4CP0A

Crystal structure of epithelial adhesin 9 a domain (epa9a) from candida glabrata in complex with lactose
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
250
structure length
219
Chain Sequence
AHYPRPEGCSSPPNAVSVGLHMDLYNYPYLYVKQCWNPEYQDPNFPRYGYKKYGSFGSSDHVNGKISWDHNEFKEGCKPIMARLPTAYNYPAKITFSNFTMVLSGYFKPKSTGLYKFEIHADDFILFNFGSKNAFECCNREESIDNFGPYVAYAMWPNEADQELEVYLFEDSYYPIRLFYNNRDYHSKFMVGFYPPNTEEITYDFDGYLYMLDDTGNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPITHELIAL ADHESIN 9
publication title The Structure and Function of the Epithelial Adhesins (Working)
rcsb
source organism Candida glabrata
molecule tags Cell adhesion
total genus 61
structure length 219
sequence length 250
ec nomenclature
pdb deposition date 2014-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10528 GLEYA GLEYA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4cp0A00
4ASLA 4A3XA 2XJSA 4AHWA 4CP2A 2XJRA 4AFBA 4LHLA 2XJPA 4AFAA 4AI1A 2XJTA 2XJVA 4AHYA 4GQ7A 4COYA 4COVA 2XJQA 4COWA 2XJUA 5A3LA 4COUA 5A3MA 4CP0A 4LHKA 4AFCA 4LHNA 4AF9A 4AI0A 4AI2A 4COZA 4D3WA 4AI3A 4CP1A 4AHXA 4AHZA
chains in the Genus database with same CATH superfamily
1RUG3 2AC1A 4MXWA 3VN4A 3VZNA 1N1TA 3H8UA 4WBBA 4DB5A 1AR73 1LODA 3AFGA 1CWPA 1ZZ7A 4GKYA 4QKNA 1UAIA 5E88A 2IFRA 3IIIA 5A3WA 5FUIA 2NQYA 2G4IA 3WNOA 2BFUL 1R081 3OEBA 3MFCA 2W91A 3M1HA 4KL1A 5ANNA 2WIIB 2A7AA 2BNOA 2RS32 4Y24A 2HWB2 1RUJ2 4QDQA 2VCCA 2C26A 4QGMA 4YFWA 3RNSA 4QPGA 1K5MC 1Q8VA 4WZCA 1W0PA 5FP8A 3T2OA 4Q27A 1OVSA 2ZTNA 3T0BA 3SITA 1ZREA 2KXLA 4YZ3A 2VNOA 4GWJA 2HEYF 5A3TA 3U37A 3MLLA 3KCXA 2YBSA 1IS5A 4W8JA 2E32A 1BYHA 1W99A 1SACA 4QX2A 2WZEA 2JDUA 4QAWA 3RGBA 5C6CA 3VZOA 1NCQA 1RYYA 3KVBA 1KFUL 1M06G 4XFHA 2EXIA 3ITQA 2YZ4A 1WMFA 3ACFA 4LNVA 1GNZA 4QWNA 3M3QA 1VBD1 4NPMA 4K8FA 1LOBA 4XJ8A 5BXXA 5GZCA 4BMEA 4D8MA 4UWDA 4K1YA 1GV9A 1UY0A 3R05A 1SLAA 2VAUA 5FP3A 1RUJ1 4IGQA 5FY9A 3HBZA 4HONA 5BNPB 2XQXA 3L9JT 1LECA 1CZSA 5FPBA 3WQBA 2MEV3 2C1FA 1IG0A 3QD6A 1A8DA 5GLTA 2XL9A 3AC0A 1GNHA 2BDRA 2JG9C 4COWA 1L7LA 2Y33A 4Y22B 4Q29A 4L8QA 2VVFA 4XILA 4UOJA 4NOTA 4JKMA 1US2A 1R1A3 3VV1A 4GULA 4QQHA 5I0SA 4TZDA 3VLBB 5C8CA 3I2OA 2WWSA 4XW3A 2WO1A 3TEZA 1IQDC 4CCEA 1PZ7A 4QU2A 3O0VA 4XFGA 5HBAA 1AXYA 4B7EA 2VNRA 3WG2A 4UFJA 2XL7A 4MOAA 1VBA2 1Q8SA 2ZCWA 1NY71 2LROA 3VDDB 4MGTA 2G9FA 3V65A 2B39A 1PNGA 1LOCA 5FZ3A 1X8MA 1PGL2 1V6KA 1F2NA 3K75B 4GZ9A 2VECA 2R063 2P3IA 1O3QA 1E5SA 4BQ4A 2OIIA 3LD8A 4JDMA 4AZZA 1D4M2 3WG1A 5JDBA 3FHQA 3ZFEB 1V9U3 4WZFA 5EQUA 1QXJA 4XIOA 4ZZ5A 1VBC3 4DXRA 5BNNC 1F15A 2CGOA 3ILNA 4IV3C 5FK8A 4NPRA 4N9IA 1VB4A 1RGSA 1H2NA 3IAPA 1PMIA 2PN5A 1EYBA 1WCDJ 3MUY1 2JDKA 2XJPA 5GZGA 4H55A 4BCUA 5FZEA 4A4AA 3FN9A 4W65A 1TVGA 1S0GA 1ZA4A 4AI9A 2ES3A 4ASKA 3P5BA 2X8KA 1YJKA 1F4HA 4GWNA 3MUZ1 1RUNA 3VGIA 4ISQA 4X8NA 1ND2B 5F5CA 1AX1A 1QH7A 5IVEA 5JOWA 4LHNA 3VBSA 3T2TA 4MLOA 1KS4A 3VD5A 2XBO3 1RHI2 1W05A 2XLFA 1MEC3 4LA3A 1WLTA 5EWSA 3DEMA 1CZTA 2OUJA 1ZBE2 4P9XA 3RMXA 2VG9A 4K9SA 4L9BA 5LATA 2E7AA 4TTGA 2A6YA 3LIHA 4U36A 1AYM1 3OYWB 4LIUA 1JYNA 4XETA 5FPVA 4DY5A 1ASJ3 3FFZA 3H3UA 1W6OB 5FY4A 2JDZA 1KXGA 4NJ4A 2D44A 4M3CF 1UY3A 4HFSA 1OD5A 3OBZA 1GQHA 2B8MA 2AYHA 5C70A 4RS5C 1M4WA 4YG3A 1MS8A 3M4FA 2QQVA 4S2HA 3SCFA 2DURA 2VD7A 1IPSA 3MPBA 2BBAA 3P3NA 4Q26A 4IEOA 2QFEA 5F6KA 1UU4A 5FYTA 2XMLA 3WDWA 3H1MA 3BIWE 5FREA 3ZR6A 1K5MA 5DUUA 4DINB 3IMMA 2VOWA 4QDRA 4CXWA 2RDRA 3MIEA 4M00A 3WDUA 1GR3A 1JU3A 5JXJA 1PO22 4D69A 1XPWA 2QZ3A 3POJA 2W39A 1G9AA 5HCBA 1QOOA 2RS33 2HWB3 1RHI1 2Y6HA 3TNQA 2FHRA 1SMVA 2C4XA 4L2NA 2D93A 3PL0A 1CX1A 2JD9A 2VZVA 1HXS2 3JUUA 1QDCA 1XNAA 3DYMA 4HVQA 1VBE1 1CR7A 4ISRA 2WINB 2WZR1 5F5QA 5D8AB 2DCKA 4GALA 4YW1A 2UURA 3LQCA 2VO5A 3ORJA 1Y4WA 1CAUB 1R092 4XUTA 5A6QA 2WA3A 3IMNA 4FP2A 3T4VA 2E7QA 2RHPA 4V1PA 3C7HA 3VBFB 2F17A 3S6PA 1D2SA 4AHXA 4CTEA 5I0UA 2JICA 4QB1A 2VTXA 4LO5B 1DQ6A 4AR2A 3ZXAC 3GCWA 4FFHA 5FXXA 2BGCA 1T6GC 3TEYA 4UFMA 1VMJA 3LB9A 3ZMNA 2YXSA 4JRLA 4HVRA 1W9TA 1WLDA 1G8WA 5DPNA 3LSDA 5FOBB 4XJAA 3RZKA 3LFIA 5KHJA 2RDQA 4I02A 4IDZA 5DZGA 4WV8A 5GJ6A 2WYSA 4QXCA 2ZGRA 4EWEA 1JZ8A 4X8PA 3I3EA 5DQ0A 5LY2A 2Q8DA 2YU1A 1UZ0A 1VPHA 2MPFA 4MO3M 2A71A 3LOIA 4MV2A 5FJKA 3WCRA 3ZN5A 5M0TA 4O7XA 3JXSA 1WD3A 1E5RA 3LAGA 1HXS1 3I8TA 2V09A 3CJIC 3JD72 5KHIA 4XZUG 1CIYA 1HQWA 1HV1A 3LEGA 4P00B 4QX7A 4FPHA 5I93A 4Q4V2 1O4TA 2IWGB 1PMJX 3UESA 4SLIA 3KCCA 3AKSA 4A6OA 1N1VA 5LB6A 3ACIA 4HK8A 4B29A 4OHWA 1GNYA 1YFYA 1CZVA 1FPN1 4XFFA 2G19A 1IGOA 2BTVC 4FSJA 1URXA 3I2IA 4GH4C 3WY6A 3JQXA 1VRH2 1FOD3 2BEOA 3OG2A 5FZ9A 1HX6A 5LBCA 3KT7A 5IVYA 1VBA3 2XPJA 3U11A 2FD8A 3H3ZA 3VUOA 3MIHA 4CRQA 4M3CE 1BKZA 1UPIA 2HWE1 3RZZA 3OPTA 5BNNA 1SLTA 2DV9A 4ASLA 4IV3A 2JE7A 2XJRA 4E8DA 4GMP3 4W50A 5A7OA 1W2NA 1D4M3 1PIV3 2ZGOA 4RFT0 4AWDA 5A6XA 4XF3A 3ALQA 4XFBA 3NVCA 4XYXA 1ND3B 3ME2A 2J1UA 4NHKA 2VZTA 4CDQB 2PA7A 4IW3A 4AQ2A 1OLRA 4CZSA 1GWMA 1W8TA 1F5FA 5LBEA 1GZTA 4YNIA 4BZ4A 4R9CA 3WDYA 2RR12 3HVDA 2ZKNA 1JUIA 2P37A 3C7EA 1JZ7A 4AEMA 5C9AC 2LM3A 4BYYA 1D0GA 5FP7A 3KLSA 2ARAA 2D6NA 2JE8A 2WKKA 3CMGA 4PDWB 5DXDA 4RGGA 3H0OA 3NWKA 4R8HA 2JDPA 3USUA 3ZYFA 5A33A 4F7ZA 4LO6B 1L7RA 5DMYA 5LZ6A 4MVTA 4RYDA 2R49A 2BUKA 1QJX2 2D98A 1VRH1 2Q30A 4AFAA 3GGLA 4HKWA 1CAVB 1PHMA 1AYN1 1RUD3 1YCIA 3LGRA 4M4RA 3R4UA 4META 2Q8EA 1W8FA 3CEWA 1KDKA 4XUNA 3Q8EA 1GOFA 1ZBE3 3VBHB 4KWLA 2EF6A 3N35A 2G1MA 4BISA 2R6QA 5H9RA 5APAA 1U5IA 4RS5A 3WQ0A 3AL6A 2ZX4A 3LA3A 1NZIA 1GQGA 4MUVA 5IVFA 1O4ZA 4DQAA 3H8XA 2IVIB 1W8WA 2JJ6A 2ZGNA 4ZU5A 1LEDA 1FMD2 1I6XA 2Z79A 1G86A 2EIBA 3HNBM 1JODA 4Y1ZA 2XVGA 2Y0OA 1OXCA 1X82A 2VMCA 1UXZA 3BVCA 3J8F2 5FYHA 4CDXB 4V2VA 5C3SA 5LBFA 1JOPA 2B45X 1JHNA 1XNCA 4IE0A 4RR3C 3LA7A 4BLIA 1TMF2 1DFQA 3RWNA 3EXUA 5FR3A 4HN0A 1PO23 4XFCA 1W9WA 1QOTA 2HEWF 3DKWA 3KM5A 1QF3A 2WS92 4DS0A 4YPJA 2WQ4A 1CAXA 4AQ6A 2EXJA 5IVVA 2VVEA 2XKOA 4N8MA 1WBLA 3EHKA 4XACA 1AL23 3PLQA 2AUYA 4YFZA 4EYUA 2VZUA 1HN1A 1V6IA 2EIDA 3WG3A 4CU7A 1RUE2 2BRTA 3AKQA 2NN8A 5IATA 3NW4A 2VGDA 5GLVA 3TB0A 2VJXA 1QJZA 1RC6A 3VKLA 5CBLA 1FMD1 1O6UA 4KWKA 1R093 2AZ5A 4IGPA 4MGKE 4FAGA 1RVF2 2L9LA 2IXJA 3H1WA 3ZYHA 1DBNA 3I7DA 5A3PA 4GB32 3J8F1 5A7WB 5FCCA 2DCTA 3SH4A 2O1QA 3CZUA 3GZEA 2BFUS 3CKHA 5D1IA 3RYPA 4OFGA 2R30A 4AEDC 1SDWA 1TMF1 1SG3A 2Y0IA 3AJZA 5JMOA 1WWYA 2A3YA 3CJIA 1V0AA 4A44A 2BERA 3K48A 3CIHA 4AAXA 2VQUA 4BMBA 5LASA 1E5HA 4UW5A 4YZ4A 3WUCA 3O1RA 3WNNA 3UYJA 2X5IB 1PGW1 1LHNA 1UKRA 2IXLA 3POEA 2GP5A 1DGLA 2O14A 2VBPA 4AXOA 4BQ1A 4CDWC 2Q1ZB 3UETA 3VHRA 3JD73 4AW7A 1HRI1 1VIWB 1GFF2 2R0FA 4QX1A 4QPYA 4URAA 3MIBA 1O8SA 3VB9A 2VULA 4UBHA 3W58A 2WNUB 4Q4V3 1PVXA 4BXSV 4GH4A 2WSUA 3HMYA 4Q4Y2 2XWJB 2GNBA 2W1SA 2VCMA 1NYWA 1QJY2 2H0VA 2XJTA 2VW1A 1RVF1 4JGZC 5LW9A 4CCKA 3FUOA 4XF9A 1SPPA 3IPVA 2Q1FA 1XOYA 1ZBA1 4NN0A 3EBRA 3ZXKA 5A6YA 4MYEA 1JYCA 4E2GA 2WL1A 4YW7A 2JDYA 3G6JB 1RUH2 1RUF1 3T30A 5JSRA 2WZPP 3ZFGC 1EAH1 1YI7A 1SBFA 1UY4A 1ZZCA 2RMU2 4BPZA 3AP6A 4YM1A 4AFDA 3DCQA 2ZA9A 1WMDA 3ROUA 4QKFA 4GWMA 1QJU2 3THDA 1PK6C 4EE2A 2UWAA 2JKBA 4RSUA 4UI9L 4C91A 2DVDA 2LS6A 4JTOA 1DLCA 1NA1B 2E31A 4UF0A 4DY3A 3OB8A 3HN1A 5F5AA 1OLQA 2W52A 4Q4X2 5C9AA 2DBNA 3B7MA 2PQQA 1U5ZA 4KBBA 4QM8A 2WWUA 4AHZA 1FXZA 4XHXA 5IK7A 2IXCA 4JGYB 3OF1A 5F3EA 3D4KA 5F9TA 2VMDA 2X10A 5JXIA 4BM8A 3J9SA 4PLNA 4YVWB 4DRVA 2K2SA 2RR13 4S2DA 2YV8A 3KS7A 4IV1B 4M3CA 5CZKA 1LHWA 4A7KA 1K42A 2BOJA 2CWMA 3V0BA 1DYKA 1EP0A 2LRPA 2WYFA 5EV7A 3OPWA 2JECA 2W46A 4YW6A 5KHKA 4CCDA 1HJFA 4XTMA 3O5SA 2DUQA 1OQDA 1QJX3 5H9PA 1DCSA 1QEXA 2EIGA 5FY0A 5FZOA 2PAEA 3AYCA 5FZHA 2BZDA 3N4MA 1VRBA 2XVLA 1H9WA 1K45A 4Y20B 4CDUB 2NP0A 2PQSA 1HQLA 2JDNA 4AI8A 1H2MA 3GBWA 2Z4FA 3LA2A 3E1F1 1IPJA 3NV3A 4LBQA 4K21A 5C4WB 3DUIA 3KT4A 2WT0A 2ILMA 1PMHX 1AJKA 4O9GA 1JZ3A 4ORFA 4RR3A 2E33A 1NKGA 1P8JA 3BU7A 1ENXA 4QPGC 4OI4A 2WFF2 3JQWA 4ONUA 5FTTC 3VBRB 1UWWA 3W59A 2QNKA 4CUGA 3T1MA 4IESA 1XSRA 1RUG1 1AX0A 2NM1A 2J42A 3IIAA 4MXWB 4PIZA 4DXTA 4A3XA 1AUYA 5C7GA 1AR71 5DAPA 5L7OC 2W5FA 5D2AA 4ARXA 1GICA 3HN3A 4C0BA 3C3VA 2VCBA 1Y9QA 2HWC2 3M3EA 4I0BA 2WS93 3AMQA 5GKAC 2O0OA 5A7NA 3UL2A 1F5JA 4W6WA 3TOJA 2OQ6A 1X9PA 4DRRA 3CQOA 3UNPA 1NE6A 2KA3A 2BVBA 4ZHNA 4HXCA 2ENRA 2F4PA 2UY9A 3ATGA 4R4ZA 2QQNA 2OZ6A 4HETA 1X8EA 4YYOA 1UU5A 2C0ZA 4ZONA 5SV8A 1RUE3 2P6HA 4B4QA 2J1TA 1IZ3A 2QQUA 3MF6A 3RI8A 1OC1A 1EPWA 2ZGSA 4EN0A 3EMRA 2CAVA 4LE3A 1H0BA 3SHRA 4DUVA 2PHRA 3I49A 1F4AA 3O1SA 4AEDA 1MPXA 2AREA 4MHRA 2UU8A 5J48A 4DMIA 1MQTC 4MGQA 4UFLA 5AVAA 4GB33 4LKFA 2FZ2A 3U4SA 3T0DA 4BWOA 1TNRA 1JZ6A 2DDUA 5A7QA 5DN2A 3SH3A 3AMPA 1NCQB 2JXAA 4HSJA 3N9PA 4YGCA 4CDWA 3VKOA 4L0PA 4FPKA 4DOUA 1FV2A 2ZHKA 3NNLA 4HKOA 2A6XA 3VKNA 3O12A 4JKLA 4E27A 1MZ6A 1V6LA 4ZZ8A 1ZM1A 5ERLA 2PXJA 2ZOEB 4QU1A 4QPIC 3R6SA 4L92A 4MADA 1GOGA 1W3XA 3I54A 1K3IA 3ES1A 5BV6A 3QH7A 4NMIA 5EXOA 2ZGLA 3SXWA 2OYZA 2NYYA 1JZ2A 4M0NA 4CCNA 5J3UA 1SLBA 5FY5A 1OPOA 4JGZA 1OA4A 3ZSMA 2ARXA 2D6PA 3HT2A 4GD4A 2MEV1 2G9ZA 4DZGA 1VBC2 1WUVA 2XJQA 4K20A 5L73A 4B7KA 2HWD3 4EZHA 4Q4Y3 2JDHA 4OCTA 1CX4A 1NCRC 2VR4A 4Z07A 4OZOA 3ZFGA 5J1XA 3LEMA 1QJY3 3PVEA 3WDXA 3CL1A 3RZLA 2WQZC 1BMV1 1R1A1 3PHMA 4LKSA 1DZTA 1W9FA 1YQ8A 4KI5M 4CPBD 3AMHA 1PK6A 5C8CB 5AC92 2Z42A 2E7TA 1RUH3 2VMIA 3M3IA 1ST8A 4DEQA 2RMU3 2GC0A 3DXTA 3INAA 2VZRA 3NJVA 4Q5OA 1O3TA 5BY5A 1CESA 1A8MA 4AFBA 3VDCA 4QQLA 1KS5A 2IVJA 3AKRA 1KITA 3POWA 3LOBA 3PTYA 5A32A 4FTEA 1QJU3 2XVKA 1MEC2 3IWZA 1E57A 3AYAA 3Q8FA 2XDVA 3D5OA 3D82A 1VALA 2CV6A 2R061 3FHAA 3VDAA 3X29B 3WUDA 5HXVA 1Q8PA 3GZAA 4Q4X3 1AL0G 1W8OA 2JG8B 1V9U1 1VP6A 3JZVA 1ASJ2 1UNBA 1ONAA 1ZYBA 1VBC1 3AL5A 3BTZA 4AI3A 1OF3A 2VZ3A 1N3QA 1JZ4A 2YFUA 1AR82 3TEWA 3W9AA 4MGSA 2IC1A 3ZM8A 1VAKA 3FBYA 3ZXEA 2O8QA 1I5ZA 3I3QA 4XHBA 5I0TA 3OUIA 1W28A 5EJZB 1WD4A 2OZJA 2R042 4HPKA 1YQCA 2IXKA 1YIPA 3RQ0A 4E4SA 1UF2C 1XRUA 2YGMA 2EIEA 3W5MA 3GZUC 1YO8A 4P08A 3AX4A 4S2GA 4NAMA 4YLZA 1PO13 3MEPA 3WINE 4XVHA 2VQ0A 5FP4A 3K51A 4XCBA 1S0BA 3VBSB 4OZXA 3F95A 5HV4A 3PMEA 1WW7A 1ZRIA 2XBO1 2XLGA 3VZJA 1AXKA 1MEC1 3DPRC 2XKPA 4HBNA 5FYUA 1LOAA 2EICA 4K8RB 4AGVA 3WW2A 3CBNA 2WFPA 3UKTA 2MNGA 1HRV3 1UMHA 5CNAA 1OFSA 4OI2A 3OPZA 3RPQA 3HWJA 3UJOA 1ENSA 1SLCA 3I3DA 1O4YA 3KSCA 5B4NA 5L19A 1UMIA 4OI0A 5J36A 3POIA 3ZXGA 1ASJ1 1EY2A 2YC2A 1MS3A 2P34A 3MW3A 3ZN6A 5LK5A 5L7OA 3PMSA 4LO4B 2WNOA 2WT2A 1QY4A 2WFF3 3BOWA 3LFMA 1LU2A 2IFWA 3RZHA 1YYNA 4AGRA 4HT1T 4XJ9A 4WVMA 3URFA 5IJRA 3HD8B 3THPA 1YRZA 4FI9A 3EO6A 5A80A 1LR5A 5FZKA 3KQ4B 1DU3D 2ZEXA 2W68A 4Z1VA 1BVP1 2DBIA 2HBTA 5FMCA 3O1PA 1K5MB 1XBFA 1QMJA 1T6BX 3IAQA 5FOJB 3VD3A 1MS4A 2OW4A 2HWC3 3W20A 1Z7S2 4LBNA 4A6SA 2CL2A 3ON7A 2IXHA 1YNAA 5G04L 3M3OA 2RS31 2HWB1 3SKVA 4EROA 3VHNA 4CUBA 1A78A 2ADEA 2WNEA 2N7GA 2XUMA 1LGBA 1SLLA 1MQTA 4NAOA 4CP9A 2WT1A 5FY1A 3MBWA 4P14A 1IKQA 5A3MA 4P9GA 4FOQA 4E4HA 1JBCA 1JZ5A 3NO8A 4LQRA 5FZ1A 3VZMA 4LO7A 1W9YA 1C57A 2WDBA 4L99A 4D3WA 1CD3G 4O65A 1J83A 3E6CC 3HQRA 1W03A 1XNDA 1AZDA 1RITA 1W9SA 4QPIA 4G9SB 4MXVA 1NT0A 2XWBB 4DUXA 4FPFA 3N9OA 1EUTA 1RUI3 3PJYA 5FYBA 1FOD2 2P6CA 2E26A 4Q8LA 1RMU2 5F6LB 2D3PA 1HDKA 2W94A 4CUCA 1OOPC 1J3QA 3I97A 1W6PA 1OUXA 2JG9B 3BPZA 5KHHA 4XAAA 4N53C 1Q3EA 2XQRA 1G7YA 2GMPA 1NCRA 1H30A 2QQKA 2DUOA 2OS2A 2FDHA 1VMHA 1PIV2 4HN1A 4YGBA 4BLJA 3U10A 3KCYA 4YW2A 4AI2A 4NRMA 4I0AA 1LGCA 4UW3A 2V5YA 4Z8BA 2WBKA 3FMGA 3O1VA 1UIKA 3I59A 4Z2WA 4YW4A 2B4KA 2BJSA 3HQXA 3WW4A 5LWBA 4HG6B 3GF6A 4CYDA 3T09A 3RDIA 4YM2A 4PBOA 5FPLA 1GP5A 5JPMB 3B93A 4ZU7A 1HB4A 2QQPA 4ZKTB 1GBGA 5AC93 1UL9A 3NQHA 1WA4A 2QCSB 1LGNA 2ET1A 1R1ZA 1N3OA 3AZYA 4MGIE 5FBJA 2ORZA 5FLJA 4A45A 1FOD1 4BH9A 3I2FA 3U4XA 1VBB2 4LE4A 1VBA1 5T5JA 1KJRA 4XDQA 1DQ5A 2OXBA 4FO9A 4IXLA 4P5YA 1RUD2 1IS4A 2AENA 2WJSA 1FT9A 2ZEWA 1LU1A 4FPYA 2QQMA 1W2TA 4LK7A 3VL9A 5BNNB 1JYIA 4IV3B 1XYOA 3RRDA 5EJ1B 4GMP1 1AR92 3WR0A 1C28A 4BQ5A 3QLQA 1D4M1 1PIV1 5C5UA 3S5AA 1U0AA 1UIJA 1ZVFA 1WZXA 4GIQA 2A73B 1F9KA 5L9BA 4OVEA 5DG2A 1UYYA 1ZRDA 3MDPA 3NJZA 4N90A 1AR83 2BGOA 3NKGA 1RL3A 2WC2A 2ZEYA 3LPGA 4UYBA 3T0AA 3VD9A 3WNXA 4IE5A 4D6QA 2PAMA 5T54A 5FZ4A 1AF9A 5BUVA 2R043 3PU3A 3FWEA 2FZ1A 3WDVA 3DPRA 3NAPC 4IEPA 3NKTA 3USUB 5L9VA 2XG3A 5A33B 5I8TA 1LNSA 3ZSEA 2KM2A 1H1MA 1W6QA 2D3RA 2ZXQA 3KWVA 2E53A 5CISA 5DZFA 1YI9A 2DU0A 3JB8A 1QKQA 4AL9A 3Q8AA 1UKGA 1S2BA 1RUD1 3Q8BA 4OHXA 1LESA 3A23A 3FX3A 4CEYC 1VMFA 1ZBE1 2Y8KA 5IYYA 4GA9A 1AL22 4RS5B 3RZJA 4LOSA 4AAPA 4AFCA 3OD4A 5JIUA 3I3MA 3BTAA 1PVC3 4XC9A 1OF4A 1UYZA 1YJLA 1DG6A 4N7UA 1W04A 2BV4A 4B4PA 3HNMA 1EV12 4YZ2A 4ATEA 3VBUC 2YROA 4OHYA 4B4RA 3M70A 4PLMA 5FYZA 3ZSLA 5I8SA 4JCKA 2VVDA 1ALYA 3K46A 2P1BA 1DHKB 2C24A 1BHGA 2YB7A 4KG8A 4IGOA 5FUPA 4ZS2A 1MS1A 2Z69A 2WNVC 1LHOA 3A21A 3H1YA 5F2WA 1N47A 4LKEA 1I9RA 4BB3A 1L3JA 4LUMA 1PO21 1Z7S3 5CKQA 1YQ5A 3IDEA 3LDRA 4YRDA 5EPAA 1OQEA 2Y6LA 4FOVA 4I3PA 2NMOA 4AVTA 1CAXB 3POYA 4JDOA 4XF4A 1W3VA 1QWRA 2ADDA 4QMAA 1NLRA 1UZYA 1W8ZA 1W0OA 2I45A 3POBA 1JW6A 3S30A 1AL21 2J1EA 3P3PA 2GH8A 2GDFA 2PHWA 4FPJA 2ARBA 3C7GA 1IHMA 5CKNA 1PM7A 4JQTA 1J3PA 4Q0SA 5GALA 5IHRA 3VZLA 4F3JA 1KEXA 1QGLA 1V6NA 2BNNA 1R091 1RXGA 2D5FA 3O1UA 2YYOA 4GXLA 4COUA 1D7PM 1FATA 1KRIA 1OOPA 2VMEA 1WLCA 2C9KA 2IZWA 1ENQA 4R9BA 4RQPC 4BIFA 1LHUA 3E5QA 3OUJA 2H6CA 5B2GB 1ULOA 2GNTA 2JIJA 2CGPA 2VXRA 4N53A 4QPWA 4ASMB 4D0QA 1YC61 3AP7A 5LBBA 1C4RA 1RUC2 5T50A 5SV5A 1AX2A 1RMU3 1NZCA 2GC2A 1UXXX 2ZMLA 3PDQA 1KJLA 5ABJC 5JCTA 5EP9A 3CJIB 4R4XA 3U75A 2WLPA 4AEKA 2BP6A 3DYPA 4LHLA 4XEZA 1F31A 3C7FA 3SNMA 4YM0A 1ZNPA 1SFYA 2B9UA 3RYRA 2RS52 5DDJ3 1LAJA 1D0HA 4AVBA 5K8SA 5FKBA 3OOXA 5JSOA 2TBVA 1BXHA 3JD71 2CY6A 1S0DA 2I07B 5F2SA 5GZFA 2UY8A 1XYNA 1BVVA 3ILRA 1CPNA 4M01A 2EVXA 4PQ9A 2PELA 4Q4V1 4UW6A 1H6XA 2UYAA 4XQWA 4GH4B 5JR2A 4CCLA 4NHYA 2NZ9A 3OGRA 1WLWA 2LW8A 2RS12 2VBDA 4OLLA 4CCOA 3BALA 4P02B 1SPPB 4LBQD 3IPVB 3H8RA 1IPKA 3VD7A 1DDLA 1QJEA 2JD4A 2ZACA 1H2KA 1NX9A 4CCMA 4PI0A 1POV0 1VBB3 2FMYA 5CU1A 5G05L 3MLKA 4D94A 3U0ZA 1F8VA 4IEVA 4LMFA 4FTSA 4YARA 2BGPA 2W1UA 1Z78A 1ZRRA 1NLQA 1XNTA 2WUHA 5FZ6A 3CLPA 4Y33A 1C8M2 5JI7A 2OKXA 2D6LX 2DTWA 2VPVA 1AR93 3J7LA 4W6YA 1PM4A 4UF0B 3A0NA 3A7QA 5C9AB 2ORXA 2A1XA 1MACA 3QCWA 4Y5Z0 3KT1A 4FTBA 1HW5A 2Q1MA 4OUSA 3NAPA 3T08A 4E4ZA 2VC9A 2HKXA 5JZGC 2H6BA 3DL3A 4UW4A 4Z82A 2K0GA 3S0MA 1H8TC 2RR11 4NHLA 3TN93 1GANA 1ULPA 2R1BA 2DVAA 4EWDA 1TME2 4K3UA 4M3CB 3ZN4A 1W6MA 4GKXA 2FDKA 3HEIA 1PGL1 4X6QB 4OQ9A 2CWSA 2ARCA 3V0BB 3BI3A 1UN1A 2V72A 4O9EA 1J1TA 4CEYA 1V70A 3ZOIA 5FO9B 1GYKA 3TEXA 4YVSC 1OQ1A 1HB2A 4Q0QA 4XJUA 1QJX1 2JX9A 1XXNA 3EYPA 3K3NA 3WCSA 1JYTA 5FZOB 1RTVA 5CVRA 5FXZA 3ZFFC 5C3RA 3VD4A 1UZVA 2BWCA 3WP4A 2QKDA 3R0RA 5FWEA 3PUHA 1JXNA 3VBUA 3LEKA 3AKPA 4ITCA 1LULA 4LBQB 2E6VA 2W92A 4B1LA 1DP0A 1MVEA 1JTZX 1QU0A 3WNMA 4W6XA 5I91A 4LIVA 3NNMA 1ULDA 2QTWB 5TSWA 3KGLA 3C7OA 1EV13 4CU6A 2VXJA 3ETQA 3OJBA 3MIFA 2WNVA 4RR3B 3B01A 1UYPA 2OQ7A 1OPMA 2CHHA 2QDNA 1HQNA 2PMWB 4TWTA 1X7NA 2YUEA 4JVAA 4WM7C 3RS6A 3VHOA 2CDOA 4XZPA 5FIXA 5FYYA 1T2XA 4OQ8A 3B00A 4XF0A 2NPIA 3N7JA 5FXWA 1SEFA 2VNGA 3VDBA 3MW4A 2VW2A 4IEUA 3LE0A 5C3QA 1W6NA 1CJPA 4XQDA 1CAWA 4OYUA 4QDSA 2Y34A 3LDKA 4Y4YA 1GZWA 4JKKA 2BOIA 3WD5A 1DF0A 5KXEA 1W0NA 2GNMA 2WS91 4CXYA 1GUIA 3R4SA 5LA0A 5FFOC 2QDRA 2VUJA 4H3WA 4QHBA 1YFXA 4Y1XA 3OGGA 4RQPA 3LWCA 1YFWA 4RGAA 5FRAA 2V5DA 4OHZA 1RUE1 1G9DA 4NIDA 3KD4A 1Z0HA 4AQSA 3S7EA 4QQPA 4R9DA 4Y5SA 1SLIA 2HWD2 4IERA 5EZWA 3D6EA 5DUWA 4NO4A 3WW1A 4AG4A 1K5JA 4AEDB 4KWJA 3FBMA 4M4PA 4CEWC 1DYPA 5ABJA 1BCXA 1ULEA 4GB31 5IVBA 1OSGA 3DXUA 2GN7A 3N7LA 2XJVA 4L97A 3KHCA 4EZ4A 1JOJA 3LSEA 4D7SA 1RUC3 4KGQA 2B5HA 4WVVA 5DAQA 3PIGA 3W21A 2QQLA 1RJ8A 2R7EB 3DF0A 1KFXL 3GHMA 3FLRA 5FYVA 4BOWA 4CDWB 2VZQA 1GWKA 2CDPA 2ZABA 4K6BA 4Y1VA 4Q2FA 5CADA 2EAKA 3IDCB 1REEA 1XSQA 2PHDA 4NIHA 5K0UC 1W8UA 4RHV3 3WW3A 4D7YA 2GN3A 2HBUA 2YY1A 5FAXA 3NNFA 4YZ1A 5FQ0A 4BQWA 2Q8CA 2C6SA 4INDA 2WWJA 3J26N 1W90A 4QD2A 4UFKA 5FO7B 2OT7A 3HBKA 4I30A 2OPKA 2RS53 4XMIA 1OMIA 5FPAA 4CSWA 3ABZA 3MHZA 5KXCA 4JGZB 1SQ4A 3WSOA 2QE3A 2FCVA 4DPNA 3JBG2 1DQ4A 2BNMA 4AHYA 2HWD1 2FDGA 4Q4Y1 3WVJA 1UOFA 4XQ4A 3ZFGB 5IK5A 1XE0A 1QJY1 1S0CA 1X33A 3OSDA 1MZEA 4IEQA 4LO8A 4V2WA 3LZZA 4XOGA 2RS13 4LR4A 4NRQA 1BK1A 5A1FA 3WDTA 4C90A 1UW8A 1PK6B 3PVBB 1HLCA 2VBBA 1RUH1 5BPXA 1W2UA 1WCQA 1SBEA 1PO12 5CFCC 2RMU1 4LBMA 3ZSKA 3K4ZA 3ASIA 4E2QA 2P3YA 3U07A 3UKNA 2MHFA 3OBAA 1AR62 4QQ2A 4AOCA 4YW3A 1OH4A 4NWWA 1WMXA 5A32B 1QJU1 1C8M3 3CDZB 4IEWA 5JZGA 2QQWA 3MICA 5K4LA 1BLZA 1J1LA 1H8TA 2A6VA 4XUQA 4UT5A 1HRV2 4JX0A 4GAZA 1DIWA 4H2AA 2YGLA 2BYVE 1QXPA 2P2KA 4LEJA 4Q4X1 5C5TA 3GHNA 5CKMA 3KV5A 4QX5A 2JWPA 4UXAA 3WNKA 5K9YA 5EJ3A 5CG8A 4YGDA 3ENRA 5LA9A 3SMHA 4P5HA 4EWAA 2JEMA 4M0HA 4AI0A 3NMBA 2X05A 4YVSA 4EQVA 2FCUA 3DN7A 3TAYA 1TME3 5C3PA 3AYEA 1YLLA 3DECA 3KV4A 4TLFA 3ZFFA 2NLRA 1XE7A 4PJYA 3SH5A 5FZ7A 3GZTB 4HPKB 5F1RA 2B46X 2YMZA 2P3JA 2VW0A 3GNEA 2ET7A 3I2HA 2SLIA 2RDSA 3DKQA 3LIGA 3RYKA 4CXXA 5JI9A 3GDBA 4Q1RA 1UZWA 4GJZA 4AQTA 4ZPIA 1PO11 4I09A 1IS3A 5IW0A 4KMQA 3AP4A 3IZOA 5FPZA 3BB6A 3SCHA 2RV9A 2PLV3 3GM8A 5FMDA 1J59A 3CHXA 4QPGB 4WM7A 3ZYPA 1KGYA 1HRV1 5FY8A 5F8PA 4ZY9A 3ZDSA 5HI0A 4PIYA 2RDNA 4XUOA 3H9AA 2ZHLA 1HKDA 3ST7A 5CFDC 1C5IA 4JC1A 3ES4A 5E89A 2LTNA 4NRPA 5F7UA 3KV6A 3ACHA 3OUHA 4CP2A 2ERFA 2YU2A 3MW2A 3ZN6B 3CZJA 3EJKA 5L7OB 3WF0A 2K9ZA 2PHTA 2WFF1 3ACLA 2D3SA 4C8DA 3ZYBA 4XCAA 2VQAA 3SCGA 3FZ3A 2XXZA 1VLNA 1RUI2 4AFMA 1IG3A 2A6ZA 4Q8KA 1O8PA 1W8NA 2VZ1A 2LUWA 5T55A 3MV11 4O61A 4P9JA 2WQ8A 1YEWA 3AP5A 3N3HA 1LB2A 5IK4A 1JMUB 2HWC1 2VMGA 4NHXA 4AVAA 2PHXA 2HWF3 3K4DA 4QB2A 4KG0A 3RSJA 3UT0A 1O5UA 4LPLA 4RN5A 1OLMA 5F39A 5A3NA 4NIGA 1PNFA 3MPPG 2VM9A 2XB6C 3VBOC 5BNOC 5A1LA 1JI6A 1KDMA 1SCRA 1CONA 2W47A 1MS5A 4CEWA 2A70A 1UY1A 3IN9A 1MQTB 4CP9B 2TEPA 4GQ7A 3D8CA 2BVVA 4KU7A 1DQ0A 1QIQA 3ELNA 3AKTA 3H42B 3HNYM 3IKWA 3PUQA 2GALA 4JTNA 3SC7X 4CUAA 4N43C 3NRUA 2PTMA 4QM9A 3UGFA 2ZHMA 2PYTA 4TN7A 2RM22 3KB5A 1W06A 1PGSA 4BU2A 3GBGA 2YPJA 3F2ZA 1Y3TA 3POFA 4Y26A 2W1WA 3NSTA 5J98B 3MO4A 5IWFA 4JQRA 5K0UA 4QPIB 3O1TA 5EHDA 3JCIA 4MZUA 4P9IA 1UU6A 5FZBA 1QQP3 4AGGA 2A5ZA 2D6OX 2GSYA 1RUI1 4WM8C 4XMAA 1C3HA 3VKFC 1WCSA 1D2QA 2X29A 2XUEA 4AE2A 4E4DX 4SBVA 1BBT2 5FYIA 5JOZA 4FPGA 1JHJA 3NJYA 1GOHA 1W6PB 1DGRN 4RFRB 2R072 4UFIA 4IEZA 3ZIWA 1B35C 3FUQA 2R0HA 4PIXA 1D4VB 3V0AA 2JB4A 2JG8C 2ZS6B 3PIJA 3I4IA 4E8CA 2XR4A 5FY7A 1NCRB 3M7AA 4FXGB 5IFTA 3SKJE 3BTYA 4NUBA 3OBRA 4E2SA 2ZAAA 1HB3A 2GNDA 4I2OA 3B02A 5JXGA 4NE9A 2YPDA 3MIGA 3JBG3 4BK4A 3PJQA 5IUQA 1NAEA 1R082 3OEAA 4C1XA 3I59B 4FPCA 2AR6A 5F37A 2IUWA 5CB7A 3GBFA 5CFCA 4KU8A 4ES9A 1ZA7A 1YHFA 1MZ5A 2CNAA 1AHSA 4H7MA 4OUMA 5FK7A 2Q5TA 4FPOB 4A7ZA 2V73A 5AC91 4WVZA 2GP3A 4ATFA 2D43A 1S0JA 1ULGA 4LUKA 1A3KA 5JOYA 3AZZA 5KC6A 3HPNA 1I3HA 1H9PA 1AR63 3ZMOA 3MIDA 2UWBA 4XUPA 5EYYA 3DYOA 3NL1A 5FZ0A 2OX0A 4BQ3A 4B8EA 4ET7A 5LEJA 4LORA 2ZBJA 2ZGKA 3ACGA 3N7KA 3OGJA 2VCAA 2ZHNA 5JIAA 4AYUA 3OY8A 1JU4A 5DABA 4AHWA 1AVBA 1YXWA 1MZFA 3T3YA 2I2SA 2A3XA 2YFZA 2A75A 1PVC2 1GZCA 1OHFA 1VBD2 2D6KA 1OUSA 4B1MA 1ODNA 4OULA 1B09A 3TRSB 3VKMA 2VTFA 3LF7A 5ACA3 5FPXA 1GMMA 1R64A 1AR81 3J4UH 5T3NA 2KD7A 1UO9A 4YW5A 1C8NA 2YC0A 5F32A 5HPOA 2WAOA 3OTFA 1ULCA 5IK8A 2R041 2GC1A 3PU8A 4AEJA 4MG2A 3ZXFA 3PUAA 5FZ8A 2DUPA 1POV3 3DPRB 2J1VA 3PURA 4S2FA 4QB6A 1HN0A 2EXKA 1N3PA 1W6QB 2W08A 1SBDA 5CFDA 3THTA 4B3NA 5FZIA 3KV9A 4ZXKA 5BNPC 3E97A 3ZSJA 1XJAA 2V4AA 3EB7A 4CE8A 1X36A 2KR2A 2UWCA 1S0EA 1BEV3 1PZ8A 3MYXA 5H9QA 1XC6A 2VY0A 5CEHA 4FQ4A 4QGLA 3U14A 3WQ7A 3THCA 3V56A 1LENA 5LRSA 5A7SA 2EALA 2J1SA 3ETPA 3T4HB 2XLAA 1PVC1 2ETEA 1F35A 1NY72 2R32A 2ZPXA 5IFPA 4TLGA 3N9LA 3U1XA 5T5LA 2VMFA 3AMNA 2XHNA 3H7YA 3BODA 3ZYJB 4CP1A 4DXZA 2WO7A 3N36A 5DG1A 3B69A 1Q56A 4MGZE 5FZMA 3ZYRA 1Q5OA 1H1IA 2X09A 4EN7B 1ZZ6A 4RGKA 1LHVA 3AM2A 1J58A 2Y6GA 1GP4A 3VDDC 4FP3A 4Q1PA 2DCJA 3VBOA 5BNOA 1LJ7A 1ZZ9A 1COV3 1GWLA 1RINA 3NJXA 2CAUA 4Q0UA 4H7LA 3SEEA 4A42A 1ZX5A 2PHFA 3CJXA 3S7IA 4LOTA 1H2LA 1OD3A 2ATFA 3NV1A 4YZ5A 3AZVA 3RJ2X 1Z7S1 1AJOA 1J84A 3CU7A 3PUIA 3O1MA 1XU1A 4U2AA 2B9VA 3ZFEC 4QHZA 5GZEA 5J7MA 2GMMA 2CGNA 4N43A 3O1OA 2ZX1A 2BPA2 4PCRA 2CYFA 5T52A 5HCAA 2Y38A 2ZJCA 1APNA 4DFSA 5DDJ2 3ZDVA 2ID4A 1V6JA 1OI6A 4HLTA 1G9CA 4N9HA 2JB8A 4EN8B 3O7OA 1UZZA 2JDAA 1VAVA 2ZMNA 1IQAA 2WO2A 1MS0A 1DQ2A 5E16A 4HZFA 4C0HA 1DLLA 4UBGA 4Q4W3 4WM8A 3VZKA 4L11A 1YWKA 2CTVA 2RM23 3E6DA 3FHIB 1QH6A 1OVPA 4LITA 3UJQA 5FV3A 5LK7B 1OOPB 2P5BA 2ZZQA 4HSLA 3WG4A 1BZWA 2W9XA 1B35A 4LHSA 4AVCA 5FZLA 1FYUA 3FJSA 2VOXA 2JG8A 1ND2C 4N53B 1TZOA 5FP9A 1AYM2 2W2IA 1YUDA 3I3BA 3AXEA 4FFIA 4HANA 3HIFA 1L7QA 2FCTA 1WCUA 1RMU1 2C5DA 5EYXA 2VNVA 1BBT3 3GJBA 1UMZA 2P17A 2WR9A 3R4DB 4A41A 4KBZA 3H8OA 1FAYA 1O5LA 4NPLA 5F3GA 2R073 5KXDA 2VOVA 3AJYA 4P9LA 1NOVA 4G4FA 2BW8A 2Z2SB 3CF6E 2EXHA 5DAWA 2VUAA 3A0KA 3RVHA 3ZYIB 4CCJA 1JH5A 1QOSA 1XNBA 4IEXA 4D6RA 2XGXA 5DDJ1 3ZXDA 1GKBA 3PVNA 4HVOA 1QHDA 1R083 3FLPA 2E63A 5GLWA 2Y26A 1CPMA 4YWAA 4GJYA 3TN92 3LEIA 1FNYA 5JXHA 1SDDB 3AMMA 1ZRCA 2W1QA 1DGWA 3E6BA 1O3RA 2O8OA 2DVGA 4I3GA 5FPUA 1U5XA 4ARYA 5K7PA 1XNKA 2D97A 4CPBA 1K12A 4LTAA 1VBE2 3BN6A 2TNFA 1SFNA 2WZR2 3POSA 4CU8A 5AVPA 4YG6A 1JOBA 4QHOA 2ZX3A 1QXRA 1VBB1 5KWRA 1PX4A 2VUCA 3QBQA 2BWAA 2QQJA 4FBFA 4QX8A 3W5NA 1LRHA 5A3OA 3ECQA 4YM3A 2PHLA 4OUEA 1PZ9A 4OHVA 5D21A 5FMBA 3H3LA 1N1SA 1AR91 1LOGA 5D8AC 1GU3A 2AGSA 3GXUA 1RJ7A 1U5YA 4LHKA 4RA0A 5CYYA 4D6SA 3E5UA 3KZ4C 1TG7A 4FVVA 4KGGA 1OKQA 5DUXA 1X50A 3L2YA 2W3JA 1VBD3 1S0FA 4DUWA 3MZHA 3VBFC 4WVWA 5FYMA 4BQ2A 3NAPB 5A70A 3UGHA 1SCSA 3AFKA 3WXPA 4AVVA 3TN91 4FFFA 3RMYA 3N9MA 3O0XA 4DIQA 3K4AA 5E1RA 1RUJ3 4OMDA 3HT1A 1W6MB 2XOMA 5BNPA 4Y1YA 2P4EA 1FI2A 1CN1A 1NXMA 2G9GA 2QJVA 3FC0A 3PTRB 4ZS3A 1RB8G 2XH6A 4BK5A 2PFWA 4CCCA 4CEYB 3K3OA 3POGA 4K7JA 3S57A 1O3SA 2WN2A 5JOXA 4Y22A 5CIRA 3ZLIA 4LULA 2ZX0A 1O7FA 2VE1A 2QUOA 4NHMA 1FPN2 2AEYA 4EN6B 3VBUB 3ZR5A 2RE9A 3MLJA 1DGWX 1UPSA 3AB0A 1Y9MA 1LKNA 4NVPA 1Y9GA 5FZAA 1OA2A 4BQXA 4LBKA 5HCHA 2WLQA 1DZQA 3QACA 4IETA 4URTA 5FMOS 2H0BA 3VDDA 5C8WA 4A2UA 5FWJA 1EV11 2XONA 4I0WB 2HWE2 4LJHA 2QZ2A 1QJFA 1WBFA 2JG9A 2WNVB 4J1XA 4RD7A 2Q0AA 5BYNA 3BU0A 4GWIA 4C1WA 1S55A 4AF9A 4JDNA 3BKZA 2Z5WA 3ZFEA 3BUCA 4XPVA 2VOKA 2IXIA 3B9IA 1DGRA 3ZX7A 3WHTA 1W6NB 2RJKA 1XU2A 1CAWB 1TQ5A 2DU1A 1W8HA 4XDOA 2XJSA 3PUSA 1GZWB 2ZGQA 5J96B 2FDIA 2DCZA 3CO2A 2J1RA 2B42B 4PI2A 2W87A 4RHV2 4XXPA 2VZSA 1OT5A 3WLUA 1ND3C 2GC3A 2ZGPA 2X53S 4CDQC 2RJLA 2DF7A 4Y4RA 2ZEZA 4QXKA 4RQPB 1LOFC 3P1IA 1UOGA 2J1AA 5KHGA 1ND2A 2AACA 5DUVA 3B3QE 4P9YA 3NNGA 5E8AA 4PDWC 3KQRA 1UY2A 1O91A 4XJWA 1AYN2 5JAXA 1JN2P 2ZAHA 4J1WA 3B9CA 3KF3A 5FZGA 4Y1UA 1X9TA 2DFCA 2HLEA 5ANQA 3ZXLA 1J3RA 5ABJB 3I2JA 4Z92B 3N7MA 4LLFA 5H9SA 2FDJA 1AYM3 1W2OA 2Q4SA 3DV8A 3OYWA 1RUC1 1OH3A 3BPSA 1W6OA 2J7MA 5FUNA 2OA2A 2DVFA 4FQZA 4KH9A 3RI9A 4XDPA 3KVAA 3LCPA 3GALA 3VBHC 1V6OA 5BNQA 3C2UA 4HKLA 4IE4A 3AK0A 3ZKYA 4NROA 2HJIA 4RHV1 5FLIA 1HB1A 3FL7A 2VU9A 1H8VA 5LA2A 2EA7A 5FQ0B 5IAXA 2RS51 3OGSA 4LBLA 2GH2A 1G9BA 4MHUA 4XIKA 1I1EA 1GLHA 1KQRA 2K46A 4EN9B 2VH9A 3AYDA 4XTPA 2WZ8A 2TUNA 3WV6A 2GZWA 2YHJA 5LEKA 3H50A 4CDXC 2CSGA 5C71A 2QBXA 2D40A 5KBFA 3WX5A 5LCWL 5B4XA 5I0RA 1RHI3 1WA6X 2B7YA 2P3KA 1STMA 1GP6A 4DXSA 1ZRFA 5A7PA 1ENRA 2GMEA 1ZZ8A 2YBKA 2RS11 1WW6A 1UOJA 3N9NA 3WF3A 4BIOA 4XE9A 1VBE3 1VE0A 4XAEA 1C1LA 2WZR3 2WA4A 1A6CA 5D8AA 4XXAA 2DVBA 1CIWA 3ZPOA 5FLHA 3AZWA 3MF9A 1NG0A 4ZU4A 4J25A 3ZYGA 3ZO0B 1CAUA 1JUHA 1FX5A 3KHBA 4QX3A 1NQDA 3VBFA 1ACCA 5DAXA 2PLV2 3ZIXA 4K1ZA 3RZMA 2FDFA 2FBEA 3UGGA 1C8M1 5IVCA 3QH6A 5JZGB 1OBNA 4FPEA 2VZOA 1H8TB 3ZPYA 4EJRA 4JV4A 1UX6A 1LOEA 3ZVXA 4BE3A 5JPNB 5F3CA 4LBJA 5KC5A 5JLVA 4PF1A 4Q0PA 2F6BA 1VR3A 4JZRA 4JHZA 1WCKA 1UQXA 2FQPA 1OFNA 2YC4A 1OLME 4YVSB 5I8YA 4OMCA 1S1AA 4LK6A 1TME1 2VL4A 4COZA 5CG9A 4LLOA 4XFIA 1O59A 2GU9A 3K2OA 3T1LA 1PGW2 4DO0A 3ZFFB 1S0IA 2DCYA 3TWIA 3RFRA 1HXS3 4E9KA 4Z2AA 4K40A 3WNLA 4QT6A 1WW4A 3OD0A 3B94A 1HRI2 1SHWB 4BHPA 2W0XA 2HEVF 1G6NA 3GJAA 5J09A 4AK3A 1YIFA 4H14A 2JDMA 1WW5A 2CU5A 2RVAA 3P6BA 5JSPA 1C1FA 3FFQA 4UFHA 4D7TA 2X5IC 2HWF2 3C8XA 4NIIA 2DTYA 4LKDA 2JKXA 2DWRA 2FMDA 1Q43A 3M8LA 3H7JA 2PLV1 3IM0A 2YDEA 4P9WA 1NQJA 5IAVA 1YFUA 4DEVA 1FPN3 4G3YC 1ZBA2 2WAAA 5HV0A 2WNUC 1OKOA 4IE6A 4WM7B 3NNJA 5C3OA 3RG0A 3NV4A 1RUF2 1SZBA 2VQTA 3MI8A 2BQPA 1H4HA 2HYKA 3IBMA 1EAH2 1OURA 5HCFA 1RUOA 1NLSA 2Y60A 2PAKA 3J7HA 4QQOA 5J37A 2A3WA 2HWE3 2ZGMA 3WF2A 3I2DA 2F4LA 2Y6JA 3BYWA 5LA1A 2VZPA 5ISLA 4JHTA 2AEZA 3KMHA 3PVOA 5A3LA 5AFBA 1QQP2 2E9QA 3AP9A 1ND3A 1ZZBA 4XF1A 1WGPA 4CDQA 5I0DA 1MS9A 5FZCA 3I2GA 1WMEA 1GZ9A 1Q8OA 4IQPA 3J7MA 3BTXA 1E5IA 1LOFA 3HOBA 3WP3A 2BU9A 1NA1C 3BCWA 3D3AA 4CA9A 2HWF1 3UKVA 3WP5A 2Y6FA 3A4UA 4HL0A 4N7IA 1UCXA 4PDWA 2I74A 1DYOA 3Q8CA 4QGNA 3LKJA 1QNWA 3G7DA 4JGYC 1UX7A 3Q9OA 5GZDA 4CVUA 2Y64A 3VHPA 4LT5A 4CEWB 4YVWC 1ODMA 1XYPA 4IEYA 2OVUA 5JR7B 1VRH3 4PT6A 4IV1C 3AVSA 1N1YA 2OPWA 3TNPB 3WZ1A 2XJUA 3WOGA 1A34A 3RWKX 2QQIA 1S2KA 1LTEA 1CAVA 2WRAA 3A22A 1AYN3 4FXKB 4IL7A 3HJRA 4FOWA 2VUDA 4NWVA 3VBHA 4BQYA 4F83A 2DFBA 3GYDA 1EPZA 1JS9A 1YQ2A 3BOPA 3FLTA 5FJHA 4XBNA 4A3ZA 4PF5A 5EFUA 1AXZA 5K0UB 2ZMKA 1V6MA 4XJZA 1QQP1 3APBA 3O0WA 1OA3A 4J6GA 4MH0E 5JUVA 1GQPA 5E6HA 4CDUC 2JIGA 1JYWA 5A1AA 1HJGA 4QX0A 4OI1A 3HAGA 4BA6A 2PHUA 5C4WC 4ES8A 4CDXA 3SISA 3T2PA 4FPLA 3KGZA 1EUUA 3V0AB 2NMNA 3WHUA 1JYXA 5CA6A 1RUG2 1TE1B 1XQNA 2ZKLA 3LDBA 1V00A 4X6RB 3AXDA 1IS6A 1CQ9A 1AR72 4A7YA 3TBDA 4PQQA 4PHZA 3OBTA 4XABA 3T2QA 4DNYA 3VBRC 1NXD1 3JBG1 3S5QA 5KXBA 2D5HA 3FE5A 2GAUA 1MVQA 5FMOL 5FZDA 5ACA2 5T5PA 3M3CA 5L9RA 4W4ZA 2HYXA 4MGYE 3SQOA 3ZKUA 1Q8QA 4IE7A 4LBOA 5CFCB 5A3UA 1QDOA 2RG4A 4YG0A 3IT8A 3IDAA 1H6YA 4BJ0A 1HIXA 4YGEA 1CGPA 4QXHA 1RIRA 3L2HA 3AZXA 2R16A 1TNFA 3NV2A 5FXVA 3ILFA 2DYCA 2AH2A 3USSA 1H4GA 1FMD3 3RJRA 2YBPA 4KNCA 1AR61 4HK9A 3KF5A 3WF4A 4Y3OA 2WSVA 5AFEA 3J8F3 5A7WA 4JRAA 5EIYB 1BEV2 1S4CA 5JWPA 1UYXA 1LCLA 2XHKA 3OY8B 3OGVA 4AVSA 3HQUA 4PLOA 1ULFA 4FT8A 5GLZA 1TMF3 1U12A 5DZEA 4MX3A 1Y7BA 3K77A 4HMZA 4AI1A 4TYSA 5ACA1 2QVSB 4XURA 1QNYA 2ZGUA 3GCXA 1H1AA 4QKDA 5LRRA 2VOTA 5DAVA 4TXWA 4F8AA 4WVMB 1NCQC 1JYVA 3IB3A 2X5IA 3E5XA 2W95A 3QOPA 3VL8A 4Y5TA 5HXMA 5JMCA 4R52A 4EV0A 4GMP0 3MV01 2C9AA 1HRI3 1COV2 1POV1 2MEV2 4MSVA 1REFA 1SFPA 1UOBA 3DGTA 5FKCA 5FYCA 2A6WA 3IDBB 2WNUA 1IOAA 4NR1A 2ZZJA 5L36A 4PBPA 3N9QA 1FNZA 5IT6A 2VMHA 3I2KA 3UK9A 5CFDB 4NIAA 1RXFA 4TSVA 1REDA 2ZGTA 3BIEA 2WABA 1RVF3 1BMV2 2OUHA 3B5LB 1HV0A 1R1A2 3PNAA 2J22A 1ZBA3 3HR9A 3RZGA 1BEV1 3ZXJA 5FDBA 1VB2A 5CAZA 5T5OA 1RUF3 4R9AA 2JE9A 4JAAA 1EAH3 2ZX2A 4BDVB 1XE8A 1YQ6A 1WKYA 2E51A 3OCPA 4XBLA 4Q4W2 1LEMA 5F3IA 5JVVA 4XFAA 3WQ1A 3J7NA 3D0JA 1BK0A 5C8CC 2HH9A 5LY1A 2R1DA 3LPFA 2JENA 2UYBA 1TEIA 1NA1A 2R062 3SEPA 5IVJA 3WNPA 4Q0VA 4FCAA 1V9U2 1Y43B 3UV9A 3VBOB 1NE4A 5BNOB 1COV1 4JGYA 2V4VA 1CVNA 1DZRA 4FAHA 4YVWA 4LA2A 5F5IA 4ZXEA 1S2EA 4IV1A 3WEZA 2D7FA 1BQPA 3V64A 1DQ1A 2Q8OA 2VTXJ 4CU9A 3MGUA 3WP6A 2WO3A 4N43B 4CP0A 1KD7A 1G9FA 3O14A 2YG0A 5FYSA 1I5PA 1IKPA 2QQOA 4RL7A 3JB4C 5A6ZA 3SLIA 1FV3A 2Y6KA 3D0SA 3M2MA 5FBZA 5C33A 1UD1A 3CNAA 4COYA 4KWUA 1GSLA 2RJ2A 4Q4W1 4WM8B 2XBO2 1MR5A 1NUKA 2RM21 2SBAA 4FFGA 4QXBA 4Y20A 5GLUA 4CDUA 1C5HA 4BXFA 2D6MA 1W39A 2LALA 3JU9A 4COVA 1PX3A 5C4WA 1VJ2A 5FO8B 1B35B 5FZFA 4I01A 3WT3A 3MFAA 1W2AX 2WN3A 3EQEA 4LXLA 4QKBA 4KQ7A 4IUGA 3BGAA 1VAMA 3VBSC 4XBQA 4HOOA 2BBVA 1BJQA 1POQA 1XB9A 5KR7A 1BBT1 3AVRA 4YSFA 5GM0A 3TYJA 3VBRA 2R071 1US3A 4UAPA 3WF1A 3U78A 1CJDA 2EAAA 4FOYA
chains in the Genus database with same CATH topology
1RUG3 4MXWA 3VN4A 3VZNA 1N1TA 3H8UA 4WBBA 4DB5A 1AR73 1LODA 3AFGA 1ZZ7A 4GKYA 1UAIA 5E88A 2IFRA 2NQYA 2G4IA 2BFUL 1R081 3MFCA 3M1HA 4KL1A 2WIIB 2A7AA 2BNOA 2RS32 4Y24A 2HWB2 1RUJ2 4YFWA 4QGMA 3RNSA 4QPGA 1K5MC 1Q8VA 4WZCA 1W0PA 4Q27A 2ZTNA 3SITA 1ZREA 2KXLA 4YZ3A 2VNOA 2HEYF 3MLLA 3KCXA 1IS5A 1BYHA 1SACA 5C6CA 3VZOA 1NCQA 1KFUL 1M06G 4XFHA 2EXIA 2YZ4A 1WMFA 4LNVA 1GNZA 3M3QA 1VBD1 4K8FA 1LOBA 4XJ8A 5BXXA 5GZCA 4BMEA 4K1YA 1GV9A 3R05A 1SLAA 1RUJ1 3HBZA 5BNPB 3L9JT 1LECA 2MEV3 2C1FA 3QD6A 1A8DA 5GLTA 2XL9A 4COWA 1GNHA 2JG9C 4Y22B 4Q29A 4L8QA 2VVFA 4XILA 4NOTA 1R1A3 3VV1A 4GULA 4QQHA 5I0SA 4TZDA 3VLBB 5C8CA 2WWSA 4XW3A 1PZ7A 4QU2A 3O0VA 4XFGA 5HBAA 1AXYA 4B7EA 2VNRA 3WG2A 2XL7A 1VBA2 1Q8SA 2ZCWA 1NY71 3VDDB 2G9FA 3V65A 2B39A 1PNGA 1LOCA 1X8MA 1PGL2 1V6KA 1F2NA 2VECA 2R063 2P3IA 1O3QA 2OIIA 4JDMA 1D4M2 3WG1A 5JDBA 3ZFEB 1V9U3 4WZFA 1QXJA 4XIOA 1VBC3 5BNNC 2CGOA 3ILNA 4IV3C 4NPRA 4N9IA 1VB4A 1RGSA 1H2NA 1PMIA 2PN5A 1EYBA 1WCDJ 2XJPA 5GZGA 4H55A 4BCUA 4W65A 1S0GA 1ZA4A 2ES3A 2X8KA 1YJKA 4GWNA 1RUNA 3VGIA 4ISQA 4X8NA 1ND2B 5JOWA 1AX1A 1QH7A 4LHNA 3VBSA 3T2TA 4MLOA 1KS4A 2XBO3 1RHI2 2XLFA 1MEC3 4LA3A 1WLTA 5EWSA 2OUJA 1ZBE2 4P9XA 3RMXA 2VG9A 4K9SA 4L9BA 2E7AA 2A6YA 4U36A 1AYM1 3OYWB 4XETA 4DY5A 1ASJ3 3FFZA 3H3UA 1W6OB 2JDZA 1KXGA 2D44A 4M3CF 4HFSA 1OD5A 1GQHA 2B8MA 2AYHA 4RS5C 1M4WA 4YG3A 1MS8A 3M4FA 4S2HA 3SCFA 2DURA 3MPBA 3V64A 3P3NA 4Q26A 4IEOA 2QFEA 5F6KA 1UU4A 3WDWA 3H1MA 3BIWE 5FREA 1K5MA 5DUUA 4DINB 2VOWA 3MIEA 4M00A 3WDUA 1GR3A 1PO22 4D69A 2QZ3A 2W39A 1G9AA 5HCBA 1QOOA 2RS33 2HWB3 1RHI1 3TNQA 2FHRA 1SMVA 4L2NA 2D93A 3JUUA 1HXS2 1QDCA 4HVQA 1VBE1 1CR7A 4ISRA 2WINB 2WZR1 5F5QA 5D8AB 2DCKA 4GALA 4YW1A 2UURA 1CAUB 1R092 2WA3A 3IMNA 4FP2A 2E7QA 2RHPA 4V1PA 3VBFB 3S6PA 1D2SA 4AHXA 4CTEA 5I0UA 2JICA 4LO5B 1DQ6A 3ZXAC 2BGCA 1T6GC 3LB9A 3ZMNA 2YXSA 4JRLA 4HVRA 1WLDA 1G8WA 3LSDA 5FOBB 4XJAA 5KHJA 5GJ6A 4I02A 5DZGA 4WV8A 4EWEA 2ZGRA 4X8PA 2MPFA 3WCRA 4MV2A 2A71A 3LOIA 1WD3A 3LAGA 1HXS1 3I8TA 2V09A 3CJIC 3JD72 5KHIA 1HQWA 1HV1A 4FPHA 5I93A 4Q4V2 1O4TA 2IWGB 4SLIA 3KCCA 3AKSA 1N1VA 4HK8A 4B29A 4OHWA 1YFYA 1FPN1 4XFFA 1IGOA 2BTVC 4FSJA 1URXA 3WY6A 4GH4C 3JQXA 1VRH2 1FOD3 2BEOA 1HX6A 3KT7A 1VBA3 2XPJA 3U11A 3H3ZA 3VUOA 3MIHA 4CRQA 4M3CE 1BKZA 1UPIA 2HWE1 3RZZA 5BNNA 1SLTA 2DV9A 4ASLA 4IV3A 2JE7A 2XJRA 4GMP3 1D4M3 1PIV3 2ZGOA 4RFT0 4AWDA 4XF3A 3ALQA 4XFBA 3NVCA 4XYXA 1ND3B 3ME2A 4NHKA 4CDQB 2PA7A 4CZSA 4AQ2A 1OLRA 1F5FA 4YNIA 4BZ4A 4R9CA 3WDYA 2RR12 2ZKNA 1JUIA 2P37A 4AEMA 5C9AC 2LM3A 4BYYA 1D0GA 3KLSA 2D6NA 4PDWB 2WKKA 5DXDA 4RGGA 3H0OA 3NWKA 4R8HA 3USUA 4F7ZA 5A33A 4LO6B 4MVTA 2R49A 2BUKA 1QJX2 2D98A 1VRH1 2Q30A 4AFAA 4HKWA 1CAVB 1PHMA 1AYN1 1RUD3 1YCIA 3LGRA 4META 3R4UA 3CEWA 1KDKA 3VBHB 1ZBE3 4KWLA 2EF6A 3N35A 2R6QA 5H9RA 1U5IA 4RS5A 3WQ0A 2ZX4A 3LA3A 1GQGA 4MUVA 1O4ZA 4DQAA 2JJ6A 2ZGNA 4ZU5A 1LEDA 1FMD2 1I6XA 2Z79A 1G86A 4Y1ZA 2XVGA 2Y0OA 1X82A 3J8F2 4CDXB 2B45X 1JHNA 1XNCA 4RR3C 3LA7A 4BLIA 1TMF2 1DFQA 3RWNA 3EXUA 4HN0A 1PO23 4XFCA 1QOTA 2HEWF 3DKWA 3KM5A 1QF3A 2WS92 4DS0A 2WQ4A 1CAXA 4AQ6A 2EXJA 2VVEA 2XKOA 1WBLA 3EHKA 4YFZA 1AL23 3PLQA 2AUYA 1V6IA 3WG3A 1RUE2 3AKQA 2NN8A 3NW4A 2VGDA 5GLVA 3TB0A 1QJZA 1RC6A 3VKLA 5CBLA 1FMD1 4KWKA 1R093 2AZ5A 4MGKE 4FAGA 1RVF2 2IXJA 3H1WA 1DBNA 3I7DA 4GB32 3J8F1 5FCCA 2DCTA 3SH4A 2O1QA 2BFUS 5D1IA 3RYPA 4OFGA 2R30A 4AEDC 1SDWA 1TMF1 2Y0IA 3AJZA 2A3YA 3CJIA 3K48A 4BMBA 4YZ4A 4UW5A 3WUCA 2X5IB 1PGW1 1LHNA 1UKRA 2IXLA 1DGLA 4AXOA 4BQ1A 4CDWC 2Q1ZB 3VHRA 3JD73 1HRI1 1VIWB 1GFF2 2R0FA 4QPYA 3MIBA 2VULA 4UBHA 3W58A 2WNUB 4Q4V3 1PVXA 4GH4A 2WSUA 3HMYA 4Q4Y2 2XWJB 2GNBA 1NYWA 1QJY2 2H0VA 2XJTA 2VW1A 1RVF1 4JGZC 3FUOA 4XF9A 3IPVA 4NN0A 1ZBA1 3ZXKA 3EBRA 4MYEA 1JYCA 4E2GA 2WL1A 3G6JB 1RUH2 1RUF1 5JSRA 2WZPP 3ZFGC 1EAH1 1YI7A 1SBFA 1ZZCA 2RMU2 4BPZA 3AP6A 4YM1A 4AFDA 2ZA9A 1WMDA 3ROUA 4GWMA 1QJU2 1PK6C 2UWAA 2JKBA 4RSUA 4C91A 2DVDA 4JTOA 1NA1B 4DY3A 3HN1A 1OLQA 2W52A 4Q4X2 5C9AA 3B7MA 2PQQA 1U5ZA 4KBBA 4QM8A 4AHZA 1FXZA 4XHXA 5IK7A 2IXCA 4JGYB 3OF1A 3D4KA 5F9TA 4BM8A 3J9SA 4PLNA 4YVWB 4DRVA 2K2SA 2RR13 4S2DA 2YV8A 3KS7A 4IV1B 4M3CA 1LHWA 4A7KA 2CWMA 3V0BA 1DYKA 1EP0A 5EV7A 2JECA 5KHKA 4XTMA 3O5SA 2DUQA 1OQDA 1QJX3 5H9PA 2EIGA 2PAEA 3AYCA 3N4MA 2XVLA 1H9WA 4Y20B 2NP0A 4CDUB 1HQLA 4AI8A 1H2MA 3GBWA 3LA2A 4LBQA 1IPJA 3NV3A 4K21A 5C4WB 3DUIA 3KT4A 2WT0A 2ILMA 1AJKA 4O9GA 4ORFA 4RR3A 3BU7A 1ENXA 4QPGC 4OI4A 2WFF2 3JQWA 4ONUA 5FTTC 3VBRB 3W59A 2QNKA 3T1MA 4IESA 1RUG1 1AX0A 2NM1A 3IIAA 4MXWB 4PIZA 4A3XA 1AUYA 1AR71 5L7OC 1GICA 4C0BA 3C3VA 4I0BA 1Y9QA 2HWC2 3M3EA 5GKAC 2WS93 3AMQA 3UL2A 2O0OA 4COYA 1F5JA 4W6WA 3TOJA 4DRRA 1NE6A 2KA3A 2BVBA 2ENRA 2F4PA 2UY9A 3ATGA 4R4ZA 2OZ6A 4HETA 1X8EA 4YYOA 1UU5A 2C0ZA 5SV8A 1RUE3 4B4QA 1IZ3A 3MF6A 3RI8A 1EPWA 2ZGSA 4EN0A 2CAVA 4LE3A 1H0BA 3SHRA 2PHRA 4AEDA 2AREA 2UU8A 5J48A 4DMIA 1MQTC 5AVAA 4GB33 2FZ2A 4BWOA 1TNRA 3SH3A 3AMPA 1NCQB 2JXAA 4HSJA 4YGCA 4CDWA 3VKOA 4FPKA 4DOUA 1FV2A 2ZHKA 3VKNA 4HKOA 2A6XA 3O12A 4E27A 1MZ6A 1V6LA 1ZM1A 2ZOEB 4QPIC 3R6SA 4L92A 3I54A 5BV6A 3ES1A 3QH7A 5EXOA 2ZGLA 3SXWA 2OYZA 2NYYA 4M0NA 5J3UA 1SLBA 1OPOA 4JGZA 1OA4A 3ZSMA 2ARXA 2D6PA 3HT2A 2MEV1 4DZGA 1VBC2 1WUVA 2XJQA 4K20A 5L73A 4B7KA 2HWD3 4Q4Y3 1CX4A 1NCRC 4Z07A 3ZFGA 1QJY3 3PVEA 3WDXA 3CL1A 2WQZC 1BMV1 1R1A1 3PHMA 1DZTA 5C8CB 3AMHA 1PK6A 5AC92 2Z42A 2E7TA 1RUH3 2VMIA 3M3IA 2RMU3 2GC0A 3INAA 1O3TA 5BY5A 1CESA 1A8MA 4AFBA 4QQLA 1KS5A 3AKRA 3LOBA 1KITA 3POWA 3PTYA 5A32A 4FTEA 1QJU3 2XVKA 1MEC2 3IWZA 1E57A 3AYAA 3D5OA 3D82A 1VALA 2CV6A 2R061 3X29B 3WUDA 5HXVA 1Q8PA 3GZAA 4Q4X3 1AL0G 2JG8B 1V9U1 1VP6A 3JZVA 1ASJ2 1ONAA 1ZYBA 1VBC1 4AI3A 1N3QA 1AR82 3W9AA 2IC1A 1VAKA 3FBYA 3ZXEA 2O8QA 1I5ZA 4XHBA 5I0TA 1WD4A 2OZJA 2R042 4HPKA 2IXKA 1YIPA 3RQ0A 4E4SA 1UF2C 1XRUA 2YGMA 3GZUC 1YO8A 3AX4A 4S2GA 4YLZA 1PO13 3MEPA 3WINE 2VQ0A 3K51A 1S0BA 3VBSB 4OZXA 3PMEA 1WW7A 2XBO1 2XLGA 3VZJA 1AXKA 1MEC1 3DPRC 2XKPA 4HBNA 4AGVA 1LOAA 3WW2A 2WFPA 3UKTA 2MNGA 1HRV3 5CNAA 1OFSA 4OI2A 3OPZA 3RPQA 3HWJA 3UJOA 1ENSA 1SLCA 3KSCA 1O4YA 5L19A 4OI0A 5J36A 3ZXGA 1ASJ1 1EY2A 1MS3A 2P34A 3MW3A 3ZN6A 5LK5A 5L7OA 3PMSA 4LO4B 2WT2A 1QY4A 2WFF3 3BOWA 1LU2A 2IFWA 1YYNA 4AGRA 4HT1T 4XJ9A 4WVMA 3URFA 3HD8B 3THPA 1YRZA 3EO6A 1LR5A 1DU3D 2W68A 4Z1VA 1BVP1 1K5MB 1QMJA 5FOJB 1MS4A 2OW4A 2HWC3 1Z7S2 4LBNA 2CL2A 2IXHA 1YNAA 3M3OA 2RS31 2HWB1 4EROA 3VHNA 1A78A 2WNEA 2N7GA 2XUMA 1LGBA 1SLLA 1MQTA 2WT1A 4P14A 1IKQA 5A3MA 4P9GA 4FOQA 1JBCA 3NO8A 3VZMA 4LO7A 1C57A 4L99A 4D3WA 1CD3G 3E6CC 1XNDA 1AZDA 1RITA 4QPIA 4G9SB 4MXVA 2XWBB 4FPFA 1RUI3 3PJYA 1FOD2 4Q8LA 1RMU2 5F6LB 2D3PA 1HDKA 1OOPC 1J3QA 1W6PA 2JG9B 3BPZA 5KHHA 4N53C 1Q3EA 1G7YA 2GMPA 1NCRA 1H30A 2DUOA 1PIV2 4HN1A 4YGBA 4BLJA 3U10A 3KCYA 4YW2A 4AI2A 4I0AA 1LGCA 4UW3A 2V5YA 4Z8BA 3FMGA 1UIKA 3I59A 4Z2WA 4YW4A 3HQXA 3WW4A 3GF6A 4CYDA 3RDIA 4YM2A 4PBOA 5JPMB 3B93A 4ZU7A 2QQPA 4ZKTB 1GBGA 5AC93 1UL9A 1WA4A 2QCSB 1LGNA 2ET1A 1R1ZA 1N3OA 3AZYA 4MGIE 5FLJA 1FOD1 4BH9A 3U4XA 1VBB2 4LE4A 1VBA1 5T5JA 1KJRA 4XDQA 1DQ5A 4FO9A 4IXLA 1RUD2 1IS4A 2AENA 2WJSA 1FT9A 4FPYA 1LU1A 5BNNB 3VL9A 1JYIA 1PGL1 4IV3B 1XYOA 3RRDA 4GMP1 1AR92 3WR0A 1C28A 3QLQA 1D4M1 1PIV1 1U0AA 1UIJA 1ZVFA 4GIQA 2A73B 1F9KA 4OVEA 5DG2A 1ZRDA 3MDPA 3NJZA 4N90A 1AR83 3NKGA 1RL3A 2WC2A 3WNXA 2PAMA 5T54A 5BUVA 1AF9A 2R043 3FWEA 2FZ1A 3WDVA 3DPRA 3NAPC 4IEPA 3NKTA 3USUB 2XG3A 5A33B 5I8TA 3ZSEA 2KM2A 1H1MA 1W6QA 2D3RA 2E53A 5DZFA 1YI9A 2DU0A 3JB8A 1QKQA 1UKGA 1S2BA 1RUD1 4OHXA 1LESA 3FX3A 4CEYC 1ZBE1 4GA9A 1AL22 4RS5B 4AFCA 3OD4A 5JIUA 3BTAA 1PVC3 1YJLA 1DG6A 4N7UA 4B4PA 1EV12 4YZ2A 4ATEA 3VBUC 2YROA 4OHYA 4B4RA 3M70A 4PLMA 3ZSLA 5I8SA 4JCKA 2VVDA 1ALYA 1DHKB 4KG8A 1MS1A 2Z69A 2WNVC 1LHOA 3H1YA 1N47A 1I9RA 1L3JA 4LUMA 1PO21 1Z7S3 3IDEA 4YRDA 1OQEA 4FOVA 4I3PA 2NMOA 4AVTA 1CAXB 3POYA 4JDOA 4XF4A 4QMAA 1QWRA 1NLRA 1UZYA 1W0OA 2I45A 3S30A 1JW6A 1AL21 3P3PA 2GH8A 2GDFA 2PHWA 4FPJA 2ARBA 1IHMA 1PM7A 1J3PA 4Q0SA 5GALA 3VZLA 4F3JA 1QGLA 1V6NA 2BNNA 1R091 2D5FA 2YYOA 4GXLA 4COUA 1FATA 1KRIA 1OOPA 1WLCA 2IZWA 4R9BA 1ENQA 4RQPC 4BIFA 1LHUA 3E5QA 2H6CA 5B2GB 2GNTA 2CGPA 2VXRA 4N53A 4ASMB 3AP7A 1C4RA 1RUC2 5T50A 5SV5A 1AX2A 1RMU3 1NZCA 2GC2A 2ZMLA 1KJLA 5ABJC 5JCTA 3CJIB 4R4XA 2WLPA 4AEKA 4LHLA 4XEZA 1F31A 3SNMA 4YM0A 1ZNPA 1SFYA 2B9UA 3RYRA 2RS52 5DDJ3 1D0HA 4AVBA 5K8SA 5JSOA 2TBVA 1BXHA 3JD71 2CY6A 1S0DA 2I07B 5GZFA 4AW7A 2UY8A 1XYNA 1BVVA 3ILRA 1CPNA 4M01A 2EVXA 4PQ9A 2PELA 4Q4V1 4UW6A 2UYAA 4XQWA 4GH4B 2NZ9A 1WLWA 2RS12 4OLLA 3BALA 4LBQD 3IPVB 1IPKA 1DDLA 2JD4A 2ZACA 1H2KA 1POV0 1VBB3 2FMYA 5CU1A 3U0ZA 3MLKA 4D94A 1F8VA 4IEVA 4FTSA 4YARA 1Z78A 1ZRRA 3CLPA 1C8M2 5JI7A 2D6LX 2DTWA 2VPVA 1AR93 4W6YA 3A0NA 5C9AB 1MACA 3QCWA 4Y5Z0 3KT1A 2Q1MA 1HW5A 4OUSA 3NAPA 4E4ZA 2HKXA 5JZGC 2H6BA 3DL3A 4UW4A 4Z82A 2K0GA 3S0MA 1H8TC 2RR11 4NHLA 3TN93 1GANA 2R1BA 4EWDA 2DVAA 1TME2 4K3UA 4M3CB 3ZN4A 1W6MA 4GKXA 4X6QB 2CWSA 3V0BB 1UN1A 4O9EA 1J1TA 4CEYA 1V70A 5FO9B 1GYKA 4YVSC 1OQ1A 4Q0QA 4XJUA 1QJX1 2JX9A 1XXNA 3WCSA 1RTVA 5CVRA 3ZFFC 2BWCA 3WP4A 2QKDA 3R0RA 1JXNA 3VBUA 3AKPA 4ITCA 1LULA 4LBQB 2E6VA 1MVEA 1JTZX 1QU0A 4W6XA 5I91A 1ULDA 5TSWA 3KGLA 1EV13 3OJBA 3ETQA 3MIFA 2WNVA 4RR3B 3B01A 2QDNA 4TWTA 1OPMA 4WM7C 1HQNA 3VHOA 1X7NA 2YUEA 4JVAA 3RS6A 4XZPA 3B00A 4XF0A 2NPIA 3N7JA 1SEFA 2VNGA 3MW4A 2VW2A 4IEUA 1W6NA 1CJPA 4XQDA 1CAWA 4Y4YA 1GZWA 3WD5A 1DF0A 5KXEA 2GNMA 2WS91 3R4SA 5FFOC 2QDRA 2VUJA 4H3WA 4QHBA 1YFXA 4Y1XA 3OGGA 4RQPA 3LWCA 1YFWA 4RGAA 5FRAA 4OHZA 1RUE1 1G9DA 3KD4A 1Z0HA 4AQSA 3S7EA 4QQPA 4R9DA 1SLIA 2HWD2 4IERA 5EZWA 3D6EA 5DUWA 4NO4A 3WW1A 4AG4A 4AEDB 4KWJA 3FBMA 4CEWC 1DYPA 5ABJA 1BCXA 1ULEA 4GB31 1OSGA 2GN7A 3N7LA 2XJVA 4L97A 1JOJA 3LSEA 4D7SA 1RUC3 4KGQA 2B5HA 4WVVA 3DF0A 1RJ8A 3GHMA 1KFXL 3FLRA 4BOWA 4CDWB 2ZABA 4K6BA 4Y1VA 4Q2FA 5CADA 2EAKA 3IDCB 1REEA 2PHDA 5K0UC 4RHV3 3WW3A 4D7YA 2GN3A 2YY1A 5FAXA 4YZ1A 5FQ0A 4INDA 5FO7B 3J26N 4QD2A 4I30A 2OPKA 2RS53 4XMIA 1OMIA 5KXCA 4JGZB 1SQ4A 2QE3A 4DPNA 3JBG2 1DQ4A 2BNMA 4AHYA 2HWD1 4Q4Y1 3WVJA 4XQ4A 3ZFGB 5IK5A 1QJY1 1S0CA 1X33A 4LO8A 1MZEA 4IEQA 3LZZA 4XOGA 2RS13 4LR4A 1BK1A 3WDTA 4C90A 1UW8A 1PK6B 3PVBB 1HLCA 1RUH1 5BPXA 1W2UA 1SBEA 1PO12 5CFCC 2RMU1 4LBMA 3ZSKA 4E2QA 3ASIA 1AR62 3UKNA 3U07A 4FTBA 2MHFA 4QQ2A 4YW3A 4NWWA 5A32B 1QJU1 1C8M3 5JZGA 4IEWA 3MICA 2A6VA 1J1LA 1H8TA 1HRV2 1DIWA 2YGLA 2BYVE 1QXPA 2P2KA 4LEJA 4Q4X1 3GHNA 5K9YA 4UXAA 4QX5A 5CG8A 5EJ3A 4YGDA 3ENRA 3SMHA 4P5HA 4EWAA 2JEMA 4M0HA 4AI0A 4YVSA 3DN7A 3TAYA 1TME3 3AYEA 1YLLA 4TLFA 3ZFFA 2NLRA 1XE7A 4PJYA 3SH5A 3GZTB 4HPKB 5F1RA 2B46X 2YMZA 2P3JA 2VW0A 3GNEA 2ET7A 2SLIA 5JI9A 3RYKA 4Q1RA 4AQTA 1PO11 4I09A 1IS3A 3AP4A 5FPZA 3BB6A 3SCHA 2PLV3 1J59A 4QPGB 4WM7A 3ZYPA 1HRV1 3ZDSA 5HI0A 4PIYA 3H9AA 2ZHLA 1HKDA 3ST7A 5CFDC 1C5IA 4JC1A 3ES4A 5E89A 2LTNA 4CP2A 2ERFA 3MW2A 3ZN6B 3EJKA 5L7OB 2K9ZA 2PHTA 2WFF1 3ACLA 2D3SA 2VQAA 3SCGA 3FZ3A 1VLNA 1RUI2 4AFMA 2A6ZA 4Q8KA 2LUWA 5T55A 4P9JA 3AP5A 3N3HA 1LB2A 5IK4A 2HWC1 2VMGA 4AVAA 2PHXA 2HWF3 4KG0A 3RSJA 1O5UA 1PNFA 3MPPG 2XB6C 3VBOC 5BNOC 1KDMA 1SCRA 1CONA 1MS5A 4CEWA 2A70A 3IN9A 1MQTB 2TEPA 4GQ7A 3D8CA 2BVVA 4KU7A 1DQ0A 3ELNA 3IKWA 3AKTA 4JTNA 2GALA 4N43C 2PTMA 4QM9A 2ZHMA 2PYTA 2RM22 3KB5A 1PGSA 3GBGA 2YPJA 1Y3TA 4Y26A 3NSTA 5J98B 4JQRA 5K0UA 4QPIB 3JCIA 4MZUA 4P9IA 1UU6A 1QQP3 4AGGA 2A5ZA 2D6OX 2GSYA 1RUI1 4WM8C 4XMAA 1C3HA 3VKFC 1WCSA 1D2QA 2X29A 4E4DX 4AE2A 4SBVA 1BBT2 5JOZA 4FPGA 1W6PB 1DGRN 2R072 4IEZA 3ZIWA 1B35C 3FUQA 2R0HA 4PIXA 1D4VB 3V0AA 2JG8C 2ZS6B 3I4IA 1NCRB 3M7AA 4FXGB 3OBRA 4E2SA 2ZAAA 4I2OA 2GNDA 3B02A 3MIGA 3JBG3 3PJQA 5IUQA 4C1XA 1R082 3I59B 4FPCA 2AR6A 5CB7A 3GBFA 5CFCA 4KU8A 4ES9A 1YHFA 1MZ5A 2CNAA 1AHSA 4H7MA 4OUMA 2Q5TA 4FPOB 4A7ZA 2V73A 5AC91 4WVZA 4ATFA 2D43A 1S0JA 1ULGA 4LUKA 1A3KA 5JOYA 3AZZA 5KC6A 1I3HA 1H9PA 1AR63 3ZMOA 3MIDA 2UWBA 5EYYA 3NL1A 4B8EA 5LEJA 2ZBJA 2ZGKA 3N7KA 3OGJA 5JIAA 4AYUA 2ZHNA 3OY8A 4AHWA 1AVBA 1YXWA 1MZFA 2I2SA 2A3XA 2A75A 1PVC2 1GZCA 1OHFA 1VBD2 2D6KA 4OULA 1B09A 3TRSB 3VKMA 5ACA3 5FPXA 5T3NA 1AR81 3J4UH 4YW5A 1C8NA 2YC0A 3OTFA 1ULCA 5IK8A 2R041 2GC1A 4AEJA 3ZXFA 2DUPA 1POV3 3DPRB 4S2FA 2EXKA 1N3PA 1W6QB 2W08A 1SBDA 5CFDA 3THTA 4B3NA 4ZXKA 5BNPC 3E97A 3ZSJA 1X36A 2UWCA 1S0EA 1BEV3 1PZ8A 3MYXA 5H9QA 2VY0A 4FQ4A 4QGLA 3WQ7A 3V56A 1LENA 5LRSA 2EALA 2XLAA 1PVC1 2ETEA 1NY72 2R32A 2ZPXA 5T5LA 3AMNA 3H7YA 3BODA 3ZYJB 4CP1A 4DXZA 3N36A 5DG1A 3ZYRA 3B69A 1Q56A 4MGZE 4EN7B 1Q5OA 1H1IA 1ZZ6A 1LHVA 3AM2A 1J58A 3VDDC 4FP3A 4Q1PA 2DCJA 3VBOA 5BNOA 1LJ7A 1ZZ9A 1COV3 1RINA 4Q0UA 2CAUA 4H7LA 1ZX5A 2PHFA 3CJXA 3S7IA 1H2LA 2ATFA 3NV1A 4YZ5A 3AZVA 3RJ2X 1Z7S1 1AJOA 3CU7A 1XU1A 4U2AA 3ZFEC 5J7MA 5GZEA 2GMMA 2CGNA 4N43A 2ZX1A 2BPA2 4PCRA 2CYFA 5T52A 5HCAA 2Y38A 2ZJCA 1APNA 4DFSA 5DDJ2 1V6JA 1OI6A 4HLTA 1G9CA 4N9HA 4EN8B 3O7OA 1UZZA 2ZMNA 1VAVA 1IQAA 1MS0A 1DQ2A 5E16A 4HZFA 4C0HA 1DLLA 4UBGA 4Q4W3 4WM8A 3VZKA 4L11A 1YWKA 2CTVA 2RM23 3E6DA 3FHIB 1QH6A 3UJQA 5LK7B 1OOPB 3WG4A 2ZZQA 4HSLA 1BZWA 4AVCA 1B35A 1FYUA 3FJSA 2VOXA 2JG8A 1ND2C 4N53B 1AYM2 1YUDA 3AXEA 4HANA 3HIFA 1RMU1 2C5DA 5EYXA 1BBT3 1UMZA 2P17A 3R4DB 1FAYA 1O5LA 2R073 5KXDA 2VOVA 3AJYA 4P9LA 1NOVA 4G4FA 2BW8A 2Z2SB 3CF6E 2EXHA 2VUAA 3A0KA 3ZYIB 1JH5A 1QOSA 1XNBA 4IEXA 2XGXA 5DDJ1 3ZXDA 1GKBA 3PVNA 4HVOA 1QHDA 1R083 3FLPA 2E63A 5GLWA 2Y26A 1CPMA 3TN92 1FNYA 3AMMA 1ZRCA 1DGWA 3E6BA 1O3RA 2O8OA 2DVGA 4I3GA 1U5XA 5K7PA 1XNKA 2D97A 4LTAA 1VBE2 2TNFA 1SFNA 2WZR2 3POSA 5AVPA 4YG6A 2ZX3A 1QXRA 1VBB1 5KWRA 3QBQA 2BWAA 4FBFA 1LRHA 3ECQA 4YM3A 2PHLA 1PZ9A 4OHVA 1N1SA 1AR91 1LOGA 5D8AC 2AGSA 4LHKA 4RA0A 1RJ7A 1U5YA 3E5UA 3KZ4C 4FVVA 4KGGA 1OKQA 5DUXA 1X50A 3L2YA 1VBD3 1S0FA 3MZHA 3VBFC 4WVWA 3NAPB 1SCSA 3AFKA 3WXPA