3BB6A

Crystal structure of the p64488 protein from e.coli (strain k12). northeast structural genomics consortium target er596
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
109
structure length
109
Chain Sequence
MLQIPQNYIHTRSTPFWNKQTAPAGIFERHLDKGTRPGVYPRLSVMHGAVKYLGYADEHSAEPDQVILIEAGQFAVFPPEKWHNIEAMTDDTYFNIDFFVAPEVLMEGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein yeaR
publication title X-Ray structure of the P64488 from E.coli (strain K12).
rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 18
structure length 109
sequence length 109
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09313 DUF1971 Domain of unknown function (DUF1971)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3bb6A00
3PLQA 4Z07A 1ZRCA 4HZFA 2Q1ZB 3H3UA 4BHPA 4BIFA 4MGYE 2PYTA 4CYDA 1JUHA 3C3VA 4O9EA 4O9GA 4XF1A 5FLIA 4EWAA 3IIAA 4L11A 3WW3A 5I0SA 3IDBB 4MGZE 5CU1A 2HJIA 4HN1A 1YFWA 3BCWA 1ZZBA 4Q0QA 2GU9A 3KGLA 2Z2SB 3FWEA 4WBBA 5KHKA 2K9ZA 3DKWA 2BEOA 3FFQA 2XKPA 1PM7A 3PNAA 4XFBA 3DN7A 5FLJA 1O5UA 1V70A 4X6RB 4LTAA 4OLLA 4Q0SA 3PVBB 4MGKE 4IERA 3EHKA 1RGSA 3SCHA 1DZRA 4Q0UA 1X7NA 2KXLA 4PIXA 1DZTA 2GZWA 3U10A 5BY5A 1FT9A 1SQ4A 2H0VA 2O1QA 4MUVA 1X82A 4EWDA 1ZZ8A 3ELNA 1OMIA 3SXWA 1Q5OA 1ZZCA 1UIKA 4QMAA 4MV2A 5E1RA 3LWCA 1WGPA 4HSJA 3WW1A 5BXXA 1EY2A 5LRRA 2GC3A 4BYYA 2Z69A 1O3TA 3NW4A 3HT1A 4P9GA 3H7YA 3CF6E 2ZCWA 5BUVA 1EYBA 3NSTA 3H1YA 2OPKA 2XKOA 5LEKA 1NE6A 4YARA 2N7GA 4E2SA 4IEYA 1LRHA 3E5XA 3O14A 2IXHA 4HVRA 2QNKA 1J3PA 1H1IA 4MX3A 3RYRA 1WLTA 2PAKA 5K8SA 1O5LA 1I5ZA 4N9HA 3WW2A 5JSPA 4UBHA 1CAWB 1LB2A 1CAXB 3E6DA 3LAGA 4XFCA 2B5HA 3FX3A 4J1WA 4NVPA 5BPXA 3ES1A 3KMHA 2D40A 2UY8A 2ETEA 1RL3A 2WC2A 4HSLA 3OD0A 3MPBA 2ET1A 2XLAA 4WVZA 1VP6A 5CVRA 4LEJA 5J7MA 1QXRA 1X8EA 3D82A 4EV0A 3DL3A 1UIJA 5KHGA 1VJ2A 2D5FA 4Q0PA 3NJZA 4K8FA 2F4PA 4LUMA 2H6BA 3OTFA 4ZU4A 4ZU7A 4JVAA 2CGPA 1NE4A 2PAEA 2PTMA 3RYKA 1ZRRA 4XFFA 4PIZA 2OZJA 1EPZA 2P17A 2XLGA 2QCSB 2C0ZA 2BNMA 2QDRA 2PHDA 5FPZA 3BU7A 4FBFA 1ZRDA 5FPXA 4LUKA 4KL1A 2CAUA 2UYAA 3MDPA 4META 2IXKA 3H50A 3LA2A 2IXLA 5JR7B 2BYVE 1IPKA 1YFXA 4LULA 1ZX5A 3EO6A 1Q43A 4ORFA 5KHIA 3RDIA 3ZDSA 4QM9A 1QWRA 4KWKA 4IETA 4EROA 5I8TA 4N9IA 4J1XA 5F1RA 5CADA 4IEPA 4I0AA 4IEQA 1J3QA 1FXZA 4XF3A 2IC1A 3NVCA 2VECA 1CGPA 2BGCA 4JTOA 1ZZ7A 3I7DA 4KU8A 2Q4SA 1ZREA 4I3PA 2GC0A 1U12A 4UXAA 5EFUA 3U11A 1O3QA 1ZRFA 3FZ3A 4AVBA 4FAHA 2EVXA 3JZVA 4XETA 5FQ0B 4LA2A 4QGMA 5FQ0A 5EZWA 2GC1A 2EAAA 4LA3A 3H9AA 3M3IA 2FMYA 5FCCA 4I02A 4KWJA 4XF0A 1IPJA 2GH2A 2IXJA 4TLFA 3GYDA 4YSFA 2O8QA 1J3RA 5I91A 5I0RA 2Q30A 3B02A 4L2NA 3LOIA 3E6CC 1UD1A 4AQ6A 4WZCA 3TNQA 1J59A 4MH0E 3DV8A 3HIFA 3ST7A 5AVPA 4AVCA 4IESA 4ONUA 3D0SA 4E2QA 1H1MA 3HT2A 1SFNA 4QXKA 4IEVA 2OYZA 2D93A 1CAWA 4IEWA 5I0TA 1DGWA 1CAXA 4XF4A 2BNOA 1HW5A 5C6CA 3SCFA 2E9QA 3G7DA 4YYOA 5I93A 4PIYA 3IWZA 4UBGA 4F7ZA 2XLFA 2MPFA 4Q0VA 1TQ5A 3ES4A 3S7IA 3CLPA 1CX4A 4FT8A 3S7EA 3E5UA 3SHRA 1RUNA 3RZZA 3M70A 3NL1A 1YHFA 5KHHA 3OF1A 4I01A 3MYXA 4I0BA 4HN0A 2HKXA 3UKTA 5I8SA 2BNNA 2CAVA 1SEFA 4Q29A 3BB6A 5I8YA 3EBRA 3H1WA 3U0ZA 2MHFA 4MZUA 3LZZA 1O7FA 1Q3EA 4IEUA 3SCGA 3I54A 1NZCA 4XFAA 1GQGA 3CJXA 5I0UA 5KBFA 3ACLA 5C8WA 4MGIE 3H1MA 5FLHA 1LR5A 4HMZA 3KCCA 1YFYA 2V09A 4HBNA 4AXOA 2UYBA 4AVAA 2UY9A 1FI2A 3QOPA 2B8MA 2XHKA 3I59B 3R6SA 3USSA 1GQHA 1CAUB 2PA7A 4XFHA 1XE8A 1UPIA 2K0GA 2PHLA 4RD7A 1YFUA 3I59A 4XF9A 3KGZA 1CAUA 4Z82A 3CL1A 2QVSB 1L3JA 1OI6A 3ROUA 4XFGA 4EWEA 3H3ZA 4AQ2A 1J58A 3OGJA 4B29A 3RPQA 4ZU5A 2GC2A 5KHJA 3LA3A 5T3NA 1OFNA 1EP0A 1O3RA 1YUDA 2D5HA 1OD5A 4KWLA 4YRDA 3H7JA 1YLLA 1WA4A 1RUOA 5E16A 2PFWA 3E5QA 2DCTA 2PQQA 3WW4A 1NXMA 3FHIB 1ZZ6A 1QY4A 5BV6A 3E6BA 1DGRA 4R52A 4I09A 4QM8A 4XFIA 1XE7A 3RYPA 1YWKA 2EA7A 5JSOA 5J48A 1UCXA 2OA2A 4IEOA 4LLOA 3D0JA 3IDCB 2IXIA 2Y0OA 2OZ6A 2MNGA 4YNIA 3N4MA 1X8MA 3CO2A 4I2OA 2PAMA 4HVQA 3H8UA 3BPZA 4JV4A 3BALA 4D7TA 3LA7A 3UKNA 4BH9A 2GAUA 2VQAA 2XL9A 4QX5A 3EQEA 5JCTA 2Q0AA 3NKTA 4IEXA 5JSRA 4IEZA 4QGLA 2XL7A 2XGXA 3EJKA 2H6CA 1Y9QA 2FQPA 3IBMA 4E2GA 5JAXA 3KSCA 4H7LA 4X6QB 4JTNA 1RC6A 1PMIA 1ZZ9A 1XRUA 4A2UA 1I6XA 2B9UA 4F8AA 3VHRA 1LKNA 1J1LA 4XEZA 4R8HA 5HI0A 2CV6A 2ET7A 3L2HA 4DINB 4HVOA 3CEWA 3ETQA 3QACA 3SMHA 3RNSA 4D7SA 2ZKLA 1QXJA 1ZVFA 1CAVB 2VPVA 5LEJA 3FJSA 5J3UA 2ATFA 1CAVA 4KU7A 4HLTA 1G6NA 1RTVA 1UW8A 3OCPA 5FDBA 2IXCA 4GULA 4OFGA 3E97A 1O3SA 1ZNPA 1O4TA 4QGNA 5D1IA 3HQXA 3S0MA 3TNPB 2WFPA 2QJVA 1Y3TA 3FE5A 1VR3A 3MZHA 3UKVA 4PJYA 2I45A 5LRSA 4FAGA 3GBFA 1NYWA
chains in the Genus database with same CATH superfamily
4Z07A 2HYKA 3H3UA 3H0OA 4F83A 4CYDA 2W94A 4FOWA 1JUHA 1UYPA 1ULCA 4LHKA 1Q8PA 2VXJA 5FLIA 5FPLA 3A7QA 4NN0A 4Q4Y1 3WNMA 1VBE2 2VOXA 5CNAA 2XPJA 3IDBB 5T5JA 1HRI3 1YFWA 1G9DA 1QJU2 2WQ8A 4Y1ZA 2XJQA 3J8F1 4Q0QA 3KWVA 1VB2A 1YO8A 2IVJA 2XVLA 3T3YA 1GZTA 2HEYF 3N9NA 3FWEA 4ZY9A 4NRQA 4B4QA 3T4VA 1N3QA 4Y22A 3OUHA 2K9ZA 4P08A 2RS13 2P4EA 3C2UA 3ZKUA 2VVFA 2YV8A 5A1LA 1VMFA 1JYWA 5E89A 1CD3G 4W50A 4AAPA 1V00A 1GP6A 1N1YA 3VDCA 1M4WA 4CCKA 3DN7A 4QKNA 5LK7B 3TEZA 1O5UA 1DGRN 2CSGA 4LITA 4AHZA 3O1PA 3FLTA 5AVAA 2VO5A 1PZ8A 3WDUA 2JG8B 4LIVA 4CSWA 4IERA 2GN7A 5T50A 3ZM8A 4DEVA 3LFMA 3POSA 4Y4RA 3VKFC 1X7NA 4PIXA 5FK7A 1G86A 1ND2A 3AMPA 1FT9A 3N7JA 2VOKA 5CFDA 3J7MA 2MEV1 3U10A 5BY5A 1RMU2 2W3JA 3B00A 2R0HA 1FMD2 4CU9A 3THTA 3PIJA 3ELNA 2Y6LA 1UIKA 2CNAA 4PI0A 1L7LA 3CBNA 1CIWA 5DZEA 3CJIA 3L2YA 2AREA 3LWCA 4FPGA 5DDJ1 4FI9A 4BWOA 1BBT3 1XB9A 3W21A 3WUCA 1NLQA 1V6JA 3MIHA 2GMMA 3RJRA 3WG4A 1LOBA 5AC92 2A71A 3CMGA 1PVC2 3NW4A 4MYEA 5FYIA 5EQUA 3VBFA 1SG3A 1EYBA 1GYKA 1H8TB 1LECA 1UKGA 2XKOA 2JG8C 5A32A 4QWNA 1IKPA 2N7GA 4GJZA 4OMDA 1L7QA 2Q8CA 4D6SA 4IEYA 2ZKNA 3E5XA 4ISRA 4ZONA 5D8AA 4HVRA 3BODA 4ZPIA 4A44A 4K7JA 3OPZA 1S2KA 3K75B 4G4FA 3R05A 4H55A 1OXCA 4PF5A 3ZYHA 4AK3A 4AR2A 4COWA 5JZGC 5BYNA 1VBE1 2W39A 3OYWA 2EIDA 1AL21 1PO22 2RS53 1CAXB 2HWC1 1C57A 1DQ6A 3E1F1 3LAGA 1FPN1 4CUAA 5IFTA 4B4RA 5APAA 1SLBA 4FBFA 3RZKA 4J1WA 5BPXA 4FPFA 3KMHA 1ZRDA 2UY8A 1UY1A 2CY6A 1TME2 4FFIA 5F5QA 1CIYA 2DURA 2XQXA 3TOJA 4HKWA 2WWUA 4LEJA 1PNFA 5J7MA 1QXRA 2D6MA 4M3CF 5H9QA 3ZXJA 5FZ4A 2JDHA 3TN92 2DFBA 2J1VA 3RWKX 5KHGA 2XWJB 5FO7B 1IZ3A 5A80A 4QHZA 1OQ1A 2VUAA 4Q0PA 4PLMA 3ZFEB 4KG0A 2DTWA 1PHMA 2JIGA 2VZPA 1JW6A 1UNBA 4QPYA 4YGDA 2KM2A 3LQCA 4LMFA 4Y3OA 1VBC1 4JVAA 4BISA 1N1TA 1NCRA 3ACHA 2PAEA 5EIYB 3AL5A 2WO7A 3I3DA 3ZXLA 2F4LA 4COZA 1JN2P 1UY3A 4BMBA 1JH5A 4WV8A 4Y1YA 1RMU1 5C70A 1U5YA 4AYUA 1IHMA 2W1QA 1AR72 1N3PA 3KQRA 3QCWA 5L9VA 3EB7A 2K46A 1SPPB 2JICA 1A3KA 3AXEA 1DQ1A 3PTRB 5GLZA 3T09A 5FYCA 1AXZA 1F4AA 2UYAA 1QOOA 3WG3A 5A6YA 4Q4Y3 3KZ4C 4XZUG 3NNJA 2D6NA 1WW7A 1N1SA 2HH9A 2VZ3A 4NIGA 4UW4A 2CTVA 2WZPP 3LA2A 4YW3A 2BOIA 2IXLA 4QPWA 1L7RA 3ZFEC 4OHWA 1ZX5A 3AX4A 2H0BA 1JYCA 1JTZX 4BXFA 5CFCC 1QU0A 1DFQA 2ZXQA 2EXJA 5KHIA 5DUVA 3BKZA 4D94A 2VZVA 4RN5A 5L73A 4IETA 4DOUA 4JGYB 4J6GA 1ODNA 4WVWA 4EROA 5I8TA 4N9IA 1NCQB 2Y60A 1OH4A 5F3CA 3MIDA 1UYXA 2Y6GA 1A34A 2FZ1A 2D43A 4XJAA 5EV7A 2WT2A 2ZTNA 2VECA 2JKBA 1PO21 3WHUA 2QQNA 4CPBA 2YFUA 2BGCA 3IDEA 4RYDA 3CZJA 3O0WA 4P5HA 1QHDA 4WM8A 2EXIA 1C1LA 1URXA 4FFHA 1U12A 4RR3B 1GOGA 1HDKA 4UXAA 2WN3A 1F31A 3USUB 3NJYA 3SKJE 1ZRFA 3QH6A 4NIDA 2EVXA 2MEV3 2HYXA 4LHSA 5C4WB 3HN1A 2DYCA 1REFA 2VW0A 3JZVA 4RQPB 3UJOA 1WMDA 3CQOA 4ISQA 4XUTA 5FREA 2DVGA 5JDBA 3MI8A 3MGUA 2W0XA 3JCIA 1LENA 3BYWA 3TN91 5F3IA 3WY6A 2RJ2A 4RS5B 3MUY1 4JGYC 2AR6A 1IS5A 1NCQC 2ZX1A 1LGBA 4I02A 4WM7C 3S5QA 3OY8B 3VZMA 5BNNA 3GJAA 3J7NA 4QPIB 1ODMA 2VH9A 3VL9A 3T2TA 3M2MA 2E7QA 2YU1A 3B3QE 3P6BA 3TBDA 1WZXA 4UT5A 5FUIA 5I91A 5A7WA 2J42A 1PO13 5F3EA 2WWJA 2DDUA 2JG9A 3RWNA 2EIGA 3KS7A 3LPGA 1CZSA 5IAVA 4LK6A 5LBCA 3SEPA 4AQ6A 4WZCA 1Q8QA 3WG2A 4DIQA 1HRV3 1H8TA 3MLKA 4RQPC 5AVPA 4FOVA 4IESA 2W68A 3WLUA 4NIHA 4LORA 1AL23 1YIPA 3ILRA 2HWD1 4FOQA 4FPJA 3AZWA 2HWC3 1MZEA 4LNVA 1FPN3 1ENXA 1R091 3KQ4B 4E2QA 1I9RA 2GMEA 1JYXA 5GZFA 4XJ8A 4QXKA 5C8CC 3FN9A 3MIGA 4IEVA 4OUSA 5DQ0A 2D93A 1S55A 4GB31 5I0TA 5FY1A 1CAXA 4QPIC 1HB2A 1LODA 2BNOA 1DBNA 1X9PA 4XILA 1W6OB 1UO9A 1W2UA 4CU8A 1RJ7A 1PZ7A 2E9QA 3G7DA 4A6SA 2P1BA 2W87A 4PIYA 1LEDA 3R4UA 5IVBA 4F7ZA 2UU8A 5CB7A 3ZSEA 1CQ9A 3AK0A 3ASIA 4KG8A 1LEMA 1TQ5A 4RL7A 3WCRA 4JKLA 5ANNA 1HV0A 1CX4A 1VBC3 3B7MA 5F7UA 3TEXA 3MICA 1ZBA3 4OYUA 3BIWE 4JGZB 4C0HA 4Q1PA 2VTXA 1LHNA 3POIA 1RUNA 1LAJA 2BW8A 3O1SA 5FIXA 3WNNA 3V56A 2R7EB 1HXS3 2P3IA 2XJRA 4E9KA 4LO7A 4K6BA 4I01A 2J1TA 1GOHA 3MYXA 2DV9A 1F5FA 2Y6FA 2JE7A 4B3NA 5FZ8A 4HG6B 2CAVA 4K40A 4LE4A 1D4VB 4QU2A 3G6JB 2RG4A 2D6KA 2R32A 5LASA 5I8YA 1W28A 3H1WA 1JOPA 1AR92 3OBAA 5LA1A 2RVAA 1JYNA 5CZKA 5FZHA 3WX5A 3SCGA 5GZCA 2E7AA 2VNOA 4LQRA 1QJFA 2CU5A 2AEZA 4IV3C 3VB9A 4YZ5A 1YXWA 3M8LA 1FYUA 5F9TA 2VULA 2X53S 5LCWL 1US3A 4JGZC 3ACLA 5JXHA 5IVJA 1Z7S3 1B35A 5FYUA 4DRRA 5GZGA 5GLTA 5CBLA 2WAOA 2P6HA 3ZN6B 1MS4A 4HBNA 2WYFA 1QGLA 2BERA 2R16A 1GP5A 4GMP0 4UI9L 3U37A 2DF7A 1CAUB 2PA7A 5FJKA 1PGW1 1PIV3 1YFUA 1F2NA 3AKRA 4TZDA 5B4NA 3PUQA 4GQ7A 3CU7A 2WLQA 2QVSB 4C91A 4E4ZA 5FOJB 3EMRA 4DZGA 3Q9OA 3IKWA 1RUH2 4MXWB 5EJZB 5F3GA 1NUKA 1OFSA 3A23A 1BKZA 5EPAA 1WCUA 4AEJA 4EZ4A 1UX6A 3KCXA 2G1MA 4IE4A 5FWJA 4TN7A 2QQUA 5FYVA 1ASJ2 5B2GB 3ZLIA 4ZU5A 1UY0A 5KC5A 3LA3A 5IYYA 1OFNA 3UGFA 3BVCA 2J22A 1YUDA 2WR9A 5C4WA 2ZGSA 1EPWA 1OD5A 3DYPA 2BJSA 2YU2A 4YRDA 2WFF3 2WS92 4DUVA 1Q56A 1WA4A 1S0EA 3POWA 4OVEA 5A70A 4P00B 3HJRA 2A5ZA 4CP1A 2XWBB 5K0UB 2DCTA 4MHUA 4QKFA 3JQWA 4RS5A 4YVWA 3ILNA 1CPMA 4PI2A 5KXBA 2FCUA 2XR4A 1HN1A 4GXLA 1YWKA 4FFFA 3ABZA 5JSOA 2YZ4A 3OEAA 5FWEA 5SV8A 2XXZA 4LKSA 3OPTA 1POV0 1W90A 1BCXA 1JU3A 3IDCB 1Z0HA 3WINE 1W9SA 5ERLA 5FMOS 2Y0OA 1C8M3 2MNGA 4YGEA 4E4SA 1W2AX 3POJA 1PGL2 1UU6A 4XPVA 2HWD3 5DPNA 1PK6C 1KXGA 4GMP3 1F5JA 3VHNA 2C24A 1OUXA 2DCJA 1W0OA 3BALA 2YB7A 4Q2FA 4QQ2A 4YZ4A 5FPUA 4BH9A 4CVUA 4QX5A 1UZWA 4XDOA 5FZOB 4R9CA 3VD7A 1JUIA 2TBVA 3WXPA 5K0UC 1AX2A 1OLME 4GAZA 3S57A 4YLZA 3TYJA 5JCTA 2BU9A 4QGLA 1IS4A 4NIIA 4LO4B 4M0HA 4BA6A 2XGXA 3OEBA 1LU2A 4LBLA 3PMSA 1X33A 4A3XA 4LE3A 3HBKA 1HRI2 3EJKA 1B09A 1VPHA 5JAXA 1CN1A 1JU4A 4NOTA 4N7IA 4H7LA 3ZXDA 1LHVA 1W6OA 1RC6A 1ZZ9A 4JTNA 1XU1A 2E26A 4YZ2A 3QD6A 1EAH1 4IGOA 1EV11 2JDZA 5G04L 4O7XA 3OBRA 3N35A 1KGYA 4K1ZA 2GNBA 1J1LA 4TLGA 5CKQA 1W0NA 3CZUA 2CV6A 2RS12 4YVSB 2C1FA 4SBVA 3WNKA 5DG2A 5EXOA 3H8OA 3ZIWA 2HWF1 3ON7A 4AFBA 3VGIA 4BJ0A 1AR82 1YEWA 4CP9B 4A45A 2ZKLA 1NY71 4N90A 1BK1A 1IQAA 3ZPOA 4LBKA 3ZYBA 2ZZQA 4NAMA 4W8JA 5GALA 2RHPA 5KXEA 1CAVA 4AQTA 5CG8A 1OQEA 3WNPA 1GNZA 1G6NA 4CCDA 1BHGA 1W9TA 4QHOA 4FTBA 2CDOA 1WBLA 3IT8A 2JENA 4OFGA 1ZNPA 3GZAA 2YG0A 5IK8A 3DEMA 2BOJA 5K4LA 4KNCA 3S0MA 3LSEA 3TNPB 3ZFFA 1S0CA 5BNPB 1F8VA 2BFUL 3FC0A 4Q27A 4QDRA 3THDA 3ZN4A 1QJY1 1Y9MA 3IMMA 4YVSC 2QJVA 1K5MC 2XUMA 1BBT2 4EN7B 1JXNA 4Y5TA 1IG0A 3MZHA 2PLV1 3UKVA 4KWUA 3Q8AA 1XNBA 2VMEA 2A6XA 2R073 2R043 4IE5A 4OHYA 1LNSA 2L9LA 4Y5Z0 4RFT0 5LY1A 3GCXA 4BHPA 3P5BA 3B9CA 4CP0A 1H4HA 1BJQA 3K51A 4CU7A 1UZVA 1G9FA 3C3VA 4RGAA 2VBBA 5DUUA 1D0HA 2HBUA 5FZ3A 1MZ6A 3WW3A 1WD4A 5DAWA 5CU1A 5K7PA 1SBEA 4QXCA 1LULA 1NT0A 2HJIA 4LBMA 4COYA 5CG9A 1AL0G 5C3SA 4JDNA 2GU9A 2D6PA 5BNPC 2RS52 2YFZA 2YGLA 2GMPA 2YDEA 2A6WA 3WR0A 1ULGA 3HEIA 1CVNA 3PIGA 4ITCA 3V65A 4I30A 2HEWF 1GNHA 4AFMA 2ZGUA 2BVBA 2EIBA 1Y9GA 2NMNA 3DCQA 4YFWA 4CDUB 2Y6KA 3LGRA 1PM7A 5K9YA 2JJ6A 2XBO1 2RS11 2TNFA 2JXAA 2V4VA 1QQP2 3APBA 3FBYA 4UFMA 3BPSA 3VBHA 5EYXA 2PMWB 2PHFA 4PHZA 1XNCA 3H8RA 5FLJA 2DUOA 5ACA2 3ME2A 3MFAA 1V70A 2W1SA 2ZGLA 1Q8OA 1YIFA 1VLNA 4MGKE 5F2WA 1RGSA 3VZLA 1DZRA 4Q0UA 5CFDB 3N7LA 3IN9A 1KD7A 1UF2C 5ABJA 5BNOB 3V0BB 1SQ4A 2H0VA 1DP0A 1WMFA 4YPJA 5DAXA 4EWDA 3MBWA 4QX2A 1XC6A 4R4ZA 1GNYA 1OMIA 4QPGB 1Q5OA 1ZZCA 4D0QA 5FYZA 4MV2A 4CUGA 2A6ZA 5E1RA 2R063 1CESA 3C7FA 2J1AA 1KRIA 2VY0A 5IVVA 3EXUA 1EY2A 2JDYA 2X5IB 3LIGA 1RHI1 1SLAA 5LRRA 3RZMA 4BYYA 3THCA 1BBT1 2ZGMA 2OPWA 2V5YA 2Z69A 3NNGA 4Q4Y2 4A7YA 4A7ZA 4XBNA 4CDXC 5F37A 1O3TA 1ZRIA 3BIEA 5FYYA 5A32B 4FXKB 5BUVA 3CF6E 2OPKA 3AXDA 5D8AB 5LEKA 3AB0A 1ND2C 4EN8B 5CFDC 4YW2A 1EAH3 1LRHA 1EV13 1OD3A 3I2JA 3AP9A 1W03A 2Y33A 2WNUA 3O14A 1VMJA 1YJLA 2QNKA 4LIUA 1H1IA 1TE1B 4CPBD 4BE3A 3RYRA 1WLWA 5CKNA 2PAKA 4CCJA 1BEV3 1O5LA 4Q5OA 5A6ZA 4LO6B 1BVVA 2HWF3 5G05L 1XU2A 3CJIC 5FUPA 4UBHA 2ZHNA 2WWSA 1LOFA 3E6DA 4XFCA 2WZEA 4R9AA 2B5HA 4AHXA 4HK9A 2ZMNA 3ES1A 5FZEA 3BTAA 4QT6A 1OURA 5J09A 1RL3A 2WC2A 4K1YA 3VBFC 1LJ7A 4NAOA 3ZYPA 2X10A 3MPBA 2TEPA 2XLAA 5CVRA 4UFIA 3UESA 1PZ9A 1D2SA 4FOYA 2TUNA 4C1XA 1R083 1X8EA 2RDNA 4ZXKA 3SITA 2MEV2 1W9WA 5D8AC 2B4KA 4JCKA 3T08A 4EV0A 5IJRA 3L9JT 1UIJA 2YPJA 4AI8A 1C28A 2D97A 2NN8A 2QTWB 1W9FA 4QX1A 4A41A 4K8FA 3WDWA 3OSDA 2H6BA 4PDWA 4ZU4A 3SISA 2XJSA 2XB6C 2WQZC 1NE4A 1MEC1 4Y24A 2PTMA 3OUIA 2O8OA 4XXPA 1ZRRA 3O1OA 2VMHA 2BQPA 4Q4X1 2P17A 5FK8A 2ZABA 1CR7A 5FRAA 3THPA 3PHMA 5A3LA 1UX7A 2ARAA 2VZ1A 3DYMA 1JZ2A 3GGLA 4FCAA 1AR63 2AC1A 1LESA 2VOTA 4FPHA 3RG0A 4KL1A 1OPOA 2CAUA 2OUHA 3WDXA 2EIEA 1LOGA 3WNOA 1RUG1 4ATFA 3OGVA 1ENRA 2QDNA 2XH6A 2Y64A 4XQDA 1JBCA 2BDRA 3H50A 1OKOA 2G9FA 1GUIA 3KCYA 4UFHA 2JDPA 3VDDA 1KITA 3WP6A 2B42B 1OHFA 1IPKA 3BOPA 1AL22 3JBG3 4YW7A 3WQ7A 1GP4A 3EO6A 2HWC2 2FDIA 2B46X 2A3YA 1FPN2 1NCRC 1Q43A 1H2KA 2VOVA 4HXCA 5A1AA 4PCRA 2ZGKA 1GZCA 1RVF1 1FOD1 2I07B 4URAA 4KWKA 2Y0IA 2P3YA 2YHJA 4HT1T 5TSWA 1DYOA 5C5UA 1VBA1 5FFOC 5F1RA 1QDCA 2XBO3 4IEQA 4KGQA 5DXDA 5FP7A 3VD4A 1W6PA 3B69A 2AH2A 3BTZA 2IC1A 2O14A 1K12A 2V5DA 2DFCA 1I3HA 3RMYA 4CDUA 1X9TA 4WM8B 2GP5A 2C4XA 2RS33 2BFUS 1WUVA 2Q4SA 4HONA 4YWAA 4NWVA 1W6QB 3VD3A 4FPKA 2JX9A 3PUAA 5EFUA 3U11A 1O3QA 1OA2A 1VBC2 2VZQA 3FZ3A 3KLSA 5HXMA 1V6KA 3AZXA 2AACA 3BN6A 3JUUA 4XHBA 5EP9A 1YQ8A 3HQRA 4FFGA 4LA2A 1MS1A 4V2VA 1K42A 4XAEA 1F15A 5FQ0A 5FPBA 5BNOA 5CYYA 1AJOA 2W95A 2YC4A 3V0BA 3O1VA 3LEMA 5A6QA 1H0BA 2GC1A 3UL2A 2EAAA 4UF0B 2GNTA 3H9AA 4DXZA 5BNNB 3RZGA 5FZGA 2PHTA 1RHI3 2VQ0A 4KWJA 1OVPA 4QPGA 1KEXA 4RSUA 5FPVA 4CTEA 3UJQA 1DDLA 4CXWA 3MO4A 2WSUA 5GLWA 4TLFA 3WSOA 4KGGA 1D4M1 2RDRA 5L9RA 5FZ0A 1T6GC 1DYPA 5A7WB 1J3RA 4KI5M 5FXZA 1KS5A 2WO2A 1UOFA 2JG9B 2X5IA 2O0OA 4UFKA 4WM8C 1E57A 4Y20A 5F5IA 3AP4A 4B4PA 3VBUA 4L2NA 5M0TA 4PT6A 4BQ5A 1U5XA 3GF6A 3TNQA 1PO11 4MH0E 3DV8A 3N7KA 1Z7S2 3IIIA 1QNYA 2WDBA 2D6OX 1DCSA 1WD3A 4ONUA 3KM5A 1UOJA 3W59A 1HRV1 1SBDA 1HQNA 3WF1A 4BOWA 2WZ8A 3D0SA 3VKNA 3U4SA 3VDAA 3ACFA 1R1A3 5GLVA 4EJRA 2W92A 4OCTA 1T6BX 3ZYFA 3POEA 5BNNC 1PIV2 1PM4A 1G9CA 2AUYA 3AL6A 4IEWA 3GDBA 1TMF1 2D7FA 1DGWA 1XYOA 1REDA 4L99A 4V1PA 1A6CA 4NROA 1C5HA 3BI3A 3SEEA 4HPKA 3WVJA 5C6CA 5DZGA 2JG9C 4DUXA 2VZSA 4CP2A 3LOBA 4QX7A 1GMMA 1UU4A 4YW6A 3ITQA 2XLFA 4LBQD 1HJGA 2MPFA 5ANQA 1H8TC 3RI9A 4QQHA 1EUTA 3NV2A 3LDBA 4QX3A 2W1UA 3S7IA 4AEMA 3CLPA 3AMHA 3HN3A 3MFCA 2BBAA 3DKQA 4GWNA 1DGLA 1RUD1 4FT8A 1COV3 2ZMLA 2WIIB 3K4ZA 1IOAA 5FZDA 3S7EA 3SHRA 5F39A 1MEC3 2D3RA 1ND3B 3RZZA 1BMV1 1PNGA 4NPRA 3VLBB 1ZBE3 3BTXA 3PJQA 1ZBA1 3J4UH 1W04A 3ETPA 4C90A 4Q4X3 4B1LA 1BXHA 4L0PA 2YC0A 2ZGQA 1S2EA 1BYHA 1HXS1 4I0BA 2JD4A 1ULDA 3POBA 4QKBA 3UKTA 2BNNA 1GV9A 5T55A 1S0FA 2PHRA 2WO3A 4MSVA 3ZXGA 1RUG3 3C7OA 2RJLA 3WP5A 2OT7A 2ES3A 1W0PA 4N43A 4D8MA 1C8M2 4HANA 1SZBA 1IGOA 4B7EA 1R64A 1YQ2A 2OQ6A 4AI0A 2RM21 4QB6A 3I49A 5JIUA 3I54A 1JODA 2CWMA 2HWD2 3WF2A 2B9VA 1GQGA 1R092 3AP6A 1B35B 1RVF3 2YY1A 3AKTA 1FOD3 4MGIE 3RQ0A 2VCCA 4XTPA 5FLHA 4GB32 1VBA3 1M06G 4HMZA 3KCCA 1AJKA 5A7NA 2V09A 4MOAA 4XAAA 1Z7S1 1JZ3A 2UY9A 5FP8A 1RUF1 4BZ4A 3QOPA 2VXRA 4N7UA 5FMOL 1W3VA 2B8MA 3R0RA 4UYBA 3R6SA 3NNMA 3F95A 5LA2A 3SKVA 2V4AA 4LK7A 1UPIA 2PHLA 1RUJ1 3VBSB 3I59A 3RSJA 2QQKA 4IGQA 4XUQA 4YW1A 2R49A 2JECA 2WT1A 3MIBA 4XACA 4XJ9A 5FY7A 3ZMNA 1PIV1 3K3OA 5GLUA 3P1IA 2EALA 2UWAA 1L3JA 1OI6A 3CIHA 1WKYA 3AKSA 5KXCA 5LZ6A 5FXVA 4CU6A 4UOJA 3VDBA 4NHYA 4KBZA 3LEKA 3D3AA 2HWB3 4N8MA 1W6QA 4AQ2A 3WF3A 1QDOA 3JB4C 1GFF2 4AG4A 4B29A 1B35C 4XE9A 2UWCA 3RPQA 4HL0A 1W8FA 4JRLA 5T52A 2GC2A 1E5RA 1O3RA 1KDMA 4KWLA 3PU3A 1RUOA 1UMZA 5C9AA 4YVWB 5C71A 3M7AA 3LDRA 3K3NA 1GICA 1U5ZA 1UAIA 2UURA 2PQQA 3K46A 1GWKA 1WCKA 1D4M3 1F9KA 2WFF1 3MPPG 2VD7A 4NHKA 2JB4A 4UF0A 1ZZ6A 1QY4A 5D2AA 5JWPA 3PVNA 2ILMA 4XFIA 1Y43B 3RZLA 4Y1UA 2P5BA 2D44A 3KV6A 2QQIA 2BWAA 4LLFA 4D7YA 4FVVA 5J48A 2ZX0A 3OPWA 5HCAA 3GZUC 2YXSA 5C33A 1VAMA 2IXIA 1JI6A 3Q8FA 5DABA 5F5AA 4RR3C 1YYNA 3IDAA 3ZKYA 4XDPA 2Z42A 4UFLA 4YNIA 3LKJA 1DQ4A 2PAMA 2QQJA 4XURA 3U14A 1HQWA 5C4WC 5L36A 1C8M1 1J83A 4YGCA 1JZ4A 1SLTA 2R072 2R042 3IPVA 3KT1A 4JV4A 1CJDA 4NIAA 3JD73 3FMGA 3LA7A 3UKNA 1PGW2 4GMP1 2OKXA 3VZNA 1GU3A 2VQAA 4LOTA 4AOCA 4RS5C 4YVWC 1TMF3 3TAYA 1VB4A 3QLQA 1J1TA 1QIQA 1SHWB 1SCSA 2XJTA 3H3LA 4JX0A 2ZX3A 3WDTA 4MGQA 1VAKA 4N53B 3IBMA 4WVMA 4XQWA 4E2GA 3KSCA 3ZIXA 2IUWA 3HWJA 4NWWA 1XRUA 1RJ8A 1QMJA 3M3EA 3R4SA 1W8OA 3RS6A 2B9UA 2UWBA 3B01A 4Q4W3 3VHRA 1RUD3 3NNFA 3RZJA 3LDKA 2VMIA 4R8HA 4XCBA 4XEZA 3RFRA 1S0JA 5FBZA 3LEGA 4JAAA 5HCHA 5JXJA 5LB6A 2G19A 2VBDA 3CEWA 3MF9A 3NAPA 3QACA 5FKCA 3AP5A 1CWPA 4P9IA 3NV1A 4R9BA 3AM2A 5LBBA 2G4IA 2R1DA 4AVTA 1CAVB 1ND3A 2GSYA 2VPVA 1MZ5A 3NKGA 2ZGPA 1OOPA 4LBNA 4ZXEA 4BIOA 1JZ8A 1HIXA 4OHXA 5JOZA 1V6NA 1WLCA 1W99A 5T5OA 1OPMA 1POV1 1UW8A 3AFGA 3O7OA 2IXCA 5GZDA 4QU1A 3SH5A 5FZFA 4GULA 1JHNA 3E97A 2RM23 1GWMA 3ZFFB 2PN5A 4Y33A 3VKOA 2YROA 3WDVA 1W8TA 4QGNA 3DXTA 1JOBA 5D1IA 1MVQA 2WKKA 3GHMA 3FUOA 5JI9A 2WFPA 3I2GA 4NHLA 4JDMA 2ORZA 1WW4A 2R062 1PX3A 5JR2A 3LFIA 2F6BA 4GZ9A 4EE2A 4RHV1 5CAZA 4HKLA 1RUF3 4O61A 1H6YA 1MS5A 4BQ2A 4P9WA 4P9LA 4P14A 2ZAHA 3HNBM 1JZ7A 1GZWB 1XXNA 4OI1A 5HBAA 4DEQA 1XSRA 2ADDA 1NYWA 1RUJ3 2PQSA 2WNVB 4FP3A 2R071 4HZFA 3T0DA 2Q1ZB 2R041 1UN1A 2I2SA 2JDMA 2VMGA 1GKBA 4MGYE 5E8AA 4AL9A 4E4DX 4E8DA 3MHZA 1EAH2 1CONA 1EV12 4O9EA 1ACCA 1Y7BA 3AYDA 1TG7A 4XF1A 4EWAA 3GJBA 5I0SA 3VBSA 1UYYA 2D98A 1NZIA 3ZFFC 3PVEA 3M4FA 4HN1A 4JHTA 1UKRA 5IATA 2Q1FA 1ZZBA 2HWF2 3KGLA 2Z2SB 2JKXA 3WHTA 3MLLA 4Q1RA 2AEYA 1NY72 3VBOA 3I3MA 1Q8SA 1O8PA 4DXTA 4WBBA 4DMIA 2JIJA 1XNTA 4QQLA 5KHKA 1ENQA 4MO3M 4LKDA 5LBFA 2RDSA 4DQAA 5EJ1B 3N9MA 3FFQA 4BQ4A 2GDFA 3VBHB 5J1XA 4R9DA 4QQPA 2XKPA 3PNAA 2ARBA 2P37A 2IZWA 4CEYB 2DVBA 4JRAA 1R082 1A8DA 5JUVA 3ZFGA 4JC1A 2JDAA 4KH9A 2QBXA 4X6RB 4OLLA 4Q0SA 3WF4A 4YM3A 5FJHA 4KBBA 3FHQA 3EHKA 5ABJB 2WBKA 4MADA 5IT6A 2ZGOA 1QJY2 5H9SA 4JQRA 3D4KA 1O4YA 4NJ4A 1UXXX 1DZTA 2B7YA 2E7TA 2ZBJA 4BMEA 4QHBA 1DYKA 2O1QA 2PLV2 5F5CA 4MUVA 1KDKA 2RR11 1ZA4A 2ZAAA 2Y8KA 4K3UA 2ZJCA 2EXHA 1UY4A 3SXWA 2DWRA 4QMAA 2FDKA 3TRSB 4HSJA 2BTVC 3WW1A 1NA1A 3VBHC 4X8NA 5J96B 1YI9A 2HWE1 1W8WA 2GC3A 3AP7A 2R061 1AR73 4UW5A 1V6LA 4IE7A 3NV4A 5EYYA 4OQ9A 2QZ3A 2Z4FA 3PJYA 1G9BA 1OF3A 3RVHA 2LRPA 2XUEA 2ZCWA 3H7YA 5FYMA 2A3WA 1QF3A 3HPNA 2WLPA 2WNUB 3JBG2 5ABJC 2XJPA 4IDZA 2JDKA 3W20A 4E2SA 5C3OA 5ISLA 2IXHA 2WA4A 4N53A 4A4AA 1J3PA 4MX3A 1H2MA 1LCLA 3NMBA 1WLTA 1AYM3 5C3QA 2BBVA 2YMZA 3AVRA 3WW2A 4W6XA 3AMNA 5JSPA 2XBO2 2ZA9A 4GIQA 1BEV1 1ULEA 4GA9A 4ZZ8A 2VW1A 5FV3A 3VV1A 3ZSLA 3GM8A 4NVPA 1UMHA 2ARXA 2R1BA 4DNYA 2ETEA 2RS32 5C5TA 2WL1A 1W3XA 1GLHA 4UAPA 3OD0A 2ET1A 3A21A 4B7KA 4XHXA 1POV3 1VP6A 2BPA2 5I0DA 2VL4A 3RJ2X 4CCLA 1JYIA 1S0IA 4BK5A 1FATA 4FQ4A 2WNUC 1SDDB 1ZYBA 5IHRA 1DG6A 1R081 1VJ2A 3HQUA 2D5FA 4HK8A 4MLOA 4PDWB 1NLRA 4H3WA 1DQ0A 3PVOA 2KA3A 4XC9A 4LUMA 4OZXA 4XUPA 4Y26A 5HPOA 1GOFA 1ULFA 3O0XA 3POGA 3UK9A 4ZU7A 5L7OA 1K5JA 1LOFC 4XBLA 4RHV3 3WZ1A 1ULPA 4AF9A 3N9QA 1RHI2 1YI7A 3WOGA 2XOMA 1HB3A 4PIZA 5LATA 1RUI1 2E51A 4LXLA 4Z8BA 2OZJA 1EPZA 4S2HA 2PXJA 2XLGA 4NO4A 4AAXA 4Z1VA 2QCSB 1LOEA 2C0ZA 2BWCA 4OI2A 4OHZA 2QDRA 2Q8OA 1UY2A 4CDQA 2GP3A 5IK7A 2RE9A 4K8RB 2VUDA 5FPXA 1GZWA 4NRPA 2EXKA 2YC2A 3CDZB 1DU3D 2VTXJ 3MDPA 2WNVA 3SLIA 1AR61 1W39A 3VDDB 1VBD1 2IXKA 2VNGA 4LOSA 4Q4V1 5JR7B 1UWWA 4CE8A 1W2NA 4PDWC 2ZOEB 4LULA 1OLMA 3MIFA 2ZEZA 3UNPA 2D3SA 4XBQA 3W9AA 2EF6A 1R1A2 5IFPA 3JBG1 3ZDSA 1XNDA 2VR4A 1QWRA 2ZGNA 4J25A 4QDSA 5A6XA 2VNRA 4U36A 1W6PB 4J1XA 4O65A 1XBFA 2C26A 2XVKA 5CADA 1J3QA 3DPRA 1FXZA 3CKHA 4COUA 4XCAA 4P9JA 2ZACA 3VL8A 3NVCA 1RB8G 1C3HA 3W58A 2JB8A 4IV1A 3I7DA 4MVTA 1MQTB 1QJX3 3GXUA 1RUE3 1H2NA 4CEYA 4ZHNA 3BU0A 2ZPXA 4AGVA 3VDDC 1SFYA 4D69A 2RS31 1WBFA 3I3EA 4EZHA 3N36A 1N47A 1SMVA 1COV2 1R1ZA 5F32A 3OUJA 2OVUA 5FZ9A 2FDFA 1MEC2 3AMMA 4XETA 2RR13 5FQ0B 3T2OA 2LW8A 4GH4A 4AGGA 4F3JA 4LT5A 2NM1A 1H8VA 4QGMA 1IKQA 4P5YA 3DUIA 4Q4X2 3P3PA 4BK4A 1DZQA 5EZWA 3Q8CA 5KC6A 4NMIA 1BK0A 3F2ZA 1RINA 3VUOA 1S0GA 3M3IA 2FMYA 3FFZA 4XF0A 1LHOA 3O0VA 2HWE3 4C8DA 1RYYA 2BVVA 5CISA 3GALA 1IPJA 4M3CE 3NJVA 2LS6A 1RUG2 5FY9A 2IXJA 1K3IA 2VM9A 3T1LA 2IFWA 1VRBA 3GYDA 1UZ0A 4Y20B 5DAQA 3N9PA 4SLIA 4YSFA 4YW4A 1MS8A 2IVIB 2O8QA 1S2BA 3UGHA 2DBNA 3VBUB 4BQXA 4CZSA 4Q8KA 5I0RA 3JQXA 4L9BA 4NRMA 1PMJX 2QQMA 4COVA 4IUGA 4OMCA 2Q30A 1WW6A 3B02A 5IW0A 4ARXA 3LOIA 3E6CC 2E33A 3KV9A 1HQLA 1UD1A 4PQQA 4TSVA 1RVF2 1FOD2 2CHHA 2ZEWA 3S6PA 4JHZA 4PQ9A 3TWIA 3ZSJA 3HNMA 5BNOC 2VVEA 1VBA2 1W6MA 2W52A 3AC0A 2DU0A 5A33B 3LPFA 4NUBA 5GKAC 3WEZA 2XVGA 5GZEA 5A3PA 4EYUA 1H1MA 3WG1A 3I3BA 4YZ1A 4QPGC 3BUCA 1MS9A 3HT2A 4YG3A 5F6KA 4TXWA 1W6NA 2SLIA 4IGPA 4QQOA 4LHNA 2OYZA 4NR1A 1TNRA 1HN0A 1KFUL 1O91A 1VBB3 1R1A1 4LBQA 3K48A 1SBFA 5FPAA 4HPKB 4FPCA 4XF4A 4B8EA 1VMHA 4MXVA 4RGKA 1UU5A 2J1SA 2X5IC 1HW5A 1WMXA 2AZ5A 5FR3A 1N3OA 3AVSA 1D0GA 3SCFA 3VBUC 1OA3A 2YBKA 4YYOA 5I93A 1O6UA 1AYN3 4K20A 4ZKTB 3IWZA 4UBGA 3RGBA 4LJHA 1FAYA 1OLQA 1TVGA 5FYBA 1S4CA 3LIHA 4Q0VA 1DHKB 3ES4A 4OULA 4UWDA 1RUH3 2IWGB 5KXDA 3I2IA 3O12A 2OX0A 5JPNB 2NP0A 3N7MA 1T2XA 3AJZA 2XG3A 3E5UA 2Z5WA 3A0NA 5FZBA 4ET7A 1COV1 2VU9A 1MZFA 1RUI3 5DAVA 4QKDA 1D4M2 4W65A 3A0KA 1G7YA 4PLNA 2WS93 3LCPA 1ZBE1 5FUNA 4EN9B 3OGRA 2QQPA 3DF0A 1J84A 2HLEA 2NPIA 2FMDA 5C3RA 4HN0A 3T1MA 3ZXAC 3LSDA 5I8SA 4GALA 1SEFA 4FQZA 3U75A 4N43B 1WCDJ 3FUQA 3PUIA 4FPOB 2ZHMA 4D6QA 1D2QA 3AYEA 4OI4A 3T0BA 1PO12 3EBRA 3KT7A 1VBD3 1W8HA 1C8NA 3GZEA 4FPLA 4NPMA 5A3OA 4B1MA 1QXPA 2MHFA 2J1UA 4I3GA 4Q4V3 2HEVF 3LZZA 2P34A 4MZUA 3RMXA 3ZYJB 1O7FA 1Q3EA 1HRV2 2JD9A 5GM0A 1NZCA 4V2WA 4ASLA 4NPLA 2RDQA 2FZ2A 4XFAA 3ALQA 3TEWA 1QOSA 1PVXA 5KBFA 3JD72 2VZRA 3CHXA 1UQXA 4AEKA 5A3TA 5C8WA 5IK4A 5JMCA 2WZR1 1TMF2 3WD5A 1HLCA 1LR5A 2OS2A 3O5SA 4XQ4A 1YFYA 3FL7A 4Z92B 2UYBA 1FI2A 2C6SA 1H9PA 3WUDA 1IS6A 1W2OA 2XHKA 1PX4A 3I59B 3USSA 1GQHA 2R30A 3N9OA 1V9U1 2K0GA 4RD7A 4CEWA 2WAAA 4WZFA 1STMA 1ZM1A 5JMOA 1AXKA 3K2OA 3KGZA 1OBNA 4N43C 4QDQA 2E32A 5EWSA 4Z82A 1FV3A 4ZS3A 4XVHA 3N3HA 1S0DA 1QH7A 1ZA7A 3VBRA 2DU1A 4QXHA 5JPMB 1AVBA 4Q4W2 1RUD2 3H8XA 3I2OA 2FCTA 1MQTA 4CA9A 4CXYA 1BMV2 4MG2A 4CUCA 5FZ7A 1JMUB 4MHRA 4AI2A 3JXSA 1J58A 2VUCA 1ZBA2 3C7GA 1U0AA 1I1EA 4LHLA 1DIWA 4BU2A 3D8CA 5FYTA 3POFA 5FZCA 4U2AA 2HWB1 5KHJA 1VRH1 3JU9A 5FY8A 5T3NA 1HXS2 5C9AB 4XMAA 4CDUC 2Y34A 4WVVA 3H7JA 2LALA 1YLLA 4W6YA 3ZYRA 1AR83 2ID4A 5E16A 3U1XA 2PFWA 1Y4WA 2VNVA 3WW4A 2A7AA 3RRDA 3PU8A 1GQPA 4CDXA 1JYTA 5BV6A 3E6BA 4YM0A 5SV5A 2RM22 4I09A 1C4RA 4QM8A 4MGTA 3NWKA 3RYPA 1WWYA 3ZVXA 1Q8VA 3VD5A 4AI9A 3GCWA 1UCXA 2OA2A 2RMU1 2BV4A 4GD4A 4TYSA 4FTSA 5JZGB 3N4MA 1X8MA 2VMDA 1BLZA 3IPVB 4HVQA 1RUF2 5FZIA 2Y38A 3H8UA 2VZTA 1GBGA 1HX6A 3BPZA 2Q8DA 5IVFA 3HOBA 1LTEA 4GWMA 3S30A 5C9AC 3ILFA 1RUC1 2E63A 1RUJ2 2GAUA 3I3QA 4XMIA 3C7EA 4QB1A 5FZAA 1AF9A 1TNFA 5A33A 3PTYA 1SACA 2VC9A 3JD71 3KHBA 3ZSMA 1ENSA 1QOTA 4PLOA 2Q0AA 2WT0A 3DGTA 4CCCA 2IFRA 4WVMB 4QD2A 2I74A 2PHXA 4X6QB 3WQ1A 4CDWA 3AYAA 1JYVA 1UXZA 1W8UA 2CGNA 5A7OA 1UOGA 2WO1A 3HVDA 2NZ9A 4BDVB 3PURA 3HR9A 4F8AA 1LKNA 1DQ5A 2WQ4A 1XOYA 3NAPB 5IVCA 2VAUA 2B45X 5HCFA 3K4AA 4Q4W1 1QJU1 1OLRA 3B93A 3L2HA 4DINB 5FO8B 3S5AA 3PUHA 4HVOA 5LWBA 1OUSA 2WFF2 5JIAA 2WJSA 5J98B 4D7SA 4ATEA 3KB5A 1OOPB 1DGWX 5JOYA 5DAPA 2X09A 3UYJA 1ZVFA 4XZPA 3T4HB 3OB8A 4FPEA 1QQP3 4AEDA 3MUZ1 4YZ3A 2CDPA 3NO8A 3HNYM 3VZOA 4AFAA 2DVFA 4HLTA 1MS0A 2OXBA 4CCEA 1KJLA 3OCPA 5ACA3 4JKMA 2ZX4A 1W9YA 2HBTA 4S2FA 5GJ6A 5CFCB 3URFA 3C8XA 3FLRA 1UPSA 2E6VA 1GZ9A 3I2DA 3U78A 1N1VA 3NAPC 4HKOA 1REEA 2WZR3 4GWJA 5KR7A 1Y3TA 1VR3A 1APNA 1K45A 2QQVA 1CX1A 4GKXA 4FP2A 1FMD1 2YUEA 1ND3C 4INDA 5LA9A 2I45A 4DXRA 3LD8A 1HB4A 4CUBA 1OOPC 3I8TA 5LRSA 3IM0A 3SC7X 1UL9A 4IW3A 2QQLA 3GBFA 4FAGA 3DECA 1V9U3 1QJZA 5BNQA 5AFEA 2NQYA 3PLQA 1FX5A 2AYHA 2ZGRA 1OVSA 4XOGA 2JDNA 1ZRCA 4XUOA 4BIFA 2PYTA 4XUNA 5FKBA 2Q5TA 1VALA 5AC91 4AVSA 4M0NA 4O9GA 2BUKA 3IIAA 4L11A 3X29B 1PVC1 4H2AA 1OH3A 2C5DA 2ARCA 1CPNA 3J8F3 4MGZE 3BGAA 4AGRA 1AYM2 3WQ0A 3BCWA 3BOWA 1KQRA 1W8NA 1CJPA 3LEIA 1TZOA 1QNWA 3VBOB 5J36A 2D6LX 3VKMA 4P02B 4OI0A 3WNLA 3PUSA 5DUXA 1VRH3 2ZMKA 5JXIA 4ZS2A 2VCAA 3KF5A 2RJKA 4LKEA 2FDHA 5LA0A 4Y1XA 4WM7B 3ZO0B 4IE0A 4BQ3A 2J1RA 4AQSA 4ES8A 3DKWA 2BEOA 3N9LA 2YBPA 5A3NA 2XJUA 1PGSA 5HXVA 2NLRA 2RV9A 3R4DB 4XW3A 3ACGA 1LU1A 4XFBA 3ZFGB 3IB3A 2W47A 1FNZA 2KR2A 3D6EA 5FOBB 4QAWA 1GSLA 4CP9A 3ZXFA 4LTAA 5CIRA 3VBSC 1MACA 1TME1 2RMU3 1RITA 3PVBB 4AVVA 3HD8B 3SCHA 4DB5A 2CL2A 1H1AA 3J7HA 3QBQA 3GNEA 1KFXL 4PF1A 3KHCA 4H14A 2JG8A 5IVYA 3WQBA 2KXLA 2GZWA 1OA4A 2WSVA 4LBOA 1DF0A 4RHV2 1LHUA 3VBOC 3Q8BA 1X82A 4DO0A 4LO5B 1ZZ8A 3MW2A 5D21A 1E5IA 2VBPA 3B9IA 3ORJA 4JDOA 5DDJ3 4OZOA 1RUC3 4QXBA 3WNXA 5C8CB 3WT3A 5JZGA 1NA1B 1OSGA 4AHYA 2PHWA 1GANA 3ZMOA 1OKQA 1W2TA 5FZ6A 5A3MA 1WGPA 5BXXA 4AE2A 2DCYA 2JDUA 4Y1VA 1W06A 2ZX2A 3FBMA 2W46A 3HBZA 4EN0A 1HV1A 5LK5A 5AFBA 3ZFGC 4CCOA 3HT1A 4P9GA 3WP3A 1AR71 4DY3A 4XABA 4BQ1A 3NSTA 3H1YA 1XQNA 5FZ1A 1NE6A 4YARA 3ZR5A 4AZZA 5A1FA 4AFCA 3ENRA 1LHWA 2BRTA 4LO8A 2LUWA 2JE9A 3VD9A 2A70A 3H42B 2YBSA 1VBE3 2WNOA 1XYNA 2A3XA 2F17A 3D5OA 3KV4A 1TEIA 5K8SA 2XQRA 4Y4YA 1QJU3 5JI7A 1I5ZA 4N9HA 3O1TA 4ZZ5A 1CAWB 1HB1A 1XNKA 1ALYA 4GWIA 1AYM1 5JOWA 1I5PA 3INAA 1NA1C 1LB2A 2LTNA 2A73B 2EICA 3FX3A 5HV0A 1SLCA 2D40A 4BLJA 2W91A 1QJX2 3MW4A 2W5FA 1WLDA 1RUE2 4HSLA 1LGNA 4JQTA 3ZYGA 1WW5A 4WVZA 5FAXA 2Z79A 1WA6X 3Q8EA 5IVEA 4CXXA 3OG2A 1OC1A 1LOCA 1NKGA 3D82A 2QKDA 5FBJA 2FD8A 4IV3B 3DL3A 2RR12 4G9SB 4N53C 5JXGA 2ZEXA 3PL0A 3O1MA 4FSJA 2X8KA 3NJZA 5L7OB 2F4PA 3MV11 4LBJA 4QX0A 3OTFA 1E5HA 4W6WA 1QKQA 3ZFEA 3GBGA 5CFCA 5A7SA 2FDJA 2CGPA 1RMU3 3M3CA 1FMD3 2HWE2 4D6RA 2XHNA 2ENRA 3K77A 3RYKA 1V0AA 4XFFA 4L97A 2ERFA 5DN2A 2XMLA 3ECQA 5LW9A 3OBZA 1O59A 4CDQB 5CKMA 3VKLA 2FDGA 3WF0A 2ORXA 5CA6A 2QE3A 3AZYA 5EHDA 2YYOA 2BGPA 3MLJA 2BNMA 3PDQA 3UGGA 3VN4A 2PHDA 4GJYA 5FPZA 3BU7A 5AC93 1YQ5A 2B39A 2R0FA 4LUKA 3I97A 5T54A 2Q1MA 1NQJA 2VVDA 3I2FA 1PVC3 1SPPA 4HETA 4RA0A 4META 4OUEA 5FZLA 3NNLA 2W1WA 4MGSA 4P9XA 5F6LB 2BYVE 1YFXA 1NLSA 4NHXA 1W05A 2P3KA 5DZFA 5FMBA 4A3ZA 1BEV2 2PHUA 5L7OC 2W2IA 1VE0A 4IXLA 3WCSA 4ORFA 2OQ7A 3RDIA 3M3OA 2LROA 4QM9A 2GH8A 3I2KA 4Z2AA 1A78A 2E53A 3SH3A 4IL7A 5A3WA 3AKQA 4I0WB 3DPRB 3MV01 4A6OA 1VBB2 2NMOA 1JS9A 2NYYA 4A7KA 4LPLA 1AHSA 4IEPA 2BGOA 4I0AA 1PO23 4JGYA 1NAEA 5FP4A 4XF3A 1NCQA 4DRVA 4CDQC 3JB8A 1Z78A 4IV1B 1OQDA 4WM7A 5FYSA 4ES9A 4Y5SA 4S2DA 1X50A 1CGPA 1AYN2 4FTEA 3AJYA 5A3UA 1DLCA 2A75A 1ZZ7A 2WNVC 4JTOA 4PBOA 1O8SA 4KU8A 1TME3 4K9SA 1QH6A 1ZREA 2ZZJA 3OBTA 4E8CA 5H9PA 3OD4A 4I3PA 2GC0A 4R4XA 3KD4A 2WYSA 1QJX1 2LM3A 2QFEA 4AVBA 4FAHA 1RUE1 2R6QA 3P3NA 4GH4B 2PELA 1SLIA 3EYPA 4RR3A 3ZX7A 3VHOA 1PK6B 3SQOA 3USUA 4XJZA 2D3PA 3TN93 4NE9A 4XJUA 1RUI2 4RQPA 1BQPA 1WCSA 1U5IA 2OW4A 2CWSA 2P2KA 1EUUA 3O1UA 3AKPA 3DPRC 2ZHLA 1UYZA 4LA3A 2ZEYA 1RXGA 3OGGA 1H6XA 1MS3A 2ADEA 5FCCA 2DVDA 5HV4A 3TEYA 1SCRA 2XDVA 4BQYA 2WN2A 3O1RA 2AENA 1XE0A 3UT0A 3ZXKA 5C8CA 2GH2A 1MPXA 4IV1C 5FZKA 1AR62 3OY8A 1PMHX 1VBD2 4RGGA 5E88A 2GNMA 2QZ2A 2V73A 2P3JA 4QPIA 4CEYC 4QX8A 3RI8A 2JWPA 4Q4V2 4E27A 5DG1A 1SFPA 2K2SA 4M00A 3PMEA 1HJFA 4X8PA 3UV9A 4AW7A 2Y26A 4ASKA 3M3QA 3T2QA 1QEXA 1LGCA 2CGOA 1GWLA 1FV2A 4GH4C 4UW3A 5FY4A 1H30A 1W6MB 1J59A 3HIFA 3ST7A 1AR91 4P9YA 1WMEA 4AVCA 5F2SA 5T5PA 4TTGA 1R093 3WDYA 3GHNA 3ZSKA 4XDQA 2WINB 5J37A 3AZVA 4D3WA 3OJBA 3U4XA 3RZHA 1JZ5A 4L8QA 2XONA 4C1WA 1W6NB 4GB33 2C9KA 1KS4A 1SFNA 1AX0A 2P6CA 4LBQB 5IAXA 2CYFA 3C7HA 1CAWA 2KD7A 4M4RA 1H9WA 5IWFA 1NQDA 1VAVA 4K21A 3B5LB 1AUYA 4DS0A 4H7MA 3OOXA 1O4ZA 1ONAA 2BZDA 3TB0A 1VBB1 1YQ6A 3A22A 1IQDC 5FP3A 1DQ2A 3HMYA 4CCNA 1POQA 2W08A 3IAPA 1E5SA 4IQPA 4YW5A 1G9AA 1AYN1 1UZYA 2GN3A 3LB9A 4E4HA 1K5MB 1V6MA 1GR3A 2VCBA 4IV3A 1RUH1 5DUWA 4RFRB 1SDWA 4URTA 4YG6A 3SNMA 1AX1A 2WRAA 3M70A 3MW3A 3NL1A 4JGZA 2VOWA 3IAQA 1YHFA 2QUOA 2A6YA 1ASJ1 4HOOA 5H9RA 5KHHA 3K4DA 3DYOA 3OF1A 3KVBA 5FTTC 2VQTA 1NOVA 3IMNA 3AZZA 1IG3A 2VTFA 3MIEA 1LOAA 2G9GA 4TWTA 4XJWA 2WUHA 3ZYIB 2WS91 2HKXA 3HAGA 5IK5A 4Q29A 3V0AB 3U07A 4YFZA 1US2A 3BB6A 2W9XA 4Q26A 4JKKA 1H4GA 4CRQA 4M3CB 1S1AA 5KWRA 3U0ZA 2GALA 2VGDA 3I2HA 4JZRA 3ZOIA 2QQOA 4IEUA 4OUMA 2A1XA 5DMYA 5LY2A 2AGSA 3CJXA 4XXAA 4L92A 5FMDA 5I0UA 3VZJA 3H1MA 5EJ3A 4LKFA 3GBWA 3ZPYA 1V6IA 4W4ZA 3KF3A 1PGL1 1ULOA 2FHRA 4AXOA 3MF6A 4AVAA 4DPNA 3KV5A 1AZDA 4CEWB 3ZN6A 3ZN5A 4FPYA 2VQUA 2FBEA 4XFHA 1XE8A 2FCVA 3KT4A 1OT5A 1G8WA 4XF9A 1CAUA 5FXWA 3VBRB 4AFDA 4UFJA 1BVP1 3T2PA 5L19A 3CL1A 2G9ZA 4BB3A 3KVAA 1HKDA 1OF4A 2E31A 2J1EA 3AMQA 4OHVA 1NG0A 5CEHA 3ROUA 3AYCA 4C0BA 2JE8A 3B94A 4ARYA 4XFGA 4EWEA 3MEPA 3ATGA 1HRI1 3H3ZA 4YM1A 5FYHA 4Y22B 4MXWA 3WV6A 3OGJA 4A42A 3VHPA 3DXUA 5B4XA 5A7QA 3BTYA 4DUWA 1ZBE2 2VMFA 1EP0A 2D5HA 1PK6A 4KMQA 3W5NA 4LR4A 1CZTA 4KQ7A 2ZS6B 1S0BA 1MVEA 3V64A 3ZR6A 5IUQA 4CDXB 3E5QA 2QQWA 4BQWA 4CEWC 4S2GA 1FNYA 1NXMA 3M1HA 1AR81 3FHIB 4PBPA 4QB2A 5K0UA 2DVAA 3ZXEA 1DGRA 1C1FA 2BP6A 4R52A 5A7PA 5JLVA 1NXD1 1XE7A 2OUJA 4GKYA 3VBRC 3LE0A 1ND2B 4AI3A 5JOXA 2EA7A 3NV3A 2GNDA 1X36A 2DBIA 1MQTC 2DUQA 2SBAA 4IEOA 4LLOA 1JOJA 4EN6B 3D0JA 1XNAA 2VUJA 4XTMA 1XSQA 1AR93 5FP9A 1NX9A 2WZR2 1SLLA 2OZ6A 5C7GA 4NHMA 3CO2A 3AFKA 4I2OA 3CJIB 2VJXA 4BM8A 3POYA 2YGMA 2Y6HA 1AXYA 3VZKA 2V72A 3FHAA 4Q8LA 3LF7A 5C3PA 4D7TA 1VIWB 1IS3A 1DLLA 1V9U2 2DUPA 1YRZA 1XYPA 2XL9A 3EQEA 3VBFB 2VCMA 1MR5A 2VG9A 4IEXA 3NKTA 5FZOA 5JSRA 4IEZA 1F35A 4FXGB 4XIKA 2XL7A 3J8F2 4CDWB 1UOBA 2H6CA 1Y9QA 2FQPA 5FY5A 4G3YC 3J26N 5LBEA 1PMIA 3NJXA 4EQVA 2HWB2 4DFSA 4A2UA 2VMCA 1VRH2 3T0AA 3WP4A 1I6XA 1ST8A 3GZTB 3OYWB 5F8PA 4OQ8A 2A6VA 4DXSA 5FY0A 2VZOA 5HI0A 1KJRA 4BCUA 1WCQA 3NRUA 2ET7A 3NQHA 4FO9A 4YG0A 2VW2A 3IZOA 4XIOA 1ASJ3 3ETQA 4YVSA 4AWDA 3SH4A 1BZWA 1K5MA 3I4IA 2X05A 4XYXA 3RNSA 2RS51 2JEMA 3SMHA 2WA3A 2DTYA 1YNAA 3UETA 1QXJA 1JHJA 1YJKA 3J7LA 5LEJA 5FXXA 4ASMB 1UZZA 2WABA 1V6OA 2ZGTA 3FJSA 2OIIA 2Y6JA 4M01A 2ATFA 4AEDB 4AHWA 5J3UA 1RXFA 1P8JA 1XJAA 3CNAA 4YM2A 3ACIA 4YGBA 1YQCA 2RMU2 1UMIA 4KU7A 5HCBA 1C5IA 4BXSV 1YCIA 2J7MA 2X29A 4DY5A 1RTVA 2ZHKA 4CDWC 2C9AA 5FMCA 5FDBA 1QQP1 3J9SA 5JVVA 4BPZA 1O3SA 3A4UA 4UW6A 4M4PA 3V0AA 1QJEA 5ACA1 1O4TA 5L9BA 1QJY3 5E6HA 1NCRB 3HQXA 5T5LA 2WNEA 3W5MA 4IE6A 4M3CA 5DDJ2 1IPSA 1RUC2 2Q8EA 4Z2WA 1F4HA 2YPDA 1A8MA 1W8ZA 2PLV3 5FZMA 5BNPA 4CCMA 2XJVA 1JZ6A 2DCZA 2VE1A 2VZUA 3QH7A 2DCKA 1D7PM 3FE5A 4PJYA 4AI1A 1H2LA 3FLPA 3OGSA 3ZDVA 4BLIA 5FO9B 1RIRA 2EAKA 3T30A 1YC61 1XPWA 4AEDC 4HFSA 1CZVA
chains in the Genus database with same CATH topology
4Z07A 2HYKA 3H3UA 3H0OA 4F83A 4CYDA 4FOWA 1JUHA 4LHKA 1ULCA 1Q8PA 5FLIA 4NN0A 4Q4Y1 1VBE2 2VOXA 5CNAA 2XPJA 3IDBB 5T5JA 1HRI3 1YFWA 1G9DA 1QJU2 4Y1ZA 2XJQA 3J8F1 4Q0QA 1VB2A 1YO8A 2XVLA 2HEYF 3FWEA 4B4QA 1N3QA 4Y22A 2K9ZA 2RS13 3C2UA 2VVFA 2YV8A 5E89A 1CD3G 1V00A 1N1YA 1M4WA 3DN7A 5LK7B 1O5UA 1DGRN 4AHZA 3FLTA 5AVAA 1PZ8A 3WDUA 2JG8B 4IERA 2GN7A 5T50A 3POSA 3VKFC 1X7NA 4PIXA 1G86A 1ND2A 3AMPA 1FT9A 3N7JA 2VOKA 5CFDA 3U10A 2MEV1 5BY5A 1RMU2 3B00A 2R0HA 1FMD2 3THTA 3ELNA 1UIKA 2CNAA 1CIWA 5DZEA 3CJIA 3L2YA 2AREA 3LWCA 4FPGA 5DDJ1 4BWOA 1BBT3 3WUCA 1V6JA 3MIHA 2GMMA 3RJRA 3WG4A 1LOBA 5AC92 2A71A 1PVC2 3NW4A 4MYEA 3VBFA 1EYBA 1GYKA 1H8TB 1LECA 1UKGA 2XKOA 2JG8C 5A32A 1IKPA 2N7GA 4IEYA 2ZKNA 3E5XA 4ISRA 5D8AA 4HVRA 3BODA 4K7JA 3OPZA 1S2KA 4G4FA 3R05A 4H55A 4PF5A 4AK3A 4COWA 5JZGC 5BYNA 1VBE1 2W39A 3OYWA 1AL21 1PO22 2RS53 1CAXB 2HWC1 1C57A 1DQ6A 3LAGA 1FPN1 4B4RA 1SLBA 4J1WA 5BPXA 4FPFA 3KMHA 2UY8A 2CY6A 1TME2 5F5QA 2DURA 3TOJA 4HKWA 4LEJA 1PNFA 5J7MA 1QXRA 2D6MA 4M3CF 5H9QA 3ZXJA 3TN92 2DFBA 5KHGA 2XWJB 5FO7B 1IZ3A 1OQ1A 2VUAA 4Q0PA 4PLMA 3ZFEB 4KG0A 2DTWA 1PHMA 4QPYA 4YGDA 1JW6A 2KM2A 1VBC1 4JVAA 1N1TA 1NCRA 2PAEA 3ZXLA 4COZA 1JN2P 4BMBA 1JH5A 4WV8A 4Y1YA 1RMU1 1U5YA 4AYUA 1IHMA 1AR72 1N3PA 3KQRA 3QCWA 2JICA 1A3KA 3AXEA 1DQ1A 5GLZA 3WG3A 4FBFA 1ZRDA 1AXZA 2UYAA 1QOOA 4Q4Y3 3KZ4C 2D6NA 1WW7A 1N1SA 4UW4A 2CTVA 2WZPP 3LA2A 4YW3A 2IXLA 3ZFEC 4OHWA 1ZX5A 3AX4A 2H0BA 1JYCA 1JTZX 5CFCC 1QU0A 1DFQA 5KHIA 2EXJA 5DUVA 4D94A 4DOUA 5L73A 4IETA 4EROA 4JGYB 4J6GA 5I8TA 4WVWA 4N9IA 1NCQB 3MIDA 2FZ1A 2D43A 4XJAA 5EV7A 2WT2A 2ZTNA 2VECA 2JKBA 1PO21 3WHUA 2BGCA 3IDEA 3O0WA 4P5HA 1QHDA 4WM8A 2EXIA 1C1LA 1URXA 1U12A 4RR3B 4UXAA 1HDKA 1ZRFA 1F31A 3USUB 3QH6A 2EVXA 2MEV3 5C4WB 3HN1A 2DYCA 1REFA 2VW0A 3JZVA 4RQPB 3UJOA 1WMDA 5FREA 4ISQA 2DVGA 5JDBA 3MI8A 3MGUA 2W0XA 3JCIA 1LENA 3TN91 3WY6A 4RS5B 4JGYC 2AR6A 1IS5A 1NCQC 2ZX1A 1LGBA 4I02A 4WM7C 3OY8B 3VZMA 5BNNA 4QPIB 2VH9A 3VL9A 3T2TA 3M2MA 2E7QA 3B3QE 3TBDA 5I91A 1PO13 2JG9A 3RWNA 2EIGA 3KS7A 4AQ6A 4WZCA 1Q8QA 3WG2A 1HRV3 1H8TA 3MLKA 4RQPC 5AVPA 4FOVA 4IESA 2W68A 3WLUA 1AL23 1YIPA 3ILRA 2HWD1 4FOQA 4FPJA 3AZWA 2HWC3 1MZEA 4LNVA 1FPN3 1ENXA 1R091 4E2QA 1I9RA 2GMEA 5GZFA 4XJ8A 4QXKA 5C8CC 3MIGA 4IEVA 4OUSA 2D93A 1S55A 4GB31 5I0TA 1CAXA 4QPIC 1LODA 2BNOA 1DBNA 4XILA 1W6OB 1W2UA 1RJ7A 1PZ7A 2E9QA 3G7DA 4PIYA 1LEDA 3R4UA 4F7ZA 2UU8A 5CB7A 3ZSEA 1CQ9A 3AK0A 3ASIA 4KG8A 1LEMA 1TQ5A 4RL7A 3WCRA 1HV0A 1CX4A 1VBC3 3B7MA 3MICA 1ZBA3 3BIWE 4JGZB 4C0HA 4Q1PA 1RUNA 1LHNA 2BW8A 3V56A 2XJRA 1HXS3 2P3IA 4E9KA 4LO7A 4K6BA 4I01A 3MYXA 2DV9A 1F5FA 2JE7A 4B3NA 2CAVA 4K40A 4LE4A 1D4VB 4QU2A 3G6JB 2D6KA 2R32A 5I8YA 3H1WA 1AR92 3WX5A 3SCGA 5GZCA 2E7AA 2VNOA 4YZ5A 4IV3C 1YXWA 3M8LA 1FYUA 5F9TA 2VULA 2X53S 4JGZC 3ACLA 1Z7S3 1B35A 4DRRA 5GZGA 5GLTA 5CBLA 3ZN6B 1MS4A 4HBNA 1QGLA 2R16A 4GMP0 2DF7A 1CAUB 2PA7A 1PGW1 1PIV3 1YFUA 1F2NA 3AKRA 4TZDA 4GQ7A 3CU7A 2WLQA 2QVSB 4C91A 4E4ZA 5FOJB 4DZGA 3Q9OA 3IKWA 1RUH2 4MXWB 1OFSA 1BKZA 4AEJA 1UX6A 3KCXA 1ASJ2 5B2GB 4ZU5A 5KC5A 3LA3A 1OFNA 5C4WA 1YUDA 2ZGSA 1EPWA 1OD5A 4YRDA 2WFF3 2WS92 1Q56A 1WA4A 1S0EA 3POWA 4OVEA 2A5ZA 4CP1A 2XWBB 5K0UB 2DCTA 3JQWA 4RS5A 4YVWA 3ILNA 1CPMA 5KXBA 4GXLA 1YWKA 5JSOA 2YZ4A 5SV8A 1POV0 1BCXA 3IDCB 1Z0HA 3WINE 5FMOS 2Y0OA 1C8M3 2MNGA 4YGEA 4E4SA 1PGL2 1UU6A 4XPVA 2HWD3 1PK6C 1KXGA 4GMP3 1F5JA 3VHNA 2DCJA 1W0OA 3BALA 4Q2FA 4QQ2A 4YZ4A 4BH9A 4QX5A 4R9CA 3WXPA 1JUIA 2TBVA 5K0UC 1AX2A 4YLZA 3TYJA 5JCTA 4QGLA 1IS4A 4LO4B 4M0HA 4BA6A 2XGXA 1LU2A 4LBLA 3PMSA 1X33A 4A3XA 4LE3A 1HRI2 3EJKA 1B09A 5JAXA 1CN1A 4NOTA 4N7IA 4H7LA 3ZXDA 1LHVA 1W6OA 1RC6A 1ZZ9A 4JTNA 1XU1A 4YZ2A 3QD6A 1EAH1 1EV11 2JDZA 3OBRA 3N35A 4K1ZA 2GNBA 1J1LA 4YVSB 2CV6A 2RS12 2C1FA 4SBVA 5DG2A 5EXOA 3ZIWA 2HWF1 4AFBA 3VGIA 1AR82 2ZKLA 1NY71 4N90A 1BK1A 1IQAA 4LBKA 2ZZQA 5GALA 2RHPA 5KXEA 1CAVA 4AQTA 5CG8A 1OQEA 1GNZA 1G6NA 4FTBA 1WBLA 3IT8A 2JENA 4OFGA 1ZNPA 3GZAA 5IK8A 4KNCA 3S0MA 3LSEA 3TNPB 3ZFFA 1S0CA 5BNPB 1F8VA 2BFUL 3FC0A 4Q27A 3ZN4A 1QJY1 4YVSC 2QJVA 1K5MC 2XUMA 1BBT2 4EN7B 1JXNA 3MZHA 2PLV1 3UKVA 1XNBA 2A6XA 2R073 2R043 4Y5Z0 4RFT0 4BHPA 3B9CA 4CP0A 1H4HA 1BJQA 3K51A 3C3VA 1G9FA 4RGAA 5DUUA 1D0HA 1MZ6A 3WW3A 1WD4A 5CU1A 5K7PA 1SBEA 1LULA 2HJIA 4LBMA 4COYA 5CG9A 1AL0G 4JDNA 2GU9A 2D6PA 5BNPC 2RS52 2YGLA 2GMPA 2YDEA 2A6WA 3WR0A 1ULGA 1CVNA 4ITCA 3V65A 4I30A 2HEWF 1GNHA 4AFMA 2ZGUA 2BVBA 2NMNA 4YFWA 4CDUB 3LGRA 1PM7A 5K9YA 2JJ6A 2XBO1 2RS11 2TNFA 2JXAA 1QQP2 3APBA 3FBYA 3VBHA 5EYXA 2PHFA 1XNCA 5FLJA 2DUOA 5ACA2 3ME2A 3MFAA 1V70A 2ZGLA 1Q8OA 1YIFA 1VLNA 4MGKE 1RGSA 3VZLA 1DZRA 4Q0UA 5CFDB 3N7LA 3IN9A 1KD7A 1UF2C 5ABJA 5BNOB 3V0BB 1SQ4A 2H0VA 1WMFA 4EWDA 4R4ZA 1OMIA 4QPGB 1Q5OA 1ZZCA 4MV2A 2A6ZA 5E1RA 2R063 1CESA 1KRIA 2VY0A 3EXUA 1EY2A 2X5IB 1RHI1 1SLAA 5LRRA 4BYYA 1BBT1 2ZGMA 2V5YA 2Z69A 4Q4Y2 4A7YA 4A7ZA 4CDXC 1O3TA 4XBNA 5A32B 4FXKB 5BUVA 3CF6E 2OPKA 3AXDA 5D8AB 5LEKA 3AB0A 1ND2C 4EN8B 5CFDC 4YW2A 1EAH3 1LRHA 1EV13 3AP9A 2WNUA 3O14A 1YJLA 2QNKA 1H1IA 1TE1B 4BE3A 3RYRA 1WLWA 2PAKA 1BEV3 1O5LA 4LO6B 1BVVA 2HWF3 1XU2A 3CJIC 4UBHA 2ZHNA 2WWSA 1LOFA 3E6DA 4XFCA 4R9AA 2B5HA 4AHXA 4HK9A 2ZMNA 3ES1A 3BTAA 4QT6A 5J09A 1RL3A 2WC2A 4K1YA 3VBFC 1LJ7A 3ZYPA 3MPBA 2TEPA 2XLAA 5CVRA 1PZ9A 1D2SA 4FOYA 2TUNA 4C1XA 1R083 1X8EA 4ZXKA 3SITA 2MEV2 5D8AC 4JCKA 4EV0A 3L9JT 1UIJA 2YPJA 4AI8A 1C28A 2D97A 2NN8A 4K8FA 3WDWA 2H6BA 4PDWA 4ZU4A 3SISA 2XJSA 2XB6C 2WQZC 1NE4A 1MEC1 4Y24A 2PTMA 2O8OA 4XXPA 1ZRRA 2VMHA 2BQPA 4Q4X1 2P17A 2ZABA 1CR7A 5FRAA 3THPA 3PHMA 5A3LA 4FCAA 1AR63 1LESA 4FPHA 3RG0A 4KL1A 1OPOA 2CAUA 2OUHA 3WDXA 1LOGA 1RUG1 4ATFA 1ENRA 2QDNA 2XH6A 4XQDA 1JBCA 3H50A 3KCYA 2G9FA 3WP6A 3VDDA 1KITA 2B42B 1OHFA 1IPKA 3BOPA 1AL22 3JBG3 3WQ7A 3EO6A 2HWC2 2B46X 2A3YA 1FPN2 1NCRC 1Q43A 1H2KA 2VOVA 4PCRA 2ZGKA 1GZCA 1RVF1 1FOD1 2I07B 4KWKA 2Y0IA 2YHJA 4HT1T 5TSWA 1VBA1 5FFOC 5F1RA 1QDCA 2XBO3 4IEQA 4KGQA 5DXDA 1W6PA 3B69A 2AH2A 2IC1A 2DFCA 1I3HA 3RMYA 4CDUA 4WM8B 2RS33 2BFUS 1WUVA 2Q4SA 4NWVA 1W6QB 4FPKA 2JX9A 5EFUA 3U11A 1O3QA 1OA2A 1VBC2 3FZ3A 3KLSA 1V6KA 3AZXA 4XHBA 3JUUA 4LA2A 1MS1A 5FQ0A 5BNOA 1AJOA 3V0BA 1H0BA 2GC1A 3UL2A 2EAAA 4DXZA 2GNTA 3H9AA 5BNNB 2PHTA 1RHI3 2VQ0A 4KWJA 4QPGA 4RSUA 4CTEA 3UJQA 1DDLA 2WSUA 5GLWA 4TLFA 4KGGA 1D4M1 1T6GC 1DYPA 1J3RA 1KS5A 4WM8C 2X5IA 2JG9B 2O0OA 4Y20A 1E57A 3AP4A 4B4PA 3VBUA 4L2NA 1U5XA 3GF6A 3TNQA 1PO11 4MH0E 3DV8A 3N7KA 1Z7S2 1QNYA 2D6OX 1WD3A 4ONUA 3KM5A 3W59A 1HRV1 1SBDA 1HQNA 4BOWA 3D0SA 3VKNA 1R1A3 5GLVA 4EJRA 5BNNC 1PIV2 1G9CA 2AUYA 4IEWA 4V1PA 1TMF1 2D7FA 1DGWA 1XYOA 1REDA 4L99A 1A6CA 1C5HA 4HPKA 3WVJA 5C6CA 5DZGA 2JG9C 4CP2A 3LOBA 1UU4A 2XLFA 4LBQD 2MPFA 3RI9A 1H8TC 4QQHA 3NV2A 4AEMA 3S7IA 3CLPA 3AMHA 3MFCA 4GWNA 1DGLA 1RUD1 4FT8A 1COV3 2ZMLA 2WIIB 3S7EA 1IOAA 3SHRA 1BMV1 1MEC3 2D3RA 1ND3B 3RZZA 1PNGA 4NPRA 3VLBB 1ZBE3 3PJQA 1ZBA1 3J4UH 4C90A 4Q4X3 1BXHA 2YC0A 2ZGQA 1BYHA 1HXS1 4I0BA 2JD4A 1ULDA 3UKTA 2BNNA 1GV9A 5T55A 1S0FA 2PHRA 4MSVA 3ZXGA 1RUG3 3WP5A 2RJLA 2ES3A 1W0PA 4N43A 1C8M2 4HANA 1IGOA 4B7EA 4AI0A 2RM21 5JIUA 3I54A 2CWMA 2HWD2 1GQGA 1R092 3AP6A 1B35B 1RVF3 2YY1A 3AKTA 1FOD3 4MGIE 3RQ0A 4XTPA 5FLHA 4GB32 1VBA3 1M06G 4HMZA 3KCCA 1AJKA 2V09A 1Z7S1 2UY9A 1RUF1 4BZ4A 3QOPA 2VXRA 4N7UA 5FMOL 2B8MA 3R0RA 3R6SA 1UPIA 2PHLA 1RUJ1 3VBSB 3I59A 3RSJA 4YW1A 2R49A 2JECA 2WT1A 3MIBA 4XJ9A 3ZMNA 1PIV1 5GLUA 2EALA 2UWAA 1L3JA 1OI6A 3AKSA 5KXCA 2HWB3 4AQ2A 1W6QA 1QDOA 3JB4C 1GFF2 4AG4A 4B29A 1B35C 4XE9A 2UWCA 3RPQA 4HL0A 5T52A 4JRLA 2GC2A 1O3RA 1KDMA 4KWLA 1RUOA 1UMZA 5C9AA 4YVWB 3M7AA 1GICA 1U5ZA 1UAIA 2UURA 2PQQA 3MPPG 1WCKA 2WFF1 1D4M3 1F9KA 4NHKA 4Q26A 1ZZ6A 1QY4A 5JWPA 3PVNA 2ILMA 4XFIA 1Y43B 4Y1UA 2D44A 5J48A 2BWAA 4LLFA 4D7YA 4FVVA 2ZX0A 5HCAA 3GZUC 2YXSA 5C33A 1VAMA 2IXIA 4RR3C 1YYNA 2Z42A 4YNIA 3LKJA 1DQ4A 2PAMA 5C4WC 1HQWA 1C8M1 4YGCA 1SLTA 2R072 2R042 3IPVA 3KT1A 4JV4A 1CJDA 3JD73 3FMGA 3LA7A 3UKNA 1PGW2 4GMP1 3VZNA 2VQAA 4RS5C 4YVWC 1TMF3 3TAYA 1VB4A 3QLQA 1J1TA 1SCSA 2XJTA 2ZX3A 3WDTA 1VAKA 4N53B 3IBMA 4WVMA 4XQWA 4E2GA 3KSCA 3ZIXA 3HWJA 4NWWA 1XRUA 1RJ8A 1QMJA 3M3EA 3R4SA 3RS6A 2B9UA 2UWBA 3B01A 4Q4W3 3VHRA 1RUD3 2VMIA 4R8HA 4XEZA 1S0JA 5FBZA 4JAAA 3MF9A 3CEWA 3NAPA 3QACA 3AP5A 4P9IA 3NV1A 4R9BA 3AM2A 2G4IA 2R1DA 4AVTA 1CAVB 1ND3A 2GSYA 2VPVA 1MZ5A 3NKGA 2ZGPA 1OOPA 4LBNA 4BIOA 1HIXA 4OHXA 5JOZA 1V6NA 1WLCA 5T5OA 1OPMA 1POV1 1UW8A 3AFGA 3O7OA 2IXCA 5GZDA 3SH5A 4GULA 1JHNA 3E97A 2RM23 3ZFFB 2PN5A 3VKOA 2YROA 3WDVA 4QGNA 5D1IA 1MVQA 2WKKA 3GHMA 3FUOA 5JI9A 2WFPA 4NHLA 4JDMA 2R062 1WW4A 2F6BA 4RHV1 5CAZA 4HKLA 1RUF3 1MS5A 4P9WA 4P9LA 4P14A 2ZAHA 1GZWB 1XXNA 4OI1A 5HBAA 1NYWA 1RUJ3 2WNVB 4FP3A 2R071 4HZFA 2Q1ZB 2R041 1UN1A 2I2SA 2VMGA 5E8AA 1GKBA 4MGYE 4E4DX 1EAH2 1CONA 1EV12 4O9EA 1Y7BA 3AYDA 4XF1A 4EWAA 5I0SA 3VBSA 2D98A 3ZFFC 3PVEA 3M4FA 4HN1A 1UKRA 1ZZBA 2HWF2 3KGLA 2Z2SB 3WHTA 3MLLA 4Q1RA 1NY72 3VBOA 1Q8SA 4WBBA 4DMIA 4QQLA 5KHKA 1ENQA 4DQAA 3FFQA 2GDFA 3VBHB 4R9DA 4QQPA 2XKPA 3PNAA 2ARBA 2P37A 2IZWA 4CEYB 2DVBA 4JRAA 1R082 1A8DA 3ZFGA 4JC1A 4KH9A 4X6RB 4OLLA 4Q0SA 4YM3A 4KBBA 3EHKA 5ABJB 5IT6A 2ZGOA 1QJY2 5H9SA 4JQRA 3D4KA 1O4YA 1DZTA 2B7YA 2E7TA 2ZBJA 4BMEA 4QHBA 1DYKA 2O1QA 2PLV2 4MUVA 1KDKA 2RR11 1ZA4A 2ZAAA 4K3UA 2ZJCA 2EXHA 3SXWA 2DWRA 4QMAA 3TRSB 4HSJA 2BTVC 3WW1A 1NA1A 3VBHC 4X8NA 5J96B 1YI9A 2HWE1 2GC3A 3AP7A 2R061 1AR73 4UW5A 1V6LA 3NV4A 5EYYA 2QZ3A 3PJYA 1G9BA 3H7YA 2ZCWA 2A3WA 1QF3A 2WLPA 2WNUB 3JBG2 5ABJC 2XJPA 4E2SA 2IXHA 2WA4A 4N53A 1J3PA 4MX3A 1H2MA 1LCLA 1WLTA 1AYM3 2BBVA 2YMZA 3WW2A 4W6XA 3AMNA 5JSPA 2XBO2 2ZA9A 4GIQA 1BEV1 1ULEA 4GA9A 2VW1A 3VV1A 3ZSLA 4NVPA 2R1BA 2ARXA 4DNYA 2ETEA 2RS32 2WL1A 1GLHA 3OD0A 2ET1A 4B7KA 4XHXA 1POV3 1VP6A 2BPA2 3RJ2X 1JYIA 1S0IA 1FATA 4FQ4A 2WNUC 1ZYBA 1DG6A 1R081 1VJ2A 2D5FA 4HK8A 4MLOA 4PDWB 1NLRA 4H3WA 1DQ0A 3PVOA 2KA3A 4Y26A 4LUMA 4OZXA 1ULFA 3O0XA 3UK9A 5L7OA 4ZU7A 1LOFC 4XBLA 4AF9A 4RHV3 3WZ1A 1RHI2 1YI7A 3WOGA 4PIZA 1RUI1 2E51A 4Z8BA 2OZJA 1EPZA 4S2HA 2XLGA 4NO4A 4Z1VA 2QCSB 1LOEA 2C0ZA 2BWCA 4OI2A 4OHZA 2QDRA 2Q8OA 4CDQA 5IK7A 2RE9A 5FPXA 1GZWA 2EXKA 1DU3D 3MDPA 2WNVA 3SLIA 1AR61 1W39A 3VDDB 1VBD1