3CEWA

Crystal structure of a cupin protein (bf4112) from bacteroides fragilis. northeast structural genomics consortium target bfr205
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
118
structure length
118
Chain Sequence
MKNYQKMSVAQDARVELHDSLALTGAEVSINHLPAGAGVPFVHSHKQNEEIYGILSGKGFITIDGEKIELQAGDWLRIAPDGKRQISAASDSPIGFLCIQVKAGSLEGYTMTDGVVQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a cupin protein (BF4112) from Bacteroides fragilis. Northeast Structural Genomics Consortium target BfR205.
rcsb
source organism Bacteroides fragilis
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized cupin protein
total genus 17
structure length 118
sequence length 118
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3cewA01
3B02A 4PIXA 3SCGA 1YFUA 3GBFA 2XLFA 4RD7A 2QJVA 5KBFA 4FBFA 2N7GA 3RZZA 1J3QA 4WBBA 4YSFA 5D1IA 4F7ZA 5I93A 3MYXA 2MPFA 4I02A 4HVQA 2ETEA 4FAHA 3CF6E 3I7DA 4MX3A 4HN0A 4N9HA 3CO2A 2GZWA 3E5XA 4OFGA 1YWKA 3R6SA 4IEWA 3OCPA 4HVOA 3U11A 4XFHA 5CU1A 2D93A 3FFQA 4H7LA 2P17A 2H0VA 4R8HA 5LEKA 3ACLA 1O4TA 5BV6A 2XHKA 2ET1A 4Q0VA 5HI0A 4KWJA 4XF4A 1YUDA 4MZUA 1DGRA 4Q0SA 3LAGA 1O5UA 1OI6A 1RL3A 3BALA 3ES4A 1O5LA 3S0MA 1L3JA 4EWDA 4IEOA 4Z82A 3BPZA 4IEXA 4XF0A 2Q4SA 1YFXA 3E6BA 2VPVA 4E2GA 3NJZA 4XETA 2PHLA 1YFWA 4BIFA 2ATFA 3H7YA 2GU9A 4UBHA 3ZDSA 1ZRFA 4MV2A 3LA7A 4J1WA 3BU7A 5JSPA 3CL1A 4JVAA 4JTOA 2CGPA 4QM9A 1EYBA 4O9GA 3CLPA 4K8FA 2B8MA 1VR3A 2HKXA 4I01A 2H6CA 2PA7A 1Y3TA 1GQHA 1NYWA 1ZZBA 3D82A 5F1RA 1DZTA 2DCTA 3QACA 3H9AA 1O3RA 3KMHA 4YARA 3I54A 3C3VA 2F4PA 1DZRA 1ZRRA 3O14A 1ZZ7A 4MGYE 1G6NA 2OA2A 1CAWA 4IETA 2PQQA 2XL9A 3BB6A 5JAXA 1VJ2A 5BY5A 3NW4A 1PM7A 4ZU5A 4AVBA 3MPBA 4QXKA 2PFWA 1I6XA 4Q0QA 4J1XA 1U12A 2OPKA 3PLQA 1X7NA 4YNIA 2KXLA 4EWAA 5FQ0B 1UIKA 1ZZCA 3H1MA 5J7MA 4IEQA 2VQAA 3LOIA 3SCFA 4Q0UA 2GH2A 1EPZA 1YFYA 2MHFA 3CEWA 4KWLA 5FCCA 4IEZA 3RYPA 3FJSA 4KU7A 4IERA 1UIJA 1H1MA 2H6BA 2XLAA 2D5FA 4AQ6A 2UYAA 4WZCA 1PMIA 1RUOA 3E6CC 2IXJA 1IPJA 5KHHA 4A2UA 3ELNA 3IDBB 2IXLA 4QM8A 3WW1A 3EJKA 2UY9A 3MZHA 4EV0A 5E16A 5EFUA 3EBRA 4UXAA 4JV4A 4XFCA 1ZZ8A 3EQEA 1LR5A 1NZCA 4LTAA 3HT2A 1QWRA 1O3SA 1Q43A 3DKWA 4LULA 4E2QA 4MH0E 3ROUA 2O1QA 1DGWA 1FXZA 4MUVA 4TLFA 4XEZA 2V09A 4MGZE 3KGLA 5J48A 1CX4A 4NVPA 5CVRA 2ZCWA 3UKTA 3FWEA 1X82A 3E5UA 3DL3A 1EP0A 5KHJA 2I45A 2XLGA 5KHGA 2IXIA 4KL1A 4XFBA 3TNQA 3FE5A 2PAKA 5E1RA 1NXMA 2XKPA 4XF9A 5AVPA 3S7EA 3KSCA 4D7SA 1WLTA 2BGCA 2Z69A 3KGZA 3M70A 4WVZA 3KCCA 1OMIA 3PVBB 2MNGA 3SCHA 3U0ZA 4PIYA 4EROA 1UCXA 1OD5A 4MGKE 5EZWA 5FLHA 3LA2A 2BNMA 2XL7A 2PAMA 2EVXA 4XFFA 5BXXA 1LRHA 3D0JA 1CAWB 1QXJA 4L11A 4EWEA 3WW4A 4LLOA 3H1WA 3OF1A 2WC2A 2CAUA 3E6DA 4QMAA 3CJXA 4PIZA 3S7IA 2QDRA 1I5ZA 2O8QA 1SQ4A 4HMZA 4I2OA 1CGPA 1Y9QA 2D5HA 4XF3A 5LRRA 1ZRCA 4O9EA 4LA2A 3MDPA 4HBNA 1CAUA 2IC1A 1XE7A 1CAVA 3H7JA 1J1LA 4L2NA 4LA3A 2B5HA 2CV6A 3WW2A 1O3TA 1FT9A 2C0ZA 3H3ZA 1XRUA 1V70A 2OZJA 1J3RA 4XFIA 4YYOA 3VHRA 3U10A 2Y0OA 4IEPA 5BUVA 2CAVA 4F8AA 3HQXA 5FQ0A 5C6CA 1NE6A 3H8UA 3SXWA 2BNNA 4E2SA 4KU8A 3OD0A 1CAXA 3TNPB 3RYRA 3PNAA 4HLTA 4PJYA 3IBMA 4HVRA 3M3IA 4HSJA 4GULA 5JSRA 1Q5OA 3FZ3A 3FX3A 3DN7A 5FLJA 4XFAA 2GC3A 4Q29A 2IXHA 2K9ZA 4LUMA 1QY4A 4X6QB 3RYKA 3RNSA 5T3NA 3ES1A 4UBGA 1LKNA 2PHDA 4KWKA 3H50A 3WW3A 4DINB 5I8YA 5J3UA 5I0UA 4D7TA 1WGPA 1RUNA 1UW8A 4B29A 3L2HA 2GC0A 5I0RA 1ZRDA 1ZNPA 5KHIA 3SHRA 5JSOA 1RC6A 2BYVE 4AQ2A 4BYYA 3NL1A 5K8SA 3ETQA 1IPKA 4MGIE 2K0GA 1WA4A 2ZKLA 2GC2A 1H1IA 4N9IA 4META 3RDIA 5FDBA 2PAEA 3E5QA 1UPIA 2GC1A 4P9GA 1NE4A 2BEOA 4ZU7A 4LUKA 2GAUA 3OTFA 5C8WA 4HZFA 2QVSB 3E97A 1X8EA 4FAGA 1RTVA 1O7FA 4XF1A 4OLLA 3NVCA 4YRDA 2IXKA 4AVAA 1OFNA 2UY8A 3UKNA 3LWCA 3DV8A 3HT1A 1CAXB 2PYTA 3H3UA 4ORFA 2QNKA 3OGJA 1O3QA 4R52A 3ST7A 4HN1A 2Q30A 1XE8A 2OYZA 4Q0PA 2OZ6A 5JCTA 1ZZ9A 5FLIA 5I8SA 5I0SA 1J3PA 4I09A 5FPZA 5KHKA 4Z07A 2EAAA 1EY2A 3IDCB 5LRSA 4ZU4A 2EA7A 4BH9A 1SEFA 1TQ5A 1CAVB 3GYDA 5I8TA 2UYBA 1UD1A 2VECA 4CYDA 3JZVA 2Q0AA 3I59B 3NKTA 1SFNA 2B9UA 1J59A 4ONUA 3IIAA 5BPXA 5LEJA 4QGNA 3IWZA 1GQGA 3USSA 1RGSA 4I0BA 2FMYA 3LZZA 1HW5A 1VP6A 3NSTA 4HSLA 4QGLA 5JR7B 4QX5A 2QCSB 1LB2A 3N4MA 3H1YA 4AVCA 2BNOA 2XGXA 2Z2SB 4IEYA 2FQPA 1X8MA 3FHIB 4X6RB 3QOPA 4AXOA 5I0TA 4IESA 4IEUA 4I0AA 4JTNA 4LEJA 1FI2A 3UKVA 2PTMA 2E9QA 4QGMA 4BHPA 5I91A 3G7DA 1J58A 5FPXA 1ZX5A 1CAUB 4I3PA 3BCWA 2XKOA 2D40A 2HJIA 2IXCA 1Q3EA 2ET7A 3EHKA 1JUHA 1QXRA 2Q1ZB 3EO6A 1YHFA 3RPQA 1YLLA 4XFGA 1ZZ6A 3D0SA 2WFPA 5CADA 3I59A 1ZVFA 3HIFA 4FT8A 4IEVA 3SMHA 1ZREA 3LA3A
chains in the Genus database with same CATH superfamily
3VBSB 2WZR3 2A7AA 2X5IC 3B02A 3VBFC 4QB2A 2XLFA 1NCRB 2QQKA 3ZMNA 3OGGA 2N7GA 1J3QA 1WMXA 3VD3A 1G9CA 2KA3A 1YQ5A 3F95A 4WVWA 3H8XA 4I02A 1OLME 2AZ5A 2W08A 2W95A 2Z5WA 4QDQA 1A78A 3V0AB 4FAHA 1KDKA 3APBA 2PHXA 2XB6C 4YW2A 2VZ1A 4Y1VA 2GNBA 1DZQA 2SLIA 1WD4A 1N1TA 1WW5A 1IGOA 2WO1A 3WQ0A 1N3PA 1LJ7A 5A3PA 3CJIC 5F9TA 2ZGUA 4XQ4A 3WP3A 3S5AA 1BMV2 4HVOA 4XFHA 4ZONA 4E4DX 2VMHA 2HWF1 1RJ7A 2H0VA 2VZSA 2A3WA 3NNMA 4L99A 4LLFA 5FZFA 1O4TA 1W8UA 2WO2A 2LM3A 2XHKA 4FP2A 5KXDA 4FSJA 3WP5A 5L9BA 2AENA 5F5CA 1JZ2A 1HRI1 2WQZC 1AF9A 3ECQA 4FVVA 1LOGA 4LT5A 2P5BA 5J1XA 5JZGC 4Q4Y3 1JN2P 3RSJA 1O5LA 3ZVXA 4COUA 4IEOA 4EWDA 2A71A 1TE1B 1MEC3 1ULOA 2JDKA 1T2XA 2ZS6B 1YFXA 2MEV2 4NAOA 4QPIC 1MVEA 3M1HA 2PQSA 4ZZ8A 4XETA 5IUQA 3PUQA 5A7WA 1MS3A 2R6QA 1XPWA 3VBOC 1CESA 5GM0A 5F3GA 4A7KA 2BW8A 4UBHA 2GU9A 3PUAA 4BIFA 5K7PA 1ZRFA 4HPKA 4MV2A 1R1A2 1ZRIA 4JVAA 4YW7A 2F17A 3KT1A 5LY2A 1JYIA 4JTOA 5JWPA 2A6XA 1EYBA 1ZBA2 2CGOA 3N3HA 1WMEA 4K8FA 4LE3A 5IVEA 3SEEA 3HN3A 1H9PA 4I01A 4PLOA 2D6MA 1JI6A 2ZGOA 2QQUA 3LEKA 5FY1A 2JDYA 4TZDA 2PLV3 5F1RA 2LRPA 4OUSA 4Q4X2 5K4LA 1TME1 4PBOA 4SLIA 5FP7A 3C8XA 3ZFEC 2JB8A 1O3RA 5BNOC 1HQWA 2V72A 3C3VA 3TN92 5JXGA 1C57A 1DZRA 1DDLA 2Z79A 2H0BA 4BZ4A 3G6JB 1AR62 1ZZ7A 3I2JA 4MGYE 1G6NA 1MS1A 2HWE2 5JXJA 3PMEA 2RM23 2PQQA 2BTVC 1RUG3 3BB6A 2WNVC 4V2WA 3TWIA 2GN7A 4FXKB 4COYA 2HBTA 3ZXEA 5BY5A 2PMWB 4CDWC 3WDYA 5LASA 2XR4A 2VUJA 4XZUG 1K45A 2HWC1 3CJIB 4L8QA 2PFWA 3RGBA 1F4HA 3ZSJA 1I6XA 4A7ZA 3OPWA 5BNQA 5FMDA 4LKDA 3ME2A 2R30A 5E88A 1TEIA 1UZ0A 2W3JA 5FUIA 3JBG2 5JLVA 2OKXA 1ACCA 2ORXA 4R9DA 4EN6B 4EWAA 1F5JA 2KXLA 5JOZA 2A6VA 5C5TA 2CHHA 4RHV1 3T0AA 4Q8KA 1DYOA 3ATGA 1WLCA 5AFEA 1YYNA 5BNNA 1OURA 3ZYJB 5K0UB 1ZA7A 2X09A 5B4NA 3TN93 1RUE1 3GZEA 1BLZA 2VQAA 4JDNA 2JX9A 3SCFA 4QQPA 4C0HA 3VD4A 4Q4W1 4CPBD 4KWLA 3H8OA 4LBMA 2WAAA 4FXGB 2PHTA 1YRZA 2AH2A 4KU7A 2XJSA 2J22A 2XLAA 5L36A 3TYJA 4ZPIA 2X5IA 3WT3A 2CYFA 4U36A 4WZCA 4B4RA 1LOFA 4MVTA 4YG3A 2NN8A 4IQPA 2IFRA 5FZ8A 1GNYA 2AC1A 1IPJA 4QPIA 4QB6A 4QQHA 5KHHA 4BQYA 3ELNA 4YM0A 5FXVA 1RUF2 2WDBA 3BTZA 5H9RA 2SBAA 5K0UA 1QNYA 3EJKA 1RJ8A 1VBC2 4GWJA 1JOBA 5C9AB 4UXAA 4JV4A 3BVCA 4V2VA 4CCNA 2VMDA 3AZVA 4OI2A 4TWTA 5FIXA 1AYN1 1LR5A 2R071 3EQEA 4LTAA 1HXS1 1B35A 2HWC2 1O3SA 1REFA 4LULA 4E2QA 4MH0E 3ZSKA 1ND3B 5FK8A 2W68A 1RMU1 2RR11 1OKOA 2O1QA 1MEC2 2W92A 2BFUS 5FPVA 4MUVA 1RMU3 5JMOA 4N53A 1HQNA 4QHBA 4MGZE 3KGLA 5DZEA 3VKNA 3OGVA 1CX4A 5E8AA 4NVPA 1H2NA 4IL7A 1Q8VA 1X82A 3AC0A 2ZZQA 4RQPA 4Y20B 3E5UA 3DL3A 3AYDA 2E51A 1OUSA 3ZN4A 1LOBA 2OPWA 4EQVA 2RS32 3GBWA 1ZBA1 3WG4A 3D5OA 2R041 1AR82 4TXWA 5KHGA 1PVXA 1W9WA 4KL1A 3UESA 1TNRA 2A6ZA 2UURA 3QCWA 4KBZA 1C5HA 2RG4A 2R49A 2ZGKA 3R05A 4B3NA 4P9LA 2YGLA 1NXMA 1V6LA 2P6HA 1W39A 2RJLA 1K42A 2QKDA 3ZFFB 4NPRA 2BGCA 1Q8OA 4YW5A 5FZCA 4PT6A 5A32B 4CEWB 5CIRA 1W6PA 1BXHA 5F37A 3KCCA 4NJ4A 4QX8A 1VPHA 3BIEA 1RHI2 1OA3A 2UWCA 4AFAA 4EROA 2JB4A 1SCSA 3ON7A 1GNHA 3VZJA 3V0BB 1W2AX 2BVBA 4YLZA 2Q8OA 5EZWA 4R9BA 1H0BA 3LA2A 5IWFA 1I1EA 3C7HA 1AYM1 2E33A 4XUNA 1QJU3 2WRAA 2VOVA 3UK9A 4IW3A 5CKNA 3ABZA 5BXXA 3MW3A 3SITA 3VGIA 3AYCA 3JCIA 1ZYBA 4XJ9A 3O0WA 5A32A 2VG9A 3UJOA 2LS6A 2ADEA 5A3NA 2VJXA 1O4ZA 4LK6A 1LU1A 3H1WA 2HWF2 5DXDA 3THTA 4NIDA 2R1BA 5E89A 3OF1A 2CAUA 3E6DA 1FOD3 4Q4V1 3U1XA 4TYSA 4FTEA 4NE9A 2JG8B 3MW4A 1UXXX 2TEPA 4GJYA 4HMZA 1CGPA 1W04A 1QQP2 2IVIB 2VBBA 4X8PA 4XF3A 2K2SA 4PLNA 3LPGA 4FOVA 4AEKA 4AOCA 5CAZA 2LUWA 1JHJA 3M8LA 4HL0A 1VAVA 2ZAHA 5APAA 3WXPA 1IPSA 1YQ6A 3LEMA 1ALYA 1KQRA 2D3PA 1MZ6A 4A3ZA 3FLTA 3K46A 4FFIA 3VKOA 4KGQA 4AEJA 1W8TA 4AEDC 3FLRA 1H6XA 1BEV3 3H7JA 5JOYA 2BBAA 1C3HA 2UWAA 2DBIA 2KD7A 2E7QA 1WD3A 4L2NA 2RDQA 5A3OA 2O14A 3CHXA 5T5PA 3OJBA 4QX1A 5DUUA 3VHNA 3WG1A 2CV6A 3ZXDA 4B1MA 1R092 3CZUA 5CFCB 5LK7B 4Y5TA 1O3TA 1R1ZA 2E7TA 3H3ZA 1V6OA 1UNBA 3AXEA 2FHRA 1V70A 1EAH1 1GOGA 3ACIA 1PM4A 1HLCA 1QH6A 4MSVA 1JZ4A 1OLMA 2VMGA 2CAVA 2LW8A 4GZ9A 3HQXA 4XJZA 1UU5A 3OOXA 2JKXA 5EYYA 1HIXA 5FQ0A 1NE6A 4C8DA 4A6SA 3SXWA 3BODA 4JCKA 5IVCA 2BNNA 5DUVA 1IQAA 1Q56A 1N3QA 3O1OA 4YZ2A 1N1YA 5BNOB 4OI4A 5C8CA 3TNPB 1SMVA 2JG9A 3AFGA 3PNAA 1BEV2 1ONAA 1XU2A 1TMF1 3OGRA 3MUY1 4XUQA 1QHDA 1VLNA 3NKGA 5LA1A 4HVRA 3LIHA 3M3IA 3N36A 3ZSEA 3I2HA 2ZKNA 5JIUA 3VLBB 3V56A 3DN7A 5DAQA 2FCUA 3AYEA 1AR81 3T0BA 2HWD2 5F3EA 1S2EA 2IXHA 2JIGA 2K9ZA 4DO0A 4CDQA 4W65A 2JG9C 1GBGA 3WNKA 2BOIA 4PF5A 1SLTA 3ILRA 4MADA 4QHZA 1KS4A 1NZIA 3A0NA 5DAVA 1KDMA 4AAPA 4HONA 2WZ8A 1TG7A 1CR7A 2P37A 4K20A 1QXPA 1AL23 3H50A 4IV3C 3WW3A 5B4XA 3X29B 1WW7A 5J96B 3JD72 4XZPA 5JPMB 3HOBA 1UW8A 4B29A 3WF1A 2DYCA 2GC0A 3L2HA 1ND2B 4XDPA 1SACA 5T5JA 2FZ2A 3ACGA 2AR6A 2W94A 2ZEWA 3I3QA 3I8TA 4YG0A 5DDJ3 4OHWA 1NAEA 3SKJE 3BI3A 4HKOA 4WVMA 3OUJA 2WSUA 4URTA 2ZMNA 4XJ8A 5A7SA 5KHIA 2BQPA 2E63A 3ITQA 1W90A 2BYVE 1WMDA 2WS92 2ZJCA 3MO4A 4AQ2A 4DXZA 2WFF1 3NL1A 5LB6A 3ETQA 3U4XA 2NP0A 5FBZA 1MZEA 4RQPB 1D0HA 3AL5A 2GC2A 2PHUA 1H1IA 4N8MA 2XPJA 2HYXA 1VBC1 4YPJA 4NO4A 4LKSA 2GC1A 4LBQB 4P9GA 2V5DA 4XC9A 1UAIA 4G9SB 1N3OA 4YGEA 2WAOA 3KV4A 3P3NA 1R64A 4RYDA 4IE4A 5C4WC 5GZDA 3ZYGA 5C8CB 4Y1YA 2R7EB 2JG8C 4DRVA 2W46A 2C9KA 2WJSA 1X8EA 3B7MA 4Y4RA 2IVJA 4CSWA 4FAGA 1G7YA 4GMP3 4XF1A 5I0DA 4OLLA 2WZPP 3GXUA 2HEWF 5LY1A 3J9SA 1QJY2 1C8M1 1OA4A 2WNVA 2YUEA 4XQDA 2GMMA 2B46X 2WQ8A 4XURA 3DV8A 1J83A 5A3UA 2WS91 3C7GA 4LOSA 3BOWA 3IAQA 1R091 1M4WA 4ORFA 3WX5A 1YO8A 2QNKA 1V9U1 3ZN6A 2RS31 4Y4YA 1O3QA 4R52A 1XJAA 1ND3A 1SFYA 4BXFA 4HN1A 2RS51 2VOKA 2DUOA 1SDWA 3FBMA 1UQXA 4DIQA 2WN3A 1F15A 4Q0PA 3L9JT 4QKNA 5F5AA 1JYWA 4Q2FA 5FJKA 1H2LA 1ZZ9A 1AJOA 2XJRA 4LHKA 5I8SA 3AP5A 4NMIA 5C3RA 3NJVA 1AR91 1AUYA 2FCTA 5I0SA 5JZGA 4XCAA 2Q8DA 4I09A 5FPZA 3ZYRA 4M0NA 5KHKA 4QXHA 1EUUA 3UJQA 2VXJA 1Z7S3 1DQ0A 3THDA 3IPVB 4UW4A 4F83A 1S0DA 1RXGA 2DCKA 1C8M2 1SEFA 5FRAA 1X50A 3ZIXA 1AR73 5T55A 4ARYA 5D8AC 1TQ5A 1CAVB 3GYDA 4WM7C 2JICA 3VKMA 3J8F2 1D0GA 1UD1A 5GLVA 3SKVA 1GOFA 1X9TA 1SBDA 2Q0AA 3JZVA 1A8DA 5ACA3 1I3HA 4FQZA 3POEA 5FZ1A 1AX2A 2RS11 1Y7BA 4KNCA 4AWDA 4BE3A 4CCJA 1K5MB 2OUJA 2HBUA 4UOJA 4QGNA 1OT5A 3PIJA 3AVRA 3USSA 4FFGA 1PGL2 3JD73 1VB4A 4GMP0 4IUGA 1IG3A 4Y22B 1VP6A 5FZHA 3NSTA 3B69A 4LBNA 2UWBA 4PBPA 1LHOA 3VBRB 5A33B 3NWKA 2QCSB 1NUKA 1UZYA 1W9FA 3M3QA 3N9NA 4MGSA 5GZEA 2XGXA 3MIFA 1NY72 1IS3A 5C7GA 3DXUA 2ZTNA 3UYJA 2VCMA 2NQYA 2X5IB 3VBSC 2VM9A 1VAKA 4JKLA 2HWB2 1CPMA 2QQJA 1J1TA 4S2GA 4HG6B 4LEJA 3M4FA 4H14A 1LOFC 1PO22 5FZKA 2WZR2 4CCLA 3QD6A 1PO12 4CPBA 4MOAA 3VUOA 2XWJB 4E9KA 5C3QA 5FPXA 3I49A 2ZMKA 2RVAA 1E57A 1RB8G 2B9VA 3VZLA 3TEXA 1ZX5A 3LEIA 4YW4A 5HXMA 2JDPA 2ZABA 1NOVA 4AR2A 2WNUB 4MHRA 2D40A 4HK8A 2HJIA 3VDDB 1YJLA 4FPFA 4R9AA 3P3PA 4BU2A 1OH4A 3AKPA 3CMGA 2IXCA 1LGCA 5FZEA 5HCAA 4JQRA 3T30A 3WUCA 1VBA3 4PDWA 1VBD1 1GFF2 1CZTA 1PO21 2ET7A 2R073 3NJYA 1PGSA 3ZXKA 1VIWB 5EWSA 1VBC3 2ZGNA 2JIJA 5CYYA 1CQ9A 3BOPA 2WFPA 4AFDA 5JOXA 1WKYA 1O59A 1DQ2A 1OSGA 4Y1XA 5FY5A 4IEVA 4Z2WA 1JZ6A 1NG0A 2ZX2A 3MBWA 4YM2A 1AJKA 3THCA 4W6XA 2ZACA 2VGDA 2YXSA 4AW7A 5EHDA 2HWE3 2AGSA 4WM8C 4WBBA 4DZGA 5D1IA 1Y4WA 3MYXA 5I93A 2MPFA 2JG9B 2W87A 3I2DA 4BIOA 2VZRA 2Y6KA 2ETEA 3LB9A 1HB3A 1OA2A 4W4ZA 4CU8A 4XXPA 4CDUA 4LO8A 2ZHLA 1W6PB 4MX3A 4OI0A 2X05A 4YM3A 4OZXA 1LULA 2VZQA 1LECA 3PTRB 3U11A 1XE0A 4YZ1A 1CZSA 5CU1A 3HAGA 4R8HA 5LATA 2CTVA 2VMEA 1QH7A 5F5IA 4AGRA 1H8TB 5LEKA 3FC0A 3ILFA 1FNZA 1GZ9A 2ET1A 3N7KA 3AMHA 2JDUA 3WG2A 3WF0A 3K48A 5HI0A 4XF4A 4MZUA 5A7QA 5AFBA 4IE5A 2BGPA 5C70A 4E4HA 1O5UA 1JODA 1ZA4A 2RR12 1RL3A 3MF9A 3ZKYA 4A45A 4I30A 3UNPA 3RZLA 3BPZA 4GWMA 1GWMA 4FI9A 5DG2A 4QU1A 2BJSA 3E6BA 2JKBA 1IOAA 1BCXA 1XNAA 4WM7A 4FPJA 1XBFA 2VPVA 5CKQA 1COV2 5BNPB 5C5UA 2PHLA 4JGYA 1YFWA 2VW1A 4NHLA 4Q4X1 1FMD3 4YZ5A 3CIHA 3ZDSA 2QQOA 2D3SA 1HJFA 1MVQA 5ANQA 4QXBA 1XSRA 3GALA 2WN2A 3HQUA 5FP9A 3AZYA 3DYMA 2WS93 5EQUA 5CFDC 3IB3A 2B8MA 2HH9A 5FUNA 3MIBA 1VB2A 3N7LA 1XNKA 2NYYA 3VBOB 1UMHA 4FOYA 3KQ4B 5FZGA 4K40A 1AXZA 1AXKA 3Q8BA 1QIQA 2EXHA 4XBQA 2C24A 2JXAA 4GMP1 2Q8CA 4DOUA 3KMHA 4YARA 4JKMA 1S2KA 3AJYA 5FREA 1UYZA 4CU6A 2F4PA 2FDKA 4U2AA 3VBSA 3R0RA 3O14A 4BK5A 4D69A 3B3QE 4NHKA 3TEWA 2VBDA 1WZXA 1W3XA 3ACHA 5C3PA 1PM7A 3PVEA 3K75B 2W1SA 2TNFA 3JQXA 3MPBA 5LBEA 3WLUA 3BPSA 5GLUA 5FYVA 1ODNA 3NV1A 4AAXA 3IN9A 2HYKA 2BRTA 3M3EA 4QX3A 5FOJB 4OVEA 3PLQA 1X7NA 4YNIA 4QXCA 5FYUA 2QQPA 1UKGA 1VRH3 2VU9A 2VOTA 3FMGA 3H1MA 3FBYA 1IKPA 5KXBA 1VBB1 2BFUL 1B09A 1ST8A 4IEQA 5L73A 3LOIA 3ZKUA 2BPA2 3P5BA 1AL21 5F3CA 1EPZA 1SLIA 1V6JA 3CEWA 4W8JA 4IEZA 2I2SA 1MACA 1GANA 5BNPC 4YVSB 4CUCA 1LGBA 4IERA 2OXBA 1D4M1 1WLWA 2G9ZA 1S0CA 3HWJA 4F3JA 3VBUA 2UYAA 4LBJA 4BPZA 4PI2A 3R4DB 4FP3A 1UZWA 4EYUA 1RUOA 5DDJ2 2IXJA 4CCKA 5A6YA 4V1PA 3POIA 4HFSA 2W9XA 3KV5A 4CCDA 4OMCA 2WO7A 3RWNA 4EZ4A 3MZHA 4EV0A 2ZX1A 3EBRA 4RSUA 2HWB1 2WT1A 3J7LA 4QPGC 2ZBJA 3WP6A 3ZN5A 5FYCA 1VE0A 1VRH2 1BEV1 3ZR5A 3NNLA 1MQTC 1Q43A 1SPPA 5A7OA 1MS8A 3DXTA 5T52A 1PMJX 4QX0A 4Y22A 3ROUA 1DYKA 4LITA 4OHXA 1UXZA 5GLWA 2DF7A 4P9YA 1J84A 5L7OA 3OBTA 1DGWA 2CNAA 4RA0A 4YW1A 2XDVA 4XEZA 2V09A 3BIWE 5DAXA 4FPHA 4OQ8A 1CJPA 1W6OA 1MPXA 4LO4B 4YZ3A 5FWEA 5IVFA 2RMU2 5FAXA 3FWEA 3VKFC 4RR3A 4Q4V3 3T0DA 2ZPXA 3J26N 3RZGA 1EP0A 4LNVA 3HBZA 2WIIB 1GR3A 3IKWA 4XHBA 1SZBA 1LOEA 2ENRA 3O5SA 4QT6A 2WWUA 2C26A 3VBRC 4DPNA 3S30A 4IE0A 3SC7X 2IXIA 2VCBA 4RN5A 3ZFGA 1RUC3 5EPAA 5AVAA 3TNQA 2YGMA 4GD4A 2F4LA 4KI5M 3TAYA 1OOPA 2J1SA 4A6OA 3O12A 4BMEA 1WCSA 3KWVA 4D7SA 1KITA 1WLTA 5K0UC 1F8VA 2XQRA 5KWRA 2Q1MA 3M70A 2VY0A 1OQDA 4JHTA 3HD8B 1IS5A 5CFDA 2YU1A 3PVBB 2MNGA 5FKCA 3U0ZA 2HWE1 2ZHKA 2W1WA 4ASKA 3ZSLA 1BJQA 3RZMA 2E6VA 4NN0A 3AP7A 2OX0A 4QQOA 2BZDA 2YDEA 3DPRA 2BNMA 3LDRA 4AFMA 1LESA 1REDA 3ZYIB 1YIFA 2Y6FA 1HRV1 1O8PA 5IVYA 1QXJA 4BXSV 1DBNA 1RUD1 3V64A 4AI2A 5C9AC 1N1VA 2KM2A 1AYM3 3ZXGA 3CJXA 2YBKA 5C4WB 3S7IA 1QF3A 1WW6A 2QDRA 4MG2A 1I5ZA 3T3YA 2XVKA 3BTXA 2RV9A 3ZFEB 4I2OA 2WLPA 2RM21 4OMDA 4HT1T 2XJPA 1UYXA 1YQCA 3SLIA 4HETA 4R9CA 4IXLA 1UU6A 3I3DA 1D4VB 1JYNA 5LRRA 1HB4A 2PXJA 4CDWA 4CP9A 2MEV1 4HBNA 1XE7A 3VDAA 3VL9A 1HRI2 2XG3A 1OF4A 3KT4A 4E8DA 4Z92B 1IKQA 1YEWA 4CDQC 2OT7A 2WNEA 2J1TA 3T09A 2ZX4A 1GWLA 3OYWA 4NHXA 1EPWA 3FHAA 4MXVA 4FPKA 4P02B 4CP0A 2GNDA 4WM8A 1VMJA 3VHRA 4DXRA 2PLV2 2P3IA 2WYSA 3LEGA 4IV3B 1GP6A 1CIYA 4P9IA 1XXNA 4IEPA 1W6MB 3RG0A 2FDHA 5HCFA 5DUXA 4UFKA 3H8UA 1AXYA 4AQSA 3JD71 3ZMOA 3OSDA 4WV8A 2J1EA 4NHYA 1W2NA 1U5XA 2A3YA 2VW0A 3GCWA 4LJHA 2LTNA 4O65A 4P9WA 1A34A 1XYPA 5L9RA 5AC93 1E5SA 1HRI3 3KHCA 3T2QA 4FPYA 3ZXLA 2HWB3 4K9SA 4PJYA 3IBMA 2Y33A 2VMCA 4QQLA 4GULA 3ASIA 3N9PA 4XUPA 4M3CF 4AEMA 1EV12 3FX3A 4FOWA 2W91A 4QQ2A 4AI3A 1F35A 5FLJA 1QJZA 3VN4A 2JDHA 3NO8A 2EF6A 4FFFA 3POWA 4LUMA 1QY4A 4X6QB 1KEXA 4L0PA 4D94A 2DVDA 2RDRA 3I2IA 3KM5A 1SHWB 3LE0A 4WM7B 5T5OA 3U78A 2ZGSA 4X8NA 1WA6X 3ES1A 2YROA 3OBAA 2ZA9A 2VZVA 4UBGA 4XXAA 2PHDA 1P8JA 2YG0A 4Q4W3 4NIHA 3M2MA 3OBRA 5I8YA 1GQPA 3N9MA 1WGPA 1RUE2 3PVNA 3PUHA 4NIGA 4FOQA 1G86A 1LGNA 1ZRDA 1ZNPA 1TME3 2VZUA 2JD4A 5F2WA 5A1AA 1GZTA 1RUJ2 2J1VA 5FXXA 2RDNA 1UF2C 5A3MA 4PHZA 4AGGA 1US2A 1C28A 5H9PA 1UYYA 5A7WB 4DXTA 1RYYA 3FHQA 3HEIA 2BGOA 4PI0A 4CDXA 4JC1A 1EUTA 4JDOA 3HJRA 5IVBA 1IPKA 3B93A 3J7MA 2YFZA 2K0GA 2JE9A 5LBFA 1LEDA 2P6CA 4JRAA 2HWC3 5CISA 5IK7A 1YI9A 3RDIA 2BUKA 2PAEA 5FDBA 1UPIA 1VAMA 4XOGA 3V65A 3WY6A 3SNMA 3K4DA 4XILA 1IQDC 2CSGA 4DFSA 1CVNA 2JDAA 3OTFA 2CU5A 1K12A 4CDUC 1U5ZA 1OF3A 1JW6A 1ULEA 1RMU2 1MQTB 1NLSA 1COV1 2BOJA 3HR9A 3N9OA 3PUSA 3GDBA 1CONA 4XW3A 5LA2A 3E97A 4K6BA 2Y34A 5EJ3A 1QGLA 3WF4A 5A80A 1RTVA 1JYVA 2VOWA 3POBA 3NAPA 4YRDA 2XXZA 3AKTA 2G4IA 2WUHA 4KG8A 5F6LB 2G1MA 2UY8A 1W2TA 5JIAA 3HT1A 1ULGA 4BJ0A 3KF5A 1W8FA 2GP5A 4H3WA 3H3UA 1UY1A 4D6SA 2DDUA 4GQ7A 3ST7A 2YC0A 4YVSC 4BQ4A 2XVLA 5CFCC 2IFWA 1LNSA 2DU0A 2WNUA 1OPOA 3B01A 3AFKA 4NWWA 4D8MA 1HKDA 2XOMA 4IE6A 4CCOA 1NY71 3W5NA 2NM1A 2ZGMA 4AE2A 4XQWA 1PZ7A 5A70A 1J3PA 2EXKA 3RI8A 1VBB3 1DYPA 3EXUA 2DTWA 3BGAA 2X53S 1PVC3 4LKEA 4Q8LA 5FYIA 2EAAA 1JTZX 5A3WA 1V6KA 1DFQA 3IDCB 4A4AA 1O4YA 4RS5A 2EA7A 1GYKA 1G9DA 3ACFA 5FZ0A 4BLJA 4A7YA 3OBZA 4L92A 4J25A 4CA9A 3GF6A 1OUXA 4RR3C 1OQ1A 2VECA 2VNOA 4CYDA 1W0OA 1E5IA 5JDBA 4LIUA 3OGSA 5EYXA 1LCLA 5FWJA 3MLLA 1FPN3 4IV1A 4HKLA 1LODA 1ENSA 1PO23 2RDSA 4UW5A 3Q8FA 2C5DA 1VBD3 3A23A 1J59A 4AHYA 3B9IA 3ZFGC 4N7IA 1AL22 4E27A 5EXOA 3T1LA 4HPKB 4D7YA 1UKRA 2FMYA 3LZZA 3TRSB 5FTTC 4QGLA 5DQ0A 4LE4A 2R062 4XTMA 4C91A 5SV8A 4KQ7A 4QX5A 3RMYA 2D98A 1NA1A 3B00A 1JZ3A 2RHPA 5IAXA 3CU7A 3H1YA 3I2GA 1X33A 2BNOA 2Z2SB 3GHNA 1BQPA 2D43A 4IEYA 1GICA 3AB0A 3FHIB 4X6RB 4H2AA 4DUVA 2JENA 5IVVA 1JU4A 4UF0A 4LKFA 5C4WA 4ZZ5A 1W28A 1FYUA 1O91A 4JTNA 4M0HA 2XVGA 5FZIA 3RS6A 4YM1A 1UMIA 3ZYHA 5CFDB 1GZCA 2E9QA 4QGMA 4AEDA 4BHPA 1J58A 2RMU1 3LD8A 3T1MA 3PMSA 3WV6A 1WCKA 3IIIA 4OUMA 3N7JA 4W50A 4ITCA 1CAUB 4LR4A 4N43C 1K5JA 3BCWA 1PGL1 5A6XA 1LHNA 3Q8EA 1SLCA 5ABJA 5H9SA 2WABA 4H55A 4Q4Y2 1XNCA 3M3CA 1HN0A 3AZXA 1VBE3 1MS9A 1K3IA 1NXD1 1RUH1 3I2FA 3RQ0A 3RPQA 1BMV1 2AEZA 1I5PA 3L2YA 5FMOL 5GKAC 1W3VA 4L9BA 2VTFA 3ZPOA 4AHXA 5CADA 1H4GA 1HRV2 3HIFA 4P5YA 1Y43B 3H3LA 2BVVA 2GNMA 1PO13 4QU2A 4BQ1A 4CDXB 3P6BA 5FJHA 3SCGA 2JDMA 3IMNA 4GH4C 2QJVA 4YFWA 4YVWC 1VRBA 2VNGA 1CN1A 3RZZA 2DCYA 3MGUA 4UFHA 3WF2A 4YSFA 2I07B 1YQ2A 4F7ZA 4ISQA 4CEYA 4QX7A 1PHMA 4HVQA 1MZ5A 1ASJ1 1KXGA 4MGTA 4AVSA 2YYOA 2HWD1 4A41A 3H8RA 3CF6E 5HPOA 2R072 3AJZA 4HN0A 4N9HA 5AC92 3FN9A 3MFAA 1K5MC 3CO2A 4XBLA 4WM8B 3AKSA 3E5XA 1QKQA 2FCVA 1OXCA 1YWKA 4IEWA 3R6SA 4J6GA 2JE8A 1RUF1 3OCPA 1ENQA 3MW2A 4S2HA 5A33A 3J8F3 3JQWA 1HRV3 2D93A 2BDRA 2ZEYA 5L19A 5J37A 1NCRC 1S4CA 5FMCA 3OEAA 5FY4A 3ZM8A 1UOBA 2D3RA 4Q0VA 1RUJ1 2OVUA 4IE7A 4PQ9A 4N7UA 1VBA1 4XBNA 2ZGLA 3KZ4C 3S6PA 4KWJA 2XJTA 5LZ6A 4UW6A 1YUDA 1QJX1 1NCQC 1KD7A 1NLRA 1DGRA 1W8ZA 2R32A 2VVEA 2XUEA 3K2OA 1S0BA 3LAGA 2ARXA 3RI9A 3JB4C 3S0MA 4Z82A 3KB5A 4IEXA 4XF0A 1PK6C 4OHVA 5CB7A 1QQP3 4Y1UA 3AKRA 4B8EA 2OW4A 2VZPA 1ZBE3 4FPOB 1XNDA 3NJZA 4BK4A 4RL7A 2ARBA 2RS12 4LIVA 4LO6B 2EALA 2Y6GA 3H7YA 4GIQA 4QPWA 1JYXA 3LA7A 1PNFA 1CZVA 3WNMA 3BU7A 3MICA 1UY4A 3CL1A 3LKJA 3POGA 2G9GA 3WDWA 2YBSA 5LCWL 4K21A 4Z8BA 2CGPA 4QM9A 1ND2A 4MHUA 3GZUC 3ZFFA 4O9GA 3CLPA 1VR3A 2HKXA 4I0WB 1PK6A 2FBEA 2R0FA 2PA7A 2V5YA 2DV9A 3MV01 1FX5A 1ODMA 1UPSA 5FYZA 3S5QA 1GQHA 3U37A 4C90A 1NYWA 4ARXA 3AXDA 4C0BA 3GNEA 1DZTA 3NRUA 3V0BA 3T2PA 3HMYA 1D4M3 3QACA 1W06A 4Q1RA 5EV7A 1QU0A 3H9AA 3I54A 4UF0B 4BCUA 3DEMA 4JDMA 1B35B 4DB5A 4ET7A 5IFPA 1ZRRA 3ZFFC 1AR92 1NLQA 1V6MA 1YXWA 3KD4A 3VBHA 1CAWA 1GKBA 4IETA 1UU4A 1YC61 2B7YA 5JI7A 2Y38A 2YV8A 3HNBM 1JH5A 2RS13 1PK6B 3WD5A 5JAXA 2WZEA 4N53B 2WLQA 3PU8A 4KWUA 3JBG3 4AVBA 1PIV3 1N1SA 1OKQA 4UFIA 2ORZA 1AR83 4HKWA 1RUG2 4Q0QA 5FMOS 1YIPA 1V9U2 4XACA 2BBVA 1BBT2 1XYNA 3LF7A 1DU3D 1Y9MA 2DVAA 3GCXA 1UN1A 4AI8A 1K5MA 2OPKA 4JKKA 1Z7S1 5FQ0B 1TMF3 1UIKA 4GWIA 3WINE 2ZX0A 4NHMA 4GA9A 1ZZCA 2C1FA 2DFBA 1E5RA 1L7QA 2YPDA 1PVC1 2JEMA 3HQRA 1S2BA 2AUYA 1UMZA 2A75A 3OG2A 4LBQA 3JU9A 4XUTA 3TEYA 3ZXAC 3HPNA 4AI0A 5FZ6A 1UOFA 2VOXA 2GH2A 2MHFA 2R0HA 1UY0A 5FCCA 5F7UA 1G9AA 4ZS3A 4RS5B 1UIJA 2R042 3SEPA 2NPIA 1V00A 3DGTA 5GLTA 2D5FA 1YCIA 5HCBA 4AHZA 3AVSA 4BQWA 4CCEA 2QQIA 1PMIA 2NZ9A 2VD7A 1RUC1 3A21A 3B94A 4UWDA 5HBAA 4OHZA 4ES8A 3MIDA 2WA4A 2QZ3A 1V9U3 1GP4A 2X29A 2Z4FA 4Y24A 3IT8A 3IDBB 2IXLA 4O7XA 4QM8A 4D6QA 1BBT1 2FDJA 2UY9A 4QDSA 1TNFA 4N43A 2NMOA 3MLJA 5E16A 5F3IA 3MF6A 2D7FA 4XFCA 4AFBA 5CBLA 1ZZ8A 3ZIWA 5F32A 2WYFA 4LBQD 3I3BA 3A4UA 3HBKA 1QWRA 3DKWA 4AYUA 4L97A 4N90A 2XBO2 4P00B 3C7EA 3KVBA 1W6QA 3NV2A 3VZNA 4DNYA 1ULCA 2OQ6A 1OH3A 1BK0A 1FXZA 1NQDA 1PX3A 3C2UA 3POYA 2Y26A 1W0NA 4LK7A 2QFEA 1GMMA 4CEWC 4DUXA 1IS6A 5FKBA 3U4SA 4A44A 5J48A 4N43B 3KVAA 3CQOA 2HEVF 5D21A 4FFHA 5CVRA 2WNUC 2FD8A 2Q8EA 4P9JA 2D6PA 1OVPA 2ZAAA 1WBLA 4CTEA 2C9AA 2CWSA 3UGHA 1W6QB 2J1RA 2GSYA 4CP1A 4K3UA 3MIHA 4B7EA 2CY6A 4XFBA 1G8WA 4OYUA 2OUHA 3FE5A 2W52A 4M00A 4Q4X3 4XF9A 5FO8B 5AVPA 3F2ZA 3KSCA 4BB3A 1ENRA 1LENA 1SLAA 4LHSA 3KGZA 3AM2A 2CL2A 2ZXQA 1BVVA 5IAVA 4ASMB 5F8PA 1S55A 2VUCA 4WVZA 2EIBA 4Q4Y1 4Z1VA 4PIYA 2OS2A 4NWVA 1VRH1 1UCXA 4M01A 4IV1C 2AACA 3OUIA 1EAH2 1WCUA 4YVWA 4ZKTB 2ZEZA 4RFT0 4GH4A 2PAMA 5ABJC 2VVDA 2YHJA 3TEZA 3IAPA 1AX1A 1LRHA 2E26A 2R043 2WFF2 3D0JA 1CAWB 4OI1A 5CG8A 4L11A 4W6WA 4GB33 4EWEA 3A0KA 1N47A 3JBG1 2PELA 3A22A 4A3XA 1C5IA 3TB0A 1S0FA 1XOYA 4QMAA 1V0AA 2YY1A 3LPFA 4PIZA 3R4UA 5FUPA 5AC91 5ABJB 2ZX3A 1ND3C 1SQ4A 2W0XA 4NRPA 1BK1A 2DUQA 5T54A 2O8OA 4MGQA 5FYBA 1LU2A 1Y9QA 2D5HA 2GN3A 5LWBA 2V73A 2D6OX 4O9EA 4NIIA 1ZRCA 1H6YA 3LDBA 2ARCA 4LA2A 5DN2A 3MDPA 3OB8A 2IC1A 1RINA 2O0OA 3URFA 3WZ1A 3O1VA 4TSVA 4BISA 1CAVA 2WZR1 2VW2A 3KF3A 1HXS3 3LCPA 3VBHB 1J1LA 1W8OA 1YI7A 1OPMA 1VBB2 5ERLA 3C7OA 5IK8A 2P4EA 4TLGA 5B2GB 1LHVA 2B5HA 2JG8A 3WW2A 4COVA 3K4ZA 3NJXA 1RUI1 1HB2A 1FATA 5BNOA 2C0ZA 1WCQA 1GV9A 2GALA 4E4SA 4XABA 2QDNA 1J3RA 2VQTA 5FYTA 1DHKB 3NAPC 5IT6A 1FMD1 4PDWC 4YYOA 1AYM2 1HN1A 3LOBA 3U10A 4CEWA 5BUVA 4UT5A 3LDKA 3O7OA 3Q8CA 4K1YA 2VNRA 1H8TA 5JUVA 1JZ5A 2AYHA 1RVF1 1W99A 4AEDB 3PVOA 1RUE3 4FQ4A 1MR5A 4AZZA 4KU8A 3OD0A 3ZR6A 3VBFA 1STMA 2A6YA 1QJEA 4HLTA 1RUJ3 4FPLA 2J42A 2WL1A 1AYN3 2CDOA 4QHOA 4AI1A 4C1WA 4EJRA 1KRIA 2Y6LA 3C7FA 1LHWA 2P1BA 3WQ7A 1RUD3 3HNYM 5CA6A 4GJZA 5GLZA 1GUIA 3WNLA 1Q5OA 5FPAA 3J8F1 1X9PA 3MLKA 2ADDA 1PZ8A 4XFAA 1SCRA 4YGBA 1QJU1 2A73B 4AQTA 4Q29A 5DG1A 1BZWA 3VZKA 3W5MA 4Y20A 4ZS2A 1SLLA 2FMDA 5DABA 4XDOA 3GZAA 3AP4A 4COZA 3RZKA 1RUG1 1LKNA 4KWKA 1AR61 1YJKA 1ASJ2 4DINB 1QOOA 4D3WA 4Z2AA 4D7TA 1OFSA 3K3NA 3JUUA 3WDUA 1C1FA 4ES9A 3LIGA 4CZSA 1TVGA 2IWGB 1DGLA 2BP6A 5IK5A 2KR2A 3HVDA 1PO11 2RS52 4XYXA 2ZHNA 2PN5A 4CDQB 1GSLA 3QH6A 3V0AA 3SHRA 3GM8A 1RC6A 4XAAA 5K8SA 5FOBB 2E32A 2Y64A 1HV0A 5FMBA 2ZOEB 4CCCA 5IYYA 5JOWA 3RFRA 2B45X 3R4SA 1KJRA 4MYEA 1C8M3 4N9IA 5F39A 3QBQA 3E5QA 3PJYA 1PGW2 1W03A 3W20A 4ATEA 4NR1A 1DQ1A 4JRLA 4Y33A 2BEOA 5FZBA 4ZU7A 3VBOA 5A3LA 3BKZA 4Q1PA 2R063 3OEBA 4LUKA 2W2IA 5C8WA 5CEHA 3EB7A 2RM22 1UYPA 4GXLA 4QKDA 4HZFA 4WVMB 4ATFA 2ES3A 4KBBA 3BTAA 3MFCA 2E7AA 2RR13 2QVSB 3CJIA 1MZFA 3T2OA 3VD5A 3GZTB 1C1LA 1DP0A 1O7FA 2HLEA 4NPMA 2VQUA 1XB9A 1JYCA 3NVCA 4B7KA 1JZ8A 1XQNA 2TUNA 3ZPYA 2RS33 4D6RA 1GU3A 1QMJA 4Y1ZA 3UKNA 2JE7A 1CAXB 2PYTA 4EE2A 3ZOIA 2DBNA 1LAJA 3MI8A 3N35A 3OGJA 5F6KA 4IGOA 5DZFA 4PQQA 4RS5C 1SBEA 4RFRB 3ZYBA 2Q30A 1ULPA 4FPCA 1F5FA 2WT2A 1XE8A 2VZTA 2OYZA 3VD7A 2YBPA 3MIGA 5EJ1B 2P2KA 3T2TA 4GAZA 4Y5SA 1RHI3 3RJRA 1ZBE2 4LMFA 3UL2A 4XE9A 2XBO3 4CCMA 2X10A 3MPPG 3MV11 4QPIB 2D6NA 1RXFA 4Z07A 5CG9A 2VH9A 1A3KA 3AMPA 4XDQA 1M06G 1RITA 4BQXA 1HB1A 4UAPA 4OZOA 5FZ4A 4AVTA 3I2KA 5LRSA 5L7OB 3SISA 4YVSA 4P5HA 1FPN1 1V6IA 5J98B 4BH9A 5F2SA 4CU9A 5DAPA 1UOGA 5FPLA 4CUGA 4OHYA 1GLHA 4RQPC 2P3JA 3VB9A 1JOPA 3QLQA 2JECA 1AZDA 1LTEA 3NKTA 1SFNA 1TMF2 2ZGRA 5FZOB 5M0TA 1RUC2 3O0VA 3IIAA 3K77A 5BPXA 4Q4W2 2G19A 4HK9A 1RUH2 1ND2C 1RGSA 2QQNA 2WQ4A 4I0BA 4LBLA 5FY8A 5KR7A 3WHUA 4PCRA 3DUIA 1HW5A 1XNBA 5JR2A 2E53A 3EMRA 1PIV2 2P34A 4QX2A 1Q8PA 1LOCA 2QUOA 3DCQA 5JR7B 3WOGA 3I97A 5HCHA 2VAUA 4AVCA 2Y6HA 1W6OB 3AK0A 5JVVA 4AL9A 4P08A 1APNA 1TZOA 2GH8A 4UYBA 1FV3A 1NKGA 3QOPA 4YWAA 2BWCA 5FZLA 5I0TA 5H9QA 3ZLIA 5GJ6A 3NQHA 1YNAA 1H2KA 2A6WA 2VXRA 4IEUA 5IJRA 1R081 4SBVA 3WUDA 1FI2A 4KMQA 2PTMA 2NMNA 2Y60A 4DMIA 2JJ6A 5D2AA 5A6QA 5D8AB 1FPN2 1MS4A 5C8CC 3O1MA 1GP5A 1T6GC 1PX4A 3POJA 4LPLA 5C9AA 2A5ZA 1HDKA 1COV3 1CD3G 1OBNA 5DAWA 2B39A 2GDFA 2W5FA 3JXSA 4RGAA 4GH4B 3K51A 4QKBA 3WHTA 1WMFA 3PHMA 1UZZA 2R061 1QJFA 3NMBA 2LROA 4JGZA 2DTYA 3M3OA 2WINB 3EHKA 5CFCA 4CXWA 1IHMA 1JUHA 1QXRA 3POSA 1WCDJ 1WUVA 1R083 3EO6A 1POV3 4DRRA 1YLLA 2W47A 2OQ7A 4XFGA 1AL0G 4CEYC 2HWF3 3D0SA 2JDNA 5CZKA 3ZDVA 3RRDA 5JXHA 1JOJA 1ZVFA 2A1XA 1ZREA 1S0IA 3GHMA 3LA3A 1DQ4A 1H1AA 3GJAA 5EP9A 4QWNA 1BHGA 1JXNA 3WDTA 4TTGA 2EIGA 3K4AA 3VBUC 2WNVB 2V4AA 4PIXA 2EXJA 4KG0A 1YFUA 2DCJA 3DPRC 3GBFA 4RD7A 3VDBA 4CXYA 2P3YA 2ID4A 4WVVA 2WO3A 3SH5A 5FP8A 4FBFA 5KBFA 1ZM1A 4LXLA 5E6HA 1T6BX 2GNTA 1DQ6A 2D44A 2ZHMA 5KXCA 3O1SA 4KGGA 5T5LA 3KQRA 3I7DA 4IDZA 5A7NA 1DLCA 1KFUL 1VBE2 3TBDA 5KXEA 1I9RA 1SBFA 1YQ8A 3NV3A 4WZFA 4CDWB 3K3OA 2GZWA 3AZWA 4OFGA 5JZGB 1EV11 4CVUA 2YPJA 3AP6A 4DUWA 3WDVA 1SLBA 3CDZB 1S0EA 1QDCA 2ILMA 2P17A 3FFQA 4H7LA 2DVFA 3D6EA 3ACLA 1HJGA 1MS5A 3O0XA 4DQAA 3W58A 5BV6A 4YW6A 2IZWA 3USUB 4S2FA 3KCYA 1S1AA 4AK3A 4LO5B 1Q8QA 5A6ZA 3WNOA 3OPTA 1W8WA 2VCCA 4MO3M 2GMPA 4Q0SA 3LFIA 1HX6A 1OI6A 1H30A 3BALA 3ES4A 1L3JA 1OQEA 2BWAA 4NRMA 2PHWA 3PL0A 2Q4SA 1W8NA 1A6CA 3I4IA 4XUOA 3PURA 2Q1FA 4BWOA 2PHRA 4E2GA 4JX0A 3RZJA 2VR4A 3VDCA 4LQRA 2VQ0A 4QPGB 4DEQA 4XIOA 1POV0 3ZX7A 1KJLA 1TME2 5FZ3A 2B4KA 4UW3A 2ATFA 2CWMA 2WSVA 1W0PA 4DY3A 4J1WA 5JSPA 1LEMA 2R16A 5FP4A 1E5HA 2JDZA 3UGGA 5FZDA 3ZSMA 4AI9A 3T4HB 4K1ZA 4BQ2A 5GALA 2H6CA 3BUCA 1R082 4NRQA 1Y3TA 4EN8B 5BYNA 3OY8B 4OUEA 2QTWB 3PUIA 1ZZBA 3D82A 2XONA 5A1FA 2DCTA 2YFUA 3UETA 4G3YC 4JGZC 3DYPA 4JZRA 4AVVA 2FDIA 4BQ5A 4XHXA 3RVHA 4CE8A 3AYAA 1HQLA 4ISRA 5A3TA 1W2OA 4YG6A 2OA2A 4C1XA 1Z7S2 4XMAA 2XL9A 4B4PA 1UOJA 4AF9A 1VJ2A 2EXIA 4BDVB 1JHNA 3INAA 5KC6A 3NW4A 3UT0A 1SG3A 4ZU5A 4LHLA 3O1TA 4XVHA 4QXKA 1DF0A 2Y8KA 4XIKA 5EJZB 1UY2A 2DWRA 4CUAA 1NQJA 3W21A 4EN9B 1RUD2 3AX4A 1HV1A 3ZFEA 4J1XA 1U12A 1RUF3 4JAAA 4ZY9A 4BA6A 4BLIA 3BTYA 1EV13 4BMBA 5J36A 2P3KA 1H9WA 3A7QA 5J09A 4JQTA 1VBD2 1WLDA 2WNOA 1URXA 2FDGA 4Y3OA 3J4UH 4IGPA 5GZCA 1VALA 5J7MA 4LOTA 3ZXJA 4M3CE 1O8SA 2J7MA 1AR93 2D6KA 4Q0UA 1AR63 3TN91 2LALA 1PMHX 1YFYA 2J1AA 4XJAA 3RYPA 1NT0A 3WQBA 1OVSA 3FJSA 4S2DA 1KFXL 1H1MA 2H6BA 1DCSA 3WR0A 4CP2A 2BERA 1MQTA 1UWWA 1Z0HA 4AQ6A 2PLV1 2WR9A 2WWSA 3E6CC 3MHZA 2AEYA 4A2UA 2QQVA 3IDAA 1QNWA 4COWA 4IGQA 1L7LA 3B9CA 2OIIA 3WW1A 3IDEA 3PIGA 1A8MA 2A70A 3BYWA 5FZ7A 1H4HA 3MUZ1 4LBOA 4MXWA 5EFUA 3S57A 5FXZA 1DGWX 1R1A3 4Q26A 3WVJA 4A42A 1NZCA 1VBE1 2BV4A 2QZ2A 4YFZA 3HT2A 3PTYA 1NA1C 3WG3A 2I74A 1PNGA 4FCAA 1UZVA 1W9TA 4UFLA 5FV3A 3POFA 2XUMA 2WWJA 5IATA 2ZGTA 1JMUB 2ARAA 3IPVA 4IV1B 3ZYFA 4TLFA 3ZXFA 4E8CA 1U5YA 2JWPA 3VHPA 3RZHA 1F4AA 4XJUA 4DS0A 1VBA2 1S0JA 4OULA 2YC4A 3P1IA 4FO9A 2ZCWA 5LA9A 3UKTA 4XTPA 4ASLA 4CP9B 2YU2A 2VZOA 1JS9A 2VL4A 3WF3A 1SPPB 2EAKA 3QH7A 3GGLA 5KHJA 2WFF3 2VZ3A 5FZOA 2I45A 1DGRN 3CKHA 2W1UA 2XLGA 1H8TC 2YC2A 1JU3A 1KS5A 1GOHA 2PAKA 4GKYA 5DDJ1 5E1RA 3U75A 2XH6A 2XKPA 3WDXA 1W8HA 4G4FA 2R1DA 3S7EA 2XJUA 3VV1A 2F6BA 2ZZJA 1PZ9A 2Z69A 2VC9A 4JHZA 2VBPA 1CX1A 4CDXC 1MEC1 2J1UA 3OPZA 4LBKA 1OMIA 3I2OA 1WBFA 4JGZB 3SCHA 5DMYA 3GBGA 4XJWA 1AYN2 2VVFA 5JXIA 2EIEA 2XHNA 3ZYPA 1JBCA 1W05A 1OD5A 4MGKE 4NPLA 4RHV3 5FLHA 4EN7B 5CKMA 5DUWA 1DIWA 3J7HA 4GB32 2XL7A 2DURA 2EVXA 4XFFA 4XCBA 1GWKA 4DY5A 4INDA 2D97A 3CZJA 1W6NA 1H8VA 4OQ9A 3WW4A 4LLOA 4FPEA 3MIEA 4AHWA 4GWNA 2WC2A 5C33A 1MS0A 3CNAA 3E1F1 3ORJA 3RMXA 4JGYC 2O8QA 5FPBA 1L7RA 2WKKA 1FNYA 4NROA 2FDFA 1POQA 4PDWB 2EICA 1Q8SA 4OCTA 3H0OA 1RIRA 1FMD2 1D2QA 1RHI1 3DYOA 1OOPC 3FLPA 4K8RB 2VULA 1CAUA 3WQ1A 1OLQA 4RHV2 2D6LX 1G9FA 4CU7A 4GKXA 1QJX2 5FYSA 3VBHC 1EAH3 2WA3A 4EZHA 3PJQA 3O1PA 1IZ3A 1OLRA 2RE9A 4LA3A 3ZO0B 5FR3A 5LK5A 2V4VA 5FO7B 1FT9A 3HN1A 5C3OA 2YMZA 1POV1 3T08A 3AMMA 5HV0A 3B5LB 1XRUA 2OZJA 3WCRA 4QD2A 4XFIA 1D4M2 5FZAA 1FOD2 2VUAA 2ZEXA 5GZFA 1LHUA 2Y0OA 3Q8AA 5FY9A 4H7MA 4F8AA 3I3EA 3Q9OA 4YW3A 4ZXEA 1ULFA 1OD3A 3LSDA 1NA1B 5C6CA 5HXVA 5D8AA 4JGYB 3D3AA 1QJU2 5HV4A 1H2MA 1XC6A 2WT0A 3KV9A 4E2SA 2QE3A 5K9YA 4QPYA 1CAXA 3RYRA 3H42B 4EN0A 2EIDA 1QJX3 1JYTA 3FUQA 1FOD1 4LHNA 2C6SA 3VDDA 1VMHA 3BN6A 3WP4A 1F2NA 1CIWA 3UGFA 4ZHNA 1DG6A 1BBT3 3NAPB 4HSJA 1AR72 3IZOA 3SH4A 3D8CA 3W59A 2XJQA 3ENRA 3FZ3A 3NNJA 5JSRA 5L7OC 1NCQA 3FUOA 2GC3A 3AZZA 2BU9A 1UX7A 4BM8A 1PIV1 2RJ2A 3D4KA 3RYKA 3J7NA 1QOSA 2TBVA 3OUHA 3O1UA 3RNSA 5G04L 1C8NA 5T3NA 4M4PA 3SH3A 3DECA 4QPGA 2AREA 1QJY1 2W39A 4MLOA 5J3UA 5DPNA 4Y5Z0 5I0UA 4HOOA 1RVF2 2ZGQA 1RUNA 3KV6A 4GALA 5LW9A 2XWBB 5FY0A 1OOPB 5I0RA 1WW4A 5FK7A 3I3MA 4R4ZA 1XU1A 2XMLA 5ANNA 5FP3A 2NLRA 1AHSA 1LOAA 4B4QA 2L9LA 4NIAA 4NAMA 2W1QA 5JSOA 3VHOA 1ZBA3 2ZMLA 4BYYA 5FYHA 1IG0A 2PHFA 4MGIE 4IV3A 4QDRA 5FZMA 4RR3B 3KS7A 3PU3A 1WA4A 2ZKLA 5IFTA 4UFMA 1W2UA 5FXWA 4META 1DLLA 1UL9A 1Y9GA 3KHBA 4PF1A 5LA0A 3DF0A 4LORA 1SFPA 2VCAA 3SQOA 3WSOA 3MEPA 4BOWA 1NE4A 3VZMA 3WNXA 3VBRA 1NX9A 4DXSA 4RGGA 2GAUA 3ZFGB 1ZBE1 1IS4A 2XBO1 1AX0A 3U07A 3T4VA 3USUA 1ULDA 3FFZA 3VL8A 3O1RA 1QQP1 4R4XA 5SV5A 5T50A 5IHRA 1GZWB 5DZGA 3KCXA 3NV4A 5F5QA 2Z42A 4ZXKA 4BQ3A 1W9SA 2JD9A 1SDDB 4Q4V2 1US3A 2VTXJ 2RMU3 3JB8A 1D2SA 4RGKA 4Y26A 3ETPA 1R1A1 2IXKA 5FY7A 1QOTA 2HEYF 3UV9A 4AVAA 3HNMA 1AVBA 4UFJA 3THPA 5BNPA 1OFNA 5IVJA 3LWCA 4CXXA 3VZOA 3VBFB 4NOTA 1VMFA 5IW0A 1V6NA 4P9XA 4O61A 2DCZA 3BU0A 2X8KA 2GP3A 3AP9A 4AGVA 5TSWA 4CEYB 4TN7A 1REEA 4P14A 4FPGA 1GZWA 1UY3A 4PLMA 5ACA2 2ERFA 2OZ6A 5JCTA 3CBNA 2MEV3 2Y0IA 5KC5A 5FLIA 2HWD3 4QAWA 2Y6JA 1OC1A 3DKQA 4YGDA 2QBXA 4XAEA 5BNNB 1XNTA 4LO7A 4YVWB 1XSQA 1CPNA 3LQCA 3LSEA 1BVP1 3LFMA 5FFOC 1PGW1 3KT7A 2UU8A 2YB7A 5LBBA 4FTSA 2C4XA 1U5IA 5FBJA 4CRQA 3VD9A 2YZ4A 3NNGA 4DEVA 3IMMA 2VMFA 3WCSA 1EY2A 1F31A 3EYPA 2GMEA 4UI9L 5ACA1 4QKFA 2Q5TA 4ZU4A 5G05L 1PVC2 4GB31 1WWYA 1BYHA 1KGYA 4W6YA 5C71A 1OHFA 1AR71 5CNAA 5FO9B 2UYBA 5I8TA 4K7JA 2VNVA 1U0AA 4HXCA 5C3SA 1RUH3 4Q5OA 5L9VA 1FV2A 2XQXA 3I59B 3KLSA 2XJVA 3OD4A 1CJDA 2B9UA 2DFCA 2K46A 3OYWB 3TOJA 3FL7A 5FYMA 1QDOA 4ONUA 3RWKX 4CDUB 1D7PM 5EIYB 3W9AA 1ASJ3 5LEJA 2G9FA 3IWZA 1GQGA 2QQWA 1NCRA 5GZGA 1RVF3 1QJY3 1ENXA 1JUIA 5A7PA 2VE1A 2E31A 1W6MA 1GNZA 4HSLA 2VMIA 1G9BA 3RJ2X 1X36A 1FAYA 2WBKA 3PDQA 3VKLA 5BNNC 1LB2A 2RS53 1HXS2 3N4MA 3NNFA 5IK4A 5FZ9A 4QB1A 1W6NB 2FQPA 2VTXA 4XPVA 1X8MA 2DU1A 4M3CB 4CUBA 1R093 4Q27A 3VBUB 1O6UA 1RUI3 3LGRA 3N7MA 4AFCA 4AXOA 5JI9A 5ISLA 1CWPA 4IESA 1BKZA 3M7AA 3VDDC 4I0AA 4YZ4A 3AKQA 4B1LA 3UKVA 3GJBA 3AMNA 1UX6A 1XYOA 5FYYA 3N9QA 3ALQA 4M4RA 1W9YA 2RJKA 1QEXA 5FPUA 5I91A 2QQMA 3G7DA 2IUWA 2CGNA 2VO5A 1NCQB 3N9LA 4MXWB 3ZN6B 5LBCA 4E4ZA 1JZ7A 5JPNB 4FTBA 2B42B 4I3PA 2ZGPA 3DPRB 4I3GA 4M3CA 2XKOA 1Z78A 4AG4A 3WNNA 3AMQA 4URAA 2CDPA 5JMCA 1B35C 4NUBA 3ILNA 1DQ5A 4XMIA 4YGCA 1Q3EA 1UO9A 5A1LA 4KH9A 3AL6A 4D0QA 3IM0A 2QQLA 2Q1ZB 3WEZA 1C4RA 1YHFA 3OY8A 1F9KA 1ZZ6A 3WNPA 3U14A 1RUI2 4N53C 3I59A 2A3XA 2DVGA 4FT8A 3SMHA 2DVBA 4HANA 2VUDA 1S0GA 2DUPA 2FZ1A
chains in the Genus database with same CATH topology
3VBSB 2WZR3 2A7AA 2X5IC 3B02A 3VBFC 2XLFA 1NCRB 3ZMNA 3OGGA 2N7GA 1J3QA 1G9CA 2KA3A 4WVWA 4I02A 2W08A 2AZ5A 2Z5WA 3V0AB 1A78A 4FAHA 1KDKA 3APBA 2PHXA 2XB6C 4YW2A 4Y1VA 2GNBA 1DZQA 2SLIA 1WD4A 1N1TA 1WW5A 1IGOA 3WQ0A 1N3PA 1LJ7A 5F9TA 3CJIC 2ZGUA 4XQ4A 3WP3A 1BMV2 4HVOA 4XFHA 4E4DX 2VMHA 2HWF1 1RJ7A 2H0VA 4L99A 2A3WA 4LLFA 1O4TA 2LM3A 2XHKA 4FP2A 5KXDA 4FSJA 3WP5A 2AENA 1HRI1 2WQZC 1AF9A 3ECQA 4FVVA 1LOGA 4LT5A 5JZGC 4Q4Y3 1JN2P 3RSJA 1O5LA 3ZVXA 4COUA 4IEOA 4EWDA 2A71A 1TE1B 1MEC3 2ZS6B 1YFXA 2MEV2 4QPIC 1MVEA 3M1HA 4XETA 5IUQA 1MS3A 2R6QA 3VBOC 1CESA 5GM0A 4A7KA 2BW8A 4UBHA 2GU9A 4BIFA 5K7PA 1ZRFA 4HPKA 4MV2A 1R1A2 4JVAA 1JYIA 3KT1A 4JTOA 5JWPA 2A6XA 1EYBA 1ZBA2 2CGOA 3N3HA 1WMEA 4K8FA 4LE3A 1H9PA 4I01A 4PLOA 2D6MA 2ZGOA 4TZDA 2PLV3 5F1RA 4OUSA 4Q4X2 1TME1 4PBOA 4SLIA 3ZFEC 1O3RA 5BNOC 1HQWA 3C3VA 3TN92 1C57A 1DZRA 1DDLA 2Z79A 2H0BA 4BZ4A 3G6JB 1AR62 1ZZ7A 4MGYE 1G6NA 1MS1A 2HWE2 3PMEA 2RM23 2PQQA 3BB6A 1RUG3 2BTVC 2WNVC 4COYA 3TWIA 2GN7A 4FXKB 3ZXEA 5BY5A 4CDWC 3WDYA 2VUJA 3ZSJA 2HWC1 3CJIB 4L8QA 2PFWA 4A7ZA 1I6XA 5BNQA 3ME2A 2R30A 5E88A 1TEIA 5JLVA 3JBG2 5JOZA 4R9DA 4EN6B 4EWAA 1F5JA 2KXLA 2A6VA 4RHV1 4Q8KA 3ATGA 1WLCA 5AFEA 1YYNA 5BNNA 3ZYJB 5K0UB 3TN93 1RUE1 4JDNA 2VQAA 4C0HA 2JX9A 3SCFA 4QQPA 4Q4W1 4KWLA 4LBMA 4FXGB 2PHTA 1YRZA 2AH2A 4KU7A 2XJSA 2XLAA 5L36A 3TYJA 3WT3A 2X5IA 2CYFA 4U36A 4WZCA 4B4RA 1LOFA 4MVTA 4YG3A 2NN8A 4IQPA 2IFRA 1IPJA 4QPIA 4QQHA 5KHHA 3ELNA 4YM0A 1RUF2 5H9RA 2SBAA 5K0UA 1QNYA 3EJKA 1RJ8A 1VBC2 5C9AB 4UXAA 4JV4A 3AZVA 4OI2A 4TWTA 1AYN1 1LR5A 2R071 3EQEA 4LTAA 1HXS1 1B35A 2HWC2 1O3SA 1REFA 4LULA 4E2QA 4MH0E 3ZSKA 1ND3B 2W68A 1RMU1 2RR11 2O1QA 1MEC2 2BFUS 4MUVA 1RMU3 4N53A 1HQNA 4QHBA 4MGZE 3KGLA 5DZEA 3VKNA 1CX4A 5E8AA 4NVPA 1H2NA 4IL7A 1Q8VA 1X82A 4RQPA 2ZZQA 4Y20B 3E5UA 3DL3A 3AYDA 2E51A 3ZN4A 1LOBA 2RS32 3GBWA 1ZBA1 3WG4A 3D5OA 2R041 1AR82 5KHGA 1PVXA 4KL1A 1TNRA 2A6ZA 2UURA 3QCWA 4B3NA 1C5HA 2ZGKA 2R49A 3R05A 4P9LA 2YGLA 1NXMA 1V6LA 1W39A 2RJLA 2QKDA 3ZFFB 4NPRA 2BGCA 1Q8OA 4YW5A 5A32B 4CEWB 5CIRA 1W6PA 1BXHA 3KCCA 1RHI2 1OA3A 2UWCA 4AFAA 4EROA 1SCSA 1GNHA 3VZJA 3V0BB 2BVBA 4YLZA 2Q8OA 5EZWA 4R9BA 1H0BA 3LA2A 1I1EA 1AYM1 1QJU3 2VOVA 3UK9A 5BXXA 3MW3A 3SITA 3VGIA 3AYCA 3JCIA 1ZYBA 4XJ9A 3O0WA 5A32A 2VG9A 3UJOA 1O4ZA 1LU1A 3H1WA 2HWF2 5DXDA 3THTA 2R1BA 5E89A 3OF1A 2CAUA 3E6DA 1FOD3 4Q4V1 4TYSA 4FTEA 2JG8B 3MW4A 2TEPA 4HMZA 1CGPA 1QQP2 4X8PA 4XF3A 2K2SA 4PLNA 4FOVA 5CAZA 4AEKA 2LUWA 3M8LA 4HL0A 1VAVA 2ZAHA 3WXPA 1ALYA 1KQRA 2D3PA 1MZ6A 4AEJA 3FLTA 3VKOA 4KGQA 5JOYA 4AEDC 3FLRA 1BEV3 3H7JA 1C3HA 2UWAA 2E7QA 1WD3A 4L2NA 3VHNA 5T5PA 3ZXDA 3OJBA 5DUUA 3WG1A 2CV6A 5LK7B 1R092 5CFCB 1O3TA 1R1ZA 2E7TA 3H3ZA 1V6OA 3AXEA 2FHRA 1V70A 1EAH1 1HLCA 1QH6A 4MSVA 2VMGA 2CAVA 3HQXA 4XJZA 1UU5A 5EYYA 1HIXA 5FQ0A 1NE6A 3SXWA 3BODA 4JCKA 2BNNA 5DUVA 1IQAA 1Q56A 1N3QA 4YZ2A 1N1YA 5BNOB 4OI4A 5C8CA 3TNPB 1SMVA 2JG9A 3AFGA 3PNAA 1BEV2 1ONAA 1XU2A 1TMF1 1QHDA 1VLNA 3NKGA 4HVRA 3M3IA 3N36A 3ZSEA 2ZKNA 5JIUA 3VLBB 3V56A 3DN7A 3AYEA 1AR81 2HWD2 2IXHA 2K9ZA 4CDQA 4W65A 2JG9C 1GBGA 4PF5A 1SLTA 3ILRA 1KS4A 3A0NA 1KDMA 1CR7A 2P37A 4K20A 1QXPA 1AL23 3H50A 4IV3C 3WW3A 5J96B 3X29B 1WW7A 3JD72 4XZPA 5JPMB 1UW8A 4B29A 2DYCA 2GC0A 3L2HA 1ND2B 2FZ2A 1SACA 5T5JA 2AR6A 3I8TA 5DDJ3 4YG0A 4OHWA 4HKOA 4WVMA 2WSUA 4URTA 2ZMNA 4XJ8A 5KHIA 2BQPA 2E63A 2BYVE 1WMDA 2WS92 2ZJCA 4AQ2A 4DXZA 2NP0A 2WFF1 3NL1A 3U4XA 3ETQA 5FBZA 1MZEA 4RQPB 1D0HA 2GC2A 2PHUA 1H1IA 2XPJA 1VBC1 4NO4A 2GC1A 4LBQB 4P9GA 1UAIA 4G9SB 1N3OA 4YGEA 3P3NA 5C4WC 5GZDA 3ZYGA 5C8CB 4Y1YA 2JG8C 4DRVA 2WJSA 1X8EA 3B7MA 4FAGA 1G7YA 4GMP3 4XF1A 4OLLA 2WZPP 2HEWF 3J9SA 1QJY2 1C8M1 1OA4A 2WNVA 2YUEA 4XQDA 2GMMA 2B46X 3DV8A 2WS91 3BOWA 3WX5A 1R091 1M4WA 4ORFA 3ZN6A 1YO8A 2QNKA 1V9U1 2RS31 4Y4YA 1O3QA 4R52A 1ND3A 1SFYA 4HN1A 2RS51 2VOKA 2DUOA 1SDWA 3FBMA 4Q0PA 3L9JT 4Q2FA 1H2LA 1ZZ9A 1AJOA 2XJRA 4LHKA 5I8SA 3AP5A 1AR91 1AUYA 5I0SA 5JZGA 4I09A 5FPZA 3ZYRA 4M0NA 5KHKA 3UJQA 1Z7S3 1DQ0A 3IPVB 4UW4A 4F83A 1S0DA 2DCKA 1C8M2 1SEFA 5FRAA 1X50A 3ZIXA 1AR73 5T55A 5D8AC 1TQ5A 1CAVB 3GYDA 4WM7C 2JICA 3VKMA 3J8F2 1D0GA 1UD1A 5GLVA 3JZVA 1SBDA 2Q0AA 1A8DA 5ACA3 1I3HA 4FQZA 1AX2A 2RS11 1Y7BA 4KNCA 4AWDA 4BE3A 1K5MB 2OUJA 4QGNA 3USSA 1PGL2 3JD73 1VB4A 4GMP0 4Y22B 1VP6A 3NSTA 3B69A 4LBNA 2UWBA 4PBPA 1LHOA 3VBRB 5A33B 3NWKA 2QCSB 1UZYA 3M3QA 5GZEA 2XGXA 3MIFA 1NY72 1IS3A 2ZTNA 2NQYA 2X5IB 3VBSC 1VAKA 2HWB2 1CPMA 1J1TA 4S2GA 4LEJA 3M4FA 4H14A 1LOFC 1PO22 2WZR2 3QD6A 1PO12 3VUOA 2XWJB 4E9KA 5FPXA 2ZMKA 1E57A 1RB8G 3VZLA 1ZX5A 4YW4A 2ZABA 1NOVA 2WNUB 2D40A 4HK8A 2HJIA 3VDDB 1YJLA 4FPFA 4R9AA 3P3PA 3AKPA 2IXCA 1LGCA 5HCAA 4JQRA 3WUCA 1VBA3 4PDWA 1VBD1 1GFF2 1PO21 2ET7A 2R073 1PGSA 3ZXKA 1VIWB 5EWSA 1VBC3 2ZGNA 1CQ9A 3BOPA 2WFPA 4AFDA 5JOXA 1DQ2A 1OSGA 4Y1XA 4IEVA 4Z2WA 1NG0A 2ZX2A 4YM2A 1AJKA 4W6XA 2ZACA 2VGDA 2YXSA 4AW7A 2HWE3 2AGSA 4WM8C 4WBBA 4DZGA 5D1IA 5I93A 3MYXA 2MPFA 2JG9B 3I2DA 4BIOA 2ETEA 3LB9A 1OA2A 4XXPA 4CDUA 4LO8A 2ZHLA 1W6PB 4MX3A 4OI0A 4YM3A 4OZXA 1LULA 1LECA 3U11A 4YZ1A 5CU1A 3HAGA 4R8HA 2CTVA 5LEKA 1QH7A 4AGRA 1H8TB 3FC0A 3ILFA 1FNZA 1GZ9A 2ET1A 3N7KA 3AMHA 3WG2A 5HI0A 3K48A 4XF4A 4MZUA 5AFBA 1O5UA 1ZA4A 2RR12 3MF9A 1RL3A 4I30A 3BPZA 4GWMA 5DG2A 3E6BA 4WM7A 2JKBA 1IOAA 1BCXA 4FPJA 2VPVA 5BNPB 1COV2 2PHLA 4JGYA 1YFWA 2VW1A 4NHLA 4Q4X1 1FMD3 4YZ5A 3ZDSA 2D3SA 1MVQA 3GALA 3AZYA 2WS93 5CFDC 2B8MA 3MIBA 1VB2A 3N7LA 2NYYA 1XNKA 3VBOB 4FOYA 4K40A 1AXZA 1AXKA 2EXHA 4XBQA 2JXAA 4GMP1 4DOUA 3KMHA 4YARA 1S2KA 3AJYA 5FREA 2F4PA 4U2AA 3VBSA 3R0RA 3O14A 4D69A 3B3QE 4NHKA 1PM7A 3PVEA 2TNFA 3JQXA 3MPBA 3WLUA 5GLUA 3NV1A 3IN9A 2HYKA 3M3EA 5FOJB 4OVEA 3PLQA 1X7NA 4YNIA 2QQPA 1UKGA 1VRH3 2VU9A 3FMGA 3H1MA 3FBYA 1IKPA 5KXBA 1VBB1 2BFUL 1B09A 4IEQA 5L73A 3LOIA 2BPA2 1AL21 1EPZA 1SLIA 1V6JA 3CEWA 4IEZA 2I2SA 1MACA 1GANA 5BNPC 4YVSB 1LGBA 4IERA 1D4M1 1WLWA 3HWJA 1S0CA 4F3JA 3VBUA 2UYAA 4LBJA 4BPZA 3R4DB 4FP3A 1RUOA 5DDJ2 2IXJA 4V1PA 4HFSA 3RWNA 3MZHA 4EV0A 2ZX1A 3EBRA 4RSUA 2HWB1 2WT1A 4QPGC 3WP6A 2ZBJA 3ZN5A 1VRH2 1BEV1 4D94A 1MQTC 1Q43A 5T52A 1MS8A 4Y22A 3ROUA 1DYKA 4OHXA 5GLWA 2DF7A 4P9YA 5L7OA 3OBTA 1DGWA 2CNAA 4RA0A 4YW1A 4XEZA 2V09A 3BIWE 4FPHA 1CJPA 1W6OA 4LO4B 4YZ3A 2RMU2 5FAXA 3FWEA 3VKFC 4RR3A 4Q4V3 2ZPXA 3J26N 1EP0A 4LNVA 3HBZA 2WIIB 1GR3A 3IKWA 4XHBA 2ENRA 1LOEA 3O5SA 4QT6A 4DPNA 3VBRC 3S30A 2IXIA 3ZFGA 1RUC3 5AVAA 3TNQA 2YGMA 3TAYA 4BMEA 1OOPA 3O12A 1WCSA 4D7SA 1KITA 1WLTA 5K0UC 1F8VA 5KWRA 2Q1MA 3M70A 2VY0A 1OQDA 3HD8B 1IS5A 5CFDA 3PVBB 2MNGA 3U0ZA 2HWE1 2ZHKA 3ZSLA 1BJQA 2E6VA 4NN0A 3AP7A 4QQOA 2YDEA 3DPRA 2BNMA 4AFMA 1LESA 1REDA 3ZYIB 1YIFA 1HRV1 1QXJA 1DBNA 1RUD1 3V64A 4AI2A 5C9AC 1N1VA 2KM2A 1AYM3 3ZXGA 3CJXA 5C4WB 3S7IA 1QF3A 1WW6A 2QDRA 1I5ZA 2XVKA 3ZFEB 4I2OA 2WLPA 2RM21 4HT1T 2XJPA 3SLIA 4HETA 4R9CA 4IXLA 1UU6A 1D4VB 5LRRA 4CDWA 2MEV1 4HBNA 1XE7A 3VL9A 1HRI2 2XG3A 3KT4A 4Z92B 1IKQA 4CDQC 2WNEA 2ZX4A 3OYWA 1EPWA 4MXVA 4FPKA 4CP0A 2GNDA 4WM8A 3VHRA 2PLV2 2P3IA 4IV3B 4P9IA 1XXNA 4IEPA 1W6MB 3RG0A 5HCFA 5DUXA 3H8UA 1AXYA 4AQSA 3JD71 3ZMOA 4WV8A 4P9WA 1U5XA 2A3YA 2VW0A 2LTNA 1XYPA 5AC93 1HRI3 4FPYA 3ZXLA 2HWB3 4K9SA 4PJYA 3IBMA 4QQLA 4GULA 3ASIA 4M3CF 4AEMA 1EV12 3FX3A 4FOWA 4QQ2A 4AI3A 5FLJA 1QJZA 3VN4A 3NO8A 2EF6A 3POWA 4LUMA 1QY4A 4X6QB 2DVDA 3KM5A 4WM7B 5T5OA 2ZGSA 4X8NA 3ES1A 2YROA 2ZA9A 4UBGA 4XXAA 2PHDA 4Q4W3 3M2MA 3OBRA 5I8YA 3PVNA 1WGPA 1RUE2 4FOQA 1G86A 1LGNA 1ZRDA 1ZNPA 1TME3 2JD4A 1RUJ2 1UF2C 5A3MA 4AGGA 1C28A 5H9PA 4CDXA 4JC1A 4JDOA 1IPKA 3B93A 2K0GA 2JE9A 1LEDA 4JRAA 2HWC3 5IK7A 1YI9A 3RDIA 2BUKA 2PAEA 5FDBA 1UPIA 1VAMA 4XOGA 3V65A 3WY6A 3SNMA 4XILA 4DFSA 1CVNA 4CDUC 3OTFA 1U5ZA 1JW6A 1ULEA 1RMU2 1MQTB 1NLSA 1COV1 3HR9A 1CONA 4XW3A 3E97A 4K6BA 5EJ3A 1QGLA 1RTVA 2VOWA 3NAPA 4YRDA 3AKTA 2G4IA 4KG8A 5F6LB 2UY8A 5JIAA 3HT1A 1ULGA 4H3WA 3H3UA 4GQ7A 3ST7A 2YC0A 4YVSC 2XVLA 5CFCC 2IFWA 2DU0A 2WNUA 1OPOA 3B01A 3AFKA 4NWWA 1HKDA 1NY71 2NM1A 2ZGMA 4AE2A 4XQWA 1PZ7A 1J3PA 2EXKA 3RI8A 1VBB3 1DYPA 3EXUA 2DTWA 2X53S 1PVC3 4Q8LA 2EAAA 1JTZX 1V6KA 1DFQA 3IDCB 1O4YA 4RS5A 2EA7A 1GYKA 1G9DA 4BLJA 4A7YA 4L92A 3GF6A 4RR3C 1OQ1A 2VECA 2VNOA 4CYDA 1W0OA 5JDBA 5EYXA 1LCLA 3MLLA 1FPN3 4IV1A 4HKLA 1LODA 1ENSA 1PO23 4UW5A 2C5DA 1VBD3 1J59A 4AHYA 3B9IA 3ZFGC 4N7IA 1AL22 4E27A 5EXOA 3T1LA 4HPKB 4D7YA 1UKRA 2FMYA 3LZZA 3TRSB 5FTTC 4QGLA 4LE4A 2R062 4XTMA 4C91A 5SV8A 4KQ7A 4QX5A 3RMYA 2D98A 1NA1A 3B00A 2RHPA 3CU7A 3H1YA 1X33A 2BNOA 2Z2SB 3GHNA 1BQPA 2D43A 4IEYA 1GICA 3AB0A 3FHIB 4X6RB 2JENA 5C4WA 1FYUA 1O91A 4JTNA 4M0HA 2XVGA 3RS6A 4YM1A 5CFDB 1GZCA 2E9QA 4QGMA 4AEDA 4BHPA 1J58A 2RMU1 3T1MA 3PMSA 3WV6A 1WCKA 4OUMA 3N7JA 4ITCA 1CAUB 4LR4A 4N43C 3BCWA 1PGL1 1LHNA 1SLCA 5ABJA 5H9SA 4H55A 4Q4Y2 1XNCA 3M3CA 3AZXA 1VBE3 1MS9A 1NXD1 1RUH1 3RQ0A 3RPQA 1BMV1 3L2YA 5FMOL 5GKAC 4L9BA 4AHXA 5CADA 1H4GA 1HRV2 3HIFA 1Y43B 2BVVA 2GNMA 1PO13 4QU2A 4BQ1A 4CDXB 3SCGA 3IMNA 4GH4C 2QJVA 4YFWA 4YVWC 2VNGA 1CN1A 3RZZA 2DCYA 3MGUA 4YSFA 2I07B 4F7ZA 4ISQA 4CEYA 1PHMA 4HVQA 1MZ5A 1ASJ1 1KXGA 4AVSA 2YYOA 2HWD1 3CF6E 2R072 3AJZA 4HN0A 4N9HA 5AC92 3MFAA 1K5MC 3CO2A 4XBLA 4WM8B 3AKSA 3E5XA 1QKQA 1YWKA 3R6SA 4IEWA 4J6GA 3OCPA 1RUF1 4S2HA 1ENQA 3MW2A 5A33A 3J8F3 3JQWA 1HRV3 2D93A 5L19A 5J37A 1NCRC 2D3RA 4Q0VA 1RUJ1 2OVUA 4PQ9A 4N7UA 1VBA1 4XBNA 2ZGLA 3KZ4C 3S6PA 4KWJA 2XJTA 4UW6A 1YUDA 1QJX1 1NCQC 1KD7A 1NLRA 1DGRA 2R32A 2VVEA 3RI9A 1S0BA 3LAGA 2ARXA 3JB4C 3S0MA 4Z82A 3KB5A 4IEXA 4XF0A 1PK6C 4OHVA 5CB7A 1QQP3 4Y1UA 3AKRA 4B8EA 2OW4A 4FPOB 1ZBE3 1XNDA 3NJZA 4RL7A 2ARBA 2RS12 4LO6B 2EALA 3H7YA 4GIQA 3LA7A 1PNFA 3BU7A 3MICA 3CL1A 3LKJA 2G9GA 3WDWA 4K21A 4Z8BA 2CGPA 4QM9A 1ND2A 3ZFFA 3GZUC 4O9GA 3CLPA 1VR3A 2HKXA 4I0WB 1PK6A 2FBEA 2R0FA 2PA7A 2V5YA 2DV9A 1FX5A 1UPSA 4C90A 1GQHA 1NYWA 3AXDA 4C0BA 3GNEA 1DZTA 3V0BA 3HMYA 1D4M3 3QACA 4Q1RA 5EV7A 1QU0A 3H9AA 3I54A 4BCUA 4JDMA 1B35B 4DB5A 1ZRRA 3ZFFC 1AR92 3VBHA 1V6MA 1YXWA 3KD4A 1CAWA 1GKBA 4IETA 1UU4A 2B7YA 5JI7A 2Y38A 2YV8A 1JH5A 2RS13 1PK6B 3WD5A 5JAXA 4N53B 2WLQA 3JBG3 4AVBA 1PIV3 1N1SA 1OKQA 1AR83 4HKWA 1RUG2 4Q0QA 5FMOS 1YIPA 1V9U2 2BBVA 1BBT2 1XYNA 1DU3D 2DVAA 1UN1A 4AI8A 1K5MA 2OPKA