4YM2A

Crystal structure of the human galectin-4 c-terminal carbohydrate recognition domain in complex with lactose-3'-sulfate
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
138
structure length
138
Chain Sequence
PTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Sugar binding protein
molecule keywords Galectin-4
publication title Structural characterization of human galectin-4 C-terminal domain: elucidating the molecular basis for recognition of glycosphingolipids, sulfated saccharides and blood group antigens.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 138
sequence length 138
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ym2A00
2YZ4A 1G86A 2DTWA 3ZSLA 1HLCA 4BPZA 5GLZA 1V6MA 3INAA 5T5LA 2ZHNA 2R49A 3AXEA 2HYKA 4PF5A 1ENQA 1AXKA 2YROA 3N35A 2NP0A 4YGBA 1AX2A 3IMNA 2ZAAA 3O0WA 2DYCA 2A6YA 1I3HA 1SACA 1DIWA 2P34A 4P14A 4K21A 2DVDA 5JMCA 1AJKA 2A6XA 1Q8PA 3FFZA 2VW2A 4PBPA 4RL7A 1LOFC 1W6QA 1DYKA 3O5SA 1W0PA 5IK4A 2CNAA 2EXJA 3AP5A 1DFQA 1YXWA 1LGNA 2VU9A 2NM1A 3AJYA 3POSA 2DURA 5IUQA 1V00A 4DS0A 2XG3A 3V0BA 3GALA 2ZGRA 1F5FA 3WDWA 1Q56A 1V6KA 1PZ9A 2VXRA 4M3CA 1MVQA 1JBCA 1QNYA 1J1TA 4YG6A 1DQ6A 1W6NA 4AYUA 1JN2P 4LBKA 1CONA 4JCKA 1BQPA 4XXAA 1X50A 1AJOA 2B7YA 4AGVA 3R05A 5T55A 1FNYA 1PZ8A 1ULGA 5SV8A 3D4KA 1CPMA 1GZCA 2VW0A 5L73A 4AGGA 4H55A 4AWDA 5T5JA 5EYYA 2DVFA 3AYDA 1VLNA 3IN9A 1IKQA 2A71A 3IPVB 4YM2A 3AZZA 1LTEA 2PHFA 3SH5A 2R0FA 1GLHA 4FPOB 1LHWA 4XXPA 4XIKA 1GYKA 4YZ1A 2ZGNA 3O12A 3RMXA 5JOWA 4XILA 3A4UA 3GNEA 4YW4A 4Y1YA 4Q8KA 1AXZA 1Z78A 2D6PA 2C9AA 2OW4A 1WBLA 4FPKA 4UW5A 2ZGUA 4OZXA 3WUDA 2AUYA 4YZ2A 2NYYA 3SH4A 2EALA 3VUOA 3V0AB 1KRIA 2A6WA 2PHTA 1AXYA 4ISQA 1C4RA 1N3QA 4YW1A 1MS3A 4DPNA 2WT1A 1KJRA 2ZGMA 1LOGA 4XTMA 5JDBA 1N3PA 1MS1A 1B09A 2GMPA 4Y22B 1BJQA 1S0BA 1QOOA 4XMIA 2P37A 4XDQA 1GICA 2WSVA 4WVWA 2E51A 1BKZA 4YGDA 5JOXA 5CBLA 5CB7A 1QDOA 5FRAA 1S0FA 5IT6A 5DUWA 4M3CF 4XIOA 1DZQA 1RITA 4FQZA 1GBGA 2GNMA 1LESA 3ZSMA 5JOYA 3USUA 1HQWA 4DRRA 1O4YA 1QOSA 3C2UA 5DG2A 3POYA 1C1FA 1QU0A 4CZSA 1OQ1A 2P3IA 4FPYA 3W59A 2ZGLA 4L8QA 4AVVA 1GNZA 1LU1A 2WT2A 4YM0A 3DGTA 1GV9A 1S0EA 4GKXA 4HANA 5DZFA 1LODA 2PELA 3ILFA 5H9SA 1SLCA 4CRQA 2PHUA 1QOTA 1SCSA 1MVEA 4MYEA 3ZXLA 4NOTA 4Q2FA 1WBFA 2ZMKA 1APNA 1SFYA 2GN7A 1CPNA 2RHPA 3AJZA 4R9BA 2ES3A 3MW2A 3WOGA 1EPWA 1ENRA 3TAYA 4XJZA 5GZFA 1JYIA 2A5ZA 5GZDA 2EAKA 2VW1A 4BM8A 4FPEA 2A7AA 3FLTA 4D69A 4P9XA 3NV1A 1DQ4A 1MACA 4IQPA 4Y26A 2P3JA 3UL2A 3WG2A 3ZSKA 1WLDA 4XOGA 2JE9A 2OVUA 4XBNA 5GM0A 4BQ1A 1N1VA 4KBBA 1G9BA 1LOBA 3QCWA 3AK0A 2GNBA 2W08A 4GA9A 4ITCA 1PZ7A 4YM3A 4K1YA 1AX1A 2GNTA 2LTNA 1Q8VA 1C1LA 1R1ZA 2AYHA 1WLWA 2ERFA 2D7FA 3A0NA 4LBQD 1DQ2A 1QKQA 2R1DA 3AP7A 3OYWB 2WQZC 1GNHA 2PHRA 1IS5A 3RQ0A 2XB6C 3PJQA 3NV3A 4YM1A 5F9TA 2ENRA 4YW5A 4YFWA 1BXHA 3N3HA 4P9WA 3N7LA 1QMJA 1KQRA 1MZ6A 3WUCA 3WG1A 4JRAA 4FP2A 3JU9A 4GXLA 3B9CA 1URXA 1N1TA 2DU1A 2GALA 4XE9A 1IS3A 3ENRA 2V5YA 1ENSA 4PQ9A 1FYUA 4YW2A 4I30A 1S0CA 4XHXA 1LECA 4ATEA 2FHRA 2WSUA 1LOEA 1SBDA 1FX5A 5FREA 5HCFA 3N36A 4Z8BA 3FBYA 2CL2A 2UU8A 3HN1A 1W6OB 2DV9A 4FPLA 1Q8OA 1GZWA 1LENA 2A70A 4YFZA 1CVNA 3U4XA 5IK5A 4AVTA 3OY8B 1DYPA 5GLUA 1CJPA 2A6ZA 1MS4A 2GMEA 3IPVA 4RA0A 5E89A 2D6KA 1FAYA 3WLUA 4C1XA 3ATGA 3NWKA 2AR6A 2JD4A 1N1SA 3WDTA 1LCLA 2CWMA 2WLQA 4C1WA 5CAZA 4FP3A 1YI7A 4PBOA 1GZ9A 1CN1A 5DZGA 3B69A 2D6LX 3JUUA 1DBNA 2NZ9A 3SLIA 3M3EA 1LOFA 3ZXJA 1ULFA 1F9KA 1SLIA 3V65A 3MW3A 2EIGA 4LBLA 4DRVA 3VKNA 2ZACA 1DQ0A 3FLPA 1O4ZA 3IKWA 4UW4A 4Q1RA 3RS6A 1MS5A 4U36A 4WV8A 1V6JA 1OFSA 1UX6A 4FPFA 1ZM1A 1IS4A 1WD4A 1ZA4A 3AXDA 1LHVA 4UW3A 3SISA 5BYNA 1LHOA 2EXKA 4WZFA 2JKBA 2SLIA 1HDKA 3NV2A 3I4IA 3UJQA 2GDFA 4FOYA 1G8WA 3R4UA 2TEPA 1LHUA 3WG3A 4Q1PA 2ZMLA 4BLJA 1A8DA 1WW4A 1UMZA 1NLSA 2ZGTA 1MS0A 1LJ7A 4GKYA 2AGSA 1DHKB 4W65A 3ZVXA 2EXHA 4Y20B 3TB0A 4DFSA 5T54A 3ZSJA 1LGCA 4Y1VA 4P9YA 3AZVA 3ZXKA 1UZZA 2AENA 2CTVA 1AVBA 4XJUA 1MS9A 2A3WA 2CYFA 5T52A 3AYCA 3PVNA 1DQ5A 3N7MA 2DUQA 4ZXKA 2VY0A 4FPHA 1S0JA 1LULA 1YRZA 1H30A 2DUOA 2FMDA 4ASMB 1G9AA 1S0GA 2W52A 4XBLA 1LOAA 4XMAA 2D3SA 2AREA 1S0DA 3R4SA 4GALA 4ISRA 3WCRA 2D6NA 5GLTA 3M3QA 4BOWA 2ZGOA 2JECA 4FVVA 1AZDA 1W6PB 1LEDA 1SLLA 2V73A 3MPPG 3AP6A 2DWRA 2R1BA 1V6NA 1D2SA 4R9CA 1CESA 2A75A 4ZKTB 4UW6A 4FOWA 1QNWA 4ATFA 1LHNA 2ZMNA 4LBQB 5GZGA 4M3CE 4YGCA 3AZWA 1W6MB 4GWNA 4K1ZA 3KQRA 3RSJA 3D6EA 1G9FA 1ULCA 2AH2A 4TYSA 1A78A 1LEMA 3Q9OA 3ILRA 1IS6A 1C57A 2E7TA 3DUIA 3RRDA 3OYWA 5EWSA 1OKQA 1G7YA 2D3RA 2YY1A 3ZYRA 3B3QE 3M2MA 2NN8A 1Q8SA 1QF3A 2YV8A 2YXSA 2ZGQA 2WKKA 1UL9A 1ONAA 2GMMA 5HCAA 1AX0A 2WT0A 3KM5A 1JXNA 5H9PA 1DQ1A 3POWA 1SLBA 5EYXA 1MZ5A 5CNAA 4Q8LA 1A3KA 1KDKA 3WNXA 2CY6A 1D0HA 1UKGA 5H9QA 3LSEA 4AGRA 4FOVA 4XTPA 3WZ1A 1H9WA 1CR7A 2P2KA 4Y1XA 1JHNA 1IKPA 3RMYA 1SBEA 1FV3A 4YW3A 3ZPYA 5KXBA 3QLQA 4BLIA 1CIWA 2E53A 5DUVA 1BYHA 1KDMA 1LU2A 1SLTA 3B01A 1W6OA 5DUXA 5GZCA 4LBOA 1CQ9A 2DU0A 1VAVA 2R0HA 3VKFC 3WDUA 1Z0HA 3T2TA 3VKMA 3OY8A 2WNEA 3AZXA 3SH3A 2D6OX 4BMEA 1G9CA 1ULEA 1WW6A 1JOJA 5LK5A 5GLVA 1KITA 1V6IA 3UJOA 4Q26A 3ZXEA 3PVOA 3W58A 1KJLA 1FV2A 2D3PA 2ZHLA 1LGBA 2YMZA 4LBJA 4XJ9A 4YLZA 5DUUA 2UURA 1FNZA 2DVAA 3AYAA 3M3CA 4GWMA 4HL0A 3HMYA 2JJ6A 3M1HA 2D43A 3OGGA 4Y24A 5GALA 3AX4A 5E88A 3WDVA 3WHUA 1WW7A 4DQAA 3FUOA 1SBFA 3WCSA 3A0KA 4SLIA 1S1AA 1V6LA 4LBNA 2UWAA 4M01A 2ZBJA 2ZZJA 3IM0A 2A3YA 2ZHKA 3V0AA 3AFKA 3N7JA 3AZYA 2H0BA 2D44A 1N3OA 3HR9A 2ARBA 1YO8A 1Q8QA 4CTEA 1HQLA 2LALA 5T5PA 1UN1A 3UK9A 1UAIA 4FPCA 3O0VA 4Y20A 4Y22A 4NO4A 2E7QA 5GZEA 5T50A 2OUHA 1W6QB 1QGLA 2ZKNA 1JUIA 1N47A 1W0OA 1WD3A 3BODA 4XZPA 5AVAA 1GKBA 5EXOA 2NMNA 2C5DA 1HKDA 5DZEA 4FOQA 5HCBA 4YG0A 1NXD1 4TZDA 5E8AA 3V0BB 3BOPA 3VKOA 1GZWB 1H9PA 3LSDA 5F5QA 3AP4A 4M3CB 2DVBA 2ZGKA 4YZ3A 5KXDA 1JYCA 1W6NB 3M3OA 4YGEA 3OPZA 2DVGA 1DLLA 1FATA 1AF9A 2SBAA 3MW4A 1YIFA 4M00A 4XBQA 3ASIA 1S0IA 3VV1A 1G9DA 1SCRA 3ZYPA 1F31A 3L2YA 2D6MA 3OBRA 2EF6A 4Y1UA 1W6PA 4XJWA 2W68A 4R9DA 2JE7A 5IK8A 3VKLA 3AP9A 3B00A 2R16A 1WLCA 5JVVA 5DG1A 3WDYA 4Q27A 4LBQA 3H0OA 2ZA9A 1SLAA 2ARXA 5GJ6A 3WG4A 3CNAA 4F83A 1W6MA 3T1LA 4YZ5A 1I1EA 2NMOA 1N1YA 3SITA 3I8TA 4XHBA 1U0AA 3BTAA 2PHWA 1VALA 5KXEA 2EXIA 5DXDA 5T5OA 2Q5TA 3LCPA 1VAMA 2E6VA 5KXCA 1DGLA 1UPSA 3T1MA 3V64A 3MEPA 1MS8A 2I2SA 2JDZA 4XYXA 5JLVA 2ZGPA 4FPGA 3OBTA 2GNDA 3PMEA 5IK7A 2A6VA 2CWSA 5GLWA 3SNMA 4BMBA 2ZGSA 1YYNA 3OJBA 5JOZA 4WVVA 2ZHMA 3BIWE 4Y1ZA 2UWBA 4PCRA 1Y7BA 2UWCA 4FQ4A 3AYEA 3USUB 4AVSA 1GSLA 2DUPA 1VIWB 3PVEA 2A3XA 1XQNA 4LBMA 4YZ4A 2KM2A 2WJSA 2Z42A 3ZXFA 2GN3A 2OUJA 4XJ8A 1TEIA 1UZYA 2VH9A 1JW6A 1RINA 1LOCA 3WV6A 3FLRA 4XJAA 1MR5A 2G4IA 5H9RA 2P3KA 3O0XA 4FPJA 1IOAA 1WCSA 4R9AA 1BZWA 1ULDA 3ILNA 4YG3A 2PHXA 1GANA 2VUAA 3WHTA 5CA6A 3FUQA 4K20A 1QDCA 1RIRA 2ZABA 3APBA 1WW5A 3D5OA 3RG0A 3WDXA 4U2AA 1WUVA 2DTYA 3NV4A 2W39A 1V6OA 4JC1A 2BQPA 3N7KA 3WVJA
chains in the Genus database with same CATH superfamily
2VPVA 2PA7A 5FXZA 1G86A 3LDBA 3ZSLA 3FWEA 1COV1 2WZR3 4E27A 2IC1A 1JYTA 3WXPA 2WAOA 4CP2A 3UKVA 1W04A 2BUKA 3AM2A 3CJXA 3MF9A 1AXKA 3IMNA 3O0WA 4HK9A 1CAUB 4HPKB 4KGQA 3ROUA 3GM8A 1I3HA 1SACA 2DVDA 1JZ3A 4QB1A 2P17A 2JDHA 2Y6GA 5FZ8A 1Q8PA 3FFZA 4YPJA 4MGTA 3KWVA 5BUVA 4CEYB 3TEWA 1ULOA 1ZBE1 3V56A 1DYKA 5DABA 3K2OA 2XJUA 5IK4A 2VUCA 5JUVA 4NPLA 2R30A 3TNPB 1DFQA 2VU9A 2FDKA 1S2KA 2NM1A 5JIUA 2MEV2 2XG3A 3OUHA 3RZHA 1EV12 1UZWA 1F5FA 1RUI3 1Q56A 1V6KA 2VULA 2VXRA 2ZGRA 4M3CA 4LNVA 5LZ6A 1QNYA 1MEC2 1DQ6A 2Y8KA 3MIBA 4URTA 4XXAA 5CFCA 2Q1FA 3SXWA 3VD4A 1MQTA 1OI6A 4A2UA 4LO7A 3UT0A 1CPMA 1GZCA 4AWDA 4H55A 5T5JA 2DVFA 4CEWC 3IN9A 4BU2A 2PHDA 4EWDA 2VGDA 3ZYGA 4X8PA 5DAWA 4QB2A 2E33A 2PHFA 1OT5A 5FMOS 3E5UA 4JGZC 1LHWA 4DXTA 2ZGNA 3RMXA 1DP0A 1UY1A 4XILA 2Q8OA 5IJRA 3I3BA 4Y1YA 2XONA 4Q8KA 1CAXA 3TN93 3OD4A 2C9AA 3O7OA 2ZGUA 3WINE 2AUYA 1C3HA 1POV0 4N53C 2JWPA 4BE3A 1XNAA 1C4RA 1YJKA 4NIDA 1N3QA 2ZGMA 4XTMA 5IATA 3E1F1 4FBFA 1MS1A 3HIFA 1QOOA 1EPZA 4H3WA 3KF5A 4XDQA 1GICA 4WVWA 1BKZA 2VC9A 5A33B 5CBLA 4BQ2A 1CJDA 3I3MA 2QJVA 5ANQA 1VR3A 4XF0A 1C5HA 1TMF2 4NR1A 5LBFA 3U75A 1GBGA 4DXZA 3USUA 5JAXA 1UY0A 3C2UA 4KH9A 1VB4A 3POYA 5JXHA 3POIA 1SQ4A 3THDA 4LUMA 5ISLA 5JWPA 2MEV1 2JDAA 2QQWA 3E6DA 1PHMA 4Z92B 1LU1A 1W8TA 2WT2A 4I0AA 3DGTA 1MEC1 4A6SA 5DZFA 1PNFA 1UYYA 4B7KA 1ZZ7A 1SCSA 2WC2A 2HWD2 3CKHA 4LMFA 5FLJA 3FHAA 4AI2A 3AJZA 1IHMA 1SFYA 2GN7A 4R9BA 1X82A 5IVCA 2ES3A 3WOGA 1EPWA 4I0WB 4XJZA 2BVBA 1XU2A 2A5ZA 2QQOA 4ZPIA 4ET7A 1D2QA 1UYXA 1ENXA 1WA4A 1PGW2 1J3PA 2A7AA 4HT1T 4D69A 4P9XA 2HWC1 1PGSA 3DYOA 1DQ4A 3EBRA 3K75B 2JG9B 4IEZA 2P3JA 4IV1A 4AEKA 4HETA 4AE2A 4WM7B 4QX3A 3BKZA 2YFZA 4FAHA 1WLDA 2CAVA 3J7NA 3HT1A 1N1VA 1ND2C 2NPIA 1B35C 1LOBA 2ILMA 2X5IB 5FBZA 5FMOL 5A3TA 4G4FA 3BVCA 1PZ7A 3ALQA 4ITCA 4EZHA 3NKTA 5KR7A 3E6CC 4I2OA 3NSTA 3TYJA 5L7OA 3PL0A 2Y64A 1WLWA 5A7PA 3NNMA 3A0NA 1NY71 2UY9A 4KMQA 3AP7A 1FPN1 1GQPA 2XJVA 4PF1A 2PHRA 2WNUA 5KWRA 5IVEA 5EFUA 5A70A 3IDCB 3N9QA 3AVSA 1Y4WA 4TTGA 1REEA 1RJ8A 2JDKA 4YFWA 5FMBA 4BHPA 5BPXA 3ZKYA 3DXTA 1QMJA 2D98A 4NVPA 5C3PA 2Y6JA 4L97A 1RUC2 3WUCA 2CGNA 1AL21 4O65A 3JU9A 3OEBA 4XQDA 5I8SA 4GH4B 5A7OA 4QU2A 1NZCA 4XE9A 1SEFA 2BGPA 4B4PA 1QJEA 4YW2A 5B2GB 5L9VA 2DCJA 3PIGA 3HQXA 4AEDA 1AR92 5C3SA 5J48A 4Q4V2 2J1TA 2VVEA 2WFF3 3WW4A 2VCAA 3AMPA 4J6GA 2JDPA 4A3ZA 4P9JA 3GJBA 1DU3D 4CDUC 1FX5A 4UBGA 3ZYHA 3I2OA 3N36A 5LY1A 2CL2A 3AMQA 1Q8OA 1GZWA 4Q0PA 4YFZA 5BNOC 2R32A 4QX0A 3O1VA 4G9SB 4AVTA 4S2HA 4RA0A 2FQPA 4BDVB 3WLUA 1RUJ2 2FZ2A 4BWOA 5I93A 1IG3A 1RB8G 3VDBA 1VB2A 2VMFA 4Q0VA 2GH8A 4XURA 1CN1A 1EAH1 4DNYA 3JUUA 5ABJB 5D8AC 3VD3A 1PK6C 3ZXJA 1K12A 2JKXA 3MW3A 2EIGA 2VR4A 4Q29A 1W9WA 4XUQA 2FDFA 3RNSA 1CZSA 2VG9A 1FMD1 1OA2A 3T08A 2MEV3 2QQIA 4RFRB 3Q8AA 1EV13 2BFUS 4P9LA 2VMDA 1MEC3 3RYKA 1ZRDA 1W3VA 2YC0A 1ZA4A 1WD4A 5A1LA 1SHWB 5EJ3A 2YU2A 5FP8A 1LHOA 3SISA 4CDQC 3PTRB 1W2UA 4RQPC 1ACCA 1JZ6A 1GU3A 2JKBA 2WN3A 1PM7A 4B29A 3UGFA 3NV2A 2OZJA 3I4IA 4BQ4A 4FOYA 3P1IA 1LHUA 3HAGA 1W2NA 3FHQA 4RFT0 3PIJA 2J1AA 5CFDB 2ZEZA 1DHKB 2PTMA 2EXHA 4CCNA 2JB8A 4MXWA 4QXCA 5T54A 2JB4A 1W8ZA 4P9YA 1RUC1 5CG9A 4IW3A 4QHZA 1VRH2 1UZZA 1QH7A 2AENA 2CTVA 2WAAA 2A3WA 4XJUA 2EIEA 4FFFA 1HV1A 3ZSEA 4OI1A 4LHKA 4ZZ5A 2BERA 3U11A 4BQ3A 2G9ZA 3POGA 2MPFA 1X9TA 3Q8FA 1UXXX 4YSFA 4Y4YA 3VBUA 4FPHA 1YRZA 2DUOA 2FMDA 1UWWA 4N43C 4RSUA 1S0GA 3UYJA 4XBLA 5FZOB 4QPIB 4QHBA 1F8VA 2KR2A 1HB2A 4I0BA 3CL1A 2ET7A 2I45A 2JECA 4FVVA 2RS52 1QJY2 1W6PB 2VOVA 5ACA2 1I9RA 1RMU2 3MLJA 4R9CA 1TMF3 2QDRA 1AL23 1QJX2 2CHHA 2R041 4IERA 2ZZQA 3HOBA 3MUY1 2QE3A 2TBVA 4UFLA 2RM21 3UKTA 3LPFA 5FY5A 1US3A 4XUTA 5FXXA 4YVWA 4HN1A 3Q9OA 3J4UH 1F2NA 4K40A 4JTOA 1C57A 3H8OA 3BOWA 2E7TA 2E9QA 5FO7B 3I54A 1W2TA 1EYBA 5EWSA 1RUNA 2YY1A 1OURA 2Y6KA 2NN8A 2HWD3 2YV8A 2WWSA 1NLQA 3WF4A 3VB9A 4DIQA 5A3PA 3K4DA 2C6SA 2GC1A 1W05A 4AF9A 1W8NA 1NQDA 2RS12 2RS31 2WT0A 3ZIWA 3RI9A 1X33A 5EP9A 3ZOIA 3ORJA 4ARXA 3CLPA 5CNAA 1D0HA 3O1RA 5H9QA 5EHDA 3W5MA 2PAEA 1NUKA 3JBG2 4KL1A 5FK8A 3WZ1A 2WN2A 1F35A 4BXFA 1VRH1 4CU9A 3RMYA 1UZVA 2BEOA 5KXBA 1CGPA 3QLQA 1PIV2 4XFIA 4RS5B 5JR7B 5SV5A 4CUGA 4HVRA 4PIZA 2ZCWA 4ARYA 1GP4A 1LU2A 4CU8A 5C9AB 3B01A 3M8LA 4LBOA 1CQ9A 2QQNA 5FZCA 1VAVA 2R0HA 4XFGA 4YVSB 3RI8A 3VKMA 1UKRA 3F95A 3NRUA 1VBC1 3GYDA 5GLVA 5LK5A 3S7EA 4K3UA 1AYM1 2VVFA 2ZHLA 2ZX3A 1LGBA 5A6XA 4LBJA 1W8OA 3M7AA 1JZ5A 4LKDA 1FNZA 1PO11 2R6QA 3LFIA 4XUNA 1RUC3 1YQ2A 3EHKA 2PFWA 5AC92 1J1LA 3M1HA 4N90A 2WL1A 3ZYFA 3OGGA 3LIHA 4E4SA 5AFBA 1ND3B 3WHUA 1WW7A 1CZTA 1QQP1 4Q4V3 1V6LA 2D40A 1NQJA 3HQRA 2VMIA 4Y4RA 2ZBJA 1TQ5A 3ES4A 3IM0A 2A3YA 2ZHKA 5LBBA 3EXUA 2VZTA 1O3RA 3LE0A 1XNCA 3VBRC 4DUXA 2R7EB 5CIRA 3ZYIB 4BZ4A 1BK0A 4CTEA 3U10A 4FPCA 2YHJA 3O0VA 4FFHA 1RUJ3 2RDSA 2E7QA 4QPGA 2ZKNA 2VUJA 4L0PA 1JUIA 1WD3A 3MV11 3ETPA 2BW8A 2PMWB 5EXOA 1JZ8A 4H14A 3ZMNA 1T6GC 2R043 4N7IA 5HCBA 3VD7A 4TZDA 3U4SA 4AAPA 4NWWA 5G04L 3U78A 4M3CB 3PDQA 4YZ3A 4OI2A 4GMP3 3M3OA 2VQTA 1R082 1FATA 5CFCB 1UCXA 2C1FA 3PUQA 3H8RA 3T0DA 2IVJA 1MQTB 5GKAC 2SBAA 1PX4A 1U5ZA 4XBQA 5FUPA 3ASIA 1S0IA 2X09A 4NRQA 3VV1A 2BVVA 1ZRFA 4AEJA 5I0TA 1G9DA 1XJAA 3L2YA 3J7MA 5CU1A 2WIIB 2JE7A 3HT2A 1W39A 5C4WC 3AP9A 5JXIA 3I2KA 3I97A 2OPKA 3IMMA 5LWBA 5JVVA 1SG3A 1BBT2 4LBQA 5C70A 1XBFA 1WCKA 5GJ6A 1I1EA 1W6MA 3BN6A 2VM9A 5CKNA 3VBHA 1CAXB 2IFRA 2XDVA 4LE3A 4CP1A 2AC1A 1VRH3 5FZIA 1TNRA 1RUOA 2J1UA 3KCXA 5FZ4A 3EJKA 4QDRA 4CCLA 4AI3A 2EXIA 1REDA 1QXPA 5LK7B 2FD8A 4QKDA 4P5YA 3LCPA 1NXMA 3SHRA 3LDRA 2B39A 1DGLA 2HWF1 4XC9A 4MG2A 3MEPA 5F5IA 4K8FA 4S2DA 2ZGPA 4CDXA 4CXWA 3G6JB 5A6ZA 4PJYA 5D1IA 3RPQA 3SNMA 1DG6A 2DCTA 2ZHMA 4MUVA 2UWBA 4LTAA 2RS53 1QJY3 2PAMA 5FZ3A 2UWCA 3E5XA 5ACA3 4AQ2A 4MH0E 4E4DX 1RMU3 4FQ4A 4YW6A 3USUB 2WQ4A 3VBFC 2RMU1 4GWIA 4AVSA 2BGCA 3K3OA 4NUBA 3ZO0B 4CCJA 1QJX3 1OLME 4UF0A 5A1AA 4HVOA 2YPDA 4LBMA 4QQPA 4GJYA 4Q4W2 1NA1A 4RR3A 3ST7A 5FZMA 4IETA 2OUJA 1ZZ8A 1XNTA 3Q8CA 1QQP3 1GQGA 2QFEA 4UXAA 4L11A 1JW6A 2VMCA 3O14A 3FLRA 2I07B 2G4IA 1O8SA 2P3KA 5JSPA 4EE2A 2E32A 3O0XA 3TBDA 4XFHA 1BZWA 5A7WA 2VBDA 1DZRA 1UXZA 4NPRA 4YG3A 3WHTA 5CA6A 4K20A 1QDCA 3RG0A 3WDXA 5FO8B 2RS13 4U2AA 4A7ZA 1POV1 2J1RA 4IV1B 1WLTA 3FC0A 4CDWB 1BBT1 3H7YA 3VDAA 4JC1A 2VAUA 4RHV1 2BQPA 3ACIA 3VBSA 1VBD1 1Z7S1 1RTVA 2DTWA 1F15A 2JDYA 1HLCA 2YPJA 4AFBA 5FYMA 1JYXA 1V6MA 1RUE2 2N7GA 2XBO2 4PHZA 5I0RA 2QBXA 2R49A 4EN6B 5L7OB 1UYZA 3ELNA 3C7HA 1JZ4A 1QJU2 2HYKA 3AXEA 2W1QA 3PUSA 1ENQA 4XETA 5K4LA 4AHWA 1OUXA 3I49A 4FFIA 1AX2A 1IZ3A 3CHXA 4YGBA 4AVCA 1YQ5A 4AR2A 2NP0A 2XH6A 3DPRA 3WY6A 1DIWA 1XYNA 1V9U2 2WNUB 4K21A 4XFBA 4XAAA 5FWEA 3T09A 2A6XA 2VZQA 4LORA 5AVPA 4RL7A 1LOFC 4LQRA 3SKJE 5KC5A 4I3PA 3DXUA 2RJKA 3KZ4C 4O61A 3O5SA 4B4QA 4ZXEA 1WZXA 5KHGA 1FOD2 1QJZA 2GZWA 3LEMA 4LO4B 3R6SA 3KLSA 3MIFA 4IEVA 2CAUA 1LGNA 2RDNA 4BISA 3BUCA 1W06A 1V00A 4MADA 5FZ1A 3JB4C 5A3UA 3WDWA 1PZ9A 5AC93 1MVQA 4HK8A 1J1TA 3H1WA 4AEDB 5FR3A 4AYUA 1JN2P 1CONA 4JCKA 2ZEYA 1QY4A 3A7QA 2B7YA 3HVDA 3TN92 4Z1VA 4FT8A 5F37A 2HKXA 4OUMA 2VQAA 4NRPA 1PZ8A 2HJIA 2FCUA 4JQRA 3D4KA 2O14A 2VW0A 3CZJA 4TLFA 4XUOA 1W90A 5HI0A 2C9KA 4ZZ8A 3I2GA 1R091 5LASA 2VMHA 1GLHA 2GAUA 4CVUA 4TLGA 4XIKA 1GYKA 5FYIA 4YZ1A 5JOWA 3O12A 1VBB2 1YQCA 4IGOA 3PJYA 1HRV2 1TG7A 3GNEA 4YW4A 3ZFGA 5FKCA 1AXZA 1NZIA 1OF3A 3GXUA 4Q4X2 4AI1A 4FPKA 3T0BA 2WDBA 4W6WA 3V0AB 3JQXA 3GZTB 4CE8A 1X8MA 5FMDA 4AG4A 1BHGA 3OBAA 3UESA 4YW1A 2FDHA 1NT0A 4DPNA 2XBO1 3OUJA 1OD3A 4COYA 5LA1A 4Y22B 4WBBA 1QJU1 3BU0A 1R083 1XNKA 2P37A 2WSVA 2JG9C 3AMNA 1OLQA 1ZYBA 2QVSB 2RJ2A 4YGDA 5J98B 1COV2 3QH7A 4LJHA 5FRAA 5DUWA 5FY7A 5FUIA 5F6LB 3LOBA 2X5IC 3NJZA 4FQZA 2B8MA 4E9KA 3I2IA 3DF0A 1IPSA 3L2HA 4TWTA 3WQ7A 3H1MA 1H2KA 4MXWB 4CCKA 5F6KA 1OH3A 3CIHA 1OQ1A 1TME1 3HJRA 4N53A 4FPYA 1BBT3 1GNYA 1ZZ6A 4XPVA 4CSWA 1ZBE2 2QUOA 5JMOA 3AL6A 3KVAA 4Q4Y1 1UU4A 4GKXA 3HWJA 4Z82A 2AACA 4V1PA 2D5FA 2B9VA 5CYYA 2PHUA 4CRQA 3THCA 3ZXLA 4LA2A 3VBOB 4LO8A 4NOTA 3VBUB 3N9NA 5JCTA 1CPNA 2JDUA 3MW2A 1NE6A 1UOJA 5FCCA 3D82A 5GZFA 3I59A 5CZKA 2EAKA 4GH4C 5GZDA 1JYIA 1H0BA 1X9PA 4LPLA 2W46A 2BTVC 4B3NA 5TSWA 1O3SA 3B93A 2CDPA 5IWFA 1MACA 3AKTA 4IQPA 4Y26A 4H7LA 1S4CA 3W5NA 3KHBA 2Z79A 3ZSKA 2Q0AA 2XJQA 5T3NA 3BB6A 4CPBA 5K0UC 2VUDA 4GJZA 1J84A 2GC2A 4IE0A 2V72A 3I2HA 2XJPA 4TN7A 4YM3A 4XCBA 1WCQA 2GNTA 2IFWA 3UKNA 3J26N 2RDQA 4YVWB 2ERFA 2D7FA 4QKFA 1IQAA 2XHKA 3NW4A 4Q4W3 2RJLA 2R1DA 4W6XA 4TSVA 2P6HA 5FUNA 4Q0UA 1GNHA 2VZOA 1ND3A 1W2OA 2I74A 4HLTA 4C90A 1P8JA 5FYBA 4B1LA 2P4EA 3LZZA 3PJQA 2EA7A 4QWNA 5ABJC 2ENRA 3LEIA 3LWCA 2YYOA 3J7HA 5A3OA 3WP6A 5M0TA 1JZ7A 1BXHA 3CJIC 2IXHA 4WM8A 1R093 3P3PA 3PVBB 4B1MA 1YEWA 3PLQA 3N7LA 1O3QA 1MZ6A 2VTFA 1ND2A 4FP2A 3IAPA 4GXLA 5BNPA 5HCHA 1ZA7A 2GALA 5FY8A 4QHOA 1IS3A 4OLLA 4MGSA 4PQ9A 1RUF1 1Y43B 3H8UA 1U12A 4EWAA 2AEZA 2RDRA 4XHXA 5FLIA 1IG0A 4COWA 3FZ3A 2VTXA 1E57A 1LOEA 1W8UA 1OBNA 1UMIA 5JXGA 4KG0A 4Z8BA 3FBYA 3K77A 1RUE3 2FCVA 1GOGA 2XBO3 3SEEA 1DGRN 1NLRA 4JDMA 1GWLA 1CVNA 1QJU3 1Y3TA 2LM3A 2VTXJ 2W1UA 1MZEA 1DYPA 1H2MA 2A6ZA 5GLUA 3DEMA 3U14A 4C1XA 2D6KA 1FAYA 3MIHA 3NWKA 3WQ0A 1V9U3 2WLQA 5CAZA 3KF3A 5ANNA 3WNPA 5DZGA 1X36A 2NZ9A 5FK7A 4BK4A 1I5ZA 1FOD3 1ULFA 1SLIA 4IEOA 5BNNC 3DV8A 1KFUL 3M4FA 5L19A 1RC6A 1PX3A 1XE0A 2HWC2 2XXZA 5LEJA 4QXKA 1OLMA 2Y60A 5FV3A 4QPIC 3TEYA 2QTWB 1V0AA 3RS6A 1NOVA 4AHYA 3ZR5A 4KWLA 3JXSA 4ES8A 4ORFA 5BNOA 1ZM1A 3OGSA 1LHVA 4KI5M 2EXKA 3SEPA 4NN0A 1U5XA 4WZFA 5FTTC 4PDWA 2BBVA 2K9ZA 2GDFA 1G8WA 2TEPA 1KS4A 3WG3A 5K9YA 4IGQA 4Q1PA 4D94A 2FCTA 1NY72 3VHRA 3ZN4A 1A8DA 1NLSA 4LO5B 5D8AA 1TNFA 1MS0A 5C5TA 2AGSA 1FPN2 1LNSA 3TB0A 4PI0A 1LGCA 4QPGB 4Y1VA 1H1MA 5IVYA 1YFUA 1VBB3 1HRV3 3NO8A 3VZMA 1UOGA 3PVNA 2PYTA 4Q4X3 3KCCA 3WF0A 4BK5A 3J8F2 3ZM8A 1DQ5A 1K5MA 2PN5A 1AL22 1HW5A 4AOCA 4QGNA 4NHMA 4EQVA 2HWE1 3MF6A 4HMZA 1STMA 1S0JA 1LULA 1W2AX 2YC4A 3OD0A 1G9AA 1Y9MA 1LOAA 3DKWA 1NAEA 2AREA 4GALA 4P9IA 5FZFA 2HBTA 1SZBA 2YFUA 2Y38A 2H6BA 4NRMA 3NAPA 4XFCA 4BOWA 3L9JT 3ACHA 1H2LA 4AI8A 1AZDA 5FPAA 1SLLA 4BXSV 1COV3 3S6PA 3N9OA 4OVEA 4RS5C 2R1BA 4DINB 1GP5A 2VBPA 1W8HA 2HBUA 3QACA 4I09A 1RL3A 2Q30A 4LBQB 5FP4A 3ZDVA 4YGCA 1Y9GA 1W6MB 2ET1A 3AMMA 3AZWA 4G3YC 4JGYA 4K1ZA 3VBHB 4YVSC 4BIFA 1ULCA 3GF6A 4ZU4A 3R4DB 1LEMA 4N43A 1EAH2 2JIJA 4UI9L 1ZBE3 4W8JA 4I3GA 4HFSA 5J09A 3HBKA 3DUIA 4CDWA 3FBMA 1ZZCA 3OYWA 3R0RA 1W8WA 3B7MA 1G7YA 1FMD2 2W9XA 4YYOA 5FP9A 5FYUA 2WKKA 2P3YA 4CDXB 1ONAA 2BWAA 1OPMA 5HCAA 1AX0A 3RJ2X 3MBWA 1JXNA 3P3NA 4PT6A 1DQ1A 3POWA 2VVDA 1MZ5A 1A3KA 3N9MA 4HN0A 1AR71 4XTPA 4QX7A 2X53S 5FZEA 5FPLA 1IKPA 1DCSA 2VL4A 1SBEA 3GBGA 1CIWA 4AFDA 4UF0B 1JMUB 1UQXA 3E6BA 5DUVA 5LY2A 4Y3OA 3J8F1 5CADA 2DDUA 1VPHA 1KDMA 1UW8A 1NA1B 4RR3B 5GZCA 5FLHA 1HXS1 4A44A 3MI8A 2VD7A 3IDAA 1OKOA 1W0NA 2DU0A 4D3WA 3ZYJB 1W8FA 1Z0HA 3T2TA 5IYYA 3KHCA 3LF7A 5A3LA 3SH3A 2OPWA 2D6OX 5HXVA 5JZGA 1WW6A 1VBA1 1JOJA 1V6IA 1AHSA 4FTSA 1OA3A 3ZXEA 1XE7A 1FV2A 2D3PA 3KB5A 5A7WB 4I02A 1CX4A 1GFF2 2XLFA 4XJ9A 1UYPA 5DUUA 2JIGA 2VOXA 4WVMB 5FIXA 3AYAA 4QKNA 1LB2A 4GWMA 3J7LA 4HL0A 5IFTA 2JJ6A 2F4PA 2W1WA 4S2FA 1RYYA 2D43A 5FY9A 2VCMA 4Y24A 1KD7A 4GB32 3VBSB 4QQ2A 2W47A 4DQAA 3BPSA 1L3JA 4FXGB 3A0KA 1OOPC 1S1AA 1VMJA 2GH2A 5EPAA 2R042 4LEJA 2UWAA 1W9YA 4J1WA 4Y33A 4ASLA 5FZ7A 4YW7A 2RM22 4EYUA 4R4ZA 5AFEA 4E2SA 2XUEA 1M06G 3V0AA 1WMEA 3AFKA 3AKSA 3FL7A 1KEXA 3N7JA 3H8XA 2Y26A 3H7JA 3LGRA 3DPRB 1YO8A 3OPWA 1Q8QA 3IDBB 4A4AA 1UN1A 1DZTA 2WBKA 1UAIA 5DAVA 4RGGA 3K4ZA 4Y20A 4Y22A 4AAXA 5LCWL 2OX0A 4E4HA 4DB5A 3ES1A 4CXXA 1W0OA 2BNNA 3BODA 1ST8A 1GKBA 1YQ8A 3PU3A 5IAXA 1GQHA 1TVGA 5DZEA 4FOQA 2FDIA 2RS32 1HV0A 1NXD1 1OH4A 2OA2A 3I2DA 4LOSA 3U0ZA 3CEWA 2D97A 1K45A 1R64A 2ZGKA 5KXDA 4Z07A 2EIDA 3IB3A 2HWC3 4ZHNA 3ACLA 1JU3A 3THTA 2DVGA 1DLLA 1OVPA 3VBRA 5J96B 3LA3A 3MW4A 3GBFA 4NMIA 4YARA 4IEPA 3SCFA 2D6MA 3BALA 2Z4FA 4Y1UA 2DBIA 1KFXL 2BZDA 3Q8BA 4FI9A 4R9DA 3VBOA 1D4M1 3B00A 5F7UA 2R16A 1JODA 5DG1A 4UT5A 1FPN3 4OUEA 2ARXA 2Q8EA 4YZ5A 1VBC2 3K48A 3WG4A 4F83A 3T1LA 3ZFGB 1AYM2 4K8RB 3I8TA 5F5CA 3PUHA 4HKLA 5HV4A 5I8TA 3C7FA 1W28A 2CDOA 3WNKA 3BTAA 1NCRA 4META 5CKMA 2JG8A 4GB31 5KXEA 1PO12 5DXDA 3H42B 3J8F3 1HB4A 1VJ2A 3GHNA 4IE7A 5T5OA 4CCDA 1VAMA 3AFGA 2E6VA 2ZTNA 3LEKA 2PLV1 4AQ6A 5JLVA 5L9RA 4F3JA 2GP3A 4CA9A 3OBTA 4IV1C 1QQP2 4BMBA 2CWSA 1JU4A 5FZBA 4JX0A 3GZEA 1IPJA 4Y1ZA 4PI2A 3MO4A 4PCRA 1UOBA 2LRPA 4QX1A 4EZ4A 1GSLA 3KV6A 2DUPA 4IESA 2XWBB 3PVEA 5E16A 4N53B 2PXJA 1SMVA 1H2NA 2Y34A 3SQOA 1XQNA 4YZ4A 4F8AA 4L9BA 3ZIXA 4IXLA 2YUEA 1ZRRA 4QB6A 3VDDC 2HH9A 3HBZA 2WNUC 1QWRA 2GN3A 3ZXFA 4XJ8A 5EIYB 4LUKA 1TEIA 1HN1A 1EAH3 5C71A 5A3NA 2WNVC 4AVAA 1CAVA 3TNQA 5KBFA 4Q0SA 4OQ9A 5H9RA 4R8HA 1H1IA 4XF3A 3T4HB 2EVXA 1FMD3 1RUD1 3I59B 1ULDA 3MFAA 5LATA 3MV01 3OSDA 4DXRA 2QQPA 1BMV1 4XVHA 3O1PA 4NHLA 3FUQA 5F9TA 1RIRA 2XJSA 3AVRA 2Y6FA 3CF6E 3WW2A 4Z2WA 4AEDC 4IE4A 4YWAA 3ZXAC 4AVBA 2DTYA 3MPBA 3NV4A 2W39A 2WS91 4LK7A 1OFNA 2VNGA 2B5HA 3ZFEA 1RHI1 5FZ0A 4D6SA 4ASKA 5FY0A 3N7KA 2WLPA 5EV7A 4N9HA 1RVF1 2HEYF 4GZ9A 3AC0A 4BPZA 3INAA 3WQ1A 5T5LA 1OQEA 4KBZA 5K7PA 1VMFA 1WMXA 2JE8A 5JPNB 3M70A 2YROA 3LPGA 3VHNA 4QX8A 2O1QA 1A8MA 2ZAAA 3FMGA 2A6YA 3O1UA 1XC6A 4P14A 2P34A 4OMDA 2K2SA 5A6YA 1AJKA 1BLZA 2PHLA 3ZFFA 1BK1A 1H8TC 2VW2A 3H3UA 4PBPA 3WW1A 4MLOA 1CWPA 4WM8B 2HWF2 2E31A 3W9AA 3WR0A 3D3AA 1J3RA 1D4M3 3SCGA 4NHKA 1PGL2 4A7KA 1ND2B 1WKYA 2JDNA 4KGGA 1NCQC 3AP5A 1SDDB 1YXWA 1IQDC 2TUNA 4PQQA 5BNPB 4I01A 3WF3A 4DS0A 3CDZB 4OI4A 3V0BA 1VE0A 3GALA 5FZKA 1AYN1 3G7DA 4JQTA 1JBCA 4MHUA 1W9FA 2VNRA 4YG6A 3BTZA 1QHDA 1BQPA 3N9PA 4GB33 2RMU2 3I3DA 1HRI1 1SFNA 1UF2C 3JD71 1SFPA 5FYZA 5T55A 5SV8A 5J1XA 3O1OA 5C8CA 4AGGA 5EYYA 4BYYA 1UX7A 2RM23 1YIPA 3AYDA 5DAPA 1VLNA 1UU5A 3T2PA 4UFIA 4YM2A 3IWZA 5F3GA 3SH5A 3LAGA 4ZU7A 1PMJX 4XXPA 5F1RA 2VMGA 1YNAA 3B9IA 3U07A 4UFMA 2JX9A 1E5IA 3WP3A 1Z78A 4A41A 2QCSB 4QPYA 4YZ2A 4OZXA 2WO2A 4Y5TA 2NYYA 3SH4A 3T4VA 3M3IA 2PHTA 1Y9QA 5FPVA 3ZPOA 3B02A 2RS33 1S2BA 4AI9A 5C7GA 3LB9A 1KJRA 1LOGA 4MGIE 4RHV2 2GMPA 2ZXQA 5BNOB 1S0BA 5FBJA 3FHIB 1KS5A 1VBD2 1Z7S2 4XFAA 4XMIA 1JOPA 3PURA 1SPPA 1WMDA 3LQCA 2GP5A 3NL1A 5JOXA 2VZ3A 2O8OA 4D6RA 3SKVA 1L7RA 3NMBA 4PDWB 5IT6A 1RUD3 2EICA 1E5HA 3POJA 4XIOA 5FO9B 2E7AA 1DZQA 2IXCA 4F7ZA 3TOJA 2LUWA 4JZRA 5D8AB 4E2QA 2DCYA 4LO6B 1HQWA 3FFQA 1O4YA 2RR11 4DMIA 4XDPA 4CZSA 1C1FA 1QU0A 4GD4A 1W3XA 1PGL1 4IEWA 3GGLA 3JCIA 3USSA 3UV9A 3U37A 4L92A 3W59A 2ZGLA 1EP0A 2WZ8A 5LA2A 1HB3A 1VBC3 1UU6A 1AYM3 4AW7A 4AVVA 4K6BA 4Q0QA 4YM0A 4HANA 1GV9A 4COVA 1LRHA 1K5MB 1LODA 3WNLA 3ILFA 1SLCA 4ONUA 5FZLA 3AL5A 1PO13 4UFHA 4DZGA 3VD9A 2G1MA 1APNA 2RHPA 2ZX4A 4YRDA 2V09A 3E97A 2BJSA 5E6HA 1O4TA 4XDOA 2VW1A 1YQ6A 3BU7A 5BNQA 4IEXA 5DDJ1 1XNBA 3H9AA 3NAPB 4KWJA 4CXYA 1CAWA 3GCWA 3HD8B 4IV3A 5FY4A 4XW3A 4CEYC 3UL2A 5C3OA 2R071 2Y6LA 3SMHA 3WG2A 2XLAA 2GSYA 2JE9A 2OVUA 4A42A 1R092 3QCWA 4EN8B 3AK0A 3EB7A 2GNBA 1XRUA 2BYVE 3I3QA 4JGYB 1ALYA 2BWCA 4K1YA 1AX1A 3BCWA 4LITA 4WVMA 1Q8VA 1YFYA 1R1ZA 4N43B 1PO21 2AYHA 5CVRA 4ZY9A 3KMHA 4DEQA 5IFPA 2XJTA 3OYWB 4AQTA 2WQZC 2ETEA 1IS5A 1QEXA 4K9SA 1OF4A 3RQ0A 2XB6C 2VJXA 5LA0A 4YW5A 3N3HA 4P9WA 1WA6X 1OHFA 4BA6A 3WG1A 2J1SA 5K0UA 2CV6A 1RJ7A 3B9CA 4JTNA 1URXA 1N1TA 2DU1A 4CUCA 2V5YA 3C8XA 3LDKA 4IDZA 4I30A 1OD5A 1S0CA 3ETQA 1LECA 3EMRA 3VD5A 3RVHA 4ATEA 3C7OA 3S5AA 1XSQA 3H3LA 4IE5A 5EQUA 2CGPA 2A73B 2ATFA 1TME2 1RUG1 4TXWA 2DV9A 4JDNA 5F5AA 1YLLA 2VO5A 2XJRA 3CJIA 4BQXA 4E8DA 4Q4Y2 5IK5A 4RN5A 5JMCA 3IPVA 2GMEA 5JZGB 3IIAA 1O5LA 3EO6A 3NJVA 2AR6A 1AR81 2JD4A 5KHHA 4C1WA 2CWMA 5IVJA 4X6QB 1PMIA 2VQ0A 4FP3A 3CQOA 1YI7A 4PBOA 3WT3A 1VMHA 1M4WA 2HWF3 1QXRA 3SLIA 3M3EA 3OGVA 5LBEA 4H7MA 4DUVA 1D0GA 3I2FA 3KV5A 4GQ7A 4LBLA 4DRVA 1MPXA 3MDPA 3VKNA 5DQ0A 3IDEA 1DQ0A 3BGAA 3D0SA 1GOFA 4IEYA 1K5JA 1O4ZA 4QQHA 1C8M1 3IKWA 4RGKA 4U36A 4EV0A 4WV8A 3H1YA 1V6JA 1OFSA 4FPFA 5FOJB 4V2WA 2WWJA 2WYFA 5BYNA 3LD8A 3PHMA 2RMU3 5I0DA 4AHZA 3S5QA 4XUPA 2SLIA 1HDKA 4XZUG 3RFRA 4CYDA 2VQUA 4NE9A 3UJQA 3OGRA 3R4UA 5JI7A 5FFOC 3ZXDA 2XHNA 3FX3A 3KQ4B 4AL9A 1UMZA 1WW4A 4GKYA 2W3JA 4Y5Z0 3DYMA 4W65A 5FPZA 3ZVXA 2WZR1 4DFSA 4CEWA 4Y20B 5BNNA 3WEZA 5E1RA 2VNOA 4LKFA 3KGLA 5LBCA 3ZSJA 3K51A 5FP7A 4FAGA 2R073 4FTBA 3VGIA 2BPA2 1WGPA 4WM7C 5T52A 4AFAA 1MS9A 4X6RB 2CYFA 1ASJ2 4JGZA 1VAKA 1FI2A 1KGYA 2W0XA 3AYCA 1JYVA 4A45A 2DFCA 5C3QA 3N7MA 3NNJA 2DUQA 4ZXKA 2VY0A 5EJ1B 3MUZ1 3AKQA 1RUF2 3OUIA 3RZKA 4ASMB 1POV3 3MLKA 5CKQA 1ZNPA 4XMAA 2D3SA 2J7MA 1S0DA 3R4SA 4HKWA 1Q5OA 3VBRB 3CMGA 4QXHA 4RHV3 4ISRA 3WCRA 3RZMA 1ZRCA 3T2QA 5GLTA 2YC2A 1RUI1 1VBD3 1GWKA 1Z7S3 2ZGOA 2W94A 3M3QA 3OF1A 4FO9A 4J1XA 1BVVA 2BOJA 5B4XA 2V73A 5I0SA 4P08A 3AP6A 1OXCA 1V6NA 4JVAA 2HEWF 2A75A 2QQVA 2XGXA 4FOWA 4ATFA 5GZGA 1NA1C 2Y6HA 4RR3C 5JXJA 2XWJB 1UY3A 3KQRA 5JIAA 4YNIA 3RSJA 1GR3A 5A1FA 3D6EA 1G9FA 2W2IA 1DYOA 2AH2A 1CZVA 1O91A 4TYSA 4COUA 5FYYA 4BQ5A 1T6BX 4LOTA 3ILRA 1NCRB 2RV9A 2P6CA 3DYPA 2JG8B 4HOOA 2YB7A 4QMAA 4CCCA 3RRDA 2RE9A 5FXVA 2VXJA 1OKQA 2O8QA 5FYHA 5JSRA 1RUG3 5A80A 3MHZA 2ZGQA 1QF3A 3KV9A 4DEVA 2YXSA 2XKPA 2Z5WA 4LHNA 2ADDA 1PVC2 1ULPA 4LULA 4XACA 1UL9A 1WWYA 3AMHA 3VN4A 2Q1MA 2GMMA 1QH6A 3S57A 3ECQA 5H9PA 5FYSA 3VBSC 3WNXA 5FZ6A 4LKSA 1UKGA 5FY1A 5LEKA 3A23A 1ODNA 4AGRA 2VOKA 2BGOA 2RVAA 2P2KA 4Y1XA 4D6QA 1FV3A 4W6YA 4YW3A 4BLIA 1ASJ1 2VNVA 4L2NA 4MHRA 1BYHA 2BOIA 2NQYA 1B35A 5FPUA 1H1AA 4LR4A 1SLTA 4MO3M 1W6OA 3VZNA 2XVKA 2ZAHA 3KT7A 1BVP1 3UGHA 1KXGA 3RGBA 3OY8A 2WNEA 1CAVB 3AZXA 3KCYA 4JKLA 4BMEA 4AFCA 5FYCA 2Q8CA 5B4NA 3UJOA 1KITA 2V4AA 1HB1A 2HWE2 4IE6A 1WCUA 2DCZA 3PVOA 1KJLA 4CUAA 4OHVA 5FYTA 3DECA 3ZN6A 3VBFB 3CO2A 5CFDC 2UURA 1YFXA 2DVAA 1H6XA 1CX1A 1J83A 3M3CA 4D7TA 4NHYA 2VZPA 3PNAA 1EUUA 4W50A 5FZ9A 3WW3A 3ZFEB 4JKMA 4HKOA 3WDVA 5F3EA 1PVXA 2VZSA 4D7YA 4UYBA 1AR61 4J25A 2B46X 3C7GA 3NQHA 4JDOA 4OHYA 3K4AA 2OT7A 3WNNA 4M01A 2ZKLA 4KG8A 5JI9A 1TME3 2XUMA 3SC7X 1BEV1 2ZX0A 2D44A 1N3OA 3WF2A 4CDUA 2C0ZA 2HEVF 2ORZA 1T2XA 2ARBA 3HR9A 4FSJA 1HQLA 1PVC1 1V70A 2HWB1 2LALA 4Q4Y3 4X8NA 5T5PA 3UK9A 1NKGA 3ZFFB 3ZFGC 3ITQA 2OZ6A 4NO4A 4AFMA 2O0OA 4UBHA 4OQ8A 1QGLA 4M0NA 4PIYA 5I8YA 4RYDA 5LRRA 4D0QA 2PAKA 5FDBA 2X10A 2XVLA 3GZUC 3NJYA 4YG0A 4DY3A 1OOPA 3J9SA 3V0BB 3BOPA 3VKOA 1UZ0A 3LSDA 2J42A 4NIGA 2DVBA 1PK6A 5IW0A 4B4RA 1JYCA 3VDCA 5KHJA 1AR72 2B4KA 5DAXA 5ERLA 2KXLA 1LR5A 1AF9A 1FT9A 1CIYA 3NNGA 1J59A 4M00A 4MOAA 5F32A 2PQQA 4NPMA 4DXSA 5C8CB 5FJKA 1SCRA 1F31A 1LAJA 3EQEA 2W68A 1SDWA 2VOWA 2VZVA 4CDQA 1HX6A 3C7EA 1HXS2 2WFF1 4JV4A 4RQPA 3VKLA 4BB3A 4HSLA 1TZOA 5D21A 2OQ7A 4QM8A 5APAA 4LHSA 3ZDSA 3WDYA 2J22A 4Q27A 2ZA9A 1VBA2 4OCTA 1AUYA 2Q1ZB 5LA9A 2V5DA 4BH9A 3TEZA 4FFGA 1QIQA 3RJRA 3SITA 1N1YA 3WQBA 4C91A 4NROA 4XHBA 1U0AA 2VBBA 1ASJ3 2WQ8A 3OEAA 5BXXA 1XSRA 2PHWA 1JI6A 2OKXA 3PUIA 4KWUA 4UFJA 3ZYBA 4N8MA 2QKDA 2WO3A 2MHFA 3OOXA 2XPJA 4CCMA 4EN0A 3S30A 5C9AC 1L7LA 3T1MA 1OPOA 1WMFA 1RUF3 5J7MA 1MS8A 2I2SA 2JDZA 2Y0OA 3MIGA 2WRAA 1SPPB 2WO1A 1YFWA 3MICA 5GLWA 2ZGSA 1YYNA 5JOZA 4WVVA 1EV11 3BIWE 3D0JA 1Y7BA 3VHOA 2LS6A 1REFA 4AEMA 4BQYA 5CEHA 1VIWB 1XNDA 1ZREA 3THPA 2A3XA 3UGGA 3DCQA 2ZOEB 3NNFA 1YJLA 3RZLA 1OVSA 2IXKA 1CD3G 2Z42A 5G05L 1ND3C 5HBAA 3O1MA 2WYSA 4HVQA 1AR63 4A3XA 4NAMA 1UZYA 5FQ0B 4K7JA 2VH9A 1RINA 4WM8C 1LOCA 1DF0A 3IBMA 2FZ1A 4MGQA 4DUWA 2XKOA 4RD7A 1BEV3 5LW9A 1GUIA 1OSGA 1IOAA 4ZONA 4HG6B 3U1XA 5D2AA 5BNPC 4MGYE 2HWB3 1PVC3 2F4LA 3ILNA 3HPNA 4V2VA 5A7QA 4IEUA 2GC0A 3D5OA 3APBA 3LEGA 1CAWB 4IV3B 1UY4A 1WUVA 3N4MA 4KNCA 3PMSA 3TRSB 2XOMA 2QZ2A 1V6OA 3I3EA 3VDDA 3KT1A 1A6CA 3WVJA 1D4M2 1RXFA 5FP3A 2JXAA 2YZ4A 3KGZA 4OZOA 5A3MA 4KQ7A 2EAAA 5J37A 2XQXA 2YU1A 4Q5OA 4BIOA 4L99A 4SBVA 2WR9A 2WNVA 4OFGA 1OMIA 5GLZA 2B42B 4ZU5A 3WX5A 2ZHNA 3LIGA 4PLOA 3K3NA 4PF5A 3PU8A 1L7QA 1TMF1 3N35A 4IUGA 3OGJA 5CFCC 5FAXA 1MQTC 2DYCA 5CISA 1MZFA 3A21A 3OPTA 1DDLA 2BDRA 3ME2A 5K8SA 3O1TA 1C28A 5KC6A 1VRBA 5FZGA 2P1BA 3OG2A 1W6QA 4MZUA 1XU1A 4XQWA 2HWE3 1W0PA 1IGOA 2CNAA 2EXJA 2PLV2 5FPBA 2ADEA 2C24A 4HXCA 2CGOA 5K0UB 4GAZA 1VBE2 1UO9A 3AJYA 3CBNA 3P6BA 1W03A 2DURA 2IUWA 3POSA 2HWD1 1DLCA 4O9GA 5IUQA 3IIIA 3CZUA 4QX2A 4A7YA 2JDMA 2JD9A 3MFCA 1W6NA 4JHTA 1E5RA 2KD7A 4LBKA 1XPWA 1X50A 1AJOA 2QQMA 3DN7A 3KS7A 4GULA 4AGVA 3R05A 4PDWC 4CU7A 1FNYA 4QQOA 1PGW1 1ULGA 4QDSA 3VL9A 1F4HA 1WCDJ 5L73A 1QJFA 1H8TA 4NAOA 1E5SA 1S55A 1XYOA 2ZPXA 4LLOA 4COZA 4LT5A 3CJIB 1IKQA 2A71A 4AXOA 5FWJA 3IPVB 1JHJA 2VZRA 3AZZA 1LTEA 2XL7A 2R0FA 1NCQA 4QD2A 4FPOB 3K46A 1YI9A 4E8CA 4EWEA 3BTYA 3A4UA 4GIQA 1K5MC 3HEIA 1RUD2 2QQKA 2D6PA 2WUHA 3GDBA 2G9GA 1HN0A 2OW4A 1WBLA 1BMV2 4UW5A 1O8PA 4MX3A 3WUDA 1O3TA 4HSJA 3VUOA 2EALA 2IVIB 3ZR6A 1KRIA 2A6WA 5FKBA 1C5IA 1AXYA 4ISQA 4CCOA 1ZZ9A 3RZGA 4KWKA 5L9BA 4UFKA 1AL0G 5A7NA 1MS3A 2WS92 2WT1A 2YBSA 3BIEA 3NAPC 1RHI2 5JDBA 1N3PA 2QQLA 1B09A 1AR73 1X7NA 1BJQA 2DCKA 4AK3A 1JYNA 4QPWA 2W95A 2E51A 1RVF2 2WZEA 4MGZE 3W21A 2OS2A 4CP0A 5CB7A 1QDOA 2BNMA 4QX5A 1S0FA 2Q8DA 4M3CF 2Z69A 1RITA 1AR91 1IPKA 2D93A 2GNMA 4Q4V1 1LESA 3ZSMA 3DL3A 1HXS3 4JGYC 5JOYA 2EIBA 4CEWB 1QOSA 1YCIA 4UWDA 4DRRA 4IEQA 5DG2A 3URFA 1U5IA 5BNNB 1HJGA 2P3IA 5C4WA 5FJHA 5A32B 1VBE1 3WP5A 1OC1A 1UY2A 4CDWC 2WFPA 1VBA3 4CP9A 3QBQA 4JGZB 4L8QA 2ZEWA 1GNZA 1S0EA 4NJ4A 2PELA 4XAEA 1RUJ1 5H9SA 1XXNA 1QOTA 4FTEA 1MVEA 4MYEA 4EJRA 1DGRA 3ZX7A 4Q2FA 5L7OC 1WBFA 2ZMKA 1AYN2 1ZRIA 4LLFA 4FCAA 2NLRA 1ENRA 3TAYA 5BY5A 1YUDA 5J36A 4XQ4A 2BRTA 1HRI2 4BM8A 3JD72 5HXMA 3GJAA 4FPEA 3FLTA 4GMP1 2Q4SA 4BQWA 3NKGA 3NV1A 4A6OA 4M4PA 1YHFA 4WVZA 3WD5A 3KT4A 3RZJA 4XOGA 4C0BA 4QDQA 3MGUA 2W5FA 4XBNA 1EY2A 3Q8EA 4KBBA 5GM0A 4BQ1A 1G9BA 4OHWA 1US2A 5FZHA 2W08A 4GA9A 3VBFA 2BFUL 2QDNA 2LTNA 4JHZA 4CCEA 3T3YA 1C1LA 3WF1A 2H6CA 1BCXA 5JZGC 2UYAA 4LBQD 3RZZA 3T30A 1DQ2A 1QKQA 4HPKA 1CAUA 3ZN5A 4NIIA 4ZS3A 3RDIA 4YM1A 3O1SA 3NV3A 4DOUA 4CEYA 1GOHA 1ZBA2 1I5PA 1PNGA 1R1A2 5I0UA 1KQRA 2L9LA 4JRAA 4C8DA 3EYPA 4GWJA 4XABA 4B7EA 5FMCA 3H3ZA 3ENRA 1ENSA 3H50A 3MLLA 1FYUA 2K46A 3E5QA 1UNBA 2VCCA 1UMHA 4ZS2A 2IXLA 1NX9A 2FHRA 4WZCA 2RR12 2WSUA 5HV0A 1SBDA 5JPMB 5FREA 2LW8A 5HCFA 2BNOA 2RS51 1QJY1 1B35B 2FMYA 5ACA1 4PLMA 2XLGA 2UU8A 1RMU1 1W6OB 3HN1A 4FPLA 1HJFA 2VZUA 1LENA 2Z2SB 2A70A 3QH6A 2ARCA 3U4XA 3OY8B 3W58A 1QJX1 1CJPA 2W1SA 1MS4A 5E89A 3S0MA 3ATGA 1JS9A 4MVTA 3GZAA 1N1SA 2FDGA 3MYXA 1LCLA 3WDTA 3POEA 1GMMA 1AR93 1H6YA 1GZ9A 1UPIA 3B69A 2D6LX 3ZN6B 1FXZA 1DBNA 1OUSA 4AZZA 3TWIA 1LOFA 2G19A 2PLV3 1F9KA 3V65A 5DDJ2 3LA7A 1H4HA 2RG4A 1DGWA 3B94A 3UETA 1VBE3 1XE8A 2ZACA 3FLPA 4MGKE 3T0AA 5F3CA 2R072 1Q43A 4UW4A 4Q1RA 1MS5A 1UX6A 2ZS6B 1IS4A 1D7PM 1RUH2 2RS11 3AXDA 4UW3A 4BJ0A 4D7SA 1K42A 5DAQA 4B8EA 2IXIA 3VBOC 4OHZA 5EZWA 3VBUC 4NIHA 2KA3A 1S2EA 4JAAA 5A33A 4PIXA 3HNMA 4OULA 2VOTA 1F4AA 2DF7A 3JBG1 4CDUB 1PO22 4LKEA 3IT8A 4JRLA 2ZMLA 2IXJA 3A22A 1ZBA1 2ZGTA 4BLJA 4Z2AA 3MIEA 1LJ7A 1PIV1 4LXLA 5KHIA 4O9EA 1G6NA 1R1A1 3WNMA 2W92A 3LOIA 4JKKA 3HNBM 3AZVA 1RXGA 4P02B 1NCRC 3ZXKA 2JG8C 1A34A 4EN9B 2UYBA 1AVBA 3RYRA 2QNKA 3NVCA 4AQSA 2WNOA 3C3VA 1OOPB 4AHXA 2A1XA 2VCBA 3HNYM 1PK6B 4MXVA 1VP6A 5F8PA 1H30A 4YVWC 4OI0A 2W52A 3VHPA 2WS93 3CU7A 4FXKB 1RHI3 2E26A 2DBNA 3AKRA 2D6NA 5A3WA 1JOBA 4BCUA 4QU1A 5AC91 5J3UA 1RVF3 1LEDA 1QXJA 1RUG2 2BU9A 4LIVA 4CDQB 1H8VA 2WABA 2JG9A 3MPPG 5FQ0A 2GC3A 2DWRA 4RQPB 3ZXGA 4WM7A 2WWUA 1I6XA 1D2SA 1F5JA 5A6QA 4DY5A 1CESA 5IVBA 4ZKTB 2ZEXA 4UW6A 4M0HA 1QNWA 2XVGA 3I7DA 1LHNA 2XQRA 2ZMNA 5C3RA 2X5IA 2R062 4M3CE 4N9IA 4EROA 3X29B 2FBEA 1DGWX 1AR82 4GWNA 3UNPA 2F6BA 1XB9A 2UY8A 1A78A 3KV4A 3F2ZA 1IS6A 3FJSA 1UOFA 2YGMA 3T2OA 3GBWA 1PMHX 2D5HA 2D3RA 3AKPA 2VZ1A 1RUH1 3WP4A 3B3QE 4OYUA 3ZYRA 3M2MA 1Q8SA 2ID4A 1JYWA 3ZKUA 2JENA 4MV2A 1O5UA 1AYN3 1C8M2 2XMLA 1PM4A 3KM5A 3TEXA 3HN3A 3ZFEC 1YC61 1HRI3 1SLBA 3JD73 5EYXA 5FOBB 4Q8LA 4GH4A 1KDKA 4UOJA 2CY6A 3BI3A 2JICA 3OB8A 3LA2A 3LSEA 3ON7A 4O7XA 3S7IA 4FOVA 1C8NA 1JH5A 1H9WA 1CR7A 1R081 4HZFA 2HLEA 1JHNA 1UIJA 3PUAA 4XFFA 1JTZX 3ZPYA 4XF9A 2BV4A 2E53A 2WZR2 4IL7A 4QKBA 4LHLA 5JSOA 1POQA 1JUHA 3NNLA 4NIAA 3LFMA 4C0HA 1O6UA 3OBZA 4NHXA 5DUXA 3ZFFC 3POFA 4N7UA 3VKFC 3WDUA 3AB0A 2CSGA 3IZOA 5JR2A 1G9CA 1ULEA 3MIDA 3JBG3 5F39A 4Q26A 4XEZA 2J1VA 4OMCA 3VLBB 1J58A 2YMZA 1ZBA3 4LE4A 5FXWA 4YLZA 5ABJA 1PIV3 1HQNA 1ODMA 3GHMA 1R1A3 2E63A 1OQDA 4LK6A 1RUI2 2ARAA 4QPGC 1Q3EA 1ZVFA 3HMYA 5DMYA 1U5YA 2B9UA 2K0GA 5HPOA 5F2SA 5EJZB 2R061 2H0VA 2WA3A 4QGLA 5GALA 3AX4A 2BP6A 3VDDB 5E88A 1EUTA 5C8CC 3FUOA 1SBFA 4M4RA 3IAQA 4QQLA 4SLIA 3WCSA 2B45X 5IVVA 3KSCA 4CUBA 2WNVB 4P9GA 4LBNA 3QD6A 5IAVA 2RR13 4EN7B 4D8MA 2ZZJA 2YBPA 4GMP0 4CPBD 3N9LA 3AZYA 2H0BA 3MZHA 4IGPA 4LA3A 3VZJA 5DPNA 1UD1A 2VECA 5CFDA 1K3IA 4UAPA 5BV6A 5C6CA 2FDJA 2YGLA 4W4ZA 1ZX5A 2DFBA 3ABZA 5GZEA 5T50A 2OUHA 1W6QB 3QOPA 3FE5A 4HBNA 1N47A 4LIUA 4Q4W1 4XZPA 4OUSA 5AVAA 1OA4A 3ZLIA 2YDEA 2YBKA 3BPZA 2X05A 2NMNA 1XOYA 2XL9A 2C5DA 1X8EA 1HKDA 2PQSA 1RGSA 4XF4A 3WSOA 5E8AA 5LRSA 1GZWB 5DDJ3 1H9PA 5F5QA 3VBHC 3AP4A 3I2JA 1OLRA 1W6NB 3LKJA 2V4VA 2QQUA 3OPZA 4YGEA 4AI0A 4E4ZA 4H2AA 1NE4A 2QZ3A 5A32A 2X29A 3ZMOA 1YIFA 1W9SA 2WA4A 4QPIA 2ZX2A 5FZOA 2F17A 3W20A 1RUH3 2WINB 1W99A 1D4VB 4RGAA 3ZYPA 1H8TB 1GWMA 2G9FA 3OBRA 5DN2A 2EF6A 2ORXA 1W6PA 3HQUA 4XJWA 3BYWA 4P00B 3OTFA 5FZAA 5IK8A 1O59A 4CDXC 1GP6A 1PO23 3NJXA 4CU6A 4R52A 1WLCA 1NCQB 2MNGA 3RWKX 2ZX1A 1XYPA 2JEMA 3B5LB 4P5HA 3VZLA 1RUE1 3H0OA 1GZTA 1SLAA 5F3IA 4ES9A 3CNAA 2NMOA 1J3QA 5KHKA 4QT6A 1W9TA 1LKNA 1O7FA 1V9U1 1VALA 5FZDA 2VE1A 3PTYA 3WNOA 4INDA 3ACFA 2Q5TA 3JB8A 4KU7A 4XCAA 5FYVA 3VZKA 2J1EA 5KXCA 1UPSA 3V64A 5FPXA 2TNFA 4DO0A 1FOD1 1NYWA 4MSVA 4XYXA 2YG0A 3GCXA 4IV3C 4FPGA 2GNDA 3ACGA 4NWVA 3PMEA 4URAA 2A6VA 2W87A 5A7SA 1AR62 5IK7A 3OJBA 4OHXA 4XF1A 2OXBA 1H4GA 4E2GA 4R4XA 2WO7A 5CG8A 1BEV2 2CU5A 3OCPA 3AYEA 3TN91 2IWGB 2HWB2 2W91A 3SCHA 3RYPA 4RS5A 5C4WB 4QGMA 4Y5SA 2GU9A 1YWKA 1HIXA 4CP9B 2R063 5I91A 2AZ5A 2KM2A 2OQ6A 2XR4A 2HYXA 1AR83 2WJSA 2Y33A 5C9AA 4KU8A 1JZ2A 4YVSA 3JQWA 3RWNA 4QXBA 3KD4A 2LROA 1NG0A 3JZVA 5C5UA 2Y0IA 3WV6A 4XJAA 4HONA 1MR5A 4QAWA 1VBB1 2ZJCA 1HRV1 2QQJA 3P5BA 3POBA 5F2WA 4FPJA 1WCSA 5IVFA 4R9AA 4Q4X1 5C8WA 3DKQA 3DPRC 4PLNA 2X8KA 1C8M3 2PHXA 1GANA 2VUAA 3D8CA 3FN9A 5L36A 3KVBA 2ZABA 3VL8A 3BTXA 1TE1B 1WW5A 2VMEA 2WZPP 2AEYA 2C26A 2OIIA 1UIKA 5IHRA 5C33A 5LB6A 2P5BA 2IZWA 2C4XA 2OYZA 4S2GA 2WFF2 4QM9A 1ZZBA 2BBAA 3VZOA
chains in the Genus database with same CATH topology
2VPVA 2PA7A 1G86A 3ZSLA 3FWEA 1COV1 2WZR3 4E27A 2IC1A 3WXPA 4CP2A 3UKVA 3AM2A 2BUKA 3CJXA 3MF9A 1AXKA 3IMNA 3O0WA 4HK9A 1CAUB 4HPKB 4KGQA 3ROUA 1I3HA 1SACA 2DVDA 2P17A 1Q8PA 3FFZA 5BUVA 4CEYB 1ZBE1 3V56A 1DYKA 2XJUA 5IK4A 2R30A 3TNPB 1DFQA 2VU9A 1S2KA 2NM1A 5JIUA 2MEV2 2XG3A 1EV12 2ZGRA 1F5FA 1RUI3 1Q56A 1V6KA 2VULA 2VXRA 4M3CA 4LNVA 1QNYA 1MEC2 1DQ6A 3MIBA 4URTA 4XXAA 5CFCA 3SXWA 1MQTA 1OI6A 4A2UA 4LO7A 1CPMA 1GZCA 4AWDA 4H55A 5T5JA 2DVFA 4CEWC 3IN9A 2PHDA 4EWDA 2VGDA 3ZYGA 4X8PA 2PHFA 5FMOS 3E5UA 4JGZC 1LHWA 2ZGNA 3RMXA 4XILA 2Q8OA 4Y1YA 4Q8KA 1CAXA 3TN93 3OD4A 2C9AA 3O7OA 2ZGUA 3WINE 2AUYA 1C3HA 1POV0 4N53C 4BE3A 1YJKA 1C4RA 1N3QA 2ZGMA 4XTMA 4FBFA 1MS1A 3HIFA 1QOOA 1EPZA 4H3WA 4XDQA 1GICA 4WVWA 1BKZA 5A33B 5CBLA 1CJDA 2QJVA 1VR3A 4XF0A 1C5HA 1TMF2 4NR1A 1GBGA 4DXZA 3USUA 5JAXA 3C2UA 4KH9A 1VB4A 3POYA 1SQ4A 4LUMA 5JWPA 2MEV1 3E6DA 1PHMA 4Z92B 1LU1A 2WT2A 4I0AA 3DGTA 1MEC1 5DZFA 1PNFA 4B7KA 1ZZ7A 1SCSA 2WC2A 2HWD2 5FLJA 4AI2A 3AJZA 1IHMA 1SFYA 2GN7A 4R9BA 1X82A 2ES3A 3WOGA 1EPWA 4I0WB 4XJZA 2BVBA 1XU2A 2A5ZA 1D2QA 1ENXA 1WA4A 1PGW2 1J3PA 2A7AA 4HT1T 4D69A 4P9XA 2HWC1 1PGSA 4IEZA 1DQ4A 3EBRA 4IV1A 2JG9B 4AEKA 2P3JA 4AE2A 4HETA 4WM7B 4FAHA 1WLDA 2CAVA 3HT1A 1N1VA 1ND2C 2NPIA 1B35C 1LOBA 2ILMA 2X5IB 5FBZA 5FMOL 4G4FA 4ITCA 1PZ7A 3ALQA 3E6CC 3NKTA 4I2OA 3NSTA 3TYJA 5L7OA 1WLWA 3A0NA 1NY71 2UY9A 3AP7A 1FPN1 2XJVA 2PHRA 2WNUA 5KWRA 5EFUA 3IDCB 1REEA 1RJ8A 4YFWA 4BHPA 5BPXA 1QMJA 2D98A 4NVPA 3WUCA 4L97A 1RUC2 2CGNA 1AL21 3JU9A 4XQDA 5I8SA 4GH4B 4QU2A 1NZCA 4XE9A 1SEFA 4B4PA 5B2GB 4YW2A 2DCJA 3HQXA 4AEDA 1AR92 5J48A 4Q4V2 2VVEA 2WFF3 3WW4A 3AMPA 4J6GA 4P9JA 1DU3D 4CDUC 1FX5A 4UBGA 3N36A 2CL2A 3AMQA 1Q8OA 1GZWA 4Q0PA 4YFZA 5BNOC 2R32A 4G9SB 4AVTA 4S2HA 4RA0A 2FQPA 3WLUA 1RUJ2 2FZ2A 4BWOA 5I93A 1RB8G 1VB2A 4Q0VA 2GH8A 1CN1A 1EAH1 4DNYA 3JUUA 5ABJB 5D8AC 1PK6C 3ZXJA 3MW3A 2EIGA 4Q29A 3RNSA 2VG9A 1FMD1 1OA2A 2MEV3 1EV13 2BFUS 4P9LA 1MEC3 3RYKA 1ZRDA 2YC0A 1ZA4A 1WD4A 5EJ3A 3SISA 4CDQC 1LHOA 1W2UA 4RQPC 2JKBA 1PM7A 4B29A 3NV2A 2OZJA 3I4IA 4FOYA 1LHUA 3HAGA 4RFT0 5CFDB 1DHKB 2PTMA 2EXHA 4MXWA 5T54A 4P9YA 1RUC1 5CG9A 1VRH2 1UZZA 1QH7A 2AENA 2CTVA 4XJUA 2A3WA 1HV1A 3ZSEA 4OI1A 4LHKA 3U11A 2MPFA 4YSFA 4Y4YA 3VBUA 4FPHA 1YRZA 2DUOA 2FMDA 4N43C 4RSUA 1S0GA 4XBLA 4QPIB 4QHBA 1F8VA 4I0BA 3CL1A 2ET7A 2I45A 2JECA 4FVVA 2RS52 1QJY2 1W6PB 2VOVA 5ACA2 1I9RA 1RMU2 3MLJA 4R9CA 1TMF3 2QDRA 1AL23 1QJX2 2R041 4IERA 2ZZQA 2QE3A 2TBVA 2RM21 3UKTA 4YVWA 4HN1A 3Q9OA 3J4UH 1F2NA 4K40A 4JTOA 1C57A 3BOWA 2E7TA 2E9QA 5FO7B 3I54A 1EYBA 5EWSA 1RUNA 2YY1A 2NN8A 2HWD3 2YV8A 2WWSA 2GC1A 4AF9A 1NQDA 2RS12 2RS31 2WT0A 3ZIWA 3RI9A 1X33A 3CLPA 5CNAA 1D0HA 5H9QA 2PAEA 3JBG2 4KL1A 3WZ1A 1VRH1 3RMYA 2BEOA 5KXBA 1CGPA 3QLQA 1PIV2 4XFIA 4RS5B 5JR7B 5SV5A 4HVRA 4PIZA 2ZCWA 1LU2A 5C9AB 3B01A 3M8LA 4LBOA 1CQ9A 1VAVA 2R0HA 4XFGA 4YVSB 3RI8A 3VKMA 1UKRA 1VBC1 3GYDA 5GLVA 5LK5A 3S7EA 4K3UA 1AYM1 2VVFA 2ZHLA 2ZX3A 1LGBA 4LBJA 3M7AA 1FNZA 1PO11 2R6QA 1RUC3 3EHKA 2PFWA 5AC92 1J1LA 3M1HA 4N90A 2WL1A 3OGGA 4E4SA 5AFBA 1ND3B 3WHUA 1WW7A 1QQP1 4Q4V3 1V6LA 2D40A 1NQJA 2VMIA 2ZBJA 1TQ5A 3ES4A 3IM0A 2A3YA 2ZHKA 3EXUA 1O3RA 1XNCA 3VBRC 5CIRA 3ZYIB 4BZ4A 4CTEA 3U10A 4FPCA 2YHJA 3O0VA 1RUJ3 2E7QA 4QPGA 2ZKNA 2VUJA 1JUIA 1WD3A 2BW8A 5EXOA 4H14A 3ZMNA 1T6GC 2R043 4N7IA 5HCBA 4TZDA 4NWWA 4M3CB 4YZ3A 4OI2A 4GMP3 3M3OA 1R082 1FATA 5CFCB 1UCXA 2C1FA 5GKAC 1MQTB 2SBAA 1U5ZA 4XBQA 3ASIA 1S0IA 3VV1A 1ZRFA 2BVVA 4AEJA 5I0TA 1G9DA 3L2YA 5CU1A 2WIIB 2JE7A 3HT2A 1W39A 5C4WC 3AP9A 2OPKA 5JVVA 1BBT2 4LBQA 1WCKA 5GJ6A 1I1EA 1W6MA 3VBHA 1CAXB 2IFRA 4LE3A 4CP1A 1VRH3 1TNRA 1RUOA 3KCXA 3EJKA 4AI3A 2EXIA 1REDA 1QXPA 5LK7B 3LCPA 1NXMA 3SHRA 2B39A 1DGLA 2HWF1 3MEPA 4K8FA 4S2DA 2ZGPA 4CDXA 3G6JB 4PJYA 5D1IA 3RPQA 3SNMA 1DG6A 2DCTA 2ZHMA 4MUVA 2UWBA 4LTAA 2RS53 1QJY3 2PAMA 2UWCA 3E5XA 5ACA3 4AQ2A 4MH0E 4E4DX 1RMU3 4FQ4A 3USUB 2WQ4A 3VBFC 2RMU1 4AVSA 2BGCA 3ZO0B 1QJX3 4HVOA 4LBMA 4QQPA 4Q4W2 1NA1A 4RR3A 3ST7A 4IETA 2OUJA 1ZZ8A 1QQP3 1GQGA 2QFEA 4UXAA 4L11A 1JW6A 3O14A 3FLRA 2I07B 2G4IA 2P3KA 5JSPA 3O0XA 3TBDA 4XFHA 1BZWA 1DZRA 4NPRA 4YG3A 3WHTA 5CA6A 4K20A 1QDCA 3RG0A 3WDXA 5FO8B 2RS13 4U2AA 4A7ZA 1POV1 4IV1B 1WLTA 3FC0A 4CDWB 1BBT1 3H7YA 4JC1A 4RHV1 3VBSA 2BQPA 1VBD1 1Z7S1 1RTVA 2DTWA 2YPJA 1HLCA 4AFBA 1V6MA 1RUE2 2N7GA 2XBO2 5I0RA 2R49A 4EN6B 5L7OB 3ELNA 1QJU2 2HYKA 3AXEA 4XETA 4AHWA 1ENQA 2NP0A 4YGBA 1AX2A 1IZ3A 4AVCA 2XH6A 3DPRA 3WY6A 1DIWA 1XYNA 1V9U2 2WNUB 4K21A 4XFBA 2A6XA 5AVPA 4RL7A 1LOFC 5KC5A 4I3PA 3KZ4C 2RJKA 3O5SA 4B4QA 5KHGA 1FOD2 1QJZA 2GZWA 4LO4B 3R6SA 3KLSA 3MIFA 4IEVA 2CAUA 1LGNA 1V00A 3JB4C 3WDWA 1PZ9A 5AC93 1MVQA 4HK8A 1J1TA 3H1WA 4AEDB 4AYUA 1JN2P 1CONA 4JCKA 1QY4A 3TN92 2B7YA 4Z1VA 4FT8A 2HKXA 4OUMA 2VQAA 1PZ8A 2HJIA 4JQRA 3D4KA 4TLFA 2VW0A 5HI0A 1R091 2VMHA 1GLHA 2GAUA 4YZ1A 4XIKA 1GYKA 5JOWA 3O12A 1VBB2 3PJYA 1HRV2 3GNEA 4YW4A 3ZFGA 1AXZA 4Q4X2 4AI1A 4FPKA 4W6WA 3V0AB 3JQXA 3GZTB 1X8MA 4AG4A 4YW1A 4DPNA 2XBO1 4COYA 4Y22B 4WBBA 1QJU1 1R083 1XNKA 2P37A 2WSVA 2JG9C 3AMNA 1OLQA 1ZYBA 2QVSB 4YGDA 5J98B 1COV2 3QH7A 5FRAA 5DUWA 5F6LB 3LOBA 2X5IC 3NJZA 4FQZA 2B8MA 4E9KA 3DF0A 3L2HA 4TWTA 3WQ7A 3H1MA 1H2KA 4MXWB 5F6KA 4N53A 1OQ1A 1TME1 4FPYA 1BBT3 1ZZ6A 4XPVA 1ZBE2 2QUOA 4Q4Y1 1UU4A 4GKXA 3HWJA 4Z82A 4V1PA 2D5FA 4CRQA 2PHUA 3ZXLA 4LA2A 3VBOB 4LO8A 4NOTA 3VBUB 5JCTA 1CPNA 3MW2A 1NE6A 5FCCA 3D82A 5GZFA 3I59A 5GZDA 2EAKA 4GH4C 1JYIA 1H0BA 2BTVC 4B3NA 5TSWA 1O3SA 3B93A 1MACA 3AKTA 4IQPA 4Y26A 4H7LA 2Z79A 3ZSKA 2Q0AA 2XJQA 5T3NA 3BB6A 5K0UC 2GC2A 2XJPA 4YM3A 2GNTA 2IFWA 3UKNA 3J26N 4YVWB 2ERFA 2D7FA 1IQAA 2XHKA 3NW4A 4Q4W3 2RJLA 2R1DA 4W6XA 4TSVA 4Q0UA 1GNHA 4HLTA 1ND3A 2I74A 4C90A 3LZZA 3PJQA 2EA7A 5ABJC 2ENRA 3LWCA 3WP6A 2YYOA 1BXHA 3CJIC 2IXHA 4WM8A 1R093 3P3PA 3PVBB 1O3QA 3PLQA 3N7LA 1MZ6A 1ND2A 4FP2A 4GXLA 5BNPA 2GALA 1IS3A 4OLLA 4PQ9A 1RUF1 1Y43B 3H8UA 1U12A 4EWAA 4XHXA 5FLIA 4COWA 3FZ3A 1E57A 1LOEA 4KG0A 4Z8BA 3FBYA 1RUE3 2XBO3 1DGRN 1NLRA 4JDMA 1QJU3 1CVNA 2LM3A 1Y3TA 1MZEA 1DYPA 1H2MA 2A6ZA 5GLUA 4C1XA 2D6KA 1FAYA 3MIHA 3NWKA 3WQ0A 1V9U3 2WLQA 5CAZA 5DZGA 1X36A 2NZ9A 1I5ZA 1FOD3 1ULFA 1SLIA 4IEOA 5BNNC 3DV8A 1KFUL 3M4FA 5L19A 1RC6A 2HWC2 5LEJA 4QXKA 4QPIC 3RS6A 1NOVA 4AHYA 4KWLA 4ES8A 4ORFA 5BNOA 1ZM1A 1LHVA 2EXKA 4NN0A 1U5XA 4WZFA 5FTTC 4PDWA 2BBVA 2K9ZA 2GDFA 1G8WA 2TEPA 1KS4A 3WG3A 5K9YA 4Q1PA 4D94A 3VHRA 1NY72 3ZN4A 1A8DA 1NLSA 4LO5B 5D8AA 1TNFA 1MS0A 2AGSA 1FPN2 3TB0A 1LGCA 4QPGB 4Y1VA 1H1MA 1YFUA 1VBB3 1HRV3 3NO8A 3VZMA 3PVNA 2PYTA 4Q4X3 3KCCA 3J8F2 1DQ5A 1K5MA 2PN5A 1AL22 1HW5A 4QGNA 4NHMA 2HWE1 3MF6A 4HMZA 3OD0A 1S0JA 1LULA 1G9AA 1LOAA 3DKWA 2AREA 4GALA 4P9IA 2Y38A 2H6BA 3NAPA 4XFCA 4BOWA 3L9JT 1H2LA 4AI8A 1AZDA 1SLLA 1COV3 3S6PA 4OVEA 4RS5C 2R1BA 4DINB 3QACA 4I09A 1RL3A 2Q30A 4LBQB 4YGCA 2ET1A 1W6MB 3AMMA 3AZWA 4G3YC 4JGYA 4K1ZA 3VBHB 4BIFA 4YVSC 1ULCA 3GF6A 4ZU4A 3R4DB 1LEMA 4N43A 1EAH2 1ZBE3 4I3GA 4HFSA 5J09A 3DUIA 4CDWA 3FBMA 1ZZCA 3OYWA 3R0RA 3B7MA 1G7YA 1FMD2 4YYOA 2WKKA 4CDXB 1ONAA 2BWAA 1OPMA 5HCAA 1AX0A 3RJ2X 3P3NA 1JXNA 1DQ1A 3POWA 2VVDA 1MZ5A 1A3KA 4HN0A 1AR71 4XTPA 2X53S 1IKPA 3GBGA 1SBEA 1CIWA 4AFDA 5DUVA 3E6BA 3J8F1 5CADA 1KDMA 1UW8A 1NA1B 4RR3B 5GZCA 5FLHA 1HXS1 3MI8A 2DU0A 4D3WA 3ZYJB 1Z0HA 3T2TA 5A3LA 3SH3A 2D6OX 5HXVA 5JZGA 1WW6A 1VBA1 1JOJA 1V6IA 1AHSA 4FTSA 1OA3A 3ZXEA 1XE7A 1FV2A 2D3PA 3KB5A 4I02A 1CX4A 1GFF2 2XLFA 4XJ9A 5DUUA 2VOXA 4WVMB 3AYAA 1LB2A 4GWMA 4HL0A 2JJ6A 2F4PA 4S2FA 2D43A 4Y24A 1KD7A 4GB32 3VBSB 4QQ2A 4DQAA 1L3JA 4FXGB 3A0KA 1OOPC 1S1AA 2GH2A 2R042 4LEJA 2UWAA 4J1WA 4ASLA 2RM22 5AFEA 4R4ZA 4E2SA 1M06G 3V0AA 1WMEA 3AFKA 3AKSA 3N7JA 2Y26A 3H7JA 3LGRA 3DPRB 1YO8A 1Q8QA 3IDBB 1UN1A 1DZTA 1UAIA 4RGGA 4Y20A 4Y22A 4DB5A 3ES1A 1W0OA 2BNNA 3BODA 1GKBA 1GQHA 5DZEA 4FOQA 2RS32 1HV0A