4YM2A

Crystal structure of the human galectin-4 c-terminal carbohydrate recognition domain in complex with lactose-3'-sulfate
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
138
structure length
138
Chain Sequence
b'PTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Galectin-4
publication title Structural characterization of human galectin-4 C-terminal domain: elucidating the molecular basis for recognition of glycosphingolipids, sulfated saccharides and blood group antigens.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 31
structure length 138
sequence length 138
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ym2A00
2A5ZA 3GNEA 1WBLA 4ISQA 4CTEA 3N35A 3HN1A 4P14A 5IK8A 2AYHA 1W6PA 2DVDA 2ZGPA 4CZSA 1ZM1A 2XG3A 1JYCA 3SNMA 4Z8BA 5JMCA 3AP6A 1S0CA 4FPYA 3T2TA 1QU0A 1N1TA 2JJ6A 2ZGRA 1Z0HA 3OJBA 4YM2A 1AZDA 2ZACA 2GALA 4Q2FA 1TEIA 3N3HA 4YZ5A 1SCSA 1XQNA 1W6MA 2ZBJA 3FLTA 4R9AA 3ZXJA 4FQZA 1LHWA 1LJ7A 3AYEA 3V64A 3M3OA 3V0BA 4XYXA 1IOAA 2AH2A 4LBQD 1NXD1 1S0GA 3A0KA 2D3RA 4YG0A 3UL2A 2VXRA 5JVVA 1WW7A 5DG2A 1GSLA 4U36A 4SLIA 1S0IA 2WNEA 1G9FA 3ILNA 1BYHA 3O5SA 2VH9A 5JDBA 1VAMA 2FHRA 2OUHA 2DURA 4LBQB 1KJRA 4XMIA 2WT0A 3WOGA 2VW2A 1LHNA 4XJWA 5GZCA 1HQWA 1Q56A 1YRZA 4BLJA 1AXZA 2PELA 5IT6A 4YW2A 5F5QA 4DQAA 3GALA 1G7YA 2ZHNA 5DZEA 1JOJA 4CRQA 1W6NB 1UZYA 2R0HA 2RHPA 3VV1A 2CYFA 2EXJA 1YYNA 1X50A 1QOSA 3NV1A 2E6VA 1LEMA 2P37A 3UK9A 1W0OA 1UZZA 1RITA 2TEPA 1C1LA 1RINA 1AX0A 2CWMA 1SLBA 4LBJA 5DG1A 2P34A 3POWA 4BLIA 3HMYA 1N3OA 1WLCA 3B9CA 1C57A 3TAYA 1AF9A 4AWDA 5H9RA 1LOFC 2D6MA 4K1ZA 1WLWA 4XIOA 1IS4A 1N3PA 4XHXA 1MZ5A 1V6IA 4U2AA 5GZEA 5KXDA 5DXDA 4YFZA 1JXNA 2D6KA 3WDXA 1MS9A 3WHTA 2ZAAA 3WG1A 1WW5A 2DUPA 4NOTA 2XB6C 1LHVA 1CIWA 1KITA 1IS6A 1ENQA 3Q9OA 1QDCA 2OVUA 3AYAA 3PMEA 1W6NA 4FPEA 1CQ9A 1PZ7A 2GNDA 4UW4A 4XTPA 2V73A 4GALA 4YW3A 4FQ4A 5JOWA 3JUUA 4Y1VA 1IKQA 2A6XA 3OBTA 2UURA 4ZKTB 3U4XA 3ILFA 2DU0A 2NMOA 2R0FA 2ZGQA 1F5FA 2E7TA 1BXHA 2ZGMA 5T50A 4LBLA 1JW6A 2ZGKA 2AREA 1URXA 4FPOB 4Y1UA 3TB0A 1Q8PA 5DUVA 1CPNA 2D6LX 5T5LA 3RMYA 4FPFA 4YW1A 2NP0A 1WW4A 2GMPA 1QNYA 3R4UA 3B3QE 5JOYA 2SBAA 2W52A 3T1MA 4FPCA 1DBNA 4XXAA 1JBCA 4YZ4A 2Q5TA 5T55A 1EPWA 1SLIA 2ZHLA 4YM0A 3VKLA 1CR7A 2I2SA 1AJKA 2JD4A 1MACA 4L8QA 2UU8A 1Q8SA 3AZVA 5LK5A 3SISA 1W6QB 2ZZJA 1PZ9A 1QKQA 3T1LA 1VAVA 1LHOA 3ZVXA 4Q8KA 5FREA 3N7JA 3POSA 4YGDA 4XOGA 2WQZC 5IUQA 2EF6A 5KXEA 1G9DA 3SH5A 2ARXA 2ZGSA 3WVJA 2AENA 5DUWA 4Y20B 1QGLA 5T5PA 1HQLA 3PJQA 4GKXA 4KBBA 1DLLA 4Q1PA 4WVVA 2R1DA 1LU1A 1QOOA 2NM1A 4FP3A 1SBDA 3O0VA 2ES3A 3AZXA 2ENRA 5GLUA 2A3YA 2ZABA 4M3CF 3IPVB 3AP9A 3ENRA 1SLAA 5EXOA 2LTNA 4YGEA 2GNTA 2KM2A 3N7LA 2EXIA 2Z42A 1FATA 1W6QA 3WV6A 2CTVA 3FUOA 3H0OA 3SITA 1LEDA 3MPPG 1OQ1A 3C2UA 4XMAA 1SACA 4DPNA 4XZPA 2A70A 2D6PA 2PHUA 2UWBA 4UW5A 1W6OB 4BOWA 1QOTA 2YZ4A 3NV2A 3I4IA 4WV8A 3WZ1A 4GA9A 4Y20A 5GM0A 2VUAA 1N1VA 3D6EA 1UAIA 1HDKA 4BMEA 5DUXA 5GLZA 3ZXEA 2R16A 3WCRA 1FV2A 3V0AB 5L73A 4XHBA 4RL7A 2PHXA 2YV8A 4FPGA 4MYEA 5T5OA 1OFSA 1DQ5A 3IKWA 3IPVA 3QLQA 3FUQA 2A6ZA 1GLHA 2CWSA 4Q1RA 4UW3A 3ZXFA 3FLRA 4FPKA 1YIFA 2W08A 3WG2A 2E53A 2DYCA 3WUCA 3PVOA 4ISRA 1DQ6A 2ZGTA 5E8AA 2D3PA 1LGCA 2WKKA 4XXPA 1LGBA 1A78A 1GNHA 2PHFA 3NWKA 5E88A 1W6OA 3ZSKA 2UWAA 2SLIA 4XILA 4LBMA 3O12A 2CL2A 3USUB 2DWRA 2ZMKA 3WNXA 1HKDA 5CBLA 2DTWA 3ZYRA 1LHUA 5H9SA 1H30A 2EAKA 3ZSLA 3B69A 1UMZA 3PVNA 5CAZA 5GZGA 3B00A 1LU2A 5FRAA 4Y1YA 3IM0A 3OY8B 1C4RA 1LULA 5EYYA 1BKZA 4P9YA 1F31A 1GV9A 1O4ZA 2D6OX 2A3XA 3AXEA 4NO4A 1D2SA 4YM1A 4Y26A 2R49A 3OGGA 3AXDA 2NZ9A 3RQ0A 4AYUA 1JYIA 2ZA9A 4M00A 4JRAA 4AGVA 1LENA 5HCFA 5GLVA 1V6MA 4LBQA 1G86A 1CONA 1MS5A 3L2YA 5DUUA 1LODA 3N7KA 1GZCA 4FPLA 5GZDA 3WDVA 1CESA 2D44A 3RMXA 1R1ZA 1ULEA 1WCSA 2ZMLA 2ZKNA 1MR5A 3O0WA 4GWNA 2D3SA 4Y1ZA 4Y24A 3NV3A 4GKYA 2P3IA 1KRIA 2B7YA 1AXKA 3ZXLA 3WCSA 2ERFA 4M01A 4XJAA 1YXWA 3FBYA 5GALA 2GN3A 4BQ1A 3ZYPA 1Y7BA 1FV3A 1Q8VA 3OY8A 4XJ8A 1SFYA 5IK7A 2PHWA 2ZGLA 5T52A 2V5YA 2DUOA 2WJSA 4RA0A 2DVBA 2DVGA 3AZZA 1JHNA 2R1BA 3M3EA 3A0NA 3SH4A 1ULCA 3OYWB 4FOQA 4Q8LA 3NV4A 3KQRA 1LCLA 4R9BA 1FNYA 2YXSA 1MVEA 3OBRA 4P9WA 2D6NA 1G8WA 1MS0A 1MS3A 3PVEA 1N3QA 1S0JA 1S0DA 3AP4A 4Y22B 1CPMA 1ULFA 5EYXA 4YZ1A 4PF5A 3MW3A 5AVAA 3RG0A 1V6JA 1MS4A 4PBOA 5CB7A 2WSUA 4YZ3A 1DQ4A 3A4UA 4GXLA 3WUDA 1LESA 3VKMA 1DYKA 5EWSA 1KJLA 4XJ9A 4HL0A 2E51A 1GZWB 2JKBA 1I3HA 3N7MA 1W0PA 3IMNA 3OYWA 1DFQA 1GKBA 1AXYA 2NMNA 1V6LA 2ZGOA 4W65A 1KQRA 5HCAA 1WBFA 2H0BA 2YROA 3HR9A 1BJQA 4YW5A 5JLVA 1AX2A 1DYPA 1W6PB 5CNAA 4XDQA 4Y22A 1WW6A 1G9BA 1MS8A 1U0AA 2JECA 1LECA 2A6VA 2PHTA 1A8DA 1MZ6A 4YGCA 3ZSJA 2C9AA 3R05A 4FOVA 4XBNA 1WD3A 3UJQA 3BIWE 1VLNA 1SLLA 1WD4A 3OPZA 5CA6A 5KXCA 3WDYA 3MW2A 4K1YA 2HYKA 3O0XA 1W6MB 4XBQA 4ASMB 4XJUA 4BPZA 4TZDA 1OKQA 3VUOA 1UKGA 1S0EA 2YMZA 3I8TA 1C1FA 1DQ2A 4UW6A 3WDUA 1GZWA 4FOYA 1UX6A 2W68A 4H55A 4YFWA 4D69A 1LOEA 1MVQA 3KM5A 4FPJA 4WVWA 2WLQA 4M3CE 1DGLA 1BQPA 1LGNA 2ZHMA 5E89A 3WG3A 4K20A 5DZGA 1F9KA 5T54A 2P3JA 1J1TA 1GANA 3AZWA 3RSJA 1YO8A 4FP2A 5GJ6A 3RS6A 3ZSMA 4WZFA 4DS0A 3M2MA 3AFKA 4FOWA 1ULGA 2NN8A 4PCRA 3AP5A 2P3KA 3ATGA 2A71A 2JDZA 2VY0A 2DU1A 1S0FA 1B09A 1WUVA 1V00A 1Z78A 3AZYA 2NYYA 3ZPYA 1VALA 4PBPA 1CJPA 4LBOA 5T5JA 2DVAA 2DVFA 4Y1XA 2A6WA 2PHRA 3VKFC 4AVTA 3JU9A 1N47A 2GMMA 3V0AA 3MW4A 1KDKA 1V6OA 2G4IA 5BYNA 3SH3A 4AGRA 1GICA 2ARBA 2VW1A 1UL9A 4YLZA 1N1YA 3MEPA 3WG4A 1JN2P 1YI7A 1SLCA 4LBNA 3BTAA 3POYA 1GNZA 2ZMNA 1NLSA 1MS1A 3FLPA 5GLWA 4YZ2A 1UN1A 3D4KA 4JCKA 2LALA 5GZFA 2EXHA 4Q26A 3SLIA 2ZGNA 3M3CA 3WDTA 4M3CB 5HCBA 1RIRA 2VW0A 2WT1A 3V65A 3USUA 1G9AA 1A3KA 1V6NA 4YG6A 1D0HA 2WT2A 4XIKA 2EIGA 3D5OA 1N1SA 3VKOA 4XTMA 4DRRA 1AVBA 4P9XA 1GBGA 2YY1A 4TYSA 4YM3A 3LCPA 1DQ0A 2GDFA 5H9PA 4K21A 3AYDA 3WHUA 4F83A 3ILRA 4C1WA 2UWCA 3AJZA 3RRDA 1ULDA 1G9CA 2CY6A 1AJOA 3W58A 1DIWA 1VIWB 2C5DA 2FMDA 5IK4A 1QMJA 1ZA4A 3UJOA 3WDWA 1BZWA 1HLCA 3N36A 1DHKB 2DTYA 4OZXA 4ATEA 1LOGA 4ZXKA 1ENRA 3M1HA 5H9QA 3APBA 3M3QA 2D43A 4BMBA 3FFZA 5IK5A 1Q8OA 3AP7A 1IS3A 4XE9A 2AR6A 4R9DA 1SBEA 4IQPA 1QF3A 1LTEA 4FVVA 4BM8A 2A7AA 1LOBA 4M3CA 1Q8QA 1QDOA 3B01A 5JOZA 3LSEA 2AGSA 1SLTA 4Q27A 1GZ9A 3VKNA 1PZ8A 1WLDA 4R9CA 1H9WA 4YW4A 1V6KA 4XBLA 4HANA 2GNBA 2DV9A 2JE7A 1FX5A 3DUIA 3QCWA 1LOAA 2GMEA 1H9PA 2A6YA 1FYUA 1FNZA 1AX1A 1ONAA 1APNA 1S0BA 3CNAA 2A75A 1LOFA 2BQPA 1IKPA 1GYKA 5JOXA 1QNWA 4ATFA 2AUYA 3AX4A 4GWMA 1SCRA 5SV8A 2OW4A 1I1EA 1LOCA 4DRVA 2D7FA 2A3WA 2VU9A 2EALA 2JE9A 3DGTA 4DFSA 1FAYA 1JUIA 2ZGUA 2GNMA 4FPHA 3W59A 4YGBA 3LSDA 1CVNA 3ASIA 4ITCA 3AYCA 2E7QA 4YG3A 1CN1A 3IN9A 3INAA 4PQ9A 1S1AA 2ZHKA 2W39A 3R4SA 4C1XA 4I30A 2CNAA 1UPSA 3BODA 4AVVA 4XJZA 4AVSA 2EXKA 1KDMA 5DZFA 4AGGA 5F9TA 5GLTA 1DZQA 2P2KA 3WLUA 3BOPA 4JC1A 4LBKA 3V0BB 1SBFA 2OUJA 1O4YA 2GN7A 2WSVA 3AJYA 3AK0A 5KXBA 1ENSA 3ZXKA 1IS5A 1DQ1A 2DUQA
chains in the Genus database with same CATH superfamily
2A5ZA 5IVFA 3JD73 2FDHA 5FLJA 4RN5A 4IGPA 3HN1A 5DAPA 5LB6A 2R062 5FZAA 3OD4A 3C7FA 5IK8A 1W6PA 2DVDA 1ZM1A 1JYCA 4RHV3 3SNMA 3ZFEB 4Z8BA 4FPYA 4MHRA 3MUY1 1RUNA 4CP9A 1H8TB 4IE7A 4OHXA 3OJBA 2JG9C 1U5IA 3OGRA 4EWEA 1AZDA 2GALA 5CFDC 1RC6A 2VZTA 5IYYA 1GOFA 3QH6A 4WVMB 2Y60A 1ND2B 3FC0A 3M3OA 2W1QA 2HWF3 2AH2A 1W8UA 4LBQD 1NXD1 5JMOA 1S0GA 3DEMA 3FZ3A 5SV5A 1WMDA 5A6XA 5KC6A 3ES4A 1NCRA 3KV4A 3UL2A 4QDRA 5DG2A 2WWUA 2QZ2A 2WLPA 5A7WB 2BV4A 1G9FA 1AR63 3H7JA 3O5SA 4D6QA 5IVCA 1HN1A 2OUHA 5FUIA 3WOGA 4MOAA 2HWC2 2VW2A 1H6YA 4D3WA 5I91A 2VUDA 2RR13 2RMU3 5I0UA 2J1TA 3SXWA 1XB9A 3RPQA 5IT6A 1UW8A 2IXLA 1AXZA 3HPNA 5JZGA 3GALA 1HJGA 1JOJA 1TME3 4QM9A 3LIGA 1NAEA 1UZYA 1W6NB 1H2LA 2R0HA 2HYXA 4Y33A 3S5QA 4OHWA 4ZHNA 4LTAA 1X50A 4QPIC 1EUTA 1H6XA 1JZ5A 1QJEA 4MGZE 2ZX0A 3MV01 5L7OA 1CGPA 2CWMA 1PO21 4BLIA 1O3RA 3JXSA 5FOBB 5H9RA 4LO4B 3I59B 1LOFC 2D6MA 1TMF3 4ASKA 5KXDA 2W3JA 5FYVA 1W8OA 3IAPA 4AE2A 4MLOA 3DYPA 4GJYA 3WHTA 4AI1A 4BA6A 2WZR3 1WW5A 3CO2A 5C70A 1UYYA 2DCZA 1BLZA 1COV1 4YVSB 1IS6A 1TVGA 1Y43B 3VBFB 4AFMA 3SEEA 2OVUA 1UOBA 3RZKA 4I2OA 2HWB1 4UW4A 1CQ9A 1UIJA 1YC61 2GNDA 2XBO3 4GALA 1VAKA 4MX3A 1AYN3 1RUF2 4GD4A 1ZBE2 4Y1VA 1W04A 1JZ2A 1UU5A 4MGYE 4NMIA 5FP4A 2DU0A 2NMOA 5FQ0B 1F5FA 1DZTA 1SDWA 3LFIA 1JW6A 3D82A 4Y1UA 4NJ4A 2VQAA 1W8WA 3QBQA 4LO6B 1W28A 2Z69A 2E32A 3BU0A 3WF1A 5FYZA 2OA2A 4FPFA 3BI3A 2NP0A 1CAWB 2HWD3 1UXZA 1QNYA 2X53S 3C3VA 4NHLA 3ALQA 4Z92B 5JOYA 1PMJX 2RS31 2VR4A 2JDHA 5FO7B 1GQPA 1R1A2 2VMHA 2ZKLA 3VKLA 4CPBA 1AJKA 1MACA 1O4TA 3S0MA 3SISA 4QQOA 5LA1A 1W6QB 2ZZJA 4S2FA 1ZRCA 5BNOB 4HK9A 1ND3C 1J58A 5A7NA 1I6XA 4Q8KA 1RUG2 1ZZ6A 5IUQA 4LHNA 2EF6A 2XJUA 5LRRA 2W0XA 2ARXA 3NW4A 3WVJA 5LASA 1W9YA 5HXVA 3KHCA 1ZREA 2BNMA 1LKNA 1RUC3 1AL23 1HQLA 4INDA 3PJQA 3IB3A 4QX1A 4WVVA 1BBT1 3SC7X 1QOOA 4FP3A 3AZXA 3VBOC 4Q5OA 3ZN6B 5C7GA 2ENRA 1S4CA 2UYAA 1QJU2 2A3YA 5JXIA 1IG3A 1VBA1 3IPVB 5CIRA 1O5LA 4ONUA 2WO1A 4QPGA 1ND3B 3VBHA 5JSRA 5C6CA 3DPRB 2KM2A 2XKPA 3N7LA 1IPJA 2PAMA 5LBFA 2MNGA 2IXKA 2PTMA 2CGNA 3WV6A 4O9GA 2Z4FA 4KWJA 5FYSA 1LEDA 2XJSA 4HBNA 5FY8A 2L9LA 4A6SA 4DPNA 4EWDA 5AC92 4XZPA 2PHUA 4UW5A 5TSWA 1W6OB 2FCVA 2Q0AA 1E5SA 1TQ5A 3C7OA 2F4PA 3WZ1A 1VBC2 3NAPA 4Y20A 1M4WA 4JGYC 3D6EA 4XUNA 5F3GA 3WF2A 3BGAA 3J8F1 5I8SA 3K46A 5F5CA 4BMEA 5LBBA 1JYWA 3EBRA 4A2UA 4CU6A 4XAAA 3VBRC 3LEKA 3NRUA 2PHXA 2XQRA 5FZHA 4ZU7A 3NJXA 1DYOA 2YV8A 5T5OA 2HEVF 4XAEA 3W5NA 1NQDA 4NPRA 4UT5A 1YIFA 2ARCA 2Y8KA 4NRMA 4D7YA 5FUPA 2XHNA 4EZHA 2FQPA 3WUCA 1S2BA 2ZGTA 5BNNA 2BGPA 1WKYA 5E8AA 3CMGA 3E6DA 2WKKA 3ZFEA 4JGYB 1EY2A 1RUJ1 3ZSKA 1S2KA 3USSA 3MHZA 4CUGA 1H8TA 4BU2A 5A70A 4LBMA 3VBRB 3U1XA 2ET1A 4NPLA 4P08A 4TLFA 3USUB 4AI3A 3ACLA 1IGOA 2JIGA 4FBFA 1W8ZA 3LDBA 5K0UC 4QKNA 2DTWA 4WVMA 4QGNA 1VMJA 2DFCA 4RD7A 5FXVA 1H30A 3ZYRA 1ACCA 4HFSA 4P9JA 4AZZA 3B69A 4Y5Z0 1LU2A 4BB3A 1OBNA 3I7DA 4Y1YA 5DAVA 4N43C 1LULA 3OGSA 3DECA 4A3ZA 3KWVA 2D6OX 1GV9A 1O4ZA 2EVXA 2A3XA 3IBMA 2H6BA 2DCKA 1XPWA 2XMLA 4GMP3 4IEUA 3C8XA 4K3UA 4CCOA 3MF9A 4CCJA 2AZ5A 5A7WA 4D8MA 2XJTA 4K7JA 2WWSA 3LA7A 2JG9A 2YUEA 4OI2A 3SHRA 1V6MA 4A42A 5K0UB 1CONA 5CFDA 1H1AA 2ZXQA 3CJIC 3L2YA 5GZDA 2B8MA 3RJ2X 3JB4C 4K9SA 3BTXA 1OPOA 4OHVA 2H0VA 5FJKA 1VBB2 1JODA 2ZKNA 4GWNA 2JDKA 4A7KA 2JG8B 1D4VB 4R4ZA 1KRIA 2RS11 1RMU3 1K5MB 2B39A 1AXKA 3WCSA 5GALA 4M01A 5C4WC 5G04L 3URFA 2MPFA 3OG2A 1FV3A 1Q8VA 5IK7A 5C9AB 4Z2AA 3THCA 5T52A 1IPSA 2V5YA 2WJSA 1DDLA 1FT9A 3LFMA 1H2MA 3PTYA 3I59A 1M06G 4CXWA 4DB5A 5KR7A 3WF4A 4BQYA 3SKJE 5I93A 3KQRA 1Q43A 1FNYA 1MVEA 5F32A 4BQWA 2WABA 1MS0A 2XJPA 1MS3A 3PVEA 1JZ3A 4QPIA 2VUCA 2PHLA 3PTRB 1FOD2 4LE4A 3VBFA 1CPMA 5C4WB 1UZVA 4YZ1A 4L2NA 3KGZA 2VZPA 4AFCA 4ZZ5A 3HQRA 3KT7A 3H3ZA 3ZMOA 1W9TA 4CEWB 3H3LA 2D5FA 4A44A 1JYTA 1JOBA 1NKGA 1KD7A 2IXCA 4JAAA 2B46X 3Q8FA 1UU6A 1PO22 5FO9B 1RUOA 1Z7S1 2W2IA 2HWF2 4UBGA 4GZ9A 5FXWA 2DCTA 4Q0PA 1GZWB 3N7MA 2YPDA 3IMNA 3MV11 4DXSA 3GDBA 1DLCA 4PHZA 4AEKA 1CAWA 1ZRIA 1GKBA 2P5BA 1AXYA 2Z5WA 2JB4A 2NMNA 2XR4A 4QHBA 3TEXA 4C8DA 3HR9A 3RZLA 4S2DA 1BJQA 4W4ZA 4EZ4A 5JLVA 1VBD3 4HXCA 1COV2 1O6UA 4AK3A 5C3OA 1MS8A 2JECA 1LECA 2VMIA 3ITQA 2YB7A 5LATA 3H1MA 5BNOA 1KEXA 2WS91 1CAVB 3TNQA 4XBNA 4PLOA 4Y4YA 5F3IA 3UJQA 1VBE3 2XVGA 3BCWA 1KXGA 2VCAA 2QNKA 4K1YA 3RFRA 3TOJA 1QQP2 1OVPA 4B1MA 2BWCA 3AMHA 2W94A 1OKQA 3CZJA 3BB6A 3M8LA 4Q4Y1 1W2OA 3I8TA 4BE3A 4YFWA 1UX6A 4H55A 3N9PA 3OBAA 1MEC2 4BQ2A 1AR71 1LGNA 5EZWA 3ZN6A 4QB6A 4CVUA 5DZGA 3AKPA 2FCUA 1EV11 4UFKA 2RS32 2WYFA 3IZOA 5T54A 4CCDA 3FN9A 2DCJA 1ND3A 3POEA 1I5PA 4N7UA 3DPRA 4GB31 1C8M3 4LO8A 4K6BA 5F5AA 4FP2A 1ZRFA 3M2MA 4FOWA 1NUKA 3LA2A 4NROA 2FDKA 1D4M1 3AP5A 1W9SA 2VY0A 1US3A 3MI8A 3I3QA 1S0FA 4ET7A 5CVRA 1B09A 3TRSB 3ON7A 2XUMA 3AZYA 1V00A 3KVAA 3NL1A 4XF1A 1OQEA 2NYYA 2FD8A 5BNQA 1OA3A 4LBOA 2DVFA 4Y1XA 3CU7A 4QPYA 3GJBA 2QQUA 3JU9A 5FLHA 4BXFA 4DEQA 1ASJ3 2WAOA 2YC2A 2HWE2 2PLV3 1PMHX 4AVBA 3W5MA 1H2NA 2G4IA 4IDZA 4AGRA 1GICA 4XFFA 5FYCA 2G9FA 3J7NA 4DINB 1SHWB 2VW1A 3J9SA 1UF2C 2XUEA 2X29A 5BXXA 1XE0A 4ES8A 1JN2P 5JI9A 1JUHA 4LORA 4SBVA 4I0AA 3POYA 2W1WA 4LHLA 3HD8B 2P1BA 2XL9A 2VMGA 2VC9A 1NY71 4JGYA 2EXHA 2RJLA 3ZXAC 2YBPA 3M3CA 4DOUA 5HCBA 3VBRA 2R071 3USUA 4XZUG 1XNKA 1V6NA 2ZZQA 4JQTA 2JX9A 2G19A 2WT2A 2PXJA 4XIKA 2EIGA 3J8F2 2WA3A 2VVDA 1T6BX 1AVBA 5J1XA 4E8DA 4TYSA 2Y0OA 4B7KA 4P02B 1PM4A 4EN9B 4CPBD 4K21A 3WHUA 1ZRRA 3JQWA 1OXCA 1ZBA1 3OGVA 4C1WA 1KGYA 5FJHA 3C7EA 1VIWB 5IK4A 1C5HA 1HLCA 2DTYA 3WNOA 3I2OA 3VB9A 1ENRA 3M1HA 3DYOA 4N9HA 4LK6A 1GQGA 1OA4A 4BQ3A 5K0UA 1GZTA 3I2FA 1RUJ2 1YQ6A 1SBEA 1HN0A 1JYNA 1LTEA 2RE9A 1R091 2RM23 3B01A 4F8AA 4LK7A 2R061 3I2HA 4IUGA 3LSEA 5FPLA 1SLTA 1RUI3 4R9CA 3A21A 3K3NA 4XURA 2RJKA 3DUIA 1FX5A 2MHFA 3QCWA 1LOAA 1WA6X 4NAMA 3T0BA 5ABJC 5KHKA 1PVC2 4NHYA 2A6YA 2WIIB 4LMFA 4QB1A 3CHXA 2I74A 1AX1A 3CNAA 1GP6A 4MXVA 5FYHA 2PA7A 2BQPA 2IXHA 5JOXA 4LUKA 2ZX4A 2EIDA 3VD9A 3CJIA 1YFYA 4LIVA 2D7FA 4PQQA 2A3WA 2VU9A 4QX0A 3T4HB 2JE9A 2R041 5F6KA 2ZGUA 1A6CA 2PQSA 4FPHA 1VRH3 2OIIA 2RDQA 3LSDA 5DAWA 4RQPB 4NAOA 3HVDA 3INAA 1RVF3 2ZHKA 5C4WA 4RFT0 4DZGA 1L3JA 3QD6A 3RZJA 1RL3A 1RJ8A 3GZEA 2HWC1 1UPSA 5KHIA 3ACGA 5FZMA 4CP9B 4LHSA 3Q8BA 1DGWX 3O1TA 4XJZA 1PGSA 3AL6A 4CEWA 2B9UA 2ZAHA 3K3OA 4AHZA 3E97A 4CDQC 4RGGA 2RDSA 4XEZA 4JC1A 5KBFA 1L7RA 5FZBA 1C5IA 2XJRA 2GN7A 5KXBA 3AJYA 3AK0A 2WFF1 1ENSA 1IS5A 3MIBA 5FMOL 2G9GA 1K42A 3GNEA 5LCWL 2VZQA 4P5YA 4W8JA 2BVVA 4A45A 3J26N 5FMCA 1U12A 3ETPA 2LUWA 2IFWA 5D2AA 4HKLA 4CZSA 1PO13 2XG3A 3VDAA 4KGQA 3SCHA 2JKXA 1XYOA 3VLBB 3AP6A 3BYWA 4PIZA 2ORXA 1RHI1 3UKNA 4I09A 1CAVA 3KCCA 5FYMA 3OSDA 4YM2A 2MEV1 2ZACA 4HN0A 4E9KA 3CEWA 4Q2FA 1EAH1 4YZ5A 3BTZA 1SCSA 4R9AA 3T0DA 1VMFA 4FQZA 3BPZA 4IE5A 4QHZA 3MZHA 1LJ7A 3AYEA 1Z7S2 3OGJA 3PJYA 4PLNA 5FPVA 5J36A 4CEYC 2VTXA 5FMDA 4QX5A 1E5RA 1GOGA 4E27A 4BIFA 2VXRA 5KHGA 5L7OB 3B9IA 2X10A 4NHKA 5T3NA 4AQ2A 4CP0A 2XH6A 2Y6GA 4JHTA 1XYPA 3SKVA 4U36A 3LA3A 1S0IA 2WNEA 4Q4W2 3LF7A 2FHRA 5FMOS 4XMIA 5A6QA 3H3UA 1B35C 4QGLA 1OLME 2CAVA 4NIIA 2WS92 3IDAA 3THDA 3HBZA 1PM7A 1YRZA 4BLJA 5F5QA 1R1A1 2Q1ZB 3LEMA 1PGL2 4RGKA 5C5TA 2C9KA 1R081 4BHPA 1POV3 5BUVA 3VV1A 3RNSA 4Q4Y2 1JZ4A 4CE8A 1YYNA 4AVCA 2V09A 1QOSA 3NJZA 1RUG1 2P37A 2EAAA 2VNRA 4XACA 1GR3A 1BVVA 1AR72 1RINA 1AX0A 5DG1A 5K4LA 3POWA 3PUHA 3HMYA 3TN93 3NNFA 3N9QA 1EV12 1AF9A 4Q4V2 4OQ8A 2J1SA 2VZ3A 2TBVA 3AMMA 1IS4A 2J1RA 4XQDA 4U2AA 5C8WA 1JXNA 2D6KA 3WDXA 1MS9A 1W8TA 1QJU1 3K4ZA 4Y3OA 2BWAA 3WG1A 4W6WA 1D4M2 1ZZ8A 3ZR5A 3K4AA 4BDVB 2CGPA 1ENQA 3Q9OA 2VOXA 1QDCA 2W1SA 1NZCA 5I0RA 3ZYBA 1IHMA 4URAA 2WZ8A 1JYVA 2V73A 4YW3A 1YUDA 5LA9A 1OT5A 3JUUA 4CDUC 3AC0A 1BK0A 4JKMA 5AC91 3NQHA 2VNOA 3OBTA 2UURA 4AHWA 2O0OA 5G05L 2ZGQA 3VZMA 1BXHA 5A7SA 1VBC1 1URXA 2GC3A 1DZRA 1RTVA 2IZWA 1QJX1 4XQ4A 3WP5A 4GULA 5T5LA 4D6SA 3M3IA 2GMPA 2CDOA 3AKTA 1RUE3 2W87A 4IE6A 4CXXA 3B3QE 3ME2A 1OH4A 3T1MA 2Y6FA 1DBNA 1OH3A 4DUWA 5T55A 1EPWA 1W2UA 1SLIA 1DU3D 1C8M2 1LR5A 1XU2A 2ZHLA 1RUD3 2JD4A 4L8QA 3F2ZA 5LWBA 2RS53 3WQ1A 1DG6A 5LK5A 3WY6A 2YFUA 4RGAA 1W05A 2ZEXA 1NOVA 5A80A 1NA1C 3T1LA 3FFQA 5EV7A 1VAVA 4LA3A 3WF3A 3N7JA 4Z1VA 3I54A 4IE4A 4XC9A 5KXEA 1G9DA 4CYDA 2ZGSA 2PQQA 5FZ6A 3WNNA 4LJHA 5IATA 2VMFA 1OLRA 2AENA 2PYTA 2VVFA 3NAPB 1PVXA 4Y20B 4AI2A 1QGLA 5T5PA 1ZBA2 5FBJA 4GKXA 4TXWA 3ACIA 1DLLA 5JCTA 4BIOA 3O0VA 4HSLA 2ES3A 4LO5B 1JOPA 3PDQA 4M3CF 5L19A 4Z07A 3MLKA 3AP9A 1SLAA 2J1AA 2LTNA 2KXLA 5F3CA 1YI9A 2GNTA 1UY3A 4RQPA 1R092 3ZM8A 4HVQA 5EPAA 3ACFA 5ABJA 2E26A 3MPPG 1OQ1A 5BNNB 2W5FA 2WR9A 1SACA 3P3PA 1WMFA 2UWBA 2JEMA 3PUSA 5LBCA 4G4FA 4BOWA 2YZ4A 3FE5A 3GCWA 2NPIA 4OULA 1MQTC 1SMVA 2RV9A 5DQ0A 4GA9A 1VBB1 2JDPA 2VVEA 4XF0A 1JZ8A 1UAIA 5C8CC 1HDKA 2HKXA 3P5BA 1JS9A 2R16A 1ZX5A 3V0AB 5L73A 4XHBA 3OD0A 5BY5A 5FXXA 5FZKA 3T2PA 3S57A 2VTXJ 1DQ5A 2R042 3IKWA 2CWSA 1GLHA 4PT6A 4AI9A 4Q1RA 2Y6JA 1ZNPA 4UW3A 4AAXA 3FLRA 3WW4A 3WG2A 1W99A 4YWAA 1ZRDA 2DYCA 4TLGA 2X09A 3PVOA 4R4XA 1DQ6A 4N53C 4AAPA 2BVBA 3U10A 2JG9B 4QX7A 1LGCA 2P6CA 4XXPA 5CFDB 1LGBA 1A78A 3CLPA 4FCAA 5E88A 2SLIA 2YG0A 5APAA 1C28A 3MYXA 4KNCA 4XILA 2FDGA 2DWRA 3WNXA 1AR92 1FOD1 1F5JA 4G9SB 1LHUA 3SEPA 5A6ZA 2VNVA 4I02A 2EAKA 4DXRA 2VOWA 1QJY3 3PVNA 3BU7A 5CAZA 1UY0A 5GZGA 2CU5A 5FRAA 3AMQA 2WFF2 1FPN3 2GC1A 3IM0A 4H7LA 4OHZA 5EYYA 3VN4A 2VZOA 1BKZA 2O8QA 5FR3A 1PIV3 3PIGA 3AXEA 4YM1A 2HWF1 4FAGA 3ZO0B 1UOFA 3EYPA 2R49A 3OGGA 3AXDA 2HWB3 4XPVA 3RQ0A 4AYUA 1HXS2 2ZA9A 1HB4A 2YU2A 1O8PA 4FFIA 4GWIA 5GLVA 1YLLA 5FP8A 3MIGA 3S7IA 1RHI2 2WA4A 4META 3BN6A 5FZ7A 5FOJB 3RMXA 1R1ZA 4QXKA 2MEV2 4QPIB 4CU7A 4NHXA 2D3SA 4OUEA 1EAH2 4Y1ZA 4CEYA 1NE4A 4AEDC 1J84A 1UY1A 1J59A 1NCQC 3LIHA 2B7YA 2R7EB 4AFBA 4B4PA 1OPMA 1HB2A 2QDRA 5FPBA 5I0TA 1OURA 2VUJA 1GWLA 2JICA 5FZGA 3FHAA 3ROUA 1KS5A 5A7PA 3UT0A 1QQP1 5CZKA 2YBKA 3ZLIA 1BMV1 1B35A 3AZZA 4CXYA 1JHNA 3K4DA 2R1BA 1RJ7A 1MEC1 3E5XA 4QXBA 3KLSA 3SH4A 3WR0A 3ZYHA 1XSQA 2UY9A 4EQVA 5JAXA 4QQHA 1LCLA 2YBSA 4AEDB 4IXLA 2YXSA 4P9WA 1NCQB 2JDAA 2D6NA 1QJFA 1TMF1 1G8WA 3JBG2 1UOJA 1OF3A 1WCQA 1N3QA 1E57A 1ZZ9A 2BEOA 3HNMA 3NNMA 4CA9A 3C7GA 5EYXA 3ZKYA 1R082 2WZR1 5AVAA 3WT3A 4NWWA 4R8HA 3FMGA 4IEQA 4DEVA 1OD5A 2VMDA 1V6JA 4PBOA 2WQ8A 5CB7A 3H8XA 1VBA3 1GNYA 2WSUA 2CV6A 3A4UA 4GXLA 4LPLA 3WUDA 5E16A 1UYZA 4FT8A 3FHQA 1PHMA 2XBO1 2Q4SA 1DYKA 5DDJ2 1KJLA 5EWSA 1AYN1 3VDDC 3POBA 4HL0A 3PLQA 1OLMA 1J3PA 3PURA 2V4AA 4NRPA 4JVAA 4CCMA 4P00B 2QE3A 4PLMA 5DAXA 3OYWA 1AYM3 4QKFA 2HWE1 4KWLA 3ZYJB 5EJZB 4W65A 1WWYA 2H0BA 4UFMA 5FYTA 1K3IA 4WM8C 2BYVE 1AX2A 1DYPA 5CNAA 2VTFA 3BALA 4Y22A 1OA2A 1WW6A 5A3LA 2HWD1 1A8DA 3NJYA 3ZSJA 4PIYA 2XKOA 3R05A 4XETA 2KR2A 3VDDB 4B29A 1REDA 1SLLA 4UBHA 3O0XA 5EHDA 4XUPA 4ASMB 3DKWA 4TZDA 3B02A 4GJZA 3UGFA 3VBOB 2BJSA 1S0EA 1K12A 4UWDA 4QD2A 1DQ2A 4CCCA 4E4HA 5JSPA 4MH0E 1QJX2 1MVQA 4FPJA 2OKXA 5IVEA 4OVEA 2WLQA 1NLQA 1DGWA 2ZHMA 5E89A 2Y38A 3WG3A 3WW2A 1AR83 1W03A 5AFBA 1VB2A 2IUWA 1GWMA 1UMHA 2WZPP 2LRPA 4JDMA 3ZPOA 4JGZC 1J1TA 2BOIA 3AZWA 5F8PA 1O8SA 3RSJA 1W06A 5K9YA 4QAWA 5LW9A 3BUCA 3RS6A 5CADA 4WZFA 1W0NA 4COYA 3MFCA 1ULGA 4IV3C 4IERA 2NN8A 5JIUA 4PCRA 2P3KA 3ATGA 1SEFA 4F7ZA 2DU1A 4MV2A 1BEV2 2WINB 4MGKE 4COUA 1WUVA 4C0HA 2WNOA 2XGXA 1DGRA 1W3VA 4IEOA 4MSVA 4X8NA 3ZPYA 1U5XA 1XOYA 3PVBB 5T5JA 1CJPA 3VKFC 4NVPA 4QMAA 5KWRA 3ACHA 3SCGA 4JGZB 3V0AA 3MW4A 2IC1A 1PVC1 4HVOA 4RFRB 1KDKA 1V6OA 4JRLA 5BYNA 4OMCA 1OF4A 1TZOA 4Q0QA 1RXFA 1UL9A 5I0DA 4LT5A 3IAQA 5C71A 1JU3A 3V56A 5FY7A 4DY5A 3CBNA 4MVTA 4IEWA 1MZEA 1W2AX 1SQ4A 3BTAA 4IEVA 3CL1A 1GNZA 4ZS2A 5FUNA 5FZ4A 1GMMA 2Q30A 1PX3A 2DBNA 1NLSA 2RS13 2ZMNA 3FLPA 3HN3A 3LDRA 4HZFA 5GLWA 4B1LA 4W50A 1W39A 4Q26A 3T30A 1Y4WA 1YQ5A 4AHXA 2WN2A 3OUJA 5IAXA 2Y6HA 3V65A 2A73B 4A7YA 4E4SA 3VHNA 1D0HA 3UGHA 3J4UH 1FMD2 1VJ2A 4I0BA 3X29B 5FLIA 4N43B 1VPHA 1GBGA 2A1XA 5FP3A 5H9PA 5D8AC 1ULDA 3I97A 2QDNA 3NNJA 4N53A 2BUKA 2YPJA 3OPWA 3O1SA 5AVPA 1HB3A 1QMJA 2EIEA 3RYRA 1BZWA 1CAUB 3WDWA 3N36A 1IG0A 4ATEA 3CJIB 5EJ3A 2QTWB 3VBUC 5BNPC 4IEPA 4BMBA 2D43A 4YRDA 3U4SA 1V9U3 3JD72 1SZBA 5A6YA 4GMP1 1NLRA 5CKMA 2VOTA 4M3CA 1QDOA 2C26A 1SPPB 3A7QA 4KGGA 3POIA 2XWBB 3PUAA 3CKHA 4RHV2 1GZ9A 4XFIA 3VKNA 1PZ8A 1WLDA 5F2WA 3AB0A 4XBLA 4LIUA 2XWJB 4RYDA 1W9WA 3Q8EA 2GMEA 3MF6A 4Y5TA 3WQBA 1LNSA 3RZMA 2BNOA 3VBUB 1W9FA 1LOFA 4FO9A 1K45A 5C3SA 1IKPA 1I5ZA 1QXPA 1RUH3 3GZUC 4GWMA 3I2JA 1UCXA 5SV8A 1UZWA 5JIAA 4DRVA 5JPMB 1PK6C 3DGTA 4DIQA 1HQNA 3NKGA 3H1WA 3N9MA 3NNLA 4P5HA 2QBXA 4AEDA 3ZDSA 4YGBA 4V2WA 3I3DA 1XSRA 3KS7A 1NCQA 5CYYA 1AR62 3AVRA 4Q4W1 4AR2A 4YG3A 1CN1A 1UWWA 2W39A 1ZA7A 4C1XA 3BOWA 4I30A 2J7MA 2RR12 5E6HA 2RMU2 3EXUA 1YCIA 2WDBA 1QJZA 1F4HA 2EXKA 2Y6LA 5DZFA 1TME2 3POGA 3ZFGC 5M0TA 1UOGA 1PGL1 4OZOA 1CD3G 1DZQA 4G3YC 2X5IC 1H4HA 4GAZA 3MO4A 3VZJA 5ACA3 3BOPA 1BMV2 4GB33 4XDOA 2B9VA 2GC2A 2OUJA 2VCCA 4NIDA 1QXRA 1VP6A 4YSFA 4OMDA 2BBAA 1STMA 2Q8DA 3LQCA 2JDUA 4EN6B 4A3XA 1WBLA 1HRV3 4O61A 4YPJA 2QFEA 2JDNA 4Q4V1 1TMF2 3N35A 4WZCA 3T0AA 4CTEA 3RYPA 2CDPA 1HIXA 4JDNA 2ZGPA 3MICA 4EV0A 4XFCA 5JXGA 4FFGA 5J09A 1H0BA 1EYBA 5A3WA 5JMCA 2BW8A 2WN3A 3D0JA 2WZR2 1OD3A 2QVSB 2PAEA 2X5IB 3VDDA 1QU0A 1VBD1 2G9ZA 1YIPA 4LO7A 4UXAA 4CUBA 3KCXA 1XQNA 3FLTA 3ZXJA 4CU8A 3AL5A 3M4FA 4L9BA 2XBO2 4HT1T 2RVAA 2OPKA 5A7QA 3ZYFA 1AYN2 5FPXA 3VBOA 4QHOA 3V0BA 1VBE1 1YNAA 1IOAA 4N9IA 1RYYA 3I3MA 1WLTA 3HEIA 4QX8A 4WM8A 3HNYM 3AKQA 4KI5M 3O7OA 3U14A 5JVVA 3ZN4A 5IVJA 3I49A 3VD3A 1F2NA 5J3UA 4QQLA 1XBFA 1GSLA 2V4VA 2FDFA 3ILNA 4DXTA 1BYHA 2R073 3ZKUA 2NQYA 1VAMA 5CG8A 2HWD2 4JQRA 2Y6KA 2DURA 1KJRA 2WT0A 1U5YA 1W8HA 4XJWA 4CU9A 5GZCA 4Q0SA 1W8FA 3ELNA 3MGUA 4HETA 1IQDC 1Q56A 2PELA 4YW2A 3WXPA 1C8M1 4XW3A 3T09A 4CRQA 1WCDJ 2K2SA 2WC2A 2Z79A 3D8CA 4PF1A 3E5QA 2RHPA 4IEZA 3D0SA 4Q4X3 4BISA 4EN0A 4KG0A 3NV1A 4Q0UA 3I2KA 1LEMA 2QQMA 2WNUC 1W0OA 3MDPA 3UK9A 1D7PM 1REEA 1TNFA 4JGZA 1C1LA 5IHRA 2CGOA 3WW1A 1RUC2 3PHMA 1AL22 5ISLA 5FZOB 1N3OA 3B9CA 5HXMA 4AWDA 2NLRA 4JHZA 2B45X 1UD1A 2IWGB 2UY8A 2R063 1AYM2 1ASJ1 4XUQA 1GFF2 2O8OA 2PLV1 3BTYA 5GZEA 5DXDA 4YFZA 2K0GA 1UNBA 5LA0A 3A23A 4HN1A 5FP9A 3GBFA 1RXGA 1CIWA 5IJRA 1KITA 1POQA 5HCHA 3PMEA 3TWIA 4FPEA 1PZ7A 4XTPA 5IWFA 3N9OA 5ANNA 4ES9A 3T2QA 4EN8B 4CP1A 4DNYA 4QDSA 2P4EA 3DKQA 3U4XA 4N43A 4N90A 5ERLA 2R0FA 3BKZA 4LKDA 4I3PA 4LBLA 3RGBA 2ZGKA 3NNGA 3B93A 2AREA 4FPOB 5FYUA 4N8MA 2QQPA 3VDBA 1X9TA 2GP5A 1ODMA 2D6LX 2HEWF 4X8PA 3VBSC 3RMYA 3N4MA 1AR82 1CAUA 3FWEA 4H14A 4YW1A 5J7MA 4UAPA 3C7HA 3KZ4C 2HWC3 4KU8A 2QQNA 3B5LB 2BFUS 3OTFA 3I3EA 5FY9A 4AFDA 1X82A 1W90A 1JBCA 1ZZCA 2WZEA 2Q5TA 4WM7C 4YZ4A 4OHYA 3KD4A 3CF6E 1CR7A 3R4DB 4NE9A 2LW8A 4K8FA 3HNBM 3HOBA 1SPPA 5ABJB 3ZVXA 2ZEYA 3DF0A 3SQOA 5FREA 5A32A 3POSA 4YGDA 4XOGA 5D8AA 4AW7A 3SH5A 3UNPA 2RM21 3ES1A 3HAGA 5FZFA 4NN0A 1R64A 3RI8A 3VBUA 2D98A 1AR91 2ZEZA 4Q1PA 2OS2A 1W2TA 2R1DA 4O7XA 3O14A 4Z82A 1JTZX 1SBDA 2K46A 4HK8A 5HPOA 2QQKA 3GHNA 1MZFA 1NCRC 4HLTA 3NJVA 3P3NA 3E6BA 2C4XA 3AMPA 1XNDA 2AEYA 4YGEA 4CDXC 2OT7A 2J42A 2ZS6B 3KT4A 5FMBA 2ADDA 2CTVA 3H0OA 4AEJA 1HXS1 3O1VA 4XMAA 3VHOA 4AI8A 1RUF3 1ULPA 2AEZA 4HKWA 1ZBE3 2IXJA 2JDYA 2A70A 2D6PA 2WWJA 3KVBA 3TNPB 3UV9A 5CFCC 1QOTA 4CDQB 5FKCA 3I4IA 4WV8A 1JHJA 3RWNA 3RYKA 1RVF1 5GM0A 1N1VA 5JZGC 1WA4A 1OLQA 1ZVFA 2E7AA 1PK6A 1RMU2 3R0RA 5GLZA 3ZXEA 3NKTA 3WCRA 1FV2A 1VB4A 3LDKA 3U07A 4RL7A 4C91A 4CDXB 4Q0VA 4FPGA 4NRQA 2YDEA 1OFSA 3QLQA 5FWEA 4COVA 2ZJCA 4ZZ8A 2A6ZA 5FYBA 1CZTA 2CSGA 3LAGA 1XE7A 5L9RA 3AKRA 4CDWC 1YWKA 5CFCB 1YQ8A 1HX6A 2E53A 1UQXA 3PL0A 4CCKA 4ISRA 1LB2A 2QJVA 2IVJA 4OYUA 1GNHA 3NWKA 3ZIXA 1UZ0A 4OUSA 5FBZA 2X5IA 4N7IA 1AUYA 1HJFA 3WF0A 2VL4A 3JBG1 3O12A 4QU2A 4MHUA 2R30A 1PO11 2ZMKA 1YFWA 4CEYB 3W20A 4AQ6A 5J98B 1XXNA 5IFPA 4LULA 1QY4A 4IESA 5IW0A 5D21A 1DCSA 3ZSLA 4I0WB 4AXOA 3B00A 5IVYA 1QJU3 4ZONA 4IEYA 3ZYGA 1C4RA 5EIYB 4P9YA 5DDJ1 2JE8A 4NO4A 1B35B 4GMP0 5D1IA 2PAKA 1O5UA 4XFBA 5E1RA 1WGPA 5BPXA 4M00A 4AGVA 4E8CA 1ULOA 1V70A 5HCFA 3IDEA 1ODNA 2J22A 1G86A 4IGOA 1MS5A 5EFUA 1GZCA 4HONA 1CESA 2D44A 5IFTA 1VBD2 1ULEA 1MR5A 1VBC3 3WEZA 2C0ZA 1OUXA 5C5UA 3VD4A 4O9EA 4NIAA 4LKFA 1O7FA 4BWOA 3ZXLA 5LK7B 1VBE2 2ERFA 1UY2A 1YXWA 3KT1A 3ZXDA 4IETA 1HRI3 1Y7BA 5HV4A 3OY8A 3RZHA 1SFYA 2PHWA 1POV1 2DUOA 4LA2A 2VGDA 4ZU4A 5FZOA 2EICA 2ETEA 2DVBA 4IV1C 2ATFA 3WQ0A 2XLFA 3G7DA 3A0NA 3EO6A 3OYWB 4Q8LA 5JWPA 1O59A 3NV4A 3TN91 4AG4A 5FIXA 3OBRA 5F6LB 3D3AA 3O1PA 3K51A 4V1PA 4QPGC 4AQSA 2BERA 3RVHA 3MLJA 2OZJA 1S0DA 1IQAA 4Y22B 3VBHC 4CDUB 3J7HA 3UKTA 4LUMA 1Q5OA 2WNUA 2BTVC 2VD7A 2XJQA 4PF5A 1UU4A 3MW3A 4W6YA 1O3SA 1SG3A 1X33A 3MIDA 4RR3C 3EJKA 3K2OA 5AFEA 1C3HA 5FPAA 1NQJA 3KQ4B 4IV1B 4YNIA 4YZ3A 1DQ4A 1BEV1 1LESA 5DABA 3WP3A 4FXGB 2BRTA 4XJ9A 3PU3A 2E51A 3QH7A 1JI6A 1GUIA 4JZRA 1SDDB 1XNBA 1ASJ2 2E31A 2PHDA 2PLV2 5IVBA 1DFQA 3KB5A 4YVWC 4OI1A 1L7LA 5F1RA 3BVCA 3DXTA 4HMZA 1KQRA 3OEBA 1WBFA 4XABA 1OOPC 2YROA 4MG2A 4XUTA 4YW5A 1NA1B 3LEGA 3I2IA 1O91A 1VBB3 4NR1A 4XDQA 1G9BA 1QIQA 2B4KA 3UYJA 4HPKB 3UGGA 1RUE1 1BCXA 2PHTA 2WYSA 4YGCA 2VECA 1WD3A 1VR3A 1WD4A 2VZUA 1SFPA 3BIWE 1IPKA 3OPZA 4MO3M 3ZFEC 5KXCA 2OXBA 3MW2A 2RS51 3ZFFC 1W6MB 5JSOA 1D2QA 3LGRA 4XJUA 1H8TC 2ZOEB 5JUVA 4YVWB 4HVRA 2F17A 3VUOA 1Q3EA 4UW6A 1UPIA 3WDUA 1T2XA 4FOYA 2CAUA 4GWJA 1FMD1 1X36A 1LOEA 1OOPB 3KM5A 5CG9A 2RDRA 4WM7A 1A8MA 1DGLA 4M3CE 3U78A 1ND2C 2TNFA 1HB1A 3I3BA 4KL1A 1MPXA 4PJYA 2IXIA 3ST7A 1F9KA 2O14A 5B2GB 2JXAA 3WSOA 5L9BA 4EJRA 1EP0A 2GP3A 4E2GA 3F95A 1FOD3 3QOPA 1YO8A 4L97A 2GU9A 3WNPA 3WNKA 3TEYA 3ZFFB 2JB8A 4DS0A 4AFAA 1MQTB 2VG9A 2A71A 2JDZA 3JD71 5C8CB 2VOKA 1O3QA 2RM22 1XJAA 2Y64A 3P1IA 4CDQA 2VE1A 1Z78A 2I45A 2EA7A 1PO23 1REFA 3OEAA 1RUI2 4KG8A 4RHV1 4PBPA 4OI0A 2DVAA 4EROA 4QX3A 2TUNA 2VZRA 4ZY9A 4JTOA 2GMMA 2E33A 5FZDA 4CUAA 4CDXA 4AHYA 5I8TA 1OVSA 3SH3A 3DN7A 2Q8OA 4CSWA 1H8VA 4N53B 3FBMA 4PIXA 1N1YA 1X8EA 3MEPA 1COV3 2RDNA 1YI7A 4DUVA 5F2SA 5CFCA 3KCYA 2DBIA 5FY0A 2JIJA 4OCTA 5EQUA 4YZ2A 3PNAA 2F4LA 1UN1A 1VRH2 5JI7A 1OI6A 3VZOA 1O3TA 2LALA 4MADA 5GZFA 4M0NA 3SLIA 4QQPA 4K40A 3LD8A 2BGCA 4JTNA 3MLLA 1DGRN 4Q29A 3U75A 3WDTA 1QQP3 4M3CB 1AR61 1RIRA 4I01A 4RS5C 1GQHA 2VW0A 2WT1A 1RVF2 4QB2A 2YC0A 4YVSC 5LY1A 3VBFC 4J6GA 2VO5A 1N1SA 1PGW2 3VKOA 1XYNA 1MEC3 2HBUA 2JDMA 2RMU1 2RR11 2W95A 5JXJA 2W92A 2BZDA 4CDWA 2YY1A 4QM8A 2Q8EA 2VCMA 4FI9A 3LCPA 4YM3A 5A3PA 2GDFA 1TME1 2C6SA 4QT6A 5FYYA 2UWCA 3AJZA 2DCYA 2RS33 3CQOA 2CY6A 2YGLA 3W58A 1DIWA 2C5DA 2FMDA 1QXJA 5GKAC 1ZA4A 2XXZA 1QJY1 4JX0A 4UFHA 4BQ4A 4OZXA 4AI0A 1SFNA 4QPWA 4YARA 1TG7A 3Q8AA 1FPN1 3GJAA 3M3QA 4MGQA 2GSYA 4RS5B 4S2HA 5DPNA 5IK5A 1Q8OA 3AP7A 1D0GA 1PIV1 4OQ9A 3TEWA 4XE9A 2AR6A 4R9DA 2BPA2 1QF3A 2GC0A 4FFFA 4L92A 1LOBA 4IGQA 5FK8A 5L36A 1Q8QA 3T3YA 5CISA 5JOZA 1PO12 2AGSA 3KHBA 4Q27A 1IZ3A 1PX4A 1H9WA 1X7NA 1V6KA 2B5HA 5J96B 4HANA 1BBT3 2GNBA 2DV9A 2XVLA 2RJ2A 3LB9A 1CWPA 5BNOC 1H9PA 2ILMA 2HWE3 2VPVA 2XHKA 1CJDA 3DV8A 4MZUA 1FYUA 1FNZA 1F15A 2A75A 4AL9A 1Y9GA 3NMBA 5FZIA 1YEWA 3AX4A 4M4PA 1SCRA 4XVHA 2D97A 3H9AA 1I1EA 2Z2SB 1LOCA 5LY2A 1JUIA 4CCLA 3W59A 3U11A 5F3EA 1CVNA 2ID4A 4EN7B 5F7UA 3AYCA 2E7QA 5FZEA 3AKSA 4CDUA 1NX9A 3DPRC 4QU1A 2N7GA 4K8RB 1C8NA 3J8F3 4EYUA 3J7MA 3BODA 3OOXA 2VBBA 4I3GA 2WO3A 1V0AA 4H2AA 3PUQA 1KFXL 2R6QA 1H2KA 1YHFA 2I07B 2PMWB 4IV1A 1WMXA 3RWKX 3PIJA 1GU3A 3M7AA 1NE6A 4UOJA 4D7TA 1OC1A 5F39A 4IL7A 3V0BB 1WZXA 3UESA 5HI0A 1J1LA 1O4YA 4LEJA 3K48A 4XUOA 3IIAA 1DQ1A 4WM8B 2DUQA 1S55A 2HBTA 3FJSA 3K75B 3AVSA 4CCNA 5A3TA 3LOIA 1W3XA 1RUC1 1F35A 4XF3A 3TN92 1AL21 4ISQA 1RUJ3 1W2NA 2W46A 3S30A 1E5IA 3KGLA 3N9LA 4P14A 1XE8A 1NA1A 2AYHA 2VQ0A 4RR3A 1AYM1 1UY4A 2YHJA 2KD7A 2WNVC 1F8VA 1ENXA 4HPKA 4UF0B 4ZPIA 1S0CA 4QKBA 3T2TA 2HJIA 4WBBA 2BP6A 2VULA 1JMUB 2J1EA 2ZGRA 1N1TA 2JJ6A 4HG6B 1Z0HA 1PVC3 1DP0A 3ZDVA 1RGSA 1TEIA 3N3HA 2J1UA 4Z2WA 2ZBJA 1W6MA 4PDWC 4KMQA 4XCBA 5FZ0A 2OX0A 1NXMA 3HBKA 4FFHA 3RZZA 1LHWA 4YVWA 3SCFA 3V64A 4CCEA 5C33A 5A3MA 4XYXA 3O1RA 1HRI2 3TEZA 3H7YA 2YYOA 1OOPA 5EJ1B 3FHIB 3A0KA 1ZZBA 2D3RA 4YG0A 2W47A 1WW7A 1JZ6A 2WNVB 2BBVA 3GYDA 4SLIA 4JV4A 1QH6A 4O65A 5CKQA 1J3QA 3EMRA 4IV3B 5FAXA 4NIHA 2VH9A 3PMSA 3HQXA 3VZKA 1AR81 2XLAA 2Y33A 4CUCA 1RUE2 4LBQB 2QQJA 2VZ1A 1LHNA 4PDWB 3ZFFA 5I8YA 4GH4C 1MQTA 2O1QA 1NG0A 5A3OA 1HQWA 2BOJA 2GAUA 4DQAA 1RUD2 1G7YA 2ZHNA 3H8UA 5DZEA 2RS52 5FXZA 4DO0A 4E4ZA 5C8CA 2KA3A 4NHMA 1J3RA 3FL7A 1QHDA 1POV0 2CYFA 4MUVA 1ND2A 2EIBA 2EXJA 2QQIA 2J1VA 4D94A 1LRHA 4BQ5A 4P9GA 3LWCA 2JG8C 4X6QB 2E6VA 2JWPA 4KWUA 5JR7B 1UZZA 4PI2A 1RITA 2TEPA 4F3JA 2VOVA 1WMEA 1K5MC 2V5DA 4LBJA 1SLBA 3WNLA 2P34A 2UYBA 2XONA 4FTEA 1WLCA 1C57A 3TAYA 1QH7A 2Y26A 4GH4B 4K1ZA 1WLWA 5C9AC 4XIOA 5J48A 1N3PA 4FTBA 2W1UA 4UYBA 1MZ5A 1V6IA 2BNNA 2HEYF 2GZWA 4XHXA 5FP7A 4MGIE 1FI2A 4L99A 2VAUA 3HWJA 2ZAAA 3ETQA 4BH9A 2DUPA 4NOTA 4C0BA 2XB6C 4J25A 1LHVA 4BQXA 5LRSA 5C3QA 3RI9A 2OZ6A 5FY4A 2V72A 2W9XA 3AYAA 1W6NA 3MFAA 4HSJA 1EPZA 2ARAA 2FCTA 4FQ4A 1I9RA 1Z7S3 5JOWA 1QWRA 1IKQA 2A6XA 3LPFA 5FK7A 5D8AB 3KV5A 3OBZA 5A32B 4ZKTB 5FPUA 3OUHA 3ILFA 2E7TA 2ZGMA 5T50A 3HJRA 2BGOA 4CEWC 2C24A 5BNPB 2DDUA 3GM8A 2AC1A 1Q8PA 3TB0A 5DUVA 4AVAA 4JDOA 1CPNA 2JENA 1A34A 1J83A 5KHJA 4Q4W3 1RMU1 1T6GC 3GF6A 4AF9A 2LS6A 3P6BA 1WW4A 4A7ZA 1UMIA 3R4UA 3GBWA 3OCPA 2SBAA 2W52A 4RS5A 4FPCA 1S2EA 2WS93 4UFIA 4XXAA 4YVSA 3WNMA 4A41A 4LLFA 2I2SA 3OB8A 2UU8A 1Q8SA 3AZVA 3MIFA 4BK5A 4MGTA 2VBDA 1PZ9A 3MIHA 1QKQA 4B7EA 4Q4Y3 1V9U1 2HH9A 1LHOA 3L2HA 1KS4A 2WQZC 5FCCA 4ZXEA 5FQ0A 4TSVA 4LLOA 2DF7A 1AR73 2P3YA 5DUWA 1WCKA 4FTSA 2ZX3A 4J1WA 4P9LA 1EV13 1UX7A 4KBBA 3CZUA 4Q4V3 1PK6B 3N9NA 4AOCA 1CAXB 1XC6A 1LU1A 1AHSA 2NM1A 2F6BA 1QJY2 4YYOA 2VMCA 4B3NA 5GLUA 3LEIA 4XCAA 2ZABA 2WQ4A 3KV9A 1FPN2 1XNAA 4QGMA 3MUZ1 1H1IA 2CHHA 1D4M3 1PIV2 3ENRA 4XFHA 5EXOA 5JXHA 1RUH1 4MGSA 3RZGA 2EXIA 2HWB2 3KF3A 1YFXA 2Z42A 1CX1A 1FATA 1GP4A 1W6QA 5FKBA 3FUOA 2H6CA 4GIQA 3SITA 1OHFA 3VD7A 3C2UA 5FWJA 3HT1A 2C1FA 4LXLA 4XF9A 2X05A 2ZX1A 4X6RB 3ZFGB 2QQWA 5LEJA 4Y4RA 3NV2A 5A1LA 4ZS3A 4LKEA 1K5JA 1P8JA 2VUAA 4OLLA 5A33B 5L9VA 1U5ZA 2DFBA 1X8MA 4XQWA 5DUXA 2VXJA 2QZ3A 1FXZA 3RJRA 1Y9MA 2YU1A 3HQUA 4MYEA 2QUOA 3GXUA 3VDCA 3IPVA 2WL1A 3FUQA 4D7SA 4IEXA 5ACA1 3ZXFA 4FPKA 3ZOIA 2W08A 3WX5A 2WAAA 1BHGA 4JKLA 1OUSA 1US2A 4A6OA 3VHPA 4COZA 5CEHA 5HV0A 3OF1A 4M0HA 5FV3A 1CIYA 2K9ZA 2D3PA 4TN7A 4JKKA 4UF0A 1HRV1 3S7EA 2PHFA 1GP5A 4YM0A 1W6OA 2UWAA 4AQTA 4MXWB 4HKOA 2VZSA 2CL2A 4S2GA 1E5HA 4A4AA 1CX4A 4ARXA 3H1YA 3GGLA 1HKDA 3O1UA 5DMYA 5CBLA 2GH8A 1ZBA3 3GBGA 3U37A 1BBT2 4OFGA 3VZNA 5H9SA 1LAJA 3AMNA 5BV6A 5K7PA 1UMZA 3JQXA 1VBA2 4J1XA 3SMHA 3VL9A 4XDPA 5B4NA 3OY8B 3UETA 2ORZA 2P17A 1F31A 4RSUA 2WNVA 3JB8A 1D2SA 5IAVA 1PNFA 2BFUL 3PUIA 4V2VA 4Y26A 3L9JT 1R093 2NZ9A 2FDIA 1JYIA 2X8KA 4IV3A 3THTA 3ZMNA 4JRAA 4HOOA 5J37A 1LENA 1DF0A 2YGMA 3RDIA 1OFNA 2QQOA 4LBQA 1YQCA 1L7QA 5DUUA 1LODA 3N7KA 4FPLA 4PDWA 2RG4A 2FDJA 3WDVA 2WO2A 5F5IA 3DL3A 4KBZA 2ZMLA 1WCSA 2E63A 3O0WA 2FZ2A 4Y24A 3POJA 3S5AA 3NV3A 1CZSA 4GKYA 4DY3A 2WNUB 2P3IA 4LITA 3W21A 4TWTA 2W91A 5HBAA 1UYPA 1OSGA 4XFAA 4CP2A 5A1FA 4XJAA 3FBYA 3KMHA 2GN3A 3CDZB 2WUHA 4BQ1A 1HW5A 1NYWA 3ZYPA 2PFWA 2R043 4XJ8A 5DAQA 2ZGLA 3O1MA 5CKNA 3LE0A 4Q4X1 4COWA 1Y3TA 4RA0A 5FZ9A 1QEXA 2DVGA 2XOMA 3QACA 4GH4A 4IW3A 4FXKB 3M3EA 2Q8CA 4DUXA 1ULCA 2IFRA 4BXSV 4FOQA 4R9BA 1TNRA 3U0ZA 3B94A 3POFA 4KU7A 3CJXA 1XNCA 2VNGA 1S0JA 4W6XA 3AP4A 2VQTA 2D40A 1ULFA 2JG8A 5FZ8A 1AR93 4RQPC 5FY5A 3H50A 1K5MA 1ST8A 1YJLA 4BYYA 1F4AA 3RG0A 5FZ1A 1MS4A 3A22A 3H8OA 2WFF3 2XDVA 5C9AA 3IT8A 3VKMA 3VBSB 3VZLA 2YFZA 5CU1A 1YJKA 4E2SA 4YW6A 1RUI1 4LNVA 5BNPA 4P9IA 5LBEA 2JKBA 4EWAA 1I3HA 1KFUL 1W0PA 3WINE 3EQEA 1HXS3 2OQ6A 3IMMA 3THPA 4WM7B 3ZYIB 1VRBA 1NT0A 4Y5SA 5FFOC 2OQ7A 3ZXGA 1PNGA 1V6LA 1XNTA 2ZGOA 4LE3A 5A7OA 5HCAA 4BJ0A 1EUUA 1RHI3 4LQRA 1HV0A 1OMIA 3TYJA 3DXUA 2OPWA 1UXXX 1W6PB 3LZZA 3IDCB 2MEV3 1U0AA 4UFLA 1EAH3 2A6VA 1MZ6A 3ZIWA 2RS12 4UFJA 2C9AA 4FOVA 3K77A 3IDBB 1VRH1 3NVCA 1VLNA 5CA6A 1Y9QA 2P6HA 1X9PA 2XL7A 3ZX7A 3WDYA 2HYKA 4XBQA 2VCBA 2QCSB 3IIIA 4BPZA 4LKSA 5KC5A 3PU8A 2FZ1A 1UKGA 4LR4A 2QQLA 2HLEA 1C1FA 2IVIB 2YMZA 3BPSA 1GZWA 2FBEA 3OPTA 2W68A 4KQ7A 4L11A 4D69A 4WVWA 4D0QA 1CAXA 1PGW1 2Y34A 4ZU5A 1NCRB 3Q8CA 3T2OA 4ARYA 1BQPA 4KH9A 1XU1A 4K20A 4UI9L 2LROA 4B4QA 2ZEWA 3I2DA 2AACA 2Q1FA 2P3JA 1GWKA 2ZTNA 3AFGA 3JBG3 4OI4A 1GANA 3MPBA 4R52A 5L7OC 2VMEA 2GH2A 3TBDA 1R1A3 1JU4A 5GJ6A 5JR2A 3ZSMA 1R083 3JCIA 3AFKA 5FYIA 3H8RA 1V9U2 3WP6A 3GHMA 3T08A 4FAHA 2QQVA 3ORJA 5JZGB 3ZFGA 2VQUA 1RUG3 4YW7A 2XLGA 3MIEA 4QDQA 1BVP1 2XVKA 2QKDA 5DDJ3 1UIKA 1VALA 1RUF1 5A3UA 5A33A 5JDBA 1ZBE1 4AVTA 2A6WA 2PHRA 3M70A 5C3PA 1N47A 3I2GA 4CDWB 2VBPA 4H7MA 5FZ3A 3O1OA 3WW3A 4TTGA 2BU9A 1OKOA 2ARBA 4NWVA 4YLZA 5A3NA 4C90A 4BCUA 1RUH2 3WG4A 3GZAA 4PI0A 4BZ4A 3WP4A 1SLCA 4LBNA 5EP9A 5FPZA 5K8SA 2WFPA 1MS1A 1H4GA 3BIEA 4E4DX 1TE1B 3D4KA 4JCKA 5FTTC 2FMYA 3G6JB 5AC93 4WVZA 2ZGNA 4LOTA 4QXHA 4MXWA 5IVVA 2B42B 5FZCA 1G9AA 4GQ7A 1A3KA 3ZSEA 4YG6A 3ABZA 3HT2A 4OUMA 3D5OA 1ZZ7A 3ECQA 1QJX3 4XTMA 4LOSA 4QQ2A 4BK4A 2ZCWA 1HV1A 3IWZA 4DRRA 3E6CC 5I0SA 3J7LA 4NPMA 1WCUA 4P9XA 1DQ0A 3EHKA 5DN2A 5A1AA 3AYDA 3DYMA 4URTA 4F83A 3ILRA 1VE0A 3AM2A 1XRUA 4IE0A 3RRDA 3W9AA 2WO7A 1G9CA 1AJOA 5ACA2 4NUBA 3UJOA 4GB32 2D93A 3MBWA 1DHKB 4KWKA 3VD5A 3E5UA 1LOGA 4ORFA 1PMIA 1RB8G 4ZXKA 3H42B 3VL8A 5H9QA 3VHRA 1BK1A 2PN5A 3APBA 2ET7A 3FFZA 3NSTA 4M4RA 2JD9A 1IS3A 1HRV2 2G1MA 3OUIA 3WQ7A 4BM8A 4IQPA 5LEKA 1GOHA 4FVVA 1BEV3 1ALYA 2A7AA 3B7MA 3KV6A 4AEMA 1H1MA 2BDRA 5LZ6A 3FX3A 2XPJA 2Y0IA 2R32A 2WRAA 3KSCA 3CIHA 1UO9A 3GCXA 1UKRA 4YW4A 1YFUA 4EE2A 3NO8A 4XF4A 2JE7A 4DMIA 4E2QA 1AL0G 5KHHA 3ZN5A 2VJXA 1ONAA 3LKJA 1APNA 1S0BA 3DCQA 3LPGA 4H3WA 3T4VA 2YC4A 1YQ2A 2LM3A 2ADEA 4ASLA 1GYKA 1QNWA 4ATFA 2AUYA 2Q1MA 3NAPC 5JPNB 4QWNA 2OW4A 1JH5A 1HRI1 2VZVA 2D5HA 4QXCA 3S6PA 2EALA 3KF5A 4QKDA 4DFSA 1FAYA 4L0PA 2GNMA 4QPGB 4B8EA 2XQXA 1NY72 3WD5A 1UYXA 2ZX2A 3VBHB 5FZLA 2OYZA 4D6RA 3ASIA 4NIGA 4XFGA 3HIFA 4ITCA 4B4RA 1G6NA 2R072 1CZVA 4RR3B 1JYXA 3IN9A 4PQ9A 1S1AA 2XJVA 4LHKA 3R4SA 5LA2A 2CNAA 1FMD3 2ZPXA 1ZYBA 5FY1A 4AVVA 3E1F1 5BNNC 5FO8B 3GZTB 5B4XA 3EB7A 1KDMA 4AGGA 4AVSA 3UKVA 2WBKA 5C3RA 1RUD1 5F9TA 1NZIA 5GLTA 3R6SA 3VBSA 2P2KA 5F37A 4DXZA 3JZVA 4Q4X2 3LOBA 3WLUA 1VMHA 5ANQA 4LBKA 5FDBA 3VGIA 2VM9A 1JZ7A 1SBFA 3ZR6A 1W8NA 2WSVA 3ZXKA 1OQDA 4QX2A 4FSJA 2E9QA
chains in the Genus database with same CATH topology
2A5ZA 3JD73 5FLJA 3HN1A 2R062 5IK8A 3OD4A 1W6PA 2DVDA 1ZM1A 1JYCA 4RHV3 3SNMA 3ZFEB 4Z8BA 4FPYA 1RUNA 1H8TB 4OHXA 3OJBA 2JG9C 1U5IA 4EWEA 1AZDA 2GALA 5CFDC 1RC6A 3QH6A 4WVMB 1ND2B 3FC0A 3M3OA 2HWF3 2AH2A 4LBQD 1NXD1 1S0GA 3FZ3A 5KC6A 5SV5A 1WMDA 3ES4A 1NCRA 3UL2A 5DG2A 2QZ2A 2WLPA 1G9FA 1AR63 3H7JA 3O5SA 2OUHA 3WOGA 5I91A 2HWC2 2VW2A 4D3WA 2RR13 2RMU3 5I0UA 3SXWA 3RPQA 5IT6A 1UW8A 2IXLA 1AXZA 5JZGA 3GALA 1JOJA 1TME3 4QM9A 1W6NB 1UZYA 2R0HA 1H2LA 4OHWA 4LTAA 1X50A 4QPIC 4MGZE 2ZX0A 5L7OA 1CGPA 2CWMA 1PO21 4BLIA 1O3RA 5FOBB 5H9RA 4LO4B 3I59B 1LOFC 2D6MA 1TMF3 5KXDA 4AE2A 4MLOA 4AI1A 3WHTA 4BA6A 2WZR3 1WW5A 3CO2A 2DCZA 4YVSB 1COV1 1IS6A 1Y43B 3VBFB 4AFMA 2OVUA 4I2OA 2HWB1 4UW4A 1CQ9A 1UIJA 2GNDA 2XBO3 4GALA 1VAKA 4MX3A 1AYN3 1RUF2 1ZBE2 4Y1VA 1UU5A 4MGYE 2DU0A 2NMOA 5FQ0B 1F5FA 1DZTA 1SDWA 1JW6A 3D82A 4Y1UA 2VQAA 4LO6B 3QBQA 2Z69A 2OA2A 4FPFA 2NP0A 1CAWB 2HWD3 1QNYA 2X53S 3C3VA 4NHLA 3ALQA 4Z92B 5JOYA 2RS31 5FO7B 1R1A2 2ZKLA 2VMHA 3VKLA 1AJKA 1MACA 1O4TA 3S0MA 3SISA 4QQOA 1W6QB 2ZZJA 4S2FA 1ZRCA 5BNOB 4HK9A 1ND3C 1J58A 1I6XA 4Q8KA 1RUG2 1ZZ6A 5IUQA 4LHNA 2EF6A 2XJUA 5LRRA 2W0XA 2ARXA 3NW4A 3WVJA 1ZREA 5HXVA 2BNMA 1LKNA 1RUC3 1AL23 1HQLA 4INDA 3PJQA 4WVVA 1BBT1 1QOOA 4FP3A 3AZXA 3VBOC 3ZN6B 2ENRA 2UYAA 1QJU2 2A3YA 1VBA1 3IPVB 5CIRA 1O5LA 4ONUA 4QPGA 1ND3B 3VBHA 5JSRA 5C6CA 3DPRB 2KM2A 2XKPA 3N7LA 1IPJA 2PAMA 2MNGA 2IXKA 2PTMA 2CGNA 3WV6A 4O9GA 4KWJA 1LEDA 2XJSA 4HBNA 4DPNA 4EWDA 5AC92 4XZPA 2PHUA 4UW5A 5TSWA 1W6OB 2Q0AA 1TQ5A 2F4PA 3WZ1A 1VBC2 3NAPA 4Y20A 1M4WA 4JGYC 3D6EA 3J8F1 5I8SA 4BMEA 3EBRA 4A2UA 3VBRC 2PHXA 4ZU7A 2YV8A 5T5OA 2HEVF 1NQDA 4NPRA 1YIFA 4D7YA 2FQPA 3WUCA 1S2BA 2ZGTA 5BNNA 5E8AA 3E6DA 2WKKA 3ZFEA 4JGYB 1EY2A 1RUJ1 3ZSKA 1S2KA 3USSA 1H8TA 4LBMA 3VBRB 2ET1A 4TLFA 3USUB 4AI3A 3ACLA 1IGOA 4FBFA 5K0UC 2DTWA 4WVMA 4QGNA 4RD7A 2DFCA 3ZYRA 1H30A 4HFSA 4P9JA 3B69A 4Y5Z0 1LU2A 4Y1YA 3I7DA 4N43C 1LULA 2D6OX 1GV9A 1O4ZA 2EVXA 2A3XA 3IBMA 2H6BA 2DCKA 4GMP3 4IEUA 4K3UA 3MF9A 2AZ5A 2XJTA 4K7JA 2WWSA 3LA7A 2JG9A 2YUEA 4OI2A 3SHRA 1V6MA 5K0UB 1CONA 5CFDA 1H1AA 3CJIC 3L2YA 5GZDA 2B8MA 3RJ2X 3JB4C 4K9SA 1OPOA 4OHVA 2H0VA 1VBB2 2ZKNA 4GWNA 4A7KA 2JG8B 1D4VB 4R4ZA 1KRIA 2RS11 1RMU3 1K5MB 2B39A 1AXKA 3WCSA 5GALA 4M01A 5C4WC 3URFA 2MPFA 1FV3A 1Q8VA 5IK7A 5C9AB 5T52A 2V5YA 2WJSA 1DDLA 1FT9A 1H2MA 3PTYA 3I59A 1M06G 4DB5A 5I93A 3KQRA 1Q43A 1FNYA 1MVEA 1MS0A 2XJPA 1MS3A 3PVEA 4QPIA 2PHLA 4LE4A 1FOD2 5C4WB 3VBFA 1CPMA 4YZ1A 4L2NA 3KGZA 4AFCA 3KT7A 3H3ZA 3ZMOA 4CEWB 2D5FA 2IXCA 1KD7A 4JAAA 2B46X 1UU6A 1PO22 5FO9B 1RUOA 1Z7S1 2HWF2 4UBGA 2DCTA 4Q0PA 1GZWB 3N7MA 3IMNA 4AEKA 1CAWA 2Z5WA 1GKBA 1AXYA 4QHBA 2NMNA 3HR9A 4S2DA 1BJQA 5JLVA 1VBD3 1COV2 4AK3A 1MS8A 2JECA 1LECA 2VMIA 3H1MA 5BNOA 2WS91 1CAVB 3TNQA 4XBNA 4PLOA 4Y4YA 3UJQA 1VBE3 2XVGA 3BCWA 1KXGA 2QNKA 4K1YA 3TOJA 1QQP2 2BWCA 3AMHA 1OKQA 4Q4Y1 3BB6A 3M8LA 3I8TA 4BE3A 4YFWA 1UX6A 4H55A 1MEC2 1AR71 1LGNA 5EZWA 3ZN6A 5DZGA 3AKPA 1EV11 5T54A 2RS32 2DCJA 1ND3A 4N7UA 3DPRA 4GB31 1C8M3 4LO8A 4K6BA 4FP2A 1ZRFA 3M2MA 4FOWA 3LA2A 1D4M1 3AP5A 2VY0A 3MI8A 1S0FA 5CVRA 1B09A 3TRSB 2XUMA 3AZYA 1V00A 3NL1A 4XF1A 1OQEA 2NYYA 5BNQA 1OA3A 4LBOA 2DVFA 4Y1XA 3CU7A 4QPYA 3JU9A 5FLHA 1ASJ3 2HWE2 2PLV3 4AVBA 1H2NA 2G4IA 4AGRA 1GICA 4XFFA 2G9FA 4DINB 2VW1A 3J9SA 1UF2C 2X29A 5BXXA 4ES8A 1JN2P 5JI9A 1JUHA 4SBVA 4I0AA 3POYA 4LHLA 3HD8B 2XL9A 2VMGA 1NY71 4JGYA 2EXHA 2RJLA 3ZXAC 3M3CA 4DOUA 5HCBA 3VBRA 2R071 3USUA 1XNKA 1V6NA 2ZZQA 2JX9A 2WT2A 4XIKA 2EIGA 3J8F2 2WA3A 2VVDA 1AVBA 4TYSA 2Y0OA 4B7KA 4EN9B 4K21A 3WHUA 1ZRRA 3JQWA 1ZBA1 4C1WA 1VIWB 5IK4A 1C5HA 1HLCA 2DTYA 1ENRA 3M1HA 4N9HA 1GQGA 1OA4A 5K0UA 1RUJ2 1SBEA 1LTEA 2RE9A 1R091 2RM23 3B01A 4F8AA 2R061 3LSEA 1SLTA 1RUI3 4R9CA 2RJKA 3DUIA 1FX5A 2MHFA 3QCWA 1LOAA 5ABJC 5KHKA 1PVC2 2A6YA 2WIIB 2I74A 1AX1A 3CNAA 4MXVA 2PA7A 2BQPA 2IXHA 5JOXA 4LUKA 2ZX4A 3CJIA 1YFYA 2D7FA 2VU9A 2A3WA 2JE9A 2R041 5F6KA 2ZGUA 1A6CA 4FPHA 1VRH3 2OIIA 3LSDA 4RQPB 3INAA 1RVF3 2ZHKA 5C4WA 4RFT0 4DZGA 1L3JA 3QD6A 1RL3A 1RJ8A 2HWC1 1UPSA 5KHIA 1DGWX 4XJZA 1PGSA 4CEWA 2B9UA 2ZAHA 4AHZA 3E97A 4CDQC 4RGGA 4XEZA 4JC1A 5KBFA 1C5IA 2XJRA 2GN7A 5KXBA 3AJYA 3AK0A 2WFF1 1ENSA 1IS5A 3MIBA 5FMOL 2G9GA 3GNEA 2BVVA 3J26N 1U12A 2LUWA 2IFWA 4HKLA 4CZSA 1PO13 2XG3A 4KGQA 3SCHA 1XYOA 3VLBB 3AP6A 4PIZA 1RHI1 3UKNA 4I09A 1CAVA 3KCCA 4YM2A 2MEV1 2ZACA 4HN0A 4E9KA 3CEWA 4Q2FA 1EAH1 4YZ5A 1SCSA 4R9AA 4FQZA 3BPZA 3MZHA 1LJ7A 3AYEA 1Z7S2 3OGJA 3PJYA 4PLNA 5J36A 4CEYC 4QX5A 4E27A 4BIFA 2VXRA 5KHGA 5L7OB 3B9IA 4NHKA 5T3NA 4AQ2A 4CP0A 2XH6A 1XYPA 4U36A 3LA3A 1S0IA 2WNEA 4Q4W2 2FHRA 5FMOS 4XMIA 3H3UA 1B35C 4QGLA 2CAVA 2WS92 3HBZA 1PM7A 1YRZA 4BLJA 5F5QA 1R1A1 2Q1ZB 1PGL2 1R081 4BHPA 1POV3 5BUVA 3VV1A 3RNSA 4Q4Y2 1YYNA 4AVCA 2V09A 1QOSA 3NJZA 1RUG1 2P37A 2EAAA 2VNRA 1GR3A 1BVVA 1AR72 1RINA 1AX0A 5DG1A 3POWA 3HMYA 3TN93 1EV12 1AF9A 4Q4V2 2TBVA 3AMMA 1IS4A 4XQDA 4U2AA 5C8WA 1JXNA 2D6KA 3WDXA 1MS9A 1QJU1 2BWAA 3WG1A 4W6WA 1D4M2 1ZZ8A 2CGPA 1ENQA 3Q9OA 2VOXA 1QDCA 1NZCA 5I0RA 1IHMA 2V73A 4YW3A 1YUDA 3JUUA 4CDUC 5AC91 4AHWA 2VNOA 3OBTA 2UURA 2O0OA 2ZGQA 3VZMA 1BXHA 1VBC1 1URXA 2GC3A 1DZRA 1RTVA 2IZWA 1QJX1 4XQ4A 3WP5A 4GULA 5T5LA 3M3IA 2GMPA 3AKTA 1RUE3 3B3QE 3ME2A 3T1MA 1DBNA 5T55A 1EPWA 1SLIA 1DU3D 1W2UA 1C8M2 1LR5A 1XU2A 2ZHLA 1RUD3 2JD4A 4L8QA 2RS53 3WQ1A 1DG6A 5LK5A 3WY6A 4RGAA 1NOVA 1NA1C 3T1LA 3FFQA 5EV7A 1VAVA 4LA3A 4Z1VA 3N7JA 3I54A 5KXEA 1G9DA 4CYDA 2ZGSA 2PQQA 1OLRA 2AENA 2PYTA 2VVFA 3NAPB 1PVXA 4Y20B 4AI2A 1QGLA 5T5PA 1ZBA2 4GKXA 5JCTA 1DLLA 4BIOA 3O0VA 4HSLA 2ES3A 4LO5B 4M3CF 5L19A 4Z07A 3MLKA 3AP9A 1SLAA 2LTNA 2KXLA 1YI9A 2GNTA 4RQPA 1R092 4HVQA 5ABJA 3MPPG 1OQ1A 5BNNB 3P3PA 1SACA 1WMFA 2UWBA 2JEMA 4G4FA 4BOWA 2YZ4A 3FE5A 2NPIA 4OULA 1MQTC 1SMVA 4GA9A 1VBB1 2VVEA 4XF0A 1UAIA 5C8CC 1HDKA 2HKXA 2R16A 1ZX5A 3V0AB 5L73A 4XHBA 3OD0A 5BY5A 1DQ5A 2R042 3IKWA 2CWSA 1GLHA 4Q1RA 1ZNPA 4UW3A 3FLRA 3WW4A 3WG2A 1ZRDA 2DYCA 3PVOA 4R4XA 1DQ6A 4N53C 2BVBA 3U10A 2JG9B 1LGCA 4XXPA 5CFDB 1LGBA 1A78A 3CLPA 4FCAA 5E88A 2SLIA 1C28A 3MYXA 4KNCA 4XILA 2DWRA 3WNXA 1AR92 1FOD1 1F5JA 4G9SB 1LHUA 4I02A 2EAKA 2VOWA 1QJY3 3PVNA 3BU7A 5CAZA 5GZGA 5FRAA 3AMQA 2WFF2 1FPN3 2GC1A 3IM0A 4H7LA 4OHZA 5EYYA 3VN4A 1BKZA 2O8QA 1PIV3 3AXEA 4YM1A 2HWF1 4FAGA 3ZO0B 2R49A 3OGGA 3AXDA 2HWB3 4XPVA 3RQ0A 4AYUA 1HXS2 2ZA9A 5GLVA 1YLLA 3MIGA 3S7IA 1RHI2 2WA4A 4META 5FOJB 3RMXA 1R1ZA 4QXKA 2MEV2 4QPIB 2D3SA 4Y1ZA 1EAH2 4CEYA 1NE4A 4AEDC 1J59A 1NCQC 2B7YA 4AFBA 4B4PA 1OPMA 2QDRA 5I0TA 2VUJA 2JICA 3ROUA 1KS5A 1QQP1 1BMV1 1B35A 3AZZA 1JHNA 2R1BA 1RJ7A 1MEC1 3E5XA 3WR0A 3KLSA 3SH4A 2UY9A 5JAXA 4QQHA 1LCLA 4AEDB 4IXLA 2YXSA 4P9WA 1NCQB 3JBG2 1TMF1 2D6NA 1G8WA 1N3QA 1E57A 1ZZ9A 2BEOA 5EYXA 1R082 2WZR1 5AVAA 3WT3A 4NWWA 4R8HA 3FMGA 4IEQA 1OD5A 1V6JA 4PBOA 5CB7A 1VBA3 2WSUA 3A4UA 2CV6A 4GXLA 3WUDA 5E16A 4FT8A 1PHMA 2XBO1 2Q4SA 1DYKA 5DDJ2 1KJLA 5EWSA 1AYN1 3VDDC 4HL0A 3PLQA 1J3PA 4JVAA 2QE3A 4PLMA 3OYWA 1AYM3 2HWE1 4KWLA 3ZYJB 4W65A 2H0BA 4WM8C 2BYVE 1AX2A 1DYPA 5CNAA 3BALA 4Y22A 1OA2A 1WW6A 5A3LA 2HWD1 1A8DA 3ZSJA 4PIYA 2XKOA 3R05A 4XETA 3VDDB 4B29A 1REDA 1SLLA 4UBHA 3O0XA 4ASMB 4TZDA 3DKWA 3B02A 3VBOB 1S0EA 4QD2A 1DQ2A 5JSPA 4MH0E 1QJX2 1MVQA 4FPJA 4OVEA 2WLQA 1DGWA 2ZHMA 5E89A 2Y38A 3WG3A 3WW2A 1AR83 5AFBA 1VB2A 2WZPP 4JDMA 4JGZC 1J1TA 3AZWA 5K9YA 3RSJA 3RS6A 5CADA 4WZFA 4COYA 3MFCA 1ULGA 4IV3C 4IERA 2NN8A 5JIUA 4PCRA 2P3KA 3ATGA 1SEFA 4F7ZA 2DU1A 4MV2A 1BEV2 2WINB 4MGKE 4COUA 1WUVA 4C0HA 2XGXA 4IEOA 1DGRA 4MSVA 4X8NA 3ZPYA 1U5XA 3PVBB 5T5JA 1CJPA 3VKFC 4NVPA 4QMAA 5KWRA 3SCGA 4JGZB 3V0AA 3MW4A 2IC1A 1PVC1 4HVOA 1KDKA 1V6OA 4JRLA 5BYNA 4Q0QA 1UL9A 4LT5A 3V56A 4DY5A 4MVTA 4IEWA 1MZEA 4IEVA 1SQ4A 3BTAA 3CL1A 1GNZA 2Q30A 2ZMNA 2RS13 1NLSA 3FLPA 4HZFA 5GLWA 1W39A 4Q26A 4AHXA 3V65A 2A73B