1WLWA

Congerin ii y16s single mutant
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
134
structure length
134
Chain Sequence
DRAEVRNIPFKLGMSLTVGGVVNSNATRFSINVGESTDSIAMHMDHRFSYGADQNVLVLNSLVHNVGWQQEERSKKFPFTKGDHFQTTITFDTHTFYIQLSNGETVEFPNRNKDAAFNLIYLAGDARLTFVRLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Congerin II
publication title In vitro evolutionary thermostabilization of congerin II: a limited reproduction of natural protein evolution by artificial selection pressure
pubmed doi rcsb
source organism Conger myriaster
molecule tags Sugar binding protein
total genus 28
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1wlwA00
3ZSKA 4AVSA 4K21A 5GLZA 3AK0A 2R1DA 3AYEA 1GYKA 1SBEA 2EAKA 5CAZA 3VUOA 3KM5A 5DUWA 4BM8A 4Y1XA 3WDYA 3VV1A 1AX2A 1NLSA 2DVFA 2GN7A 1FX5A 5H9RA 5T54A 3WHUA 1BZWA 4YM1A 4BPZA 4FOVA 1DQ2A 1CQ9A 3UJOA 3MEPA 5IUQA 3L2YA 2P3KA 5GLWA 1Q8PA 1SCRA 4XTPA 1UL9A 1CESA 4BMEA 1FATA 3ASIA 2ERFA 1HLCA 1JYCA 3D4KA 1DQ4A 1CJPA 5EWSA 2E6VA 4Y26A 2V5YA 3OY8B 3R4UA 1N3PA 4ASMB 4GALA 3QLQA 1LESA 1H30A 2B7YA 3WV6A 3POSA 1WW7A 4WZFA 3FLRA 3MW2A 1DQ0A 1C1FA 4XXAA 1SBFA 5GALA 2D3PA 2OVUA 4XBNA 2EXHA 4YZ4A 1V6OA 3AZYA 3WDVA 2H0BA 1QKQA 1AJKA 4XBQA 2EXKA 2NMNA 5T50A 1JHNA 5E89A 2WT1A 4YM3A 4XYXA 1ULDA 1WLDA 2CTVA 5DZGA 4W65A 1IS5A 1QNYA 2R0FA 3WCRA 1MR5A 2R1BA 4FPGA 2GDFA 4XILA 2ZBJA 4D69A 1CN1A 2YV8A 4SLIA 1N1SA 4XXPA 1G9AA 2VU9A 2D6OX 2P2KA 1N1VA 5IT6A 3RG0A 3H0OA 2ARXA 5DZEA 2D44A 3O0XA 4YFWA 4CRQA 4UW5A 3RQ0A 4LBOA 1KJRA 1V6JA 3BOPA 5CB7A 1MS0A 1BXHA 5BYNA 4AVTA 2YMZA 2TEPA 4LBQA 1BQPA 1FV2A 1AF9A 2VW1A 1SLLA 2PHWA 3M2MA 3USUB 3AZVA 4L8QA 2AR6A 1GANA 1V6NA 5JDBA 2PELA 1VIWB 4NOTA 1VAMA 2CNAA 2ZZJA 3AYAA 4XDQA 1S0GA 1KJLA 1YO8A 1ZA4A 2A6WA 4DRVA 1S0FA 1W6PA 1VALA 4FPFA 2DU1A 2BQPA 1RITA 4XMIA 1QU0A 2GN3A 3AP7A 2UU8A 3W58A 1V6KA 4M3CE 2C5DA 3RMYA 2YXSA 1W6NA 5JOZA 2ZAAA 3NV2A 1CIWA 3V0BB 3B00A 4PQ9A 1CR7A 4XHBA 3ZXEA 1R1ZA 1LHOA 1KDMA 3A0NA 4WVWA 3ZSMA 3SH4A 3PMEA 3IM0A 1GZWA 4FQZA 1GICA 1LGNA 2ENRA 2VH9A 4H55A 5T5OA 3SITA 1S0JA 5HCBA 1N3OA 1HDKA 4YG0A 5FRAA 2VW2A 2VY0A 1S0CA 5JOXA 2OUHA 2OUJA 1LOAA 3AJYA 2E7QA 5GZEA 2P3JA 1S1AA 2A6XA 3VKMA 2DTYA 1O4ZA 1KITA 3SNMA 1Z0HA 5H9SA 5GLUA 3LCPA 3TB0A 3OYWA 1FNZA 2ZMLA 3OBTA 2EXIA 2A6VA 1V6LA 4LBQD 1WBLA 3KQRA 1C1LA 1DBNA 1DLLA 4ITCA 4XIKA 3M3CA 3N7LA 1W0PA 3B69A 4PF5A 5GZGA 2GNTA 1AXKA 1W0OA 4FPEA 3VKFC 3WUDA 2PHFA 3AYCA 4TZDA 4M3CA 3FLTA 5GLVA 3N3HA 5IK7A 3ZVXA 1WW4A 2W08A 5EYXA 1G9BA 3AZXA 4GWMA 1UPSA 3HR9A 1SLCA 1Q8OA 2P3IA 1C4RA 2Q5TA 1WLWA 2WT2A 4ATFA 3O12A 1W6QB 4JCKA 5JOWA 1JXNA 1Q8SA 1DQ6A 4DRRA 1KQRA 4LBJA 1JBCA 3LSEA 4UW6A 3ZYRA 4C1WA 2DUPA 2GMEA 1ULEA 4XJ8A 2A6ZA 3AP6A 1LHWA 1G9DA 2XB6C 3FUQA 1DHKB 3Q9OA 3V64A 1GNZA 5E88A 2P34A 1H9PA 5GM0A 1LODA 1YI7A 1Q56A 4Y20A 2FHRA 5DG1A 1GLHA 1G8WA 1JW6A 1ONAA 1H9WA 2VUAA 1QNWA 3OJBA 3B9CA 2D6PA 4KBBA 1SLAA 2ZABA 3INAA 1Y7BA 1MVQA 3B3QE 5T55A 2A75A 5KXCA 1GV9A 1UN1A 3BODA 1UMZA 1UZYA 3W59A 1S0IA 1GBGA 1UKGA 3M3QA 3N7MA 5LK5A 3AXEA 1WCSA 2SLIA 5H9PA 5E8AA 2HYKA 2WJSA 2DVGA 3JUUA 4R9DA 3D6EA 1LU1A 1FAYA 4Q26A 3V65A 4YW3A 5CA6A 1X50A 1A3KA 5SV8A 1IOAA 1DZQA 2D6LX 3AZWA 3LSDA 1QF3A 3B01A 1ULFA 1W6OA 1F5FA 2DYCA 3M3EA 1HQLA 3IMNA 3MW3A 1MZ6A 4K20A 3ENRA 3M1HA 1TEIA 4M3CF 1MS8A 4XE9A 5AVAA 2A71A 4FPYA 1Q8VA 4Q2FA 4Q8KA 4YZ5A 1MS1A 2DVBA 2VW0A 3RSJA 3SH5A 1MS4A 5DUVA 1GNHA 3UL2A 1QDCA 3CNAA 3WDTA 1GZWB 2WLQA 1IKPA 4XIOA 4P14A 1RINA 2PHTA 3WDWA 1A8DA 4BMBA 4ISRA 5EYYA 4YW4A 4BQ1A 4Y22B 1UZZA 2EALA 4P9WA 4XJAA 1I3HA 1YYNA 1N1YA 4YG6A 1LOFC 1AX0A 1YRZA 1B09A 4XJZA 3ZSLA 4Q27A 1A78A 1IS6A 1WUVA 1AVBA 4Q8LA 4WV8A 2E51A 3QCWA 5HCAA 3OYWB 2UWCA 5GZCA 1ENRA 3IPVB 5DXDA 1PZ9A 2NMOA 2I2SA 1LOFA 2JDZA 1PZ7A 1OQ1A 1Q8QA 2YY1A 2WNEA 2AGSA 1QOTA 2E7TA 5IK8A 1MS9A 3SISA 1DQ1A 3OPZA 4JRAA 3AJZA 2AYHA 2GALA 4UW4A 1N47A 2DVAA 2P37A 3O0WA 2GMPA 5FREA 1VLNA 4Q1PA 4FPLA 1AXZA 1SLIA 3O0VA 3POWA 4DS0A 2ZGUA 1V00A 3VKOA 1W6MB 4DPNA 3HMYA 3OY8A 3D5OA 1G9CA 1JN2P 3V0AB 1FV3A 1ENQA 2ZGOA 3WNXA 2RHPA 4LBKA 4PBPA 2PHUA 4LBMA 2A3XA 3RRDA 2ZGTA 4P9XA 2ZHMA 4YLZA 5JVVA 2A6YA 2JE7A 3DUIA 5EXOA 4XJWA 2WQZC 5JOYA 3WLUA 1LHNA 3PVEA 2ZGNA 2D6MA 3ZPYA 2WKKA 3I4IA 4FOQA 2A3WA 4XHXA 2ZHLA 1GZ9A 1HQWA 1AX1A 2DVDA 4U36A 1BKZA 3WUCA 3NV3A 4DQAA 2ZGQA 2A70A 1V6MA 1KRIA 1LOEA 4GA9A 3DGTA 4AGVA 4LBLA 4FP3A 2NN8A 2OW4A 3APBA 4FPJA 4Y1ZA 3ZYPA 5HCFA 2ZGRA 2CYFA 3WCSA 4Q1RA 1HKDA 1MS5A 4CTEA 4C1XA 1DIWA 4BOWA 4HANA 3T1MA 1ULCA 3WG4A 2ZMKA 4YFZA 2DWRA 2ZA9A 2ZHNA 3USUA 1N1TA 4WVVA 2ZGSA 4P9YA 1N3QA 2WSUA 1NXD1 3PVOA 1V6IA 2NP0A 3FUOA 1F31A 4BLIA 1W6OB 5KXDA 2A5ZA 3WG1A 2KM2A 2YROA 3ILRA 4OZXA 3WDUA 1QDOA 1LEDA 4BLJA 1APNA 1DGLA 5T5JA 4FP2A 1WLCA 3OBRA 3NV1A 2A3YA 1YIFA 2AENA 4YW5A 2FMDA 2DTWA 3FLPA 4GKXA 4YGEA 4NO4A 3V0BA 3ATGA 4FOYA 4U2AA 3A0KA 4XMAA 4FPOB 1LECA 1YXWA 5T5PA 2EF6A 5F9TA 1BJQA 2UWBA 1UAIA 4YG3A 3RS6A 2NZ9A 3IN9A 1J1TA 2W52A 4FOWA 1G7YA 2GMMA 4CZSA 4LBQB 3T1LA 1ENSA 2WSVA 2GNBA 4DFSA 3AXDA 1OKQA 1BYHA 1LJ7A 2GNMA 2NM1A 4FVVA 3SH3A 4FQ4A 4XZPA 1URXA 3PJQA 2D3RA 1W6PB 4YZ3A 5KXEA 2SBAA 2G4IA 4ZKTB 2PHRA 1ULGA 4Z8BA 5IK4A 1G9FA 1W6NB 1WBFA 3ZXFA 4HL0A 3WHTA 2ZGLA 1LU2A 3AX4A 5KXBA 2V73A 1RIRA 1U0AA 4XJ9A 1WD4A 1MVEA 3IKWA 5GLTA 2DUOA 2JKBA 1W6QA 1IKQA 4PBOA 5T52A 1AXYA 3VKNA 1QMJA 1PZ8A 2JECA 3U4XA 4JC1A 2R0HA 4YM0A 4K1YA 5IK5A 3BIWE 5GZDA 3WDXA 1WD3A 2D6KA 2ZGMA 4Y1UA 4XTMA 4YGCA 2VXRA 3N7JA 1OFSA 2ZGKA 3N35A 4FPCA 2PHXA 3AZZA 4UW3A 2NYYA 1JOJA 3WZ1A 4AVVA 4M00A 4AGGA 3AP5A 3SLIA 3ZXKA 4M3CB 4I30A 2C9AA 4XOGA 1C57A 3R4SA 2LTNA 3UK9A 1LULA 2XG3A 2ZACA 2W68A 1G86A 5T5LA 5H9QA 3ZXLA 5CBLA 5F5QA 4XBLA 1GKBA 1GZCA 3UJQA 4RA0A 4PCRA 3MPPG 4GXLA 1LOCA 2JE9A 2CWMA 2UURA 2EXJA 3GALA 4Y1VA 1CONA 1S0EA 1IS4A 1LGCA 2E53A 2ZHKA 1SLTA 3NV4A 4Y1YA 4YGBA 4YZ2A 1I1EA 1QOSA 4MYEA 5CNAA 2JD4A 1LOBA 4FPHA 3ZXJA 2CY6A 5DG2A 1SFYA 1CPNA 3AP9A 2R49A 4F83A 1JYIA 4K1ZA 2AUYA 3C2UA 5JLVA 1MZ5A 3HN1A 4R9CA 5JMCA 2D3SA 1D2SA 5DUXA 3BTAA 4LBNA 2UWAA 2ZKNA 3FBYA 1WW6A 3AYDA 1SBDA 4Y20B 1XQNA 1Z78A 1CPMA 3N36A 3A4UA 3I8TA 4GWNA 4TYSA 4YW2A 2A7AA 1DQ5A 1O4YA 2YZ4A 3WG2A 2DV9A 3OGGA 2AH2A 1LHUA 1LOGA 3WG3A 1MACA 1FNYA 1AJOA 3T2TA 1DYPA 3WOGA 3ILFA 2D6NA 2ZMNA 1LTEA 2W39A 3GNEA 3FFZA 3R05A 4Y22A 1DYKA 4YW1A 3PVNA 2DUQA 3ZSJA 4ATEA 1S0DA 1QGLA 1LCLA 4IQPA 4ISQA 2DURA 2WT0A 4XJUA 4YM2A 4YZ1A 1QOOA 3JU9A 1VAVA 1LEMA 3POYA 3M3OA 1GSLA 4ZXKA 2LALA 3RMXA 3AP4A 4Y24A 4RL7A 1D0HA 1ZM1A 1MS3A 3IPVA 1S0BA 2D7FA 2D43A 4YGDA 4AWDA 1LGBA 5L73A 3WVJA 1KDKA 4AGRA 1CVNA 1LENA 1SACA 1FYUA 1SCSA 2GNDA 4R9BA 4AYUA 3AFKA 2ZGPA 2ARBA 1F9KA 2Z42A 5DUUA 3TAYA 1JUIA 3NWKA 2CL2A 5GZFA 2CWSA 2R16A 3MW4A 1WW5A 1LHVA 4FPKA 4M01A 5DZFA 1IS3A 1AZDA 1EPWA 5GJ6A 2EIGA 1UX6A 1W6MA 2JJ6A 3N7KA 4R9AA 2ES3A 2AREA 3V0AA 4GKYA 1DFQA 1SLBA 3VKLA 3ILNA 2DU0A 3O5SA
chains in the Genus database with same CATH superfamily
2VVEA 2BV4A 4QXBA 3ZSKA 4AVSA 1ZZ7A 2CAUA 1SBEA 3VUOA 2FMYA 1ASJ2 2IWGB 1DGWA 2I74A 1NLRA 1JZ3A 2JDMA 2X29A 4Q4X1 4LNVA 4ZS2A 1ZBA2 3VV1A 3WDYA 1RUD2 3WP6A 4CCKA 1EV12 1NLSA 3ZYFA 4BK5A 1FX5A 4RHV1 2HWD2 3KLSA 3QH6A 3WHUA 1H4GA 3NNMA 1CQ9A 3MEPA 5IUQA 5HXVA 3LIGA 5A3MA 4RQPB 4Y3OA 3L2YA 1W04A 1W28A 1PO23 1RUF1 1OXCA 4P5YA 4IEWA 4Q0QA 4I2OA 3UESA 1Y4WA 3ASIA 4NHKA 3D4KA 2QJVA 5LBEA 5C33A 2VZQA 2IVJA 3FZ3A 4INDA 1N3PA 3WW4A 3MDPA 4AF9A 1LESA 2B7YA 1WW7A 1PGSA 3NQHA 4OUEA 4LITA 4NE9A 3K2OA 3NJZA 1DQ0A 1NKGA 2I45A 1U12A 1XYOA 2VAUA 1NCQA 1E5HA 1POV1 4Y5TA 4UFMA 3I2FA 1ZBA3 1AJKA 2C24A 2YC2A 3A21A 3MIBA 2RM22 2NMNA 4L0PA 2VZUA 4A44A 5L7OA 1UMIA 1JYWA 2HWD3 1ULDA 1FI2A 3MZHA 2YPDA 4IV1B 2CTVA 1IPSA 3VL8A 2Y26A 3GF6A 1UXZA 3WQ7A 1WCKA 1MZFA 2Q8CA 3MI8A 3LDKA 1UX7A 2JDAA 2ZBJA 3LEKA 2RS13 2VULA 3EXUA 1ASJ1 1E5SA 4CCOA 4CU6A 1G9AA 1CWPA 2D6OX 4HLTA 1N1VA 5FBJA 5FP8A 1OMIA 1RUD1 3AKRA 5FZOA 3RG0A 1EV11 3O0XA 4QX3A 2XPJA 1QJY2 2HWD1 4UW5A 2J1TA 1O4TA 1ZYBA 2CDOA 4NRPA 2ZX0A 3BOPA 4NVPA 4RYDA 1CAXB 4IE6A 2J22A 5BYNA 4HK9A 3PUQA 4AVTA 4EV0A 2VD7A 2IUWA 4LBQA 2CGPA 1XE7A 2ZEWA 5AFEA 4P9GA 2O8OA 3AZVA 4L8QA 4IEZA 1V6NA 3QH7A 4S2DA 2XJPA 4E4DX 3U75A 1C5IA 2Y6JA 2XJQA 1NA1C 3RZMA 2G9FA 3IDEA 1S0GA 1JUHA 2A6WA 1XE0A 1S0FA 2DU1A 2BQPA 5IVEA 3VBHA 2UU8A 1TME3 3W58A 1V6KA 2PLV2 5LY1A 4FT8A 3MV11 3VD5A 3LAGA 5IJRA 1FOD1 5HBAA 3NO8A 4PQ9A 1CR7A 2BTVC 4XHBA 1L7QA 1IZ3A 2RM21 3PDQA 4JVAA 4YVWA 3A0NA 1F2NA 1QJY3 3LPGA 4LLFA 5BY5A 2FCVA 2WWSA 1LGNA 1Y3TA 4H55A 5T5OA 4Q0VA 3SITA 2Q0AA 5D8AC 3E5XA 2G1MA 4I0WB 2DCJA 4B1MA 2VY0A 4BB3A 5JOXA 1LOAA 3MIDA 4QQHA 4QT6A 3WQ1A 1RGSA 2ZJCA 1GU3A 1UIJA 2EIDA 2DTYA 4KU7A 1KITA 2C1FA 1Z0HA 3SNMA 1QJX2 1W8UA 1UPIA 2ATFA 2VNVA 3H3LA 2WA3A 3K77A 5F2WA 5H9SA 5C4WA 3TB0A 3WW1A 1RUNA 1UY0A 3O7OA 2EXIA 2A6VA 1V6LA 4Q0SA 4B3NA 3E5UA 1C1LA 2VUCA 3KQRA 4Y5Z0 2VNGA 4TLGA 4GMP3 3ZR6A 3GZUC 2D40A 3MF9A 5IYYA 3WUDA 3H8RA 2XOMA 4M3CA 4AI8A 4QX2A 5FO8B 1HRI2 4GB32 3ZVXA 1NUKA 2W08A 3RNSA 5LRSA 2JG8A 3AZXA 3K4AA 3IT8A 4GWMA 4JGZC 3VBSC 1J3RA 4YPJA 5B2GB 4CDUC 2RDQA 4UFLA 4KU8A 5BNOA 2P3IA 4N9IA 1C4RA 2Q5TA 2BNNA 4GIQA 4UXAA 2JB8A 4AI2A 5I0DA 2Y33A 1W6QB 2PLV1 4Q4Y3 3H8UA 1Q8SA 2H0VA 5A3PA 1Q43A 1XSQA 4NWVA 4OI1A 2Y6FA 1QJX3 2C6SA 2DUPA 3NJYA 5LWBA 1ULEA 4LHNA 3WT3A 3BVCA 4LO7A 1DHKB 4W6WA 5FY4A 2VZTA 2VE1A 2R6QA 1Q56A 3GGLA 5DG1A 4CU8A 5A33B 1GLHA 1GWKA 1UXXX 3M4FA 4M0HA 1HRI3 4GB33 4N53B 5LW9A 4MOAA 2CAVA 3B9CA 3VZNA 4KBBA 1BMV2 1SLAA 5JAXA 2ZABA 2XVLA 3MV01 2CGNA 1QXRA 4YW7A 1MVQA 4CP9B 3CF6E 5T55A 3TRSB 5KXCA 3NRUA 4NAOA 2FD8A 3VDBA 2RMU2 1RUG2 5LEKA 3NAPC 2VOWA 1NCRA 2W1WA 3Q8CA 1QJU2 4N9HA 3D0SA 3KWVA 5E8AA 2HYKA 2BUKA 2X09A 2Y6HA 2JXAA 1POQA 5I0TA 5DAXA 3G6JB 2BVVA 3LD8A 4NPRA 1OPMA 2KD7A 4Q26A 2JDKA 1A3KA 2XONA 2VL4A 1SFNA 1UWWA 1YWKA 3AZWA 4OUSA 1EPZA 5KHKA 2BJSA 2X5IB 1HQLA 3VZMA 2WNUB 2IXKA 3AMNA 3U78A 4EN6B 5AC91 4K20A 2BGPA 3RYPA 4GH4C 1DF0A 2WRAA 3T0BA 1OLMA 4FPYA 4K3UA 4Q2FA 4OFGA 4N8MA 3S57A 2HWB3 1K12A 1MQTC 1RUC1 1X8MA 2WFPA 5FP9A 3UL2A 1VJ2A 4K6BA 5EJ1B 3R6SA 1AYM3 5FZIA 4XIOA 2RMU3 1RUG3 4XW3A 4CUCA 4O61A 4YW4A 1XNBA 4F8AA 3TEZA 4EZ4A 1QJU3 2PN5A 4Y22B 3SCHA 4XJAA 3EBRA 2IXHA 3U1XA 2XR4A 1YRZA 4ZZ8A 4XJZA 1SFPA 4Q27A 2JE8A 1YI9A 1GMMA 2AEYA 4DXTA 2E51A 2Q8DA 4C0BA 5HCAA 3H1WA 2BFUL 4ZXEA 3IPVB 1TNRA 1CAVA 2I2SA 3KF5A 4XZUG 1PZ7A 1CD3G 1OQ1A 1Q8QA 4LA3A 3AB0A 4QB6A 3E5QA 1QOTA 4HN1A 1AR72 1QQP2 4FXKB 4J25A 3B7MA 3J26N 2N7GA 2PYTA 4Z82A 2X8KA 3R4DB 3SISA 2YHJA 2DVAA 5FREA 1VLNA 1NA1A 2BGOA 2WYFA 5C9AC 3OGSA 2ZGUA 5FZ7A 1W6MB 2EIBA 4QWNA 3D5OA 3E97A 4NUBA 4ZU5A 3V0AB 1PO13 4BYYA 2W5FA 1BEV2 4PLOA 2W2IA 3T3YA 5JSPA 3S7EA 3LDRA 5I0UA 3VD3A 4CXWA 3TEXA 5LEJA 2HBUA 1REFA 4MV2A 4C8DA 2W0XA 5EXOA 4C91A 1W9SA 1R082 5JOYA 3LDBA 2LUWA 4AAXA 5JZGC 3ZPYA 1X7NA 5A7PA 1ZZCA 4PLNA 2C0ZA 2ZHLA 3DYPA 2W47A 5D8AA 3O1RA 2DVDA 3AM2A 3MGUA 2P6CA 3PL0A 2HWE3 1GOHA 4H3WA 4E4ZA 4HVQA 3WUCA 5TSWA 5FPZA 3WF2A 2UYBA 4DQAA 1UYZA 1V6MA 2A70A 2J1VA 1LOEA 2R30A 3E1F1 4GA9A 1TVGA 5FYCA 4JGYC 5A7WB 3SC7X 4FAHA 5FWJA 2XLFA 4DXSA 4Y1ZA 2VZSA 1I5PA 2LW8A 4XUPA 3ZYPA 4EN8B 5IVJA 1XXNA 4I02A 4LPLA 4MHUA 1HKDA 3KS7A 3WCSA 4CTEA 4O9GA 1BEV3 1DIWA 3PIJA 4Q0PA 3EQEA 4HANA 5EJ3A 2PQQA 1AR71 1QQP1 3T1MA 2B39A 2G9ZA 2QZ2A 5CG9A 1UY1A 2ZHNA 1REEA 3MIHA 3USUA 4XF1A 2RDRA 2GZWA 4IETA 5J1XA 3MIEA 5M0TA 3LA7A 2VZRA 1NAEA 1R083 4MHRA 3VBSA 5FP7A 3B93A 3IIIA 1UZVA 1WWYA 5FXZA 4CDUA 4LOTA 2YC4A 5IVFA 2A5ZA 2DCTA 3P3PA 3THCA 5C8WA 5KXDA 1JZ6A 3WDUA 1YLLA 3POEA 3LEIA 1DGLA 4QHZA 5E6HA 5T5JA 4FP2A 3SQOA 1VBB1 1WLCA 2YU1A 3NV1A 4XFGA 1AR62 4A4AA 4XFFA 2PTMA 2AENA 1PIV1 1UCXA 5FKBA 2HKXA 4E8DA 3CZUA 1IPJA 3ATGA 4FOYA 3A0KA 4XMAA 5DABA 4XUQA 1VRH1 2V4VA 2WZ8A 1YXWA 5F9TA 2EF6A 5EP9A 4YYOA 2DF7A 4YG3A 3RS6A 4XAEA 3IN9A 3RZJA 1WMFA 3D82A 4FOWA 3I3DA 3T1LA 1ENSA 2GNBA 4XQDA 3Q8BA 5DAVA 2VCAA 1OKQA 1BYHA 1VMFA 2GNMA 3JB8A 4LORA 3B9IA 4I3PA 2Y6LA 4QKBA 4FQ4A 1K5MB 5FYZA 1O3SA 4XZPA 2XLGA 2X10A 1YFUA 3NAPA 4EYUA 1CAUA 2Z69A 1AR63 1SPPB 4COVA 1TQ5A 4CDWC 4FFHA 1ZRFA 5IK4A 4NIIA 1G9FA 1W6NB 4RN5A 3PNAA 3JD72 3VDAA 5FPUA 5CFCC 2VXJA 1XYPA 5E16A 1LU2A 4OQ9A 3MFCA 5KXBA 3POIA 1U0AA 1CGPA 1MVEA 1W9FA 3RI9A 3WP4A 3J8F3 3ES1A 3O1UA 3ZIXA 5I8SA 4GH4A 5FOJB 1GP5A 3NNJA 5F5AA 4IEPA 5FJHA 1X33A 2WZR1 3AKQA 3ZDVA 2VBDA 3MUZ1 2VC9A 3VB9A 3WINE 2BRTA 2LROA 2D6KA 1JYTA 3HBZA 4XTMA 3IDAA 1RUI3 2ZGKA 3MUY1 4FPCA 2PHXA 5JXJA 4UW3A 2Z5WA 3WZ1A 4M00A 4WM7C 4AGGA 3HVDA 3GZEA 5KHGA 3JD73 3HD8B 1C57A 2P3YA 1HB1A 1JH5A 3ZXLA 2XG3A 3FL7A 3HQUA 4CPBD 4CDQB 4GZ9A 1GNYA 2WQ8A 4FFFA 3E6CC 4XBLA 2Z2SB 3DYMA 1GKBA 1GR3A 1H4HA 3UJQA 4QQ2A 2R042 4QPYA 5F5CA 4RA0A 4IERA 4S2HA 3I3EA 2VTFA 1LOCA 4GXLA 4Y33A 4YNIA 3MICA 4QDSA 1DZRA 5DN2A 5KHIA 4AHWA 1S0EA 1W9YA 4IGQA 4Y1YA 3O1MA 3HQRA 1DGWX 1POV0 1M4WA 5CNAA 4CEYB 4FPHA 1LOBA 5C3PA 3ZXJA 1ACCA 4BXFA 1H8TA 5C9AA 3ZMNA 3IDCB 2R49A 1JYIA 4P9LA 3BU7A 4AVAA 5A3LA 1HB4A 5F5IA 1VMJA 5JMCA 1D2SA 4QMAA 4N7IA 4RS5B 5LATA 1WW6A 4LKSA 4N90A 3DECA 3DEMA 3A4UA 4XCBA 5FYIA 4EWDA 3RWKX 1DQ5A 1O4YA 1ODNA 1UMHA 1YIPA 1WA4A 3WG2A 3BTXA 1NZCA 5FUNA 4D3WA 1OFNA 5JXGA 2VZ3A 1LHUA 4HG6B 4KWLA 5JZGA 2ZAHA 3VD9A 4AEDC 3CJIB 1AJOA 1U5IA 3T2TA 3GZAA 5ACA2 2R043 3ILFA 3ZFGB 2D6NA 2ZMNA 1LTEA 1CZVA 4NAMA 3R05A 2VNOA 1DYKA 3OSDA 1QIQA 2W3JA 4YM2A 3ETQA 3ME2A 2Q8EA 1YQ5A 3B94A 3M3OA 1GSLA 4B4QA 2QQIA 4JGYA 3RMXA 4JX0A 5IATA 3K75B 1FMD2 4S2GA 1ZRCA 3BCWA 4GULA 3ACHA 1UYPA 1NOVA 2VOTA 4HVRA 3ZM8A 1S0BA 4YGDA 4JTNA 1LGBA 3MHZA 3ZR5A 3ETPA 5FZHA 2DBNA 1O3RA 1CVNA 1LENA 1SACA 1FYUA 2GNDA 1XC6A 4L97A 5F37A 5DUUA 5FP3A 3S5QA 4D7SA 2CL2A 3WY6A 2CWSA 5ABJC 1UYXA 2TBVA 5BNNC 4ZHNA 1H2LA 1EPWA 3GBWA 2ZTNA 3JQWA 2FBEA 2WDBA 2EIGA 4QPGB 4MGTA 5EZWA 4R9AA 3PMSA 3N7KA 5ACA3 3LQCA 1YQ6A 1PM4A 2QQWA 3A22A 4MG2A 1KS4A 2HYXA 4BQ5A 4CUAA 3VKLA 5DQ0A 2B8MA 1SDDB 4Z1VA 1FMD3 2JDYA 2YDEA 3AYEA 2R1DA 2Q8OA 1IG3A 4Z2WA 4IL7A 4MLOA 1PVC3 1G6NA 2PAMA 4Y1XA 3SKVA 4X6QB 3SXWA 1PMIA 4CXYA 1AR82 5IFTA 1OSGA 1XRUA 4EJRA 4QM8A 3LFMA 1BZWA 1GOFA 1DQ2A 4FOVA 1UY4A 2ZOEB 3VN4A 1EAH1 2J1SA 4KMQA 3K51A 1FMD1 1UZWA 3L2HA 4QX8A 1D4M1 5FFOC 1SCRA 1UL9A 5JIAA 5EPAA 4G4FA 4AFCA 4AFAA 3KZ4C 3AMQA 1FATA 2ERFA 1ND2C 3RJ2X 3OY8B 3R4UA 2VBPA 2XJVA 5HPOA 1XU2A 1T2XA 4GALA 1ND3B 3ORJA 3QLQA 1S2KA 1C5HA 5FZ8A 1H30A 4CDWA 3POSA 5JWPA 3KV6A 3ZXGA 2D3PA 5CFCA 1F5JA 5FMBA 2EXHA 2IXLA 1V6OA 2JDPA 3WDVA 4R4ZA 2H0BA 3VBFB 3ZFFC 4BIFA 5J09A 3O1TA 5T50A 1JHNA 1RUJ2 2WT1A 4YM3A 3UKTA 1UYYA 1WLDA 1XJAA 4XACA 1IS5A 4RSUA 2R0FA 3OOXA 3WCRA 4K40A 4Z92B 4HPKB 5C3OA 1A34A 3T4VA 3IIAA 4D69A 1K3IA 4SLIA 4KGQA 4XXPA 3T2QA 5FPXA 4OZOA 2CGOA 4J6GA 4CCLA 1AR81 3H0OA 2ARXA 5DZEA 2D44A 3O1PA 3THDA 1VBA1 3NSTA 4B1LA 3RQ0A 1SDWA 1KJRA 4WM7A 2QE3A 2MEV1 5C3SA 4QX1A 2OQ6A 2R7EB 2YMZA 3U0ZA 2HLEA 3RZGA 3T0AA 4AI1A 1AF9A 3BYWA 2VW1A 1SLLA 2XJRA 4RQPC 4XAAA 3ZPOA 4COYA 2AR6A 5FMDA 1E5RA 4A42A 5JDBA 1OD5A 4NOTA 4KL1A 1VAMA 3AYAA 3LEMA 1QY4A 5F6LB 5HV4A 2Y8KA 1O8SA 2WAOA 2YC0A 4YVWC 4GWIA 4DRVA 1DGRA 1W6PA 4FPFA 4CCNA 1R64A 2GN3A 4XUNA 4A2UA 4L92A 4QB1A 4M3CE 4CSWA 2YXSA 4IW3A 4ZONA 4A45A 3EYPA 3V0BB 3EMRA 3OPTA 4M4PA 1R1ZA 4DOUA 1LHOA 1RUJ1 2W87A 5G04L 2Q1FA 3SH4A 2BVBA 3IM0A 3PMEA 1GZWA 4FQZA 4BISA 2ZPXA 1GICA 2ENRA 2VH9A 3OD4A 3VZOA 1FPN2 4IV1C 5DDJ3 5CADA 4XF9A 1S0JA 5HCBA 1N3OA 1HDKA 4YG0A 5FRAA 2J1UA 2VW2A 1W8WA 2OUHA 5GZEA 1IQAA 2YBKA 4N43B 5B4XA 3IDBB 4DY3A 5FZ0A 5L9VA 2PXJA 3VKMA 5J98B 4AEDA 5F3EA 1AL22 1O4ZA 1OQDA 2IFWA 4LR4A 2W92A 4LHLA 4EWEA 2E26A 4FO9A 3OYWA 4UOJA 2HWC2 2ZMLA 4XVHA 4LBQD 3KHCA 1RXFA 1YC61 1OUSA 3H7JA 5JUVA 1VBE3 1IG0A 3F2ZA 3N7LA 2GNTA 1AXKA 1PGW2 2ZEYA 2GC0A 2PHFA 3AYCA 5J7MA 3N3HA 4XDPA 5FK8A 1W90A 5IK7A 1DG6A 1YFXA 2WFF3 1WW4A 2VG9A 1UPSA 1F35A 1PO22 1RUH1 1HXS1 3H7YA 4QPIB 3CL1A 3NKTA 3ZXAC 1WLWA 2X05A 4WVZA 3O12A 4JCKA 3SMHA 3VBUA 4CDXC 1HB3A 2PAKA 5IW0A 2WAAA 5LK7B 4RR3A 1VPHA 1O59A 3TYJA 3X29B 1KQRA 4AI3A 5BNNA 3KCYA 5J37A 1YQCA 1AL23 3LSEA 3ZYRA 4B7EA 1I9RA 4XJ8A 4AHXA 3POFA 2HWC3 2QNKA 4E8CA 5A1AA 2XB6C 1HV1A 1QH6A 1Z7S2 1FPN1 2VQAA 3QBQA 1YI7A 2FHRA 3ZOIA 2JENA 2VUAA 1ONAA 1OLME 3HT1A 1NCRC 3ZKYA 2R063 2D6PA 3H1YA 3WNNA 3WR0A 1Y7BA 1GZTA 1J83A 2RS12 4JTOA 1UMZA 1UZYA 2GU9A 3RJRA 1RUE3 1GBGA 1QH7A 3N7MA 3SCFA 3HNMA 2B46X 3MLJA 5F1RA 1OOPB 1WCSA 3AXEA 4P00B 2TUNA 1PGW1 2VMEA 3U37A 3DKQA 3WF3A 4DIQA 5EIYB 5FY8A 4DZGA 1XPWA 1M06G 2WJSA 1XSRA 5CIRA 2DVGA 2BOIA 4YWAA 3QD6A 1AL0G 4KH9A 4LXLA 3V65A 4AHZA 5FZLA 1PO21 1IOAA 1ND2A 4NHLA 2QUOA 1JZ7A 2OX0A 4HN0A 4IV3B 1Z7S3 3KVAA 5FQ0B 4URAA 3FHIB 3VBHB 3IMNA 4FFIA 1MZ6A 4A6OA 1LB2A 1ZBE3 5D21A 2Y34A 3ENRA 3M1HA 1ULOA 3MIGA 4XE9A 2DDUA 1Q8VA 3HN3A 3KT7A 4NJ4A 4DUVA 2DVBA 2XKOA 3ZFFA 1I5ZA 1TME2 5CZKA 1MS4A 5DUVA 1HIXA 3H3ZA 3TBDA 3WDTA 4QKNA 2WLQA 4FBFA 4PDWB 1RINA 5JXHA 3WDWA 1W2OA 1OURA 1W2UA 1ZBA1 4OYUA 2QVSB 1UZZA 2EALA 4XFIA 1N1YA 3BI3A 1IGOA 1WCUA 4QB2A 4ARXA 4CP9A 1AX0A 2ZCWA 3QACA 4KQ7A 1NE6A 4LKFA 4N53C 1IS6A 2WL1A 3LF7A 4WV8A 4BHPA 2O8QA 5IVCA 3HJRA 2RS11 3CIHA 1UU4A 1SHWB 5GZCA 3VBOB 4JKMA 2NMOA 1PX4A 3VDDB 2JDZA 4XUTA 3BALA 2W1QA 1BK1A 2AGSA 5CG8A 4MGZE 3KSCA 3SEEA 1JOBA 4RQPA 4PHZA 1B35B 1DQ1A 3BN6A 3OPZA 4JRAA 2XL9A 2CSGA 3VHOA 4D6QA 2GMPA 1JZ5A 4GAZA 2FDHA 4FPLA 1AXZA 3TOJA 5JSRA 1ZZ6A 2DCYA 4OMCA 1OQEA 5FKCA 5FXWA 4LTAA 5D2AA 2OZJA 3DYOA 1AYN3 1JN2P 2X5IC 2AZ5A 1VP6A 3G7DA 4CU7A 1QWRA 3GYDA 3H1MA 3POBA 1WLTA 2WNUC 3DL3A 3Q8AA 4LBMA 2CHHA 5FCCA 4UFHA 3T4HB 1W2TA 4QHBA 5A6XA 4P9XA 5FWEA 1PK6C 5JVVA 1TME1 3PURA 4Q4Y2 5I8YA 4MGKE 4XJWA 1NX9A 4NROA 4LHKA 4W50A 4QXKA 3U11A 5C6CA 1DDLA 3IMMA 4AEKA 5F3CA 2A3WA 4IV1A 4Y5SA 1QJY1 3I54A 3ALQA 3NNGA 4L2NA 1HQWA 1AX1A 5CYYA 2ARAA 1OUXA 4QPWA 1NQDA 2ZGQA 2C4XA 1J3QA 1R1A2 5IFPA 3I97A 4NN0A 2OW4A 4FPJA 4QQLA 4DB5A 2VUJA 4NR1A 5FPAA 2CYFA 1MS5A 4MGQA 3CDZB 1CAXA 2Q1ZB 4AK3A 2ZEZA 1XNKA 2PQSA 1EUUA 3NW4A 1N1TA 4GMP1 4NHXA 4P5HA 4NHYA 4P9YA 2WSUA 1NXD1 5F6KA 1V6IA 4Z2AA 3DXUA 4BQ2A 5A7SA 3C7OA 3OCPA 3N9LA 4KWUA 5DAPA 2YROA 3Q8FA 4BLJA 1GFF2 3HNBM 4CDXA 3OBRA 4DNYA 1WMEA 4GQ7A 4H7LA 1KXGA 3U10A 1YQ8A 2GC3A 4TTGA 1JODA 1VBD3 2XQXA 1R1A3 1W8NA 3FLPA 4Q4Y1 4YW5A 1RVF3 3K4ZA 3WX5A 3HQXA 5A1FA 3KHBA 1H1IA 1QJX1 1NZIA 1RHI2 2HWB2 1MZEA 2RDSA 1T6GC 3NKGA 3IWZA 1AYM2 4W4ZA 5IAVA 2GP3A 2W52A 1G7YA 1YUDA 2OQ7A 5CKNA 2DFCA 4B8EA 1HRI1 1MEC3 4GB31 1LJ7A 3OTFA 4MXWB 2NM1A 4FVVA 4BE3A 4C90A 1HX6A 4TN7A 2RR12 5FR3A 3FX3A 2O0OA 4C0HA 4F7ZA 2D3RA 1W99A 3IB3A 4QXCA 3WQ0A 2FDFA 1UW8A 4YZ3A 4X8PA 4FTBA 4ZKTB 2ID4A 5T3NA 3W5NA 2Y60A 1DCSA 5JR7B 1UY2A 2QFEA 1RHI3 2WQ4A 3AX4A 5AVPA 1RIRA 3AMHA 3MLKA 1WD4A 4XJ9A 4D8MA 2DUOA 5FP4A 3UKNA 1W6QA 1UOGA 5T52A 2ZZQA 1PO12 1PZ8A 3OBAA 4JDNA 1T6BX 2R0HA 4K1YA 3FBMA 5IK5A 1BK0A 3RZZA 5FY5A 1BMV1 2FQPA 3CU7A 3WDXA 1RMU2 1WD3A 2B45X 4Y1UA 2HWB1 2RR13 2VXRA 3N7JA 1OFSA 1AYM1 1W03A 3ITQA 4DXRA 2RMU1 1RUG1 4QX0A 3AZZA 3S6PA 3PUHA 5A33A 2IXCA 4CCCA 2RG4A 1QJU1 3H3UA 4RFRB 2EICA 4N53A 4UFJA 5I8TA 2HWE2 4P02B 2ET1A 2VCMA 2ZACA 1A8MA 1G86A 1PX3A 5FUPA 1COV3 5CBLA 1K5MC 3ZYJB 1GZCA 2IZWA 1H8TC 2HEYF 5LA1A 4H2AA 4D7TA 3MPPG 5A7QA 5K0UB 2CWMA 2UURA 3ZMOA 4AG4A 4E4SA 5IVVA 1XB9A 4Y1VA 1SLTA 2ZX2A 3NV4A 4JGZB 1QOSA 4MYEA 4IESA 2JDHA 3UGGA 4LKEA 2JD4A 3TEYA 1RMU3 4PQQA 1RTVA 4JRLA 1CPNA 4LJHA 5A3WA 3WNKA 4K1ZA 2AUYA 2X5IA 4LK7A 1OKOA 1MZ5A 3HN1A 4R9CA 3HOBA 4UT5A 4AQ6A 2UYAA 2WNUA 4O65A 1STMA 4E2GA 4LBNA 2UWAA 3U07A 5LA2A 1PO11 2DBIA 2GH8A 1XQNA 1Z78A 3D0JA 4HSJA 4Y20B 1PK6A 4YVSB 4YW2A 5JXIA 3S30A 2HWF3 5FZAA 3GBFA 4LIUA 2XGXA 1MACA 2ORXA 4MXVA 5FO7B 4QGLA 5FTTC 2FZ1A 1DYPA 3WOGA 4IDZA 4CCEA 4WBBA 2BERA 4Y22A 4YW1A 2XXZA 4IGPA 1S0DA 4IQPA 4XC9A 1TMF2 2WT0A 5FZMA 3N9NA 3JU9A 1H2NA 2FDGA 3PTRB 2HWE1 2R072 3W20A 1XNAA 2LALA 1OBNA 3JBG3 1DP0A 1KFXL 1L7RA 1REDA 1OI6A 2W94A 3NAPB 1D0HA 1ZM1A 2BW8A 3IPVA 4CDQC 1WCQA 4HSLA 1CAUB 4QKFA 1KDKA 2VMFA 3B02A 5A1LA 1SCSA 4R9BA 1BEV1 2ARBA 1HW5A 2H6CA 2MNGA 2Z42A 3TAYA 1JUIA 5DZFA 3NL1A 4FPKA 1WW5A 4M01A 1IS3A 2XL7A 1YJKA 5EJZB 3PUIA 2WYSA 4HZFA 1LNSA 1Q3EA 1W6MA 1R081 3OG2A 3V0AA 1CAWB 4XUOA 2RS32 1TMF3 1SLBA 1SEFA 4RS5C 3ZYBA 1C3HA 5C5UA 2JKXA 4TSVA 3J8F2 1MQTB 2R073 5C8CB 3C7HA 3GJBA 3FHAA 4K21A 4CCMA 2JIJA 3AK0A 4OQ8A 2EAKA 3ZN6B 5CAZA 2XHNA 2JDNA 3KM5A 4Q0UA 4Q4W3 3J9SA 2C26A 3AKTA 2F6BA 2X53S 3CJIC 3WP5A 3BTZA 4AZZA 2DVFA 2ZKLA 5H9RA 2QQNA 1JZ4A 4YM1A 4BPZA 3P6BA 4OI0A 3UJOA 1RUI2 4LO5B 2R32A 1OC1A 1W3VA 2P3KA 4CXXA 5GLWA 1Q8PA 5A7WA 4XTPA 1YJLA 2DCKA 1CESA 4BMEA 3GM8A 1BVVA 1CJPA 3UYJA 4Y26A 5F39A 4KGGA 2RS33 4XFHA 1QJFA 2BDRA 3EO6A 3WV6A 3A23A 3GXUA 3WNMA 4WZFA 1AR61 3CHXA 3FLRA 4IEQA 3GHNA 3JB4C 1C1FA 2JWPA 1SBFA 2OA2A 5GALA 1W05A 3RWNA 3PIGA 5A32B 3AZYA 3N9OA 4QPGC 5A80A 5L19A 4OHYA 3J7LA 4F3JA 2EXKA 5E89A 3M3IA 4XYXA 1FT9A 2XVGA 4KG8A 1H1AA 2FDJA 2VNRA 1QNYA 4Q5OA 4DINB 3J8F1 2RDNA 1W8OA 3HBKA 3NNLA 2R1BA 4FPGA 2GDFA 4PJYA 5FYMA 1W06A 2BU9A 3DPRB 2VZVA 3PU8A 2D93A 4LUKA 3THTA 3S5AA 4HKLA 4XFAA 2P2KA 5IT6A 4SBVA 1GQHA 4YFWA 5BPXA 3MYXA 5AFBA 4L11A 5I93A 4ZZ5A 4LBOA 2ILMA 1RUI1 5F7UA 1NY72 2NLRA 2VOVA 1QEXA 1BQPA 1FV2A 3PJYA 2GH2A 4QDRA 4FTEA 1YFWA 3JD71 2PELA 5DAQA 5F3IA 5KC6A 2XH6A 1K5MA 1VBC3 2ZZJA 3CEWA 5A7NA 5FBZA 5JCTA 4XDQA 3LKJA 2QZ3A 1YO8A 1C8NA 1ZA4A 3O1SA 1LAJA 2WS92 4NPMA 1H2MA 4HXCA 1SPPA 4PI2A 2W1UA 1ND3C 1QU0A 3AP7A 1JZ8A 4MH0E 2C5DA 2VOXA 2VZPA 4RGAA 5FYUA 1W6NA 2ZX3A 5JOZA 2ZAAA 1W39A 1CIWA 5HV0A 2IXJA 5A3NA 2KA3A 3ZXEA 1VB4A 3GZTB 3VBRC 4Z07A 4WVWA 3VBFC 3ZSMA 4DUWA 1GP4A 2VR4A 3N9QA 4D94A 1NLQA 2JB4A 1JU3A 4UBGA 1U5XA 4H14A 4PT6A 4FFGA 4UF0B 1S0CA 2OUJA 1WMXA 2E7QA 3PU3A 4MX3A 4OHXA 1WGPA 2A6XA 2QQPA 1ZREA 4IEYA 5JI7A 1HQNA 3AMMA 1ZNPA 1CZSA 1BLZA 1GWLA 2XVKA 1EY2A 1FNZA 3SEPA 1VRBA 2WS93 4DMIA 1WBLA 3J4UH 1PVC2 4NWWA 2R041 3M3CA 1W0PA 3M70A 3B69A 2XBO3 3ACGA 3WXPA 3PVBB 1W0OA 4BWOA 5C71A 3H8XA 1ZVFA 3FLTA 3VBUC 3FC0A 3S7IA 3OUJA 2HEVF 2JX9A 4JHZA 5FY9A 4CDQA 3TN92 4RR3C 5BXXA 3CO2A 2BWCA 5DAWA 3M7AA 4IGOA 4Q4V2 1KD7A 2VTXJ 4ATFA 5A6ZA 5CFDB 1JXNA 5F3GA 5LY2A 5BNPB 3AVRA 1DQ6A 4DRRA 3LWCA 4LBJA 1OLQA 3GHMA 1JBCA 4QHOA 2QDRA 2WNVB 2VJXA 4XQ4A 4C1WA 1C28A 3ABZA 2J42A 3I2OA 4OMDA 2AACA 4IE7A 1LHWA 2PAEA 1G9DA 2DCZA 1R092 2XLAA 3FUQA 3Q9OA 4EN9B 3V64A 4NRMA 4DEVA 4RS5A 5ACA1 5FZFA 4GJZA 3WD5A 2MHFA 2YGMA 2CU5A 1Y43B 1JW6A 2XWBB 5JPMB 5IHRA 2E32A 4UWDA 1QNWA 4N43C 2Y0IA 4W6XA 1NXMA 3TN93 1HRV2 3I2JA 3INAA 3CJIA 5EV7A 3RI8A 5JR2A 1Y9MA 2K0GA 2A75A 3B3QE 4QQPA 1GV9A 4Q4V3 1UN1A 4META 3ZFGA 2WBKA 4AL9A 4LT5A 1S0IA 1PVC1 1UKGA 2FCTA 5F2SA 2SLIA 2WNOA 3LEGA 1JTZX 4AFBA 2ETEA 2RJ2A 3AL5A 3HWJA 4GMP0 5H9PA 3C7FA 1X82A 4CP1A 3JUUA 2JG9C 2RS53 4R9DA 4MVTA 5KR7A 1LU1A 4LO6B 1FAYA 4WVMA 5HCHA 1NQJA 1US2A 5CA6A 2WUHA 4LA2A 1XOYA 5BNQA 2D6LX 3LSDA 1R093 4HONA 4MZUA 4Y4RA 1ULFA 1W6OA 3H50A 5FYHA 4CEWB 1H1MA 3ZFEB 3MW3A 4HT1T 3J7MA 4QD2A 1X9PA 4QPIC 4WM8B 4AQSA 1XYNA 5FYBA 3IAQA 4DY5A 4A7YA 4XABA 1MS8A 1X8EA 4BCUA 2W91A 3KCXA 4E9KA 1S55A 4YZ5A 1HRV3 3ZIWA 4QPGA 3SH5A 2EAAA 1BBT3 1ODMA 2Y38A 4D6RA 2WINB 1JZ2A 1GNHA 2XDVA 3CNAA 5FK7A 1GZWB 1IKPA 4LULA 4P14A 1AR93 2PHTA 4AVBA 5EYYA 5FZ1A 3UT0A 1YYNA 1TNFA 1NG0A 4MSVA 1SQ4A 1K45A 1S2EA 2Y6GA 3CKHA 3CQOA 4YG6A 4A7ZA 1AHSA 5DDJ2 5FZEA 3ZSLA 5I0SA 2GAUA 3BPSA 1WUVA 4Q8LA 5FAXA 5FZKA 3QCWA 1IPKA 3I59B 3J7HA 5I91A 3OYWB 2VMGA 1UQXA 3OB8A 3NJXA 2V09A 1ENRA 4YW6A 1ZRDA 1GUIA 1LOFA 4CYDA 2J1EA 2BOJA 4A41A 1TZOA 3VHPA 2WNEA 1OOPC 1OF4A 2E7TA 2QTWB 1MS9A 4JKLA 1VBE2 4UW4A 2AYHA 2GALA 3GBGA 2P37A 5FYSA 3ZN5A 1SLIA 2TNFA 3CJXA 4DS0A 1YEWA 2VM9A 3VKOA 3ZX7A 3CLPA 4LQRA 1UF2C 2WFF2 3HMYA 3EJKA 3OY8A 4XETA 3PLQA 4IV3C 1UNBA 1YFYA 2ADEA 1ND3A 4K9SA 2ZGOA 2RHPA 4DXZA 1RXGA 5ABJB 5EFUA 3RZHA 3LFIA 2PHUA 2A3XA 4MGSA 4BH9A 4FAGA 3KGZA 5HI0A 3NVCA 5IVBA 2ZHMA 3MF6A 4YLZA 4AFDA 5J36A 2A6YA 1KGYA 4IE0A 1KFUL 3GCWA 3VBRA 4EE2A 1X36A 3VBFA 5A7OA 1LHNA 1V9U3 2ZGNA 3CMGA 2D6MA 1RUOA 4PDWC 1W0NA 3W5MA 4NMIA 2WZEA 2B5HA 1GWMA 2JDUA 1ENXA 5KBFA 2OT7A 2G9GA 1VB2A 4J1WA 4UFKA 3KD4A 2G19A 4HPKA 2VPVA 5DDJ1 2WZPP 3NV3A 2QKDA 5A70A 2WO2A 4OI2A 1UOBA 4AGVA 1E5IA 3ON7A 4LBLA 4FP3A 2NN8A 4Q4X2 1OD3A 5HCFA 2ZGRA 4BQ4A 2R062 4EQVA 4Q1RA 3VDDC 5LB6A 3I2KA 2YB7A 3WG4A 2ZMKA 1VBE1 1RUE2 1LKNA 2ZA9A 3DV8A 1U5YA 1RUF2 1B35C 1S4CA 2P17A 2V4AA 2ZGSA 4X6RB 2RVAA 5FMOS 4X8NA 3VD7A 1O3QA 5K8SA 2NP0A 2QQVA 1NCQB 2RV9A 3FUOA 1XBFA 1HN1A 1F15A 4LIVA 4BLIA 2WFF1 3CZJA 1ALYA 3FWEA 3IAPA 1ZA7A 5I0RA 1NYWA 5J3UA 1QDOA 2ARCA 4GJYA 5L7OB 4KWJA 4NIHA 1UU5A 5A3UA 1RB8G 1J3PA 1C8M3 3N4MA 4BQXA 2A1XA 3O1OA 4ASKA 4W6YA 3OGRA 4PF1A 1ZBE2 2XQRA 4QU2A 4ZS3A 5FLJA 3V0BA 5C3RA 4Q4X3 2B9VA 4NHMA 4U2AA 1F4AA 1AL21 4FPOB 4RHV3 1OA2A 5FZOB 4OHWA 5FZ9A 4IEUA 3WNOA 5JMOA 5T5PA 4LHSA 2VMIA 5CISA 2HWC1 2VMHA 2UWBA 2WLPA 4QX7A 5JPNB 1SG3A 1J1TA 4CZSA 1V0AA 2GMMA 1RUF3 2D98A 4LBQB 4E2QA 4N43A 5BUVA 4I3GA 3JZVA 3KQ4B 4CU9A 5FY0A 4LMFA 1BHGA 3AXDA 1QXPA 4K8FA 4COWA 3F95A 1H6YA 5IWFA 2R061 3SH3A 4EN7B 1URXA 4JZRA 2V5DA 3B5LB 3PJQA 1RUE1 2XMLA 2YG0A 2XHKA 5KXEA 2SBAA 2JG9A 2Y64A 1XNTA 3I2IA 4BDVB 4UAPA 1POV3 5LCWL 1PMJX 1WBFA 2QQLA 3ZXFA 3WHTA 3O1VA 4YVWB 4AXOA 3T09A 2V73A 3POJA 2Z79A 4QPIA 2BWAA 2E33A 2JKBA 1W8HA 2ET7A 1Z7S1 1IKQA 4I0AA 4OCTA 1AYN2 2VQUA 1QMJA 3PUAA 1ZBE1 3U4XA 1ASJ3 4Q29A 3BGAA 3VDCA 4L99A 5FYYA 4YM0A 1FOD2 3ELNA 4LK6A 4EN0A 3T0DA 3HNYM 3BIWE 1RUD3 5BV6A 1EV13 1UD1A 3ES4A 4DEQA 4ES9A 5C4WB 2PHDA 1O3TA 3MFAA 2CDPA 3AC0A 3BB6A 3E6BA 1OVSA 1DYOA 1JOJA 1W8ZA 2NYYA 3T30A 4AVVA 4M0NA 1YHFA 3AP5A 1X9TA 4M3CB 1PVXA 1S2BA 2J7MA 4HETA 4NPLA 4V2VA 4XF4A 2Q1MA 4IUGA 4XOGA 5CU1A 3UGFA 2VTXA 4FSJA 4OHZA 3UK9A 2EA7A 2JG8B 2O1QA 2E63A 5H9QA 5LBCA 4LKDA 3DXTA 1OOPA 5BNOB 1FXZA 4PCRA 4D6SA 3I7DA 2JE9A 1O5LA 4ORFA 5FIXA 5CEHA 3GALA 4YGBA 2E53A 2VOKA 2ZHKA 1FOD3 1P8JA 1GQPA 1RJ8A 2B9UA 2RM23 2ZX4A 5ANNA 2CY6A 4EROA 3LZZA 4BK4A 1SFYA 2OZ6A 2QQKA 1QXJA 1V70A 2BZDA 1U5ZA 4CDXB 3LGRA 4IV3A 4E4HA 5FQ0A 4XURA 5JLVA 1WKYA 5FY1A 3TNPB 4NRQA 3U14A 1AYN1 3WW2A 3FBYA 3H8OA 3AYDA 4CP2A 1W2NA 1SBDA 2B42B 2NPIA 3N36A 5FYTA 4AAPA 4TYSA 4BA6A 4D0QA 3TEWA 3OGJA 4URTA 3LPFA 1ULPA 2ORZA 2YZ4A 3OGGA 4YARA 1LOGA 1VBD2 1ST8A 2YGLA 2WO3A 4PDWA 4COZA 1RVF2 4Y4YA 3FFZA 2J1AA 2W39A 4HKWA 4NIAA 4FXGB 4HBNA 3PVNA 2DUQA 4LO4B 1NCRB 1UZ0A 1LCLA 4B4RA 4QKDA 2WN2A 2DURA 1HV0A 1US3A 4XJUA 3SCGA 1QOOA 3AKSA 2BP6A 1LEMA 1UO9A 4JAAA 2WO7A 2KR2A 2P6HA 1JOPA 4AW7A 5C5TA 3C7EA 3AP4A 4LE4A 5FXXA 3GJAA 4AVCA 1JS9A 2B4KA 2WWUA 3VBOA 1JI6A 2WWJA 3ECQA 3VDDA 1MEC2 4KNCA 4A6SA 5FZDA 5GKAC 2PLV3 3NNFA 4ONUA 3WVJA 4AGRA 3LA3A 2WIIB 4JDMA 3K48A 5K0UC 2ZGPA 1F9KA 1HJGA 1B35A 3VHRA 4N7UA 4KBZA 4QDQA 5FZ3A 5GZFA 5IVYA 2R16A 5GJ6A 1J84A 2WO1A 1JU4A 1OLRA 3I3QA 3KGLA 4B29A 2AREA 3WW3A 5K9YA 5AC92 4J1XA 4GKYA 2QDNA 2OPKA 4ARYA 3AVSA 3OPWA 4YVSC 3ILNA 3AFKA 3WEZA 1PNFA 3UETA 1L3JA 1PNGA 5GLZA 1RUC2 1VBD1 1GYKA 1R1A1 3E6DA 1WCDJ 5FV3A 4BZ4A 3K4DA 3KT4A 5DUWA 1RVF1 4BM8A 3ZKUA 2XUMA 1AX2A 5APAA 4DUXA 4AFMA 1CAVB 2GN7A 5T54A 3KMHA 2IVIB 4CP0A 1BVP1 1OF3A 5K7PA 4UI9L 3JCIA 1F4HA 2OIIA 4QGMA 4XDOA 4PIYA 5CKMA 1UOJA 3VGIA 4BXSV 1NA1B 1UIKA 1HB2A 1MEC1 5L9RA 1HLCA 1JYCA 2LRPA 1DQ4A 3O14A 5EWSA 1YNAA 2E6VA 2V5YA 3P5BA 5FZBA 5A6QA 2ZX1A 4IEVA 1Y9QA 5AC93 4ASMB 3ZN4A 1COV2 3RPQA 3U4SA 3ST7A 4R52A 3M8LA 3R0RA 2PA7A 1RUC3 3MW2A 4HFSA 4XXAA 2OVUA 4XBNA 4YZ4A 3VL9A 3H42B 2E7AA 5A3TA 1J58A 1QKQA 4XBQA 3CBNA 1EUTA 1RHI1 3I2GA 1EP0A 4AI9A 4OUMA 4W65A 2BNMA 5D8AB 4LEJA 5DZGA 1PK6B 1YCIA 2RJKA 1MR5A 4IE4A 3BU0A 3PTYA 4XILA 1F8VA 2VVDA 3QOPA 2VZOA 5LASA 5C8CC 1CN1A 2YV8A 1N1SA 2VU9A 2HWF2 2QQOA 2VUDA 3ACLA 3C8XA 4BU2A 1OH3A 4CRQA 3LA2A 2BBAA 2RR11 1V6JA 5LBFA 3OUHA 3BOWA 2BNOA 2L9LA 5CB7A 1MS0A 1BXHA 1CX4A 2Y6KA 2TEPA 2EVXA 2QBXA 3USUB 3M2MA 2PHWA 1XNCA 5C70A 5FYVA 3RFRA 2VQTA 1GANA 3DF0A 3OEAA 4MXWA 2P5BA 3DKWA 3VBSB 1VIWB 2YYOA 3T2OA 2CNAA 4I0BA 4CDUB 2ZXQA 3L9JT 3JBG2 3KCCA 3RGBA 1COV1 1KJLA 4CCJA 4XMIA 1VALA 4CVUA 2QQJA 1RITA 2WA4A 1W8FA 4OVEA 3RMYA 2ADDA 4G9SB 1D4VB 4G3YC 3NV2A 3KV5A 4M4RA 3VZJA 2OXBA 3B00A 4IEOA 1KDMA 3LIHA 2YPJA 4RGGA 1RMU1 3MPBA 4P9IA 5JSOA 3LB9A 3I49A 1VBB2 2F4LA 4RD7A 3VLBB 3BTYA 5KWRA 1PIV2 3FE5A 5A6YA 3AJYA 2W46A 5K4LA 1K42A 2XWJB 2VQ0A 3AFGA 2P3JA 4OHVA 1S1AA 3DPRC 4XPVA 2HWF1 1VRH2 3EHKA 2LS6A 4KI5M 3KT1A 5GLUA 3LCPA 1SMVA 4ZU7A 4CUBA 3NJVA 3OBTA 4D7YA 4YFZA 1AR73 1QQP3 4ITCA 1DBNA 1DLLA 2VO5A 4Q4W2 4XIKA 4PF5A 5GZGA 2GP5A 3WNLA 4FPEA 3BPZA 3VKFC 4TZDA 5GLVA 3K3OA 2W95A 5FY7A 3UKVA 5L36A 4FCAA 1MPXA 5EYXA 1G9BA 3KF3A 3ZYGA 2K46A 4CEYC 3HR9A 4CE8A 3JBG1 1VBB3 1SLCA 1QJZA 3AMPA 1Q8OA 2UY9A 1VR3A 2O14A 4LUMA 5K0UA 2WT2A 1OHFA 1PIV3 4GH4B 1DZTA 5JOWA 4TWTA 2PMWB 2VZ1A 4OULA 4JGZA 4CUGA 4NIGA 4P9JA 4HOOA 2XJSA 5FDBA 4UW6A 1VRH3 4PIXA 3RYRA 1W3XA 3ZLIA 2GMEA 1NE4A 3RYKA 2A6ZA 3AP6A 1UOFA 4COUA 4TXWA 1RC6A 2D5FA 1GNZA 1JYNA 5E88A 2P34A 1H9PA 1O5UA 1LODA 4XF0A 4Y20A 4YVSA 5GM0A 4IEXA 3ZFGC 1G8WA 1H9WA 1TMF1 2WZR2 4UBHA 4JV4A 3RZKA 2I07B 3OJBA 3PUSA 4QM9A 5B4NA 1D0GA 5FLIA 4R4XA 1CX1A 2R071 2VCCA 4QU1A 3POGA 3S0MA 3WF0A 4E2SA 3HPNA 3BODA 3W59A 1XU1A 1W9WA 2BGCA 4K8RB 3M3QA 4Q4W1 5LK5A 3GCXA 1Q5OA 5J48A 4GD4A 2KXLA 1PM7A 1O91A 4E27A 5KC5A 3D6EA 4JDOA 1YQ2A 5C9AB 4YW3A 4YSFA 1X50A 1H8TB 2Y0OA 5SV8A 3WF1A 1DZQA 2W9XA 3DN7A 3MIFA 3PHMA 1HJFA 1QF3A 3B01A 2K9ZA 1F5FA 2DYCA 3M3EA 4PIZA 1DLCA 1XNDA 1J1LA 1VBC2 5FXVA 1RYYA 1TG7A 3AKPA 3VD4A 2BPA2 2RS31 4AHYA 2WZR3 5E1RA 5CFDC 5BNPC 1TEIA 4M3CF 5D1IA 4LE3A 4O7XA 2A71A 5F8PA 1O7FA 1WZXA 5AVAA 2K2SA 4Q8KA 5LRRA 1MS1A 2WNVC 2VW0A 3RSJA 5FPBA 3T08A 3KV4A 4V1PA 3W21A 5JZGB 1QDCA 2UY8A 5FMCA 1I6XA 3K3NA 1A6CA 2OS2A 4MADA 4ZPIA 1CAWA 3THPA 1A8DA 4BMBA 4BQWA 4ISRA 1H0BA 4BQ1A 2RE9A 4P9WA 5ANQA 1I3HA 4XQWA 5HXMA 5ERLA 1LOFC 1MQTA 4XFBA 1BCXA 4QXHA 5C8CA 1RL3A 1B09A 3JXSA 3ZSEA 1A78A 5CKQA 4B7KA 5JI9A 4JGYB 1AVBA 3ZN6A 4AE2A 1TE1B 1OA4A 5FPVA 2UWCA 5JIUA 3RZLA 5DXDA 1PZ9A 5C3QA 5FZCA 3FHQA 2F17A 2BYVE 1OT5A 2YY1A 4BQYA 5CVRA 5IK8A 3GDBA 1VE0A 3AJZA 2D5HA 2XBO2 1N47A 3O0WA 2F4PA 5FOBB 4Q1PA 3POWA 2E9QA 2VBBA 3O0VA 3ZDSA 1V00A 4GWJA 4PLMA 4AEJA 4DPNA 2OPWA 1G9CA 3ZYHA 2PHLA 1VBC1 4QX5A 4B4PA 1FV3A 1ENQA 3A7QA 4CEWC 3SHRA 2YBSA 3ZFEC 3WNXA 4LBKA 4WM8C 4UYBA 2BFUS 2WC2A 4PBPA 4AR2A 1O6UA 5F32A 1OH4A 3RRDA 4A3XA 3I3MA 2ZGTA 3KV9A 1RJ7A 1AUYA 4ZU4A 2WN3A 2JE7A 4QGNA 3DUIA 5A32A 1ZRIA 3BKZA 2WQZC 5LA0A 3WLUA 1H6XA 4JHTA 5FZ4A 3PVEA 2IXIA 3MLLA 4H7MA 1ZZBA 5EHDA 3IBMA 3MO4A 2WKKA 3I4IA 4FOQA 4CA9A 4WZCA 4XHXA 3TNQA 3WF4A 1W8TA 2GSYA 5FMOL 1GZ9A 3W9AA 3UNPA 4U36A 5FPLA 1BKZA 2OKXA 1NY71 4PI0A 2VVFA 2GC2A 3DPRA 3LOIA 4OI4A 4FTSA 1KRIA 2Q4SA 1UU6A 3DGTA 2HJIA 5FLHA 3OD0A 3WNPA 3APBA 3ROUA 5KHJA 2C9KA 2PFWA 1GP6A 2WR9A 5FZ6A 4C1XA 4BOWA 4EWAA 2YUEA 3BIEA 1K5JA 4RFT0 1ULCA 2WS91 4HK8A 2P1BA 2DWRA 1OPOA 4CDWB 1EAH2 1WA6X 4JQTA 1O8PA 2WABA 2XBO1 1CZTA 4WVMB 1JHJA 1LRHA 1D4M2 4WVVA 3VZKA 1OVPA 5EQUA 3KVBA 1N3QA 3PVOA 4CEYA 5CFCB 2GC1A 1F31A 1W2AX 2HH9A 2RS52 3OBZA 4YRDA 1W6OB 2YFZA 3WG1A 4OLLA 1H8VA 2KM2A 2LM3A 3ILRA 4IXLA 1WMDA 1LEDA 4OZXA 2FDKA 1APNA 4MGIE 1QHDA 2P4EA 5C7GA 4KG0A 1XE8A 2A3YA 3BUCA 1YIFA 5ISLA 3FN9A 2FMDA 2DTWA 2VCBA 4GKXA 4YGEA 4NO4A 1LR5A 3WSOA 2NQYA 1JYXA 3SKJE 2Z4FA 4ASLA 1LECA 3J7NA 1BBT2 1J59A 4R8HA 1BJQA 1QJEA 4QQOA 5L9BA 1UAIA 5FUIA 2NZ9A 1AR92 1EAH3 4WM7B 4UF0A 4BIOA 5LZ6A 2QCSB 3EB7A 1D4M3 2CV6A 3UV9A 2WSVA 4LO8A 3H9AA 4DFSA 1GOGA 2MPFA 3TN91 1VBA2 3WP3A 3NMBA 3ZO0B 2XKPA 4BJ0A 1KEXA 4Q4V1 1ZZ9A 4CPBA 2MEV2 3LOBA 1W6PB 3VHNA 4A7KA 3FFQA 4KWKA 3RVHA 1CIYA 2G4IA 2PHRA 4XCAA 1D2QA 1ULGA 2D97A 4Z8BA 4AI0A 4AOCA 2RS51 4HL0A 3USSA 1PGL2 2A73B 2Q30A 1NCQC 2ZGLA 4MUVA 3KB5A 4AEMA 2JEMA 3IKWA 5GLTA 2OYZA 3P1IA 2VMDA 5L7OC 1R091 2AC1A 5CFDA 4PBOA 3JQXA 1AXYA 5BNPA 1UY3A 3VKNA 2JECA 4JC1A 1GQGA 4XFCA 3VBRB 2W1SA 2WNVA 4EZHA 1UKRA 1AR83 3I3BA 5GZDA 4AEDB 3Q8EA 3UGHA 1HRV1 1VBA3 2ZGMA 1BBT1 2YBPA 4YGCA 4TLFA 3FJSA 3WQBA 2MEV3 3ZYIB 3N35A 4ET7A 1IQDC 2RJLA 1AR91 1V9U2 1ZX5A 1ZZ8A 1HN0A 3SLIA 3ZXKA 5DMYA 3OF1A 4I30A 2C9AA 5J96B 2YU2A 2ZS6B 3R4SA 2LTNA 1LULA 2FCUA 5G05L 2W68A 3HEIA 1D7PM 1ZRRA 2HEWF 5T5LA 2YFUA 5FO9B 2E31A 3ACFA 4W8JA 5F5QA 3C3VA 3D8CA 3TWIA 2ZEXA 4MGYE 1Y9GA 2FZ2A 5KHHA 5LBBA 2EXJA 1L7LA 3VBUB 1CONA 1IS4A 1LGCA 2EIEA 2XJTA 5DPNA 3VBHC 4YZ2A 1I1EA 1DU3D 2VGDA 4RR3B 5BNNB 1PGL1 1EYBA 1RUJ3 5IAXA 3I2HA 5DG2A 3AP9A 3OGVA 5FJKA 2JD9A 1RUH2 4F83A 1HXS2 2HBTA 3C2UA 4CEWA 3URFA 2D3SA 3ZFEA 5DUXA 3BTAA 2XUEA 4WM8A 1PMHX 2ZKNA 2IC1A 4FI9A 1KS5A 4ES8A 2QQMA 1CPMA 4GWNA 3I8TA 3LE0A 4K7JA 3ACIA 4XEZA 4CCDA 2A7AA 4NIDA 4O9EA 5SV5A 1C8M2 2DFBA 2DV9A 2IFRA 3OUIA 3D3AA 3I2DA 2AH2A 1H2KA 1W9TA 3IZOA 4ZY9A 3WG3A 3OEBA 1FNYA 3ZXDA 4V2WA 5C4WC 2VMCA 3GNEA 3RDIA 1V9U1 1CJDA 4JQRA 2FDIA 4RHV2 5LA9A 3VBOC 3ZSJA 1QGLA 4ATEA 4ISQA 1NT0A 2JIGA 4AQTA 3MBWA 4YZ1A 4I09A 1VAVA 3POYA 3N9PA 1VAKA 4ZXKA 1DGRN 2AEZA 4L9BA 4LLOA 4RGKA 1PHMA 4S2FA 3I59A 4Y24A 2V72A 1IHMA 1RUH3 4P08A 2VECA 4HMZA 4RL7A 1HXS3 4A3ZA 2JG8C 1ND2B 1MS3A 3AL6A 2D7FA 2D43A 4MO3M 3T2PA 4AWDA 3HAGA 1SZBA 4QAWA 5A3OA 4JKKA 5L73A 2BEOA 5BNOC 2JG9B 4XF3A 3K46A 3HIFA 4AYUA 2H6BA 2JICA 3HT2A 3NWKA 3P3NA 3DCQA 3MW4A 1LHVA 1VMHA 3C7GA 1AZDA 3ZFFB 4BQ3A 4I01A 4DO0A 2QQUA 1UX6A 2JJ6A 4HKOA 4UFIA 1JYVA 1FPN3 2BBVA 2ES3A 4LOSA 4HVOA 5FZGA 1JMUB 3FMGA 3VZLA 3V56A 2XJUA 1DFQA 5ABJA 1OA3A 3N9MA 4IE5A 4AQ2A 1E57A 2DU0A 2J1RA 1C8M1 3O5SA
chains in the Genus database with same CATH topology
2VVEA 3ZSKA 4AVSA 1ZZ7A 2CAUA 1SBEA 3VUOA 2FMYA 1ASJ2 2IWGB 1DGWA 2I74A 1NLRA 2X29A 4Q4X1 4LNVA 1ZBA2 3VV1A 3WDYA 1RUD2 3WP6A 1EV12 1NLSA 1FX5A 4RHV1 2HWD2 3KLSA 3QH6A 3WHUA 1H4GA 1CQ9A 3MEPA 5IUQA 5HXVA 5A3MA 4RQPB 3L2YA 1PO23 1RUF1 4IEWA 4Q0QA 4I2OA 3ASIA 4NHKA 3D4KA 2QJVA 5C33A 3FZ3A 4INDA 1N3PA 3WW4A 3MDPA 4AF9A 1LESA 2B7YA 1WW7A 1PGSA 3NJZA 1DQ0A 2I45A 1U12A 1XYOA 1NCQA 1POV1 1ZBA3 1AJKA 3MIBA 2RM22 2NMNA 5L7OA 2HWD3 1ULDA 1FI2A 3MZHA 4IV1B 2CTVA 3VL8A 2Y26A 3GF6A 3WQ7A 1WCKA 1MZFA 3MI8A 2ZBJA 2RS13 2VULA 3EXUA 1ASJ1 1G9AA 2D6OX 4HLTA 1N1VA 1OMIA 1RUD1 3AKRA 3RG0A 1EV11 3O0XA 2XPJA 1QJY2 2HWD1 4UW5A 1O4TA 1ZYBA 2ZX0A 3BOPA 4NVPA 1CAXB 5BYNA 4HK9A 4EV0A 4AVTA 4LBQA 2CGPA 1XE7A 5AFEA 4P9GA 2O8OA 3AZVA 4L8QA 4IEZA 1V6NA 3QH7A 4S2DA 2XJPA 4E4DX 1C5IA 2XJQA 1NA1C 2G9FA 3IDEA 1S0GA 1JUHA 2A6WA 1S0FA 2DU1A 2BQPA 3VBHA 2UU8A 1TME3 3W58A 1V6KA 2PLV2 4FT8A 3LAGA 1FOD1 5HBAA 3NO8A 4PQ9A 1CR7A 2BTVC 4XHBA 4YVWA 1IZ3A 2RM21 4JVAA 3A0NA 1F2NA 1QJY3 4LLFA 5BY5A 2WWSA 1LGNA 1Y3TA 4H55A 5T5OA 4Q0VA 3SITA 2Q0AA 5D8AC 3E5XA 4I0WB 2DCJA 2VY0A 5JOXA 1LOAA 3MIDA 4QQHA 4QT6A 3WQ1A 1RGSA 2ZJCA 4KU7A 1UIJA 2DTYA 1KITA 2C1FA 1Z0HA 3SNMA 1QJX2 4A7ZA 1UPIA 2ATFA 5H9SA 2WA3A 3TB0A 5C4WA 1RUNA 3WW1A 3O7OA 2EXIA 2A6VA 1V6LA 4Q0SA 4B3NA 3E5UA 1C1LA 3KQRA 4Y5Z0 2VNGA 4GMP3 3GZUC 2D40A 3MF9A 3WUDA 4M3CA 4AI8A 5FO8B 1HRI2 4GB32 3ZVXA 2W08A 3RNSA 5LRSA 2JG8A 3AZXA 4JGZC 3IT8A 4GWMA 3VBSC 5B2GB 1J3RA 4CDUC 4KU8A 5BNOA 2P3IA 4N9IA 1C4RA 2Q5TA 2BNNA 4GIQA 4UXAA 4AI2A 1W6QB 2PLV1 4Q4Y3 3H8UA 1Q8SA 2H0VA 1Q43A 4NWVA 4OI1A 1QJX3 2DUPA 1ULEA 4LHNA 3WT3A 4LO7A 1DHKB 4W6WA 2R6QA 1Q56A 5DG1A 5A33B 1GLHA 4M0HA 3M4FA 1HRI3 4GB33 4N53B 2CAVA 3B9CA 3VZNA 4KBBA 1BMV2 1SLAA 5JAXA 2ZABA 2XVLA 2CGNA 1QXRA 1MVQA 3CF6E 5T55A 3TRSB 5KXCA 5LEKA 2RMU2 1RUG2 3NAPC 2VOWA 1NCRA 1QJU2 4N9HA 3D0SA 5E8AA 2HYKA 2BUKA 2JXAA 5I0TA 3G6JB 2BVVA 4NPRA 1OPMA 4Q26A 1A3KA 1SFNA 3AZWA 1YWKA 4OUSA 1EPZA 5KHKA 2X5IB 1HQLA 3VZMA 2WNUB 2IXKA 3AMNA 4EN6B 5AC91 4K20A 3RYPA 4GH4C 1DF0A 4FPYA 4K3UA 4Q2FA 4OFGA 2HWB3 2WFPA 1MQTC 1RUC1 1X8MA 3UL2A 1VJ2A 4K6BA 3R6SA 1AYM3 4XIOA 2RMU3 1RUG3 4XW3A 4YW4A 1XNBA 4F8AA 1QJU3 2PN5A 4Y22B 3SCHA 4XJAA 3EBRA 2IXHA 1YRZA 4XJZA 4Q27A 1YI9A 2E51A 4C0BA 5HCAA 3H1WA 2BFUL 3IPVB 1TNRA 1CAVA 2I2SA 1PZ7A 1CD3G 1OQ1A 1Q8QA 4LA3A 3AB0A 3E5QA 1QOTA 4HN1A 1AR72 1QQP2 4FXKB 3SISA 3B7MA 3J26N 2N7GA 2PYTA 4Z82A 2X8KA 3R4DB 2YHJA 2DVAA 5FREA 1VLNA 1NA1A 5C9AC 2ZGUA 1W6MB 3D5OA 3E97A 4ZU5A 3V0AB 1PO13 4BYYA 1BEV2 4PLOA 5JSPA 3S7EA 5I0UA 5LEJA 1REFA 4MV2A 2W0XA 5EXOA 4C91A 1R082 5JOYA 2LUWA 5JZGC 3ZPYA 1X7NA 1ZZCA 4PLNA 2C0ZA 2ZHLA 5D8AA 2DVDA 3AM2A 3MGUA 4H3WA 2HWE3 4E4ZA 4HVQA 3WUCA 5TSWA 5FPZA 4DQAA 2UYBA 2A70A 1V6MA 2R30A 1LOEA 4FAHA 4GA9A 4JGYC 2XLFA 4Y1ZA 3ZYPA 4EN8B 1XXNA 4I02A 3WCSA 1HKDA 3KS7A 4CTEA 4O9GA 1BEV3 1DIWA 4Q0PA 3EQEA 4HANA 5EJ3A 2PQQA 1AR71 1QQP1 3T1MA 2B39A 5CG9A 2QZ2A 2ZHNA 1REEA 3MIHA 3USUA 4XF1A 2GZWA 4IETA 3MIEA 3LA7A 1R083 3VBSA 3B93A 4CDUA 5KXDA 2A5ZA 2DCTA 3P3PA 5C8WA 3WDUA 1YLLA 1DGLA 5T5JA 4FP2A 1VBB1 1WLCA 3NV1A 4XFGA 1AR62 4XFFA 2PTMA 2AENA 1PIV1 1UCXA 2HKXA 1IPJA 3ATGA 4FOYA 3A0KA 4XMAA 1VRH1 1YXWA 5F9TA 2EF6A 4YYOA 2DF7A 4YG3A 3RS6A 3IN9A 1WMFA 3D82A 4FOWA 3T1LA 1ENSA 2GNBA 4XQDA 1OKQA 1BYHA 2GNMA 3JB8A 3B9IA 4I3PA 4FQ4A 1K5MB 1O3SA 4XZPA 2XLGA 1YFUA 3NAPA 1CAUA 2Z69A 1AR63 4COVA 1TQ5A 4CDWC 1ZRFA 5IK4A 1G9FA 1W6NB 3PNAA 3JD72 5CFCC 1XYPA 5E16A 1LU2A 3MFCA 5KXBA 1U0AA 1CGPA 1MVEA 3RI9A 3WP4A 3J8F3 3ES1A 3ZIXA 5I8SA 4GH4A 5FOJB 4IEPA 1X33A 2WZR1 3AKQA 3WINE 2D6KA 3HBZA 4XTMA 1RUI3 2ZGKA 4FPCA 2PHXA 4UW3A 2Z5WA 3WZ1A 4M00A 4WM7C 4AGGA 5KHGA 3JD73 3HD8B 1C57A 1JH5A 3ZXLA 2XG3A 4CDQB 3E6CC 4XBLA 2Z2SB 1GKBA 1GR3A 1H4HA 3UJQA 4QQ2A 2R042 4QPYA 4RA0A 4IERA 4S2HA 4GXLA 1LOCA 4YNIA 5KHIA 3MICA 1DZRA 4AHWA 1S0EA 4Y1YA 1DGWX 1POV0 1M4WA 5CNAA 4CEYB 4FPHA 1LOBA 5C9AA 3ZXJA 1H8TA 3ZMNA 3IDCB 2R49A 1JYIA 4P9LA 3BU7A 4AVAA 5A3LA 5JMCA 1D2SA 4QMAA 4N7IA 4RS5B 1WW6A 4N90A 4EWDA 3A4UA 1DQ5A 1O4YA 1YIPA 1WA4A 3WG2A 1NZCA 4D3WA 1OFNA 4KWLA 1LHUA 5JZGA 2ZAHA 4AEDC 3CJIB 1AJOA 1U5IA 3T2TA 3GZAA 5ACA2 2R043 3ILFA 3ZFGB 2D6NA 2ZMNA 1LTEA 3R05A 2VNOA 1DYKA 4YM2A 3ETQA 3ME2A 3B94A 3M3OA 1GSLA 4B4QA 3RMXA 4JGYA 1FMD2 4S2GA 1ZRCA 3BCWA 4GULA 1NOVA 4HVRA 1S0BA 4YGDA 4JTNA 1LGBA 1O3RA 1CVNA 1LENA 1SACA 1FYUA 2GNDA 4L97A 5DUUA 4D7SA 2CL2A 3WY6A 2CWSA 5ABJC 2TBVA 5BNNC 1H2LA 1EPWA 3GBWA 2ZTNA 3JQWA 2FBEA 4QPGB 2EIGA 5EZWA 4R9AA 3PMSA 3N7KA 5ACA3 1KS4A 3VKLA 2B8MA 4Z1VA 1FMD3 2YDEA 3AYEA 2R1DA 2Q8OA 4Z2WA 4IL7A 4MLOA 1PVC3 1G6NA 2PAMA 4Y1XA 4X6QB 3SXWA 1PMIA 1AR82 1OSGA 1XRUA 4EJRA 4QM8A 1BZWA 4FOVA 1DQ2A 2ZOEB 3VN4A 1EAH1 3K51A 1FMD1 3L2HA 1D4M1 5FFOC 1SCRA 1UL9A 5JIAA 4AFCA 4G4FA 4AFAA 3KZ4C 3AMQA 1FATA 2ERFA 1ND2C 3RJ2X 3OY8B 3R4UA 2XJVA 1XU2A 4GALA 1ND3B 3QLQA 1S2KA 1C5HA 1H30A 4CDWA 3POSA 5JWPA 3ZXGA 2D3PA 5CFCA 1F5JA 2EXHA 2IXLA 1V6OA 3WDVA 4R4ZA 2H0BA 3VBFB 3ZFFC 4BIFA 5J09A 5T50A 1JHNA 1RUJ2 2WT1A 4YM3A 3UKTA 1WLDA 1IS5A 4RSUA 2R0FA 3WCRA 4K40A 4Z92B 4HPKB 3IIAA 4D69A 4SLIA 4KGQA 4XXPA 5FPXA 2CGOA 4J6GA 1AR81 3H0OA 2ARXA 5DZEA 2D44A 1VBA1 3NSTA 3RQ0A 1SDWA 1KJRA 4WM7A 2QE3A 2MEV1 2YMZA 3U0ZA 4AI1A 1AF9A 4RQPC 2VW1A 1SLLA 2XJRA 4COYA 2AR6A 5JDBA 1OD5A 4NOTA 4KL1A 1VAMA 3AYAA 1QY4A 5F6LB 2YC0A 4YVWC 4DRVA 1DGRA 1W6PA 4FPFA 2GN3A 4A2UA 4L92A 4M3CE 2YXSA 3V0BB 1R1ZA 4DOUA 1LHOA 1RUJ1 3SH4A 2BVBA 3IM0A 3PMEA 1GZWA 4FQZA 2ZPXA 1GICA 2ENRA 2VH9A 3OD4A 3VZOA 1FPN2 4IV1C 5DDJ3 5CADA 4XF9A 1S0JA 5HCBA 1N3OA 1HDKA 4YG0A 5FRAA 2VW2A 2OUHA 5GZEA 1IQAA 4DY3A 4N43B 3IDBB 3VKMA 5J98B 4AEDA 1AL22 1O4ZA 2IFWA 1OQDA 4LR4A 4EWEA 4LHLA 4FO9A 3OYWA 2HWC2 2ZMLA 4LBQD 3H7JA 1VBE3 3N7LA 2GNTA 1AXKA 1PGW2 2GC0A 2PHFA 3AYCA 3N3HA 5IK7A 1DG6A 1YFXA 2WFF3 1WW4A 2VG9A 1UPSA 1PO22 1RUH1 1HXS1 3H7YA 4QPIB 3CL1A 3NKTA 3ZXAC 1WLWA 4CDXC 4WVZA 3O12A 4JCKA 3SMHA 3VBUA 2PAKA 5LK7B 4RR3A 4AI3A 3TYJA 3X29B 5BNNA 1KQRA 3KCYA 5J37A 4B7EA 1AL23 3LSEA 3ZYRA 1I9RA 4XJ8A 4AHXA 2HWC3 2QNKA 2XB6C 1HV1A 1QH6A 1Z7S2 1FPN1 2VQAA 3QBQA 1YI7A 2FHRA 2JENA 2VUAA 1ONAA 3HT1A 1NCRC 2R063 2D6PA 3H1YA 3WR0A 1Y7BA 2RS12 4JTOA 1UMZA 1UZYA 2GU9A 3RJRA 1RUE3 1GBGA 1QH7A 3N7MA 3SCFA 2B46X 3MLJA 5F1RA 1OOPB 1WCSA 3AXEA 5J7MA 2TUNA 1PGW1 4DZGA 1M06G 2WJSA 5CIRA 2DVGA 3QD6A 1AL0G 4KH9A 3V65A 4AHZA 1PO21 1IOAA 1ND2A 4NHLA 2QUOA 4HN0A 4IV3B 1Z7S3 5FQ0B 3FHIB 3VBHB 3IMNA 1LB2A 1MZ6A 1ZBE3 3ENRA 3M1HA 3MIGA 4XE9A 1Q8VA 3KT7A 2DVBA 2XKOA 3ZFFA 1I5ZA 1TME2 1MS4A 5DUVA 1HIXA 3H3ZA 3TBDA 3WDTA 2WLQA 4FBFA 4PDWB 1RINA 3WDWA 1W2UA 1ZBA1 2QVSB 1UZZA 2EALA 4XFIA 1N1YA 1IGOA 1AX0A 2ZCWA 3QACA 4KQ7A 1NE6A 4N53C 1IS6A 2WL1A 4WV8A 4BHPA 2O8QA 2RS11 1UU4A 5GZCA 3VBOB 2NMOA 3VDDB 2JDZA 3BALA 1BK1A 2AGSA 5CG8A 4MGZE 3KSCA 4RQPA 1B35B 1DQ1A 3OPZA 4JRAA 2XL9A 3VHOA 2GMPA 4FPLA 1AXZA 3TOJA 5JSRA 1ZZ6A 2DCYA 1OQEA 4LTAA 2OZJA 1AYN3 1JN2P 2X5IC 1VP6A 2AZ5A 3G7DA 1QWRA 3GYDA 3H1MA 1WLTA 2WNUC 3DL3A 4LBMA 5FCCA 4QHBA 4P9XA 1PK6C 5JVVA 1TME1 4Q4Y2 5I8YA 4MGKE 4XJWA 4LHKA 4QXKA 3U11A 5C6CA 1DDLA 4AEKA 2A3WA 4IV1A 1QJY1 3I54A 3ALQA 4L2NA 1HQWA 1AX1A 1NQDA 2ZGQA 1J3QA 1R1A2 4NN0A 2OW4A 4FPJA 4QQLA 4DB5A 2VUJA 4NR1A 2CYFA 1MS5A 1CAXA 2Q1ZB 4AK3A 1XNKA 3NW4A 1N1TA 4GMP1 4P5HA 4P9YA 5F6KA 2WSUA 1NXD1 1V6IA 3OCPA 2YROA 4BLJA 1GFF2 4CDXA 3OBRA 4DNYA 1WMEA 4GQ7A 4H7LA 1KXGA 3U10A 2GC3A 1VBD3 1R1A3 3FLPA 4Q4Y1 4YW5A 1RVF3 3WX5A 3HQXA 1H1IA 1QJX1 1RHI2 2HWB2 1MZEA 1T6GC 3NKGA 3IWZA 1AYM2 2W52A 1G7YA 1YUDA 2DFCA 4B8EA 1HRI1 1MEC3 4GB31 1LJ7A 3OTFA 4MXWB 2NM1A 4FVVA 4BE3A 4C90A 1HX6A 2RR12 3FX3A 2O0OA 4C0HA 4F7ZA 2D3RA 3WQ0A 1UW8A 4YZ3A 4X8PA 4FTBA 4ZKTB 5T3NA 5JR7B 2QFEA 1RHI3 2WQ4A 3AX4A 5AVPA 1RIRA 3AMHA 3MLKA 1WD4A 4XJ9A 2DUOA