3BB6A

Crystal structure of the p64488 protein from e.coli (strain k12). northeast structural genomics consortium target er596
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
109
structure length
109
Chain Sequence
b'MLQIPQNYIHTRSTPFWNKQTAPAGIFERHLDKGTRPGVYPRLSVMHGAVKYLGYADEHSAEPDQVILIEAGQFAVFPPEKWHNIEAMTDDTYFNIDFFVAPEVLMEGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein yeaR
publication title X-Ray structure of the P64488 from E.coli (strain K12).
rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 18
structure length 109
sequence length 109
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09313 DUF1971 Domain of unknown function (DUF1971)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3bb6A00
5C6CA 1UW8A 2BEOA 3LWCA 2ET1A 3IDCB 3SHRA 3U0ZA 4QM9A 3KMHA 2O1QA 2MHFA 4YNIA 4KWLA 1RUNA 2QCSB 2F4PA 5E16A 2D5FA 1V70A 4NVPA 5FPZA 1QXRA 4BH9A 4LLOA 3PVBB 4IETA 2B8MA 2D40A 3PNAA 4HN1A 4XEZA 1YFWA 3TNPB 3NL1A 1DZRA 1PMIA 2CAVA 1I5ZA 3JZVA 3OCPA 4HVOA 4EWDA 4I2OA 1O5LA 4Q0PA 2GAUA 3RYKA 4WVZA 3DL3A 5E1RA 2IXIA 4I0BA 2UY9A 4PIYA 2QVSB 3MZHA 2Y0OA 2XLAA 1IPKA 1QY4A 2Q1ZB 3EO6A 1OMIA 3H7JA 4KWKA 4XFIA 1CAWB 2XKPA 2PAKA 5KBFA 3S0MA 4JV4A 2BNMA 2ETEA 5T3NA 4MGZE 3M70A 1ZVFA 3DV8A 1J59A 3NW4A 3TNQA 3I54A 3RDIA 3HT1A 1UIJA 1FT9A 4L2NA 1WGPA 4WBBA 4QX5A 3E6BA 2H0VA 2HJIA 2XHKA 1YFUA 4XETA 3NVCA 1J3PA 1VR3A 5LEKA 4E2GA 4FAHA 1EYBA 4Z07A 2IXJA 4MZUA 5I91A 2BYVE 1X8EA 2D5HA 4R8HA 1OI6A 4IEVA 1EPZA 1LKNA 1Y9QA 3UKTA 4IEYA 1XE8A 3CO2A 1LRHA 3FX3A 2Q30A 4XF9A 3WW4A 1RGSA 4XF0A 5I0RA 4F7ZA 2B5HA 4Q0QA 3KGLA 3O14A 4EWEA 2VPVA 3GYDA 1VP6A 2OA2A 3FFQA 4UBGA 4IEOA 1QXJA 2GC1A 4IEUA 5J7MA 4Q29A 3CF6E 4LTAA 2PTMA 4META 2UYBA 5JSPA 1L3JA 1J58A 4I3PA 4KWJA 2XL9A 4ZU5A 2ZCWA 2H6CA 4JVAA 4IEQA 4R52A 4XFGA 5BXXA 3BB6A 1Q43A 4QM8A 2E9QA 5I8YA 4BHPA 3H3ZA 4J1WA 3C3VA 2IC1A 1WLTA 4MX3A 5CVRA 3IBMA 3ELNA 3E6DA 3H1WA 4H7LA 1JUHA 4HSJA 5F1RA 2XGXA 3NKTA 5KHIA 1O3TA 5KHHA 2PA7A 2UY8A 4LA3A 1UPIA 4XFHA 1EY2A 3WW3A 2MNGA 4O9GA 4N9HA 4LUKA 5JSOA 3E6CC 1CGPA 2V09A 4I01A 4MGKE 4AVAA 1I6XA 1Q5OA 4QGLA 3OGJA 5LRRA 4XF3A 3QOPA 4YARA 1Y3TA 1YHFA 1ZREA 1YUDA 4JTNA 4AQ2A 1O5UA 1EP0A 4E2SA 5K8SA 4BIFA 4OLLA 3FJSA 4YRDA 3WW2A 1CAUA 3NJZA 1CX4A 3MPBA 3I7DA 4KL1A 3KCCA 5LEJA 2ATFA 4IEWA 3HIFA 4ZU4A 1WA4A 5KHKA 3D0SA 1XE7A 1Q3EA 4HZFA 4HSLA 4I0AA 2Q0AA 1UD1A 4F8AA 5KHGA 2CAUA 3R6SA 2GH2A 4LA2A 4X6RB 3B02A 5I0TA 2P17A 1RL3A 3FZ3A 1NE4A 3U11A 2I45A 4IEXA 2GC0A 1O3QA 3LA2A 5LRSA 5FCCA 4EROA 2XLGA 1O4TA 3H3UA 1X82A 4YSFA 1OFNA 4L11A 1O3SA 4FAGA 4YYOA 1O7FA 3RYRA 2FMYA 3E5UA 1GQGA 3CLPA 2GC2A 4MUVA 4ZU7A 5BUVA 1ZX5A 3L2HA 2EAAA 3U10A 4RD7A 5BV6A 1TQ5A 2MPFA 3DN7A 1CAUB 1U12A 3ST7A 2HKXA 2PHLA 2CGPA 5FQ0A 1YLLA 1X7NA 1HW5A 3M3IA 4XFAA 3BALA 5FLJA 1DGRA 4OFGA 4XFFA 5C8WA 2GC3A 4AQ6A 3HT2A 1VJ2A 4XFBA 1RUOA 4MV2A 3IWZA 1FI2A 4D7TA 3E5XA 4PJYA 4HLTA 3EHKA 4WZCA 3LZZA 3I59A 1X8MA 4AXOA 4XF1A 1G6NA 1H1IA 2K0GA 5D1IA 4HMZA 4E2QA 4HN0A 1DZTA 2XKOA 3H50A 5HI0A 4TLFA 3NSTA 1UIKA 1CAXA 3QACA 3RNSA 2BNOA 4ONUA 5J48A 2KXLA 4AVBA 2QDRA 3FWEA 2N7GA 4FT8A 2EVXA 1ZZ6A 3E5QA 5AVPA 4GULA 4A2UA 4X6QB 3GBFA 3LA7A 5FQ0B 1SQ4A 4I09A 4XFCA 5I8SA 3EJKA 4ORFA 1J1LA 1YFXA 5CU1A 2UYAA 5FDBA 3IDBB 4IERA 2PHDA 3OD0A 3FE5A 3USSA 1PM7A 1RC6A 3RZZA 4I02A 2XL7A 2IXHA 2O8QA 4KU8A 3I59B 4LEJA 1OD5A 3D0JA 4O9EA 1LB2A 1ZZ9A 3SXWA 2CV6A 3LA3A 4QGNA 3SCHA 4LULA 3N4MA 4KU7A 3LAGA 1ZZCA 4FBFA 3DKWA 1ZZ7A 2QJVA 3RPQA 1CAXB 2PAMA 4HBNA 1NE6A 2PQQA 3CEWA 2GZWA 4J1XA 2BNNA 3KSCA 4BYYA 3PLQA 3KGZA 2OPKA 3E97A 4PIZA 4AVCA 3SCGA 3MDPA 4CYDA 5I93A 2DCTA 2K9ZA 1YWKA 4IEZA 3UKNA 3BCWA 5JR7B 2EA7A 2Z69A 5FPXA 1NXMA 5I0UA 1RTVA 5EFUA 2VECA 3UKVA 3IIAA 3ES4A 1J3QA 1CAVA 2FQPA 2GU9A 4K8FA 4Q0UA 3ROUA 2B9UA 3CL1A 1FXZA 2BGCA 2Z2SB 2IXCA 4B29A 2PFWA 3BPZA 2D93A 1DGWA 3H7YA 2ZKLA 3EQEA 3MYXA 5CADA 1ZZ8A 2XLFA 4Q0VA 4QMAA 1YFYA 4MH0E 3H8UA 1O3RA 3ETQA 4IEPA 3ACLA 1ZNPA 2QNKA 3BU7A 2OZJA 4UXAA 5JAXA 5BY5A 5I8TA 3D82A 4D7SA 2Q4SA 3SCFA 1GQHA 3OF1A 2IXKA 3OTFA 4P9GA 3CJXA 4IESA 3RYPA 4PIXA 4JTOA 4N9IA 1ZRCA 3G7DA 4EWAA 3ZDSA 5FLIA 1NZCA 4HVQA 2C0ZA 3ES1A 5JSRA 1IPJA 4QXKA 1UCXA 3H1YA 1CAVB 4LUMA 3SMHA 4UBHA 3H9AA 4Z82A 3S7EA 2OZ6A 2PYTA 1ZRRA 2PAEA 3S7IA 5EZWA 1NYWA 3H1MA 3VHRA 1J3RA 4DINB 5I0SA 2IXLA 2H6BA 5J3UA 4MGIE 3EBRA 3HQXA 4QGMA 5FLHA 1QWRA 2ET7A 1SEFA 4XF4A 3WW1A 4Q0SA 2OYZA 1SFNA 1LR5A 4EV0A 1XRUA 3FHIB 2WFPA 3LOIA 4HVRA 1H1MA 1ZRDA 2VQAA 5KHJA 4MGYE 1CAWA 1ZZBA 2WC2A 5JCTA 5BPXA 1ZRFA
chains in the Genus database with same CATH superfamily
3ZXEA 2RV9A 1TE1B 1WW5A 2J1VA 1UW8A 3IM0A 1OOPC 1ULGA 5FZBA 5GZDA 3OG2A 2JWPA 3WF3A 2C6SA 3I3BA 4N43B 3RFRA 4KH9A 4QM9A 3WNKA 1BBT1 2WWJA 1DQ0A 4RFRB 2O1QA 2MHFA 4A4AA 3AKSA 3O1SA 1RUNA 4R9AA 2F4PA 2GNBA 1W9TA 2WS92 2XWJB 5E16A 2BBVA 5DDJ1 5HCFA 4COUA 2A3WA 3PJQA 4Y5SA 1APNA 1HRV3 4UW5A 3Q9OA 2WO3A 3RZKA 3A0KA 4A6SA 2Y0IA 1O6UA 3I2KA 3WNPA 1D4M2 4LKSA 2ARXA 4LLOA 4D69A 4EZHA 2B8MA 3N9OA 5FMCA 4QB2A 1W2OA 4CU8A 3JZVA 4HVOA 4UW3A 1LOBA 4UW6A 1JZ2A 1DFQA 1PVC1 4LBMA 4ATFA 1GP6A 3LE0A 2P34A 1BVP1 4NR1A 3RYKA 4BDVB 4DXRA 5A3UA 3DL3A 1JYVA 2IXIA 5LBFA 5C8CC 3SEPA 4M4RA 3SH5A 2XPJA 3MI8A 3MW4A 1IHMA 4CP9B 4YM3A 2QVSB 2ADEA 3MPPG 2Y0OA 3AYEA 2XLAA 3DF0A 1IPKA 1WCDJ 2Q1ZB 2WNUB 1W2UA 4GWMA 3VZKA 5LA9A 1QJY3 2JDYA 4RYDA 5EV7A 4XFIA 2VOXA 4BCUA 5FXZA 2XKPA 2Q1FA 2DCJA 4BZ4A 1AUYA 4QXBA 1HRV1 3ZN6A 1OVSA 1H6XA 1NLRA 3M8LA 4EN7B 5GM0A 5T3NA 1ACCA 2VMGA 1FV3A 4L8QA 4MGZE 3O1RA 5FYTA 1DLCA 3ZMOA 3RG0A 3BPSA 1LOFA 1Q8VA 3RDIA 3ZXGA 3N9NA 5C9AC 1W2NA 2VW2A 2O0OA 3VHNA 5C3QA 3E6BA 1H2KA 3H0OA 2H0VA 5GZGA 3W59A 1RUG3 2R0FA 4DRVA 1I3HA 1K5MC 2XHKA 1EUUA 3C7GA 3PU3A 4E8CA 5JOYA 4NPLA 3C2UA 1YFUA 5TSWA 1SBEA 2QQIA 4NHLA 3Q8BA 5A33B 1J3PA 2GMMA 5B4NA 2P3KA 5E89A 4COWA 5C4WB 1W8TA 2J22A 1R64A 1QJY1 3CHXA 2TEPA 1NCRA 1OC1A 3DEMA 2IXJA 5FZOA 3H42B 1HJGA 3KVBA 1OI6A 4JKLA 2A7AA 4IEVA 1EPZA 4OHWA 4A3ZA 2VY0A 1EUTA 4PBOA 1U0AA 2O14A 5JIAA 5BNNB 1LRHA 1LAJA 1Y43B 4LXLA 3D8CA 3AJYA 2Y6JA 5FPLA 3UGGA 2YU2A 4OI1A 3T2TA 4XF0A 3ILFA 2YMZA 3WW4A 1A34A 1WA6X 5JWPA 4Q4Y2 5KC5A 3PUIA 2PHFA 1HKDA 3I97A 1UYZA 2FCUA 1V0AA 3I3DA 4NRQA 4P9IA 4FSJA 1XQNA 2KA3A 2IWGB 2WNOA 2WQ4A 5JI7A 2P3YA 1EV13 1UPSA 5FKBA 1VBE2 1MZEA 2OA2A 2ZGQA 5CFCC 3FFQA 5T5OA 4UBGA 3T2QA 4FFIA 5GLVA 5IAXA 2BU9A 2JB4A 4IW3A 4Q29A 4LTAA 2PTMA 2VZRA 3VKOA 2FDKA 2WWUA 4A7KA 1H2LA 3JB4C 1MS0A 1PMJX 5D8AB 4D8MA 3RZHA 5FYIA 5F5AA 3NNFA 4IE7A 1VB2A 3V0AA 4FFHA 5FY1A 5DXDA 1Q8OA 1F5FA 3A23A 3VL9A 4IUGA 2E32A 5BXXA 4BLIA 1Q43A 4QM8A 3OSDA 1EAH3 4BQ5A 3BKZA 1MZ6A 5I8YA 2PXJA 2B39A 2XJSA 3H3LA 3H3ZA 3POYA 4JDMA 3WDXA 3EXUA 4MX3A 4ARYA 2ZX1A 4ASLA 3PIGA 2GP5A 2Z42A 5LBCA 2VZPA 4QU1A 3ELNA 4HKLA 3VBHC 3AKPA 1AJKA 1YRZA 2Y8KA 3B5LB 3JU9A 4BXSV 4FPLA 4QD2A 2WA3A 1NY71 3E6DA 3IAPA 4HSJA 1SPPA 5CIRA 2AREA 3WX5A 5F1RA 3NKTA 5A6YA 1WLWA 2C4XA 4AI0A 2YBPA 4YGBA 1XB9A 5FZ9A 4XFHA 1EY2A 3WW3A 5LBEA 3AVSA 2OQ7A 1FNYA 2MNGA 2ZX2A 4N43C 2WN3A 1E5IA 1A8DA 2XQXA 3K77A 2V09A 3NAPB 4FTEA 1JU3A 5ERLA 2B4KA 4QGLA 4V2WA 5FP4A 4YZ5A 3OGJA 1L7RA 2Y64A 3OUJA 1CESA 5ACA2 1UL9A 5JDBA 4CXXA 2FD8A 2J1EA 3I2HA 1S0GA 2HWE3 4Y24A 3ZX7A 1DYPA 1RHI2 4AQ2A 1O5UA 4MXWB 1EAH1 4W4ZA 1UXXX 5KXEA 1BHGA 4TTGA 3TB0A 3WW2A 4A41A 4RR3A 4YVWB 3WF2A 4NHMA 2J1TA 2RDNA 3JD72 3DPRB 1C1FA 3KCCA 4RS5B 4ZKTB 1GP5A 3PVNA 3I49A 4AEMA 4IEWA 1V9U3 3M2MA 1OF4A 3TOJA 5KHKA 1YIFA 3ZSEA 1LOEA 4BQYA 2B9VA 5F37A 5T5JA 4QX2A 1MVQA 3RWKX 1PGW1 3RI9A 3ZFFB 1Q3EA 1S2KA 4NMIA 4HZFA 3MV11 2WZR3 3FLPA 4C0HA 1NOVA 4P9JA 4CEYB 3RJ2X 2CAUA 2RR13 3R6SA 4XDQA 2GH2A 3K3NA 3OGSA 1SLLA 1WCUA 2XXZA 4JDNA 1RL3A 1AR93 2HWE1 3VBUA 1JH5A 4XHBA 5FP9A 1W0NA 1MR5A 1CJPA 1JUIA 2GC0A 3OGGA 4Z8BA 3HOBA 4JCKA 4EROA 1O4TA 1OFNA 4WV8A 2ZBJA 4YG6A 1PNGA 4JGZC 1GP4A 1RUE3 4Q8KA 5DUWA 3HNBM 1V9U1 1VAMA 2R043 5JXIA 1OKQA 2FMYA 2Y33A 1W6OB 3WCSA 1NAEA 3WDWA 4NAMA 2VMHA 1VRH3 2CGOA 1AXYA 2HWC3 3CLPA 2GC2A 1AHSA 3N7LA 5F3GA 5BNPA 4D7YA 1WW4A 1WCSA 5H9QA 5BUVA 4UFJA 5FK8A 4PHZA 5FREA 2WZR1 2EAAA 3PU8A 5C4WC 3VBSB 2GP3A 2D6OX 2A3XA 1IGOA 1TQ5A 4UW4A 2ZMKA 2BZDA 2RR11 3ST7A 2PHLA 2R32A 4YGCA 3RS6A 1N1YA 1AR91 1W6PB 2WYFA 1HW5A 3M3IA 4HONA 2RE9A 3FHQA 2L9LA 1W6NB 1AL22 4YZ3A 1W6QB 4EN9B 4XFBA 1RUE1 3SNMA 1SMVA 3IAQA 3LEKA 5JXGA 4D7TA 2AENA 2RJKA 3AZVA 1JBCA 4AAPA 4WZCA 2Q8EA 4DXTA 1NCQB 1Z0HA 3B9IA 1BBT2 2FDIA 4QQLA 4C1WA 3OGVA 5JIUA 1OA3A 3WQ1A 1H1IA 1RUI3 4XPVA 4HMZA 5DDJ2 1QEXA 1V6IA 4XZPA 2AUYA 3H50A 1UYYA 3V0BA 3KV5A 4YW1A 3J9SA 3R05A 4IDZA 1BYHA 2J1AA 1M4WA 4XDPA 4YPJA 3QACA 2VVDA 5CA6A 2UWCA 2HEYF 1LJ7A 3GBGA 3QH7A 2DUQA 3GXUA 3RNSA 4AZZA 2HWD3 1O4ZA 4XW3A 5D8AC 2DVFA 4P9XA 1PVC2 3QLQA 2N7GA 1XNDA 2LRPA 4XE9A 5JMOA 4DZGA 4G4FA 3IKWA 5KXCA 4LMFA 1QOSA 2EXIA 1QU0A 2WYSA 2YU1A 3KV9A 5EIYB 5ABJB 5LCWL 3WG4A 3N9LA 4P9YA 2WSUA 2VJXA 2F17A 4CDWB 1QKQA 1SFPA 5JOWA 5FOJB 3U1XA 1IOAA 2A6YA 3LDRA 4IERA 4IXLA 5EP9A 5T5LA 3OD0A 2OXBA 3FE5A 3MV01 1N1VA 1W04A 2ZGNA 4AI1A 4DXZA 2FCVA 4QKDA 3RRDA 2Z4FA 4OQ8A 1XC6A 4GQ7A 2RJLA 5FZ3A 4GXLA 5L73A 2XL7A 3D6EA 1LENA 2P1BA 2DWRA 4KU8A 2DURA 2EXHA 3I8TA 1XPWA 1AYM1 3AMHA 3D0JA 5BNOA 1LB2A 3LCPA 1DBNA 3ITQA 1T2XA 2VXJA 3SXWA 3OY8B 3U4XA 3M3EA 3O0VA 4BQ3A 4HK8A 4LULA 3WHUA 4FP2A 4KU7A 2VZQA 2VMFA 1PK6A 4GAZA 4JHTA 3DKWA 4QDRA 2QJVA 3W20A 2A71A 4ZHNA 2JDMA 1BCXA 4HPKA 3UJOA 2BTVC 2OVUA 1V6OA 1JOPA 3DPRC 2PELA 2VCBA 3WF0A 4RS5C 1QJY2 4AI9A 2R1BA 3KSCA 3ZXJA 3O1MA 3ZN5A 2VL4A 2WFF2 5FBZA 2LS6A 3NKGA 1YYNA 1H30A 1D4M3 1V6JA 5LB6A 5CFDA 1K42A 4E9KA 1DGWX 3NV4A 3U14A 5FV3A 2Y34A 5FPUA 3U75A 3OJBA 3BTXA 3LIHA 1LHNA 4CYDA 1W8FA 2DCTA 3BTZA 1H1AA 2TUNA 3POGA 4CEYC 2ZEWA 3NNGA 3UKNA 1ULEA 4YW5A 3BCWA 5JR7B 2Z69A 2CDPA 2LTNA 1KS4A 3GJBA 4S2DA 1XYOA 4HXCA 2VECA 2OKXA 4D94A 3IIAA 3VZNA 4AGVA 1J3QA 2FQPA 1UY2A 1W06A 4M00A 4PDWA 2B9UA 4Q0UA 1UMZA 1I5PA 5CISA 1P8JA 5CB7A 4A44A 2WNVC 3MIDA 2NMNA 2C5DA 1CONA 3VBRB 4P02B 4QDSA 5K4LA 1NA1C 2IXCA 1IQAA 3GZUC 5M0TA 2ES3A 3BPZA 1DGWA 2CY6A 3WG3A 4B7EA 4DFSA 5FY9A 1HB1A 5FYHA 5HXMA 5L9VA 2VMCA 3KZ4C 2ZKLA 2Y6FA 4MGTA 5FZKA 2XONA 5FZ7A 1ZZ8A 4AI8A 2XLFA 4B4QA 5F9TA 1AXZA 5JUVA 1JOBA 1R081 3NV2A 1JTZX 2C9KA 2P3IA 3ETQA 1PVXA 4IEPA 4UF0B 4XCBA 1UZYA 1ZNPA 2QNKA 4IGQA 1W03A 1UN1A 5JAXA 5BY5A 1Q8PA 3D82A 5IWFA 3PIJA 3VKNA 4CCMA 1GQHA 4RA0A 1HQLA 1LU1A 3WXPA 1JZ8A 1QQP3 1NY72 2BVBA 1UY4A 5H9RA 1OLMA 4JGYB 2DU1A 4CE8A 2ZTNA 4LO8A 2OS2A 4RGAA 3TRSB 4ZZ8A 2IZWA 4L92A 3IPVA 3M7AA 2FDJA 2V5YA 4FXGB 2ADDA 4B4RA 2J7MA 3OBRA 4B8EA 3KV4A 1ULOA 3ATGA 4QT6A 1DIWA 3ETPA 2I74A 1IPJA 4QXKA 3ZN4A 1HLCA 2E33A 5FYYA 3I2GA 3H1YA 5A1FA 1OA2A 1UY0A 3TEWA 1HV0A 1OSGA 3H9AA 1UY3A 3AP4A 4FOYA 3A4UA 2VC9A 2PYTA 1EAH2 4M01A 3LGRA 5A7SA 4YVSB 2F4LA 4L97A 1TZOA 1W9FA 4YZ4A 5EZWA 3H1MA 3O1PA 3VHRA 3M3CA 1J3RA 4Q4X3 5C3RA 3VDBA 2W87A 4MVTA 2BFUL 3VBOB 2H6BA 1QQP1 4MGIE 3EBRA 3HQXA 3WP6A 4ATEA 1AYN3 3ZKUA 4CU9A 3AZYA 1SEFA 3K4DA 1PGW2 3O5SA 4XF4A 3OEBA 1KEXA 4DUXA 4Q0SA 5FY0A 4CDXA 5JZGB 2EIDA 1IKPA 5L36A 1G9DA 1L7LA 1VMHA 4LNVA 3RZGA 3FHIB 3LOIA 5FXVA 4OMDA 5FUNA 5FFOC 1NQJA 4CDWC 3R0RA 4CCDA 5KHJA 4MGYE 5A3WA 2VNRA 1C4RA 1KDKA 2WC2A 4GB33 4AEDA 1JZ7A 4QPGC 2HWE2 5BPXA 5JCTA 1XNKA 3WLUA 4Y26A 1IPSA 3J8F1 4XJ9A 2JDZA 2JECA 4CUBA 1LESA 5C6CA 1FMD3 3I4IA 1NQDA 1G9FA 1OLRA 2G19A 3MIFA 3MW2A 3AFGA 1FPN3 4GH4B 5DAVA 3IDCB 2W1UA 4FPOB 1JYIA 3SHRA 2LUWA 4RQPA 4Q4X1 4L0PA 1K45A 1DQ1A 1GYKA 1V9U2 1UKGA 2YB7A 3KHCA 4YNIA 1H0BA 4IE0A 4KWLA 3F95A 1AYN1 5DMYA 2FCTA 1AX0A 5D2AA 1WBLA 4FFGA 4I30A 2CU5A 1I9RA 2VW0A 3WF4A 4XVHA 5DAXA 1QXRA 1RMU2 2C1FA 2XBO1 3WNLA 2QQWA 1MACA 2WZR2 1JZ5A 5C33A 1RINA 3PVBB 2I2SA 5C71A 4CUCA 4C1XA 2FMDA 3OCPA 1PMIA 2CAVA 1I5ZA 3VB9A 2JENA 4BMEA 4K8RB 2G9ZA 1B35B 4KGGA 4GB31 4XOGA 1E57A 1AR92 4CEWC 1RHI3 4Q0PA 3H8OA 5E1RA 1CZTA 1FMD1 1GWLA 1VMFA 4LQRA 4PIYA 1FPN1 3KT1A 4R9CA 4Z2AA 1VRBA 3WNOA 3MZHA 4TN7A 1DZQA 1RUE2 1VB4A 5FTTC 3ZIXA 1DGRN 3T0AA 1VE0A 1BLZA 2YXSA 4CU7A 1QIQA 3FLTA 4WM8B 4FP3A 4BQ2A 3BI3A 2FDHA 1CAWB 1N1SA 2KM2A 3J7MA 1DQ4A 4IGOA 2PAKA 2ZGTA 1KD7A 2J1SA 2ENRA 3AYDA 2BNMA 2ZHNA 1UNBA 2ZEYA 3PUQA 4WVVA 2PHWA 5BYNA 1DQ5A 4AL9A 3EB7A 4YW3A 1ZM1A 2G1MA 3C7HA 3M70A 1BVVA 1ZVFA 3NV3A 5AVAA 3UNPA 2E6VA 4HETA 4XTPA 3JUUA 4JHZA 4XUNA 5DG2A 2XJRA 3HT1A 1J1TA 2GH8A 4L9BA 4V1PA 5GLUA 3HBZA 2AACA 4GMP3 4L2NA 4B1MA 4B7KA 1BXHA 5IT6A 4QQOA 4A6OA 5A3LA 2HBUA 2WZEA 2WZ8A 4CCOA 4D6RA 1GZTA 1OH3A 2A3YA 4Y22B 3GGLA 4RGGA 2PN5A 1BZWA 3B01A 5K7PA 1FNZA 4XETA 1WMFA 2CWMA 1Q8SA 5A32A 1YJKA 3KF5A 5CEHA 1UOBA 1DQ6A 1QOTA 2QQMA 2UWAA 2W95A 1H4HA 4Z07A 2BYVE 4LHLA 1LGCA 3OPTA 3P3NA 1U5IA 1LKNA 1Y9QA 2A73B 3NWKA 3ZDVA 4J25A 1PGL1 1KRIA 1XE8A 2PMWB 2Q30A 3GBWA 4XF9A 4OHYA 1RGSA 5KXDA 2YV8A 1S0DA 5I0RA 4C91A 1GNHA 4I3GA 4F7ZA 2MEV1 1JYNA 4CXYA 1HB4A 3NJVA 2IVJA 4AHZA 3DYMA 1AYM2 1XNCA 2WDBA 1PO23 2D3PA 2RDRA 3O14A 4EN8B 3A7QA 5CYYA 3ZN6B 1Q8QA 4M3CA 4XXPA 2WR9A 3O0XA 4GWIA 5T54A 1W2TA 4AFBA 2O8OA 3MIHA 5LA1A 1T6GC 1BBT3 2DVDA 4DY3A 1OXCA 3PHMA 5IJRA 3WNXA 4XBLA 2UYBA 2WT2A 5JSPA 2JXAA 1J58A 4HT1T 1J84A 4I3PA 5DDJ3 4CP2A 3BOWA 1YJLA 2Y6KA 3MUZ1 4KWJA 1JN2P 2GDFA 4LO5B 4H7MA 2YGLA 5GLWA 4OI0A 4IV1A 4L99A 4NO4A 5IVVA 4IEQA 4R52A 1RJ8A 4IE4A 1CWPA 3BB6A 4OUSA 4FOWA 2E9QA 4BHPA 4AQSA 2DCZA 1NCRB 5FYUA 4D6SA 1SHWB 5FZOB 5CVRA 3LIGA 4LLFA 1PO21 3AZZA 1AR73 3KT7A 2V72A 4DB5A 2VVFA 2C24A 5KWRA 4XCAA 3W9AA 1HJFA 5FO8B 2OIIA 2Q8DA 3H1WA 4H7LA 1JUHA 4AVTA 4GH4C 1Y7BA 4DO0A 3AMNA 2XGXA 4GD4A 4URAA 5KHIA 2JG8C 4LA3A 2UY8A 4C8DA 5A3PA 4QWNA 1ONAA 1SLAA 1TVGA 1YQ8A 2D3RA 2X09A 2NN8A 4P5HA 3NJXA 4O9GA 3UGHA 4E4DX 5DABA 4UFIA 5FIXA 3ZPYA 1NLSA 3AP5A 4MGKE 4AVAA 4CPBA 2VUJA 3E1F1 3HVDA 4QX1A 2DBIA 1DP0A 5LRRA 3P3PA 4XBNA 5A1LA 1G9CA 2QQUA 1OVPA 2QQKA 3Q8FA 1YUDA 1H4GA 3URFA 4XDOA 1LNSA 4OLLA 2AZ5A 3FJSA 4S2FA 2W47A 2BOJA 3T0DA 2EAKA 3NJZA 3VZOA 4UWDA 3MPBA 1AR71 5FZ0A 1B35C 1FOD3 1R082 2ZGUA 2CGNA 1LU2A 2VZTA 3DGTA 1XYNA 3I7DA 4FXKB 4KL1A 3ZFEA 2UU8A 1PMHX 2EALA 5LA2A 3WP3A 3WUDA 4E8DA 1R1A3 1WA4A 2W3JA 4XIKA 3VZLA 1JW6A 2D98A 3V0AB 3RWNA 3ZR5A 3N7KA 4MYEA 2WINB 4PQQA 4CCLA 4BQ4A 4W6YA 2D6PA 1WMDA 5GLZA 1V6MA 3AP6A 1ULCA 2VH9A 4RFT0 4R9DA 3ORJA 4FOVA 2W0XA 3RJRA 4F8AA 3VLBB 1XJAA 2WFF3 2E31A 5IAVA 4WM8C 4H2AA 1W3XA 5F5IA 4LT5A 5FZFA 4DS0A 4LA2A 4JKKA 4X6RB 2VO5A 2NZ9A 1NE4A 1RVF3 3FC0A 3U11A 4IEXA 4KQ7A 1CR7A 1V6KA 2ZHLA 1GZWA 4NHYA 1SG3A 3GZTB 5F7UA 1D2QA 5F6KA 3O1OA 2QDNA 3IIIA 1FOD1 1O7FA 1REDA 3HNMA 3TEYA 1QMJA 2B45X 1R1A1 5FR3A 3UETA 2JKXA 2Y6GA 4K21A 2BPA2 2CTVA 2CWSA 3BYWA 1F9KA 1QQP2 4MO3M 3VD3A 1IG0A 2DVGA 4KNCA 1LGNA 2XR4A 2WFF1 1KGYA 1UOFA 2MPFA 5DAPA 2RG4A 4RR3B 4WVWA 2HKXA 2KR2A 2CGPA 2DFCA 4MLOA 5FQ0A 3L2YA 5FZDA 3AC0A 4OCTA 1RVF1 4XFAA 4JDOA 1NT0A 4E4SA 4QAWA 2I07B 1DGRA 1BK1A 1HDKA 4OFGA 2VE1A 2RDQA 3J8F2 4AQ6A 2YY1A 4ARXA 3HT2A 3VBHA 2B7YA 2DV9A 5DUVA 2VR4A 5IK8A 1FI2A 4GJYA 4QXCA 4FO9A 3LDBA 3ZYHA 3QD6A 4Q4X2 4DEQA 4AHWA 3I3MA 3ACFA 1X8MA 3VKFC 1A78A 4AXOA 3VBUB 1G6NA 2R7EB 1AYN2 1COV3 2ZS6B 3IN9A 2VUCA 1UYXA 4M0HA 1S2BA 4N43A 3UESA 4HANA 2JD4A 1XXNA 5HI0A 4TLFA 2KD7A 1GSLA 2Y38A 2XBO2 1LTEA 4FQZA 1LOFC 4OZOA 5LW9A 3ZM8A 2W46A 2YUEA 3VDCA 5A3NA 1IG3A 2KXLA 2W92A 5FMOS 4GB32 4DUVA 2WQ8A 2QDRA 5BNPB 3T1LA 4KI5M 2VNGA 4P9LA 1JYWA 2VM9A 1FMD2 1ZZ6A 1H9PA 2P4EA 4GJZA 4INDA 2XVLA 4YM2A 1FPN2 1O4YA 5FMDA 4FQ4A 4LO6B 4C90A 5GALA 1AR61 1ND2C 2AC1A 3AYAA 1NCRC 4TSVA 2BOIA 1DGLA 5F32A 1SQ4A 1GKBA 5I8SA 5IK7A 1COV1 1X9TA 4ISRA 1US3A 1J1LA 1YFXA 4AOCA 2UYAA 1S0FA 2VMIA 3CJIB 3IMMA 5FDBA 1R093 1ZBE3 3PVEA 1WZXA 1JXNA 1SLIA 3ECQA 3DKQA 2P37A 2NP0A 3VD7A 1N3QA 2W2IA 3GCXA 2VGDA 2VNVA 1PM7A 4PT6A 3HPNA 2WNEA 1ULFA 4GKXA 1TNRA 4FPJA 4AI2A 2X29A 1AVBA 1H6YA 5T5PA 4ZS3A 1W8WA 1MEC3 2IXHA 4XXAA 5G05L 1SLTA 4LEJA 4B3NA 5HPOA 4K1YA 5H9PA 1ZZ9A 3B3QE 1PIV3 1BEV1 2CV6A 3DYOA 4JGZA 4P9WA 3KQRA 3LA3A 3C8XA 4QGNA 3WDTA 3BTYA 3N4MA 3V0BB 3GZEA 4XACA 1ZZ7A 2P6HA 3RPQA 2VOWA 2CL2A 1SLCA 3ILRA 4OHVA 4QPIA 3WD5A 4LE3A 5LY1A 2AYHA 2PQQA 3OUHA 4P14A 2E7TA 5K0UA 3PUHA 1ZBA1 2WUHA 2BNNA 1R091 1XU2A 1ZBE1 3AMPA 2D3SA 4BYYA 3KGZA 1RMU3 3E97A 4K40A 1HXS3 2WNUC 1PGL2 4QHZA 1VBD3 4NRPA 3N9PA 4AVCA 3O0WA 3SCGA 5IFTA 5EJ3A 2XJUA 2ZGOA 5I93A 2K9ZA 2VQ0A 3R4DB 1MEC1 2ZXQA 1QF3A 1YWKA 2MEV2 3M3OA 5F3EA 2R16A 2R063 4K7JA 5IK4A 1PIV1 2EA7A 1KFUL 2NYYA 1QJU1 4M0NA 5JXJA 1ASJ3 3VZMA 3JCIA 1OQDA 4CDUB 2RS51 2HEWF 3ES4A 4BIOA 4COYA 5AFBA 2GU9A 4E27A 3K2OA 3SISA 3ROUA 3CMGA 2W08A 5FP7A 1IKQA 3J7LA 1U5YA 2Z2SB 1MS3A 1RMU1 5BNOB 2D93A 3B00A 1D7PM 1NXD1 2WO1A 4Y5Z0 1HXS1 3CIHA 3Q8AA 4B4PA 5FWJA 4Z2WA 3AJZA 1VBD1 1WW7A 5FP8A 3MYXA 3OBAA 5C5UA 4IQPA 4Q8LA 3JQWA 5CADA 1XBFA 1PK6B 3UYJA 1PNFA 3HWJA 3U4SA 3UK9A 4YFZA 2VCCA 4NE9A 1VBA1 4HPKB 4QMAA 4BK5A 3H8UA 3GM8A 2R061 3N7MA 2VW1A 5HCBA 4W6WA 5JI9A 5BNNC 3BU7A 4HG6B 2EIBA 2DFBA 1POV0 4XQWA 1ASJ1 1PO22 1F4AA 1KFXL 3WCRA 5LZ6A 2Q4SA 4D6QA 4IL7A 2JG9A 3OF1A 2LM3A 5CFDB 4JKMA 1W9SA 3AXDA 4IESA 1ZA7A 2SBAA 3RYPA 2QZ3A 3PURA 4JTOA 4LHNA 3TBDA 5IVJA 1ZRCA 3WUCA 4OHXA 5JR2A 3S57A 2PHRA 1G8WA 4IV3B 2QQVA 3BTAA 4OUEA 2Q8CA 2A6WA 5A70A 2PLV1 2ZGPA 2DVAA 1NZCA 5GLTA 1I1EA 2XDVA 1E5HA 4UT5A 3ES1A 3TNQA 3VBUC 3MLJA 4YW4A 1QGLA 2ZABA 1Z7S3 5C7GA 1LHWA 4LUMA 4M4PA 2BWCA 2ZHMA 5LK5A 4DQAA 3ZXLA 3MIEA 2OZ6A 4PDWB 2QKDA 3ME2A 1LHUA 2WL1A 1H8TA 1ZRRA 3MIBA 3CZJA 4BK4A 3TYJA 4O61A 2RS13 5E88A 1AYM3 4Y1XA 2B42B 1RXGA 4LO4B 1NYWA 3H8XA 2CHHA 1AR72 4ZS2A 3M1HA 4Y3OA 5BNPC 5DUUA 2IXLA 2P3JA 5FPVA 5FO7B 4AHYA 4QGMA 5J3UA 5FLHA 1RB8G 3Q8CA 2ET7A 2A6XA 5LASA 4DEVA 2FZ1A 1UQXA 4PI0A 5L7OA 4Q4V3 2NLRA 1GOFA 4IE5A 5DZGA 4EV0A 1BMV1 2ZA9A 3ACIA 1NZIA 3WNMA 1JYXA 4RN5A 1POQA 2VBPA 1JZ3A 2VQAA 2OT7A 1HIXA 2QFEA 2HWF1 1N3OA 1UY1A 1Z7S1 2Z79A 3CJIC 3FUQA 4QQHA 4CCCA 1XE0A 3ZXDA 2YG0A 2F6BA 1KDMA 1HN1A 2ZZQA 1LEDA 3NAPC 2AEZA 4LO7A 3ZR6A 4MOAA 2BEOA 1W8OA 4XHXA 2RS11 4EN6B 4AR2A 3IPVB 4Z92B 1ENXA 1FOD2 3K48A 5FMOL 2XHNA 4YGDA 5FYCA 3U0ZA 3B69A 3OYWA 3PVOA 4LBQA 1XOYA 1SBDA 1V6LA 1R1A2 2IFRA 4AK3A 3GZAA 4UFHA 4GALA 5A3MA 3MICA 2WNVA 2D5FA 4YVWC 4OZXA 1IQDC 1V70A 3ZMNA 4M3CF 1VMJA 4IE6A 4NVPA 1NA1A 2C9AA 2JE7A 5DAWA 4Q4V1 3W5MA 4CUAA 4BH9A 4EJRA 2WT1A 4Q5OA 4S2GA 2EXJA 3PNAA 2D40A 4F3JA 3HBKA 3ZXKA 1YFWA 3TNPB 2W39A 3NL1A 3WZ1A 1W28A 4BU2A 4UFLA 3ZFFC 4I2OA 1O8PA 1AZDA 4ZPIA 2VBDA 5DN2A 1O5LA 1RVF2 4WZFA 2GAUA 1GNZA 1S0BA 2OQ6A 5FYVA 2WZPP 5FZ4A 2UY9A 3LKJA 5FAXA 4MG2A 2EIGA 2WJSA 4W8JA 5DQ0A 5IVEA 4KMQA 4CDXB 1R083 2ZZJA 2WO2A 4FOQA 1QY4A 1W6NA 1A8MA 3EO6A 5FYMA 1YIPA 4EN0A 3ON7A 3IT8A 1OUXA 4KWKA 4ZONA 4NPMA 1SCSA 5L9RA 4AEDB 5KBFA 3U37A 2GSYA 1H2NA 3S0MA 4CDUC 4AFAA 4Y4RA 4ZY9A 4F83A 2VBBA 1PO11 5CKNA 4WM7A 4LITA 1WLCA 5CKMA 5DG1A 4ISQA 2PHUA 2YBSA 3I54A 1UO9A 3NW4A 1SACA 1UU5A 2CDOA 4XBQA 5F6LB 4U36A 5BNOC 4LPLA 3AKTA 1WGPA 2GNTA 3VDDA 3VBSC 3SH4A 5A6QA 1QJX3 1RITA 3HJRA 4K3UA 4UFMA 2V4VA 3KHBA 3U78A 4W50A 2BQPA 3KQ4B 2HWB3 3KB5A 4QKFA 3VD5A 4OULA 3LPFA 3NVCA 3T4VA 1HRI1 1GWMA 2RMU3 3T3YA 4AGGA 4LBLA 3K46A 1AR62 1UXZA 1OKOA 4FAHA 4DY5A 2D6LX 2DUOA 2VUAA 4MZUA 1GU3A 2WKKA 3D5OA 5FY8A 3VGIA 1H8VA 1X8EA 3FN9A 4LK6A 4R8HA 1COV2 4CVUA 4HK9A 1CZVA 4CU6A 3UKTA 3LD8A 1AX2A 2D7FA 2ZMLA 4IEYA 3CO2A 2W91A 4N7UA 4FPYA 3WP5A 1MS5A 2VG9A 3FX3A 2W94A 1NCQC 2JKBA 4CP0A 5EHDA 3K3OA 1OUSA 4E4ZA 3POJA 1ZRIA 1DLLA 4N53A 4Y5TA 2VQUA 4IV3C 1FX5A 1X36A 2D43A 4QPGA 2YC2A 4LIUA 3WDYA 1QDOA 3AB0A 2X5IA 2B5HA 2ZKNA 4A45A 1QJX1 3J8F3 3Q8EA 4ZXKA 1Z78A 2YBKA 3KGLA 4NAOA 2HWB1 5FY7A 5SV5A 1BEV2 3LSDA 1RUJ1 1TEIA 2RMU1 1XSRA 3PJYA 2W68A 1CX1A 4IEOA 4GZ9A 4G3YC 1QXPA 2RM23 1DG6A 3ZPOA 4K1ZA 1RUF1 3WSOA 1SDWA 1OD3A 3DECA 4XAEA 5FY4A 2UWBA 2G4IA 3CF6E 4PI2A 2SLIA 5A7WA 1QJFA 1ZBA2 3ZFGA 2ZAAA 1R092 1ZBE2 5A7OA 5GZEA 5I0DA 3HR9A 4JX0A 1SFYA 1N47A 2Q5TA 1C5HA 2XBO3 2ZCWA 2ZGLA 2H6CA 2ZGKA 4K6BA 2QBXA 4CXWA 5LWBA 3KV6A 4U2AA 4A7ZA 2IFWA 4EZ4A 1Y4WA 4CEWA 4XFGA 3ACGA 4Y1YA 2VULA 5A32B 3VL8A 1FATA 1QH6A 2RHPA 2D6NA 1MEC2 2IC1A 4OUMA 1GV9A 1PGSA 5SV8A 2VAUA 1WBFA 1PIV2 5FWEA 1ND3A 1QJU2 1W9YA 1OH4A 1UU6A 4YG0A 2RM21 3I2IA 2RS52 4YW2A 2R6QA 3LFIA 3WDVA 1UPIA 3NMBA 4O65A 3UL2A 2E63A 4N9HA 1KJRA 1F8VA 2QE3A 4LUKA 5IVCA 1W0PA 3E6CC 1CGPA 3ASIA 4I01A 1D0GA 3ZYIB 1Q5OA 1Y9GA 4PLMA 3EYPA 4WVMA 3POIA 1AXKA 3RVHA 4QQ2A 1GFF2 1HXS2 3LOBA 2J1RA 3J7HA 3QOPA 4YARA 4YZ1A 3RZJA 1Y3TA 1VBD2 2AEYA 3GALA 2BV4A 4M3CB 3ZLIA 4DUWA 1STMA 3JBG1 2B46X 4BLJA 2FHRA 4E2SA 5K8SA 4BIFA 3N3HA 1C8M1 4MGQA 2YC0A 2DTYA 4YRDA 2QQPA 1VBA2 3GHNA 1WD3A 1CAUA 1RUH3 4MHUA 2IVIB 2VZ3A 4Y1VA 3T08A 4AG4A 4OI2A 5IK5A 2R062 3MEPA 4NRMA 1GLHA 1HQNA 3AM2A 3ZYFA 3P1IA 5LEJA 4NIGA 3PDQA 3HD8B 5FXWA 1ASJ2 1N1TA 3HIFA 4ZU4A 2ZHKA 3RZMA 3D0SA 4CDQA 4E4HA 5JMCA 4LIVA 2VZUA 1OPMA 2R0HA 1DU3D 1XE7A 4IV1B 4CDXC 2ZACA 5IVBA 3N36A 3AKRA 4HSLA 4I0AA 4EYUA 2Q0AA 5FZEA 1UD1A 3PTRB 3USUA 1CPNA 2PLV2 3WF1A 2BP6A 2ZAHA 4AEDC 3OGRA 5I0TA 2VTXA 1ENQA 4AVSA 2I45A 5FYZA 2ORZA 3VBRC 3N9MA 5JPMB 5CG9A 4KG8A 4UYBA 1LODA 5LRSA 1CVNA 1XNAA 5FCCA 2MEV3 1K5JA 3H3UA 3PUAA 4NIIA 4ASKA 4BQ1A 1RUH1 4CPBD 3INAA 2XUEA 4FAGA 1O3SA 4YYOA 2XJPA 3S5AA 1GICA 3RYRA 4CCEA 3K75B 1US2A 1RYYA 2LW8A 5FY5A 4W65A 2E51A 2Y26A 3LPGA 2Q1MA 4RSUA 3E5UA 5ABJA 1MQTA 1ODMA 2VTXJ 1VBC3 3SKJE 2RS31 1LCLA 1GQGA 4MUVA 4ZU7A 3KVAA 5CBLA 1ZX5A 1TMF1 2A6VA 3JB8A 4P00B 4QPYA 3W5NA 4RD7A 1F15A 3ZYPA 5J36A 3WINE 1G86A 5FZ6A 3SEEA 3T30A 2WQZC 1BMV2 1X33A 2JICA 3ZFEB 3THCA 1YLLA 4JGYC 1X7NA 4NHXA 1JODA 5A80A 1SBFA 4PF1A 1RUD3 3VBFA 4Y20A 2HWF2 1Z7S2 1HN0A 2X8KA 2HBTA 3WV6A 4MGSA 1LGBA 4BISA 1UWWA 4XFFA 4AQTA 3OPZA 1UKRA 4AEJA 4AFMA 2XB6C 4G9SB 2GMEA 1RXFA 2DDUA 4YZ2A 2RS12 4I0WB 1OOPA 3T2OA 4AYUA 2ZX3A 4Y1UA 4HLTA 1VBC1 1DQ2A 4BXFA 3EHKA 4XJ8A 3WY6A 1OQ1A 2GNDA 2JG8A 2JE9A 2ZX4A 3I59A 1QJEA 4NROA 4OMCA 4Q4W1 4XF1A 4DIQA 2K0GA 4E2QA 4QX8A 1E5RA 4YVSC 1J83A 1YQ5A 2XJVA 3ZYGA 1DDLA 4PCRA 4XC9A 4CSWA 5HXVA 3IDEA 2VZSA 2XKOA 3DXUA 3FL7A 3IZOA 1GOHA 2ID4A 4KGQA 2XWBB 5EJ1B 3SKVA 4Q4V2 2TNFA 1ULPA 3ZSJA 1UIKA 3VBOC 1CAXA 2YFZA 4AI3A 5J09A 2YDEA 3WOGA 1RUD1 5FPAA 4QU2A 4ONUA 5J48A 5JZGC 3WHTA 3HMYA 1YCIA 4AVBA 5A6ZA 2YZ4A 3KCXA 2XH6A 4QX7A 1ULDA 2EVXA 3UT0A 5B2GB 5C8CA 1IS6A 4XABA 5FJHA 3VZJA 4LHSA 4X6QB 1OFSA 3FFZA 1QOOA 1QDCA 4PF5A 3G6JB 4N90A 4ASMB 3LA7A 1PHMA 5FQ0B 3SLIA 1C5IA 4I09A 1JOJA 2CSGA 2A5ZA 3CDZB 1YO8A 2ZPXA 5FBJA 5FRAA 3EJKA 3BUCA 4ORFA 5CU1A 5HV0A 3CZUA 3IDBB 1UX6A 1OLQA 3SH3A 1PX4A 2QQOA 5A7NA 1CIWA 2JIJA 5F39A 2WWSA 3APBA 2VOVA 3VBHB 3KT4A 3USSA 4AWDA 1PO12 2VD7A 5IVYA 4XZUG 1RC6A 3I3QA 4I02A 3HQRA 5DPNA 2CNAA 2W9XA 1OBNA 1MS9A 3SC7X 1MS1A 2XVKA 3BVCA 4BJ0A 1HB3A 2H0BA 5C9AA 4OHZA 1RJ7A 2FBEA 3DUIA 1IS3A 4AE2A 2LROA 4SBVA 3OEAA 3SCHA 1UU4A 4GMP0 1K5MA 4K20A 1KXGA 3ZSMA 3LAGA 1ZZCA 3C7EA 3GJAA 1CN1A 4AGRA 5HBAA 3KCYA 1HRI2 3NO8A 3T4HB 5J37A 4JRAA 3UJQA 2PAMA 3LQCA 1NE6A 4HBNA 4Y22A 4COZA 4FPKA 1LOAA 5A3TA 5JLVA 4J1XA 4JZRA 4RL7A 3T0BA 2YGMA 3PLQA 4YGEA 4BWOA 1UOJA 2RJ2A 1O59A 2E53A 4IV1C 5IW0A 1WKYA 2Z5WA 3GHMA 5FZGA 4AAXA 1TG7A 3POEA 3U07A 3MDPA 2YHJA 5FO9B 4A3XA 2DYCA 2GN7A 2XJQA 4AVVA 4IEZA 1ODNA 4NIHA 1SPPB 1PZ9A 4Q27A 1QJX2 5I0UA 4D0QA 3CNAA 4CRQA 5CAZA 1X50A 4BA6A 2HWB2 1OQEA 4LKEA 4UFKA 1CAVA 1RUJ2 2RMU2 1DHKB 5CFCA 5IVFA 1W2AX 3R4UA 1R1ZA 3WNNA 2BBAA 3VHOA 3ZSKA 4AHXA 1RUF2 4ZZ5A 3LFMA 4FI9A 4BB3A 2WAOA 1XNBA 2BGCA 1V00A 2PFWA 3AL5A 4XUQA 2TBVA 1S2EA 1W39A 3WQ0A 2XJTA 4JGZB 3EQEA 1REEA 2Q8OA 2R073 4UOJA 3MIGA 1YQCA 3J4UH 2VCMA 3OBTA 3FUOA 3NRUA 2FZ2A 4HFSA 4QPIB 1MPXA 1Y9MA 4MH0E 1CPMA 3ZFEC 5K0UB 4QB6A 1O8SA 1AJOA 1W0OA 1VPHA 2K2SA 3CKHA 2DVBA 3MHZA 4UXAA 2BUKA 5EQUA 1DF0A 3O12A 4NHKA 4X8NA 4OYUA 3MLKA 5E8AA 1W6MA 3BU0A 1ND2A 5LBBA 3RZLA 3C7FA 3FHAA 1G9AA 3DXTA 5J96B 3VD9A 4P9GA 1HX6A 2A1XA 5GKAC 4AEKA 1AR63 2LALA 2RM22 1WD4A 1F5JA 1H2MA 3GCWA 1JYCA 3OOXA 4PIXA 2YPDA 4N9IA 1A6CA 1YI7A 3G7DA 1GBGA 4EWAA 3GNEA 2ZGMA 5FLIA 2HEVF 1LOGA 2JDNA 5DZEA 3V56A 4HVQA 2P2KA 4YM1A 3JQXA 2C0ZA 2JDHA 4QB1A 4OQ9A 5AC93 5JSRA 4TYSA 2DUPA 2Y6HA 3VHPA 1UCXA 2R071 4XJZA 3QH6A 4UBHA 1RUG1 3B9CA 4UAPA 3JBG2 1UX7A 3K4ZA 4Z82A 3S5QA 4HKWA 4PQ9A 5J1XA 1C8M2 4EE2A 1RIRA 1LHVA 1RUC3 2VCAA 3OPWA 2BGPA 3S7IA 1BEV3 5EYXA 4Q2FA 1C3HA 5KXBA 4GA9A 3UGFA 3VKMA 4QXHA 3TEXA 5F5CA 5C3SA 5FYBA 2GMPA 5FZMA 4LK7A 4H55A 4RGKA 4CP9A 1WCQA 4YLZA 5EYYA 1FAYA 3VN4A 1SFNA 1XYPA 3TN93 1ZBA3 3O1UA 2VQTA 1G9BA 2PHXA 4XURA 1XRUA 1GMMA 4Y33A 2J1UA 2WNUA 5EWSA 3T2PA 5AC91 1WWYA 2W1WA 4A7YA 5C3PA 5CKQA 3C7OA 3JXSA 5FUIA 1UZVA 1YEWA 1POV3 1ZZBA 4XYXA 3POBA 2JG9B 3RMYA 1BK0A 3CQOA 3I2JA 4H14A 2EXKA 4CA9A 5L9BA 4QKNA 4DOUA 1EV11 1ALYA 1YQ2A 3LWCA 2P5BA 3O7OA 2ET1A 4CZSA 1RUH2 5DUXA 1GZ9A 1RUC1 3BGAA 4URTA 4V2VA 4X8PA 5FZ8A 5LK7B 3WQ7A 2VNOA 3NV1A 1QJU3 1F2NA 3KMHA 2WLQA 3LEMA 4KBBA 2QCSB 3KLSA 4TXWA 2RS53 1W05A 2RS32 3J26N 3N35A 4HKOA 1UOGA 2JEMA 3W58A 3LEGA 5FPZA 2W52A 2NPIA 3B7MA 3TN91 1TMF2 2GN3A 2JDKA 1H8TB 5C4WA 4IETA 1UZWA 2G9FA 4GIQA 4Q1RA 4QKBA 4HN1A 5J98B 1TNFA 4XEZA 3ZXFA 3KF3A 1DZRA 2OUHA 4EWDA 1KITA 3VKLA 4Q26A 5IFPA 1POV1 2VU9A 3QCWA 3WVJA 3CBNA 3BIEA 2BRTA 3P6BA 3MGUA 3MFAA 2E7QA 4WVZA 4CCKA 4H3WA 2R1DA 2NMOA 1CQ9A 4HOOA 4I0BA 1VBA3 4NJ4A 5BNNA 4OVEA 1IS4A 5L7OB 2CYFA 4AFCA 2DU0A 1Q56A 2DCYA 1JZ6A 5T50A 2ARCA 1OMIA 2R49A 3H7JA 2WN2A 3ILNA 2QQNA 4NN0A 1VBC2 3D3AA 4SLIA 5C5TA 2JB8A 3PMSA 3A0NA 4Q4W2 1YI9A 4XQ4A 1FV2A 4JV4A 1VBB3 5E6HA 1HV1A 4LOSA 2ETEA 4JRLA 2BVVA 2V4AA 1XNTA 3LSEA 4XMAA 4LBQD 2PLV3 1HB2A 1OF3A 2W5FA 3DV8A 3IMNA 3KWVA 4YFWA 1X9PA 3ZO0B 4NUBA 3ZSLA 5A6XA 1J59A 1UIJA 3MO4A 3OYWB 1FT9A 2P6CA 2AR6A 4LBQB 1RUD2 4WBBA 1QH7A 4R9BA 2VOTA 4OI4A 4QX5A 5D8AA 3RQ0A 2WNVB 3CU7A 2HJIA 3FBMA 4RR3C 4GKYA 1LULA 3PMEA 1GANA 1NA1B 1EPWA 4XAAA 3BODA 3L9JT 4QPIC 1LEMA 1AR83 1LECA 1VR3A 4YW6A 1VLNA 2ZEXA 3VDAA 5K0UC 2V5DA 3AKQA 4E2GA 5LEKA 4Y4YA 3GF6A 4FPGA 1EYBA 3M3QA 5I91A 3AFKA 4ES8A 4PLOA 2D5HA 3WG2A 4R4XA 3PUSA 1VBB1 2D6KA 1OLME 4P5YA 2DBNA 1BKZA 1UYPA 4P08A 5F2SA 4FPEA 2C26A 2YROA 5FXXA 1MZ5A 2OUJA 5ISLA 4BMBA 5ANNA 2R30A 3CJIA 4CTEA 5T55A 5FK7A 4TWTA 3AYCA 1VAKA 2BFUS 3MBWA 2HWF3 4DNYA 4BQXA 3NAPA 5K9YA 3KD4A 1S0EA 3LDKA 2VTFA 4NOTA 3D4KA 4Q0QA 1NKGA 2R041 4XJWA 4EWEA 2VPVA 2EF6A 2EIEA 1VP6A 1K3IA 3GYDA 4XJAA 1XU1A 1QHDA 1AR81 1VRH1 2HWC1 4NIAA 5JPNB 1S4CA 4MXWA 4WM7B 1B09A 1OPOA 1QXJA 2GC1A 3DCQA 3F2ZA 4IEUA 4QHOA 1SLBA 5D21A 1FYUA 4YVWA 1YC61 5EXOA 5J7MA 3BIWE 3HNYM 3DPRA 4META 4RS5A 1L3JA 3VDDB 4QQPA 2ARBA 3S30A 1GZCA 2XL9A 4ZU5A 4MSVA 3QBQA 4DRRA 3I2DA 3B94A 3ZFFA 1DYOA 4O7XA 3IB3A 2YYOA 2JDPA 4JVAA 1UAIA 1JZ4A 1VALA 2GALA 2VMDA 2VVEA 1ST8A 2XOMA 4J1WA 2AH2A 4YG3A 3C3VA 1TME3 1WLTA 2E26A 4CEYA 1UF2C 3IBMA 2WBKA 3OB8A 4XIOA 5B4XA 3POFA 1S1AA 4K9SA 5FKCA 2JG9C 1PX3A 5FYSA 5CZKA 4FVVA 4Z1VA 2DF7A 2JDUA 1BQPA 1D0HA 1RUI1 2FDFA 3THPA 3ACHA 1O3TA 5KHHA 2PA7A 3HN3A 4N53B 2V73A 4QPGB 1HRV2 4CDUA 5JSOA 1YNAA 3POWA 5FOBB 2X5IB 4MADA 1W6OA 1I6XA 4RHV3 2HWD1 4QX0A 4XF3A 1PO13 2WAAA 5GZFA 2WLPA 1YHFA 1ZREA 5FJKA 5IUQA 4CCJA 5KC6A 5LA0A 4JTNA 4LKDA 1VIWB 1EP0A 2WRAA 2YC4A 3EMRA 1H8TC 4XUTA 3UV9A 2ZGRA 3VBSA 1TME1 1W8NA 1U5XA 3KM5A 4XQDA 2OPWA 4HL0A 1GR3A 1CX4A 3NQHA 4YM0A 3MLLA 5A7WB 3WDUA 1W6PA 2ATFA 3ZFGB 5HV4A 3DYPA 1O91A 4GWJA 2JDAA 2WS93 1XSQA 1HRI3 3TEZA 4LBOA 3AK0A 1F35A 1OA4A 4QPWA 5L7OC 1W6QA 4CEWB 5CG8A 3AMMA 2WO7A 4NWWA 3THDA 1WMEA 2NQYA 3WP4A 5KHGA 2VMEA 3RI8A 5AFEA 4RHV1 4ES9A 3ZVXA 1MVEA 1NCQA 3B02A 2P17A 3ZOIA 3FZ3A 5A1AA 2QZ2A 1ND3B 4NPRA 4IV3A 3AXEA 4FPHA 5ANQA 3OUIA 4RQPB 4BM8A 2R072 3LA2A 1O3QA 2A70A 1REFA 5CNAA 2XLGA 4MHRA 1RUG2 1X82A 1N3PA 4YSFA 2XQRA 4NIDA 4L11A 1DCSA 1G7YA 1GUIA 4AFDA 2WA4A 3A21A 5F2WA 4MXVA 3VV1A 1KS5A 4LE4A 1PK6C 4DMIA 4FPCA 4WVMB 1F4HA 2WS91 1RUJ3 3K4AA 1QNYA 2ZGSA 4LORA 5FZLA 2J42A 1RUF3 3L2HA 3WEZA 3M4FA 3U10A 1D4M1 2WABA 2QQLA 2X05A 1T6BX 3A22A 2BGOA 3ZYBA 5BV6A 3DN7A 1CAUB 4XUPA 1U12A 3LEIA 3W21A 2G9GA 5CFDC 3MF6A 1LOCA 3NNJA 5FP3A 5AC92 1UZ0A 1V6NA 4CDWA 2QTWB 1AX1A 1WLDA 5FLJA 2D44A 3BALA 4ITCA 4YWAA 3RSJA 5IYYA 3MUY1 5LY2A 1F31A 1L7QA 2Y60A 3S6PA 4CDQB 3H8RA 1A3KA 2DCKA 4TLGA 1W9WA 4JQRA 5JVVA 5C8WA 2GC3A 2VZOA 3NJYA 2BERA 1HQWA 1MS4A 2Y6LA 1VJ2A 1RUOA 2ORXA 4MV2A 3IWZA 1EV12 3USUB 3WG1A 1RUC2 2BWAA 3E5XA 4PJYA 5DAQA 3NNLA 1OT5A 4GWNA 3LZZA 3VD4A 3AP9A 4PDWC 4M3CE 3AL6A 3MW3A 2YPJA 3RGBA 4Y1ZA 3T09A 5D1IA 3OY8A 4HN0A 3THTA 1IZ3A 2A6ZA 1DZTA 4WM7C 1UMIA 2YFUA 3ZYRA 3WR0A 3NSTA 3TN92 1W8ZA 2RVAA 5LATA 2D97A 1C8NA 2VOKA 3VUOA 5FZIA 3ZKYA 4Q4Y3 5A7QA 3HAGA 3BOPA 3VDDC 5FZHA 2BNOA 1MQTB 2XG3A 1SDDB 1W8HA 3SQOA 4CCNA 4LJHA 1K12A 2ZX0A 3FWEA 5EPAA 3WT3A 3JBG3 4FT8A 4LHKA 1C8M3 1YQ6A 1PZ8A 3E5QA 4QX3A 1VBE3 4Q1PA 1E5SA 4KWUA 3AZXA 3V64A 1WMXA 4A42A 5AVPA 1ENSA 2OW4A 3N9QA 4GULA 3TWIA 3WQBA 4R4ZA 2VZVA 4A2UA 3GBFA 2FDGA 3O1VA 4BPZA 4FFFA 4COVA 2XUMA 2OX0A 4XFCA 5DZFA 1QJZA 1CJDA 4LBKA 3VBFB 4Y20B 5EJZB 3AMQA 3HN1A 4TZDA 2PHDA 4N8MA 1SZBA 3HQUA 2BDRA 1GOGA 1S55A 4EQVA 5FZAA 4W6XA 4XJUA 1JU4A 4N53C 5F3CA 1UMHA 4LKFA 5IHRA 1KQRA 1OOPB 1DYKA 4Q4Y1 5FUPA 3RZZA 5JOXA 2HYKA 3AVRA 2X5IC 3VBRA 4BQWA 4CUGA 1JS9A 2O8QA 3I59B 2JG8B 1JMUB 1OD5A 1QNWA 4O9EA 4N7IA 3POSA 1W90A 1VBE1 3I2OA 3IDAA 1WCKA 4XMIA 5FZ1A 3AP7A 2BW8A 4FBFA 3PL0A 5H9SA 1GQPA 1W3VA 5A7PA 4FPFA 1CAXB 1OURA 3ABZA 4XTMA 2WT0A 3CEWA 3O1TA 5T52A 2GZWA 4UF0A 3RMXA 2RS33 1AL0G 2VUDA 4C0BA 3SITA 3ZFGC 3J7NA 2JE8A 1W99A 4QHBA 4BE3A 2OPKA 1TMF3 1VBB2 2RR12 5ACA3 4PIZA 1MZFA 5A3OA 5C8CB 1VAVA 4JGYA 2HLEA 2JJ6A 2X53S 1BJQA 3V65A 5C3OA 5APAA 2E7AA 4PLNA 1ZYBA 1S0JA 1S0CA 3NNMA 3R4SA 4IGPA 3N7JA 2EICA 3JD73 4ET7A 4YW7A 4LOTA 4JQTA 4S2HA 5FPXA 1WUVA 1NXMA 1ND3C 1YXWA 2K46A 2R042 4RQPC 1RTVA 1C1LA 5EFUA 3UKVA 3AZWA 1AR82 1VRH2 2JX9A 2HWC2 4K8FA 4BOWA 5IATA 4ZXEA 4FTBA 3KS7A 3P5BA 5KR7A 4YVSA 1FXZA 3CL1A 2W1SA 2X10A 4Q4W3 2BJSA 5FPBA 3BN6A 4B29A 5G04L 3K51A 1IS5A 2QUOA 3MFCA 5C9AB 3H7YA 5ACA1 4UI9L 3VBOA 1K5MB 1RHI1 2ZEZA 5L19A 5JOZA 1CD3G 3OD4A 3FLRA 2PQSA 1ENRA 2NM1A 4DPNA 5JZGA 3ZYJB 1D4VB 4Q0VA 3ENRA 1S0IA 1YFYA 4LR4A 1CIYA 1OHFA 1URXA 2A75A 2D6MA 3JD71 3LF7A 1O3RA 1PZ7A 4QDQA 3ACLA 2JIGA 1M06G 2OZJA 1ZA4A 5F8PA 4CP1A 4LBJA 5I8TA 1JHJA 2XVGA 2HYXA 1NX9A 4CDQC 3T1MA 4AW7A 4D7SA 4FCAA 3SCFA 5HCAA 5JXHA 1C57A 2IXKA 3OTFA 5FMBA 1SCRA 3CJXA 2RDSA 5C70A 1H9WA 4PBPA 5A33A 4GH4A 2ZJCA 1PM4A 1RUI2 1NLQA 3I3EA 5F5QA 3ZDSA 3TAYA 1W8UA 1AF9A 3LB9A 1GZWB 2VXRA 2PHTA 2ARAA 2QQJA 3AX4A 4B1LA 2GNMA 1LHOA 2HH9A 3HEIA 2HWD2 2XMLA 4GMP1 4XILA 4DXSA 1CAVB 1AL23 3SMHA 1GNYA 4NWVA 5CFCB 1JHNA 4D3WA 4FTSA 3S7EA 4JC1A 3GDBA 1NUKA 2UURA 1TME2 2PAEA 1JI6A 1NG0A 3FMGA 1CZSA 3X29B 5BNQA 2IUWA 3MF9A 5ABJC 1KJLA 1MQTC 2WSVA 2ZOEB 1B35A 2ZMNA 3ALQA 4DINB 1GWKA 2W1QA 3I2FA 5I0SA 1JYTA 3B93A 1C28A 4JAAA 1QWRA 2ERFA 1UZZA 2ILMA 2AGSA 5GZCA 3WW1A 5FZCA 2OYZA 4AF9A 1LR5A 1MS8A 4KBZA 4XUOA 3FBYA 2WFPA 1U5ZA 3ZXAC 2DTWA 4RHV2 4HVRA 4WM8A 1H1MA 1ZRDA 1D2SA 1WW6A 2WIIB 2VZ1A 4J6GA 3VBFC 1CAWA 1W6MB 5F3IA 3ZIWA 3OBZA 1ND2B 1PVC3 2JD9A 4LBNA 1AL21 5GJ6A 3PTYA 4KG0A 5HCHA 1ZRFA
chains in the Genus database with same CATH topology
3ZXEA 1TE1B 1WW5A 1UW8A 3IM0A 1OOPC 1ULGA 5GZDA 4N43B 4KH9A 4QM9A 1BBT1 1DQ0A 2O1QA 2MHFA 1RUNA 3AKSA 4R9AA 2F4PA 2GNBA 2WS92 2XWJB 5E16A 2BBVA 5DDJ1 5HCFA 4COUA 2A3WA 3PJQA 1APNA 1HRV3 4UW5A 3Q9OA 3A0KA 2Y0IA 4D69A 1D4M2 4LLOA 2ARXA 2B8MA 3JZVA 4HVOA 4UW3A 1LOBA 4UW6A 1DFQA 1PVC1 4LBMA 4ATFA 2P34A 1BVP1 4NR1A 3RYKA 3DL3A 2IXIA 5C8CC 3SH5A 2XPJA 3MI8A 3MW4A 1IHMA 4YM3A 2QVSB 3MPPG 2Y0OA 3AYEA 2XLAA 3DF0A 1IPKA 1WCDJ 2Q1ZB 2WNUB 1W2UA 4GWMA 3VZKA 1QJY3 5EV7A 4XFIA 2VOXA 4BCUA 2XKPA 2DCJA 4BZ4A 1AUYA 1HRV1 3ZN6A 1NLRA 3M8LA 4EN7B 5GM0A 5T3NA 2VMGA 1FV3A 4L8QA 4MGZE 3ZMOA 3RG0A 1LOFA 1Q8VA 3RDIA 3ZXGA 5C9AC 2VW2A 2O0OA 3VHNA 3E6BA 1H2KA 3H0OA 2H0VA 5GZGA 3W59A 1RUG3 2R0FA 4DRVA 1I3HA 1K5MC 2XHKA 5JOYA 3C2UA 1YFUA 5TSWA 1SBEA 4NHLA 1J3PA 2GMMA 2P3KA 5E89A 4COWA 5C4WB 1QJY1 2TEPA 1NCRA 2IXJA 1OI6A 2A7AA 4IEVA 1EPZA 4OHWA 2VY0A 4PBOA 1U0AA 5JIAA 5BNNB 1LRHA 1Y43B 3D8CA 3AJYA 4OI1A 3T2TA 3WW4A 4XF0A 3ILFA 2YMZA 5JWPA 4Q4Y2 5KC5A 2PHFA 1HKDA 4P9IA 4FSJA 1XQNA 2KA3A 2IWGB 2WQ4A 5JI7A 1EV13 1UPSA 1VBE2 1MZEA 2OA2A 2ZGQA 5CFCC 3FFQA 5T5OA 4UBGA 5GLVA 4Q29A 4LTAA 2PTMA 3VKOA 4A7KA 1H2LA 3JB4C 1MS0A 5D8AB 1VB2A 3V0AA 5DXDA 1Q8OA 1F5FA 3VL9A 5BXXA 4BLIA 1Q43A 4QM8A 1EAH3 1MZ6A 5I8YA 3H3ZA 2XJSA 2B39A 3POYA 4JDMA 3WDXA 3EXUA 4MX3A 2ZX1A 4ASLA 2Z42A 3VBHC 3ELNA 4HKLA 3AKPA 1AJKA 1YRZA 3B5LB 3JU9A 4FPLA 4QD2A 2WA3A 1NY71 3E6DA 4HSJA 5CIRA 2AREA 3WX5A 5F1RA 3NKTA 1WLWA 4AI0A 4YGBA 4XFHA 1EY2A 3WW3A 1FNYA 2MNGA 2ZX2A 4N43C 1A8DA 2V09A 3NAPB 4FTEA 4QGLA 4YZ5A 3OGJA 1CESA 5ACA2 1UL9A 5JDBA 4Y24A 1S0GA 2HWE3 3ZX7A 1DYPA 1RHI2 4AQ2A 1O5UA 4MXWB 1EAH1 5KXEA 3TB0A 3WW2A 4RR3A 4YVWB 4NHMA 3JD72 3DPRB 1C1FA 3KCCA 4RS5B 4ZKTB 3PVNA 4AEMA 4IEWA 1V9U3 3M2MA 3TOJA 5KHKA 1YIFA 3ZSEA 1LOEA 5T5JA 1MVQA 1PGW1 3RI9A 3ZFFB 1Q3EA 1S2KA 4HZFA 2WZR3 3FLPA 4C0HA 1NOVA 4P9JA 4CEYB 3RJ2X 2CAUA 2RR13 3R6SA 4XDQA 2GH2A 1SLLA 4JDNA 1RL3A 1AR93 2HWE1 3VBUA 1JH5A 4XHBA 1MR5A 1CJPA 1JUIA 2GC0A 3OGGA 4Z8BA 4JCKA 4EROA 1O4TA 1OFNA 4WV8A 2ZBJA 4YG6A 1PNGA 4JGZC 4Q8KA 1RUE3 5DUWA 1V9U1 1VAMA 2R043 1OKQA 2FMYA 3WCSA 1W6OB 3WDWA 2VMHA 1VRH3 2CGOA 1AXYA 2HWC3 3CLPA 2GC2A 1AHSA 3N7LA 5BNPA 4D7YA 1WW4A 1WCSA 5H9QA 5BUVA 5FREA 2WZR1 2EAAA 5C4WC 3VBSB 2D6OX 2A3XA 1IGOA 1TQ5A 4UW4A 2ZMKA 2RR11 3ST7A 2PHLA 2R32A 4YGCA 3RS6A 1N1YA 1AR91 1W6PB 1HW5A 3M3IA 2RE9A 1W6NB 1AL22 4YZ3A 1W6QB 4EN9B 4XFBA 1RUE1 3SNMA 1SMVA 4D7TA 2AENA 2RJKA 3AZVA 1JBCA 4WZCA 1NCQB 1Z0HA 3B9IA 1BBT2 4QQLA 4C1WA 5JIUA 1OA3A 3WQ1A 1H1IA 1RUI3 4XPVA 4HMZA 5DDJ2 1V6IA 4XZPA 2AUYA 3H50A 3V0BA 4YW1A 3J9SA 3R05A 1BYHA 1M4WA 3QACA 2VVDA 5CA6A 2UWCA 2HEYF 1LJ7A 3GBGA 3QH7A 2DUQA 3RNSA 2HWD3 1O4ZA 4XW3A 5D8AC 2DVFA 4P9XA 1PVC2 3QLQA 2N7GA 1XNDA 4XE9A 4DZGA 4G4FA 3IKWA 5KXCA 1QOSA 2EXIA 1QU0A 3WG4A 4P9YA 2WSUA 4CDWB 1QKQA 5JOWA 5FOJB 1IOAA 2A6YA 4IERA 4IXLA 5T5LA 3OD0A 3FE5A 1N1VA 2ZGNA 4AI1A 4DXZA 3RRDA 4GQ7A 2RJLA 4GXLA 5L73A 2XL7A 3D6EA 1LENA 2DWRA 4KU8A 2DURA 2EXHA 3I8TA 3D0JA 1AYM1 3AMHA 5BNOA 1LB2A 3LCPA 1DBNA 3U4XA 3SXWA 3OY8B 3M3EA 3O0VA 4HK8A 4LULA 3WHUA 4FP2A 4KU7A 1PK6A 3DKWA 2QJVA 2A71A 1BCXA 4HPKA 3UJOA 2BTVC 2OVUA 1V6OA 3DPRC 2PELA 4RS5C 1QJY2 2R1BA 3KSCA 3ZXJA 3ZN5A 2WFF2 5FBZA 3NKGA 1YYNA 1H30A 1D4M3 1V6JA 5CFDA 4E9KA 1DGWX 3NV4A 3OJBA 1LHNA 4CYDA 2DCTA 1H1AA 2TUNA 4CEYC 3UKNA 1ULEA 4YW5A 3BCWA 5JR7B 2Z69A 2LTNA 1KS4A 4S2DA 1XYOA 2VECA 4D94A 3IIAA 3VZNA 4AGVA 1J3QA 2FQPA 4Q0UA 4M00A 4PDWA 2B9UA 1UMZA 5CB7A 2WNVC 3MIDA 2NMNA 2C5DA 1CONA 3VBRB 1NA1C 2IXCA 1IQAA 3GZUC 2ES3A 3BPZA 1DGWA 2CY6A 3WG3A 4B7EA 4DFSA 3KZ4C 2ZKLA 1ZZ8A 4AI8A 2XLFA 4B4QA 5F9TA 1AXZA 1R081 3NV2A 1JTZX 2P3IA 3ETQA 4IEPA 1PVXA 1UZYA 2QNKA 1ZNPA 1UN1A 5JAXA 5BY5A 1Q8PA 3D82A 3VKNA 1GQHA 4RA0A 1HQLA 1LU1A 3WXPA 1QQP3 1NY72 2BVBA 5H9RA 4JGYB 2DU1A 2ZTNA 4LO8A 4RGAA 3TRSB 2IZWA 4L92A 3IPVA 3M7AA 4FXGB 2V5YA 4B4RA 3OBRA 4B8EA 3ATGA 4QT6A 1DIWA 2I74A 1IPJA 4QXKA 3ZN4A 1HLCA 3H1YA 1OA2A 1HV0A 1OSGA 3H9AA 3AP4A 4FOYA 3A4UA 2PYTA 1EAH2 4M01A 3LGRA 4YVSB 4L97A 4YZ4A 5EZWA 3H1MA 3VHRA 3M3CA 1J3RA 4Q4X3 4MVTA 2BFUL 3VBOB 2H6BA 1QQP1 4MGIE 3EBRA 3HQXA 3WP6A 4ATEA 1AYN3 3AZYA 1SEFA 3O5SA 1PGW2 4XF4A 4Q0SA 4CDXA 5JZGB 1G9DA 1IKPA 5L36A 4LNVA 3FHIB 3LOIA 5FFOC 1NQJA 4CDWC 3R0RA 5KHJA 4MGYE 2VNRA 1C4RA 1KDKA 2WC2A 4GB33 4AEDA 4QPGC 2HWE2 5BPXA 5JCTA 1XNKA 3WLUA 4Y26A 3J8F1 4XJ9A 2JDZA 2JECA 1LESA 5C6CA 1FMD3 3I4IA 1NQDA 1G9FA 1OLRA 3MW2A 3MIFA 4GH4B 3AFGA 1FPN3 5A33B 3IDCB 4FPOB 1JYIA 3SHRA 2LUWA 4RQPA 4Q4X1 1DQ1A 1GYKA 1V9U2 1UKGA 4YNIA 1H0BA 4KWLA 1AYN1 1AX0A 1WBLA 4I30A 1I9RA 2VW0A 1QXRA 1RMU2 2C1FA 2XBO1 2WZR2 1MACA 5C33A 1RINA 3PVBB 2I2SA 4C1XA 2FMDA 3OCPA 1PMIA 2CAVA 1I5ZA 4BMEA 2JENA 4KGGA 1B35B 4XOGA 4GB31 1E57A 1AR92 4CEWC 1RHI3 4Q0PA 5E1RA 1FMD1 4PIYA 1FPN1 3KT1A 4R9CA 3MZHA 1DZQA 1RUE2 1VB4A 5FTTC 3ZIXA 1DGRN 2YXSA 3FLTA 4WM8B 4FP3A 1CAWB 1N1SA 2KM2A 1DQ4A 2PAKA 2ZGTA 1KD7A 2ENRA 3AYDA 2BNMA 2ZHNA 4WVVA 2PHWA 5BYNA 1DQ5A 4YW3A 1ZM1A 3M70A 1BVVA 1ZVFA 3NV3A 5AVAA 2E6VA 4HETA 4XTPA 3JUUA 5DG2A 2XJRA 3HT1A 1J1TA 2GH8A 4L9BA 4V1PA 5GLUA 3HBZA 4GMP3 4L2NA 4B7KA 1BXHA 5IT6A 4QQOA 5A3LA 2A3YA 4Y22B 4RGGA 2PN5A 1BZWA 3B01A 5K7PA 1FNZA 4XETA 1WMFA 2CWMA 1Q8SA 5A32A 1YJKA 1DQ6A 1QOTA 2UWAA 4Z07A 1H4HA 2BYVE 4LHLA 1LGCA 3P3NA 1U5IA 1LKNA 1Y9QA 2A73B 3NWKA 1PGL1 1KRIA 1XE8A 2Q30A 3GBWA 4XF9A 4OHYA 1RGSA 5KXDA 2YV8A 1S0DA 5I0RA 4C91A 1GNHA 4I3GA 4F7ZA 2MEV1 4AHZA 1AYM2 1XNCA 3O14A 1PO23 2D3PA 4EN8B 3ZN6B 1Q8QA 4M3CA 4XXPA 3O0XA 5T54A 4AFBA 2O8OA 3MIHA 1T6GC 1BBT3 2DVDA 4DY3A 3PHMA 3WNXA 4XBLA 2UYBA 2WT2A 5JSPA 2JXAA 1J58A 4HT1T 4I3PA 5DDJ3 4CP2A 3BOWA 1YJLA 4KWJA 1JN2P 2GDFA 4LO5B 4H7MA 2YGLA 5GLWA 4OI0A 4IV1A 4L99A 4NO4A 4IEQA 4R52A 1RJ8A 3BB6A 4OUSA 4FOWA 2E9QA 4BHPA 4AQSA 2DCZA 1NCRB 5CVRA 4LLFA 1PO21 3AZZA 1AR73 3KT7A 4DB5A 2VVFA 5KWRA 3W9AA 5FO8B 2OIIA 4AVTA 3H1WA 4H7LA 1JUHA 4GH4C 1Y7BA 3AMNA 2XGXA 5KHIA 2JG8C 4LA3A 2UY8A 1ONAA 1SLAA 4E4DX 2D3RA 4P5HA 2NN8A 4O9GA 3ZPYA 1NLSA 3AP5A 4MGKE 4AVAA 2VUJA 5LRRA 3P3PA 4XBNA 1G9CA 1YUDA 1H4GA 3URFA 4OLLA 2AZ5A 3FJSA 4S2FA 2EAKA 3NJZA 3VZOA 3MPBA 1AR71 1B35C 1FOD3 1R082 2ZGUA 2CGNA 1LU2A 3I7DA 3DGTA 1XYNA 4FXKB 4KL1A 3ZFEA 2UU8A 2EALA 3WP3A 3WUDA 1R1A3 1WA4A 4XIKA 3VZLA 1JW6A 2D98A 3V0AB 3RWNA 3N7KA 4MYEA 2WINB 4W6YA 2D6PA 1WMDA 5GLZA 1V6MA 3AP6A 1ULCA 2VH9A 4RFT0 4R9DA 4FOVA 2W0XA 3RJRA 4F8AA 3VLBB 2WFF3 4WM8C 4LT5A 4DS0A 4LA2A 4X6RB 2NZ9A 1NE4A 1RVF3 3FC0A 3U11A 4IEXA 4KQ7A 1CR7A 1V6KA 2ZHLA 1GZWA 3GZTB 1D2QA 5F6KA 2QDNA 1FOD1 1O7FA 1REDA 1QMJA 2B45X 1R1A1 4K21A 2BPA2 2CTVA 2CWSA 1F9KA 1QQP2 2DVGA 4KNCA 1LGNA 2WFF1 2MPFA 4RR3B 4WVWA 2HKXA 2CGPA 2DFCA 4MLOA 5FQ0A 3L2YA 1RVF1 4XFAA 4JDOA 4E4SA 2I07B 1DGRA 1BK1A 1HDKA 4OFGA 3J8F2 4AQ6A 2YY1A 3HT2A 3VBHA 2B7YA 2DV9A 5DUVA 5IK8A 1FI2A 4FO9A 3QD6A 4Q4X2 4AHWA 1X8MA 3VKFC 1A78A 4AXOA 3VBUB 1G6NA 2ZS6B 1AYN2 1COV3 3IN9A 4M0HA 1S2BA 4N43A 4HANA 2JD4A 1XXNA 5HI0A 4TLFA 1GSLA 2Y38A 2XBO2 1LTEA 4FQZA 1LOFC 2YUEA 2KXLA 5FMOS 4GB32 2QDRA 5BNPB 3T1LA 2VNGA 4P9LA 1FMD2 1ZZ6A 1H9PA 4INDA 2XVLA 4YM2A 1FPN2 1O4YA 4FQ4A 4LO6B 4C90A 5GALA 1AR61 1ND2C 3AYAA 1NCRC 4TSVA 1DGLA 1SQ4A 1GKBA 5I8SA 5IK7A 1COV1 4ISRA 1J1LA 1YFXA 2UYAA 1S0FA 2VMIA 3CJIB 5FDBA 1R093 1ZBE3 3PVEA 1JXNA 1SLIA 3ECQA 2P37A 2NP0A 1N3QA 2VGDA 1PM7A 2WNEA 1ULFA 4GKXA 1TNRA 4FPJA 4AI2A 2X29A 1AVBA 5T5PA 1MEC3 2IXHA 4XXAA 4B3NA 1SLTA 4LEJA 4K1YA 5H9PA 1ZZ9A 3B3QE 1PIV3 1BEV1 2CV6A 4JGZA 4P9WA 3WDTA 3KQRA 3LA3A 4QGNA 3N4MA 3V0BB 1ZZ7A 3RPQA 2VOWA 2CL2A 1SLCA 3ILRA 4OHVA 4QPIA 3WD5A 4LE3A 2AYHA 2PQQA 4P14A 2E7TA 5K0UA 1ZBA1 2BNNA 1R091 1XU2A 1ZBE1 3AMPA 2D3SA 4BYYA 3KGZA 1RMU3 3E97A 4K40A 1HXS3 2WNUC 1PGL2 1VBD3 4AVCA 3O0WA 3SCGA 5EJ3A 2XJUA 2ZGOA 5I93A 2K9ZA 2VQ0A 3R4DB 1MEC1 1QF3A 1YWKA 2MEV2 3M3OA 2R16A 2R063 4K7JA 5IK4A 1PIV1 2EA7A 1KFUL 2NYYA 1QJU1 4M0NA 1ASJ3 3VZMA 3JCIA 1OQDA 4CDUB 2RS51 2HEWF 3ES4A 4BIOA 4COYA 5AFBA 2GU9A 4E27A 3SISA 3ROUA 2W08A 1IKQA 1U5YA 2Z2SB 1MS3A 1RMU1 5BNOB 2D93A 3B00A 1NXD1 4Y5Z0 1HXS1 4B4PA 4Z2WA 3AJZA 1VBD1 1WW7A 3MYXA 4IQPA 4Q8LA 3JQWA 5CADA 1PK6B 1PNFA 3HWJA 4YFZA 3UK9A 1VBA1 4HPKB 4QMAA 3H8UA 2R061 3N7MA 2VW1A 5HCBA 4W6WA 5JI9A 5BNNC 3BU7A 2DFBA 1POV0 4XQWA 1ASJ1 1PO22 1KFXL 3WCRA 2Q4SA 4IL7A 2JG9A 3OF1A 2LM3A 5CFDB 3AXDA 4IESA 2SBAA 3RYPA 2QZ3A 4JTOA 4LHNA 3TBDA 1ZRCA 3WUCA 4OHXA 2PHRA 1G8WA 4IV3B 3BTAA 2A6WA 2PLV1 2ZGPA 2DVAA 1NZCA 5GLTA 1I1EA 3ES1A 3VBUC 3MLJA 4YW4A 1QGLA 2ZABA 1Z7S3 1LHWA 4LUMA 5LK5A 2BWCA 2ZHMA 4DQAA 3ZXLA 3MIEA 2OZ6A 4PDWB 2QKDA 3ME2A 1LHUA 2WL1A 1H8TA 1ZRRA 3MIBA 3TYJA 2RS13 5E88A 1AYM3 4Y1XA 2B42B 4LO4B 1NYWA 1AR72 3M1HA 5BNPC 5DUUA 2IXLA 2P3JA 5FO7B 4AHYA 5J3UA 4QGMA 1RB8G 5FLHA 2ET7A 2A6XA 2FZ1A 5L7OA 4Q4V3 2NLRA 5DZGA 4EV0A 1BMV1 2ZA9A 2VQAA 1HIXA 2QFEA 2HWF1 1N3OA 1Z7S1 2Z79A 3CJIC 3FUQA 4QQHA 3ZXDA 2F6BA 1KDMA 2ZZQA 1LEDA 3NAPC 4LO7A 2BEOA 4XHXA 2RS11 4EN6B 3IPVB 4Z92B 1ENXA 1FOD2 3K48A 5FMOL 4YGDA 3U0ZA 3B69A 3OYWA 3PVOA 4LBQA 1SBDA 1V6LA 1R1A2 2IFRA 4AK3A 3GZAA 4GALA 5A3MA 3MICA 2WNVA 2D5FA 4YVWC 4OZXA 1V70A 3ZMNA 4M3CF 4NVPA 1NA1A 2C9AA 2JE7A 4Q4V1 4BH9A 4EJRA 2WT1A 4S2GA 2EXJA 3PNAA 2D40A 4F3JA 3ZXKA 1YFWA 3TNPB 2W39A 3NL1A 3WZ1A 3ZFFC 4I2OA 1AZDA 1O5LA 1RVF2 4WZFA 2GAUA 1GNZA 1S0BA 2WZPP 2UY9A 3LKJA 5FAXA 2EIGA 2WJSA 4CDXB 1R083 2ZZJA 4FOQA 1QY4A 1W6NA 1A8MA 3EO6A 1YIPA 4EN0A 4KWKA 3IT8A 1SCSA 4AEDB 5KBFA 2GSYA 1H2NA 3S0MA 4CDUC 4AFAA 4F83A 1PO11 4WM7A 1WLCA 5DG1A 4ISQA 2PHUA 3NW4A 3I54A 4XBQA 5F6LB 1SACA 1UU5A 3TNQA 4U36A 5BNOC 3AKTA 1WGPA 2GNTA 3VDDA 3VBSC 3SH4A 1QJX3 1RITA 4K3UA 2BQPA 2HWB3 3KB5A 4OULA 3NVCA 1HRI1 2RMU3 4AGGA 4LBLA 1AR62 4FAHA 4DY5A 2D6LX 2DUOA 2VUAA 4MZUA 2WKKA 3D5OA 3VGIA 1H8VA 1X8EA 4R8HA 1COV2 4HK9A 3UKTA 1AX2A 2D7FA 2ZMLA 4IEYA 3CO2A 4N7UA 4FPYA 3WP5A 1MS5A 2VG9A 3FX3A 1NCQC 2JKBA 4CP0A 4E4ZA 4N53A 1DLLA 4IV3C 1FX5A 1X36A 2D43A 4QPGA 3WDYA 1QDOA 3AB0A 2X5IA 2B5HA 2ZKNA 1QJX1 3J8F3 4ZXKA 1Z78A 3KGLA 2HWB1 5SV5A 1BEV2 3LSDA 1RUJ1 1TEIA 2RMU1 3PJYA 2W68A 4IEOA 4G3YC 1QXPA 2RM23 1DG6A 4K1ZA 1RUF1 1SDWA 2UWBA 2G4IA 3CF6E 2SLIA 1ZBA2 3ZFGA 2ZAAA 1R092 1ZBE2 5GZEA 3HR9A 1SFYA 1N47A 2Q5TA 1C5HA 2XBO3 2ZCWA 2ZGLA 2H6CA 2ZGKA