3CEWA

Crystal structure of a cupin protein (bf4112) from bacteroides fragilis. northeast structural genomics consortium target bfr205
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
118
structure length
118
Chain Sequence
MKNYQKMSVAQDARVELHDSLALTGAEVSINHLPAGAGVPFVHSHKQNEEIYGILSGKGFITIDGEKIELQAGDWLRIAPDGKRQISAASDSPIGFLCIQVKAGSLEGYTMTDGVVQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized cupin protein
publication title Crystal structure of a cupin protein (BF4112) from Bacteroides fragilis. Northeast Structural Genomics Consortium target BfR205.
rcsb
source organism Bacteroides fragilis
total genus 17
structure length 118
sequence length 118
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3cewA01
5I93A 1XE7A 4LUMA 1ZREA 5J3UA 4E2SA 2ET7A 1GQGA 4IEYA 1O3SA 1YUDA 3S7EA 1DZRA 5JCTA 4FBFA 4UBGA 4XF1A 3EHKA 3LA7A 3OGJA 4AVAA 5KHJA 2XLAA 2O8QA 5BXXA 5K8SA 3LWCA 3ETQA 1SQ4A 1O3RA 4R52A 1Q5OA 3U0ZA 4IESA 4QGNA 2XKOA 4YRDA 1ZVFA 5KHIA 3RDIA 2OA2A 4GULA 1O7FA 1U12A 3H1YA 2IXLA 3FE5A 4HSJA 1ZRDA 4L2NA 2BNMA 1L3JA 4XETA 4JTOA 2OYZA 2FQPA 2Z69A 4RD7A 4LULA 1O3TA 1OFNA 3JZVA 4XFBA 5FLIA 3BB6A 3RYRA 3PLQA 2IXJA 1V70A 3DV8A 3ROUA 4MGKE 2ZCWA 2BGCA 1J1LA 2UY9A 3WW2A 3D82A 3M3IA 3I59B 4OFGA 5C8WA 5I8YA 4LTAA 3NL1A 3OF1A 1ZRFA 2B5HA 2B9UA 2CAVA 2PAMA 3SCHA 5FDBA 2BNNA 2QCSB 4LLOA 4JV4A 3LA2A 4HVQA 5I0RA 1ZRCA 1CAWB 3LAGA 4EWAA 5BV6A 4AQ2A 5KHHA 1H1MA 1PMIA 2GAUA 1UCXA 2HKXA 4MUVA 4Z82A 2PHLA 5BUVA 4WZCA 2CAUA 2GC3A 4LA2A 4D7SA 1YFYA 5J48A 4HMZA 2IC1A 4OLLA 3G7DA 3MDPA 5BY5A 5JSOA 1CAUB 4HVOA 1ZZ9A 5LEJA 2GC1A 1OMIA 4Q0SA 2WC2A 3MPBA 1YFWA 3USSA 4LUKA 3IDCB 3E5QA 2QNKA 2WFPA 1YHFA 2VECA 2GZWA 3M70A 4IEOA 3FX3A 4TLFA 3H1WA 3NW4A 2ZKLA 4N9IA 1O5LA 5CVRA 3U11A 3LA3A 4KWJA 5CU1A 5LEKA 2Q30A 2MNGA 4F8AA 1JUHA 3ELNA 4XFFA 3I59A 3TNQA 1LR5A 3IBMA 5I8TA 1PM7A 1EYBA 2XHKA 3PNAA 2ATFA 1EY2A 4XFHA 5FCCA 2BEOA 3HIFA 5C6CA 3SMHA 2Z2SB 4XF0A 3RNSA 3QACA 3NSTA 5BPXA 1WLTA 2EA7A 3IDBB 1CAWA 1X8EA 3BALA 3D0JA 3NJZA 4UXAA 3WW4A 1ZZBA 4J1XA 2Q1ZB 2QJVA 2HJIA 5JSPA 1YFUA 1IPKA 4Q0UA 3U10A 4Q0VA 3NVCA 3DL3A 2MPFA 2XL7A 1EPZA 2H6BA 3MZHA 4FAHA 4HVRA 1ZX5A 4UBHA 1X8MA 2GU9A 1NXMA 1I5ZA 4LEJA 1CAUA 4A2UA 4K8FA 1QY4A 2XKPA 5FQ0B 2D40A 3RZZA 1ZZCA 3FFQA 5JSRA 2FMYA 3NKTA 4LA3A 2BYVE 1DGRA 1DGWA 2OPKA 3EQEA 4HSLA 5I91A 1LRHA 1ZZ7A 4MGYE 4I0AA 5D1IA 1UW8A 3ES1A 2D93A 3GBFA 1CX4A 1QXJA 4B29A 1NYWA 3SHRA 3KGZA 3I7DA 4MX3A 1CAVB 4O9GA 1LB2A 4PJYA 3EJKA 1SEFA 4O9EA 2N7GA 4QXKA 2XLGA 4IEQA 4XFIA 2B8MA 5I8SA 1EP0A 4XF3A 3BU7A 4IERA 4IEUA 3WW1A 5KBFA 1UIJA 4P9GA 1RL3A 2EAAA 4XEZA 4Q0QA 3ST7A 5KHKA 1XE8A 1ZZ8A 1FT9A 3O14A 2CV6A 2VQAA 2D5FA 3SXWA 4D7TA 1J59A 1QXRA 4XFCA 1Y9QA 1VP6A 2VPVA 4IEWA 3E5UA 4YYOA 3KCCA 5CADA 5FQ0A 5FPXA 1SFNA 4JTNA 3H3UA 4H7LA 4META 4MZUA 4Z07A 3VHRA 1GQHA 1LKNA 4BIFA 4ZU4A 1Q3EA 5I0TA 3H1MA 4FT8A 2Q0AA 4E2QA 4PIZA 2UY8A 4PIXA 4EV0A 5I0SA 3GYDA 4X6QB 4ZU5A 1ZRRA 3H8UA 3QOPA 3CO2A 1CAVA 4Q29A 1HW5A 4ONUA 2UYBA 2XGXA 1J3QA 4I09A 1UIKA 1UD1A 3E97A 3H9AA 1O3QA 1RC6A 3UKVA 3E5XA 4MGZE 2C0ZA 2IXCA 3UKNA 4EWEA 3CLPA 1WGPA 4KL1A 3I54A 4KWLA 4BHPA 3E6DA 4QGMA 3CF6E 2BNOA 2DCTA 3FJSA 3KSCA 3OD0A 2Q4SA 1RUOA 3SCFA 4QGLA 1IPJA 4QM8A 3RPQA 1RGSA 2Y0OA 4HN1A 1RUNA 3E6BA 1TQ5A 1YFXA 2K0GA 4AVCA 3LZZA 2GC2A 2P17A 2K9ZA 3OCPA 2UYAA 4YNIA 1J3RA 3FHIB 4AQ6A 1Y3TA 2PHDA 4KU8A 2H0VA 4EROA 4PIYA 2GC0A 3FZ3A 3HT2A 1Q43A 1DZTA 3BCWA 4L11A 4MV2A 3ZDSA 1CGPA 5EFUA 3C3VA 3ACLA 3KMHA 1WA4A 4KU7A 5E16A 4YARA 1G6NA 5FLJA 3N4MA 4N9HA 3HT1A 3CJXA 4E2GA 2H6CA 1ZNPA 2XL9A 3ES4A 4XF9A 4WVZA 1OI6A 3S0MA 5J7MA 4NVPA 3RYPA 4QX5A 3CL1A 4X6RB 1J58A 2I45A 4ZU7A 2PFWA 1CAXB 2QVSB 3LOIA 2ET1A 4QM9A 4XFGA 1NE6A 2PYTA 1NZCA 4IETA 5T3NA 4HZFA 1I6XA 1NE4A 2MHFA 1YWKA 1RTVA 2GH2A 3H7JA 5E1RA 4QMAA 3WW3A 4IEVA 3H7YA 3E6CC 4WBBA 2EVXA 1O5UA 2OZ6A 2V09A 4HN0A 4I2OA 2ETEA 4J1WA 5FLHA 1FI2A 3OTFA 3D0SA 4I01A 4I02A 1OD5A 3BPZA 2PTMA 1UPIA 3HQXA 1VR3A 4XFAA 3PVBB 2PQQA 3IIAA 2QDRA 1X7NA 1J3PA 1FXZA 1YLLA 1CAXA 4IEXA 4AVBA 2D5HA 2IXKA 3L2HA 4XF4A 5KHGA 4AXOA 3H50A 4YSFA 3R6SA 1H1IA 3FWEA 4F7ZA 4ORFA 5FPZA 3MYXA 4DINB 2CGPA 4HBNA 4FAGA 2PA7A 5F1RA 5EZWA 2XLFA 4BYYA 2KXLA 2PAKA 1QWRA 1O4TA 3UKTA 4R8HA 2E9QA 3H3ZA 4MGIE 4BH9A 1ZZ6A 2PAEA 5AVPA 4EWDA 3CEWA 5LRRA 1VJ2A 4I0BA 3DN7A 3EO6A 4MH0E 2IXHA 4CYDA 3KGLA 4IEZA 4JVAA 3S7IA 4I3PA 5HI0A 1XRUA 3RYKA 2IXIA 4HLTA 3IWZA 4Q0PA 2O1QA 5JR7B 3EBRA 3TNPB 4IEPA 3DKWA 3B02A 2F4PA 4KWKA 3SCGA 1X82A 5LRSA 2OZJA 5JAXA 5I0UA
chains in the Genus database with same CATH superfamily
3AP4A 1VBA1 2YV8A 1YQ5A 4LUMA 5C71A 4K21A 4YVWC 1KS5A 4IEYA 5FMOS 3C8XA 1WLWA 5DAXA 4UBGA 3CBNA 1FOD3 2A1XA 2JB8A 3BTAA 2V73A 4NWWA 3SKVA 5IVFA 3TEYA 3OUJA 1SBDA 1GWKA 5C7GA 5KHJA 1V6LA 1O91A 1YYNA 2C6SA 4PI2A 1JYVA 1W6QA 4UFJA 1HJGA 2XLAA 5AVAA 5BNOB 2VR4A 2IUWA 2JDKA 1R1A1 3GHMA 1V6OA 3CNAA 1Q5OA 3M8LA 3N7JA 4IESA 4KGQA 2KA3A 4BE3A 4UF0A 2OXBA 5BNPA 2W9XA 1HRI1 2ZX4A 1AXZA 4CUAA 3VBRC 1S0FA 5ACA2 3K3NA 5K0UB 4Y22A 5IK7A 5KHIA 1XOYA 2OUHA 3VLBB 1PIV2 3IMMA 5FP4A 4IL7A 4BQ5A 2RS31 5A3WA 2BNMA 3JXSA 3WF2A 2OS2A 4MGQA 3WNPA 4XETA 2OYZA 4CEYC 1EUTA 1MS9A 1ND3C 3NWKA 4NO4A 3HPNA 1JTZX 2CSGA 2VAUA 5FKCA 2C9KA 5DZGA 4QAWA 1GOGA 1OFNA 1W9YA 1WW4A 2SBAA 2VNRA 1W06A 3JZVA 1FV3A 4XXPA 4NPRA 3WR0A 5L9VA 4AFBA 4O61A 4NPLA 3B3QE 5FLIA 2JDAA 5GZDA 2XH6A 2DUOA 2FDFA 2VW0A 4BCUA 1KDMA 4LBJA 2ZCWA 4MGKE 1LOGA 4M00A 1HV0A 5FY9A 3D82A 4Q4V3 2JIGA 2J1RA 4XJ9A 5C8WA 5FZBA 1OA4A 2JD9A 2RR12 2VZTA 3LFMA 5FYIA 5AC92 4DQAA 5JZGB 1OXCA 4OULA 1POV0 3QBQA 4W6YA 4IE5A 4TTGA 3A7QA 3OF1A 1ZRFA 4WVMA 5IJRA 2B9UA 3NKGA 2CAVA 2VUJA 2QQJA 1CPMA 3EXUA 5GLWA 4YG3A 5KC6A 4LLOA 1JW6A 1K5MB 1V00A 2C5DA 2CHHA 2R30A 1SACA 3C7GA 3POFA 4P5HA 4CPBD 2PHXA 3ILRA 3LAGA 5F6KA 3ON7A 1W8NA 4AQ2A 2DBNA 3ILNA 2YBKA 2RMU3 2JE8A 1H1MA 1H2MA 1QDCA 2B9VA 1RXGA 3IZOA 3T09A 4K3UA 1PVC3 2VY0A 2F6BA 3HVDA 4MUVA 2X5IB 4NE9A 1XU2A 2WO1A 4OUEA 5BUVA 1W8TA 1ENQA 2VO5A 4M3CF 5L36A 1UY4A 2WBKA 4UAPA 2XBO3 5F5IA 3TB0A 3T2QA 1JZ5A 3OG2A 3SH5A 2W95A 4LMFA 4D7SA 2P37A 2D6LX 1IKQA 4CDQA 4HMZA 3CJIB 3LF7A 3MDPA 4N53C 4OMDA 5BY5A 5J1XA 1KD7A 3E1F1 1CAUB 1VRH2 5FZHA 2W1UA 4NHKA 1ZZ9A 4A42A 1LOCA 1PO11 4Y5TA 2R062 2W91A 4B8EA 2A70A 4WM7C 3MUZ1 4FFFA 5DG2A 3H8OA 2ERFA 2EXJA 4K40A 1YEWA 4ZS2A 1AYM2 2DCZA 3M70A 1UKRA 2GZWA 1LGCA 1NOVA 4ZXEA 2AC1A 3WHUA 2P2KA 5CVRA 4D6SA 2GP3A 3LA3A 2AR6A 3JD71 1SBFA 3VHPA 4F8AA 1BLZA 1JUHA 3UJOA 1LR5A 2X09A 3IBMA 2AREA 2XB6C 4NHMA 5A32B 5I8TA 2W52A 1IS4A 1EYBA 1X9TA 2XHKA 2PHFA 3WD5A 4XDPA 5FR3A 1EY2A 3JQWA 5EJ1B 2BEOA 2Y6KA 3WNLA 4AHXA 3VHNA 1LHVA 3RNSA 1DZQA 5IATA 1SZBA 2QDNA 3N3HA 4BA6A 3RZLA 2B39A 4XURA 1CAWA 4QPYA 4ZS3A 5ABJA 3D0JA 5FZEA 3V0BA 1ULOA 2ARXA 3WW4A 1W8HA 1ZZBA 2VU9A 2X8KA 4WM8C 3VZLA 3VUOA 2BU9A 1PGL1 2L9LA 2QJVA 1J1TA 4FPOB 5JSPA 1W3XA 5JXGA 2QZ3A 1IPKA 1AYN1 1QJU3 1REDA 4M0HA 3DL3A 1Z7S2 2X29A 2EIDA 3UK9A 2XL7A 4AGRA 1UWWA 1ASJ2 4YW6A 4BXFA 4CDUA 1OOPA 2EAKA 5EIYB 1YO8A 3QLQA 2EICA 3ECQA 1ZX5A 3ZIWA 1S0JA 4FFGA 1NQJA 4HK8A 4NRPA 2OT7A 4A2UA 1QOOA 2QE3A 2XKPA 4QT6A 2AENA 3VZKA 4LBQA 1OFSA 5FQ0B 4YW5A 2GH8A 1E5RA 4K20A 4YGCA 4XQWA 3ABZA 1ZZCA 2D3PA 5JSRA 2VBDA 4PHZA 1H2NA 4CUGA 2VOXA 2RM21 1DGRA 5ANNA 1JOBA 3EQEA 1W03A 1LRHA 1KS4A 1OURA 1KXGA 1OLQA 4XBLA 3KT4A 4KNCA 1UW8A 2D93A 3TN91 5A7NA 3A21A 2ZHMA 3N9MA 4HETA 1QXJA 1NYWA 2WDBA 3GNEA 4IDZA 3SHRA 3AYDA 4CDXC 3CU7A 4MX3A 2AH2A 3O0VA 3KHCA 1LB2A 1SG3A 1COV1 4RQPB 1HRV3 2Q8DA 1XU1A 2JECA 4O9EA 2ES3A 4Y24A 4DY3A 4H2AA 5LY1A 4PF5A 1Q8VA 2XLGA 1JZ8A 1C1FA 2JWPA 2JE9A 5EYYA 5IWFA 1FMD2 3IDEA 1GNZA 1DBNA 2WJSA 3NNMA 4XFIA 2ZGTA 4Y5Z0 3LGRA 2LW8A 1C8M2 4Z2AA 2WNVA 5A7OA 1Q8QA 5FWEA 1XXNA 1HQLA 1HB3A 3POSA 4ISRA 5EYXA 2YU2A 3T1LA 5AFBA 5C5UA 1AR62 3BTXA 4XQDA 1H8TB 1UIJA 1N3PA 3MLLA 1RL3A 1MZ5A 1EV13 2EAAA 2WWSA 2WZR3 3OY8B 4XZPA 3T0BA 3IAPA 1MEC2 3J7MA 2CV6A 1ZRIA 1O8PA 1JBCA 2A6XA 1VB4A 1Y4WA 3AJYA 4KH9A 4W4ZA 4F83A 1XSQA 5FZFA 4NAOA 4HFSA 1AR92 3SXWA 4LJHA 4IGPA 3W59A 1J59A 2WNUC 1VPHA 1D4M1 4XFCA 1W8FA 3VKLA 3C7EA 4MXWA 3ZFGC 5E89A 2VPVA 1W28A 3LSDA 5F3GA 4CU9A 3KF3A 4GH4A 3KCCA 4A6SA 1A3KA 3BPSA 3AM2A 3ZPYA 3OGRA 4CEWB 5FPXA 4JTNA 2JG9A 3MO4A 3H3UA 2V5DA 3PDQA 1HQNA 1FYUA 2HWB2 4META 2JG8A 2VCAA 1LKNA 4GD4A 4A7ZA 4C1XA 1PMJX 1XNAA 3ILFA 3I3MA 5LA0A 1Q3EA 3RSJA 1R082 3RS6A 1AR63 4W8JA 5F5AA 3ZXFA 1Y43B 1Z78A 2IFWA 4QPIB 4PIZA 3HJRA 4AI1A 4YGBA 2D97A 3MHZA 1QGLA 4X6QB 1OUSA 2ZGRA 1GOHA 3CO2A 4MOAA 2ZEWA 3LQCA 3AZYA 2NMNA 1HW5A 4RR3B 1MS1A 2KR2A 2XGXA 1RUH2 2WQ8A 3UGGA 1VBB1 4QHBA 5C4WC 2VNOA 1RC6A 1WCSA 1XSRA 3N9PA 3O1MA 4LITA 3WNMA 2W68A 1JU4A 2HWB3 2DVFA 2VCBA 3W58A 1WGPA 2D6NA 3AP9A 1RUG3 1ST8A 4BHPA 4LBNA 1JZ2A 1R083 4DPNA 1QDOA 3Q8FA 4RHV1 2A6ZA 2R16A 3QH6A 1UYZA 4QGLA 1I9RA 4CXXA 1QKQA 5FMCA 3RPQA 5BNNA 2YGMA 4KBBA 4GAZA 5FUIA 4BIOA 3AKTA 3E6BA 2WAAA 1YFXA 4AVCA 4BB3A 2FCTA 2GC2A 4QKBA 1WZXA 4JQTA 3OCPA 1PK6B 1WD3A 1FOD1 2R0HA 4XPVA 4GWNA 1MQTA 1YI9A 1BEV3 2Z42A 4CDWA 3KV4A 1ZA7A 3OBZA 2PHDA 2TUNA 4KU8A 3OGSA 1L7RA 1AL23 5F8PA 3DCQA 1DZTA 1VBC3 2BZDA 4L11A 4XABA 3KWVA 5JPMB 5EFUA 1KGYA 1UYYA 2D3SA 2D98A 2G9ZA 1RJ8A 2VZ3A 4CP9B 3RJRA 5SV8A 1ALYA 1LENA 3HT1A 2JJ6A 1VMHA 2J1EA 3AVSA 3FLTA 4YZ5A 3CJXA 2E32A 2H6CA 3CZJA 5BNPC 2XL9A 3ES4A 4RN5A 3LE0A 1OKOA 5CFCB 1W9TA 5K4LA 4NVPA 5DAVA 3VDAA 5A7QA 1QQP2 1QH7A 4LKEA 3SEEA 1J58A 1T6GC 3WQ1A 2ZABA 5HCBA 1RHI2 1C4RA 5FXWA 1X36A 3AVRA 5CAZA 2WNOA 4P9YA 3DXUA 4JZRA 3THDA 5IT6A 1NE6A 1TEIA 4WVWA 5FKBA 3WNKA 2ID4A 3K77A 1Y7BA 1JH5A 2AGSA 3VBUA 4AL9A 4AEDA 5JMCA 3O1OA 4Q4V1 1UOJA 1POV3 1YC61 1BVVA 1W3VA 1C1LA 2FDJA 3R0RA 2WT0A 1YWKA 3B94A 2BW8A 5EPAA 4IV3A 3MW4A 4J25A 4JRLA 4CRQA 3H7JA 4L9BA 1GYKA 4XJZA 1LCLA 2UU8A 3OJBA 2HBUA 1JYXA 3AP6A 3F95A 3S30A 3JBG2 4GWMA 3LDRA 3OPZA 1QH6A 4NIGA 1HLCA 1ULDA 2EIBA 1SCSA 3H7YA 1L7LA 1NA1B 2B42B 3WDYA 1X9PA 2Y6LA 1SLLA 2CTVA 3EYPA 4JGZB 3ZM8A 1RHI3 4ZZ5A 1RMU2 2RMU1 3P3PA 1GANA 2RDRA 1PGW1 2ENRA 3VBOA 5KR7A 4HN0A 1Z0HA 1WMDA 5FZAA 4BLIA 4I2OA 3WDWA 1PVC1 1F5FA 1I3HA 2BFUS 1FI2A 1HN0A 3D0SA 4LBOA 4XUQA 1OD5A 2W0XA 3B69A 1TMF2 3BPZA 4OUSA 4NHYA 3JU9A 3N7LA 2XBO1 1NCQA 3POJA 4GZ9A 3WSOA 3MEPA 1V9U2 1A78A 2VUAA 4WV8A 3VL9A 5BYNA 1GWMA 4YZ3A 3DF0A 3WG1A 1JZ7A 4CP0A 4OMCA 3IIAA 2WSUA 1WW5A 1O8SA 1MPXA 1W99A 4CDQC 1X7NA 4FFHA 5FYTA 1RUI2 1IQAA 2V72A 2E7TA 3ZN6B 5FYSA 1FXZA 2DURA 4AR2A 1MZFA 1HQWA 1RMU3 1U5IA 3I2FA 3J9SA 3L2HA 4AXOA 3N35A 2BOIA 5FMOL 3ZR5A 1LNSA 1W6NB 2ZEZA 1OT5A 3FMGA 3Q8BA 3Q8EA 4FOWA 4P9LA 4XYXA 5GLZA 4A41A 1ENSA 2CGPA 3GZUC 3ZYJB 1WCQA 5DMYA 3HR9A 3VD3A 2NN8A 3NV2A 1OQEA 4Y20A 5FV3A 2J22A 5A6ZA 5KC5A 4A44A 2JKBA 4BQ4A 4BYYA 1WCKA 1QWRA 3I2JA 3N36A 3PUAA 2E26A 2BTVC 3PURA 3AYEA 1A34A 4BH9A 1ZZ6A 5AVPA 4EWDA 2P6CA 2Y26A 1RUI3 2YBPA 4TWTA 1YCIA 2CWSA 2JDMA 3GALA 2IXHA 3IT8A 1XRUA 3RYKA 4JX0A 1W6MA 4HLTA 1SHWB 3IPVB 4CCMA 3MI8A 5JZGA 5ABJC 5JIUA 2R0FA 1DGLA 1QJU1 2YHJA 5IVVA 4XDQA 3DKWA 3O12A 2HWC2 4OI0A 1GSLA 2ZGLA 4QD2A 4SLIA 5LRSA 1HX6A 2R073 5F2WA 4Q4W3 2BUKA 2WSVA 2ZKNA 3J8F1 1ND2A 2OZJA 1AHSA 2VOKA 2HWE3 3M3OA 4IXLA 3ITQA 3WX5A 3ZYIB 3MW3A 3SLIA 1H4GA 3BUCA 2ZMKA 5HV4A 1JZ6A 1TME2 2E7AA 1SPPB 2LTNA 3ZMOA 1YUDA 4QHZA 4CDUC 3GCXA 1S55A 1OOPC 1GQPA 1G9FA 4WZFA 3ZFEA 5JCTA 1W8UA 4IE6A 4XF1A 4XHXA 5JI7A 2E7QA 4JKKA 5HCHA 2E33A 3OGJA 4FP2A 1YNAA 2BWCA 1B09A 3KLSA 1AJKA 3S6PA 1AX1A 4DB5A 5L7OB 3VBFA 5FP3A 1FPN3 1W2OA 2R6QA 3ETQA 1SQ4A 1O3RA 2OPWA 3HNMA 4KG8A 5FXZA 4CXYA 1JXNA 4QGNA 3VBSA 1BZWA 4BDVB 4IV1A 1UY1A 3B01A 2XOMA 5LATA 1IZ3A 1CQ9A 2HWC3 3DPRB 2OA2A 3ASIA 3J7LA 1O7FA 3PJYA 4M01A 2JDHA 1WD4A 3VZJA 1JI6A 2QQWA 5EV7A 5FJHA 1HRV1 3TYJA 4LO4B 5JLVA 1ZRDA 2R1BA 2DVDA 4Y26A 4R9BA 1U5ZA 4TXWA 1YRZA 1DQ4A 3HMYA 1UMZA 3WQBA 5J36A 4XCBA 1ODNA 1HB1A 1QOTA 5H9QA 1HKDA 1O3TA 1E5IA 1BMV2 4COUA 4XFBA 1ENRA 5A7SA 1QEXA 1MS5A 4N43A 2ZPXA 3RYRA 3N7KA 3H42B 3PLQA 1RUJ3 2ZGMA 3DV8A 2WZR1 1EV11 3GBWA 5DDJ2 2BGCA 2WNVC 4FOVA 3SH3A 3BVCA 4NIAA 1J1LA 3UGHA 4RFT0 1YXWA 2QQIA 4LORA 1AUYA 4OFGA 1GOFA 2HWF3 4RS5A 4V2VA 3VZOA 1GZWB 1HJFA 5C9AB 1HXS2 4LHLA 5I8YA 1SLBA 3OPWA 1JYIA 1H9PA 2QQKA 4GMP3 3WEZA 4D8MA 1DF0A 3MFAA 1GBGA 2B7YA 1JHNA 3SCHA 5FDBA 2QCSB 3VDDB 4W65A 1H8VA 4PQQA 3LA2A 3AX4A 3AP7A 4U2AA 1G9CA 4JGYB 3WG3A 2NPIA 4BQ1A 1F31A 4YW2A 3V65A 5KHHA 2I07B 1GICA 4AI9A 4GH4C 4QDQA 2GALA 1AJOA 2GAUA 3J4UH 5D8AA 1ZBE2 5T55A 5F39A 1FATA 1WW7A 1DGRN 1VBD2 3RMXA 3TRSB 3ZLIA 4CPBA 2JG9C 2C4XA 3GXUA 4H3WA 4MG2A 2QTWB 4L99A 3G6JB 3ZO0B 4BQWA 4QXBA 1V6MA 2JG8C 1XBFA 3POBA 2Q8OA 2UWBA 2VBPA 4YVWB 2YGLA 2WS92 4AW7A 4LA2A 5FYMA 4YPJA 4K8RB 5J48A 4DY5A 2ZGUA 3M7AA 4Y1ZA 4E9KA 2BGOA 5AFEA 5JSOA 4BISA 4HVOA 1RVF3 5J37A 2HYKA 1XNTA 5A7PA 5LEJA 1OQ1A 2F17A 3HWJA 4GKXA 4XAAA 5FZCA 1GFF2 1OMIA 2QQOA 2VMFA 3HD8B 2YC0A 1AL0G 1YFWA 3MPBA 1G9BA 1H2KA 4HPKB 1GWLA 3JB8A 5EQUA 2WFPA 5FJKA 5F3EA 3MV11 4IEOA 4TLFA 4NRQA 2HWB1 2ZKLA 3VBRB 3O1UA 4G3YC 1DYPA 1EUUA 1RUG1 2QQNA 3DECA 2Z79A 3AKRA 1BQPA 2DWRA 1VBD3 4KWJA 4Y1UA 5LEKA 3BI3A 4CCEA 2Q30A 1OPOA 1VBE3 4K7JA 3U14A 4AAXA 2MNGA 2VZRA 4EJRA 1DHKB 3TNQA 3N9LA 3I59A 1CN1A 3ZYGA 1K12A 4Q4X3 3SNMA 4LXLA 1PO23 2YFUA 1B35A 2YPDA 3ORJA 5LK5A 1LU2A 1ND3B 4FPYA 4LHKA 3USUA 4CEYB 2YDEA 3KM5A 4TLGA 1MS8A 1RUC2 4BMBA 2ATFA 4AF9A 1N3QA 2ZMLA 4UI9L 1F2NA 1BEV1 4XFHA 2PLV2 3HIFA 4EN9B 2R043 5BNNC 3EB7A 4XF0A 3QACA 3NSTA 5A1AA 4XMIA 1PZ7A 3ALQA 3RGBA 3IDBB 3PVOA 1AL21 2BQPA 4UW3A 1GKBA 1MQTC 1YQ2A 2RJLA 1VBC1 3NJZA 4GB32 4YM2A 3ZVXA 5GZFA 4CDWC 2VQUA 4UXAA 4J6GA 5L73A 3T1MA 4QB1A 5FPBA 4LT5A 3KQRA 1DIWA 5JXIA 3RG0A 3VKOA 1N1SA 2E53A 5TSWA 4QKNA 3HBKA 5F6LB 1PGSA 5CKNA 4Q0UA 4IGQA 5FZKA 1V6KA 3NVCA 5A7WB 2DVGA 5IW0A 5C3OA 3I2DA 5A6QA 3OEAA 1GUIA 2RS13 2YPJA 4FOYA 5FIXA 4FP3A 1I5ZA 4LEJA 2J1SA 4L92A 4MVTA 3I2HA 4CCKA 2DVBA 5FXVA 4JKMA 5FY5A 5FK7A 1UZWA 1US2A 2HLEA 1QU0A 3BTZA 1W6PA 4FTBA 2DTWA 2VCMA 4GJYA 4DXSA 3PUIA 3RZHA 2P5BA 2D3RA 3NKTA 2E63A 3K4AA 4LA3A 1POV1 2BYVE 4COZA 1W2TA 3ZFFA 4MLOA 1DCSA 5DXDA 4EN7B 3QCWA 2OPKA 4FFIA 3SKJE 1QIQA 4N53B 3POIA 4MGYE 3VBUC 1TE1B 3A23A 1CESA 4AEDC 1HIXA 2AYHA 2OQ6A 4RYDA 4B29A 4D3WA 4Y33A 3MLKA 4WM7B 1CAVB 2GNMA 4IV3C 4AQTA 4FO9A 3I3QA 5LK7B 1BCXA 1W9SA 3EJKA 4R4XA 2ZMNA 5HV0A 4Q4Y2 4XZUG 4KG0A 1NT0A 4QXKA 4P14A 2VVEA 1QJX2 5J96B 3LFIA 2LUWA 4CU6A 1LOAA 2XJRA 5ACA3 4IEQA 3IM0A 1PIV3 2VZVA 2OVUA 5EWSA 3V0AB 1RUF2 3I2OA 3L9JT 2W5FA 4LPLA 4XXAA 3VBOC 2PN5A 2Z5WA 3BU7A 1ULEA 3WW1A 3P3NA 2ZGSA 3POEA 5A3NA 3C7FA 1UXZA 4NWVA 4XEZA 3RZMA 1XE8A 3J26N 1FT9A 4Y1XA 2NQYA 1VALA 3R4DB 1S0GA 2WQZC 1YQCA 2MEV2 2YROA 1MVQA 4OZXA 4EN6B 4JC1A 1NCQC 4QPGA 3MFCA 4UW4A 4Q1RA 3NV4A 2XDVA 2VMCA 1S0CA 2CY6A 2HWD2 2YFZA 1G8WA 1UYPA 1Y9QA 1XE0A 1S1AA 1VP6A 5I0DA 1GNHA 1O59A 3JCIA 4YYOA 4WM8B 2HBTA 3U37A 4AHZA 5FZOA 5CADA 3TEZA 3B5LB 1RMU1 2A3YA 2RR13 1RITA 3VBHA 3WNOA 5AC93 4M3CA 4MZUA 3OPTA 3S5AA 1WMFA 2VW1A 2QQVA 2EXIA 4D94A 1F5JA 1RUF3 4ZU4A 1U5XA 4BIFA 2WFF2 3NNGA 5FUPA 3NJYA 4K9SA 5FY4A 4LO5B 2BWAA 4EZ4A 1AVBA 3W5NA 3A0KA 2RJKA 4I30A 2HEVF 3V64A 5CG8A 4H55A 3GYDA 1ONAA 3O1SA 2J1VA 3OOXA 3QOPA 3M3CA 5J09A 3FBYA 5GM0A 5A3TA 2QUOA 4Q29A 5IK4A 2A6YA 4ONUA 3RZJA 2UYBA 4EYUA 5LW9A 1J3QA 1RUI1 4I09A 4YG0A 4XIKA 2LS6A 2DFBA 4ASMB 1F8VA 4FCAA 4R9AA 2ZGOA 4JHTA 1X33A 2W1SA 4FPJA 4BWOA 3UKNA 4EWEA 1TZOA 1BXHA 1QNYA 2J1TA 4GKYA 1SDWA 1VRH3 4N8MA 5FZLA 2B46X 4E4HA 4CDXB 4KL1A 3I54A 4KWLA 5C8CA 1BBT2 1D2SA 2R071 2R063 4Q4W1 4QGMA 4YW1A 5GKAC 4BJ0A 5JZGC 2HWE1 1FNYA 3PHMA 2G4IA 4LO6B 5FPVA 1AR72 3SCFA 5JOYA 5ANQA 5FP7A 1AYM3 4B1MA 3AMHA 1NCRA 1OKQA 1YJLA 2RDNA 4COYA 2VD7A 1ND2C 1E5SA 2XVKA 1AR82 1DQ1A 4HOOA 2UYAA 1OBNA 1YIPA 4COWA 2VH9A 1RYYA 1J3RA 3AZXA 1LOFA 3FHIB 2VC9A 3LIGA 1Y3TA 4JAAA 4AQ6A 3RI9A 4CU8A 3ZFEC 2VJXA 3FZ3A 2V4AA 3HQUA 4XBQA 1FPN1 4H14A 3BCWA 3ZDSA 2DU1A 1HDKA 1EPWA 4IQPA 4DUWA 1CGPA 5JWPA 3C3VA 3B7MA 3I97A 1QJFA 5CFDA 1HB2A 4KU7A 1SMVA 5E16A 1UXXX 1G6NA 3VBFC 1ZBA2 4YVSA 1N47A 5FLJA 2DUPA 2WNUB 4Y4YA 1DDLA 1EAH2 1S0IA 2AACA 1V6IA 3VBSC 4ARXA 3ZFGB 4IV1C 1L7QA 2P3KA 1W6OB 1VE0A 1KDKA 2QZ2A 3HN1A 2BFUL 4N90A 1CWPA 4EN8B 3AKQA 5A70A 3MIEA 1DG6A 1OA2A 2IVJA 3RYPA 2FCUA 3OB8A 3CL1A 4X6RB 3AJZA 3I2GA 1TNFA 5IFTA 3LOIA 3VD9A 4XIOA 4C1WA 4UT5A 4FI9A 1Z7S3 2ARAA 4PLMA 1JYCA 1DQ5A 2ZEYA 4XAEA 1TVGA 2Q5TA 4XJUA 1ASJ3 5FO8B 2PYTA 1RUJ1 4IETA 4CA9A 2BPA2 5T3NA 2FHRA 1QHDA 4HZFA 2VXJA 1JMUB 2FDIA 1I6XA 5LBBA 1NE4A 2HWF1 4N43C 1RUD2 4B7EA 1LHWA 2FD8A 4LKFA 1RTVA 4P00B 5IHRA 3NNLA 2ZHLA 1CIWA 1EAH3 1F4AA 3WINE 4GMP1 5CNAA 3ZMNA 2R1DA 4YM1A 4FXKB 1KJRA 3WW3A 4RS5C 5C4WB 3PU8A 3OD4A 2ADDA 4IEVA 5F9TA 1SCRA 4YZ1A 4ZKTB 1VIWB 5IAXA 2DV9A 5DUVA 1UX7A 5E6HA 1O5UA 2LROA 3WF4A 1R092 1JYTA 2A7AA 1C8NA 1MS3A 1S4CA 3OYWB 3U07A 2ETEA 3O0XA 3M1HA 4P5YA 4OI2A 5FLHA 5T5OA 1NY72 3BODA 4I01A 4I02A 4QQPA 4QX0A 3D8CA 1UOGA 2VZOA 3B00A 4C8DA 2PTMA 2TEPA 3LKJA 5FYBA 5FBZA 5D8AC 3W9AA 3K4DA 1H0BA 1UPIA 3HQXA 4AFMA 3VKFC 1GMMA 1RUE2 3OGVA 4A7YA 1FMD3 3SH4A 2NLRA 1S2EA 3MIGA 2FDKA 1C8M3 3PVBB 2JDZA 3IKWA 4JRAA 2RS52 3ACHA 3AYCA 2XR4A 3TEWA 5FAXA 2QQLA 1JUIA 4Y1VA 1DQ6A 1RVF1 3AXDA 4QU1A 5FZIA 3X29B 3FUOA 4FTSA 5GZCA 4JDOA 4ZY9A 2CGNA 4BQ3A 1MEC3 4OQ9A 4Q27A 1CAXA 1F4HA 2C26A 2D5HA 1W6QB 4HKWA 3I49A 3DGTA 4G9SB 4W6WA 4XF4A 1AR93 4YSFA 1UF2C 1GR3A 2J7MA 1VBD1 2ZX2A 3R6SA 1H1IA 2R7EB 2YZ4A 4CTEA 4UF0B 1VBE1 1OH3A 5FPZA 5A1FA 3MYXA 4R9DA 5BNPB 4S2HA 4DINB 1DLLA 4Y22B 4A7KA 4Q4X1 1UOBA 1PO21 1BKZA 5GLTA 3NNFA 3ACIA 5EXOA 2VMIA 3TWIA 3JUUA 1UNBA 2PAKA 3ZPOA 1JZ4A 2VZ1A 4AFAA 1O4TA 2R041 4BPZA 3K46A 2E9QA 3H3ZA 1B35C 4MGIE 4BZ4A 1UU6A 3VD5A 3CEWA 4Y5SA 3ZDVA 4DRRA 3WG2A 1K3IA 1VJ2A 4C91A 4E8CA 3HAGA 5A33B 5LWBA 4M4RA 1GP5A 3UGFA 4IEZA 4JVAA 5C33A 2Y6GA 4RA0A 4ZZ8A 5HI0A 1E57A 1Y9GA 3UV9A 1VBA2 2NM1A 1T2XA 2NMOA 3LSEA 5JVVA 1BHGA 3HNYM 5CKQA 1AZDA 1LJ7A 1RUH3 3EBRA 3PVEA 4IEPA 2ZX0A 2WLQA 5LBEA 1X82A 5JXHA 2OQ7A 2ZOEB 3ZXLA 2DF7A 5JAXA 3AC0A 2RS11 5JI9A 4WVMB 5I93A 1KFXL 5IYYA 3VZMA 2G9FA 4E2SA 5J3UA 2ET7A 3ZXDA 1GQGA 2WNEA 2JICA 4CU7A 2XUEA 5A33A 1R1A2 4QWNA 3AKPA 3CQOA 3NNJA 3S7EA 2GNDA 2JKXA 3M2MA 3MW2A 4FPCA 3ENRA 1C28A 1XNBA 4GWIA 2ZHNA 4D7YA 1HRI2 2VTFA 1WBLA 2ZGQA 3HOBA 4AVAA 5CEHA 4BQXA 2O8QA 5BXXA 1HV1A 5K8SA 5DG1A 5A3PA 3WDVA 5FZGA 1UOFA 2CL2A 2WIIB 4HONA 1VAKA 3AXEA 2RS32 4C90A 2H0BA 2D44A 4O7XA 4YRDA 5FRAA 4PDWA 1ZVFA 4EE2A 2C1FA 3ZFFC 4CDQB 3BN6A 3RDIA 4GULA 1CX1A 4IE4A 1FNZA 1DQ2A 1BK1A 1IOAA 3CZUA 2Q1MA 3H1YA 1ACCA 2IXLA 3FE5A 4ZXKA 3POGA 2ILMA 4L2NA 3C7OA 1UO9A 2Z4FA 4ASLA 1L3JA 4ES9A 2D6KA 2Z69A 3WUDA 3AMMA 5ACA1 1CIYA 3IN9A 3O1PA 5FPAA 4IUGA 4LULA 1PIV1 3MUY1 3NV1A 4BK4A 1URXA 1NQDA 4YLZA 1C5HA 4UFLA 1IS5A 4OYUA 1R1ZA 4QPWA 2BVVA 5IVEA 3KS7A 2IXJA 1V70A 4AI3A 5LY2A 1QQP3 5IK5A 1XC6A 3NAPA 1H4HA 4BU2A 4PQ9A 3ZOIA 2XJVA 4QQ2A 1OVPA 2WLPA 3M3EA 3KV9A 4A6OA 3SISA 5EJ3A 4LHNA 1UQXA 2OX0A 3LDKA 2BBAA 4JV4A 4QPGC 4A3ZA 4LKSA 3J7HA 2A71A 4GA9A 2RDSA 4HVQA 2RR11 1MS0A 1CAWB 5ABJB 5AC91 1OC1A 2KD7A 4AK3A 4URAA 1YIFA 4EWAA 2E31A 4JCKA 5BV6A 2I2SA 3V0BB 4U36A 5JOXA 1W2UA 1RUF1 1T6BX 2JENA 4QKDA 1UCXA 1IQDC 3JBG3 2HKXA 4BOWA 4ZONA 5BNOA 3VBHC 4B4RA 4G4FA 3LIHA 2WYSA 3THCA 4XTPA 1DYOA 2BERA 1I1EA 3K2OA 2BGPA 2GC3A 1IS3A 1PO12 3CDZB 5FY0A 2AEYA 5K0UA 4CDUB 1ULCA 1OOPB 2ADEA 3H8XA 4RGGA 1W9FA 2IC1A 2NYYA 2VM9A 4OLLA 3G7DA 1U5YA 3ZN4A 4Q2FA 5EHDA 4XJAA 1LHUA 4OHYA 1TMF3 4LBQB 3VKMA 3WP5A 4E8DA 2GC1A 4DUXA 3JD72 4Q0SA 2OW4A 1IS6A 1V9U3 2WC2A 4LUKA 3E5QA 3KHBA 2QNKA 3T2OA 5LBFA 3ME2A 3H1WA 5JR2A 4YM3A 3NW4A 4LOTA 1VRH1 1O5LA 4DO0A 2VUCA 5FY1A 2NP0A 2R061 3IIIA 5LA9A 2VE1A 4GWJA 2A6WA 1JOJA 3TOJA 3GZEA 4XFFA 2CDPA 1AYM1 2ZS6B 4Q5OA 4DXZA 1PO13 4B4QA 1SLTA 5C8CC 3M3QA 1G9AA 5DUXA 5H9PA 4CCLA 1XYPA 1SFYA 2WAOA 3LCPA 4P9XA 2VZPA 3ZXJA 3N9OA 4FPKA 4FVVA 5HCFA 1PGL2 2BDRA 5LA2A 3D3AA 1NCRC 2Z2SB 3FUQA 4XMAA 3NQHA 3WNXA 4AG4A 1F9KA 1K5MA 2EXKA 3GGLA 3T08A 5C5TA 3THPA 2EA7A 4FPEA 3AKSA 4FTEA 1CZVA 3O1TA 2WNVB 4OI1A 3BALA 3H8RA 4AHWA 3VN4A 1LOFC 3A22A 4J1XA 3KCYA 1LOEA 4AZZA 1PX3A 1CONA 5K7PA 3Q8AA 1XB9A 1Q8PA 1QXPA 3OEBA 3M4FA 2X5IA 1W9WA 2JB4A 3LEIA 4LIVA 2P3YA 2W92A 5EP9A 4FPLA 4UYBA 4UFIA 2R49A 1LGNA 5FZ6A 3U10A 4AHYA 5HBAA 5CFDC 2MPFA 3K75B 1QMJA 1EPZA 1LGBA 4YVSC 4FAHA 3CJIA 5E8AA 1ZYBA 1VLNA 1ENXA 1QF3A 5T50A 1LULA 4UBHA 5DZEA 1X8MA 4OHZA 4MXWB 1NXMA 3GZTB 1CAUA 3WLUA 4K8FA 1FV2A 3AL5A 4GH4B 5L19A 2RM22 3FBMA 1N1VA 4XOGA 4A4AA 2XJUA 1Z7S1 4ZPIA 2P3IA 3KCXA 1NG0A 2JG9B 3MGUA 3RZZA 1ASJ1 2DVAA 3FFQA 3TN92 4CVUA 2XUMA 2JG8B 1PMHX 2XWBB 3D5OA 3BGAA 1SFPA 3UESA 1STMA 3JB4C 1KRIA 1TME3 3ZSEA 2ZX1A 1COV2 4HSLA 5I91A 1ZZ7A 5A1LA 5DAPA 4FPGA 2A3XA 3VHOA 3RZKA 3N7MA 3ES1A 3AMQA 2XJQA 1SLAA 4IW3A 4LKDA 1CX4A 2D6MA 4NOTA 5C3PA 1UAIA 4M0NA 3KGZA 3I7DA 3OSDA 4MHUA 5A32A 5GZGA 4QX8A 3RZGA 3N9QA 4O9GA 4PJYA 1OPMA 2VCCA 3ZXKA 4DFSA 2YYOA 1WKYA 5FXXA 5CB7A 1D2QA 1XNDA 4R9CA 2ZTNA 2VW2A 5J98B 2B8MA 4ASKA 3LPFA 3O5SA 1REEA 1UPSA 1V0AA 4NJ4A 5I8SA 1EP0A 3AYAA 2JE7A 3H3LA 4XF3A 3LEMA 1PM4A 4IERA 2B45X 3HBZA 4V1PA 3ACGA 5A6YA 4E4SA 5KBFA 4P9GA 4X8NA 1D4M2 4XJ8A 5LASA 1N1TA 1FMD1 3O14A 1PZ8A 1C8M1 1ZA4A 4AI8A 5BNNB 2VQAA 2YBSA 3K4ZA 3KVBA 4EZHA 4XTMA 1AR61 1JHJA 3AFKA 5F5CA 4D7TA 4KGGA 3WCSA 4N7IA 5DDJ3 3VD4A 1MQTB 2Y33A 4CDWB 1S2KA 2ZAHA 3I8TA 1MEC1 1S0DA 4Q8KA 4E4ZA 5A6XA 5LA1A 1SLCA 4IEWA 4Y3OA 1LHOA 2Y6FA 3E5UA 4E27A 1NXD1 5FQ0A 2JEMA 2GN3A 4UWDA 1AR91 1HXS3 2JDYA 5L9RA 3GCWA 1OD3A 5APAA 4PLOA 3VHRA 1GQHA 4GALA 3T3YA 3WNNA 1S0EA 3CKHA 3VD7A 2CGOA 5T5LA 4FT8A 3WCRA 4Z1VA 1VBB2 4E2QA 1UX6A 4PIXA 2WUHA 3T2TA 3ZYFA 4EV0A 5I0SA 3VKNA 5DAWA 1NX9A 2RV9A 1ZBE3 3H8UA 2VNVA 4P9JA 1R081 4LOSA 1OLMA 4PBPA 2VQ0A 4RQPA 4R4ZA 2OKXA 3U78A 1UIKA 1IGOA 4HG6B 1UD1A 3H9AA 4QQHA 1O3QA 4Q26A 5FZ3A 4YM0A 5KXCA 3WP3A 2WS93 2TNFA 2Q1FA 3E5XA 4RHV2 4MGZE 4RSUA 2C0ZA 2IXCA 1Q8OA 1GP4A 2QKDA 2JDUA 1WCDJ 3VBUB 4B3NA 4DOUA 4AEDB 4LK7A 3ZSMA 2WABA 4ES8A 1RUH1 1REFA 2Y34A 1UZZA 3WT3A 1BYHA 1H8TA 1FOD2 3OY8A 4IV3B 1CPNA 1H1AA 5G05L 3FJSA 3HEIA 2Q4SA 1DLCA 3GBGA 1IPJA 4D0QA 3UYJA 1D0GA 1KEXA 1A6CA 5H9SA 3F2ZA 3WQ7A 4K6BA 2BV4A 4QKFA 2K9ZA 3KF5A 2WWUA 4YNIA 3ZIXA 1K5JA 1RB8G 4AYUA 3VBOB 4XVHA 4BMEA 2ZX3A 5JIAA 3HN3A 2VZQA 5F32A 2PMWB 2GC0A 4PIYA 4EROA 3HT2A 4CEWA 3ZXGA 1Q43A 2XQXA 2YUEA 1RUC3 4MV2A 2QQUA 1LECA 5JMOA 2GDFA 5F5QA 1DP0A 3PJQA 4HKLA 1APNA 2PLV3 1VRBA 1NCQB 2WINB 1R64A 3ACLA 5FMDA 3ZSLA 1MZEA 4YARA 2Y6HA 1C5IA 5FOJB 3N4MA 5CYYA 1MVEA 2EALA 4QPIA 4B7KA 4E2GA 4GB33 4PDWC 3D4KA 3FL7A 2RJ2A 2XVLA 1WLCA 3A4UA 2DDUA 2Y60A 4WVZA 4XF9A 1OI6A 4DMIA 5FO9B 3S0MA 4L97A 2C9AA 1OF4A 4RR3A 1BK0A 4H7MA 4XQ4A 4Q4V2 1C3HA 4AEKA 2QVSB 3NJXA 3ZXEA 4ZU7A 2ET1A 2V5YA 4Z8BA 2Y8KA 4QM9A 1NKGA 1JYWA 4CP1A 4UW6A 3VDBA 2BOJA 3GJAA 4MGSA 1PNFA 2UWAA 1QQP1 1RHI1 1W90A 4QQOA 3ZXAC 3ZYRA 3S57A 1UMIA 2ZGPA 2B4KA 1H6YA 2CU5A 4QHOA 4Y20B 2GH2A 4MYEA 4E4DX 1F15A 2WRAA 2PHUA 4LK6A 2RMU2 1G7YA 3FC0A 3SQOA 4CCDA 1PGW2 2VTXJ 3NAPC 4KMQA 4QMAA 4OQ8A 5DPNA 1PVC2 1O4YA 5FYHA 1NZIA 1OA3A 1O6UA 2VQTA 4MXVA 4S2DA 5DAQA 5HXVA 5JXJA 3E6CC 5T54A 1LESA 1PK6A 4WBBA 4HT1T 2EVXA 4HXCA 2W3JA 2XBO2 3UJQA 5BNQA 2OZ6A 4M3CE 4YFWA 2GSYA 2V09A 1W6MB 3JBG1 3CMGA 3PIJA 3Q8CA 5DABA 5IVBA 2GNBA 4HANA 5K9YA 4HKOA 1QJZA 1Q56A 4YWAA 3WOGA 1YQ6A 3C2UA 4Q4Y3 1N3OA 1HB4A 5FZ4A 3PUHA 1QJX3 4OI4A 3RVHA 4CP9A 5BNOC 1ND2B 1VR3A 4XFAA 2CYFA 2WWJA 2CNAA 3QD6A 1RINA 2PELA 4ITCA 2QDRA 2GN7A 5HPOA 1XPWA 1TMF1 1KFUL 2VMGA 3DYMA 5CFCA 5K0UC 4AFCA 3ZFEB 1CVNA 2ZACA 1J3PA 4AE2A 4OHVA 3D6EA 4TN7A 1JU3A 4CCNA 1V9U1 2QQMA 4N7UA 2BVBA 2ZGKA 4CUBA 2ZHKA 1YLLA 2XWJB 3H0OA 2NZ9A 4IEXA 4AVBA 3KT7A 2MEV3 5F3IA 1C57A 5FYZA 3THTA 3VBFB 1KITA 4L0PA 4UOJA 5FYVA 3U1XA 2D6OX 4QDSA 3VBSB 2HWD3 4F7ZA 2K46A 4IV1B 2VL4A 4ISQA 2ZBJA 1O4ZA 3TAYA 3W21A 4Q8LA 1GU3A 4D6QA 1PHMA 3JQXA 4OHXA 4FAGA 1U0AA 5KXDA 2DCYA 5FREA 3IB3A 5F1RA 5EZWA 1W8ZA 2FBEA 2XLFA 3AMPA 3APBA 2KXLA 3K48A 3T4HB 2FDHA 1QJY2 2HEYF 5FY8A 3O1RA 2GNTA 4BQYA 2E6VA 2VVDA 3V56A 4FPHA 4YW7A 2UURA 1UYXA 5LRRA 1PX4A 1NA1A 2J1AA 2WFF3 1GLHA 1QJU2 4I0BA 4P9WA 3DN7A 5F3CA 4MH0E 1JYNA 3S7IA 4JGZA 3RMYA 4I3PA 3WDTA 3J8F2 3UETA 4N43B 3URFA 2RG4A 4AEJA 1K5MC 2IXIA 1IG0A 1RXFA 2W94A 1WLDA 4CUCA 3IWZA 4FSJA 2P3JA 1XYOA 4KBZA 5JOWA 5LB6A 2XONA 4XCAA 2JDPA 2YB7A 4AI0A 2CWMA 4GQ7A 3TNPB 3IMNA 4LBMA 4RS5B 4BK5A 3AB0A 2F4PA 4KWKA 3SCGA 1LOBA 5IK8A 2BP6A 2X5IC 5GJ6A 1POQA 2O8OA 5I0UA 3DEMA 5CISA 2HH9A 3KV5A 4LLFA 1XE7A 3LDBA 3RI8A 1ZREA 1UY3A 2XG3A 5B2GB 1SDDB 1QJY3 2WL1A 5SV5A 1O3SA 1CZTA 1DZRA 1UY0A 2HWC1 4FBFA 2C24A 3CJIC 2J42A 1BBT3 5LCWL 3ZN5A 3EHKA 2O14A 4FQZA 4JKLA 2DBIA 5DQ0A 2IZWA 2XVGA 3KD4A 4NMIA 3RRDA 2VOVA 3LA7A 3ZN6A 4AGVA 5ERLA 5JOZA 3BIEA 1AR73 1K42A 1IPSA 2JDNA 1XNKA 2WO7A 1UKGA 2RHPA 5D8AB 1ULGA 1TME1 3DKQA 3J8F3 4RGAA 5FO7B 3FHQA 3LWCA 5FTTC 4NROA 5FK8A 1HRV2 1AR83 4R52A 3U0ZA 2VOWA 2ZZJA 2XKOA 1W6NA 2RDQA 3WP6A 1F35A 1RIRA 4YGEA 1UZ0A 1UL9A 3KVAA 3O0WA 1JS9A 1W8WA 2FCVA 5FZDA 3ZR6A 4OHWA 4XUPA 5CBLA 4QB2A 5FWJA 3W5MA 1U12A 4V2WA 2GP5A 3T4VA 5IFPA 1JOPA 4XACA 1AXKA 1W2NA 4HSJA 2W2IA 4JQRA 1AX2A 2DCKA 1EV12 2FQPA 2HYXA 2WZR2 3FFZA 3GDBA 4IGOA 4JTOA 2XPJA 1ZBA3 4RD7A 1VAMA 4TZDA 4SBVA 3WDUA 4NPMA 4HL0A 3QH7A 1PZ9A 3GHNA 2W1QA 1QOSA 3PL0A 3BB6A 1LU1A 3IPVA 1WW6A 3DYOA 4D69A 2YG0A 3ROUA 2R32A 1OHFA 2XMLA 4GXLA 1GV9A 4PF1A 1UZYA 2UY9A 3WW2A 3M3IA 3WF1A 3I59B 1BMV1 3T2PA 3WQ0A 1B35B 3I3BA 3USUB 1W8OA 3HQRA 4LTAA 3NL1A 4COVA 3OBAA 5DDJ1 2B5HA 5IVCA 5IAVA 2PAMA 3SITA 3FN9A 4I0WB 2BNNA 4AVSA 1SPPA 3BYWA 1GZ9A 3B9CA 1RUD3 2YMZA 5I0RA 1ZRCA 2VMHA 1W2AX 4P9IA 5CKMA 3R4UA 4ET7A 1HXS1 3AFGA 2AEZA 2EXHA 3BOWA 4NUBA 5FFOC 2Y38A 1PMIA 5T5PA 2TBVA 4XUOA 5L7OA 2YY1A 4Z82A 2YC4A 2PHLA 2WZPP 1GNYA 4QXHA 4WZCA 3I4IA 2SLIA 1WUVA 4QU2A 3I3EA 4DNYA 2CAUA 2PXJA 1QNWA 1LHNA 1YJKA 1R093 5B4XA 4GMP0 2XJPA 5IVJA 1YFYA 2IWGB 2P34A 3NJVA 3DPRA 1ZBE1 5A3MA 2JD4A 3U75A 1S0BA 4XILA 4RGKA 5FPLA 1RUG2 3PMEA 5T5JA 3MBWA 1OVSA 4XUNA 3GM8A 2WZ8A 2WS91 3I3DA 2A5ZA 1RUE3 3POYA 1BJQA 1W6PB 1ZM1A 2ZJCA 3IDCB 3USSA 3VZNA 4RQPC 4AQSA 3OUIA 1YHFA 2VECA 4QDRA 5GZEA 5HCAA 3FX3A 2RS53 4N9IA 3CIHA 3WY6A 1TNRA 3OGGA 3ZFFB 3U11A 4IE7A 1W05A 4YG6A 2WYFA 2JX9A 5CU1A 5FBJA 3WZ1A 1BEV2 3N9NA 2ARBA 3ZYPA 3ELNA 3FHAA 5GLVA 2Y64A 3VB9A 5M0TA 4PLNA 3Q9OA 5IVYA 1QJEA 3BU0A 5DUUA 1DFQA 1AL22 1GZWA 1H8TC 3WDXA 3WVJA 5C9AA 5A3LA 1PM7A 2KM2A 1VBC2 3PNAA 1E5HA 4URTA 3K3OA 4FXGB 1JN2P 5FCCA 1Q8SA 4PCRA 2VULA 2WKKA 4NHLA 3SMHA 4XJWA 5C6CA 5LZ6A 3NMBA 3BKZA 1GP6A 3DYPA 5GLUA 5FMBA 3VDDA 4ARYA 5BPXA 1WLTA 2UWCA 1US3A 1VMFA 2OUJA 1MR5A 1X8EA 4JGYA 3AZZA 4Z92B 2WA4A 1RUC1 3R4SA 3PTRB 3OUHA 4XDOA 2Q1ZB 2PLV1 4DXRA 3INAA 4P08A 4CEWC 2HJIA 2A3WA 1OLRA 2DCJA 1OH4A 1YFUA 3AZWA 4GIQA 4M4PA 4Q0VA 2V4VA 2JXAA 3A0NA 4NHXA 4QQLA 4GB31 2DU0A 4YVWA 4XE9A 5CA6A 4QPGB 4YW4A 2H6BA 2QFEA 1OF3A 1RJ7A 2O0OA 3MZHA 3ZYHA 4LBQD 1NUKA 1VBA3 4HVRA 4QPIC 2GU9A 5FOBB 2VMDA 3KZ4C 1QY4A 5FZOB 4QX3A 3ZSKA 3VBHB 1M06G 1OQDA 2D40A 4M3CB 4NR1A 5FZ7A 2EF6A 5LBCA 3MPPG 4RR3C 5HXMA 1D0HA 3LEKA 4HPKA 4TYSA 2FMYA 2PHWA 4OUMA 3WV6A 1JODA 2WA3A 3MLJA 2VVFA 3MIFA 3IDAA 2A6VA 3VBRA 3VL8A 1R1A3 4F3JA 5CG9A 1DGWA 2VOTA 2Y6JA 4I0AA 5D1IA 4OZOA 4BXSV 1H9WA 5A80A 1CJPA 1HRI3 2DUQA 3POWA 3GBFA 3NO8A 2G19A 2ZXQA 1VB2A 4LO8A 4A45A 4CEYA 5D2AA 1ND3A 4LE4A 4YZ4A 3WF3A 4XBNA 4CP2A 3LB9A 5L9BA 1VMJA 4TSVA 3KB5A 3VDCA 4UFHA 3T0DA 1SEFA 2W87A 1A8DA 2N7GA 2RS33 3TBDA 1IHMA 2IFRA 5DUWA 3SEPA 3MF6A 4QX7A 1PK6C 1WWYA 2XJTA 3MIBA 4CCJA 4KI5M 2PHRA 2VXRA 1XJAA 3AP5A 4Q4Y1 4B1LA 3GF6A 4IEUA 3FLRA 1QJX1 1W04A 2VMEA 3LPGA 4A3XA 5C3QA 5C8CB 1PNGA 4Q0QA 3ST7A 5KHKA 3UNPA 1ZZ8A 2X05A 2WQ4A 1ULPA 2VTXA 2D43A 2EIEA 5A7WA 4DRVA 4DUVA 1NCRB 5F2SA 2D5FA 5DN2A 3RQ0A 2RE9A 1QXRA 2WZEA 3C7HA 4DIQA 2QBXA 1DGWX 4GJZA 1N1YA 2VG9A 1XYNA 4O65A 1HN1A 2GMMA 5CFCC 2MEV1 5B4NA 2VNGA 1SFNA 2HEWF 4OVEA 1G9DA 3LOBA 4H7LA 2PQSA 4AOCA 1NLSA 3EMRA 4KWUA 1W0OA 4Z07A 2GMPA 2ZA9A 4CCOA 4DEQA 2HWD1 5FUNA 5CFDB 1JZ3A 3UT0A 5I0TA 1IG3A 1H30A 5EJZB 2FMDA 4YVSB 4JHZA 4LBKA 3H1MA 2Q0AA 2G9GA 4N53A 4PT6A 1A8MA 2UY8A 5JUVA 1WCUA 2G1MA 3DXTA 3S5QA 2JIJA 3MIDA 2ARCA 4ZU5A 1ZRRA 2X53S 3T30A 3LD8A 4NIHA 3T0AA 1J83A 4WM7A 1CAVA 5E88A 5DZFA 2WFF1 3PUQA 3NV3A 4I3GA 2VZUA 3E97A 4PI0A 2VBBA 5FYUA 4INDA 2R072 3ZKUA 1MZ6A 4Q4W2 3UKVA 5T52A 2HWE2 2E51A 2WT2A 4D6RA 5JPNB 1Y9MA 1NA1C 2I74A 5JDBA 1KJLA 4RFRB 3O1VA 2P6HA 3V0AA 3PVNA 2XHNA 3CLPA 4JGZC 1TG7A 5FZ9A 1LAJA 2PHTA 3MIHA 3E6DA 1I5PA 3JD73 3CF6E 2BNOA 1AYN2 2DCTA 1UU4A 3KSCA 3OD0A 4CZSA 1RUOA 1LEDA 4AVVA 4NAMA 5G04L 1W0PA 4QM8A 3WG4A 1RGSA 4DZGA 1G86A 2Y0OA 4HN1A 2DYCA 1WA6X 1RUNA 1TQ5A 1QJY1 3OBTA 1FPN2 2K0GA 4FOQA 4IE0A 4HK9A 1W39A 3PU3A 3LZZA 4DXTA 2WT1A 3W20A 2P17A 5FP8A 2BBVA 2GMEA 1BBT1 1MS4A 1NLQA 3MICA 4QX2A 3ZX7A 1SBEA 1AR71 3VV1A 4WM8A 1SLIA 2H0VA 4XW3A 4LNVA 5A3OA 4LR4A 4AGGA 1D4VB 2A75A 1AR81 1LODA 5ISLA 3MV01 2FZ2A 5CZKA 4Q1PA 3J7NA 3KMHA 4JDMA 1WA4A 2F4LA 3PTYA 5F7UA 2D6PA 4AWDA 4X8PA 3PUSA 5C3SA 4KQ7A 3FLPA 4N9HA 1AX0A 4XC9A 3KV6A 2W46A 1W0NA 1AYN3 4XUTA 4DS0A 3WHTA 2Q8CA 3RJ2X 1ZNPA 5F37A 5D21A 4S2FA 2Y0IA 2LRPA 4MADA 5J7MA 1CJDA 1RUJ2 2ORZA 3MF9A 1MACA 4QX5A 2Q8EA 1ZBA1 2I45A 5FZMA 4W6XA 1EAH1 1CAXB 1S2BA 2PFWA 2ZEXA 3BOPA 2HWF2 4LE3A 5A3UA 1CZSA 3HNBM 4K1YA 1XQNA 4YFZA 1V6NA 1NAEA 4FQ4A 4LHSA 2ORXA 3BIWE 4XFGA 2OIIA 3WP4A 4QX1A 5C3RA 1NZCA 3NRUA 1WMXA 4Z2WA 1P8JA 4FPFA 3IAQA 2YC2A 2P4EA 1UY2A 2MHFA 2RM23 4CDXA 4BQ2A 1ULFA 2AUYA 1DYKA 2ZAAA 2LALA 3KT1A 2WR9A 4B4PA 3ZYBA 4CCCA 4NIDA 3AZVA 1LTEA 1CD3G 5E1RA 4Y4RA 1M4WA 2BRTA 2W1WA 4P02B 3TN93 1K45A 2W08A 2WO2A 3RWNA 2EIGA 4EN0A 4AVTA 2BJSA 4YW3A 5FYCA 3B93A 1NLRA 2RVAA 4C0HA 1RUD1 1J84A 4MHRA 1BVP1 1COV3 5KXBA 1OSGA 4Y1YA 1IKPA 4L8QA 1AF9A 1WBFA 4RL7A 1VAVA 2VZSA 2W39A 1DU3D 2FDGA 4XHBA 4ATEA 3B9IA 3P1IA 4J1WA 3ETPA 3OTFA 5CIRA 5FP9A 3KQ4B 1RVF2 1XNCA 2DFCA 2XXZA 3P6BA 5FPUA 2X10A 5L7OC 1R091 2WN2A 3I2KA 4WVVA 1D7PM 2WNUA 2XQRA 4AEMA 3DUIA 5IUQA 2PQQA 3CHXA 4BM8A 5FY7A 1YI7A 1NY71 3ZFGA 5FZ1A 1W6OA 3AL6A 4QXCA 2VUDA 1YQ8A 4MGTA 1OLME 2IVIB 3O7OA 1H2LA 3GZAA 3DPRC 4NN0A 5FZ8A 2CDOA 4PBOA 3TEXA 3PIGA 1D4M3 1RUE1 1VBE2 2WN3A 3K51A 3I2IA 2A73B 4Q4X2 3LEGA 1WMEA 4NRMA 2IXKA 2RS51 1PO22 1FX5A 4ZHNA 1UN1A 5KHGA 3AMNA 5KXEA 3WF0A 2LM3A 3H50A 3RWKX 1ODMA 2YXSA 3UL2A 1PVXA 4UW5A 1UU5A 3FWEA 5C70A 2D7FA 4UFMA 5FYYA 2R042 4ORFA 3P5BA 4PDWB 1UMHA 1X50A 4K1ZA 4CSWA 4NIIA 3OBRA 4AFDA 4HBNA 1V6JA 3U4SA 2VGDA 3ZKYA 4LIUA 1UZVA 4JDNA 2PA7A 3ACFA 4BLJA 3PMSA 3ATGA 4YGDA 5GALA 4LBLA 5KWRA 2K2SA 4S2GA 5H9RA 3R05A 3SC7X 4EQVA 1GZTA 2ZGNA 4LQRA 4UFKA 4MO3M 4ATFA 1H6XA 5C4WA 3UKTA 4R8HA 3U4XA 1AXYA 5C9AC 2PAEA 4OCTA 1DQ0A 4W50A 4C0BA 1VBB3 4CE8A 2P1BA 3EO6A 3AK0A 2FZ1A 3L2YA 3KGLA 5FZ0A 4CYDA 1GZCA 3VDDC 3OYWA 4MSVA 2J1UA 4LO7A 2QQPA 3RFRA 4AI2A 3BTYA 2RS12 2YU1A 3ZSJA 1KQRA 4JGYC 4Q0PA 2O1QA 2XJSA 5JR7B 3WUCA 3GJBA 3NAPB 4DEVA 2DTYA 1CR7A 4AAPA 2W47A 2AZ5A 2WO3A 4QB6A 3B02A 4CXWA 4YZ2A 1LEMA 3VGIA 3WXPA 4RHV3 1OUXA 2ZZQA 1FAYA
chains in the Genus database with same CATH topology
3AP4A 1VBA1 2YV8A 4LUMA 4K21A 4YVWC 1KS5A 4IEYA 5FMOS 1WLWA 4UBGA 1FOD3 3BTAA 2V73A 4NWWA 1SBDA 5KHJA 1V6LA 1O91A 1YYNA 1W6QA 2XLAA 5AVAA 5BNOB 1R1A1 3GHMA 1V6OA 3CNAA 1Q5OA 3M8LA 3N7JA 4IESA 4KGQA 2KA3A 4BE3A 5BNPA 1HRI1 2ZX4A 1AXZA 3VBRC 1S0FA 5ACA2 5K0UB 5IK7A 4Y22A 5KHIA 2OUHA 3VLBB 1PIV2 4IL7A 2RS31 2BNMA 4XETA 2OYZA 4CEYC 1MS9A 1ND3C 3NWKA 4NO4A 1JTZX 5DZGA 5A33A 4XXPA 1OFNA 1WW4A 2VNRA 2SBAA 3JZVA 3WR0A 1FV3A 4NPRA 4AFBA 3B3QE 5FLIA 5GZDA 2XH6A 2DUOA 2VW0A 4BCUA 1KDMA 4LBJA 2ZCWA 4MGKE 1LOGA 4M00A 1HV0A 3D82A 4Q4V3 4XJ9A 5C8WA 1OA4A 2RR12 5AC92 4DQAA 5JZGB 4W6YA 4OULA 1POV0 3QBQA 3OF1A 1ZRFA 4WVMA 2B9UA 3NKGA 2CAVA 2VUJA 3EXUA 1CPMA 5GLWA 4YG3A 5KC6A 4LLOA 1JW6A 1K5MB 1V00A 2C5DA 2R30A 1SACA 4P5HA 2PHXA 3ILRA 3LAGA 5F6KA 4AQ2A 3ILNA 2RMU3 1H1MA 1H2MA 1QDCA 4K3UA 1PVC3 2VY0A 2F6BA 4MUVA 5FOJB 2X5IB 5BUVA 1XU2A 1ENQA 4M3CF 5L36A 3TB0A 2XBO3 4D7SA 2P37A 2D6LX 1IKQA 4CDQA 4HMZA 3CJIB 3MDPA 4N53C 5BY5A 1KD7A 1CAUB 1VRH2 4NHKA 1ZZ9A 1LOCA 1PO11 4B8EA 2R062 2A70A 4WM7C 5DG2A 2ERFA 2EXJA 4K40A 1AYM2 2DCZA 3M70A 1UKRA 2GZWA 1LGCA 1NOVA 3WHUA 2P2KA 5CVRA 3LA3A 2AR6A 3JD71 1SBFA 3VHPA 4F8AA 1JUHA 3UJOA 1LR5A 3IBMA 2AREA 2XB6C 4NHMA 5A32B 5I8TA 2W52A 1IS4A 1EYBA 2XHKA 2PHFA 3WD5A 1EY2A 3JQWA 2BEOA 4AHXA 3VHNA 1LHVA 3RNSA 1DZQA 2QDNA 3N3HA 4BA6A 2B39A 1CAWA 4QPYA 5ABJA 3D0JA 3V0BA 2ARXA 3WW4A 1ZZBA 2VU9A 2X8KA 4WM8C 3VZLA 3VUOA 1PGL1 2QJVA 1J1TA 4FPOB 5JSPA 2QZ3A 1IPKA 1AYN1 1QJU3 1REDA 4M0HA 3DL3A 1Z7S2 2X29A 3UK9A 2XL7A 4AGRA 1ASJ2 4CDUA 1OOPA 2EAKA 1YO8A 3QLQA 3ECQA 1ZX5A 3ZIWA 1S0JA 1NQJA 4HK8A 4A2UA 1QOOA 2QE3A 2XKPA 4QT6A 2AENA 3VZKA 4LBQA 1OFSA 5FQ0B 4YW5A 2GH8A 4K20A 4YGCA 4XQWA 1ZZCA 2D3PA 5JSRA 1H2NA 2VOXA 2RM21 1DGRA 3EQEA 1LRHA 1KS4A 4XBLA 1KXGA 1OLQA 3KT4A 4KNCA 1UW8A 2D93A 3TN91 2ZHMA 4HETA 1QXJA 1NYWA 3GNEA 3SHRA 4CDXC 3AYDA 3CU7A 4MX3A 2AH2A 3O0VA 1LB2A 4RQPB 1COV1 1HRV3 1XU1A 2JECA 4O9EA 2ES3A 4Y24A 4DY3A 4PF5A 1Q8VA 2XLGA 1C1FA 2JE9A 5EYYA 1FMD2 3IDEA 1GNZA 1DBNA 2WJSA 4XFIA 2ZGTA 4Y5Z0 3LGRA 1C8M2 2WNVA 1Q8QA 1XXNA 1HQLA 3POSA 4ISRA 5EYXA 3T1LA 5AFBA 1AR62 4XQDA 1H8TB 1UIJA 1N3PA 3MLLA 1RL3A 1MZ5A 1EV13 2EAAA 2WWSA 2WZR3 3OY8B 4XZPA 3ZXGA 4YZ1A 1MEC2 2CV6A 3AJYA 1JBCA 2A6XA 1VB4A 4KH9A 4F83A 4HFSA 1AR92 3SXWA 3W59A 1J59A 2WNUC 1D4M1 4XFCA 3VKLA 4MXWA 3ZFGC 5E89A 2VPVA 3LSDA 4GH4A 3KCCA 1A3KA 3AM2A 3ZPYA 4CEWB 5FPXA 4JTNA 2JG9A 3H3UA 1HQNA 1FYUA 2HWB2 4META 2JG8A 1LKNA 4A7ZA 4C1XA 3ILFA 1Q3EA 3RSJA 1R082 3RS6A 1AR63 3ZXFA 1Y43B 1Z78A 2IFWA 4QPIB 4PIZA 4AI1A 4YGBA 2D97A 1QGLA 4X6QB 2ZGRA 3CO2A 3AZYA 2NMNA 1HW5A 4RR3B 1MS1A 2XGXA 1RUH2 1VBB1 4QHBA 5C4WC 2VNOA 1RC6A 1WCSA 2W68A 2HWB3 2DVFA 3W58A 1WGPA 2D6NA 3AP9A 1RUG3 4BHPA 4LBNA 1R083 4DPNA 1QDOA 4RHV1 2A6ZA 2R16A 3QH6A 4QGLA 1I9RA 1QKQA 3RPQA 5BNNA 2YGMA 4KBBA 4BIOA 3AKTA 3E6BA 1YFXA 4AVCA 2GC2A 3OCPA 1PK6B 1WD3A 1FOD1 2R0HA 4XPVA 4GWNA 1MQTA 1YI9A 1BEV3 2Z42A 4CDWA 2PHDA 2TUNA 4KU8A 1AL23 1DZTA 1VBC3 4L11A 5JPMB 5EFUA 2D3SA 2D98A 1RJ8A 3RJRA 5SV8A 1ALYA 1LENA 3HT1A 2JJ6A 3FLTA 4YZ5A 3CJXA 2H6CA 5BNPC 2XL9A 3ES4A 5CFCB 4NVPA 1QQP2 1QH7A 1J58A 1T6GC 3WQ1A 2ZABA 5HCBA 1RHI2 1C4RA 1X36A 5CAZA 4P9YA 5IT6A 1NE6A 1TEIA 4WVWA 1Y7BA 1JH5A 2AGSA 3VBUA 4AEDA 5JMCA 4Q4V1 1POV3 1BVVA 1C1LA 3R0RA 2WT0A 1YWKA 3B94A 2BW8A 4IV3A 3MW4A 4JRLA 4CRQA 3H7JA 4L9BA 1GYKA 4XJZA 1LCLA 2UU8A 3OJBA 3AP6A 3S30A 3JBG2 4GWMA 3OPZA 1QH6A 1HLCA 1ULDA 1SCSA 3H7YA 1NA1B 2B42B 3WDYA 1SLLA 2CTVA 4JGZB 1RHI3 1RMU2 2RMU1 3P3PA 1GANA 3VBOA 1PGW1 2ENRA 4HN0A 1Z0HA 1WMDA 4BLIA 4I2OA 3WDWA 1PVC1 1F5FA 1I3HA 2BFUS 1FI2A 3D0SA 4LBOA 1OD5A 2W0XA 3B69A 1TMF2 3BPZA 4OUSA 3JU9A 3N7LA 2XBO1 1NCQA 3MEPA 1V9U2 1A78A 2VUAA 4WV8A 3VL9A 5BYNA 4YZ3A 3DF0A 3WG1A 4CP0A 3IIAA 2WSUA 1WW5A 4CDQC 1X7NA 1RUI2 1IQAA 2E7TA 3ZN6B 1FXZA 2DURA 1MZFA 1HQWA 1RMU3 1U5IA 3J9SA 3L2HA 4AXOA 3N35A 5FMOL 1W6NB 3FMGA 4FOWA 4P9LA 4XYXA 5GLZA 1ENSA 2CGPA 3GZUC 3ZYJB 3HR9A 2NN8A 3NV2A 1OQEA 4Y20A 5KC5A 2JKBA 4BYYA 1WCKA 1QWRA 3N36A 2BTVC 3AYEA 4BH9A 1ZZ6A 5AVPA 4EWDA 2Y26A 1RUI3 4TWTA 1YCIA 2CWSA 3GALA 2IXHA 3IT8A 1XRUA 3RYKA 1W6MA 4HLTA 3IPVB 3MI8A 5JZGA 5ABJC 5JIUA 2R0FA 1DGLA 1QJU1 2YHJA 4XDQA 3DKWA 3O12A 2HWC2 4OI0A 1GSLA 2ZGLA 4QD2A 4SLIA 5LRSA 1HX6A 2R073 3WT3A 4Q4W3 2BUKA 2WSVA 2ZKNA 3J8F1 1ND2A 2OZJA 2VOKA 1AHSA 2HWE3 3M3OA 4IXLA 3ZYIB 3WX5A 3MW3A 3SLIA 1H4GA 2ZMKA 1TME2 2E7AA 2LTNA 3ZMOA 1YUDA 4CDUC 1S55A 1OOPC 4WZFA 1G9FA 3ZFEA 5JCTA 4XF1A 4XHXA 5JI7A 2E7QA 3OGJA 4FP2A 1YNAA 2BWCA 1B09A 3KLSA 1AJKA 3S6PA 1AX1A 4DB5A 5L7OB 3VBFA 1FPN3 2R6QA 3ETQA 1SQ4A 1O3RA 4KG8A 1JXNA 4QGNA 3VBSA 1BZWA 4IV1A 3B01A 1IZ3A 1CQ9A 2HWC3 3DPRB 2OA2A 3ASIA 4M01A 1O7FA 3PJYA 1WD4A 3VZJA 3TYJA 5EV7A 1HRV1 4LO4B 5JLVA 1ZRDA 2R1BA 2DVDA 4Y26A 4R9BA 1U5ZA 1YRZA 1DQ4A 3HMYA 1UMZA 5J36A 5H9QA 1BMV2 1QOTA 1O3TA 1HKDA 4COUA 4XFBA 1ENRA 4N43A 1MS5A 2ZPXA 3RYRA 3N7KA 5GJ6A 3PLQA 1RUJ3 2ZGMA 3DV8A 2WZR1 1EV11 3GBWA 5DDJ2 2BGCA 2WNVC 4FOVA 3SH3A 1J1LA 4RFT0 1YXWA 4OFGA 1AUYA 2HWF3 3VZOA 4RS5A 1GZWB 5C9AB 1HXS2 4LHLA 5I8YA 1SLBA 1JYIA 1H9PA 4GMP3 1DF0A 3MFAA 1GBGA 2B7YA 1JHNA 3SCHA 5FDBA 2QCSB 3VDDB 4W65A 1H8VA 3LA2A 3AX4A 3AP7A 4U2AA 1G9CA 4JGYB 3WG3A 2NPIA 4BQ1A 1F31A 4YW2A 3V65A 5KHHA 2I07B 1GICA 4GH4C 2GALA 1AJOA 2GAUA 3J4UH 5D8AA 1ZBE2 5T55A 3SH5A 1FATA 1WW7A 1DGRN 1VBD2 3RMXA 3TRSB 2JG9C 4H3WA 4L99A 3G6JB 3ZO0B 1V6MA 2JG8C 2Q8OA 2UWBA 4YVWB 2YGLA 2WS92 4AW7A 4LA2A 5J48A 4DY5A 2ZGUA 3M7AA 4Y1ZA 4E9KA 5AFEA 5JSOA 4HVOA 1RVF3 5J37A 2HYKA 5LEJA 1OQ1A 4GKXA 3HWJA 1GFF2 1OMIA 3HD8B 2YC0A 1AL0G 1YFWA 3MPBA 1G9BA 1H2KA 4HPKB 3JB8A 2WFPA 4IEOA 4TLFA 2HWB1 2ZKLA 3VBRB 4G3YC 1DYPA 1RUG1 2Z79A 3AKRA 1BQPA 2DWRA 1VBD3 4KWJA 4Y1UA 5LEKA 2Q30A 1OPOA 1VBE3 4K7JA 4EJRA 2MNGA 1DHKB 3TNQA 3I59A 1CN1A 3ZYGA 4Q4X3 3SNMA 1PO23 5LK5A 1B35A 4CEYB 1LU2A 1ND3B 4FPYA 4LHKA 3USUA 2YDEA 3KM5A 1MS8A 1RUC2 4BMBA 2ATFA 4AF9A 1N3QA 2ZMLA 4XFHA 1F2NA 1BEV1 4EN9B 2PLV2 3HIFA 5BNNC 2R043 4XF0A 3QACA 3NSTA 4XMIA 1PZ7A 3ALQA 3IDBB 3PVOA 1AL21 2BQPA 4UW3A 1GKBA 1MQTC 4YM2A 2RJLA 1VBC1 3NJZA 4GB32 3ZVXA 4CDWC 5GZFA 4UXAA 4J6GA 5L73A 3T1MA 4LT5A 3KQRA 1DIWA 3RG0A 3VKOA 1N1SA 2E53A 5TSWA 5F6LB 1PGSA 4Q0UA 1V6KA 3NVCA 2DVGA 3I2DA 2RS13 2YPJA 4FOYA 4FP3A 1I5ZA 4LEJA 4L92A 4F3JA 4MVTA 2DVBA 1QU0A 1W6PA 4FTBA 2DTWA 2D3RA 3NKTA 2E63A 4LA3A 1POV1 2BYVE 4COZA 3ZFFA 4MLOA 5DXDA 4EN7B 3QCWA 2OPKA 4N53B 4MGYE 3VBUC 1TE1B 4AEDC 1CESA 1HIXA 2AYHA 4B29A 4D3WA 3MLKA 4WM7B 1CAVB 2GNMA 4IV3C 4AQTA 4FO9A 5LK7B 1BCXA 4R4XA 3EJKA 2ZMNA 4Q4Y2 4KG0A 4QXKA 4P14A 2VVEA 1QJX2 5J96B 2LUWA 1LOAA 2XJRA 5ACA3 4IEQA 3IM0A 1PIV3 2OVUA 5EWSA 3V0AB 1RUF2 3L9JT 4XXAA 3VBOC 2PN5A 2Z5WA 3BU7A 1ULEA 3WW1A 3P3NA 2ZGSA 4NWVA 4XEZA 1XE8A 3J26N 1FT9A 4Y1XA 2NQYA 1VALA 3R4DB 1S0GA 2WQZC 2MEV2 2YROA 1MVQA 4OZXA 4EN6B 4JC1A 1NCQC 4QPGA 3MFCA 4UW4A 4Q1RA 3NV4A 1S0CA 2CY6A 2HWD2 1G8WA 1Y9QA 1S1AA 1VP6A 1GNHA 3JCIA 4YYOA 4AHZA 4WM8B 5CADA 3B5LB 1RMU1 2A3YA 2RR13 1RITA 3VBHA 5AC93 4M3CA 4MZUA 1WMFA 2VW1A 2EXIA 4D94A 1F5JA 1RUF3 4ZU4A 1U5XA 4BIFA 2WFF2 4K9SA 4LO5B 2BWAA 1AVBA 3A0KA 2RJKA 4I30A 2HEVF 3V64A 5CG8A 4H55A 3GYDA 1ONAA 3QOPA 3M3CA 5J09A 3FBYA 5GM0A 2QUOA 4Q29A 5IK4A 2A6YA 4ONUA 2UYBA 1J3QA 1RUI1 4I09A 4YG0A 4XIKA 2DFBA 4ASMB 1F8VA 4FCAA 4R9AA 2ZGOA 1X33A 4FPJA 4BWOA 3UKNA 4EWEA 1BXHA 1QNYA 4GKYA 1SDWA 1VRH3 2B46X 4CDXB 4KL1A 3I54A 4KWLA 5C8CA 1BBT2 1D2SA 2R071 2R063 4Q4W1 4QGMA 4YW1A 5GKAC 5JZGC 2HWE1 1FNYA 3PHMA 2G4IA 4LO6B 3SCFA 1AR72 5JOYA 1AYM3 3AMHA 1NCRA 1OKQA 1YJLA 4COYA 1ND2C 2XVKA 1AR82 1DQ1A 2UYAA 1YIPA 4COWA 2VH9A 1J3RA 3AZXA 1LOFA 3FHIB 4AQ6A 1Y3TA 4JAAA 3RI9A 3ZFEC 3FZ3A 4XBQA 1FPN1 4H14A 3BCWA 3ZDSA 2DU1A 1HDKA 1EPWA 4IQPA 1CGPA 5JWPA 3C3VA 3B7MA 5CFDA 4KU7A 1SMVA 5E16A 1G6NA 3VBFC 1ZBA2 4YVSA 1N47A 5FLJA 2DUPA 2WNUB 4Y4YA 1DDLA 1EAH2 1S0IA 1V6IA 3VBSC 3ZFGB 4IV1C 2P3KA 1W6OB 1KDKA 2QZ2A 3HN1A 2BFUL 4N90A 4EN8B 3AKQA 3MIEA 1DG6A 1OA2A 3RYPA 3CL1A 4X6RB 3AJZA 1TNFA 3LOIA 4XIOA 4C1WA 1Z7S3 4PLMA 1JYCA 1DQ5A 2Q5TA 4XJUA 1ASJ3 5FO8B 2PYTA 1RUJ1 4IETA 2BPA2 5T3NA 2FHRA 1QHDA 4HZFA 1I6XA 1NE4A 2HWF1 4N43C 1RUD2 4B7EA 1LHWA 1RTVA 2ZHLA 1CIWA 1EAH3 3WINE 4GMP1 5CNAA 3ZMNA 2R1DA 4YM1A 4FXKB 1KJRA 3WW3A 4RS5C 5C4WB 3OD4A 4IEVA 5F9TA 1SCRA 4ZKTB 1VIWB 2DV9A 5DUVA 1O5UA 1R092 2A7AA 1C8NA 1MS3A 3OYWB 3U07A 2ETEA 3O0XA 3M1HA 4OI2A 5FLHA 5T5OA 1NY72 3BODA 4I01A 4I02A 4QQPA 3D8CA 3B00A 2PTMA 2TEPA 3LKJA 5FBZA 5D8AC 3W9AA 4AFMA 1H0BA 1UPIA 3HQXA 3VKFC 1RUE2 4A7YA 1FMD3 3SH4A 2NLRA 3MIGA 1C8M3 3PVBB 2JDZA 3IKWA 4JRAA 2RS52 3AYCA 5FAXA 1JUIA 4Y1VA 1DQ6A 1RVF1 3AXDA 3X29B 3FUOA 4FTSA 5GZCA 4JDOA 2CGNA 1MEC3 4Q27A 1CAXA 2D5HA 1W6QB 4HKWA 3DGTA 4G9SB 4W6WA 4XF4A 1AR93 4YSFA 1UF2C 1GR3A 1VBD1 2ZX2A 3R6SA 1H1IA 2YZ4A 4CTEA 1VBE1 5BNPB 5FPZA 3MYXA 4R9DA 4S2HA 4DINB 1DLLA 4Y22B 4A7KA 4Q4X1 1PO21 1BKZA 5GLTA 5EXOA 2VMIA 3TWIA 3JUUA 2PAKA 4AFAA 1O4TA 2R041 4BPZA 2E9QA 3H3ZA 1B35C 4MGIE 4BZ4A 1UU6A 3CEWA 4DRRA 3WG2A 1VJ2A 4C91A 3HAGA 5A33B 5C33A 4IEZA 4JVAA 4RA0A 5HI0A 1E57A 3UV9A 1VBA2 2NM1A 2NMOA 3LSEA 5JVVA 1AZDA 1LJ7A 1RUH3 3EBRA 3PVEA 4IEPA 2ZX0A 2WLQA 1X82A 2ZOEB 3ZXLA 2DF7A 5JAXA 2RS11 5JI9A 4WVMB 5I93A 1KFXL 3VZMA 2G9FA 4E2SA 5J3UA 2ET7A 3ZXDA 1GQGA 2WNEA 2JICA 1R1A2 3S7EA 3AKPA 2GNDA 3M2MA 3MW2A 4FPCA 3ENRA 1C28A 1XNBA 2ZHNA 4D7YA 1HRI2 1WBLA 2ZGQA 4AVAA 2O8QA 5BXXA 1HV1A 5K8SA 5DG1A 3WDVA 2CL2A 2WIIB 1VAKA 3AXEA 2RS32 4C90A 2H0BA 2D44A 4YRDA 5FRAA 4PDWA 1ZVFA 2C1FA 3ZFFC 4CDQB 3RDIA 4GULA 1FNZA 1DQ2A 1BK1A 1IOAA 2Q1MA 3H1YA 2IXLA 3FE5A 4ZXKA 2ILMA 4L2NA 4ASLA 1L3JA 4ES9A 2D6KA 2Z69A 3WUDA 3AMMA 5ACA1 3IN9A 4LULA 1PIV1 3NV1A 1URXA 1NQDA 4YLZA 1C5HA 1IS5A 1R1ZA 2BVVA 3KS7A 2IXJA 1V70A 4AI3A 1QQP3 5IK5A 3NAPA 1H4HA 4PQ9A 2XJVA 4QQ2A 2WLPA 3M3EA 3SISA 5EJ3A 4LHNA 4JV4A 4QPGC 2A71A 4GA9A 4HVQA 2RR11 1MS0A 1CAWB 5ABJB 5AC91 4AK3A 1YIFA 4EWAA 4JCKA 5BV6A 3V0BB 2I2SA 4U36A 5JOXA 1W2UA 1RUF1 2JENA 4BOWA 1UCXA 3JBG3 2HKXA 5BNOA 3VBHC 4B4RA 4G4FA 4XTPA 1I1EA 2GC3A 1IS3A 1PO12 5K0UA 4CDUB 1ULCA 1OOPB 4RGGA 2IC1A 2NYYA 4OLLA 3G7DA 1U5YA 3ZN4A 4Q2FA 4XJAA 1LHUA 4OHYA 1TMF3 4LBQB 3VKMA 3WP5A 2GC1A 3JD72 4Q0SA 2WC2A 1IS6A 1V9U3 2OW4A 4LUKA 3E5QA