4CP0A

Crystal structure of epithelial adhesin 9 a domain (epa9a) from candida glabrata in complex with lactose
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
250
structure length
219
Chain Sequence
AHYPRPEGCSSPPNAVSVGLHMDLYNYPYLYVKQCWNPEYQDPNFPRYGYKKYGSFGSSDHVNGKISWDHNEFKEGCKPIMARLPTAYNYPAKITFSNFTMVLSGYFKPKSTGLYKFEIHADDFILFNFGSKNAFECCNREESIDNFGPYVAYAMWPNEADQELEVYLFEDSYYPIRLFYNNRDYHSKFMVGFYPPNTEEITYDFDGYLYMLDDTGNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords EPITHELIAL ADHESIN 9
publication title The Structure and Function of the Epithelial Adhesins (Working)
rcsb
source organism Candida glabrata
total genus 61
structure length 219
sequence length 250
ec nomenclature
pdb deposition date 2014-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10528 GLEYA GLEYA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4cp0A00
4AFCA 4CP0A 4CP1A 4AI0A 4AFBA 4ASLA 5A3LA 4AHYA 2XJQA 4A3XA 4LHKA 4AFAA 4COYA 2XJUA 4COVA 4AHZA 4COZA 4D3WA 4AI2A 2XJTA 4AF9A 5A3MA 4AI1A 4CP2A 4AI3A 2XJSA 4COUA 4COWA 4AHXA 2XJRA 2XJPA 2XJVA 4GQ7A 4AHWA 4LHLA 4LHNA
chains in the Genus database with same CATH superfamily
1TMF3 3PL0A 4F7ZA 2Q1MA 4NHLA 1HX6A 1G9FA 4ISRA 3RMXA 5HBAA 5JOXA 1Q8SA 4D8MA 2EIBA 4QQOA 1DF0A 5LBBA 1RUH2 2PTMA 3T08A 4JHZA 2Q8OA 1CZVA 1QJY1 1AYM3 4KNCA 4XJ8A 1U5YA 3WF0A 1UKGA 4IEZA 1JZ4A 4RS5A 4MXVA 1G9CA 4N7IA 2EICA 2YDEA 1LOFA 3AMMA 5BPXA 5IHRA 1DP0A 4YVWB 2QBXA 4AI3A 1POV1 3N9PA 4GWJA 3RRDA 2Q30A 2UWAA 2GC1A 2IC1A 5BNOB 4QHZA 1W04A 4LBQB 3TB0A 1IQAA 2H6CA 1TG7A 2JE9A 4NROA 4Y1YA 5A80A 2ZZQA 4H3WA 4C91A 5H9PA 1MVEA 4N43B 4XFAA 4HKLA 2PHFA 2WN2A 4FPLA 4MYEA 4AI9A 4AVSA 3BGAA 4BQ3A 4JVAA 4K9SA 4RSUA 4LOTA 2J42A 3Q8AA 2OXBA 2Y38A 1W8WA 2XL9A 4LEJA 4NR1A 1JYVA 1D2QA 3KLSA 3V64A 3T2PA 3O0WA 4IV1A 4IXLA 3KS7A 4KQ7A 5HV0A 3ACHA 2EIDA 1ZZ6A 1UOJA 3BU7A 4I3PA 3R4UA 2D5HA 4LLOA 1WKYA 4AHXA 1H8TC 1ULPA 3USSA 3CJIB 3VZKA 3THDA 1BBT3 4MOAA 4CPBD 5IVCA 5FYZA 4FSJA 4XZPA 1GZWB 3HBZA 3J7LA 3ON7A 2D7FA 4UFKA 3U07A 3I2FA 4E8CA 2RS11 2ZGPA 2AR6A 4MGYE 2XLGA 4XILA 3AXEA 2ZABA 3GCXA 4HN0A 3AFKA 4PIZA 2JG8C 3WVJA 1VR3A 1O3QA 2Z2SB 4A41A 1CAXB 1TME3 3A4UA 5F2WA 1V9U2 1RJ8A 3ZXGA 2ET1A 3VZJA 4JRLA 2D6KA 4FFIA 4JKKA 1QJY3 4XDPA 1OFSA 3WQ0A 3FJSA 3K48A 5FZMA 1F5JA 1TE1B 2F6BA 3OG2A 4ARXA 4CVUA 4UF0A 4DUWA 4NAMA 2R49A 2Y6GA 1YLLA 3H42B 4FPEA 4QKNA 2RR11 2TBVA 5FYTA 3MFCA 5FZLA 2MEV3 2WUHA 5E8AA 3UV9A 4XJUA 3RI9A 1H30A 3D82A 4Y26A 4OYUA 4CDXA 1RUI2 1LESA 5J98B 1L7LA 1MS4A 4AGRA 5F6LB 4A3ZA 5L73A 3SMHA 2AUYA 2H0BA 3FLPA 5JI7A 1Z7S1 3H8OA 2W87A 4A7ZA 1HLCA 5DN2A 2FQPA 1DLCA 5E6HA 5E16A 2JDNA 3SEPA 1VBB2 2Y33A 3N9QA 4XTMA 1G9AA 3OYWB 3IMNA 5BXXA 4L2NA 1S2KA 5DDJ1 1JN2P 4BQYA 1ND3A 3ETPA 4UFHA 3WG1A 2CDPA 1AX1A 2DBNA 2OQ6A 2QQLA 2WNVA 4ZXKA 3UT0A 1VBA3 2JDUA 3WV6A 4Q4Y1 1LENA 4J6GA 1VBC2 4L8QA 2F4PA 4GD4A 4HONA 1UU6A 2GP3A 3O5SA 1GQHA 2CGOA 5BV6A 2QFEA 2W3JA 2WN3A 4W65A 1CQ9A 5FXVA 1VAVA 4BXSV 3BTAA 4TTGA 2R1DA 2VMDA 3OGGA 1C1FA 4AI2A 1DQ2A 1DG6A 4XTPA 2DCKA 3KCXA 3IWZA 2UY8A 4NE9A 1SPPA 2OUJA 4NIGA 4QDSA 2YV8A 4I30A 3MW4A 4PQ9A 5DZEA 3UYJA 4A6OA 1PMHX 3VBHB 4HSLA 4LHNA 1UYZA 4LMFA 2A3XA 2A6YA 4GULA 5DAVA 5EP9A 4FAHA 3GALA 3ECQA 3OGVA 3SXWA 1D4M3 2WNUC 2W95A 2QCSB 3JBG1 4URAA 3KSCA 5KHGA 5A6ZA 1N3QA 1G9BA 1WCSA 2RR13 2WL1A 3AFGA 3A21A 4NHXA 2R32A 4W4ZA 1O59A 1ULOA 3HNYM 5A7PA 3A7QA 1IS4A 1POV0 1W2OA 3D5OA 4AI8A 1LHVA 1CJPA 4H7MA 2Q8CA 2XLFA 1IKPA 4ZU5A 2ZKNA 1X8EA 4GH4A 3THTA 3OTFA 1HRI1 1OVPA 1NCRB 1VB4A 1Z7S3 2NMOA 2VUDA 3A23A 4QX0A 2OYZA 5DXDA 2ZMLA 1WCQA 2VZOA 3ES1A 3KZ4C 2B45X 3ZFEA 2B4KA 5L7OA 1H8TB 5JVVA 2HH9A 5I0RA 1VPHA 4OHXA 3MUZ1 1MS5A 1G6NA 4FI9A 5T54A 4HOOA 2BOJA 1OH3A 4XF9A 4WZFA 2NZ9A 3LGRA 4OHZA 5KHIA 2AEYA 1VE0A 1D4VB 1ZZ7A 2D93A 1QNYA 2J1VA 4TWTA 4DEQA 2ZXQA 1O8SA 4B1LA 2QQKA 1PX4A 2HLEA 2E33A 3N7KA 4IE6A 4OUSA 5IVYA 4CEYC 1DYKA 4CCNA 3O1OA 1D2SA 2JDYA 3D0SA 3FN9A 1RUD3 4JGZA 1VBE3 4YGEA 5BY5A 1W9YA 2QUOA 2R073 3D0JA 2BDRA 3FBYA 3NNGA 4ZS3A 4BQXA 1T6BX 1JBCA 1GICA 3SCGA 2WNEA 1W9SA 2W92A 3KM5A 4KMQA 4YFZA 1JZ6A 4RN5A 1WW4A 5GLVA 2HWC2 3AMNA 4CP1A 4QHBA 4NIDA 1WD4A 4XFFA 5JDBA 1BEV2 4C0BA 5F37A 4Z8BA 4P9JA 4AHYA 2GNTA 2A6ZA 4W50A 2P4EA 1XE7A 3GZTB 2WDBA 4HXCA 2P1BA 2QQWA 4DUXA 3KV5A 3JBG3 5FBJA 4LBQD 1O4YA 2PMWB 2R1BA 3WDYA 2B46X 4Q0VA 4FPHA 3RJRA 1QH7A 1YQ8A 3T4VA 1CONA 2BFUL 4K3UA 3AP4A 1TVGA 3VBUC 1GU3A 1AX0A 4RD7A 2WS92 4LO5B 1XYNA 2WSVA 1XQNA 5CFDC 3K4DA 1R091 4NHMA 4GAZA 1OOPA 3CZJA 5C8WA 1RJ7A 3BI3A 1G86A 1HRI3 5FYUA 3ILFA 4UFJA 1WCKA 1JYCA 1W8TA 1NT0A 5FZGA 2EXKA 2NP0A 5AC91 1NAEA 4XXPA 4K6BA 4RHV1 2G19A 3AL5A 2ZX3A 1WUVA 1S1AA 2A3YA 3HMYA 1IOAA 2YBKA 3RWKX 4F83A 1YI9A 3EJKA 3K2OA 1B35A 1O6UA 1RUC1 5CISA 1RL3A 2JB8A 5IK5A 4AQ2A 1UYXA 4EQVA 2W39A 3RZMA 2JG9B 1VRH3 1WLDA 2YC2A 3M2MA 5C5UA 1R64A 1DU3D 4FOQA 3VBOC 1BZWA 3AJZA 3IPVB 3DKWA 2C9KA 3AKRA 4AW7A 5C3RA 2UURA 5LA1A 3MFAA 3K75B 1QJX2 2VMGA 5FUNA 1FOD1 5AVAA 4K40A 1TNRA 4LPLA 4R9BA 2D3PA 1UXXX 1JYXA 4CUAA 3R4DB 2XHNA 4Q1PA 5KWRA 1BXHA 3B5LB 3Q8EA 1NZIA 4IE0A 5GZFA 2W47A 2LW8A 2VPVA 4O9GA 4XIKA 1RB8G 3WDXA 4AL9A 1X7NA 1LRHA 3J8F1 3BIEA 1LODA 4IEQA 4WVMA 1CZSA 4IV3A 3ETQA 5LRSA 3I59B 5JOYA 2QJVA 1JUHA 4AEMA 2IXLA 2FZ2A 2DF7A 3W21A 4E2QA 1LEDA 4A42A 3I2IA 2JDAA 2Y34A 3NWKA 1TMF2 3WNNA 4DRRA 4LO8A 4OVEA 1MEC1 5ANQA 5H9SA 4F3JA 4DUVA 4CXYA 4BPZA 3DYOA 4KWLA 4Y24A 4BHPA 4FOYA 4BLJA 2JJ6A 3WNXA 2PLV1 2VM9A 2Z79A 4XFCA 5FY5A 2BERA 3SLIA 1N1TA 3LA2A 4Z2AA 2HWF1 4DIQA 1O5UA 5FJKA 2DVAA 1YIPA 5FJHA 2XQRA 2P6HA 4FXKB 3C7FA 3UJQA 5FP3A 1W8NA 4LK6A 4WM8C 2XWBB 4RHV3 1MS8A 2HJIA 3OUHA 4LA2A 4Q0PA 3AC0A 4YW2A 2E26A 3JD71 4ET7A 4M4PA 2VQAA 1UU5A 3GCWA 2YC4A 4NRPA 5DAPA 1RUC3 3QH6A 3WX5A 3W9AA 3EHKA 4GB32 3HEIA 3P5BA 1GV9A 1KS5A 5FDBA 2H0VA 2CAVA 2WFF1 4FPFA 3I49A 1PNGA 4NVPA 4PCRA 3BN6A 3ZXAC 4CEYB 5A6XA 1RUF1 3HN3A 1XU1A 2CU5A 2YGLA 5IK8A 3VZMA 1JOPA 2GZWA 3HQRA 4LULA 1J83A 4IESA 5JOZA 5DAWA 1DCSA 5FK8A 1PM4A 1QDCA 1V9U1 5LEJA 1RUH3 4W6XA 4YM0A 1AR92 4FQ4A 4CCKA 4FPKA 3BTYA 3N9LA 3ZDVA 3HIFA 3VHRA 1CAWA 3DL3A 1LGNA 3KGZA 1BMV1 2DU1A 4OI0A 2OZJA 1IPKA 3O1UA 1KDMA 1AR62 2VJXA 2Y6KA 1RUI1 2RDSA 1Y9QA 2VZRA 3A0NA 4XABA 5J96B 2ZX0A 2YBPA 1SEFA 2H6BA 4XQDA 1W99A 1JZ2A 1LAJA 4LA3A 3U37A 4K1YA 2XGXA 5FZ4A 3RWNA 1OI6A 3UJOA 3RI8A 1I3HA 4LIVA 5CFDB 1VBB1 3TN92 1UX7A 2WAOA 5CZKA 2PAKA 3ZR5A 5IVVA 3EB7A 2X5IA 3NNMA 2B42B 5KXCA 1VB2A 1LULA 4QXBA 1FMD2 1KQRA 1KXGA 5FO7B 4DNYA 1O4ZA 1C4RA 1A8DA 2IXJA 4KG0A 3MZHA 5DAQA 4CCLA 1IKQA 3M1HA 3OUJA 1D0GA 4FXGB 2PQQA 2AACA 3I3DA 3H7JA 1U0AA 3VL9A 2YYOA 2QQUA 3ZIWA 4S2GA 3VBOB 1DGRA 3FWEA 1PGW2 4J25A 1W6NB 2D3RA 2RS32 2XJQA 1KRIA 3RZGA 1ZYBA 4YW4A 1WZXA 5CKNA 4GJYA 1DIWA 1QF3A 4K8FA 4MXWB 4BCUA 2ZGQA 3NV1A 4QAWA 2BBAA 4AQSA 1GWLA 2C26A 4WBBA 3WF1A 1SDWA 2JECA 2ZEWA 2MPFA 4Q0SA 1V9U3 3NV4A 2YMZA 4Y5Z0 1REDA 3RZKA 4TLFA 1UYPA 5ABJC 3DECA 2RMU1 1X82A 1OF4A 2W1QA 1ZVFA 4N53C 3PIJA 4MGZE 4A45A 5EHDA 3SKVA 3CMGA 4RGGA 3M3CA 3WW2A 4CDWC 4DXZA 3MV01 3CDZB 1RUI3 4GZ9A 2D6LX 2GC3A 4IE4A 3ENRA 4XHXA 1RUOA 1XNKA 4R52A 1PIV2 5IFPA 1C8M1 4IUGA 3KHBA 4I09A 2RM21 2XOMA 3MEPA 4GKYA 4DZGA 3BUCA 4IGPA 1VBB3 5LK5A 3X29B 4P14A 2JKBA 4XJ9A 4IW3A 2FBEA 1GOGA 2XDVA 4QQLA 5C7GA 3GXUA 1YQ2A 2ORXA 2WYFA 2YB7A 1I6XA 1XNBA 4LORA 3ILRA 3K3OA 4B7KA 1F9KA 2FDFA 1PGL2 3JQWA 5FLJA 2DU0A 3HNMA 4AFBA 3RPQA 4ARYA 4QB6A 4XE9A 5C6CA 2RVAA 2WWSA 3POIA 1VBC3 2PHWA 2ZHLA 2VMHA 2YPJA 1LHOA 4WM7C 1OUXA 1QJZA 3FHAA 4ONUA 5B4XA 2ZAAA 4DEVA 3CF6E 5AFBA 3NAPA 1WLCA 5KBFA 3WG3A 1MVQA 1SBEA 3D3AA 1UIJA 2CHHA 3FMGA 1ZBA2 5FBZA 3ZXFA 2EVXA 3ZX7A 3WDWA 3RS6A 1WCUA 4ZPIA 2Q8DA 2HWC1 2RJ2A 1KFXL 3ABZA 1LU1A 1W6OB 2P6CA 2WIIB 4YYOA 1LB2A 4Y4RA 2D44A 3VB9A 1SACA 1YXWA 2EXJA 2PAMA 4QPGA 4XFIA 3ZLIA 3O0XA 3JZVA 3MIGA 3LPFA 5FLHA 2K0GA 4LT5A 4CE8A 2A70A 3MV11 4PQQA 1JI6A 1YHFA 5A32A 2WR9A 1W3XA 1XPWA 3ZYBA 2B9UA 2Y60A 1WW7A 3H3ZA 3PU8A 4E4HA 1H6YA 1NLQA 1YFYA 3I97A 2V4VA 5DG1A 5FXXA 2A1XA 2VW2A 3GBGA 1HIXA 1PO22 4YFWA 1FXZA 3LEMA 4NRMA 4ASKA 1A78A 5DUVA 4O9EA 5EYXA 3T2TA 4K1ZA 2KXLA 4CU9A 3K77A 3ZSEA 5BNQA 4BQ2A 1RUE2 2VW1A 2CWMA 4NIAA 5JR2A 3TEWA 3VV1A 5FYCA 4DOUA 5FY1A 5FK7A 5C8CA 3ORJA 4YGDA 2A71A 4AVBA 4EZ4A 4A7KA 4X6RB 4YZ1A 2FDKA 2XPJA 4FFFA 3G6JB 4GMP1 4FTEA 1SFYA 2EALA 2R062 4UBHA 3PIGA 1FATA 3WT3A 4EV0A 1UPIA 3P6BA 1JU4A 2WNVB 4TXWA 5IK4A 2RJLA 3B7MA 1PM7A 3GZUC 4GJZA 4D0QA 5BNNC 1S0GA 1QJX1 4FO9A 1AJKA 3H1YA 3LEIA 3QD6A 1LU2A 2HEWF 1S0JA 3NO8A 3N35A 4N43C 2Y0IA 4XOGA 3UKTA 2VGDA 4GA9A 1JYNA 1BCXA 3AKQA 3VD5A 3ZR6A 5F5AA 5C3QA 5FV3A 2VH9A 2B8MA 3MPBA 4K7JA 3F95A 4OQ9A 3VZOA 5A70A 2ZGLA 4IGOA 3AJYA 5ABJB 2VE1A 2HWC3 2EXIA 1OPMA 5E88A 1SPPB 1YJLA 1BEV3 4N53B 3PHMA 1ULDA 4QGNA 4OI1A 3V0AA 3V56A 1RUNA 4AHZA 3KV4A 3WP6A 4UFIA 3H8XA 1H1MA 3VBSC 1IS3A 5ANNA 1YCIA 1LOBA 1K3IA 2J1TA 1OLRA 4Y33A 5FUPA 1VRH2 5FPBA 3WP3A 4CDWB 3R6SA 2WWJA 1TMF1 2SLIA 5CKQA 3L2YA 5LBEA 3GBFA 2GN3A 2GU9A 2XQXA 2BVBA 4FBFA 4K21A 1V00A 4N9IA 3VDBA 5AFEA 4M3CF 2WS93 4PBPA 3NJVA 2AEZA 3BIWE 1R1A2 2DCJA 3LCPA 1UO9A 3K4ZA 2WC2A 2VBDA 3MPPG 3N9NA 1QIQA 1OQ1A 5BNPC 1C8NA 3POFA 4M0NA 5A3LA 4EN7B 1PK6A 1ZA7A 3PTRB 3J4UH 3MW3A 4BQ1A 1RUJ2 5C5TA 2DVBA 5I93A 3VN4A 1AR82 1JODA 1QQP2 3VDCA 1UX6A 4NWVA 3POYA 1DQ0A 3QCWA 1S2EA 4AQ6A 1JOBA 4GB31 1WA4A 4MX3A 1AR72 4WM7B 3NW4A 5FZOB 1COV2 3IAPA 1JZ8A 2YU1A 1IS5A 2VU9A 1ZRDA 4L97A 1O3SA 5F7UA 4XDOA 5FY8A 2JE7A 4BB3A 3JQXA 2E7AA 1QJX3 3NJZA 1YFWA 3WNLA 1UAIA 5ISLA 4QGMA 4Q4X2 4XUTA 1YRZA 4HKWA 4ZY9A 1W8HA 4UFLA 4I3GA 5F32A 4QXCA 2I45A 4QU2A 2BNNA 2BNMA 4LQRA 1ZRFA 3NQHA 2D6MA 4CEWC 2JD9A 4M4RA 2ZZJA 1W6QA 5EIYB 5LY1A 4FCAA 1KDKA 3WINE 4L0PA 1BBT1 3LOIA 1S0CA 4PT6A 2O8OA 5JPNB 1NA1A 3TBDA 2Y0OA 3ZFFC 1NY72 1NOVA 5FIXA 5LA9A 2NM1A 3M3QA 3FHIB 5GZEA 3PUSA 2D40A 3D6EA 5T3NA 1QXRA 3SITA 1V6OA 4Y3OA 5F3EA 1OLQA 1PNFA 1MS3A 1OPOA 3FFZA 3TN91 4XQ4A 1OD3A 2QQNA 4AWDA 4MGSA 1TME1 2HBTA 2XBO2 4IEXA 5T50A 3THCA 2W52A 4OHWA 3RZLA 2WKKA 5HXMA 1FMD1 5EXOA 4XPVA 1QY4A 4XAEA 4DFSA 5EFUA 3KF5A 3VBHC 3T4HB 5LWBA 4HVQA 1K5MC 1YI7A 2MEV1 2C0ZA 4KGQA 1H2KA 2Z42A 4UW4A 4MHRA 4OI4A 4UBGA 1UY0A 1ZRRA 3U75A 2Q1ZB 1DGLA 2HYKA 2XXZA 4GWNA 1EV12 4HPKB 4GB33 5BNNB 4YG3A 2RS31 4PIXA 3USUB 2QQOA 4XBLA 4GMP0 4AI0A 1D7PM 3VDDA 1RC6A 2Q1FA 5K0UC 1D0HA 1E5IA 4I01A 1WMEA 4XW3A 5DZGA 3WHUA 1QJU2 4U36A 5FQ0A 3THPA 3MLLA 1WW6A 4NHYA 1NCRC 2JE8A 4L11A 4CZSA 5LRRA 2PA7A 3T2OA 1AR93 2GN7A 2RDQA 4I0AA 5BYNA 5T52A 3VBRC 2W5FA 5EWSA 1E5HA 4Y22A 4IE7A 1QKQA 1VBA1 4ZU4A 3U10A 3ZYHA 1PVXA 4LUMA 3VBSB 1AR63 1CAUB 4CP9B 4S2DA 1CAVA 1MS9A 3MUY1 4RGKA 1ZBE2 2EF6A 2Z4FA 2XVGA 4BJ0A 4D69A 4EROA 4MADA 3IBMA 4M3CE 1XNDA 3SC7X 4F8AA 4PF1A 4JGYA 1WD3A 1I9RA 5M0TA 3WNPA 1GZCA 3N9OA 1REFA 2A7AA 4Q0QA 4CDUC 1ZA4A 3TN93 1KGYA 2ZGSA 4DB5A 4Q0UA 2ID4A 4XMIA 5BNPB 1GOHA 2WO1A 4AGGA 4XHBA 2Z5WA 1W8FA 1AL0G 4XUPA 1D4M1 1MS0A 2YGMA 1PMIA 1FMD3 3I7DA 4XF4A 2VR4A 1IHMA 3WLUA 3ZPOA 4CUGA 1PGL1 4G4FA 1EYBA 5A1AA 1FYUA 2ZGRA 5JZGA 3W5NA 4IERA 4U2AA 1PVC2 4KG8A 2G1MA 3RDIA 2DCZA 2YZ4A 4Z07A 4D7SA 4RQPC 3VL8A 1QHDA 1O3TA 3ZFGA 4AGVA 4JCKA 4B4PA 2W0XA 2RS33 4M3CB 3O1TA 2VOVA 1JH5A 3E5UA 1JW6A 1JYTA 4UW6A 2QQJA 3FHQA 1S0FA 2HWB2 3DPRC 2WWUA 4BOWA 4CPBA 5F9TA 4COWA 5FZCA 4CEWB 4CU8A 1X36A 1WW5A 3PVNA 3ZXEA 4YGCA 3VD7A 2CDOA 3VZLA 2PHXA 1FX5A 4XBQA 4LBJA 4OI2A 2WZ8A 3VBFA 4RYDA 1AVBA 1N3PA 3H7YA 4WV8A 2Y8KA 1IS6A 4XURA 1AXYA 4LKEA 4W8JA 3E1F1 4FPOB 3ZFFB 1Y9MA 4LBLA 2ATFA 1APNA 2JG9C 4LKFA 3LA7A 5FKCA 3WZ1A 4E27A 2HYXA 1PIV3 1RIRA 4COZA 5C4WA 1Q8OA 1PO21 3T1MA 1QEXA 4UW5A 1RUD1 3TEXA 1VBE1 3TRSB 4C1XA 2VD7A 2R071 4EE2A 1WWYA 2TEPA 4XCAA 1RUE1 1QOTA 3QOPA 4CYDA 1ND2A 2I2SA 1XSRA 5CFCA 4QPIA 5FP8A 4BMEA 2WYSA 1MZ5A 5L9RA 4JDMA 2UWCA 4LO4B 2JD4A 4BIOA 4PDWA 2K46A 2X5IB 2QNKA 1K5MB 1STMA 3LEKA 5JR7B 5C9AC 2PFWA 4CCJA 3ZN6B 1W05A 1NCQC 1HQLA 3BCWA 3KCCA 3LDKA 5T5OA 2LUWA 4CCDA 1OT5A 1OC1A 1RHI2 3U0ZA 4GALA 5FPAA 3IM0A 1UOFA 4PIYA 3RFRA 3VKFC 5D8AC 4UYBA 3SISA 2Y64A 4JX0A 3GGLA 1ACCA 3IIAA 2ZHNA 5JSOA 3WD5A 4EWAA 5K0UB 3ILNA 5G05L 1ZBA3 3CQOA 1SLBA 2VMEA 4UWDA 1WGPA 4C90A 2DTWA 2ZX1A 3E5XA 1W2AX 2GNMA 2PHDA 3AMPA 3POJA 1W8UA 3K51A 5EPAA 1J3RA 3LDRA 3NNJA 5HCAA 3VBRB 2D5FA 2VW0A 2XKPA 5K4LA 2TUNA 2VBPA 1YQ6A 2HWE2 4QPYA 3TEZA 2AH2A 2B7YA 1JOJA 3RZJA 4OHYA 4XF1A 1VRH1 1XBFA 3GZEA 2JENA 1X9PA 3VKMA 1OURA 2J1AA 2OA2A 4Q2FA 3IT8A 4LKDA 1A34A 3AVRA 1UMIA 5JOWA 1REEA 1J1LA 4BU2A 4D94A 4JHTA 3AYDA 3WCSA 4IL7A 5BUVA 3T0BA 2R042 5FY4A 1VMJA 4CDUB 2R7EB 1PO23 4CUCA 3KV9A 1H2NA 5DUWA 1KD7A 1N47A 2I74A 1SLTA 1EY2A 1MPXA 1RUE3 2OT7A 3PMSA 1BK0A 4KBBA 3ELNA 2P3JA 4HN1A 3ZYGA 5A3UA 2QVSB 2AENA 2R0FA 4WZCA 1RUJ1 4YM3A 3LFMA 4P5YA 4DY3A 3OBAA 2IVIB 5ERLA 1ZRIA 1QQP1 3J7NA 3N9MA 3LAGA 4XC9A 3U1XA 2I07B 5A7WB 3ZSLA 1URXA 2R063 2ZX4A 3OGSA 5ACA2 4AAPA 4AF9A 3KVAA 1COV1 4YPJA 1V6MA 2DURA 1MQTA 2D6NA 4RQPB 4B1MA 2ILMA 3AKSA 4BLIA 2ERFA 1DGWA 4DY5A 5FZKA 2ENRA 2IFRA 4OQ8A 1NUKA 1WA6X 2W2IA 3S7IA 5HPOA 1W6PA 4Q4X1 3VKOA 1OLME 2FDHA 3WG4A 2K9ZA 4YVSA 2HKXA 3AP7A 3DPRB 2VMFA 1GP4A 5L9VA 4I0BA 3S5AA 2A75A 2DVGA 3RMYA 4B8EA 3ZO0B 1V6JA 5G04L 2L9LA 1DYOA 4ASLA 4D6SA 4QM8A 3IB3A 3OY8B 4NJ4A 4JQRA 3J7HA 1W0OA 1LR5A 5CBLA 1YQ5A 4N9HA 4PLMA 4Z2WA 1NY71 1F35A 1CN1A 1GMMA 3D8CA 4IEOA 4RR3C 1LHUA 1WMFA 4ORFA 3CIHA 2GMPA 2BZDA 4CCEA 4PI2A 5FY9A 2GMMA 1K45A 4HBNA 5A32B 5LB6A 3SEEA 3ZDSA 1UW8A 1W6MB 5EZWA 1J3QA 4LHLA 1PHMA 4EN6B 4QKBA 4YVWA 2XBO1 3ZXLA 1OMIA 1DZRA 3C2UA 4KGGA 1R1A3 1RUH1 4CDQC 4W6YA 3RGBA 5BNOA 5FZHA 2P17A 4BIFA 4UI9L 4CCOA 1XJAA 3N7LA 3FX3A 3OPTA 4FPCA 4LBQA 5GLWA 4IEYA 4AR2A 2QZ2A 3LSDA 3N4MA 5C9AB 4FPGA 3DUIA 3POWA 5K7PA 4HMZA 1RUJ3 3POSA 4JDNA 1NCQB 1LEMA 2X09A 4LIUA 4P5HA 4ATFA 4EN8B 1AR83 4AEDA 1QQP3 4RS5C 4XVHA 1AYN2 1EV11 3OPWA 3GHNA 1GR3A 1LOFC 2PELA 2ZGTA 3BOWA 2C9AA 5F5CA 1BYHA 1AR73 3B93A 5FPVA 5FYHA 1GP6A 2DUPA 1COV3 4L99A 1UY3A 2VNGA 1UIKA 4LNVA 5D8AB 2J1RA 3NV3A 4XXAA 5F6KA 3NV2A 4QM9A 1W8ZA 5FKBA 3PNAA 1W9WA 1CX4A 2W9XA 3PUAA 3BALA 2HWD2 1CVNA 1F4AA 4IEPA 4Q4X3 5JXGA 3VD4A 3CJIA 4QXKA 1NQDA 3LDBA 1H2MA 4XZUG 3GF6A 1GZWA 2XJTA 5CB7A 2KR2A 1S0IA 2DFBA 1EPZA 4IV1C 4ES8A 3KGLA 5FZDA 2XH6A 2QE3A 2XUEA 3N36A 2C6SA 4WVWA 4C1WA 3TEYA 3WNMA 3S6PA 3WDTA 1ST8A 1VALA 3JB8A 4KL1A 4LO6B 2VQTA 1CAXA 1LTEA 1E57A 3CLPA 3QLQA 5FZIA 2UY9A 1GP5A 3E5QA 2Q8EA 1PZ8A 1RTVA 3SKJE 5CA6A 1DZQA 2F17A 4D7YA 3ST7A 1DQ5A 5T55A 2XMLA 4LBNA 4A4AA 2P3YA 4KBZA 4AVCA 3KF3A 5LEKA 1LHNA 3C3VA 3U11A 1HN1A 3ITQA 3LIGA 2WQ4A 2XBO3 5JCTA 5FP4A 1RMU2 1GZTA 3I8TA 1GYKA 2WO3A 5CVRA 2EIEA 1JMUB 3AYCA 2Y6HA 2IZWA 5IAXA 4MGQA 1O5LA 2G9GA 3ME2A 4GWIA 4CUBA 4YZ2A 4FTSA 2BFUS 3LE0A 2WFPA 4Q5OA 1PVC1 3DF0A 1NLSA 1WLTA 4AHWA 2IXHA 3OGJA 4V1PA 4YNIA 2IXKA 1EV13 2WT1A 4IEWA 4MG2A 2P5BA 1HB4A 4KU8A 3WQ1A 1XYPA 1GQGA 3OYWA 3MO4A 4FP2A 4XF0A 4DMIA 3BYWA 3HT2A 5D1IA 1GLHA 1HB2A 1AUYA 1UZ0A 5A33B 4IDZA 3P3NA 1FPN2 4Y5TA 3URFA 1Q56A 4CDXC 4CU6A 1VAMA 2WA3A 5I8YA 2DFCA 2LRPA 4GXLA 2HWB1 1C1LA 2EA7A 1W8OA 1QJU3 3W59A 3UETA 1B09A 4CCCA 3TOJA 1FAYA 1HRV2 3LFIA 3MLKA 2R0HA 4QT6A 4P9YA 1QMJA 1SFNA 3GNEA 4JC1A 4UXAA 4FOVA 3EO6A 1SCRA 3ZYPA 3I3BA 2O1QA 4IETA 3ZXDA 3HQXA 4XMAA 3ZN4A 1DHKB 5FXWA 4DXTA 5J7MA 1JU3A 1VBC1 1ND3C 2RE9A 4HKOA 4RR3B 5F5QA 1ZBE3 2ARCA 3RYPA 2V09A 3ZIXA 4QPWA 2WNVC 5FZ8A 3OCPA 4DPNA 1GBGA 2VZTA 4BYYA 1OSGA 2WZR3 1GNHA 5FMCA 5FY7A 4Q26A 3FLRA 4YGBA 5JXIA 2XL7A 4CDQB 2VULA 3S57A 2C24A 3B01A 2JDZA 1WMDA 1YWKA 3O1SA 4QXHA 1Y3TA 4BISA 2E31A 4CXWA 4ATEA 2E7TA 5FUIA 1ALYA 3OUIA 5IK7A 1T2XA 2QQIA 2CNAA 3KV6A 1NYWA 2VC9A 1W2TA 4E4ZA 1FNYA 2QDNA 2ZGMA 2XB6C 1LCLA 5FYYA 4RS5B 2X8KA 3OOXA 1DQ6A 3WEZA 1Y7BA 2JKXA 5FYSA 3KCYA 4IEVA 4J1XA 2UYBA 1PVC3 1YEWA 2W1UA 5DMYA 4FFHA 5FPLA 1JZ3A 2LS6A 2Q0AA 1BLZA 1GZ9A 5L19A 5B2GB 4ISQA 5I0TA 2WO7A 4I0WB 5D2AA 5J1XA 5FTTC 1H8TA 3AXDA 4HT1T 2JIJA 1PZ7A 1N1SA 4O61A 3SQOA 5FZ3A 1W39A 1S4CA 3KQ4B 2HWB3 2KD7A 1UOBA 2PHUA 5GLUA 1Q5OA 2FMYA 1S0EA 3NJYA 2WSUA 2GAUA 4GH4C 3RNSA 4H7LA 1CZTA 2BOIA 4WVVA 4IV1B 3GYDA 2XR4A 5L7OC 3ZVXA 3ZFEC 1GNYA 1ZZBA 5I91A 2D6PA 2JG8A 2DCYA 5HCBA 4FTBA 4AG4A 2JX9A 5B4NA 3RZHA 2DBIA 2RS12 1OXCA 1L7QA 3P1IA 4FT8A 4INDA 4K8RB 4RA0A 4AK3A 4YM2A 1HQNA 1YFUA 3FC0A 4Y1XA 2LM3A 1CPMA 5D21A 2AZ5A 2W94A 4XFHA 4V2WA 2JICA 5EJ3A 5KR7A 2OKXA 4HK9A 1XE8A 3IDEA 1C5IA 2BU9A 4PLOA 5FR3A 3U4XA 5FMDA 2DTYA 2BWAA 1J1TA 4MHUA 2BGPA 3ZSMA 1BEV1 4JGZC 1YFXA 3CBNA 1MZ6A 4XETA 3WF4A 4E2SA 4R4XA 1NZCA 1UMHA 5FOBB 2ZKLA 3W58A 1RHI3 4QDQA 2V5DA 2EAAA 3H8UA 2VOTA 2ZGNA 3WQBA 1UQXA 4UF0B 5LZ6A 2FCVA 1P8JA 1ULEA 5F39A 4OHVA 3CZUA 1KITA 4B7EA 4R8HA 5JMOA 1C28A 5JWPA 5KXBA 1XNAA 5EV7A 5A7NA 4N8MA 2WS91 2DWRA 4CDXB 5FWJA 4BWOA 5A1LA 4HSJA 1WLWA 5FFOC 1YC61 3AYEA 3MI8A 3ZFGB 2BYVE 1VP6A 4QMAA 2VXJA 3FLTA 5DDJ2 5I8SA 3Q8BA 1F15A 1ENQA 2E53A 4LO7A 5CAZA 5CG8A 4QX7A 1LGBA 3GM8A 1SLCA 3ZYIB 1TEIA 3C7EA 4FFGA 4QX1A 1OOPC 3IPVA 1VAKA 3ACIA 4AZZA 2HWE3 1EP0A 4Q4Y2 1IQDC 2ORZA 5FLIA 1VMFA 4FP3A 5FOJB 1ND3B 3R4SA 4Y1ZA 3MIFA 4YWAA 1F31A 1GWKA 3LD8A 4MGKE 1NE4A 5JPMB 1B35C 1UZWA 5FYIA 5JXJA 5KHJA 3OGRA 3ZMOA 4BDVB 2G9FA 4CTEA 3KT7A 3WP5A 2DVFA 3QACA 4EWEA 1PO12 1RVF2 1KS4A 2R043 2WNUA 3H50A 1L7RA 4XYXA 2BNOA 1ENXA 4UT5A 5EYYA 1HJFA 3I59A 3C7HA 3G7DA 2ES3A 5A3NA 2ZAHA 2DUOA 4YRDA 1ND2B 3MDPA 3FL7A 5CFCB 2JWPA 3AMHA 5F1RA 3H1MA 4XBNA 4UAPA 4NWWA 1DBNA 1NXD1 3HD8B 5F2SA 4L92A 3OD4A 5K9YA 4NOTA 5ACA3 5T5LA 3DV8A 3EMRA 3WDVA 1H1IA 3KWVA 3CKHA 4P9LA 4CU7A 4IV3C 3SH5A 1ZRCA 3DN7A 1LJ7A 2ARXA 3BKZA 5KC6A 4Q27A 5L9BA 3AP9A 5JAXA 2VCMA 3UNPA 2IWGB 4QKFA 4ZZ8A 1K42A 2VTFA 1QXPA 1ZREA 4GH4B 3T1LA 4HG6B 1V0AA 2X05A 4A2UA 5FZ0A 1SMVA 3B00A 2DDUA 4QX3A 5KHHA 4XDQA 5L7OB 4AEJA 4CEYA 3ZFEB 4XACA 1F5FA 3EXUA 4R9DA 1HV1A 2VZ3A 1DYPA 2VZVA 2WRAA 1QNWA 3AL6A 5JIAA 3ZOIA 3UESA 2A73B 3AMQA 1FT9A 4FOWA 4MGTA 2YC0A 2VUCA 3ZN5A 3L2HA 2FDGA 1Q8VA 3NJXA 5FZFA 5FMOL 3ACGA 5C70A 2VQ0A 1XYOA 3ZXJA 4AEKA 5LBCA 2VOKA 3AZZA 3WW1A 3NNFA 3LQCA 1AR91 4AFMA 1XNCA 3JU9A 5A3MA 1UF2C 4JGZB 1NE6A 1CX1A 1CIYA 5C3SA 2CTVA 2GP5A 1G7YA 3MIEA 3M4FA 3LKJA 5FZAA 3VDAA 3VUOA 1S0BA 3VBUA 5FREA 4M00A 1AR61 1S2BA 3I2HA 5GJ6A 5LK7B 3BVCA 2ZPXA 3S5QA 2GMEA 1AYN3 5CFDA 5CYYA 3HQUA 1YQCA 5FO8B 3PMEA 4PBOA 2ZMKA 3FFQA 4Y1VA 3RVHA 1OFNA 3VHPA 4DXRA 3M70A 1FPN1 1UNBA 4MUVA 3OJBA 2BBVA 3RQ0A 1ZNPA 2UWBA 3TAYA 5SV8A 2J1UA 1R092 4PI0A 2HWD3 2VZSA 3OD0A 1MZEA 1POQA 1UYYA 2XVLA 1W9FA 4XAAA 5GZCA 1GANA 3CEWA 2XUMA 2ZTNA 3UK9A 4DXSA 1MS1A 1UZZA 3J26N 5AC92 1OUSA 1V70A 1JS9A 3R0RA 5FYBA 4CA9A 4XJZA 3WG2A 1QDOA 3P3PA 1LECA 1YNAA 3HN1A 4KWJA 4S2HA 3SH4A 3VBOA 2E9QA 5SV5A 1OOPB 1V6NA 2CSGA 5T5JA 1FI2A 1N1VA 1W6NA 2BQPA 2X5IC 5CEHA 3A0KA 1SZBA 3D4KA 1SBDA 2HEVF 3MF9A 1SLIA 4HLTA 5FP7A 3ZSJA 4MXWA 3HAGA 4BK5A 3MF6A 2PN5A 4QQ2A 1H9PA 2YG0A 2ZHKA 4N7UA 5FWEA 3WW4A 3DYPA 3T0DA 4QX2A 5GLZA 4Z82A 3S0MA 2IXCA 1B35B 1PGW1 2Y6LA 5I8TA 2FHRA 1FOD2 4OMCA 5FZ6A 3ZMNA 3FBMA 1ZZ8A 3NMBA 2CL2A 3AVSA 5J48A 1BHGA 2G9ZA 1ENSA 4IGQA 4M01A 4B4QA 1LGCA 2YFZA 3INAA 1RMU3 3VZNA 3NRUA 2ZMNA 1TQ5A 1I5ZA 5LA0A 3U4SA 3WNKA 3J8F2 1UMZA 5F3CA 2YROA 2ZEYA 4KH9A 1OD5A 2PHTA 3BTZA 5FYVA 4NRQA 1VMHA 4AOCA 3U78A 4Q8LA 2J1EA 1QOSA 4KI5M 2X29A 5J09A 4LHSA 5IAVA 1JYWA 3WW3A 1PIV1 4AEDB 4WVMB 4IV3B 3OEAA 1MEC2 4DO0A 1DQ4A 2WZR2 2VQUA 1CIWA 3WOGA 1FPN3 4WM8A 5LCWL 5C3OA 1CJDA 3AKPA 1VBD2 2AREA 2MNGA 1XB9A 2PLV2 3BB6A 3PVOA 3CJXA 4H14A 2RJKA 2VNOA 4HZFA 2HWF2 4QHOA 2RS52 4D6RA 2QZ3A 2ZEXA 1BVVA 1HRV3 1AF9A 4LBKA 3LF7A 4YZ3A 2W1WA 2ZA9A 3ZKYA 1PGSA 2ZEZA 3PUHA 3ZYJB 4E4SA 3H9AA 4QGLA 4TSVA 4ZHNA 3JD72 1SBFA 2VO5A 4IQPA 1K12A 5FMOS 3HT1A 3B94A 4R4ZA 3QBQA 2EXHA 2GNDA 2OIIA 2W91A 4Q4V2 2JDMA 3I2GA 1U12A 3V65A 1I1EA 1QJFA 1J59A 2WFF2 2SBAA 4L9BA 2ETEA 5IVFA 5EJ1B 5DABA 2FZ1A 1RUF2 1RXGA 1W6OA 2RDNA 3VD9A 3N3HA 4AE2A 1VIWB 1ZBA1 3IZOA 2YBSA 4B3NA 2OPKA 2BPA2 2Z69A 2WNOA 1N3OA 3BOPA 5HV4A 3WF2A 1ULFA 4CP2A 5IJRA 4O65A 1Z0HA 2VCCA 3NAPC 3PDQA 1ASJ2 1JTZX 2A6XA 5HCFA 2VZQA 2WLPA 1DGRN 4QX5A 2PHRA 4I02A 4GQ7A 4BMBA 4FQZA 2B9VA 5H9QA 1OA3A 1POV3 2WT2A 3UKNA 1BMV2 2IXIA 4NIIA 4YW1A 4ZONA 5FZBA 3OBRA 3OB8A 2VBBA 1E5SA 1X8MA 2NPIA 2ZS6B 2VTXJ 2YFUA 4ZKTB 3B69A 1VJ2A 4QPGC 1SHWB 4YZ5A 2E63A 1C3HA 1CAWB 2VZUA 1MZFA 1Y4WA 2HBUA 4LLFA 4COVA 5DUUA 2B5HA 2PXJA 2BWCA 2VY0A 2WZPP 3RYRA 2WLQA 2BW8A 2QQVA 3NKGA 4AVVA 1QU0A 5FP9A 4BZ4A 4XQWA 3MYXA 5JIUA 5CU1A 4PF5A 2Q4SA 3VHNA 4A6SA 1UPSA 4LBOA 3ASIA 2KA3A 1JZ5A 2IVJA 4OUMA 4R9CA 4RFT0 5A7QA 1UWWA 1CPNA 4G9SB 4NIHA 1JZ7A 1QOOA 4JKLA 4KWKA 4AQTA 5FRAA 3KVBA 1IZ3A 1NLRA 4E4DX 2R061 1O4TA 5I0DA 1EAH2 3JXSA 3PUIA 5IVJA 4JV4A 1OBNA 1J58A 2C4XA 3J7MA 4SLIA 2XG3A 5LASA 4A3XA 4O7XA 5C8CC 1A3KA 2QTWB 5IATA 3I2JA 3WP4A 3WDUA 1QWRA 1YIFA 2RS13 1Z78A 2FCUA 2VG9A 1XOYA 1IPJA 2ARAA 4XEZA 2BTVC 4YSFA 5ABJA 1PO11 1H0BA 1RVF1 2JDPA 5APAA 4CP9A 1SCSA 3I3EA 3OF1A 3HPNA 3HBKA 3GBWA 4N53A 5A3OA 1HJGA 2VECA 4RGAA 4ZU7A 1OKQA 5FO9B 4GIQA 2G4IA 4XF3A 4A7YA 3AZVA 3TNQA 4XJAA 4J1WA 3DEMA 4CDWA 2RMU2 3UGGA 2YXSA 3CHXA 2WJSA 5JSPA 1PX3A 3M7AA 3KB5A 3AP5A 1M4WA 1NG0A 5JUVA 2OX0A 3RJ2X 1V6LA 2XLAA 2BJSA 5C3PA 4LE3A 2CAUA 4E8DA 3RSJA 2ZGUA 4X8NA 2D3SA 3Q9OA 3HWJA 2VUAA 1YUDA 3KQRA 3S30A 1OF3A 4NUBA 3CNAA 5C33A 5JI9A 3ATGA 1C8M2 1ZX5A 2RM22 4CSWA 2UYAA 3OSDA 3T30A 4MV2A 4B4RA 2ARBA 5CKMA 3IDAA 4Y1UA 5CNAA 5KXEA 1VLNA 2VCBA 3ZPYA 3VD3A 2XJPA 2Y6JA 3VHOA 1R1A1 1UXZA 1XRUA 2P34A 1CD3G 5FMBA 1UN1A 4MSVA 2R16A 5EJZB 2AYHA 4NHKA 4TYSA 2J1SA 3JCIA 3EBRA 5FCCA 5DZFA 3UGHA 4QB1A 5DDJ3 3IIIA 4WM7A 5K8SA 5FZOA 1FV2A 4BQ5A 1U5XA 3DCQA 5GM0A 1AR81 3WXPA 2C5DA 1EUUA 2FMDA 2VAUA 2ZOEB 4LOSA 3LA3A 4EJRA 2Y26A 4Q4Y3 3FUQA 2E7QA 1PK6C 1AR71 2LALA 3GZAA 2XHKA 4LITA 1AXZA 1ODNA 3IAQA 4W6WA 5LA2A 1ULGA 3E97A 4Q4W2 2JG8B 1GNZA 1N1YA 3MIHA 4Y20A 4YW3A 3O1MA 3HR9A 5C71A 1KFUL 3I3MA 4CRQA 2ET7A 1PO13 1RVF3 1SQ4A 3AYAA 2K2SA 1NX9A 1Q8QA 1X9TA 3M3OA 5E89A 3NAPB 3GHMA 4AVTA 3IN9A 4M0HA 4BE3A 3PU3A 1NKGA 2V5YA 4EWDA 1OQDA 2GSYA 4YW5A 3N7JA 3TNPB 2A6WA 2IUWA 2RV9A 5FZEA 2W68A 4EYUA 3POGA 1AL22 1C57A 3OBTA 1CGPA 3M3EA 2V72A 3U14A 1R082 2R6QA 4H55A 4QPGB 4ITCA 5HI0A 1KJRA 4XCBA 1DQ1A 3R05A 4Q8KA 1GFF2 1NA1C 2A3WA 1W0NA 2D98A 2FCTA 2YU2A 3KT4A 1UKRA 3O14A 1OQEA 3Q8FA 4SBVA 3NSTA 3PTYA 4AYUA 4B29A 5I0UA 4D7TA 2NQYA 3AM2A 4HANA 4XUNA 2NYYA 2ZACA 5DUXA 1KJLA 1DLLA 2BP6A 4XUOA 2VOWA 3H3UA 1WBFA 1SLLA 3IKWA 1HB1A 2ZCWA 4HPKA 3VKNA 2DVDA 4LUKA 2GALA 4XFBA 1QGLA 3USUA 5BNNA 2JXAA 2O14A 3CO2A 2V73A 5FXZA 1J84A 4N43A 3LPGA 4HL0A 4KWUA 3KHCA 1AJOA 1CR7A 1HXS2 2Q5TA 5C8CB 4Z92B 4G3YC 2E51A 3H0OA 1U5IA 1DFQA 5T5PA 1RUG2 2AC1A 2P3KA 4YM1A 5KXDA 3EYPA 2VZPA 2GH8A 3B3QE 1IGOA 2VMCA 3IDBB 1RITA 4NO4A 4HVRA 1JYIA 2OUHA 3S7EA 4CP0A 4LK7A 3OBZA 1QJU1 2CV6A 1Q43A 4IEUA 5LY2A 3VBSA 2DCTA 1CAUA 1GWMA 2DV9A 2JDKA 2PQSA 2WNUB 1XE0A 3DKQA 3MGUA 4LKSA 3VDDC 1YYNA 1W2UA 5JLVA 1IG3A 4FAGA 1OVSA 1HB3A 1SLAA 4RL7A 2P3IA 4Z1VA 5KHKA 5EQUA 5IW0A 3RZZA 5GALA 2VTXA 4FPJA 5DG2A 1ZBE1 1W0PA 3AK0A 4H2AA 5A1FA 1RYYA 3V0AB 1MACA 4HFSA 5DQ0A 4JRAA 3SCFA 1S0DA 1OA2A 1W06A 5BNPA 3W20A 4P9GA 2VMIA 2WZR1 5A3TA 4UW3A 3B9IA 1UY2A 4E2GA 1VBD1 3K46A 3H8RA 4NPMA 5GZGA 3BU0A 4PLNA 1HN0A 1AYM2 1DGWX 1R093 3VGIA 2YHJA 2RS51 2QDRA 1WMXA 2PYTA 4JGYC 4YLZA 3PVBB 2RG4A 3OPZA 2EIGA 4JAAA 5AC93 1RINA 3H1WA 3GJBA 4QKDA 3WSOA 4BA6A 3NVCA 2TNFA 2XONA 1LKNA 1JHNA 1K5JA 4ES9A 1H8VA 5E1RA 2D6OX 4M3CA 5L36A 4OZXA 1LNSA 2JIGA 4Q4V1 3SHRA 3UGFA 4P00B 1IPSA 1PK6B 3I2DA 3W5MA 4XJWA 5CG9A 4QB2A 2KM2A 2ZJCA 3DXUA 3BTXA 3WF3A 4DS0A 3DXTA 3HVDA 2BGCA 4CEWA 5JZGC 5HXVA 4OZOA 1UL9A 1FOD3 2WABA 1ODMA 3H3LA 4LHKA 1OHFA 3K3NA 2DUQA 4COYA 4FVVA 1SFPA 5IVBA 5FY0A 5JXHA 1ULCA 4JDOA 3ZFGC 1ASJ1 3RG0A 4JQTA 5CIRA 2GH2A 1ZZCA 5H9RA 4AI1A 5I0SA 4OUEA 2N7GA 3Q8CA 3T3YA 3ZFFA 3TYJA 1BBT2 2J22A 1W28A 3C8XA 5FZ9A 2OZ6A 3BODA 1J3PA 3J8F3 5DAXA 3ZM8A 1H4HA 4DINB 3WUDA 3ZYFA 3HJRA 3ZSKA 1W6QB 1BKZA 4E9KA 2VUJA 3I54A 3DYMA 3I2KA 3VBUB 3O0VA 3PURA 3VBFC 5JMCA 4QU1A 2A6VA 3AZWA 2E6VA 4NAOA 1HW5A 1YO8A 4AAXA 3I2OA 1PMJX 1NA1B 1BQPA 1WBLA 3QH7A 1MEC3 5J3UA 3PLQA 3VBHA 5LATA 3V0BA 1K5MA 1GSLA 1TME2 4MGIE 4ZZ5A 1VBD3 2PLV3 3PUQA 1DZTA 3B9CA 3ZN6A 4TN7A 1QJY2 2HWF3 2BV4A 5C4WC 2OPWA 2VVDA 4CCMA 1H9WA 2RS53 5J37A 5A7SA 1W2NA 3ALQA 3TWIA 2MEV2 3LOBA 1EAH1 1ND2C 1QXJA 2D97A 1UU4A 2JDHA 1HV0A 2C1FA 5CFCC 2VOXA 4QPIC 3JD73 2WO2A 1RHI1 5K0UA 2QQMA 1RXFA 4X6QB 5FPZA 4JTNA 1JHJA 2CWSA 2OS2A 3PJQA 4NMIA 4PDWC 4Q4V3 4PHZA 1NCRA 2WFF3 1LOGA 3M8LA 4AFAA 2BEOA 4C8DA 3O1VA 4ZXEA 1RUF3 4AFDA 1TZOA 4LXLA 4S2FA 1UY1A 2BUKA 2VL4A 2ZX2A 3VBRA 4QD2A 3C7GA 2CGPA 1AX2A 3LZZA 1SDDB 2WINB 2RDRA 4C0HA 5F3GA 3VDDB 1ASJ3 2XJVA 5LBFA 2CGNA 5FQ0B 2PAEA 4TLGA 2HEYF 1VBA2 2X10A 2HWE1 4BXFA 2WA4A 5JSRA 1GKBA 3NNLA 2WQ8A 2W1SA 2JEMA 4YW6A 4IE5A 2VVEA 4LJHA 4FPYA 4CDUA 4Y22B 1ENRA 3KD4A 4META 2MHFA 4QX8A 2JB4A 3E6DA 3MIBA 4YZ4A 3ZYRA 2BGOA 3GJAA 1F2NA 3T0AA 1CAVB 2R041 2AGSA 2PHLA 2WT0A 4EN9B 5HCHA 3I3QA 1VRBA 3AZXA 4BQWA 1W90A 3L9JT 3POBA 1LOEA 2WBKA 2D43A 2LTNA 1PZ9A 1H6XA 3AKTA 5A7WA 4JGYB 5IFTA 1UD1A 5FPUA 3MHZA 4OCTA 4WM8B 3VLBB 1BK1A 5F3IA 1D4M2 1S55A 3MICA 4UFMA 5IVEA 2GC0A 2W46A 4BM8A 4RQPA 3M3IA 3HOBA 5FAXA 4GWMA 1QJEA 3CU7A 3E6CC 3WUCA 2RR12 5A6YA 4NPLA 1UY4A 2CY6A 2FD8A 1EAH3 4XUQA 1IG0A 1WCDJ 1OA4A 4EZHA 4OFGA 5ACA1 3IDCB 2X53S 1XU2A 3AZYA 3AX4A 3DPRA 4Q4W1 4D3WA 2WAAA 4Q1RA 3LWCA 4ZS2A 5IWFA 5JZGB 4JZRA 5GKAC 2IFWA 1E5RA 3BPZA 3CL1A 5TSWA 2P2KA 2QKDA 5A6QA 1Z7S2 4AVAA 2DYCA 2VNRA 3OY8A 1UZVA 1MQTC 1MR5A 3WQ7A 2J7MA 3OEBA 2O8QA 3WHTA 4LBMA 5A7OA 3AP6A 2NMNA 4YG6A 2CYFA 5FZ1A 3ZXKA 2YY1A 2ADDA 2JG9A 2RMU3 4R9AA 4RFRB 1JXNA 4YVSC 3LIHA 2W08A 5IYYA 1AL21 2BVVA 1W6MA 2OQ7A 3O12A 3UL2A 4HVOA 1R081 1X50A 2XJUA 5FYMA 3F2ZA 4MH0E 1NQJA 4OULA 4P08A 1ZM1A 3SH3A 5FPXA 1O7FA 3VBFB 5A3WA 1YJKA 2F4LA 5A3PA 1OLMA 2O0OA 1C8M3 1H2LA 5F8PA 2RM23 1SG3A 1RUD2 2OW4A 1VBE2 5LW9A 1LOCA 1W03A 2R072 1OKOA 3DGTA 1Y9GA 5C9AA 1H1AA 2B39A 5F5IA 2YPDA 4MZUA 2XVKA 1CESA 1NCQA 3KMHA 2EAKA 2VZ1A 3LSEA 4AFCA 5C4WB 4URTA 3FZ3A 3PJYA 3PVEA 5GLTA 2RHPA 1T6GC 2Y6FA 1LHWA 4UOJA 3ROUA 4YVWC 3EQEA 3KT1A 3UKVA 4P9IA 4CXXA 1W9TA 2VCAA 5D8AA 2ADEA 3JBG2 2R30A 4LTAA 1OH4A 2E32A 4QPIB 3WNOA 1HXS1 5BNOC 1G9DA 1AYN1 1I5PA 5IT6A 2UU8A 1RUG1 4PDWB 3ACFA 4EN0A 5FZ7A 3NKTA 1H4GA 4MLOA 1Q3EA 3POEA 4N90A 2XJRA 4Q4W3 3ACLA 1UCXA 1HQWA 3E6BA 3LB9A 1HKDA 4KU7A 1FV3A 4AEDC 4XIOA 1XSQA 2HWD1 4QQHA 5AVPA 1HRI2 1QH6A 1EUTA 4YW7A 2NLRA 4BH9A 1DDLA 1AZDA 4DQAA 4GKXA 1NXMA 3IMMA 4I2OA 2NN8A 3HNBM 4ASMB 3K4AA 3V0BB 1US3A 3B02A 1V6IA 1ONAA 2VXRA 3T09A 4YARA 3NL1A 1AXKA 3CJIC 1BJQA 1TNFA 1U5ZA 1V6KA 4XFGA 2XKOA 2WZEA 1CWPA 1AL23 1F4HA 4Y4YA 3O1RA 4COUA 4Q29A 4OLLA 2V4AA 4K20A 1HDKA 1R083 3AB0A 5J36A 3ES4A 1GUIA 3FUOA 3JB4C 1O3RA 3I4IA 1R1ZA 1KEXA 1UOGA 4NPRA 1AYM1 3O7OA 5DPNA 4LR4A 1O8PA 2ZHMA 4JTOA 1A6CA 1F8VA 1FNZA 4D6QA 5GZDA 4OMDA 1JUIA 1RMU1 4BK4A 2OVUA 3MW2A 4A44A 1A8MA 2A5ZA 2VVFA 2ZGKA 1UZYA 2YUEA 1W3VA 4HK8A 3ZKUA 4GMP3 3MLJA 4MVTA 5CADA 1M06G 5KC5A 4P02B 3O1PA 2XJSA 5A33A 2BRTA 3MIDA 2GC2A 2GDFA 4QQPA 2XWJB 1HXS3 3APBA 2VNVA 1GOFA 3SNMA 3T2QA 1EPWA 4PJYA 4P9WA 1RUG3 4HETA 1RGSA 1XNTA 1X33A 3LEGA 4V2VA 3VKLA 3J9SA 5IUQA 1AHSA 3BPSA 3C7OA 4LE4A 4AXOA 3N7MA 4BQ4A 1MQTB 1Y43B 2P37A 2WQZC 2QQPA 3SCHA 1GQPA 3JUUA 4Y20B 2LROA 4QWNA 2ZBJA 2FDIA 1HRV1 1W6PB 1O91A 1US2A 4P9XA 1G8WA 2ZGOA 4YG0A 1Q8PA 1L3JA 1LOAA 4RR3A 3WCRA 4RHV2 3WR0A 3WY6A 4YVSB 1ZZ9A 1XC6A 4X8PA 2FDJA 2GNBA 3FE5A 4TZDA 4Y5SA 4WVZA 1RUC2 4QDRA 1BVP1 1XXNA 3GDBA 4DRVA 3A22A 3MBWA 3RYKA 4NN0A 4MO3M 1C5HA 4CDQA 4JKMA
chains in the Genus database with same CATH topology
1TMF3 4F7ZA 2Q1MA 4NHLA 1HX6A 1G9FA 4ISRA 3RMXA 5HBAA 5JOXA 1Q8SA 4QQOA 1DF0A 3WDWA 1RUH2 2PTMA 2Q8OA 4A7YA 1QJY1 1AYM3 4KNCA 4XJ8A 1U5YA 1UKGA 4IEZA 4RS5A 4MXVA 1G9CA 4N7IA 2YDEA 1LOFA 3AMMA 5BPXA 4YVWB 4AI3A 1POV1 3RRDA 2Q30A 2UWAA 2GC1A 2IC1A 5BNOB 4LBQB 3TB0A 1IQAA 2H6CA 2JE9A 4Y1YA 2ZZQA 4H3WA 4C91A 5H9PA 1MVEA 4N43B 4XFAA 4HKLA 2PHFA 4FPLA 4MYEA 4AVSA 4JVAA 4K9SA 4RSUA 2Y38A 2XL9A 4LEJA 4NR1A 1D2QA 3KLSA 3V64A 3O0WA 4IV1A 4IXLA 3KS7A 4KQ7A 3BU7A 1ZZ6A 4I3PA 3R4UA 2D5HA 4LLOA 4AHXA 1H8TC 3USSA 3CJIB 3VZKA 1BBT3 4FSJA 4XZPA 1GZWB 3HBZA 2D7FA 3U07A 2RS11 2ZGPA 2AR6A 4MGYE 2XLGA 4XILA 3AXEA 2ZABA 4HN0A 3AFKA 4PIZA 2JG8C 3WVJA 1VR3A 1O3QA 2Z2SB 1CAXB 1TME3 3A4UA 1V9U2 1RJ8A 3ZXGA 2ET1A 3VZJA 4JRLA 2D6KA 3WQ0A 1QJY3 1OFSA 3FJSA 3K48A 1F5JA 1TE1B 2F6BA 2R49A 1YLLA 4FPEA 2RR11 2TBVA 3VZLA 3MFCA 3ZSEA 2MEV3 5E8AA 3UV9A 4XJUA 3RI9A 1H30A 3D82A 4Y26A 4CDXA 1RUI2 1LESA 5J98B 1MS4A 4AGRA 5F6LB 5L73A 3SMHA 2AUYA 2H0BA 3FLPA 5JI7A 1Z7S1 4A7ZA 1HLCA 2FQPA 5E16A 1VBB2 4XTMA 1G9AA 3OYWB 3IMNA 5BXXA 4L2NA 1S2KA 5DDJ1 1JN2P 1ND3A 3WG1A 1AX1A 2WNVA 4ZXKA 1VBA3 3WV6A 4Q4Y1 1LENA 4J6GA 1VBC2 4L8QA 2F4PA 1UU6A 3O5SA 1GQHA 2CGOA 5BV6A 2QFEA 4W65A 1CQ9A 1VAVA 3BTAA 2R1DA 3OGGA 4AI2A 1C1FA 1DQ2A 1DG6A 4XTPA 2DCKA 3KCXA 3IWZA 2UY8A 2OUJA 2YV8A 4I30A 3MW4A 4PQ9A 5DZEA 3VBHB 4HSLA 4LHNA 2A3XA 2A6YA 4GULA 4FAHA 3V0BB 3GALA 3ECQA 3SXWA 1D4M3 2WNUC 2QCSB 3JBG1 3KSCA 5KHGA 1N3QA 1G9BA 1WCSA 2RR13 2WL1A 3AFGA 2R32A 1IS4A 1POV0 3D5OA 4AI8A 1LHVA 1CJPA 4H7MA 2XLFA 1IKPA 4ZU5A 2ZKNA 1X8EA 4GH4A 3THTA 3OTFA 1HRI1 1VB4A 1NCRB 2NMOA 1Z7S3 2OYZA 5DXDA 2ZMLA 3KZ4C 3ES1A 5L7OA 2B45X 3ZFEA 1H8TB 5JVVA 5I0RA 4OHXA 1MS5A 1G6NA 5T54A 4XF9A 4WZFA 2NZ9A 3LGRA 4OHZA 5KHIA 1ZZ7A 1D4VB 2D93A 1QNYA 4TWTA 4OUSA 3N7KA 4CEYC 1DYKA 1D2SA 3D0SA 1RUD3 4JGZA 1VBE3 4YGEA 5BY5A 2QUOA 2R073 3D0JA 3FBYA 3SCGA 1JBCA 1GICA 2WNEA 3KM5A 4YFZA 1WW4A 5GLVA 2HWC2 3AMNA 4CP1A 4QHBA 1WD4A 4XFFA 5JDBA 1BEV2 4C0BA 4Z8BA 4P9JA 4AHYA 2GNTA 2A6ZA 1XE7A 3GZTB 3JBG3 4LBQD 1O4YA 2R1BA 3WDYA 2B46X 4Q0VA 4FPHA 3RJRA 1QH7A 1CONA 2BFUL 4K3UA 3AP4A 3VBUC 1AX0A 4RD7A 2WS92 4LO5B 2WSVA 1XYNA 1XQNA 5CFDC 1R091 4NHMA 1OOPA 5C8WA 1RJ7A 1G86A 1HRI3 3ILFA 2NP0A 1WCKA 1JYCA 2EXKA 5AC91 4XXPA 4K6BA 4RHV1 2ZX3A 1WUVA 1S1AA 2A3YA 3HMYA 1IOAA 4F83A 1YI9A 3EJKA 1B35A 1RUC1 1RL3A 5IK5A 4AQ2A 2W39A 2JG9B 1VRH3 1WLDA 3M2MA 1DU3D 4FOQA 3VBOC 1BZWA 3AJZA 3IPVB 3DKWA 3AKRA 4AW7A 2UURA 3MFAA 1QJX2 2VMGA 1FOD1 5AVAA 4K40A 1TNRA 4R9BA 2D3PA 3R4DB 4Q1PA 5KWRA 1BXHA 3B5LB 5GZFA 4O9GA 2VPVA 4XIKA 1RB8G 3WDXA 1X7NA 1LRHA 3J8F1 1LODA 4IEQA 4WVMA 4IV3A 3ETQA 5LRSA 3I59B 5JOYA 2QJVA 1JUHA 4AEMA 2IXLA 2FZ2A 2DF7A 4E2QA 1LEDA 3NWKA 1TMF2 4DRRA 4LO8A 4OVEA 1MEC1 5H9SA 4F3JA 4BPZA 4KWLA 4Y24A 4BHPA 4FOYA 4BLJA 2JJ6A 3WNXA 2PLV1 4XFCA 2Z79A 3SLIA 1N1TA 3LA2A 2HWF1 1O5UA 2DVAA 1YIPA 4FXKB 3UJQA 4WM8C 2XWBB 4RHV3 1MS8A 2HJIA 4LA2A 4Q0PA 4YW2A 3JD71 2VQAA 1UU5A 1RUC3 3QH6A 3WX5A 3W9AA 3EHKA 4GB32 1GV9A 1KS5A 5FDBA 2H0VA 2CAVA 2WFF1 4FPFA 1PNGA 4NVPA 4PCRA 4CEYB 3ZXAC 1RUF1 1XU1A 2YGLA 5IK8A 3VZMA 2GZWA 4LULA 4IESA 5JOZA 1QDCA 1V9U1 5LEJA 1RUH3 4W6XA 4YM0A 1AR92 4FQ4A 4FPKA 3HIFA 3VHRA 1CAWA 3DL3A 1LGNA 3KGZA 1BMV1 2DU1A 4OI0A 2OZJA 1IPKA 1KDMA 1AR62 1RUI1 1Y9QA 3A0NA 5J96B 2ZX0A 1SEFA 2H6BA 4XQDA 4LA3A 4K1YA 2XGXA 3RWNA 1OI6A 3UJOA 3RI8A 1I3HA 5CFDB 1VBB1 3TN92 2PAKA 2X5IA 2B42B 5KXCA 1VB2A 1LULA 1KXGA 1FMD2 1KQRA 5FO7B 4DNYA 1O4ZA 1C4RA 1A8DA 2IXJA 4KG0A 3MZHA 1IKQA 3M1HA 4FXGB 1D0GA 2PQQA 3H7JA 1U0AA 3VL9A 2YYOA 3ZIWA 4S2GA 3VBOB 1DGRA 3FWEA 1PGW2 1W6NB 2D3RA 2RS32 2XJQA 1KRIA 1ZYBA 4YW4A 4MXWB 1DIWA 1QF3A 4K8FA 4BCUA 2ZGQA 3NV1A 4AQSA 4WBBA 1SDWA 2JECA 2MPFA 4Q0SA 1V9U3 3NV4A 2YMZA 4Y5Z0 1REDA 4TLFA 5ABJC 2RMU1 1X82A 1ZVFA 4N53C 4MGZE 4RGGA 3M3CA 3WW2A 4CDWC 4DXZA 1RUI3 4XHXA 2D6LX 2GC3A 1RUOA 3ENRA 1XNKA 4R52A 1PIV2 1C8M1 4I09A 2RM21 3MEPA 4GKYA 4DZGA 1VBB3 5LK5A 3X29B 4P14A 2JKBA 4XJ9A 2FBEA 4QQLA 1I6XA 1XNBA 4B7KA 3ILRA 1PGL2 1F9KA 3JQWA 5FLJA 2DU0A 4AFBA 3RPQA 4XE9A 5C6CA 2WWSA 1VBC3 2PHWA 2ZHLA 2VMHA 2YPJA 1LHOA 4WM7C 1QJZA 4ONUA 2ZAAA 3CF6E 5AFBA 3NAPA 1WLCA 5KBFA 3WG3A 1MVQA 1SBEA 3FMGA 1UIJA 3ZXFA 5FBZA 1ZBA2 2EVXA 3ZX7A 3RS6A 2HWC1 1KFXL 1LU1A 1W6OB 2WIIB 4YYOA 1LB2A 2D44A 1SACA 1YXWA 2EXJA 2PAMA 4QPGA 4XFIA 3O0XA 3JZVA 3MIGA 5FLHA 2K0GA 4LT5A 2A70A 1YHFA 5A32A 2B9UA 3H3ZA 1WW7A 1YFYA 5DG1A 2VW2A 3GBGA 1HIXA 1PO22 4YFWA 1FXZA 1A78A 5DUVA 4O9EA 5EYXA 3T2TA 4K1ZA 2KXLA 5BNQA 1RUE2 2VW1A 2CWMA 3VV1A 4DOUA 5C8CA 4AVBA 4YGDA 2A71A 4A7KA 4X6RB 4YZ1A 2XPJA 4FTEA 3G6JB 4GMP1 1SFYA 2EALA 2R062 4UBHA 1FATA 3WT3A 4EV0A 1UPIA 2WNVB 5IK4A 2RJLA 3B7MA 1PM7A 3GZUC 5BNNC 1S0GA 1QJX1 4FO9A 1AJKA 3H1YA 3QD6A 1LU2A 2HEWF 1S0JA 3NO8A 3N35A 4N43C 2Y0IA 4XOGA 3UKTA 2VGDA 4GA9A 1BCXA 3AKQA 3VZOA 2VH9A 2B8MA 3MPBA 4K7JA 2ZGLA 3AJYA 5ABJB 2HWC3 2EXIA 1OPMA 5E88A 1YJLA 1BEV3 4N53B 3PHMA 1ULDA 4QGNA 4OI1A 3V0AA 3V56A 1RUNA 4AHZA 3WP6A 1H1MA 3VBSC 1IS3A 1YCIA 1LOBA 4CDWB 1OLRA 3WP3A 1VRH2 3R6SA 1TMF1 2SLIA 3L2YA 3GBFA 2GN3A 2GU9A 2BVBA 4FBFA 4K21A 1V00A 4N9IA 5AFEA 4M3CF 2WS93 4PBPA 3BIWE 1R1A2 2DCJA 3LCPA 2WC2A 3MPPG 1OQ1A 5BNPC 1C8NA 4M0NA 5A3LA 4EN7B 1PK6A 3J4UH 3MW3A 4BQ1A 1RUJ2 2DVBA 5I93A 3VN4A 1AR82 1QQP2 1UX6A 4NWVA 3POYA 1DQ0A 3QCWA 4AQ6A 4GB31 1WA4A 4MX3A 1AR72 4WM7B 3NW4A 1COV2 1ZRDA 1IS5A 2VU9A 4L97A 1O3SA 2JE7A 3JQXA 2E7AA 1QJX3 3NJZA 1YFWA 1UAIA 4QGMA 4Q4X2 1YRZA 4HKWA 4I3GA 2I45A 4QU2A 2BNNA 2BNMA 1ZRFA 2D6MA 4CEWC 2ZZJA 1W6QA 4FCAA 1KDKA 3WINE 1BBT1 3LOIA 1S0CA 5JPNB 2O8OA 1NA1A 3TBDA 2Y0OA 3ZFFC 1NY72 1NOVA 2NM1A 3M3QA 3FHIB 5GZEA 2D40A 3D6EA 5T3NA 1QXRA 3SITA 1V6OA 1OLQA 1PNFA 1MS3A 1OPOA 3FFZA 3TN91 4XQ4A 4AWDA 1TME1 2XBO2 4IEXA 5T50A 2W52A 4OHWA 2WKKA 1FMD1 5EXOA 4XPVA 1QY4A 4DFSA 5EFUA 3VBHC 1K5MC 1YI7A 2MEV1 2C0ZA 4KGQA 1H2KA 2Z42A 4UW4A 4OI4A 4UBGA 1ZRRA 2Q1ZB 1DGLA 2HYKA 4GWNA 1EV12 4HPKB 4GB33 5BNNB 4YG3A 2RS31 4PIXA 3USUB 4XBLA 4GMP0 4AI0A 3VDDA 1RC6A 5K0UC 1D0HA 4I01A 1WMEA 4XW3A 5DZGA 3WHUA 1QJU2 4U36A 5FQ0A 3THPA 3MLLA 1WW6A 1NCRC 4CZSA 4L11A 5LRRA 2PA7A 1AR93 2GN7A 4I0AA 5BYNA 5T52A 3VBRC 5EWSA 4Y22A 1QKQA 1VBA1 4ZU4A 3U10A 1PVXA 4LUMA 3VBSB 1AR63 1CAUB 4S2DA 1CAVA 1MS9A 1ZBE2 2EF6A 2XVGA 4D69A 4EROA 3IBMA 4M3CE 1XNDA 4F8AA 4JGYA 1WD3A 1I9RA 1GZCA 1REFA 2A7AA 4Q0QA 4CDUC 1ZA4A 3TN93 2ZGSA 4DB5A 4Q0UA 5BNPB 4XMIA 4AGGA 4XHBA 2Z5WA 1AL0G 1D4M1 1MS0A 2YGMA 1PMIA 1FMD3 3I7DA 4XF4A 1PGL1 1IHMA 3WLUA 4G4FA 1EYBA 5JZGA 1FYUA 2ZGRA 4IERA 4U2AA 1PVC2 4KG8A 3RDIA 2DCZA 2YZ4A 4Z07A 4D7SA 4RQPC 3VL8A 1QHDA 1O3TA 3ZFGA 4AGVA 4JCKA 4B4PA 2W0XA 2RS33 4M3CB 2VOVA 1JH5A 3E5UA 1JW6A 4UW6A 1S0FA 2HWB2 3DPRC 4BOWA 5F9TA 4COWA 4CEWB 1X36A 1WW5A 3PVNA 3ZXEA 4YGCA 2PHXA 1FX5A 4XBQA 4LBJA 4OI2A 3VBFA 1AVBA 1N3PA 3H7YA 4WV8A 1IS6A 1AXYA 4FPOB 3ZFFB 4LBLA 2ATFA 1APNA 2JG9C 3LA7A 3WZ1A 4E27A 1PIV3 1RIRA 4COZA 5C4WA 1Q8OA 1PO21 3T1MA 4UW5A 1RUD1 3TRSB 1VBE1 4C1XA 2R071 2TEPA 1RUE1 1QOTA 3QOPA 4CYDA 1ND2A 2I2SA 5CFCA 4QPIA 4BMEA 1MZ5A 4JDMA 2UWCA 4LO4B 2JD4A 4BIOA 4PDWA 2X5IB 2QNKA 1K5MB 5JR7B 5C9AC 2PFWA 3ZN6B 1NCQC 1HQLA 3BCWA 3KCCA 5T5OA 2LUWA 3U0ZA 1RHI2 4GALA 3IM0A 4PIYA 3VKFC 5D8AC 3SISA 3IIAA 2ZHNA 5JSOA 3WD5A 4EWAA 5K0UB 3ILNA 1ZBA3 1SLBA 1WGPA 4C90A 2DTWA 2ZX1A 3E5XA 2GNMA 2PHDA 3AMPA 3K51A 1J3RA 5HCAA 3VBRB 2D5FA 2VW0A 2XKPA 2TUNA 2HWE2 4QPYA 2AH2A 2B7YA 1JOJA 4OHYA 4XF1A 1VRH1 2JENA 3VKMA 2OA2A 4Q2FA 3IT8A 5JOWA 1REEA 1J1LA 4D94A 3AYDA 3WCSA 4IL7A 5BUVA 2R042 4CDUB 1PO23 1H2NA 5DUWA 1KD7A 1N47A 2I74A 1SLTA 1EY2A 1RUE3 3PMSA 4KBBA 3ELNA 2P3JA 4HN1A 3ZYGA 2QVSB 2AENA 2R0FA 4WZCA 1RUJ1 4YM3A 4DY3A 1QQP1 3LAGA 2I07B 3ZSLA 1URXA 2R063 2ZX4A 5ACA2 4AF9A 1COV1 1V6MA 2DURA 1MQTA 2D6NA 4RQPB 2ILMA 3AKSA 4BLIA 2ERFA 1DGWA 4DY5A 2ENRA 2IFRA 3S7IA 1W6PA 4Q4X1 3VKOA 3WG4A 2K9ZA 4YVSA 2HKXA 3AP7A 3DPRB 4I0BA 2A75A 2DVGA 3RMYA 4B8EA 3ZO0B 1V6JA 4ASLA 4QM8A 3OY8B 4JQRA 1W0OA 1LR5A 5CBLA 4N9HA 4PLMA 4Z2WA 1NY71 1CN1A 3D8CA 4IEOA 4RR3C 1LHUA 1WMFA 4ORFA 2GMPA 2GMMA 5A32B 4HBNA 3ZDSA 1UW8A 1W6MB 5EZWA 1J3QA 4LHLA 1PHMA 4EN6B 4YVWA 2XBO1 3ZXLA 1OMIA 1DZRA 3C2UA 4KGGA 1R1A3 1RUH1 4CDQC 4W6YA 5BNOA 4BIFA 2P17A 4FPCA 3N7LA 3FX3A 4LBQA 5GLWA 4IEYA 2QZ2A 3LSDA 3N4MA 5C9AB 4FPGA 3DUIA 3POWA 5K7PA 4HMZA 1RUJ3 3POSA 4JDNA 1NCQB 1LEMA 4P5HA 4ATFA 4TZDA 4EN8B 1AR83 4AEDA 1QQP3 4RS5C 1AYN2 1EV11 3GHNA 1GR3A 1LOFC 2PELA 2ZGTA 3BOWA 2C9AA 1BYHA 1AR73 3B93A 2DUPA 5D8AB 1COV3 4L99A 2VNGA 4LNVA 1UIKA 5F6KA 3NV3A 4XXAA 3NV2A 4QM9A 3PNAA 1CX4A 3BALA 2HWD2 1CVNA 4IEPA 4Q4X3 3CJIA 4QXKA 1NQDA 1H2MA 3GF6A 1GZWA 2XJTA 5CB7A 1S0IA 2DFBA 1EPZA 4IV1C 4ES8A 3KGLA 2XH6A 2QE3A 3N36A 4WVWA 4C1WA 3S6PA 3WDTA 1VALA 3JB8A 4KL1A 4LO6B 3QLQA 1CAXA 1LTEA 1E57A 3CLPA 2UY9A 3E5QA 1PZ8A 1RTVA 5CA6A 1DZQA 4D7YA 3ST7A 1DQ5A 5T55A 4LBNA 4AVCA 5LEKA 1LHNA 3C3VA 3U11A 2WQ4A 2XBO3 5JCTA 1RMU2 3I8TA 1GYKA 5CVRA 3AYCA 2IZWA 1O5LA 2G9GA 3ME2A 4YZ2A 4FTSA 2BFUS 2WFPA 1PVC1 3DF0A 1NLSA 1WLTA 4AHWA 2IXHA 3OGJA 4V1PA 4YNIA 2IXKA 1EV13 2WT1A 4IEWA 4KU8A 3WQ1A 1XYPA 1GQGA 3OYWA 4FP2A 4XF0A 4DMIA 3HT2A 5D1IA 1GLHA 1AUYA 5A33B 3P3NA 1FPN2 3URFA 4CDXC 1Q56A 1VAMA 2WA3A 5I8YA 2DFCA 4GXLA 2HWB1 1C1LA 2EA7A 1QJU3 3W59A 1B09A 3TOJA 1FAYA 1HRV2 3MLKA 4QT6A 2R0HA 4P9YA 1QMJA 1SFNA 3GNEA 4JC1A 4UXAA 4FOVA 3EO6A 1SCRA 3ZYPA 2O1QA 4IETA 3ZXDA 3HQXA 4XMAA 3ZN4A 1DHKB 5J7MA 1VBC1 1ND3C 2RE9A 4HKOA 4RR3B 5F5QA 1ZBE3 3RYPA 2V09A 3ZIXA 2WNVC 4DPNA 3OCPA 1GBGA 4BYYA 1OSGA 2WZR3 1GNHA 4Q26A 3FLRA 4YGBA 2XL7A 4CDQB 2VULA 3B01A 2JDZA 1WMDA 1YWKA 1Y3TA 4ATEA 2E7TA 1ALYA 5IK7A 2CNAA 1NYWA 4E4ZA 1FNYA 2QDNA 2ZGMA 2XB6C 1LCLA 4RS5B 2X8KA 1DQ6A 1Y7BA 3KCYA 4IEVA 4J1XA 2UYBA 1PVC3 2Q0AA 1GZ9A 5L19A 5B2GB 4ISQA 5I0TA 4I0WB 5FTTC 1H8TA 3AXDA 4HT1T 1PZ7A 1N1SA 1W39A 2HWB3 2PHUA 5GLUA 1Q5OA 2FMYA 1S0EA 4GH4C 2WSUA 2GAUA 3RNSA 4H7LA 4WVVA 4IV1B 3GYDA 5L7OC 3ZVXA 3ZFEC 1ZZBA 5I91A 2D6PA 2JG8A 2DCYA 5HCBA 4FTBA 4AG4A 2JX9A 2RS12 4INDA 4AK3A 4FT8A 4RA0A 4YM2A 1HQNA 1YFUA 3FC0A 4Y1XA 2LM3A 1CPMA 2AZ5A 4XFHA 5EJ3A 2JICA 4HK9A 1XE8A 3IDEA 1C5IA 4PLOA 3U4XA 2DTYA 2BWAA 1J1TA 3ZSMA 1BEV1 4JGZC 1YFXA 1MZ6A 4XETA 4E2SA 4R4XA 1NZCA 5FOBB 2ZKLA 3W58A 1RHI3 3H8UA 2EAAA 2ZGNA 1ULEA 4OHVA 1KITA 4B7EA 4R8HA 1C28A 5JWPA 5KXBA 5EV7A 4CDXB 2WS91 2DWRA 4BWOA 4HSJA 1WLWA 5FFOC 3AYEA 3MI8A 3ZFGB 2BYVE 1VP6A 4QMAA 3FLTA 5DDJ2 5I8SA 2E53A 1ENQA 5CAZA 4LO7A 5CG8A 1LGBA 3ZYIB 1SLCA 1TEIA 1OOPC 3IPVA 1VAKA 2HWE3 1EP0A 4Q4Y2 5FOJB 5FLIA 4FP3A 1ND3B 3R4SA 4Y1ZA 3MIFA 1F31A 4MGKE 1NE4A 5JPMB 1B35C 5KHJA 3ZMOA 2G9FA 4CTEA 3KT7A 3WP5A 2DVFA 3QACA 4EWEA 1PO12 1RVF2 1KS4A 2R043 2WNUA 3H50A 4XYXA 2BNOA 1ENXA 5EYYA 3I59A 3G7DA 2ES3A 2ZAHA 2DUOA 4YRDA 1ND2B 3MDPA 5CFCB 3AMHA 5F1RA 3H1MA 4XBNA 4NWWA 1DBNA 1NXD1 3HD8B 4L92A 3OD4A 5K9YA 4NOTA 5ACA3 5T5LA 3DV8A 3WDVA 1H1IA 4P9LA 4IV3C 3SH5A 1ZRCA 3DN7A 1LJ7A 2ARXA 5KC6A 4Q27A 3AP9A 5JAXA 2IWGB 1QXPA 1ZREA 4GH4B 3T1LA 4A2UA 1SMVA 3B00A 5KHHA 4XDQA 5L7OB 4AEJA 4CEYA 3ZFEB 1F5FA 3EXUA 4R9DA 1HV1A 1DYPA 1QNWA 5JIAA 2A73B 3AMQA 1FT9A 4FOWA 2YC0A 3ZN5A 3L2HA 1Q8VA 5FMOL 2VQ0A 1XYOA 3ZXJA 4AEKA 2VOKA 3AZZA 3WW1A 1AR91 4AFMA 1XNCA 3JU9A 1UF2C 4JGZB 1NE6A 2CTVA 1G7YA 3MIEA 3M4FA 3LKJA 3VUOA 1S0BA 3VBUA 5FREA 4M00A 1AR61 1S2BA 5LK7B 5GJ6A 2ZPXA 2GMEA 1AYN3 5CFDA 5FO8B 3PMEA 4PBOA 2ZMKA 3FFQA 4Y1VA 1OFNA 3VHPA 3M70A 1FPN1 4MUVA 2BBVA 3OJBA 3RQ0A 1ZNPA 2UWBA 3TAYA 5SV8A 1R092 2HWD3 3OD0A 1MZEA 2XVLA 5GZCA 1GANA 3CEWA 2XUMA 2ZTNA 3UK9A 1MS1A 1UZZA 3J26N 5AC92 1V70A 3R0RA 4XJZA 3WG2A 1QDOA 3P3PA 1LECA 1YNAA 3HN1A 4KWJA 4S2HA 3SH4A 3VBOA 2E9QA 5SV5A 1OOPB 1V6NA 5T5JA 1FI2A 1N1VA 1W6NA 2X5IC 2BQPA 3A0KA 3D4KA 1SBDA 2HEVF 3MF9A 1SLIA 4HLTA 3ZSJA 4MXWA 3HAGA 3MF6A 2PN5A 4QQ2A 1H9PA 2ZHKA 4N7UA 3WW4A 5GLZA 4Z82A 3S0MA 2IXCA 1B35B 1PGW1 5I8TA 2FHRA 1FOD2 3ZMNA 3FBMA 1ZZ8A 2CL2A 5J48A 1ENSA 4M01A 4B4QA 1LGCA 3INAA 1RMU3 3VZNA 2ZMNA 1TQ5A 1I5ZA 3J8F2 1UMZA 2YROA 4KH9A 1OD5A 2PHTA 4Q8LA 1QOSA 2X29A 5J09A 3WW3A 1PIV1 4AEDB 4WVMB 4IV3B 1MEC2 1DQ4A 2WZR2 3WOGA 1CIWA 1FPN3 4WM8A 1CJDA 3AKPA 1VBD2 2AREA 2MNGA 2PLV2 3BB6A 3PVOA 4H14A 3CJXA 4HZFA 2RJKA 2VNOA 2HWF2 2RS52 2QZ3A 1BVVA 1HRV3 1AF9A 4LBKA 4YZ3A 2ZA9A 1PGSA 3ZYJB 4E4SA 3H9AA 4QGLA 4TSVA 3JD72 1SBFA 4IQPA 5FMOS 3HT1A 3B94A 4R4ZA 3QBQA 2EXHA 2GNDA 2OIIA 4Q4V2 1I1EA 3V65A 1U12A 1J59A 2WFF2 2SBAA 4L9BA 2ETEA 2FZ1A 1RUF2 1W6OA 3N3HA 4AE2A 1VIWB 1ZBA1 4B3NA 2OPKA 2BPA2 2Z69A 1N3OA 3BOPA 1ULFA 4CP2A 1Z0HA 3NAPC 1ASJ2 1JTZX 2A6XA 5HCFA 2WLPA 1DGRN 4QX5A 2PHRA 4I02A 4GQ7A 4BMBA 4FQZA 5H9QA 3UKNA 1OA3A 1POV3 2WT2A 1BMV2 2IXIA 4YW1A 3OBRA 1X8MA 2NPIA 2ZS6B 4ZKTB 3B69A 1VJ2A 4QPGC 4YZ5A 2E63A 1C3HA 1CAWB 1MZFA 4LLFA 4COVA 5DUUA 2B5HA 3RYRA 2BWCA 2VY0A 2WZPP 2WLQA 2BW8A 3NKGA 4AVVA 1QU0A 4BZ4A 4XQWA 3MYXA 5JIUA 5CU1A 4PF5A 2Q4SA 3VHNA 1UPSA 4LBOA 3ASIA 2KA3A 4OUMA 4R9CA 4RFT0 4G9SB 1CPNA 1QOOA 4AQTA 4KWKA 4E4DX 5FRAA 1IZ3A 1NLRA 2R061 1O4TA 1EAH2 4JV4A 1J58A 4SLIA 4A3XA 2XG3A 5C8CC 1A3KA 3WP4A 3WDUA 1QWRA 1YIFA 2RS13 1Z78A 2VG9A 1IPJA 4XEZA 2BTVC 4YSFA 5ABJA 1PO11 1H0BA 1RVF1 1SCSA 3OF1A 3GBWA 4N53A 2VECA 4RGAA 4ZU7A 1OKQA 5FO9B 4GIQA 2G4IA 4XF3A 3AZVA 3TNQA 4XJAA 4J1WA 4CDWA 2RMU2 2YXSA 5JSPA 2WJSA 3M7AA 3KB5A 3AP5A 1M4WA 1NG0A 3RJ2X 1V6LA 2XLAA 4LE3A 2CAUA 3RSJA 2ZGUA 4X8NA 2D3SA 3Q9OA 3HWJA 2VUAA 1YUDA 3KQRA 3S30A 3CNAA 5C33A 5JI9A 3ATGA 1C8M2 1ZX5A 2RM22 2UYAA 4B4RA 4MV2A 2ARBA 4Y1UA 5CNAA 5KXEA 1VLNA 3ZPYA 2XJPA 3VHOA 1R1A1 2P34A 1XRUA 1CD3G 1UN1A 4MSVA 2R16A 2AYHA 4NHKA 4TYSA 3JCIA 3EBRA 5FCCA 5DZFA 5DDJ3 4WM7A 5K8SA 1FV2A 1U5XA 5GM0A 1AR81 3WXPA 2C5DA 2FMDA 2ZOEB 3LA3A 4EJRA 2Y26A 4Q4Y3 3FUQA 2E7QA 1PK6C 1AR71 2LALA 3GZAA 2XHKA 4W6WA 1AXZA 5A3MA 1ULGA 3E97A 4Q4W2 2JG8B 1GNZA 1N1YA 3MIH