4CP0A

Crystal structure of epithelial adhesin 9 a domain (epa9a) from candida glabrata in complex with lactose
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
250
structure length
219
Chain Sequence
AHYPRPEGCSSPPNAVSVGLHMDLYNYPYLYVKQCWNPEYQDPNFPRYGYKKYGSFGSSDHVNGKISWDHNEFKEGCKPIMARLPTAYNYPAKITFSNFTMVLSGYFKPKSTGLYKFEIHADDFILFNFGSKNAFECCNREESIDNFGPYVAYAMWPNEADQELEVYLFEDSYYPIRLFYNNRDYHSKFMVGFYPPNTEEITYDFDGYLYMLDDTGNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPITHELIAL ADHESIN 9
publication title The Structure and Function of the Epithelial Adhesins (Working)
rcsb
source organism Candida glabrata
molecule tags Cell adhesion
total genus 61
structure length 219
sequence length 250
ec nomenclature
pdb deposition date 2014-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10528 GLEYA GLEYA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4cp0A00
4A3XA 4COWA 2XJUA 4AI2A 4LHLA 4ASLA 4COVA 4AFAA 4LHNA 4AI0A 2XJTA 4AI1A 5A3LA 4AHWA 4LHKA 2XJRA 4AF9A 4AHZA 4AFBA 4CP1A 5A3MA 4GQ7A 4CP0A 4CP2A 4D3WA 4AI3A 4AFCA 4COYA 2XJPA 4AHXA 2XJQA 4AHYA 4COUA 2XJVA 4COZA 2XJSA
chains in the Genus database with same CATH superfamily
3POSA 2P3KA 4PIZA 5LY2A 4QPGC 3RVHA 4C91A 2WZPP 2JICA 1Z7S2 1GZWA 3LEIA 4YVSC 4LHNA 2ES3A 4QXKA 4ARXA 3OGSA 5ACA3 2LTNA 3FHQA 1HXS1 1DYOA 3IPVA 4RN5A 2LALA 3AP4A 5FZ1A 4AZZA 4UAPA 4AEDA 3T08A 2NPIA 4HK8A 3VKFC 1YJLA 1X36A 4EWDA 5EYXA 1LGNA 4LK6A 1QJU1 3HQRA 4NIGA 1RUJ1 2A6YA 4UW3A 4ZXKA 2A6WA 2QQUA 4BXFA 1CPMA 1W8UA 2ZGUA 5D8AC 1W2UA 1Y43B 1W8ZA 3VBRB 4XURA 4CU9A 2JE8A 2VQ0A 3OPWA 5FLIA 1ZBE2 1YUDA 3PIGA 1ASJ3 3LPGA 1CVNA 4LORA 4DIQA 1ACCA 4LO4B 2BDRA 4AI0A 1V6JA 5FKBA 3RDIA 5FZMA 2O1QA 3ZPOA 3FE5A 1XU2A 2QZ3A 3OGRA 2JDYA 3G7DA 3PIJA 5FO9B 3LGRA 1REEA 1U12A 4HPKB 4AEMA 4DINB 3BB6A 5BNQA 1LOGA 3WNKA 2XLGA 2Z42A 3MI8A 3KMHA 3ATGA 4WVMB 1YIFA 5FP4A 1PO11 1JYVA 4BCUA 1OPOA 1PM7A 3JD73 4NOTA 3RZLA 5K0UB 4LE4A 1ND2A 3OEBA 3TBDA 1HJFA 2WA4A 2E7AA 1TE1B 4CXWA 4OLLA 1PIV1 1REDA 4HBNA 2HKXA 3MDPA 3TN91 1ZBA3 4B7KA 1RUH3 4A41A 4CEYC 4YNIA 3CO2A 2HWB2 2YUEA 5IVEA 1IS4A 2GSYA 3A23A 3ETQA 5D21A 1GUIA 1LTEA 1R1ZA 5ISLA 4XVHA 1MS5A 1H2NA 2B45X 2XMLA 5KR7A 3ZYFA 2CV6A 2BNMA 3WNNA 1D4M2 3N7JA 1NE4A 4IGQA 4NR1A 1HX6A 1F4HA 1TG7A 2IZWA 2Y6JA 1BMV2 4L8QA 1ZA7A 5CEHA 4LJHA 1EAH2 2RS32 3J7LA 2WZEA 3FWEA 1CAWB 3RG0A 2R30A 5FJKA 5FMOL 4CDUA 4P9YA 3MBWA 3MGUA 1E57A 2RMU1 4MXWB 4Y1UA 5FK8A 4KWUA 2P37A 4RS5C 1IKPA 2W92A 3J8F3 5DG1A 4AGRA 5AFEA 5J37A 1HRV3 4D6QA 2YC4A 1KRIA 3UGGA 4HL0A 2ETEA 4UFIA 1IS3A 3WF3A 5A3MA 2OA2A 1FPN1 3MICA 1OD5A 3ILFA 2WN3A 1MS9A 1MS3A 2WS91 4XUTA 5T55A 2ZEZA 3BKZA 2HWE1 1Q5OA 1UMHA 4HZFA 2Y6KA 2XH6A 3MLJA 5FZBA 3WW3A 1TMF2 2QQPA 1BEV1 3P1IA 4LLOA 4E2QA 1LESA 1QMJA 1XC6A 2WWUA 1NLRA 2VU9A 3I2FA 3E97A 2DCZA 4DOUA 3ZKYA 1O4YA 3PUQA 1YXWA 2WC2A 4GMP1 4ISQA 4LKFA 4Y1ZA 2R042 3TEZA 3J4UH 2GNTA 5BNNC 1TME1 3BTYA 5FYCA 2W68A 3RJRA 1UYPA 3WVJA 3MUY1 2RHPA 1OQ1A 5C8WA 2ZA9A 4RHV3 1WZXA 3GALA 4L11A 1RYYA 3T4VA 1IS5A 2HEVF 4EN6B 3H8RA 2VUCA 2XBO2 1PMJX 1POV1 3DXUA 2WFPA 1DGRN 4MH0E 5CFCB 4PIXA 1QJY3 1QGLA 3K3NA 1VBD1 1LEDA 3IT8A 5C6CA 3W59A 3U4SA 1JZ7A 1V00A 4EJRA 3K46A 3V0BB 1PGL2 4DUWA 1K5MC 4YFZA 3ZN4A 5LEJA 1O7FA 2J1AA 1H8TA 3AFKA 1CZSA 4KNCA 4OMDA 2R063 1UIJA 2ZCWA 4KBBA 4NWWA 3UKNA 4AI8A 5KXEA 4XIOA 1PO21 1UY3A 2OS2A 4A7YA 3BN6A 3WG1A 2YYOA 4R9AA 3D82A 1RITA 5LK5A 3ZPYA 4NPMA 1QQP1 5FKCA 4EQVA 2LW8A 3A0KA 1V6MA 4BQ1A 3OUJA 1W9TA 3B94A 4CXXA 1RUD3 2WZR1 1UCXA 5JVVA 4U2AA 4EV0A 1NX9A 1MQTC 1MR5A 3LIHA 1OH4A 2ZGLA 4UT5A 3UKTA 1YI7A 4IW3A 4D6RA 1OFNA 5L9BA 1IPSA 3B02A 3IIAA 1ASJ2 3ZSMA 2WT1A 1Z0HA 4UI9L 1W6NB 3PJQA 5G05L 1L3JA 1AR82 1W05A 2XL7A 4IE6A 4CDXC 2D44A 1ALYA 1AXKA 2XLFA 3BVCA 3I2HA 4AQTA 5EYYA 5KHGA 3ES4A 3UGHA 1A8DA 2FCUA 4RQPB 4N53C 2PQSA 1O5UA 1FOD1 3F95A 2KD7A 2GNMA 1OQEA 3BYWA 3AFGA 1CJPA 3WF2A 3C3VA 4CEWB 3TOJA 5KC6A 1O4TA 3ZN5A 2V72A 4CCKA 1XSRA 4HSLA 5C9AC 5IFTA 5C33A 4QPIC 5F8PA 3C2UA 4P9LA 3RZJA 3CKHA 2OXBA 3CZUA 3KWVA 5F3GA 1ZREA 5FZIA 2PELA 3WUDA 2RVAA 2RM21 4LOTA 1ZBA2 4IV3B 1RUH2 4HVQA 4E4ZA 3WP6A 1S0CA 4AFDA 3C7HA 3GDBA 3OB8A 4Y5SA 5KBFA 1H6YA 4KGQA 4JHZA 1OVPA 4QB1A 2VY0A 3TN93 4QQHA 1WW4A 2CNAA 2DWRA 3I59A 1NKGA 3L9JT 4FP2A 2D6KA 2ZKLA 3PUAA 2A3XA 4CUBA 2YHJA 5L36A 1BBT1 3POFA 1PK6C 2VCBA 3KVAA 1X7NA 5K8SA 1UIKA 1VBC1 3FC0A 2ZGOA 2FDHA 3N3HA 3D4KA 4K40A 1NQDA 2DTYA 4FAHA 2W94A 1MZ5A 2ZPXA 1G9AA 5FZ9A 4RFT0 2VECA 4NRQA 4R9DA 4O9EA 3WQ7A 3D5OA 4CZSA 1XQNA 2HWF1 1CPNA 3RPQA 4FTBA 2RR11 3MF9A 2V73A 1ZYBA 2ID4A 2Y6GA 2CGNA 5SV8A 2QQJA 1ULCA 4XC9A 4IETA 4QPYA 1RVF3 3J8F2 4W6XA 3KQRA 4XXPA 3TWIA 4YGEA 3T0AA 4AQ6A 1HRV2 2IXIA 3ABZA 1DZQA 1H4HA 4I09A 4A3ZA 4JTOA 3K51A 2W1UA 5IUQA 5LY1A 5FLJA 3BOPA 3CF6E 4S2DA 2E26A 1W03A 1GWMA 3KVBA 4QQ2A 4GJYA 2BWAA 5DABA 2RG4A 1NCRB 3VBOA 4R4ZA 1PGSA 4KL1A 4GQ7A 2HBTA 2R073 3DUIA 1W8OA 4D7TA 5FUPA 3O14A 4QT6A 5DAVA 1WA6X 1XYNA 4META 3I2OA 1RHI3 4P9WA 1UX6A 5AVPA 1BEV3 1RIRA 3NJVA 3NNFA 5T5JA 5LWBA 3BTAA 4ZXEA 3GJAA 1RUF2 1ZZ9A 3DECA 3EXUA 5T5LA 3MZHA 2VPVA 1SQ4A 2W3JA 2EAKA 1PVC2 2K2SA 4LOSA 4UW5A 5FZ8A 2E7TA 3HBKA 1RUE3 1GWLA 3WP3A 1AYN3 2B46X 5C3OA 2FMYA 4CDUB 1OF3A 2A6VA 2WYSA 3P3NA 1QJY2 1LOBA 3H3UA 5A3UA 5FZAA 2Y38A 4JDNA 4JGYB 3E5UA 4Q4X1 5FZKA 4ARYA 2HEYF 1UL9A 2FMDA 4Y4YA 3VDDA 4COWA 2BBVA 3RYRA 3S7EA 2JE9A 4XJ9A 5FY1A 1JZ6A 3ZYGA 3LA2A 3K77A 3KV9A 4QU2A 1XYPA 3HEIA 5B2GB 1W8WA 1DQ2A 1UMZA 3K4DA 4CCMA 1WBLA 1T6BX 4IEYA 2UWCA 4NMIA 3ETPA 2ZHKA 3NNMA 4XTMA 3ZR5A 4MG2A 1S1AA 2AC1A 1B35A 5E89A 1GOFA 1KS4A 2W08A 5I0SA 2VMIA 2Y34A 4BQ5A 2I74A 2A7AA 3SH5A 3O1UA 4R4XA 4YZ5A 4INDA 2ARCA 2OZ6A 1UKGA 5DG2A 5A33B 4AG4A 1KDKA 1JOJA 3MF6A 3H50A 3LCPA 3UV9A 3U14A 2Y6HA 2NN8A 3I4IA 5FYYA 5IYYA 3RQ0A 5JZGA 1CQ9A 3ZFGB 1NOVA 4P5YA 5J36A 3DYMA 4Z1VA 4W8JA 2BFUS 1ZX5A 1VMJA 2JG8B 3NV1A 4PHZA 3UT0A 1AL21 4J6GA 1Z7S1 4K21A 1BLZA 5FAXA 3O12A 1S0FA 3SKJE 3OCPA 5HBAA 4JZRA 5C8CB 5C3RA 3I2JA 5DZGA 5CA6A 2VG9A 2CGPA 1ENSA 2EVXA 3DPRB 1UF2C 2HJIA 4B4RA 5IHRA 4FFIA 5CADA 4ZHNA 1LAJA 3WQ0A 3N7MA 3ZIWA 4CSWA 5IK8A 2EXKA 5JI7A 5KHIA 2FDGA 1E5RA 2XJVA 5CG9A 1XB9A 3SH4A 2QJVA 2FBEA 4XDPA 5A7PA 2RDSA 1QNYA 1PNGA 1Q8SA 2EIEA 3J7HA 4WVWA 3QCWA 3FLRA 1ONAA 2I2SA 4OHXA 2FD8A 1KITA 5FZOA 4XF3A 4GH4A 1YQ6A 4CCOA 2JIGA 4P9XA 4ZU7A 5HCAA 4Z07A 3B01A 4CA9A 2ZAHA 1GV9A 3WR0A 1VBC3 5EZWA 1FMD3 4ZY9A 1N1SA 2P3YA 4WM7B 1RB8G 4KWJA 1QOSA 1PVXA 3D0SA 5BNPB 1AX2A 2VW1A 2AACA 5H9RA 3WEZA 3VGIA 2JD4A 1ZRRA 3LIGA 5ABJB 3LEMA 4WM8A 2HWF3 1QEXA 4IQPA 3H42B 4GWMA 1OLRA 5FYUA 3AYAA 3GBWA 1FV2A 1RMU3 2YROA 1G9CA 2D97A 2YG0A 1UPSA 4UW4A 2VVFA 3M8LA 4FBFA 3SKVA 2YC0A 2RJKA 5FMCA 4M3CA 4AGGA 2HWB1 2QDRA 2RS13 4XTPA 3WG4A 3K4AA 4Z8BA 1CX1A 4YM3A 2JDAA 4A6OA 2LS6A 2G9ZA 2R072 2VUDA 4LBOA 4ZU4A 3M1HA 4L92A 4TYSA 5T3NA 1F31A 5KWRA 1MACA 2A6ZA 1MS1A 4IXLA 1RHI2 5FP7A 1D4M1 2A3WA 4BYYA 3GZEA 4XCBA 1SLLA 5F3EA 3I7DA 1N1VA 2QVSB 3MIGA 3ZFFC 2PHRA 3DV8A 3S0MA 4QX8A 2WUHA 3SHRA 1HB3A 2WJSA 4LKEA 1G6NA 1EAH1 2P1BA 4OHYA 4EROA 4PDWA 4R8HA 2VMFA 5FBZA 1OOPA 1H0BA 3P5BA 1C5HA 2Q8EA 3I3DA 1RUE2 4YFWA 5IJRA 1VP6A 3OPTA 1ZM1A 2A71A 2H6CA 2UURA 3ALQA 3JQXA 4G3YC 4YVWB 5H9QA 3VBSB 1ULGA 4Q4W3 5L7OA 1A34A 2RDRA 5A70A 1W9FA 4QXHA 3KSCA 2ATFA 3TB0A 3U37A 1WBFA 4ZKTB 2NYYA 4BPZA 2B7YA 3MUZ1 1D0GA 5BXXA 2JXAA 2BRTA 3QH6A 4HG6B 1TMF1 2DU1A 1UD1A 5EJ1B 2E9QA 1Y9MA 2XJSA 1UOBA 1KQRA 4AYUA 3AL5A 4IEVA 3BPZA 5EV7A 3WDXA 1CWPA 2AENA 2Q1ZB 2F17A 4QD2A 2R041 4C0HA 1US3A 2NZ9A 3NAPB 1PX3A 1CAUA 1RUI3 4CP1A 4UXAA 3AB0A 4QMAA 3VBRC 4GB33 4TLGA 5E8AA 2RE9A 5DDJ2 4AL9A 5L9VA 4FFFA 1UKRA 2XBO1 1XRUA 3HN1A 1ZNPA 2UYAA 1XNKA 2WNOA 4MYEA 1W28A 4RR3B 3ZDVA 4AOCA 3JCIA 3U07A 1UY2A 3LSEA 4I0AA 1ND3A 5A7WA 1NA1B 1UU5A 5ACA1 2AEYA 3VHOA 3ZSKA 2Q5TA 5C71A 1L7RA 1RL3A 4BK4A 2VQUA 2HWC3 3IDBB 5GZEA 2BPA2 1W6QA 3RNSA 2GALA 3ZKUA 3P3PA 2VBDA 1FATA 1GZTA 2VOTA 4JCKA 4Q0PA 4CCCA 2ORXA 3TEWA 4KWKA 1AX0A 5K0UC 4YW2A 2BERA 2QNKA 4F7ZA 1YO8A 1BYHA 1QHDA 1JYXA 2ZOEB 2TEPA 2Z2SB 2IXLA 2OVUA 4E2SA 1LOEA 4XDQA 3O1OA 3E5XA 4B1MA 4NIDA 2VTFA 3VL8A 1CAVB 1UYXA 1ASJ1 5J1XA 1ZBE3 1AR81 3I49A 3C7OA 3NJXA 3USUA 4L97A 2FQPA 2D6MA 2IVIB 1D7PM 1XNAA 2QDNA 2V09A 4XBLA 4NWVA 3JQWA 4CUGA 4JQRA 3SEEA 3T2PA 3VHNA 1SCRA 3PUSA 5FBJA 5CFDA 1KGYA 3J7NA 1FMD2 2OW4A 1JUHA 2ZX2A 4O61A 3WNXA 4BQWA 5GLVA 1BVP1 3AKPA 3AKSA 3VKMA 1BQPA 1JN2P 5FP9A 3T1MA 3V56A 3WG3A 3N35A 1LOFC 3ZFEA 3JD71 3Q8FA 4GD4A 3T09A 1BK0A 2D5HA 2GP3A 3AJZA 1V6LA 1GKBA 4CCNA 2J7MA 2ZEYA 4QB6A 1Q3EA 4BIFA 1RMU2 4NIIA 4LR4A 3U0ZA 3KHCA 1ENXA 1O8PA 4L0PA 5AVAA 3W58A 2E51A 1ZBA1 3KT4A 1RUH1 2ZTNA 2W87A 4L2NA 3F2ZA 4CXYA 3AMHA 4NAOA 3FJSA 3AVSA 4QHOA 1WMDA 1UAIA 4QM9A 3QD6A 5H9PA 4DUVA 1GFF2 5F7UA 1KFUL 4IV1B 1AR93 1JW6A 4FOYA 1AUYA 1S0BA 4YW4A 3VD3A 3WF1A 2FDFA 1I5PA 1VJ2A 5JSPA 4JDOA 3R4SA 2DBIA 3KZ4C 1VMHA 2AZ5A 5C4WB 2ET7A 4MZUA 1W06A 2C0ZA 4NHYA 2NP0A 5DUWA 3ITQA 2FZ1A 3LOBA 4HMZA 1OA3A 3N9NA 1MVQA 4MGTA 4OVEA 5FYTA 5FZ3A 3EMRA 1O91A 5A3WA 4QX7A 5GZDA 2GC2A 4XACA 5IT6A 2L9LA 4NHMA 2ZHMA 3RJ2X 2IC1A 1UYYA 4JRAA 2EAAA 2DTWA 2P6CA 2G19A 1UZVA 3KB5A 2RS33 3NV2A 2JEMA 3PURA 3N7KA 3ZR6A 3J8F1 4LBQB 1DGLA 1UMIA 5FLHA 1J1LA 1J58A 1RUG3 1Q8OA 2ZGSA 2JKBA 1HRV1 3VBUA 4OI0A 1SEFA 1QH7A 1Y9GA 2VQTA 3M70A 2OX0A 4Q4W2 5BUVA 2HYKA 1GANA 1O3SA 1NY71 1X8EA 4HT1T 4Y20A 1O3RA 2WNVA 2YU2A 3VL9A 2X5IA 3AP6A 1HB4A 4Q2FA 3ZXDA 5IVBA 1N3QA 1UOGA 1IHMA 4N43B 5EP9A 1UZ0A 5DAWA 3M3IA 1JBCA 3OGJA 1H6XA 1ODNA 2PHDA 4V2VA 4XJUA 3UESA 4YLZA 1RUC3 3RYPA 3RZGA 1W9WA 1MZ6A 4AVSA 4PT6A 2FDKA 2ZBJA 1MS0A 1NXD1 1LHWA 2JX9A 1W6PA 2GH8A 1UU6A 3H3LA 4J25A 4URTA 4B3NA 2B4KA 1IG3A 4DO0A 5CB7A 1GNZA 3A22A 1RUF1 2E31A 5FPUA 3TEXA 4M3CE 1RUI2 3ZYJB 2JIJA 2D3SA 4M00A 3OD0A 4QX5A 4R9BA 4ATEA 3A4UA 4Y5TA 4Y22B 4XFGA 4IE4A 3B7MA 3EJKA 2GU9A 4AR2A 4D3WA 2O14A 4QXBA 1SLTA 1OOPB 4SLIA 5FRAA 3AZYA 1I9RA 2EICA 2KA3A 1QJY1 4Q4V2 1ZZ8A 4JV4A 1UZYA 2B5HA 4TTGA 3ZDSA 4P14A 1W99A 3S7IA 3WDWA 5HXVA 4HKLA 4F3JA 4H7MA 2J1SA 4RQPC 5L7OB 1LHUA 4AFMA 1NQJA 5FYHA 1M4WA 2W1WA 2XG3A 2VZTA 2HWC2 2R061 4WVVA 4CEWC 1S2EA 2IXJA 4JTNA 1GQPA 1OXCA 5GZCA 1WCUA 2AH2A 4ISRA 2BNOA 5HI0A 5CVRA 3LWCA 2VZPA 4HSJA 4LO6B 4QPGA 2VZUA 4XMAA 1T6GC 5JXGA 3BOWA 4JGZB 4YVSA 1RUD1 3R4UA 3VBHB 3GHNA 4IV3C 4KGGA 4XAEA 3VBFB 3KGLA 4EWAA 4Z2AA 1WMXA 2PA7A 5M0TA 4LO5B 1HRI2 2C9KA 2EALA 4OUEA 3OJBA 4KU7A 2DF7A 4LO8A 1AR83 3DF0A 1WD3A 1NG0A 1HB2A 1WKYA 4NIAA 1F35A 2VNVA 4K1ZA 4K9SA 5D8AA 1VBB2 3GXUA 3OBZA 2GC1A 3D3AA 2JDPA 3KLSA 4RGAA 1LHNA 1Y4WA 1R083 4AAPA 1EPWA 3U1XA 1XE7A 3PU8A 2VVEA 1Q8QA 2F4LA 1UX7A 4CP9A 2PHLA 5G04L 5I8TA 1Q43A 1JYIA 3KV4A 2P34A 2QQLA 2OUHA 2Y6FA 4GKYA 2DVBA 4XBNA 1UU4A 3FFZA 1DQ1A 4EWEA 2XJUA 1OUSA 4QKNA 2C26A 1AR92 3H1MA 1M06G 1V70A 4V1PA 4MGYE 3KHBA 4NVPA 1NCQB 1NCRC 2GC3A 5CU1A 2ZZJA 2CDOA 3HWJA 3ZX7A 1JU4A 2WNUB 3ORJA 4SBVA 4RSUA 2P17A 4K6BA 3Q9OA 2W5FA 3KV5A 2PHWA 4CU7A 4YM1A 2J1TA 2FCVA 1VAMA 1CD3G 3KT1A 5KHHA 1G8WA 4CEYA 2JG9A 5JOWA 1MZEA 4AI3A 3THPA 4Y3OA 3PMSA 2DBNA 1SDDB 3M2MA 4D7SA 5TSWA 3Q8BA 5GKAC 3UJQA 2AEZA 1HV0A 5DPNA 4IEPA 1RVF1 1OPMA 4FPFA 2JDMA 2QUOA 1RUG2 2CHHA 3OYWB 4GIQA 4LHSA 1VBE3 4Q27A 5FPBA 5GZFA 1S0JA 5KXCA 3H8OA 1ULOA 4QQOA 1PM4A 3WW1A 3I97A 4BM8A 5A3LA 2JD9A 5FO7B 3VZMA 2X09A 3URFA 2GMPA 1U5YA 3I2KA 3LQCA 3POWA 3U78A 5FUIA 5K4LA 1OSGA 1WCDJ 3KT7A 4NHXA 2YMZA 5JOXA 4E27A 2R071 4YW7A 4JGYC 3MPBA 2ARXA 3AXEA 3CU7A 5AFBA 1REFA 1YI9A 1RUC2 1YIPA 1WD4A 1RXGA 4B7EA 5FDBA 4R52A 1RHI1 2WAOA 2VNOA 4QWNA 1MEC2 2QQVA 1APNA 3OG2A 3J7MA 3VKOA 5K9YA 3VV1A 4CCEA 2ZACA 3B3QE 3AMQA 1DIWA 2D93A 1RUF3 2K46A 1BZWA 1RUE1 3PLQA 4IEZA 1LR5A 1AYN1 1CESA 1PVC3 1QJFA 1XNBA 2VH9A 1VE0A 2ADDA 4QHZA 3VHPA 2TNFA 1W6MA 1H4GA 2WO7A 4BQ4A 5A3PA 3PHMA 2QQKA 3AC0A 4XF1A 4DXSA 1K12A 2QQWA 3VUOA 2R16A 3ZFGC 3ZIXA 5BNNA 2NMOA 3CJIA 1G9FA 2PYTA 1VALA 1R1A2 4JDMA 5A7OA 2JG8C 3WDYA 4N90A 2VBPA 2VD7A 1YHFA 1XE8A 2OUJA 1G9DA 2ARBA 3KCYA 1OURA 5FXWA 3WQBA 1VLNA 4AVAA 4BDVB 5LB6A 2NLRA 2BGOA 4XABA 5C8CC 2JDUA 4FPEA 3MHZA 1W6OA 3GCWA 4ZS3A 5FR3A 3DPRC 3PVNA 1WCQA 1X8MA 3FHAA 4FPJA 5LA2A 4C0BA 3BIEA 2QBXA 4ASKA 2YDEA 5GM0A 2KXLA 2W1QA 1K5MA 1WW7A 4CDWB 1VRH3 1OF4A 3M3CA 4YW5A 2UWAA 1QDCA 3PTYA 5ANNA 4Q1RA 5F2SA 1YEWA 4IUGA 4XFIA 5FUNA 4AHYA 5AC93 3NNGA 1UY0A 3HQUA 4YZ3A 5LEKA 4COZA 2CGOA 4XCAA 5EPAA 4AVVA 2C6SA 4UF0A 1LGBA 2PHTA 2SLIA 3B93A 4COVA 1F2NA 3H1WA 3SISA 4M0HA 3SCHA 1ZZBA 3QH7A 2DV9A 3GZTB 3MPPG 5FZHA 4PBPA 4XUQA 1FNYA 2XL9A 4CDQB 1MQTA 3K3OA 1R082 2BYVE 2P6HA 1QH6A 4BLJA 5LK7B 5BNOB 1UO9A 2DUQA 4WM7C 1YFWA 2QFEA 4AFBA 2P2KA 5BNPC 3T1LA 1LCLA 2E7QA 1IKQA 1UN1A 3OUIA 5IWFA 1JH5A 3WNOA 1S4CA 5ABJC 1GZWB 4N53A 5JLVA 3WCRA 2RV9A 3IPVB 3LEKA 2UU8A 4TZDA 1OA4A 3U4XA 1YC61 4AEDB 1C57A 2XGXA 4KQ7A 3H1YA 1W8TA 1UZWA 4PI0A 5C9AA 5I8YA 3EQEA 5FCCA 2C1FA 4QPIA 2D6OX 3MIDA 2X05A 1YWKA 4QM8A 2VUJA 1XOYA 2Q8DA 4HN0A 1HLCA 4CTEA 1R093 1COV3 2K9ZA 4OULA 4M0NA 3ZM8A 1FMD1 3H7JA 5FPXA 1A8MA 2JB8A 5FMOS 1JZ2A 1NZIA 2BUKA 4W4ZA 5APAA 3RMYA 1GWKA 1URXA 2IUWA 2JKXA 4IEQA 2DCYA 3LSDA 3FMGA 1PK6A 4MGKE 2WABA 4QAWA 1DP0A 2QTWB 3AP9A 5BV6A 1RMU1 1VBE2 2F6BA 4PIYA 3VD4A 4LHLA 3L2YA 1AZDA 4XHXA 4D8MA 2XPJA 1Q8PA 2X29A 2MEV3 3ZSEA 3DKQA 1H1IA 2RS11 4YVWC 2J1EA 3VBSC 1I3HA 4ES9A 5FJHA 3N7LA 1C28A 3W9AA 1ND2B 2WL1A 1G7YA 1LOAA 2R32A 2Z69A 1JYWA 4IESA 1VB4A 2Y0OA 4I3GA 4XAAA 4AE2A 4EZHA 5SV5A 1CGPA 4UFHA 2ZX1A 1AHSA 2IVJA 2ZKNA 4X6RB 5F6LB 3W5MA 1VMFA 5C3QA 4A42A 3ST7A 4A7ZA 1FI2A 1QF3A 2C5DA 1DGWX 1KEXA 3O1TA 2DVFA 5FQ0A 1BK1A 1KS5A 4ASMB 4QDQA 4ITCA 2JG9B 1EYBA 3I2GA 3NAPC 5BYNA 4HN1A 3V0AA 4LITA 4DRRA 2ZX0A 4XUNA 4YWAA 3UL2A 4Q4W1 3ZN6A 2VTXJ 4I02A 4CU6A 1WWYA 5A32A 1EUTA 3ACLA 4N9IA 4CCJA 1ZZ7A 2WSVA 4XFHA 2FHRA 4RR3C 3ASIA 2Y64A 4MSVA 3UJOA 4C8DA 4GZ9A 3NNLA 5FWJA 3IM0A 4LQRA 3T2TA 3I3EA 5A1FA 3CMGA 1NA1C 1SHWB 4LBLA 1H1MA 2V5YA 4E4SA 1GMMA 2W9XA 3GZAA 4KWLA 3VZLA 1K5JA 3CBNA 3T2OA 1JOPA 2BBAA 3GCXA 1DQ5A 5JOYA 5GJ6A 4UYBA 1W3XA 5DUVA 5FZFA 4PJYA 4D6SA 4DUXA 4JKKA 1RUI1 5EJZB 4CU8A 4XBQA 1V9U3 1UQXA 4XF4A 1BKZA 3BPSA 5A7SA 1VRH2 1JZ4A 4BJ0A 4GB31 1WCKA 1SFPA 3EB7A 4YZ2A 4YG6A 2E63A 3U11A 5AC92 2XHNA 1LGCA 1RC6A 1QJX3 1AR73 5EFUA 1O4ZA 5EIYB 2YPJA 5DDJ3 5ERLA 1I6XA 4PQQA 2QQNA 1OFSA 2V4AA 1SCSA 1O8SA 3BGAA 3HNYM 3ZYIB 1HXS2 2A3YA 4PBOA 1GYKA 1LB2A 3IWZA 5I0TA 3S5QA 3AMMA 1BXHA 1GP6A 2HWC1 2B42B 3CJIB 1GNHA 5A3TA 5I0UA 1JOBA 1QJU2 4NROA 1RUJ2 3WP5A 2XOMA 3GF6A 4OYUA 2HLEA 4HFSA 3GBFA 3WW2A 5JXJA 3JBG3 4I3PA 5JPNB 5CKMA 1JYTA 2R6QA 1H8TB 1DU3D 1H1AA 4I0WB 1QIQA 3H8XA 3PU3A 5T52A 1GOGA 4YG0A 5I93A 1SFNA 2VO5A 3HBZA 4IV1C 4PF1A 1ZBE1 5I0RA 1FXZA 1HRI1 3PUHA 5DAPA 3CIHA 1SLIA 2DVDA 1J59A 3MV11 4QX0A 4XQDA 5HXMA 3VKNA 3N9PA 1W0OA 3OGGA 4PLOA 5C4WC 2GC0A 2B39A 2G9FA 2AR6A 1R092 3ZXFA 1COV2 2ZXQA 3W20A 1NUKA 5IFPA 2E33A 3PVBB 1S0DA 5F37A 3LOIA 4K8FA 4OUSA 4QX1A 4AEJA 2Q8CA 2VR4A 3T0DA 1SPPA 1STMA 4B4PA 1HV1A 1PNFA 3MIHA 4FPKA 3TAYA 3N4MA 1MZFA 2GNDA 1JTZX 4YW1A 3WLUA 2SBAA 4EN8B 1JMUB 4BMBA 1OA2A 1V6IA 5A3NA 2W47A 3P6BA 2MEV2 4RA0A 3T30A 4D7YA 3O0VA 3NV3A 1AR91 4UWDA 3RWNA 5A1AA 4QX2A 2ZMLA 1C1FA 1VR3A 1ODMA 1S0EA 4XXAA 1SFYA 4O7XA 1J3QA 5HCFA 2YY1A 3BCWA 4N43C 3LE0A 4QX3A 1L7LA 3ZSJA 2BU9A 3FUOA 4BK5A 4KMQA 1DQ0A 2H6BA 2VMHA 4QXCA 3I59B 2B9UA 2Z4FA 4IL7A 2QQOA 1BMV1 2W95A 2ZZQA 1X82A 2VOXA 5FZ0A 1DYKA 2ZGQA 2RS31 4LK7A 4BXSV 5JMCA 3VZNA 1RINA 4Q4Y3 2Q8OA 4K1YA 2VOWA 2IFWA 3FL7A 1RUG1 1EUUA 4HETA 5CISA 2PN5A 1H9PA 1VB2A 3FZ3A 3POGA 5FY4A 1EV13 1FPN2 4OHZA 4HVRA 5FY8A 3VKLA 3ZFFA 2ZEXA 3BU0A 1FT9A 5JSRA 2HYXA 3BTXA 1WCSA 1LEMA 1OOPC 4DB5A 5DMYA 4M4PA 3PUIA 4FOVA 1US2A 2E53A 5FMBA 3VDCA 2RJ2A 2Y60A 3EHKA 3NKTA 3LEGA 5LRRA 1IS6A 3CQOA 3ILRA 1DZTA 1JU3A 1RUC1 2A6XA 2HBUA 5EJ3A 1GZ9A 2ZHNA 3HR9A 1QWRA 3VBOB 2AYHA 1TME2 3J9SA 1MEC1 5F5IA 5FZLA 2VCCA 3M3EA 4GALA 5IVVA 2BVVA 3N36A 5CNAA 3O1RA 2W0XA 3T2QA 2Z79A 4XUPA 1ST8A 1S2KA 1V9U2 1F9KA 1NXMA 1XPWA 2XVGA 3ZMNA 2GNBA 1LKNA 4I0BA 2AREA 4JGZC 4HKWA 5IVYA 2BP6A 4IEUA 3VBHC 1BJQA 2D7FA 3VBFC 4FPCA 3CNAA 3FFQA 3JZVA 1QJX2 1AR72 2TBVA 3K2OA 3SLIA 2JB4A 1D4VB 1SLBA 4P5HA 3R4DB 4ZONA 1A78A 2KR2A 1OLQA 4OMCA 3JUUA 5FYMA 5H9SA 2E32A 4JX0A 4AQSA 1HJGA 4Q4V3 5JIUA 1PZ8A 3MFCA 3PDQA 4H2AA 4NJ4A 2D43A 4EZ4A 1PO22 3AKQA 5EWSA 3VBRA 3QACA 4XJ8A 1PGL1 3NSTA 1O5LA 1QQP2 1QU0A 4XILA 1H30A 4AHZA 2WFF3 1LULA 1LRHA 5BY5A 3HOBA 5J98B 3WDTA 4OUMA 4PLNA 3JBG2 4BQ2A 4CUCA 3VDDB 2XB6C 2XLAA 3WUCA 2NMNA 4BE3A 2VOKA 4MGIE 3HPNA 2PQQA 2ILMA 3GHMA 3KV6A 4MGQA 4TN7A 2VJXA 4HPKA 3G6JB 4NE9A 3ZMOA 4HKOA 4Z2WA 3HN3A 1AXYA 4WVMA 3VN4A 3LA3A 3GZUC 4LEJA 2YC2A 4JHTA 1NCQC 3APBA 1B35B 1HRI3 1J1TA 4ZS2A 4DQAA 3SNMA 4LBKA 4IDZA 1ZA4A 2GN3A 2WNUC 2W2IA 5HV0A 3KQ4B 1CN1A 1QKQA 2UYBA 3AZXA 3EBRA 4LA3A 1AR63 1SDWA 1CAXA 2VM9A 2R49A 4J1WA 2XXZA 3AZWA 1R081 3BIWE 1VBB3 3LFIA 2CAVA 5JZGB 1VPHA 5F1RA 4LBQD 5FZEA 1RJ8A 4FPHA 3BTZA 3WP4A 4UBHA 3RI8A 3ZOIA 5CIRA 3IKWA 1UXZA 5L19A 3KF3A 1HDKA 1F15A 1OLMA 4H3WA 2WIIB 1DGWA 5E6HA 2CL2A 2WINB 3NQHA 4CPBD 1TVGA 2A73B 3R6SA 2PAMA 3OTFA 1PZ7A 1FYUA 3VDAA 4LLFA 4MO3M 3DGTA 1YLLA 1SACA 1GQGA 1GP4A 2VZSA 1OKOA 2Y6LA 4LULA 2MNGA 5FYZA 2CYFA 1PMIA 1WLTA 1CAWA 4IEXA 1VAVA 4LPLA 4H14A 5KHKA 2B8MA 2ERFA 3HIFA 1K45A 2DFBA 5GLWA 1NE6A 2RJLA 3WF4A 1MPXA 1C4RA 4YGDA 1SZBA 3ROUA 1EY2A 1AYM3 3E6DA 4FXGB 4IGPA 4WZCA 4XFBA 1W39A 3NRUA 2RR12 4P9IA 1GBGA 1XJAA 4S2HA 5F39A 1I1EA 1F8VA 4TLFA 3POEA 4D69A 3M3QA 4GMP0 4DY5A 3L2HA 1DYPA 5FZOB 2VMEA 2DVGA 4GH4B 3AL6A 3IBMA 4Q4Y2 3OOXA 4G4FA 4Z82A 4KI5M 3WXPA 3MO4A 2QQIA 2J22A 4NAMA 2YV8A 1VBE1 5I8SA 3KM5A 1EV12 4CYDA 1YFUA 2WQZC 4FQ4A 4XQWA 5A6XA 4Y33A 2ZMKA 3LFMA 3WT3A 2PXJA 2QCSB 3Q8EA 4I30A 5JPMB 4FT8A 4X6QB 1KFXL 5HCBA 1POV0 1QXPA 4WM8B 4L9BA 2FDJA 4LUMA 3T4HB 1ENRA 4XF0A 1MVEA 5CFCC 4JKLA 2WN2A 2WKKA 5JAXA 5T54A 4Y1YA 4M3CB 2FDIA 1OUXA 1LODA 2P3JA 2WDBA 1K42A 2ZS6B 5F3CA 4OI2A 4O65A 5FK7A 5KHJA 3MW4A 3TEYA 2BGCA 4M4RA 1ZRDA 4IE7A 1IOAA 5DXDA 3SXWA 1MEC3 3N9OA 4LA2A 3ECQA 4FPLA 2K0GA 5D1IA 1PHMA 3MLKA 4YPJA 2DUPA 4LKDA 1X33A 1Q8VA 3NV4A 5FY9A 2R0FA 1N47A 3FBMA 3PVOA 4LBMA 4LTAA 4TWTA 3IDEA 4OZXA 1PVC1 2GMEA 4U36A 4BU2A 5I91A 4CDWC 2O8OA 3LA7A 4Q0VA 3O1VA 4AWDA 4RYDA 4QKFA 2VZQA 4MADA 3RMXA 4E4HA 3DN7A 4PDWB 1CIWA 1POQA 5C5UA 2PAEA 1O3TA 5FZGA 1JZ5A 4AHXA 1C8NA 1HQLA 4TSVA 3T0BA 2G4IA 2LROA 5FV3A 3MIBA 3THTA 2DDUA 2IXCA 3IMMA 2VZOA 1R1A3 1XBFA 2WWJA 2A5ZA 4NIHA 4CDQC 2XQXA 2I45A 1QXJA 4IEWA 4W6YA 5B4XA 5BNOC 2WFF2 1UZZA 3NNJA 1DZRA 4LHKA 1W6NA 3FLTA 4UFLA 2VCAA 1IPKA 1DQ4A 2BWCA 4DY3A 5JXHA 1IPJA 1DG6A 4RQPA 3NKGA 4OFGA 4H7LA 3IZOA 1VRH1 4LIUA 1YQ2A 3V65A 3N9LA 2RS53 4G9SB 1OC1A 2XR4A 4AEDC 5AC91 4CEWA 3RSJA 2W39A 1VBA3 3O0WA 4J1XA 3ZXKA 4F8AA 1AL22 1WLCA 2VTXA 3RFRA 4C1XA 1CAUB 3M3OA 1JXNA 1W9SA 2C24A 3VHRA 1HIXA 4QDRA 2J1RA 3M4FA 5LRSA 2DUOA 2OQ7A 4BH9A 4IV3A 5FOBB 1AR62 5FOJB 4HXCA 1DLLA 4BLIA 4MOAA 4OI4A 2CSGA 1KDMA 2BEOA 3NL1A 4MHRA 4GJZA 5L73A 2EXHA 1XNDA 2CDPA 4Q29A 1AXZA 4XMIA 3WDUA 2TUNA 4IE5A 3LAGA 4AVTA 2X8KA 1ND3B 3GJBA 5A7WB 1NLQA 5FP3A 4K3UA 1W2TA 4BZ4A 5HV4A 2A75A 4DXZA 4MX3A 4ES8A 4OI1A 5JR2A 1W6QB 1W90A 4P00B 3RS6A 3AMNA 5IW0A 3C7GA 2A70A 3AZVA 5KC5A 2O8QA 4XIKA 5GLZA 2LUWA 1LHVA 4XE9A 3ACHA 4DS0A 1GICA 3RI9A 4NUBA 1ND2C 2WR9A 1LNSA 5LBBA 1BHGA 5JUVA 3A21A 3BODA 4BQ3A 2I07B 5FZDA 1CZTA 1L7QA 1OQDA 1XNTA 5GALA 3WOGA 2QZ2A 3OF1A 4A2UA 4H55A 1R091 3VZJA 1AYM2 1COV1 1KXGA 3B00A 4YZ4A 2H0VA 4AFCA 3K48A 5DUXA 5LBCA 2HH9A 2VZVA 2XJPA 2D40A 3MW3A 4Y24A 3USUB 1NCRA 2XJQA 2HWD3 4QQLA 5JWPA 3I2DA 3C7FA 4DNYA 1CAXB 4M3CF 4QDSA 4UFJA 1JHJA 2JG9C 1O59A 5CFDB 3AP5A 4I2OA 2W52A 5FPLA 4CVUA 2WWSA 5C3SA 1W2NA 3B9IA 4PI2A 2MEV1 4AEKA 2WT2A 1C8M3 2ZMNA 1DFQA 1YYNA 3ZFEB 2XJRA 3AKTA 3U75A 4CDUC 4C90A 5D2AA 1LU2A 2W91A 1PMHX 2E6VA 1A6CA 4JAAA 2Y8KA 4M01A 4HANA 4A45A 1GZCA 2VE1A 1YQ8A 5FZCA 2YBKA 4RS5A 4NN0A 5IK7A 2DYCA 1OLME 2OIIA 2ZGKA 3C8XA 3KCCA 4FFGA 2BGPA 1X9PA 4NRMA 3UKVA 1KJRA 3AMPA 1H2MA 3D6EA 5FO8B 5GLTA 2WNEA 2OQ6A 4JGYA 5JXIA 3QLQA 3DYPA 4HONA 5F5QA 1W0NA 1GR3A 3FN9A 4FO9A 3DCQA 3A7QA 3NJZA 2J1UA 2GP5A 4K20A 4CRQA 2EF6A 3IB3A 4GWJA 4W6WA 4AI9A 4BWOA 3ZYBA 1D2SA 1I5ZA 3BALA 3AJYA 1WGPA 4CE8A 3RZMA 4ZU5A 4N7IA 2ENRA 3ACGA 1C5IA 3PJYA 1YQCA 1HW5A 4GAZA 1GNYA 4LO7A 4QQPA 3AKRA 3H0OA 3AYCA 5FPZA 1WA4A 3VBUB 4S2FA 3HJRA 4LBNA 5DN2A 3KGZA 3IAQA 4Y20B 5A33A 2WNVB 4B8EA 2CY6A 4DRVA 2X5IB 5DAQA 2VZRA 2RDNA 3CJIC 3FBYA 3OBRA 1YJKA 3WDVA 5J96B 3ZFGA 4GXLA 5CG8A 1LJ7A 1TNFA 1GLHA 1E5IA 1SBEA 2V5DA 1W2OA 2WQ4A 3DL3A 4LXLA 5LATA 1Q56A 4LIVA 2JG8A 5A7QA 1LHOA 1V9U1 4XJAA 4O9GA 3ZXGA 2D6PA 2Z5WA 1ZZCA 1V6KA 3U10A 1BVVA 1H8TC 2JECA 4EYUA 2RS52 2PLV3 2YBSA 5JI9A 1GOHA 1W6PB 3O5SA 4E8DA 4W50A 1VBA2 5T5PA 5A7NA 4EN9B 4X8PA 5C8CA 1QJX1 1AR71 1RGSA 2WO1A 3AYDA 5DDJ1 4B29A 2PFWA 2GN7A 4XOGA 3VZOA 2WLQA 5CYYA 3UETA 5ACA2 1DQ6A 5GZGA 2J42A 3DPRA 5KXBA 2XKOA 1H2KA 1XU1A 2JDHA 2YB7A 3ES1A 4XUOA 3WZ1A 1UW8A 3SCGA 2R1DA 3H3ZA 1WW5A 3THCA 1HXS3 2XJTA 3MEPA 1DDLA 4NHLA 4P9GA 4E9KA 3MIFA 3IN9A 3USSA 1XSQA 2YFZA 4IERA 4Q8KA 2GDFA 5T5OA 5LCWL 2UY9A 3ILNA 3CZJA 4EN7B 3WSOA 3UNPA 1QJU3 1RUJ3 3WG2A 4CCDA 4CDXA 1WLWA 1O6UA 2PAKA 3FX3A 3JBG1 4PF5A 1VIWB 2AUYA 4D94A 5IK4A 5LA9A 2IXHA 4DZGA 3KS7A 5C70A 1LOCA 2OPKA 5FPAA 2CTVA 2B9VA 1F5JA 1G86A 4L99A 4WM7A 1ZRFA 1LU1A 1NYWA 1JZ3A 5BNPA 1PGW2 1QNWA 2VULA 4QPGB 3GBGA 4ZZ5A 3DEMA 5ABJA 4OZOA 2BFUL 4XF9A 4YVSB 4P02B 5A3OA 3UGFA 2WO3A 3CDZB 3KD4A 2IWGB 3EO6A 5FYIA 1YFYA 2OZJA 3SMHA 1X9TA 4BQXA 3JD72 1IZ3A 1XNCA 1PO13 4LNVA 2HWD2 1UNBA 2BTVC 2D98A 2P4EA 5F6KA 1CR7A 5D8AB 1PIV3 3MFAA 2Y0IA 2UY8A 5JR7B 2HEWF 3S30A 4D0QA 5F9TA 3AYEA 4DEVA 2A1XA 2QKDA 2XVKA 4IEOA 1C8M2 2EA7A 3HT2A 3MLLA 4Q1PA 4RL7A 4UOJA 2FCTA 1JYCA 2MHFA 3B69A 2D6LX 3ZYRA 4CP9B 1JZ8A 1V0AA 3OY8A 4AAXA 3WNMA 1OD3A 1WLDA 1O3QA 1WMEA 1YCIA 3J26N 3CL1A 2VNGA 4FPOB 5FXXA 2DFCA 4OCTA 3RZHA 2C4XA 1NAEA 1WW6A 4QU1A 3OBTA 4YVWA 3VBSA 1VAKA 1IG0A 3VBOC 5FP8A 5FYBA 1D0HA 3B9CA 5I0DA 1FNZA 2RMU3 3QBQA 5EQUA 4AVBA 1UPIA 4Q4Y1 1S0GA 3WD5A 4CEYB 4BIOA 2R7EB 1NY72 3RRDA 2P3IA 3SEPA 4GA9A 1EV11 2NQYA 1UOJA 2EIGA 4WBBA 5CZKA 4XHBA 4AF9A 5A1LA 1LENA 4XYXA 4FAGA 3I3BA 3CLPA 3HVDA 3NVCA 3PL0A 4JQTA 4LMFA 4MLOA 1FPN3 5DQ0A 4YW3A 1IQAA 1W9YA 2BNNA 2ZABA 2WS93 3I8TA 3OSDA 1JYNA 5HCHA 1LECA 2HWE3 2XDVA 4JRLA 4KBZA 4A4AA 2VC9A 2VW2A 3NAPA 5FXVA 4A6SA 1OI6A 3BU7A 3TYJA 2JDKA 4TXWA 4DPNA 4A7KA 5K7PA 4AXOA 4OHVA 4ZZ8A 4BA6A 1N1TA 4MGSA 4HLTA 3I54A 4Q0UA 4QKBA 3AK0A 3VD9A 4XETA 2ADEA 4FOQA 5LBEA 3MW2A 3W21A 1V6OA 4GMP3 2YZ4A 4AFAA 1JODA 4NO4A 4NPLA 3ZXAC 1PX4A 1TME3 4RR3A 1D2QA 3KF5A 4RHV2 3QOPA 4RS5B 2ZX4A 3AP7A 3VDDC 1S2BA 3FUQA 4QGMA 1ZRIA 1NA1A 1OH3A 1HQWA 2Y26A 4Q26A 2WO2A 4YW6A 5LA1A 1EPZA 2PLV2 2VL4A 3C7EA 5IATA 1U5ZA 5J09A 1RUOA 4ZPIA 5KXDA 1POV3 5IVFA 2KM2A 1K3IA 3D8CA 3POYA 2YGMA 4YM0A 2GH2A 1IQDC 2R1BA 1CX4A 1VBD3 2ZGNA 2PHFA 4XPVA 3H9AA 5ANQA 4BHPA 3BI3A 4P08A 1MS8A 1B35C 4Q4V1 5FZ4A 2ZGMA 2R062 1N1YA 3OD4A 2EIBA 3WF0A 4QHBA 1W6MB 2Q1FA 4FCAA 5C3PA 2D5FA 2OT7A 3O1SA 2ZJCA 5F32A 3E6BA 4HOOA 4FTEA 3TNPB 1NT0A 1PO23 5CKQA 2WBKA 1KD7A 3S57A 2VGDA 4EE2A 5JZGC 2WFF1 1CAVA 1Y7BA 5E88A 5BNNB 2DCJA 2MPFA 4MVTA 4DMIA 3LKJA 4OQ8A 5FREA 3ACIA 1QQP3 3ACFA 1RUD2 4PLMA 4IGOA 3AXDA 1W3VA 1DCSA 2WZR3 2Q4SA 3NO8A 4DXTA 3RZZA 3THDA 4COUA 1Y9QA 3LD8A 4A44A 3WNLA 4UFKA 1W6OB 2LRPA 5JSOA 1Z78A 1BCXA 1TEIA 3M7AA 1AX1A 2QQMA 3I3MA 2OKXA 2Y33A 2C9AA 4N7UA 4WZFA 5FYVA 4Q0SA 2XUMA 4CUAA 4UBGA 1K5MB 1FOD3 2ZHLA 5FIXA 1QOTA 3Q8CA 1NLSA 3WINE 4CCLA 2WT0A 1AR61 3ZVXA 4DFSA 1SLAA 4P9JA 1VBB1 1JUIA 1EP0A 1ULPA 2BW8A 3JB8A 3KCXA 1PO12 5J3UA 4IV1A 3HQXA 2YFUA 3WQ1A 4UF0B 5LZ6A 2JE7A 3TRSB 1Y3TA 2JJ6A 3HNMA 2DVAA 3LZZA 1PIV2 4GH4C 3LPFA 3ZYHA 2DURA 4ORFA 5C4WA 2PHUA 1XYOA 2RM23 4QGLA 4XQ4A 3TN92 4OQ9A 1MQTB 1HKDA 4XEZA 2WQ8A 4Y1VA 2BJSA 3A0NA 2WYFA 4S2GA 3LB9A 4UW6A 2ZGRA 1AVBA 4F83A 4JKMA 4AVCA 4EN0A 3PMEA 3POIA 3ZXEA 3ZLIA 2X53S 4YYOA 4CDXB 5F2WA 1NZCA 4WM8C 1BBT3 3RYKA 1RTVA 4AK3A 4N53B 4ATFA 1TQ5A 4IE0A 4YZ1A 3I3QA 3H8UA 4NPRA 1U5XA 2IXKA 2X10A 2YGLA 4FXKB 4LBQA 4XFAA 4C1WA 1F5FA 1TZOA 1AYM1 5C9AB 1W8FA 4GKXA 2NM1A 4MGZE 1GU3A 4LE3A 2EXIA 5A80A 1J83A 2Q30A 4CPBA 4QPIB 1HQNA 1RVF2 3UK9A 1SLCA 2RR13 5E16A 1UXXX 2ZGTA 2H0BA 5FY5A 1QY4A 4FFHA 2RMU2 1AJOA 2ORZA 2BOIA 4FI9A 4K8RB 4Q8LA 4XFCA 1JI6A 2BZDA 4ASLA 4HK9A 4N43A 1W0PA 2VZ3A 4KU8A 4BB3A 3Q8AA 3JU9A 4B4QA 1E5SA 1H9WA 1P8JA 3E5QA 1J3PA 2WS92 3GNEA 4PDWC 1H8VA 2D3PA 2EIDA 1N3PA 1PK6B 2HWE2 3O0XA 5F3IA 2XWBB 4QB2A 4XJZA 3ZXJA 4JC1A 4YARA 2ET1A 3OPZA 3SCFA 4NHKA 3LDKA 1G9BA 1X50A 4FTSA 5DZEA 3GGLA 1BEV2 3NJYA 3WW4A 3DYOA 4RGKA 3CEWA 3OY8B 2ZEWA 4Y22A 4RFRB 5L7OC 3R05A 4PCRA 1E5HA 2EXJA 2VNRA 2VQAA 5LW9A 4R9CA 1J3RA 1DF0A 2JWPA 3FLPA 2N7GA 3WX5A 3T3YA 1AYN2 4AI1A 2VBBA 1PZ9A 1QJEA 1RJ7A 1OVSA 5LA0A 2XKPA 4Q0QA 5J48A 3HNBM 1JHNA 1YFXA 2F4PA 2ZGPA 1FAYA 3DKWA 1WUVA 1CIYA 1RUNA 5FQ0B 2QE3A 1HN0A 4WV8A 1GQHA 1YRZA 2ZX3A 1CJDA 3ME2A 1VBD2 3IMNA 4KH9A 4Q4X3 4Z92B 4E4DX 3V0AB 3K4ZA 4FQZA 4AGVA 1ULDA 2VMDA 2JDZA 5F5AA 5FYSA 4HVOA 4JGZA 1R1A1 3HT1A 3ZN6B 3VBHA 3NMBA 3RWKX 3VBFA 2WSUA 5A32B 1FV3A 2R0HA 3INAA 1DBNA 5IAVA 2DU0A 3WNPA 4RD7A 5J7MA 2CWSA 3PNAA 1SMVA 2J1VA 4I01A 2BOJA 3SC7X 4OHWA 3AVRA 1ND3C 2W1SA 4XZPA 1DGRA 1DHKB 2WZR2 3OBAA 1S55A 3SQOA 1YNAA 2G1MA 3LDRA 2FZ2A 2RS51 4FVVA 4URAA 2V4VA 3K75B 3IAPA 2P5BA 1W2AX 1VBA1 5CKNA 1N3OA 2PMWB 1C3HA 2RDQA 5IVCA 5B4NA 2DCKA 4N9HA 1HB1A 4LT5A 1AL23 2CU5A 1FOD2 1Z7S3 5K0UA 4LBJA 2G9GA 1H2LA 1JS9A 3SITA 5IK5A 4LUKA 2XWJB 2VUAA 4XJWA 3VD7A 1OT5A 4XDOA 4N8MA 1QXRA 5JCTA 5E1RA 1HN1A 1ENQA 1B09A 5T50A 4JVAA 4CP0A 3PTRB 1NCQA 3RGBA 4MXVA 3LDBA 3RZKA 2RM22 3WY6A 2WNUA 1GSLA 2OPWA 3IDAA 2UWBA 2WAAA 1QDOA 4YGBA 2OYZA 1U0AA 1W8HA 3ENRA 5CFDC 4ET7A 2XQRA 4X8NA 4YRDA 1A3KA 3OEAA 4KG0A 4BQYA 2D6NA 2WLPA 2XVLA 3POJA 4QKDA 4BOWA 2VW0A 3W5NA 2YPDA 3POBA 1U5IA 4YG3A 3NW4A 5JOZA 1UWWA 3ZFEC 4QPWA 1PGW1 1BBT2 2BV4A 3HMYA 1LOFA 3DXTA 3IIIA 2VMCA 4MV2A 4AHWA 5CAZA 1VBC2 2VOVA 4PQ9A 4Y5Z0 4AQ2A 2YU1A 3CHXA 1S0IA 4YM2A 3OYWA 4MXWA 4XZUG 5FZ6A 2ZAAA 3HD8B 1XE0A 3VDBA 2XUEA 4W65A 1ZZ6A 5FY0A 3GYDA 2BQPA 1SBFA 2HWF2 4FSJA 4QGNA 5FTTC 3WHUA 5DUUA 3V64A 2ARAA 2D3RA 2HWD1 1MS4A 3VB9A 4A3XA 5C5TA 3I2IA 4E8CA 2YBPA 4AI2A 3FHIB 2RS12 4Y1XA 3BUCA 4XFFA 2AGSA 4Y26A 1ULFA 5FFOC 5BPXA 3WCSA 3NWKA 2HWB3 1C8M1 4FPYA 4BMEA 1SPPB 2WRAA 1OBNA 2VVDA 3OUHA 1AF9A 4BISA 3OGVA 4GULA 2XONA 2YXSA 3AM2A 3ELNA 5L9RA 2DCTA 2CWMA 5HPOA 4UFMA 3TNQA 3AX4A 1SBDA 1YQ5A 2JENA 1QOOA 2VCMA 5EXOA 5FY7A 3X29B 4XW3A 2VAUA 4CP2A 4DEQA 1UY4A 5CBLA 5FZ7A 1D4M3 3R0RA 1AL0G 5FXZA 3VBUC 1VRBA 4K7JA 5DAXA 3N9MA 1AJKA 4NRPA 2GMMA 2WA3A 3ZSLA 1RXFA 3ZXLA 4B1LA 5IAXA 1T2XA 4Q5OA 5JMOA 5F5CA 1XXNA 2WNVC 3H7YA 1EAH3 2X5IC 4GWNA 4E2GA 5IVJA 1QJZA 1IGOA 3IDCB 1DLCA 3PVEA 5A6ZA 5DZFA 2GZWA 1CONA 1ZVFA 5CFCA 3ZYPA 1GP5A 2Q1MA 1F4AA 3EYPA 3E1F1 4WVZA 2GAUA 3O1MA 1OMIA 3JXSA 3N9QA 3V0BA 3ZO0B 3SH3A 2VMGA 3LF7A 5C7GA 4MHUA 5JIAA 1CZVA 4Q4X2 3VD5A 3MYXA 2XHKA 2VZ1A 2JDNA 5LASA 2LM3A 2PTMA 1OHFA 3O1PA 1TNRA 2WZ8A 4FOWA 1OKQA 3ON7A 3E6CC 4ONUA 1TMF3 3JB4C 1V6NA 3ZFFB 2Q0AA 4CDWA 1WMFA 2O0OA 4AW7A 3CJXA 2W46A 2BVBA 3WV6A 1FX5A 2PHXA 5A6YA 1W8NA 4RGGA 5EHDA 3VZKA 3B5LB 3O7OA 4YSFA 1J84A 2VXJA 5LBFA 2R043 2CAUA 3UYJA 3WHTA 5GLUA 5A6QA 3GM8A 3MV01 4RHV1 2VXRA 3HAGA 4FP3A 4GB32 5JDBA 3VLBB 4LKSA 1ZRCA 1KJLA 3S5AA 1UY1A 1UOFA 1SG3A 2PLV1 4CDQA 5FMDA 1W04A 4MUVA 4COYA 3S6PA 4FPGA 3MIEA 4V2WA 2IFRA 2XBO3 1R64A 5BNOA 1UYZA 4YGCA 5FPVA 3AZZA 4Y4RA 4GWIA 1ULEA 4DXRA 4KG8A 3D0JA 1C1LA 5FWEA
chains in the Genus database with same CATH topology
3POSA 2P3KA 4PIZA 4QPGC 4C91A 2WZPP 2JICA 1Z7S2 1GZWA 4YVSC 4LHNA 2ES3A 4QXKA 5ACA3 2LTNA 1HXS1 3IPVA 2LALA 3AP4A 4AEDA 2NPIA 4HK8A 3VKFC 1YJLA 1X36A 4EWDA 5EYXA 1LGNA 1QJU1 1RUJ1 2A6YA 4UW3A 4ZXKA 2A6WA 1CPMA 2ZGUA 5D8AC 1W2UA 1Y43B 3VBRB 2VQ0A 5FLIA 1ZBE2 1YUDA 1ASJ3 1CVNA 4LO4B 4AI0A 1V6JA 3RDIA 2O1QA 3FE5A 1XU2A 2QZ3A 3G7DA 5FO9B 3LGRA 1REEA 1U12A 4HPKB 4AEMA 4DINB 3BB6A 5BNQA 1LOGA 2XLGA 2Z42A 3MI8A 3KMHA 3ATGA 4WVMB 1YIFA 1PO11 4BCUA 1OPOA 1PM7A 3JD73 4NOTA 5K0UB 4LE4A 1ND2A 3TBDA 2WA4A 2E7AA 1TE1B 4OLLA 1PIV1 1REDA 4HBNA 2HKXA 3MDPA 3TN91 1ZBA3 4B7KA 1RUH3 4CEYC 4YNIA 3CO2A 2HWB2 2YUEA 1IS4A 2GSYA 3ETQA 1LTEA 1R1ZA 1MS5A 1H2NA 2B45X 2CV6A 2BNMA 1D4M2 3N7JA 1NE4A 4NR1A 1HX6A 2IZWA 1BMV2 4L8QA 1EAH2 2RS32 3FWEA 1CAWB 3RG0A 2R30A 5FMOL 4CDUA 4P9YA 4MXWB 3MGUA 1E57A 2RMU1 3WUCA 4Y1UA 4AGRA 5JLVA 2P37A 4RS5C 1IKPA 3J8F3 5DG1A 5AFEA 5J37A 1HRV3 1KRIA 4HL0A 2ETEA 1IS3A 5A3MA 2OA2A 1FPN1 3MICA 1OD5A 3ILFA 2WS91 1MS9A 1MS3A 5T55A 2HWE1 1Q5OA 4HZFA 2XH6A 3MLJA 3WW3A 1TMF2 2QQPA 1BEV1 4LLOA 4E2QA 1LESA 1QMJA 1NLRA 2VU9A 3E97A 2DCZA 4DOUA 1O4YA 1YXWA 2WC2A 4GMP1 4ISQA 4Y1ZA 2R042 3J4UH 2GNTA 5BNNC 1TME1 2W68A 3RJRA 3WVJA 2RHPA 1OQ1A 5C8WA 2ZA9A 4RHV3 3GALA 4L11A 1IS5A 2HEVF 4EN6B 2XBO2 1POV1 2WFPA 1DGRN 4MH0E 5CFCB 4PIXA 1QJY3 1QGLA 1VBD1 1LEDA 3IT8A 5C6CA 3W59A 1V00A 3V0BB 1PGL2 1K5MC 4YFZA 3ZN4A 5LEJA 1O7FA 3AFKA 1H8TA 4KNCA 2R063 1UIJA 2ZCWA 4KBBA 4NWWA 3UKNA 4AI8A 5KXEA 4XIOA 1PO21 4A7YA 3WG1A 2YYOA 4R9AA 3D82A 1RITA 3ZPYA 1QQP1 3A0KA 1V6MA 4BQ1A 3B94A 1RUD3 2WZR1 1UCXA 5JVVA 4U2AA 4EV0A 1MQTC 1MR5A 3UKTA 2ZGLA 1YI7A 1OFNA 3B02A 3IIAA 1ASJ2 3ZSMA 2WT1A 1Z0HA 1W6NB 3PJQA 1L3JA 1AR82 2XL7A 4CDXC 2D44A 1ALYA 1AXKA 2XLFA 4AQTA 5EYYA 5KHGA 3ES4A 1A8DA 4RQPB 4N53C 1O5UA 1FOD1 2GNMA 1OQEA 3AFGA 1CJPA 3C3VA 4CEWB 3TOJA 5KC6A 1O4TA 3ZN5A 4HSLA 5C9AC 5C33A 4QPIC 3C2UA 4P9LA 1ZREA 2PELA 3WUDA 2RM21 1ZBA2 4IV3B 1RUH2 4HVQA 4E4ZA 3WP6A 1S0CA 4AFDA 5KBFA 3E6CC 4KGQA 2VY0A 3TN93 4QQHA 1WW4A 2CNAA 2DWRA 3I59A 3L9JT 4FP2A 2D6KA 2ZKLA 2A3XA 2YHJA 5L36A 1BBT1 1PK6C 1X7NA 5K8SA 1UIKA 1VBC1 3FC0A 2ZGOA 3N3HA 3D4KA 4K40A 1NQDA 2DTYA 4FAHA 1MZ5A 2ZPXA 1G9AA 4RFT0 2VECA 4R9DA 4O9EA 3WQ7A 3D5OA 4CZSA 1XQNA 2HWF1 1CPNA 3RPQA 4FTBA 2RR11 3MF9A 2V73A 1ZYBA 2CGNA 5SV8A 1ULCA 4IETA 4QPYA 1RVF3 3J8F2 4W6XA 3KQRA 4XXPA 3TWIA 4YGEA 4AQ6A 1HRV2 2IXIA 4I09A 1DZQA 1H4HA 4JTOA 3K51A 5IUQA 5FLJA 3BOPA 3CF6E 4S2DA 4QQ2A 3VBOA 2BWAA 1NCRB 4R4ZA 1PGSA 4KL1A 4GQ7A 2R073 3DUIA 4D7TA 3O14A 4QT6A 1XYNA 4META 1RHI3 4P9WA 1UX6A 5AVPA 1BEV3 1RIRA 5T5JA 3BTAA 1RUF2 1ZZ9A 3EXUA 5T5LA 3MZHA 2VPVA 1SQ4A 2K2SA 1PVC2 2EAKA 4UW5A 2E7TA 1RUE3 3WP3A 1AYN3 2B46X 2FMYA 4CDUB 2A6VA 3P3NA 1QJY2 1LOBA 3H3UA 2Y38A 4JDNA 4JGYB 3E5UA 4Q4X1 2HEYF 1UL9A 2FMDA 4Y4YA 3VDDA 4COWA 2BBVA 3RYRA 3S7EA 2JE9A 4XJ9A 3ZYGA 3LA2A 4QU2A 1XYPA 5B2GB 1DQ2A 1UMZA 1WBLA 4IEYA 2UWCA 2ZHKA 4XTMA 1S1AA 1B35A 5E89A 1KS4A 2W08A 5I0SA 2VMIA 2I74A 2A7AA 3SH5A 4R4XA 4YZ5A 4INDA 2OZ6A 1UKGA 5DG2A 5A33B 4AG4A 1KDKA 1JOJA 3MF6A 3H50A 3LCPA 3UV9A 2NN8A 3I4IA 3RQ0A 5JZGA 1CQ9A 3ZFGB 1NOVA 5J36A 4Z1VA 2BFUS 1ZX5A 2JG8B 3NV1A 1AL21 4J6GA 1Z7S1 4K21A 5FAXA 3O12A 1S0FA 5HBAA 3OCPA 5C8CB 5DZGA 5CA6A 2VG9A 2CGPA 1ENSA 2EVXA 3DPRB 1UF2C 2HJIA 4B4RA 5CADA 3WQ0A 3N7MA 3ZIWA 5IK8A 2EXKA 5JI7A 5KHIA 2XJVA 5CG9A 3SH4A 2QJVA 2FBEA 1QNYA 1PNGA 1Q8SA 4WVWA 3QCWA 3FLRA 1ONAA 2I2SA 4OHXA 1KITA 4XF3A 4GH4A 4P9XA 4ZU7A 5HCAA 4Z07A 3B01A 2ZAHA 1GV9A 3WR0A 1VBC3 5EZWA 1FMD3 1N1SA 4WM7B 1RB8G 4KWJA 1QOSA 1PVXA 3D0SA 5BNPB 1AX2A 2VW1A 5H9RA 3VGIA 2JD4A 1ZRRA 5ABJB 4WM8A 2HWF3 4IQPA 4GWMA 1OLRA 3AYAA 3GBWA 1FV2A 1RMU3 2YROA 1G9CA 2D97A 1UPSA 4UW4A 2VVFA 3M8LA 4FBFA 2YC0A 2RJKA 4M3CA 4AGGA 2HWB1 2QDRA 2RS13 4XTPA 3WG4A 4Z8BA 4YM3A 2R072 5T3NA 4LBOA 4ZU4A 3M1HA 4L92A 4TYSA 1F31A 5KWRA 1MACA 2A6ZA 1MS1A 4IXLA 1RHI2 1D4M1 2A3WA 4BYYA 1SLLA 3I7DA 1N1VA 2QVSB 3MIGA 3ZFFC 2PHRA 3DV8A 3S0MA 3SHRA 2WJSA 1G6NA 1EAH1 4OHYA 4EROA 4PDWA 4R8HA 5FBZA 1OOPA 1H0BA 1C5HA 1RUE2 4YFWA 1VP6A 1ZM1A 2A71A 2H6CA 2UURA 3ALQA 3JQXA 4G3YC 4YVWB 5H9QA 3VBSB 1ULGA 4Q4W3 5L7OA 3KSCA 2ATFA 3TB0A 1WBFA 4ZKTB 2NYYA 4BPZA 2B7YA 1D0GA 5BXXA 2JXAA 3QH6A 1TMF1 2DU1A 1UD1A 2E9QA 2XJSA 1KQRA 4AYUA 4IEVA 3BPZA 5EV7A 3WDXA 2AENA 2Q1ZB 4QD2A 2R041 4C0HA 2NZ9A 3NAPB 1CAUA 1RUI3 4CP1A 4UXAA 3AB0A 4QMAA 3VBRC 4GB33 5E8AA 2RE9A 5DDJ2 1UKRA 2XBO1 1XRUA 3HN1A 1ZNPA 2UYAA 1XNKA 4MYEA 4RR3B 3JCIA 3U07A 3LSEA 4I0AA 1ND3A 1NA1B 1UU5A 5ACA1 3VHOA 3ZSKA 2Q5TA 1RL3A 3IDBB 2HWC3 5GZEA 2BPA2 1W6QA 3RNSA 2GALA 3P3PA 1FATA 4JCKA 4Q0PA 4KWKA 1AX0A 5K0UC 4YW2A 2QNKA 4F7ZA 1YO8A 1BYHA 1QHDA 2ZOEB 2TEPA 2Z2SB 2IXLA 2OVUA 4E2SA 1LOEA 4XDQA 3E5XA 3VL8A 1CAVB 1ASJ1 1ZBE3 1AR81 3USUA 4L97A 2FQPA 2D6MA 2V09A 4XBLA 2QDNA 4NWVA 3JQWA 4JQRA 3VHNA 1SCRA 5CFDA 1FMD2 2OW4A 1JUHA 2ZX2A 3WNXA 5GLVA 1BVP1 3AKPA 3AKSA 3VKMA 1BQPA 1JN2P 3T1MA 3V56A 3WG3A 3N35A 1LOFC 3ZFEA 3JD71 2D5HA 3AJZA 1V6LA 1GKBA 1Q3EA 4BIFA 1RMU2 4LR4A 3U0ZA 1ENXA 5AVAA 3W58A 2E51A 1ZBA1 3KT4A 1RUH1 2ZTNA 4L2NA 3AMHA 3FJSA 1WMDA 1UAIA 4QM9A 3QD6A 5H9PA 1GFF2 1KFUL 4IV1B 1AR93 1JW6A 4FOYA 1AUYA 1S0BA 4YW4A 5JSPA 1VJ2A 4JDOA 3R4SA 3KZ4C 2AZ5A 5C4WB 2ET7A 4MZUA 2C0ZA 2NP0A 5DUWA 2FZ1A 3LOBA 4HMZA 1OA3A 1MVQA 4OVEA 1O91A 5GZDA 2GC2A 5IT6A 4NHMA 2ZHMA 3RJ2X 2IC1A 4JRAA 2EAAA 2DTWA 3KB5A 2RS33 3NV2A 2JEMA 3N7KA 3J8F1 4LBQB 1DGLA 5FLHA 1J1LA 1J58A 1RUG3 1Q8OA 2ZGSA 2JKBA 1HRV1 3VBUA 4OI0A 1SEFA 1QH7A 1O3SA 5BUVA 3M70A 4Q4W2 2HYKA 1GANA 1NY71 1X8EA 4HT1T 4Y20A 1O3RA 2WNVA 3VL9A 2X5IA 3AP6A 4Q2FA 3ZXDA 1N3QA 1IHMA 4N43B 3M3IA 1JBCA 3OGJA 2PHDA 4XJUA 4YLZA 1RUC3 3RYPA 1MZ6A 4AVSA 2ZBJA 1MS0A 1NXD1 1LHWA 2JX9A 1W6PA 2GH8A 1UU6A 4URTA 4B3NA 5CB7A 1GNZA 1RUF1 4M3CE 1RUI2 3ZYJB 2D3SA 4M00A 3OD0A 4QX5A 4R9BA 4ATEA 3A4UA 4Y22B 4XFGA 3B7MA 3EJKA 2GU9A 4D3WA 1SLTA 1OOPB 4SLIA 5FRAA 3AZYA 1I9RA 2KA3A 1QJY1 4Q4V2 1ZZ8A 4JV4A 1UZYA 2B5HA 3ZDSA 4P14A 3S7IA 3WDWA 5HXVA 4HKLA 4F3JA 4H7MA 4RQPC 5L7OB 1LHUA 4AFMA 1NQJA 1M4WA 2XG3A 2HWC2 2R061 4WVVA 4CEWC 2IXJA 4JTNA 5GZCA 2AH2A 4ISRA 2BNOA 5HI0A 5CVRA 3LWCA 4HSJA 4LO6B 4QPGA 4XMAA 1T6GC 3BOWA 4JGZB 4YVSA 1RUD1 3R4UA 3VBHB 3GHNA 4IV3C 4KGGA 4EWAA 3VBFB 3KGLA 2PA7A 4LO5B 1HRI2 2EALA 3OJBA 4KU7A 2DF7A 4LO8A 1AR83 3DF0A 1WD3A 1NG0A 4K1ZA 4K9SA 5D8AA 1VBB2 2GC1A 3KLSA 4RGAA 1LHNA 1R083 1EPWA 1XE7A 2VVEA 1Q8QA 2PHLA 5I8TA 1Q43A 1JYIA 2P34A 2OUHA 4GKYA 2DVBA 4XBNA 1UU4A 3FFZA 1DQ1A 4EWEA 2XJUA 1AR92 3H1MA 1M06G 1V70A 4V1PA 4MGYE 4NVPA 1NCQB 1NCRC 2GC3A 5CU1A 2ZZJA 3HWJA 3ZX7A 2WNUB 4SBVA 4RSUA 2P17A 4K6BA 3Q9OA 2PHWA 4YM1A 1VAMA 1CD3G 3KT1A 5KHHA 1G8WA 4CEYA 2JG9A 5JOWA 1MZEA 4AI3A 3THPA 3PMSA 3M2MA 4D7SA 5TSWA 5GKAC 3UJQA 1HV0A 4IEPA 1RVF1 1OPMA 4FPFA 2QUOA 1RUG2 3OYWB 4GIQA 4Q27A 1VBE3 5GZFA 1S0JA 5KXCA 4QQOA 3WW1A 4BM8A 5A3LA 5FO7B 3VZMA 3URFA 2GMPA 1U5YA 3POWA 1OSGA 1WCDJ 3KT7A 5JOXA 2YMZA 4E27A 2R071 4JGYC 3MPBA 2ARXA 3AXEA 3CU7A 5AFBA 1REFA 1YI9A 1RUC2 1YIPA 1WD4A 4B7EA 5FDBA 4R52A 1RHI1 2VNOA 1MEC2 1APNA 3VKOA 5K9YA 3VV1A 2ZACA 3B3QE 3AMQA 1DIWA 2D93A 1RUF3 1BZWA 1RUE1 3PLQA 4IEZA 1LR5A 1AYN1 1CESA 1PVC3 1XNBA 2VH9A 3VHPA 2TNFA 1W6MA 1H4GA 3PHMA 4XF1A 3VUOA 2R16A 3ZFGC 3ZIXA 5BNNA 2NMOA 3CJIA 1G9FA 2PYTA 1VALA 1R1A2 4JDMA 2JG8C 3WDYA 4N90A 1YHFA 1XE8A 2OUJA 1G9DA 2ARBA 3KCYA 1VLNA 4AVAA 2NLRA 5C8CC 4FPEA 1W6OA 3DPRC 3PVNA 1X8MA 4FPJA 4C0BA 2YDEA 5GM0A 2KXLA 1K5MA 1WW7A 4CDWB 1VRH3 3M3CA 4YW5A 2UWAA 1QDCA 3PTYA 4Q1RA 4XFIA 5AC93 4AHYA 4YZ3A 5LEKA 4COZA 2CGOA 4AVVA 1LGBA 2PHTA 2SLIA 3B93A 4COVA 1F2NA 3H1WA 3SISA 4M0HA 3SCHA 1ZZBA 3QH7A 2DV9A 3GZTB 3MPPG 4PBPA 4CDQB 1FNYA 2XL9A 1MQTA 1R082 2BYVE 4BLJA 1QH6A 5LK7B 5BNOB 2DUQA 4WM7C 1YFWA 2QFEA 4AFBA 2P2KA 5BNPC 3T1LA 1LCLA 2E7QA 1IKQA 1UN1A 1JH5A 5ABJC 1GZWB 4N53A 3WCRA 3IPVB 4TZDA 2UU8A 1OA4A 3U4XA 4AEDB 1C57A 2XGXA 4KQ7A 3H1YA 5C9AA 5I8YA 3EQEA 5FCCA 2C1FA 4QPIA 2D6OX 3MIDA 1YWKA 4QM8A 2VUJA 4HN0A 1HLCA 4CTEA 1R093 1COV3 2K9ZA 4OULA 4M0NA 1FMD1 3H7JA 5FPXA 1A8MA 5FMOS 2BUKA 3RMYA 1URXA 4IEQA 4MGKE 2DCYA 3LSDA 3FMGA 1PK6A 3AP9A 5BV6A 1RMU1 1VBE2 2F6BA 4PIYA 4LHLA 3L2YA 1AZDA 4XHXA 2XPJA 1Q8PA 2X29A 2MEV3 3ZSEA 1H1IA 2RS11 4YVWC 3VBSC 1I3HA 4ES9A 3N7LA 1C28A 3W9AA 1ND2B 2WL1A 1G7YA 1LOAA 2R32A 2Z69A 4IESA 1VB4A 2Y0OA 4I3GA 4AE2A 5SV5A 1CGPA 2ZX1A 1AHSA 2ZKNA 5F6LB 4X6RB 3ST7A 4A7ZA 1FI2A 1QF3A 2C5DA 1DGWX 2DVFA 5FQ0A 1BK1A 1KS5A 4ASMB 4ITCA 2JG9B 1EYBA 3NAPC 5BYNA 4HN1A 3V0AA 4DRRA 2ZX0A 3UL2A 4Q4W1 3ZN6A 4I02A 5A32A 3ACLA 4N9IA 1ZZ7A 2WSVA 4XFHA 2FHRA 4RR3C 3ASIA 4MSVA 3UJOA 3IM0A 3T2TA 1NA1C 4LBLA 1H1MA 2V5YA 4E4SA 3GZAA 4KWLA 3VZLA 1DQ5A 5JOYA 5GJ6A 5DUVA 4PJYA 1RUI1 4XBQA 1V9U3 4XF4A 1BKZA 1VRH2 4GB31 1WCKA 4YZ2A 4YG6A 2E63A 3U11A 5AC92 1LGCA 1RC6A 1QJX3 1AR73 5EFUA 1O4ZA 2YPJA 5DDJ3 1I6XA 1OFSA 1SCSA 3ZYIB 1HXS2 2A3YA 4PBOA 1GYKA 1LB2A 3IWZA 5I0TA 3AMMA 1BXHA 2HWC1 2B42B 3CJIB 1GNHA 5I0UA 1QJU2 3WP5A 1RUJ2 3GF6A 4HFSA 3GBFA 3WW2A 3JBG3 4I3PA 5JPNB 2R6QA 1H8TB 1DU3D 1H1AA 4I0WB 5T52A 4YG0A 1SFNA 3HBZA 4IV1C 1ZBE1 5I0RA 1FXZA 1HRI1 1SLIA 2DVDA 1J59A 4XQDA 3VKNA 1W0OA 3OGGA 4PLOA 5C4WC 2GC0A 2B39A 2G9FA 2AR6A 1R092 3ZXFA 1COV2 3PVBB 1S0DA 3LOIA 4K8FA 4OUSA 4AEJA 4B4PA 1HV1A 1PNFA 3MIHA 4FPKA 3TAYA 3N4MA 1MZFA 2GNDA 1JTZX 4YW1A 3WLUA 2SBAA 4EN8B 4BMBA 1OA2A 1V6IA 2MEV2 4RA0A 4D7YA 3O0VA 3NV3A 1AR91 3RWNA 2ZMLA 1C1FA 1VR3A 1S0EA 4XXAA 1SFYA 1J3QA 5HCFA 2YY1A 3BCWA 4N43C 3ZSJA 3FUOA 1DQ0A 2H6BA 2VMHA 3I59B 2B9UA 4IL7A 1BMV1 2ZZQA 1X82A 2VOXA 1DYKA 2ZGQA 2RS31 5JMCA 3VZNA 1RINA 4Q4Y3 2Q8OA 4K1YA 2VOWA 2IFWA 1RUG1 4HETA 2PN5A 1H9PA 1VB2A 3FZ3A 1EV13 1FPN2 4OHZA 4HVRA 3VKLA 3ZFFA 1FT9A 5JSRA 1WCSA 1LEMA 1OOPC 4DB5A 4FOVA 2E53A 3EHKA 3NKTA 5LRRA 1IS6A 3ILRA 1DZTA 1RUC1 2A6XA 5EJ3A 1GZ9A 2ZHNA 3HR9A 1QWRA 3VBOB 2AYHA 1TME2 3J9SA 1MEC1 3M3EA 4GALA 2BVVA 3N36A 5CNAA 2W0XA 2Z79A 1S2KA 1V9U2 1F9KA 1NXMA 2XVGA 3ZMNA 2GNBA 1LKNA 4I0BA 2AREA 4JGZC 4HKWA 4IEUA 3VBHC 1BJQA 2D7FA 3VBFC 4FPCA 3CNAA 3FFQA 3JZVA 1QJX2 1AR72 2TBVA 3SLIA 1D4VB 1SLBA 4P5HA 3R4DB 5LK5A 1A78A 1OLQA 3JUUA 5H9SA 4AQSA 4Q4V3 5JIUA 1PZ8A 3MFCA 2D43A 1PO22 3AKQA 5EWSA 3VBRA 3QACA 4XJ8A 1PGL1 3NSTA 1O5LA 1QQP2 1QU0A 4XILA 1H30A 4AHZA 2WFF3 1LULA 1LRHA 5BY5A 5J98B 3WDTA 4OUMA 4PLNA 3JBG2 3VDDB 2XB6C 2XLAA 4BE3A 2NMNA 2VOKA 4MGIE 2PQQA 2ILMA 3GHMA 4HPKA 3G6JB 3ZMOA 4HKOA 4Z2WA 1AXYA 4WVMA 3VN4A 3LA3A 3GZUC 4LEJA 1NCQC 3APBA 1B35B 1HRI3 1J1TA 4DQAA 3SNMA 4LBKA 1ZA4A 2GN3A 2WNUC 1CN1A 1QKQA 2UYBA 3AZXA 3EBRA 4LA3A 1AR63 1SDWA 1CAXA 2R49A 4J1WA 3AZWA 3BIWE 1R081 1VBB3 2CAVA 5JZGB 5F1RA 4LBQD 1RJ8A 4FPHA 3WP4A 4UBHA 3RI8A 5CIRA 3IKWA 5L19A 1HDKA 4H3WA 2WIIB 1DGWA 2CL2A 2WINB 2A73B 3R6SA 2PAMA 3OTFA 1PZ7A 1FYUA 4LLFA 3DGTA 1YLLA 1SACA 1GQGA 4LULA 2MNGA 2CYFA 1PMIA 1WLTA 1CAWA 4IEXA 1VAVA 4H14A 5KHKA 2B8MA 2ERFA 3HIFA 2DFBA 5GLWA 1NE6A 2RJLA 1C4RA 4YGDA 3ROUA 1EY2A 1AYM3 3E6DA 4FXGB 4WZCA 4XFBA 1W39A 1I1EA 2RR12 4P9IA 1GBGA 4S2HA 1F8VA 4TLFA 4D69A 3M3QA 4GMP0 4DY5A 3L2HA 1DYPA 2DVGA 4GH4B 3IBMA 4Q4Y2 4G4FA 4Z82A 3WXPA 2YV8A 1VBE1 5I8SA 3KM5A 1EV12 4CYDA 1YFUA 2WQZC 4FQ4A 4XQWA 2ZMKA 3WT3A 2QCSB 4I30A 5JPMB 4FT8A 4X6QB 1KFXL 5HCBA 1POV0 1QXPA 4WM8B 4L9BA 4LUMA 1ENRA 4XF0A 1MVEA 5CFCC 2WKKA 5JAXA 5T54A 4Y1YA 4M3CB 1LODA 2P3JA 2ZS6B 4OI2A 5KHJA 3MW4A 2BGCA 1ZRDA 1IOAA 5DXDA 3SXWA 1MEC3 4LA2A 5D1IA 3ECQA 4FPLA 2K0GA 1PHMA 3MLKA 2DUPA 1X33A 1Q8VA 3NV4A 2R0FA 1N47A 3FBMA 3PVOA 4LBMA 4LTAA 4TWTA 3IDEA 4OZXA 1PVC1 2GMEA 4U36A 5I91A 4CDWC 2O8OA 3LA7A 4Q0VA 4AWDA 3RMXA 3DN7A 4PDWB 1CIWA 2PAEA 1O3TA 4AHXA 1C8NA 1HQLA 4TSVA 2G4IA 3MIBA 3THTA 2IXCA 1R1A3 2A5ZA 4CDQC 2I45A 1QXJA 4IEWA 4W6YA 5BNOC 2WFF2 1UZZA 1DZRA 4LHKA 1W6NA 3FLTA 1IPKA 1DQ4A 2BWCA 4DY3A 1IPJA 1DG6A 4RQPA 3NKGA 4OFGA 4H7LA 1VRH1 3V65A 4G9SB 2RS53 4AEDC 5AC91 4CEWA 3RSJA 2W39A 1VBA3 3O0WA 4J1XA 3ZXKA 4F8AA 1AL22 1WLCA 4C1XA 1CAUB 3M3OA 1JXNA 3VHRA 1HIXA 3M4FA 5LRSA 2DUOA 4BH9A 4IV3A 5FOBB 1AR62 5FOJB 4BLIA 1DLLA 4OI4A 1KDMA 2BEOA 3NL1A 5L73A 2EXHA 1XNDA 4XMIA 4Q29A 1AXZA 3WDUA 2TUNA 3LAGA 4AVTA 2X8KA 1ND3B 4K3UA 4BZ4A 2A75A 4DXZA 4MX3A 4ES8A 4OI1A 1W6QB 3RS6A 3AMNA 2A70A 3AZVA 5KC5A 2O8QA 4XIKA 5GLZA 2LUWA 1LHVA 4XE9A 4DS0A 1GICA 3RI9A 1ND2C 3BODA 2I07B 5GALA 1OQDA 3WOGA 2QZ2A 3OF1A 4A2UA 4H55A 1R091 3VZJA 1AYM2 1COV1 1KXGA 3B00A 4YZ4A 2H0VA 4AFCA 3K48A 5DUXA 3MW3A 2XJPA 2D40A 3USUB 4Y24A 1NCRA 2XJQA 2HWD3 4QQLA 5JWPA 3I2DA 4DNYA 1CAXB 4M3CF 2JG9C 5CFDB 3AP5A 4I2OA 2W52A 2WWSA 3B9IA 2MEV1 4AEKA 2WT2A 1C8M3 2ZMNA 1DFQA 1YYNA 3ZFEB 2XJRA 3AKTA 4CDUC 4C90A 1LU2A 2E6VA 1A6CA 4JAAA 4M01A 4HANA 1GZCA 4RS5A 4NN0A 5IK7A 2DYCA 2OIIA 2ZGKA 3KCCA 3UKVA 1KJRA 3AMPA 1H2MA 3D6EA 5FO8B 5GLTA 2WNEA 4JGYA 3QLQA 5F5QA 1GR3A 4FO9A 3NJZA 4K20A 4CRQA 2EF6A 4W6WA 4BWOA 1D2SA 1I5ZA 3BALA 3AJYA 1WGPA 4ZU5A 4N7IA 2ENRA 1C5IA 3PJYA 1HW5A 4LO7A 3VBUB 4QQPA 5FPZA 3AKRA 3H0OA 3AYCA 1WA4A 4S2FA 4LBNA 3KGZA 4EJRA 4Y20B 5A33A 2WNVB 4B8EA 2CY6A 4DRVA 2X5IB 3CJIC 3FBYA 3OBRA 1YJKA 3WDVA 5J96B 3ZFGA 4GXLA 5CG8A 1LJ7A 1TNFA 1GLHA 3DL3A 1SBEA 2WQ4A 1Q56A 2JG8A 1LHOA 1V9U1 4XJAA 4O9GA 3ZXGA 2D6PA 2Z5WA 1ZZCA 1V6KA 3U10A 1BVVA 1H8TC 2JECA 2RS52 2PLV3 5JI9A 1W6PB 3O5SA 1VBA2 5T5PA 5C8CA 4EN9B 4X8PA 1QJX1 1AR71 1RGSA 3AYDA 5DDJ1 4B29A 2PFWA 2GN7A 4XOGA 3VZOA 2WLQA 5ACA2 5GZGA 1DQ6A 3DPRA 5KXBA 2XKOA 1H2KA 1XU1A 3WZ1A 3ES1A 1UW8A 3SCGA 2R1DA 3H3ZA 1WW5A 1HXS3 2XJTA 3MEPA 1DDLA 4NHLA 4P9GA 4E9KA 3MIFA 3IN9A 3USSA 4IERA 4Q8KA 2GDFA 5T5OA 2UY9A 3ILNA 4EN7B 1QJU3 1RUJ3 3WG2A 4CDXA 1WLWA 2PAKA 3FX3A 3JBG1 4PF5A 4D94A 1VIWB 2AUYA 5IK4A 4DZGA 2IXHA 3KS7A 1LOCA 2OPKA 2CTVA 1F5JA 1G86A 4L99A 4WM7A 1ZRFA 1LU1A 1NYWA 5BNPA 1PGW2 1QNWA 2VULA 4QPGB 3GBGA 5ABJA 2BFUL 4XF9A 4YVSB 3KD4A 2IWGB 3EO6A 1YFYA 2OZJA