4YM2A

Crystal structure of the human galectin-4 c-terminal carbohydrate recognition domain in complex with lactose-3'-sulfate
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
138
structure length
138
Chain Sequence
PTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Galectin-4
publication title Structural characterization of human galectin-4 C-terminal domain: elucidating the molecular basis for recognition of glycosphingolipids, sulfated saccharides and blood group antigens.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 31
structure length 138
sequence length 138
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ym2A00
2A75A 2JD4A 1W6MB 2R1DA 2VY0A 5EXOA 3D5OA 2D6LX 2PHRA 3A0NA 1FX5A 4YGDA 2G4IA 4LBKA 4LBQA 4YGEA 3BOPA 2AREA 2A6YA 3B69A 1BQPA 1ENSA 1WBFA 3PVOA 4UW5A 1OFSA 3N36A 3QLQA 1HLCA 1O4ZA 4WZFA 4Y26A 2A6WA 2EF6A 4Q8LA 2DUPA 2D44A 4GA9A 4XJAA 2D3RA 3O12A 5T5OA 5CA6A 5CAZA 3IM0A 3VUOA 4K1ZA 4XIOA 1LGBA 3HMYA 1HQWA 4XTPA 3WV6A 3WDWA 5JOZA 2DVBA 4I30A 3PVNA 1ZM1A 4JRAA 2OUJA 2OVUA 5AVAA 1CJPA 1LU2A 4YG0A 4GALA 2A5ZA 2UWBA 4K21A 1WUVA 3GNEA 1W6NB 2VU9A 2ZHNA 1UKGA 3FLPA 3NV4A 4Q2FA 5DUWA 2A71A 1UZYA 3WDVA 1FNYA 5F9TA 2EALA 5T52A 1RIRA 4ZKTB 1LHVA 1VALA 2NN8A 1MS4A 1GZWA 4ATFA 4YZ5A 3AYDA 1W6OA 2ZGOA 3N7KA 1X50A 3O0XA 2GNDA 4FPHA 3POSA 4R9AA 1AXZA 2A3XA 3AXEA 4XJ8A 3RSJA 5EYXA 2SBAA 3ZSMA 2ARBA 1GANA 1CR7A 4LBJA 1ENRA 1GNZA 1VAMA 2PHXA 4ISQA 5GZCA 1LENA 4AGGA 5GZDA 3O0VA 3I4IA 3M2MA 3WUCA 2ES3A 5KXEA 1DHKB 5DZFA 1LJ7A 2EXJA 2R1BA 5JOXA 2TEPA 1DYKA 2WLQA 3AJYA 3POWA 5IK5A 1C4RA 1VIWB 2A6XA 3ZXLA 4FPOB 3ZYPA 1JN2P 2ZHMA 3CNAA 2ENRA 3A4UA 1NLSA 1V6JA 1YXWA 2JDZA 1WD4A 4XIKA 1IKPA 1DQ5A 1SFYA 4FPGA 1LHNA 1CESA 1PZ8A 5H9SA 1BYHA 4F83A 1VLNA 1LECA 2HYKA 1G9FA 3ZVXA 2I2SA 2A70A 4MYEA 4DRVA 5T55A 4XJUA 2DVFA 4YZ2A 1RITA 4LBLA 3VKLA 3WDXA 1GNHA 5KXDA 1MS9A 2BQPA 4BMEA 3B3QE 1NXD1 2ZABA 2GMPA 3PVEA 4RA0A 4XBNA 2A6VA 1SBDA 1RINA 5LK5A 4YW5A 1G9BA 1MVQA 2VW0A 5GLVA 1IS5A 1JOJA 1GZWB 3AFKA 4XHXA 3WG4A 2VUAA 4K20A 2C9AA 4DRRA 2JE7A 1QNWA 1QOTA 1MVEA 2CNAA 2CY6A 3KM5A 3N3HA 3OY8A 4GKYA 1DZQA 2EXKA 5DUVA 4FOYA 2EXIA 1UN1A 2DYCA 2GMEA 3AYCA 5GLTA 2NZ9A 3AP9A 2D6KA 3W58A 1LEDA 1WCSA 1BXHA 4Y22B 4BMBA 3VKMA 2D43A 2OUHA 2P37A 2ZGMA 1Q8VA 5JVVA 3RQ0A 3ZPYA 3ZXJA 5CBLA 2WJSA 1G9AA 1MZ5A 4HL0A 2D7FA 1QMJA 1V6IA 3USUA 5IT6A 4ASMB 3BTAA 3LSEA 3IN9A 3WCSA 1V6OA 4D69A 2NP0A 4XILA 1WLWA 2EIGA 1YRZA 2P3KA 3AP7A 4YW4A 3SNMA 1AXYA 4AVTA 2ZHLA 2YXSA 2D6NA 1QDCA 1AVBA 2E6VA 2PELA 3NWKA 1WLDA 1N3PA 3AXDA 5SV8A 3WZ1A 1ULDA 1FNZA 4DQAA 3WHUA 3V65A 5IK4A 3OYWA 4XBLA 4P9XA 1AZDA 1PZ7A 4XJWA 5CNAA 4FPCA 1G8WA 1ULFA 4Y24A 1KDKA 4M01A 3DGTA 1I3HA 1LOFA 2ZGUA 4M3CF 1UL9A 3FBYA 1DIWA 4WVWA 3VKFC 3D4KA 4XJ9A 1DQ1A 3IPVA 4H55A 1W6PA 1O4YA 1V6MA 1V6KA 2DUOA 2D6OX 2V73A 3APBA 3LCPA 2AR6A 5DXDA 3T1MA 3UJQA 4GWNA 1H30A 4HANA 4XTMA 1MR5A 3VKNA 1D2SA 2NMOA 4NOTA 3UJOA 3WVJA 5BYNA 1GBGA 1F5FA 4P9YA 3SH5A 3R4SA 5JOYA 1URXA 1LULA 3D6EA 1FV3A 4P9WA 2V5YA 4KBBA 5E88A 4GKXA 4YZ1A 3SH4A 1LU1A 3M3QA 1Q8QA 1W6QA 3WG2A 1JBCA 3N7MA 1MS0A 1N1VA 2P2KA 2PHWA 1LHOA 4Q26A 1IS3A 3AK0A 1C57A 4Y1ZA 2KM2A 1F9KA 1SBFA 1AJOA 1B09A 3RMYA 3OYWB 2WT1A 1LTEA 2E7QA 2DTYA 4XOGA 3IMNA 2WT0A 4YFZA 2ZBJA 3T1LA 1GYKA 2C5DA 1WLCA 1FAYA 5FRAA 1R1ZA 1SLBA 1OQ1A 3IPVB 1W6PB 1AF9A 1UZZA 4OZXA 3AP6A 4BM8A 2GALA 4C1WA 1OKQA 2DV9A 3MEPA 1YO8A 4WVVA 4YM3A 3M3CA 3ZSJA 2ZGTA 3INAA 3ILNA 4LBQB 2SLIA 3N7LA 2ZKNA 3N7JA 3NV3A 1YIFA 2YMZA 1S0CA 3M1HA 3OGGA 1S0JA 1LOEA 3AZZA 1F31A 4YZ4A 4FP2A 3POYA 4YGBA 2DURA 1S0FA 1W0PA 1DQ6A 4YGCA 2LTNA 3BIWE 3MW4A 1N3QA 2GN3A 3WOGA 1QDOA 4AGRA 4CZSA 3AZVA 2B7YA 4Y1XA 4YM2A 2AGSA 1WW7A 2CWSA 4FQZA 2GNTA 3U4XA 2A3WA 4R9DA 1Q56A 2D6PA 3AZYA 1DYPA 5EYYA 2YROA 1Z0HA 3SISA 1WW4A 1N1SA 1BJQA 2WSUA 1W6OB 4NO4A 3WDYA 1WW6A 1SACA 1CPNA 3Q9OA 1QGLA 4YM0A 1SLLA 5GJ6A 3RG0A 5DG2A 2CTVA 3WLUA 1ULGA 2PHUA 2ARXA 1APNA 4P14A 4YFWA 4DS0A 1MS5A 2ERFA 4ATEA 4AWDA 4AVVA 2A3YA 1V6NA 2DVAA 5DUUA 4CTEA 1S0DA 3WCRA 3WDTA 1QNYA 3OBTA 1LOGA 3WG3A 1LGNA 4U2AA 5IUQA 1DFQA 4PF5A 3H0OA 4R9CA 3AZXA 4YW1A 4XBQA 4FOWA 4FPYA 3MW2A 4XJZA 1LESA 1ULCA 2D6MA 1UX6A 3AX4A 1V6LA 2XB6C 5GM0A 3NV1A 4LBNA 1AX2A 4FPLA 3V0AA 3O0WA 2GN7A 3FLRA 4GWMA 2GNMA 2AENA 1A78A 3RS6A 3GALA 2R49A 5H9RA 2WKKA 3R05A 1UPSA 1Z78A 4YW3A 5HCAA 4LBQD 5GLUA 1WD3A 4CRQA 3UL2A 1N47A 1SLIA 2P34A 2ZA9A 4YW2A 2A6ZA 5GZGA 2DWRA 4ISRA 2E7TA 1Y7BA 2W52A 1DQ0A 3AP4A 2NMNA 1KITA 2FMDA 3TAYA 2AH2A 2ZMNA 4GXLA 5DUXA 4JC1A 5GZEA 1Q8SA 1CVNA 2ZHKA 4XYXA 5JDBA 1MZ6A 2ZGPA 4XE9A 4XXPA 4Q1RA 4Q27A 4W65A 2JJ6A 2CL2A 1JHNA 1H9WA 3OY8B 1DBNA 4DPNA 1H9PA 4L8QA 1IOAA 1MACA 1S0BA 1KDMA 4AGVA 4AYUA 4IQPA 2ZGQA 2EXHA 3FFZA 1DQ2A 3WDUA 4Z8BA 2JECA 2R16A 1C1LA 3MPPG 4Y1UA 2LALA 2Z42A 3TB0A 1G86A 2CWMA 4XHBA 4M00A 2ZGSA 4LBOA 5T5PA 5IK8A 3USUB 1HDKA 1KJLA 3AJZA 2RHPA 4YG3A 1TEIA 3WUDA 1QOOA 2ZZJA 4UW6A 1W0OA 3KQRA 3RMXA 3ZXKA 4XXAA 3ILRA 5L73A 3I8TA 3PJQA 3V0AB 3HN1A 3SH3A 3JU9A 2ZAAA 3ZSLA 4PQ9A 3ZSKA 1YYNA 1UMZA 5IK7A 3O5SA 1ZA4A 2NM1A 1CIWA 3AZWA 4PCRA 2ZGKA 4AVSA 2UU8A 2XG3A 2AYHA 4FPEA 1A8DA 4BOWA 3A0KA 5T5LA 1I1EA 5T50A 1GV9A 1A3KA 1GSLA 1S1AA 1AJKA 2VH9A 4XMAA 4ZXKA 3V64A 3VKOA 4JCKA 3B9CA 3WNXA 4SLIA 2W39A 4FOVA 3DUIA 3SLIA 1FATA 5KXBA 2JE9A 2E53A 1SLTA 3W59A 2YY1A 1MS8A 1MS3A 3QCWA 4FQ4A 1WW5A 3BODA 1KQRA 2YZ4A 5FREA 1IS4A 2VXRA 2A7AA 2W68A 1HKDA 2WT2A 3R4UA 3LSDA 4UW4A 4M3CA 4BLIA 1D0HA 1G9CA 3IKWA 1U0AA 1JXNA 1GLHA 2ZGNA 4Y22A 5HCFA 3T2TA 3V0BA 2DU0A 2ZMLA 3C2UA 4BPZA 4Q1PA 4RL7A 3VV1A 1S0EA 1LOAA 2PHFA 1W6QB 1SLAA 2DU1A 2VW1A 4FPFA 2VW2A 4YZ3A 1LCLA 3N35A 3OBRA 2D3SA 3PMEA 4YG6A 2UURA 3ZYRA 4FPKA 2ZACA 1S0IA 2WQZC 4FVVA 4Y1YA 1BZWA 3WG1A 1N1YA 5DZEA 2ZMKA 2R0HA 1QF3A 1VAVA 2GNBA 5KXCA 4TZDA 2DTWA 1CN1A 1DLLA 4M3CE 4R9BA 4XZPA 5JLVA 3FUOA 3SITA 2UWAA 5T5JA 4LBMA 5E8AA 1DQ4A 4Y1VA 2DVGA 4YLZA 4PBPA 5DZGA 1PZ9A 3AP5A 1AXKA 2ZGRA 1IS6A 2GDFA 4FP3A 1XQNA 3JUUA 1N3OA 1GKBA 1QOSA 3ZXFA 4FPJA 4BLJA 3UK9A 5GALA 1LOBA 1LEMA 1JYCA 2FHRA 1MS1A 1QKQA 3ILFA 3M3OA 1J1TA 2P3IA 2PHTA 2JKBA 2E51A 2WSVA 3AYAA 1CONA 2DVDA 3NV2A 4XMIA 4Y20A 1KJRA 1LHUA 3ZXEA 1N1TA 1WBLA 2Q5TA 2R0FA 4U36A 5CB7A 4XDQA 1W6MA 4PBOA 3MW3A 4YM1A 5H9QA 1CPMA 1SCSA 3RRDA 3OPZA 1BKZA 1ULEA 1C1FA 1UAIA 5F5QA 1ONAA 5JMCA 1HQLA 1QU0A 2NYYA 3FUQA 4M3CB 5GLZA 1LGCA 3M3EA 1V00A 3V0BB 2D3PA 1LHWA 4FOQA 1S0GA 3HR9A 2AUYA 1Q8OA 3OJBA 1JUIA 1SCRA 1FYUA 2H0BA 4K1YA 4WV8A 3AYEA 2W08A 4C1XA 2UWCA 1G9DA 3ASIA 1SBEA 2GMMA 1G7YA 2CYFA 3ENRA 1W6NA 1EPWA 1YI7A 5E89A 4TYSA 3B00A 5GLWA 5GZFA 2EAKA 3WHTA 2P3JA 1CQ9A 1LODA 5T54A 5H9PA 1AX0A 1LOCA 1GICA 1IKQA 4Q8KA 2ZGLA 1Q8PA 1AX1A 4UW3A 3FLTA 1GZ9A 2DUQA 2WNEA 3ATGA 1KRIA 1GZCA 4ITCA 1DGLA 5EWSA 5HCBA 1LOFC 5DG1A 1JYIA 3L2YA 5JOWA 1FV2A 1ENQA 4DFSA 2YV8A 4Y20B 1JW6A 1SLCA 3B01A 4BQ1A 2OW4A
chains in the Genus database with same CATH superfamily
5JZGA 3VB9A 3O7OA 1FXZA 5C4WA 2XVGA 2A6YA 2DF7A 1BQPA 2JIGA 3NJYA 1QY4A 1D2QA 1OFSA 3N36A 5EJ1B 4JKKA 5C9AC 1H8TC 1MEC1 4ASLA 2A6WA 4WZCA 4EZ4A 3P5BA 4LHKA 5CA6A 4LHSA 4QDSA 4N53C 4N90A 3KCXA 1XSQA 3KV4A 5A6XA 2WUHA 3K3NA 1YI9A 5F6KA 5FZOB 4HPKB 1CAVA 4QPGB 4YRDA 4MXWB 3SEEA 3LOBA 2VZPA 2JDNA 4YG0A 4GALA 2VCBA 2XXZA 3GNEA 4DXSA 4Q2FA 3I2IA 1PMIA 2A71A 5JSOA 3NVCA 5FZIA 3UKTA 3WDVA 1BMV2 3AKTA 3UKVA 1LHVA 2NN8A 4NIDA 4YZ5A 3AMQA 5ANNA 3VHRA 3N7KA 1C3HA 1Z7S2 1YIPA 5JCTA 4XFIA 1TNRA 5FP3A 4RQPB 4A42A 4FTSA 3POSA 3POGA 2A3XA 3ZSMA 2SBAA 4NPMA 5KHGA 1CR7A 1VAMA 1DZRA 3MGUA 2PHXA 4Q4V1 3CBNA 1O5UA 2C6SA 5JWPA 2JG8B 1AYN2 4GJZA 4Q0SA 2QQWA 5IWFA 2R1BA 5JOXA 5I91A 1GOHA 2WLQA 3AJYA 4R4XA 1HJGA 4CUGA 3R0RA 2R30A 5L9VA 2HWF2 2WABA 2A6XA 4PLOA 4JTNA 3ZYPA 1PGL2 1YFUA 1ZRIA 4NWWA 2ENRA 3A4UA 3RYPA 4WVMA 1VBD1 4BQYA 4QKDA 1NYWA 3LFIA 4EN8B 3P3NA 3PUSA 1UU6A 1SFYA 2O8QA 1IHMA 2H0VA 4JGZC 4LE4A 4HLTA 1LHNA 1VLNA 1LECA 4GAZA 4COUA 3MFCA 2J1VA 2WWSA 2W91A 3FN9A 1D7PM 3ZXDA 2ADDA 3VKLA 2RJKA 2X09A 1YCIA 5L9BA 5KXDA 4OZOA 3HWJA 2XUEA 4BMEA 4IEOA 3PVEA 2GMPA 4W6XA 1ZRFA 3BI3A 1G9BA 1RINA 1PK6B 2RDSA 2FD8A 3C7HA 5FZ4A 5HXVA 5JSPA 3AFKA 3WG4A 5L7OB 3POFA 2VUAA 2HWE3 4P9IA 3VDAA 1QNWA 3OY8A 1MVEA 3I3MA 2RE9A 4Q4X1 3CU7A 5DUVA 2P3YA 4XF3A 2V09A 2VVDA 1RJ8A 4NPRA 5GLTA 2Z4FA 3RZZA 1S55A 1BEV3 2XONA 4B29A 1LEDA 1LRHA 3U1XA 3R6SA 3V56A 4OUSA 5JVVA 3ZPYA 3RQ0A 3ZXJA 5CBLA 3O1UA 1I9RA 4HN1A 2QFEA 3VDDA 4XFCA 2PYTA 1H2MA 3USUA 1V6IA 2VMEA 2BEOA 2B9VA 4UFKA 3VZMA 1O8SA 1V6OA 3WCSA 4XILA 3ZFFA 1WLWA 1YRZA 1HW5A 4ZU4A 2RMU2 2YXSA 4ES9A 1GOFA 3WZ1A 1FMD1 1N3PA 1WLDA 4NMIA 1FNZA 2VAUA 5CFDC 5IK4A 3OBZA 5K0UC 5DMYA 1PZ7A 5CNAA 4FPCA 1RUJ1 1G8WA 5BNPA 2Q0AA 3GHMA 4RGAA 1KDKA 3VD3A 4WM8A 5CEHA 3DGTA 1I3HA 3IIIA 4D0QA 4S2DA 5JDBA 1DIWA 3D4KA 4D3WA 1UU5A 2IXJA 1EPZA 1GMMA 1TQ5A 4XF0A 2P6HA 1R083 2P4EA 1W28A 1MQTC 4A6OA 4QXBA 2D6OX 3PJYA 2QNKA 3IBMA 3UJQA 3DYMA 2WNVB 3BGAA 4IV3A 1MR5A 4Q4W1 5FZMA 4QB2A 1D2SA 2Y64A 3URFA 2EA7A 5FK7A 1AR61 3NNFA 3NAPB 4P9YA 4QX0A 1REDA 5FO9B 4I0AA 5LRSA 3CEWA 4IGPA 1FV3A 2OZJA 2TUNA 3EXUA 2V5YA 2JDYA 2MNGA 1RUH2 4LA2A 4NHMA 2HWE2 4KG0A 1Q8QA 1W6QA 1YQ2A 2BV4A 2CV6A 1VPHA 4J1WA 2WZR3 5EP9A 4NIIA 4Q0PA 1N1VA 3ALQA 3DCQA 2XWBB 3S7IA 3AK0A 1BEV2 2G9ZA 3LD8A 2K9ZA 4CCDA 3EB7A 1AJOA 2QZ2A 2FBEA 3N9OA 2VOXA 4TXWA 2ETEA 3GZUC 1NA1A 5DDJ1 3LEMA 2E7QA 5BXXA 1H6YA 4YFZA 2FDIA 2ZBJA 3T1LA 2C5DA 2VBDA 3F2ZA 4NHXA 2DCTA 5FPBA 4E2SA 5A32A 3EHKA 5F7UA 2ID4A 1O59A 5A6ZA 1FAYA 4GMP1 5FRAA 5A6YA 4LO4B 3WX5A 3KV5A 4C91A 5FZLA 3BVCA 2R071 5AFEA 5LY1A 2Q8EA 3IPVB 1AR71 4PIZA 3DL3A 1GQGA 2HWC1 3C8XA 3TEWA 1AF9A 4OZXA 2OQ6A 2QBXA 4ES8A 2GALA 2IXIA 2JG9B 3CO2A 3F95A 4I01A 4L97A 2P5BA 1YO8A 1US2A 1YFYA 4LO5B 4WVVA 3O1RA 5JXGA 1UNBA 2HBTA 2SLIA 3N7LA 1XNCA 2XJQA 3PU8A 4AFBA 4F3JA 1ND3B 1YIFA 4CA9A 4W6YA 1NE4A 5FMOS 3FFQA 2XJRA 5CFCA 3RZKA 3AZZA 1F31A 3S5QA 4IEVA 2PFWA 4YZ4A 1VJ2A 4FP2A 1RJ7A 4DY5A 4YGBA 2VZUA 3S0MA 4XQDA 3KB5A 1CAUA 5FWJA 3GCXA 4JGYC 4AHXA 3BIWE 4BA6A 4D7YA 2FZ1A 3J8F3 4AI3A 4CZSA 3THDA 3U37A 1ZZ8A 1PVC1 1W0NA 2XPJA 1J3QA 2G1MA 1ZNPA 3KMHA 2EIBA 5L36A 3SISA 3K4ZA 5LA1A 4HSLA 4QHZA 3KVAA 4CEYA 2QQPA 2R041 3M8LA 3E1F1 1SMVA 4EJRA 4NO4A 3WDYA 2XWJB 1SACA 1QJX3 1QGLA 1VMHA 1SLLA 2K2SA 4HETA 4NVPA 1NXMA 4QPWA 1B35B 1X8EA 1UZ0A 1VBA1 1W03A 1ULGA 2DBIA 4RHV3 2X05A 3WNNA 2W94A 2WZR2 1OSGA 3MIHA 5A1FA 4OQ8A 2ARXA 1APNA 1Y3TA 2CAVA 4P14A 1F35A 3ACLA 1BK0A 3BB6A 3R4DB 4CE8A 1NOVA 4XAEA 4CTEA 1W8TA 1H6XA 3ME2A 1QXRA 1FI2A 5ACA1 2ADEA 3WW3A 4GH4C 5FLIA 4WM7A 3VBFC 4ARXA 5F39A 1HB3A 3FHAA 1PO23 3I2JA 3H8OA 4NRPA 2C24A 2GZWA 1V6LA 3NV1A 4LBNA 4QU2A 3RWKX 4AW7A 3V0AA 5A1AA 1QJU1 2GNMA 1DGWX 5M0TA 4QM9A 1NKGA 2VOTA 3ZXAC 4RR3B 3BIEA 1Z78A 5CKMA 2Y0OA 5APAA 2VMIA 5HCAA 4OI4A 1WD3A 5ABJC 4MO3M 1WCQA 4AEJA 4G4FA 5IVVA 1CGPA 2A6ZA 4F7ZA 5FZOA 2W52A 4I0WB 2NMNA 3VBSC 5GZEA 3T4HB 1HV1A 1UIKA 2ZHKA 4XYXA 4COZA 1R1A3 1AR83 1MZ6A 2ZGPA 1QJZA 1W06A 4Q4Y1 2XBO3 4MHRA 4X6QB 4XE9A 4E4ZA 5F37A 4Q1RA 4J6GA 2OA2A 3KHBA 2E9QA 4LUKA 4DY3A 2X29A 5A7NA 3PL0A 2ZX0A 4XF1A 3TWIA 3J8F2 5EIYB 1MACA 1OD5A 4AGVA 4IQPA 1Q3EA 4XFHA 2JECA 2R16A 2YC4A 4RS5C 2CAUA 3TB0A 1CIYA 3SEPA 2W2IA 1UOFA 2VZQA 3ES4A 4M00A 2F6BA 4Q0QA 1SFPA 4MX3A 4AG4A 4S2GA 4HKOA 5F3IA 2PHDA 5C8CC 2JG8A 4C0HA 4UFLA 1HDKA 1VMJA 1QJX2 2WNUC 3AJZA 2RHPA 4TLFA 1TEIA 4IEZA 3ZIXA 2V5DA 3T2QA 2ZZJA 4JKLA 3NW4A 1JI6A 2BERA 2ZJCA 3QH7A 4CDUC 1CZSA 2JX9A 4P5YA 1AL23 2ZAAA 1R091 3K46A 3MIBA 4IGQA 2RJ2A 4COYA 3CJIC 2MEV3 1UMZA 2XOMA 3WSOA 4HONA 4YSFA 5IK7A 2NM1A 2RS13 1OD3A 4QDRA 3MIFA 4NHKA 2XG3A 4OHYA 3MDPA 5E6HA 4BOWA 5LZ6A 5T5LA 4N7UA 1RUE1 2EVXA 1RUI3 4ZXKA 1EP0A 4ZS3A 3V64A 5FDBA 5JPMB 1PO22 2BNOA 1IZ3A 1I6XA 3ZFGC 2W39A 3DUIA 3OSDA 1FATA 2PTMA 5EJ3A 2DCYA 1SLTA 3I54A 3LEGA 2RS51 5FLJA 4MGIE 1PK6A 4QKFA 1HV0A 1MS8A 3K2OA 1ODMA 4DZGA 3W5MA 1BBT3 4IV1B 4LK7A 4W50A 2YZ4A 5FYVA 1OH3A 2WN2A 2ILMA 3LSDA 1TNFA 3HNYM 1IQAA 4OHVA 2Q30A 5BNOA 1W05A 3IKWA 4ZZ5A 1U0AA 1NCRC 2LRPA 3V0BA 1R1A2 1AR82 3DXTA 4AZZA 3TN93 2XBO2 2ZMLA 3C2UA 3DYPA 4BQXA 4IDZA 4RL7A 4XPVA 2PXJA 3WQ7A 1S0EA 1IPKA 3KD4A 1LOAA 2Y38A 2WFF1 1H1AA 1RUD1 1LCLA 3OBRA 3K77A 3TNQA 1UF2C 2QTWB 4MOAA 4Y33A 4FPKA 1FPN1 4QPYA 4QQLA 4BE3A 5IHRA 1H0BA 2RJLA 2ZACA 5FXZA 2IUWA 3ZLIA 2JENA 4EROA 2WYFA 5DZEA 2WWUA 1TE1B 3J7MA 3UKNA 2R0HA 3OEBA 5KXCA 1RB8G 1EV13 2DTWA 4JAAA 2IC1A 3CLPA 5FBJA 4E2QA 1ULPA 4QGNA 3SITA 4KG8A 1J83A 4AFAA 2K0GA 4LBMA 4AFDA 4KMQA 4B1LA 1V70A 2DVGA 4Y4RA 4YLZA 2IFWA 3GZAA 4KU8A 1PZ9A 1AXKA 2ZGRA 2JD9A 1N3OA 4QQHA 2VOWA 4DXRA 5BNNC 3OGRA 3AL5A 2Y33A 4P9GA 1HRV3 1CAXB 1MS1A 1AL22 1J1TA 2PHTA 3AYAA 1ST8A 4NPLA 3OGVA 1CONA 1OT5A 2MEV2 4Y20A 1JS9A 3I97A 4AXOA 1BK1A 2XJTA 1WBLA 4U36A 2X5IA 2QZ3A 5H9QA 1HXS3 3MW3A 4AEDB 5JUVA 1SCSA 2WZEA 4CU8A 1W39A 1IGOA 1UAIA 4CCLA 5F5QA 1CX4A 3U75A 2NYYA 4M3CB 4CXWA 5GLZA 3HT2A 4BK5A 4CEWB 1LGCA 5A7SA 3TOJA 3AC0A 2D3PA 3NAPA 3MPBA 2CDPA 4CCKA 1H1MA 2Q8DA 4WV8A 4XZUG 1BBT2 1CWPA 3WP3A 4K9SA 2UWCA 1XE8A 1ZZ6A 2W46A 4IE4A 3U11A 4ZS2A 1YQCA 2CYFA 3ENRA 5LBFA 4COWA 1W6NA 4BIFA 2WINB 1MZFA 3B00A 3OUHA 2J1RA 1COV1 4AFCA 1CQ9A 5FAXA 3D0SA 3J7NA 5T54A 4E4DX 4TSVA 2ZEWA 2FQPA 3Q8EA 1GICA 1MEC3 5A7QA 3U10A 4Q8KA 5CKNA 2Q1FA 1Q8PA 3ZFEC 2JICA 3FLTA 4AQTA 2WNEA 1GZCA 4ITCA 1DGLA 4UT5A 5HCBA 3ST7A 4CDXB 2B9UA 3NKGA 5DG1A 1ND2B 5C5UA 1Y43B 4HVOA 5JOWA 1FV2A 1RGSA 1OH4A 1IQDC 3TBDA 3JZVA 5C7GA 1RMU1 1JW6A 2J1UA 2QQOA 4BQ1A 2JG9A 1EV12 1ULOA 1UYZA 2JD4A 1W6MB 2XL9A 4BB3A 2R1DA 5EXOA 3KCYA 5JZGC 3BKZA 2PHRA 4CYDA 1NY72 4IW3A 2G4IA 1W9SA 1D4VB 4DUVA 5C4WC 3RFRA 4BQ3A 1WBFA 3PVOA 2PAMA 4UW5A 2XH6A 1HN1A 4LHNA 3VBUB 4MGTA 4Y26A 1HRV2 2EF6A 4Q8LA 4QAWA 5FP9A 5A6QA 3BTZA 5T5OA 2LM3A 2CSGA 3IM0A 1VRH2 4K1ZA 3FJSA 4GULA 4Q4V3 4XIOA 2OXBA 5DPNA 4BZ4A 2QQJA 1HQWA 2VMCA 3T08A 1X9TA 3WDWA 1HXS2 2DVBA 2IVJA 3IDAA 4GMP0 2VOKA 2OUJA 2WAAA 4MVTA 1LU2A 3GZTB 2A5ZA 2UWBA 1WUVA 3NV4A 5F2SA 1UKGA 2WS91 5DUWA 2Z2SB 4LUMA 3AMHA 2OX0A 5T52A 1RIRA 3UESA 4ZKTB 1OC1A 1XU2A 1ZRDA 3AYDA 1VBD3 3ZN4A 3I2KA 2VG9A 1X50A 3O0XA 1V9U1 1JZ3A 1AXZA 1PGSA 4XJ8A 2WAOA 2WZPP 2ARBA 2RS11 1GNZA 2WN3A 1UMIA 4ZZ8A 1SHWB 4MADA 1XJAA 4DO0A 5GZDA 4K6BA 3I4IA 4BU2A 5FMBA 2ES3A 1G6NA 1XNTA 4L0PA 4XFAA 2ZXQA 3MBWA 2QDRA 5JI9A 1ASJ1 1MEC2 5FZ3A 3WNOA 2HEYF 1WMXA 3ZXLA 1JN2P 3OPWA 4OMCA 2ZHMA 4PDWA 5FUNA 4BQ4A 5D8AB 2QQIA 5C9AB 1C8M1 5J96B 1NLSA 1H8TB 4JX0A 3QH6A 4IL7A 4XIKA 4NAOA 2IZWA 2QJVA 1RUG1 1TVGA 3D0JA 5LEKA 4F83A 1VBE1 2BGPA 3MV11 5H9SA 2HYKA 3CZUA 4SBVA 1WMDA 1ZZCA 2I2SA 1YEWA 2B46X 4MYEA 4RR3A 4XJUA 4DRVA 4AVCA 3VLBB 4YZ2A 1OBNA 5B4XA 3N9QA 3PVBB 2LROA 3E6DA 4LBLA 3TN91 4G3YC 1GNHA 4QWNA 5F32A 1OQDA 3RVHA 1YHFA 2BBVA 2FDHA 3B3QE 4XBNA 4HK9A 5FMDA 4JKMA 2A6VA 4ZU7A 5LK5A 4YW5A 2VNVA 1MVQA 5LB6A 3OGJA 4CUAA 3WP5A 4IE5A 1JOJA 1GZWB 1OA3A 1XNKA 4O9EA 4XHXA 1FMD3 4K20A 3OF1A 2C9AA 4Q4V2 3LF7A 2CY6A 4GKYA 4PI2A 2VNOA 5FYHA 2FDFA 3VBOA 3O1MA 4FOYA 3ZXGA 1PM4A 2DYCA 2YDEA 2OPWA 4B1MA 4QKNA 2YUEA 2VXJA 1RUJ3 3AP9A 3VBRC 3ON7A 2D6KA 4N9HA 4XFGA 1BXHA 4LULA 3T0AA 4MGSA 2XUMA 1Q8VA 4NAMA 1OOPB 5JR2A 2HWD1 2IXKA 1MZ5A 3VDDC 1G9AA 1V0AA 1VBD2 3VD7A 4FFIA 3SKJE 4ASMB 3IN9A 1HB1A 1WCDJ 2J1SA 3ZFFC 4BK4A 2EIGA 4AVTA 2BTVC 4YW4A 5LY2A 1AXYA 4K8FA 1BLZA 2ZHLA 2D6NA 2VZOA 1E5SA 3MHZA 3WF2A 4DQAA 1ZRRA 1ULDA 4HVRA 4FTBA 4Q4W3 4XCAA 3AVSA 3KSCA 1UXXX 4JHTA 3VZLA 1AR63 4XJWA 2PAKA 3KGZA 1JODA 4IEXA 5BNPC 3VBHB 4WM8C 2EIEA 2VMGA 3OTFA 1H2LA 1YFXA 4YVWB 4OVEA 3CMGA 5A3LA 3EO6A 4Q4X2 3T4VA 3GBWA 1JOBA 3KQ4B 3H7YA 1OXCA 1O7FA 3P3PA 3LCPA 5LBCA 5DXDA 3T1MA 3ETQA 2HLEA 4IV1A 5DAXA 1H30A 1K5MC 1WWYA 4IV3C 5DDJ3 3IMMA 4YW6A 1JUHA 4J1XA 3VKNA 4ZHNA 4CDWA 5BYNA 1X33A 1OPOA 1F5FA 4GMP3 5FXWA 3SH5A 2XLGA 5FPUA 1URXA 2R073 4P9WA 4BCUA 3FX3A 1AR73 4LKDA 5A3PA 1FMD2 2HWC3 4DIQA 4I02A 3VHNA 4KI5M 5LK7B 5JI7A 1JBCA 3GGLA 3N7MA 1MS0A 4KWLA 2YHJA 1JYWA 1RUJ2 1VB4A 3ZKYA 1QQP1 1C57A 2B8MA 4JVAA 1GP4A 5FBZA 3RMYA 3OYWB 1D4M1 5K0UB 1NA1C 2GP5A 4JZRA 3DPRA 5FYMA 4CCMA 1JOPA 1GYKA 3D3AA 3RZLA 1WLCA 3TYJA 3U07A 4M4RA 4E4SA 4QHOA 1DG6A 2F17A 1RC6A 1LKNA 2J7MA 3PUQA 1JU3A 2RG4A 4AI9A 1W6PB 1PVC3 1UZZA 4IEPA 3AP6A 4BM8A 3I3EA 4WVZA 1YFWA 2DV9A 2VZSA 4LORA 2YPDA 2FCVA 3RWNA 3M3CA 4LKSA 2ZGTA 1C8NA 2HWB1 2R043 2D40A 3KVBA 3N7JA 1O3QA 1IPSA 3JBG1 3ZN6B 2YMZA 4LNVA 1NZCA 1S0CA 3RI8A 3FHIB 4OHXA 1EUUA 3H8RA 3T0DA 2BYVE 1UQXA 5CFCC 1LOEA 4UFJA 1R64A 4A3XA 1VBA3 4KBZA 3FHQA 4H3WA 5I0RA 2DURA 1W0PA 1DQ6A 4ZY9A 5CG8A 3MW4A 1OF4A 1N3QA 3S5AA 3WOGA 2V4VA 1QDOA 4HXCA 4AGRA 4P5HA 3AZVA 3VD5A 4UAPA 5DDJ2 2WYSA 1WW7A 5F3EA 5ACA3 5FYIA 3NL1A 2ET1A 2D6PA 5EYYA 1DYPA 4Z1VA 5A3OA 5FPXA 2ZEXA 3KT7A 5A3TA 1WW4A 2XVKA 4CEYC 1TME1 4LT5A 2PAEA 1BJQA 4AF9A 4AQ6A 3MO4A 1W6OB 2R072 4D94A 3RYKA 4YM0A 1AR72 1QJU3 2BPA2 2VTFA 2HWC2 3KS7A 4MGKE 1OLQA 4OMDA 1X36A 1GWLA 3VBRA 1Y4WA 1JH5A 2E63A 3IDCB 2DFBA 3I2FA 4B4PA 4ATEA 3BPZA 2GC0A 5JAXA 3DN7A 1V6NA 1SDWA 1J3RA 4JRLA 3G7DA 3CDZB 3PMSA 3M4FA 2VUDA 2Z69A 1LGNA 3HQRA 4FFHA 3OUJA 4Q4Y3 2QUOA 3FL7A 3AZXA 5FZDA 3B93A 4WM7C 2CGNA 4JDMA 4FOWA 3MW2A 4EWEA 2J1EA 4N43B 2D97A 1UX6A 4XF4A 4MUVA 3ZO0B 4R8HA 3WNPA 3ZOIA 3O0WA 5K4LA 4FI9A 3PTYA 4XETA 4AI2A 3VBUA 4S2HA 1PVC2 2R49A 2VUJA 1M4WA 5LASA 4LEJA 4AR2A 2F4LA 4YW3A 2VZTA 4LBQD 4ONUA 1N47A 1POV1 2R042 2VR4A 2P34A 4OHWA 1AHSA 3NKTA 4KQ7A 5FZ6A 4AAXA 4AQSA 4KWUA 1P8JA 2DWRA 5FZ0A 5C71A 3SQOA 1DQ0A 3AP4A 1KITA 3FE5A 4MV2A 2AH2A 3UYJA 4JC1A 4EWAA 1Q8SA 5JXHA 1CVNA 4YVSB 1NLRA 1VBA2 4GWIA 4PIXA 4XXPA 4W65A 2JJ6A 3NSTA 2CL2A 1JHNA 2JDMA 1F5JA 1H9PA 1K5MA 1R093 1ZZBA 1TG7A 3MFAA 3ORJA 2Y6JA 4QD2A 1PIV3 1IOAA 1S0BA 4XF9A 1KDMA 1O91A 3FFZA 2EXHA 3J4UH 1DQ2A 4O7XA 4GD4A 4NIHA 1C1LA 1WMFA 4FXGB 1W2UA 2XQRA 2QE3A 5ACA2 2XR4A 5C3RA 2CWMA 1RUE3 2DCJA 1Z7S1 4H7MA 2NQYA 4Y5SA 3W9AA 5LATA 3ZYBA 5IK8A 1YUDA 2JG8C 1W9WA 5A7WA 5FY1A 4TLGA 3ZYIB 1QJU2 1YQ8A 4GH4B 1LR5A 2RS53 3LEKA 1QOOA 1W0OA 4QT6A 3CQOA 4XXAA 1XC6A 1C5HA 3H8UA 3PJQA 4LQRA 4N9IA 5D8AA 3JU9A 4PQ9A 4ORFA 3ZSKA 1ZREA 3PIJA 3HEIA 4NRMA 3E5UA 1XYPA 4PCRA 5A33B 2ZZQA 2O8OA 2C26A 3HN3A 2ZPXA 4AVSA 1X7NA 5B2GB 3DYOA 4FPEA 2CU5A 4I0BA 4MH0E 4Q4Y2 5I8TA 5A3UA 3L2HA 1UKRA 4XMAA 5J36A 1ZA7A 3HNBM 1OQEA 1DZTA 3OGSA 3VBSB 4CDQB 4SLIA 4FTEA 2WFF3 1VRBA 1OFNA 4FOVA 2XVLA 2Y6HA 3SLIA 4WBBA 1RUD3 4AAPA 1PX4A 4P08A 4XFBA 4RFT0 4RSUA 2KXLA 5TSWA 3KGLA 5FP4A 1PK6C 2VMHA 1FPN3 2VULA 1S2KA 2YY1A 5FK8A 1MS3A 3QCWA 3GYDA 4LLOA 5FZ1A 4AHZA 5L7OC 4C8DA 2XJUA 4XQ4A 4GZ9A 2VXRA 3POBA 1HKDA 1DYOA 2DCZA 2BRTA 3R4UA 4YWAA 3VHPA 3LGRA 3K4AA 3H9AA 1D0HA 4NIAA 3I7DA 5BNOC 2HBUA 3N4MA 4AI1A 1R082 1L3JA 3T2TA 2WO1A 3NMBA 3BTXA 3ETPA 4HK8A 4LR4A 5FY5A 2FMYA 4LO7A 1XNBA 2WNUB 4RGGA 1OOPA 1RUF1 2BP6A 3VV1A 4BHPA 2QVSB 2VQTA 1R092 5FKBA 3DKWA 3DXUA 1W2TA 4YZ3A 1YQ5A 2D3SA 5F3GA 3MV01 2UURA 5BNQA 5FOJB 1E5HA 4I09A 4FVVA 1RUE2 3CJIB 2ZX2A 3ROUA 3A22A 4TZDA 1CN1A 1DLLA 4M3CE 5F6LB 4FBFA 2Q1ZB 4L9BA 1QIQA 2W1WA 1POQA 3EYPA 3NJZA 5E8AA 1DQ4A 1YLLA 5T5JA 2Y6FA 4FT8A 2RS52 3PUHA 3VBHA 4QGMA 3CZJA 1QOSA 3ZXFA 3UK9A 3OG2A 4YVWA 1UPIA 1LEMA 1UZVA 3M3OA 3ILFA 4UWDA 2WSVA 1LNSA 1X82A 1I5ZA 2JKBA 3ZXEA 1XYOA 4W8JA 1L7QA 2GAUA 4DUXA 1N1TA 2Q5TA 5CB7A 5DQ0A 2X5IC 2XKOA 4PBOA 4XDQA 2B42B 4CP9B 3I59B 3RRDA 1COV3 4QX3A 3AKPA 3OPZA 3MLJA 1ULEA 1QEXA 1OA4A 1W8NA 3HD8B 1J59A 3LEIA 4UF0B 2WFF2 2XHKA 4DXZA 1ZVFA 3MLLA 4MGZE 1LHWA 1E5RA 3NAPC 1A34A 3HR9A 3TEXA 5E16A 1VBB1 2F4PA 1JUIA 1FPN2 5AFBA 4YNIA 1FYUA 5C6CA 1NCQB 4OFGA 5FZ7A 5K9YA 5LEJA 4HFSA 1RMU3 3J7LA 4HPKA 3ASIA 4QPGA 4MXWA 4B4QA 4OLLA 1YJLA 4E4HA 1F2NA 4BQWA 4A4AA 3IT8A 1WMEA 1UY1A 3AMNA 5BV6A 1KD7A 2OT7A 1A6CA 5CIRA 1OI6A 2P3JA 3WHTA 1GNYA 5JXIA 4B7EA 1QHDA 2IWGB 4YYOA 1IKQA 4RQPA 1AYM1 2BW8A 4AHWA 1PNFA 3GF6A 4LIUA 2DUQA 4QQPA 5EWSA 2WO2A 4M0HA 1LOFC 4QPIB 3USSA 4EN6B 5BNNB 1JYIA 3HAGA 2CGPA 2RS31 1FOD1 1IG0A 4GQ7A 4DFSA 3B01A 4URAA 2JG9C 2WS93 2D6LX 4A7ZA 2XL7A 4OYUA 4XC9A 5ANQA 3OBAA 1EUTA 4YGEA 3ZYFA 4NE9A 3BOPA 3VZKA 4RHV2 3B69A 3ZN6A 2JXAA 2XKPA 2XJVA 1W8HA 1ND3C 3AKSA 3LA3A 1V9U3 1XE0A 1O4ZA 2VNGA 1PIV1 4MZUA 4XJAA 2D3RA 3O12A 5BPXA 3S30A 5LW9A 1WA4A 1LGBA 4XTPA 4CXYA 2XGXA 2VECA 4KWJA 3WV6A 5C8WA 4H14A 4I30A 1XPWA 4QQ2A 5AVPA 3PVNA 1ZM1A 1COV2 4JRAA 3NO8A 4Z2WA 4D6RA 4DOUA 2DFCA 2I45A 5ERLA 3BPSA 2VU9A 1ASJ3 2ZHNA 4Z82A 5FPAA 5KC5A 1VMFA 3ES1A 1UZYA 4NHLA 4Q0UA 2EALA 2ZS6B 4QX5A 1W8UA 4M4PA 2VCAA 1PGW1 1VALA 1MS4A 3K51A 1C8M3 1K3IA 1ZZ9A 3ITQA 3ZIWA 4ATFA 1W6OA 2ZGOA 5L7OA 3LIGA 1CD3G 1RUG3 4CVUA 4FPHA 4R9AA 4XFFA 1WKYA 2KR2A 1VBE3 3LPFA 1RMU2 2UY8A 3AXEA 5DAQA 5EYXA 1GANA 1B35C 3UGFA 4LBJA 3B7MA 4ISQA 4LMFA 5GZCA 4AGGA 3MIGA 1W8FA 1W9FA 5IATA 3WUCA 5KXEA 4ZONA 4YPJA 1DHKB 1LJ7A 1EAH3 5JZGB 2TEPA 5IK5A 1A8MA 2OZ6A 4OULA 1UYPA 1C4RA 1H2NA 5C4WB 5FZAA 4XCBA 4FPOB 2VL4A 1MZEA 3LA7A 4JHZA 5KC6A 4PDWC 3CNAA 3VD4A 4N43A 1JZ7A 1YXWA 4D8MA 1J58A 3HT1A 5F3CA 1RVF1 1XOYA 3I3QA 1CESA 1PZ8A 1LAJA 4QX2A 1PMHX 3ZVXA 3RZHA 1G9FA 2RV9A 2B39A 3AKQA 5HCHA 1F4HA 2WS92 5CU1A 4RR3C 1PM7A 3CKHA 5D1IA 1CAVB 3ECQA 4MG2A 3WDXA 3MYXA 2HWD3 3SXWA 4CP0A 1ZBA1 1MS9A 1Q5OA 2BQPA 4EZHA 1KFUL 1NXD1 2ZABA 2G19A 2UY9A 4RA0A 5LBBA 1V9U2 2AZ5A 3TEYA 4W4ZA 1IS5A 2YPJA 4B8EA 2JDPA 2B5HA 2RS12 3EJKA 1H4GA 2ARAA 4O65A 3WR0A 2JE7A 1QOTA 3KM5A 4DEVA 2WDBA 3IDBB 5FQ0B 5KHKA 2WNVA 1DZQA 2EXKA 2RDNA 4DNYA 1RUI2 3MI8A 3VBOC 2EXIA 1UN1A 5C5TA 2GMEA 2R063 4LO6B 2VZRA 2GC2A 3LWCA 2GC3A 3G6JB 4Q0VA 1ASJ2 2IVIB 2OIIA 4MHUA 3VKMA 2OUHA 2GH8A 3LZZA 2ZX4A 2WBKA 4IXLA 2A1XA 4HL0A 1C8M2 2D7FA 4ZXEA 5F8PA 3ZYGA 3LSEA 2CHHA 1POV0 2QDNA 4D69A 1JU4A 1RUG2 1ZYBA 4COVA 1VBE2 4HZFA 5FOBB 1DP0A 3WY6A 3QD6A 2E6VA 2PELA 4WVMB 5SV8A 3O1VA 4YW7A 3VD9A 3TN92 3H1WA 3PURA 4O61A 1AZDA 1ULFA 4Y24A 3DF0A 3WT3A 1W90A 4CU9A 2GU9A 4M01A 4CUCA 1UXZA 1JYVA 1TMF1 1RUC1 4E9KA 1LOFA 1T2XA 3ZMOA 2ZGUA 4M3CF 4KGQA 3FBYA 4WVWA 3UT0A 1RHI1 1DQ1A 3IPVA 1VBC1 1JMUB 5FIXA 4CDQA 1JHJA 4F8AA 3N9LA 1V6MA 2QQKA 1V6KA 3C3VA 3WNMA 1ZZ7A 1XE7A 3AM2A 1UY0A 3NNMA 5AC91 5IFPA 2VQUA 1QQP3 2V73A 1QXPA 5F5AA 2Q8OA 4IV1C 1CAWB 1D4M3 4MLOA 4XTMA 1ZBE1 1ND3A 2Y6LA 2HWD2 1UO9A 2JWPA 2NMOA 4I3GA 4NOTA 3WVJA 2VD7A 4CDWC 3BUCA 5CKQA 4C0BA 2CGOA 4TTGA 2Y34A 5JOYA 1UYYA 2HH9A 3JD71 1LULA 4GB31 1BCXA 4IGOA 4JQTA 4NHYA 3VL8A 3Q8CA 2YYOA 3VDDB 4META 2J1TA 2VC9A 1DF0A 4KBBA 2DBNA 5E88A 3I3BA 1QJY1 4GKXA 4YZ1A 4Y5Z0 3X29B 3ZFFB 1LU1A 3M3QA 3WG2A 3BOWA 5CG9A 3ELNA 1WCKA 1ODNA 5F1RA 2HWB3 4Q26A 5JXJA 4K7JA 3JBG3 2KM2A 3K75B 2RDQA 1W2OA 1JYNA 1HIXA 1LTEA 4IUGA 2KA3A 2DTYA 2HEVF 3IMNA 4XOGA 5KHIA 2VCCA 3DPRC 1OPMA 5A70A 4K40A 5BNPB 2YGLA 1QJEA 5FZHA 5JR7B 4WM8B 3N9MA 1SLBA 2C0ZA 1B35A 5IVEA 1D0GA 2VBPA 3NRUA 1OQ1A 2J1AA 3W21A 2RM23 3E6BA 4XDOA 1W9YA 1W9TA 3VZOA 4C1WA 2Y6GA 3HIFA 1ACCA 2WC2A 5FLHA 1OVPA 3INAA 3ILNA 4LBQB 1W2AX 3B5LB 1TME3 3NV3A 2C4XA 3PIGA 1JZ2A 4LOSA 4AVAA 4NIGA 3GZEA 4NRQA 4N7IA 3T3YA 1M06G 3M1HA 4XUOA 3ZKUA 3OGGA 2YGMA 1S0JA 2DDUA 4H7LA 3WQ0A 2YC2A 3B02A 3IIAA 3W20A 3POYA 4N53B 5FZ9A 3IZOA 2WLPA 1O6UA 3BCWA 2TBVA 4YGCA 2LTNA 1QQP2 2HEWF 2G9GA 2VVFA 1HRI3 3QBQA 1NCQA 3OEAA 4XUNA 2PHLA 4Y1XA 1D4M2 3AB0A 4YM2A 2CWSA 4FQZA 5J98B 1EAH1 4CCJA 4R9DA 2D5HA 1Q56A 4CPBD 3AZYA 5I93A 1GU3A 4UFMA 1Z0HA 5FWEA 1N1SA 2WSUA 2VOVA 1AR91 1KFXL 2PQSA 5GJ6A 2W47A 3RG0A 3NNGA 5A32B 4AQ2A 2WA4A 2HJIA 2W1UA 1UOBA 4A6SA 5FYSA 3WLUA 3PU3A 4YFWA 3WD5A 4DS0A 1POV3 4QPIA 1MS5A 2BZDA 2VVEA 2WA3A 2WRAA 3PHMA 2WQ4A 1Q43A 5F5CA 5FZ8A 3ZDSA 3JBG2 2FCUA 1F15A 2A3YA 2VE1A 2IFRA 3JCIA 2OYZA 4EWDA 3WDTA 3WW2A 3T2OA 1LOGA 3WG3A 4U2AA 1CZVA 4PF5A 2TNFA 2VZ3A 3ACFA 3CF6E 3LPGA 1W3XA 2LS6A 4QX8A 4R9CA 5EZWA 3DKQA 4M0NA 5F5IA 4XBQA 1X9PA 4FPYA 4UI9L 4XJZA 4BQ2A 2D6MA 3HQUA 1GZTA 1XNAA 4FPLA 5CFCB 4JGZB 3P6BA 2GN7A 2PMWB 4DINB 1A78A 3BU7A 3RS6A 3VBUC 2R061 2WKKA 3VHOA 4AL9A 1UPSA 2O14A 3HQXA 1Z7S3 4DEQA 1TME2 4YW2A 2ORZA 3KHCA 5GZGA 2R6QA 5CYYA 1KEXA 2ZEYA 1Y7BA 4R4ZA 5HI0A 3TAYA 2JEMA 2ZMNA 3MICA 4RD7A 4CEYB 1T6BX 2W92A 1BVVA 4XEZA 4JTOA 2VBBA 4Q27A 2PLV1 2WIIB 1DBNA 4DPNA 4D7TA 1S4CA 3U14A 4AYUA 3WDUA 4Z8BA 2P6CA 4Y1UA 5FUPA 5D2AA 3GM8A 4NWVA 2YB7A 1G86A 4XHBA 4ASKA 3NJXA 1UU4A 3BTYA 2ZGSA 1NAEA 1E57A 4LBOA 3RJ2X 2W5FA 5T5PA 1RUNA 2L9LA 3KWVA 2XDVA 3WF0A 4MXVA 4HG6B 5CISA 3WUDA 1SPPB 2D93A 4BXFA 5J7MA 4WM7B 1H1IA 3KQRA 5FMOL 2YBKA 2RR11 1SQ4A 3I8TA 3U0ZA 5CFDB 3V0AB 2K46A 3SCGA 3HN1A 3RGBA 3SH3A 5D8AC 3ZSLA 1PO11 2GP3A 1YYNA 4FFGA 2QQNA 3O5SA 4FO9A 4D6QA 1CIWA 3AZWA 3H1MA 4IERA 1US3A 4QX1A 5FY4A 1VR3A 2JKXA 1O4TA 4E27A 3A0KA 2Z79A 1ALYA 1GV9A 1GSLA 1OLME 1AJKA 1QH6A 1S1AA 1GQPA 4XUQA 5FY8A 3VKOA 1UMHA 1RUF3 4L2NA 3B9CA 4LJHA 4UBHA 4A45A 5C3QA 5IVCA 1S2EA 3T30A 3JB8A 4OCTA 1OKOA 3GDBA 1YNAA 1MQTB 1YC61 1CAXA 4Q4W2 5FYTA 4A7YA 3W59A 1DGRN 1AR62 4A41A 4FQ4A 1WW5A 3BODA 1SFNA 1KQRA 4AEDA 5FREA 4QB6A 4HBNA 2BNNA 5FQ0A 5JIUA 5LCWL 3GJAA 3FBMA 2RMU3 4M3CA 5T3NA 1RTVA 3O1PA 2W1QA 2JDAA 3CHXA 1PNGA 4XW3A 2ZGNA 4XQWA 4CEWA 4LXLA 3BN6A 5HCFA 4OHZA 1PHMA 1O8PA 5I0SA 2V4AA 4BPZA 4Y4YA 4L11A 5A3WA 4EN7B 4Q1PA 3AKRA 4B4RA 1K42A 3LAGA 5IFTA 2RM21 1OOPC 1XRUA 2PHFA 3THPA 1SLAA 2DU1A 1XXNA 2VW1A 2XJSA 4IEQA 4S2FA 4RGKA 3PMEA 4OI0A 5FZFA 1VE0A 4OI2A 4YG6A 5FMCA 4BXSV 3ZYRA 3ZN5A 1NZIA 4Y1YA 1BZWA 3WG1A 1N1YA 2ZMKA 4PI0A 1QF3A 1VAVA 3LDBA 4QKBA 2ZCWA 3BYWA 4R9BA 5JLVA 3FUOA 3VDBA 2W1SA 1W04A 2UWAA 1DGRA 1U5YA 2RDRA 1KS4A 5GKAC 4LKEA 1BHGA 5DZGA 1SZBA 3MIDA 5LA2A 3AP5A 2AACA 1IS6A 1VBB3 2GDFA 1XQNA 2J42A 1EY2A 4FP3A 3VBHC 4CDXA 1JZ5A 3VDCA 2VTXJ 1ND2A 2QQLA 2PQQA 3M70A 4FPJA 5GALA 3GXUA 2ZEZA 1T6GC 5DN2A 4YVWC 1L7RA 1HRI1 2FHRA 4QX7A 5DAVA 4AFMA 2P3IA 3I2OA 4PHZA 3NV2A 2E51A 4QHBA 4XDPA 5FO8B 3OPTA 5FZCA 1GFF2 3D8CA 1LHUA 3TNPB 3DECA 4GWJA 4BYYA 1RUH3 1W6MA 2VMFA 1CPMA 1TZOA 2YU2A 1BKZA 1XYNA 4QGLA 2JDHA 3O1TA 1CAWA 4LHLA 3LA2A 3PUAA 5J37A 1QU0A 2W9XA 3FUQA 3FWEA 1RUF2 5BNOB 1AYM3 3WNKA 4OQ9A 1V00A 4W6WA 2AEYA 3V0BB 3B94A 4FOQA 2EIDA 1S0GA 3NJVA 2AUYA 1Q8OA 3PNAA 4JGYB 2WNOA 5FXXA 3ZM8A 3OJBA 3KV6A 4HSJA 1SCRA 2H0BA 4K1YA 2RS33 3AYEA 1FOD3 2W08A 5F2WA 2DCKA 5FY0A 3WQBA 4P02B 4CCNA 5IVFA 4QMAA 1G9DA 1SBEA 2GMMA 3J26N 1XNDA 4QPGC 1G7YA 3D82A 4OUMA 2QCSB 3WINE 3AMMA 5EHDA 5I0UA 3WNLA 1WZXA 1EPWA 1YI7A 5E89A 1RUOA 3K4DA 5FZEA 2BU9A 2E33A 3LKJA 1YWKA 4ZU5A 3HVDA 4KL1A 3I2GA 1WCUA 4HT1T 1LOCA 3THTA 2R7EB 4K3UA 4RQPC 1AX1A 2OKXA 2QQMA 3UGGA 1GZ9A 1BMV1 2YBPA 3QOPA 2Y26A 3WF1A 3O1OA 3MIEA 4OUEA 3GCWA 2JB8A 4Y20B 1SLCA 3SHRA 3ABZA 1VB2A 2X5IB 1QJFA 2A75A 5A3MA 4LOTA 1XBFA 2VY0A 3H3UA 3D5OA 3SCHA 4YGDA 3A0NA 1FX5A 3VBFB 3RZJA 1W8OA 4LBKA 4LBQA 2AREA 3A7QA 1AYN1 3I2HA 5C3SA 1VBB2 5FFOC 1ENSA 1JTZX 4XAAA 4K8RB 5C9AA 5EJZB 3LQCA 3WP6A 3QLQA 1H8TA 1HLCA 2OPKA 4WZFA 5C70A 3T2PA 4E8DA 5IAXA 2HWF1 2DUPA 2GSYA 2D44A 4GA9A 3IAQA 4Y5TA 3MF6A 4FXKB 2BWCA 3SC7X 5CAZA 3VUOA 4N53A 1PGL1 5ABJB 2H6CA 2PA7A 3HMYA 5JOZA 1STMA 2Y0IA 3H1YA 4PT6A 3U78A 1GQHA 2OVUA 5AVAA 3LE0A 4CP1A 1CJPA 1FT9A 2H6BA 1GWMA 2BBAA 4K21A 2ZX3A 1W6NB 1CJDA 2N7GA 3FLPA 3OD4A 5I8SA 1HQNA 1HJFA 2KD7A 4XUTA 1AYM2 4HVQA 3ACHA 1FNYA 3M7AA 3RPQA 3NQHA 5F9TA 5HBAA 1UIJA 3LOIA 3FMGA 1GZWA 3CIHA 4EQVA 1UW8A 1K45A 2GNDA 2RS32 1FOD2 1RVF3 1Y9GA 1W8WA 3P1IA 1XB9A 4D7SA 4NN0A 5JIAA 3RSJA 4RS5B 3ZR6A 2WZ8A 3UV9A 3RNSA 1ENRA 2Y60A 1GP6A 3WW4A 4HN0A 2EAAA 1LENA 4PLMA 5C8CB 2VZVA 3O0VA 5G05L 3M2MA 1ZBA3 3EMRA 5DZFA 2EXJA 5FCCA 3RZMA 3ZYJB 4UYBA 1DYKA 2BWAA 2O0OA 3POWA 3SCFA 3ZDVA 4E2GA 5AC93 2Z5WA 1VIWB 3AVRA 1PIV2 2BGCA 2ORXA 3MLKA 1J3PA 2FDKA 2ARCA 4CDUB 2UYAA 2I74A 2J22A 2CDOA 4IE6A 4PQQA 4N43C 4CXXA 1V6JA 5KBFA 3K48A 4QM8A 4CU6A 2JDZA 1WD4A 1NQDA 1IKPA 4LE3A 2E7AA 4JGZA 1DQ5A 4FPGA 3C7OA 3RYRA 1BYHA 2RMU1 4AK3A 1S2BA 1XU1A 2VPVA 4V2WA 2A70A 2VCMA 4L99A 4DUWA 5T55A 1XSRA 2DVFA 1DCSA 3OUIA 4TWTA 5BY5A 5IVBA 1RITA 3ZFGB 1PGW2 4E8CA 1SDDB 3KT4A 4TN7A 4IEUA 4PJYA 4AI0A 4CP2A 3CL1A 2JIJA 1SBDA 4QQOA 1YQ6A 4FAHA 2VW0A 5GLVA 5ISLA 5J09A 4YVSC 2ET7A 4LIVA 1JYTA 3A23A 5HV4A 2NP0A 4DRRA 3N3HA 2CNAA 1AL0G 1H4HA 4P9LA 3LFMA 1C5IA 2WNVC 2A73B 4EYUA 3AYCA 1NUKA 1H2KA 2E31A 3H3LA 4PLNA 4AOCA 2NZ9A 5IVYA 3GJBA 1NCRB 4V1PA 3W58A 1WCSA 1QXJA 1RUD2 4Y22B 3RZGA 1TMF3 1RUC3 4BMBA 2D43A 1IG3A 2P37A 2ZGMA 3EQEA 4UOJA 1RYYA 1RHI3 2WJSA 3ZX7A 1VBC3 3VGIA 1QMJA 4IEWA 1NG0A 4MSVA 5IT6A 3BTAA 4XUPA 1RVF2 1SPPA 2P3KA 3AP7A 4N8MA 2VNRA 5FY7A 3AL6A 3JQXA 4PDWB 3SNMA 1QDCA 2D5FA 2LUWA 3FZ3A 4NR1A 1AVBA 1RUH1 2VGDA 3NWKA 3C7FA 3AXDA 3CJXA 5LA9A 3HJRA 2HWE1 2LW8A 5CFDA 2ZTNA 1UY2A 3E5QA 5FPLA 3S57A 1ZBE3 5FYZA 1RL3A 3V65A 3OYWA 3WHUA 4LLFA 3ZPOA 1ZBA2 5K0UA 4XBLA 4P9XA 5FZGA 4HKLA 1WLTA 3NNJA 2VQAA 1RXGA 2BVVA 1BEV1 3JD73 1UY3A 4GB33 2VTXA 3IB3A 4DMIA 4EN9B 4IE0A 5IAVA 1UL9A 1QJY3 3VKFC 3WQ1A 2B4KA 2HKXA 4XJ9A 1PMJX 4H55A 4CDQC 2VO5A 1W6PA 1O4YA 2C1FA 2DUOA 5IJRA 1MQTA 4C90A 1JYXA 1WGPA 3APBA 3M3IA 5C3OA 2AR6A 2YBSA 3KLSA 1Y9MA 3OD0A 5E1RA 5I8YA 4P00B 5FKCA 4GWNA 4GJYA 2JDUA 3MUZ1 3VBOB 4O9GA 1K5JA 4HANA 3I49A 3RDIA 2HYXA 4HMZA 4A7KA 5C33A 3IAPA 5IW0A 5LRRA 4B3NA 3UJOA 2JDKA 1GBGA 1REFA 4CCEA 1C28A 4Z2AA 1J1LA 3K3OA 3R4SA 3D6EA 2WFPA 4UBGA 2FDGA 2VMDA 3JXSA 5DAPA 2W95A 3SH4A 4QDQA 3WF3A 5FO7B 4LA3A 1L7LA 1EYBA 1F4AA 2BGOA 2IXCA 2RVAA 1R081 3KV9A 5FUIA 3UGHA 3ZYHA 3OCPA 4LTAA 2P2KA 2PHWA 1LHOA 2X53S 5FP7A 1OUXA 4XACA 1HB2A 1IS3A 5FY9A 3UNPA 3FC0A 4FSJA 1W99A 3N9NA 4Y1ZA 1F9KA 1SBFA 1UCXA 4JDOA 5FV3A 1O5LA 1B09A 1REEA 1RUC2 1TMF2 2WT1A 5A80A 2BNMA 2E26A 3ACGA 4JDNA 4BIOA 5B4NA 2WT0A 5J48A 1RHI2 2WQ8A 2V72A 1VBC2 2BFUL 1H8VA 2BUKA 3ZFEB 2MPFA 2IXHA 3AFGA 4MGYE 5L9RA 5K7PA 1GP5A 1R1ZA 4HOOA 4FAGA 3H7JA 3Q8FA 5AC92 3MF9A 2X10A 3HPNA 2OQ7A 1GR3A 1X8MA 3L9JT 1JZ8A 1OKQA 1ZBE2 3MEPA 2JB4A 3MUY1 3PUIA 4YM3A 2WZR1 3ZSJA 4LK6A 4MGQA 2ZKNA 4BISA 3JD72 4LITA 4GB32 1ZRCA 2B45X 1AR93 3QACA 5A7PA 2QQVA 3ACIA 2BVBA 2XJPA 4CDWB 1QJY2 3POIA 3WW1A 4A44A 4BQ5A 2ZAHA 4AE2A 2ZX1A 1U5ZA 1O3TA 4NUBA 3ZR5A 1UX7A 5FYUA 2R32A 5I0TA 5HPOA 4JGYA 1S0FA 2BDRA 2G9FA 4EE2A 1GOGA 5IVJA 2GN3A 5FYBA 4BJ0A 1OHFA 1Y9QA 1NCQC 5DAWA 2B7YA 4GIQA 3VN4A 5LWBA 4DB5A 2AGSA 2MHFA 2VUCA 2GNTA 1DGWA 3U4XA 2A3WA 1NLQA 2ZKLA 2YROA 3I3DA 1UYXA 2WWJA 1VP6A 4YVSA 3JQWA 2JE8A 1E5IA 5JMOA 1UWWA 3VL9A 1WW6A 3DPRB 1CPNA 3Q9OA 4BWOA 4Q29A 3JB4C 1W3VA 5DG2A 2CTVA 4CSWA 2PHUA 3KCCA 5LBEA 2BJSA 4P9JA 1F8VA 2XMLA 1NE6A 2Y8KA 4QPIC 2ERFA 2VQ0A 2PN5A 5D21A 3BU0A 4AWDA 4AI8A 4UFHA 3J8F1 4AVVA 5DUUA 2WO3A 1J84A 2DVAA 1S0DA 3WCRA 1QNYA 1VRH3 3OBTA 5FJHA 1U5IA 5IUQA 1DFQA 2OS2A 3H0OA 4JV4A 4GH4A 3Q8BA 2PLV3 3VBFA 4YW1A 5FR3A 1OLRA 1LESA 1ULCA 3AX4A 5GM0A 2W87A 2XB6C 3Q8AA 2AEZA 2XHNA 4KU7A 1AX2A 4Y3OA 3ZMNA 4DXTA 5I0DA 1QJX1 3FLRA 4GWMA 2AENA 2YG0A 3GALA 3HBKA 4R52A 5H9RA 4BH9A 4ET7A 5BUVA 2AC1A 2VZ1A 1EAH2 3I2DA 4FFFA 1AUYA 3R05A 5A33A 1JZ6A 4Q5OA 4RHV1 5C3PA 2FZ2A 3VZJA 5ABJA 1KGYA 4LKFA 5GLUA 3KZ4C 3U4SA 3UL2A 4CRQA 1SLIA 3DEMA 2ZA9A 5JSRA 4Z92B 4QXCA 5FPVA 4ISRA 2E7TA 3W5NA 1AR92 2D98A 4X8PA 3T0BA 1HX6A 5FPZA 3VBSA 2FMDA 4GXLA 2NPIA 5DUXA 1NX9A 1UOJA 4FCAA 3WEZA 1I5PA 2RR13 4XABA 5JPNB 4OI1A 4CCOA 5FZKA 1H9WA 1PO21 1GUIA 3OY8B 3UETA 1PO13 4L8QA 5FYYA 3LDKA 3KF5A 2BOJA 2YFZA 4JQRA 4I2OA 3VBRB 2ZGQA 1RXFA 5CVRA 1PX3A 3MPPG 1HB4A 2LALA 2Z42A 4RS5A 4J25A 1OF3A 3LB9A 4G9SB 1QH7A 5FP8A 4ARYA 1UY4A 2NLRA 5J1XA 5A1LA 1OLMA 5C8CA 1KS5A 4UXAA 1KXGA 3USUB 4QB1A 4KWKA 4HKWA 2WL1A 2WNUA 5HV0A 3SKVA 3C7GA 1KJLA 4YG3A 4A2UA 4UW6A 2QQUA 3MZHA 1R1A1 1AR81 2R062 3IWZA 3RMXA 3ZXKA 2XBO1 4NJ4A 3ILRA 3RJRA 5L73A 4CDUA 4IEYA 1OURA 3POEA 2XQXA 3A21A 4KNCA 4INDA 5KWRA 3H50A 3CJIA 5KHHA 4RN5A 1DLCA 1ZA4A 1OVSA 2WO7A 2ZGKA 5EPAA 3O14A 4Z07A 2UU8A 2AYHA 1I1EA 1A8DA 1U12A 5T50A 5EQUA 1OMIA 1A3KA 2VH9A 2PLV2 2WR9A 1SG3A 2VM9A 4JCKA 4AEKA 5FXVA 3WNXA 2XLFA 3E5XA 5EV7A 3ZFGA 4LPLA 3HOBA 5KXBA 2JE9A 2E53A 5A3NA 4PIYA 3POJA 4KH9A 5SV5A 3GHNA 2YFUA 2UYBA 3VZNA 1UD1A 1MPXA 2O1QA 3E6CC 4CP9A 1K5MB 4IV3B 3S6PA 4AEDC 3I59A 3WF4A 2ATFA 1IS4A 2C9KA 2YU1A 3S7EA 2W68A 2A7AA 1AL21 2WT2A 3H42B 1IPJA 4I3PA 4URTA 5K8SA 2MEV1 4QXKA 4UW4A 4BLIA 3SMHA 1G9CA 4RYDA 4UF0A 3GBGA 1JXNA 1GLHA 1NCRA 3AMPA 3RI9A 4A3ZA 4Y22A 4CEWC 5HXMA 5J3UA 5LA0A 3OOXA 3WP4A 2DU0A 3TEZA 1NQJA 2RR12 1RUI1 1CZTA 5A7WB 2Q4SA 2FCTA 2ZOEB 4CCCA 4XURA 3NNLA 1W6QB 4FPFA 1PO12 4B7KA 3H3ZA 2VW2A 5DABA 1O3RA 2XLAA 2W0XA 3DV8A 3N35A 5EFUA 3T09A 2IXLA 4NROA 3PDQA 1JZ4A 1GWKA 4XVHA 3KF3A 1S0IA 1BBT1 2WQZC 4Q4X3 1NA1B 1NT0A 3C7EA 1YJKA 1K12A 1W2NA 2GNBA 3ZSEA 1OA2A 4XZPA 1DDLA 2P1BA 5FZBA 3WXPA 2P17A 4Y1VA 3B9IA 4PBPA 2BOIA 3LIHA 4CUBA 1ZX5A 2BFUS 2QKDA 1VAKA 2X8KA 3JUUA 1O3SA 4L92A 5BNNA 2HWB2 1GKBA 3J9SA 4AEMA 4BLJA 4CDXC 1ND2C 5KR7A 1QWRA 2E32A 1LOBA 3GBFA 1JYCA 4AHYA 1QKQA 4D6SA 4ZPIA 4XMIA 5IYYA 4X6RB 2DVDA 1KJRA 4IE7A 3HBZA 3BALA 2R0FA 2W3JA 4YM1A 1W8ZA 3THCA 5KHJA 1UZWA 2GC1A 5FJKA 1C1FA 5A7OA 4QXHA 1ONAA 2FDJA 2Q1MA 5JMCA 1HQLA 1EV11 3PTRB 4IETA 2RM22 1PVXA 1U5XA 2VJXA 3M3EA 1ENXA 1NY71 4KGGA 4CPBA 1LB2A 5CZKA 1CAUB 1DU3D 4EN0A 4V2VA 4X8NA 3IDEA 3LDRA 1HN0A 4H2AA 4C1XA 2I07B 1HRV1 3TRSB 2YC0A 3J7HA 4QU1A 1VRH1 1OUSA 1SEFA 2EICA 3PLQA 1UOGA 4UFIA 5FYCA 1HXS1 2Y6KA 4TYSA 2Q8CA 5GLWA 5GZFA 1AYN3 1CX1A 3KT1A 3O1SA 2EAKA 2GH2A 1LODA 3E97A 5H9PA 3HNMA 4BDVB 1AX0A 4IESA 2HWF3 4AVBA 1HRI2 3ZFEA 2ZGLA 4UW3A 3EBRA 1KRIA 3ATGA 5CADA 4RFRB 1WA6X 5FTTC 5L19A 4YARA 3N9PA 3L2YA 5G04L 4LO8A 1BVP1 4CU7A 1ENQA 4EV0A 3OB8A 2YV8A 4PF1A 2OW4A 3H8XA
chains in the Genus database with same CATH topology
5JZGA 3O7OA 1FXZA 5C4WA 2XVGA 2A6YA 2DF7A 1BQPA 1QY4A 1D2QA 1OFSA 3N36A 5C9AC 1H8TC 1MEC1 4ASLA 2A6WA 4WZCA 4LHKA 5CA6A 4N53C 4N90A 3KCXA 1YI9A 5F6KA 4HPKB 1CAVA 4QPGB 4YRDA 4MXWB 3LOBA 4YG0A 4GALA 3GNEA 4Q2FA 5JSOA 1PMIA 2A71A 3NVCA 3UKTA 3WDVA 1BMV2 3AKTA 3UKVA 1LHVA 2NN8A 4YZ5A 3AMQA 3VHRA 3N7KA 1C3HA 1Z7S2 1YIPA 5JCTA 4XFIA 1TNRA 4RQPB 4FTSA 3POSA 2A3XA 3ZSMA 2SBAA 5KHGA 1CR7A 1VAMA 1DZRA 3MGUA 2PHXA 4Q4V1 1O5UA 5JWPA 2JG8B 1AYN2 4Q0SA 5JOXA 2R1BA 5I91A 2WLQA 3AJYA 4R4XA 3R0RA 2R30A 2HWF2 2A6XA 4PLOA 4JTNA 3ZYPA 1PGL2 1YFUA 4NWWA 2ENRA 3A4UA 3RYPA 4WVMA 1VBD1 1NYWA 4EN8B 3P3NA 1UU6A 1SFYA 2O8QA 1IHMA 2H0VA 4JGZC 4LE4A 4HLTA 1LHNA 1VLNA 1LECA 4COUA 3MFCA 2WWSA 3ZXDA 3VKLA 2RJKA 1YCIA 5KXDA 3HWJA 4BMEA 4IEOA 3PVEA 2GMPA 4W6XA 1ZRFA 1G9BA 1RINA 1PK6B 5HXVA 5JSPA 3AFKA 3WG4A 5L7OB 2VUAA 2HWE3 4P9IA 1QNWA 3OY8A 1MVEA 2RE9A 4Q4X1 3CU7A 5DUVA 4XF3A 2V09A 2VVDA 1RJ8A 4NPRA 5GLTA 3RZZA 1S55A 1BEV3 4B29A 1LEDA 1LRHA 3R6SA 3V56A 4OUSA 5JVVA 3ZPYA 3RQ0A 3ZXJA 5CBLA 1I9RA 4HN1A 2QFEA 3VDDA 4XFCA 2PYTA 1H2MA 3USUA 1V6IA 3VZMA 2BEOA 3WCSA 3ZFFA 1V6OA 4XILA 1WLWA 1YRZA 1HW5A 4ZU4A 2RMU2 2YXSA 4ES9A 1FMD1 1N3PA 1WLDA 1FNZA 5CFDC 5IK4A 5K0UC 1PZ7A 5CNAA 4FPCA 1RUJ1 1G8WA 5BNPA 2Q0AA 3GHMA 4RGAA 1KDKA 4WM8A 3DGTA 1I3HA 4S2DA 1DIWA 3D4KA 4D3WA 1UU5A 2IXJA 1EPZA 4XF0A 1TQ5A 1R083 1MQTC 2D6OX 3PJYA 2QNKA 3IBMA 3UJQA 2WNVB 4IV3A 1MR5A 4Q4W1 1D2SA 3URFA 2EA7A 1AR61 3NAPB 4P9YA 1REDA 5FO9B 4I0AA 5LRSA 3CEWA 1FV3A 2OZJA 2TUNA 3EXUA 2V5YA 2MNGA 1RUH2 4LA2A 4NHMA 2HWE2 4KG0A 1Q8QA 1W6QA 2CV6A 4J1WA 2WZR3 4Q0PA 1N1VA 3ALQA 2XWBB 3S7IA 3AK0A 1BEV2 2K9ZA 2QZ2A 1AJOA 2FBEA 2VOXA 2ETEA 3GZUC 1NA1A 5DDJ1 2E7QA 5BXXA 4YFZA 2ZBJA 3T1LA 2C5DA 4E2SA 2DCTA 5A32A 3EHKA 1FAYA 4GMP1 5FRAA 4LO4B 3WX5A 4C91A 5AFEA 2R071 3IPVB 1AR71 4PIZA 3DL3A 1GQGA 2HWC1 1AF9A 4OZXA 4ES8A 2GALA 2IXIA 2JG9B 3CO2A 4L97A 4I01A 1YO8A 1YFYA 4LO5B 4WVVA 2SLIA 3N7LA 1XNCA 2XJQA 4AFBA 4F3JA 1ND3B 1YIFA 4W6YA 1NE4A 5FMOS 3FFQA 2XJRA 5CFCA 3AZZA 1F31A 4IEVA 2PFWA 4YZ4A 1VJ2A 4FP2A 1RJ7A 4DY5A 4YGBA 3S0MA 4XQDA 3KB5A 1CAUA 4JGYC 4AHXA 3BIWE 4BA6A 4D7YA 2FZ1A 3J8F3 4AI3A 4CZSA 1ZZ8A 1PVC1 2XPJA 1J3QA 1ZNPA 3KMHA 5L36A 3SISA 4HSLA 4CEYA 2QQPA 2R041 3M8LA 4EJRA 1SMVA 4NO4A 3WDYA 2XWJB 1SACA 1QJX3 1QGLA 1SLLA 2K2SA 4HETA 4NVPA 1NXMA 1B35B 1X8EA 1VBA1 1ULGA 4RHV3 2WZR2 3MIHA 1OSGA 2ARXA 1APNA 1Y3TA 2CAVA 4P14A 3ACLA 3BB6A 3R4DB 1NOVA 4CTEA 3ME2A 1QXRA 1FI2A 5ACA1 3WW3A 4GH4C 5FLIA 4WM7A 3VBFC 1PO23 2GZWA 1V6LA 3NV1A 4LBNA 4QU2A 4AW7A 3V0AA 1QJU1 2GNMA 1DGWX 4QM9A 3ZXAC 4RR3B 1Z78A 2Y0OA 5HCAA 2VMIA 4OI4A 1WD3A 5ABJC 4AEJA 4G4FA 1CGPA 2A6ZA 4F7ZA 2W52A 4I0WB 2NMNA 3VBSC 5GZEA 1HV1A 1UIKA 2ZHKA 4XYXA 4COZA 1R1A3 1AR83 1MZ6A 2ZGPA 1QJZA 4XE9A 4Q4Y1 2XBO3 5JDBA 4X6QB 4E4ZA 4Q1RA 4J6GA 2OA2A 2E9QA 4LUKA 2X29A 2ZX0A 4XF1A 3TWIA 3J8F2 1MACA 1OD5A 4AGVA 4IQPA 1Q3EA 4XFHA 2JECA 2R16A 4RS5C 2CAUA 3TB0A 3ES4A 4M00A 2F6BA 4Q0QA 4MX3A 4AG4A 4S2GA 4HKOA 5C8CC 2PHDA 2JG8A 4C0HA 1HDKA 2WNUC 1QJX2 3AJZA 2RHPA 4TLFA 1TEIA 4IEZA 3ZIXA 2ZZJA 3NW4A 2ZJCA 3QH7A 4CDUC 2JX9A 1AL23 2ZAAA 1R091 3MIBA 4YSFA 4COYA 3CJIC 2MEV3 1UMZA 5IK7A 2NM1A 2RS13 3MIFA 4NHKA 2XG3A 4OHYA 3MDPA 4BOWA 5T5LA 4N7UA 1RUE1 2EVXA 1RUI3 4ZXKA 1EP0A 3V64A 5JPMB 5FDBA 1PO22 2BNOA 1IZ3A 1I6XA 3ZFGC 2W39A 3DUIA 1FATA 2PTMA 5EJ3A 2DCYA 1SLTA 3I54A 2RS51 5FLJA 4MGIE 1PK6A 1HV0A 1MS8A 4DZGA 1BBT3 4IV1B 2YZ4A 2ILMA 3LSDA 1TNFA 1IQAA 4OHVA 2Q30A 5BNOA 3IKWA 1U0AA 1NCRC 3V0BA 1R1A2 1AR82 3TN93 2XBO2 2ZMLA 3C2UA 4XPVA 4RL7A 3WQ7A 1S0EA 1IPKA 3KD4A 2Y38A 1LOAA 2WFF1 1H1AA 1RUD1 1LCLA 3OBRA 3TNQA 1UF2C 4FPKA 1FPN1 4QPYA 4QQLA 4BE3A 1H0BA 2RJLA 2ZACA 2JENA 4EROA 5DZEA 3UKNA 1TE1B 2R0HA 5KXCA 1RB8G 1EV13 2DTWA 4JAAA 2IC1A 3CLPA 4E2QA 4QGNA 3SITA 4KG8A 4AFAA 2K0GA 4LBMA 4AFDA 1V70A 2DVGA 4YLZA 2IFWA 3GZAA 4KU8A 1PZ9A 1AXKA 2ZGRA 1N3OA 4QQHA 2VOWA 5BNNC 4P9GA 1HRV3 1CAXB 1MS1A 1AL22 1J1TA 2PHTA 3AYAA 3WZ1A 1CONA 2MEV2 4Y20A 4AXOA 1BK1A 2XJTA 1WBLA 4U36A 2X5IA 2QZ3A 5H9QA 1HXS3 3MW3A 4AEDB 1SCSA 1W39A 1IGOA 1UAIA 5F5QA 1CX4A 2NYYA 4M3CB 5GLZA 3HT2A 4CEWB 1LGCA 3TOJA 2D3PA 3NAPA 3MPBA 1H1MA 4WV8A 1BBT2 3WP3A 4K9SA 2UWCA 1XE8A 1ZZ6A 3U11A 2CYFA 4COWA 3ENRA 1W6NA 4BIFA 2WINB 1MZFA 3B00A 1COV1 4AFCA 1CQ9A 5FAXA 3D0SA 5T54A 4E4DX 4TSVA 2FQPA 1GICA 1MEC3 3U10A 4Q8KA 1Q8PA 3ZFEC 2JICA 3FLTA 4AQTA 2WNEA 1GZCA 4ITCA 1DGLA 5HCBA 3ST7A 4CDXB 2B9UA 3NKGA 5DG1A 1ND2B 1Y43B 4HVOA 5JOWA 1FV2A 1RGSA 3TBDA 3JZVA 1RMU1 1JW6A 4BQ1A 2JG9A 1EV12 2JD4A 5JZGC 1W6MB 2XL9A 2R1DA 5EXOA 3KCYA 2PHRA 4CYDA 1NY72 2G4IA 1D4VB 5C4WC 1WBFA 3PVOA 2PAMA 4UW5A 2XH6A 4LHNA 3VBUB 4Y26A 1HRV2 2EF6A 4Q8LA 5T5OA 2LM3A 3IM0A 1VRH2 4K1ZA 3FJSA 4GULA 4Q4V3 4XIOA 4BZ4A 1HQWA 3WDWA 1HXS2 2DVBA 4GMP0 2VOKA 2OUJA 4MVTA 1LU2A 3GZTB 2A5ZA 2UWBA 1WUVA 3NV4A 1UKGA 2WS91 5DUWA 2Z2SB 4LUMA 3AMHA 5T52A 1RIRA 4ZKTB 1ZRDA 1XU2A 3AYDA 1VBD3 3ZN4A 2VG9A 1X50A 3O0XA 1V9U1 1AXZA 1PGSA 4XJ8A 2WZPP 2ARBA 2RS11 1GNZA 5GZDA 4K6BA 3I4IA 2ES3A 1G6NA 4XFAA 5JI9A 2QDRA 1ASJ1 1MEC2 2HEYF 3ZXLA 1JN2P 2ZHMA 4PDWA 5D8AB 5C9AB 1C8M1 1NLSA 1H8TB 3QH6A 4IL7A 4XIKA 2IZWA 2QJVA 1RUG1 5LEKA 3D0JA 4F83A 1VBE1 5H9SA 2HYKA 4SBVA 1WMDA 1ZZCA 2I2SA 4MYEA 2B46X 4RR3A 4DRVA 4XJUA 4AVCA 3VLBB 4YZ2A 3PVBB 3E6DA 4LBLA 3TN91 4G3YC 1GNHA 1OQDA 2BBVA 1YHFA 3B3QE 4XBNA 4HK9A 4ZU7A 2A6VA 5LK5A 4YW5A 1MVQA 3OGJA 3WP5A 1JOJA 1GZWB 1OA3A 1XNKA 4O9EA 4XHXA 1FMD3 4K20A 3OF1A 2C9AA 4Q4V2 2CY6A 4GKYA 2VNOA 3VBOA 4FOYA 3ZXGA 2DYCA 2YDEA 2YUEA 1RUJ3 3AP9A 3VBRC 2D6KA 4N9HA 4XFGA 1BXHA 4LULA 2XUMA 1Q8VA 1OOPB 2HWD1 2IXKA 1MZ5A 3VDDC 1G9AA 1VBD2 4ASMB 3IN9A 1WCDJ 3ZFFC 2EIGA 4AVTA 2BTVC 4YW4A 1AXYA 4K8FA 2ZHLA 2D6NA 4DQAA 1ZRRA 1ULDA 4HVRA 4FTBA 4Q4W3 3KSCA 3VZLA 1AR63 4XJWA 2PAKA 3KGZA 4IEXA 5BNPC 3VBHB 4WM8C 2VMGA 3OTFA 1H2LA 1YFXA 4YVWB 4OVEA 5A3LA 3EO6A 4Q4X2 3GBWA 3H7YA 1O7FA 3P3PA 3LCPA 5DXDA 3T1MA 3ETQA 4IV1A 1H30A 1K5MC 4IV3C 5DDJ3 1JUHA 4J1XA 3VKNA 4CDWA 5BYNA 1X33A 1OPOA 1F5FA 4GMP3 3SH5A 2XLGA 1URXA 2R073 4P9WA 4BCUA 3FX3A 1AR73 1FMD2 2HWC3 4I02A 3VHNA 5LK7B 5JI7A 1JBCA 3N7MA 1MS0A 4KWLA 2YHJA 1RUJ2 1VB4A 1QQP1 1C57A 2B8MA 4JVAA 5FBZA 3RMYA 3OYWB 1D4M1 5K0UB 1NA1C 3DPRA 1GYKA 1WLCA 3TYJA 3U07A 4E4SA 1DG6A 1RC6A 1LKNA 1W6PB 1PVC3 1UZZA 4IEPA 3AP6A 4BM8A 4WVZA 1YFWA 2DV9A 3RWNA 3M3CA 2ZGTA 1C8NA 2HWB1 2R043 2D40A 3N7JA 1O3QA 3JBG1 3ZN6B 2YMZA 4LNVA 1NZCA 1S0CA 3RI8A 3FHIB 4OHXA 2BYVE 5CFCC 1LOEA 4A3XA 1VBA3 4H3WA 5I0RA 2DURA 1W0PA 1DQ6A 5CG8A 3MW4A 1N3QA 3WOGA 1QDOA 4AGRA 4P5HA 3AZVA 5DDJ2 1WW7A 5ACA3 3NL1A 2ET1A 2D6PA 5EYYA 1DYPA 4Z1VA 5FPXA 3KT7A 1WW4A 2XVKA 4CEYC 1TME1 4LT5A 2PAEA 1BJQA 4AF9A 4AQ6A 1W6OB 2R072 4D94A 3RYKA 4YM0A 1AR72 1QJU3 2BPA2 2HWC2 3KS7A 4MGKE 1OLQA 1X36A 3VBRA 1JH5A 2E63A 3IDCB 2DFBA 4B4PA 4ATEA 3BPZA 2GC0A 5JAXA 3DN7A 1V6NA 1SDWA 1J3RA 4JRLA 3G7DA 3PMSA 3M4FA 2Z69A 1LGNA 4Q4Y3 2QUOA 3AZXA 3B93A 4WM7C 2CGNA 4JDMA 4FOWA 3MW2A 4EWEA 4N43B 2D97A 1UX6A 4XF4A 4MUVA 3ZO0B 4R8HA 3O0WA 3PTYA 4XETA 4AI2A 3VBUA 4S2HA 1PVC2 2R49A 2VUJA 1M4WA 4LEJA 4YW3A 4LBQD 4ONUA 1N47A 1POV1 2R042 2P34A 4OHWA 1AHSA 3NKTA 4KQ7A 4AQSA 2DWRA 1DQ0A 3AP4A 1KITA 3FE5A 4MV2A 2AH2A 4JC1A 4EWAA 1Q8SA 1CVNA 4YVSB 1NLRA 1VBA2 4PIXA 4XXPA 4W65A 2JJ6A 3NSTA 2CL2A 1JHNA 1F5JA 1H9PA 1K5MA 1R093 1ZZBA 3MFAA 4QD2A 1PIV3 1IOAA 1S0BA 4XF9A 1KDMA 1O91A 3FFZA 2EXHA 3J4UH 1DQ2A 1C1LA 1WMFA 4FXGB 1W2UA 5ACA2 2QE3A 2CWMA 1RUE3 2DCJA 1Z7S1 4H7MA 2NQYA 3W9AA 5IK8A 1YUDA 2JG8C 1QJU2 4GH4B 1LR5A 2RS53 1QOOA 1W0OA 4QT6A 4XXAA 1C5HA 3H8UA 3PJQA 4N9IA 5D8AA 3JU9A 4PQ9A 4ORFA 3ZSKA 1ZREA 3E5UA 1XYPA 4PCRA 5A33B 2ZZQA 2O8OA 2ZPXA 4AVSA 1X7NA 5B2GB 4FPEA 4I0BA 4MH0E 4Q4Y2 5I8TA 3L2HA 1UKRA 4XMAA 5J36A 1OQEA 1DZTA 3VBSB 4CDQB 4FTEA 4SLIA 2WFF3 1OFNA 4FOVA 2XVLA 3SLIA 4WBBA 1RUD3 4XFBA 4RFT0 4RSUA 2KXLA 5TSWA