4YM2A

Crystal structure of the human galectin-4 c-terminal carbohydrate recognition domain in complex with lactose-3'-sulfate
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
138
structure length
138
Chain Sequence
PTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural characterization of human galectin-4 C-terminal domain: elucidating the molecular basis for recognition of glycosphingolipids, sulfated saccharides and blood group antigens.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
molecule keywords Galectin-4
total genus 31
structure length 138
sequence length 138
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ym2A00
1LECA 2D6LX 3PMEA 1JUIA 5BYNA 4BM8A 4FP2A 3VKOA 1BKZA 2D6NA 1HLCA 4W65A 3R05A 2I2SA 2DV9A 2A6ZA 2V73A 4Z8BA 2W08A 4Y1UA 2GN3A 2AYHA 2DUPA 3T1LA 2C5DA 3SH4A 1QOOA 3WLUA 2ZHKA 4ZXKA 2UWAA 1BXHA 2DURA 4Y22A 1DIWA 1LHNA 4YZ4A 4Q2FA 4XZPA 3WVJA 1HQLA 4ITCA 3NV4A 1GNZA 4XIOA 5CB7A 2ZKNA 4FPEA 3U4XA 1KDMA 4RL7A 2JE9A 2ZACA 1UZZA 1W6OA 4MYEA 3UJQA 2NN8A 3BTAA 4FPFA 4GWMA 1U0AA 4M00A 4UW6A 2PHTA 2PHXA 3AYAA 4R9DA 2PHRA 1CPMA 1BJQA 1WW4A 2EXJA 4P9XA 1D0HA 4ASMB 1V00A 1GICA 4Y24A 4Y1XA 2A5ZA 2JDZA 3IMNA 2CL2A 1JYIA 2OW4A 4PBPA 4C1WA 5IT6A 2PHUA 2B7YA 4FPJA 5DXDA 1IS5A 2A6YA 2ZAAA 1BZWA 4XBQA 3ZYRA 3N7JA 1LU2A 5GLVA 3AJYA 3B00A 1CPNA 4GA9A 2AUYA 4XYXA 5GZFA 3MW4A 1S0CA 1SLIA 4Q26A 1GKBA 5SV8A 1S0JA 3WG3A 2D6KA 1UX6A 3OBTA 1NLSA 1YXWA 2ENRA 2E7QA 2YZ4A 4LBNA 1A3KA 2JECA 4JC1A 1VALA 3POWA 2EIGA 1WBFA 2NMNA 1LOGA 4XDQA 2FMDA 5JOXA 3V64A 1G9BA 2D3SA 4LBQA 5JOWA 4K21A 1LOEA 2D6MA 3LSEA 4UW5A 2D6OX 1S1AA 3O0XA 3RS6A 3WNXA 1LJ7A 2CYFA 4FPHA 2OVUA 3VV1A 4H55A 3WG2A 2ZMNA 3RMYA 3OY8A 3ZSLA 1DQ5A 1W6QA 2ZGUA 3SH5A 2OUJA 3IPVB 4LBJA 5EXOA 5HCAA 3WDWA 1Y7BA 3FLTA 5KXCA 5CA6A 2AR6A 4WZFA 1LENA 4GALA 2UWCA 4YW4A 1MS1A 2A71A 1MZ5A 2WQZC 5GZCA 3GNEA 4WVVA 4ISQA 1W0OA 4JRAA 2WKKA 1FV3A 1QDOA 2NZ9A 4XJ8A 1CN1A 4DRVA 4I30A 4M01A 3BIWE 2R0HA 1GNHA 4XJUA 4XXPA 1KJLA 4ISRA 4YM2A 2NMOA 3WZ1A 1GZCA 3A0KA 2ARBA 2CNAA 5FRAA 3USUB 2WSUA 2D43A 2E53A 2ZGRA 5H9SA 4ATEA 3V0AA 1DLLA 1WW7A 1AZDA 1J1TA 1QOTA 1W6NB 2UWBA 3AK0A 3O5SA 4AVVA 3RRDA 3MPPG 3T1MA 5CBLA 1LHUA 4FP3A 1W6MA 4DPNA 2VW2A 2ZHNA 3AYEA 1A78A 2BQPA 2H0BA 4SLIA 2PHFA 5HCFA 3TAYA 2JJ6A 1Q8PA 2YMZA 2VH9A 1CR7A 4YM0A 1ENSA 4FOWA 2W68A 1DQ0A 2R1DA 1MZ6A 2VXRA 3AZWA 3C2UA 3HR9A 3NWKA 4FQ4A 4HANA 1YI7A 1OQ1A 1GANA 3WHTA 3ZXKA 1V6MA 3NV2A 1Q8QA 3AP4A 3I4IA 1MS0A 4YW1A 5IK4A 1DQ2A 3AXEA 1HQWA 3A0NA 5E8AA 2VW1A 3KM5A 1JN2P 5KXEA 3PVNA 5IK5A 2UU8A 4FPGA 2SBAA 4BMBA 4BPZA 1LOCA 2GDFA 3OGGA 4L8QA 1BQPA 2GNTA 4XE9A 1QU0A 3NV3A 3R4SA 5GALA 4YZ1A 5GLZA 1WLDA 2YXSA 3A4UA 3WG4A 1I1EA 2D44A 2ZGSA 4DFSA 1ENQA 4GWNA 4XHBA 1OKQA 2JD4A 4Y26A 1WUVA 2EXKA 1GV9A 1G8WA 1IS6A 2P3KA 1SLLA 2C9AA 2NM1A 1G9DA 5EYYA 1W6PA 1ZM1A 2DVDA 2A70A 1OFSA 3IPVA 3WCRA 1AXZA 1CJPA 2AREA 3WCSA 4UW3A 4XJAA 2CWMA 1H9WA 3M1HA 4YG3A 3AYDA 1QMJA 5T55A 1C1FA 4ZKTB 3AZYA 2JE7A 2TEPA 3N3HA 3NV1A 4BMEA 3SITA 1WBLA 2ZBJA 1AVBA 5GLTA 3DUIA 3FUQA 2ZGMA 1JHNA 1GLHA 1F31A 3QLQA 1IOAA 3RMXA 1LOBA 4TYSA 4FVVA 4P9WA 1W6NA 3OJBA 2A3XA 1V6KA 3FLRA 3JUUA 3BODA 1QDCA 4Y22B 4XTMA 1DBNA 3WG1A 4M3CF 1SCSA 4YM1A 3R4UA 3PJQA 4RA0A 1FNZA 3ENRA 3KQRA 4CRQA 2A6XA 3ZXLA 4Q1PA 1RINA 4ATFA 2A6WA 3N7LA 1DQ4A 1LODA 1W6OB 1PZ9A 3IN9A 1Z0HA 4YGCA 4FPOB 2E51A 1WW5A 1ONAA 1GYKA 2D6PA 3OYWA 5E88A 5CNAA 1UL9A 1SCRA 5IK8A 2EF6A 4M3CB 2DUQA 2NYYA 4OZXA 1DZQA 3OYWB 1BYHA 1MS3A 2CY6A 2V5YA 4LBOA 3ZVXA 2UURA 3V0BA 4LBLA 1ULFA 3ZSJA 3ATGA 5T5PA 2LTNA 1N3PA 1LULA 3RG0A 1KITA 1IS4A 4FPYA 2KM2A 2A6VA 2EAKA 2R49A 2P34A 5GLUA 3AZZA 1LGCA 2ZGNA 3N7KA 4XBNA 3VUOA 1B09A 5H9RA 2OUHA 2GMEA 1FV2A 3AFKA 1X50A 1G86A 1SBDA 4XMIA 2WNEA 1S0BA 3AP9A 3W58A 4WVWA 5GLWA 1UKGA 2DVBA 2WSVA 1VAMA 3UK9A 1WD3A 4GXLA 1LHWA 1LCLA 1UN1A 2ZGPA 3SNMA 1R1ZA 3B69A 3B3QE 4Q1RA 2DYCA 4YGBA 4YFZA 5JOZA 4Y1YA 3ZYPA 4NO4A 2ZABA 1YIFA 2YROA 5JDBA 4K1ZA 1DFQA 1N1TA 2DVAA 2WLQA 4XJWA 1G9FA 3WDYA 1SBEA 1V6NA 1QF3A 2CWSA 4P14A 3ILFA 1LEDA 4YZ5A 5JMCA 5IUQA 1AXKA 4YZ3A 4C1XA 1VLNA 2ZZJA 2ZHMA 3ILNA 3TB0A 5JVVA 1SLBA 2DTWA 2DVGA 1CQ9A 2DWRA 4Q27A 5LK5A 4BLJA 3D6EA 4KBBA 3ZXEA 5DZFA 5E89A 2SLIA 3GALA 3H0OA 1V6IA 2DU0A 3MW2A 3SISA 3FUOA 5IK7A 2P3JA 3RSJA 1YO8A 1FATA 3M3CA 4YGEA 1A8DA 3IKWA 2YV8A 3ZXJA 2WT1A 3AZVA 2VW0A 4HL0A 5DUXA 3WDVA 4FOVA 1W0PA 2EXHA 1S0IA 1V6LA 1W6MB 2AGSA 3AP7A 1Q8SA 2GALA 1PZ8A 1UMZA 2ZGOA 4U36A 4U2AA 4YLZA 1WCSA 3WDTA 2ZMLA 4YG6A 2WT0A 3N35A 1LGBA 4LBKA 2D3RA 4FOQA 1N47A 1UZYA 1GSLA 5GJ6A 3VKMA 2DVFA 5DG1A 3SH3A 1H9PA 1JYCA 3FFZA 3POSA 2FHRA 5AVAA 1LU1A 1QOSA 3USUA 3V65A 2GNMA 5GZGA 1KDKA 3JU9A 3Q9OA 5H9PA 1ULDA 4PBOA 4R9BA 1FNYA 1JOJA 3DGTA 4XILA 3D5OA 5DUVA 1VIWB 2GMPA 1GZWB 1JBCA 2VY0A 4GKYA 1UAIA 5T5JA 1MR5A 3ZXFA 1C4RA 1AF9A 2DUOA 4PCRA 2DTYA 1GZWA 5T54A 1LHOA 2VU9A 1LTEA 3INAA 1C1LA 4D69A 1MS8A 3ZSMA 4JCKA 1GZ9A 4LBQB 3VKLA 1QNWA 4XMAA 4YW5A 1N3OA 5JOYA 4K1YA 2A3WA 4PF5A 4YGDA 1LEMA 2XG3A 1ENRA 1MVEA 1S0DA 4YFWA 4AWDA 2R1BA 5T5LA 1MACA 1DQ1A 1NXD1 4YG0A 4LBQD 5L73A 1AX2A 3AXDA 1MVQA 3OY8B 1N1SA 1W6QB 1V6JA 2EALA 1IKQA 1WLCA 2RHPA 4AVTA 4Q8LA 2P37A 3ZSKA 4AYUA 1JW6A 1Z78A 2JKBA 3AP5A 1AX1A 1Q8OA 2ES3A 3AX4A 1QGLA 3WOGA 4F83A 2ARXA 1AXYA 5JLVA 1KJRA 3O12A 4FPCA 1S0EA 1SLTA 4GKXA 3AP6A 1FX5A 1SBFA 4FPLA 4M3CE 3N7MA 5T52A 5F5QA 5F9TA 2D3PA 1IS3A 1KRIA 1PZ7A 2EXIA 5H9QA 4PQ9A 2Q5TA 5KXBA 1Q56A 3AZXA 3WHUA 2GNBA 2W52A 5EWSA 1ULEA 2Z42A 3FBYA 2AENA 3AJZA 5GM0A 1G9CA 3OPZA 4AGVA 3ILRA 2CTVA 3B01A 3T2TA 1I3HA 2A3YA 4WV8A 1WD4A 1O4YA 4XJZA 4P9YA 3UL2A 1LOAA 3WUDA 4AGGA 1JXNA 1RITA 1AJOA 2NP0A 3QCWA 1RIRA 3HMYA 4Y20B 1N3QA 3BOPA 1S0FA 2ZMKA 2R0FA 2A75A 5GZEA 2P2KA 1SFYA 1SLCA 3PVEA 4LBMA 4UW4A 4XJ9A 1D2SA 1LHVA 3O0VA 1ULGA 4IQPA 2ERFA 4Q8KA 2E7TA 1AX0A 1H30A 2GN7A 4M3CA 1N1VA 1HKDA 1VAVA 1SACA 1APNA 3FLPA 1LGNA 3I8TA 5T5OA 4DS0A 4BOWA 1CONA 5DZGA 3D4KA 3V0BB 3N36A 3MW3A 1DGLA 1QKQA 2YY1A 2ZHLA 3V0AB 1MS9A 3HN1A 2AH2A 5DG2A 3ZPYA 1WW6A 4NOTA 2D7FA 3RQ0A 3WUCA 3AYCA 2XB6C 1LESA 4R9AA 4XXAA 2PELA 2A7AA 2ZA9A 1ZA4A 1CIWA 4YW3A 4FOYA 3M3OA 1DYPA 1URXA 5CAZA 1O4ZA 1S0GA 5HCBA 3M2MA 2P3IA 4DQAA 3B9CA 5GZDA 4AVSA 2ZGTA 1XQNA 1G9AA 2E6VA 4YW2A 1WLWA 2GMMA 1QNYA 1LOFA 1EPWA 2GNDA 4Y1VA 1W6PB 3APBA 3M3QA 3M3EA 1IKPA 4YZ2A 1GBGA 3VKFC 2VUAA 4XHXA 1MS5A 5DUWA 3W59A 1V6OA 4AGRA 4BQ1A 1ULCA 2ZGKA 4DRRA 4CTEA 1FAYA 1HDKA 2R16A 2WT2A 2ZGLA 4YM3A 4BLIA 3UJOA 4TZDA 1F9KA 3ASIA 3SLIA 3VKNA 1UPSA 3LSDA 3WDUA 2PHWA 5KXDA 5T50A 4XOGA 5DZEA 3O0WA 1KQRA 1DYKA 1CESA 2G4IA 5FREA 4XBLA 1C57A 4CZSA 1Q8VA 2DU1A 1N1YA 2LALA 1LOFC 3L2YA 3OBRA 3IM0A 1F5FA 1SLAA 4Y1ZA 3WDXA 4FQZA 2WJSA 3LCPA 5EYXA 1DQ6A 3PVOA 4XIKA 1TEIA 1DHKB 1FYUA 4FPKA 1AJKA 4Y20A 4R9CA 1CVNA 3MEPA 3WV6A 1YYNA 4XTPA 4K20A 5DUUA 3POYA 1YRZA 2W39A 2ZGQA 1MS4A 2HYKA 3CNAA 1G7YA
chains in the Genus database with same CATH superfamily
4I09A 1RL3A 5L7OA 3DXTA 3OGVA 4BM8A 4CCCA 4AFCA 3EJKA 4HXCA 3CU7A 4W65A 3JXSA 3R05A 5L7OB 2I2SA 3ES4A 3VBHC 1TMF2 2WQ4A 4Z8BA 5A3NA 2W08A 1X8EA 4CE8A 1CZVA 4NR1A 2F6BA 2AYHA 2GN3A 5FYHA 4P00B 4D8MA 2RMU1 3WLUA 3THDA 1PO23 1PO12 1BXHA 2FBEA 2WN2A 1RUD1 3PIGA 5F6LB 3TYJA 5HXMA 1F35A 3VUOA 2F4LA 1RUG3 2Y6LA 4XF3A 4ITCA 4XFGA 1RMU1 1OOPB 5CB7A 2WLPA 3LZZA 2ZKNA 2BVVA 1KDMA 1O5UA 5DAXA 3UJQA 2RJLA 3BTAA 2BFUS 2P3YA 3ACLA 3AYAA 3JD71 3ORJA 4JGZB 4KQ7A 1CPMA 3NJZA 4LXLA 4N90A 4R9DA 4RSUA 4Z2AA 1V00A 4K3UA 4BH9A 4Y1XA 4Q4W2 1H0BA 4XCAA 3LF7A 3OG2A 1JMUB 1JYIA 4JGZA 4AFDA 4LT5A 2FDJA 4TXWA 4C1WA 5IT6A 4RGKA 2B7YA 2VNVA 4IE7A 4PDWA 2X05A 4QQ2A 2IXJA 2FQPA 3POGA 1K42A 4PIXA 3ZYRA 2V4AA 3U14A 3ST7A 4PDWB 4ET7A 3AMHA 4GA9A 2AUYA 1T2XA 4XYXA 3RJ2X 4CDWA 4GH4B 5HV0A 4ASKA 5DAPA 1QXPA 2BGCA 4AOCA 4BCUA 1BVP1 1JYTA 2J1TA 2ZX2A 4P9GA 3NSTA 3U10A 1A3KA 3WP3A 3POWA 2EIGA 4MXVA 5I8TA 1F2NA 2VOVA 4AXOA 1LOEA 2WFF1 4Q4W3 2E7AA 5FYIA 3RS6A 3ZN6A 1NCRC 1PMJX 3VV1A 4MUVA 3OY8A 3T4HB 4QM8A 3POBA 2X29A 4JGZC 5A7PA 1AR71 2RR11 3MV01 1R1A2 3FJSA 2AR6A 3S0MA 1RVF1 2L9LA 4YW4A 4MO3M 3URFA 1TNFA 4A7ZA 1AR72 1R64A 2RR12 1OSGA 2WR9A 1MZ5A 2K9ZA 5FZBA 1I5PA 1PO13 3ZN5A 5FCCA 4OHYA 3W9AA 4ISQA 3GDBA 4GMP3 1J3PA 1DGRN 4JRAA 3MLLA 1QDOA 1NXMA 1CN1A 1W28A 4IGQA 4M01A 4RS5A 4H2AA 3BIWE 1KXGA 1W03A 1GNHA 4XJUA 5FYMA 4YM2A 2NMOA 3QD6A 1XU2A 4LK7A 1QJX1 3I59A 3V0AA 3I2OA 3ACIA 3FHQA 3THCA 2WBKA 1MEC2 5FOBB 3VBRC 2W94A 3AK0A 1SG3A 1K5MB 4AFAA 2R063 1H6XA 4JTNA 3T1MA 2VZTA 4A41A 3K3OA 5APAA 3FE5A 4NMIA 5LASA 5JIUA 3ZPOA 5KR7A 1A78A 3SEEA 2JDYA 3MIDA 3U0ZA 4J1WA 4ARYA 1QJU1 4DINB 4SLIA 4MADA 4FSJA 2JJ6A 3WF3A 2VH9A 5FO7B 4CDQB 5A7QA 2VTXA 4YM0A 4FOWA 3WV6A 3ZSKA 3NWKA 5F6KA 5FP8A 4NIIA 4PI0A 5IVFA 4UYBA 3VBFB 2JDHA 3WHTA 1ZRDA 4FT8A 3K77A 3I4IA 4CUGA 5IK4A 1DQ2A 1H8TC 1YQ5A 3Q8CA 3A0NA 5E8AA 4OVEA 3RI8A 2VW1A 1NYWA 3NNMA 3KM5A 2VZOA 1JN2P 4GJYA 1Y4WA 4O9GA 5DAVA 4CCJA 5KXEA 5IK5A 1L7QA 2W1UA 2FZ2A 5CKNA 4YWAA 2GDFA 1VRBA 4XE9A 5BY5A 1W2NA 3LA7A 5GALA 3CLPA 5GLZA 2ORZA 3VBHB 3WG4A 2PAKA 4HVQA 2YU2A 1ENQA 4GWNA 2QTWB 1OKQA 2JD4A 3EMRA 5FZ0A 3ZLIA 3VBHA 1TVGA 1GV9A 3WNKA 5FZOA 4L0PA 1SLLA 3K4ZA 4CCMA 2NLRA 3GF6A 5EYYA 4CDXB 2XBO1 2DVDA 2HWB3 2A70A 4IV1A 1OFSA 1OVSA 1OKOA 4MVTA 3IPVA 3PUIA 2HWE3 2ZZQA 4QQPA 1AXZA 1CJPA 2YC4A 5L9RA 4WVMB 4UW3A 4CDXA 4CPBD 5JR2A 3KGLA 4EE2A 1K12A 3VBOC 1C1FA 1FPN3 5EV7A 2QCSB 2RDRA 3AZYA 3KV9A 4WVMA 5DQ0A 3QOPA 3L2HA 3N3HA 1OMIA 2WZ8A 4Y4YA 4BMEA 3SITA 2OKXA 3WD5A 2O8OA 4A7KA 3ZYHA 1RUI1 5A3WA 3AMNA 2R043 1DU3D 3H1YA 2GP3A 4AFBA 1F31A 3QLQA 1LOBA 4JGYA 4B29A 1AR83 3VD4A 4OI0A 3EXUA 1V6KA 3VDCA 3BODA 4UBHA 1W8FA 3HJRA 4XTMA 2FCVA 3E5UA 4R4XA 1OQDA 2X53S 4Q1PA 5BNOC 4V2WA 5FPAA 4A3ZA 1PGL1 1QJFA 4ATFA 2A6WA 4O65A 1LODA 5C6CA 3NKTA 1OF4A 4FO9A 2FDGA 1Z0HA 5A6QA 1OBNA 2DCTA 2QQVA 2WDBA 5CNAA 3AKRA 4FFGA 4QX3A 3LFIA 5KC5A 3DECA 1BEV3 2LROA 4EZHA 4DUVA 1QJX2 2VUDA 4Q4X3 2FDFA 4LBOA 2GAUA 2WNVB 4AAPA 4LBLA 2X8KA 3N9OA 2A1XA 5BNPC 1SQ4A 5D1IA 4DY3A 3I7DA 2GC3A 3O1OA 4EWAA 2EAKA 2VOTA 1XE8A 3C7EA 3SC7X 2ZGNA 2ETEA 4FFFA 3ZXAC 1JZ3A 5C3OA 2GMEA 1ZVFA 3E6CC 5IVCA 2DF7A 1ND2A 3W5MA 5A1LA 4WVWA 3LDKA 1CAWA 1QWRA 1WD3A 2ZKLA 4GXLA 4J6GA 5F8PA 3UKNA 5IATA 2ZGPA 1GOHA 1R1ZA 4OYUA 4YGBA 4CCEA 1T6BX 2YPDA 1VB4A 2HEYF 4Y1YA 3ZYPA 1EY2A 2ZABA 4RR3B 1JYNA 2BYVE 1OA3A 5CIRA 1YQCA 2DVAA 2VCMA 2WABA 3F95A 3WDYA 2OS2A 4Y3OA 5FUNA 4M4RA 3ELNA 1WLTA 4XFHA 4RQPA 3VZNA 2QZ3A 3DL3A 4KG0A 4AI1A 2ZZJA 1Q3EA 4OFGA 2HBUA 3ZO0B 2HWF2 1SHWB 1XNCA 1XSQA 3TB0A 5BNOA 1SLBA 1NCQA 1XNTA 2LUWA 3H42B 3IDCB 4Y5Z0 4DY5A 1GP5A 3VBUA 1MQTC 2JE8A 3D6EA 2WWSA 5A6ZA 3ZXEA 3CDZB 4LO4B 5FY8A 2VCCA 4HVRA 4MXWA 2VQ0A 3GALA 3H0OA 1V6IA 3ZDVA 1E57A 2XONA 4N53A 3SISA 3DKWA 2WO7A 4QHZA 3ZFGC 5C8CA 1FATA 4MXWB 1A8DA 5CG8A 2YV8A 3MIEA 2P17A 2WFF3 4Q4W1 4NHMA 1D4VB 3KMHA 1ENXA 3LA2A 5A6YA 5D2AA 4GIQA 5JXHA 1CAXB 1H4GA 4K6BA 3WDVA 4CEWB 4AI9A 2EXHA 2D97A 1W6MB 2CDPA 2W95A 3AP7A 4IE5A 4U36A 4D0QA 2VOKA 4YLZA 3WNPA 4CDUA 3K4DA 3PLQA 1QQP3 1UU6A 2ZMLA 4CEWA 4MGZE 5CG9A 3AVRA 3JQWA 1UOGA 2D3RA 4DIQA 1N47A 5GJ6A 2RDSA 3X29B 2DVFA 4QX2A 4XW3A 5DG1A 4OHZA 4TWTA 1H9PA 1JYCA 3FFZA 4AAXA 4LA3A 2FHRA 3USUA 3V65A 3H8OA 3N9MA 2WZR3 3ZMOA 3JU9A 2EIDA 3I2FA 5JUVA 1D2QA 5EHDA 2J7MA 1JOJA 1ODMA 2R7EB 4UBGA 1UW8A 1RUJ2 1XNDA 2VD7A 1VIWB 4AVAA 1F4HA 1U5ZA 4JHZA 2VY0A 4GKYA 1UAIA 1J58A 2LRPA 2WIIB 1DG6A 5J48A 1OHFA 1J59A 2CGPA 2DUOA 2HLEA 1AR62 1H1IA 2G19A 1LHOA 1LTEA 1JODA 1QH7A 1G6NA 2ZPXA 4NPLA 4D69A 1MS8A 2ZTNA 4FXGB 3O1SA 4ZPIA 3C7HA 1QNWA 4D6QA 2WRAA 1QJU3 2WZPP 4YW5A 1N3OA 3WNOA 4MLOA 1R082 5A7WB 5FXZA 2XG3A 1QJZA 1S0DA 1YNAA 2VCBA 5T5LA 1IPSA 3P5BA 1VRH3 4LBQD 2BEOA 3RFRA 1WLCA 3RVHA 4AVTA 4CCOA 4A4AA 1HB1A 4I02A 1SPPA 3DYPA 2PFWA 1XYPA 5LA9A 3CL1A 4Q0SA 4AVBA 4AW7A 2NQYA 1UF2C 1WCDJ 3LDBA 1FPN2 3NW4A 2C26A 4LHNA 2EIEA 4FPCA 1RUF1 1EAH2 1W8HA 4GKXA 3R6SA 5F9TA 1W9FA 3N7MA 2O0OA 2FD8A 1IS3A 3CMGA 3FL7A 2WZEA 3GZUC 1W3XA 4Z1VA 1UY4A 2RS11 3I54A 5C5UA 3WHUA 2GNBA 2W52A 3AVSA 5I0RA 4BIFA 5JSPA 1C8NA 1UX7A 2HYXA 1HRV1 4QX7A 2Z42A 3TN92 1A34A 1FOD1 1GZTA 3GJBA 4HN1A 5LWBA 3DCQA 2VVDA 1GP6A 4CCLA 3O1TA 1PM4A 4IL7A 2ORXA 4WV8A 4ARXA 5D21A 5JWPA 2NP0A 3MBWA 1GMMA 1L7LA 1YI9A 4Y20B 1N3QA 3BOPA 3WW1A 4AK3A 5GZEA 1X33A 3K4AA 4EN9B 1Y9GA 4LBMA 4XJ9A 1ULGA 5J7MA 2ERFA 2E7TA 1H30A 2ZJCA 4XUOA 5DPNA 3NJVA 3N9NA 2XJVA 4RS5B 2GSYA 1VAVA 3FLPA 1APNA 1LGNA 5KWRA 2ADDA 2BU9A 5DZGA 4LOTA 3N36A 5HV4A 3MW3A 3V0BB 1DGLA 2TNFA 2Z79A 1CAVA 1DGWX 2ZHLA 4NN0A 3V0AB 1A8MA 2AH2A 4OULA 1WW6A 2EVXA 1UKRA 1P8JA 3POFA 3IDBB 1D4M2 3UV9A 1K5MA 1I9RA 4UAPA 2X09A 4QGLA 4XXAA 5FP9A 1VRH1 4AR2A 3IB3A 4YW3A 1OH3A 1YEWA 1UIKA 1URXA 5A7NA 1FXZA 1OOPC 3MFAA 4AEDC 1KD7A 4LJHA 1C5IA 2J1VA 1AHSA 3KF5A 4QPWA 2B9VA 2PHLA 3PTYA 4DQAA 1JYXA 3B9CA 5GZDA 2K0GA 4BK5A 5FLHA 1OD5A 2BNMA 4ZZ5A 2E6VA 5I0SA 1WLWA 2GNDA 1EPWA 2BWCA 1JZ6A 3H9AA 1GBGA 3VKFC 4AZZA 1HRI2 1W05A 5FLIA 5FZ6A 4COYA 1NA1B 4AGRA 4OZOA 2OZ6A 3KCCA 4CP9B 1TZOA 1ULCA 2OPWA 5CVRA 2CV6A 4CEYB 1RJ7A 3IIAA 2WT2A 2R16A 3P6BA 1NA1A 4L99A 4INDA 4CP9A 4TZDA 3SLIA 1AYN2 1AYM1 1R1A3 1UPSA 2Y0OA 3R4DB 2PHWA 3T2PA 1JS9A 3N9PA 4CEYC 3SXWA 1BCXA 2O14A 2QQNA 3GBWA 4D3WA 2HWD2 1XPWA 4IEUA 3I2DA 4CDUC 1LAJA 3LFMA 1LOFC 5KC6A 5A32B 1SLAA 3IT8A 4H14A 4JAAA 4CPBA 2J1AA 2WJSA 3LCPA 4IV1B 4BZ4A 1EAH3 4CCDA 2BGPA 1RXGA 2F4PA 1DHKB 1R093 1SMVA 4FPKA 2ZX0A 3TWIA 4BQ5A 5C4WB 3ECQA 3WP6A 3OPWA 2QQMA 3ZFEA 3AMMA 3ZIWA 1B35C 3NL1A 3A7QA 1CAUB 3M70A 2V09A 2W39A 2ZGQA 4CXXA 3U4SA 5KHJA 3S5AA 4N9HA 2WUHA 4HKLA 2D6LX 1RUNA 1ZRCA 2JDKA 4JKMA 4QQOA 3WW3A 4QPIC 3ZFFC 3P3NA 4FP2A 3VHOA 4AEKA 4RHV1 4AI2A 4ES8A 3GYDA 5IVJA 2DCZA 1WCQA 1NG0A 1HLCA 1O59A 2XUEA 4NWWA 1TQ5A 1QJU2 3S6PA 2FDKA 4H3WA 4PLMA 2DV9A 2A6ZA 1JUHA 2DUPA 3GM8A 3T1LA 2O8QA 5C71A 2ZHKA 2UWAA 1PX4A 2DURA 4XEZA 4G9SB 4JKKA 2PLV1 2V72A 3I3QA 3TEZA 3WVJA 4FFHA 3UGGA 1O4TA 1PK6B 4XF4A 1GNZA 1RYYA 1DCSA 3K51A 3LPGA 3KWVA 3U4XA 4RL7A 1NT0A 1PK6A 1IPJA 2JE9A 3EYPA 4NWVA 2NN8A 4JVAA 2PHXA 4ASMB 1WW4A 1XBFA 5I0DA 1D0HA 3TEWA 1GICA 1BLZA 4Y24A 4WBBA 2JDZA 2CL2A 1PO22 3ZFEC 2GH2A 2PHUA 3GZAA 4XFBA 1Y9MA 1H2LA 3E6DA 5FBJA 3BTXA 4IEXA 2A6YA 3KLSA 5IAVA 5FY4A 1QJY2 3TEYA 1WCKA 2IFWA 5JZGB 2E31A 1S0CA 2QE3A 1JOBA 2XXZA 5SV8A 1S0JA 2B39A 1HB2A 2YFUA 1NA1C 3HPNA 1HXS1 3MLJA 1YXWA 2WFF2 4KWUA 4FBFA 1DYOA 2ENRA 3AM2A 4HFSA 3MZHA 4TTGA 1NZCA 4JC1A 1RHI1 4NE9A 1RVF3 4BQ3A 1WBFA 1CX4A 1CZSA 1LOGA 1WA6X 2ARCA 2NMNA 4LULA 3V64A 5ACA1 4SBVA 5JOXA 5L9BA 4K21A 4IESA 2PQQA 3SCFA 3LSEA 1EP0A 4K40A 4UW5A 2D6OX 3O0XA 5FZ9A 2CAUA 2R30A 1ASJ3 4HN0A 1UU5A 1LJ7A 4Y5TA 3WSOA 4EROA 4MV2A 2HWF3 2Q8OA 4H55A 1ZRIA 2CU5A 3NJXA 5ABJA 1TME1 1UYXA 2Q1MA 3MIGA 3ZKUA 3RYPA 1DQ5A 1W6QA 5FZ3A 3SH5A 5LZ6A 3K46A 4LBJA 4WM8C 5HCAA 3WDWA 3ZDSA 3MDPA 2JDPA 5A33B 5C5TA 3AMPA 4Q4Y3 1OUXA 4WZFA 2R061 2UWCA 4GALA 2JENA 2QQLA 1WA4A 2E33A 4PLOA 5GZCA 3GNEA 3OB8A 4WVVA 5A33A 4CUAA 4Q0VA 3VLBB 3PNAA 2WKKA 1M4WA 4XJ8A 1OI6A 3PIJA 2YG0A 1XSRA 2DBNA 2E63A 3PTRB 3ACGA 5FZ8A 4XXPA 1KJLA 2GU9A 5LBEA 3DPRC 2FCUA 1GZCA 3POJA 5FRAA 2ZGRA 4ATEA 1VBC2 5FBZA 1DLLA 1WW7A 1XOYA 3BGAA 5FZGA 3S7EA 1QOTA 1W6NB 4XQ4A 4ONUA 3I2KA 4P9LA 4JRLA 3MPPG 4XFIA 5I0UA 3LEGA 4ES9A 3NNJA 1LHUA 2YBKA 4HOOA 4BWOA 1W6MA 4DPNA 3DKQA 1HXS2 2VW2A 4NRPA 4QXHA 2PN5A 2JKXA 2VMHA 4Z82A 3TAYA 1Q8PA 1F4AA 3WR0A 4B3NA 5JMOA 5FPZA 3I97A 2BOJA 2P4EA 1ENSA 1OQEA 3C2UA 1MZ6A 1BEV2 3AZWA 1W9WA 4HANA 3VL8A 1U12A 1OQ1A 1GANA 1YI7A 4OI4A 5IVEA 1YFWA 1OD3A 3NV2A 4N8MA 3MIHA 4YW1A 1HQWA 3MUZ1 4ZU4A 1YFUA 3H8UA 2UU8A 3QBQA 2K46A 4BMBA 3D82A 3U07A 1LOCA 2C6SA 2VUCA 5LRSA 3ETQA 4JHTA 2ZXQA 3NNLA 2JDNA 3HD8B 3OBZA 1K3IA 1WLDA 4Y4RA 3A4UA 4IDZA 2D44A 4JTOA 3V56A 3MICA 4XHBA 3KCXA 1AR82 1QEXA 2CHHA 2P3KA 2QDNA 4V2VA 1O6UA 2C9AA 3FMGA 4W4ZA 3U11A 5FY9A 2YGLA 1JI6A 2AREA 2VGDA 4LMFA 4QQLA 1XE0A 4YW7A 3WCSA 2BNOA 3CEWA 2VECA 1ZBE3 3MF6A 4GULA 2CWMA 4XJAA 5A7SA 2XPJA 3M1HA 4WM7A 5T55A 5IW0A 2VBDA 1QXJA 3VDDA 1BK1A 4EN0A 1MZFA 4RGGA 5DDJ2 2AEYA 1RXFA 3IDEA 1ZZBA 3B94A 4Q4V1 2O1QA 2ZBJA 5LBFA 1AVBA 3CJIC 3DUIA 3VDDB 5JXGA 5A3PA 2Y6GA 1I5ZA 1GLHA 5C9AA 1IOAA 2ZEXA 3PVBB 3RMXA 1B35A 4QPIB 2JX9A 4D7SA 3OJBA 2BBVA 2A3XA 1CIYA 1BEV1 1WZXA 2VQUA 4GD4A 1Q5OA 5C3PA 3WG1A 2VE1A 3HBKA 3N9QA 4M3CF 3T30A 2AC1A 3ZIXA 3PJQA 4N43C 4RA0A 2YFZA 5A1AA 1FNZA 1JOPA 3VBUC 3ENRA 3H3ZA 3KQRA 5DN2A 5G04L 1YHFA 1OA4A 1POV0 2A6XA 3ZXLA 2Y6FA 3J8F1 1ZZ7A 3FHIB 3N7LA 1GU3A 2ILMA 3M7AA 5FP7A 4EN8B 4WM8B 1VBC1 4AF9A 5E88A 4N43A 1GYKA 2D6PA 3HWJA 2RJKA 1PIV1 2W0XA 2VBBA 4AHYA 2W9XA 3BPSA 4OZXA 4GAZA 3R0RA 5F5AA 3ZOIA 1GQGA 2W91A 5EZWA 2YPJA 2CY6A 4HPKA 4G4FA 3J7MA 4LK6A 3ZVXA 4A44A 4AQ2A 3V0BA 3S57A 4N9IA 3ZSJA 2BV4A 4FXKB 5T5PA 3WX5A 2D98A 3CJIA 3RZZA 1IG0A 1N3PA 3GBFA 1JYWA 4UT5A 1KITA 3CJIB 2R062 4GWIA 2R49A 4X6RB 3VZKA 1LR5A 1POV1 2QFEA 4I01A 4MG2A 2QQJA 1B09A 1KGYA 1TME2 2OUHA 3JQXA 1NOVA 4MOAA 2WNEA 3T2OA 1HN1A 4Z2WA 3DPRB 4AEJA 1VBB3 3HVDA 3VBFC 3WF1A 2VOXA 4OHXA 1VAMA 4QDRA 2DCJA 3HQUA 1PIV2 5FXWA 3HQXA 3B3QE 5J96B 2DYCA 1RHI2 2VQTA 4NO4A 4IV3C 4OCTA 2ZEWA 4OQ8A 2YROA 1WMFA 1AR73 1SFPA 1W04A 2RR13 4K1ZA 1G9FA 1SBEA 2VMIA 2WINB 3J8F2 4UXAA 2CWSA 4P14A 1PO11 2ZEZA 3ILFA 3ITQA 4OI1A 4JGYC 3NAPA 4YZ5A 4HMZA 4NIDA 4L11A 1AXKA 5IUQA 3FFQA 3TNPB 4C1XA 1PVC1 1UZVA 3GXUA 3MO4A 1US2A 1Z7S3 3NAPB 2DVGA 3BPZA 4Q27A 1XXNA 5LK5A 1W99A 1TG7A 4NROA 1AYM3 1EPZA 1O8SA 1R1A1 2PMWB 2OYZA 5E16A 4NIAA 4B1LA 5BV6A 1RUD3 2EICA 3KZ4C 3EQEA 1FOD2 3HBZA 1DGWA 2VO5A 4BK4A 2OXBA 3OEBA 4IEPA 1ZA7A 3FN9A 4BQYA 1DP0A 3AZVA 5K9YA 2LM3A 3BTYA 1OOPA 3F2ZA 2CAVA 4EN6B 2X10A 5FMOS 5FYZA 1VMJA 4KGGA 5DUXA 2R073 4YNIA 4B8EA 3B5LB 4IXLA 2VMFA 1S0IA 2YBPA 4QB2A 1PZ8A 4JDOA 4U2AA 2HWC1 5A3TA 3WDTA 5FDBA 2BW8A 5FWEA 2WO1A 2JEMA 3ACHA 4FOQA 1RUC1 1NKGA 4W6XA 1S4CA 1GSLA 3NRUA 3VKMA 3SH3A 3I3DA 1H8TB 3BI3A 3H8XA 3TNQA 1VBB1 5AVAA 1LU1A 4OLLA 3Q9OA 4R4ZA 5JSOA 5F5IA 4JDNA 1ULDA 1C8M3 4PBOA 4R9BA 3DGTA 4DUWA 1QJEA 5I8SA 3KQ4B 3JBG1 5JIAA 5FZMA 3IMMA 3D5OA 4XILA 2GMPA 1U5XA 5LA0A 1JBCA 5D8AC 2PLV3 3ZXFA 1MR5A 2XL7A 2YU1A 3WF2A 4LOSA 4E2QA 5I91A 1QHDA 2DTYA 2VU9A 2XVGA 1C1LA 1H8VA 2J1EA 4YRDA 3ZSMA 5K8SA 1F8VA 1GZ9A 3RPQA 3KT1A 3WW2A 2Q0AA 4XMAA 3VBOA 3KV5A 1UY2A 2WZR1 5D8AA 5FK8A 4K1YA 2A3WA 1RB8G 4CP0A 4WVZA 4YGDA 1LEMA 2BUKA 2QKDA 1MVEA 3ZN6B 1E5RA 4AWDA 2R1BA 3VBOB 4O61A 2YGMA 1JH5A 4XVHA 1NXD1 4LIUA 4YG0A 5IJRA 5L73A 3BN6A 4QDQA 1MVQA 2P6CA 3OY8B 2D40A 1N1SA 3OD0A 5JPMB 5LBCA 2RHPA 3ZFGB 2P37A 5LA1A 1RUI3 1Z78A 2JKBA 2RM23 2ES3A 2ZAHA 2R041 2JIJA 3AX4A 1QGLA 2B4KA 4F83A 2EA7A 2VZPA 1YQ6A 3T09A 4DB5A 1KJRA 1W90A 3AL5A 3O12A 1SLTA 4X8PA 1SBFA 5F5QA 5J36A 3VBRA 1V9U1 1KRIA 2WS93 4B1MA 5CKQA 1S2KA 3Q8BA 1Q56A 5FYSA 2RDQA 2PYTA 1ULEA 3ETPA 3FWEA 3FBYA 3GCWA 3OGJA 1RUC3 2WL1A 2KXLA 5ANNA 3PU8A 5FZLA 4AI8A 3MI8A 5EIYB 2W87A 4LNVA 3T2TA 4URAA 3UL2A 1WD4A 1O4YA 1IG3A 2YBSA 3K48A 4DO0A 3WUDA 3FC0A 3SEPA 5IVVA 1NY71 2IUWA 1UU4A 1RITA 4R52A 1ZBA3 4RGAA 1M06G 3EHKA 4N53C 3WP5A 1RIRA 1WMDA 3HMYA 4BQ4A 1S0FA 1ZBA2 4IERA 1RUH1 2R0FA 4Y33A 5CU1A 3T08A 2MEV2 1SLCA 2GZWA 2PTMA 3C3VA 4UW4A 1W8WA 3O0VA 4IQPA 2JDUA 2AACA 4A6SA 5LEJA 2GN7A 4M3CA 5G05L 4CDQA 1HRV3 1NCRA 4JV4A 3AC0A 5T5OA 1J3RA 2XR4A 4KU8A 4QGMA 4E4DX 5IYYA 4XAEA 1CONA 3VBFA 4E4ZA 2W1QA 3D4KA 2VQAA 1BMV1 2YY1A 1QKQA 3LDRA 2BOIA 3M3IA 4KWJA 4MX3A 4CUBA 1UWWA 1J83A 1MS9A 3ZFFA 4CEWC 1VE0A 2PA7A 5FZIA 3B9IA 4OUMA 4IV3A 5CFCB 3HEIA 3ZFFB 1DLCA 2A7AA 4FOYA 1MZEA 2RM22 3M3OA 5JR7B 1OLMA 1HQNA 5CYYA 2W2IA 2ZOEB 3ZKYA 3KT4A 4LO6B 1O4ZA 2RM21 4L92A 4UF0A 2Y6HA 3M2MA 1PO21 3HT1A 2XBO3 4QMAA 3OEAA 2ZGTA 1AR92 4AQTA 4QGNA 1BBT1 2GMMA 3CHXA 1LOFA 3MHZA 4PDWC 5FMDA 5SV5A 4S2FA 4KU7A 3VZOA 5IHRA 1IKPA 5KHIA 3O1UA 3C7OA 4XQDA 4I2OA 4LEJA 1JZ8A 3TOJA 5JCTA 2BNNA 5DUWA 3W59A 1V6OA 2JIGA 2JG8A 1YQ2A 3ME2A 3WNLA 2YYOA 1RUF2 1HDKA 2Z69A 4LO7A 1FMD2 3VZJA 3E97A 1F9KA 2JG8B 3ASIA 4IEOA 3LSDA 3USSA 3FX3A 5T50A 5HBAA 4XOGA 3D0JA 5DZEA 2Q8EA 2VMGA 4MH0E 3EBRA 1PGL2 1ZBA1 3HIFA 3H7JA 4XQWA 1YWKA 2VMDA 3T2QA 4XBLA 4CZSA 2ZCWA 4QU2A 1GUIA 1RUH3 3HQRA 1RJ8A 4PIYA 4RFRB 1RTVA 3IWZA 4F8AA 1AL22 1KS4A 4Y1ZA 1PGW1 3WDXA 3LGRA 1DQ6A 1GP4A 3PVOA 3GGLA 1ND3A 2WN3A 4XIKA 2J42A 1FYUA 5FO8B 4E4SA 2XH6A 3MEPA 3CF6E 3WP4A 2OT7A 3HAGA 5DUUA 4LA2A 1J1LA 4AQ6A 3JD72 2HYKA 3CNAA 2R072 3IZOA 1LECA 2WA3A 1JUIA 1OA2A 1W8UA 3KGZA 4IEZA 4ASLA 5BYNA 1GR3A 5BXXA 1GWMA 1BKZA 1JZ5A 4GB31 1UIJA 1XJAA 2J1RA 2XLGA 1H1MA 2XGXA 3WQBA 5FPLA 4Y1UA 2WNUC 1RUD2 2WNVA 1QOOA 4LHSA 1DF0A 4UFIA 4ZXKA 3VD3A 4CSWA 4YZ4A 4Q2FA 1AYM2 2QQIA 4XZPA 1NLRA 5FYCA 1HQLA 1S2BA 1DZTA 4E2GA 3WXPA 3T0BA 1Z7S2 5FWJA 1C28A 2QQPA 1YLLA 4L2NA 2EAAA 2ZACA 1C3HA 4P9IA 2HBTA 1UZZA 3SCGA 4GWMA 4FPFA 3VDAA 2JDAA 1U0AA 5CFCC 1CGPA 4COZA 2PHRA 2EXJA 2YC2A 3ZYFA 5FY1A 3U1XA 4FTEA 4QQHA 5LCWL 2R6QA 4EV0A 1XYOA 2OW4A 5EQUA 1W2OA 3OUHA 4IEQA 1HV0A 1RHI3 4BQ2A 4EWDA 3RYKA 5EJ1B 1NE6A 1PIV3 4ZU7A 3K3NA 1IS5A 2ZAAA 4HLTA 3WNMA 4XBQA 5I0TA 5A3LA 1LU2A 5GLVA 1VBB2 1L3JA 1CPNA 4JZRA 3RGBA 5GZFA 3MW4A 1SLIA 2QUOA 3PHMA 4Q26A 4QHBA 3OGRA 4RQPB 2D6KA 5FZCA 3UKTA 5IVYA 1UX6A 2Y34A 1AL0G 3OBTA 1NLSA 1JU3A 4LUMA 2VZ1A 2E7QA 5BNOB 2WWUA 2JXAA 3S30A 2YZ4A 2RG4A 1FT9A 2F17A 2LS6A 2OZJA 1IQDC 1VALA 2WNUB 3DPRA 1POV3 3DXUA 4Q4Y1 4XDQA 4XUNA 2FMDA 1G9BA 4LBQA 5JOWA 3RZHA 4AHWA 4ORFA 2VM9A 2D6MA 4OQ9A 4CYDA 1Y9QA 4HKWA 5C8CB 3ON7A 2CYFA 4FPHA 2OVUA 4HSLA 3RZMA 3NVCA 2ZMNA 3WG2A 3RMYA 4GQ7A 3VBSA 2ZGUA 2XJPA 2BJSA 2OUJA 2V4VA 3IPVB 5EXOA 3FLTA 1RUG1 5B4XA 2QNKA 2W3JA 2X5IC 1LENA 4QM9A 4QPGB 1RMU3 5ABJC 2IC1A 2WQZC 1PVC2 3SKJE 1W0OA 5BPXA 1QY4A 2CGNA 4DRVA 4I30A 4XUTA 3CQOA 2R0HA 3VHPA 3NAPC 2P1BA 1V9U3 4DUXA 1TE1B 4ISRA 3GJAA 3A0KA 2ARBA 2XMLA 4NPRA 3USUB 2WSUA 4HZFA 3BKZA 4HETA 4F7ZA 4JGYB 4W8JA 3EB7A 1AZDA 1J1TA 4V1PA 4FTBA 3AL6A 4IETA 4HBNA 4X8NA 5F3EA 5JXJA 5FZKA 3UYJA 3PMSA 3ZR6A 5DMYA 5HPOA 2W92A 5C8WA 4KGQA 5CBLA 5DABA 1GWKA 3AYEA 4IEYA 2HJIA 3CIHA 5F3GA 2NPIA 4DEQA 1YJKA 4ZXEA 3RNSA 2XKOA 5FZEA 3D8CA 3UGHA 2BQPA 2H0BA 5HCFA 4XCBA 4LUKA 2YMZA 3DEMA 5FO9B 1CR7A 2H6CA 1UO9A 3ES1A 4XURA 1DQ0A 3RZKA 3GHMA 1H2KA 4FQ4A 4KG8A 3OCPA 3ZXKA 4IW3A 5CFDA 1V6MA 4PF1A 1YCIA 2QQKA 1Q8QA 3AP4A 4M0NA 4GH4A 1L7RA 5LY1A 1NCQC 5ERLA 4QT6A 2BDRA 4Z07A 1GQHA 5F1RA 4FPGA 1YJLA 4LHLA 2SBAA 3ACFA 3WW4A 4D7YA 4BPZA 5CADA 1XRUA 1IGOA 4L8QA 1BQPA 1WWYA 4LKFA 5B2GB 2VZ3A 4D94A 1K5MC 2J1SA 4RFT0 5FMCA 2YXSA 1ZNPA 5AFBA 4AI3A 1NQJA 5C3QA 4KWKA 4MZUA 4DFSA 3FBMA 4C0BA 3Q8FA 1WUVA 3J7HA 2EXKA 1X9PA 3Q8AA 2BERA 2ARAA 3U78A 1G8WA 1IS6A 2XBO2 5K7PA 1NX9A 4KI5M 4NVPA 2NM1A 3GZEA 5AC93 2QBXA 1G9DA 1W6PA 1ZM1A 2WO2A 4GMP1 3KVBA 4QXKA 1BBT3 2TUNA 3LEMA 2RS52 4PQQA 5IFPA 1COV3 5K4LA 1O5LA 1V0AA 1H9WA 4YG3A 3ZFGA 4CU7A 2C1FA 3AYDA 1QMJA 4RHV3 1GOFA 1HRI1 2JE7A 2TEPA 4DXZA 4K8FA 4XETA 4URTA 3NO8A 1ND3C 3I2HA 4NAMA 2XJQA 2VTXJ 1OPOA 1BVVA 4Q4V2 3UESA 2Q4SA 1T6GC 2QDRA 4E9KA 4NAOA 4IE0A 1JHNA 3JBG2 2VZUA 4QX1A 2KA3A 3RYRA 2VZSA 4FVVA 4P9WA 2WYFA 1ZREA 5FKCA 2WC2A 3FLRA 3JUUA 4CVUA 2WS91 1QDCA 2VPVA 1NZIA 1DBNA 4Y22B 4YM1A 1O3QA 2Q8DA 3WF4A 4CRQA 2D5HA 1F5JA 1CJDA 4MGSA 5C3SA 2YUEA 5ANQA 1DQ4A 2JDMA 3NKGA 1W6OB 1S55A 3BOWA 4M0HA 1PMHX 2B8MA 1VBD2 1CAXA 2PAEA 4J25A 1WW5A 3NMBA 3OYWA 1UL9A 3DYOA 1SCRA 1OURA 1UXXX 3T0DA 1VJ2A 2EF6A 1SFNA 4M3CB 2DUQA 2NYYA 3MFCA 5M0TA 2DBIA 3OYWB 4CXYA 1DDLA 3AKTA 3T3YA 1MS3A 2V5YA 4GB33 5LRRA 1IQAA 5IVBA 1ULFA 3ATGA 3ABZA 1VBA2 2LTNA 1LULA 2JD9A 2RE9A 2XWJB 3RG0A 4IV3B 4E2SA 4OUEA 3H50A 2P34A 2XHNA 3AZZA 1LGCA 4IGOA 4XBNA 5FLJA 3VL9A 5F2SA 3ZYIB 2EIBA 1O3TA 2VVFA 3J4UH 1FV2A 1S2EA 1X50A 4B4PA 1G86A 5LW9A 1U5YA 1PNGA 2DFBA 1REDA 2WYSA 2XQRA 1PMIA 1OLME 4NPMA 3OGSA 4YVWB 3P1IA 5FZOB 3W58A 3LEIA 3ZM8A 5FXVA 5GLWA 3GBGA 4UF0B 1QJY3 2DVBA 1JU4A 2WSVA 4IV1C 3LE0A 3OF1A 3UK9A 4K8RB 4QPYA 1LCLA 4XFFA 1UN1A 4Q29A 1EAH1 3B69A 4YVWA 3SNMA 4XDPA 5J37A 2E26A 4YFZA 5JZGC 1JYVA 5KHGA 2OIIA 5I93A 4BB3A 3WINE 3ZXDA 3O1MA 1HJGA 3OUIA 2FMYA 1OT5A 1YIFA 3FHAA 4Q5OA 1HB4A 1DFQA 1N1TA 2J22A 5A7WA 4XF9A 2WAAA 5C4WA 2RS32 2XLFA 1QXRA 3O14A 2PLV2 2Y64A 1QF3A 1DZRA 2WNVC 4FAHA 1ZZ8A 2GP5A 1LEDA 4BA6A 1W3VA 3CZJA 5JMCA 3D0SA 4LO8A 3MUY1 4N7IA 1C8M2 1VLNA 2WO3A 2ZHMA 2GC1A 3ILNA 4MHRA 1J84A 3B93A 2BVBA 5BNQA 1CQ9A 2RS33 5FOJB 4FAGA 4BLJA 4XFCA 1W39A 1W8TA 1ZX5A 2DDUA 3I2JA 5DZFA 2UYBA 5E89A 4ZHNA 2SLIA 2DU0A 2XL9A 2PQSA 3UGFA 3MIFA 5IK7A 1XE7A 3LAGA 1YC61 1MQTB 1UZ0A 2XWBB 1UY0A 1ZZCA 3OBAA 3RSJA 4DNYA 3M3CA 3ZX7A 2GC0A 3ZXJA 1RGSA 2Z5WA 3OOXA 1OPMA 3UKVA 4S2GA 3WNNA 1MQTA 1RUJ1 2PXJA 2VW0A 2WFPA 5BNNC 4LIVA 2D93A 4YW6A 1Z7S1 2XOMA 1EV11 5JSRA 1V6LA 1Q8SA 1W06A 2GALA 2ZGOA 5DAQA 4BU2A 1WCSA 1VPHA 4TN7A 4ZY9A 1LGBA 1R092 4BIOA 3RZJA 1FOD3 1VBA3 1UZYA 3PUAA 2R32A 2ZX1A 1XNBA 4MSVA 2IFRA 3BUCA 4GB32 1NE4A 3JCIA 2BP6A 2BPA2 1AYN1 3POSA 5C33A 3RDIA 1K5JA 1D7PM 1QJY1 4KBZA 3VZLA 5H9PA 1W9TA 2QZ2A 2HWD3 3I3MA 1FNYA 4BJ0A 3IAPA 1LRHA 4EJRA 5DUVA 4HK8A 4AEDB 3W5NA 1UYPA 1VBD3 5FYYA 1GZWB 2E9QA 1ND2B 1VMFA 1WKYA 3KF3A 5T5JA 3I2GA 1C4RA 5F3CA 1AF9A 2BRTA 4PCRA 2ZX4A 3DF0A 1GZWA 2QQWA 4L9BA 5DDJ1 3INAA 1DGRA 4NJ4A 1POQA 3H7YA 4BDVB 1W8OA 5JI7A 3LOIA 3VKLA 2Y60A 3WF0A 3ZXGA 5LBBA 1PNFA 5JOYA 5EP9A 2Y8KA 5C4WC 1C8M1 3KB5A 3POEA 4YFWA 2Q30A 1RUE3 3JBG3 1VAKA 1DQ1A 1WCUA 4GJZA 2WQ8A 4C90A 1AX2A 4HONA 3UNPA 1UXZA 1W6QB 2EALA 1IKQA 1Y3TA 4Q4V3 5A3OA 1UQXA 4Y5SA 1AX1A 1PM7A 1Q8OA 1ZZ6A 5FY0A 1NCQB 1X9TA 2HWC2 2I74A 1E5SA 4OI2A 2XQXA 3VBUB 2ARXA 2BTVC 4RHV2 2VTFA 5FXXA 4CDQC 1O3RA 1D4M3 4UFKA 1FX5A 4FPLA 4BE3A 5T52A 3IBMA 1COV2 1HJFA 2VZQA 4N53B 5FJKA 1PZ7A 1EV13 1BK0A 5FP3A 5H9QA 4PQ9A 1UY1A 4QPGC 1BBT2 2Q5TA 3E1F1 2ZEYA 1I6XA 4NHYA 1UPIA 5KXBA 4P5HA 3DN7A 1ZRFA 5FPVA 5FKBA 1G9CA 2VAUA 5KHKA 5A32A 1HW5A 3LPFA 5IWFA 4B4QA 4CP2A 2A3YA 2WAOA 2BBAA 1LOAA 3M4FA 2JB8A 4GZ9A 2HWE1 4QAWA 1JXNA 3ALQA 5CFDC 3N4MA 1O7FA 3QCWA 3RWNA 1KEXA 1NLQA 5FUPA 4N7UA 4B4RA 1HIXA 2A75A 4QPGA 4I3GA 5FYVA 2P2KA 1SZBA 4H7MA 3PVEA 1D2SA 1LHVA 1ULPA 4CDXC 1AX0A 4LR4A 5FYBA 4DXTA 1N1VA 3TN93 3C8XA 1FI2A 4QXBA 2QVSB 2VZVA 3CZUA 4DS0A 3LOBA 1CZTA 4A42A 1NAEA 3MLKA 2P5BA 4CDWC 3B7MA 2G9GA 4Z92B 2ET1A 2MEV1 2Y6KA 4LKDA 3O1VA 1ACCA 4NOTA 3H8RA 4O9EA 3UETA 4YPJA 4E4HA 3WUCA 3AYCA 4OMCA 2DCKA 3JB8A 4D6RA 4QB6A 1H2NA 2ZA9A 1ZA4A 1CIWA 1ZBE2 3QH6A 5IAXA 5JAXA 3RZGA 3K75B 2IXIA 4RN5A 5FZ1A 3OUJA 5HCBA 2XJUA 4A6OA 1X82A 4PI2A 1E5HA 3H1WA 4AVSA 2QJVA 4WM7C 5EJZB 2CGOA 3RJRA 1G9AA 4QX8A 1QNYA 4Y1VA 4META 3WQ0A 2WNOA 5T3NA 3M3QA 3M3EA 1W8ZA 3IIIA 3P3PA 2JG9A 4KH9A 4YZ2A 1SPPB 4LORA 5CFDB 1H6YA 1MS5A 4DMIA 2Q1FA 3PU3A 2ZGKA 3QACA 2FDIA 4LQRA 4BYYA 1PVC3 4QB1A 4CTEA 4JQRA 2ZGLA 4YM3A 3CKHA 1AR63 4ZS3A 4JX0A 3UJOA 1Q43A 3VDDC 1Y43B 3THPA 4BLIA 5FQ0A 5A1FA 3VKNA 3WDUA 1SDWA 3BU0A 1LB2A 5KXDA 5KBFA 3TRSB 3A23A 5FQ0B 1LNSA 3O0WA 2Y33A 1KQRA 5I8YA 1DYKA 3L9JT 1TMF1 2G4IA 2H6BA 3MIBA 5FREA 3J7NA 3PURA 1Q8VA 2DU1A 2WZR2 1CAWB 5C9AB 1GNYA 2VUJA 2LALA 3OBRA 3L2YA 1H4HA 3IM0A 4NRQA 3OD4A 4YVWC 5LATA 4HT1T 5FYUA 1EV12 4EN7B 4FQZA 5JPNB 4S2HA 1SEFA 2R071 4GH4C 3SCHA 4G3YC 1X36A 1HXS3 2VCAA 4KMQA 4OHVA 3TN91 4CU9A 4Y20A 1RUOA 5AC91 1CVNA 2HWC3 5K0UB 3C7GA 4QKBA 4K20A 1VP6A 3POYA 1COV1 4RD7A 1G7YA 1TNRA 3PMEA 5FZ4A 4WM8A 2P6HA 4NIGA 1YFXA 1RUE2 3VKOA 1FPN1 4MGQA 3KHCA 2D6NA 1ASJ1 1OH4A 3LEKA 4X6QB 4OHWA 3ROUA 5A6XA 3HNMA 4IGPA 4J1XA 4NHLA 1CAVB 4LPLA 5A3MA 2V73A 1UOBA 4AE2A 2C5DA 3LWCA 3SH4A 4Y22A 1DIWA 4I3PA 1LHNA 5LA2A 4AI0A 3ZYGA 3MGUA 3U37A 4UWDA 3NV4A 4LLFA 4XIOA 4FPEA 4P02B 1XB9A 2B46X 3PL0A 4XUQA 1W6OA 4MYEA 4UW6A 4M00A 3E5XA 4QHOA 5L7OC 2PHTA 2XJTA 1AR61 1BJQA 1ODNA 4P9XA 2JG8C 2MNGA 2G9ZA 1AR91 3H1MA 3CJXA 2A5ZA 4B7EA 3IMNA 3T4VA 2JG9C 4PBPA 1EYBA 2ID4A 3PDQA 1V70A 2IWGB 1RVF2 4D6SA 4FPJA 1UYZA 2FZ1A 5DXDA 1BZWA 5L36A 1WMEA 1XNKA 3N7JA 3AJYA 1ALYA 2VMEA 3B00A 3MF9A 4CCNA 2IVIB 1GKBA 3BB6A 3WG3A 4K9SA 3JD73 2HWD1 1ZRRA 4CUCA 2KR2A 1PK6C 3HN3A 3MV11 3KSCA 1SDDB 3NNGA 1XU1A 2VR4A 1BMV2 4JDMA 4JKLA 3I2IA 1D0GA 4LBNA 2JECA 3KCYA 1UZWA 1XYNA 5AFEA 3AKQA 4H7LA 2D3SA 1AUYA 4LITA 1UNBA 3VD5A 5JXIA 4MGTA 5FYTA 1AL23 1VBE1 2PHDA 4QKNA 1S1AA 3KV4A 3WNXA 1RUH2 1O3SA 4FTSA 1E5IA 3ZFEB 1CX1A 1CAUA 3ZSLA 4GWJA 3ZR5A 3H3LA 1STMA 3H3UA 1EUTA 1Y7BA 5KXCA 3M8LA 1KFXL 1YQ8A 5CA6A 5FZHA 1FMD3 5A3UA 3UT0A 4WM7B 1GOGA 1HV1A 1MS1A 1U5IA 2AZ5A 2A71A 5CISA 4EYUA 1OC1A 5FK7A 3LD8A 1FV3A 4B7KA 4NIHA 1D4M1 2NZ9A 4I0WB 5IFTA 2YC0A 3HT2A 2VMCA 2OA2A 3PUHA 2RS31 2B45X 4LE4A 1ULOA 3VHRA 3WZ1A 4E8CA 2CNAA 1YIPA 2IXLA 2D43A 1AR93 1YUDA 2E53A 3B02A 3AKPA 5H9SA 2W47A 1J3QA 2R042 2JWPA 5F5CA 2UWBA 2X5IB 1ST8A 2RS51 3O5SA 5B4NA 4AVVA 3RRDA 3VB9A 4CXWA 2OQ7A 3IDAA 2JICA 3EO6A 4FP3A 4BXSV 5BNPB 1YFYA 5FIXA 3PUSA 5BUVA 2VC9A 2ZHNA 4LE3A 3S5QA 4XF0A 2PHFA 3RWKX 4Q0PA 2HWE2 4EQVA 4TLFA 3O1RA 2W68A 2HWB2 2R1DA 2VXRA 2XVKA 3HR9A 4M4PA 3BTZA 4ZS2A 1XNAA 2DCYA 2VZRA 4NUBA 2IVJA 1VBA1 4IEVA 5A80A 4AHZA 4TLGA 3OTFA 1WMXA 3MYXA 1MS0A 4QU1A 3AXEA 3HOBA 3U75A 3I3BA 4E8DA 1AYN3 2XJRA 2MEV3 3PVNA 4AEDA 4IUGA 3OGGA 2GNTA 1QU0A 2UY8A 3NV3A 3R4SA 4A7YA 3J26N 4F3JA 4YZ1A 1HRI3 4NHXA 3RZLA 1VBD1 1I1EA 2Y6JA 2ZGSA 3I3EA 3MPBA 1HX6A 4C0HA 3DYMA 2AEZA 4Y26A 5TSWA 4DOUA 4S2DA 2VVEA 1OXCA 4YARA 5FZFA 3BVCA 4HK9A 2RDNA 5LK7B 2VNOA 3HNBM 4LTAA 2CDOA 1OLQA 3WCRA 2V5DA 1UD1A 1X7NA 1ND2C 5J1XA 1CD3G 3E6BA 4HG6B 4CEYA 1H2MA 2VNRA 1RUE1 2I07B 2QQOA 4ZKTB 1IPKA 4EWEA 3NV1A 1VMHA 4HSJA 4LKEA 2RS53 1WBLA 5HI0A 5GLTA 4LHKA 3AMQA 3FUQA 1O8PA 1MEC3 2ZGMA 3WQ7A 5AC92 5A7OA 1PVXA 1NCRB 2HWB1 1GFF2 1OFNA 1MPXA 2D5FA 5HXVA 4TYSA 5FR3A 1W6NA 3J9SA 4COVA 1SCSA 1XC6A 3R4UA 2OPKA 2PAMA 4MGKE 3BALA 5LY2A 5FPXA 5FP4A 2IXCA 4UFMA 5CFCA 1OUSA 5J3UA 5FZDA 1W8NA 1RINA 3KVAA 2Y26A 2IXKA 5F32A 4DXRA 5GKAC 4AEMA 1R091 5FZAA 2VG9A 4UFLA 2BFUL 4UOJA 1PZ9A 5F3IA 3IN9A 5CZKA 1F15A 2XVLA 2BWAA 3O7OA 4YGCA 4FPOB 2E51A 4QX0A 4W6YA 3SKVA 1ONAA 2YB7A 4ZZ8A 1NQDA 1GWLA 5LEKA 3AKSA 4XACA 5FY7A 5IK8A 1PHMA 2RJ2A 2HEWF 2RVAA 2XUMA 1REEA 3POIA 4I0AA 3KV6A 5L9VA 2J1UA 2OX0A 2FDHA 1DZQA 5DAWA 1REFA 1BYHA 2Y38A 2UURA 5KHHA 1H8TA 5E1RA 4P5YA 4CDWB 1IS4A 4FPYA 2KM2A 2A6VA 3VHNA 4PIZA 5GLUA 4OMDA 5FTTC 3N7KA 3RI9A 5H9RA 2UYAA 3ZN4A 1ZBE1 3AFKA 1SBDA 1VRH2 3ZMNA 2VNGA 4XMIA 2H0VA 3G7DA 1EUUA 1S0BA 3AP9A 3DV8A 1KS5A 4Q4X1 1UKGA 4C91A 1R083 1V9U2 2HKXA 1LHWA 3OPTA 2IZWA 3NQHA 1PX3A 4Q1RA 3WY6A 1US3A 4K7JA 4C8DA 5JOZA 3O1PA 3VD9A 1MEC1 1HN0A 4RQPC 2JB4A 4HKOA 2JG9B 4YVSC 5JDBA 1NUKA 4XJWA 2WLQA 1RMU2 4AL9A 5FPBA 1V6NA 2WA4A 5JZGA 1W0NA 3G6JB 3LIGA 3VD7A 2OQ6A 2QQUA 4KNCA 1RUJ3 2XDVA 3KS7A 3J7LA 1QIQA 4I0BA 4WZCA 4YZ3A 4OUSA 4AFMA 5F7UA 2Y0IA 4R8HA 5K0UC 4BISA 5JVVA 2DTWA 3J8F3 2DWRA 1B35B 4QPIA 2W1SA 5C3RA 1K45A 1RUG2 1WGPA 4KBBA 3ZYBA 3BYWA 3MW2A 3CBNA 2ET7A 4L97A 3FUOA 4UFHA 5L19A 3KHBA 1QH6A 3K2OA 4XF1A 1TMF3 2ATFA 2P3JA 3I59B 1UMIA 1YO8A 4YGEA 4LLOA 1W2UA 4QX5A 3IKWA 1QQP2 4DXSA 5C9AC 2IXHA 4IEWA 2WT1A 2C9KA 4O7XA 1GQPA 5JI9A 1W2AX 5ABJB 1JZ7A 4ZONA 4HL0A 5K0UA 4FOVA 1W0PA 1TME3 5EJ3A 4N43B 1JZ4A 2W1WA 4XZUG 2AGSA 5EPAA 3TBDA 4BQXA 1UMZA 3VDBA 4YG6A 2WT0A 3N35A 3PJYA 2XJSA 4LBKA 2GC2A 4KL1A 4W6WA 3BU7A 3GCXA 2VXJA 4P08A 4RYDA 5BNNB 1QOSA 2GNMA 2ZS6B 1R081 4AG4A 1KDKA 3LQCA 4DZGA 2CSGA 2WWJA 4CU6A 5GZGA 5BNNA 3OSDA 3TEXA 3SQOA 1O91A 4NRMA 4A3XA 2XLAA 3NJYA 2I45A 4PJYA 3KT7A 4CU8A 1QQP1 4D7TA 2VL4A 4FI9A 5AVPA 5T54A 1JZ2A 4AVCA 3BCWA 4KWLA 2GH8A 1A6CA 4NHKA 1LKNA 1W9YA 4JCKA 5C8CC 3N9LA 4LBQB 5FFOC 4PLNA 4IE4A 4FFIA 4PF5A 5F39A 2RS13 1ENRA 4XDOA 4YYOA 4W50A 1MACA 2G1MA 4XUPA 4QDSA 5FUIA 1RC6A 4BXFA 2XKPA 2RMU2 3AXDA 3VBSB 2A73B 1V6JA 4XAAA 3THTA 2BGOA 3GZTB 4Q8LA 4AYUA 1JW6A 3AP5A 5FJHA 5DDJ3 3WOGA 1AXYA 1IZ3A 2C4XA 5JLVA 1S0EA 4YSFA 3AP6A 4COWA 5J09A 4M3CE 3WQ1A 5C7GA 4QKFA 2D3PA 1PGSA 2EXIA 4P9JA 2E32A 4Q4X2 3AFGA 1QJX3 3I49A 4LKSA 3AZXA 2VOWA 4FCAA 5EFUA 3W21A 4JQTA 1W9SA 3LKJA 4PHZA 1ZZ9A 3LIHA 3IAQA 5EWSA 2AENA 3AJZA 3GHNA 5GM0A 5ACA3 1ZYBA 3JZVA 3OPZA 4GMP0 1PGW2 3ILRA 2CTVA 3B01A 4MHUA 1I3HA 4AGVA 3A22A 1AL21 1VBE3 4XJZA 2Z4FA 4P9YA 4AGGA 4COUA 5FMOL 1ND3B 2G9FA 4MGYE 4CP1A 1CWPA 1JHJA 4YVSB 1AJOA 1RUF3 2HWF1 3VGIA 3S7IA 3ZYJB 2BZDA 2ZMKA 3LB9A 4YVSA 3C7FA 1SFYA 1VBE2 2RV9A 4Q8KA 4XC9A 4ZU5A 3VZMA 1UMHA 3LA3A 4IE6A 1FMD1 2C0ZA 5ACA2 1HKDA 1SACA 3I8TA 2YDEA 5C70A 1JTZX 5FZ7A 4BOWA 3QH7A 5CKMA 4Q0QA 1C5HA 4DEVA 3VN4A 1UY3A 4AQSA 3HN1A 5DG2A 2VULA 3ZPYA 2D7FA 5HCHA 3RQ0A 2Q1ZB 2X5IA 3AB0A 3E5QA 5A70A 2Q8CA 2XB6C 1LESA 5E6HA 1HB3A 2LW8A 2B42B 1VB2A 4R9AA 3SMHA 2PELA 4E27A 2B9UA 2B5HA 2W5FA 2XHKA 5BNPA 1DYPA 5CEHA 2Z2SB 2K2SA 4RS5C 4PT6A 1UOFA 5LB6A 5CAZA 3SHRA 1BHGA 4XFAA 5D8AB 1OF3A 1S0GA 5FMBA 2RMU3 2P3IA 3CO2A 4TSVA 2KD7A 1W2TA 1IHMA 4A45A 4AHXA 4BHPA 1VBC3 3FZ3A 1XQNA 4YW2A 2RS12 3JB4C 4QWNA 1HRV2 1W6PB 2HEVF 2MPFA 3APBA 4BQWA 4RR3A 4HPKB 2MHFA 5F37A 4QXCA 3BIEA 2VUAA 4QKDA 4XHXA 4BQ1A 4CA9A 1UOJA 4DRRA 2DFCA 5F2WA 3ZSEA 1FAYA 3PUQA 1VR3A 4Q0UA 4Q4Y2 2YHJA 1OVPA 4CCKA 4QD2A 3VBRB 4UI9L 3WEZA 5FY5A 3T0AA 2VBPA 1RUC2 5FV3A 1KFUL 4HVOA 1AR81 1CESA 4A2UA 1C57A 4RR3C 1N1YA 3NNFA 2TBVA 1ASJ2 1H1AA 3D3AA 1NY72 3W20A 4XPVA 1F5FA 2WNUA 2WS92 2C24A 2N7GA 5EYXA 2UY9A 4LO5B 5ISLA 2ADEA 3KD4A 5FAXA 1X8MA 4UFJA 2W46A 1TEIA 4EZ4A 1AJKA 2FCTA 2HH9A 3A21A 5J98B 1UCXA 2VJXA 4R9CA 3HNYM 1YYNA 3WT3A 4XTPA 1RUI2 4XABA 3Q8EA 4MGIE 1OLRA 1YRZA 3VBSC 1MS4A 4CDUB 5FPUA 2ZX3A 1UYYA
chains in the Genus database with same CATH topology
4I09A 1RL3A 5L7OA 4BM8A 4AFCA 3EJKA 3CU7A 4W65A 3R05A 5L7OB 2I2SA 3ES4A 3VBHC 1TMF2 2WQ4A 4Z8BA 2W08A 1X8EA 4NR1A 1ZRCA 2F6BA 2AYHA 2GN3A 2RMU1 3WLUA 1PO23 1PO12 1BXHA 2FBEA 5F6LB 1RUD1 3TYJA 1RUG3 4XF3A 4ITCA 4XFGA 1RMU1 1OOPB 5CB7A 2WLPA 3LZZA 2ZKNA 2BVVA 1KDMA 1O5UA 3UJQA 2RJLA 3BTAA 2BFUS 3ACLA 3AYAA 3JD71 4KQ7A 4JGZB 4N90A 1CPMA 3NJZA 4R9DA 4RSUA 1V00A 4K3UA 4BH9A 4Y1XA 4Q4W2 1H0BA 1JYIA 4JGZA 4AFDA 4LT5A 4C1WA 5IT6A 2B7YA 4PDWA 4QQ2A 2IXJA 2FQPA 4PIXA 3ZYRA 3ST7A 4PDWB 3AMHA 4GA9A 2AUYA 4XYXA 3RJ2X 4CDWA 4GH4B 1QXPA 2BGCA 4BCUA 1BVP1 4P9GA 2ZX2A 3U10A 3NSTA 1A3KA 3WP3A 3POWA 2EIGA 4MXVA 5I8TA 1F2NA 2VOVA 4AXOA 1LOEA 2WFF1 4Q4W3 2E7AA 3RS6A 3ZN6A 1NCRC 3VV1A 4MUVA 3OY8A 4QM8A 4JGZC 2X29A 1AR71 2RR11 1R1A2 3FJSA 2AR6A 3S0MA 1RVF1 4YW4A 3URFA 1TNFA 4A7ZA 1AR72 2RR12 1OSGA 1MZ5A 2K9ZA 3ZN5A 1PO13 5FCCA 4OHYA 3W9AA 4ISQA 4GMP3 4JRAA 1J3PA 1DGRN 3MLLA 1QDOA 1NXMA 1CN1A 4M01A 4RS5A 3BIWE 1KXGA 1GNHA 4XJUA 4YM2A 2NMOA 3QD6A 1XU2A 1QJX1 3I59A 3V0AA 1MEC2 5FOBB 3VBRC 3AK0A 1K5MB 4AFAA 2R063 3T1MA 4JTNA 3FE5A 5JIUA 1A78A 3MIDA 3U0ZA 4J1WA 1QJU1 4DINB 4SLIA 4FSJA 2JJ6A 2VH9A 5FO7B 4CDQB 4YM0A 4FOWA 3WV6A 3ZSKA 3NWKA 5F6KA 1ZRDA 3VBFB 3WHTA 4FT8A 3I4IA 5IK4A 1DQ2A 1H8TC 3RI8A 3A0NA 5E8AA 4OVEA 2VW1A 1NYWA 3KM5A 1JN2P 5KXEA 4O9GA 5IK5A 2FZ2A 2GDFA 4XE9A 5BY5A 3LA7A 5GALA 3CLPA 5GLZA 3VBHB 3WG4A 2PAKA 4HVQA 1ENQA 4GWNA 1OKQA 2JD4A 3VBHA 1GV9A 1SLLA 2NLRA 3GF6A 5EYYA 4CDXB 2XBO1 2DVDA 2HWB3 2A70A 4IV1A 1OFSA 4MVTA 3IPVA 4QQPA 2HWE3 2ZZQA 1AXZA 1CJPA 4WVMB 4UW3A 4CDXA 3KGLA 3VBOC 1C1FA 1FPN3 5EV7A 2QCSB 3AZYA 4WVMA 3QOPA 3L2HA 3N3HA 1OMIA 4Y4YA 4BMEA 3SITA 3WD5A 2O8OA 4A7KA 1RUI1 3AMNA 2R043 1DU3D 3H1YA 4AFBA 1F31A 3QLQA 1LOBA 4JGYA 4B29A 1AR83 4OI0A 3EXUA 1V6KA 3BODA 4UBHA 4XTMA 3E5UA 4R4XA 1OQDA 2X53S 4Q1PA 5BNOC 1PGL1 4ATFA 2A6WA 1LODA 5C6CA 3NKTA 4FO9A 1Z0HA 2DCTA 5CNAA 3AKRA 5KC5A 1BEV3 1QJX2 4Q4X3 4LBOA 2GAUA 2WNVB 4LBLA 2X8KA 5BNPC 1SQ4A 5D1IA 4DY3A 3I7DA 2GC3A 4EWAA 2EAKA 1XE8A 2ZGNA 2ETEA 3ZXAC 2GMEA 1ZVFA 3E6CC 2DF7A 1ND2A 4WVWA 1CAWA 1QWRA 1WD3A 2ZKLA 4GXLA 4J6GA 3UKNA 2ZGPA 1R1ZA 4YGBA 1VB4A 2HEYF 4Y1YA 3ZYPA 1EY2A 2ZABA 4RR3B 1OA3A 2BYVE 5CIRA 2DVAA 3WDYA 3ELNA 1WLTA 4XFHA 4RQPA 3VZNA 2QZ3A 3DL3A 4KG0A 4AI1A 2ZZJA 1Q3EA 4OFGA 3ZO0B 2HWF2 1XNCA 3TB0A 5BNOA 1SLBA 1NCQA 3IDCB 2LUWA 4Y5Z0 4DY5A 3VBUA 1MQTC 3D6EA 2WWSA 3ZXEA 4LO4B 4HVRA 4MXWA 2VQ0A 3GALA 3H0OA 1V6IA 1E57A 4N53A 3SISA 3DKWA 3ZFGC 5C8CA 1FATA 4MXWB 1A8DA 5CG8A 2YV8A 3MIEA 2P17A 2WFF3 4Q4W1 4NHMA 1D4VB 3KMHA 1ENXA 3LA2A 4GIQA 1CAXB 1H4GA 4K6BA 3WDVA 4CEWB 2EXHA 2D97A 1W6MB 3AP7A 4U36A 2VOKA 4YLZA 4CDUA 3PLQA 1QQP3 1UU6A 2ZMLA 4CEWA 4MGZE 5CG9A 3JQWA 2D3RA 1N47A 5GJ6A 3X29B 2DVFA 4XW3A 5DG1A 4OHZA 4TWTA 1H9PA 1JYCA 3FFZA 4LA3A 2FHRA 3USUA 3V65A 2WZR3 3ZMOA 3JU9A 1D2QA 1JOJA 4UBGA 1UW8A 1RUJ2 1XNDA 1VIWB 4AVAA 1U5ZA 2VY0A 4GKYA 1UAIA 1J58A 2WIIB 1DG6A 5J48A 1OHFA 1J59A 2CGPA 2DUOA 1AR62 1H1IA 1LHOA 1LTEA 1QH7A 1G6NA 2ZPXA 4D69A 1MS8A 2ZTNA 4FXGB 1QNWA 1QJU3 2WZPP 4YW5A 1N3OA 4MLOA 1R082 2XG3A 1QJZA 1S0DA 1YNAA 5T5LA 1VRH3 4LBQD 2BEOA 1WLCA 4AVTA 4I02A 2PFWA 1XYPA 3CL1A 4Q0SA 4AVBA 4AW7A 1WCDJ 1UF2C 2NQYA 1FPN2 3NW4A 4LHNA 4FPCA 1RUF1 1EAH2 4GKXA 3R6SA 5F9TA 3N7MA 2O0OA 1IS3A 3GZUC 4Z1VA 2RS11 3I54A 3WHUA 2GNBA 2W52A 5I0RA 4BIFA 5JSPA 1C8NA 1HRV1 2Z42A 3TN92 1FOD1 4HN1A 2VVDA 4IL7A 4WV8A 5JWPA 2NP0A 1YI9A 4Y20B 1N3QA 3BOPA 3WW1A 4AK3A 5GZEA 1X33A 4EN9B 4LBMA 4XJ9A 1ULGA 5J7MA 2ERFA 2E7TA 1H30A 2ZJCA 2XJVA 4RS5B 2GSYA 1VAVA 3FLPA 1APNA 1LGNA 5KWRA 5DZGA 3V0BB 3N36A 3MW3A 1DGLA 2TNFA 2Z79A 1CAVA 1DGWX 2ZHLA 4NN0A 3V0AB 1A8MA 2AH2A 4OULA 1WW6A 2EVXA 1UKRA 3UV9A 3IDBB 1D4M2 1K5MA 1I9RA 4QGLA 4XXAA 1VRH1 4YW3A 1UIKA 1URXA 1FXZA 1OOPC 3MFAA 4AEDC 1KD7A 1C5IA 1AHSA 2PHLA 3PTYA 4DQAA 3B9CA 5GZDA 2K0GA 5FLHA 1OD5A 2BNMA 5I0SA 2E6VA 1WLWA 2GNDA 1EPWA 2BWCA 3H9AA 1GBGA 3VKFC 1HRI2 5FLIA 4COYA 1NA1B 4AGRA 2OZ6A 3KCCA 1ULCA 5CVRA 2CV6A 4CEYB 1RJ7A 3IIAA 2WT2A 2R16A 1NA1A 4L99A 4INDA 4TZDA 3SLIA 1AYN2 1AYM1 1R1A3 1UPSA 2Y0OA 3R4DB 2PHWA 4CEYC 3SXWA 1BCXA 3GBWA 4D3WA 2HWD2 4IEUA 3I2DA 4CDUC 1LOFC 5KC6A 5A32B 1SLAA 3IT8A 4H14A 4JAAA 2WJSA 3LCPA 4IV1B 4BZ4A 1EAH3 2F4PA 1DHKB 1R093 1SMVA 4FPKA 2ZX0A 3TWIA 5C4WB 3ECQA 3WP6A 3ZFEA 3AMMA 3ZIWA 1B35C 3NL1A 1CAUB 3M70A 2V09A 2W39A 2ZGQA 5KHJA 4N9HA 4HKLA 2D6LX 1RUNA 4QQOA 3WW3A 4QPIC 3ZFFC 3P3NA 4FP2A 3VHOA 4AEKA 4RHV1 4AI2A 4ES8A 3GYDA 2DCZA 1NG0A 1HLCA 3S6PA 4NWWA 1TQ5A 1QJU2 4H3WA 4PLMA 2DV9A 2A6ZA 1JUHA 2DUPA 3T1LA 2O8QA 2ZHKA 2UWAA 4XEZA 2DURA 4G9SB 2PLV1 3WVJA 1O4TA 1PK6B 4XF4A 1GNZA 3K51A 3U4XA 4RL7A 1PK6A 2JE9A 1IPJA 4NWVA 2NN8A 4JVAA 2PHXA 4ASMB 1WW4A 1D0HA 1GICA 4Y24A 4WBBA 2JDZA 2CL2A 1PO22 3ZFEC 2GH2A 2PHUA 3GZAA 4XFBA 1H2LA 3E6DA 4IEXA 2A6YA 3KLSA 1QJY2 1WCKA 2IFWA 5JZGB 1S0CA 2QE3A 5SV8A 1S0JA 2B39A 1NA1C 1HXS1 3MLJA 1YXWA 2WFF2 4FBFA 2ENRA 3AM2A 4HFSA 3MZHA 1NZCA 4JC1A 1RHI1 1RVF3 1WBFA 1CX4A 1LOGA 2NMNA 4LULA 5ACA1 3V64A 5JOXA 4SBVA 4K21A 4IESA 2PQQA 3SCFA 3LSEA 1EP0A 4K40A 4UW5A 2D6OX 3O0XA 2CAUA 2R30A 1ASJ3 4HN0A 1UU5A 1LJ7A 4EROA 4MV2A 2HWF3 2Q8OA 4H55A 5ABJA 1TME1 2Q1MA 3MIGA 3RYPA 1DQ5A 1W6QA 3SH5A 4LBJA 4WM8C 5HCAA 3WDWA 3ZDSA 3MDPA 5A33B 3AMPA 4Q4Y3 4WZFA 2R061 2UWCA 4GALA 2JENA 1WA4A 4PLOA 5GZCA 3GNEA 5A33A 4WVVA 4Q0VA 3VLBB 3PNAA 2WKKA 1M4WA 4XJ8A 1OI6A 2E63A 4XXPA 1KJLA 2GU9A 3DPRC 1GZCA 5FRAA 2ZGRA 4ATEA 1VBC2 5FBZA 1DLLA 1WW7A 3S7EA 1QOTA 1W6NB 4XQ4A 4ONUA 4P9LA 4JRLA 3MPPG 4XFIA 5I0UA 4ES9A 1LHUA 4BWOA 1W6MA 4DPNA 1HXS2 2VW2A 2PN5A 2VMHA 4Z82A 3TAYA 1Q8PA 4B3NA 3WR0A 5FPZA 1ENSA 1OQEA 3C2UA 1MZ6A 1BEV2 3AZWA 4HANA 3VL8A 1U12A 1OQ1A 1GANA 1YI7A 4OI4A 1YFWA 3NV2A 3MIHA 4YW1A 1HQWA 4ZU4A 1YFUA 3H8UA 2UU8A 3QBQA 4BMBA 3D82A 3U07A 1LOCA 5LRSA 3ETQA 3HD8B 1WLDA 3A4UA 2D44A 4JTOA 3V56A 3MICA 4XHBA 3KCXA 1AR82 2P3KA 2QDNA 2C9AA 3FMGA 3U11A 2YGLA 2VGDA 2AREA 3WCSA 4QQLA 2BNOA 3CEWA 2VECA 1ZBE3 3MF6A 4GULA 2CWMA 4XJAA 2XPJA 3M1HA 4WM7A 5T55A 1QXJA 3VDDA 1BK1A 4EN0A 1MZFA 4RGGA 5DDJ2 3IDEA 1ZZBA 3B94A 4Q4V1 2O1QA 2ZBJA 1AVBA 3CJIC 3DUIA 3VDDB 1I5ZA 1GLHA 5C9AA 1IOAA 3PVBB 3RMXA 1B35A 4QPIB 2JX9A 4D7SA 3OJBA 2BBVA 2A3XA 1BEV1 1Q5OA 3WG1A 4M3CF 3ZIXA 3PJQA 4N43C 4RA0A 1FNZA 3VBUC 3ENRA 3H3ZA 3KQRA 1YHFA 1OA4A 1POV0 2A6XA 3ZXLA 3J8F1 1ZZ7A 3FHIB 3N7LA 2ILMA 3M7AA 4EN8B 4WM8B 1VBC1 4AF9A 5E88A 4N43A 1GYKA 2D6PA 3HWJA 2RJKA 1PIV1 2W0XA 4AHYA 4OZXA 3R0RA 1GQGA 5EZWA 2YPJA 2CY6A 4HPKA 4G4FA 3ZVXA 4AQ2A 3V0BA 4N9IA 3ZSJA 4FXKB 5T5PA 3WX5A 2D98A 3CJIA 3RZZA 1N3PA 3GBFA 1KITA 3CJIB 2R062 2R49A 4X6RB 3VZKA 1LR5A 1POV1 2QFEA 4I01A 1B09A 1TME2 2OUHA 3JQXA 1NOVA 2WNEA 4Z2WA 3DPRB 4AEJA 1VBB3 3VBFC 2VOXA 4OHXA 1VAMA 2DCJA 1PIV2 3HQXA 3B3QE 5J96B 2DYCA 1RHI2 4NO4A 4IV3C 2YROA 1WMFA 1AR73 2RR13 4K1ZA 1G9FA 1SBEA 2VMIA 2WINB 3J8F2 4UXAA 2CWSA 4P14A 1PO11 3ILFA 4OI1A 4YZ5A 4JGYC 3NAPA 4HMZA 4L11A 1AXKA 5IUQA 3FFQA 3TNPB 4C1XA 1PVC1 1Z7S3 3NAPB 3BPZA 2DVGA 4Q27A 1XXNA 5LK5A 1AYM3 1EPZA 1R1A1 2OYZA 5E16A 5BV6A 1RUD3 3KZ4C 3EQEA 1FOD2 3HBZA 1DGWA 4IEPA 3AZVA 5K9YA 2LM3A 1OOPA 2CAVA 4EN6B 5FMOS 4KGGA 5DUXA 2R073 4YNIA 4B8EA 3B5LB 4IXLA 1S0IA 1PZ8A 4U2AA 2HWC1 3WDTA 5FDBA 2BW8A 2JEMA 4FOQA 1RUC1 4W6XA 1GSLA 3VKMA 3SH3A 1H8TB 3TNQA 1VBB1 5AVAA 1LU1A 4OLLA 3Q9OA 4R4ZA 5JSOA 4JDNA 1ULDA 1C8M3 4PBOA 4R9BA 3DGTA 5I8SA 3JBG1 5JIAA 4XILA 3D5OA 2GMPA 1U5XA 1JBCA 5D8AC 2PLV3 3ZXFA 1MR5A 2XL7A 4E2QA 5I91A 1QHDA 2DTYA 2VU9A 2XVGA 1C1LA 1H8VA 4YRDA 3ZSMA 5K8SA 1F8VA 1GZ9A 3RPQA 3KT1A 3WW2A 2Q0AA 4XMAA 3VBOA 2WZR1 5D8AA 4K1YA 2A3WA 1RB8G 4CP0A 4WVZA 4YGDA 1LEMA 2BUKA 2QKDA 1MVEA 3ZN6B 4AWDA 2R1BA 3VBOB 2YGMA 1JH5A 1NXD1 4YG0A 5L73A 1MVQA 3OY8B 2D40A 1N1SA 3OD0A 5JPMB 2RHPA 3ZFGB 2P37A 1RUI3 1Z78A 2JKBA 2RM23 2ES3A 2ZAHA 2R041 3AX4A 1QGLA 4F83A 2EA7A 4DB5A 1KJRA 3O12A 1SLTA