3BB6A

Crystal structure of the p64488 protein from e.coli (strain k12). northeast structural genomics consortium target er596
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
109
structure length
109
Chain Sequence
MLQIPQNYIHTRSTPFWNKQTAPAGIFERHLDKGTRPGVYPRLSVMHGAVKYLGYADEHSAEPDQVILIEAGQFAVFPPEKWHNIEAMTDDTYFNIDFFVAPEVLMEGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein yeaR
publication title X-Ray structure of the P64488 from E.coli (strain K12).
rcsb
source organism Escherichia coli
total genus 18
structure length 109
sequence length 109
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09313 DUF1971 Domain of unknown function (DUF1971)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3bb6A00
3KSCA 4ZU7A 4Q0UA 1H1IA 4LA3A 1CGPA 1EYBA 1J3PA 4YYOA 2ETEA 4HSJA 5BY5A 5CADA 2XHKA 3H3UA 2IC1A 4B29A 1DGRA 5JCTA 5D1IA 4JTOA 3SMHA 3I54A 2IXIA 4MGZE 4F8AA 2B5HA 2BNOA 1Q3EA 4XFBA 4WVZA 4AQ6A 4IEOA 3ES4A 3TNPB 3N4MA 2N7GA 4UBHA 2XLAA 4I01A 4MUVA 1IPKA 4QXKA 5JSRA 1J58A 4UBGA 3UKVA 1LR5A 4IEYA 4IESA 5BUVA 4Q0VA 1V70A 3G7DA 2OZJA 4QMAA 1O3QA 3H3ZA 2PTMA 3NKTA 3BPZA 3FZ3A 4PJYA 1X8EA 1YUDA 5BXXA 2PQQA 2PAEA 5I8YA 3CL1A 4YSFA 2GU9A 3GBFA 4Z82A 4LULA 3KMHA 2CV6A 4AVBA 5I0SA 4EV0A 3EQEA 2ATFA 1UW8A 3BCWA 3H7JA 4KU7A 4XF4A 5FQ0A 3C3VA 3SHRA 3CJXA 1HW5A 4CYDA 1DZTA 1NXMA 2QCSB 4N9IA 5FPZA 2PAKA 4K8FA 1Y9QA 1CAUB 1DZRA 2MHFA 3SCGA 3E5QA 4YARA 3MYXA 2PAMA 3QACA 3OGJA 4BIFA 3EO6A 4YNIA 3U0ZA 1L3JA 3TNQA 4KWKA 1GQHA 3H7YA 2WC2A 2PHDA 2O1QA 3E6BA 4HSLA 3GYDA 4BYYA 3L2HA 4MZUA 2BYVE 2K0GA 2BNNA 2Y0OA 3I59B 3PNAA 4JVAA 4H7LA 5BV6A 4ZU5A 5J7MA 1EPZA 4WZCA 2E9QA 4ZU4A 3ROUA 2EAAA 3RDIA 1JUHA 4QX5A 2D93A 1Y3TA 3HIFA 4R8HA 1J3QA 3ZDSA 4AVCA 3B02A 2EA7A 1TQ5A 3QOPA 5T3NA 4QM8A 1UCXA 4KU8A 1Q5OA 2XKOA 3CLPA 1RUOA 3DKWA 2UYAA 1J1LA 4I0AA 3NW4A 1XE8A 2XLFA 1YFYA 2BEOA 3BB6A 2QJVA 5KHJA 2QDRA 4RD7A 5I0TA 3OD0A 4HN0A 4MH0E 5I0RA 4MGKE 2Z2SB 2K9ZA 3HQXA 1GQGA 3E97A 4LTAA 1ZRDA 2H6BA 3FWEA 1WLTA 5E16A 4X6QB 2O8QA 2Q0AA 2GC1A 3ETQA 4P9GA 5FDBA 3E6CC 2PA7A 1PMIA 3RYKA 4Q29A 1YFWA 1PM7A 2IXHA 4HLTA 2Z69A 2CGPA 1EY2A 3D82A 3H50A 3S7IA 4JV4A 2UY9A 3FJSA 3E5UA 2GZWA 3H9AA 2GC3A 1ZNPA 4I3PA 1CAVA 2ZCWA 5I8SA 1X8MA 1FI2A 1I5ZA 3O14A 4E2GA 5FPXA 1O7FA 4XEZA 5I0UA 3FHIB 4EWDA 1ZZ7A 4HVOA 2B9UA 4AVAA 2PFWA 4XETA 1CX4A 4XFHA 3HT2A 5J3UA 3KCCA 2PYTA 1O5LA 3RNSA 3LOIA 3IWZA 1CAWA 4I09A 1ZZ6A 2Q1ZB 3LA3A 2OA2A 3H1WA 1FT9A 3LZZA 3R6SA 5FLHA 2HJIA 4XFAA 3WW1A 2XL9A 4KWJA 3SCFA 4I0BA 4EWEA 1X7NA 4IERA 3D0SA 1EP0A 2FMYA 3WW4A 4E2SA 2KXLA 1J3RA 3RYPA 3NVCA 4FAHA 1QY4A 5FCCA 4N9HA 1CAXA 1ZX5A 1U12A 4META 3LA2A 4QGNA 4UXAA 4D7TA 1RUNA 4HVRA 4Q0PA 1LB2A 4J1WA 1NZCA 1UPIA 1VJ2A 2IXJA 2GC2A 3IIAA 3PVBB 4DINB 4MV2A 4Q0QA 4WBBA 4AQ2A 4HBNA 1H1MA 1ZRRA 1ZVFA 2IXKA 3OF1A 3PLQA 2GH2A 4FAGA 1VR3A 1WA4A 3M3IA 5C8WA 4ONUA 3ES1A 4MGIE 3E6DA 2OYZA 2GC0A 4IEQA 1RGSA 1QXJA 4IEUA 2VECA 3OTFA 2OPKA 2XL7A 1ZZ9A 4XFCA 3KGZA 4BHPA 3H1YA 3M70A 5KHGA 3EBRA 1IPJA 3LWCA 4JTNA 5FLJA 5K8SA 4TLFA 4IETA 3USSA 4FT8A 3RYRA 4J1XA 3BALA 3IDBB 1YFXA 3UKTA 2D5FA 2QNKA 1CAVB 4L11A 4O9GA 1RTVA 3SCHA 3VHRA 4NVPA 2H6CA 1UD1A 3JZVA 4FBFA 3WW3A 1J59A 5I8TA 3I59A 4PIZA 2C0ZA 3D0JA 3EJKA 2CAVA 2IXLA 3HT1A 4EROA 3RPQA 2XGXA 3U10A 5AVPA 4XFIA 5CU1A 4GULA 1O5UA 5HI0A 4XF0A 2UYBA 4QM9A 4F7ZA 1CAWB 5FQ0B 4IEPA 5LRRA 3MZHA 4HZFA 1SQ4A 5EFUA 5C6CA 3S0MA 4XF3A 3FFQA 3LAGA 4I02A 2BGCA 5CVRA 1O3RA 2XLGA 1LKNA 4Q0SA 5I91A 1SFNA 2MNGA 3ELNA 2P17A 3S7EA 4IEXA 4KWLA 1G6NA 2OZ6A 4EWAA 3E5XA 1ZZ8A 1NE6A 1QXRA 2D40A 2BNMA 4X6RB 1CAXB 1YWKA 3DV8A 1WGPA 4HN1A 4LA2A 5KHIA 3CF6E 2WFPA 3KGLA 3CEWA 1YHFA 2QVSB 4LUMA 3NJZA 5KHHA 2V09A 2CAUA 3FX3A 3RZZA 2Q4SA 3DN7A 2H0VA 3NSTA 4D7SA 3IBMA 5KHKA 2ET1A 3OCPA 4XF9A 5JAXA 1YLLA 4OFGA 4LEJA 2IXCA 3UKNA 1Q43A 4QGMA 4AXOA 3WW2A 3SXWA 3H8UA 1QWRA 2MPFA 4HMZA 4Z07A 4A2UA 1RC6A 4PIYA 5JR7B 1ZRFA 2XKPA 4L2NA 5LEJA 4OLLA 4E2QA 1DGWA 4XFFA 1UIKA 4XF1A 1VP6A 3LA7A 1XRUA 3NL1A 2VPVA 1OI6A 2Q30A 3MDPA 3ACLA 1O3TA 2HKXA 4XFGA 1ZZCA 1OD5A 1RL3A 3EHKA 5LRSA 4KL1A 4MX3A 3FE5A 1OFNA 2DCTA 3ST7A 3IDCB 1UIJA 3I7DA 4O9EA 5F1RA 1O3SA 3MPBA 1YFUA 5EZWA 2D5HA 1X82A 2ZKLA 4IEWA 3U11A 5JSOA 1LRHA 1CAUA 1I6XA 2EVXA 2F4PA 1XE7A 1ZREA 1O4TA 5BPXA 2PHLA 5J48A 4HVQA 2UY8A 1ZRCA 5I93A 3DL3A 4IEVA 3H1MA 5FLIA 5KBFA 4I2OA 2ET7A 4BH9A 1OMIA 2GAUA 2FQPA 2I45A 1FXZA 5LEKA 4R52A 1NE4A 1ZZBA 3BU7A 1NYWA 2VQAA 5JSPA 4ORFA 4MGYE 4YRDA 4QGLA 3CO2A 4PIXA 1SEFA 4IEZA 4LLOA 2B8MA 5E1RA 4LUKA
chains in the Genus database with same CATH superfamily
4HXCA 4UW4A 4KMQA 3KSCA 3VKMA 1EV11 3A0NA 5ABJB 1N1TA 4CDQC 2WO3A 4LA3A 1CGPA 1EYBA 1J3PA 1GOHA 1UNBA 5FP9A 2VC9A 3B5LB 2KD7A 2NMOA 1N1YA 4DMIA 4B4PA 1QJX3 4HSJA 5BY5A 2KR2A 2GMPA 1GQPA 3AYDA 1UKGA 2UWBA 1URXA 5D1IA 3L2YA 4H2AA 1C28A 3S57A 4B4QA 1W05A 4Y1XA 5FZ0A 2FZ2A 1HN1A 3POFA 3T30A 1V6IA 4WVZA 5A32A 5JLVA 5FOJB 3KQ4B 4MXWA 5EV7A 4YZ1A 1VMHA 3ALQA 2JX9A 4FPLA 3VBRA 4LBKA 4JGZC 4CCCA 5APAA 5M0TA 1WCUA 1CN1A 1H30A 1ZA7A 4Q26A 3ZMNA 5BNNA 4UBGA 3UKVA 4QD2A 5A33A 1LR5A 3WNMA 2BFUS 3K3NA 3VDCA 5IK5A 3I2OA 3G7DA 3VZNA 4PBPA 1S55A 1AXKA 3I8TA 4N7UA 4UFLA 3CJIC 5FWEA 3H3ZA 2PTMA 1UX6A 2EXHA 4XILA 2D44A 3ENRA 3SLIA 3NAPA 1QQP3 3ZFGC 3HN3A 3AMQA 3JXSA 2FDGA 3PVNA 1L7LA 2VMIA 2W2IA 4IDZA 3FLRA 5I8YA 1JYCA 2MEV2 1CPMA 3VKNA 4DUVA 1JZ4A 1ST8A 3KMHA 4XZUG 3ZR6A 1ASJ2 2ERFA 1UKRA 3OGGA 1W39A 4OVEA 5C4WA 3GM8A 1AL21 3SHRA 1PO12 4MGTA 4M0NA 4WVVA 3M3QA 4CEYC 4AGRA 3WG2A 1DHKB 1NCRC 2XXZA 3KT7A 3N36A 5FPZA 5L7OB 3RZKA 2PAKA 1CAUB 4LE3A 5BNOA 2CSGA 1ODNA 1K5JA 1SDDB 5FKBA 1VBB2 2WWJA 2PAMA 3QACA 2EALA 1RUI2 4KG0A 1QDOA 1MQTB 2LTNA 1C57A 4YNIA 3VUOA 1RXFA 4KWKA 3ECQA 1JUIA 2VOTA 3WF2A 1YIFA 1SLBA 2PHDA 2O1QA 2WC2A 4CP9A 1BZWA 3O0WA 5C5UA 4NJ4A 4FPFA 5C9AC 1RXGA 4YGCA 5JIAA 3L2HA 3UGGA 1VIWB 2BYVE 2K0GA 5FJKA 1RUE2 3K77A 1NLQA 1R083 1UYZA 4P9YA 4C8DA 2Y60A 2JDAA 5A7NA 2CDOA 1ONAA 4ZU5A 2Q5TA 2XBO2 3ZKYA 1LOFC 3GZUC 2J1VA 3VZMA 4XHXA 1VE0A 2VCMA 1RVF1 3POYA 5FY1A 1FMD2 1PIV3 1RJ8A 3ROUA 4WM7A 5F3GA 4QX2A 4AAXA 4AHXA 5CFCA 5HCAA 4BK5A 2E31A 4QX5A 4AEDC 1H9WA 1GICA 2D93A 1QJU2 4GMP1 4XUTA 1J3QA 4ZZ5A 2A73B 1L7RA 1U5ZA 3KV6A 4QKNA 5A1AA 1G9BA 4QHBA 3KVAA 4WVMB 3RMXA 4K9SA 4FVVA 1DQ0A 5K7PA 3PMEA 5T3NA 3MW2A 3IZOA 4KU8A 5GLUA 2JG9A 1JZ7A 1BMV2 5F3EA 3CLPA 2RDQA 2RR13 4URAA 1SACA 3E1F1 4XXPA 4RGGA 3JBG3 1UMZA 4OHZA 4I0AA 3ZYBA 1YEWA 2WAAA 2CWMA 2G9ZA 2YG0A 4DFSA 3EYPA 1UO9A 1GZWB 3VKLA 4E4ZA 5FPLA 2XLFA 1MVEA 2DURA 3J8F3 1PO22 1FX5A 1XU1A 1IKPA 1WMFA 5LZ6A 2QJVA 2IFRA 2VO5A 3VD9A 1BCXA 4HN0A 5I0RA 2YBPA 3RGBA 2LRPA 4ASLA 5KXBA 2Z2SB 2YU1A 1GQGA 2VW0A 1F15A 1EUTA 1GWKA 4A3XA 5FYTA 3ME2A 2QE3A 2IFWA 2VL4A 4OQ9A 4YW6A 5LY1A 4HANA 4M3CA 4M3CE 2Q8DA 2ORZA 4X8PA 2Q0AA 3ZSJA 4Y1YA 4QXBA 3ZYHA 1MR5A 2VZSA 4XACA 1YC61 1O4YA 1OKOA 5FR3A 2PA7A 2BW8A 5FK7A 2IXHA 1Y4WA 1V6NA 1UXZA 2Z69A 4BIOA 2VQUA 4P9IA 2J1UA 1G9DA 3H50A 4FP3A 2UY9A 3VZOA 3ZFFA 2W92A 3O5SA 4NMIA 4HT1T 3E5UA 4HK9A 2GC3A 2C5DA 1J1TA 4HOOA 4QDQA 5DAWA 4DNYA 2K46A 4D6QA 4YW1A 4CUBA 3OUHA 1X8MA 3AB0A 3WNLA 4BB3A 4XC9A 3RS6A 1I5ZA 4IE7A 3KB5A 1ND3A 2YMZA 3U37A 1W6MA 3GBWA 4FFHA 4XEZA 4ET7A 3TB0A 3D6EA 2CU5A 4QX0A 1H6XA 3ZFEC 5IVBA 3RFRA 3ZN6B 4W4ZA 4TZDA 3HNMA 3BIEA 3WHUA 4DQAA 1LOEA 2Z4FA 5LK5A 4JRLA 1WCSA 5J3UA 3KCCA 1O5LA 1OF4A 4QKDA 3RNSA 3LOIA 3IWZA 3SKJE 5B4NA 4URTA 1KDKA 4I09A 5DXDA 2VNRA 2WFF3 3I2DA 2WWUA 1QHDA 3BIWE 3LA3A 1R093 1B09A 1RYYA 4P14A 2QQKA 3MLJA 2R30A 3NV3A 3IPVA 4P00B 4XFAA 3WW1A 4KWJA 4I0BA 4P9JA 1X7NA 3D0SA 2B7YA 5AVAA 4A6SA 1POV0 2DVAA 2PHWA 4XW3A 2DVBA 2E26A 1W6PB 4G3YC 4Q4Y1 1AX1A 4PBOA 1A6CA 3WW4A 1LODA 2KXLA 5L9VA 1J3RA 4OHXA 1U5XA 3B9CA 2K2SA 4XAEA 4M00A 2DYCA 1OPOA 2RJLA 2XWJB 5LCWL 1QY4A 4IGPA 4Y33A 5ABJC 1HXS1 3AYEA 3LA2A 1RUD1 2JE9A 4QGNA 4GB31 1LB2A 4J1WA 1MACA 3SQOA 4Q1PA 1AL23 1NZCA 4CCJA 2HBUA 4RN5A 3V0AB 4Q4V3 5IK8A 4DINB 1PNFA 4AI2A 4UW5A 3SH4A 5FUIA 1RUF3 4AFMA 4A7YA 4NR1A 5J1XA 3AMHA 5FY0A 2JJ6A 3OF1A 4QKBA 1W8WA 3WNPA 5DZGA 1WA4A 3OY8A 1NY72 3M3IA 4HL0A 5HCFA 5DUVA 2OKXA 1HLCA 2VMEA 3OPWA 1ZM1A 1XJAA 1IGOA 2BZDA 2VJXA 4CRQA 2GC0A 3POSA 5FREA 2ZX3A 1LHOA 4LO7A 1S1AA 5FP8A 5FBJA 4BPZA 2VECA 2R043 1YQ2A 2DFCA 1EAH2 2V4AA 3GALA 5FYHA 2XL7A 1ZZ9A 3MI8A 4XBNA 4PLOA 1AR81 1NQJA 3GGLA 5JZGB 1JYNA 1COV2 5LK7B 1E5RA 1AYM3 1OOPC 1WLCA 4Y26A 5FZ4A 1LHVA 4LHNA 2GN3A 1RHI1 3M70A 2QZ2A 3KLSA 2ZMKA 3EBRA 5HV0A 2FDIA 4LHKA 4WV8A 3AP5A 4RR3C 5I0DA 4UAPA 2WYSA 2ZHNA 4J1XA 4QU1A 5EPAA 3IDBB 4QB1A 3A4UA 4UFJA 3UKTA 4N53B 2QNKA 2I2SA 1CAVB 1W28A 4YVSB 4CCLA 4L11A 4O9GA 4EN7B 2RS12 2RM21 2HWC1 4HFSA 3QH6A 3O1UA 5CBLA 4C1XA 2H6CA 4KBZA 4IV3B 3A7QA 3U07A 3WW3A 3F2ZA 4M01A 1JBCA 3I59A 4Y3OA 1APNA 1ZBA3 2C0ZA 3D0JA 4PIZA 4AHWA 1JODA 2B42B 1JZ3A 2QQOA 2ZMLA 1B35A 3RPQA 4EROA 1E5HA 1ULGA 3X29B 5FY8A 3AXDA 4PF1A 4BXFA 1D4M2 3LD8A 5DABA 2AYHA 1TME1 1W2UA 1W2TA 1KFXL 2WQZC 3L9JT 4GULA 3N7KA 3RJ2X 4CDXA 1MQTC 5F32A 2G4IA 1VMJA 3BGAA 3ILNA 2UWAA 2NM1A 3NNLA 2V5DA 2HWE2 3MZHA 5D8AB 4LQRA 5FXXA 4AHYA 1NUKA 2SBAA 2ZX1A 3UYJA 4XF3A 3V56A 2OS2A 5A3WA 1Q56A 2JG8C 1QJFA 1R1A2 2RHPA 2A3XA 1AZDA 2EF6A 2W68A 4Q0SA 4YG0A 4LITA 5FWJA 5I91A 3MIEA 1QH7A 4BQ5A 3ELNA 4IEXA 1H9PA 2VBDA 2XVLA 5B4XA 1ZZ8A 5A3MA 2DFBA 4XIOA 2WA4A 4LK6A 2Y6FA 1IS4A 2HWD1 2QTWB 4X6RB 4CA9A 4LA2A 4LMFA 3AYCA 1EUUA 2A70A 1W3XA 2VBPA 1QJX2 3P3NA 2OUHA 2BWCA 2UURA 3NJZA 2JE8A 2WNUB 5KHHA 2CAUA 4N43B 5E8AA 3RZZA 4B1LA 1ZRIA 2Q4SA 3AC0A 3DN7A 3ZDVA 1YQCA 1NCQA 5K0UB 1Y9MA 3JU9A 1QJZA 3IBMA 1TZOA 2XBO3 4QQHA 2AEZA 4RA0A 1VALA 5JXJA 1K45A 3MIDA 4P9WA 5FZHA 4A45A 4BISA 1GU3A 3CBNA 5C8CA 5JAXA 5LASA 2IXCA 2PLV3 3W5NA 1Q43A 4AXOA 5CIRA 3M3EA 3SXWA 4CDUA 2VG9A 1TMF3 2YPDA 3H8UA 4NHXA 5FK8A 4K8RB 3VBHB 5JI7A 3N9NA 4CEWA 1CONA 3O1OA 2WQ4A 2JENA 4A2UA 1RC6A 4PIYA 3O1VA 3AP4A 1GWMA 1OH4A 3U75A 1LCLA 1OF3A 5HXVA 5FPUA 1GLHA 1N1VA 5F5QA 1UIKA 2ZGSA 2YXSA 4QB2A 5IAVA 1GZTA 2VBBA 4Y22B 4XF1A 3LA7A 2WQ8A 4L99A 5FZOB 1QQP2 2SLIA 3O1RA 3MFCA 3T0DA 5D21A 2JDNA 1SPPA 2HYXA 4Y1UA 2JICA 3WDWA 2ZGNA 4XJ9A 5IATA 1SBEA 5CKQA 4JGZB 1BKZA 4QX7A 3MIGA 5FYCA 3EXUA 5J37A 3SH5A 3AX4A 4YG6A 3VD4A 5FYYA 1OI6A 3WQ1A 4YGEA 1F31A 3EMRA 4ATEA 2ARAA 5L19A 1S0BA 3WQBA 3M7AA 4CU9A 4XJWA 4TSVA 3I2HA 4L0PA 1OPMA 3SEPA 2AREA 1YRZA 4LO6B 5KR7A 5AC93 2HEWF 2WT0A 4KL1A 5BNPA 1RUD3 4MX3A 1IS3A 3ST7A 3TAYA 3WG1A 1UIJA 1PZ7A 3B3QE 4C90A 1NA1B 3BTYA 2GMEA 2VMHA 1OVSA 3ZFGB 1ULEA 3DUIA 1OQ1A 4P5YA 2CGOA 2I74A 1W3VA 2A3YA 1LRHA 4JDMA 4JDNA 2EICA 1VAKA 3VLBB 2D6LX 1HX6A 5BPXA 2DUPA 4MSVA 4K40A 4CE8A 1NT0A 2VAUA 2Q8OA 1C3HA 3W58A 3ZXDA 4BOWA 5GZFA 1XOYA 3DL3A 4IEVA 5ACA3 5FLIA 4COYA 5T50A 2XQXA 5FY9A 1DIWA 5KBFA 1GSLA 2DF7A 2IVJA 2W08A 2I45A 1FXZA 4IGOA 2YBKA 1CJPA 4COZA 1R082 2A6YA 3ZN5A 1CJDA 1ZZBA 2WS93 1VBD1 2RE9A 2YGMA 4QPWA 1NYWA 2DU0A 4XTPA 1AXZA 2VMDA 3FMGA 3T4VA 2ZOEB 3LSDA 3VDDA 1OQDA 1UOBA 1PK6A 1PIV2 3W9AA 2VTXJ 1C4RA 1JTZX 3CO2A 4AVTA 4PIXA 3ZXFA 1F8VA 2DDUA 3TN93 3UGHA 4A7KA 4LUKA 5FP4A 3I3DA 5A7WB 4XQDA 4ZU7A 3V65A 5FZAA 1SLCA 3OEBA 5EJ1B 2FBEA 1LENA 2VNVA 3GJAA 1AVBA 1AX2A 1YIPA 1WMXA 2EAKA 2NLRA 4S2GA 3VKFC 5LA0A 2XHKA 3FN9A 3KCYA 4A4AA 4B29A 2E51A 2RR12 1UY3A 2R073 3JD73 4EN0A 4JTOA 5A3OA 4MGZE 2LS6A 3BPSA 4P9XA 3MHZA 3JBG2 3A23A 5BNQA 1HB4A 4F8AA 1UYYA 1UY0A 4GWIA 2BU9A 1Q3EA 1HRI1 3H8XA 3J8F2 4Z2AA 3ES4A 1XNAA 2N7GA 4DB5A 2A5ZA 4LT5A 1XC6A 2JDHA 3S5AA 4JGYB 1TME3 2WN3A 3SITA 3O7OA 5JSRA 1J58A 1UOJA 2ZXQA 1H2LA 2QQVA 3ZXLA 3ZOIA 1QJY1 3AP9A 4IESA 1AHSA 3TYJA 2IUWA 4AYUA 2ZGTA 5DDJ1 4BDVB 3NKTA 4CCOA 4QPGA 2ZAAA 5F5IA 1FOD1 5E89A 4YG3A 4TXWA 3ZSKA 2P5BA 5H9PA 1OBNA 2PQQA 4LKSA 2W9XA 3THPA 3CL1A 3HNYM 2GU9A 4C0HA 4LULA 5L73A 3FUQA 1VBE3 4AVBA 4NRQA 5FYBA 4EV0A 3R0RA 5I0SA 4ZXKA 5GZEA 1K5MA 3EQEA 3WR0A 3VBUB 4UF0A 3BCWA 1YI9A 1IS6A 1CZSA 1JS9A 3C3VA 4KU7A 3CJXA 4YVSC 1W6OA 2ADDA 2TBVA 2E63A 3EB7A 4G9SB 4O65A 1H0BA 4XMIA 5FMDA 5CG9A 4K21A 2JWPA 4QPIA 4N9IA 5DG1A 1FPN3 2X53S 3KV4A 2JKXA 4IV3C 1Y9QA 4K8FA 5A3PA 4A42A 5CKNA 2GP5A 2MHFA 1K12A 3SCGA 2WJSA 4XURA 1COV3 1YYNA 4OZOA 2HEVF 2LW8A 1BEV3 3LDBA 2WO7A 5FYIA 3TNQA 3UJOA 2PXJA 5IYYA 1ZYBA 1KS4A 1GNHA 1F9KA 4CCDA 3ZYPA 1JZ2A 2BTVC 2VH9A 4INDA 2E7AA 4R9DA 2F4LA 3GNEA 4XCBA 3K4DA 3SNMA 2PMWB 2WFF2 2WUHA 1JYTA 2EXIA 2AC1A 1T6BX 3AKPA 4LBQD 1R092 5D8AC 2BNNA 5BV6A 1CPNA 1UMHA 2OW4A 2QQMA 1OHFA 3OB8A 1XNTA 2R7EB 3LE0A 5IUQA 4WZCA 1A3KA 2ARCA 4Q4X1 5J7MA 3WF0A 1ODMA 1BVVA 2WDBA 2E9QA 1HJFA 2XWBB 1UQXA 1C5IA 3OYWB 3DXTA 3BU0A 2R16A 5FO8B 1MEC1 2R49A 1BBT1 3DEMA 3RDIA 5F3CA 1MS0A 4Q4W3 3T2QA 4Q27A 1AXYA 1JUHA 2YBSA 4YZ4A 5IK7A 4CPBA 3WG3A 1DQ1A 1OD3A 4O61A 1CR7A 1YQ6A 2A1XA 3HQUA 4ISQA 2B45X 4MVTA 2HWB3 4OHYA 5DZEA 1PVC1 1UZZA 3KT1A 3IAQA 1AL22 1AR71 1W2OA 1KQRA 1UCXA 4YVWA 1QJEA 3BOPA 3OBRA 4Q4V2 2WNUC 2XKOA 1ZBE1 1WCKA 1W99A 2D6NA 3B00A 4IXLA 1RUF2 3PUIA 1C8M1 4N43C 2R1BA 5EJ3A 5A32B 3T2TA 2YPJA 3M4FA 4MXWB 1S0EA 4BMBA 4BCUA 5J96B 2GMMA 3QD6A 2W87A 3NW4A 4JHZA 5F2WA 1V6MA 3ZN4A 2WZR3 3WNXA 3KWVA 4XPVA 3BB6A 5BNNB 1MS1A 5IK4A 3VBOA 2O0OA 4L9BA 5I0TA 1CZTA 2AZ5A 4MH0E 5HXMA 4MGKE 4RHV1 3VBSA 1W6NA 2J42A 4MXVA 3MW4A 3D4KA 2R042 4QWNA 4A3ZA 3VBHC 1BK0A 3LB9A 2BOIA 2WAOA 3LDRA 4NRMA 2RS33 4AW7A 5FZEA 4ARXA 3NAPB 4KBBA 3CQOA 1X9TA 2H6BA 3WEZA 2XG3A 1AYM2 2ZTNA 3FWEA 4LBNA 4X6QB 5E16A 4A6OA 1E5IA 2R0FA 2OQ6A 2LROA 5JMOA 4P9GA 5FDBA 3E6CC 4OI0A 1PMIA 3RYKA 3IMMA 1TNFA 1V6LA 1YFWA 3OOXA 4HLTA 4Q29A 3RZGA 2CGPA 5T5PA 1OVPA 4FOVA 3D82A 1H8TA 3OJBA 5JMCA 3W20A 5C4WB 2WR9A 3S7IA 3VBFA 1G8WA 2WZ8A 1JU4A 3BTAA 1OQEA 2JIGA 3UETA 3FJSA 4CDWA 3RZMA 5LY2A 2P2KA 1H4HA 1QF3A 2ZPXA 1AYN3 4CP0A 2HWF1 4XJ8A 1FV3A 3RRDA 3DCQA 3BTXA 1RUG3 1OOPB 1ZBA2 3ABZA 2YFUA 2Y26A 1HRV1 2ILMA 1NA1C 1WMEA 5FZ6A 4AVVA 5C3RA 2PHUA 4B8EA 4RR3B 3OG2A 4EWDA 3AJYA 2B46X 2UU8A 4CP9B 1A8DA 4BU2A 1QOOA 2WNVA 3AMNA 3TEXA 2B9UA 5T52A 2PFWA 3K75B 1CX4A 5J98B 3N3HA 2WNOA 5AFBA 2XUMA 2HBTA 5EP9A 2QQLA 3VV1A 1VB2A 5FZKA 1CAWA 2TEPA 2VUDA 5FMBA 3WNKA 2XJSA 4X8NA 4AQTA 1LHUA 1WD3A 1QJY3 3H1WA 4CCNA 3O1MA 2W1WA 3O1TA 2G9FA 2HJIA 5FMOS 4WM7B 4XTMA 2RMU3 5CFCB 3HR9A 2R063 5H9SA 2W52A 3J7MA 1TE1B 4V1PA 3ZR5A 4FOYA 5HBAA 4Z92B 3LEMA 4IERA 1XYPA 2QKDA 3ZXKA 2VNGA 4LHLA 1NOVA 2IZWA 4COUA 4E4DX 4G4FA 2VTFA 2P3YA 2ZGOA 4E2SA 4JKLA 3C8XA 3RMYA 1D0GA 2ZGPA 5IW0A 5F9TA 1NAEA 2CL2A 3HN1A 5JR2A 2NMNA 4FAHA 4FTEA 3APBA 2ZMNA 4N9HA 1ZX5A 2JG9B 3AP7A 4META 2JG8B 4H3WA 4UXAA 1RUNA 4TYSA 4Y1ZA 4LIUA 3ZSEA 3GHMA 4Q8LA 4LIVA 1I9RA 1VBA1 4FQ4A 1MZFA 4MV2A 1C1FA 1SCSA 4Q0QA 4GH4A 2NYYA 2F6BA 3C7EA 2X5IA 1QU0A 4WBBA 5E88A 3W5MA 2O8OA 3WV6A 1H1MA 1ZVFA 3PLQA 3D3AA 4QX8A 2ZHKA 4JRAA 1IZ3A 1OURA 3N7JA 1VR3A 4OQ8A 2PLV2 1AR63 4RQPC 2OT7A 5C8WA 4ONUA 2XJUA 1TMF2 1S0JA 3N9QA 3OEAA 4FPKA 2G9GA 3M3CA 3M8LA 3NNFA 5T5OA 1HB1A 1WCQA 4JGYC 4TN7A 2XJPA 2YC4A 3VN4A 5KXDA 5FZ8A 1CX1A 4IEUA 2X8KA 3OTFA 3ZSLA 5L36A 2BBVA 4Q5OA 2OX0A 2P6HA 2VVDA 4ARYA 2ZGQA 3H0OA 5JXIA 2D6MA 2WSUA 2JDKA 5A7PA 4W6YA 3ZIXA 1W9YA 5JPMB 2DBNA 1DLCA 4XDQA 5L7OA 5KHGA 1YI7A 2XJQA 3ZXEA 2VOVA 3P5BA 3LWCA 3R4DB 4JTNA 5EQUA 4TLFA 5FLJA 1GP4A 1SZBA 1W8OA 1KJLA 1HB3A 1XYNA 4FT8A 1BBT3 3RYRA 2J1RA 1NLSA 3BALA 1UPSA 5A7OA 4L97A 5EHDA 1X9PA 4YLZA 1JYIA 5FZLA 3WDTA 1GP5A 1F4HA 1PHMA 3B01A 4NHYA 3VZJA 1VMFA 5CISA 4J6GA 3A0KA 2DCYA 1AL0G 2XR4A 5AC92 3VBUC 1RUD2 1ND3B 3AM2A 5FO9B 5DAPA 2OQ7A 3JZVA 2BUKA 1UOGA 4DXRA 1J59A 4D3WA 5I8TA 4DUXA 2Y38A 4YW5A 1DP0A 3Q8AA 3EJKA 4KI5M 1ZBE3 2IXLA 3PVOA 5FYSA 1E5SA 1Z0HA 2ZA9A 2MEV1 2VVFA 1ALYA 2XGXA 5LBBA 2D98A 4ISRA 3U10A 3WQ0A 4KQ7A 1DF0A 3T08A 4Y4YA 3I49A 2WT2A 5HI0A 3ITQA 3ZYRA 5ACA2 1TVGA 2VCCA 3Q8BA 2AR6A 4QHZA 4QM9A 1R1ZA 2VCAA 4F7ZA 4MOAA 5FQ0B 2PHTA 4IEPA 1EV13 4W8JA 2I07B 4KG8A 4YGDA 5LRRA 1JN2P 1JZ5A 5C6CA 3S0MA 2AENA 2JKBA 3HBKA 1V00A 2WS92 1XNDA 1MS8A 1XNCA 3IPVB 4QQOA 1DQ5A 4NIIA 3K46A 1WWYA 1O3RA 4RL7A 3POGA 1DGWX 1H2MA 2WSVA 1VBB1 4A41A 1PX3A 3AFKA 2P17A 3LKJA 5FZBA 4XJAA 4AEMA 4LPLA 4YGBA 2BGPA 3PJYA 4D7YA 2BJSA 3J4UH 1NXD1 3TN92 4AQSA 3THDA 1NE6A 5LWBA 3PL0A 1QXRA 3V0BA 4D8MA 5C71A 5FOBB 3R4SA 1O6UA 4DOUA 4NPLA 4AZZA 4HN1A 4Y5Z0 5DUXA 5KHIA 2WFPA 3KGLA 4ZKTB 4RFT0 4YW3A 4LBQA 1RUE1 1RMU1 1W9TA 3ZPYA 5BYNA 3OPZA 2E7TA 1VRH1 5IJRA 1S4CA 3PMSA 2HWF3 4KWUA 2DCJA 2R072 3ACIA 3JD72 2QQNA 3N9MA 4XQ4A 3NSTA 2DBIA 1HQNA 2W1SA 3GHNA 1FMD1 4IV1A 4N90A 5KHKA 2ZGRA 3ZVXA 3WDUA 3OY8B 4QX3A 2NPIA 1PGSA 3I3QA 4R9BA 5FBZA 4WZFA 3I97A 5FUNA 3BOWA 1F5FA 2YZ4A 3FFZA 4D69A 1YLLA 1QJU1 4NPMA 4OFGA 3AVRA 3VBRC 3WY6A 3UKNA 4D6SA 1LHWA 2OIIA 3WW2A 1TME2 1U0AA 2XPJA 1J83A 1SBFA 3HOBA 4F3JA 1DG6A 1QWRA 1NQDA 1GANA 3OBAA 5BNNC 3AXEA 3GJBA 4OHVA 4YFZA 1ZRFA 4S2FA 1W6QA 3FLPA 4LOTA 3BODA 1C1LA 4NO4A 5LBEA 4FPGA 4XFFA 3ZYGA 1X36A 1JYWA 3IAPA 2D97A 1F35A 3VKOA 3ORJA 3VHNA 3AYAA 3NAPC 1PMJX 3RQ0A 1XRUA 4ZS2A 1PO21 3IIIA 3O0XA 2XJVA 5F37A 2WRAA 2GP3A 3HAGA 4MGQA 5ANQA 3ZYFA 3MIBA 1JZ8A 3TEWA 1VBE2 4LORA 4O7XA 4Y4RA 1AUYA 2BPA2 4OUMA 5KXEA 3MDPA 5C4WC 1UXXX 1V9U1 4NHLA 5FPAA 1O3TA 2D3RA 4ITCA 4AFBA 4QX1A 3WF4A 2QDNA 2GNDA 2G19A 1CESA 2RS51 5A6ZA 4UFHA 2P34A 3TWIA 3FE5A 1OFNA 3W21A 5F1RA 2QZ3A 1FPN2 4O9EA 3OBZA 2W39A 5DPNA 4LBJA 5FZCA 1KITA 1VPHA 3PU3A 4BMEA 4EZ4A 5BNOC 4LLFA 4NHMA 1K3IA 1W90A 3VB9A 1X82A 4FXGB 4QQ2A 4YW4A 5JSOA 4DXSA 1BEV2 1I6XA 1ULCA 5ERLA 2CDPA 1RVF3 1YQ5A 1O4TA 2V73A 5T55A 3WUDA 5J48A 4HG6B 1IKQA 1NZIA 3HBZA 3MUZ1 2Y6GA 4E8CA 1DFQA 4DXTA 3H1MA 1G9CA 3VHOA 3ZXAC 4GMP3 4UFKA 2VZUA 4WM8A 5F5AA 1OMIA 1XXNA 2E7QA 5C3OA 2FQPA 1WZXA 5ISLA 4NPRA 5GKAC 2LUWA 4R52A 5JVVA 4R4XA 1W03A 3GF6A 3LQCA 4GKYA 3MEPA 4BE3A 5C5TA 1LOGA 1JHJA 3ZLIA 3BVCA 3PDQA 5JSPA 2BERA 5JOZA 3H8OA 1NKGA 3USUA 4LBMA 1GYKA 3RVHA 4OMDA 2YROA 4WM7C 3KQRA 4Q4W2 4RS5A 5CFCC 5B2GB 1KS5A 2YUEA 5E1RA 4PQ9A 1KEXA 4BQ4A 5SV5A 1POQA 3DXUA 4Q0UA 1PGL1 3MLKA 4CPBD 3ZIWA 2HWB2 1D2SA 1HKDA 1RIRA 3ZYIB 2BGOA 1VBC1 4YYOA 2Y6JA 3C7FA 5JI9A 1NCQB 4MO3M 3H3UA 4XDPA 3PU8A 5FY4A 4PLMA 4OI2A 2JG9C 1PVXA 5DAVA 5AFEA 4QDRA 4NROA 5JCTA 3BTZA 5F6KA 2V72A 2IXIA 3K48A 3OUIA 5F6LB 5JZGA 3N35A 5C8CB 3A22A 4XFBA 1S0IA 3MF9A 4IEOA 1YJKA 1ENRA 2WZR2 3N4MA 1UU6A 2ZZQA 3WCRA 4LKEA 2XLAA 4CEWB 4AHZA 2YU2A 5EYYA 1K42A 1H8VA 4MUVA 2GH8A 4XMAA 2FCUA 1IPKA 2ZJCA 5DUWA 3LSEA 1ND2A 2VM9A 4GA9A 4N53A 4QXKA 3AK0A 2Q1MA 3VGIA 1A34A 2WN2A 5IAXA 4IEYA 3FL7A 2RS32 2XOMA 2XJRA 3HMYA 3WF3A 4AGVA 4XJZA 2OZJA 3DPRA 1Y9GA 3ATGA 5FYUA 1SMVA 1SPPB 1MVQA 1AX0A 4JKMA 4HPKA 4V2WA 2L9LA 1Q8VA 3SH3A 4AI9A 1NY71 1SFPA 2DVGA 4DIQA 4CVUA 1BVP1 5A1FA 4FSJA 2PAEA 4YWAA 1PM4A 4CUCA 3NJVA 4HKLA 4SBVA 1ACCA 3GBFA 3Q8FA 4Z82A 5LBFA 1TEIA 4LHSA 4R9CA 1HV0A 3ZFFC 5EJZB 4BA6A 2W1QA 4DRRA 4XBLA 1AYN2 2ATFA 1EAH1 2JD9A 4EN8B 5EIYB 5BNPB 3TEYA 3H7JA 3MO4A 4DY3A 4FO9A 5T5LA 1HW5A 2TUNA 3RZJA 1DZTA 4AFCA 1OLRA 1NXMA 1RMU3 3OUJA 1RUG2 2BBAA 2CGNA 3B94A 4C0BA 2VW1A 4XUNA 1VRH3 1ND3C 5JDBA 1WD4A 1QNWA 3ACGA 4BLJA 1RJ7A 3MYXA 5KC6A 1UU4A 5C33A 1LAJA 3OGJA 1KXGA 3EO6A 1CVNA 3U0ZA 2WNEA 1L3JA 1DYPA 2QUOA 4PDWA 4Y20A 3U1XA 1GQHA 1REEA 3UGFA 4P02B 2RS11 1A78A 5A3UA 3E6BA 4HSLA 2WKKA 2YV8A 3K4ZA 3PHMA 2JDMA 3GYDA 4Q4Y3 3KV9A 4D94A 5K4LA 2VMCA 3BKZA 3VDDB 1GNYA 1QJY2 1LGNA 2Y0OA 1HXS3 2VOWA 4JVAA 2VCBA 1PK6B 4H7LA 4QKFA 5CFDA 3IDAA 3KT4A 4GB33 2HLEA 2RMU2 1SLTA 3D5OA 5DDJ2 2J7MA 2R062 4ZU4A 4CU8A 3KS7A 4QHOA 3IT8A 4QPYA 3POBA 3ACFA 1Z7S1 3SKVA 4CUAA 4JZRA 1GOFA 1JOPA 2AACA 2WIIB 3T3YA 3VHPA 1A8MA 2C1FA 2P4EA 2VUAA 3LEIA 3I4IA 1S2BA 4XJUA 3ZO0B 1LOCA 1JW6A 4HKWA 4NIHA 1Y3TA 2RJKA 2VR4A 3AJZA 3JB4C 3MGUA 3ZDSA 4AVCA 4CU6A 5A3LA 4CDQA 2QQWA 1Q8SA 4DPNA 3JQWA 1IOAA 3MICA 2WZPP 4FTSA 5IVYA 4DEVA 5CYYA 2EA7A 2XUEA 1V9U3 2VW2A 3MV01 4B4RA 4QM8A 1UWWA 3BN6A 4N8MA 1H6YA 2RS53 5GLZA 1RUOA 1J84A 1WW4A 4AFAA 5CG8A 4FTBA 2DCKA 1AR83 2WABA 1U5YA 2ZGKA 1J1LA 4XZPA 1UY2A 5IVJA 5G04L 1AR62 1LOAA 4EYUA 3O1PA 3TRSB 5IFPA 3WG4A 1YFYA 3AKQA 1RHI3 2Y6HA 2VMFA 3NWKA 3IN9A 5FZIA 4AEKA 2BEOA 4R9AA 2QDRA 1JYXA 2AH2A 3KVBA 1ENSA 2JDZA 3N9OA 4RD7A 1QJX1 1DYKA 3O1SA 4Y5SA 4Z8BA 2K9ZA 2C6SA 3H42B 3CIHA 3HQXA 5A3NA 1QH6A 3J7NA 3WHTA 1JMUB 1RUH1 2HWC3 2HYKA 2J1TA 2RM23 2H0BA 4HKOA 3E97A 4QPGB 4DUWA 4Z1VA 1WW5A 3CJIA 4LTAA 2BFUL 2IWGB 5JPNB 2XH6A 1WLTA 2AUYA 3ASIA 2O8QA 5JXGA 2GC1A 3ZFGA 2VZ3A 3PIJA 4GWJA 4RQPB 3KF5A 1PM7A 4KH9A 4FQZA 1BBT2 1EY2A 1RUJ1 5FZGA 3RWNA 1K5MB 1REFA 4JV4A 1BK1A 4Y1VA 3AFGA 5SV8A 3S30A 4ES8A 2DUQA 2J22A 5FZ9A 4EQVA 2GNBA 1DDLA 2Y33A 4IUGA 1W6OB 4WM8C 3H9AA 3URFA 3CNAA 1ZNPA 1OLQA 3CZUA 4I3PA 5HCBA 3HNBM 1PNGA 4L8QA 1HQLA 2FDKA 3DYPA 5I8SA 4CXYA 4CEYA 2XB6C 2QFEA 3SISA 1VBC3 2GALA 1QQP1 5FZMA 1NCRA 2E6VA 3PUQA 3O14A 5FPXA 1ZBE2 4W6XA 2OXBA 1B35C 1JU3A 4GQ7A 4LNVA 2B39A 2JB4A 3PUAA 3FHIB 1HIXA 2PELA 4QB6A 3VL8A 1W9FA 4HVOA 5DAXA 4AVAA 4CDXC 3OGSA 1VAVA 3ON7A 4AEJA 4PCRA 2WLPA 2QQPA 1F5JA 3MFAA 5DUUA 4BWOA 4FFGA 1EV12 3DYMA 5C9AA 4BM8A 4OUEA 2HWD3 2YDEA 2YY1A 4FP2A 5LW9A 1ULPA 1OC1A 2VTXA 4LXLA 1VLNA 2OA2A 1BLZA 4TTGA 1Q8QA 1FT9A 1QOTA 3LZZA 5FLHA 1LEDA 2FDHA 1LOFA 3CDZB 4AR2A 1D7PM 1MZ5A 2W1UA 2XL9A 3SCFA 4EWEA 4FPOB 3OSDA 4E4HA 4GXLA 2O14A 2VNOA 2BDRA 2RDSA 2FMYA 2WA3A 4QDSA 1QGLA 4AEDA 4NAMA 4P9LA 4AAPA 5IT6A 3RYPA 5C70A 4DY5A 1VAMA 2GNTA 3NVCA 5F3IA 5FYMA 1CAXA 1R081 1U12A 1MZEA 1RUC1 1X33A 2WINB 1UF2C 3C7OA 3LPGA 4D7TA 4MG2A 3WQ7A 2YC0A 3LOBA 2ZZJA 2HWF2 3WSOA 1N3OA 4K1ZA 1UPIA 1VJ2A 2IXJA 1NCQC 2WZEA 3PVBB 1PIV1 5A7SA 2VULA 5J36A 3HWJA 1W8ZA 3GZTB 4NE9A 2W46A 4ZHNA 2VU9A 1FYUA 1US2A 1HRV2 3AZZA 1S2KA 4HONA 5CAZA 3ILRA 5C8CC 3VBOB 1FNYA 1W8UA 1S0GA 5A1LA 5JOWA 4MGIE 4CDUC 3RSJA 3VBSB 3E6DA 2OYZA 1BJQA 4CEWC 1PX4A 3AZWA 1RGSA 4OMCA 2CNAA 4BQ3A 5IVEA 1MS9A 4UWDA 1QXJA 3WVJA 3FHQA 1BXHA 3FLTA 2RR11 3NQHA 1YJLA 3MBWA 4XFCA 5IWFA 2R0HA 2JD4A 5IHRA 3H1YA 5LBCA 1I3HA 4CZSA 1XSRA 3J8F1 1QKQA 4NUBA 5GJ6A 2GDFA 2Z5WA 3THCA 3P3PA 3PIGA 1IPJA 1H8TB 3U4SA 3VBRB 1LU1A 2VQ0A 3M1HA 5K8SA 4IETA 3U78A 3VBFB 1Z7S3 5FXVA 5E6HA 3QBQA 1O91A 4GALA 3USSA 3WP5A 3W59A 3GZEA 4ZXEA 5A33B 2KM2A 2D3PA 2B9VA 1SFYA 4HK8A 1SBDA 3O0VA 5FP3A 3CHXA 5BNPC 1BQPA 4JQTA 3WX5A 3POEA 4BQ2A 1AR91 5LA1A 2E32A 3WZ1A 3OGVA 3MV11 4ZONA 3PUHA 2CAVA 1VBD3 3HT1A 2CTVA 2WNVB 4FPCA 3RG0A 2VZ1A 4M3CF 2WBKA 4OYUA 5IVVA 1RVF2 3B69A 3ZFEA 4E9KA 5AVPA 5CU1A 2A71A 1PGW1 1O5UA 2YC2A 3HD8B 3NNGA 4XF0A 1JHNA 2RG4A 4CP2A 3IDEA 1CAWB 3P6BA 2FDJA 2DU1A 1STMA 2EIDA 1SQ4A 2VMGA 2FCVA 2W5FA 3FFQA 4LO4B 2VZPA 4LJHA 2VXRA 4I02A 3VDDC 1RINA 2KA3A 4L92A 1RUH3 2ES3A 1CIWA 2WO2A 2WYFA 2XLGA 5BNOB 5HCHA 1LKNA 1XB9A 1SFNA 1PK6C 2RDRA 4Q2FA 3WP3A 3WINE 1WA6X 1CD3G 4XUPA 4RYDA 4E8DA 4MLOA 4FPEA 3LDKA 3T0BA 1HRI3 1IQDC 2D40A 2BNMA 4OI1A 1RUJ3 4FXKB 1WGPA 2WFF1 2EIBA 3GCXA 5GZDA 2VGDA 1S0FA 4IE6A 1R091 5LB6A 4YZ3A 5ABJA 1YHFA 4ATFA 2YHJA 5F39A 4XYXA 4LK7A 1LTEA 4PT6A 3CZJA 2JXAA 5HV4A 1EPWA 1UAIA 5FY5A 1N47A 3FX3A 3LEGA 4GH4B 4IE0A 4JC1A 2X5IB 4K1YA 1I1EA 5F8PA 1C5HA 4D7SA 2Z42A 2OUJA 3QLQA 3RWKX 1UYPA 5F7UA 1O8PA 5D2AA 5DDJ3 1M06G 4HETA 3LIGA 1FOD3 3NV4A 3KD4A 2HH9A 1SCRA 3LFMA 4NHKA 4LEJA 4I0WB 3FC0A 4QGMA 2VOXA 2VVEA 2E33A 1UYXA 1WBFA 4GKXA 4AI0A 2Y6LA 2W47A 2MPFA 2ZX4A 1XNKA 2B4KA 1H2NA 1I5PA 1POV1 1XQNA 2XKPA 3IB3A 4L2NA 4Q4V1 4KNCA 3ZXJA 3KM5A 4JDOA 3AKSA 4C1WA 1RUF1 1QXPA 4NIAA 3I2KA 4LOSA 4XE9A 5A7QA 3HEIA 4QPGC 2WO1A 1VP6A 3S5QA 1OOPA 3AP6A 3MW3A 4EZHA 1CIYA 4IE5A 1OUSA 4LBOA 4XIKA 4RR3A 1WLWA 1CWPA 2EIGA 1Y43B 2P3IA 5GLVA 4MHRA 1ULDA 4P5HA 2R041 2X10A 3HQRA 3KZ4C 1K5MC 3MUY1 5EYXA 5JOXA 1KGYA 2WWSA 2PN5A 1ZZCA 1RMU2 4A7ZA 4QXHA 5LRSA 4M3CB 1RUC3 1AYM1 3OD4A 4S2HA 2R6QA 3IDCB 1VRH2 4GJYA 4QPIC 2A6WA 4EJRA 3OPTA 4BJ0A 4ZS3A 3I2FA 1AJKA 1HV1A 1CZVA 1OFSA 3GDBA 3MPBA 4J25A 3S6PA 3AVSA 5FJHA 2HEYF 3CMGA 2D5HA 2RJ2A 5GM0A 2ZKLA 3U11A 2ADEA 2Y8KA 4Q4X3 1CAUA 4S2DA 2F4PA 3HPNA 2JB8A 3AZXA 3JB8A 1ZREA 4ASKA 4JX0A 1MEC3 3BUCA 3ZFFB 2D6PA 2VD7A 1MQTA 2CHHA 5CEHA 5DQ0A 5FO7B 4CUGA 4Q4Y2 4Q1RA 4BQYA 5FZ1A 4W65A 3N9LA 4COVA 1W04A 2ET7A 3AKRA 4BH9A 1W0PA 5LEKA 2V4VA 1W8FA 1HXS2 1ZBA1 2X29A 1ENXA 2VOKA 2XVGA 2JG8A 3RI9A 4UW6A 4COWA 1Q8OA 5FAXA 3WNNA 1W6MB 4LKDA 4GB32 1PVC3 2VQAA 1AR73 3CKHA 5FMCA 3VL9A 4LO5B 2BP6A 2W3JA 4JQRA 2QQUA 3QH7A 5L9RA 4QGLA 5FXZA 1C8M3 3V0BB 2BRTA 2C4XA 5KWRA 1S0CA 4DO0A 1SEFA 4LLOA 2RDNA 2ZGUA 1SG3A 1ASJ1 5FZDA 4AI8A 1IG3A 4JAAA 4LBQB 1IPSA 1H1IA 4XAAA 2DTYA 1WKYA 4XVHA 1PO11 1DU3D 1V9U2 1JH5A 1IHMA 1L7QA 2ETEA 5CADA 4RHV3 4JKKA 1F4AA 3DF0A 4WVMA 2IC1A 2P3JA 4GJZA 4I30A 4IV1B 4JHTA 5DN2A 2RS52 4YVWC 3AZYA 3BI3A 2W95A 1DGRA 2EXKA 1G9FA 3SMHA 2JECA 3AZVA 1AR82 3I54A 1AR93 2B5HA 3KHBA 2JDPA 3N7MA 1RUI1 4YZ5A 3NJXA 2BNOA 4IE4A 4U36A 1GR3A 5TSWA 2Y6KA 2P1BA 4AQ6A 3O12A 1GZCA 1RHI2 3TNPB 4UBHA 3B7MA 4LBLA 4A44A 1D2QA 4XCAA 4I01A 1GZWA 3R05A 3VBOC 4OZXA 1W6QB 2ARBA 1BYHA 3FBMA 3Q8CA 4OUSA 3VBSC 4W50A 2RM22 2HWC2 5BUVA 4Q0VA 1OKQA 1V70A 5FKCA 5A80A 1DQ4A 1O3QA 4QMAA 2XBO1 1DYOA 1OA2A 3BPZA 1E57A 3FZ3A 3N9PA 4PJYA 3POIA 4F83A 1X8EA 2ZACA 1HJGA 1YUDA 2PLV1 5BXXA 5HPOA 1GUIA 1GBGA 3Q8EA 1TMF1 1HRV3 2J1EA 3F95A 2VZVA 1H8TC 4YSFA 3GZAA 3VBFC 3VDAA 1LGBA 2CV6A 3GXUA 5FUPA 1XYOA 4CDWC 1T6GC 2D7FA 4GWMA 1PGL2 1LOBA 1UX7A 5EXOA 2VY0A 1UW8A 4XF4A 5LA2A 1DZQA 4B3NA 2DCZA 3J9SA 5FQ0A 2EXJA 1GFF2 3DECA 3HJRA 3K2OA 4B7KA 4CYDA 1MS4A 1VBC2 2D6KA 4FOQA 4PLNA 4CSWA 1BMV1 2QCSB 3ZM8A 5FTTC 3SEEA 3FHAA 1XSQA 3VD7A 5C3SA 2P37A 1Y7BA 5JIUA 3RI8A 2R32A 4CCKA 3WDVA 2UWCA 1DZRA 4YARA 3E5QA 5KXCA 2G1MA 4BXSV 4BIFA 1SLIA 2WT1A 1IS5A 2WNVC 3WLUA 4BK4A 2A6XA 5KC5A 4OHWA 1JYVA 5JWPA 1QDCA 4QQPA 4EE2A 2DTWA 3H7YA 4WM8B 3ZN6A 5IFTA 3U4XA 1QIQA 4FPYA 5F2SA 1H1AA 3INAA 1MS5A 1NX9A 2HWD2 5AC91 1YXWA 3NV2A 4BYYA 4CTEA 3J26N 3T4HB 1HN0A 2VZTA 4MZUA 3ZX7A 1PZ9A 4YFWA 5LATA 4DXZA 4OULA 5CNAA 5DZFA 1POV3 3TEZA 3I59B 5G05L 3PNAA 3K3OA 2XONA 3USUB 3T0AA 4U2AA 1EPZA 1B35B 2FHRA 1QOSA 1H2KA 1KD7A 2CY6A 4MGSA 5FYVA 3RJRA 1RB8G 4RS5B 4GMP0 1HB2A 1YQ8A 1VBA3 3I3BA 2EAAA 1GZ9A 4CDXB 1N1SA 3LF7A 2A75A 2ZAHA 5ACA1 4XXAA 1JOJA 1BHGA 1JZ6A 1WW6A 4MHUA 3HIFA 1FNZA 2XVKA 3IMNA 3OBTA 1YCIA 4NRPA 4R8HA 5C7GA 1LGCA 1W6PA 3ZMOA 3B02A 5GLWA 3GBGA 4AG4A 2Q1FA 4YM3A 2WS91 3WDYA 4YM2A 3N7LA 1TQ5A 2Z79A 3QOPA 3WT3A 4I3GA 2BOJA 1Q5OA 5J09A 3DKWA 4DS0A 1U5IA 4GH4C 3LGRA 3U14A 2X5IC 3NKGA 3VZLA 3V0AA 1WBLA 2UYAA 3AMMA 3POJA 3TN91 1XBFA 1LHNA 1XE8A 2ZEZA 4XOGA 4AWDA 1IQAA 4UFIA 1ND2B 4K6BA 2JDYA 4NWWA 5KHJA 2VUJA 2LM3A 3T1LA 1W2AX 1NLRA 2Y0IA 3OD0A 3VD5A 2XJTA 1HQWA 1LNSA 3UK9A 3P1IA 1DLLA 2EIEA 1KRIA 3DPRB 2R071 3JD71 4ZZ8A 3J7LA 4GD4A 3PUSA 2W94A 2AGSA 2DUOA 3V64A 4BLIA 4HPKB 4IQPA 1S0DA 3MIHA 1ZRDA 2QBXA 2C9AA 3MIFA 5A6XA 1WMDA 2JIJA 5L7OC 2YFZA 2C26A 3ETQA 1AF9A 1N3PA 1Z7S2 3JCIA 1OA4A 4NOTA 1FV2A 4CDUB 2BVVA 4D6RA 3LFIA 2GSYA 2MEV3 5CZKA 5GALA 3K4AA 4DRVA 1V0AA 1DQ2A 2E53A 4FPHA 2NP0A 2A3WA 2D3SA 1ASJ3 1O59A 2GZWA 4H55A 2R1DA 1CAVA 1WCDJ 4NWVA 2ZCWA 4YVSA 4DEQA 4PF5A 1PO13 4GIQA 2YYOA 4B1MA 4CP1A 4E27A 2XDVA 4V2VA 1KDMA 1FI2A 3T09A 3UT0A 4AL9A 4AGGA 4E2GA 4IV3A 4Q8KA 1GMMA 1VBD2 1O7FA 3J7HA 2Q8CA 2C9KA 4CU7A 5I0UA 4PDWB 4Y20B 3KV5A 1VBB3 1VBE1 1RUI3 1ZZ7A 1SLAA 5FRAA 3C2UA 4B7EA 2ORXA 2ZBJA 3PURA 4XETA 4XFHA 1LECA 4YZ2A 1OLMA 1OLME 3HT2A 4UOJA 2PYTA 4LKFA 4D0QA 2VQTA 4Z2WA 1SHWB 3RZHA 4UYBA 3WP4A 4JCKA 5CFDB 4UW3A 1FPN1 5GLTA 1GKBA 1ZZ6A 2BWAA 2Q1ZB 5D8AA 4BQWA 1US3A 1RUE3 1RUH2 2ZEWA 4GWNA 5FIXA 4BQXA 4XUOA 1COV1 2ID4A 3R6SA 3M2MA 3QCWA 1OSGA 1BEV1 4TWTA 5C3PA 2DVFA 1FMD3 4YW7A 3UJQA 3ILFA 1EP0A 1SDWA 1HRI2 4CDQB 2JE7A 1VB4A 3I2GA 1RUJ2 1LESA 1GOGA 2NZ9A 1QJU3 2P6CA 3A21A 3THTA 2VE1A 1P8JA 3ZXGA 2ZGLA 3PVEA 4RGAA 5FCCA 3TBDA 4XUQA 3WCSA 3ZSMA 1DGRN 2TNFA 2BQPA 3ETPA 5ANNA 4HVRA 1OH3A 4Q0PA 2ZX0A 1W9WA 2P3KA 5JUVA 2GC2A 2WNUA 3IIAA 2ZHLA 1Q8PA 4IV1C 4N43A 1JI6A 4GZ9A 5K0UA 4Q4W1 3C7GA 4AQ2A 4HBNA 1FOD2 1ZRRA 1D4M1 1UZYA 2IXKA 1NG0A 1OUXA 2GH2A 4N7IA 4RFRB 4FAGA 2DWRA 2W0XA 1G7YA 3LPFA 4LO8A 1UY1A 1LJ7A 1UMIA 2JDUA 2PQSA 2RV9A 1JXNA 2J1AA 3ES1A 1PO23 3JUUA 4QXCA 1XU2A 3I2JA 2HWB1 3M3OA 2ZHMA 2C24A 1OXCA 2HWE1 4IEQA 4FI9A 5DG2A 2ZEYA 4NN0A 3G6JB 2ZEXA 3WNOA 1RITA 3H8RA 3VBHA 4AI1A 3CJIB 4NIDA 3LIHA 1YO8A 2OPKA 2F17A 1R1A1 4M0HA 3KGZA 4LE4A 3MF6A 4K3UA 4BHPA 2V5YA 2A6ZA 1O8SA 2ZX2A 5FXWA 4OI4A 2X05A 4IL7A 2D43A 2JEMA 2WZR1 3CU7A 2CWSA 2ENRA 4XDOA 4Y22A 5DAQA 5FZOA 2GNMA 4LR4A 4AF9A 4PI0A 4OCTA 3UL2A 3T2OA 5CA6A 5GZGA 3H3LA 2DVDA 2XHNA 1YFXA 3WP6A 2D5FA 3Q9OA 5FPVA 4JGZA 1W0NA 4ZY9A 1UZVA 1M4WA 2BVBA 3B93A 5EWSA 2ZGMA 1RTVA 1T2XA 4QQLA 2RS31 3SCHA 4CEYB 4YM0A 4BZ4A 4C91A 1NCRB 1RUC2 1UU5A 4NVPA 3VHRA 1LULA 3OGRA 3SC7X 1MZ6A 5IVFA 1UD1A 1V6JA 4FBFA 3NV1A 3PTRB 4TLGA 4DZGA 4FFIA 1HDKA 1W8TA 1QNYA 4R4ZA 2FMDA 4FOWA 4KGQA 4UFMA 1XNBA 2PHRA 5C3QA 3I2IA 1NA1A 3D8CA 4Q4X2 2GN7A 1UL9A 1LEMA 2AEYA 4XHBA 1GNZA 4ZPIA 4XFIA 1MEC2 3BYWA 1UOFA 3HVDA 2UYBA 3WF1A 4CXXA 5C9AB 1AYN1 1F2NA 1WLDA 4UF0B 4CCEA 2OVUA 2ARXA 3R4UA 4HZFA 5EFUA 1C8NA 2Y34A 1RUG1 2D6OX 3LEKA 3VD3A 2PHFA 1UZWA 4QPIB 3RZLA 3LAGA 4RSUA 2BV4A 1PVC2 4UT5A 5CKMA 4YW2A 5JXHA 1O4ZA 1AR72 2BGCA 3IM0A 1R64A 1GWLA 4IGQA 4MYEA 4P08A 1AJOA 1OA3A 5CVRA 5H9RA 4NIGA 3I3EA 5L9BA 1G9AA 5FPBA 3WXPA 2MNGA 3S7EA 1GV9A 3K51A 2YB7A 1C8M2 4KWLA 1DQ6A 1QEXA 1G6NA 2OZ6A 5F5CA 4AEDB 4RS5C 4EWAA 3E5XA 1DCSA 5FMOL 2DV9A 2ZS6B 3C7HA 2ZKNA 1OT5A 4M4RA 4AK3A 2PHXA 5FV3A 4K7JA 4WVWA 3AL6A 1CAXB 3NJYA 1YWKA 1W8HA 2FCTA 3DV8A 4FCAA 2ZABA 1KFUL 3CF6E 5A7WA 3CEWA 1LU2A 4UI9L 2X09A 4EN9B 5A3TA 3NNJA 4RHV2 1FAYA 2QVSB 4LUMA 1DBNA 1TG7A 3DYOA 1JOBA 2V09A 2QQIA 2OPWA 4ES9A 4EN6B 2RMU1 4KGGA 2H0VA 2R061 3MLLA 1N3QA 1AR92 4YM1A 4CCMA 1ULOA 4AVSA 5JZGC 2VUCA 4BQ1A 3UV9A 3DKQA 2ET1A 3WDXA 3ZYJB 4AOCA 3OCPA 4XF9A 5CB7A 4YPJA 4AI3A 2W91A 2FDFA 4RQPA 1TNRA 3UNPA 1CQ9A 1W9SA 3FUOA 1QMJA 1X50A 1PGW2 3PTYA 4W6WA 1ND2C 3KHCA 3NRUA 4N53C 4ASMB 4FFFA 2FD8A 4JGYA 4HMZA 4XABA 4Z07A 5JR7B 5LA9A 1W0OA 4YVWB 2J1SA 5LEJA 2A6VA 1EAH3 2WLQA 4OLLA 5FZ3A 4E2QA 5IVCA 1DGWA 3DPRC 3WD5A 3B9IA 2VZRA 4FPJA 2VZQA 4K20A 5FZFA 1AR61 1S2EA 1ULFA 4PQQA 2XMLA 4QT6A 1W2NA 3NNMA 1PZ8A 1WW7A 3FBYA 3VZKA 3IKWA 3TOJA 2RVAA 3T2PA 1DGLA 3NL1A 5FZ7A 1ZA4A 2WL1A 2A7AA 2YGLA 4QU2A 3T1MA 1XPWA 2LALA 2VPVA 4CXWA 3AMPA 1W6NB 2CYFA 2VZOA 5A6YA 1Z78A 2Q30A 4NAOA 1KJRA 3ACLA 2RS13 1G86A 1PMHX 1ENQA 2HKXA 4XFGA 1D4VB 3WUCA 5A70A 3VBUA 1OD5A 1RL3A 3EHKA 5FP7A 5JOYA 1W06A 1WUVA 2DCTA 3I7DA 2IVIB 3WOGA 1O3SA 3JBG1 4PI2A 5A6QA 1V6KA 1YFUA 2Y64A 4PHZA 5EZWA 5DMYA 3ZFEB 3DGTA 1MPXA 4IEWA 4AFDA 3NMBA 1D0HA 3ZPOA 4RGKA 2EVXA 4MADA 5FFOC 3I3MA 1XE7A 3MPPG 5FY7A 1SLLA 1GP6A 3AL5A 5FYZA 5GZCA 1D4M3 2XQRA 4H14A 4PDWC 4QAWA 4SLIA 2PHLA 4CDWB 4HVQA 1VRBA 2FZ1A 2UY8A 3UESA 4E4SA 1ZRCA 2Q8EA 1UZ0A 1UN1A 5I93A 1XE0A 2NN8A 4AE2A 4IW3A 5K9YA 3ACHA 3KF3A 4I2OA 2HWE3 2GAUA 3ZKUA 1FATA 4XQWA 3KCXA 1MS3A 3AKTA 1NE4A 5H9QA 1H4GA 3BU7A 1IG0A 2QQJA 5CFDC 3NO8A 5T54A 4ORFA 4Y5TA 1R1A3 1W8NA 3GCWA 4Y24A 5K0UC 3JQXA 1V6OA 4MGYE 3POWA 1VBA2 1UY4A 4YRDA 3LCPA 1YNAA 4H7MA 3OYWA 4GAZA 4XBQA 3VDBA 2VXJA 2NQYA 4IEZA 1REDA 5T5JA 2B8MA 3PJQA 4M4PA
chains in the Genus database with same CATH topology
4UW4A 3VKMA 3KSCA 1EV11 3A0NA 5ABJB 1N1TA 4CDQC 4LA3A 1CGPA 1EYBA 1J3PA 3B5LB 2NMOA 1N1YA 4DMIA 4B4PA 1QJX3 4HSJA 5BY5A 2GMPA 3AYDA 1UKGA 2UWBA 1URXA 5D1IA 3L2YA 1C28A 4B4QA 2FZ2A 4Y1XA 1V6IA 4WVZA 5A32A 5JLVA 5FOJB 4MXWA 5EV7A 4YZ1A 3ALQA 4FPLA 2JX9A 3VBRA 4LBKA 4JGZC 1CN1A 1H30A 4Q26A 3ZMNA 5BNNA 4UBGA 3UKVA 4QD2A 5A33A 1LR5A 2BFUS 5IK5A 3G7DA 3VZNA 4PBPA 1S55A 1AXKA 3I8TA 4N7UA 3CJIC 3H3ZA 2PTMA 1UX6A 2EXHA 4XILA 2D44A 3ENRA 3SLIA 3NAPA 1QQP3 3ZFGC 3AMQA 3PVNA 2VMIA 3FLRA 5I8YA 1JYCA 2MEV2 1CPMA 3VKNA 3KMHA 1ASJ2 2ERFA 1UKRA 3OGGA 1W39A 4OVEA 5C4WA 1AL21 3SHRA 1PO12 4M0NA 4WVVA 3M3QA 4CEYC 4AGRA 3WG2A 1DHKB 1NCRC 3KT7A 3N36A 5FPZA 5L7OB 2PAKA 1CAUB 4LE3A 5BNOA 1VBB2 2PAMA 3QACA 2EALA 1RUI2 4KG0A 1QDOA 1MQTB 2LTNA 1C57A 4YNIA 3VUOA 4KWKA 3ECQA 1JUIA 1YIFA 1SLBA 2PHDA 2O1QA 2WC2A 1BZWA 3O0WA 4FPFA 5C9AC 4YGCA 5JIAA 3L2HA 1VIWB 2BYVE 2K0GA 1RUE2 4P9YA 1R083 4ZU5A 1ONAA 2Q5TA 2XBO2 1LOFC 3GZUC 3VZMA 4XHXA 3POYA 1RVF1 1FMD2 1PIV3 1RJ8A 3ROUA 4WM7A 4AHXA 5CFCA 5HCAA 4QX5A 4AEDC 1H9WA 1GICA 2D93A 1QJU2 4GMP1 1J3QA 2A73B 1U5ZA 1G9BA 4QHBA 4WVMB 3RMXA 4K9SA 4FVVA 1DQ0A 5K7PA 3PMEA 5T3NA 3MW2A 4KU8A 5GLUA 2JG9A 1BMV2 3CLPA 2RR13 1SACA 4XXPA 4RGGA 3JBG3 1UMZA 4OHZA 4I0AA 2CWMA 4DFSA 3VKLA 1GZWB 4E4ZA 2XLFA 1MVEA 2DURA 3J8F3 1PO22 1FX5A 1XU1A 1IKPA 1WMFA 2QJVA 2IFRA 1BCXA 4HN0A 5I0RA 4ASLA 5KXBA 2Z2SB 1GQGA 2VW0A 4A3XA 3ME2A 2QE3A 2IFWA 4HANA 4M3CA 4M3CE 4X8PA 2Q0AA 3ZSJA 4Y1YA 1MR5A 1O4YA 2PA7A 2BW8A 2IXHA 2Z69A 1V6NA 4BIOA 4P9IA 1G9DA 3H50A 4FP3A 2UY9A 3VZOA 3ZFFA 3O5SA 4HT1T 3E5UA 4HK9A 2GC3A 2C5DA 1J1TA 4DNYA 4YW1A 1X8MA 3AB0A 3RS6A 1I5ZA 3KB5A 1ND3A 2YMZA 1W6MA 3GBWA 4XEZA 3TB0A 3D6EA 3ZFEC 3ZN6B 4TZDA 3WHUA 4DQAA 1LOEA 5LK5A 4JRLA 1WCSA 5J3UA 3KCCA 1O5LA 3RNSA 3LOIA 3IWZA 4URTA 1KDKA 4I09A 5DXDA 2VNRA 2WFF3 3I2DA 1QHDA 3BIWE 3LA3A 1R093 1B09A 4P14A 3MLJA 2R30A 3NV3A 3IPVA 4XFAA 3WW1A 4KWJA 4I0BA 4P9JA 1X7NA 3D0SA 2B7YA 5AVAA 1POV0 2DVAA 2PHWA 4XW3A 2DVBA 1W6PB 4G3YC 4Q4Y1 1AX1A 4PBOA 1A6CA 3WW4A 1LODA 2KXLA 1J3RA 4OHXA 1U5XA 3B9CA 2K2SA 4M00A 2DYCA 1OPOA 2RJLA 2XWJB 1QY4A 5ABJC 1HXS1 3AYEA 3LA2A 1RUD1 2JE9A 4QGNA 4GB31 1LB2A 4J1WA 1MACA 4Q1PA 1AL23 1NZCA 3V0AB 4Q4V3 5IK8A 4DINB 1PNFA 4AI2A 4UW5A 3SH4A 1RUF3 4AFMA 4A7YA 4NR1A 3AMHA 2JJ6A 3OF1A 5DZGA 1WA4A 3OY8A 1NY72 3M3IA 4HL0A 5HCFA 5DUVA 1HLCA 1ZM1A 1IGOA 4CRQA 2GC0A 3POSA 5FREA 2ZX3A 1LHOA 4LO7A 1S1AA 4BPZA 2VECA 2R043 2DFCA 1EAH2 3GALA 2XL7A 1ZZ9A 3MI8A 4XBNA 4PLOA 1AR81 1NQJA 5JZGB 1COV2 5LK7B 1OOPC 1AYM3 1WLCA 4Y26A 1LHVA 4LHNA 2GN3A 1RHI1 3M70A 2QZ2A 3KLSA 2ZMKA 3EBRA 4LHKA 4WV8A 3AP5A 4RR3C 2ZHNA 4J1XA 3IDBB 3A4UA 3UKTA 4N53B 2QNKA 2I2SA 1CAVB 4YVSB 4L11A 4O9GA 4EN7B 2RS12 2RM21 2HWC1 4HFSA 3QH6A 5CBLA 4C1XA 2H6CA 4IV3B 3U07A 3WW3A 4M01A 1JBCA 3I59A 1APNA 1ZBA3 2C0ZA 3D0JA 4PIZA 4AHWA 2B42B 2ZMLA 4EROA 1B35A 3RPQA 1ULGA 3X29B 3AXDA 1D4M2 2AYHA 1TME1 1W2UA 2WQZC 1KFXL 3L9JT 4GULA 4CDXA 3N7KA 3RJ2X 1MQTC 2G4IA 3ILNA 2UWAA 2NM1A 3MZHA 2HWE2 5D8AB 4AHYA 2SBAA 2ZX1A 4XF3A 3V56A 1Q56A 2JG8C 1R1A2 2RHPA 2A3XA 1AZDA 2EF6A 2W68A 4Q0SA 4YG0A 5I91A 3MIEA 1QH7A 3ELNA 4IEXA 1H9PA 2XVLA 1ZZ8A 5A3MA 2DFBA 4XIOA 2WA4A 4X6RB 1IS4A 2HWD1 4LA2A 3AYCA 2A70A 3P3NA 1QJX2 2OUHA 2BWCA 2UURA 3NJZA 2WNUB 5KHHA 2CAUA 4N43B 5E8AA 3RZZA 2Q4SA 3DN7A 5K0UB 1NCQA 3JU9A 1QJZA 3IBMA 2XBO3 4QQHA 4RA0A 1VALA 3MIDA 4P9WA 5JAXA 5C8CA 2IXCA 2PLV3 1Q43A 4AXOA 5CIRA 3M3EA 3SXWA 4CDUA 2VG9A 1TMF3 3H8UA 3VBHB 5JI7A 4CEWA 1CONA 2WQ4A 2JENA 4A2UA 1RC6A 4PIYA 3AP4A 1LCLA 5HXVA 1GLHA 1N1VA 5F5QA 1UIKA 2ZGSA 2YXSA 4Y22B 4XF1A 3LA7A 4L99A 1QQP2 2SLIA 3MFCA 3WDWA 4Y1UA 2JICA 2ZGNA 4XJ9A 1SBEA 4JGZB 1BKZA 3MIGA 3EXUA 5J37A 3SH5A 3AX4A 4YG6A 1OI6A 3WQ1A 4YGEA 1F31A 5L19A 4ATEA 1S0BA 3M7AA 4XJWA 4TSVA 1OPMA 2AREA 1YRZA 4LO6B 5AC93 2HEWF 2WT0A 4KL1A 5BNPA 1RUD3 4MX3A 1IS3A 3ST7A 3TAYA 3WG1A 1UIJA 1PZ7A 3B3QE 4C90A 1NA1B 2GMEA 2VMHA 3ZFGB 1ULEA 3DUIA 1OQ1A 2CGOA 2I74A 2A3YA 1LRHA 4JDMA 4JDNA 1VAKA 3VLBB 2D6LX 1HX6A 5BPXA 2DUPA 4MSVA 4K40A 2Q8OA 1C3HA 3ZXDA 4BOWA 5GZFA 3DL3A 4IEVA 5ACA3 5FLIA 4COYA 5T50A 1DIWA 5KBFA 1GSLA 2DF7A 2W08A 2I45A 1FXZA 1CJPA 4COZA 1R082 2A6YA 3ZN5A 2WS93 1CJDA 1ZZBA 1VBD1 2RE9A 2YGMA 1NYWA 2DU0A 4XTPA 1AXZA 3FMGA 3VDDA 2ZOEB 3LSDA 1OQDA 1PK6A 1PIV2 3W9AA 1C4RA 1JTZX 3CO2A 4AVTA 4PIXA 3ZXFA 1F8VA 3TN93 4A7KA 4LUKA 4XQDA 4ZU7A 3V65A 1SLCA 2FBEA 1LENA 1AVBA 1AX2A 1YIPA 2EAKA 2NLRA 3VKFC 4S2GA 2XHKA 3KCYA 4B29A 2E51A 2RR12 2R073 3JD73 4EN0A 4JTOA 4MGZE 4P9XA 3JBG2 5BNQA 4F8AA 1Q3EA 1HRI1 3J8F2 3ES4A 2N7GA 4DB5A 2A5ZA 4LT5A 4JGYB 1TME3 3SITA 3O7OA 5JSRA 1J58A 1H2LA 3ZXLA 1QJY1 3AP9A 4IESA 1AHSA 3TYJA 4AYUA 2ZGTA 5DDJ1 3NKTA 4QPGA 2ZAAA 1FOD1 5E89A 4YG3A 3ZSKA 5H9PA 2PQQA 3THPA 3CL1A 2GU9A 4C0HA 4LULA 5L73A 3FUQA 1VBE3 4AVBA 5I0SA 4EV0A 3R0RA 4ZXKA 5GZEA 1K5MA 3EQEA 3WR0A 3VBUB 3BCWA 1YI9A 1IS6A 4KU7A 4YVSC 3C3VA 5GLWA 3CJXA 1W6OA 2TBVA 2E63A 4G9SB 1H0BA 4XMIA 5CG9A 4K21A 4QPIA 5DG1A 4N9IA 1FPN3 2X53S 4IV3C 4K8FA 1Y9QA 2MHFA 3SCGA 2WJSA 1COV3 1YYNA 2HEVF 1BEV3 3TNQA 3UJOA 1ZYBA 1KS4A 1GNHA 1F9KA 3ZYPA 2BTVC 2VH9A 4INDA 2E7AA 4R9DA 3SNMA 3GNEA 2WFF2 2EXIA 3AKPA 4LBQD 1R092 5D8AC 2BNNA 5BV6A 1CPNA 2OW4A 1OHFA 5IUQA 5J7MA 4WZCA 1A3KA 4Q4X1 2XWBB 1BVVA 2E9QA 3OYWB 1C5IA 2R16A 5FO8B 1MEC1 2R49A 1BBT1 3RDIA 1MS0A 4Q4W3 4Q27A 1AXYA 1JUHA 4YZ4A 5IK7A 3WG3A 1DQ1A 1CR7A 4ISQA 2B45X 4MVTA 2HWB3 4OHYA 5DZEA 1PVC1 1UZZA 3KT1A 1AL22 1AR71 1KQRA 1UCXA 4YVWA 3OBRA 3BOPA 4Q4V2 2WNUC 2XKOA 1ZBE1 1WCKA 3B00A 2D6NA 4IXLA 1RUF2 4N43C 1C8M1 5EJ3A 2R1BA 5A32B 3T2TA 2YPJA 3M4FA 4MXWB 1S0EA 4BMBA 4BCUA 5J96B 2GMMA 3QD6A 3NW4A 1V6MA 3ZN4A 2WZR3 3WNXA 4XPVA 3BB6A 5BNNB 1MS1A 5IK4A 3VBOA 2O0OA 4L9BA 5I0TA 4MH0E 2AZ5A 4MGKE 4RHV1 3VBSA 1W6NA 4MXVA 3MW4A 3D4KA 2R042 3VBHC 3LB9A 4AW7A 2RS33 3NAPB 4KBBA 2H6BA 2XG3A 1AYM2 2ZTNA 3FWEA 4LBNA 4X6QB 5E16A 2R0FA 4P9GA 5FDBA 3E6CC 4OI0A 1PMIA 3RYKA 4Q29A 1TNFA 1V6LA 1YFWA 4HLTA 2CGPA 5T5PA 4FOVA 3D82A 1H8TA 3OJBA 5JMCA 5C4WB 3S7IA 3VBFA 1G8WA 3BTAA 1OQEA 4CDWA 3FJSA 2P2KA 1H4HA 1QF3A 2ZPXA 1AYN3 4CP0A 2HWF1 4XJ8A 1FV3A 3RRDA 1RUG3 1OOPB 1ZBA2 2Y26A 1HRV1 2ILMA 1NA1C 1WMEA 4AVVA 2PHUA 4B8EA 4RR3B 4EWDA 3AJYA 2B46X 2UU8A 1A8DA 1QOOA 2WNVA 3AMNA 2B9UA 5T52A 2PFWA 1CX4A 5J98B 3N3HA 5AFBA 2XUMA 3VV1A 1VB2A 1CAWA 2TEPA 2XJSA 4X8NA 4AQTA 1LHUA 1WD3A 1QJY3 3H1WA 2G9FA 2HJIA 5FMOS 4WM7B 4XTMA 2RMU3 5CFCB 3HR9A 2R063 5H9SA 2W52A 4V1PA 1TE1B 5HBAA 4Z92B 4FOYA 4IERA 1XYPA 2QKDA 3ZXKA 2VNGA 4LHLA 1NOVA 2IZWA 4COUA 4E4DX 4G4FA 2ZGOA 4E2SA 3RMYA 1D0GA 2ZGPA 5F9TA 3HN1A 2CL2A 4FTEA 2NMNA 4FAHA 3APBA 2ZMNA 4N9HA 1ZX5A 2JG9B 3AP7A 4META 2JG8B 4H3WA 4UXAA 1RUNA 4TYSA 4Y1ZA 3ZSEA 3GHMA 4Q8LA 1I9RA 1VBA1 4FQ4A 1MZFA 4MV2A 1C1FA 1SCSA 4Q0QA 4GH4A 2NYYA 2F6BA 2X5IA 1QU0A 4WBBA 5E88A 2O8OA 3WV6A 1H1MA 1ZVFA 3PLQA 2ZHKA 4JRAA 1IZ3A 3N7JA 1VR3A 2PLV2 1AR63 4RQPC 5C8WA 4ONUA 2XJUA 1TMF2 1S0JA 4FPKA 2G9GA 3M3CA 3M8LA 5T5OA 4JGYC 2XJPA 3VN4A 5KXDA 4IEUA 2X8KA 3OTFA 3ZSLA 5L36A 2BBVA 2VVDA 2ZGQA 3H0OA 2D6MA 2WSUA 4W6YA 3ZIXA 5JPMB 4XDQA 5L7OA 5KHGA 1YI7A 2XJQA 3ZXEA 2VOVA 3LWCA 3R4DB 4JTNA 5FLJA 4TLFA 1KJLA 1XYNA 4FT8A 1BBT3 3RYRA 1NLSA 3BALA 1UPSA 4L97A 4YLZA 1JYIA 3WDTA 1PHMA 3B01A 3VZJA 4J6GA 3A0KA 2DCYA 1AL0G 5AC92 3VBUC 1RUD2 1ND3B 3AM2A 5FO9B 3JZVA 2BUKA 1J59A 4D3WA 5I8TA 2Y38A 4YW5A 3EJKA 1ZBE3 2IXLA 3PVOA 2ZA9A 1Z0HA 2MEV1 2VVFA 1ALYA 2XGXA 2D98A 4ISRA 3U10A 3WQ0A 4KQ7A 1DF0A 4Y4YA 2WT2A 5HI0A 3ZYRA 5ACA2 4QM9A 2AR6A 1R1ZA 4F7ZA 5FQ0B 2PHTA 4IEPA 1EV13 4YGDA 2I07B 4KG8A 5LRRA 1JN2P 5C6CA 3S0MA 2AENA 2JKBA 1V00A 2WS92 1XNDA 1MS8A 1XNCA 3IPVB 4QQOA 1DQ5A 1O3RA 4RL7A 1DGWX 1H2MA 2WSVA 1VBB1 3AFKA 2P17A 3LKJA 4XJAA 4AEMA 4YGBA 3PJYA 4D7YA 3J4UH 1NXD1 3TN92 4AQSA 1NE6A 1QXRA 3V0BA 5FOBB 3R4SA 4DOUA 4HN1A 4Y5Z0 5DUXA 5KHIA 2WFPA 3KGLA 4ZKTB 4RFT0 4YW3A 4LBQA 1RUE1 1RMU1 3ZPYA 5BYNA 3OPZA 2E7TA 1VRH1 3W58A 3PMSA 4XQ4A 2HWF3 2DCJA 2R072 3JD72 3NSTA 1HQNA 3GHNA 1FMD1 4IV1A 4N90A 5KHKA 2ZGRA 3ZVXA 3WDUA 3OY8B 2NPIA 1PGSA 4R9BA 5FBZA 4WZFA 3BOWA 1F5FA 2YZ4A 3FFZA 4D69A 1YLLA 1QJU1 3VBRC 4OFGA 3WY6A 3UKNA 1LHWA 2OIIA 3WW2A 1TME2 1U0AA 2XPJA 4F3JA 1SBFA 1DG6A 1QWRA 1NQDA 1GANA 5BNNC 3AXEA 4OHVA 4YFZA 1ZRFA 4S2FA 1W6QA 3FLPA 3BODA 1C1LA 4NO4A 4FPGA 4XFFA 3ZYGA 1X36A 2D97A 3VKOA 3VHNA 3AYAA 3NAPC 3RQ0A 1XRUA 1PO21 3O0XA 2XJVA 3HAGA 3MIBA 1VBE2 1AUYA 2BPA2 4OUMA 5KXEA 3MDPA 5C4WC 1V9U1 4NHLA 1O3TA 2D3RA 4ITCA 4AFBA 2QDNA 2GNDA 1CESA 2RS51 3TWIA 2P34A 3FE5A 1OFNA 5F1RA 2QZ3A 1FPN2 4O9EA 2W39A 4LBJA 1KITA 4BMEA 5BNOC 4LLFA 4NHMA 1X82A 4FXGB 4QQ2A 4YW4A 5JSOA 1BEV2 1I6XA 1ULCA 2V73A 1RVF3 5T55A 1O4TA 3WUDA 5J48A 1IKQA 3HBZA 1G9CA 1DFQA 3H1MA 3VHOA 3ZXAC 4GMP3 4WM8A 1OMIA 1XXNA 2E7QA 2FQPA 4NPRA 5GKAC 2LUWA 4R52A 5JVVA 4R4XA 3GF6A 4GKYA 4BE3A 3MEPA 1LOGA 5JSPA 5JOZA 3USUA 4LBMA 1GYKA 2YROA 4WM7C 3KQRA 4Q4W2 4RS5A 5CFCC 5B2GB 1KS5A 2YUEA 5E1RA 4PQ9A 5SV5A 4Q0UA 1PGL1 3MLKA 3ZIWA 2HWB2 1D2SA 1HKDA 1RIRA 3ZYIB 1VBC1 4YYOA 5JI9A 1NCQB 3H3UA 4PLMA 4OI2A 2JG9C 1PVXA 5AFEA 5JCTA 5F6KA 2IXIA 3K48A 5F6LB 5JZGA 3N35A 5C8CB 4XFBA 1S0IA 3MF9A 4IEOA 1YJKA 1ENRA 2WZR2 3N4MA 1UU6A 2ZZQA 3WCRA 2XLAA 4CEWB 4AHZA 5EYYA 1H8VA 4MUVA 2GH8A 4XMAA 5DUWA 1IPKA 2ZJCA 3LSEA 1ND2A 4GA9A 4N53A 4QXKA 3AK0A 2Q1MA 3VGIA 4IEYA 2RS32 3HMYA 2XJRA 4AGVA 4XJZA 2OZJA 3DPRA 3ATGA 1SMVA 1MVQA 1AX0A 4HPKA 1Q8VA 3SH3A 1NY71 2DVGA 1BVP1 4FSJA 2PAEA 4HKLA 4SBVA 3GBFA 4Z82A 1TEIA 4R9CA 1HV0A 3ZFFC 4BA6A 4DRRA 4XBLA 1AYN2 2ATFA 1EAH1 4EN8B 5BNPB 3H7JA 4DY3A 4FO9A 5T5LA 1HW5A 2TUNA 1DZTA 4AFCA 1OLRA 1NXMA 1RMU3 1RUG2 2CGNA 3B94A 4C0BA 2VW1A 1VRH3 1ND3C 5JDBA 1WD4A 1QNWA 4BLJA 1RJ7A 3MYXA 5KC6A 1UU4A 5C33A 3OGJA 1KXGA 3EO6A 1CVNA 3U0ZA 2WNEA 1L3JA 1DYPA 2QUOA 4PDWA 4Y20A 1GQHA 1REEA 2RS11 1A78A 3E6BA 4HSLA 2WKKA 2YV8A 3PHMA 3GYDA 4Q4Y3 4D94A 3VDDB 1QJY2 1LGNA 2Y0OA 1HXS3 2VOWA 4JVAA 4H7LA 1PK6B 5CFDA 3KT4A 4GB33 2RMU2 1SLTA 3D5OA 5DDJ2 2R062 4ZU4A 3KS7A 3IT8A 4QPYA 1Z7S1 2WIIB 3VHPA 1A8MA 2C1FA 3ZO0B 2VUAA 4XJUA 3I4IA 1S2BA 1LOCA 1JW6A 4HKWA 1Y3TA 2RJKA 3AJZA 3JB4C 3MGUA 3ZDSA 4AVCA 5A3LA 4CDQA 1Q8SA 4DPNA 3JQWA 1IOAA 3MICA 2WZPP 4FTSA 2EA7A 1V9U3 2VW2A 4B4RA 4QM8A 2RS53