3ZSLA

Crystal structure of apo human galectin-3 crd at 1.08 angstrom resolution, at cryogenic temperature
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
138
structure length
138
Chain Sequence
MLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords GALECTIN-3
publication title The Carbohydrate-Binding Site in Galectin-3 is Pre-Organized to Recognize a Sugar-Like Framework of Oxygens: Ultra-High Resolution Structures and Water Dynamics.
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2011-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3zslA00
3B00A 1N3OA 3WV6A 4XTPA 4AVTA 1WD4A 1MZ5A 1NXD1 3RQ0A 4DRRA 2JJ6A 4YZ3A 3WCSA 1O4YA 1W6QB 2D6MA 4ATFA 2SLIA 2DU1A 2JE7A 3HR9A 2EIGA 1CN1A 3BODA 1Y7BA 1N1VA 2ZACA 4FPJA 1LU2A 1JBCA 4C1XA 1FV2A 3WHUA 1JW6A 5AVAA 1S1AA 2EXHA 2ZGOA 1S0JA 5DG1A 5HCFA 1LHWA 4XJUA 4FPFA 1ULEA 4YM2A 1SLTA 1VALA 3DUIA 2ZHLA 4Y1UA 4AYUA 1HLCA 2ERFA 3ASIA 3OPZA 4TYSA 4YZ1A 1Q8QA 1S0GA 1GLHA 5GJ6A 5GLUA 5T54A 3VKMA 3R05A 1LOCA 2DV9A 3AK0A 5L73A 1ENQA 3D4KA 1LOFA 5DG2A 1CJPA 2NMNA 3FBYA 1BZWA 5T55A 1I1EA 1IKPA 5GM0A 3WDYA 2DURA 1G9FA 4P14A 5IK4A 5KXEA 1WD3A 2ZKNA 3INAA 4WV8A 3QLQA 5JMCA 4YM0A 2OUHA 4YZ4A 2E7QA 4YGEA 1SACA 2OW4A 5H9PA 5T5JA 2UURA 2KM2A 1MR5A 4CTEA 3ZXLA 2A3YA 3N35A 4LBLA 4UW6A 4MYEA 2DU0A 5DUVA 5EYYA 3PJQA 4FPOB 2ZGKA 3VUOA 4GA9A 1QNYA 2PELA 3OYWA 1DZQA 4NO4A 5T5LA 2W52A 5FRAA 1UMZA 3O12A 1LHVA 2DVAA 3AZXA 3VKLA 1G86A 3IPVA 4XILA 1S0CA 3ZXEA 3AP7A 1AVBA 1G9CA 3KQRA 5F5QA 1UKGA 2GMPA 1AXZA 2EF6A 1DYPA 1JYCA 1QMJA 2TEPA 4XBNA 2GNTA 4XYXA 4YW1A 1AX2A 2OUJA 4PF5A 1LHUA 2AH2A 3QCWA 3SITA 1Q8OA 1QF3A 3NWKA 1HQLA 2LALA 3AYEA 1MS9A 1GANA 5HCBA 1URXA 1WW7A 1AJOA 2P2KA 1MS8A 2ZGRA 1S0BA 3PVNA 4I30A 4BQ1A 2ARXA 2D43A 2ZMNA 2PHTA 1LESA 1UN1A 2D7FA 2WT2A 5BYNA 2E6VA 1UX6A 3Q9OA 1MACA 2ZBJA 4U36A 2ZZJA 1JHNA 4WVWA 4K20A 5T52A 4Z8BA 2VW1A 1W6NB 3V64A 4BMBA 5GZEA 5JOXA 1PZ7A 3WNXA 1KJRA 4AVSA 5GZGA 1SBDA 1I3HA 4Q26A 2JD4A 4Q1RA 2PHUA 1HQWA 5FREA 2A5ZA 1Q56A 1CIWA 2PHXA 4ISRA 2G4IA 3M3OA 2PHFA 4XE9A 1DGLA 1W0OA 2ZGUA 2E53A 3WUCA 1W6MB 5EXOA 2A6ZA 5GLZA 3LSDA 4ISQA 3M3CA 4XJWA 3N3HA 4WZFA 5CAZA 2DTYA 3FLTA 3ILFA 2GNMA 4XZPA 3M3EA 1O4ZA 3OY8B 4R9DA 3IKWA 5DUUA 3WDWA 4M01A 4CRQA 1X50A 3JU9A 3POWA 1IOAA 4Y22B 4YFZA 2D6LX 1GZ9A 4PQ9A 4WVVA 2VXRA 2FHRA 2DVGA 3WHTA 1OQ1A 2AYHA 2EXIA 3IM0A 4HANA 3ATGA 1SLIA 1G9BA 4XXPA 3VKNA 3SLIA 4M00A 3ZSKA 1S0DA 3OJBA 4FPLA 3MW4A 4P9YA 5F9TA 1NLSA 1LENA 1H9PA 3O0XA 5E89A 4YG6A 2ZA9A 4YZ5A 2AUYA 4Q8LA 4LBQA 2I2SA 1WBFA 4H55A 1KDMA 1KRIA 2PHRA 2YY1A 1Z0HA 1GZWA 3LSEA 4Y1VA 3L2YA 1LHOA 3AP4A 2Z42A 4LBKA 1YO8A 4XDQA 1WW5A 3WDVA 1QOTA 2YZ4A 3ZXKA 2NYYA 1FAYA 2DUQA 1GNHA 2GDFA 1BKZA 3MW3A 3PMEA 5DUWA 3WZ1A 4GKYA 2ZGTA 1FNZA 5T50A 3D5OA 2D44A 3IMNA 1UZZA 5GLWA 2XG3A 3T2TA 1FX5A 1PZ8A 4GALA 4Y20B 3FLRA 2OVUA 4YW2A 1YRZA 2CTVA 3WG1A 3AZWA 2CWSA 1CR7A 1V6OA 3N7LA 5DZGA 1CONA 3AXDA 1DBNA 1V6JA 2R16A 4FP2A 1V6KA 1S0EA 2WNEA 1LULA 4UW4A 3FUOA 4AGVA 1F31A 1MS0A 1UZYA 4OZXA 4L8QA 1N1TA 3ZSLA 2VUAA 2P3JA 4R9AA 2ZGQA 5H9SA 2WKKA 1V6IA 4JCKA 4BMEA 3A0NA 3UJQA 4PBOA 1JUIA 4Q1PA 2JECA 2JDZA 3HN1A 3LCPA 1VAVA 4XXAA 1N3QA 2AENA 4LBJA 1C57A 1CESA 5IT6A 3V0BA 1W6OA 3DGTA 1W6NA 2NN8A 3NV2A 3A4UA 2D6KA 3USUB 2VH9A 3WLUA 4CZSA 3AJZA 1Q8VA 3JUUA 4XMAA 3I8TA 4FPHA 2YXSA 3AP6A 3M3QA 2UWAA 4YLZA 4K1YA 2ZHKA 1FATA 5JOWA 2EALA 3WG4A 2D3RA 3TB0A 4UW5A 3RG0A 2YMZA 3ZYRA 1YYNA 2WQZC 2V73A 3RRDA 4FPGA 2NZ9A 1D0HA 1N1YA 1BQPA 2RHPA 2R1DA 1WW6A 1SBFA 4YG3A 5EWSA 3R4UA 1A3KA 2CWMA 5JDBA 1QOOA 2DUOA 2D6NA 2NP0A 2HYKA 3RS6A 3ILRA 4M3CA 3C2UA 3T1MA 1DQ6A 1ULCA 3UK9A 3W58A 1DQ2A 1N47A 1ZA4A 4BM8A 3O5SA 4P9XA 4U2AA 1CQ9A 2GMEA 3B9CA 3N7JA 1C4RA 4TZDA 3POSA 2A6YA 2FMDA 1W6PA 2E51A 3POYA 1CPNA 1APNA 4FVVA 1IS3A 1LECA 1ONAA 1YXWA 4FOYA 1UPSA 2AREA 4FPKA 1WLWA 4XIOA 2P3KA 4BLIA 2P3IA 1W6QA 1D2SA 1AX1A 3N7MA 3D6EA 2WT0A 5GZFA 1G9AA 5IK5A 5E8AA 3VV1A 1KQRA 3WDXA 1FV3A 1SLLA 4DPNA 3MPPG 2P34A 4PBPA 2LTNA 3V0AB 5DXDA 5CB7A 3ILNA 2A75A 3FUQA 4LBOA 4GWMA 1QDCA 1ULGA 1GSLA 2R1BA 3ZYPA 2CYFA 2DTWA 1MS3A 2A71A 3OYWB 1AX0A 4XJ9A 3H0OA 1DLLA 4XJAA 3ZXJA 1BXHA 3AP5A 4D69A 2WSVA 3TAYA 4ASMB 5CBLA 4FPCA 4FOQA 1WUVA 4AVVA 2R49A 1U0AA 1V6LA 1RITA 2ZHNA 3AYCA 2NMOA 1IKQA 4Y1YA 1A78A 4XHXA 4YW4A 4AWDA 4P9WA 3M2MA 4XOGA 1IS4A 1WW4A 2VY0A 2W68A 3N36A 3B01A 2A3WA 4ZXKA 1ULFA 4XHBA 5H9RA 4YM3A 4LBNA 3WDTA 4GKXA 4C1WA 5KXCA 1AJKA 1GYKA 3V65A 4DFSA 5IK8A 1QDOA 4IQPA 3SISA 2WLQA 4DS0A 1UL9A 1W0PA 2WT1A 1GZCA 1DQ0A 3B3QE 4DQAA 1GKBA 1LOGA 4LBQD 4YM1A 2YV8A 3ZXFA 1R1ZA 1MS5A 4XBQA 2WSUA 2W39A 1H30A 2D6PA 4YG0A 1Z78A 2H0BA 3N7KA 3WDUA 2A6XA 4ATEA 1A8DA 2AGSA 3OBRA 1G8WA 2DUPA 2ES3A 3HMYA 4Y26A 1YIFA 1LTEA 1SBEA 5T5PA 2JKBA 2V5YA 2DVBA 2GN3A 1LOFC 4XJZA 3ZVXA 1B09A 4BLJA 2VU9A 1DQ5A 3I4IA 1CVNA 1GICA 2BQPA 2CL2A 3VKOA 1SCRA 3FLPA 4M3CE 3W59A 3WUDA 5GZDA 3ENRA 1HDKA 4YGDA 4BOWA 3AZZA 3SH4A 4XBLA 2GNDA 4PCRA 4R9BA 5JVVA 1MVQA 2ENRA 1IS5A 4JC1A 1DQ1A 3O0VA 1Q8PA 2C5DA 2ZMKA 3BTAA 1LOEA 2AR6A 4RA0A 4F83A 1BYHA 2SBAA 1FYUA 4Y24A 2A70A 5DZFA 1MZ6A 4FQZA 5IK7A 5LK5A 1OKQA 2CY6A 1V00A 2CNAA 2EAKA 3PVEA 1AZDA 3VKFC 4FOWA 4AGGA 4GWNA 1QU0A 1ENSA 4XIKA 4HL0A 4Q8KA 4FOVA 1BJQA 3A0KA 3O0WA 4FPEA 1TEIA 1XQNA 1LCLA 1LHNA 2P37A 2VW0A 4R9CA 2DVDA 2DWRA 3APBA 1QGLA 4UW3A 1RINA 3PVOA 1G9DA 4YFWA 1SLCA 1UAIA 3KM5A 1VIWB 4FPYA 5JOYA 1ENRA 4LBQB 1WLDA 1QNWA 3AX4A 1LOAA 1RIRA 2XB6C 1W6MA 3FFZA 3V0AA 1ZM1A 1GZWB 2UU8A 1N1SA 3NV4A 4YGCA 3R4SA 3U4XA 2Q5TA 5DZEA 3SH3A 1YI7A 1LJ7A 1CPMA 2W08A 1LGBA 3AZVA 3WOGA 2GNBA 1DIWA 5EYXA 2EXKA 3OY8A 2R0FA 4XJ8A 1S0IA 4ITCA 5E88A 5KXDA 2WJSA 3AFKA 3SNMA 4Y22A 2ZAAA 3AZYA 1AXKA 1F5FA 3BIWE 5JOZA 5GALA 3WG2A 4JRAA 2R0HA 2UWBA 3M1HA 4K21A 4Y1ZA 5CNAA 1KJLA 1KITA 1DQ4A 2D6OX 2ZHMA 3USUA 2A7AA 1KDKA 4KBBA 4AGRA 5GZCA 2ZGNA 3ZPYA 2ARBA 1SLAA 2VW2A 1LGNA 3CNAA 5KXBA 1LGCA 1OFSA 2GMMA 5DUXA 5CA6A 4LBMA 2ZGMA 2NM1A 4RL7A 1SLBA 3OGGA 4YGBA 1WLCA 3WCRA 1IS6A 1MVEA 3MW2A 3WVJA 2E7TA 5IUQA 3ZSJA 1LEMA 2A3XA 4YZ2A 2EXJA 1HKDA 3OBTA 1FNYA 1GV9A 4XMIA 1VAMA 3MEPA 5GLTA 1J1TA 3V0BB 1VLNA 1JN2P 1LODA 1W6OB 3B69A 3RMXA 3WG3A 1EPWA 4BPZA 3GALA 2PHWA 1JYIA 4K1ZA 1ULDA 3UL2A 5GLVA 3NV1A 1AF9A 2C9AA 1F9KA 2GN7A 1DHKB 1JXNA 2ZABA 3IPVB 4W65A 4XTMA 4Y20A 1QOSA 2ZGPA 2B7YA 1LOBA 4M3CF 3T1LA 2D3SA 2UWCA 1LU1A 4GXLA 4Y1XA 4NOTA 2D3PA 1Q8SA 4FQ4A 3ZSMA 3RSJA 1GBGA 1C1LA 2DYCA 2ZMLA 4Q27A 3IN9A 1G7YA 1V6NA 3BOPA 1WCSA 4YW3A 1MS1A 1MS4A 2ZGSA 3NV3A 4M3CB 2ZGLA 1WBLA 3AYAA 1N3PA 2A6VA 1C1FA 4DRVA 1JOJA 1PZ9A 1V6MA 3AYDA 5HCAA 4SLIA 3SH5A 3RMYA 1DYKA 4YW5A 1SCSA 1DFQA 5T5OA 4FP3A 1QKQA 4ZKTB 2GALA 2YROA 1H9WA 5JLVA 3GNEA 3UJOA 5SV8A 2A6WA 1W6PB 4Q2FA 1AXYA 1GNZA 1LEDA 2JE9A 1S0FA 3AJYA 3AXEA 5H9QA 1SFYA 3AP9A 2DVFA
chains in the Genus database with same CATH superfamily
4IV3C 4CEWC 5DDJ3 3ZN5A 4Q4Y1 4AFAA 1JZ7A 4IUGA 1ZRFA 2IXKA 4KBZA 1XXNA 1YIPA 2ORXA 3NQHA 1WMDA 3PIJA 1BBT1 2JE7A 2EIGA 4SBVA 1CN1A 2C4XA 3BODA 2QBXA 1Y7BA 2ZJCA 3AFGA 1HW5A 4KGQA 4QGLA 4D6SA 1JW6A 5AVAA 5JCTA 1S1AA 2EXHA 5HCFA 3UT0A 4GMP1 5HCHA 4EQVA 5EQUA 1ULEA 3TBDA 1M06G 4YM2A 2OKXA 2XVKA 1OKOA 1PVC1 3DUIA 5EJZB 1DG6A 1YCIA 2YGLA 3S6PA 2ARAA 2TNFA 4K40A 1ZBA3 2XJPA 2YFUA 4V2WA 3S5AA 1W8ZA 2ERFA 3ASIA 3MHZA 3K4AA 1CAXA 4TYSA 1ASJ3 4OZOA 3VBUC 4CUGA 3I59B 5C3SA 1RMU1 5GLUA 2BU9A 2EA7A 2ET7A 5FBZA 2VBPA 2DV9A 3R4DB 2DBIA 4GZ9A 5ACA3 1GOHA 3FHIB 5DG2A 3J7MA 4PDWA 1CJDA 1H6XA 5A80A 5CKNA 5T55A 2DURA 2GC2A 3GBWA 2WZPP 4JGYB 1R1A3 5FZBA 2ADEA 4WV8A 3SMHA 1J59A 1TME3 1SACA 2OW4A 4HZFA 5H9PA 5JI9A 5T5JA 2KM2A 1MR5A 2BV4A 2BOIA 4UW6A 2DU0A 5EYYA 2CSGA 4D7SA 5KC6A 4CEYB 3THCA 3NNJA 4IEVA 4HKWA 3O12A 3J4UH 1GUIA 3I2GA 2EIDA 1G86A 3I2DA 3VKLA 5FY8A 3ZXEA 3AP7A 2Y6LA 1RUD1 5CFCB 4RS5C 2EF6A 1DYPA 1WKYA 1UF2C 2GNTA 5J96B 5FPVA 4B29A 1CWPA 2XUMA 1LHUA 3JBG1 3JD73 1NG0A 2WBKA 3WNLA 3ABZA 3ZYGA 1QJEA 4B7KA 3JQWA 1QF3A 2QCSB 1HQLA 1F35A 2IVJA 5CYYA 1POV3 5DQ0A 5HCBA 3MV01 2OYZA 2MEV1 3FBMA 2LRPA 3BIEA 3VHNA 1AJOA 4UBGA 2VCBA 3ZFEA 2IXHA 2QVSB 3KZ4C 3M3IA 4I30A 3RYKA 1UY3A 2F6BA 2ARXA 2D43A 1VBA2 3VD7A 2WT2A 5BYNA 5AFEA 2E6VA 3MV11 1UX6A 3RZKA 2Q8OA 2YYOA 3HPNA 5FTTC 2ZEWA 1MEC3 3MPBA 3U4SA 4BMBA 4PHZA 1GMMA 1UOJA 1PIV3 5GZEA 1KJRA 2Q8CA 5GZGA 2WQ8A 4HONA 1CIYA 2VMCA 4WM7A 4KU7A 3RI8A 2P1BA 4XAEA 1F15A 2LS6A 2PHUA 4Q0QA 1SHWB 1C8M1 2PHXA 4MH0E 2G4IA 5A7PA 1RUOA 2HEWF 2WS93 4XFGA 3I7DA 1R082 2JG9C 1UQXA 1NLQA 4O7XA 1AL22 5EXOA 2A6ZA 4NAOA 1UY2A 3VBRC 5IYYA 1J58A 4BE3A 3LSDA 3VBHB 1EAH3 3HT2A 3N3HA 4WZFA 2CV6A 4EN6B 1OOPB 4LUMA 4BJ0A 2Z4FA 2XONA 5EHDA 2B8MA 2JIJA 5KHKA 4CRQA 4M01A 3ZYHA 3D3AA 1UZWA 5FLJA 1QJX2 3I2IA 3POWA 3VBSB 3C3VA 4Z2AA 4Y22B 5BNPC 1AUYA 1GZ9A 1UIKA 3KHBA 4PQ9A 4WVVA 2FHRA 4QXKA 4S2DA 3WHTA 2EXIA 1V9U1 3ATGA 2WUHA 1G9BA 4XXPA 1NQJA 1PHMA 3OUJA 3PLQA 4GB33 5FPZA 3SLIA 3UETA 1RUE1 3AKQA 4DINB 3J7LA 5LASA 3BTZA 4P9YA 3BPSA 3MW4A 3T0DA 2RS33 3RZHA 5E89A 3MYXA 3HAGA 4CP1A 2JIGA 4NIIA 1QXPA 1ZA7A 4AI8A 2W1UA 2ZX0A 3LPFA 3OGRA 2XHNA 4AEDA 1JZ2A 1Z0HA 4Y1VA 1OT5A 5D8AA 1FPN2 4CDQC 4XDQA 3WDVA 2YZ4A 1W8NA 2NYYA 3URFA 1GNHA 1Z7S2 3MW3A 3WZ1A 2BERA 2OT7A 2ZXQA 4LK7A 4M4PA 1XSQA 1RUH3 3KSCA 1QJU2 3E97A 3VB9A 4V1PA 2B46X 1JZ5A 2LW8A 1PZ8A 4XQDA 1VRBA 4Y5SA 4F3JA 5BNNA 5JMOA 1DU3D 5FXZA 3VBFA 1YRZA 2CTVA 3WG1A 4BIFA 4WM8B 3N7LA 4RHV1 2HBUA 3VLBB 1HV1A 4QX2A 5DZGA 4YVWA 4LJHA 1UWWA 2RE9A 1DBNA 1ZZ8A 4FP2A 4AEMA 5DMYA 4CDUB 3FUOA 3MDPA 4JTOA 2JE8A 3ZSLA 2OZ6A 1JTZX 4E8DA 2ZOEB 1CX1A 1NA1C 4IDZA 1COV1 5FXVA 1PM7A 4JDNA 5T3NA 5A3MA 1OPMA 2VMDA 3MGUA 4G9SB 4LORA 3KB5A 1KEXA 5FXWA 5H9SA 4FTBA 1GP5A 4Q4W2 3A0NA 4S2FA 1JUIA 1RL3A 2JDZA 2AENA 4LBJA 3WNPA 1W6OA 1ZBE1 3T2QA 1VR3A 4L99A 4EZ4A 2D6KA 3I3MA 1O3QA 4CZSA 2IFWA 2FCTA 3VGIA 2YC2A 3M3QA 2XJQA 2V72A 1QH6A 1FATA 4BQXA 1AR91 1MZFA 2FCUA 2HWD2 2IXIA 5FYBA 4UW5A 1W3XA 4JKLA 3BU0A 3OUIA 3RRDA 2NZ9A 1BQPA 2J22A 3A22A 2CAVA 4CUCA 1SBFA 4YG3A 3IB3A 5JDBA 2XL9A 1QOOA 4CSWA 5B2GB 2D6NA 5G05L 5L9VA 3NO8A 4ONUA 4DOUA 3QD6A 1VBB3 3ILRA 2XQRA 1VBD3 4AAXA 4QQ2A 1OH4A 2RVAA 5FXXA 1N47A 1TVGA 5FZ3A 1WMEA 4HMZA 4N53C 2ZEXA 4P9XA 3ZFFA 4NHYA 5C4WB 2Y0IA 5BY5A 1RVF3 2BGCA 3LD8A 3WNKA 1UO9A 4GQ7A 1UU4A 2A6YA 2PQSA 4A41A 5J7MA 1AYN3 2KD7A 3RGBA 1IGOA 3I3QA 3WQ7A 2VTFA 1DF0A 1PO11 5C7GA 2Q1FA 1XJAA 1YXWA 1UPSA 4P00B 1RUG3 2CGNA 3HVDA 2K46A 4XIOA 4ZU7A 3AVSA 1U5IA 4NRMA 5FZDA 3O14A 3PL0A 5BV6A 3LEKA 1AX1A 1D2SA 3N7MA 3D6EA 4GIQA 2WT0A 4ORFA 1YFWA 3PHMA 3ZLIA 3DPRC 2HWF3 4RD7A 4JDOA 3VV1A 3VD9A 5IK5A 2NQYA 3WDXA 1SLLA 2PTMA 4IGPA 4PBPA 2VD7A 2ZX3A 5FCCA 3WW3A 4F8AA 5CB7A 2A75A 4LBOA 5E6HA 1ULGA 4UFLA 3T2OA 1GSLA 2DCYA 2R1BA 2J1EA 3DYMA 4N43A 4FAGA 2DTWA 2F4LA 1RTVA 3PUSA 3OYWB 3T0AA 3T08A 4COWA 4IE6A 2P3YA 3N9NA 4META 4D69A 3AP5A 4ASMB 4AQ2A 4FOQA 3ZFGA 4NHLA 1VRH3 3CBNA 1UXZA 2R49A 2XKPA 4LHKA 5FYVA 3RVHA 4YYOA 3I59A 2ZX1A 1ZRDA 2D97A 2DCKA 1NE6A 4AWDA 5JXGA 4P9WA 2HH9A 3O1PA 3NSTA 1H2MA 3CEWA 3HBKA 4DB5A 1HRV2 1XE0A 2Q0AA 1OHFA 1WW4A 3MICA 5FZEA 2A3WA 3IIAA 3T0BA 4XHBA 1K45A 4LE3A 4YM3A 3FZ3A 3MIDA 3ZXGA 5C3OA 2VQUA 1C28A 3RWNA 4DFSA 1NLRA 3HOBA 5FYYA 2WT1A 5FYIA 5FY0A 4GH4B 3DCQA 1DQ0A 3B3QE 4DQAA 2VNRA 1DGRN 1J83A 3I3DA 4OUMA 3OGJA 5B4XA 1R1ZA 3VDCA 2R043 4XBQA 1F4HA 4LXLA 4CEYA 1O3RA 2D6PA 4NUBA 2UY9A 4YG0A 3MIFA 4IXLA 2GU9A 1A8DA 3J8F3 2ES3A 5F39A 3HMYA 3BN6A 1LTEA 5HXVA 3HT1A 3DECA 3PUAA 5LZ6A 5LWBA 2DVBA 2GN3A 3O1UA 4MHUA 3LPGA 4XJZA 3S5QA 1L7QA 1RXFA 2G9FA 2VU9A 4BLJA 4E2QA 5CFCA 1QJY3 4CCMA 4DNYA 1CVNA 1T6GC 5A1LA 1NE4A 5HV0A 2BQPA 2CL2A 3VKOA 5JIUA 3HEIA 5A7QA 3OEBA 2I07B 4I0AA 3CZJA 5HV4A 4RQPC 2WAOA 5F6LB 2WO3A 4RR3C 4R52A 2YB7A 1HV0A 1GQPA 4D7TA 4PCRA 1MVQA 1OXCA 3FHQA 4PIZA 4JC1A 1DQ1A 5L9BA 3BTAA 4F83A 4RA0A 3POEA 1SZBA 4HG6B 1OKQA 4ASKA 5C3PA 1YFXA 2FD8A 2Y6HA 4XAAA 3C7OA 3VKFC 2J1AA 3CJIC 3UESA 1ENSA 3M70A 4HSLA 4UI9L 2XLFA 4Q4Y3 4XIKA 4XUTA 3BALA 2XMLA 5FPLA 4Q8KA 3RNSA 4Q0PA 4QPGB 4A42A 1W06A 5LA1A 1LHNA 2Z79A 1W04A 4RYDA 1OLMA 3NJYA 2BYVE 4N7UA 4UXAA 3WY6A 2OQ7A 1G9DA 5FMDA 4C8DA 1NKGA 1UAIA 3KM5A 1VIWB 3O1TA 5KHJA 1YQ8A 1ENRA 2J7MA 3F2ZA 3R6SA 1CAVA 1RIRA 2RR12 4GMP3 3V0AA 1OMIA 4QQPA 5FO7B 2H6BA 1GZWB 2UU8A 1N1SA 4GULA 3R4SA 5J1XA 2FBEA 3MF6A 3VBHA 3OF1A 3GYDA 3SH3A 1PVC3 1LJ7A 2O1QA 2W08A 2BGOA 4Q4X2 1OOPA 1VAKA 1DIWA 2EXKA 1HJFA 4XJ8A 5KXDA 2QQIA 1RMU3 2WJSA 4W8JA 3VBSA 1OC1A 4Y22A 3AZYA 1F5FA 1F5JA 3I97A 4MADA 3BGAA 1QY4A 3N9PA 2O8QA 4JGZC 4Y1ZA 1R081 4OVEA 1OQEA 4BQ3A 2ZHMA 1DQ4A 4LLFA 2OPWA 2WNUA 4LOTA 1W0NA 2A7AA 3C8XA 4KBBA 3FMGA 2VNVA 2ARBA 1SLAA 2VW2A 5FZOA 1PNGA 5C5TA 4QWNA 3WP3A 2GP5A 3KT7A 3LQCA 2VE1A 2NM1A 4MLOA 1SLBA 4YGBA 4NPMA 1WLCA 3WVJA 1IS6A 4CU9A 2X09A 1QJX1 4D6QA 3U4XA 3LAGA 2E7TA 1LEMA 5ERLA 3OBTA 4QM9A 4CP0A 4OHYA 1GV9A 3MBWA 2DF7A 4A3ZA 1BVVA 2C6SA 3V0BB 4KWUA 1JN2P 4KL1A 3M4FA 5G04L 2E31A 4KU8A 2XOMA 4BPZA 5JUVA 3BKZA 1JYIA 1RUD3 3AMHA 5LBFA 2Q8EA 4AQSA 5IAXA 3CQOA 2VZUA 2VUCA 3K3OA 2C9AA 1F9KA 3ACGA 2W2IA 3AMPA 3DYOA 4W65A 1QOSA 4JGYC 3JBG3 1YUDA 2ZGPA 4WM8A 4M3CF 3PMSA 4E9KA 1PX3A 5A6ZA 1D0GA 1AR72 3ZR6A 2MPFA 3LOIA 2CGOA 2MEV3 5JZGA 2FZ2A 1PK6A 3AC0A 1GBGA 3BPZA 2W95A 2ZMLA 2BNOA 3N9OA 1RHI2 1WCSA 3QBQA 1MS1A 4XFHA 1O5UA 1QJU1 2R6QA 2Y8KA 4GD4A 5DAWA 3ZFEB 4YRDA 5F37A 4URAA 3HQXA 1BMV2 1JOJA 1PZ9A 3ITQA 3TEZA 3OBZA 1DYKA 3RMYA 1DFQA 4HK8A 2CDOA 5LCWL 2GALA 4COYA 2YROA 3POJA 3VD3A 2A6WA 4C0BA 4Q2FA 1G6NA 1GNZA 2DVFA 1UX7A 4QGNA 5IWFA 4MGQA 1C8M3 5B4NA 4XTPA 4OMCA 2R7EB 4UAPA 4WM7B 2JJ6A 1W03A 2UYAA 4DY3A 1KXGA 4YZ3A 4BU2A 4B1LA 2OXBA 2D6MA 1XRUA 2JDPA 2SLIA 2DU1A 3HR9A 1FMD2 4Q4W1 2LROA 1RYYA 3J9SA 1B35C 2ZACA 1LU2A 4XQWA 5FQ0B 4AEJA 3PVBB 3WHUA 2ID4A 3ZIWA 4MSVA 2IUWA 1S0JA 5JIAA 1LHWA 1ACCA 3S7EA 4FPFA 1WCKA 2VZRA 1BK0A 3DN7A 5LBBA 1HXS2 3ES1A 4IV1C 2ZHLA 5C4WA 5EJ1B 2YHJA 4AYUA 2HWD1 1ND2C 3VZKA 4E4DX 1V9U3 4MZUA 5C8CC 1HN1A 2RMU1 1Q8QA 2Y26A 4NHKA 2FDGA 4MGSA 2LUWA 1RUE3 2VOKA 2C1FA 2P17A 4ES9A 4N9IA 3OOXA 4QXBA 4XF9A 3WX5A 4S2HA 4R4XA 4XVHA 5L73A 1D4M1 4W50A 1LOFA 2JG8C 4MO3M 3ZYIB 3FBYA 2W91A 3HD8B 3WDYA 4COUA 2BEOA 1WD3A 5FR3A 2ZKNA 4RN5A 2JICA 4B4RA 5ABJC 5JMCA 1NY72 3IMMA 4AI3A 4QM8A 4AVCA 3RYRA 2GH2A 3FHAA 4CTEA 3PU8A 4AEDB 3ZXLA 2A3YA 1H0BA 1W9FA 2WL1A 3N35A 4LBLA 4BWOA 4FPOB 4XETA 4M0HA 5CZKA 1TNFA 4GA9A 4XFCA 5EJ3A 3WP6A 1QNYA 2KXLA 4HSJA 2ZZQA 2PELA 3OCPA 2JX9A 2VAUA 3OYWA 3TN92 1DZQA 4HKLA 4NO4A 5T5LA 2Q8DA 4YSFA 1W8WA 4ZZ8A 5A3NA 5LEKA 3K51A 1WA4A 4WVZA 2DVAA 1U5XA 2WABA 4RHV3 3IPVA 4XILA 5K0UC 3A7QA 1CD3G 2WZR2 4Y4YA 1AVBA 4JVAA 1G9CA 2Y33A 5F5QA 4CP2A 1ZZ6A 3FC0A 1AXZA 1HQNA 2QDNA 4Y4RA 4C90A 3W5MA 4XBNA 2AEYA 4OHWA 1C5IA 4OMDA 1AX2A 4YVWB 4N90A 4PF5A 2AH2A 5BNOB 1COV3 4JZRA 4XDOA 2X5IB 1NCQA 2EIBA 4NIDA 2LALA 2D93A 1GANA 2HEVF 1Q43A 3UGGA 1WW7A 4BQ4A 2P2KA 2WN3A 2WINB 2ZGRA 3CMGA 3PVNA 4IEWA 4GH4A 4FTEA 2J1VA 2ZMNA 3E6CC 4DXZA 4I2OA 1ZBE3 1UN1A 2BNMA 5FYZA 1ODNA 3Q9OA 4QDSA 1MACA 4X6QB 4KGGA 4AVBA 4WVWA 2GC1A 2HWE1 1HRV1 1WCUA 2PN5A 2N7GA 4H14A 2WNVB 2XLGA 3ACLA 4X8PA 5D1IA 1AR93 3WNXA 2IZWA 3USSA 4NAMA 1I5PA 2PLV2 2W3JA 3OB8A 4CDUC 3RJRA 4LUKA 2EICA 2JD4A 4Q26A 2QFEA 3WR0A 2WRAA 5FREA 4ISRA 1Y9MA 4LKDA 4XFAA 2XVLA 2XBO1 1W8UA 4XE9A 4ET7A 1W0OA 4NMIA 1OA3A 3NJVA 4EN0A 2VMIA 3DEMA 3WF2A 2Y6KA 3M3CA 3OD0A 2RM22 2QQPA 5CAZA 2P4EA 3K4DA 3ILFA 4XUOA 4XZPA 1ND3C 2QJVA 2WFF3 3M3EA 4DXTA 4FXKB 2C9KA 4R9DA 1PO22 1SG3A 5DUUA 2B9UA 3WDWA 2OQ6A 1IOAA 2YUEA 4MVTA 1PO13 4XFBA 2ZPXA 1HB3A 3VDDB 3H50A 2XDVA 2AYHA 3AVRA 3AKPA 1E5IA 3IAQA 1HRI2 2PAKA 4HANA 4QPGA 1D4VB 1J84A 3S30A 4CCKA 2PHDA 4BH9A 2FDKA 1ZVFA 4BQ5A 1H6YA 1GNYA 3OJBA 5F9TA 1LR5A 1NLSA 4YG6A 2ZA9A 1EV12 1EYBA 1F2NA 5F3EA 2AUYA 4YZ5A 2C0ZA 4QX3A 3ZIXA 3NAPA 1WMXA 1KRIA 2V5DA 4HLTA 5FZCA 1GZWA 3L2YA 1LHOA 3AP4A 3K48A 4HXCA 5CFDA 2R062 1FAYA 2DUQA 2GDFA 3AKTA 1BKZA 3QH7A 4N43B 4QPYA 3AL5A 1IQDC 2Y64A 5T50A 3VZOA 3KV4A 2D44A 3IMNA 5C9AA 5CG8A 1JOBA 1O91A 3EBRA 3I2JA 4FI9A 5A1FA 3T2TA 4CDWC 3ZFGB 3E5XA 4OI2A 2G19A 1BEV2 5JR2A 2XWBB 5BPXA 5D2AA 4I09A 1NCRC 2CWSA 5LRRA 2RR11 5FAXA 3I3EA 3T09A 1YQCA 4YVSB 1AR82 1FI2A 3NJZA 4OQ8A 3P1IA 3H1WA 4I0BA 3ZX7A 2K9ZA 1XPWA 4DMIA 1BVP1 4Q4X1 1F31A 4BA6A 4L8QA 1UPIA 2VUAA 2P3JA 4R9AA 2QQWA 2ZGQA 2X29A 3HQUA 3UJQA 1HB1A 1R1A2 3VHPA 1SEFA 2IC1A 1A34A 1VAVA 3V0BA 1C57A 1CESA 4QXHA 4QDQA 2NN8A 3A4UA 1S2BA 4IGQA 5DAXA 4FFGA 2VH9A 4O61A 5FZGA 1GZTA 3VBOB 1ZZ9A 1VMFA 3AP6A 3TEWA 2WZEA 2WA4A 3EYPA 3GGLA 2JB8A 2WZ8A 2ZHKA 4KG8A 2OZJA 1ZNPA 5JOWA 1JYTA 3RG0A 4EZHA 1YYNA 2HBTA 5L7OB 1WW6A 2CAUA 2D40A 1H2LA 4MGKE 3EJKA 1I9RA 3R4UA 4KH9A 3H8RA 4ZPIA 2GC0A 5I0SA 4QKDA 2NP0A 1US2A 5C3QA 3VL8A 3C2UA 3T1MA 1DQ6A 3W58A 4AL9A 3LA2A 4LTAA 3WF1A 4BQYA 4C0HA 4BM8A 2TUNA 2Z69A 2E32A 3O5SA 1JZ3A 5L19A 4U2AA 3ZYBA 1QHDA 2D5FA 4A7ZA 4QMAA 3N7JA 1C4RA 4QPIC 4LO4B 3U1XA 1AYM2 4Q29A 2FMDA 1VE0A 3POYA 4AHYA 1CPNA 1AR71 4FVVA 2QNKA 5IHRA 1LECA 3GXUA 5EP9A 4FOYA 3D0SA 2VOVA 2AREA 5FK7A 5FP7A 3T4VA 4FPKA 4QGMA 2XWJB 1MEC2 1CAWA 1H8TA 1UU5A 1BMV1 1OF4A 3MIGA 1G9AA 5E8AA 4LIVA 1KQRA 2EVXA 4I02A 1CAVB 3MPPG 5FZ7A 3ROUA 5FQ0A 3V0AB 1JS9A 1L3JA 2HEYF 3ILNA 4GAZA 1UOFA 1O7FA 3SQOA 2VL4A 1QDCA 3ORJA 4QX0A 2WS92 3CJXA 2QQVA 2VR4A 3D0JA 1W2TA 1AX0A 3K75B 1PM4A 3H0OA 4FFFA 4XJ9A 1BXHA 3KVAA 5FYHA 3ZXJA 3TAYA 1Q5OA 4CDXA 3BVCA 1R083 1WUVA 3O1OA 2HKXA 1REEA 1X8MA 4DEVA 1RITA 1PX4A 1U5ZA 1HB2A 1W2UA 1H1IA 2NMOA 3AYCA 3E5UA 3EMRA 3PTRB 1FMD1 1VB2A 1TG7A 1UNBA 5A32B 5KBFA 1IKQA 4QAWA 5CIRA 5A33B 2JD9A 3THDA 3E1F1 2VVDA 3PJYA 2WNUB 2VY0A 2QQOA 3N36A 1SFNA 3DKWA 3U78A 5FZOB 4CYDA 4NRQA 1QJX3 4GKXA 4QU2A 3ETQA 1AJKA 1GYKA 5KXCA 5IK8A 2Y34A 4GB32 4IQPA 2O0OA 4XQ4A 4Z2WA 1UL9A 3DL3A 1VBE3 1W39A 2EIEA 4P5YA 2OA2A 4QB2A 4YM1A 3AMMA 2YV8A 5FYSA 4FSJA 3H3ZA 1H30A 2AEZA 1Z78A 4Z82A 2A6XA 4ATEA 4UYBA 1OBNA 3ACHA 5A3TA 1G8WA 1CZSA 4B1MA 3BI3A 4OI4A 1SBEA 2JKBA 2WYFA 4B3NA 4PDWC 1B09A 3IBMA 3OG2A 3VZMA 4OI1A 2K0GA 1QEXA 1RUH2 1S2EA 5F3CA 3FLPA 5FMOS 4QKBA 3ACFA 2LM3A 5I0RA 5GZDA 5I8SA 3ENRA 1HDKA 1NZIA 5BNOA 2W47A 1QJU3 4YGDA 2PXJA 2X5IA 3DXTA 2BGPA 3WSOA 3IIIA 4E2SA 1PK6B 5JZGB 4ZU5A 2RS11 2JDYA 3SH4A 3OD4A 1K5MA 3H8UA 4M4RA 3TN91 4OHXA 4AZZA 2WFPA 1LOEA 2AR6A 4I3PA 2E33A 3NNLA 2DBNA 4Y24A 2A70A 3HNYM 5DZFA 1MZ6A 4A44A 5IK7A 2WZR1 4GJZA 2CY6A 4QX8A 5LK5A 1VBC2 4AR2A 1MQTB 2ARCA 3JB4C 4FOWA 4AGGA 4LO6B 2ZEZA 2VZQA 1JYVA 2K2SA 3H7YA 2BWCA 1W8TA 3POBA 2WNVA 1R092 4FPEA 3O0WA 3CZUA 3SKJE 1XQNA 5E16A 2BW8A 4BXSV 5I8TA 2VW0A 3KQ4B 4R9CA 4Q4W3 2V09A 2PFWA 2KA3A 3HIFA 4JTNA 1RINA 3H3LA 3IT8A 3H1YA 4YFWA 1SLCA 3SCGA 3TNQA 4D7YA 3ZFEC 2MHFA 4LO8A 1R64A 1QNWA 4LO5B 5C3RA 1OUXA 2XB6C 1CX4A 1QXRA 1W8HA 4FXGB 1GP4A 4PLNA 5FV3A 5FY9A 5FZMA 1LRHA 3NV4A 1UYXA 3QOPA 3T2PA 4IEUA 3AZVA 3WOGA 5LBCA 4ES8A 2HWD3 5FYTA 2PLV1 1QJZA 5EYXA 4H2AA 2RMU3 4CU8A 2R0FA 2P5BA 2DCTA 2VZTA 3VDBA 5E88A 4WM7C 5FP3A 3WQBA 2PYTA 1VBB2 5FJHA 1AXKA 5JOZA 5KHGA 2ET1A 2GP3A 3VDDA 1RUJ2 4JRAA 4QKNA 2R0HA 1D4M3 2RDRA 3A21A 2P6CA 3W20A 2C24A 4CUBA 2ZTNA 2JDMA 3RFRA 4CCEA 1KJLA 1KITA 2D6OX 3USUA 3LE0A 4IV3B 4HPKA 1RVF2 4AGRA 4CEWB 5LATA 4LT5A 3Q8CA 3ZPYA 2VG9A 1YHFA 2W46A 5IJRA 2QQNA 2RM21 5KXBA 1GWKA 1LGCA 4J1WA 5LBEA 3WINE 2HWC2 5KC5A 1TE1B 2VCMA 4LBMA 4RL7A 5FYMA 5C71A 1YFYA 1UY1A 5F3IA 1U12A 3GCWA 1XNBA 4RGGA 4A3XA 5IUQA 1HB4A 4UFKA 5FP8A 1FNYA 3WF3A 5A3WA 3T4HB 2YG0A 4IEZA 1IPSA 1YI9A 3CO2A 1VLNA 3VHOA 1LODA 4JQTA 1KS4A 3RMXA 2VNGA 3GALA 1JZ8A 3VZLA 1ULDA 1YJKA 1AF9A 5KHIA 2RJKA 3IPVB 3GF6A 4AF9A 1JXNA 2ZABA 1W28A 3X29B 3VBUB 1A8MA 4AI9A 2VJXA 1OURA 3TYJA 3T1LA 4YVSA 2IVIB 2YBKA 1VRH2 4GXLA 4WZCA 4AFBA 1OPOA 2D3PA 2VGDA 3WQ0A 1JZ4A 4AEDC 1Q8SA 2R061 2WR9A 1UXXX 5D8AC 4MXWB 2RG4A 1NCQB 2BDRA 2YC4A 1V6NA 4Q27A 3SEEA 1MS4A 5FZ8A 4AFCA 4M3CB 4LHNA 4XABA 3AYAA 1WBLA 2A6VA 5JOYA 5HCAA 4JHTA 4YW5A 4DEQA 1SCSA 1STMA 3IWZA 1BEV1 2HWE3 1HRV3 3Q8EA 1QKQA 1OLME 5FPXA 4YW7A 4UFJA 4EE2A 3NNFA 5BNNC 5J09A 3SC7X 3UJOA 1AR81 3VBFC 2TBVA 3LOBA 1AXYA 1LEDA 5H9QA 3AJYA 5CU1A 2WKKA 3AP9A 4YVWC 2XH6A 3VBOA 1AR62 1N3OA 3U14A 3WV6A 4EN8B 4ZHNA 1MZ5A 4DRRA 1UOBA 2E63A 1ZRCA 2Y0OA 4L2NA 2XBO3 4D3WA 1M4WA 1W6QB 4RS5B 3FL7A 4ATFA 1IPJA 4YW6A 5FMCA 3U10A 3NNMA 5L7OA 3PTYA 4PT6A 4RFRB 1DZTA 1JBCA 1ZZCA 1RUF2 2CGPA 1FV2A 5FZ1A 5AC92 3ES4A 3BOWA 2ZGOA 4KWLA 2BVVA 1GFF2 4LK6A 1WCDJ 4K9SA 4XACA 4XJUA 4Z07A 1NYWA 3WT3A 5JR7B 5BUVA 1SLTA 2DCJA 5IVYA 4O9EA 1HIXA 3EB7A 4YPJA 3UKTA 5JWPA 5FZHA 4YZ1A 1W2NA 1S0GA 5BNQA 1GLHA 3ZDVA 4UOJA 3MFAA 4BB3A 5FYUA 4E4HA 2NPIA 1KD7A 5EFUA 5LK7B 2GC3A 1UY4A 1UCXA 4P9JA 2JENA 1LOCA 1SMVA 3AKSA 1ENQA 2QUOA 5FOJB 3I3BA 1BBT3 3F95A 2NMNA 1I1EA 1IKPA 5FZ9A 5F5IA 5F5CA 1G9FA 1PMHX 3KV9A 4P14A 3B94A 1QQP2 5KXEA 1JYNA 4B4QA 3INAA 4MG2A 3QLQA 4EWAA 2V4VA 1VBA1 1E5SA 2OUHA 2VZSA 2JG9B 4YZ4A 3NAPB 4NJ4A 3ECQA 2UURA 1W9TA 3K46A 3VBRB 3TRSB 2A1XA 2FZ1A 1AYM1 1HN0A 3ZFFC 1YFUA 2GSYA 3TEYA 5DUVA 3PJQA 1DGRA 3RPQA 5CFDB 5M0TA 1XE8A 3H42B 2IXCA 1SDDB 3O1MA 3KHCA 5J98B 2QQJA 2VOTA 4QQHA 5FRAA 1YWKA 5IVBA 4RFT0 1LHVA 5C9AB 4EN7B 2RR13 2W0XA 3ZR5A 3AL6A 5J37A 1JH5A 1OI6A 3NKTA 5FBJA 5A32A 3PNAA 4ZY9A 5JPMB 3KQRA 3D82A 5A33A 3ZO0B 2TEPA 4XYXA 4YW1A 1AL21 3BB6A 4Q4X3 5E1RA 1F4AA 4IW3A 2PHLA 4R4ZA 1ULOA 1J1LA 3QCWA 3GBGA 3LFIA 3SITA 3UGFA 4IEQA 2WS91 2BOJA 1CGPA 4IEYA 3AYEA 4DXSA 4LA3A 1OH3A 3L2HA 1URXA 4N43C 4QDRA 4YNIA 1C5HA 1P8JA 4BQ1A 1UD1A 5DABA 4AQ6A 1POQA 4XCAA 3ZKUA 1XC6A 4BK5A 1LESA 4MXVA 5IAVA 3OSDA 3ZFGC 1OQDA 4CDQB 4U36A 3KCXA 1FOD2 4K20A 5T52A 2Q1ZB 2QZ3A 4Z8BA 3FE5A 4K7JA 4ZXEA 5A6YA 5JOXA 4IE4A 1PZ7A 4URTA 2VMFA 3IAPA 2ORZA 4RGKA 4AVSA 2J1TA 5HXMA 3W9AA 4KG0A 5GKAC 3CKHA 4Q1RA 3OGSA 1JODA 1HQWA 3VN4A 3GJAA 2QTWB 3MLLA 2A5ZA 1CIWA 1JHJA 2FDIA 3M3OA 4XZUG 4C91A 2PHFA 5FYCA 5TSWA 1DGLA 1W9WA 3WUCA 5LRSA 1W6MB 1FPN1 1UZ0A 4BQ2A 4CUAA 5GLZA 5I93A 4AQTA 1Z7S1 2VMGA 4ISQA 4CEYC 1U5YA 1NA1B 4XJWA 3WXPA 3FLTA 1K42A 1UOGA 1MZEA 2HWB2 2GNMA 2MEV2 3NJXA 4LR4A 5FIXA 2WO7A 5FUNA 3JQXA 3IKWA 4G3YC 1AR73 1MQTA 3JU9A 3N4MA 1OD3A 2D6LX 2FMYA 5LA2A 5CFCC 2JDHA 2VXRA 2DVGA 3RZMA 1OQ1A 2Y6JA 1RXGA 2RS52 2W1QA 3IM0A 4JV4A 5FY4A 3UNPA 1SLIA 3VKNA 1X36A 3QACA 5DPNA 4UFMA 1CZTA 2YFZA 4LMFA 2J1SA 2G1MA 2Z2SB 2RDSA 3N9LA 5FLHA 1CAWB 1J3RA 1H9PA 1H8TB 1LENA 4J1XA 2C26A 1TZOA 4P08A 2XJTA 1C8M2 3C7GA 1RC6A 4H55A 1WBFA 4LKEA 2WIIB 1KDMA 1OFNA 1VBC1 3P3PA 1NZCA 1UY0A 2BWAA 2JDKA 2VZ3A 3ZXDA 3OBAA 1EP0A 4XCBA 4LBKA 2Z42A 1YO8A 1WW5A 1QOTA 2ADDA 3HWJA 3TEXA 5HPOA 1R091 4AE2A 1S4CA 1O59A 4BQWA 5F8PA 2ZGTA 4IGOA 5FZ6A 1RUC2 3D5OA 1FMD3 2EAAA 2VBDA 1TQ5A 3GZUC 3ZN6B 5GLWA 5K8SA 2XG3A 4HETA 4CDXB 3SXWA 1FX5A 4Y20B 3BCWA 2OVUA 4YW2A 4DUXA 3GHMA 4IE0A 5A7NA 3SEPA 1OA4A 3AZWA 4NWVA 1CR7A 3VDAA 3WF4A 1RUI2 2QKDA 4OHZA 4CCNA 4IERA 4IV3A 4CEWA 4L0PA 3KV6A 4A4AA 4INDA 1V6KA 2WNEA 1LULA 3W21A 2UYBA 1BLZA 3VBHC 4QB6A 1MS0A 1UZYA 1OLRA 3GZEA 1N1TA 1D7PM 3KT1A 4MV2A 4CA9A 5FPUA 1OOPC 4Q4V2 3ALQA 3DPRB 5FWEA 4AFMA 2XJUA 3ON7A 4IEPA 4HFSA 2OS2A 4PBOA 4OQ9A 3UGHA 1RUJ1 3VBSC 4AEKA 4TSVA 3HBZA 4EYUA 4OHVA 5DAVA 5IVFA 1W3VA 1N3QA 4XXAA 5IT6A 3WD5A 2Y38A 1W6NA 3UKVA 4WBBA 3NV2A 3ME2A 5FOBB 4K6BA 3GZAA 2WNUC 3AJZA 1Q8VA 1XNTA 3JUUA 3NMBA 3I8TA 4XMAA 2YXSA 2Q4SA 3T30A 4CXWA 4LHSA 2UWAA 2HWC1 2Y6GA 4YLZA 5A6QA 2EALA 2YPDA 2D3RA 1PNFA 4JKKA 4PIYA 3VBUA 3WG4A 2YMZA 3LEGA 3ZYRA 3UV9A 5K4LA 2V73A 4BYYA 4FPGA 5LW9A 2RS13 4NVPA 2RHPA 4QX7A 5FJKA 5BXXA 2L9LA 3CLPA 5FMBA 2QZ2A 3MIHA 3SHRA 3TN93 5AVPA 4XPVA 4A2UA 4IEXA 1A3KA 4P02B 4MXWA 1WLTA 4R8HA 5CISA 3D8CA 1REFA 1C3HA 3PUIA 2IXLA 5L36A 2BTVC 3OPTA 1K5MB 2WZR3 3CHXA 4HT1T 4M3CA 2Y60A 3RS6A 4E4ZA 3UK9A 5A1AA 4W6XA 1DQ2A 1PGSA 1UIJA 4KNCA 2XLAA 1ZA4A 1COV2 4IL7A 2GMEA 4Y3OA 4TZDA 3O1RA 3POSA 4LITA 4XF4A 4D94A 5F3GA 1YJLA 1LB2A 4WM8C 5FKCA 5FUPA 1IS3A 3WW4A 3ZPOA 4Q5OA 1ONAA 4IE5A 4RGAA 3FX3A 1NX9A 2RDQA 3G7DA 4JKMA 1AHSA 1PK6C 5CKMA 1WLWA 2P3KA 2P3IA 1W6QA 2PAMA 4CE8A 1IHMA 1PVXA 4PIXA 4RS5A 4COZA 1NT0A 2B39A 3MI8A 4WVMB 4Y5Z0 1TMF2 2AC1A 5FMOL 2R072 2O8OA 2WWUA 1PMJX 2OPKA 1FV3A 2HYXA 2P34A 1GU3A 2B45X 1CAUB 2CHHA 3HNBM 2JDNA 4X8NA 2PLV3 3WF0A 5LY2A 1H4GA 1O5LA 1NXMA 2IWGB 2KR2A 1AR61 2A71A 2VUJA 3ZSEA 4JAAA 5I0UA 4FPCA 5CBLA 4UWDA 1U0AA 1V6LA 2VMEA 1XE7A 3CJIB 3NVCA 3KCYA 4UFIA 4Y1YA 2WFF2 1A78A 4XHXA 4YW4A 3RDIA 1UYZA 2RM23 3L9JT 1QJFA 2OX0A 5CKQA 1RUF1 3M2MA 5AC91 4HPKB 3WEZA 2I45A 1T6BX 3B01A 1RB8G 1E5HA 4LBNA 2BRTA 4GWIA 1CZVA 3SISA 4DS0A 2H0VA 2WLQA 1LNSA 1W0PA 3C7EA 3NW4A 1GZCA 5DDJ2 2JG9A 3E6DA 4HK9A 3UKNA 3HJRA 1LOGA 4IEOA 4LBQD 5F6KA 3LGRA 3VBRA 3MFCA 4FTSA 1PGW2 3VD5A 5C4WC 3DF0A 1MS5A 1W2AX 3J7HA 2QE3A 1YC61 2WSUA 2VVFA 1ODMA 2W39A 3KGLA 2B5HA 3G6JB 2H0BA 3N7KA 3ZMOA 3KS7A 3WDUA 4NPRA 2J1UA 2ATFA 2AGSA 4QHZA 1VMHA 2DUPA 4Y26A 2HLEA 1YIFA 4A45A 1WGPA 5T5PA 2YC0A 1LOFC 3RWKX 5BNPA 4UFHA 1QQP1 4XUNA 4KMQA 3I4IA 4JGZB 2R063 3ST7A 4Q0UA 3W59A 2ZEYA 1ZBA2 3WUDA 3GCXA 5EV7A 4ZZ5A 5C6CA 1WA6X 3WNMA 4BOWA 5JXHA 1WCQA 1ASJ2 5IVVA 4NROA 4OI0A 3AZZA 4G4FA 4JQRA 4Z1VA 3GDBA 1IS5A 4OUEA 3O0VA 4AI1A 1BEV3 2VMHA 4NHXA 2ZMKA 5IVEA 4NIGA 5ACA2 3ZM8A 4AXOA 4NE9A 1K3IA 4FQZA 1AR83 1W9YA 2CNAA 2EAKA 3PVEA 4CDQA 2Z5WA 4KQ7A 4CP9B 1QU0A 1X9TA 2WDBA 2V4AA 3ZN4A 1TME2 4HL0A 4Z92B 1BJQA 3A0KA 4TN7A 4Q0SA 1BK1A 4I0WB 2P37A 1YQ5A 4X6RB 2XHKA 2DVDA 3E5QA 1I6XA 3ZYFA 3APBA 3LIHA 1NCQC 1YLLA 4LLOA 1QGLA 3GHNA 4UW3A 5JAXA 4YWAA 4EN9B 4LBQB 4FAHA 1WLDA 1W8FA 3WW2A 3T3YA 1XB9A 4GH4C 3MLKA 3FFZA 1W6MA 2PAEA 1ZM1A 5A7WB 1K12A 1OVSA 4LNVA 2GH8A 1FOD1 4YGCA 1GOFA 1KS5A 4QQLA 2R32A 5DZEA 4MX3A 2P6HA 2HJIA 4QHBA 1CPMA 1NA1A 3I2FA 1Q3EA 2GNBA 3RZGA 1DCSA 5K7PA 3JD72 5D21A 1S0IA 1XU1A 2JWPA 4XC9A 3SNMA 1XNDA 1UMHA 3M7AA 1X82A 4UF0B 5FZFA 4PLMA 3WG2A 1JOPA 4L92A 1XU2A 1KFUL 2UWBA 4K21A 5A3PA 1ZYBA 2W92A 1VPHA 5K9YA 1HX6A 1KDKA 5GZCA 1OUSA 3CNAA 1LGNA 3SKVA 1VBA3 1RHI1 2W9XA 2X8KA 3H8OA 2HWB1 2GMMA 4MOAA 1PIV2 5DUXA 5CA6A 1ZZBA 1AYM3 2ZGMA 3LEIA 3OGGA 1W90A 3WCRA 1MVEA 1B35B 3CU7A 4HN1A 4EWEA 3S0MA 3ZSJA 1C8NA 2XXZA 4YZ2A 1OSGA 2EXJA 4I3GA 4PI0A 3KF3A 1DYOA 4XMIA 3MUZ1 3MEPA 5CEHA 2RS51 5GLTA 4FO9A 1J1TA 3I2KA 1LKNA 5FY7A 5DAPA 3B69A 1JMUB 3WG3A 3GJBA 3N9MA 1EPWA 4OULA 2BFUL 2OIIA 4O65A 4QPGC 5I0TA 4Q0VA 4IV1B 2PHWA 4H7LA 2O14A 4N53A 3ZN6A 2RDNA 4A6OA 5GLVA 1ND2B 3JB8A 3NV1A 1EAH2 2BNNA 2GN7A 3KT4A 1AL23 1DHKB 1E5RA 4NN0A 4Y20A 3U07A 5C8CB 1QH7A 3I54A 1H4HA 4QKFA 2D3SA 1H1MA 4A6SA 3NAPC 2J42A 1GQGA 2QQKA 4NOTA 3WP5A 2JKXA 4DXRA 4E27A 4FQ4A 3ZSMA 2JG8B 3WQ1A 4XF1A 2DYCA 1O6UA 1W05A 3Q8FA 1ULPA 2VOXA 5CG9A 5CFDC 2VC9A 3K77A 4ZONA 4YW3A 2VZOA 4AHZA 3NV3A 1RUC1 1HXS1 3DPRA 5ABJB 1XNAA 3LA3A 3O1VA 4DRVA 2VBBA 3AYDA 1V6MA 3RZZA 4SLIA 2D98A 2F17A 4N8MA 5C9AC 2RS32 2ZAHA 3DV8A 4BCUA 4CCLA 4E8CA 4ZKTB 4GWJA 1L7LA 4XFFA 2VO5A 1VBE2 4D6RA 5JLVA 1RUI1 5SV8A 1W6PB 1O4TA 2WWSA 5APAA 2JE9A 3AXEA 4PI2A 1Y9GA 3MF9A 5EIYB 1SFYA 3R05A 3EXUA 3B00A 2VQAA 4AVTA 1WD4A 2ZKLA 1NXD1 4KWKA 3RQ0A 4LULA 3P3NA 5K0UB 1RJ7A 2YBSA 3WCSA 1O4YA 1W99A 4Q4V1 4Y33A 1FPN3 1TNRA 1NY71 3LF7A 3H1MA 4AHXA 1Z7S3 4OYUA 5FPBA 4FPJA 1N1VA 4HVRA 4DIQA 1UMIA 2Q1MA 4C1XA 5SV5A 1YNAA 5F5AA 2ZS6B 1LAJA 5FO8B 1UKRA 4XEZA 5DG1A 3KWVA 5FLIA 1WZXA 4LOSA 3PUHA 3O1SA 2B9VA 1NQDA 1VALA 4Y1UA 3OEAA 5C33A 1IZ3A 3E6BA 4LKFA 3FFQA 1HLCA 3OPZA 1XOYA 3TWIA 1UYPA 2MNGA 3H3UA 5GJ6A 5FO9B 1SPPA 4NWWA 4W6YA 4CVUA 5IVJA 5T54A 3LKJA 3VKMA 5FZ0A 4PJYA 3AK0A 3ZXAC 3D4KA 1YQ6A 1CJPA 2BJSA 1BZWA 4BZ4A 5GM0A 4OUSA 1VBC3 4FBFA 5IK4A 4FFHA 1H1AA 1KGYA 4WVMA 1JYWA 4RQPA 4YM0A 4YGEA 4TTGA 2E7QA 1OF3A 4RR3A 3K4ZA 1UW8A 1R093 3PUQA 3NL1A 5CVRA 4B7EA 1CAUA 2VECA 4IETA 5FUIA 4MYEA 2DDUA 4DY5A 1DZRA 2XQXA 2VULA 2ZGKA 3VUOA 2ZX2A 3C7FA 4LO7A 1EY2A 4NRPA 1US3A 2VQ0A 3KF5A 4L9BA 1ND3B 1JU4A 2W52A 1UMZA 3KV5A 2XVGA 4PLOA 5KWRA 1POV0 3AZXA 3U37A 3H9AA 1JI6A 2VZ1A 1S0CA 4XFIA 1H8TC 3M8LA 1SQ4A 1BCXA 1VBD2 3CJIA 4TXWA 1TMF1 5FZAA 3OTFA 5KR7A 2R071 1UKGA 2GMPA 2RMU2 1VMJA 2VNOA 3OPWA 4KI5M 4OFGA 3UYJA 1JYCA 1QMJA 3KLSA 4S2GA 2OUJA 3V56A 4E2GA 3B93A 2VCAA 3LB9A 4HVOA 1A6CA 4BISA 4MGZE 4AW7A 1D4M2 1Q8OA 1AYN2 1SDWA 3LIGA 3NWKA 1MS9A 3P6BA 5FZKA 1IPKA 1I5ZA 1MS8A 1RUJ3 1S0BA 1X7NA 3CIHA 3MUY1 5JXIA 1PO21 1RUG2 3A23A 3EHKA 2JB4A 1IG0A 2PHTA 1WWYA 4LQRA 4CDXC 2BZDA 2D7FA 4AOCA 2CDPA 1H8VA 2WFF1 2ZBJA 3PDQA 2ZZJA 2PMWB 5LEJA 1JHNA 2HWF2 1HRI1 3MIEA 3AMQA 2VW1A 4CU7A 1W6NB 3V64A 2HWC3 4ASLA 4CU6A 4EROA 3NNGA 4DUVA 1SBDA 2B42B 3S7IA 4CDWB 1I3HA 1EV11 4BHPA 3TNPB 1ZX5A 4JGZA 3HNMA 4HOOA 2IFRA 4LKSA 1Q56A 4J6GA 4LEJA 1NCRB 5DDJ1 5LA0A 4F7ZA 1V70A 1PGL2 2BVBA 1JUHA 1PGW1 2ZGUA 2B4KA 1NOVA 2E53A 4A7KA 3I49A 2G9GA 3ELNA 3GM8A 4PF1A 1WMFA 1X8EA 3BUCA 3I2HA 3Q8BA 4LPLA 2W1WA 5ANNA 2XJRA 1DDLA 5F2WA 2ILMA 2VCCA 5IFPA 4QHOA 4XURA 2DTYA 1DGWX 3LFMA 4TLFA 1ALYA 4Y5TA 5L9RA 4J25A 1O4ZA 3OY8B 5F7UA 4N9HA 1X50A 2WLPA 5J3UA 4YFZA 4CP9A 3B5LB 4AHWA 2WYSA 3EO6A 4K8FA 1ZBA1 1SFPA 2XL7A 2HWE2 4JDMA 2YBPA 4CPBD 1OVPA 1ASJ1 5JSRA 2R042 4M00A 4XF0A 3SCHA 3ZSKA 3IDBB 4MGYE 5BNOC 1S0DA 2X5IC 2ZX4A 5C8WA 4FPLA 1RGSA 3O0XA 4JGYA 1J3QA 2XGXA 1K5MC 3R0RA 5ANQA 3J8F2 4Q8LA 4LBQA 5ACA1 4UBHA 3H8XA 1O3SA 2I2SA 3S57A 3N9QA 1GR3A 2PHRA 2YU2A 2XBO2 3U75A 1R1A1 2YY1A 2W5FA 3LA7A 3LDKA 3LSEA 5A7WA 1QJY2 1AR63 4H3WA 3ZYJB 1TME1 3ZXKA 3EQEA 1O8SA 4HKOA 5FK8A 5FZ4A 2BPA2 5LA9A 3PMEA 5DUWA 5EPAA 2BFUS 4GKYA 2WNVC 1F8VA 1FNZA 2WWJA 2J1RA 4L11A 1UZZA 5JI7A 2YGMA 3U11A 1OA2A 3BTYA 4QPIB 4GALA 5FY5A 3W5NA 3FLRA 1DP0A 1RUF3 3J7NA 4QXCA 4UF0A 5IATA 4NR1A 5AC93 1V6OA 3KMHA 3ZKYA 3RZJA 2VQTA 1CONA 2A73B 3CL1A 4P9GA 4MGTA 3AXDA 1V6JA 3VZJA 2R16A 1GWMA 2ZCWA 1S0EA 1FT9A 4UW4A 4Q4Y2 2FCVA 4AGVA 2JEMA 3MLJA 4OZXA 4B4PA 4XW3A 3RJ2X 2VOWA 3JD71 4AK3A 5I8YA 1VB4A 1HJGA 1X9PA 1B35A 1BBT2 1POV1 1V6IA 4LA2A 4JCKA 4NHMA 3TOJA 4BMEA 4DUWA 2JDUA 5HI0A 2VUDA 4Q1PA 4ZS3A 5A3OA 2JECA 2VTXA 3HN1A 3LCPA 4EJRA 3MZHA 4QB1A 4BIOA 4DO0A 2XKOA 3VDDC 2WO1A 3IDEA 3DGTA 2VZVA 3MO4A 4EV0A 1REDA 5F32A 4PQQA 4IV1A 1QQP3 3USUB 1KFXL 3JZVA 2GZWA 3WLUA 2XJSA 2D5HA 4FPHA 1MEC1 4AI0A 1ND2A 1PVC2 2W1SA 2XUEA 2W94A 4QX1A 4XUQA 1EUTA 5C8CA 1PIV1 4K1YA 5BNPB 2E9QA 3TB0A 4TLGA 2BBAA 3AKRA 3LZZA 4L97A 3B9IA 3IDCB 2WQZC 5FY1A 1D0HA 1N1YA 1RMU2 4ZU4A 2R1DA 2WAAA 5EWSA 2VXJA 2JG8A 4QQOA 2CWMA 2DUOA 5C5UA 2HYKA 4ARYA 5ABJA 4XDPA 1ULCA 2I74A 4B8EA 2Q30A 4HVQA 1EAH1 1CQ9A 3B02A 1GOGA 3B9CA 3OUHA 3WW1A 3KD4A 1CAXB 2AACA 1W6PA 2E51A 3FN9A 5ISLA 1APNA 3POIA 2G9ZA 4YVSC 2ETEA 2WN2A 3NKGA 4COVA 4LIUA 2DFCA 4FT8A 5K0UA 4P9LA 4PDWB 1XYNA 4BLIA 2QQUA 3AM2A 3Q8AA 4GB31 4AG4A 2UY8A 3KVBA 1NUKA 1RUD2 5GZFA 3LDBA 5JPNB 1FOD3 3PURA 5LY1A 3ETPA 2RS31 3H7JA 4CCOA 4DPNA 2LTNA 5DXDA 5I91A 1VBE1 2E7AA 2FDJA 2PA7A 3FUQA 3JBG2 1ENXA 4GWMA 1UZVA 3O7OA 5F2SA 4BK4A 3PIGA 3ZYPA 1S55A 1X33A 2CYFA 2JDAA 1MS3A 4W6WA 1JU3A 1DLLA 2RV9A 4XJAA 3CF6E 1VP6A 2WSVA 3VBOC 3BU7A 1XYPA 5J36A 5FZLA 4AVVA 2QQLA 4CCDA 1W9SA 2ZHNA 1RUH1 4JRLA 4K8RB 5IVCA 5A7SA 1RHI3 4XOGA 1IS4A 1XBFA 5FFOC 2HWB3 5L7OC 1EUUA 2W68A 4CDUA 4MHRA 4W4ZA 1ULFA 1Y9QA 2BUKA 5FPAA 4ZXKA 5H9RA 4KWJA 3WDTA 4C1WA 4AFDA 2F4PA 3V65A 1QDOA 3JXSA 4GJYA 4D8MA 1GP6A 2RS53 1GKBA 5DN2A 4CCJA 2X53S 1AL0G 3ZOIA 3GZTB 1GWLA 1ZRIA 3ZXFA 4HBNA 1O3TA 3K3NA 4CXYA 2CU5A 4HN0A 3RZLA 4XUPA 5FZIA 4IE7A 2DCZA 3POFA 4A7YA 2FDFA 4BDVB 2WC2A 2FDHA 2DFBA 1ND3A 4D0QA 3OBRA 1MPXA 1IG3A 3J26N 3QH6A 2E26A 4AAPA 3HN3A 4N53B 1O8PA 2V5YA 3ZVXA 3THPA 1DQ5A 2BP6A 1RJ8A 5JSOA 1GICA 2FQPA 2NLRA 4NIAA 1SCRA 4M3CE 1QXJA 1V9U2 1DLCA 2W87A 4ZS2A 3U0ZA 2H6CA 1RUC3 1HXS3 4BXFA 1RUE2 2VTXJ 2GNDA 4XBLA 4NIHA 4R9BA 5JVVA 3WNNA 1RUNA 2ENRA 3FWEA 1Y3TA 1QWRA 1Q8PA 2C5DA 2XPJA 1BYHA 1XSRA 2SBAA 1FYUA 4P5HA 3ZDSA 4RSUA 1RUI3 1VBB1 1VJ2A 4N7IA 1NAEA 1V00A 1VBD1 1L7RA 2QQMA 4FCAA 4LE4A 4AVAA 1AZDA 1K5JA 4JHZA 4OCTA 5EZWA 4GWNA 4QX5A 4GMP0 5AFBA 4FOVA 2PQQA 1RVF1 3IZOA 3RYPA 2XJVA 1TEIA 5A3LA 3LDRA 1LCLA 4Q4V3 5FP9A 1AYN1 3BYWA 4CDWA 3OGVA 2DWRA 3PU3A 2YDEA 3MIBA 3K2OA 4V2VA 2VVEA 1EPZA 2WNOA 3PVOA 4MGIE 1D2QA 1NCRA 4FPYA 4UT5A 1RUG1 5F1RA 1XNKA 4H7MA 3AX4A 1LOAA 4RHV2 1ZRRA 5CADA 3DXUA 3AMNA 1UYYA 5D8AB 2HWF1 3I2OA 2Q5TA 4ARXA 1YI7A 5A3UA 2VPVA 3P5BA 4O9GA 1LGBA 2RS12 5A70A 3DKQA 3LEMA 5JSPA 3OY8A 4ITCA 2RJ2A 3AFKA 2RJLA 2VZPA 4NPLA 5LB6A 1H2NA 2ZAAA 3BIWE 5GALA 5BNNB 1T2XA 1S2KA 1PGL1 3VBFB 3M1HA 1GQHA 4QPWA 1VRH1 5CNAA 1SPPB 3BTXA 4LHLA 5C70A 1ZBE2 2WA3A 3KGZA 1H2KA 1PMIA 2ZGNA 3POGA 1IQAA 5JZGC 1OD5A 4XF3A 4OLLA 1OFSA 3DYPA 3KCCA 3RI9A 4DZGA 2X05A 5IW0A 3SCFA 1Y4WA 1AR92 2VM9A 3B7MA 5A7OA 3CDZB 1Y43B 2X10A 1YEWA 3ZMNA 5HBAA 3MW2A 4RQPB 5FP4A 1OLQA 4RR3B 2A3XA 4MUVA 2AZ5A 1HKDA 3JCIA 1MQTC 2JXAA 4E4SA 4CXXA 4IESA 1VAMA 2BBVA 4QU1A 4QD2A 3WNOA 5KHHA 3WP4A 2Y6FA 1W2OA 4K3UA 1DGWA 1W6OB 1V0AA 4CCCA 4TWTA 1ZREA 2R041 4JX0A 2GAUA 4K1ZA 1TMF3 3HQRA 4M0NA 2R073 3UL2A 3VD4A 5J48A 1ZZ7A 4QPIA 3VZNA 2XR4A 4EWDA 1JYXA 4XTMA 3J8F1 3IDAA 4P9IA 2R30A 2QDRA 2B7YA 1LOBA 1W8OA 2WO2A 1J3PA 5DAQA 2UWCA 1LU1A 4FFIA 1QJY1 2IXJA 4Y1XA 1PO12 2YU1A 5FDBA 3RSJA 5FWJA 5I0DA 1C1LA 1BHGA 1PO23 1QIQA 4YARA 5A6XA 2WQ4A 3IN9A 1G7YA 3BOPA 2ZGSA 1E57A 3GBFA 2ZGLA 5JXJA 4QT6A 1N3PA 1YQ2A 3THTA 3FJSA 1C1FA 2YPJA 3ACIA 3SH5A 1HRI3 3ZFFB 4AI2A 5IFTA 1ST8A 5T5OA 4FP3A 1JZ6A 1UU6A 1H9WA 1XYOA 3VL9A 3GNEA 3VHRA 3C7HA 5FKBA 4CPBA 4I01A 1FXZA 1S0FA 3NRUA 1XNCA 3AB0A 3LWCA 1EV13
chains in the Genus database with same CATH topology
4IV3C 4CEWC 5DDJ3 3ZN5A 4Q4Y1 4AFAA 1ZRFA 2IXKA 1XXNA 1YIPA 1WMDA 1BBT1 2JE7A 2EIGA 4SBVA 1CN1A 3BODA 1Y7BA 2ZJCA 3AFGA 1HW5A 4KGQA 4QGLA 1JW6A 5AVAA 5JCTA 1S1AA 2EXHA 5HCFA 4GMP1 1ULEA 3TBDA 1M06G 4YM2A 2XVKA 1PVC1 3DUIA 1DG6A 1YCIA 2YGLA 3S6PA 2TNFA 4K40A 1ZBA3 2XJPA 2ERFA 3ASIA 1CAXA 4TYSA 1ASJ3 3VBUC 3I59B 1RMU1 5GLUA 2EA7A 2ET7A 5FBZA 2DV9A 3R4DB 5ACA3 3FHIB 5DG2A 4PDWA 1CJDA 5T55A 2DURA 2GC2A 3GBWA 2WZPP 4JGYB 1R1A3 4WV8A 3SMHA 1J59A 1TME3 1SACA 2OW4A 4HZFA 5H9PA 5JI9A 5T5JA 2KM2A 1MR5A 4UW6A 2DU0A 5EYYA 4D7SA 5KC6A 4CEYB 4IEVA 4HKWA 3O12A 3J4UH 3VKLA 3I2DA 1G86A 3ZXEA 3AP7A 1RUD1 5CFCB 4RS5C 2EF6A 1DYPA 1UF2C 2GNTA 5J96B 4B29A 2XUMA 1LHUA 3JBG1 3JD73 1NG0A 3ZYGA 4B7KA 3JQWA 1QF3A 2QCSB 1HQLA 3VZNA 5HCBA 1POV3 2OYZA 2MEV1 3FBMA 3VHNA 1AJOA 4UBGA 3ZFEA 2IXHA 2QVSB 3KZ4C 3M3IA 4I30A 3RYKA 2F6BA 2ARXA 2D43A 1VBA2 2WT2A 5BYNA 5AFEA 2E6VA 1UX6A 2Q8OA 2YYOA 5FTTC 1MEC3 3MPBA 4BMBA 5GZEA 1PIV3 1KJRA 5GZGA 4WM7A 4KU7A 3RI8A 4Q0QA 2PHUA 1C8M1 2PHXA 4MH0E 2G4IA 1RUOA 2HEWF 2WS93 4XFGA 3I7DA 1R082 2JG9C 1AL22 5EXOA 2A6ZA 3VBRC 1J58A 4BE3A 3LSDA 3VBHB 1EAH3 3HT2A 3N3HA 4WZFA 2CV6A 4EN6B 1OOPB 4LUMA 2B8MA 5KHKA 4CRQA 4M01A 5FLJA 1QJX2 3POWA 3VBSB 3C3VA 4Y22B 5BNPC 1AUYA 1GZ9A 1UIKA 4PQ9A 4WVVA 2FHRA 4QXKA 4S2DA 3WHTA 2EXIA 1V9U1 3ATGA 1G9BA 4XXPA 1NQJA 1PHMA 3PLQA 4GB33 5FPZA 3SLIA 1RUE1 3AKQA 4DINB 4P9YA 3MW4A 2RS33 5E89A 3MYXA 3HAGA 4CP1A 1QXPA 4AI8A 2ZX0A 4AEDA 1Z0HA 4Y1VA 5D8AA 1FPN2 4CDQC 4XDQA 3WDVA 2YZ4A 3URFA 2NYYA 1GNHA 1Z7S2 3MW3A 3WZ1A 1RUH3 3KSCA 1QJU2 3E97A 4V1PA 2B46X 4XQDA 1PZ8A 4F3JA 5BNNA 1DU3D 3VBFA 1YRZA 2CTVA 3WG1A 4BIFA 4WM8B 3N7LA 4RHV1 3VLBB 1HV1A 5DZGA 4YVWA 2RE9A 1DBNA 1ZZ8A 4FP2A 4AEMA 4CDUB 3FUOA 3MDPA 4JTOA 3ZSLA 2OZ6A 1JTZX 2ZOEB 1NA1C 1COV1 1PM7A 4JDNA 5T3NA 5A3MA 1OPMA 3MGUA 4G9SB 5H9SA 3KB5A 4FTBA 4Q4W2 3A0NA 4S2FA 1JUIA 1RL3A 2JDZA 2AENA 4LBJA 1W6OA 1ZBE1 1VR3A 4L99A 1O3QA 2D6KA 4CZSA 2IFWA 3VGIA 3M3QA 2XJQA 1QH6A 1FATA 1AR91 1MZFA 2HWD2 2IXIA 4UW5A 3RRDA 2NZ9A 1BQPA 2CAVA 1SBFA 4YG3A 5JDBA 2XL9A 1QOOA 5B2GB 2D6NA 3NO8A 4ONUA 4DOUA 3QD6A 1VBB3 3ILRA 1VBD3 4QQ2A 1N47A 1WMEA 4HMZA 4N53C 4P9XA 3ZFFA 5C4WB 2Y0IA 5BY5A 1RVF3 2BGCA 4GQ7A 1UU4A 2A6YA 5J7MA 1AYN3 3WQ7A 1IGOA 1DF0A 1PO11 1YXWA 1UPSA 1RUG3 2CGNA 4XIOA 4ZU7A 1U5IA 3O14A 5BV6A 1AX1A 1D2SA 3N7MA 3D6EA 4GIQA 2WT0A 4ORFA 1YFWA 3PHMA 5IK5A 3DPRC 2HWF3 4RD7A 4JDOA 3VV1A 2NQYA 3WDXA 1SLLA 2PTMA 4PBPA 2ZX3A 5FCCA 3WW3A 4F8AA 5CB7A 2A75A 4LBOA 1ULGA 1GSLA 2DCYA 2R1BA 4N43A 4FAGA 2DTWA 1RTVA 3OYWB 4COWA 4META 4D69A 3AP5A 4ASMB 4AQ2A 4FOQA 3ZFGA 4NHLA 1VRH3 2R49A 2XKPA 4LHKA 4YYOA 3I59A 2ZX1A 1ZRDA 2D97A 2DCKA 1NE6A 4AWDA 4P9WA 3NSTA 1H2MA 3CEWA 4DB5A 1HRV2 2Q0AA 1OHFA 1WW4A 3MICA 2A3WA 3IIAA 4XHBA 4YM3A 4LE3A 3FZ3A 3MIDA 3ZXGA 1C28A 3RWNA 4DFSA 1NLRA 2WT1A 4GH4B 1DQ0A 3B3QE 4DQAA 2VNRA 1DGRN 4OUMA 3OGJA 1R1ZA 2R043 4XBQA 4CEYA 1O3RA 2D6PA 2UY9A 4YG0A 3MIFA 4IXLA 2GU9A 1A8DA 3J8F3 2ES3A 3HMYA 1LTEA 5HXVA 3HT1A 2DVBA 2GN3A 4XJZA 4E2QA 4BLJA 2G9FA 2VU9A 5CFCA 1QJY3 4DNYA 1CVNA 1T6GC 1NE4A 2BQPA 2CL2A 3VKOA 5JIUA 2I07B 4I0AA 4RQPC 5F6LB 4RR3C 4R52A 1HV0A 4D7TA 4PCRA 1MVQA 4PIZA 4JC1A 1DQ1A 3BTAA 4F83A 4RA0A 1OKQA 1YFXA 3VKFC 3CJIC 1ENSA 3M70A 4HSLA 4XIKA 2XLFA 4Q4Y3 3BALA 4Q8KA 3RNSA 4Q0PA 4QPGB 1LHNA 2Z79A 2BYVE 4N7UA 4UXAA 3WY6A 1G9DA 3KM5A 1UAIA 1VIWB 5KHJA 1ENRA 3R6SA 1CAVA 1RIRA 2RR12 4GMP3 3V0AA 1OMIA 4QQPA 5FO7B 2H6BA 1GZWB 2UU8A 1N1SA 4GULA 3R4SA 2FBEA 3MF6A 3VBHA 3OF1A 3GYDA 3SH3A 1PVC3 1LJ7A 2O1QA 2W08A 4Q4X2 1OOPA 1VAKA 1DIWA 2EXKA 4XJ8A 5KXDA 2WJSA 1RMU3 3VBSA 4Y22A 3AZYA 1F5FA 1F5JA 1QY4A 2O8QA 4JGZC 4Y1ZA 1R081 4OVEA 1OQEA 2ZHMA 1DQ4A 4LLFA 2WNUA 2A7AA 4KBBA 3FMGA 2ARBA 1SLAA 2VW2A 1PNGA 3WP3A 3KT7A 2NM1A 4MLOA 1SLBA 4YGBA 1WLCA 3WVJA 1IS6A 1QJX1 3LAGA 2E7TA 1LEMA 3OBTA 4QM9A 4CP0A 4OHYA 1GV9A 2DF7A 1BVVA 3V0BB 1JN2P 4KL1A 3M4FA 4KU8A 4BPZA 1JYIA 1RUD3 3AMHA 4AQSA 2C9AA 1F9KA 3AMPA 4W65A 1QOSA 4JGYC 3JBG3 1YUDA 2ZGPA 4WM8A 4M3CF 3PMSA 4E9KA 1D0GA 1AR72 2MPFA 3LOIA 2CGOA 2MEV3 5JZGA 2FZ2A 1PK6A 1GBGA 3BPZA 2ZMLA 2BNOA 1RHI2 1WCSA 3QBQA 1MS1A 4XFHA 1O5UA 1QJU1 2R6QA 3ZFEB 1BMV2 4YRDA 3HQXA 1JOJA 1PZ9A 3RMYA 1DYKA 1DFQA 4HK8A 2GALA 4COYA 2YROA 2A6WA 4C0BA 4Q2FA 1G6NA 1GNZA 2DVFA 4QGNA 1C8M3 4XTPA 4WM7B 2JJ6A 2UYAA 4DY3A 1KXGA 4YZ3A 2D6MA 1XRUA 2SLIA 2DU1A 3HR9A 1FMD2 4Q4W1 3J9SA 1B35C 2ZACA 1LU2A 4XQWA 5FQ0B 4AEJA 3PVBB 3WHUA 3ZIWA 4MSVA 1S0JA 5JIAA 1LHWA 3S7EA 4FPFA 1WCKA 3DN7A 1HXS2 3ES1A 4IV1C 2ZHLA 5C4WA 2YHJA 4AYUA 2HWD1 1ND2C 3VZKA 4E4DX 1V9U3 4MZUA 5C8CC 2RMU1 1Q8QA 2Y26A 4NHKA 2LUWA 1RUE3 2VOKA 2C1FA 2P17A 4ES9A 4N9IA 4XF9A 3WX5A 4S2HA 4R4XA 5L73A 1D4M1 1LOFA 2JG8C 3ZYIB 3FBYA 3HD8B 3WDYA 4COUA 2BEOA 1WD3A 2ZKNA 4B4RA 2JICA 5ABJC 5JMCA 1NY72 4AI3A 4QM8A 4AVCA 3RYRA 2GH2A 4CTEA 4AEDB 3ZXLA 2A3YA 1H0BA 3N35A 2WL1A 4LBLA 4BWOA 4FPOB 4XETA 4M0HA 3WP6A 1TNFA 4GA9A 4XFCA 5EJ3A 1QNYA 2KXLA 4HSJA 2ZZQA 2PELA 3OCPA 2JX9A 3OYWA 3TN92 4YSFA 1DZQA 4HKLA 4NO4A 5T5LA 5LEKA 3K51A 1WA4A 4WVZA 2DVAA 1U5XA 4RHV3 3IPVA 4XILA 5K0UC 1CD3G 2WZR2 4Y4YA 1AVBA 4JVAA 1G9CA 5F5QA 4CP2A 1ZZ6A 3FC0A 1AXZA 1HQNA 2QDNA 4C90A 4XBNA 4OHWA 1C5IA 1AX2A 4YVWB 4N90A 4PF5A 2AH2A 5BNOB 1COV3 2X5IB 1NCQA 2LALA 2D93A 1GANA 2HEVF 1Q43A 1WW7A 2P2KA 2ZGRA 2WINB 3PVNA 4IEWA 4GH4A 4FTEA 2ZMNA 3E6CC 4DXZA 4I2OA 1ZBE3 1UN1A 2BNMA 3Q9OA 1MACA 4X6QB 4KGGA 4AVBA 4WVWA 2GC1A 2HWE1 1HRV1 2PN5A 2N7GA 4H14A 2WNVB 2XLGA 3ACLA 4X8PA 5D1IA 1AR93 3WNXA 2IZWA 3USSA 2PLV2 4CDUC 4LUKA 4Q26A 2JD4A 2QFEA 3WR0A 5FREA 4ISRA 4XFAA 2XVLA 2XBO1 4XE9A 1W0OA 1OA3A 4EN0A 2VMIA 3M3CA 3OD0A 2RM22 2QQPA 5CAZA 3ILFA 4XZPA 1ND3C 2QJVA 2WFF3 3M3EA 4FXKB 4R9DA 1PO22 5DUUA 3WDWA 2B9UA 2YUEA 1IOAA 4MVTA 1PO13 4XFBA 2ZPXA 3VDDB 3H50A 2AYHA 3AKPA 4QPGA 1HRI2 2PAKA 4HANA 1D4VB 3S30A 2PHDA 4BH9A 1ZVFA 3OJBA 5F9TA 1LR5A 1NLSA 4YG6A 2ZA9A 1EV12 1EYBA 1F2NA 4YZ5A 2AUYA 2C0ZA 3ZIXA 3NAPA 1KRIA 4HLTA 1GZWA 3L2YA 1LHOA 3AP4A 3K48A 5CFDA 2R062 1FAYA 2DUQA 2GDFA 3AKTA 1BKZA 3QH7A 4N43B 4QPYA 5T50A 3VZOA 2D44A 3IMNA 5C9AA 5CG8A 3EBRA 1O91A 3T2TA 4CDWC 3ZFGB 3E5XA 4OI2A 1BEV2 2XWBB 5BPXA 4I09A 1NCRC 2CWSA 5LRRA 2RR11 5FAXA 4YVSB 1AR82 1FI2A 3NJZA 3ZX7A 3H1WA 4I0BA 2K9ZA 4DMIA 1BVP1 4Q4X1 1F31A 4BA6A 4L8QA 1UPIA 2VUAA 2P3JA 4R9AA 2ZGQA 2X29A 3UJQA 1R1A2 3VHPA 1SEFA 2IC1A 1VAVA 3V0BA 1C57A 1CESA 2NN8A 3A4UA 1S2BA 2VH9A 3VBOB 1ZZ9A 3AP6A 2WA4A 2ZHKA 4KG8A 2OZJA 1ZNPA 5JOWA 3RG0A 1YYNA 5L7OB 1WW6A 2CAUA 2D40A 1H2LA 4MGKE 3EJKA 1I9RA 3R4UA 4KH9A 2GC0A 5I0SA 2NP0A 3VL8A 3C2UA 3T1MA 1DQ6A 3W58A 3LA2A 4LTAA 4C0HA 4BM8A 2TUNA 2Z69A 3O5SA 5L19A 4U2AA 1QHDA 2D5FA 4A7ZA 4QMAA 3N7JA 1C4RA 4QPIC 4LO4B 1AYM2 4Q29A 2FMDA 3POYA 4AHYA 1CPNA 1AR71 4FVVA 2QNKA 1LECA 4FOYA 3D0SA 2VOVA 2AREA 4FPKA 4QGMA 2XWJB 1MEC2 1CAWA 1H8TA 1UU5A 1BMV1 3MIGA 1G9AA 5E8AA 1KQRA 2EVXA 4I02A 1CAVB 3MPPG 3ROUA 5FQ0A 3V0AB 1L3JA 2HEYF 3ILNA 1O7FA 1QDCA 2WS92 3CJXA 3D0JA 1AX0A 4XJ9A 3H0OA 3ZXJA 1BXHA 3TAYA 1Q5OA 4CDXA 1R083 1WUVA 2HKXA 1REEA 1X8MA 1RITA 1U5ZA 1W2UA 2NMOA 1H1IA 3AYCA 3E5UA 5A32B 3RJRA 1FMD1 1VB2A 5KBFA 1IKQA 5CIRA 5A33B 2VVDA 3PJYA 2WNUB 2VY0A 3N36A 1SFNA 3DKWA 4CYDA 1QJX3 4GKXA 4QU2A 3ETQA 1AJKA 1GYKA 5KXCA 5IK8A 4GB32 4IQPA 4XQ4A 2O0OA 4Z2WA 1UL9A 3DL3A 1VBE3 1W39A 2OA2A 4YM1A 3AMMA 2YV8A 4FSJA 3H3ZA 1H30A 1Z78A 4Z82A 2A6XA 4ATEA 1G8WA 4OI4A 1SBEA 2JKBA 4B3NA 4PDWC 1B09A 3IBMA 3VZMA 4OI1A 2K0GA 1RUH2 3FLPA 5FMOS 2LM3A 5I0RA 5GZDA 5I8SA 3ENRA 1HDKA 5BNOA 1QJU3 4YGDA 2X5IA 5JZGB 4E2SA 1PK6B 4ZU5A 2RS11 3SH4A 3OD4A 1K5MA 3H8UA 3TN91 4OHXA 2WFPA 1LOEA 2AR6A 4I3PA 4Y24A 2A70A 5DZFA 1MZ6A 5IK7A 2WZR1 5LK5A 2CY6A 1VBC2 1MQTB 3JB4C 4FOWA 4AGGA 4LO6B 2K2SA 3H7YA 2BWCA 2WNVA 1R092 4FPEA 3O0WA 1XQNA 5E16A 2BW8A 5I8TA 2VW0A