4EM2A 3LAJA 3FM3A 4R8HA 3HSFA 3DXJF 1ZREA 2GZWA 2GAUA 2VE8A 1QQIA 3ABUA 3BZ6A 4LA2A 5F64A 1LDDA 2HJIA 3BROA 1IW7F 3LQQA 4XF0A 1B59A 3RKXA 1K79A 2ZFWA 2R7DA 5DDGA 2PHLA 1USSA 3WW1A 4G7ZF 1Q3EA 4Y15A 3G7DA 4R1HA 1ZRFA 3V8KA 4EJTA 3GZ6A 1ZZ6A 2H09A 4AVBA 2XAGA 3K1MA 3J80Z 4LLLA 1SMYF 4LD5A 4HAMA 4LLOA 1S6LA 1QWRA 1ZH5A 3S7EA 2L54A 4JQFA 3HSEA 2O3FA 3HRUA 2NAZA 2KJBA 4GO1A 1ZZ9A 4YIFA 2FBKA 2HYGD 1W7PA 5ILSA 2ZO4A 2KIMA 4MGKE 2A69F 3H7YA 5LHHA 3F8CA 2ACJA 1Z9CA 4KU8A 3BB6A 3LFKA 3V7RA 2DPDA 3BJOA 1LDKB 1YW7A 3I0TA 4FHTA 2W85A 2IXLA 3IC7A 1DPRA 3KP4A 4HSJA 4A6EA 4P5OA 4MQVA 2P5LC 4Q0QA 3WG9A 3SHRA 3E6DA 1UFMA 4XRFA 5BS6A 3DPLC 4IVNA 3GZ5A 1O7FA 1TTYA 4IHTA 1IXSB 1G4DA 1SMTA 2PMUA 2BE5F 4LMYA 1IN6A 3EQEA 3W6KB 3H92A 2GA2A 3GXOA 4HX4A 3R0JA 4HF0A 2VQAA 1Z1DA 1DZTA 4QGNA 1DPUA 1XB4A 4U0VA 1YFYA 3DN7A 2CO5A 2P7VB 2ZMEB 3S7IA 2K0GA 5HS7A 1YLFA 4Q4ZF 5HDGA 4BAYA 1LEAA 2K86A 2ZKZA 1IAWA 1J3RA 4CXFA 4ESFA 3WU1B 4E2QA 3HYIA 3HT1A 2J5PA 1YFHA 2Q30A 1O3SA 1O5UA 4QM9A 4RD7A 1HKTA 3GFJA 2H94A 4OIOF 3FHIB 1SFNA 4LK1F 2LF7A 2UXNA 1G6NA 5CJ9A 3FZVA 3BALA 4CDGA
chains in the Genus database with same CATH superfamily
1BEV2 4M4RA 3RQ0A 2NS8A 4E7IA 1J83A 5A7PA 1WMDA 1YLLA 3TN92 2V26A 1S2EA 1R093 3T09A 2XAQA 1T98A 1NK2P 1STZA 2BGCA 4MGQA 3TEYA 3J7LA 3AG2H 4P02B 2WZR1 5FKNA 1NCQB 1BR4A 4IE6A 4MFEA 1REFA 1VMJA 4IE4A 3NJZA 2XPUA 2L9SA 1WCUA 2YV8A 5GPCA 4K1ZA 5F6FA 2A3XA 4SLIA 2P5KA 1VQ4I 4HKOA 2RQQA 1CQTA 4XM3A 3FMRA 1UG2A 3GVAA 2QQMA 5CFDB 1HSJA 1AJOA 4R9CA 3CMAI 4KG8A 3DXTA 1ULCA 1DP3A 3HQUA 2ZXJA 4HVRA 1OD5A 4ZDPA 1M06G 2F5VA 5I0RA 2E31A 1A5JA 4XJ8A 1W9WA 2XAHA 1JHNA 5D8KB 1W06A 2OKXA 2MW8A 3ZSEA 1VBE1 4JAAA 2VBYA 3LSIA 2XROA 2ZX2A 2JDKA 2VZTA 2VKVA 2M2EA 3FDYA 3ZXGA 1XC6A 2WBKA 4DQ2A 2QBYA 4J19A 3DXUA 4AM3A 2RS13 4NWVA 1XNDA 1ZRRA 1WW5A 3IM0A 1T33A 4G9YA 1QH6A 4KH9A 2IS4A 2DWRA 3ML6A 1OLQA 3DEWA 2HOSA 4QPYA 1QU3A 4XF9A 1SLLA 2VZ1A 3V4GA 4JX5A 3ZMDA 1OQDA 1FMVA 3UNGC 4BLJA 4TXWA 2WZR3 5BV6A 4Q4X2 3TEXA 2W24A 2R32A 3JU9A 1HQWA 1CIWA 1IJWC 2D40A 3EYYA 5GPAA 2FHRA 4ZZ5A 1LOAA 1WZ2A 3DBRB 4OVEA 4IHSA 4PZJA 2EFNA 2DODA 3TP3A 3HKZA 1MSEC 2K3FA 1GDTA 2CGOA 2CY6A 3QH7A 4E9KA 1RUH1 3APBA 4CYCA 1D1BA 3H9QA 5BXXA 2V72A 3VEPA 5J47A 5FMDA 4ENKA 5CKMA 2XSDC 3K75B 2WSUA 3KM5A 5ICGA 3OIOA 1R58A 1YYNA 1A8DA 5GZGA 2QVOA 5JUVA 4XXPA 1T0FC 4BH9A 2KDZA 2ETEA 2WL1A 4N53C 4CDXA 4AIHA 3TOBA 3WX5A 3AX4A 4XBLA 4C0HA 2STWA 3CHXA 5C5UA 4EGYA 1OA2A 3MIEA 2IXIA 3K1PA 1YFUA 3WDYA 3BLYA 3MF9A 3ZVXA 4XFGA 3BR2A 1VI0A 4WVZA 2CU5A 3WTXC 1IOAA 1WW7A 2YS9A 1HF0A 3LDRA 5IVVA 3M3CA 5JR3A 2B39A 3MDPA 2MC4A 1FSHA 5IW0A 1UOGA 2X5IB 4AWXB 4Y17A 4UB8C 3JRCA 4CUBA 4A3MJ 1R00A 3S2HJ 2OTJI 2VMIA 2HWVA 4YIRX 1RTVA 2W2IA 4B7EA 4U88A 2L9NA 4NN0A 5CQGA 1BJQA 4AZZA 3VHPA 1GZWA 2JENA 1MSFC 1VAKA 4AHXA 2JPCA 1CONA 3D6EA 1XDSA 1FTZA 1XMKA 1IRFA 4WVMB 3PUFA 1TZLA 3MIHA 4XLNF 2H1KA 4FX4A 3VBOB 1GXPA 4Q0UA 4L5IA 3HB9A 3PNYA 1QOSA 2QSFX 1RUH3 5A2QZ 4XQDA 3KLSA 4PF5A 5CKNA 2I5UA 1UQXA 3X2QH 3MYXA 2CYFA 2DVGA 1IF1A 1MMNA 3V64A 4W65A 4BL0B 3VBRC 3HDDA 4L8QA 2VOWA 2TCTA 2X9DA 1QJX1 1RUJ1 2A6XA 3GLXA 1VBB3 4RHV2 2NS0A 3Q8CA 2E9QA 5A33B 2A6VA 4UFMA 4CDQB 5FZGA 5IVJA 2G9ZA 3RZDJ 1IRXA 4AI3A 1UPIA 4OWRB 4QM8A 2P1BA 4QQ2A 2W39A 4D8MA 4K7JA 2MYSA 3FISA 1WRJA 2GDFA 4YIIA 1QNWA 4YVSC 1NA1C 3EDPA 2QSHX 2COMA 4I3GA 5JZGB 1IZ3A 3ZR8X 1HC8A 2E19A 4DUWA 4G3YC 4CCOA 5HOOA 2XGEA 4Y13A 5J7MA 2QQWA 3VDDC 3N7MA 2PQQA 2Z5UA 4AU7A 2YPJA 1C8NA 1OT5A 5C8CA 4XAEA 1DZQA 4NPMA 1SLCA 3LNQA 4QDRA 2RHPA 3LDBA 5FZ9A 1KFXL 4L92A 1WHUA 3B9CA 3OYAA 2YX7A 4JRAA 1IGOA 2F4OB 1R5HA 5DUIA 4QB2A 3NAPB 1QNYA 4IGQA 5L3FA 1AKHB 4XOPA 3C7GA 1NQJA 2EB7A 2AEZA 4Y1UA 2MABA 4B4RA 2ZX1A 1ODNA 3J7AO 3ACFA 3O2PE 2BV4A 3BPXA 3WDUA 1TWGJ 2HZTA 5FCCA 3KGZA 4CICA 1B09A 4GKXA 1B72A 1SFUA 3Q8BA 1W5TA 1QJX3 4NC8A 1RUJ3 1J1LA 3FFZA 3WV6A 2MH2A 4OI1A 2GN3A 4NIAA 3CUQB 3LPGA 4M01A 4COUA 4TSVA 1T38A 1IS4A 1DDNA 2KIQA 2D3RA 5A3UA 3JB4C 3F22A 4QIWN 3MIGA 4AQ6A 3ITQA 4UW5A 3N9NA 4RAGA 2CQKA 3DPUA 3GTPJ 4EMSA 5FZHA 5FUIA 4YG0A 1UY3A 5FFXA 4AQTA 1PGSA 1C8M1 4QXKA 2E7XA 5FP3A 4QXBA 4HLXA 3WG4A 2LP0A 3WNOA 1VBD1 3B9IA 4XJWA 3H5AA 5C4JJ 3S17J 1J58A 1A34A 3DU5A 2P4EA 3VYUB 5JR2A 1GBGA 2GMPA 2K9SA 1U5ZA 4PF1A 2V7FA 5CZKA 2W68A 2LTNA 2M1BA 1FMD1 3DGTA 4AGGA 3CCUI 2LMDA 2RS51 3GXUA 5C7GA 3U9GA 5M5XJ 4RAYA 5CIRA 3VDAA 4XUTA 2VXDA 4NPLA 4R79A 1OPMA 1ZZBA 3AYAA 3UNPA 2ORXA 3U37A 4FVVA 4LHNA 4HYEA 2LALA 3NJVA 5L19A 2M87A 4YZ1A 1GR3A 2W57A 5C9AC 1IXCA 2IT0A 4ENJA 1JYCA 4EJVA 1SDWA 4LB5A 1WJAA 1SQ4A 2ZGOA 3QQAA 1V3FA 4F7ZA 2DT6A 3H36A 3HTSB 3DBLB 1W04A 2VO5A 4AVAA 1HW5A 4OULA 2DQRA 1AR83 5DEQA 4AD9A 5M0TA 3ZMVA 5FZKA 2L0KA 2XUMA 4XL9A 4HPKA 3I4IA 4RLFA 4DZPA 3EO6A 1BBT1 4YPJA 2L7KA 1A35A 2QCOA 1F5FA 3OBRA 1ZGWA 2Q1FA 3CCEI 1C8M3 4ZZDA 2EA7A 2DTYA 3ETPA 4DXZA 2CQNA 1VBD3 2IW5A 3VYRB 5AFEA 5IFTA 3K48A 3WQBA 4JYKA 4YG3A 2R1DA 2KRHA 4OMCA 4IGPA 1YX5A 4GH4C 1RI7A 2C9KA 3ZOBA 1FMD3 2E1MC 2TDXA 2RS53 3V42A 3NNLA 1NLRA 2DYCA 3A22A 4ZDLA 3WEZA 1AR91 3M07A 3BTAA 1ULEA 4AEDB 3F6VA 1YIFA 4AAXA 2Q5TA 4FE7A 1GP6A 4CUGA 4PFOA 3I2GA 1W5CC 4E2GA 2FJ1A 4MXWA 4YW5A 3N7LA 2V4VA 5FYUA 5KVRA 4N7IA 1NT0A 1F9NA 4L5JA 1URXA 2DUPA 2P5VA 5M3FJ 3AL5A 4RB3C 3LEIA 3KVBA 4DMIA 4QGLA 3GLLA 1W6QB 1K45A 1IN4A 2O6GE 1Q56A 1JS9A 2WN2A 3KYLA 2DTZA 4XFHA 2PFBA 3PJRA 2KIUA 4LK0F 3OYEA 3VBFA 2VZ3A 4NIDA 1BBT3 2D98A 3GFLA 5J4YA 2HOAA 5E8GA 1LULA 4QB1A 2UYAA 4I76A 4M9XA 1NCQC 4UBHA 4X0GA 2V1XA 3JD72 5GLWA 3ASOH 2BTVC 4E7JA 5DMYA 2F2EA 3HOSA 2F4MB 3MFKA 2WYSA 1S3JA 2XLFA 1ZBA2 2CU7A 1OF4A 3MUY1 1LE8A 2L7MP 1X9PA 1XPXA 5KHIA 1IKQA 3VPRA 3TMOA 2AO9A 1ZELA 3J8F2 1FI2A 3TDZC 2JD4A 4JK1X 4C8DA 5EWSA 4KMFA 1V9U3 5HI0A 4RM2A 2XAUA 4ZHNA 3I97A 1AR93 4LBQB 4PDWC 5FPLA 3BOWA 3HPNA 2AEYA 5I0SA 5EGOB 1MZBA 3IAQA 5B2GB 1CVNA 1EYBA 2RM23 2XVGA 3T0DA 4AQSA 4ZH4F 2VBPA 1W90A 1NY72 2QQ9A 4RFT0 5KXBA 1QJU2 2L5QA 5DD4A 2JB4A 2G4IA 3PQJA 3W21A 2G19A 2FNAA 1W5SA 2IBDA 2V79A 1R64A 2L01A 4K40A 4YW2A 5KCMA 1RB8G 2VOXA 4M3BA 3NV1A 1H2NA 1XNCA 1NZIA 3WG3A 3I4MJ 2K5CA 1OOPB 3WTZA 3OF1A 1DUXC 2BBVA 2ZNZA 3K2AA 2QDRA 5IP6A 3O12A 2F48A 4CU7A 2Y6LA 2XBO1 3ILNA 4QPWA 1ZBE1 2A1XA 3HM5A 2VAUA 4QQPA 3SZPA 3HEIA 3IBMA 2HEWF 1GV5A 1GZ9A 1XS9A 2JIGA 1Z0XA 1OKQA 5I93A 2DO7A 4ZS2A 4GJZA 4AVVA 1QHHD 2JEMA 3CF6E 5LA2A 2QQLA 1PYVA 5FIXA 1DHKB 1NAEA 3E6BA 5CQEA 1V6OA 1Z3XA 4H55A 1V5EA 3ONQA 3GZAA 2A6EF 1BVP1 1JZ7A 5BNPA 4RR3C 2DFFA 2EXIA 1SD5A 1CF7B 3CO2A 2D45A 4BK4A 2WO7A 5A2QK 4ASKA 5HV4A 5J37A 1N1YA 1ZQ3P 5IYCJ 2Q8EA 2DK5A 2LY1A 4QHZA 4IV3C 4CCCA 2ECCA 1RR7A 1UZWA 3IAPA 1T6BX 4JGZB 1K83J 2GIZA 4ZXEA 2WA3A 4A7KA 1YIJI 3RZJA 2R071 3T8TA 4QPGA 4D0PA 4NHJA 2Z42A 5E1XA 1W39A 1NE6A 5A3NA 3AMPA 1LODA 4MFDA 1KQ0A 2ZJCA 3SLIA 5FV3A 1P4WA 4HQEA 3USUB 1CIYA 4XMIA 4G6TB 4FFHA 2WNUB 2IVIB 1HKQA 1VBC1 4IEUA 1KQ8A 2LBFB 1J1TA 2WR9A 2XJQA 1V54H 4GMP0 2XBO3 1H9GA 4QWNA 2N7GA 4Y20B 2OYZA 4IXAA 4A2UA 4FETA 3SCHA 1ZX5A 1AR72 1YOVB 5C70A 4DINB 1KU7A 3F8BA 3CCJI 4RGXA 5K7HA 5FYYA 2VASA 1YQCA 2DVDA 4CEYB 1WWYA 1XNTA 2V09A 1TC3C 3PU8A 1XE7A 1R1A3 1UN1A 2R7VA 3ZXLA 3ASIA 1IUFA 1FIAA 1UU4A 4A12A 3PLQA 1RHI1 2NRAC 3WE2A 2JX9A 9ANTA 2JDUA 4EWAA 4GAZA 2QGUA 4JHTA 1AR62 4QU2A 2WB1A 2WLPA 3P9KA 2WUHA 3IDCB 4MGYE 4CDWB 1YJLA 4Q0PA 1U5XA 1HN1A 1OMIA 3WF4A 1FNYA 3BPSA 1QVUA 2V9VA 4U0YA 4OUEA 4DUXA 3S2DJ 4KIBA 3PIOF 4P9UA 4WCGA 1D2SA 1YWKA 2J1TA 1JHFA 3VKNA 1DLCA 2W08A 4XHBA 3N97A 4BA6A 4ZXKA 5FO9B 1QZEA 1QJEA 2R073 4MH0E 2DYSH 1OCCH 4FFGA 4M4PA 1TWCJ 3BOQA 4MNUA 1KD7A 5CFDA 4XTMA 3E3VA 3J81Z 3H1WA 4BDZA 3ZN5A 3S5QA 2DOAA 3WR0A 4ZPIA 4B3NA 1NKGA 1VBC3 2W1QA 2HLEA 4KWJA 4ASNA 2X4HA 3EB7A 5GZCA 5C3RA 2OZJA 2R061 4AFBA 3KMHA 1FJLA 4CCJA 3H1CA 1G9AA 1LOEA 4V2VA 3DYOA 3Q0VA 3FF5A 3IB3A 4IEYA 1SACA 5DDJ1 3OYIA 5LA1A 3A0BC 5D8AC 1BK0A 1FATA 1FP2A 1TLHB 5HS9A 2ZPXA 3G71I 1RHI3 1G3YA 1OCRH 4LIVA 3IDBB 2F4PA 2M7BA 1HLCA 2NVYJ 3BT9A 1V4RA 2HVQA 2XR4A 5HLGA 5GADJ 2L9LA 5F32A 2RS12 1D4M3 4HX7A 1K6OA 3LA7A 1SBEA 1WLWA 4N0BA 2XRNA 5J36A 2Y6KA 1B8IB 1F4HA 1OKOA 3PU3A 2WQ8A 2DUOA 2MEV3 1LHWA 1DU3D 4Q4W1 3QP6A 3LSPA 4LG0B 2O7OA 2WYFA 1ZTRA 2ZXWH 2WZR2 4HBLA 2EINH 5DAXA 1FT9A 3CUQC 5BOXA 2PAMA 5EJ1B 4W97A 4ONUA 1Y4WA 3R61A 3ABZA 2R6QA 1ULPA 5FY5A 1F9KA 2W48A 4RS5C 5J09A 3GCMA 3K4ZA 1HA8A 3CO7C 5T3NA 2EIJH 3CLPA 2R063 3D3AA 2A6HF 2OAZA 2DQLA 3HD8B 5CYVA 2ZB9A 1Z78A 4AVPA 3M9AA 4KFCA 1AXZA 2VT2A 2LFBA 2BPA2 3HOUJ 1MPXA 5DDJ3 2BYVE 2JKXA 3SXWA 4OI2A 3AL0C 1N25A 5CKQA 1SVMA 3RYKA 3VKLA 1ERDA 4Y1VA 4CDXC 2R7OA 4C2UA 1D3YA 3CDIA 3CTAA 1FV3A 3D5RC 3GEZA 1GNHA 5FY7A 1LOFC 3GYDA 2ZEZA 5EYRA 2KZVA 1LVKA 3K4LA 1GV9A 2L2OA 4BM8A 2X5IA 3P7NA 3C7OA 4LEJA 2VZOA 1MS1A 2ELHA 3RZZA 1LHUA 4DJAA 3INAA 5LBCA 5IWFA 4R9DA 4LFUA 3FXLA 1OFSA 3MUZ1 4XJZA 5A7WB 1OD3A 4Q4W3 4XUQA 3THCA 3AXEA 4K8RB 5GKAC 5H9PA 5FWJA 3VD7A 5KC5A 2M30A 4GWNA 5JVGF 3QD6A 4WVMA 2IFWA 1P2FA 3POWA 3VBOA 1KITA 3I4PA 3FMGA 2GM4A 1REPC 5FY8A 1R5GA 3HGYA 2QFEA 3SCGA 1WJFA 4FPGA 4EWDA 3LD8A 4O7XA 4XFFA 4AHYA 3RWKX 1F1ZA 3HSRA 1TNRA 4U87A 4BE2A 3HTUA 2GNTA 1DGRM 4F92B 1RUH2 1BL0A 2GU9A 1ZNPA 1TT0A 1OCOH 2LY9A 3I53A 3PO3J 3P3PA 4NWWA 3A4CA 1NTCA 5A33A 2CRGA 4D6SA 2VH9A 1ENXA 4FE4A 5IVYA 4CDQA 1EP0A 3O8HA 2HQAA 4MOAA 2H8RA 1UYPA 1VBB2 3N9LA 2L4MA 1HKDA 2Q8OA 1ENHA 3D8CA 3CCYA 2ZC2A 4BE1A 4AGVA 2IA1A 1OPCA 3PIJA 4PLMA 3LGRA 2Z4FA 1RZ4A 4UV8A 3Q5FA 1FOKA 1O4XA 4I6ZA 3CZ6A 1ST8A 5JZGA 2D6LX 2X85A 3WINE 3ZSJA 2LROA 1R4MB 1V6NA 4LBJA 2ADUA 1R5ID 1S0EA 5C8WA 4BQQA 2ZMLA 4P1WA 2L7ZA 2B9UA 5DZEA 2BVLA 2R7WA 3WQ1A 5A6XA 1K5JA 1RVF1 2DTRA 5IT3A 3O1TA 4DYRA 3PJQA 2P8TA 5KAFC 1KQ9A 4MYEA 2PYTA 1V70A 2VG9A 5A3PA 3A2KA 1KGSA 3V7CA 4QGMA 2WNEA 2RNGA 3MN2A 2LW8A 3HNMA 2YGLA 3HQRA 4IV1C 3NWTA 1ND3B 4IHVA 4KG0A 2VTXA 5FY0A 4K1YA 4Q27A 1JHJA 4HZFA 3WHTA 3FBNB 2FDFA 2B0LA 3RZHA 2IPQX 2JRMA 3HN1A 5IT6A 5FZEA 1MMSA 2R1BA 3M70A 4QTRA 2OQGA 5GAEJ 5L7OC 4B29A 1U0JA 3CQZJ 2IAIA 2BQPA 1LFPA 3KEOA 5E17F 4X6AJ 1RUJ2 2K9MA 5CPRB 4JDNA 3RCOA 1K5MA 4OUSA 5AC91 3EQLF 3HXLA 5I8TA 2JK3A 2Y75A 1U8BA 5JLVA 1OCPA 1VQNI 1RIOH 2VQHA 3NVCA 5IK7A 4IESA 5GLZA 2ELKA 1SD6A 3PSIA 2Y6GA 2E35A 1QBJA 4LKSA 3KV5A 4S05A 2ID3A 4KICA 3FXMA 2OBPA 4CEWC 3OBZA 1A3KA 1PZ8A 2WT1A 3NWSA 4FI9A 1XYPA 1G9DA 2LS6A 1TQIA 1PMIA 2DT5A 1C1LA 4AI0A 5CFCB 5BPXA 2F4IA 3KX2A 4XAAA 1X2MA 5HNFA 1DIWA 2EIBA 1R1ZA 5HPOA 2HVRA 1UZYA 5JXJA 3ZMTA 3N9OA 1ZARA 5D5VB 4M0NA 3RKYA 4UFIA 4XUPA 3I2IA 1MJAA 2XASA 2OPWA 1C57A 4GXLA 5DG2A 2B5HA 4A0XA 5LEJA 4D7TA 2Z9OA 4N43B 2E7TA 4WZCA 1HX6A 2Y0OA 4O9GA 5CNAA 4OHXA 2RR11 4LMFA 3HOVJ 2D7FA 3QU6A 1IS6A 3ZPYA 5FZ4A 3IDAA 2Y30A 4XBFA 3SEEA 1AR82 1U0AA 4C9YA 1G2HA 1OYIA 2GC0A 3BQYA 4WM7A 5ANQA 3JBG1 3A21A 3I55I 2XH6A 4BEHB 2X6OA 3J81K 1UOFA 4CHUA 1C8M2 2JG9C 2YPDA 4YNIA 2LSOA 5FROA 4HMZA 1VBD2 3TGNA 2B8MA 4R52A 4HK8A 2LK2A 2R7UA 2DFEA 4QKFA 3G73A 4NRPA 3I3LA 4M9SA 4OHYA 5FXXA 1FMD2 2HEYF 2RS52 3PFIA 4AEDA 3KQRA 5FBJA 1U5YA 5ICCA 2XGCA 1YRZA 1EH8A 3BWGA 3LOIA 3MLKA 1FC3A 3ZQGA 4YEJA 3ECHA 4KMQA 1F8VA 4EVIA 3VFZA 2IA2A 3KP7A 2HWB1 4A0ZA 4IOCF 1IV6A 3O3KA 2DFCA 1W6QA 2IP2A 3QAHA 1XJAA 1BR1A 3VL9A 2QQNA 4H2AA 4IE7A 1YC61 2DXIA 4IOAF 2RR13 4FX0A 3U1KA 1A36A 3MF6A 1JYNA 4XN3A 4F8AA 5IT9Z 4EJUA 1B1BA 2Y2ZA 4UT5A 2WRAA 3RZLA 1S5LC 1BBT2 2O1QA 4HFSA 2F17A 1B35C 1W8ZA 3AVRA 4U2AA 2EIEA 3FE5A 1D8JA 2ZGPA 1N1SA 3FK6A 1ODDA 3E7LA 4PJMA 3B7MA 5FZCA 2XVCA 2KIFA 5EYYA 3MWMA 1S2KA 2X09A 2JXAA 5A1FA 4LHLA 3PJYA 2WO1A 4PLNA 2P3YA 1KFUL 4LQRA 4OUMA 4LOTA 3RFRA 3WY6A 5IK5A 3BU7A 2JA8J 4LBQA 5E16A 5K0UB 5EGOA 2HEOA 4HF2A 1VLNA 5A80A 4RB1A 1V9U2 3SFZA 1BN5A 2I45A 4IERA 2AUYA 2VVFA 1AR92 4LTAA 2D43A 2LVSA 4Q1PA 1Z7LA 5DTDA 3FM3A 1ZREA 2GZWA 2VE8A 2DOEA 3BZ6A 4A7ZA 5F0CA 5F64A 1LDDA 5FYIA 2RM22 1IW7F 1B59A 1QVTA 4GJYA 3UR3C 1OOPA 2JA5J 2PHLA 4CCNA 1DGRN 3WW1A 4Y15A 3LSMA 3G7DA 3THDA 1ZRFA 1WBLA 3RRDA 1WJDA 4AVBA 1H2LA 3K1MA 3CLQA 4YG6A 3J80Z 1UMZA 4LLLA 4LD5A 1H8TC 1S6LA 1ZH5A 3S7EA 4LO4B 1SFPA 2KJBA 4GO1A 1ZZ9A 1NG0A 4AL9A 2VZVA 2VQLA 4DB5A 5SV8A 1GVDA 3H7YA 2ACJA 4NAMA 4BUPA 3J7AY 3PSFA 1PX4A 4KU8A 4XKWA 5LY2A 2DPDA 4DOZA 2DA5A 3KP4A 2JJ7A 4A6EA 2R0QC 2P5LC 4Q0QA 3NNFA 4B1MA 2WKKA 5C3PA 3CCVI 1PK6C 2RDRA 1GNYA 3SHRA 5B4NA 2JDPA 1UFMA 3K46A 4IDZA 3WNXA 4KT6A 4IVNA 4XUOA 1P7IA 2OT7A 1MBEA 5F3GA 1O7FA 3HC7A 1TTYA 4IHTA 1IXSB 4JGZA 1HIXA 3W20A 3EQEA 3H92A 1X4OA 4O61A 3GXOA 3TW6A 2KD7A 4B4QA 3DTIA 1SEUA 2VQAA 1OVSA 1Z1DA 1KJRA 1XB4A 4U0VA 3G6JB 2O9LA 1ETWA 2J7MA 4DNYA 2ZMEB 4COZA 3USUA 2M0CA 1UKGA 1WMFA 2WNUA 5L9BA 3BG3A 5HDGA 1J3RA 2WWJA 2LBFA 4CXFA 1FPN1 3N9PA 4ESFA 4XHXA 3VBUB 1JUIA 3VD5A 3T0BA 4Y20A 3AZXA 4TN7A 2Q30A 4UF0B 3V65A 4JDMA 1HKTA 5JVVA 1UKRA 2XBO2 4OIOF 2O0OA 5J3LA 1G6NA 1KZHA 3FZVA 4ES9A 4YRVA 3FC0A 1HDDC 4PT6A 3GHNA 1XBFA 4PHZA 3DF8A 1W03A 4BQYA 4XQ4A 4BZ4A 2EA2A 4XSXF 4HOBA 1R1A2 3CMEI 3ZSKA 1F5JA 4CU8A 4XFBA 1BIBA 2BOIA 1R22A 3GBWA 2OV7A 4AYBN 1V00A 3E1F1 2QQUA 1XMXA 4CDWA 1LJ7A 4E27A 3NRUA 4HNUA 4HNVA 1HSTA 1U5TC 2RKHA 4AVSA 2FQPA 1MIJA 2E1CA 5DUUA 5GZFA 1ZRCA 3OPWA 3D0JA 1LQ1A 2ZSHB 4IQ4A 3WDVA 5E18F 3BPZA 3NQHA 3SFIA 2C0ZA 3K4MA 5T54A 3S0MA 1Z7UA 1DQ0A 4TZDA 5CADA 3GW2A 4BXSV 2VXZA 1H6XA 1B4AA 4C2MJ 4XPVA 2TNFA 2O03A 3LQCA 4BXXJ 3EUKL 3VB9A 2R072 5FZDA 1RC6A 3A0KA 1G3SA 5IHRA 3H9JA 4X6RB 4CCKA 4PI2A 4CXXA 5IVFA 2AREA 3F2ZA 1VBC2 5KHHA 4MQ9F 2GNBA 2IS1A 4BXFA 3N3HA 3VSLA 3RI8A 5E1WA 3R4KA 1SAXA 3MO4A 3QACA 4AQ2A 4MGRA 3FXQA 4ABZA 3B01A 3X29B 4NO4A 1WJ5A 2HZDA 4OQ8A 1MNEA 1FNZA 4FAGA 4FSJA 1C1FA 4ISRA 1H1AA 5FKOA 3P9CA 4FTEA 2ICWG 3F8MA 2X51A 3CP8A 3CU7A 1Q8VA 2IXHA 1W9FA 1RHI2 3IKWA 1S7OA 3HWJA 3TKYA 2FDHA 4OIPF 5FK8A 2FMLA 3RQIA 2VW2A 4E4HA 2XL7A 1TMF3 2FDJA 3KP2A 5M3MJ 2DOFA 4HG2A 3S5AA 1RNLA 1D4M2 2JD9A 4IETA 1B8IA 4PIYA 2OA4A 3R4SA 3ZM8A 2CFXA 2FDIA 1C4RA 3MPBA 5J8CA 2HWD3 1JU3A 1GQGA 4LG0A 1MGTA 3MV11 3WF1A 3UV9A 1EKEA 5F3IA 3AYCA 2PAEA 1ND2B 3LCPA 2MEV2 1BW6A 3LFUA 2EA4A 1BI0A 3GTQJ 2XJTA 3K3OA 2D5HA 2QQ8A 4BQ1A 1W3XA 3RMYA 2M8GX 1ZM1A 4B44A 4QX1A 2RG4A 3BI3A 2DDUA 3KCYA 3R4UA 1MQTC 3FUQA 2PLV1 3AKSA 1P4AA 3QPSA 4XZUG 1GU3A 1T39A 3LZZA 5FRAA 4UVBA 2PFWA 1JZ6A 4MZUA 3CJXA 1E5RA 2WT2A 1VBA1 1K12A 3LIHA 1R36A 1W8NA 1QXRA 1NQDA 1T6GC 2A6ZA 4QDSA 3G1MA 3J9SA 2WABA 3RZKA 3LWFA 2ZS6B 5DDJ2 1OR7A 4LB6B 5A32B 2VMCA 1QXJA 4L18B 3K4BA 3RYRA 4XONA 2VQUA 1XSDA 5FZ7A 3F0CA 4XICA 4G8XA 1D1AA 2QQJA 3DF0A 1RUF1 1SLTA 3IH2A 3T2QA 1POV1 3A0HC 1VF9A 1PVC1 5TGTA 2D6PA 2A61A 4EJWA 2ZXQA 2A68F 5A7WA 4W6WA 3E0JB 2WNVB 2ZEYA 3VBHC 3OYJA 1W6PB 1O57A 4AAPA 4ZZ8A 4CO8A 3ZN1A 4Q4W2 3BR5A 4Z2WA 5E6HA 3BU0A 4XLCA 4OOIA 2CUFA 3MICA 4A4AA 4GB31 1A78A 4XJAA 1WJCA 2VPVA 4DXRA 2W95A 1OJLA 3R60A 5BY5A 4YW3A 5F2WA 4H0EA 4FTBA 3LPFA 2JICA 3RZOJ 1IQAA 3ZXFA 1VBA3 2E2IJ 1XU2A 1VQMI 4UWDA 3CCRI 3L9JT 2YSRA 1DCSA 5LGTA 3ZRGA 4KJZA 1WA4A 2B4KA 3ES1A 1TWHJ 3ZQCA 1NG6A 4OZOA 4NC6A 4B4PA 4FCAA 2YUSA 4DY5A 4CP0A 3GFMA 4G94A 1VB4A 2XQXA 4YW1A 2EV6A 3IIIA 4H4KC 3KEYA 2W87A 3L2WA 1KA8A 5LA0A 2OA2A 2HOTA 4ENMA 4WM8A 2W92A 2KXLA 4RGUA 1F2NA 1POV3 3JRAA 2JVHA 4KIGA 1ETKA 3R6SA 1PVC3 3I3MA 1SLAA 3WP3A 1PVEA 5E1RA 2DCTA 1LAJA 1O3RA 5BPIA 5KXEA 5JI6A 3BR6A 1WLTA 1AHDP 1XSXA 4FPHA 3RIRA 4GYIA 3BTJA 3RKWA 1BIAA 1FXZA 3M3QA 3O1OA 3T1LA 3C7HA 4GB33 4LLNA 1MS4A 3OCPA 3VBSB 3E6MA 3L2QA 1L3JA 3AKPA 3QPHA 4LHSA 2ZZJA 3ZKYA 1HB1A 3RGBA 3O1MA 2JA7J 1W2OA 2A6YA 1F31A 4U0WA 4BACA 3RYPA 3AMQA 4JC1A 4A3IJ 4QX0A 3HRTA 1GHCA 3RJPA 3CD6I 1BMV1 4PQ9A 1LNSA 3HNYM 5A7OA 1P92A 1OSGA 2Y31A 1CPMA 2RV9A 2V1NA 2M0MA 4GWMA 1BOAA 4S0HB 5C4WB 1Q5OA 4P55A 1FOD1 1BI1A 2ISZA 2E2JJ 1UYXA 3V0BB 3I2HA 3LWCA 2AENA 2R7RA 4B43A 1ZLJA 1VQ6I 4XOGA 4KNCA 5IVCA 3JR9A 2XB6C 4R4XA 2HWE3 3ZMOA 1WH5A 3KZYA 2GP3A 2B9SA 2FZ2A 4GDFA 3M7AA 1ZYRF 1H0MA 2CFOA 2L02A 2HDWA 2DT7B 1PHMA 1QPIA 3WQ0A 1YCIA 2XGDA 1NUKA 3V8JA 4DBQA 5FMOL 3BODA 4DBRA 1Q8OA 2HVSA 2ES3A 2NMOA 2H8WA 2A5YB 3ECOA 3C2BA 4KYWA 3KV4A 4MGTA 3C18A 2IC1A 2GBYA 1Y1WJ 3OWTA 3M3IA 3WNNA 4D5CA 2WY8Q 1QKQA 4QKDA 5FK7A 4LBLA 2FRHA 4WX9A 3TO9A 3GMEA 4JCKA 2NP0A 3CNAA 3QLQA 2PN5A 1Y0NA 3T5XA 1RESA 1Z67A 4AK3A 1WCSA 3BR3A 3M8JA 5ERLA 4AI1A 3M1HA 4MADA 3VB2A 3I4NJ 2YHJA 2P34A 3H5RA 2Z2SB 2JWTA 4A3JJ 3K0LA 1RUI3 2WLQA 4ENNA 5BNNB 1YE9A 1LEBA 1H30A 1Y0UA 1I27A 4D9JA 4BCUA 4CTEA 4GWJA 3TEDA 5I0DA 3ZFEA 3H7JA 4N4NB 2BY3A 4XQWA 5FPBA 4COYA 3WW2A 1YS7A 4CVUA 3WTVC 1HN0A 1LDJA 2ZHLA 1S9HA 1UELB 3SZGA 1MS0A 5L36A 4L2NA 5DCMB 4UW4A 4BBRJ 2M45A 2FBHA 1LB2A 3GZUC 5DAWA 1VFCA 2BNMA 5K7PA 2Y0IA 3LSGA 5GP9A 4LUMA 1N75A 1P8JA 1VRH3 2ZFUA 5CEHA 1XN7A 2KKOA 3PVOA 3HBKA 2VTXJ 4CPBA 3ZMUA 2E7AA 4YELA 4XNFA 2NYXA 2VKEA 2RR12 1IPSA 1KU9A 1O5LA 3WE3A 1I1SA 2OUMA 3K4NA 3WXPA 4YZ3A 1UD1A 3VOEA 4M00A 1NG7A 1PNGA 4LE4A 1TME1 2AYHA 1DFQA 3WG2A 3WDWA 5HXMA 3AG3H 5KK1A 4FOQA 2YU3A 4XN0A 4QPIC 5E20A 2BW3B 3D82A 1WGXA 2DBNA 4XDOA 4JZRA 1MZ6A 2J5OA 2XB0X 4OMZA 2GN7A 2WIIB 5FZ6A 3KETA 4L0PA 4RDUA 4IEZA 4Q8LA 2ARCA 3MV01 2DUQA 1K78B 2LKXA 2Y48A 3LL7A 2DMQA 4RQPC 2BU9A 1AU7A 3UGHA 4E4DX 1XE8A 3NW4A 3JRFA 1XU1A 3WGGA 2G1MA 1BBYA 3SQNA 3ES4A 4A5NA 4OIQF 3WVJA 2R041 3DTEA 4FBFA 2RREA 4BQ5A 5ED4A 5FD6A 2WO3A 2PHFA 3ZIXA 2LD5A 2BY1A 1VMHA 1KQRA 1W2TA 3VGIA 2CNAA 3M4FA 1W6NB 1I6HJ 5CVUA 2VODA 4N53B 4UNOA 2UXXA 3GWZA 1FOYA 5LD2C 4QMAA 5FPUA 1LHVA 3WTSC 1MVQA 3TQNA 5DUKA 4B1LA 3HJEA 2XLAA 2ET7A 4NBQA 4JKKA 4NOTA 4XLEA 3PFYA 4GQ7A 5E88A 1JYIA 5I0TA 3CDZB 3VLBB 3GALA 3M3OA 3G1OA 5A7QA 2EVXA 1UAAA 5GLVA 4BQAA 3ZYGA 1RUOA 1E57A 2RC4A 5IVEA 3VZKA 1S7AA 1RUD1 1EY2A 3DUIA 3NV4A 4BIFA 4KDPA 2E34A 4YWAA 3WW3A 1ZHFA 1WW4A 1OF3A 2GOMA 3HQXA 4JGYC 1LENA 4P9FA 2DFIA 4Q5SF 1ETXA 4XIKA 4ZU5A 1R081 3HPGA 2E7QA 2MHFA 3USSA 3CJNA 1SEFA 2PHDA 2ZMEA 4O9EA 3CUOA 3OY8A 1TNFA 4Q0VA 5IY5H 2R043 2VQTA 4XQFA 4Y5TA 5A1AA 1QDOA 5F5QA 4J00A 2P4WA 2E53A 3VBUA 3VBRB 3ZQHA 5FKCA 1S0CA 2YB7A 1TG7A 4UF0A 3M8FA 2VQ0A 1GOFA 4DRVA 2NXNB 1JKOC 4IEJA 2HYKA 5ACA1 1REDA 2XPJA 2AQFA 3NQOA 3LIGA 5LCWL 2DVAA 2VM9A 1X3UA 3SXYA 1CJDA 1IRZA 4UYBA 3H8OA 5T50A 3ELNA 3M8EA 1O4ZA 4Q4V3 3AVSA 4YVSB 1NA1B 1W7PD 1NCRA 1ZAOA 1GANA 3G1LA 3MIFA 4QX2A 1NX9A 1ENSA 3FXJA 1AYN1 1IKPA 5HCAA 3VDDB 2GH8A 1RUD3 3S1NJ 2KHMA 1QJY1 3GTLJ 1I1EA 2CW7A 2VE9A 2H6BA 2PHXA 4CGZA 5HLTA 4K2EA 2BY2A 3VWBA 1MJBA 5JSPA 1U9NA 4AI8A 2VKDA 1IV8A 3IP4B 3H8RA 4EGZA 2WA4A 3KWVA 1R083 2VGDA 3BIEA 4QDQA 4Y22A 3HN3A 1XC5A 3A4UA 3S30A 5IYDJ 2J1EA 4IRHA 1QGLA 2BY0A 5KAIC 3GF6A 3UKNA 2GNMA 4HF1A 3I7DA 2WADA 3QH6A 1W2UA 3ZN0A 1PM4A 2LKSA 4M6XA 3C7JA 2F5FA 3U2RA 2FMDA 1SCRA 3IH3A 1AL0G 3IAS2 2STTA 3ZSMA 3ZPLA 2XONA 4YGBA 5ACA3 4FASD 3KS7A 1UYYA 4M72A 1GZTA 1J0RA 3OPZA 2CWMA 5IAXA 2L9RA 1C28A 1JT0A 2QQKA 4E7HA 5IOYA 2DA4A 5HCBA 2WBMA 1MBFA 2ELJA 4XDPA 1NK3P 4L9VA 1V5FA 1U9OA 2KA3A 4TLFA 2OUJA 1Q8PA 4F55A 2ZNYA 4YARA 3A01B 3I3BA 1QJY3 4NRMA 4B1RA 3ZN6B 2I74A 4IO9F 3MKLA 2ESHA 1JOBA 2M8EA 1TMF2 3SEPA 2KDOA 1UOJA 2LKPA 2W9XA 3GDBA 2B63J 3VHOA 4OHVA 1JN2P 1X4PA 2Q1ZB 1APLC 1COV3 1LR5A 1ND2A 4QXCA 5C9AB 2QBXA 5F0HA 4JQRA 2HWD2 1PO11 2GNDA 4HV6A 1AF9A 3T2OA 2HU9A 4YFKF 4Z1VA 3EUHA 4JOMA 3IH4A 2PQ8A 2BBAA 1YRNB 5FZ0A 1LEDA 4FFIA 3WODF 5FB2A 3RZMA 2X6WA 3F8NA 5IOZA 3GZTB 3LA3A 4UFJA 3A23A 1XG1A 3CBNA 4YGEA 5HV0A 3OS0A 3H0GJ 3AKRA 2VQGA 4LJHA 5BNOC 1GYKA 1DYOA 1UZVA 2NLRA 4LXLA 2GH2A 4AXOA 1NXD1 3O7OA 2EJRA 2ZXHA 1FY7A 2JQ7A 1ZA4A 1O91A 4HKWA 4XKCA 2E32A 1G59A 1G9CA 4BQ2A 2BGPA 2QEXI 4Y7NJ 5CU1A 2X6XA 4JHZA 2BGOA 3PMSA 1QF3A 3ACLA 4H7MA 1R49A 3WTYC 4PJLA 2EICA 4PJNA 2EFPA 3I59B 1IDZA 3CIHA 2R93J 4GH4B 3MW4A 4P9XA 1UMHA 4XFAA 3Q9OA 4W6XA 4IEQA 4E4ZA 5A6QA 2E1MB 4RGSA 3U07A 2Z16A 5EQUA 4RL7A 2HTSA 3RDIA 5FY4A 1SVLA 2WNVA 1QQP1 1RJ7A 3HKZN 1H8VA 1ULFA 4UFKA 1W6PA 1CAVB 4L99A 5LBQA 1A6IA 2XDVA 1PO13 1TE1B 4GD4A 5D21A 4YLZA 3G4SI 4WWCA 2W82A 5IP7J 4NPRA 2IS6A 1QO0D 3ACGA 2UY8A 2G9GA 3MEXA 3I71A 3DPTA 3AC0A 4GCVA 4RN5A 2LRPA 2ZGQA 5EV7A 3P5JA 4W6YA 1YQ8A 2P3JA 2I8DA 5FYVA 1U6GA 3O1UA 4QHBA 4BHCA 1DZRA 2CDOA 5BNNC 1DGRA 1Y39A 4KN4X 2CV1A 5T5PA 4XFIA 1HV1A 5CG9A 1TW2A 1HRI1 2X6YA 3K10A 1VBA2 1SLIA 1PIV1 5FZAA 2E5NA 4BMBA 4K20A 3MFAA 4M3FA 2VOOA 1QHDA 2JTVA 4PDKA 3HIFA 3O0VA 4YGDA 2W25A 1Y7BA 4S2HA 3WG1A 4DYQA 4K8FA 1KONA 2ZAAA 5GJ6A 3DP7A 3ZQLA 3LSDA 2VQCA 4I02A 2XAFA 3KD4A 2AACA 1OYYA 1P4XA 4LE3A 4EZ4A 4WM8C 4PDWB 2VC9A 1RGSA 1XTAA 2WFPA 4KITB 1QQP3 1W8UA 1E2XA 1I50J 1UL9A 5L3CA 4MEYF 1PVC2 1QHGA 3PQKA 4CXYA 2XWJB 1CR7A 1VAVA 2W0XA 4D7NA 3GUDA 1UHWA 1OQEA 1QIQA 5E8IA 3LMMA 3VBSA 5CB7A 1XX5A 3PTRB 1QDCA 2XJVA 4IE0A 3NARA 3SMHA 2EIGA 5K7FA 3BZCA 3AAFA 2OC6A 3RWNA 4GB32 3FMQA 3W2WA 3OD4A 3E5UA 1EA3A 4RAFA 2W84A 1OUXA 3O5SA 3ERMA 4DZJA 2XG3A 1W6MB 5FBZA 1DYKA 3U4XA 5CYYA 1U3EM 1S1AA 5FPAA 4OCTA 2YU2A 3BQZA 4YW7A 2CG4A 5D1IA 2KQRA 3RQ4A 2RNJA 2RMU1 4MXVA 2BDRA 1QXPA 2G0EA 1UB9A 3QYBA 5C44J 3T1MA 1J2XA 3BTCA 1LKNA 1NLQA 2EF6A 4BJTA 4RR3B 3VDCA 3LA2A 1OFCX 2Y34A 5C4WA 2UZKA 1K4TA 5EJCA 2GIVA 4L9TA 1S55A 4XIDA 3NL1A 2ZJ2A 3V0BA 2VUDA 2EV0A 2VUMJ 1UIJA 4IV3B 4FPCA 3BCBA 4MG2A 4GFBA 4CYDA 5JOXA 1O3QA 4A45A 2M4GA 3CDLA 2VXJA 4AYBA 5L9VA 3QU3A 1VBE3 3S1QJ 2VOPA 5CG8A 1IXRC 2J1AA 3VN4A 3F95A 2HWF2 3MCZA 1EJ9A 1A04A 3ZFGC 2F6CA 1UJ8A 2DI3A 3T2PA 2HWE2 5DYMA 4CZZA 4BBSJ 4W50A 5J96B 2ZX0A 3LSJA 3R05A 5AONA 3RJRA 2K46A 5J40A 5L3BA 4A3CJ 3S2WA 3KCCA 6PAXA 2WAEA 3SC7X 2A5WA 4UB6C 3D5SC 5L3DA 3U14A 4P9GA 4GULA 1JKPC 3OIPA 4LBQD 4G7HF 4BHPA 4LORA 3WT3A 1SFYA 1AL21 4II3A 5A3MA 5LZ6A 2P37A 1UO9A 1AUYA 3JUUA 2RMU3 4BISA 1YUDA 4QQLA 3VYTB 5F2SA 3JRGA 1QGPA 5ABJC 3CO6C 4AVTA 2VPRA 4EJOA 1MZEA 3UESA 1BMV2 4YFWA 5FP9A 3UETA 1W1WE 3LSHA 4C3JJ 1FWZA 3N7KA 1S8NA 1RITA 3M7GA 1A8MA 1KS5A 1GLNA 4KWLA 1H1IA 1NXMA 4Y1XA 3IL2A 1SZBA 3B6CA 3S3MA 1EH6A 1LHOA 3S14J 3KP6A 1RUI2 4CDUC 4HV5A 3PDQA 3GHMA 2VB6A 1H1MA 1U5IA 3POEA 1CAUA 3ZFEC 3QYFA 5FUPA 5A3OA 1OYWA 5DCMA 4L9JA 3SZTA 4IEWA 3PO2J 1X50A 1IN5A 5E3NA 2BVVA 3HJRA 3VODA 4V1PA 2LH9A 2Y9YA 3T30A 1YEWA 3H3LA 3WU0A 2HQ5A 1I6XA 3JSPA 1T08B 1SHWB 1TWFJ 4OZXA 4ZZLA 4M3CE 2PEXA 3OD0A 2LOOA 2FA5A 1I39A 3UKGA 2UWCA 2VCAA 1AL23 1Y6IA 1VRH2 2Y6JA 1PUEE 1H0BA 4TLGA 5D8AB 5HDNA 4HSTA 2RDQA 3CF2A 3DPRC 1MS3A 1EV7A 1Q8QA 4YVWC 2YX4A 5EJZB 3WCSA 2FZ1A 2E1NA 3CJIC 1OLME 5K5RA 3L9FA 3FMSA 1PNFA 1ONVA 1HCRA 4EYUA 2FE3A 1WBFA 1UOBA 3O14A 4F93B 2BW3A 5EYXA 3J7NA 1JKQC 3FL7A 5FUNA 3K51A 3GZNB 3AB0A 2HYXA 3TEWA 3MFCA 2P6SA 2UYBA 4F83A 2GSYA 1FOWA 2AC1A 3ZO0B 2EIKH 4RS5B 3ZXKA 2GALA 4KISA 2HJIA 4URTA 4FPYA 3LQQA 1K79A 4Y3OA 2JG8C 5DDGA 1VPHA 1Q3EA 3FN9A 3DYMA 4EJTA 3GZ6A 3U4SA 2W52A 2XAGA 1D0HA 4CYCB 1SMYF 4HAMA 1G9BA 3DKXA 2Z1DA 3HOXJ 4RHV1 1GZCA 5FREA 3HSEA 3I3DA 2O3FA 2NQYA 2Y0SN 1YHQI 5JI9A 2DA3A 2EALA 2FBKA 4OAZA 2HYGD 1W6NA 2KIMA 3E1SA 4MGKE 2A69F 4N53A 1W8FA 5LHHA 4BDVB 5GZEA 1N3OA 3AL0B 3V7RA 1AZDA 3BJOA 4N90A 1LDKB 2VNGA 2Y60A 3ECQA 3FHQA 4CDXB 1DPRA 2VUCA 1VQPI 4HSJA 2PHUA 4P5OA 3OYMA 4AG4A 4CU9A 5F04A 2B42B 5CBLA 1GUIA 1UHSA 4MO3M 5BS6A 3NNMA 1OA4A 4HOOA 3OOUA 2P6HA 1L7QA 1JJ8C 3FBIB 1G4DA 1SMTA 2YDEA 4XMYA 4LNVA 2BE5F 1W0TA 2GA2A 4FP3A 2IGMA 3R0JA 3AP7A 4HF0A 1XYOA 1DZTA 1DPUA 3ZGKA 2P7VB 1BQPA 2XJRA 1RPWA 5GTHC 5DZGA 5HS7A 3PM1A 1DGLA 1LEAA 1IAWA 1BOBA 2PHTA 3K4CA 4PJJA 4E2QA 1X1CA 2JA6J 1UAIA 1P9QC 4AF9A 2J5PA 3VBRA 1O5UA 3M4OJ 4RD7A 1VQ8I 2KM2A 4UW3A 2VJ5A 2R042 2PQSA 2H94A 2IXSA 1GOGA 4LK1F 1HXS2 2Y64A 5CJ9A 4Q1RA 1DU0A 4Y1ZA 3LF7A 4CDGA 1BCXA 5FPVA 2GXAA 3ZMNA 1CAXB 4J01A 5FJKA 1VQ9I 2JB8A 3OGRA 4TTGA 1BI3A 3FFQA 4UUSB 2X29A 1DLLA 4YVSA 5BQTA 1NA1A 3OL3A 1MS9A 1C3HA 4EJRA 3L00A 4CZSA 2Y8KA 1IN8A 2Y33A 4P9IA 5KHGA 4JX0A 4Q4V2 3VDDA 2OZUA 4HG6B 3PVEA 5JOZA 1R9TJ 4E70A 1NCRC 3LAPA 3UJOA 2HWC1 1MR5A 3F9KA 4QPOA 4WF2A 1W4MA 2V5DA 3BTLA 3BGAA 1UX6A 4IEPA 3JAMK 2BV6A 4AEMA 1WI3A 1X58A 1RUD2 5IPAA 3NMBA 2VCCA 5C8CB 4P9JA 2MLKA 1JUMA 3HHHA 5HNHA 3W9AA 2EXKA 2MSYA 4LBNA 3K69A 4UFHA 4IV1B 3EMRA 4D7MA 3KLNA 2C24A 1XGNA 1JYWA 2CDPA 2RS31 2FF4A 2CW0F 3ZYIB 1KDKA 4EV0A 1R082 4DY3A 4AR2A 4AEKA 3CCLI 3MHZA 1WUVA 4L0ZB 1WPKA 1WFXA 3POYA 2CV0A 3P9IA 4BKXA 1JI8A 3JRBA 1YO5C 1V6LA 5FYZA 4M3DA 1X3WB 5L7OB 3U1DA 2VMFA 4P00B 4Q0SA 1VQLI 5FLVA 1SLBA 4PBOA 1GSLA 1R71A 2PJRA 1JZ2A 2UY9A 3W59A 3KCXA 4URAA 2ZGSA 4N4OB 5ACA2 3UGGA 4OINF 4HDUA 2XPVA 3D5OA 3SKVA 2WB1N 4N7UA 3BJ6A 2WZEA 2QTWB 2D3PA 1LCLA 1XGSA 3SH3A 1RUE1 1PUFB 2VOKA 3GBFA 2WAFA 5BPDA 1GQHA 3WNMA 3BP8A 1WI9A 3A01A 4CEWB 1AA7A 2HWC3 2Y6FA 4LR4A 2CMPA 2FMYA 1BM9A 4QX5A 5LFAA 2AXLA 1X1AA 4II2A 1S29A 1RETA 3RSJA 5EEHA 1RRJA 2PELA 1QJY2 4M73A 1IGNA 2VMHA 2RAEA 5F6LB 3FK7A 3ZMZA 1C0WA 5C9AA 1WH7A 5K7ZA 4QKBA 3MGUA 2QQAA 1FIPA 4QPQA 2RS33 5EZHA 4FO9A 5IK4A 2JUCA 5FYTA 1COV2 5FYHA 3HOYJ 3ZXDA 1US3A 3RI4A 3EYIA 2XUEA 2ILMA 5KHJA 2MPFA 4IEVA 1P6RA 4COWA 2CUZA 4DQAA 3HRMA 4BJ0A 4UVCA 1YJKA 1SFEA 2E33A 4IRGA 3MW2A 1Z6RA 5EEGA 2MFZA 1W36C 3HBLA 4IQJA 5JOWA 2J22A 1LPQA 2W7NA 2DA1A 4HSLA 4UXAA 3WW4A 5CA6A 2ZHNA 3GFIA 1LUJB 1UU6A 3OYFA 3JD71 3ZFFC 2NMNA 5CKTA 3AZYA 5ISLA 2BW8A 2IVMA 4HANA 3KF5A 1SD7A 5KHDA 2JG9B 1RUE3 1ZBA1 3QODA 2NPIA 4INDA 3I59A 2QQIA 4NHMA 2OQ6A 1IO2A 4GH4A 2DVBA 2NZ9A 3KT1A 4EEFG 4HVOA 1I1GA 3RMXA 3UKTA 3AKZA 3REOA 2J42A 1SPPA 1XGMA 4LO7A 4WVWA 3OSDA 4ZC3A 1ZBE3 4RSUA 5D5UB 5T52A 1CAVA 3AFGA 4YW4A 1VZ0A 1JTXA 1NY71 2WWYA 2AQEA 2P5BA 3ZSLA 1QJU1 4I09A 1C5HA 2WDBA 4YW6A 3WF0A 2R16A 2E60A 4HN0A 1HW1A 5KXDA 1GP4A 2K85A 4HETA 1V6KA 1Y9MA 1UX7A 4AHZA 2YFZA 1TZOA 3SEQA 1PO12 4BK5A 4XLAA 2IWGB 3D4KA 3DLAA 2K40A 3D1NI 2XAJA 5K4LA 5L73A 3NSTA 1MBGA 2W91A 4XACA 2XF6A 4J25A 2LYCA 2HYJA 3CF5F 5LHIA 5DM6F 2YC4A 4Y1YA 1QRYA 3TP0A 3UK9A 1GICA 3OOXA 1FSEA 1YX3A 1NCQA 3TAYA 4NIGA 1E3PA 1R092 2A75A 4XE9A 5FYCA 3IWZA 1Y1VJ 3PL8A 1B35B 2A7AA 5ILUA 1U12A 4XEZA 5ICFA 1PZ7A 5FLXK 3L7WA 2V6EA 5J1UA 4LLGF 4Y24A 2V1DA 3I3EA 2ESNA 3LE0A 5HLIA 4LT5A 2XC7A 2YR2A 5LASA 4K3UA 1ON2A 2WAQA 1ETQA 4EN0A 4D7SA 1LTEA 2HH9A 4O65A 3OG2A 2R0FA 2IXJA 4PDWA 3H3VK 4Q2FA 1LVAA 4HK9A 1O8SA 2JE9A 3TNQA 5FZLA 2A70A 2OW4A 3ZXEA 1S0IA 4A3XA 3N05A 2X48A 4QD2A 5F7UA 1QQP2 1FYMA 2YU1A 1V5GA 1IG3A 1GLHA 2EPFA 1S0FA 3VUOA 2PX9A 3PIGA 3Q9VA 2ZEXA 3OYLA 4ZYEA 2UWMA 5GZDA 2UURA 1ETVA 1PX3A 3LEMA 2Q2EB 3ON7A 4XRMA 1QJFA 4S2GA 1MMAA 5LY1A 4BMEA 1YW9A 3UT0A 4FQZA 4MV2A 1H8TB 2VZUA 3OUIA 2V1UA 3WNLA 2YPRA 5B1BH 1OQYA 1QPMA 3ABMH 3I2OA 3RNSA 2CSOA 1YQ6A 3AFKA 4FP2A 2VMEA 2OS2A 3OEAA 2E2HJ 3F72A 4HDVA 3TNPB 2R7TA 4QX8A 5KHKA 1I9RA 5DCFA 3EXUA 3MZ8A 3OY9A 4JKLA 1FV2A 4RR3A 2ARAA 4KN7X 4XIOA 3TO6A 1PK6B 4MGIE 3G6EI 3U11A 5G05L 1VIWB 5IYYA 3FZ3A 5CISA 2HPMA 1R1TA 2NVUB 5DZFA 3H3ZA 2QZ8A 1T2XA 1FOXA 4E7ZA 4IV3A 1HQLA 2D93A 2YC2A 3ORJA 4OIRF 3BJAA 4LA3A 5LRRA 3CKHA 3WZ1A 2EAAA 2ORZA 1YO8A 5BMZA 2RVAA 2YMZA 3J7ZI 1TL8A 1VBE2 4WK8F 4FAHA 1FBSA 3OYWB 2DBIA 4RAZA 2DA2A 4HXCA 3QP5A 2EFWA 2XHKA 2BP6A 3O1PA 4ITVA 3NEUA 4IZZA 2VPLA 2ZGMA 2VCBA 4XXAA 1LHNA 1D0YA 2WQ4A 4LO8A 4P9YA 5C3SA 4Y4RA 5F37A 1XCBA 3I58A 5FZBA 4HN1A 4Y52J 3I9V2 1FZPB 3QYEA 1JXNA 3PNAA 1AX2A 4HEA2 1VQ7I 5E3LA 4SBVA 3VHNA 4PIZA 4PUSA 1XMAA 3DKYA 1F43A 4EWEA 1JYTA 1PP8F 3K3NA 4AIKA 5CVVA 2RMU2 3NJYA 4M71A 1MNMC 1LU2A 1W8HA 4QHOA 4A3KJ 1ETOA 5DG1A 1U5TB 2QJVA 2Y38A 3LOCA 5FOJB 4I0BA 5D6FA 4Z2YA 1Z0HA 1FLIA 3HOTA 1LESA 1YI9A 1ENQA 5KR7A 2DFBA 4HLYA 2VY0A 4XMAA 3K4DA 2F5CA 1IRGA 1JODA 2R5YB 3SDGA 2CQ7A 3MKYB 1VMFA 1RC9A 2Y6HA 4B8EA 1OQ1A 2ATFA 2YY1A 4BGDA 4CUAA 1Q43A 2L9VA 3Q8FA 1ENRA 2OVUA 1TQPA 1OC1A 3N7JA 1RUG1 3AMHA 3ZR6A 2H0VA 3RPUA 4JQTA 5FGMA 4W1UA 2P6CA 5GAGJ 3LEKA 1NZCA 4P14A 3H3UA 4XORA 4S04A 1ZGAA 1G86A 1XSRA 4LK6A 2C9AA 2PJPA 4OU0A 3IN9A 1UMQA 2ZGRA 3WUCA 5D8AA 4AI2A 1ZVFA 3I2JA 4QKNA 2V4JC 5J4VA 4G6DA 1UCRA 1YIOA 1AL22 3RPQA 1LGBA 3ABTA 5C8CC 4K6BA 3NAPA 2V5YA 5FP8A 5J3UA 1OVPA 4E8CA 1AKHA 2HEVF 3WUDA 4IXLA 2TEPA 5EXOA 1SC7A 2VZRA 5D8LB 4A93J 3MPPG 4YM3A 4FXGB 2XJUA 1FTTA 3U10A 1Y43B 4LKFA 3ROUA 3PUSA 1XXNA 2QDNA 4QSHA 3R4DB 4G12A 3FLPA 3LOBA 2BNOA 2FCUA 3CUQA 3AKTA 3LQRA 1AYM1 2D1HA 4N8MA 1DP7P 1JJ6C 4MUVA 4NUBA 5J8FA 1H6YA 5J1XA 1GNZA 1QJX2 4RS5A 2QZ3A 5HLHA 4I98B 1RUG3 1SBFA 3ZCOA 3L2YA 1GKBA 4X6QB 3NKGA 5C6CA 3AM2A 1MQTB 1Z77A 1PDNC 1T8IA 2ETHA 3TBIA 2E7WA 1FYLA 2FOKA 5HVQC 2M9HA 1JE8A 3DECA 2Q8DA 3MD2A 2BUKA 1QZYA 1W7PB 2UUZA 5GLUA 1QNTA 3K7AJ 3QOEA 2HKOA 2R30A 3TDUC 2GOXB 1X8EA 1I3QJ 1IQDC 3BG7A 1W0NA 5J1YA 3H8UA 5FAXA 1RVF3 1VBB1 1HB2A 1LJ9A 3NJXA 1QA6A 1PO21 4E4SA 3HVDA 1Y3TA 2CL2A 3GCXA 2DCEA 1LOFA 2FD8A 2VBXA 3AP4A 2ZCWA 2ADEA 2HNHA 2WZ8A 1X1PA 3B5LB 1ZZ8A 1MZFA 3DFGA 3GF2A 1WW6A 1AXKA 3W2VA 1ZG5A 3GTGJ 3F3XA 2HXOA 5DAVA 4NNJA 4TYSA 1ITYA 3HHGA 3VBHB 1AYM3 3LSTA 2Z79A 2DLLA 2JECA 2BEOA 1UF2C 2WNOA 4XJUA 4I3PA 4GXOA 2VVDA 1D1CA 2JDHA 3KHCA 2W1SA 1ZYBA 5LA9A 4FXKB 1J84A 5AC93 2JJ6A 1OURA 1EF4A 3J7YJ 4HW0A 2HYFA 2VOTA 4M3CB 4META 4M3EA 4PGGA 2BHYA 1EUUA 3TOJA 3FUOA 1FP1D 2K3PA 4M9ZA 3FM5A 3OTFA 3FXRA 1G8XA 3JQWA 4XF4A 4NJ4A 3VZJA 5CVJA 3V7SA 4RS8A 2BWCA 2WV1A 4BQ4A 2H0BA 2GMMA 1PO23 1X33A 1CAXA 3POIA 2VI6A 1JZ8A 4L97A 4GKYA 3QWLA 2X1CA 4YM1A 2ZBKA 4UUSA 4BNCA 4TWTA 2OPTA 2IS2A 4FPLA 2DK8A 1W8OA 1W36D 2A3YA 1RIRA 2Z5WA 5FXVA 2AZ5A 2ZZQA 5E79C 5F39A 4HRIA 5D5XB 2D6KA 3T08A 3CQOA 2LRDA 5FMOS 2FBEA 1UNBA 3KSCA 2HPIA 3BG6A 4V2FA 4P5YA 5EFUA 1K3IA 3DLLF 1VQOI 5EPAA 3S93A 2YXSA 2Y9ZA 4IV1A 1H2MA 1STMA 2VJ4A 3OL4A 5SV5A 1KDMA 3VBFC 3JBG3 3FX3A 1ODMA 5H2FC 1R1UA 1RYYA 3TB0A 4WBBA 2YGMA 5GAHJ 2ECBA 5F6KA 5E1ZB 1GT0C 1SVOA 3EUAA 4Q29A 5L7OA 4MX3A 1IZ1A 2UWBA 1WSUA 1LGNA 4UW6A