4CP0A

Crystal structure of epithelial adhesin 9 a domain (epa9a) from candida glabrata in complex with lactose
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
250
structure length
219
Chain Sequence
b'AHYPRPEGCSSPPNAVSVGLHMDLYNYPYLYVKQCWNPEYQDPNFPRYGYKKYGSFGSSDHVNGKISWDHNEFKEGCKPIMARLPTAYNYPAKITFSNFTMVLSGYFKPKSTGLYKFEIHADDFILFNFGSKNAFECCNREESIDNFGPYVAYAMWPNEADQELEVYLFEDSYYPIRLFYNNRDYHSKFMVGFYPPNTEEITYDFDGYLYMLDDTGNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPITHELIAL ADHESIN 9
publication title The Structure and Function of the Epithelial Adhesins (Working)
rcsb
source organism Candida glabrata
molecule tags Cell adhesion
total genus 61
structure length 219
sequence length 250
ec nomenclature
pdb deposition date 2014-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10528 GLEYA GLEYA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4cp0A00
5A3LA 4AF9A 4CP2A 4AHXA 4AI2A 2XJPA 4D3WA 2XJSA 4LHLA 4AI1A 2XJTA 4LHNA 4AHWA 4AHYA 4COVA 4AI0A 4A3XA 4AFAA 4COZA 2XJUA 4AI3A 4GQ7A 4AFCA 4CP0A 2XJRA 4COUA 4AFBA 2XJVA 4COWA 4CP1A 4COYA 2XJQA 4AHZA 5A3MA 4LHKA 4ASLA
chains in the Genus database with same CATH superfamily
1AJOA 2E33A 2VZPA 3MF6A 5KHGA 1W2NA 5H9RA 3WF4A 1CX1A 4BQYA 2RMU1 1S0JA 3AVSA 2AENA 1MEC2 4MOAA 1N1TA 2XQXA 5L36A 2WA3A 4RN5A 2WWUA 4H7LA 1C1FA 5A3UA 4YM3A 1ULEA 4R4ZA 3WNOA 1PZ7A 2HH9A 4UFHA 5C3OA 1LEDA 4OI1A 3A23A 4XJ9A 1HKDA 2WL1A 5BNNC 4OQ8A 1HRV3 1JYCA 3OBAA 1JZ5A 5HCFA 4CCDA 2ZX1A 4G4FA 3LF7A 4GB32 4NPMA 4QQLA 4RR3C 3UGFA 3PHMA 5JSOA 1H30A 1V6KA 1BMV2 1SLLA 1YO8A 3PIJA 2RR11 2Y6GA 3LOIA 3JQWA 5BV6A 1S2EA 2YU1A 5DUVA 5FZ4A 4P5YA 4HG6B 1DLCA 2JDHA 3PVNA 3WNLA 5F1RA 1AZDA 4YRDA 2WLPA 3IKWA 4Q4Y2 1XJAA 2X5IA 2B8MA 1NX9A 1UAIA 4NIGA 2VCMA 2NYYA 4BQ2A 5DG1A 5KC6A 4P9IA 1NLQA 2D5FA 4FTBA 1C28A 3POWA 1TQ5A 4J1XA 1Z7S3 1D4M1 2DCTA 2VE1A 2WT1A 5FYTA 4C1WA 5BNPB 2ATFA 5FOJB 2XWJB 2YC0A 1JW6A 5I0DA 2B9VA 2R16A 3GZUC 4GXLA 2HLEA 2IXHA 4NJ4A 1TNRA 3MV11 3QCWA 1LENA 3I2DA 3ZXLA 3KGZA 2PELA 3VBOC 3ZLIA 2VZRA 1ASJ1 4M3CF 4OCTA 5A7WB 4NWWA 1BEV1 1XE7A 3THTA 1UYXA 1R083 1PK6B 2IWGB 3LKJA 1QJX1 4RD7A 3KV4A 4EN6B 5IFTA 3CIHA 5G05L 3AFKA 4FPCA 3ZFGA 4Y3OA 5H9PA 2GALA 2BWCA 1W03A 2JIGA 2VD7A 3CL1A 4FFFA 3D6EA 4QQPA 2DUOA 2QQKA 5L73A 3SCFA 4Y20A 3RI9A 2PYTA 1PVC3 1GICA 2HBUA 1D4VB 1SCSA 1UY2A 4XIOA 4QMAA 4Z2AA 5C9AC 4XACA 4TSVA 1NXMA 1XNCA 3FFQA 2E7AA 3K4DA 4FP3A 3WNXA 3UYJA 1PZ8A 4CEWA 3WNKA 2I07B 5J96B 3N9PA 3S0MA 3VLBB 5JMOA 3FLTA 2UWAA 5FY4A 1Q3EA 4C91A 1DDLA 2O8QA 5HV0A 3VKMA 2VVDA 4MUVA 4YLZA 5HCAA 1OOPB 2W46A 3H8OA 4INDA 3ES1A 4HZFA 3WG4A 4CXXA 3ZFFA 1F4HA 2GN3A 2E26A 1FOD3 2ZGMA 2BFUL 3N7LA 5DMYA 5LA1A 4HONA 3VZMA 2WZR2 3ZXEA 1O8SA 5A3NA 3WQBA 2Q8DA 1YXWA 3SEEA 1IS4A 4A7YA 1MS1A 2YU2A 3AKRA 5E88A 5I0RA 3KV5A 2VOVA 3PVEA 1WLDA 2LROA 4BCUA 1WLTA 1QJZA 5D1IA 4AEJA 1SMVA 2LALA 4AXOA 4IEYA 1Z7S1 5A7PA 1XSRA 1HXS1 2P34A 4DUXA 2YMZA 3GCXA 3J8F3 4OULA 4XF4A 3ACIA 5FFOC 5CNAA 3T2TA 4C8DA 2RS33 4Q1PA 2RVAA 4QPGB 1JZ7A 2B7YA 3ACFA 2CHHA 3CHXA 5F6LB 1LOBA 3AZVA 4Q8KA 2P6HA 5DXDA 1CPNA 3R4UA 3LEGA 4TXWA 1ND3C 2D3PA 2WSUA 4N53B 1F5JA 2PLV2 2VQAA 3AC0A 3PURA 4H2AA 5JWPA 4HPKB 2R061 3GGLA 5LA2A 2WWJA 2R49A 1B09A 1T6BX 2JG9B 2Y6HA 1V6IA 2A75A 1R1A2 1LJ7A 2VMFA 3I2IA 2OQ7A 1ND2B 1ALYA 2DTYA 3EJKA 4QGMA 1PVC1 1RMU1 1YRZA 2NP0A 1FMD2 1PO12 4TWTA 1O5UA 3N9QA 4KNCA 3NV3A 2H0BA 2OIIA 3J7MA 5A1LA 3U10A 1Q8VA 2XONA 4CP9B 4RS5C 3ZR5A 1J1TA 2ZTNA 3NAPB 3WSOA 1K5MB 1CAXA 3KVAA 1QMJA 1BYHA 2OVUA 1X50A 2X09A 1DBNA 1JOJA 2D40A 4FPHA 3SKVA 4I09A 4AEKA 4RSUA 5FJHA 3GALA 4N7IA 4YZ4A 1ULPA 3VZOA 2HWD2 3UJOA 1HV0A 3ZXFA 2OXBA 1FOD1 2XB6C 5DN2A 2VW1A 4EWAA 3JU9A 1MS3A 1RUF2 2ZHNA 1VLNA 3EQEA 4BZ4A 4DMIA 2VU9A 1W9SA 1IOAA 2DCKA 2ENRA 1FYUA 3CZUA 3T09A 1YJLA 3OEBA 2VQTA 4OZOA 4FT8A 3RI8A 1NKGA 2Z2SB 4YSFA 4KU7A 5F3IA 4KH9A 4PBOA 4QPYA 4LBQB 3M8LA 4AHXA 3WEZA 4Q4X3 1X8EA 1JZ6A 4O9EA 5EJ3A 4Y22A 1CAVA 4OHWA 3SMHA 4RR3B 3WV6A 4AK3A 4HXCA 4B7EA 4YG6A 5IFPA 1OXCA 4IGQA 4B3NA 2XDVA 4GKXA 5E89A 1SEFA 5ISLA 3BU0A 1LU1A 3ZYPA 1QXRA 1WZXA 3T08A 3VKFC 4GALA 4AI3A 1IG3A 1BBT3 1Z78A 2RM22 4IEWA 4L97A 3URFA 3KSCA 4ISQA 1S0BA 3D8CA 4QAWA 5FP4A 5JVVA 1QQP2 4GH4B 4N7UA 4CA9A 3O0WA 1OPOA 1JODA 4K7JA 2XWBB 2JKBA 1RUOA 2V4AA 4IESA 2QVSB 3WNNA 1H6XA 1DQ5A 3CEWA 3K75B 4BK5A 1T2XA 1W8NA 1YFWA 1NCRC 3KZ4C 4I0WB 1QJU1 1UYZA 1UOFA 4FOWA 2VZTA 4CPBA 4ATFA 1GOHA 3WF1A 5FZEA 4LLFA 1RL3A 4LPLA 4LMFA 3SH5A 3ZXGA 2J1TA 3USUB 2TBVA 5DUXA 1CVNA 2ZX2A 1CR7A 4Q4V2 2HEYF 3UGGA 3LIGA 1IHMA 2J7MA 5T5JA 2P4EA 3D3AA 4IE5A 1LGNA 3NNJA 4HKLA 3MGUA 4Y1XA 4HSJA 5H9QA 5JXIA 1W90A 1QXPA 2AZ5A 4B4RA 5LRSA 2ARCA 4IV1C 4QKNA 3HIFA 4HOOA 3VBRC 3H1MA 5HI0A 3WLUA 4C0BA 3MYXA 1F5FA 2CTVA 3GZEA 3NV1A 3VBSB 1H8TC 5BNQA 1LR5A 1MVQA 2X05A 3VD3A 4CUAA 3ZIWA 4ARXA 3RZGA 1QU0A 3TNQA 2P3YA 4AOCA 4JDOA 1N1VA 5IVEA 1U5IA 5FPXA 2TUNA 2KD7A 3DGTA 4OI4A 4YW1A 5JXGA 2FD8A 1HDKA 3H7JA 3TEXA 4CCOA 1BXHA 1MQTC 1WMDA 4Q4X1 2ZKLA 4PHZA 4QWNA 1VB2A 1QOOA 1RXFA 5C6CA 1K3IA 1QJY2 1ZA7A 4YGBA 5H9SA 5JXJA 4X6RB 1J3QA 4WVVA 3B9CA 1VAMA 4KG8A 3RSJA 2PQSA 3CQOA 4KBBA 2E32A 3ACLA 1BBT1 1W6PA 1KEXA 5CKNA 5GZCA 1GWLA 3WDXA 1I5PA 2XJTA 5FCCA 2C9AA 4JAAA 2WNVC 3AL5A 1W04A 2PXJA 1IKPA 2GU9A 1O6UA 3KT4A 4QPWA 4X6QB 1EYBA 1JZ8A 4LBLA 1AR61 1FATA 3NJVA 1G9DA 4XDPA 4JHZA 1RUH1 2QBXA 3LSDA 4ZU5A 5LEJA 3AK0A 2A70A 3JD73 2Q8CA 2G1MA 1W0NA 1CPMA 1OLMA 1S0IA 3KF3A 1ST8A 2BPA2 3NVCA 4CP2A 1OQ1A 3ACHA 4NRPA 1JBCA 1F9KA 1UL9A 3W59A 2VECA 3MBWA 1NXD1 4AZZA 1ZM1A 1W8OA 4YW5A 5K0UB 3TN92 3GXUA 4MXWB 4PDWA 4M01A 4CEYB 4NROA 3TEYA 1OPMA 1ND3B 1S55A 2R7EB 3FL7A 3O1RA 5FYVA 4FO9A 1XPWA 4CDQB 5BNOC 5L9VA 1O3RA 2Q30A 1AJKA 4LO7A 3MO4A 1TEIA 5JZGA 5F5CA 4B4QA 3VGIA 1E5RA 3OPTA 3OSDA 2DFBA 4GWMA 3KF5A 1REEA 2ORXA 4UF0A 4XILA 2CGOA 2JG8A 1VBE2 2W92A 2JE9A 4QU1A 2J42A 5FLIA 5CFCA 4FPJA 5F3EA 5JAXA 5B4XA 3NV2A 4XYXA 3I54A 3DECA 4BHPA 5T50A 4BM8A 4RS5B 1JOBA 3GZAA 1QH7A 1H1AA 1XU1A 1DZRA 4O7XA 1V6MA 3E1F1 4OHZA 5IAVA 5C3SA 4IV3C 5HXVA 3SH4A 1W6MA 1YQ5A 1ENXA 4P9JA 2W52A 1WBFA 1XE8A 5F2SA 1YEWA 3SISA 4K8RB 3H3UA 1QH6A 3J26N 2HWB2 3A7QA 1POV3 2YGMA 2ZX0A 2QDRA 5FMOL 4JCKA 3H9AA 1MZFA 1HQLA 2CGNA 2HWF2 4LNVA 4QM9A 5LBEA 5ACA3 4CDUC 4A3ZA 1L3JA 2WO1A 2YFZA 3PDQA 4LBJA 4XDQA 4DUWA 5K9YA 4PIXA 3RZLA 4Q4Y3 1AL0G 3POYA 2EAAA 4LHNA 1RUJ2 3RGBA 1VBB3 2QJVA 5FLHA 4A2UA 1ZBA2 4I0BA 2WA4A 2D6LX 1WLCA 3GBFA 3ECQA 3JD71 5IK5A 1LCLA 1W0OA 2GC2A 1HX6A 3B7MA 4HN0A 4ZS2A 3VKLA 3V0BB 4LIUA 4D94A 3DXUA 1ZX5A 3J7NA 4D69A 3KT7A 4XOGA 4E4HA 1NCQB 1S2KA 4HN1A 2Q8EA 4JX0A 2VVFA 3KCCA 5KWRA 4CCJA 2Z5WA 3VN4A 4UW3A 1OLQA 4I2OA 3AMPA 5T5OA 2C6SA 2XJPA 3EHKA 4KGGA 3S57A 3U4SA 3H3ZA 1VBA2 2EIBA 1DYOA 4FPKA 2CWSA 2LM3A 5GZEA 3VHOA 3KS7A 4KBZA 3WDUA 4C90A 5I8TA 3SCGA 5F5IA 5T5LA 3H42B 3ZIXA 5FZOB 4ORFA 4SLIA 4DB5A 3AP9A 1AR91 5I0SA 4XURA 5A7WA 2KM2A 2XKPA 3E6BA 1EAH3 1H9PA 2X8KA 1OQDA 3G7DA 2H6BA 3GNEA 1FT9A 3LA2A 1PK6A 4AQSA 2BBVA 5A80A 1Y43B 4NPRA 4AL9A 1RUI3 4A7KA 1OKOA 3OBTA 4Y5Z0 2WWSA 2DBIA 1UF2C 1DQ6A 4LE3A 2W95A 5LWBA 2PHXA 3VZLA 2AH2A 2TNFA 4H3WA 3O1TA 4QDSA 2ZABA 3MIGA 4UFLA 2BW8A 2CL2A 5FMDA 3B01A 4AFAA 4EZHA 3ORJA 2OS2A 5F3CA 2ZEYA 4IV1B 3GJBA 2XLGA 2QCSB 4HFSA 2NLRA 2BP6A 4G3YC 4BXSV 4XTMA 5ACA1 1H8TB 1YUDA 2D6MA 3N7JA 4AWDA 3AFGA 2EXHA 2WNEA 1I5ZA 4NIDA 2OX0A 1Q8SA 1IQDC 5E6HA 3ZXKA 5A3MA 2HEVF 3ES4A 1AX0A 3F2ZA 3I97A 4D7TA 1SLIA 5F9TA 1W8TA 5I8SA 1OURA 1QXJA 1ZZ6A 2BTVC 1OOPA 4URTA 1PIV2 3CJIC 1JUIA 4AVAA 1CESA 4CDXC 4FPLA 2VUAA 1AR72 4XF9A 1EV13 1W8HA 5KR7A 2BNMA 1TG7A 1HIXA 4XPVA 5E1RA 4HBNA 4DQAA 4JDMA 4W6YA 2ZGUA 5D2AA 2WNVB 3H0OA 4YVSC 3H3LA 5FZFA 5LB6A 3ZYIB 3AMNA 4MO3M 1OUSA 4BDVB 5GLZA 1ZRRA 1BKZA 4J1WA 2FHRA 1UO9A 4MHUA 2WT2A 3HOBA 5A70A 3TNPB 2VAUA 2WZEA 3BOPA 2JDMA 4QPGA 5IHRA 1R1A3 4ASKA 4AHYA 4R9AA 2WKKA 1EAH1 1GQPA 3TOJA 4Q0PA 2XVGA 5FPLA 4D7YA 1UYPA 1LECA 4N53A 5D8AC 1FMD3 4A41A 4DXSA 3OGRA 1RUI1 2B46X 4HPKA 1ZREA 3G6JB 2PTMA 4CP1A 2JG9A 1C8M2 3AJZA 1XNKA 1DHKB 3IBMA 4BYYA 5LY2A 2WQZC 5A3LA 1ND2A 4PIYA 1FV2A 4AGVA 4YZ1A 2Y34A 3KV9A 3HBKA 3ILNA 3WP5A 5BNOB 1UZVA 3FLRA 3P5BA 4YVWB 2RS12 1XNAA 3U0ZA 4CP9A 2BBAA 2DTWA 5KXDA 4DRVA 1NE4A 2RDRA 5CVRA 2V5YA 3NAPA 1TMF3 4BISA 1K5MA 5LW9A 2BZDA 1JZ4A 5JUVA 1GV9A 3FHQA 4GQ7A 1S0CA 4RFRB 3WUDA 2WFF2 2BJSA 2WDBA 4GMP3 1RJ8A 4B4PA 3FZ3A 3RZZA 4COUA 1GQHA 1N1SA 4XFAA 4COYA 4AHZA 2VOTA 1OD5A 2QQWA 1GNZA 3Q8AA 4AEDB 5FY8A 4V1PA 1JH5A 5LATA 3CDZB 3LZZA 3ZPOA 1UOBA 4IV3B 4CU8A 1FPN2 3AYEA 5I91A 1WW4A 4I30A 3VBUA 1EV11 4RGAA 2FCTA 1KXGA 5FZDA 4D6RA 1JYNA 1YI7A 4COVA 1HB4A 5CG9A 3E5QA 1UXXX 3C7OA 3N35A 4GULA 4AE2A 4FBFA 5IVFA 3V0AB 3I2FA 4HK8A 4XUOA 1WMEA 1CD3G 1W8ZA 4UT5A 4V2VA 4S2HA 3GDBA 1RXGA 2VO5A 4CDUB 3AB0A 3WD5A 1DZQA 4LO5B 4EYUA 5K8SA 4QHBA 3AP7A 1L7QA 2D7FA 2AUYA 3IZOA 4RR3A 2DYCA 5C4WC 1RVF3 2HYXA 1IS3A 4XMAA 3NJZA 3VHPA 1RUC2 4XFCA 4HANA 4HVOA 4XHXA 3K51A 4DO0A 2UWCA 1E5IA 3H1WA 4W50A 1HJGA 5CFDB 1UXZA 4BMBA 4Y5SA 5EJ1B 5GZGA 1MZ5A 1OD3A 1W9YA 2E53A 1YFUA 2GH8A 3ASIA 4P14A 4AGRA 1W39A 1B35A 1XYNA 1GZCA 1KJRA 4IXLA 2W2IA 4S2FA 2DUQA 4GH4A 3CU7A 4JGYC 2ZJCA 1KS4A 1WD4A 2Y33A 3B93A 2KXLA 4UFJA 4WV8A 5KXEA 3QLQA 1ZZ7A 2WR9A 3BYWA 2XMLA 3NKTA 2VZQA 3OY8B 1E5SA 4YM0A 1GQGA 2VMHA 3N4MA 3OUHA 1APNA 1GP5A 3MIFA 3OGVA 1UU4A 4PLNA 3TAYA 5JI7A 4BIOA 2NMOA 1LODA 2ZGKA 3ETPA 3M7AA 4EE2A 5BUVA 1RUG3 2L9LA 3MIEA 1ULCA 1WGPA 3A0NA 3NO8A 4FPFA 5C3RA 4E4SA 2WS92 1TMF1 4QX7A 5FXZA 3HJRA 3RJRA 3USUA 3HN3A 4TTGA 4LK7A 1YQ6A 1PGW1 2UU8A 1ZYBA 3LDBA 3JUUA 1ONAA 4B29A 1TE1B 1YWKA 2VNVA 4FFHA 3JZVA 4NHMA 4EJRA 2EIDA 4ISRA 5LRRA 3R05A 1GZWB 4QD2A 1RINA 3UESA 2UYBA 4AEMA 1IPJA 1DP0A 1NG0A 4AFBA 4LA2A 3BIEA 3VBFC 3VBSA 3MIHA 4EN7B 2ZHLA 3ENRA 2VNRA 3C7GA 1NA1C 1LHUA 3ZSJA 4E8DA 3KVBA 4HSLA 4XXAA 4Y4YA 3RYPA 5IK4A 2ZGOA 2EXKA 2DVFA 1ULFA 2GNMA 2XXZA 5A6ZA 4JKLA 5DAQA 3UK9A 4LHLA 2W08A 4IERA 1ZBE2 4D8MA 3J7LA 3PUAA 2NQYA 2UY8A 4CUBA 1LHOA 4C0HA 4M3CE 2VMIA 1KITA 2F6BA 1F31A 2K9ZA 3AZZA 3GBWA 3BI3A 1RVF1 3R4SA 1UYYA 2PHFA 4FXKB 4OUSA 1WBLA 4N90A 1ZZBA 3T0AA 3TEZA 3MICA 1EUTA 2GC3A 1W6OB 3CJIB 4TZDA 4YZ5A 3LFMA 4W6XA 2VUCA 5I0TA 3OYWB 4UBHA 3FN9A 2MPFA 4CDXB 4N9IA 4K40A 2UURA 2VBDA 4JC1A 5FBZA 3B3QE 5FY5A 5BXXA 3DL3A 4QDQA 4A7ZA 4LBQD 1COV3 1YFYA 1CN1A 3W9AA 1NYWA 1ENSA 5FYCA 3UV9A 4RHV2 1RHI1 2JECA 4LR4A 1UZWA 3K4AA 4QQOA 3UKNA 5GLTA 1GZ9A 4XFHA 3WNMA 2HWC3 4B8EA 5ERLA 5FO8B 3H7YA 4LOTA 4XDOA 3U4XA 3C7FA 2VVEA 5L19A 2FCVA 3HVDA 2JD9A 2VZUA 2IC1A 3MFCA 1RUG1 4NO4A 2HWE2 4Q4W3 4KWUA 2FDFA 1N3OA 2J1AA 2VTXA 4M4RA 3DPRC 3O1PA 1AXKA 4NRQA 1UD1A 5DZEA 5JPMB 3A0KA 3I59B 5K0UA 4CCMA 4LHKA 1JHJA 4MXWA 4Q8LA 2WT0A 4CEYA 1VBD3 3HD8B 4LKFA 2JB4A 4CCCA 2VC9A 2RS53 1HN0A 3DEMA 1ND3A 3PVBB 1IS6A 3RWNA 1VBE3 1HRV1 4DXZA 2H0VA 4L92A 3E5XA 4CDQA 5FP3A 5CKMA 1DCSA 1YQCA 3L9JT 1TVGA 3PUIA 4IGPA 4BQ3A 3RWKX 3LEIA 5IVYA 4W65A 3ZKUA 2XKOA 3AX4A 3GHMA 3H1YA 1MZ6A 4XABA 5F7UA 1Y9GA 5J7MA 2QNKA 5LK5A 4XFIA 1BJQA 2GMPA 3QD6A 4L99A 1JZ3A 2HBTA 1W8FA 4RQPC 2PHRA 4HETA 2ARBA 4Y24A 1ZZCA 2MEV2 2DCYA 2A6ZA 3BUCA 4A6SA 4RS5A 2HWB3 2X5IC 5DG2A 5A7QA 1QY4A 1RUD2 3SNMA 3AL6A 5FZ9A 1VRH3 3JBG3 5F3GA 2IZWA 3C2UA 5DUWA 1Q56A 3VD9A 4IE4A 3BOWA 2A6VA 4JZRA 3N9LA 3ZKYA 5FMCA 3HR9A 3ZYBA 5CA6A 1AYM2 4Q27A 4UWDA 5JIAA 3ZMNA 5KXCA 1AR82 5CEHA 1PO23 3VDDB 5GALA 5HV4A 3HNYM 3MDPA 2YDEA 5A6YA 2FDJA 1OI6A 2E31A 3AKPA 1K12A 4WM8B 5FXWA 5IJRA 1KFXL 3GM8A 1K45A 3I4IA 3OG2A 3LPFA 4LOSA 2ZBJA 4CVUA 5M0TA 1COV1 1R081 4UYBA 1Q43A 1SCRA 2ZS6B 3LDKA 4HVRA 4N9HA 3WG3A 1ACCA 3SITA 5AC92 1CZTA 2D3RA 1REFA 1H8VA 2HWC1 4XHBA 2D6OX 2PHLA 3V0BA 3ZFGC 4BQ5A 3FJSA 3RMYA 1SBDA 1TME2 4Q4W1 2WINB 2XBO2 2XG3A 3AMQA 3SH3A 4CDWA 3RZKA 5EP9A 5SV8A 4P5HA 5DQ0A 3WX5A 4CUCA 1PGL1 5L7OB 1OA4A 3WW4A 4XJAA 1UWWA 2Y6JA 1NCQA 3KCXA 1S0GA 2B9UA 2G9FA 4AW7A 4YZ2A 2R042 1QEXA 4ZKTB 1VBD1 2D98A 3LPGA 4LQRA 4UW5A 2RS51 3FLPA 5FZKA 2C24A 1DQ0A 2XJVA 4YG3A 2VR4A 1LESA 5FTTC 4QHOA 2WNUB 2V72A 3EB7A 1HN1A 4CEWC 2QZ2A 1VBC2 4MSVA 4J6GA 4XBNA 1D0GA 1ODMA 1DQ1A 3B94A 4OQ9A 5A33B 1AL23 3D0SA 5FZAA 5CISA 1R092 4JGYB 4XJ8A 1QKQA 1K5JA 2QDNA 1QWRA 2PN5A 3FHIB 3T1MA 1VMJA 3IT8A 1OH3A 1ENQA 5FZOA 3OEAA 2DDUA 2VM9A 4Y5TA 1IKQA 4NIIA 5DDJ2 3PJQA 3I3BA 1V6JA 1OF3A 3KMHA 1C57A 1VRH1 2DVBA 3JBG1 4QGNA 2GSYA 4JDNA 1V9U2 4OLLA 2WN3A 3B00A 2IXIA 1POQA 2E63A 4RL7A 2YB7A 5FZ1A 1WW5A 1UPSA 3PUHA 4YM1A 2XQRA 3TWIA 1HRI2 3WG2A 3J8F1 1FAYA 3OGSA 5FMBA 5BNNB 2E51A 4ZPIA 1IGOA 1UZ0A 1X36A 1JI6A 4QQ2A 4V2WA 2RS31 4IV1A 3X29B 3BIWE 3WF2A 2RMU2 2WZ8A 1CAUB 2Z79A 4FFGA 2ZGSA 3VBFB 2BERA 3HQXA 4WM7C 4AHWA 4WVWA 5FPBA 1H8TA 3RFRA 1URXA 4B1LA 2VTXJ 2DVGA 2SLIA 2VGDA 3IIIA 3MEPA 4PQ9A 3O1MA 4FPOB 2XHNA 2AR6A 1AYN3 4AI9A 1H2KA 3ZVXA 1V00A 4JVAA 4XXPA 5FAXA 4AQTA 2G4IA 2DFCA 2Q8OA 5DABA 2GDFA 2JB8A 4UBGA 4K3UA 1UQXA 1RIRA 1UMIA 3FHAA 4YWAA 4P00B 2YPDA 1VAKA 2WLQA 2RR12 2TEPA 1UZYA 5EPAA 1CZSA 3FUQA 3ZMOA 2WAAA 3WCSA 1HW5A 2VCBA 4CCEA 4EQVA 2EXIA 1PNFA 2B39A 4PLMA 4YZ3A 4MGZE 1UU6A 4QXCA 5CAZA 3LOBA 4DS0A 3S5QA 3WT3A 1SBFA 5A3TA 2P3IA 2R073 2WNVA 4XBQA 5AVPA 2V73A 1XOYA 1BZWA 3VBOB 1W28A 1WMFA 1DGWA 1MVEA 1D4M2 4L11A 3ZSLA 2GP5A 3V65A 1C1LA 5FPAA 1UX7A 1DLLA 1NY71 5A32B 1I9RA 4D6SA 3LD8A 3VHNA 3KV6A 1KD7A 3DF0A 2PQQA 2W1SA 3HNMA 3HPNA 2I74A 4NPLA 3WQ1A 4ZS3A 1ASJ2 2VZOA 2CAVA 1EP0A 3DPRB 1BEV2 4XBLA 3T2PA 5JPNB 3WCRA 3GYDA 2A1XA 2RS13 1FX5A 4QB6A 1RHI2 4RGKA 1XSQA 1QJX2 2K2SA 2J1UA 1WWYA 2ZEZA 3A4UA 5C9AB 4R9BA 3ALQA 4XMIA 5DAWA 2GNTA 4QPIC 1F4AA 1C8NA 2P37A 1KRIA 3Q8EA 1BMV1 4N8MA 2VG9A 5BNOA 2JIJA 1G8WA 4MV2A 4YVWA 3PTYA 5FZHA 4XAEA 2GC1A 2B5HA 3LB9A 1DQ2A 5EJZB 1SDDB 4Z07A 1LULA 4HKWA 5FP7A 4O61A 4PF1A 5I93A 2Z42A 2ZGPA 1AYN1 4XCBA 5E8AA 4UI9L 1LRHA 2X29A 1W2UA 4QX0A 1JYWA 1SFYA 4RQPB 1WCQA 1WCUA 1JMUB 4DY3A 2BOJA 1L7LA 3OOXA 1MZEA 4LJHA 3OUIA 4EV0A 1C5IA 3THPA 4AEDA 1U0AA 5GLVA 2ZACA 2VQ0A 3AZWA 4IV3A 5JXHA 1UOJA 4JQTA 4ATEA 3H8XA 1MS0A 3FBYA 4X8NA 2A73B 4FFIA 2XJQA 3MPBA 3R4DB 2W91A 5C8CC 1W3XA 1JUHA 1US2A 2QQVA 4GWNA 4HT1T 1OC1A 1RITA 4AGGA 2W1UA 4KQ7A 1W2OA 4WVMB 3TEWA 1Q5OA 1RUC3 2JDYA 3AJYA 3DV8A 4MYEA 1UIJA 4LBKA 3WW1A 5ABJC 3V0AA 1RUE3 1MPXA 2R071 3K4ZA 5LBCA 4AQ2A 5EWSA 2HJIA 4MGYE 1Z7S2 2WRAA 2J1EA 4Z92B 4CDUA 1HXS2 1UPIA 1LOCA 5FYMA 5JDBA 5C71A 2QQUA 1ZNPA 4TLGA 2A5ZA 4XVHA 3ZN4A 2O8OA 4XQWA 1IS5A 4AYUA 3NNGA 2QZ3A 2R1BA 5CFDA 1G86A 1VPHA 3OBRA 3TB0A 3ZDVA 3D0JA 5DAVA 4YFZA 1GOGA 4LBMA 2ZMNA 1W6QB 1H2LA 4Q5OA 4JTNA 5FJKA 4XUNA 3GF6A 2A71A 1GANA 1UMZA 3QH7A 3SQOA 4NR1A 4DEQA 3M2MA 4X8PA 4KI5M 2R062 5D21A 4DNYA 1CGPA 1NE6A 1MEC3 2VZ3A 4F7ZA 3CO2A 5IK7A 1JYIA 1NUKA 4OHYA 2P5BA 3ZXAC 5C5TA 4BH9A 3T2OA 2UYAA 3BKZA 4EN0A 1PVC2 1RMU2 2ZHMA 1QGLA 1GWMA 2BGPA 4FPYA 5TSWA 3MW4A 4SBVA 3VD5A 1QNWA 1WA6X 4GB33 2GMEA 2Y38A 5IK8A 1OVSA 4IETA 5LK7B 1W3VA 3GBGA 4QB1A 4KMQA 3AP4A 4I3PA 3POFA 3WUCA 4FAHA 3LA3A 1R64A 1YYNA 3AZXA 3OPZA 1GZWA 3WP6A 3NL1A 2DWRA 4ZZ8A 5J36A 2JEMA 3B69A 3BPZA 2D6KA 3LSEA 4L2NA 1ZBE3 2VUDA 3POIA 3PIGA 1SPPB 5JCTA 2OA2A 3N3HA 2XH6A 1FOD2 1WW7A 2ZGRA 1LB2A 2XVKA 1H1IA 1NZIA 1QOTA 2BU9A 3I2GA 4O65A 4R52A 2NMNA 3UKVA 1DZTA 4IEPA 1RB8G 5C33A 4MGTA 4UXAA 3DKQA 3HQRA 2XL7A 1RUE1 2WBKA 4BB3A 2FQPA 1VMFA 2K46A 3Q8CA 1HV1A 4WM7B 2RG4A 1FI2A 1M06G 1H2MA 2GP3A 1JOPA 2FDHA 5L9BA 5FZCA 3LE0A 5FV3A 2JDPA 3J8F2 1HB1A 2GH2A 3HEIA 5FPUA 4LHSA 1ZRCA 2MNGA 1PM4A 4MGIE 5BNPA 2O14A 4I0AA 1WCDJ 2D97A 1REDA 2VBPA 3MFAA 1S0FA 3ZX7A 1VRBA 1SFPA 1W6OA 1X8MA 3CJIA 2QKDA 3D5OA 3WOGA 1Y3TA 2VW2A 4UAPA 3OYWA 5JIUA 3OD0A 4CDXA 4DEVA 3UL2A 1QJEA 2ADDA 2IVIB 3AKTA 2A6WA 2JG8C 4P9WA 2WZPP 5LBFA 4JGZC 3WP4A 3W5MA 4LT5A 4M00A 2PHWA 3I2OA 5CU1A 1NCRB 2B45X 3S7EA 1NLRA 5KHJA 1MEC1 4KU8A 1NAEA 3CLPA 1UN1A 1O4ZA 1A78A 3BPSA 1R1ZA 1SLTA 4IGOA 3ATGA 4IE0A 1C5HA 1VP6A 2W39A 3JB8A 4XEZA 4XF0A 4Z1VA 1VB4A 2WYFA 5GJ6A 5GZFA 5FUIA 3UGHA 3BVCA 4LTAA 1I3HA 2RJKA 5T5PA 1QJU2 2BEOA 2BQPA 2YC2A 4GB31 4K20A 1KJLA 2BNNA 3I59A 4BQ1A 3T2QA 5LZ6A 3OGJA 1POV1 1XQNA 3J4UH 5K4LA 4DZGA 5F8PA 5JOYA 2BGOA 3VBRB 4JRAA 3M3OA 3OJBA 1KQRA 1OLME 2RDQA 5FYBA 1LHNA 3T4HB 4E8CA 3L2YA 4XFFA 5EV7A 4K1YA 3AMMA 3IDCB 3M3CA 1ULOA 2V4VA 3ABZA 4FPGA 2WZR3 4Z82A 4Q4Y1 1ODNA 4GWJA 4HK9A 1QF3A 2MEV3 2YY1A 2OKXA 2D44A 1VBB1 2O0OA 3K2OA 2VJXA 3KQ4B 4OI0A 1JHNA 1M4WA 2XJSA 4QPIB 4QM8A 4B7KA 4M0HA 3CBNA 1MQTB 3Q9OA 3RYRA 5FP8A 3EYPA 1N1YA 2XL9A 4CUGA 3PMSA 2WAOA 1AYM3 3BU7A 2YZ4A 1UY1A 1X9TA 1AR83 3ON7A 3NKGA 4LLOA 2FZ1A 3I3EA 2XPJA 1X7NA 5JSRA 3I2KA 4I02A 2SBAA 2EAKA 4OHXA 2D6NA 1DFQA 2CAUA 1OBNA 5GZDA 2DURA 3GJAA 3BTXA 1I6XA 1UIKA 3PLQA 4LORA 1UY3A 4Q4X2 5FKCA 3RMXA 3ZPYA 5DPNA 3W20A 1O3TA 2J1RA 3IAPA 5JR7B 1S1AA 3T0DA 3KD4A 3LIHA 5F6KA 3VDDA 5EXOA 2PLV3 1HJFA 5AC93 1H9WA 4LEJA 3ZXDA 1F8VA 4NHXA 4WM8A 1OH4A 1D2QA 1DGLA 1PMIA 1SQ4A 1TME3 4P9LA 4LE4A 3C8XA 1A6CA 2XBO3 4ET7A 3ZSKA 1J59A 5A1AA 1BBT2 5C7GA 5C8CB 4COZA 1KDMA 2Y6LA 3POBA 2YXSA 2PHDA 2Y60A 3N9MA 1PO13 3VKNA 2R043 3M3EA 3ZYJB 3AP6A 4Q26A 5ABJB 3OTFA 2D93A 1AR62 2JX9A 1WLWA 2VCAA 2WUHA 1RUH2 3NMBA 3RQ0A 4CCLA 2ZA9A 1VBC3 4CU7A 3D82A 5L7OA 4DY5A 1E57A 5A6XA 3MW2A 5FBJA 1MACA 2C26A 3BN6A 4LK6A 4M4PA 1SBEA 2R6QA 1QDOA 4NOTA 4XAAA 4YGCA 3MLLA 2VZVA 5DUUA 3ZFEC 1X9PA 3QH6A 3NV4A 3FUOA 2HWD3 4PQQA 1LOAA 2C4XA 1BVP1 2WNUA 2JDAA 5LBBA 2OQ6A 5JI9A 1O7FA 1RUF3 4EROA 2WZR1 2FDKA 1W99A 2BWAA 1U12A 2B42B 2WO7A 5A33A 3BTYA 3POJA 1FV3A 3HMYA 4FOQA 4JGYA 4COWA 5IVVA 1I1EA 2J1VA 3NSTA 4P08A 2ZGNA 4FOVA 5T3NA 3ZN6B 2PA7A 1MR5A 4PCRA 2OW4A 1IPKA 3RNSA 4P02B 1S2BA 5BYNA 4G9SB 3KGLA 2ZX4A 4GD4A 4YFWA 4ASMB 4CCKA 3HN1A 4GWIA 4U2AA 3SLIA 1W8WA 2YBKA 3SHRA 4E4DX 4FQZA 3ZYRA 2ORZA 3VD4A 5C3QA 3MF9A 2J1SA 3MW3A 1L7RA 4NE9A 1C3HA 2J22A 1ZA4A 3POGA 1W6PB 3I7DA 3POSA 1GYKA 2DVAA 2OYZA 1MS5A 1YC61 3LAGA 1K42A 4LBQA 1GLHA 2PLV1 5BNNA 5JMCA 3ROUA 2BOIA 2RM23 2BRTA 1WCSA 2JDUA 2CYFA 5GLUA 2EXJA 2JD4A 3IDEA 5F32A 1R1A1 3I3QA 1QQP3 3VBFA 2PAEA 3AM2A 3DUIA 5F5AA 5IWFA 2ID4A 1A3KA 1GP6A 4M0NA 3I3MA 4META 5GM0A 1LOFC 3NNLA 5FXVA 4AVTA 2AC1A 4BU2A 1FMD1 1PO11 1KS5A 3P1IA 4N53C 5FQ0B 4A6OA 2JE8A 1S0DA 1O3SA 1H6YA 1VIWB 1D7PM 4LITA 1RUNA 2EA7A 4XIKA 1W9WA 2JG9C 3N9NA 2QUOA 1N47A 4Q29A 4YARA 1TZOA 2Z69A 3JD72 1DIWA 4ONUA 4MLOA 1GBGA 1JYTA 4Q4V3 4R8HA 2WYSA 3RG0A 5J48A 2VCCA 1NLSA 4NVPA 3ZSMA 2HWD1 4XUQA 4BLIA 1W6NB 4CZSA 2P1BA 4AI2A 3FFZA 1G9CA 1D2SA 1DU3D 2BVBA 1WA4A 1RC6A 2JG8B 3EXUA 3I2JA 4JGZB 3VBOA 1AXYA 2R1DA 3ZDSA 1IQAA 1LEMA 2WNOA 4GMP1 4OZXA 2CNAA 3AXEA 3OF1A 1BEV3 4CXWA 2WJSA 4JV4A 2E7TA 4DUVA 5A3OA 1XE0A 5IT6A 2WFPA 2WIIB 1QJX3 1GU3A 3AKSA 3IDAA 3N7KA 5FYZA 3S6PA 1GP4A 2WC2A 4L8QA 5JR2A 5A32A 2UY9A 5HCBA 5FDBA 5B4NA 5JOXA 2Q1FA 3VBUC 5CADA 3BALA 1GFF2 1AR92 4N43C 3UT0A 4CTEA 3A22A 1OFNA 5LASA 3DPRA 1O59A 1QJY3 3MV01 5J98B 2VMDA 4BK4A 4YW7A 5C9AA 1FXZA 3HT1A 4AR2A 4XF3A 2AEYA 5J37A 4YW4A 3RVHA 4NHLA 2JJ6A 2RM21 2AACA 3CNAA 4IE6A 3OD4A 2XR4A 3UKTA 2Y6FA 1QQP1 1LOEA 3W58A 2WO3A 5FXXA 2Q4SA 1U5ZA 4A4AA 4Q0QA 1NT0A 5HXMA 3C3VA 4FOYA 1DYKA 1BVVA 2A6YA 4FAGA 5EZWA 1LOGA 1ULDA 3WHUA 3ZYFA 5ACA2 1EY2A 4RQPA 3VBHC 1IZ3A 3H50A 2QQNA 3U37A 1EUUA 1B35C 4XJZA 3AVRA 5FZ7A 3P3NA 1AX1A 5FZIA 3WDWA 3WDYA 1FNYA 2FZ2A 1VBB2 4GH4C 1CONA 2RV9A 3T3YA 1AF9A 1ULGA 1PMJX 1XB9A 3CF6E 1XRUA 4CYDA 1SLAA 2OZJA 3TN93 1J3PA 1SACA 4Q4V1 1A8MA 2QFEA 2ZAAA 4MX3A 1HXS3 3C7EA 1PM7A 1LHWA 1STMA 4NAMA 5CYYA 4YVSB 3ST7A 4GA9A 2WO2A 4CCNA 4YPJA 5IVJA 1JU3A 3H8UA 1OFSA 4QKDA 5GKAC 2QQMA 4WVMA 5JLVA 2JENA 4MZUA 3V64A 5FYHA 3WY6A 5KC5A 4XFBA 4L9BA 3IB3A 1DQ4A 4ASLA 3O14A 4ARYA 3VKOA 2BDRA 3I49A 3IWZA 1XNTA 4IEQA 1Q8PA 2V09A 4MH0E 4BJ0A 1Z0HA 1PMHX 5AFEA 3H8RA 2NM1A 1HLCA 3MI8A 3ZR6A 4Z8BA 1OVPA 3B9IA 5D8AB 2VW0A 3LWCA 4OHVA 4FPEA 5CG8A 5F37A 1W9FA 2LTNA 1GR3A 3MUY1 4H55A 4Y26A 4XUPA 5GLWA 1YI9A 2R063 4CU9A 3ETQA 2ZGLA 4BXFA 4RGGA 3RS6A 4YW2A 4H7MA 4PJYA 4MGSA 3VBSC 3THDA 4YYOA 2OPWA 1EAH2 1W6QA 2ZPXA 3C7HA 1XNDA 4WVZA 4ZXKA 2XUMA 3BCWA 1RMU3 1QJY1 4QXKA 4KG0A 3OBZA 2K0GA 2ERFA 4UFIA 3ZFEB 3NNMA 1V0AA 3FX3A 1RUI2 3A21A 1VE0A 2VNOA 3PUQA 5FYSA 2IFWA 4NRMA 3DYOA 2Y8KA 3UNPA 2ZMKA 4GJYA 4IEXA 5F5QA 2DVDA 2W1QA 2YBSA 1CX4A 1J83A 2FMDA 2HWF3 4DFSA 1OMIA 2X10A 1XNBA 3ILFA 3KCYA 4WBBA 5LY1A 1YIFA 3ITQA 1Q8QA 4RYDA 4QXBA 3SEPA 2W3JA 4A3XA 4BWOA 2GAUA 4L0PA 1RUJ3 3DKWA 3PTRB 1ZBA3 1O5LA 3KWVA 4BQWA 3KM5A 2YUEA 3VZJA 5FPVA 4LO6B 2XHKA 1S0EA 4QDRA 2R30A 5T54A 5T55A 1BLZA 4XC9A 5IATA 4W8JA 3TN91 3K46A 4W6WA 4YG0A 3RZJA 1GSLA 1SPPA 2EIEA 1XYOA 1POV0 2N7GA 1H4GA 3ZN5A 3OPWA 1IPSA 2VMEA 3SC7X 1RTVA 1EV12 1UW8A 4YW3A 5LA9A 1U5XA 1Q8OA 2VZSA 4BPZA 4LKEA 3Q8BA 4EWDA 1VBA3 4PLOA 4CSWA 2P6CA 4JKMA 2KR2A 3WP3A 2VTFA 2QQJA 3N7MA 5C4WB 3E6CC 5HCHA 5BY5A 1YIPA 2W47A 2YHJA 4WM7A 5CKQA 5K0UC 3ACGA 4CEYC 4CP0A 2BVVA 3LFIA 3M70A 2XJRA 4LA3A 2JXAA 2VZ1A 2W9XA 3NNFA 1PGSA 2VMGA 3FWEA 1VBE1 5FWEA 1XBFA 1LU2A 4J25A 4UW6A 1VMHA 4M3CB 3WINE 4CDQC 3S5AA 4AVBA 1LNSA 1WUVA 2C9KA 2E7QA 3LA7A 1CAWB 2QQIA 5EHDA 1BCXA 1SZBA 1NZCA 2P3JA 2D5HA 3VL9A 2Y26A 1Y9QA 2OPKA 5JSPA 3M3IA 4LUKA 3OCPA 4K6BA 5EYYA 5A1FA 3ZFFC 3IPVB 3JQXA 4QKFA 5K7PA 3MUZ1 1NCRA 4QQHA 5EFUA 1FNZA 1QJU3 1P8JA 2HWB1 5FK8A 3WG1A 4LO8A 4E2GA 3O1VA 1US3A 4HLTA 5FY7A 2VY0A 5LCWL 5EYXA 1AUYA 1MS4A 5FMOS 5A7OA 3SXWA 5A6QA 3TBDA 5LEKA 4FTEA 1G7YA 4E4ZA 2HWF1 5CB7A 4IEVA 2ILMA 1HQWA 5C70A 1Y9MA 4QXHA 2RE9A 5F2WA 2XOMA 4AVCA 1V6OA 2EIGA 2OUHA 1PO21 4LXLA 3RRDA 1BK0A 1RUJ1 1DGRN 2VXJA 1ZBA1 3ZSEA 2P2KA 4F3JA 1H1MA 2CSGA 3VBRA 2DUPA 1W8UA 1TMF2 4KGQA 4XFGA 4IDZA 1CQ9A 1NQJA 2PMWB 2PAKA 1PIV3 1A8DA 2DCJA 3VBUB 4Q2FA 1PGW2 4N43B 1OT5A 1QHDA 1NA1B 3RZHA 2DBNA 3B02A 4OMCA 1AR73 1OQEA 4GAZA 5FP9A 1UOGA 3QACA 4PBPA 4TN7A 3O1OA 4QPIA 5HPOA 4NHKA 3ZYHA 1O91A 3RYKA 2Y0IA 1PZ9A 4CDWC 1MQTA 1O8PA 3EBRA 1VBA1 1AX2A 1ZRIA 3CZJA 4UW4A 2NZ9A 2HYKA 4LBOA 1NCQC 1GNYA 1W2AX 3HBZA 4NIHA 1SLCA 3RDIA 1MS8A 1XXNA 1XC6A 2OZ6A 3BGAA 4BLJA 3NJXA 1PNGA 4IEOA 4UFKA 2ZXQA 2WN2A 2XLAA 4ITCA 3T0BA 3UETA 4AVVA 4D0QA 2CU5A 4F8AA 3IMNA 4JKKA 1YQ2A 4ZONA 5EQUA 1UMHA 2YV8A 3VBHB 4E9KA 1CJDA 4WZFA 5DZFA 3WZ1A 1B35B 2IXLA 2R32A 3S30A 1AL21 2FMYA 4BQ4A 4K9SA 1RVF2 2YYOA 1YLLA 2JICA 4MVTA 5IAXA 1GNHA 1AR63 1C8M3 2NPIA 4XF1A 1RUH3 5HBAA 1UZZA 5C5UA 5IVCA 5C8CA 1JTZX 4IQPA 2O1QA 2BYVE 5IVBA 5JOZA 3ZO0B 1UY4A 1U5YA 2CWMA 2VMCA 3F95A 5A7NA 3SCHA 2W87A 1H4HA 2AEZA 2WQ4A 1GUIA 5ABJA 2CY6A 5SV5A 3MIBA 5FYIA 1JYXA 4I01A 4NHYA 1LGBA 3LQCA 4BQXA 4DRRA 3T30A 1UKGA 4IEUA 4B1MA 3PNAA 2ET7A 3S7IA 3LCPA 3I8TA 2A6XA 1UKRA 2CGPA 1RUG2 2WFF3 4FCAA 2D3SA 1V70A 4AFMA 2YGLA 4Q1RA 4DXRA 3LEMA 4Y1UA 5FZ3A 2F4PA 4XE9A 3K48A 1AVBA 1PIV1 1UU5A 2RJLA 3WXPA 3R6SA 1VAVA 3WDVA 1JS9A 2JE7A 3WNPA 4D3WA 2I2SA 4D6QA 2W68A 1FPN3 4A42A 1W05A 3J9SA 3IMMA 1AR71 1HB3A 2Q1MA 4LUMA 4R9CA 3BTZA 1HB2A 1HRV2 1SDWA 1WKYA 2WABA 2DF7A 4GZ9A 2IXCA 2ET1A 2Z4FA 4CRQA 3K3OA 3ZN6A 4NN0A 4Y33A 2X5IB 2DV9A 4PI0A 3QOPA 4K1ZA 4UFMA 5AVAA 3PMEA 4S2GA 5J1XA 3ELNA 1WW6A 4NUBA 2G9GA 1KDKA 3WDTA 4XQDA 5KHHA 2GMMA 4GMP0 5B2GB 5ANNA 3OGGA 4XCAA 2F4LA 2X53S 2W1WA 5LA0A 4AFDA 1E5HA 2G19A 4NAOA 4Y1VA 4A44A 3PUSA 2CDPA 1OA3A 4I3GA 4AI8A 3VV1A 1D0HA 2YROA 1RYYA 3AYDA 4QKBA 5KHKA 4Y1ZA 4CE8A 3VZKA 3M1HA 1DYPA 1NOVA 2BGCA 4HVQA 1LTEA 3K3NA 5FZ8A 4FXGB 2HKXA 2V5DA 3E5UA 4R4XA 3DN7A 3U14A 1C8M1 4DPNA 3ZXJA 2EICA 1NQDA 3MLKA 5DAPA 5FK7A 5DZGA 1V6LA 1LAJA 3ZFGB 4OI2A 3SKJE 3FMGA 4FQ4A 2GC0A 1WMXA 1UCXA 5J09A 2VOXA 2RHPA 3WQ7A 5FQ0A 2W0XA 1CIWA 3CMGA 1COV2 4Y20B 4PIZA 1R082 2ES3A 2RS11 3LDRA 1A34A 4ZHNA 2GZWA 2HWC2 3LGRA 4IW3A 5FOBB 2WS93 5FO9B 2FCUA 3JXSA 4EWEA 4Q4W2 5CZKA 2QTWB 3JB4C 5FY9A 2WFF1 3POEA 5F39A 3OY8A 4UOJA 4CEWB 4HMZA 2LW8A 2AGSA 1PGL2 1CIYA 2IUWA 2Q0AA 4YVWC 3AYCA 2PFWA 5FREA 3D4KA 5FR3A 2A7AA 1W6NA 3PJYA 1RGSA 3E97A 1QJFA 4XZUG 5FYUA 1VBD2 2EVXA 2E6VA 5KHIA 4CPBD 3WHTA 3IIAA 1FPN1 2RS52 4AVSA 5KBFA 3BTAA 3BODA 4JGZA 4QX5A 3ZFFB 3ZOIA 2UWBA 5G04L 3VZNA 1AR93 4W4ZA 2ZZJA 3U75A 4E2SA 4LKDA 1BHGA 4U36A 5FUPA 3KB5A 1JZ2A 2HEWF 1ENRA 2XGXA 4AEDC 4XW3A 5L9RA 2GNDA 5FZMA 5T52A 3I2HA 2BUKA 2ARAA 1EPWA 4QX1A 4OUMA 1GMMA 4Q0UA 2XJUA 3IAQA 4HKOA 2ZEWA 4YW6A 3VHRA 1ZRDA 1W0PA 2RJ2A 2MHFA 1LKNA 2OUJA 4HL0A 1WCKA 3HWJA 2E9QA 1RUC1 3MLJA 5JOWA 4IUGA 1VRH2 3JBG2 4C1XA 5C3PA 1QNYA 1QDCA 2FDGA 3O1UA 2FDIA 4PDWC 4YGDA 2JWPA 3IM0A 1J84A 2AYHA 2YG0A 4A45A 2D43A 4EN8B 5BPXA 4MADA 1PO22 3ZM8A 2ETEA 4OFGA 5FO7B 3WVJA 2H6CA 2RS32 3FC0A 1IG0A 3B5LB 4AAPA 2ZHKA 5JZGC 5E16A 4RHV3 5CFDC 4RFT0 3CKHA 3L2HA 1BQPA 3N9OA 1O3QA 3TYJA 4CDWB 4LBNA 5IUQA 1G9FA 2Q1ZB 3I3DA 2P17A 5FPZA 2IXKA 2Y0OA 4IE7A 4ES8A 5A7SA 2ZGQA 5FYYA 4EZ4A 2HWE3 4YNIA 5CFCC 2XLFA 4QX8A 2WS91 4JRLA 1J3RA 3O1SA 5J3UA 5CIRA 2QE3A 2Y64A 4XTPA 4XETA 3FBMA 4AAXA 1SFNA 3DYPA 3OUJA 5FY1A 4ZU7A 3P3PA 2A3XA 1X33A 2ZMLA 1CAXB 3O0XA 4YVSA 4IEZA 3O5SA 1KFUL 1OKQA 4XZPA 3T1LA 2VQUA 2JDZA 2I45A 3INAA 2R0HA 1WD3A 3P6BA 4GIQA 4H14A 4PF5A 4RA0A 4TYSA 4MG2A 2QQOA 3U78A 4IL7A 1Y7BA 1OUXA 4KL1A 2BNOA 1F2NA 2DU1A 2ZAHA 4GKYA 3RJ2X 1TNFA 4MHRA 5FKBA 1ZZ9A 3ILRA 3ZYGA 1ZZ8A 3LEKA 1SG3A 4KWKA 3IN9A 4ZXEA 4ZU4A 2JDKA 2JKXA 4GJZA 5FRAA 3M4FA 5D8AA 1AL22 3T4VA 1GZTA 1VALA 3KQRA 4JHTA 3VDAA 3NWKA 3RZMA 1O4TA 3HAGA 3HNBM 4JTOA 1ZBE1 1LHVA 2VPVA 3VD7A 4XUTA 1RUD3 4YM2A 5EIYB 4MGQA 1G9AA 1S4CA 1NY72 4PT6A 4XJUA 1RJ7A 2GN7A 2PHTA 4BIFA 3W21A 2ARXA 2WQ8A 2YC4A 3PU8A 4QHZA 3UJQA 3VL8A 3R0RA 2D6PA 3ZFEA 3PVOA 1H2NA 4Y22B 1CAVB 2RDSA 1EPZA 3VB9A 4Y4RA 4ES9A 2PAMA 4QX3A 2ZKNA 2F17A 1V6NA 3NRUA 3NW4A 4WZCA 3PL0A 4MGKE 1GKBA 1F35A 2C5DA 4KWLA 4Y1YA 1SLBA 3MPPG 3N36A 5ANQA 3ME2A 3U07A 3AZYA 1JYVA 4AF9A 2GNBA 1O4YA 2P3KA 5BNPC 2YFUA 1PVXA 1Y4WA 4RHV1 1H0BA 1LGCA 3EO6A 1W06A 3E6DA 3VDCA 1XYPA 4AI1A 1G6NA 2CV6A 1GWKA 3O0VA 3GCWA 3M3QA 1AYN2 3CJXA 3JCIA 3KLSA 4QX2A 2HWE1 3OB8A 1MS9A 2G9ZA 1DGWX 3QBQA 2IXJA 5FZGA 2ZOEB 4PI2A 4BMEA 4AG4A 3HT2A 4P9GA 5FWJA 1GOFA 2YPJA 2ZX3A 1QOSA 1PK6C 4LKSA 1G9BA 1YJKA 3DYMA 3APBA 1YHFA 3GZTB 2VNGA 5IW0A 3EMRA 2JDNA 2Q5TA 4NMIA 4Q0VA 4OMDA 1X82A 1JN2P 4AQ6A 2Y6KA 4P9XA 3DCQA 3WQ0A 3GHNA 1DG6A 5C4WA 2C1FA 4OVEA 2C0ZA 1R093 2WSVA 1YQ8A 4DINB 1CJPA 3KHCA 1J58A 2QQPA 4AI0A 1QIQA 1LOFA 2R072 2VH9A 1PX3A 5C8WA 4E27A 5FZ0A 3U1XA 2VUJA 4ZY9A 2BFUS 4M3CA 5FIXA 2IFRA 5DDJ3 1PX4A 2DCZA 1UY0A 2MEV1 3IDBB 4TLFA 5I0UA 3USSA 1F15A 4P9YA 1CAWA 3O12A 1RUD1 4S2DA 1VR3A 3V56A 4DOUA 1DGRA 2W5FA 1V9U3 2NN8A 3DXTA 4DXTA 2XUEA 4O9GA 4LO4B 1N3PA 1OOPC 4EN9B 3HQUA 3Q8FA 2R0FA 3RPQA 3WW3A 3IPVA 2ZEXA 1AYM1 1HRI3 1AR81 2VOKA 5APAA 1VJ2A 3WF3A 1OLRA 4CU6A 2W94A 4ZZ5A 3VUOA 3NQHA 1HQNA 4NIAA 1C4RA 2RMU3 1OF4A 1ZRFA 3WW2A 4K21A 1UX6A 5A3PA 3AKQA 2XVLA 3WR0A 1KGYA 4FVVA 3AP5A 3J7HA 3WF0A 2CDOA 3AXDA 5FY0A 5AC91 3VDDC 5AFBA 5FZLA 3KT1A 4QGLA 3MZHA 4WM8C 3VDBA 4Z2WA 1CAUA 1TME1 2VL4A 2ZCWA 4QPGC 2XBO1 1JU4A 4NWVA 3MHZA 4N43A 2VULA 4BA6A 4Q0SA 2RR13 1NA1A 5KXBA 1YCIA 4QU2A 3THCA 2A3YA 3W5NA 2ZGTA 2R041 3FE5A 4XQ4A 1PHMA 4K8FA 1UNBA 3U11A 3PU3A 2RDNA 2YBPA 5I8YA 3BB6A 4JQRA 2EALA 2DU0A 2IVJA 4BE3A 4FTSA 4XJWA 4QT6A 5FLJA 4PDWB 2EF6A 5A3WA 4KWJA 1AHSA 4DIQA 1VBC1 4CXYA 4LULA 1ND2C 5L7OC 4QB2A 2FBEA 5FUNA 2LUWA 4BOWA 1R091 4OYUA 1D4M3 1BK1A 1JXNA 3KHBA 1YFXA 4URAA 2ADEA 1RUE2 3TRSB 4E2QA 1DF0A 1OA2A 2OT7A 4R9DA 3AMHA 5JZGB 2LRPA 1OHFA 3MIDA 1N3QA 2B4KA 4FSJA 3O7OA 2WNUC 5FZ6A 5FZBA 2BV4A 2KA3A 1RUF1 2LS6A 5DDJ1 3VBHA 4LIVA 3NAPC 3AYAA 1K5MC 4UF0B 4MXVA 1YNAA 1CZVA 1SHWB 5CFCB 1ZVFA 4YGEA 2VXRA 5CBLA 2ZZQA 1ASJ3 1AXZA 1W2TA 1V9U1 2PHUA 1OSGA 3K77A 5DAXA 1CWPA 1T6GC 1XU2A 4D7SA 1RHI3 1W9TA 5IYYA 4AFCA 2VOWA 4F83A 4OUEA 2VBBA 4FP2A 1HRI1 2A3WA 4FI9A 1W6MB 2AREA 2QQLA 1J1LA 3NJYA
chains in the Genus database with same CATH topology
1AJOA 3MF6A 5KHGA 5H9RA 2RMU1 1S0JA 2AENA 1MEC2 1N1TA 5L36A 2WA3A 4H7LA 1C1FA 4YM3A 1ULEA 4R4ZA 1PZ7A 1LEDA 4OI1A 4XJ9A 1HKDA 2WL1A 5BNNC 1HRV3 1JYCA 5HCFA 2ZX1A 4G4FA 4GB32 4QQLA 4RR3C 3PHMA 5JSOA 1H30A 1V6KA 1SLLA 1YO8A 2RR11 3LOIA 3JQWA 5BV6A 5DUVA 3PVNA 5F1RA 1AZDA 4YRDA 2WLPA 3IKWA 4Q4Y2 2X5IA 2B8MA 1UAIA 2NYYA 5DG1A 5KC6A 4P9IA 2D5FA 4FTBA 1C28A 3POWA 1TQ5A 4J1XA 1Z7S3 1D4M1 2DCTA 2WT1A 4C1WA 5BNPB 2ATFA 5FOJB 2XWJB 2YC0A 1JW6A 2R16A 3GZUC 4GXLA 2IXHA 1TNRA 3QCWA 1LENA 3I2DA 3ZXLA 3KGZA 2PELA 3VBOC 1ASJ1 4M3CF 4NWWA 1BEV1 1XE7A 3THTA 1R083 1PK6B 2IWGB 3LKJA 1QJX1 4RD7A 4EN6B 3AFKA 4FPCA 3ZFGA 5H9PA 2GALA 2BWCA 4QQPA 3CL1A 5L73A 3D6EA 3SCFA 2DUOA 4Y20A 3RI9A 2PYTA 1PVC3 1GICA 1D4VB 1SCSA 4XIOA 4QMAA 5C9AC 4TSVA 1NXMA 1XNCA 3FFQA 2E7AA 4FP3A 3WNXA 1PZ8A 4CEWA 2I07B 5J96B 3S0MA 3VLBB 3FLTA 2UWAA 1Q3EA 4C91A 1DDLA 2O8QA 3VKMA 2VVDA 4MUVA 4YLZA 5HCAA 1OOPB 4INDA 3ES1A 4HZFA 3WG4A 3ZFFA 2GN3A 3N7LA 1FOD3 2ZGMA 2BFUL 3VZMA 2WZR2 3ZXEA 1YXWA 4A7YA 1IS4A 1MS1A 3AKRA 5E88A 5I0RA 2VOVA 3PVEA 1WLDA 4BCUA 1WLTA 1QJZA 5D1IA 4AEJA 1SMVA 2LALA 4AXOA 4IEYA 1Z7S1 1HXS1 2P34A 2YMZA 3J8F3 4OULA 4XF4A 5FFOC 5CNAA 3T2TA 2RS33 4Q1PA 4QPGB 2B7YA 5F6LB 1LOBA 3AZVA 4Q8KA 5DXDA 1CPNA 3R4UA 1ND3C 2D3PA 2WSUA 4N53B 1F5JA 2PLV2 2VQAA 5JWPA 4HPKB 2R061 2R49A 1B09A 2JG9B 1V6IA 2A75A 1R1A2 1LJ7A 1ND2B 1ALYA 2DTYA 3EJKA 4QGMA 1PVC1 1RMU1 1YRZA 2NP0A 1FMD2 1PO12 4TWTA 1O5UA 4KNCA 3NV3A 2H0BA 2OIIA 3U10A 1Q8VA 4RS5C 1J1TA 2ZTNA 3NAPB 1K5MB 1CAXA 1QMJA 1BYHA 2OVUA 1X50A 1DBNA 1JOJA 2D40A 4FPHA 4AEKA 4I09A 4RSUA 3GALA 4N7IA 4YZ4A 3VZOA 2HWD2 3UJOA 1HV0A 3ZXFA 1FOD1 2XB6C 2VW1A 4EWAA 3JU9A 1MS3A 1RUF2 2ZHNA 1VLNA 3EQEA 4BZ4A 4DMIA 2VU9A 1IOAA 2DCKA 2ENRA 1FYUA 1YJLA 4FT8A 3RI8A 2Z2SB 4YSFA 4KU7A 4KH9A 4PBOA 4QPYA 4LBQB 3M8LA 4AHXA 4Q4X3 1X8EA 4O9EA 5EJ3A 4Y22A 1CAVA 4OHWA 3SMHA 4RR3B 3WV6A 4AK3A 4B7EA 4YG6A 4B3NA 4GKXA 5E89A 1SEFA 1LU1A 3ZYPA 1QXRA 3VKFC 4GALA 4AI3A 1BBT3 1Z78A 2RM22 4IEWA 4L97A 3URFA 3KSCA 4ISQA 1S0BA 3D8CA 5JVVA 1QQP2 4GH4B 4N7UA 3O0WA 1OPOA 4K7JA 2XWBB 2JKBA 1RUOA 4IESA 2QVSB 1DQ5A 3CEWA 1YFWA 1NCRC 3KZ4C 4I0WB 1QJU1 4FOWA 4ATFA 4LLFA 1RL3A 3SH5A 3ZXGA 3USUB 2TBVA 5DUXA 1CVNA 2ZX2A 1CR7A 4Q4V2 2HEYF 1IHMA 5T5JA 1LGNA 4Y1XA 4HKLA 3MGUA 4HSJA 5H9QA 2AZ5A 1QXPA 4B4RA 5LRSA 4IV1C 3HIFA 3VBRC 3H1MA 5HI0A 3WLUA 4C0BA 3MYXA 1F5FA 2CTVA 3NV1A 3VBSB 1H8TC 5BNQA 1LR5A 1MVQA 3ZIWA 1QU0A 3TNQA 4JDOA 1N1VA 1U5IA 5FPXA 2TUNA 3DGTA 4OI4A 4YW1A 1HDKA 3H7JA 1BXHA 1MQTC 1WMDA 4Q4X1 2ZKLA 1VB2A 1QOOA 5C6CA 1QJY2 4YGBA 5H9SA 4X6RB 1J3QA 4WVVA 3B9CA 1VAMA 4KG8A 3RSJA 4KBBA 3ACLA 1BBT1 1W6PA 5GZCA 3WDXA 2XJTA 5FCCA 2C9AA 4JAAA 2WNVC 1IKPA 2GU9A 3KT4A 4X6QB 1EYBA 4LBLA 1AR61 1FATA 1G9DA 1RUH1 3LSDA 4ZU5A 5LEJA 3AK0A 2A70A 3JD73 1CPMA 1S0IA 2BPA2 3NVCA 4CP2A 1OQ1A 3W59A 1JBCA 1F9KA 1UL9A 2VECA 1NXD1 1ZM1A 4YW5A 5K0UB 3TN92 4MXWB 4PDWA 4M01A 4CEYB 1OPMA 1ND3B 1S55A 4FO9A 5BNOC 4CDQB 1O3RA 2Q30A 1AJKA 4LO7A 1TEIA 5JZGA 4B4QA 3VGIA 2DFBA 4GWMA 1REEA 4XILA 2CGOA 2JG8A 1VBE2 2JE9A 5FLIA 5CFCA 4FPJA 5JAXA 3NV2A 4XYXA 3I54A 4BHPA 5T50A 4BM8A 4RS5B 3GZAA 1QH7A 1H1AA 1XU1A 1DZRA 1V6MA 4OHZA 4IV3C 5HXVA 3SH4A 1W6MA 1ENXA 4P9JA 2W52A 1WBFA 1XE8A 3SISA 3H3UA 1QH6A 3J26N 2HWB2 1POV3 2YGMA 2ZX0A 2QDRA 5FMOL 4JCKA 3H9AA 1MZFA 1HQLA 2CGNA 2HWF2 4LNVA 4QM9A 5ACA3 4CDUC 1L3JA 4LBJA 5K9YA 4XDQA 4PIXA 4Q4Y3 1AL0G 3POYA 2EAAA 4LHNA 1RUJ2 1VBB3 2QJVA 5FLHA 4A2UA 1ZBA2 4I0BA 2WA4A 2D6LX 1WLCA 3GBFA 3ECQA 3JD71 5IK5A 1LCLA 1W0OA 2GC2A 1HX6A 3B7MA 4HN0A 3VKLA 3V0BB 4D94A 1ZX5A 4D69A 3KT7A 4XOGA 1NCQB 1S2KA 4HN1A 2VVFA 3KCCA 5KWRA 2Z5WA 3VN4A 4UW3A 1OLQA 4I2OA 3AMPA 5T5OA 2XJPA 3EHKA 4KGGA 3H3ZA 1VBA2 4FPKA 2CWSA 2LM3A 5GZEA 3VHOA 3KS7A 3WDUA 4C90A 5I8TA 3SCGA 5T5LA 3ZIXA 4ORFA 4SLIA 4DB5A 3AP9A 1AR91 5I0SA 2KM2A 2XKPA 3E6BA 1EAH3 1H9PA 2X8KA 1OQDA 3G7DA 2H6BA 3GNEA 1FT9A 3LA2A 1PK6A 4AQSA 2BBVA 1Y43B 4NPRA 1RUI3 4A7KA 3OBTA 4Y5Z0 2WWSA 1UF2C 1DQ6A 4LE3A 2PHXA 3VZLA 2AH2A 2TNFA 4H3WA 2ZABA 3MIGA 2BW8A 2CL2A 3B01A 4AFAA 4IV1B 2XLGA 2QCSB 4HFSA 2NLRA 4G3YC 4XTMA 5ACA1 1H8TB 1YUDA 2D6MA 3N7JA 4AWDA 3AFGA 2EXHA 2WNEA 1I5ZA 1Q8SA 5A3MA 3ZXKA 2HEVF 3ES4A 1AX0A 4D7TA 5F9TA 1SLIA 5I8SA 1QXJA 1ZZ6A 2BTVC 1OOPA 4URTA 1PIV2 3CJIC 1JUIA 4AVAA 1CESA 4CDXC 4FPLA 2VUAA 1AR72 4XF9A 1EV13 2BNMA 1HIXA 4XPVA 5E1RA 4HBNA 4DQAA 4JDMA 4W6YA 2ZGUA 2WNVB 3H0OA 4YVSC 3ZYIB 3AMNA 5GLZA 1ZRRA 1BKZA 4J1WA 2FHRA 2WT2A 3TNPB 3BOPA 4QPGA 1R1A3 4AHYA 4R9AA 2WKKA 1EAH1 3TOJA 4Q0PA 2XVGA 4D7YA 1LECA 4N53A 5D8AC 1FMD3 1RUI1 2B46X 4HPKA 1ZREA 3G6JB 2PTMA 4CP1A 2JG9A 1C8M2 3AJZA 1XNKA 1DHKB 3IBMA 4BYYA 2WQZC 5A3LA 1ND2A 4PIYA 1FV2A 4AGVA 4YZ1A 3ILNA 3WP5A 5BNOB 3FLRA 4YVWB 2RS12 3U0ZA 2DTWA 5KXDA 4DRVA 1NE4A 5CVRA 2V5YA 3NAPA 1TMF3 1K5MA 1GV9A 4GQ7A 1S0CA 3WUDA 2WFF2 4GMP3 1RJ8A 4B4PA 3FZ3A 3RZZA 4COUA 1GQHA 1N1SA 4XFAA 4COYA 4AHZA 1OD5A 1GNZA 4AEDB 4V1PA 1JH5A 3LZZA 4IV3B 1FPN2 3AYEA 5I91A 1WW4A 4I30A 3VBUA 1EV11 4RGAA 1KXGA 1YI7A 4COVA 5CG9A 3E5QA 3N35A 4GULA 4AE2A 4FBFA 3V0AB 4HK8A 1WMEA 1CD3G 4S2HA 4CDUB 3AB0A 3WD5A 1DZQA 4LO5B 5K8SA 4QHBA 3AP7A 2D7FA 2AUYA 4RR3A 5C4WC 2DYCA 1RVF3 1IS3A 4XMAA 3NJZA 3VHPA 1RUC2 4XFCA 4HANA 4HVOA 4XHXA 3K51A 2UWCA 3H1WA 5CFDB 4BMBA 5GZGA 1MZ5A 2GH8A 3ASIA 2E53A 1YFUA 4AGRA 4P14A 1W39A 1B35A 1XYNA 1GZCA 1KJRA 4IXLA 4S2FA 2DUQA 4GH4A 3CU7A 4JGYC 2ZJCA 1KS4A 1WD4A 3B93A 4WV8A 2KXLA 5KXEA 3QLQA 1ZZ7A 3NKTA 3OY8B 4YM0A 1GQGA 2VMHA 3N4MA 5I93A 1APNA 3MIFA 3TAYA 4PLNA 1UU4A 4BIOA 5JI7A 2NMOA 1LODA 2ZGKA 3M7AA 5BUVA 1RUG3 3MIEA 3NO8A 1ULCA 1WGPA 3A0NA 4FPFA 4E4SA 2WS92 1TMF1 3RJRA 3USUA 1PGW1 2UU8A 1ZYBA 3JUUA 1ONAA 4B29A 1TE1B 1YWKA 3JZVA 4NHMA 4EJRA 4ISRA 5LRRA 3R05A 1GZWB 4QD2A 1RINA 4AEMA 2UYBA 1IPJA 1NG0A 4AFBA 4LA2A 3VBFC 3VBSA 3MIHA 4EN7B 2ZHLA 3ENRA 2VNRA 1NA1C 1LHUA 3ZSJA 4XXAA 4HSLA 4Y4YA 3RYPA 5IK4A 2ZGOA 2EXKA 2DVFA 1ULFA 2GNMA 3UK9A 4LHLA 2W08A 4IERA 1ZBE2 2NQYA 2UY8A 1LHOA 4C0HA 4M3CE 2VMIA 1KITA 2F6BA 1F31A 2K9ZA 3AZZA 3GBWA 1RVF1 3R4SA 4FXKB 2PHFA 4OUSA 1WBLA 4N90A 1ZZBA 3MICA 2GC3A 1W6OB 3CJIB 4TZDA 4YZ5A 4W6XA 5I0TA 3OYWB 4UBHA 2MPFA 4CDXB 4N9IA 4K40A 2UURA 5FBZA 4JC1A 3B3QE 5BXXA 3DL3A 4A7ZA 4LBQD 1COV3 1YFYA 1CN1A 3W9AA 1NYWA 1ENSA 3UV9A 4RHV2 1RHI1 2JECA 4LR4A 4QQOA 3UKNA 5GLTA 1GZ9A 4XFHA 2HWC3 4B8EA 5FO8B 3H7YA 3U4XA 2VVEA 5L19A 3MFCA 4Q4W3 2IC1A 1RUG1 4NO4A 2HWE2 1N3OA 3DPRC 1AXKA 5JPMB 1UD1A 5DZEA 3A0KA 3I59B 5K0UA 4LHKA 4MXWA 4Q8LA 2WT0A 4CEYA 1VBD3 3HD8B 2RS53 1ND3A 3PVBB 1IS6A 3RWNA 1VBE3 1HRV1 4DXZA 2H0VA 4L92A 3E5XA 4CDQA 3L9JT 4W65A 2XKOA 3AX4A 3GHMA 3H1YA 1MZ6A 5J7MA 2QNKA 5LK5A 4XFIA 1BJQA 2GMPA 3QD6A 4L99A 4RQPC 2PHRA 4HETA 2ARBA 4Y24A 1ZZCA 2MEV2 2DCYA 2A6ZA 4RS5A 2HWB3 2X5IC 5DG2A 1QY4A 1RUD2 3SNMA 1VRH3 3JBG3 2IZWA 3C2UA 5DUWA 1Q56A 3BOWA 2A6VA 3HR9A 5CA6A 1AYM2 4Q27A 5KXCA 5JIAA 3ZMNA 1AR82 1PO23 3VDDB 5GALA 3MDPA 2YDEA 3AKPA 1OI6A 4WM8B 1KFXL 3I4IA 2ZBJA 1COV1 1R081 1Q43A 1SCRA 2ZS6B 4HVRA 4N9HA 3WG3A 3SITA 5AC92 2D3RA 1REFA 1H8VA 2HWC1 4XHBA 2D6OX 2PHLA 3V0BA 3ZFGC 3FJSA 3RMYA 1SBDA 1TME2 4Q4W1 2WINB 2XBO2 2XG3A 3AMQA 3SH3A 4CDWA 5SV8A 4P5HA 3WX5A 1PGL1 5L7OB 1OA4A 3WW4A 4XJAA 3KCXA 1NCQA 1S0GA 2B9UA 2G9FA 4AW7A 4YZ2A 2R042 4ZKTB 1VBD1 2D98A 4UW5A 2RS51 3FLPA 1DQ0A 2XJVA 4YG3A 1LESA 5FTTC 2WNUB 4CEWC 2QZ2A 1VBC2 4MSVA 4J6GA 4XBNA 1D0GA 3B94A 1DQ1A 5A33B 1AL23 3D0SA 1R092 4JGYB 4XJ8A 1QKQA 3FHIB 2QDNA 1QWRA 2PN5A 3T1MA 3IT8A 1ENQA 1IKQA 5DDJ2 3PJQA 1V6JA 3KMHA 1C57A 1VRH1 2DVBA 3JBG1 4QGNA 2GSYA 4JDNA 1V9U2 4OLLA 3B00A 2IXIA 2E63A 4RL7A 1WW5A 1UPSA 4YM1A 3TWIA 1HRI2 3WG2A 3J8F1 1FAYA 5BNNB 2E51A 1IGOA 1X36A 4QQ2A 2RS31 4IV1A 3X29B 3BIWE 2RMU2 2Z79A 1CAUB 2ZGSA 3VBFB 4WM7C 3HQXA 4AHWA 4WVWA 1H8TA 1URXA 3MEPA 2DVGA 2SLIA 2VGDA 4PQ9A 4FPOB 2AR6A 1AYN3 1H2KA 3ZVXA 1V00A 4JVAA 4XXPA 5FAXA 4AQTA 2G4IA 2DFCA 2Q8OA 2GDFA 4UBGA 4K3UA 1RIRA 1VAKA 2WLQA 2RR12 2TEPA 1UZYA 3FUQA 3ZMOA 3WCSA 1HW5A 2EXIA 1PNFA 2B39A 4PLMA 4YZ3A 4MGZE 1UU6A 5CAZA 3LOBA 4DS0A 3WT3A 1SBFA 2P3IA 2R073 2WNVA 4XBQA 5AVPA 2V73A 3VBOB 1BZWA 1WMFA 1DGWA 1MVEA 1D4M2 4L11A 3ZSLA 3V65A 1C1LA 1DLLA 1NY71 5A32B 1I9RA 3VHNA 1KD7A 3DF0A 2PQQA 2I74A 3WQ1A 1ASJ2 2CAVA 1EP0A 3DPRB 1BEV2 4XBLA 5JPNB 3WCRA 3GYDA 2RS13 1FX5A 1RHI2 1QJX2 2K2SA 3A4UA 5C9AB 4R9BA 3ALQA 4XMIA 2GNTA 4QPIC 1C8NA 2P37A 1KRIA 1BMV1 2VG9A 5BNOA 1G8WA 4MV2A 4YVWA 3PTYA 2GC1A 2B5HA 3LB9A 1DQ2A 4Z07A 1LULA 4HKWA 2Z42A 2ZGPA 1AYN1 5E8AA 1LRHA 2X29A 1W2UA 1SFYA 4RQPB 4DY3A 1MZEA 4EV0A 1C5IA 3THPA 4AEDA 1U0AA 5GLVA 2ZACA 2VQ0A 3AZWA 4IV3A 4ATEA 1MS0A 3FBYA 4X8NA 2A73B 2XJQA 3MPBA 3R4DB 5C8CC 1JUHA 4HT1T 4GWNA 1RITA 4AGGA 4KQ7A 4WVMB 1Q5OA 1RUC3 3AJYA 4MYEA 3DV8A 3WW1A 1UIJA 4LBKA 3V0AA 5ABJC 1RUE3 2R071 4AQ2A 5EWSA 2HJIA 4MGYE 1Z7S2 4Z92B 4CDUA 1HXS2 1UPIA 1LOCA 5JDBA 1ZNPA 2A5ZA 3ZN4A 2O8OA 4XQWA 1IS5A 4AYUA 2QZ3A 2R1BA 5CFDA 1G86A 3OBRA 3TB0A 3D0JA 4YFZA 4LBMA 2ZMNA 1W6QB 1H2LA 4JTNA 3GF6A 2A71A 1GANA 1UMZA 3QH7A 4NR1A 3M2MA 4X8PA 2R062 4DNYA 1CGPA 1NE6A 1MEC3 4F7ZA 1JYIA 3CO2A 5IK7A 4OHYA 3ZXAC 4BH9A 2UYAA 4EN0A 1PVC2 1RMU2 2ZHMA 1QGLA 4FPYA 5TSWA 3MW4A 4SBVA 1QNWA 4GB33 2GMEA 2Y38A 5IK8A 4IETA 5LK7B 3GBGA 3AP4A 4I3PA 3WUCA 4FAHA 3LA3A 1YYNA 3AZXA 3OPZA 1GZWA 3WP6A 3NL1A 2DWRA 5J36A 2JEMA 3B69A 3BPZA 2D6KA 3LSEA 4L2NA 1ZBE3 5JCTA 2OA2A 3N3HA 2XH6A 1FOD2 1WW7A 2ZGRA 1LB2A 2XVKA 1H1IA 1QOTA 4R52A 2NMNA 3UKVA 1DZTA 4IEPA 1RB8G 5C33A 4UXAA 2XL7A 1RUE1 2FQPA 1HV1A 4WM7B 1M06G 1FI2A 1H2MA 3J8F2 2GH2A 1ZRCA 2MNGA 5BNPA 4MGIE 4I0AA 1WCDJ 2D97A 1REDA 3MFAA 3ZX7A 1S0FA 1W6OA 1X8MA 3CJIA 2QKDA 3D5OA 3WOGA 1Y3TA 2VW2A 3OYWA 5JIUA 3OD0A 4CDXA 3UL2A 4P9WA 3AKTA 2A6WA 2JG8C 2WZPP 3WP4A 4JGZC 4LT5A 4M00A 2PHWA 5CU1A 1NCRB 2B45X 3S7EA 1NLRA 5KHJA 1MEC1 4KU8A 3CLPA 1UN1A 1O4ZA 1A78A 1R1ZA 1SLTA 3ATGA 1C5HA 1VP6A 2W39A 3JB8A 4XEZA 4XF0A 4Z1VA 1VB4A 5GZFA 5GJ6A 4LTAA 1I3HA 2RJKA 5T5PA 1QJU2 2BEOA 2BQPA 4GB31 4K20A 1KJLA 2BNNA 3I59A 4BQ1A 3OGJA 1POV1 1XQNA 3J4UH 4DZGA 5JOYA 3VBRB 4JRAA 3M3OA 3OJBA 1KQRA 1LHNA 3L2YA 4XFFA 5EV7A 4K1YA 3AMMA 3IDCB 3M3CA 4FPGA 2WZR3 4Z82A 4Q4Y1 4HK9A 1QF3A 2MEV3 2YY1A 2D44A 1VBB1 2O0OA 4OI0A 1JHNA 1M4WA 2XJSA 4QPIB 4QM8A 4B7KA 4M0HA 1MQTB 3Q9OA 3RYRA 1N1YA 2XL9A 3PMSA 1AYM3 3BU7A 2YZ4A 4LLOA 1AR83 3NKGA 2FZ1A 2XPJA 1X7NA 5JSRA 4I02A 2SBAA 2EAKA 4OHXA 2D6NA 1DFQA 2CAUA 5GZDA 2DURA 1BMV2 1I6XA 1UIKA 3PLQA 3ZPYA 4Q4X2 3RMXA 1O3TA 5JR7B 1S1AA 3KD4A 5F6KA 3VDDA 5EXOA 2PLV3 5AC93 1H9WA 4LEJA 3ZXDA 1F8VA 4WM8A 1D2QA 1DGLA 1PMIA 1SQ4A 1TME3 4P9LA 4LE4A 1A6CA 2XBO3 1J59A 3ZSKA 1BBT2 5C8CB 4COZA 1KDMA 2YXSA 2PHDA 1PO13 3VKNA 2R043 3M3EA 3ZYJB 3AP6A 4Q26A 5ABJB 3OTFA 2D93A 1AR62 2JX9A 1WLWA 1RUH2 3RQ0A 2ZA9A 1VBC3 3D82A 5L7OA 4DY5A 1E57A 3MW2A 1MACA 1SBEA 2R6QA 1QDOA 4NOTA 4YGCA 5DUUA 3MLLA 3ZFEC 3QH6A 3NV4A 3FUOA 2HWD3 1LOAA 1BVP1 2WNUA 5JI9A 1O7FA 1RUF3 4EROA 2WZR1 2BWAA 1U12A 2B42B 5A33A 4FOQA 1FV3A 3HMYA 4COWA 4JGYA 1I1EA 3NSTA 2ZGNA 4FOVA 5T3NA 3ZN6B 2PA7A 1MR5A 4PCRA 2OW4A 1IPKA 3RNSA 1S2BA 5BYNA 4G9SB 3KGLA 2ZX4A 4YFWA 4ASMB 3HN1A 4U2AA 3SLIA 3SHRA 4E4DX 4FQZA 3ZYRA 3MF9A 3MW3A 1C3HA 1ZA4A 1W6PB 3I7DA 3POSA 1GYKA 2DVAA 2OYZA 1MS5A 3LAGA 4LBQA 1GLHA 2PLV1 5BNNA 5JMCA 3ROUA 2RM23 1WCSA 2CYFA 5GLUA 2EXJA 2JD4A 3IDEA 1R1A1 1QQP3 3VBFA 2PAEA 3AM2A 3DUIA 1A3KA 4M0NA 4META 5GM0A 1LOFC 4AVTA 1FMD1 1PO11 1KS5A 4N53C 5FQ0B 1S0DA 1O3SA 1VIWB 1RUNA 2EA7A 4XIKA 2JG9C 2QUOA 1N47A 4Q29A 4YARA 2Z69A 3JD72 1DIWA 4ONUA 4MLOA 1GBGA 4Q4V3 4R8HA 3RG0A 5J48A 1NLSA 4NVPA 3ZSMA 2HWD1 4BLIA 1W6NB 4CZSA 4AI2A 3FFZA 1G9CA 1D2SA 1DU3D 2BVBA 1WA4A 1RC6A 2JG8B 3EXUA 4JGZB 3VBOA 1AXYA 2R1DA 3ZDSA 1IQAA 1LEMA 4GMP1 4OZXA 2CNAA 3AXEA 3OF1A 1BEV3 2WJSA 4JV4A 2E7TA 5IT6A 2WFPA 2WIIB 1QJX3 3AKSA 3N7KA 3S6PA 2WC2A 4L8QA 5A32A 2UY9A 5HCBA 5FDBA 5JOXA 3VBUC 5CADA 3BALA 1GFF2 1AR92 4N43C 4CTEA 1OFNA 3DPRA 1QJY3 5J98B 5C9AA 1FXZA 3HT1A 4XF3A 5J37A 4YW4A 4NHLA 2JJ6A 2RM21 3CNAA 3OD4A 3UKTA 1QQP1 1LOEA 3W58A 2Q4SA 1U5ZA 4Q0QA 3C3VA 4FOYA 1DYKA 1BVVA 2A6YA 4FAGA 5EZWA 1LOGA 1ULDA 3WHUA 5ACA2 1EY2A 4RQPA 3VBHC 1IZ3A 3H50A 1B35C 4XJZA 3WDYA 3P3NA 1AX1A 3WDWA 1FNYA 2FZ2A 1VBB2 4GH4C 1CONA 1AF9A 1ULGA 3CF6E 1XRUA 4CYDA 1SLAA 2OZJA 3TN93 1J3PA 1SACA 4Q4V1 1A8MA 2QFEA 2ZAAA 4MX3A 1HXS3 1PM7A 1LHWA 4YVSB 3ST7A 4GA9A 3H8UA 1OFSA 5GKAC 4WVMA 5JLVA 2JENA 4MZUA 3V64A 3WY6A 5KC5A 4XFBA 4L9BA 1DQ4A 4ASLA 3O14A 3VKOA 3IWZA 4IEQA 1Q8PA 2V09A 4MH0E 5AFEA 1Z0HA 2NM1A 1HLCA 3MI8A 4Z8BA 3B9IA 5D8AB 2VW0A 3LWCA 4OHVA 4FPEA 5CG8A 2LTNA 1GR3A 4H55A 4Y26A 5GLWA 1YI9A 2R063 3ETQA 2ZGLA 4RGGA 3RS6A 4YW2A 4H7MA 4PJYA 3VBSC 4YYOA 1EAH2 1W6QA 2ZPXA 4WVZA 1XNDA 4ZXKA 2XUMA 3BCWA 1RMU3 1QJY1 4QXKA 4KG0A 2K0GA 2ERFA 3ZFEB 3FX3A 1RUI2 2VNOA 2IFWA 2ZMKA 4IEXA 5F5QA 2DVDA 1CX4A 2FMDA 2HWF3 4DFSA 1OMIA 1XNBA 3ILFA 3KCYA 4WBBA 1YIFA 1Q8QA 4A3XA 4BWOA 2GAUA 1RUJ3 3DKWA 1ZBA3 1O5LA 3KM5A 2YUEA 3VZJA 4LO6B 2XHKA 1S0EA 5T54A 2R30A 5T55A 3TN91 4W6WA 4YG0A 1GSLA 1XYOA 1POV0 2N7GA 1H4GA 3ZN5A 1RTVA 1EV12 1UW8A 4YW3A 4BPZA 1U5XA 1Q8OA 4EWDA 1VBA3 4PLOA 3E6CC 3WP3A 3N7MA 5C4WB 5BY5A 1YIPA 2YHJA 4WM7A 5K0UC 4CEYC 4CP0A 2BVVA 3M70A 2XJRA 4LA3A 2JXAA 1PGSA 2VMGA 3FWEA 1VBE1 1LU2A 4UW6A 4CDQC 4M3CB 3WINE 4AVBA 1WUVA 2E7QA 3LA7A 1CAWB 1BCXA 3VL9A 1NZCA 2P3JA 2D5HA 5JSPA 2Y26A 1Y9QA 2OPKA 3M3IA 4LUKA 3OCPA 4K6BA 5EYYA 3ZFFC 3IPVB 3JQXA 5K7PA 1NCRA 4QQHA 5EFUA 1FNZA 1QJU3 2HWB1 3WG1A 4LO8A 4E2GA 4HLTA 2VY0A 5EYXA 1AUYA 1MS4A 5FMOS 3SXWA 5LEKA 3TBDA 4FTEA 1G7YA 4E4ZA 2HWF1 5CB7A 4IEVA 2ILMA 1HQWA 2RE9A 4AVCA 1V6OA 2EIGA 2OUHA 1PO21 3RRDA 1RUJ1 1DGRN 1ZBA1 3ZSEA 2P2KA 4F3JA 1H1MA 3VBRA 2DUPA 1TMF2 4KGQA 4XFGA 1CQ9A 1NQJA 2PAKA 1PIV3 1A8DA 2DCJA 3VBUB 4Q2FA 1PGW2 4N43B 1QHDA 1NA1B 3B02A 1AR73 1OQEA 3QACA<