3CEWA

Crystal structure of a cupin protein (bf4112) from bacteroides fragilis. northeast structural genomics consortium target bfr205
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
118
structure length
118
Chain Sequence
b'MKNYQKMSVAQDARVELHDSLALTGAEVSINHLPAGAGVPFVHSHKQNEEIYGILSGKGFITIDGEKIELQAGDWLRIAPDGKRQISAASDSPIGFLCIQVKAGSLEGYTMTDGVVQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized cupin protein
publication title Crystal structure of a cupin protein (BF4112) from Bacteroides fragilis. Northeast Structural Genomics Consortium target BfR205.
rcsb
source organism Bacteroides fragilis
molecule tags Structural genomics, unknown function
total genus 17
structure length 118
sequence length 118
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3cewA01
1SQ4A 2XHKA 3E5QA 5LRRA 1EYBA 3RYKA 4YSFA 4ZU4A 3BB6A 3HQXA 2WC2A 3MYXA 4QGLA 3GYDA 1RGSA 1Q5OA 4IEYA 5JSOA 1CAXB 2CGPA 2OZ6A 4Q0UA 4MGZE 4XETA 2EAAA 1ZRFA 2ETEA 3PLQA 1YFYA 3LA2A 4MX3A 3M3IA 4IETA 1X8EA 4XF0A 4AVBA 4KU7A 3ELNA 3LA3A 4EWEA 3HT2A 4FAGA 1ZZ9A 1DGRA 4IEPA 3H7JA 1O3SA 3RDIA 5CADA 2O1QA 2MPFA 4L2NA 3WW1A 3FWEA 4NVPA 5LEJA 3H8UA 4QGNA 2Y0OA 4ORFA 4QGMA 2GC0A 4OFGA 1CAUA 3DV8A 3S7EA 1J59A 2XLGA 1I5ZA 2IXIA 4LTAA 1RTVA 1WLTA 3BALA 4EWAA 2Q1ZB 4AQ6A 4Q29A 2FMYA 1UD1A 4EROA 3JZVA 4LA3A 3OGJA 5I0RA 2BNOA 4AQ2A 4O9EA 5JSRA 2PAMA 3MPBA 1RC6A 4GULA 5FQ0B 3LA7A 2N7GA 4YYOA 1Q43A 2PFWA 3I7DA 1YHFA 2PAEA 4QM8A 2HKXA 2K0GA 3H1WA 4F7ZA 3NJZA 4I0BA 3KSCA 1YLLA 1J3QA 2BEOA 1YFXA 2PAKA 4LUKA 5E16A 3CJXA 2QCSB 3EJKA 4KU8A 4OLLA 5KBFA 3O14A 1J3PA 1QXJA 1WGPA 4HLTA 3UKNA 1VP6A 2UYBA 3CF6E 5I0UA 3MZHA 4CYDA 2D93A 3SCHA 1CAXA 4J1WA 1SFNA 1WA4A 4I02A 4XEZA 4XF1A 3UKVA 2ZCWA 2XKOA 2UY8A 3KMHA 2ET1A 4Z82A 1FT9A 4QMAA 1CX4A 5C8WA 2PA7A 4XFCA 4A2UA 2UY9A 3H7YA 2BNMA 3NSTA 4KWJA 4MGKE 4HZFA 2D5FA 4N9IA 3E5XA 1FI2A 1ZZ6A 4XFIA 2Z69A 1ZRDA 2Q30A 2IXJA 4XFAA 1ZRCA 4IEOA 2MNGA 2V09A 3RYPA 4Z07A 3NL1A 1FXZA 1YWKA 4ZU5A 4IEWA 3RYRA 3BCWA 2WFPA 3D82A 4XF4A 2K9ZA 3IIAA 1HW5A 4F8AA 1O5UA 5KHJA 5JSPA 3S0MA 5BUVA 2Q0AA 3OCPA 3FE5A 1QY4A 3CEWA 5FQ0A 2E9QA 5FLJA 3WW3A 1ZNPA 2B5HA 2GC3A 1LKNA 2B9UA 2ATFA 1G6NA 5C6CA 4HSJA 3H3UA 1UIKA 1ZX5A 1DZTA 3NKTA 4AVAA 1GQHA 1L3JA 3HIFA 2IC1A 2PQQA 4LUMA 1DGWA 3FJSA 4R52A 3E5UA 1OMIA 2I45A 2IXLA 2OYZA 4JV4A 3EQEA 1Q3EA 4WVZA 1NYWA 1H1IA 5BV6A 4Q0QA 4XFGA 3I59B 1SEFA 1Y9QA 3E6BA 3H50A 4XFFA 4XF9A 5FLHA 3U11A 2HJIA 2CV6A 5I91A 3CLPA 3D0SA 5EFUA 1ZVFA 4IESA 5CVRA 3FHIB 3L2HA 3E97A 5FCCA 4I01A 4YRDA 2BYVE 1ZZ7A 3RZZA 2IXCA 2ZKLA 1OD5A 3ES4A 4MGYE 4EV0A 3HT1A 4R8HA 4KWKA 3SXWA 4YNIA 4BH9A 1CAWA 2PHDA 3BU7A 5BXXA 4E2SA 4FAHA 3H1YA 1EP0A 1XRUA 3FX3A 4JTNA 5KHHA 1NE4A 2ET7A 3ACLA 1XE7A 3CO2A 2KXLA 1YFUA 2VPVA 1ZZBA 1QXRA 2P17A 4BHPA 5F1RA 4HVRA 3M70A 5CU1A 3H9AA 3QACA 3SMHA 3TNPB 4I2OA 2OPKA 4UBGA 4MH0E 2QJVA 3NW4A 2BGCA 2QVSB 2H6CA 3IWZA 1RUOA 5J3UA 1ZZ8A 1NZCA 5FLIA 4MUVA 3E6DA 5FPZA 1YUDA 2XL7A 3I54A 4D7SA 4LEJA 5LRSA 4X6RB 1UIJA 5JAXA 1J58A 1TQ5A 1ZZCA 2D5HA 3BPZA 3OTFA 4BIFA 5FDBA 2BNNA 1ZREA 2F4PA 3ZDSA 4E2QA 5KHGA 3G7DA 4HBNA 3LAGA 1YFWA 4UBHA 5T3NA 1VR3A 2GH2A 5BY5A 3KCCA 1O3RA 3D0JA 4EWDA 4PJYA 3KGLA 3I59A 5K8SA 1QWRA 3EHKA 2GAUA 4Q0PA 3FZ3A 1CGPA 1PMIA 2H0VA 4Q0VA 4XFBA 2B8MA 4HSLA 5I8TA 4KWLA 4META 1O3QA 5I0SA 3OF1A 5J7MA 5LEKA 4XF3A 3ROUA 4LA2A 4AVCA 1RUNA 3MDPA 2OZJA 3FFQA 4IEUA 5J48A 1CAVB 3RPQA 4HVOA 3R6SA 2VECA 4MV2A 5D1IA 2C0ZA 4H7LA 4WBBA 5JCTA 3OD0A 3LZZA 4ZU7A 3DL3A 2DCTA 2GC1A 5HI0A 4IEQA 4N9HA 3SCFA 4I0AA 3C3VA 1NE6A 2CAUA 4X6QB 5I8YA 4J1XA 4BYYA 2EA7A 1X7NA 3H3ZA 3WW2A 3GBFA 4I09A 3CL1A 2XL9A 3EBRA 4JVAA 1EY2A 3WW4A 4HN1A 4KL1A 3ST7A 4XFHA 3S7IA 2Z2SB 3EO6A 1EPZA 1IPJA 1LR5A 3VHRA 3IDCB 2OA2A 2MHFA 1Y3TA 1I6XA 5JR7B 4L11A 2GZWA 3PVBB 5E1RA 1LB2A 2IXKA 4MZUA 2GC2A 4UXAA 3IBMA 2IXHA 3SCGA 1DZRA 4HN0A 4HVQA 4I3PA 1OFNA 2PHLA 4P9GA 4IEZA 5KHKA 3ETQA 1X8MA 4PIYA 4E2GA 3H1MA 1XE8A 4IEXA 4QXKA 3RNSA 4LLOA 1NXMA 2PTMA 3N4MA 2H6BA 4RD7A 3LOIA 1VJ2A 2FQPA 2GU9A 1O3TA 5I93A 3TNQA 3PNAA 1LRHA 4TLFA 1V70A 4LULA 2XLAA 3DN7A 1CAVA 3IDBB 1O4TA 2PYTA 1UCXA 4Q0SA 2UYAA 3B02A 3E6CC 5I0TA 3USSA 4AXOA 4PIXA 4IERA 4QM9A 5FPXA 4QX5A 2XLFA 1J3RA 4ONUA 3U10A 4D7TA 4DINB 4O9GA 5BPXA 3SHRA 2XKPA 1CAUB 4K8FA 1GQGA 3NVCA 3QOPA 1JUHA 5EZWA 1X82A 2QDRA 2CAVA 1H1MA 1ZRRA 2O8QA 1UW8A 1O5LA 2QNKA 4HMZA 1J1LA 2XGXA 2D40A 4IEVA 3LWCA 4FT8A 1U12A 4WZCA 3ES1A 1CAWB 5AVPA 1PM7A 1UPIA 4PIZA 1RL3A 3U0ZA 1O7FA 2EVXA 5KHIA 1OI6A 4B29A 4FBFA 5I8SA 4YARA 4MGIE 3KGZA 2VQAA 3DKWA 2Q4SA 3UKTA 4JTOA 1IPKA
chains in the Genus database with same CATH superfamily
4FPFA 5DG1A 5F9TA 1AL0G 4FPGA 5LRRA 4WVVA 4YSFA 1HRV2 2P6HA 2XMLA 5A6ZA 1XNAA 1GP5A 1AYM1 5FUPA 5L9BA 1QJU3 2C26A 5AFEA 4HKWA 1RUE2 1A78A 3B69A 2V72A 3DYPA 1B09A 2GH8A 2ZGTA 2DCKA 4YM1A 2C24A 2FZ1A 4D6SA 3WF0A 1NX9A 2DF7A 2RS51 2CGPA 1REFA 4NWWA 5T5LA 3KV4A 3UESA 3E1F1 2WZR1 4MGZE 2EAAA 2PLV3 4RN5A 5FPAA 1UMZA 1VBC2 1ZRFA 1PZ8A 4AFCA 1YFYA 3LIGA 1VE0A 2RM22 3LA2A 2CWMA 1X8EA 3D4KA 4IW3A 5G04L 1TME2 4AAXA 4U36A 2WUHA 2HWF3 5JXIA 2JDYA 5JXGA 2RMU2 5CEHA 1DQ2A 5LASA 1O8SA 3WR0A 4AI8A 4TWTA 4H7MA 1QJU2 4LO7A 4FPKA 4IV3C 4B1MA 4ZHNA 3H7JA 2CHHA 2GNTA 4YVWC 5LBFA 1NAEA 4AI3A 4P5YA 1S0GA 2B46X 2VOKA 3FBYA 1WMXA 4P9YA 3VZMA 3WD5A 5A6XA 3WW1A 2HWE2 1RUJ2 2BP6A 4YZ3A 3RWNA 5LEJA 5E6HA 4QGNA 2Y0OA 1OC1A 2VGDA 4YG6A 5L7OC 3V0AB 1CAUA 1R091 2WWUA 4HL0A 2WA4A 2IXIA 4LTAA 3VKOA 4Q4W3 3OBZA 4EWAA 3U1XA 2EIEA 4QX2A 3JZVA 4Y1VA 4QWNA 3U4XA 4NIDA 1COV2 5FMOL 3AKQA 3OGJA 3K3OA 5I0RA 2FDGA 3MUZ1 1N3OA 4IV1C 2PHWA 2VZQA 4BXSV 4DEQA 2QE3A 2MEV3 4O9EA 4B4RA 2CTVA 1VAKA 1US3A 2GNBA 3AYEA 2ZHLA 3MPBA 2J22A 3LA7A 1AR71 2ZHKA 3I3EA 5DZGA 3VBFB 1DQ6A 1Y4WA 5FJKA 2Y26A 4NOTA 5A3NA 2PFWA 5ACA1 1YHFA 3KV5A 4QM8A 1NQJA 3VZOA 3AZVA 3H1WA 2K0GA 3GJBA 3CBNA 4Q4W2 1QH7A 2RDRA 2W0XA 4CDUB 1JS9A 1J3QA 1D2QA 2EICA 2KD7A 4K1ZA 4XCAA 1W2OA 1YFXA 1XE0A 1N1VA 2PAKA 4LUKA 4HPKB 4HETA 2FDKA 2K2SA 1XU2A 1W9YA 2MEV2 2VL4A 3CZJA 4LK6A 5GALA 3ZXJA 4AI0A 5KBFA 3MIBA 1XYNA 2D3SA 2KR2A 3DECA 1J3PA 2QBXA 4HLTA 4ARXA 1VP6A 4JAAA 4PLMA 4CZSA 1DYKA 2LW8A 4K9SA 5C3RA 1ENQA 4LKDA 1WA6X 4BCUA 2IWGB 1BXHA 5LW9A 2FDIA 3WUCA 1NCQC 5FYTA 3WF3A 2W1SA 4PI2A 1WA4A 2QQLA 1JHNA 2GSYA 5CISA 4N90A 1QNYA 2VCAA 1GSLA 4QQOA 5IFPA 2ET1A 3DCQA 4AAPA 2Y6JA 2DFCA 4M4RA 4QMAA 5FZ0A 1LENA 2DUOA 2X8KA 1QJY1 3H8RA 4XHBA 4CUCA 4A2UA 4LIUA 2EAKA 1JYCA 1QQP1 2D44A 1VB4A 2PQSA 2GNDA 4HZFA 1BHGA 4N9IA 4YZ5A 5FY4A 3PUIA 2DU1A 4XFIA 1ULEA 3WDYA 2R32A 1F8VA 1Y7BA 1ZRDA 2RS53 1S0DA 4AQSA 4HG6B 4IEOA 2MNGA 2V09A 3IT8A 5FZ4A 3BTYA 4RQPB 3H8XA 3NL1A 5C9AA 2XWBB 3Q9OA 1CVNA 3WINE 1STMA 1JOPA 2XWJB 5F5QA 1CD3G 1QJX2 2Y6FA 4I30A 4ZU5A 4QPYA 3D82A 2AEYA 4B7EA 2VW0A 2K9ZA 4LO8A 4E4SA 4YM3A 5CFDB 2ZJCA 2ID4A 1AYM2 1KFUL 1APNA 2W68A 3AYDA 3USUA 4F8AA 4AHWA 5JSPA 2DDUA 3OJBA 4DXTA 5KXDA 4NIHA 1JYTA 1XJAA 1Q8PA 4QX3A 1OT5A 2EXHA 3ABZA 2P3JA 3OBAA 1EPWA 2WZR2 3LEMA 1OLQA 4NO4A 2ZMKA 2X09A 2GC3A 1M06G 4Q4V1 3D5OA 2B9UA 3M3CA 3OG2A 2LROA 1YO8A 1W6MA 2X29A 3ZN4A 5IATA 5L73A 3VN4A 1PNGA 4BIOA 1TMF1 2CWSA 3HIFA 4KGGA 3AP4A 2B4KA 1DGWA 2ZHNA 2YGMA 4UW5A 1OMIA 1R1ZA 4AFMA 2OYZA 3ACIA 1UOJA 4WVZA 4AFBA 3NV4A 3ZYPA 3VBRB 1W2UA 3N7MA 2WO2A 1WMFA 1AR73 4YW6A 3X29B 1JU3A 1R092 1RUF1 3N35A 3AKSA 5BV6A 1SEFA 3E6BA 5FLHA 4C1WA 2FZ2A 2W2IA 2HJIA 4W4ZA 2CV6A 3VHPA 1J84A 1V6NA 1BLZA 3CLPA 1GMMA 4RS5B 5FIXA 1XNCA 5EFUA 1JI6A 2FCTA 3VDDA 1W6NB 2VH9A 3L2HA 3PUAA 1ONAA 4YRDA 1ZZ7A 2WT1A 4M3CE 1OPOA 3P6BA 4MXWA 2WNUA 5HBAA 3I3MA 2VY0A 4DRRA 1GZWB 3ES4A 1C57A 1QOOA 3GF6A 3I2KA 2ADDA 5FY8A 4ZKTB 5ACA2 4NHYA 1T2XA 2X5IA 5EHDA 3FMGA 2VZ1A 4BH9A 2D3PA 1CAWA 1W6QB 4XQWA 3O1PA 2E7AA 1X9PA 4E2SA 1W9FA 3AXDA 3H1YA 4MOAA 1NLRA 4PQQA 1SLIA 3FLRA 2VNRA 1XRUA 3LE0A 5KHHA 1RVF1 2JICA 2RDNA 4FP3A 5IYYA 5DZFA 1S1AA 2A73B 2BERA 3KT7A 3SH4A 3UT0A 4LT5A 2VPVA 1PHMA 1QJY3 4QDRA 4XTMA 2KA3A 3JUUA 1QQP3 3ZFFA 5CA6A 1NCRB 3DGTA 2IFWA 2E51A 2FDHA 1GNZA 3SNMA 2R30A 4X8NA 2VZVA 1CQ9A 3H9AA 4Q1RA 3QACA 4CTEA 4IE4A 2XJSA 4DY3A 1SPPB 4EN8B 4I2OA 4UBGA 4GB32 1AR91 2VZTA 3K4AA 3O0VA 2NMOA 2P6CA 5T5JA 3N9PA 4R9BA 3BU0A 2HWD1 5LB6A 3ZSMA 1ZZ8A 5DUUA 5FPZA 3WF4A 1RUC2 5C9AC 5J37A 5JI7A 4D7YA 1QJY2 2XL7A 3OB8A 1VMJA 3HBZA 4D7SA 4X6RB 1UIJA 3FL7A 4XZPA 4COUA 5JAXA 2ARAA 1TQ5A 5IK5A 2VNOA 3VBSA 3QH6A 5KC6A 2BNNA 2VOXA 2QZ2A 4NR1A 2F4PA 1ND3B 4RGAA 1ZBE1 4AK3A 3G7DA 4RL7A 4Q26A 4Y33A 4HBNA 4YW5A 1ND2B 4NJ4A 2UWBA 3BYWA 5T3NA 4DZGA 1YIPA 2GH2A 3VBUB 4JZRA 5FYHA 1DQ4A 4Q4V3 3HN3A 1G9CA 5C3PA 1K3IA 4KNCA 1V6LA 3WDVA 4ET7A 2VW1A 4Q0PA 3S30A 3NJVA 3SISA 1PO11 3D8CA 1TMF3 5A6QA 4J6GA 1Y9MA 1ZRIA 2VQ0A 2E7QA 4KG0A 3T1MA 2B8MA 4HSLA 5A7SA 3LPFA 3OF1A 1H2NA 2B45X 1AVBA 2YU1A 1GLHA 3MDPA 1RUF3 2C6SA 4R9DA 1MQTA 2GDFA 3B93A 2ZZJA 3MV01 1I5PA 4LBOA 5J48A 4H3WA 1CAVB 3BGAA 3KT4A 3ZM8A 3U14A 2HEVF 3R6SA 4XMIA 2YBKA 1TMF2 1FMD1 4MV2A 1OH4A 1UX7A 2ARBA 1RUG3 4Y3OA 4B1LA 2VVEA 4KH9A 4LHSA 2YFUA 4WBBA 4EZ4A 3TWIA 3L2YA 3HOBA 3PJQA 1GOGA 4LHNA 3LQCA 4ZU7A 4M3CA 5JVVA 2XPJA 1OKQA 2GC1A 5LBBA 5HI0A 2WT0A 4GJYA 2ZGPA 3VDDC 3VDAA 1S2KA 3NO8A 4N9HA 5EYXA 5JMOA 3SCFA 5H9SA 3THTA 2P3YA 2Y6LA 4R9CA 4GA9A 5IVCA 2WNUC 2DVBA 4J1XA 2P2KA 3O1MA 2QUOA 4LE4A 4JHZA 1X7NA 3H3ZA 3HVDA 1WW6A 2J42A 2X5IC 2XL9A 3EBRA 4CDQA 3WVJA 3GGLA 2PELA 1EAH1 3NV1A 3RMXA 4DXSA 2ES3A 2NLRA 2B39A 2VVFA 1JU4A 1F35A 2JENA 5A32A 2VNGA 2XXZA 1Y9GA 2JB8A 1KGYA 5EQUA 5FY7A 4YM2A 3IDEA 4TTGA 1I6XA 4TYSA 3T30A 4BQ3A 3BOPA 2GZWA 2F4LA 5E1RA 4LBQD 1HDKA 1DIWA 4A45A 1LB2A 2IXKA 4QHOA 1G8WA 1SCSA 4MZUA 3ZFFC 3WSOA 4AI1A 2Y60A 3M4FA 2D6MA 1XPWA 4N43A 2IXHA 4H14A 3OPWA 4BMEA 5DAVA 3MI8A 3VUOA 2A3XA 5ANQA 1AR93 2VXRA 2BZDA 1LCLA 3BTZA 1UOGA 4GMP0 4I3PA 2KM2A 2AR6A 1RVF2 1O91A 3ZR5A 5FYYA 4K40A 2DTYA 5EIYB 1CZVA 4DQAA 2A6XA 2O8OA 2ZX1A 4P5HA 1XE8A 1JYXA 2DFBA 2BPA2 3OUIA 4NHLA 1NXMA 2ARCA 2PTMA 2RR11 3HD8B 4XIKA 4OHZA 3UJQA 3N4MA 1HIXA 5T54A 1XSQA 3WG1A 2HLEA 2VBDA 3B9IA 4QPIB 1ZBE3 2XJUA 4D94A 5IVBA 1MZ5A 2PXJA 4YVSB 5I93A 3VBSC 5EYYA 2WQZC 5DDJ1 1LRHA 5CB7A 3OSDA 4TLFA 2VTXJ 2OT7A 1LEDA 1V70A 1ZBA3 2HWD2 4LULA 5FZ7A 1HRI3 1PGW1 2RJ2A 4LKSA 1AR61 5FZCA 3TEZA 4KG8A 5F32A 1UNBA 4OHXA 1PO13 3RJRA 1I9RA 1O4TA 2ZTNA 2F6BA 4Y4YA 1I3HA 3KV6A 1UY3A 1UY4A 4GIQA 2JDMA 1QXPA 3B02A 3ZSLA 4DOUA 1EV13 4LO6B 4XPVA 4Y22A 1ZBE2 3OD4A 1G7YA 3LSEA 3HJRA 4OVEA 4ASMB 5EV7A 1QOTA 1HJFA 4QX5A 5FZOB 3VBOB 4CEYA 3VDBA 3OY8A 1SLAA 2QQKA 4MVTA 5A70A 1MZEA 4XUQA 2QZ3A 4DINB 4C90A 4QDQA 4O9GA 1MQTC 2R071 4YWAA 3CZUA 3SHRA 5DMYA 1PO12 2XKPA 3AKPA 1H8TB 2FDFA 4OI2A 2A70A 1KITA 3QOPA 2ZXQA 4BQ4A 2DCZA 3THDA 4Q8KA 3T2OA 3VZKA 5JZGA 2A6WA 2CAVA 3BOWA 3PVNA 5CFCA 3RZLA 3VZLA 1RUD3 5FZ3A 1R1A1 1Z0HA 4OZXA 1UW8A 3C7GA 4LHLA 4PLNA 4UFHA 3VZJA 1GZ9A 4BU2A 2K46A 3RZHA 2GALA 4JRAA 3I2OA 1AXYA 1D4M1 2D40A 3ZYRA 2XUEA 2HBTA 4FT8A 1FMD2 4WZCA 4Y24A 1HQLA 5FJHA 4CDUA 1WUVA 3A21A 5BNOB 5FPVA 1PX3A 3UGFA 1EAH3 2DVGA 3L9JT 4K7JA 3ALQA 2PHTA 3EYPA 2Z5WA 3MLJA 5AVPA 5IWFA 3VBHA 1DGWX 4CDQC 5LZ6A 1WLCA 4FPCA 1FX5A 3ZOIA 2P3KA 1GYKA 1PZ9A 1UU4A 3RI9A 1YQ2A 2ZABA 4L92A 3J7MA 4FBFA 1W8UA 4Y1YA 1CIYA 4NE9A 2QQIA 3D6EA 4CDXB 3CJIB 4Q5OA 2JG9A 2VXJA 5FZ1A 1OD3A 3UKTA 5FO8B 3C8XA 3PU3A 2XHKA 3FN9A 5FUNA 2JDHA 1DQ0A 3CMGA 1EUUA 1EYBA 3T4VA 1ASJ1 4DUWA 3O1VA 4BQXA 1GWMA 1EAH2 4N43C 5A3WA 3AVSA 4A3XA 3HBKA 2R7EB 1W28A 1H2LA 5ABJB 4K1YA 3GYDA 1JTZX 1PX4A 5IK8A 3NAPA 2C4XA 1D2SA 1HRV1 1V6IA 4IEYA 1CAXB 4ARYA 1VAMA 3LEGA 3ASIA 4LJHA 2OZ6A 3V65A 2VM9A 4Q0UA 5FV3A 2A7AA 3N9QA 1QMJA 3ZN5A 3DKQA 3FHAA 1JZ2A 4J25A 2VNVA 4MX3A 2E26A 4URAA 1S0EA 5ISLA 2NN8A 5JOWA 3U78A 5FY5A 5DAXA 3ELNA 4R9AA 2ORZA 3W21A 1PGSA 1H6XA 4A44A 1S0FA 1L7QA 4BLJA 4MG2A 2LUWA 1ZZ9A 2DVDA 5LCWL 1AHSA 1TME1 4OI1A 2YBPA 4TLGA 2VMHA 1NA1B 1UU5A 2RMU1 4YLZA 3RDIA 3ZYHA 5A1LA 5KC5A 2HEWF 3WNNA 1AR63 1IQAA 1CJDA 3FWEA 4NVPA 5FP8A 3WG3A 5F3IA 5C8CA 2XJQA 1QDCA 4QGMA 2GC0A 3ZLIA 3DV8A 1K5MB 1T6GC 2EXJA 4JGZB 2RR12 2JECA 4LBMA 3T09A 2JE7A 1I5ZA 2BGOA 2XLGA 1C8M1 4YW3A 3ZFGB 5JUVA 1YEWA 3K75B 5FOJB 1RUJ1 4I3GA 4NRQA 4ZZ8A 1SG3A 2RDQA 4ZONA 2VZUA 2OQ6A 5DDJ2 1BMV1 4XHXA 2EIGA 2RS11 5KXCA 3RGBA 4EN7B 2FBEA 2A6ZA 2CDPA 1PGW2 5GLWA 1RXGA 1ULDA 1DYOA 2E53A 2R073 3ILNA 4CEYC 1COV1 3NQHA 4GULA 3UYJA 1PGL1 1XB9A 5BNPB 1LHWA 4XUNA 3AX4A 4YYOA 1GWKA 5LWBA 1CR7A 5ANNA 5K0UA 1Q43A 5LY1A 3W5NA 1W9WA 2ZHMA 1FAYA 2ZA9A 4F7ZA 3NJZA 5FZDA 1KRIA 1PK6B 1R1A3 3DYMA 2CYFA 5JZGC 3POIA 1YLLA 1XNDA 4YGCA 4BPZA 4K3UA 5CFCC 5FZAA 5HXVA 4Q8LA 2ARXA 4RR3A 3NNFA 1W6PB 3JXSA 1GANA 2XJVA 2VCCA 4SLIA 4XUTA 4LO4B 1D4M3 3O1TA 3NKGA 4PHZA 5FYIA 2R072 4JGYB 3OGRA 1JZ5A 1DDLA 2EIBA 3I3DA 1W0OA 2XDVA 4O7XA 3SLIA 4PDWB 5IAXA 2XOMA 1F4AA 1QJFA 1UOBA 4XUOA 2BFUL 4PF1A 5I0UA 3MPPG 3AZYA 3GXUA 4CDUC 4P14A 2WWJA 1E5SA 1R1A2 4FPHA 3SCHA 2J1TA 3J7LA 1MR5A 1WW7A 3AZXA 3VBHC 2BGPA 4XEZA 2HWC2 3AMPA 1TZOA 3KMHA 1AL21 4K6BA 4PBOA 4ZXEA 3N7JA 1D4M2 1UYZA 1WZXA 4A41A 2WLQA 3INAA 4Y1XA 2JD4A 5HCBA 5LA2A 1JYNA 3WUDA 3HNBM 3V64A 5IVEA 2JG9C 2YC4A 4L97A 2V4VA 2VUJA 4LIVA 5F8PA 2VZRA 1MPXA 5CYYA 1ASJ3 1BQPA 1UOFA 2BNMA 2Y64A 3DEMA 1OLME 3DUIA 4MGKE 4CSWA 5FMCA 5FY0A 3E5XA 4BK5A 1FI2A 1ZZ6A 4GWJA 4PLOA 2Z69A 3AVRA 3VV1A 1HRV3 1UAIA 3MIEA 1U5ZA 5FP4A 2IXJA 1WBLA 4XFAA 2VUCA 1RUE3 3NAPC 3I3QA 5JOZA 3V0AA 3KQRA 1FXZA 2W95A 1UZWA 2FCUA 4NRMA 5DXDA 4KQ7A 4BZ4A 1QOSA 5A3MA 2WFPA 1VBC3 4XF4A 3QCWA 2WAOA 4N53B 1HW5A 1ASJ2 1X50A 2RM23 5C7GA 1TME3 4BQWA 1REDA 1WMEA 5BUVA 1QJX1 4HONA 4CEYB 2Q0AA 3PVEA 1ZYBA 1OUXA 1RIRA 1U5YA 2RMU3 3FC0A 4FPEA 4EN9B 4UF0B 4C91A 3VD9A 2Z79A 2RDSA 3H8OA 1QY4A 3CEWA 5B2GB 5IVYA 1AXZA 1DGLA 1MS0A 4UW6A 3GHNA 1O4YA 1S0IA 3MF6A 3VBFA 3N7KA 4QD2A 3UK9A 2QFEA 4HKOA 1C8M3 5C8CC 3GZAA 3WNMA 2HWE3 5C6CA 4IGPA 1RUJ3 2D97A 1UIKA 1H2MA 2SLIA 2OXBA 1ZX5A 3A23A 1XNKA 3HPNA 3JBG1 3NKTA 1L7RA 4QX7A 5DUXA 3THCA 1JODA 1L3JA 2JG8B 2QQMA 2BV4A 1QJEA 2PQQA 1C28A 4LUMA 2RS13 2E6VA 1KJRA 4P08A 1GZTA 1TVGA 4XJUA 2L9LA 3T2QA 5JXHA 4OHYA 4BWOA 1DLLA 1POV0 2IXLA 3NNLA 3ZYGA 4CXXA 3HN1A 4HPKA 1H30A 2BJSA 3EQEA 1Q3EA 3LDKA 3RZMA 3Q8FA 4CP0A 3AKTA 1COV3 1H1IA 4MHUA 1D0GA 4ZZ5A 5IHRA 5IK7A 2Y8KA 5FZ9A 4B4QA 2DYCA 1NT0A 3P3PA 1CPMA 5A6YA 4Q0QA 4F83A 3KV9A 2VMFA 3I2DA 1C8M2 4LKEA 2EF6A 1W8NA 4XF9A 4YG3A 3WCRA 2Q5TA 5K0UC 3ZIXA 1TG7A 4GH4B 4X8PA 2OPWA 1RMU1 1BMV2 4Z2AA 5H9RA 2RS12 2XJTA 1OBNA 1W04A 5CVRA 1FPN1 3RSJA 3ZYIB 5E8AA 2VMGA 1AX1A 3FHIB 4RR3C 3RZZA 3RRDA 3GDBA 4HK8A 1HQWA 2JE9A 2WABA 2JJ6A 4BDVB 1PGL2 1N1YA 5F6KA 4JDMA 1WWYA 2W39A 5GLTA 2V5YA 1UMHA 4R8HA 4WM8B 3W5MA 4Z2WA 4L9BA 5A7PA 4KGQA 5GKAC 2WFF2 4CEWB 3HQRA 1RJ7A 1U5IA 2PHDA 2DURA 3BU7A 2BBVA 1W8OA 5BXXA 1XNBA 2J1UA 4QB1A 1AF9A 4LE3A 5CZKA 1GP6A 5GZCA 1EP0A 3FX3A 4RQPA 4JTNA 4QU2A 4NPRA 5B4NA 5F2WA 4QPWA 2IUWA 3MHZA 5L9VA 3CO2A 4OHVA 2KXLA 5A7OA 3BIWE 3C2UA 2DCJA 1VMFA 2JIGA 3SH5A 2AC1A 3LF7A 4BHPA 4K20A 4MO3M 1JBCA 4QQPA 1OLMA 4HK9A 5HXMA 4HVRA 5CFDA 2JEMA 3ZXKA 3LB9A 3M70A 4EN0A 4PT6A 4RA0A 5JMCA 2D43A 4GMP3 3LGRA 5FZHA 5SV5A 3HAGA 5E89A 1UWWA 3LIHA 4L0PA 2WS92 4MH0E 2VMIA 2WT2A 4FOQA 4M3CF 2UWCA 3VD4A 1AL22 2H6CA 1UL9A 2A3WA 1IS5A 4RHV1 4XE9A 3TOJA 4CU7A 5J3UA 1RUOA 2R1DA 3MLLA 3W58A 4GB31 4E27A 3S57A 3E6DA 3AK0A 4NPMA 3I54A 1F2NA 4LEJA 4GXLA 4COYA 5D8AB 3OOXA 5T52A 3R0RA 3ZKYA 1PIV2 3OTFA 1JOBA 2CGOA 2IFRA 1RUC1 4B7KA 4BIFA 1QJX3 4BM8A 1LULA 4AGGA 3ZDSA 5IAVA 1W3XA 2JD9A 4XYXA 4E4HA 2VMDA 2GN7A 1AYM3 3LAGA 3PUHA 4XJAA 4ASLA 3VBRA 1FV3A 4P02B 4QQHA 4AVSA 1VR3A 5FKBA 3KCCA 1N3QA 3D0JA 5CG9A 4NRPA 5D21A 4G3YC 3FHQA 3ZXLA 2WZR3 3VBFC 5FDBA 3JBG3 3FZ3A 1PMIA 1LAJA 1F5JA 2VCMA 2QKDA 4RS5A 4XFBA 5FYBA 2W91A 1UF2C 4CCKA 4HXCA 4META 1EUTA 1W6NA 4EYUA 1AXKA 1US2A 3O5SA 4XTPA 5LEKA 4XF3A 4WVWA 1BBT1 3VL8A 2JWPA 1RUNA 1GZWA 2BFUS 1N3PA 3P1IA 1XYPA 2YUEA 4FOVA 2OZJA 4D6QA 4Z8BA 1SLCA 2Y33A 3POJA 2O0OA 5A33B 4Y4RA 2VECA 1GNYA 1IG0A 3C7HA 3JBG2 1MS9A 1OXCA 1R093 2RHPA 5KXBA 1VBD2 1W6QA 3TN91 2C0ZA 2G9ZA 2YPDA 3A7QA 1G9DA 4YW2A 1W8ZA 5FYMA 4MXVA 1F9KA 2R042 3OD0A 4BJ0A 1JZ8A 2A5ZA 2BRTA 1UZVA 5J98B 2ZGUA 1IZ3A 2RV9A 4XBLA 3KVAA 1T6BX 4QKBA 4D3WA 4ATEA 3ZYFA 4UOJA 4I0AA 5CKMA 1ZM1A 5GLZA 1DF0A 5FYVA 3WP4A 5C3QA 2CAUA 2VZ3A 1NCRA 3FLPA 4S2DA 3ZXFA 1N47A 5F3GA 4XVHA 3IAPA 1AJOA 5FR3A 1SPPA 3MW4A 1RMU2 5ACA3 1OA2A 1BVP1 3PTRB 1H4GA 3J8F1 1HN0A 3R4UA 1FPN2 1BK1A 4KL1A 4ZPIA 5GZDA 3ST7A 3WW4A 4F3JA 4LXLA 2BOIA 4WV8A 2Z2SB 4RQPC 1KS5A 5FZIA 3VHRA 2WN2A 2OA2A 3EB7A 3DPRB 4IGQA 4Y20B 3VB9A 4CP2A 5JR7B 1I1EA 4L11A 2P4EA 3P5BA 4OI0A 3OYWB 3A0KA 3RMYA 3M2MA 3WXPA 4W8JA 2QQUA 4ISRA 4UXAA 4AVTA 1X9TA 5CFDC 1PO22 1NLQA 1ND3A 2W87A 2SBAA 4HN0A 3BKZA 1D0HA 5A7WB 1ND2A 2C1FA 2IVJA 3OBTA 1DU3D 3VBUA 4RHV3 1C8NA 5FO9B 4P9GA 2NPIA 2ZEWA 3SC7X 4JRLA 3ETQA 4GB33 1X8MA 4Y1ZA 2ZMNA 1HB1A 5IVJA 2LTNA 4COZA 2VAUA 1SDDB 5T50A 4UAPA 4LLOA 3CU7A 3B5LB 2QDNA 4LOTA 2A6VA 3VHOA 5JOXA 5C70A 1W8FA 1RUC3 3LOIA 3J7HA 2AH2A 3A0NA 2R1BA 5FYSA 1WCUA 1F5FA 1WLDA 2VBBA 2DBNA 3TNQA 4COVA 4OMDA 2R061 5E88A 1K12A 3J4UH 4LBNA 5JIUA 4RHV2 2WKKA 2Y34A 2WYFA 3VBRC 3OPZA 3DN7A 1GZCA 5A1FA 5IVFA 1CAVA 3VLBB 1Q8SA 3OBRA 1YJLA 1SLTA 4FTBA 4BQ5A 1A8MA 1OUSA 4W50A 1G9BA 2A71A 1JZ7A 3POWA 5K9YA 4UFIA 4Q0SA 2WZ8A 1GKBA 1GBGA 1W06A 4A7ZA 5I0DA 5IT6A 3RZKA 2BW8A 5I0TA 1G9FA 4AXOA 2TNFA 4RS5C 1JH5A 4PIXA 2E31A 5FMOS 4BXFA 1POV1 3PUQA 4M0HA 3SH3A 1RB8G 2ZEXA 2XLFA 1H6YA 1J3RA 3I2JA 1JZ6A 1YYNA 4AVVA 1WLWA 1V9U1 2J1SA 2OUHA 1B35B 2AENA 3EXUA 3I2IA 1CN1A 3W20A 1Q8VA 1Q8OA 3JCIA 3ZN6B 2YROA 2WA3A 3TYJA 1H2KA 4FI9A 3MFCA 1LOCA 5FKCA 1LU1A 1OVSA 1OSGA 4K8FA 1GQGA 4YGBA 1JUHA 5BNQA 4CDWB 1MS4A 2QDRA 3OGGA 4AEMA 1XNTA 1H1MA 4S2HA 4EN6B 2O8QA 2WBKA 4XUPA 1O5LA 1BBT2 3I2GA 4CXWA 5FZMA 3UL2A 1J1LA 3RWKX 2ADEA 5C4WB 4YW1A 1BVVA 3AL6A 5JIAA 1N1SA 1E5HA 1W8WA 2XHNA 1SBFA 3RVHA 1NCRC 1UO9A 1LNSA 2XVLA 3LWCA 1U12A 1CAWB 1HXS1 3TN92 1NG0A 2DVFA 1ULPA 3WNLA 3M7AA 3ZKUA 2I07B 3J8F3 1RUH1 2LALA 4YGEA 3VKFC 3WOGA 1F31A 1QU0A 1ENSA 2BQPA 3QH7A 1O7FA 5A3TA 3O0XA 2EVXA 5C3SA 1XXNA 1OI6A 1OOPB 4B29A 1S0JA 2O14A 2R16A 5I8SA 2OS2A 4MGIE 3POYA 2VQAA 5AVAA 1DP0A 1MVQA 3ACFA 2FD8A 1S2BA 5JI9A 5BNNB 4GWIA 4OZOA 2Q4SA 3VD7A 1SQ4A 1JUIA 2VOTA 4CCDA 4DEVA 2ZX2A 3MGUA 4LLFA 3O0WA 4QPIA 4EQVA 1LTEA 2WNVB 1UKGA 4YVSA 3BB6A 3HQXA 3HR9A 5FWEA 3J8F2 1HV1A 1ND3C 1OVPA 2P37A 2WC2A 4YZ1A 2B42B 3AFGA 2GP3A 3ZO0B 1ND2C 4OHWA 2JDKA 1RGSA 1BZWA 1NOVA 3ATGA 4KBZA 3RZJA 3IMMA 3S5AA 4QHZA 2ZMLA 5FXWA 3VBUC 5F37A 4LO5B 5JSOA 3B7MA 1LGBA 1QEXA 4FQZA 4LR4A 1POQA 1RVF3 4AEDB 2W08A 2C9KA 2ETEA 4CE8A 4FTSA 2HH9A 5FAXA 1DQ5A 1IS4A 4H2AA 3LA3A 4NHXA 1MEC2 1AUYA 4A42A 4CUBA 5CAZA 1DLCA 3NJYA 4IEPA 5IFTA 2CU5A 5AC92 4UW4A 4JCKA 5FZOA 2A1XA 3VBOA 2OX0A 1O3SA 2XJRA 4ATFA 2O1QA 3HNYM 4LPLA 4OCTA 1AZDA 5HCAA 3H8UA 5DG2A 5FZLA 1H8TA 2HWD3 3MF9A 4OFGA 5EJ3A 3S7EA 1J59A 5FMBA 4B8EA 2HWB1 4AW7A 4QB2A 3WHTA 2AREA 3ECQA 1RTVA 4GWMA 3BALA 3ZX7A 1SHWB 3T2TA 4AQ6A 3LOBA 1POV3 3RI8A 2R062 4LMFA 4LA3A 2BNOA 3WQ0A 4HKLA 1AR81 4GQ7A 5A80A 2RS31 4P00B 4XILA 5JSRA 2PAMA 2JE8A 4C0HA 4DXZA 5FQ0B 1W9TA 1J1TA 2Y6GA 3PIGA 2N7GA 5C71A 5BNOA 4AI9A 1AJKA 3I7DA 4E9KA 2PAEA 2V5DA 1IKQA 4IE6A 2VMCA 2HKXA 2ZACA 4FPLA 4GWNA 4U2AA 3MIFA 4NIGA 4A7YA 3A22A 4LQRA 3KSCA 4NAOA 4QHBA 1HB3A 4QPGB 4TSVA 2G1MA 3Q8BA 5F7UA 4LKFA 3T1LA 1BEV2 1CIWA 5EP9A 1V9U2 4CDXA 3CJIA 4KU8A 2QCSB 1KS4A 1W6OB 3IMNA 4OLLA 4QDSA 3ZYJB 1M4WA 5IUQA 3VD3A 4G9SB 4XIOA 3UKNA 2YY1A 2UYBA 3UJOA 3IAQA 1RUH3 5LA9A 4WM7B 2CSGA 1JMUB 3OUHA 4ZS2A 3VKLA 4JX0A 1FNZA 3MZHA 1FMD3 5ABJA 3NJXA 2WZEA 4FO9A 5ERLA 3AMMA 3MFAA 2RG4A 4XCBA 1CAXA 1SFNA 3AP5A 4A4AA 2AGSA 3R4DB 1HJGA 3LDRA 3UKVA 4DO0A 2UY8A 5CKQA 1W9SA 4LITA 2EXKA 2BDRA 1WBFA 2WNEA 3LSDA 4QKDA 5FY1A 1FT9A 3FUOA 4XACA 1MACA 1DBNA 1YXWA 5FK8A 1W8TA 2HWC1 1TEIA 2ZS6B 4PI0A 1HXS2 1QH6A 1H0BA 4CRQA 1Z7S2 4Z1VA 3AZZA 3WX5A 4QPIC 4YZ2A 1RUH2 2D5FA 2VE1A 4YVSC 1Q56A 4Y5Z0 1V0AA 2WAAA 1XSRA 2XH6A 1NA1A 3WEZA 2WQ8A 2Q30A 3Q8AA 2PHUA 2VR4A 3RYPA 1UYPA 1FOD2 4Z07A 4IUGA 2D6NA 2J1VA 4NIAA 1K5MA 3URFA 4JGZA 5FZGA 3ZFGA 3LCPA 3PDQA 4XDPA 3QD6A 1YWKA 3RYRA 3GCWA 3G6JB 5GZGA 1W39A 2OVUA 3BTXA 3IIAA 4YFWA 3PU8A 5HV4A 5J36A 1HN1A 1IGOA 1O5UA 4Q27A 4QXCA 5KHJA 2ZZQA 1PVXA 4FPJA 1OPMA 2FDJA 1IS3A 5FOBB 1IKPA 2C5DA 2HYXA 2XBO2 3ZFEB 3N9NA 1VRBA 3VBOC 3VL9A 1K45A 2E9QA 4AL9A 1ZNPA 1LKNA 2QQOA 3VDCA 5BNPA 2BU9A 4AEKA 1JZ3A 2ATFA 3TEYA 1H8TC 1UKRA 2W47A 3AL5A 2EALA 4AGRA 3SKJE 4Y22B 1DZTA 4BQ1A 1PK6A 1JYVA 3ZSKA 3JD71 2RR13 2JKBA 2IC1A 2TUNA 1TE1B 3V0BB 1W90A 5FZBA 4FPYA 3M1HA 4BISA 4R52A 3E5UA 4BB3A 1W6PA 4DS0A 2I45A 1AR83 4NROA 5J09A 3AJYA 3KHBA 5DDJ3 5K7PA 1NYWA 1WW5A 1QJZA 1CX1A 1YI9A 4JGYA 4XW3A 4AHYA 1H1AA 3U07A 3VHNA 4PDWA 4XFGA 2HWB2 3TBDA 3I59B 3MIGA 2ZKNA 3IPVB 1Y9QA 4TXWA 3H50A 4W6XA 4XFFA 1ULFA 5BNOC 3KHCA 1GQPA 2JDAA 3UETA 4JKLA 3JB4C 2R6QA 4XJZA 3DF0A 1ZVFA 3OGVA 4IESA 4FOYA 2YHJA 4LBKA 1AR82 2P1BA 3GCXA 5FCCA 4DFSA 2RS32 3IB3A 1J83A 3J7NA 2WYSA 4UWDA 2IXCA 1RYYA 4XABA 1GU3A 1MVEA 4CDXC 3CJIC 1OD5A 5H9QA 4MGYE 2XJPA 4EV0A 1H4HA 1KEXA 4CP9B 1YRZA 2YB7A 4W65A 1A34A 2DBIA 5FREA 3CQOA 5L9RA 3WY6A 2QQNA 1QHDA 3MICA 1YI7A 3BTAA 3MW2A 2F17A 4WVMB 3Q8CA 4FAHA 1VB2A 4LBJA 3WZ1A 5ABJC 4E8CA 2WFF1 2PLV1 1NE4A 4IE7A 2ILMA 2ERFA 3TAYA 1RUI1 3GBWA 3I2HA 3VD5A 1LU2A 2HWC3 1ZZBA 1JHJA 3RS6A 4D6RA 3IIIA 3OEBA 2VULA 3ETPA 4N53A 3O12A 3PVOA 2GN3A 1K5JA 1S2EA 4LORA 5CU1A 4QKFA 2XONA 3APBA 1QNWA 3KCXA 4FCAA 3KF3A 4AWDA 5JPMB 2QJVA 4UF0A 5GZEA 2X10A 4A7KA 3NW4A 1NA1C 2BGCA 1OQ1A 4D69A 1UYXA 2WS91 4MUVA 1C1LA 1DCSA 1K5MC 1YUDA 4DXRA 3UNPA 4JGZC 1VPHA 2DV9A 3ME2A 4CXYA 3ZFGC 2JG8A 3TEXA 3BPZA 1GFF2 3GZEA 4LBQB 1ZREA 4CPBA 1N1TA 5KHGA 3FBMA 3HWJA 5AFBA 2CL2A 5D2AA 4FPOB 3S5QA 1LOEA 1PIV1 4UBHA 4ZS3A 2NP0A 1VRH1 1KJLA 4COWA 5FP3A 4PJYA 1OA4A 1ALYA 1PVC2 3KGLA 5JR2A 5K8SA 3I4IA 3WP6A 1CZTA 1QWRA 2PHXA 2GAUA 4XBNA 4JHTA 5FZ6A 5BNPC 4OUMA 1SCRA 3AZWA 3DXTA 4GH4A 4NN0A 2DUQA 1CGPA 2ZX4A 3ZVXA 2GMPA 4XQDA 4UW3A 5CNAA 1PK6C 2PMWB 2PHRA 5I8TA 4W6YA 1GV9A 5I0SA 1A3KA 4LBLA 3SEEA 3F2ZA 4IV3B 1IS6A 5L36A 4YVWB 4Q4X1 2VUDA 4BE3A 3ROUA 1NY72 3AP6A 4M0NA 4AVCA 2E32A 1RHI1 2WINB 2VZPA 5DAPA 3I3BA 2I74A 5FPBA 1C4RA 2W94A 3FFQA 4JGYC 1R082 4WM8A 2VCBA 4H55A 5L7OB 3RPQA 1W03A 4AEJA 3J26N 4PDWC 3KVBA 2VG9A 2YYOA 4CEWA 1HB4A 5D1IA 3JD72 1DYPA 4RYDA 4TZDA 4PCRA 5C5UA 1F4HA 4MLOA 3SKVA 1HB2A 4NHKA 1OFSA 2VC9A 5KXEA 2W3JA 4GJZA 1V6JA 3DL3A 2VTXA 3MV11 2DCTA 4TN7A 4PQ9A 1VBD1 4Y1UA 2WIIB 1GOHA 4IV1B 4GKXA 5KWRA 2R041 2R49A 4FFFA 4P9XA 4DIQA 3C3VA 3H0OA 4XAAA 4P9LA 5I8YA 4V2WA 3LKJA 1LHOA 1IPSA 4Q4Y1 4OI4A 2VQUA 5FUIA 1SBEA 4GAZA 3MEPA 3WW2A 2V4AA 2NZ9A 2BTVC 3GBFA 1JYWA 3D3AA 1YJKA 3WLUA 1S0CA 2BUKA 4FSJA 4QKNA 4OQ9A 1OH3A 2LS6A 2WFF3 2YZ4A 1DG6A 3S7IA 3ZDVA 1EPZA 3UV9A 1QGLA 1LR5A 1RUI3 3TEWA 3IDCB 3BIEA 4JKMA 3RQ0A 4E4DX 1UZZA 3CHXA 3WF1A 4LNVA 5D8AA 1LOFA 4Q2FA 3ZXGA 1S55A 1ULOA 2GC2A 1H8VA 3I2FA 4N53C 3IBMA 4FVVA 4LK7A 5FZ8A 3B00A 5C5TA 3KZ4C 3CKHA 4UFJA 1NCQB 3WV6A 1OFNA 2PLV2 1PO21 1UZYA 5KHKA 2WS93 3KB5A 4PIYA 2OQ7A 4UYBA 1RUI2 3WT3A 1IG3A 5FP7A 4OYUA 4C8DA 3H1MA 2BWAA 2HWF2 3HNMA 1UU6A 1AL23 5DUWA 3UGHA 1RJ8A 3RNSA 4MGSA 1QIQA 1RINA 1ZA7A 1R64A 4RD7A 1C5HA 4DPNA 4CUAA 1VJ2A 2FCVA 2GU9A 2JG8C 4M01A 3HEIA 1UN1A 3ITQA 3PIJA 5EXOA 5FPUA 2E7TA 1FATA 2WWSA 5F2SA 4ES9A 3O1UA 1PIV3 5FBJA 3WHUA 1OF3A 1VRH3 1HLCA 3H3LA 1W8HA 1W0NA 3K77A 4RFT0 5F3EA 5A33A 4QB6A 2E63A 2D6OX 3AXEA 1GUIA 4GZ9A 1D7PM 4YM0A 1SDWA 1UCXA 1D4VB 2VW2A 3F95A 2UYAA 1LGCA 1PZ7A 1KQRA 5FFOC 4GH4C 5FXZA 5A7NA 3U75A 3WNXA 3USSA 4B4PA 3E6CC 2WO3A 2YPJA 3RG0A 2ZGLA 3NNGA 4IERA 3KF5A 4Q4X3 4QM9A 5FPXA 4AZZA 3IM0A 1OLRA 3T0DA 4RGGA 1X36A 4HT1T 1RHI3 3B3QE 1VRH2 2ZGSA 4MGQA 5GZFA 3WNKA 1W05A 3OGSA 2ZGRA 3U10A 1WD3A 2GNMA 4EE2A 3POFA 1LGNA 1OQEA 5BPXA 2ZEZA 3AYAA 3NV3A 4OULA 4WM8C 1W2TA 3POEA 1CAUB 2VZOA 4ZXKA 4EZHA 5L19A 4CEWC 5EZWA 1X82A 4IE5A 3B9CA 4CU6A 4O61A 1VBD3 1ZRRA 4Q4X2 2QNKA 2TEPA 2D6PA 2R043 3DPRA 3N3HA 1RHI2 4Y20A 1YCIA 2AACA 4N8MA 3OYWA 2XGXA 3WG2A 1UYYA 1IOAA 2NM1A 4Q4Y3 4IEVA 3AM2A 1JW6A 4NUBA 1PM4A 4ES8A 1OHFA 3K4ZA 3WDWA 4XZUG 2YFZA 3ES1A 3M3OA 3IN9A 3ZMNA 4AI2A 1C5IA 2WO7A 5A7WA 3NRUA 2ZPXA 1LHUA 1UPIA 4PIZA 1RL3A 2W1WA 2P5BA 2C9AA 4DUVA 1RMU3 5KHIA 2WSUA 3T2PA 2WL1A 1FPN3 5GM0A 3TB0A 1DZQA 5BYNA 4EJRA 2J7MA 2DU0A 2XUMA 4G4FA 4HFSA 5FZFA 2QQWA 2VQTA 5B4XA 4LHKA 3QLQA 4NHMA 1IPKA 3KT1A 4Q4Y2 1H9PA 3E5QA 4LOSA 5D8AC 2Y38A 1LOFC 3EMRA 3KCYA 5GLUA 4RSUA 4C1XA 3RYKA 2ZBJA 4ZU4A 3U37A 2RS52 2V73A 3MYXA 3PUSA 4IQPA 1PO23 1VBB1 4QGLA 3PL0A 1Q5OA 2ZOEB 1ULGA 1OKOA 5T5OA 1TNFA 2QQVA 4ITCA 3JQWA 2AZ5A 4CP1A 4XETA 3K3NA 1OQDA 2QQPA 3I8TA 3JU9A 4DMIA 3PLQA 5LY2A 3M3IA 4IETA 4XF0A 4CCEA 3LEIA 4KU7A 4N7UA 4AVBA 1K42A 1AYN1 2G9FA 2FMDA 4EWEA 3AMNA 3BPSA 3HT2A 4N7IA 3I49A 4FAGA 1DGRA 2Y6HA 4IE0A 4NWVA 1KD7A 3ZPOA 2VU9A 5IJRA 2BOJA 4NMIA 1B35A 3O7OA 1MEC1 1LEMA 2AYHA 2MPFA 1U0AA 4L2NA 4MADA 4UI9L 1UX6A 3ZN6A 4XURA 2ZGOA 4A3ZA 4CA9A 5AC91 4RGKA 4ORFA 3TRSB 5C3OA 5C9AB 1NUKA 1UMIA 1PMJX 5A1AA 1RUG1 3AYCA 2EXIA 1JOJA 4CDWA 1WCKA 2VD7A 2VJXA 1WLTA 2ZAHA 1F15A 1H9WA 1MS3A 2Q1ZB 4UFKA 1A6CA 2D6KA 4Q29A 2FMYA 1UD1A 3VKNA 1QDOA 3USUB 4EROA 3HQUA 2W1UA 1LODA 1LECA 4FXKB 4RFRB 2WSVA 2HYKA 4JDNA 2JDZA 1GR3A 1NZIA 1AR72 4AQ2A 2RJKA 5C4WA 5K4LA 3SEPA 2VOWA 2DTWA 5FXVA 3LD8A 1RC6A 4YFZA 4MGTA 4SBVA 5H9PA 3V56A 5F3CA 4KWUA 3MUY1 5FRAA 3O1SA 3W9AA 4V2VA 1W6MB 1UY0A 1FNYA 2JX9A 4XOGA 5GJ6A 4XJ8A 2VMEA 4WZFA 3BVCA 4I0BA 2W52A 1ODNA 4A6OA 4AE2A 1OURA 3WDXA 1PMHX 1CESA 1OOPA 2YGLA 2WJSA 5F5IA 2A3YA 2BEOA 2DUPA 3FUQA 3K4DA 5E16A 3CJXA 3DPRC 2G9GA 2YXSA 3EJKA 1BBT3 2YBSA 4P9IA 3PURA 3WNOA 5BNNA 1SBDA 3O1RA 4FFGA 5HCHA 1C1FA 3O14A 1QXJA 1WGPA 4NPLA 2WNVA 1BEV1 2Y6KA 3DXUA 3CF6E 2ZGNA 3WCSA 4YGDA 4Z92B 1MZFA 2BVVA 2XVKA 5T55A 1MS5A 3N7LA 3GNEA 4CYDA 1YQCA 2D93A 2JXAA 1RXFA 1O8PA 2WLPA 2YG0A 3ZIWA 1ODMA 3TN93 1YIFA 3LDBA 4R4ZA 2XQRA 4J1WA 4I02A 3WP3A 4DRVA 3FFZA 2BWCA 2HBUA 4OQ8A 4XF1A 2ZCWA 2XKOA 3AMHA 5TSWA 3VDDB 4AEDA 1QQP2 2PN5A 3KS7A 4FP2A 2CY6A 4Z82A 2Q8OA 4W6WA 3GZTB 5FZKA 2JB4A 4MXWB 2WNUB 5CKNA 3M8LA 5CADA 1L7LA 1CX4A 1SLLA 5C8WA 2PA7A 1OA3A 4XFCA 4JQTA 3MBWA 4JQRA 1BCXA 3THPA 2OIIA 2X05A 4HANA 4AFAA 2UY9A 3H7YA 2PHFA 2X53S 3NSTA 4KWJA 3ZPYA 1WMDA 2X5IB 3RJ2X 3ZYBA 1X33A 3K48A 1YC61 1E57A 1VBB3 5DAWA 4QU1A 4D8MA 1ZBA1 1A8DA 1UPSA 1V6OA 1CPNA 1HRI1 1NXD1 1VBE1 1W0PA 1Z7S1 2OUJA 3OEAA 1DHKB 4XDQA 1ZRCA 2ORXA 3PHMA 5LK5A 1WCDJ 3N36A 4CCNA 1DQ1A 2WZPP 1NQDA 2YMZA 3AJZA 1MS1A 4CCMA 1EV11 1AYN3 1FOD1 3BCWA 3K51A 1NKGA 4IEWA 5FWJA 3ZFFB 3WF2A 2VZSA 1V6KA 2WR9A 2XR4A 3SITA 3S0MA 4MYEA 1VBB2 5DZEA 3WQ7A 1XOYA 4Q4V2 3T0BA 3POSA 2Q8EA 3OCPA 4AHZA 5DQ0A 3K2OA 1MEC3 5HV0A 3OUJA 3GJAA 5FYUA 4XQ4A 4O65A 2G4IA 3FE5A 3ZSJA 2EIDA 5AC93 5FQ0A 1B35C 5FLJA 4M00A 2B5HA 2J1RA 2Q1FA 3R4SA 3K46A 2Q8DA 3WW3A 3KM5A 3KWVA 2XBO1 1P8JA 3WG4A 3GM8A 4FQ4A 1G6NA 4R4XA 4HSJA 1YQ5A 3H3UA 1AYN2 5FTTC 4AVAA 1GQHA 1RUD1 4JKKA 3AMQA 1LHVA 3FLTA 5FMDA 2NMNA 4CDWC 2B9VA 4AQTA 4QPGA 3VBSB 3FJSA 1DGRN 2J1AA 3GHMA 2DWRA 3BUCA 1RUF2 4C0BA 4JV4A 4XJ9A 5A3OA 5LK7B 1W6OA 2R063 2CNAA 3O1OA 1SFPA 5C4WC 1LOGA 4IL7A 5F39A 2P3IA 1ZA4A 1MZ6A 4BQYA 1RUG2 2ENRA 1JZ4A 3ZXEA 4WM7A 1WD4A 3ON7A 1LESA 3U11A 5IVVA 2DCYA 2W9XA 3ENRA 5I91A 4FXGB 3ZMOA 1UY2A 3D0SA 4FOWA 5FBZA 1XQNA 1W3VA 1WKYA 3PTYA 1KDMA 2NQYA 3LPGA 1OOPC 3E97A 3RFRA 4AHXA 4AOCA 4I01A 2BYVE 2XB6C 3I97A 5IW0A 1XBFA 1CZSA 3IKWA 2ZKLA 5HCFA 3NNJA 5BNNC 1BEV3 2YU2A 1MQTB 1V9U3 3HT1A 4KWKA 4Q1PA 5C33A 5LA1A 3CDZB 4UFLA 2WNVC 3SXWA 4YNIA 1UQXA 2DVAA 1VMHA 3NNMA 4CU9A 4S2GA 3C7FA 2WN3A 4DUXA 3GZUC 5CIRA 5F6LB 3WP5A 1CJPA 3WNPA 4FTEA 2ZAAA 4M3CB 2ET7A 3ACLA 3ILRA 1VIWB 1XE7A 2IVIB 1O6UA 1LHNA 2GMEA 2ZEYA 4AEDC 1YFUA 3B01A 4B3NA 5APAA 2WQ4A 4I0WB 1ENXA 1QXRA 2P17A 5JXJA 3ACHA 3PMSA 5F1RA 2GP5A 1AR92 3N9MA 4CUGA 2YC0A 1QF3A 4YZ4A 4AYUA 5JLVA 1HXS3 5EJZB 3SMHA 3TNPB 2OPKA 3ZR6A 1VBE3 1U5XA 1GICA 1Z7S3 3BN6A 3OPTA 4XMAA 3ZFEA 1Z78A 4CDQB 5IK4A 2P34A 2I2SA 5J1XA 1SLBA 2GMMA 2QVSB 4GD4A 4KI5M 2VOVA 1G9AA 5A32B 2OW4A 3IWZA 3MO4A 4YG0A 5FYZA 1NZCA 5FLIA 4CCOA 3MLKA 3NMBA 4CCCA 3WDUA 1MS8A 1FOD3 1BK0A 5LBCA 2ZX3A 5LRSA 1V00A 1J58A 4FFHA 4CPBD 3V0BA 1ZZCA 2D5HA 5A3UA 3AP7A 4DB5A 1SZBA 5A3LA 4ISQA 1E5IA 4E2QA 2XG3A 1ZBA2 4N43B 3P3NA 1ENRA 3NV2A 1HRI2 1BYHA 1VBE2 4D0QA 4E4ZA 5T5PA 1OF4A 1HQNA 2ZGMA 3S6PA 1QKQA 1YFWA 2JDUA 2Q8CA 4PF5A 5GLVA 5JWPA 1LJ7A 4MSVA 5BY5A 1O3RA 4EWDA 2W46A 2XBO3 2RJLA 4INDA 2RE9A 3I59A 3IPVA 3EHKA 2VBPA 2ZGQA 4V1PA 2NYYA 4HOOA 5EWSA 3VGIA 1EV12 1JYIA 2UWAA 4E8DA 2WO1A 4BA6A 2ZX0A 4QX0A 2H0VA 4Q0VA 1PVC1 3AP9A 3LFIA 3A4UA 4XAEA 5SV8A 3QBQA 4AFDA 3N9LA 1ULCA 3POGA 4KWLA 5LA0A 4XXAA 5DUVA 1O3QA 5EPAA 2A75A 4QPGC 5FXXA 2Z42A 1ACCA 1HX6A 2JDPA 1O59A 4LA2A 2Q1MA 2G19A 5HPOA 3GBGA 2VTFA 3KQ4B 4CP9A 3WQ1A 3U4SA 1KXGA 4IEUA 1NY71 4HVOA 3M3QA 1BJQA 1YQ6A 3RZGA 2W92A 3BODA 1AX0A 1SACA 1RUD2 1O4ZA 4YW4A 4WM7C 1TNRA 2HWB3 2WDBA 1R081 3PMEA 4H7LA 4WVMA 4L99A 5FPLA 3UGGA 1VBA1 5JPNB 1GNHA 4QQ2A 4BOWA 3GALA 5JCTA 1WCSA 3LZZA 5LATA 1FYUA 1URXA 2TBVA 4IEQA 4QXHA 4AGVA 3HMYA 3PJYA 5DAQA 1VALA 1NE6A 2J1EA 4UT5A 3C7OA 3OY8B 1DFQA 2RS33 4K21A 4L8QA 3AFKA 2LM3A 4X6QB 4ZY9A 4BYYA 2EA7A 1IQDC 2VVDA 2FHRA 4IDZA 4AF9A 1S4CA 4I09A 1UY1A 3CL1A 4JVAA 4BMBA 4QAWA 1AX2A 1EY2A 5JZGB 1WW4A 1C3HA 3T08A 2YDEA 4HN1A 3MIDA 1RUE1 5CFCB 4XFHA 2W1QA 5A3PA 4KMQA 3EO6A 4M4PA 1IPJA 2VO5A 3T4HB 3AKRA 2MHFA 3LEKA 1Y3TA 3IZOA 4BQ2A 3AB0A 3PVBB 1VBC1 1LOAA 1JXNA 4CCLA 2RM21 3W59A 4LBQA 2RVAA 4P9JA 4JC1A 1W99A 4KBBA 3SCGA 4AR2A 1DZRA 1HKDA 4BLIA 2LRPA 1XYOA 3M3EA 1UXXX 1YNAA 4DNYA 5FYCA 1QJU1 2D98A 1SFYA 4HVQA 3VBHB 3ZSEA 2PHLA 1RITA 3Q8EA 4NIIA 3ZFEC 1S0BA 4IEZA 1W2NA 4OUEA 4ASKA 2HEYF 4XXPA 5FK7A 4E2GA 2HWE1 3MIHA 1GP4A 5A7QA 4IEXA 4XJWA 4QXKA 1KFXL 5F5AA 5KR7A 1W2AX 2XQXA 2JG9B 2H6BA 2AUYA 4A6SA 1GOFA 2FQPA 2HWF1 2R0FA 3R05A 3VKMA 1ST8A 2CDOA 2R0HA 4IV3A 4PBPA 4YVWA 5FY9A 3PNAA 2OKXA 4OUSA 3ORJA 1CWPA 3AC0A 1AR62 4QXBA 1VLNA 1XC6A 4QT6A 1O3TA 4CCJA 2XLAA 3NAPB 5JDBA 2YV8A 2D3RA 1SMVA 1HV0A 2QQJA 5L7OA 5M0TA 2AEZA 2JIJA 3IDBB 4OMCA 1FV2A 5FP9A 1KDKA 2PYTA 3KD4A 1Y43B 2JDNA 1PVC3 5CBLA 1WCQA 4XDOA 4JDOA 1G86A 3WDTA 1UXZA 4Q4W1 1IHMA 4S2FA 5DN2A 3DYOA 3ZXDA 3T0AA 4IV1A 3ACGA 1LOBA 4UFMA 4DY5A 3NWKA 4IGOA 2D6LX 5G05L 4CVUA 2A6YA 4ONUA 2YC2A 4MHRA 2H0BA 2QTWB 4QQLA 3T3YA 4D7TA 2MEV1 2UURA 2D7FA 5C8CB 4GALA 4AG4A 5FZEA 1R083 3NVCA 1Q8QA 2VUAA 3LFMA 1VBA3 1UZ0A 3POBA 3B94A 1VAVA 2WRAA 5DPNA 3BI3A 5F5CA 3SQOA 3JD73 3MW3A 2UU8A 2WNOA 5JOYA 4CU8A 4HMZA 2BBAA 2E33A 1PNFA 3ILFA 4YW7A 4Y5TA 1XU1A 1CONA 2Z4FA 2Y0IA 1JN2P 1YQ8A 5EJ1B 2BVBA 1V6MA 4GMP1 2ZGKA 2CGNA 4QX8A 4FFIA 5J96B 4URTA 5K0UB 4XBQA 2IZWA 4Y5SA 4P9WA 1VBA2 3ZXAC 3J9SA 3JQXA 3KLSA 1NCQA 1PM7A 4Y26A 3CIHA 1BKZA 3IDAA 1GWLA 4NAMA 3C7EA 3CNAA 3VZNA 3U0ZA 1E5RA 4GKYA 5CG8A 5LBEA 2B7YA 2XVGA 3N9OA 4QX1A 4IXLA 3WQBA 3JB8A 4BK4A 4RR3B 5FO7B 1NLSA 3H42B 4XC9A 2W5FA 4YARA 1REEA 3KGZA 3DKWA 4K8RB 2JKXA 4YPJA 5DABA 4JTOA 5J7MA
chains in the Genus database with same CATH topology
4FPFA 5DG1A 5F9TA 1AL0G 4FPGA 5LRRA 4WVVA 4YSFA 1HRV2 1AYM1 5AFEA 1QJU3 4HKWA 1RUE2 1A78A 3B69A 1B09A 2GH8A 2ZGTA 2DCKA 4YM1A 2FZ1A 2DF7A 2RS51 2CGPA 1REFA 4NWWA 5T5LA 2WZR1 4MGZE 2EAAA 2PLV3 1UMZA 1VBC2 1ZRFA 1PZ8A 4AFCA 1YFYA 3LA2A 2RM22 2CWMA 1X8EA 3D4KA 1TME2 4U36A 2HWF3 2RMU2 1DQ2A 3WR0A 4AI8A 4TWTA 4H7MA 1QJU2 4LO7A 4FPKA 4IV3C 3H7JA 4YVWC 2GNTA 4AI3A 1S0GA 2B46X 2VOKA 3FBYA 4P9YA 3VZMA 3WD5A 3WW1A 2HWE2 1RUJ2 4YZ3A 3RWNA 5LEJA 4QGNA 2Y0OA 4YG6A 2VGDA 5L7OC 3V0AB 1CAUA 1R091 4HL0A 2WA4A 2IXIA 4LTAA 3VKOA 4Q4W3 4EWAA 3JZVA 4Y1VA 3U4XA 1COV2 5FMOL 3AKQA 3OGJA 5I0RA 1N3OA 4IV1C 2PHWA 2QE3A 2MEV3 4O9EA 4B4RA 2CTVA 1VAKA 2GNBA 3AYEA 3MPBA 2ZHLA 3LA7A 1AR71 2ZHKA 5DZGA 3VBFB 1DQ6A 2Y26A 4NOTA 5ACA1 2PFWA 1YHFA 4QM8A 1NQJA 3VZOA 3AZVA 3H1WA 2K0GA 4Q4W2 1QH7A 2W0XA 1J3QA 1D2QA 4K1ZA 1YFXA 1N1VA 2PAKA 4LUKA 4HPKB 4HETA 2K2SA 1XU2A 5KBFA 2MEV2 3ZXJA 5GALA 4AI0A 3MIBA 1XYNA 2D3SA 1J3PA 4HLTA 1VP6A 4JAAA 4PLMA 4CZSA 1DYKA 4K9SA 1ENQA 4BCUA 2IWGB 1BXHA 3WUCA 1NCQC 1WA4A 1JHNA 2GSYA 4N90A 1QNYA 4QQOA 1GSLA 2ET1A 2DFCA 4QMAA 1LENA 2DUOA 2X8KA 1QJY1 4XHBA 4A2UA 2EAKA 1JYCA 1QQP1 2D44A 1VB4A 2GNDA 4HZFA 4N9IA 4YZ5A 2DU1A 4XFIA 1ULEA 3WDYA 2R32A 1F8VA 1Y7BA 1ZRDA 2RS53 1S0DA 4AQSA 4IEOA 2MNGA 2V09A 3IT8A 4RQPB 3NL1A 5C9AA 2XWBB 3Q9OA 1CVNA 3WINE 2XWJB 5F5QA 1CD3G 1QJX2 4I30A 4ZU5A 4QPYA 3D82A 4B7EA 2VW0A 2K9ZA 4LO8A 4E4SA 4YM3A 5CFDB 2ZJCA 3AYDA 1AYM2 1KFUL 1APNA 2W68A 3USUA 4F8AA 4AHWA 5JSPA 3OJBA 5KXDA 1Q8PA 2EXHA 2P3JA 1EPWA 2WZR2 4NO4A 1OLQA 2ZMKA 2GC3A 1M06G 4Q4V1 3D5OA 2B9UA 3M3CA 1YO8A 1W6MA 2X29A 3ZN4A 5L73A 3VN4A 1PNGA 4BIOA 1TMF1 2CWSA 3HIFA 4KGGA 3AP4A 1DGWA 2ZHNA 2YGMA 4UW5A 1OMIA 1R1ZA 4AFMA 2OYZA 4WVZA 4AFBA 3NV4A 3ZYPA 3VBRB 1W2UA 3N7MA 1WMFA 1AR73 3X29B 1R092 1RUF1 3N35A 3AKSA 5BV6A 1SEFA 3E6BA 5FLHA 4C1WA 2FZ2A 2HJIA 2CV6A 3VHPA 1V6NA 3CLPA 4RS5B 1XNCA 5EFUA 3VDDA 1W6NB 2VH9A 3L2HA 1ONAA 4YRDA 1ZZ7A 2WT1A 4M3CE 1OPOA 4MXWA 2WNUA 5HBAA 2VY0A 4DRRA 1GZWB 3ES4A 1C57A 1QOOA 3GF6A 4ZKTB 5ACA2 2X5IA 3FMGA 4BH9A 2D3PA 1CAWA 1W6QB 4XQWA 2E7AA 4E2SA 3H1YA 3AXDA 1NLRA 1SLIA 3FLRA 2VNRA 1XRUA 5KHHA 1RVF1 2JICA 4FP3A 5DZFA 1S1AA 2A73B 3KT7A 3SH4A 4LT5A 2VPVA 1PHMA 1QJY3 4XTMA 2KA3A 3JUUA 1QQP3 3ZFFA 5CA6A 1NCRB 3DGTA 2IFWA 2E51A 1GNZA 3SNMA 2R30A 4X8NA 3H9AA 1CQ9A 4Q1RA 4CTEA 3QACA 4EN8B 2XJSA 4DY3A 4I2OA 4UBGA 4GB32 1AR91 3O0VA 2NMOA 5T5JA 4R9BA 2HWD1 3ZSMA 1ZZ8A 5DUUA 5FPZA 1RUC2 5C9AC 5J37A 5JI7A 4D7YA 1QJY2 2XL7A 3HBZA 4D7SA 4X6RB 1UIJA 4XZPA 4COUA 5JAXA 1TQ5A 5IK5A 2VNOA 3VBSA 3QH6A 5KC6A 2BNNA 2VOXA 2QZ2A 4NR1A 2F4PA 1ND3B 4RGAA 1ZBE1 4AK3A 3G7DA 4RL7A 4Q26A 4HBNA 4YW5A 1ND2B 2UWBA 4DZGA 5T3NA 1YIPA 2GH2A 3VBUB 1DQ4A 4Q4V3 1G9CA 4KNCA 1V6LA 3WDVA 2VW1A 4Q0PA 3S30A 3SISA 1PO11 3D8CA 1TMF3 4J6GA 2VQ0A 2E7QA 4KG0A 3T1MA 2B8MA 4HSLA 3OF1A 1H2NA 2B45X 1AVBA 1GLHA 3MDPA 1RUF3 4R9DA 1MQTA 2GDFA 3B93A 2ZZJA 4LBOA 5J48A 4H3WA 1CAVB 3KT4A 2HEVF 3R6SA 4XMIA 1TMF2 1FMD1 4MV2A 2ARBA 1RUG3 2VVEA 4KH9A 4WBBA 3TWIA 3L2YA 3PJQA 4LHNA 4ZU7A 4M3CA 5JVVA 2XPJA 1OKQA 2GC1A 5HI0A 2WT0A 2ZGPA 3VDDC 1S2KA 3NO8A 4N9HA 5EYXA 3SCFA 5H9SA 3THTA 4R9CA 4GA9A 2WNUC 2DVBA 4J1XA 2P2KA 2QUOA 4LE4A 1X7NA 3H3ZA 1WW6A 2X5IC 2XL9A 3EBRA 4CDQA 3WVJA 2PELA 1EAH1 3NV1A 3RMXA 2ES3A 2NLRA 2B39A 2VVFA 2JENA 5A32A 2VNGA 4YM2A 3IDEA 1I6XA 4TYSA 3BOPA 2GZWA 5E1RA 4LBQD 1HDKA 1DIWA 1LB2A 2IXKA 1G8WA 1SCSA 4MZUA 3ZFFC 4AI1A 3M4FA 2D6MA 4N43A 2IXHA 4H14A 4BMEA 3MI8A 3VUOA 2A3XA 1AR93 2VXRA 1LCLA 4GMP0 4I3PA 2KM2A 2AR6A 1RVF2 1O91A 4K40A 2DTYA 4DQAA 2A6XA 2O8OA 2ZX1A 4P5HA 1XE8A 2BPA2 2DFBA 4NHLA 1NXMA 2PTMA 2RR11 3HD8B 4XIKA 4OHZA 3UJQA 3N4MA 1HIXA 5T54A 3WG1A 1O3TA 3B9IA 4QPIB 1ZBE3 2XJUA 4D94A 5CG9A 1MZ5A 4YVSB 5I93A 3VBSC 5EYYA 2WQZC 5DDJ1 1LRHA 5CB7A 4TLFA 1LEDA 1V70A 1ZBA3 2HWD2 4LULA 1HRI3 1PGW1 1AR61 4KG8A 4OHXA 1PO13 3RJRA 1I9RA 1O4TA 2ZTNA 2F6BA 4Y4YA 1I3HA 4GIQA 1QXPA 3B02A 3ZSLA 4DOUA 1EV13 4LO6B 4XPVA 4Y22A 1ZBE2 3OD4A 1G7YA 3LSEA 4OVEA 4ASMB 5EV7A 1QOTA 4QX5A 3VBOB 4CEYA 3OY8A 1SLAA 4MVTA 1MZEA 4DINB 2QZ3A 4C90A 4O9GA 1MQTC 2R071 3SHRA 1PO12 2XKPA 3AKPA 1H8TB 4OI2A 2A70A 1KITA 3QOPA 2DCZA 4Q8KA 5JZGA 3VZKA 2A6WA 2CAVA 3BOWA 3PVNA 5CFCA 3VZLA 1RUD3 1R1A1 1Z0HA 4OZXA 1UW8A 4LHLA 4PLNA 3VZJA 1GZ9A 2GALA 4JRAA 1AXYA 1D4M1 2D40A 3ZYRA 4FT8A 1FMD2 4WZCA 4Y24A 1HQLA 4CDUA 1WUVA 5BNOB 1EAH3 2DVGA 3L9JT 4K7JA 3ALQA 2PHTA 3MLJA 2Z5WA 5AVPA 3VBHA 1DGWX 4CDQC 1WLCA 4FPCA 1FX5A 2P3KA 1GYKA 1PZ9A 1UU4A 3RI9A 2ZABA 4L92A 4FBFA 4Y1YA 3D6EA 4CDXB 3CJIB 2JG9A 3UKTA 5FO8B 2XHKA 1DQ0A 1EYBA 1ASJ1 1EAH2 4N43C 4A3XA 1H2LA 5ABJB 4K1YA 3GYDA 1JTZX 3NAPA 1D2SA 1HRV1 1V6IA 4IEYA 1CAXB 1VAMA 3ASIA 3V65A 2OZ6A 4Q0UA 2A7AA 1QMJA 3ZN5A 4MX3A 1S0EA 2NN8A 5JOWA 3ELNA 4R9AA 1PGSA 1S0FA 4BLJA 2LUWA 1ZZ9A 2DVDA 1AHSA 1TME1 4OI1A 2VMHA 1NA1B 1UU5A 2RMU1 4YLZA 3RDIA 5KC5A 2HEWF 1AR63 1IQAA 1CJDA 3FWEA 4NVPA 3WG3A 5C8CA 2XJQA 1QDCA 4QGMA 2GC0A 3DV8A 1K5MB 1T6GC 2EXJA 4JGZB 2RR12 2JECA 4LBMA 2JE7A 1I5ZA 2XLGA 4YW3A 1C8M1 3ZFGB 5FOJB 1RUJ1 4I3GA 5DDJ2 1BMV1 4XHXA 2EIGA 2RS11 5KXCA 4EN7B 2FBEA 2A6ZA 1PGW2 5GLWA 1ULDA 2E53A 2R073 3ILNA 4CEYC 1COV1 4GULA 1PGL1 5BNPB 1LHWA 3AX4A 4YYOA 1CR7A 5K0UA 1Q43A 2ZHMA 1FAYA 2ZA9A 4F7ZA 3NJZA 1KRIA 1PK6B 1R1A3 5JZGC 2CYFA 1YLLA 1XNDA 4YGCA 4BPZA 4K3UA 5CFCC 5HXVA 4Q8LA 2ARXA 4RR3A 1W6PB 1GANA 2XJVA 4SLIA 4LO4B 1D4M3 3NKGA 2R072 4JGYB 1DDLA 1W0OA 3SLIA 4PDWB 2BFUL 5I0UA 3MPPG 3AZYA 4CDUC 4P14A 1R1A2 4FPHA 3SCHA 1MR5A 1WW7A 3AZXA 3VBHC 4XEZA 2HWC2 3AMPA 3KMHA 1AL21 4K6BA 4PBOA 3N7JA 1D4M2 2WLQA 3INAA 4Y1XA 2JD4A 5HCBA 3WUDA 3V64A 2JG9C 4L97A 2VUJA 1ASJ3 1BQPA 3DUIA 2BNMA 4MGKE 3E5XA 1FI2A 1ZZ6A 4PLOA 2Z69A 3VV1A 1HRV3 1UAIA 3MIEA 1U5ZA 2IXJA 1WBLA 4XFAA 1RUE3 3NAPC 5JOZA 3V0AA 3KQRA 1FXZA 5DXDA 4KQ7A 4BZ4A 1QOSA 5A3MA 2WFPA 1VBC3 4XF4A 3QCWA 4N53B 1HW5A 1ASJ2 1X50A 2RM23 1TME3 1REDA 1WMEA 5BUVA 1QJX1 2Q0AA 3PVEA 1ZYBA 1RIRA 1U5YA 2RMU3 3FC0A 4FPEA 4EN9B 4C91A 2Z79A 1QY4A 3CEWA 5B2GB 1AXZA 1DGLA 1MS0A 4UW6A 3GHNA 1O4YA 1S0IA 3MF6A 3VBFA 3N7KA 4QD2A 3UK9A 2QFEA 4HKOA 1C8M3 5C8CC 3GZAA 5C6CA 2HWE3 1RUJ3 2D97A 1UIKA 1H2MA 2SLIA 1ZX5A 5DUXA 1XNKA 3JBG1 3NKTA 1L3JA 2JG8B 2PQQA 1C28A 4LUMA 2RS13 2E6VA 1KJRA 4XJUA 4OHYA 4BWOA 1DLLA 1POV0 2IXLA 3ZYGA 3HN1A 4HPKA 1H30A 3EQEA 1Q3EA 4CP0A 3AKTA 1COV3 1H1IA 1D0GA 5IK7A 4B4QA 2DYCA 3P3PA 1CPMA 4Q0QA 4F83A 3I2DA 1C8M2 2EF6A 4XF9A 4YG3A 3WCRA 2Q5TA 5K0UC 3ZIXA 4GH4B 4X8PA 1RMU1 1BMV2 5H9RA 2RS12 2XJTA 5CVRA 1FPN1 3RSJA 3ZYIB 5E8AA 2VMGA 1AX1A 3FHIB 4RR3C 3RZZA 3RRDA 4HK8A 1HQWA 2JE9A 2JJ6A 1PGL2 1N1YA 5F6KA 4JDMA 2W39A 5GLTA 2V5YA 4R8HA 4WM8B 4Z2WA 4L9BA 4KGQA 5GKAC 2WFF2 4CEWB 1RJ7A 1U5IA 2PHDA 2DURA 3BU7A 2BBVA 5BXXA 1XNBA 5GZCA 1AF9A 4LE3A 1EP0A 3FX3A 4RQPA 4JTNA 4QU2A 4NPRA 3CO2A 4OHVA 2KXLA 3BIWE 3C2UA 2DCJA 3SH5A 4BHPA 4K20A 4QQPA 1JBCA 4HK9A 4HVRA 5CFDA 2JEMA 3ZXKA 3LB9A 3M70A 4EN0A 4RA0A 5JMCA 2D43A 4GMP3 3LGRA 5SV5A 3HAGA 5E89A 2WS92 4MH0E 2VMIA 2WT2A 4FOQA 4M3CF 2UWCA 1AL22 2H6CA 1UL9A 2A3WA 1IS5A 4RHV1 4XE9A 3TOJA 5J3UA 1RUOA 2R1DA 3MLLA 3W58A 4GB31 4E27A 3E6DA 3AK0A 3I54A 1F2NA 4LEJA 4GXLA 4COYA 5D8AB 5T52A 3R0RA 1PIV2 3OTFA 2CGOA 2IFRA 4B7KA 1RUC1 4BIFA 4BM8A 1QJX3 5FDBA 1LULA 4AGGA 3ZDSA 4XYXA 2GN7A 1AYM3 3LAGA 4XJAA 4ASLA 3VBRA 1FV3A 4AVSA 4QQHA 1VR3A 3KCCA 1N3QA 3D0JA 4G3YC 3ZXLA 2WZR3 3VBFC 3JBG3 3FZ3A 1PMIA 1F5JA 2QKDA 4RS5A 4XFBA 1UF2C 4META 1W6NA 1AXKA 3O5SA 4XTPA 5LEKA 4XF3A 4WVWA 1BBT1 3VL8A 1RUNA 1GZWA 2BFUS 1N3PA 1XYPA 2YUEA 4FOVA 2OZJA 4Z8BA 1SLCA 2O0OA 5A33B 2VECA 3JBG2 1MS9A 1R093 2RHPA 5KXBA 1VBD2 1W6QA 3TN91 2C0ZA 1G9DA 4YW2A 4MXVA 1F9KA 2R042 3OD0A 2A5ZA 5J98B 2ZGUA 1IZ3A 4XBLA 4D3WA 4ATEA 4I0AA 5GLZA 1ZM1A 1DF0A 3WP4A 2CAUA 1NCRA 3FLPA 4S2DA 3ZXFA 1N47A 1AJOA 3MW4A 1RMU2 5ACA3 1OA2A 1BVP1 1H4GA 3J8F1 3R4UA 5GZDA 1FPN2 1BK1A 4KL1A 3WW4A 3ST7A 4F3JA 4WV8A 2Z2SB 4RQPC 1KS5A 3VHRA 2OA2A 3DPRB 4Y20B 4CP2A 5JR7B 1I1EA 4L11A 4OI0A 3OYWB 3A0KA 3RMYA 3M2MA 3WXPA 4ISRA 4UXAA 4AVTA 5CFDC 1PO22 1ND3A 2SBAA 4HN0A 1D0HA 1ND2A 2C1FA 3OBTA 1DU3D 3VBUA 4RHV3 1C8NA 5FO9B 4P9GA 2NPIA 4JRLA 3ETQA 4GB33 1X8MA 4Y1ZA 2ZMNA 2LTNA 4COZA 5T50A 4LLOA 3CU7A 3B5LB 2QDNA 2A6VA 3VHOA 5JOXA 1RUC3 3LOIA 2AH2A 3A0NA 2R1BA 4COVA 1F5FA 1WLDA 3TNQA 2R061 5E88A 3J4UH 4LBNA 5JIUA 4RHV2 2WKKA 3VBRC 3OPZA 3DN7A 1GZCA 1CAVA 3VLBB 1Q8SA 3OBRA 1YJLA 1SLTA 4FTBA 1A8MA 1G9BA 2A71A 3POWA 5K9YA 4Q0SA 5IT6A 1GKBA 1GBGA 4A7ZA 2BW8A 5I0TA 1G9FA 4AXOA 2TNFA 4RS5C 1JH5A 4PIXA 5FMOS 1POV1 4M0HA 3SH3A 1RB8G 2XLFA 1J3RA 1YYNA 4AVVA 1WLWA 1V9U1 2OUHA 3EXUA 1B35B 2AENA 1CN1A 1Q8VA 1Q8OA 3JCIA 3ZN6B 2YROA 2WA3A 3TYJA 1H2KA 3MFCA 1LOCA 1LU1A 1OSGA 4K8FA 1GQGA 4YGBA 1JUHA 5BNQA 4CDWB 1MS4A 2QDRA 3OGGA 4AEMA 1H1MA 4S2HA 4EN6B 2O8QA 1O5LA 1BBT2 3UL2A 1J1LA 5C4WB 4YW1A 1BVVA 5JIAA 1N1SA 1SBFA 1NCRC 2XVLA 3LWCA 1U12A 1CAWB 1HXS1 3TN92 1NG0A 2DVFA 3M7AA 2I07B 3J8F3 1RUH1 2LALA 4YGEA 3VKFC 3WOGA 1F31A 1QU0A 1ENSA 2BQPA 3QH7A 1O7FA 3O0XA 2EVXA 1XXNA 1OI6A 1OOPB 4B29A 1S0JA 2R16A 5I8SA 4MGIE 3POYA 2VQAA 5AVAA 1MVQA 1S2BA 5JI9A 5BNNB 2Q4SA 1SQ4A 1JUIA 2ZX2A 3MGUA 4LLFA 3O0WA 4QPIA 1LTEA 2WNVB 1UKGA 4YVSA 3BB6A 3HQXA 3HR9A 3J8F2 1HV1A 1ND3C 2WC2A 2P37A 4YZ1A 2B42B 3AFGA 3ZO0B 1ND2C 4OHWA 1RGSA 1BZWA 1NOVA 3ATGA 5JSOA 2ZMLA 3VBUC 4LO5B 3B7MA 1LGBA 4FQZA 4LR4A 1RVF3 4AEDB 2W08A 2ETEA 4FTSA 5FAXA 1DQ5A 1IS4A 3LA3A 1MEC2 1AUYA 5CAZA 4IEPA 5AC92 4UW4A 4JCKA 3VBOA 1O3SA 2XJRA 4ATFA 2O1QA 1AZDA 5HCAA 3H8UA 5DG2A 1H8TA 2HWD3 3MF9A 4OFGA 5EJ3A 3S7EA 1J59A 4B8EA 2HWB1 4AW7A 3WHTA 2AREA 3ECQA 1RTVA 4GWMA 3BALA 3ZX7A 3T2TA 4AQ6A 3LOBA 1POV3 3RI8A 2R062 4LA3A 2BNOA 3WQ0A 4HKLA 1AR81 4GQ7A 2RS31 4XILA 5JSRA 2PAMA 4C0HA 4DXZA 5FQ0B 1J1TA 2N7GA 5BNOA 1AJKA 3I7DA 4E9KA 2PAEA 1IKQA 2HKXA 2ZACA 4FPLA 4GWNA 4U2AA 3MIFA 4A7YA 3KSCA 4QHBA 4QPGB 4TSVA 3T1LA 1BEV2 1CIWA 1V9U2 4CDXA 3CJIA 4KU8A 2QCSB 1KS4A 1W6OB 3IMNA 4OLLA 3ZYJB 1M4WA 5IUQA 4G9SB 4XIOA 3UKNA 2YY1A 2UYBA 3UJOA 1RUH3 4WM7B 3VKLA 3MZHA 1FNZA 1FMD3 5ABJA 4FO9A 3AMMA 3MFAA 1CAXA 1SFNA 3AP5A 2AGSA 3R4DB 3UKVA 2UY8A 2EXKA 2WNEA 1WBFA 3LSDA 1FT9A 3FUOA 1MACA 1DBNA 1YXWA 2ZS6B 2HWC1 1TEIA 1HXS2 1QH6A 1H0BA 4CRQA 1Z7S2 4Z1VA