1WLWA

Congerin ii y16s single mutant
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
134
structure length
134
Chain Sequence
DRAEVRNIPFKLGMSLTVGGVVNSNATRFSINVGESTDSIAMHMDHRFSYGADQNVLVLNSLVHNVGWQQEERSKKFPFTKGDHFQTTITFDTHTFYIQLSNGETVEFPNRNKDAAFNLIYLAGDARLTFVRLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Congerin II
publication title In vitro evolutionary thermostabilization of congerin II: a limited reproduction of natural protein evolution by artificial selection pressure
pubmed doi rcsb
source organism Conger myriaster
total genus 28
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1wlwA00
5JVVA 2R49A 3OJBA 2XG3A 2ZGSA 4XIKA 3SNMA 2ZKNA 5EXOA 4ZXKA 2ZGMA 1LGCA 2ZMKA 2CWMA 3HN1A 3ZSJA 4UW4A 2ZGOA 2D7FA 2ZACA 1LHUA 1KRIA 1MVQA 2WKKA 1QDCA 2AREA 4W65A 4ATEA 1N3QA 2OUHA 2GMPA 2VW2A 3ATGA 5JOZA 1Y7BA 2W52A 1N1VA 1YI7A 4YLZA 5T5JA 2NZ9A 4XJ9A 1V6JA 1XQNA 3AP5A 5JOWA 1JOJA 4Q1RA 4ZKTB 4H55A 1MS0A 2EIGA 2D6PA 3C2UA 3B9CA 3RRDA 1V6OA 1ENQA 4XTMA 3Q9OA 1QOTA 1IS5A 1UL9A 1WW7A 1HKDA 3B01A 4YM3A 3AJZA 3SLIA 1GYKA 1LU1A 3PVOA 4XYXA 4ISRA 5JLVA 3LSEA 2A7AA 1QOOA 4R9CA 1W6PA 2VW1A 3ZXEA 1V00A 2GNDA 2V73A 4YW5A 2D44A 3HR9A 4XBQA 1YO8A 1QKQA 1JHNA 3AZYA 2A6YA 5GLVA 4JRAA 3RQ0A 2ZGTA 5H9RA 3ZYRA 1DQ2A 1HLCA 1JBCA 2CY6A 1AXZA 2ZHNA 4Q2FA 1OKQA 3VKLA 1KJLA 5T5PA 1V6NA 4LBMA 1S0DA 3V0BA 1LOCA 1IKPA 1F9KA 2A6XA 2CYFA 3PMEA 1Z0HA 4YZ3A 5E8AA 4FP2A 5IK4A 1TEIA 1Q8OA 1UN1A 3LSDA 2GALA 1WLDA 1FYUA 1DQ6A 1WUVA 1FNZA 3UJOA 5KXCA 1WW5A 1LGBA 1CVNA 1KDMA 2CWSA 4UW6A 2A3XA 5HCAA 1WBFA 2D6LX 1DQ1A 3ENRA 3RSJA 4DS0A 4RL7A 4DQAA 4XJ8A 4TYSA 4ASMB 1SFYA 4U36A 4XBNA 2P37A 1HDKA 4ISQA 1LOFC 1KQRA 4P9XA 2VXRA 1SLBA 2DVAA 3AZXA 4M3CB 1LOBA 4Y20B 1JW6A 1W0PA 4FOWA 1W6NB 1ZM1A 1MR5A 5GLUA 3SH4A 3ILRA 5F9TA 4PCRA 2UURA 2VY0A 2W39A 4PBPA 3V64A 3A0NA 4R9BA 1S0BA 1ULFA 3IPVB 3A0KA 1CESA 2DUQA 2CTVA 4AVTA 2BQPA 2DTWA 3WG4A 2R1DA 1LOFA 1G9AA 4FVVA 4I30A 1G7YA 3VV1A 4XXPA 3FUOA 2YZ4A 2XB6C 4NO4A 3OGGA 1ULGA 2GNBA 4YW3A 1W6MA 4FPEA 3OBRA 2AENA 1SBDA 4LBOA 5DG2A 3SH3A 5IK8A 2HYKA 4XHBA 1F5FA 2E53A 1MVEA 4PF5A 3I4IA 5F5QA 1H30A 4OZXA 2C9AA 3VKNA 2A5ZA 2DYCA 4YFZA 2EAKA 1N3PA 1ZA4A 1JN2P 1C4RA 2YXSA 4YM2A 1BQPA 3WNXA 4Y1VA 4FOYA 4XE9A 1H9WA 1S1AA 2GN7A 1BJQA 1D0HA 4XMIA 1ULDA 1LJ7A 3BODA 3RS6A 5IK7A 4K20A 2OUJA 3KQRA 3MW4A 4BLJA 2PHTA 3B00A 1GZWA 1FAYA 2E7TA 4BMEA 3AP7A 1YRZA 3MEPA 5CA6A 1YXWA 3ZSLA 2JKBA 1ULEA 3AYEA 5IT6A 2W68A 4K1ZA 2ZHMA 2TEPA 4Y22A 1GZ9A 1UAIA 2ZZJA 3ZSMA 4XJZA 1QOSA 3M3EA 3NV2A 1N47A 2R1BA 2GNTA 1WD4A 1UZYA 3V65A 2SBAA 3INAA 3M3OA 2D6KA 1QMJA 1SLLA 3NV1A 4M3CE 4ITCA 4R9DA 1DGLA 5GZCA 1S0JA 4YW2A 1JXNA 3AXDA 4AWDA 2ZGQA 3N36A 3QCWA 4BOWA 1A78A 4XOGA 4NOTA 3VKOA 1YIFA 5FRAA 1ULCA 2DVGA 3ZSKA 2AUYA 3R4UA 4BPZA 4U2AA 3AP9A 3AJYA 2P3IA 3ILNA 1VALA 4Q27A 2E7QA 2ZBJA 1AX0A 4YZ1A 1GZCA 3USUA 4XJAA 2GNMA 1O4YA 3ZXFA 3ILFA 1SBFA 1AZDA 1G9DA 1CIWA 3APBA 3WUCA 1IS6A 1LCLA 1LULA 1G9CA 3KM5A 2ZGNA 4MYEA 1BYHA 1MS1A 4Y1YA 1APNA 1GNHA 1WCSA 2DWRA 3IM0A 4CZSA 2JE9A 4FPOB 2WT1A 5GZGA 2ZGPA 1MZ6A 4Y22B 2JJ6A 1LOGA 4LBLA 1DQ0A 1ENSA 1VIWB 2DV9A 2CNAA 4FQZA 4FPHA 4P9YA 2W08A 3V0AB 4XMAA 2NMOA 1VLNA 2JE7A 5GLWA 3FLRA 1S0IA 2D3SA 4YG6A 1Q8VA 2ZGUA 2WLQA 1GV9A 3RMXA 1RINA 5DUXA 3D5OA 1HQLA 3W59A 1QNYA 1LOAA 4YZ5A 3A4UA 5DUUA 1JUIA 4FQ4A 4Q8KA 4XJUA 5GZDA 3BTAA 3NV3A 3VKMA 1CPNA 5L73A 1IOAA 2GMEA 5T5OA 4F83A 3UK9A 1LECA 3L2YA 1LODA 2VU9A 1QNWA 1AX1A 4Y26A 5GLTA 1VAVA 3RMYA 1WW4A 1WW6A 1LGNA 3OPZA 1W0OA 1LESA 1C1FA 1B09A 1DBNA 4FOVA 2ARXA 1MS8A 3AZVA 2EF6A 1SACA 4C1XA 3T1MA 1Q8PA 3PVEA 5BYNA 3RG0A 2PHWA 3ZXLA 5CNAA 4YG3A 4TZDA 1LHVA 2ZMNA 3D6EA 4AYUA 1J1TA 3VUOA 3UL2A 1W6PB 2D3RA 3AYDA 5SV8A 2OW4A 4XTPA 2WNEA 4D69A 5GJ6A 1LHOA 1Z78A 4BM8A 4Q26A 3M3CA 1FX5A 4Y1ZA 2NN8A 4XHXA 1RIRA 2JD4A 3AZWA 2LALA 4WZFA 4GKYA 4AGGA 1FATA 1WLCA 3V0BB 1AF9A 1LENA 2YROA 4UW3A 2C5DA 5GLZA 5CBLA 3FLPA 4LBJA 1G9FA 2ZHKA 4P14A 3AX4A 1I1EA 4FPJA 5T5LA 2UWBA 2A75A 2NM1A 2WSUA 5DZEA 5GALA 4BQ1A 3O0XA 2AH2A 3WLUA 1PZ8A 3ZYPA 3DUIA 4XBLA 1BKZA 1CJPA 2ZGRA 3AXEA 5T52A 4FPKA 4FPLA 1AXKA 3PVNA 3ZPYA 4FPGA 1DIWA 4YFWA 5DZGA 4K1YA 4GWMA 3WG2A 2WT2A 2ZAAA 2E6VA 1V6IA 3JU9A 2ZGKA 1I3HA 2V5YA 5DUVA 3BIWE 1FV3A 5GZEA 2D6OX 2P34A 4Z8BA 1URXA 3R05A 4PBOA 1OFSA 1AJOA 2H0BA 2SLIA 2VUAA 4GXLA 1WLWA 1Q8QA 2DU0A 1AJKA 1LEMA 1CN1A 2FMDA 4YM1A 5CB7A 4YG0A 5KXBA 4FPCA 1W6MB 5EYXA 1LTEA 1SLAA 2JECA 1GNZA 3O5SA 2EXKA 1CPMA 4DFSA 3AYCA 2A6ZA 1KITA 2DVFA 3MPPG 2DU1A 1NXD1 2D3PA 1MS9A 2VW0A 4YGDA 2UU8A 1V6LA 1C1LA 1PZ9A 3WOGA 1V6KA 1G86A 2ERFA 3N7KA 1A8DA 3I8TA 3GNEA 1MACA 2FHRA 1N1TA 4GALA 2A3YA 4LBQA 1QDOA 3MW3A 2EXJA 1S0FA 4WVWA 3TB0A 3N35A 1MS3A 4FP3A 2R0FA 3FFZA 4Q8LA 1ONAA 4AGRA 1A3KA 1JYCA 4LBQD 3WDVA 2ARBA 1FV2A 2YY1A 1SBEA 3OY8A 4DPNA 1V6MA 1GZWB 1AVBA 3ZXJA 5EYYA 4LBKA 1UMZA 4YZ2A 4WVVA 5T54A 1S0CA 2UWAA 3T2TA 1IS4A 4AGVA 1KJRA 2Z42A 5E89A 4SLIA 3O12A 1N3OA 2YV8A 5HCFA 1EPWA 1D2SA 1HQWA 4XZPA 2PELA 5T50A 3WVJA 1H9PA 2A6WA 3AYAA 3OYWA 4M3CF 3LCPA 4BLIA 2P2KA 5GM0A 5JMCA 4YW1A 1SLTA 4ATFA 2P3KA 3WDWA 5H9PA 1Q8SA 3SISA 3MW2A 3WG3A 1S0GA 1BZWA 5DG1A 2DURA 2ZHLA 5CAZA 3IN9A 4M3CA 1QF3A 4YZ4A 4Y20A 3SITA 2PHUA 3BOPA 1W6NA 2E51A 5FREA 5JDBA 4XXAA 2DUOA 3AZZA 1LHNA 1DQ4A 1U0AA 4FPFA 1G9BA 1UPSA 3IPVA 4YW4A 2A3WA 2EXIA 1IS3A 2KM2A 2ZMLA 3QLQA 4P9WA 4BMBA 4AVVA 3N7JA 1NLSA 3T1LA 3WDTA 4LBQB 4L8QA 3WUDA 2B7YA 2G4IA 3WZ1A 1IKQA 2OVUA 1LOEA 3FBYA 4Y1XA 4Y1UA 3W58A 4XIOA 3USUB 2ZGLA 4RA0A 5JOXA 2AGSA 1GSLA 2WJSA 3M1HA 3OY8B 5DZFA 4YGEA 3ZVXA 1DHKB 1FNYA 5IK5A 3GALA 2WSVA 2D6MA 1MS4A 2CL2A 4Q1PA 2ZABA 5DUWA 1MS5A 2DTYA 3N7MA 1AXYA 1LU2A 3WDUA 3POWA 3FLTA 3FUQA 2A70A 3POYA 3O0WA 3HMYA 4JC1A 3OYWB 5H9QA 4CRQA 1AX2A 4XJWA 1JYIA 3CNAA 1CQ9A 4KBBA 5KXEA 1X50A 1BXHA 2D6NA 2WQZC 5E88A 4R9AA 2PHXA 4FPYA 2PHRA 4XDQA 1DQ5A 4HANA 1UZZA 3IMNA 3AP4A 4IQPA 1MZ5A 1SLCA 1QU0A 1YYNA 4LBNA 1CONA 4GKXA 1N1YA 1WBLA 4M00A 1LHWA 1GANA 4YGBA 3WG1A 1SCSA 3WV6A 4DRVA 2EALA 5JOYA 1DLLA 2LTNA 1O4ZA 2R16A 2DVBA 3WHUA 2AR6A 1F31A 3UJQA 1W6OA 1LEDA 2VH9A 3O0VA 4WV8A 5GZFA 4JCKA 3TAYA 3WHTA 4HL0A 1KDKA 1SLIA 1W6QA 1S0EA 4YGCA 5EWSA 2YMZA 2NP0A 1CR7A 1OQ1A 5IUQA 1Q56A 1UKGA 2ZA9A 5AVAA 3ZXKA 4CTEA 3WCRA 3POSA 1N1SA 1DFQA 1WD3A 3M3QA 2GDFA 4PQ9A 4C1WA 1C57A 1RITA 1GKBA 3B69A 2AYHA 2ENRA 3WCSA 4GWNA 3DGTA 1SCRA 2A6VA 3H0OA 1R1ZA 2WT0A 1ENRA 4Y24A 1PZ7A 3JUUA 3AK0A 2RHPA 2EXHA 2DVDA 3AFKA 3ASIA 3NWKA 2GMMA 3OBTA 4M01A 5DXDA 4XILA 3U4XA 3WDYA 3N7LA 5T55A 4GA9A 4UW5A 5HCBA 3SH5A 3D4KA 2A71A 2PHFA 4FOQA 2GN3A 3WDXA 2NYYA 1GBGA 3VKFC 1GICA 1DYKA 4DRRA 2DUPA 2UWCA 2I2SA 4K21A 2Q5TA 3N3HA 2R0HA 3B3QE 1G8WA 1UX6A 3R4SA 1DYPA 1DZQA 3PJQA 2JDZA 2D43A 2ES3A 2NMNA 4YM0A 1W6OB 1VAMA 2P3JA 3V0AA 1GLHA 3AP6A 3M2MA 3NV4A 3IKWA 5H9SA 4AVSA 5KXDA 5LK5A 1W6QB 1QGLA
chains in the Genus database with same CATH superfamily
4XIKA 3GM8A 4FTSA 2AZ5A 2R041 4NAOA 4LNVA 5EXOA 2XHNA 3NW4A 2WN3A 2ZOEB 1HRI3 1X8EA 2ZGOA 2RS31 1AR92 3NAPC 4INDA 5KBFA 1LHUA 5A7WB 4RD7A 1W8UA 4LT5A 1AHSA 1VBD2 1LKNA 1QQP2 1EP0A 3EO6A 2QQVA 2GMPA 2G1MA 1U5YA 1H4GA 1SPPB 2ZPXA 4IEZA 4V2WA 1YQ2A 3AC0A 4WM7B 5DAQA 2RDQA 4COVA 2CDOA 5A6XA 2FCUA 2W52A 5CFDB 3ME2A 1US3A 2XJVA 1YI7A 2ZCWA 5T5JA 1RGSA 1ALYA 1AR73 4NE9A 4Q1RA 2VCCA 3ZKUA 2K0GA 4DB5A 4ZKTB 3JD71 1MS0A 3WF0A 3O1TA 3RRDA 1V6OA 4XFFA 3KZ4C 1HJFA 4BK5A 4CXXA 1W2TA 5JXJA 4A44A 3C7GA 5JIAA 1UPIA 4YM3A 3AJZA 3SLIA 1GYKA 2RS12 1LU1A 4XYXA 1VBC1 1O91A 1W6PA 1CZTA 1ZNPA 2GP3A 4XUPA 4RHV2 1GP4A 1JU3A 2DBNA 2BV4A 2VAUA 3AKTA 4JV4A 3ZN4A 2ZGTA 4IEOA 1GOGA 5FP9A 1DQ2A 3ZYRA 3KV9A 4LK6A 1AXZA 1QJFA 3S7IA 1OKQA 5LZ6A 5T5PA 2BBVA 1QH6A 1S0DA 3B94A 4L0PA 2VBDA 2CYFA 3GJBA 4Q0SA 3BU7A 1Z0HA 2OIIA 4IE5A 5IK4A 3DECA 1UN1A 3LSDA 3MFAA 3UKTA 3WNPA 2QVSB 1WUVA 4RGGA 3RJRA 2BGPA 2H6CA 5KXCA 1UOJA 2J42A 1WW5A 4N53C 1CVNA 3WY6A 3KT1A 3S0MA 5A1FA 1Q43A 4MVTA 1DQ1A 4Q0PA 4ZZ8A 4AEDA 4DQAA 2PYTA 3I7DA 1EV11 2IFWA 2VZTA 4OHVA 3UNPA 1PK6B 2P37A 3SHRA 4AI1A 4ISQA 4HZFA 4QQ2A 4P9XA 2VXRA 1SLBA 4AR2A 3I49A 3MBWA 1Z7S1 5FZAA 1LOBA 4Y20B 1JW6A 4M4RA 1W6NB 4X8PA 5GLUA 3T30A 4PCRA 2WNOA 4IEYA 5FZEA 2Y60A 3ZFFA 1OMIA 4JDOA 3ACFA 4PBPA 2HLEA 2W2IA 4R9BA 3ZN6B 4AZZA 4G9SB 2WFF2 5K4LA 1A8MA 1OLQA 2CTVA 5F8PA 1HN1A 4AI8A 1LOFA 1UX7A 5A7NA 3CQOA 2Q8EA 2WNUC 2W1QA 5FR3A 1Y9MA 1E5IA 5JAXA 3RZLA 2WA3A 1HB1A 3FUOA 4OMCA 4A42A 4COZA 1M06G 2XQRA 4YW3A 5KC5A 4FPEA 1BVP1 4LBOA 1TNFA 3O1SA 1KS4A 5FPBA 4ES8A 4JAAA 3HQRA 2Q8DA 1H30A 1H8TC 4OZXA 1K5JA 2A5ZA 4FFFA 4HG6B 1HV1A 1U5XA 1ZA4A 4ES9A 5FYHA 1BQPA 5BNOC 4DUXA 3EHKA 4Y1VA 4FOYA 3E97A 2K9ZA 4AEDB 1BMV1 1UY0A 1BJQA 4MGSA 2ZAHA 1YIPA 3KHBA 3ALQA 4E4DX 1AYM2 3MW4A 3OB8A 4BLJA 2PHTA 3B00A 1ACCA 1GZWA 4AQSA 4B4PA 1ZRCA 1FAYA 1HIXA 2E7TA 2W9XA 3H42B 3QD6A 3AP7A 1UYYA 2W1SA 2JD9A 4P9JA 5L7OC 1YXWA 3E6DA 1DGWX 1HX6A 1RXFA 4QWNA 5CG8A 4NR1A 1LAJA 2DCZA 1XOYA 3ST7A 2V72A 4S2DA 4Y22A 5FDBA 4IE6A 2RM22 1ODNA 2ZZJA 3S5QA 3ZR5A 1RUD2 3ZSMA 5C8CA 2XLGA 1LR5A 4XFAA 3RNSA 3ACIA 4Q4W2 4FI9A 3NV2A 1N47A 3RZKA 3LWCA 3ZOIA 3KGZA 2SBAA 1RHI2 4BQXA 4ITCA 5FLHA 1UNBA 3PUAA 4CP9A 5F3GA 1JXNA 3BI3A 5DAWA 3VHOA 4NPRA 5LBFA 2O8OA 2Y6HA 4B29A 1V9U1 2CU5A 4XOGA 4I3GA 1KD7A 3VKOA 4LULA 4OMDA 1RUI3 5FRAA 1GOHA 2RV9A 5FXVA 1ULCA 2AUYA 3R4UA 4EV0A 2C24A 1U5IA 2RMU1 3MFCA 1I9RA 1LB2A 3AP9A 1X82A 2E7QA 2ZBJA 4DOUA 3DPRC 4DUVA 1OT5A 1OFNA 3AM2A 5FY9A 1TMF2 1YFUA 2GNMA 1O4YA 1NE6A 2HBUA 3D8CA 3DL3A 4XJAA 1OD5A 1SBFA 3WF2A 3IDAA 4JVAA 4UT5A 1BK1A 2WZR2 5FJKA 3APBA 4NHMA 3VD7A 1OLRA 1RJ7A 4H2AA 1LULA 2Y0IA 4Q0QA 5F37A 1MS1A 2DWRA 1ND3C 4OCTA 4NHYA 2P6HA 5LWBA 4CZSA 4Z1VA 2JE9A 4AI9A 5JZGC 1MZ6A 4Y22B 3VLBB 4MHUA 4O65A 1RUC3 2DV9A 5C5TA 1EV12 3V0AB 2BWCA 5IVBA 4N43B 4YVWB 3WP3A 1VLNA 4PIYA 5GLWA 1S0IA 1WLTA 2ZEXA 1C8M2 4IEPA 1IGOA 1GQGA 4AXOA 1OH3A 5I0RA 3RMXA 5DUXA 4CCEA 2GC1A 1ND2A 3W59A 4CXWA 1ZRIA 1LOAA 3LIHA 3BTXA 4UFKA 1JTZX 4RFRB 3TEXA 2JG8A 3MYXA 4XZUG 3S6PA 4XJUA 5JPNB 2RR11 3NV3A 5FZ9A 4AEMA 2WNVC 4OHYA 4F83A 3FHAA 4O7XA 3BVCA 3C8XA 5FUNA 4MGYE 5I0TA 2K2SA 3L2YA 1QJX3 4L9BA 1LODA 2G9ZA 2QNKA 3R6SA 1WW4A 1TME3 2RS53 5J09A 1LGNA 1AYN3 3OPZA 3LEKA 2QBXA 4XEZA 3Q8BA 4XF4A 4JGYB 4W6YA 4L2NA 1HW5A 4CU8A 3T1MA 3MICA 3OPTA 3ETQA 3I3DA 1PO21 3KCYA 4JGZC 1OPMA 4P9GA 5IVJA 3PLQA 3RPQA 2VUDA 3VUOA 4AL9A 4I0AA 5FZ6A 3UL2A 1RVF1 3KCCA 1OI6A 5SV8A 4GMP0 2WAAA 4AFCA 3ZFEC 1L7LA 4N7IA 1LHOA 1Z78A 2NPIA 2HEWF 2XKPA 1Y3TA 1F15A 1RUJ3 2YGLA 2MNGA 4A6OA 1X33A 3RWNA 1R1A3 4QX8A 1WLCA 4P00B 5KHHA 4CEWC 3V0BB 2XHKA 4QX2A 2YC2A 4UW3A 4WM8B 4IV1A 5GLZA 1ND2B 2YFUA 1REEA 3FLPA 4BQ5A 1WMEA 1R092 3I59A 2XMLA 3AX4A 5A3TA 2JG8B 2V5DA 3GJAA 1XE0A 3A21A 2C0ZA 4D7TA 2XOMA 1O5LA 2ZJCA 3FFQA 2NM1A 2ARAA 1UU6A 2JWPA 3VBSA 1K45A 2BU9A 5BNQA 4G3YC 1PZ8A 1MEC1 1X9PA 4W6WA 1T6BX 4WM7C 4B4RA 3HQUA 1BKZA 2ZGRA 4MUVA 5CFDC 3ZFGB 4EWAA 2WO7A 3BPZA 3ZPYA 1HV0A 5DZGA 2Y34A 4CCNA 1REDA 1XNKA 4OHWA 4AOCA 4B1LA 1PO12 2ZAAA 4LHNA 3SCHA 3RZHA 1HB3A 2WS91 3G7DA 1UYPA 3M70A 2HWE1 4Z2WA 4FT8A 3WXPA 1GWKA 2CHHA 1FV3A 5DAPA 1WKYA 2BDRA 1ZBA2 5F2WA 1QJEA 1RL3A 1J3PA 5DN2A 2VVFA 3R05A 4Y33A 1K12A 5IAXA 4OI1A 1RUG1 2FMDA 1CN1A 5EP9A 2BZDA 4PIXA 1W6MB 3U0ZA 1LTEA 1OA3A 2JECA 2VTXJ 3FBMA 3FX3A 3HT2A 4L97A 2VTFA 1ODMA 5L19A 5J37A 2JIJA 2ZKLA 1RXGA 2YDEA 4CEYB 3WF3A 1M4WA 2YBKA 4MG2A 5HI0A 1MS9A 3VZMA 2UU8A 2QJVA 2Z79A 4NJ4A 5LA0A 4QM8A 4BJ0A 3OCPA 1PZ9A 2YC4A 2FHRA 4GALA 4MOAA 3MW3A 3PL0A 3VDDB 3DN7A 5FMBA 4IXLA 5C3PA 1XB9A 3FFZA 1RYYA 1ONAA 2RDNA 1QJU1 2H0VA 3VD4A 1A3KA 3NNJA 2R062 2YY1A 4DPNA 4S2HA 2XH6A 1PIV3 5EYYA 1PK6C 1UMZA 3IIAA 5I8SA 3H1MA 2R32A 4RQPA 4LA2A 2RR12 3H3ZA 2WO1A 2BPA2 1N3OA 1POV3 2YV8A 1EPWA 1D2SA 3IDBB 4XF3A 5EV7A 4XACA 4XUNA 5T50A 3WVJA 4FBFA 3ZYBA 5I8TA 1D4M2 1WMXA 2D97A 4HN0A 2AC1A 3MUZ1 5ABJB 4TLGA 4LO4B 2BNMA 4MO3M 3J9SA 3MW2A 4LJHA 2YUEA 3SISA 2I74A 5FO9B 3WQ7A 5FCCA 4FAGA 4J1XA 5FYSA 5BNNA 5JXGA 1H0BA 4M3CA 2XKOA 5A3PA 4LLOA 1BBT3 3BOPA 4GZ9A 4EE2A 2XDVA 1FPN2 2Z69A 2E51A 5FREA 1JZ3A 1MQTA 4XW3A 2ORXA 3T0DA 1CAUA 2DUOA 1RUH2 3WQ1A 1LHNA 4EROA 2VL4A 4YW4A 3OBZA 4DXSA 3DYMA 3QLQA 4QQOA 4P9WA 1S55A 2Z5WA 1PNGA 5EIYB 3N7JA 1AL22 2AEZA 3WW1A 4GJYA 3WUDA 4CUBA 2P5BA 2G4IA 1QWRA 1IKQA 1EPZA 4UAPA 2C9KA 2JB8A 3DYOA 4OUMA 4Y4YA 5JOXA 2W94A 5DZFA 4AEDC 4K8FA 1R081 2ZTNA 2ZX4A 1JS9A 2HWD2 4MXWA 3WSOA 2B46X 4GB31 3A23A 2VOXA 4YSFA 4RQPB 1H1AA 4Q1PA 3WF1A 2HKXA 3I2KA 1W8TA 1W06A 5A7OA 2PLV1 1XNAA 1AXYA 2PMWB 2VMFA 3ZKYA 2QQPA 1JOBA 2A70A 1J3RA 2VBPA 3ZYGA 3MF9A 4AEKA 1AX2A 3SC7X 4CRQA 3GBFA 1CQ9A 4LIVA 3VBOC 5KXEA 1NCRA 2BYVE 4YARA 1W8ZA 3ZO0B 2IC1A 1VBB3 1H8VA 1WCKA 4H14A 5E88A 1RUF3 4QU2A 1P8JA 4QPIB 5CKMA 5LBBA 5JI7A 4PF1A 4IEVA 3TN92 4DINB 1RUE1 1H6XA 4HT1T 4GIQA 1CAWB 2X10A 1J59A 3MF6A 4W4ZA 1YJLA 2WBKA 4YGBA 5A33B 1W9WA 3PTRB 5D21A 1YQ8A 3VBFA 4CDXB 2FDJA 2HEVF 2R16A 3W9AA 4IEQA 2C4XA 5EZWA 2AR6A 3D0SA 3MV11 3WF4A 3B93A 4WV8A 3TAYA 5HXMA 3S30A 3N9MA 4YGCA 3S7EA 1ASJ1 5IWFA 4JRLA 1US2A 3LA2A 4KWJA 5IUQA 1Q56A 5AVAA 3ZXKA 2ZEWA 3JQXA 3JXSA 4LO7A 1DFQA 1WD3A 1YQ5A 2GDFA 2VM9A 3M3QA 1PX3A 4PDWB 2PA7A 1C57A 5HCHA 3B69A 1XYOA 2VZOA 4CE8A 1OVSA 1GWMA 3WCSA 3J8F1 5FKCA 5LA1A 1SCRA 1OC1A 2A6VA 1RUI2 1XSQA 2HBTA 1OUXA 2O8QA 3H0OA 3WW2A 1ENRA 4ZPIA 3FC0A 4FSJA 3WEZA 5F6KA 1NCRB 5FY0A 3AK0A 2DVDA 2X5IA 5LA9A 5DXDA 3U4XA 3BB6A 3N7LA 4GA9A 4KH9A 5FQ0B 4UW5A 3SH5A 4XF0A 2XJUA 3VBRA 4LHKA 4N43C 4YVWC 2PHFA 4FOQA 5FYBA 5KC6A 4UWDA 4QB2A 2KR2A 3K77A 3POIA 4Q4X1 3BTZA 4QKFA 3VKFC 1GICA 3B9IA 2UWCA 4K21A 4KI5M 1J58A 3VHPA 2R0HA 4TN7A 2HWB3 5FTTC 3O1OA 3R4SA 2Y6JA 4BQ2A 1NCQB 2HYXA 1CX4A 3OUIA 1BK0A 4YM0A 2P3JA 4GH4B 2PAKA 2FDKA 1UOGA 5H9SA 3SKVA 1QGLA 4R8HA 3T09A 1ZZ6A 3OJBA 3TYJA 2XG3A 2Q1MA 3SNMA 2ZZQA 4IEXA 3WP4A 2JDYA 1LGCA 3HN1A 2CWMA 3ZSJA 4UW4A 5LEJA 2XBO2 4FXKB 2D7FA 4OUEA 4NVPA 4QXCA 2CAUA 1IQDC 2B39A 2W92A 4JGYC 1D2QA 3VBUA 5A32B 2VW2A 3MLJA 1VMJA 2OX0A 1OLMA 4Q29A 4A7KA 1PHMA 4M0HA 2HWF3 3LPGA 2NZ9A 4Z2AA 4NROA 1V6JA 3GZUC 2X5IB 3AP5A 2IXHA 4MSVA 5DQ0A 4AG4A 5JOWA 4KGGA 1UZVA 3RI9A 4CP2A 4XURA 1COV2 2D6PA 3C2UA 2RS33 3K2OA 4I01A 1GU3A 1OXCA 3Q9OA 4ZY9A 1QOTA 3ES4A 1ULOA 4GWIA 4XF1A 1UL9A 5FXZA 1O8PA 3B01A 4NWVA 1RTVA 2VMIA 2E31A 1AR91 3MV01 3POJA 5JLVA 4WM8C 3LSEA 4GAZA 1QOOA 1TQ5A 1QQP1 5APAA 2VW1A 1BEV2 1UXZA 2JG8C 2GNDA 2V73A 2WZEA 1IQAA 3S5AA 1F4HA 4XBQA 2QQNA 1RUJ2 3AZYA 5GLVA 4HPKB 3RQ0A 2L9LA 2GC2A 4X6RB 2QFEA 1R1A2 2ZHNA 4PQQA 2ADDA 2UYBA 5LEKA 4LBMA 2BFUL 1LOCA 2I45A 4GJZA 1IKPA 3NQHA 5J3UA 4URTA 1OA2A 3ZFGC 3PMEA 4JTNA 5E8AA 4FP2A 1TEIA 3U37A 4EYUA 4P5HA 4XQ4A 1WLDA 3M4FA 2EAAA 3ROUA 3UJOA 2RS11 4Q0VA 1UF2C 5EFUA 4UW6A 3BALA 1WBFA 2EVXA 2HWC2 4GWJA 4OUSA 4DS0A 5C8WA 2XPJA 5F32A 3E5QA 4TYSA 1KEXA 3WQ0A 4I09A 4RHV1 4ASMB 4XBNA 4QHBA 5A3NA 2DVAA 4QXHA 1YWKA 3AZXA 4JQRA 4CP1A 5ANQA 2VOKA 2XL9A 4B8EA 4CVUA 5CADA 3JQWA 3ACGA 2Y33A 3CJIA 4A4AA 3SCFA 2GC3A 4XFBA 3KV5A 1WZXA 2UURA 5CEHA 2VY0A 1GP5A 4QPGB 2JENA 1GQHA 1S0BA 2V09A 4KG0A 4CEYC 3IPVB 2FD8A 2VZSA 1CESA 3A0KA 2VTXA 1JZ6A 4AVTA 4EN9B 4UBGA 2R1DA 2JE8A 3JB4C 4K7JA 3LFMA 3ZYHA 1Y4WA 2CV6A 4IV3A 1EUTA 1VBE2 1Z7S3 1ZBE2 3IAPA 3VDDC 1Y9QA 2GNBA 3OBRA 2VNVA 2AENA 1SBDA 3BPSA 5SV5A 2P6CA 3ABZA 2Y0OA 1OPOA 1F5FA 4DEVA 1E5RA 3ORJA 2E53A 3RWKX 3EMRA 3I2GA 3FWEA 3K4DA 4BHPA 4YNIA 4YFZA 3LA3A 1HRV2 2DFCA 4RS5B 2VZ3A 3ACLA 3O1VA 5CFCB 4XE9A 2WFF1 3A7QA 3RYPA 5DMYA 3OPWA 5C3SA 1SDWA 5JIUA 3RS6A 2F17A 2IFRA 3AKRA 5FZFA 5ABJC 4OFGA 1HB2A 1JYNA 3C7EA 1XNDA 2VCBA 1CAVB 2XWBB 1OD3A 1S2EA 5A6ZA 3AFGA 3BYWA 3GGLA 5FJHA 1XSRA 2R073 2W68A 5LBEA 2Q4SA 5FUPA 2IXJA 4DMIA 3PUSA 1QJY2 2UY9A 4HVOA 4XJZA 1QOSA 3H50A 4QKNA 1F4AA 1DGRN 4QGLA 3KS7A 4OLLA 1OVPA 2VZUA 1UZYA 5A6YA 4OQ8A 2WL1A 3CDZB 1O3QA 2IVJA 2D6KA 3NV1A 4BDVB 3PU8A 4M3CE 2VQTA 5GZCA 3OOXA 1AYM1 1S0JA 1AUYA 2VZ1A 3OUHA 4FO9A 2HJIA 4E2QA 3AXDA 4HBNA 3GF6A 5IJRA 3N36A 1VRH2 1W8FA 2XWJB 1HXS3 4BOWA 1VAKA 3H1YA 4EWDA 4W6XA 1JMUB 1YIFA 4RQPC 5ACA2 3R4DB 1UD1A 2VZQA 3ZSKA 3CIHA 1FMD2 4BXFA 1WCUA 2X29A 4HKOA 4A6SA 4BPZA 3ILNA 3RYKA 2P3IA 1VALA 2RM21 4Q27A 1AX0A 1RUD1 1KGYA 3FMGA 4QXKA 1GZCA 1DU3D 4YZ1A 4RGKA 4PHZA 4Q4W1 3T3YA 4PI0A 1QIQA 4IGOA 1CIWA 2X05A 1HJGA 1IS6A 1RHI1 2RDRA 4QPIC 1G9CA 1V9U3 5BXXA 5I0DA 4D3WA 1JH5A 1BYHA 5K0UA 1GNHA 1WCSA 5K8SA 3PJYA 1JOPA 2RMU3 1LOGA 1SEFA 4LBLA 3PTYA 5EJZB 4Q4Y2 3WNLA 3KQ4B 1ENSA 4ASKA 3NL1A 4FPHA 2Y6KA 2W08A 2CGNA 4LIUA 4XMAA 3PMSA 2W87A 4CDXC 1SFPA 5E6HA 5FYZA 4EN6B 4AFMA 5LA2A 1RUF2 2D3SA 4Q4V2 4YG6A 2WLQA 1TMF1 2YYOA 4CUCA 2F4PA 1I5PA 1HQLA 1W3XA 1W9SA 3D5OA 4J25A 2ATFA 1JODA 3PNAA 2WZR1 1JUIA 4AFBA 2VUJA 4PDWC 2WWJA 2PTMA 4HN1A 4O9GA 1CD3G 1CPNA 3JBG2 4DZGA 2GMEA 2FCTA 2VXJA 4F7ZA 2WZ8A 4Y26A 3ZPOA 5GLTA 2Y26A 5A80A 3H8UA 1H4HA 1OF3A 4FCAA 1LESA 3T4HB 1L7QA 1NCRC 4D7SA 1C8M1 5CZKA 1ST8A 3AZVA 2EF6A 2BP6A 2ZEYA 5J36A 3FE5A 3VD3A 3UGFA 4XVHA 4QB6A 2DCJA 2PHWA 1VB2A 2MHFA 5CNAA 4TZDA 1QHDA 1OOPA 3DXTA 1W6PB 3AYDA 3FHIB 1X7NA 1DGRA 1ZZ7A 3I97A 2WABA 3MUY1 5BPXA 5GJ6A 1NZCA 5C9AA 4Y1ZA 1NCQC 2WAOA 4GH4C 1PGW2 2ILMA 2WA4A 4GKYA 4AGGA 1FATA 3THDA 4XUTA 1LENA 5CBLA 1PO23 2BERA 4LBJA 4LE3A 2ZHKA 4XDOA 1I1EA 1RVF3 2A75A 5FPAA 2HWB2 4BWOA 2WSUA 3UGGA 5GALA 1W04A 4ZU4A 5FPZA 4BQ1A 4KL1A 3O0XA 2AH2A 2C26A 4FTEA 3HOBA 3DUIA 1JHJA 3H7YA 1CJPA 4QU1A 3VZJA 5LRSA 2WO2A 4IETA 3NJVA 4Y5SA 4DO0A 2X5IC 4FPGA 4EJRA 5FMCA 1DIWA 4BB3A 5F5AA 3ZFFB 2VMEA 3TWIA 1R091 4DXZA 1I3HA 2V5YA 1AR83 1OOPB 1OLME 4CCOA 1ZZBA 2WYSA 1MEC3 2HWF2 2PHDA 5GZEA 3GYDA 2BTVC 5I8YA 1TG7A 4PBOA 5HV0A 2H0BA 4GXLA 5C9AB 3WW3A 1ENXA 1BVVA 2B9UA 2GU9A 2RJ2A 2RG4A 1AJKA 1LEMA 4YM1A 4E4SA 4B4QA 1JZ4A 3SQOA 3KV4A 3PUHA 5EYXA 1SLAA 4CCMA 4Z07A 3ZXDA 1GNZA 4AE2A 4RFT0 3HD8B 4DFSA 2WS93 2JDUA 2DVFA 2HWE3 1S2KA 1X8MA 3LFIA 5DDJ3 2QQLA 4HVRA 1PO11 3LZZA 1MZEA 3WOGA 3ZYFA 1V6KA 1G86A 1SFNA 5FK7A 3N7KA 5FY8A 1MACA 1N1TA 2A3YA 2JDHA 1QDOA 1RUG3 3TB0A 1S0FA 4LMFA 4BA6A 1ZBA1 3N35A 1YEWA 4XFCA 5IW0A 3UETA 1EAH3 3HQXA 1JYCA 1KS5A 4LBQD 5A7QA 1FV2A 4CDWA 3N9NA 4V2VA 4F3JA 3GXUA 1GZWB 4I3PA 4YZ2A 4WVVA 1S0CA 2UWAA 3NNLA 1IS4A 3T2TA 1PMHX 1KJRA 2Z42A 4H3WA 5FLJA 3O1PA 5FO7B 3IBMA 2D5FA 1RUOA 1VBA2 2VO5A 4QX0A 5CYYA 3ZYIB 2A6WA 3OYWA 4M3CF 5C4WA 2NLRA 1GUIA 2BOIA 2EA7A 5JMCA 2XJSA 2VJXA 2VCAA 4QPGC 5C8CB 1C3HA 2P3KA 1QJU3 5A7SA 3IZOA 2OYZA 2Z4FA 4M4PA 4BQ3A 3N9QA 3WG3A 5DG1A 4QQLA 4OHXA 1QF3A 2K46A 4WVMA 2PHUA 3J7LA 2R061 4CP9B 4QT6A 1S2BA 5JDBA 1O6UA 3OG2A 3VN4A 3IAQA 4NIGA 1W90A 3HBZA 1UPSA 2EXIA 1IS3A 2KM2A 2KD7A 3DXUA 4AVVA 3T1LA 4L8QA 2ZEZA 1EY2A 2IXLA 3WZ1A 1D4M1 1SQ4A 1LOEA 2OVUA 3I2IA 3PUIA 4RS5C 3ZMNA 3FBYA 2W5FA 4A2UA 3RZMA 4B7EA 5CFCC 2ZGLA 2XVLA 2DCYA 4RA0A 1GMMA 2WJSA 4CDWB 2LW8A 1CWPA 5IHRA 5FZCA 3U1XA 2C6SA 1MS5A 1FPN1 2DTYA 3N7MA 4O61A 5FMOS 3WNMA 4MGIE 5LW9A 1LU2A 4OI4A 4E4ZA 2J1RA 2VUCA 3FLTA 3FUQA 3POWA 3POYA 1RUH1 2GC0A 3O0WA 3OYWB 4QGMA 4MLOA 1WMFA 1D4VB 4YWAA 1JYIA 3BN6A 2FDIA 3CNAA 3IMMA 4KBBA 5LY1A 5FZHA 3VZKA 1WA4A 2G9GA 3LB9A 3VDAA 3OUJA 3HN3A 1BXHA 2D6NA 1AL21 4N9IA 5B4NA 2FDGA 5G05L 5J48A 4QM9A 1R083 4UF0A 2PHRA 2YFZA 4BIOA 1POQA 2Y6GA 5I93A 4CXYA 2VNRA 3LD8A 5CVRA 2XJTA 4I0WB 2X09A 5BUVA 2PLV3 3AVRA 3FN9A 2HWD1 2QZ3A 1N1YA 1WBLA 4M00A 1LHWA 4LORA 5FZ4A 3WG1A 4E4HA 1SCSA 5CKQA 2LM3A 5D2AA 1F31A 3UJQA 1W6OA 1PVC2 4HL0A 1SLIA 5EWSA 2NP0A 4FFGA 5L9BA 3MIGA 1AR63 4CTEA 1RUE3 3WNNA 3WCRA 1N1SA 1HRI2 3BIEA 4UFHA 1NKGA 3H1WA 4QXBA 4HK8A 3NVCA 4IGPA 3TN91 2CDPA 3UKNA 3OGVA 3MZHA 2WC2A 2TBVA 4GWNA 4CCDA 1RB8G 2OPWA 1W03A 5JUVA 2XVGA 1QH7A 5DAVA 4JDMA 2VOWA 1YLLA 3PU3A 3I2JA 4Y24A 4BIFA 1POV0 5FXXA 2IXCA 1RJ8A 1ASJ3 1PZ7A 1SG3A 3UGHA 2YPDA 2RHPA 3NWKA 5L36A 3ASIA 3HVDA 2GMMA 1AR72 3WDYA 5T55A 3MIBA 4CDQA 4Q0UA 2D98A 2KA3A 2MEV3 3D4KA 2GN3A 1NT0A 2PN5A 4E27A 1O3RA 1IG3A 5FYVA 3NJXA 4IV1B 4KQ7A 1R64A 4EZHA 3I59B 1DYKA 3PIGA 2DUPA 1OURA 4JKLA 4ZS3A 3WNKA 3AL5A 5F3IA 1UWWA 1UX6A 1NLQA 5A70A 1DYPA 2VBBA 3VBSB 3RZJA 1RUI1 1W6OB 2BBAA 3KT7A 2P3YA 1W8HA 3CLPA 3AP6A 3NJZA 1WCDJ 1ULPA 2GSYA 2OZ6A 3PVBB 5LK5A 2E33A 4IW3A 2R49A 5JVVA 4MADA 5DAXA 1ZRFA 4ZXKA 2ZMKA 2E7AA 4I02A 4Q4X3 1TVGA 4QMAA 2XR4A 5CIRA 5FYUA 1H1IA 1UW8A 2OPKA 2ZACA 4QDSA 2XL7A 4GD4A 5LBCA 4QB1A 4D8MA 1QDCA 2AREA 4W65A 5BV6A 5J1XA 1N3QA 1PGL2 3K3NA 5JOZA 2ARCA 1Y7BA 2VD7A 3CEWA 2F6BA 1FT9A 1V0AA 1ZA7A 1FOD3 5FZ1A 3K48A 1N1VA 3LE0A 1TZOA 1GR3A 2BVBA 3NAPA 3LF7A 2XJRA 4NIAA 5I91A 2EIGA 4JKKA 2WZPP 2VZRA 4EZ4A 1IS5A 1OHFA 2AEYA 2J1AA 1WW7A 4XC9A 4OHZA 3M7AA 2XBO1 1OH4A 3WNOA 2FQPA 4ISRA 4F8AA 4COUA 3U75A 2A7AA 2BW8A 4R9CA 1X9TA 3AKPA 4SBVA 3ZXEA 3MIEA 1SMVA 4HOOA 4YW5A 4AQ6A 2XGXA 2YPJA 3SMHA 2DBIA 2D44A 3VL8A 1YO8A 2Q0AA 1QKQA 4LKDA 4B1MA 2A6YA 4JRAA 2QQMA 1HLCA 2CY6A 4Q2FA 3VKLA 4DIQA 2RS51 1KJLA 1W2AX 1V6NA 1NE4A 4CA9A 1IPJA 3OGSA 2P1BA 1COV1 3MGUA 4LOSA 3LEGA 4AI3A 1AR93 4UI9L 1J84A 3SXWA 1Q8OA 2GH2A 1VBD3 2GALA 1ZRRA 2E9QA 1QQP3 1FYUA 2AACA 4Y5Z0 1QY4A 1FNZA 4YVSA 1EUUA 3T4VA 4E2GA 5LK7B 4QHZA 2CWSA 3HWJA 1UKRA 3LDRA 3ZFFC 4S2GA 1O3SA 5KR7A 3NKGA 2D6LX 1BEV1 4D0QA 2DFBA 4C0BA 1OOPC 1E5SA 3H8XA 3ZX7A 1SFYA 3FL7A 2LRPA 4U36A 1VMFA 1RUJ1 4UXAA 1LOFC 4HK9A 2QUOA 3HJRA 5FWEA 5BNNB 5IYYA 1WCQA 2CGPA 4M3CB 1R1A1 3I3EA 5C9AC 2X8KA 1W0PA 4FOWA 4QDQA 1ZM1A 2PQSA 3SH4A 2VZVA 3ILRA 4MGZE 4N53A 1LNSA 4NPMA 1MQTB 1K5MA 3GHMA 3LPFA 1CAUB 1DLCA 1DZTA 2MPFA 2RS13 2W39A 3A0NA 1DG6A 3AMNA 3V64A 5B2GB 4META 1ULFA 4J1WA 4LO6B 2BWAA 3RYRA 1PMIA 2DTWA 3WG4A 5FZ3A 1GNYA 2B4KA 4RHV3 1G9AA 5FAXA 4I30A 1B35A 3N9OA 4CPBD 2HWC1 3VV1A 2QQKA 4XXPA 5I0SA 2YZ4A 2OQ6A 3OGGA 3Q8FA 2HH9A 3TRSB 4J6GA 2BUKA 4H7MA 3T2OA 4MXWB 1PX4A 5K7PA 5FP4A 5AC93 1MVEA 4PF5A 3P1IA 3UKVA 5DDJ2 4EQVA 4LOTA 4YVSB 1C28A 2C9AA 4GMP1 2X53S 3OEBA 3VKNA 2DYCA 2EAKA 4ZZ5A 1C4RA 3T0BA 1O7FA 3WNXA 4CUAA 5C33A 3OF1A 4CP0A 1H9WA 3IDEA 5C3QA 5EHDA 4BQYA 2GN7A 1NY72 1EAH2 4FFIA 3BODA 5C8CC 1XU1A 1OBNA 2OUJA 2UYAA 3KQRA 3LGRA 3TNPB 1VBE1 1ZBE1 3SEPA 1H8TA 5FYMA 4OULA 1UO9A 4BMEA 1L7RA 1YRZA 3MEPA 4C91A 2WQ4A 1K5MB 3LIGA 5BNOA 2JKBA 3VZOA 3RZGA 1STMA 2TEPA 3VBFB 1RMU3 1RUC2 2WFF3 3NRUA 1HRV1 4MGKE 3TEWA 3RI8A 3U07A 3JB8A 1B35B 3M3EA 3OGJA 2VMDA 4M0NA 5LY2A 2R1BA 4R52A 2GNTA 4YW6A 4FAHA 2O0OA 3INAA 5L7OA 2QQWA 4BCUA 1SLLA 4BQ4A 1OUSA 2VULA 4R9DA 1DGLA 2IVIB 3Q8EA 1J3QA 2B5HA 4YW2A 5FZDA 2ZGQA 5FP3A 3VDCA 3KD4A 5L7OB 1A78A 4NOTA 3IB3A 2DVGA 4PJYA 3GDBA 1QJX2 4XAEA 1H2LA 4G4FA 1A34A 4BQWA 3VD9A 1QJY1 1TME2 2RS52 1AYN2 3NNFA 2R043 5A1AA 3USUA 3DF0A 3ZXFA 1IZ3A 1PM7A 1AZDA 3VBRB 4XETA 4AI0A 1G9DA 5JPMB 3WP6A 4AVCA 3WUCA 4CU6A 5G04L 4RSUA 1LCLA 2ZS6B 3KM5A 3POBA 2ZGNA 3F95A 4MYEA 3ITQA 5FZIA 5AFEA 4MXVA 1VP6A 4XPVA 3U11A 1GFF2 1ND2C 1VRH1 2IZWA 4FPOB 2ZGPA 3K3OA 1CAXA 3DPRA 2RM23 1DQ0A 1UU5A 1VIWB 1RUD3 1UYZA 2CNAA 4FQZA 5ACA1 4LE4A 1FMD1 4JQTA 3ZIWA 3JD73 4XQWA 5K9YA 3NNMA 4KWUA 4Z82A 2ZGUA 1JZ8A 2JICA 3KB5A 1RINA 1ND3A 4K9SA 1DF0A 3CKHA 1JUHA 5JSPA 1QNYA 5FMDA 4AQ2A 2XJPA 5DUUA 4N7UA 1VBC3 4Q8KA 3VBUB 5GZDA 3VKMA 5A3UA 2QQUA 4JKMA 1IOAA 5T5OA 3K4AA 4PT6A 4JX0A 5C5UA 1LECA 5F5IA 5F1RA 2VU9A 1AX1A 3ACHA 4JZRA 1VAVA 4N8MA 2LS6A 4Q4Y1 4ONUA 1WW6A 5HV4A 5JSOA 4AVBA 4TXWA 1W0OA 1B09A 1DBNA 1TMF3 2XONA 1ZYBA 4FOVA 3VBHA 1KXGA 1RUF1 4AFDA 4Q4V1 2WZR3 2QZ2A 5KHKA 1JYVA 3I54A 2WNVA 2JG9A 3PVEA 5C6CA 4FXGB 5FBZA 4LHSA 2YBPA 1UOBA 4IV1C 1LHVA 5IVEA 1PM4A 5JMOA 3UT0A 2QTWB 4AYUA 2YB7A 2LUWA 1H1MA 4E9KA 3K51A 4P08A 3JBG1 1DCSA 1MPXA 2QDRA 2WNEA 4XTPA 1EV13 4D69A 4BM8A 2E26A 4Q26A 1I6XA 1FX5A 3H8OA 2NN8A 2R7EB 2VQ0A 3VBSC 1ZZCA 4HLTA 2MEV2 3AZWA 2LALA 1YFXA 4LITA 4JGZA 4WZCA 3WT3A 4CCCA 5A3WA 2Y38A 1AF9A 2J1VA 2YROA 4XUQA 2C5DA 2OT7A 4UFMA 2WRAA 1G9FA 1YQCA 2XLFA 3O7OA 1JYTA 4KNCA 5HPOA 4FPJA 3U10A 3ZFEA 4DXTA 3N4MA 1IHMA 5IVYA 2JEMA 1E57A 1FXZA 3DKWA 2W1UA 2FDHA 2J7MA 3UYJA 5JSRA 3CMGA 1DZRA 2Y6LA 1C5HA 5BY5A 1SDDB 3HPNA 2YC0A 5C3OA 3ZYPA 4CEWA 1W8WA 5T52A 3OD4A 1IG0A 1W8NA 4FPKA 4PIZA 4AVAA 3THPA 5IVCA 4MHRA 1W9FA 1OKOA 5T3NA 3IIIA 3VBHB 3TEZA 5FBJA 1L3JA 5FY5A 1PIV2 1PGW1 1GZTA 3MPBA 5A7WA 3CJIB 2HEYF 4GWMA 2JG9B 1XNCA 1VB4A 4P5YA 3JU9A 1V6IA 2ZGKA 4IGQA 1NA1A 3B7MA 3LEMA 3RDIA 2XLAA 4NRPA 3W5NA 1T6GC 4K6BA 1PGSA 1F35A 4LK7A 1YHFA 2HWB1 2D6OX 5CFDA 4Z8BA 2YBSA 1URXA 2G9FA 1AJOA 2SLIA 3B02A 3T2PA 2UY8A 2TNFA 2JXAA 1Q8QA 2DU0A 4IV3B 5CU1A 5CB7A 4BU2A 5KXBA 3E6CC 4FPCA 2P17A 3E6BA 1BBT2 4XCAA 4D6RA 4BH9A 3J7MA 3E5XA 5LASA 4QKBA 1XE7A 3AYCA 1CGPA 2DU1A 4XCBA 2VW0A 4YGDA 1V6LA 3I2DA 4HSJA 4P9LA 4CU9A 1C1LA 3AKQA 2ERFA 2ID4A 3GNEA 2GAUA 4WVWA 1ZRDA 2EXJA 3GZTB 1MS3A 2I07B 2HWF1 3KF5A 4MGQA 3OSDA 4Q5OA 2W46A 2WYFA 3HNMA 3NJYA 1UZ0A 3C7FA 1SBEA 3OY8A 1AVBA 1XBFA 2E63A 4IEUA 4LBKA 3ZXJA 4AGVA 3BU0A 5BNNC 4WVZA 4CSWA 1YQ6A 3ZYJB 4HETA 1PO13 4SLIA 5FKBA 3OD0A 2DF7A 3O12A 5FZKA 3SKJE 4BZ4A 4E8DA 5CG9A 1NA1B 3ETPA 3L9JT 4XZPA 4AHYA 4BLIA 2OZJA 1H9PA 1MQTC 2PAMA 3AYAA 1UMIA 3TOJA 2WWSA 3P5BA 2P2KA 5GM0A 4CUGA 1IPKA 1ZBA3 4YW1A 3D0JA 4LKEA 2B45X 1HN0A 4NN0A 5GKAC 1VBB2 5H9QA 1PK6A 1S0GA 1BZWA 2VQAA 1GP6A 1XRUA 3RZZA 1TE1B 3THCA 4Y20A 2ZX1A 3SITA 1W6NA 3J7NA 1KFUL 5F2SA 4IE7A 4XXAA 3AZZA 2KXLA 2J1SA 3IDCB 3ZN6A 3QH7A 1VBA1 2R6QA 4BMBA 4RYDA 3CF6E 5C3RA 4I2OA 4YVSC 3WDTA 1NLSA 3H9AA 1OSGA 3RJ2X 2B7YA 4AHXA 1DDLA 1BLZA 4NWWA 3HNBM 4Y1XA 3KVAA 3CU7A 3W58A 3ZIXA 1W28A 4BXSV 3DYPA 3M1HA 2R063 4LKSA 3OY8B 3OGRA 4YGEA 3ZVXA 1DHKB 2VOVA 1QXPA 3KGLA 3GALA 2WSVA 3VD5A 1W2NA 5AC92 2Q30A 4COYA 2RR13 5A3MA 4E8CA 3ZMOA 3ZXGA 5K0UB 3WDUA 5J96B 5LATA 1OQDA 4JC1A 4NRQA 1K5MC 1PMJX 2Y64A 2JDAA 1D4M3 1Q5OA 3KLSA 4H7LA 3VHRA 5FK8A 5JWPA 3KT4A 3VBFC 1RUNA 1W0NA 5L9VA 2PHXA 3AVSA 3IWZA 4HMZA 1Q3EA 4XDQA 1B35C 4HANA 1VMHA 1V70A 4LR4A 1O3TA 1FPN3 3W5MA 2JDNA 5LRRA 1MZ5A 1QU0A 3TNQA 1YYNA 1GOFA 2PFWA 2QDNA 4LBNA 1RUH3 4QQHA 2BGCA 3VBOA 1XE8A 1GANA 1JU4A 3MO4A 2GH8A 4DRVA 2EALA 5JOYA 1DLLA 2LTNA 4CPBA 1RMU2 2WIIB 4DNYA 3LEIA 5IAVA 2VH9A 3O0VA 1JI6A 1AL23 4JCKA 3W20A 4D94A 1BCXA 1KDKA 1S0EA 1ZREA 2B42B 2VMCA 2YMZA 1CZVA 3UESA 5FY1A 1UKGA 2RE9A 4QX7A 4XFIA 3NO8A 3POSA 2OS2A 3PUQA 4PQ9A 1UMHA 3F2ZA 4N9HA 5A6QA 2HWD3 4AFAA 3VBRC 3VHNA 1UZWA 2ENRA 4UYBA 5J7MA 3BKZA 3Q8AA 2Z2SB 1SZBA 3VZNA 5A3LA 1JYXA 3D3AA 2WO3A 2R071 1AL0G 1O5UA 4HXCA 4AEJA 1SHWB 3LKJA 4L11A 3JUUA 4ARXA 3AFKA 1PVC1 2R042 3J4UH 1ZZ9A 4XILA 1UXXX 2O1QA 4A7ZA 4LTAA 1J83A 2RS32 3NNGA 5FOJB 1OQEA 5C70A 2CAVA 2ZX2A 3TN93 3LDBA 4QPWA 4XABA 3WDXA 2NYYA 5D8AA 1GBGA 1HRI1 2OXBA 4RR3A 3EXUA 3C7OA 3J7HA 3LA7A 4OVEA 3VBOB 4XUOA 2FDFA 1NOVA 4QPYA 5FYYA 3ZXAC 1HXS1 1G8WA 1O4TA 1K42A 1DZQA 2JDZA 2OA2A 2EICA 2NMNA 3VBUC 3V0AA 1VAMA 4N43A 1GLHA 4KGQA 3M2MA 4Y5TA 4YVWA 3IKWA 3JD72 5F3EA 4HVQA 5KXDA 5AVPA 2XJQA 2BNOA 2ZGSA 2ZKNA 1AR71 2RDSA 3CZUA 2ZGMA 4L92A 3I2OA 5FZBA 4XQDA 3MLLA 3I3BA 5FZ8A 3WW4A 5KHJA 5HXVA 1KRIA 1MVQA 1CZSA 2WKKA 1UU4A 1VBC2 3C7HA 4LPLA 3MHZA 4ATEA 4OZOA 2XUMA 4EN8B 2OUHA 3GCWA 3VDBA 3ATGA 2JIGA 2N7GA 1W9TA 3NMBA 4JHZA 3WX5A 3ELNA 3EJKA 4ZU7A 4QKDA 4YLZA 2VECA 3GBGA 4XJ9A 1XQNA 2ZX0A 1U5ZA 1JOJA 3CL1A 5FP7A 3RGBA 4H55A 1JZ2A 1PVXA 3LOBA 3HAGA 1UY2A 3B9CA 4C8DA 1J1LA 4JGYA 1ENQA 4HFSA 4XTMA 3FZ3A 3M3IA 2ET7A 2YHJA 3KSCA 4R4ZA 5D8AB 1HKDA 5FIXA 1CIYA 5A3OA 2JX9A 2JDKA 3GHNA 4RR3B 4EN0A 3PVOA 4AW7A 1W99A 5A1LA 3AB0A 1PGL1 1V00A 3AMPA 2VVEA 2W1WA 4LEJA 5FZOA 3W21A 4A3ZA 4P02B 5BNPA 3WINE 3HR9A 5TSWA 4AI2A 2VC9A 2A1XA 3CBNA 1JHNA 5CKNA 5IFTA 4CDUA 1YJKA 3VL9A 4LO5B 5H9RA 1Z7S2 1JBCA 3VB9A 3WD5A 1NQJA 4V1PA 4BE3A 3JZVA 3V0BA 3POEA 4WM8A 1F9KA 2A6XA 2XBO3 4D6SA 4YZ3A 3TBDA 3VBHC 5EQUA 2Q1FA 2TUNA 1DYOA 3EQEA 1DQ6A 4AAXA 2VMHA 4ASLA 3CJIC 2JG9C 1XU2A 3KVBA 1LGBA 5FXWA 1KDMA 3ZN5A 4ZXEA 2A3XA 5C4WB 5HCAA 4WBBA 4URAA 2JDPA 3RSJA 3ENRA 3H3UA 1NQDA 4RL7A 4XJ8A 4LKFA 2WQ8A 3U4SA 4BYYA 3OBAA 3ZFGA 1HDKA 3CZJA 1COV3 1KQRA 5ISLA 4GB33 1W05A 4Y3OA 5AFBA 4IESA 4WVMB 1C8NA 1MR5A 4IV3C 5F9TA 2QE3A 3K75B 3GZAA 2BNNA 1H2KA 1Y9GA 4HSLA 2RVAA 2EIDA 3GCXA 2R072 2WN2A 4JDNA 3DV8A 1DGWA 1BEV3 2DUQA 3N9LA 3ECQA 2BQPA 1BMV2 5FZOB 3KCXA 2WINB 5BNPB 1NYWA 2NQYA 3QACA 4FVVA 4JHTA 5FUIA 4COWA 1G7YA 4NIHA 4CDUB 3PHMA 4ZHNA 2XUEA 2XB6C 3E5UA 3QH6A 1XYPA 4NO4A 4W50A 1ULGA 4IEWA 4YYOA 1W6MA 1UIKA 1RC6A 5DG2A 1C5IA 3SH3A 5IK8A 1XNTA 2HYKA 4XHBA 2ADEA 4CEYA 3NKTA 1Y43B 3KV6A 1O59A 1W2UA 2BFUS 2IUWA 1HXS2 1XJAA 3I4IA 5F6LB 5F5QA 5B4XA 3U14A 1YNAA 2QQOA 4NPLA 1N3PA 1JN2P 2YXSA 3AL6A 4YM2A 1AR81 1CJDA 1UQXA 4ZU5A 5F7UA 2WDBA 1NA1C 2EIEA 2HWC3 3VDDA 1S1AA 2PAEA 1A6CA 1F5JA 4B7KA 2CGOA 5FLIA 1D0HA 4XMIA 3SEEA 1ULDA 1LJ7A 4X6QB 2OQ7A 5JXIA 4AK3A 4K20A 3IT8A 5IK7A 3A22A 1I5ZA 4UF0B 2ZX3A 4UFLA 2Y8KA 4JTOA 4UFJA 3RVHA 1V9U2 5JR2A 3J8F3 4GMP3 5CA6A 4QQPA 3ZSLA 1DP0A 1FI2A 3MIHA 1ULEA 3RFRA 1XNBA 1XPWA 3AYEA 3H3LA 5IT6A 4K1ZA 2RMU2 2ZHMA 5DDJ1 1GZ9A 1UAIA 1CX1A 1YCIA 2Q1ZB 2R30A 4P9IA 5ABJA 4CU7A 3M8LA 1QXJA 4LQRA 3ZLIA 3POFA 2IXKA 1VBE3 1WD4A 1ZBE3 4R4XA 3T08A 3V65A 2VG9A 2B9VA 1NY71 1EAH1 3M3OA 1QMJA 4OI2A 3CO2A 3URFA 2Q8CA 4PLNA 4NMIA 4AWDA 3QCWA 2VNGA 5FYIA 2G19A 3D82A 5J98B 2D40A 4GULA 3MIFA 4AAPA 2YG0A 2FZ2A 4Y4RA 3R0RA 2OKXA 1REFA 1XC6A 5KWRA 1HRV3 4E2SA 5K0UC 2FZ1A 2GP5A 4U2AA 2VNOA 3AJYA 3S57A 1RUC1 4QAWA 3PDQA 2J1UA 4XDPA 2F4LA 5FY7A 2VGDA 4XAAA 2WUHA 4CDQB 1WGPA 3MIDA 3ILFA 3JCIA 4K40A 4LHLA 3O1RA 2WFPA 2W0XA 1H6YA 2VOTA 3O1MA 4Y1YA 4XF9A 2BOJA 1APNA 3T0AA 3IM0A 4KU8A 3AMMA 4C0HA 2DCKA 3B5LB 2WT1A 4CCJA 5GZGA 2E32A 2JJ6A 3KHCA 1QXRA 1S4CA 3POGA 4TTGA 1QJY3 4P9YA 1ZVFA 4MH0E 4UOJA 2D93A 2NMOA 2JE7A 1QJX1 2W95A 3AKSA 3FLRA 1UOFA 2W91A 4OQ9A 3K46A 4NIDA 4QPIA 2VCMA 1NLRA 1Q8VA 1TME1 3P6BA 1AYN1 1VR3A 2VMGA 4LA3A 5IFPA 1GV9A 2J1EA 1PO22 4IE4A 2YGMA 2Q8OA 5DABA 1X36A 1CAWA 3A4UA 4FQ4A 3WR0A 1VRH3 4YZ5A 5IVFA 4QDRA 1RVF2 4IERA 1EYBA 5A33A 3AMQA 3BTAA 3X29B 3MLKA 4KWLA 4CDXA 3BTYA 5L73A 3FJSA 1H2NA 5ACA3 3UK9A 4FFHA 3N9PA 1FMD3 3G6JB 3QBQA 1QNWA 5LB6A 5FZMA 2Y6FA 4QD2A 4HKWA 3CJXA 3RMYA 3CHXA 1C1FA 3NAPB 2D5HA 2ARXA 1MS8A 4Z92B 4BISA 1W2OA 3ZDVA 4PDWA 1SACA 5FYCA 4C1XA 1Q8PA 5BYNA 3RG0A 4D7YA 3NSTA 5C71A 3ZXLA 1JZ7A 1OF4A 4YG3A 3OEAA 4MX3A 1JYWA 1AR82 2ZMNA 5FP8A 3D6EA 2PHLA 1J1TA 1VRBA 3BOWA 1YUDA 2D3RA 4YW7A 5I0UA 4KWKA 1BHGA 1MEC2 2ORZA 3KMHA 2OW4A 4Q4Y3 4BK4A 3U78A 1ZZ8A 4AF9A 3M3CA 3ZR6A 4XHXA 1RIRA 4DY5A 5FQ0A 2JD4A 4PLOA 4Q4V3 5JCTA 4WZFA 4GQ7A 1O8SA 2LROA 2DCTA 4QHOA 4AHZA 2RJKA 1AR61 3TEYA 2WS92 2HWE2 4P14A 5T5LA 5IATA 2UWBA 4LLFA 2B8MA 3JBG3 2WNUA 4NAMA 5DZEA 1NCQA 1UCXA 4ZS2A 3I2FA 4UFIA 4GH4A 1RUG2 3WLUA 5LCWL 4TWTA 5FV3A 1HB4A 4MV2A 4XBLA 3AXEA 4A3XA 2JDMA 4FPLA 1AXKA 3PVNA 3K4ZA 2ETEA 4B3NA 4AQTA 2MEV1 4YFWA 5FPLA 3UV9A 1IPSA 4K1YA 3WG2A 2WT2A 4YPJA 4N53B 5F39A 2E6VA 2RJLA 3BCWA 5A32A 2FCVA 3HT1A 5D8AC 5DUVA 3BIWE 4RR3C 3PIJA 4L99A 4W8JA 1LRHA 4ZONA 5FOBB 3LDKA 1E5HA 2GZWA 2P34A 3BUCA 2WLPA 5CISA 1OFSA 1QJU2 2VUAA 3KWVA 2J1TA 1WLWA 1W39A 2H6BA 4PLMA 3HIFA 5FZGA 5M0TA 4YG0A 2QQJA 2FMYA 1UY1A 3O5SA 2EXKA 1CPMA 2A6ZA 1KITA 1PIV1 3MPPG 4CDWC 3DEMA 3O1UA 1NXD1 2D3PA 3LQCA 3KF3A 5FFOC 3ZSEA 1XXNA 2ET1A 1POV1 3HBKA 3AMHA 2WNUB 3THTA 1A8DA 3GBWA 3I8TA 4PI2A 4LBQA 4CCLA 1HQNA 4KMQA 3BGAA 3H8RA 4MGTA 1YFWA 4UBHA 4HPKA 1FOD1 4FP3A 2CSGA 2R0FA 5C4WC 4Q8LA 4DUWA 3E1F1 3SCGA 4AGRA 1JZ5A 5DPNA 4X8NA 4N90A 3WDVA 2ARBA 1AYM3 2QQIA 2W3JA 5HBAA 4NHXA 1UYXA 1V6MA 4IUGA 4LUKA 4NHKA 5FMOL 1H8TB 2P4EA 5T54A 4S2FA 2W47A 1BBT1 3EYPA 5E89A 1F8VA 4CYDA 5BNOB 4QX1A 5FPVA 3ZDSA 5HCFA 1HQWA 2IXIA 2PELA 4KBZA 5ANNA 5FO8B 1NXMA 4IDZA 3FHQA 2QCSB 3LCPA 3QOPA 5FZ7A 3Q8CA 1SLTA 4ATFA 4IL7A 3WDWA 2J22A 5H9PA 4Q4W3 1Q8SA 2FBEA 1VJ2A 4KG8A 1UY3A 1R082 5BNPC 1VPHA 2DURA 2VVDA 2ZHLA 3VZLA 1W9YA 3IN9A 1RHI3 4GB32 4YZ4A 1QJZA 5CAZA 1G6NA 3C3VA 4HKLA 4RN5A 4CDUC 1KFXL 2BRTA 2PLV2 4LUMA 5JZGA 2WWUA 4QPGA 4XFHA 5FYTA 1DQ4A 3I3MA 1U0AA 2XQXA 5KHGA 4FPFA 1G9BA 3LAGA 3IPVA 1VBD1 2A3WA 2ZMLA 5KHIA 3H7JA 2XVKA 4LBQB 3VGIA 2O14A 1D0GA 1YI9A 1QEXA 1OA4A 4Y1UA 4EN7B 4XIOA 3USUB 1ZX5A 1VBB1 1AR62 1RUE2 2AGSA 1GSLA 3LOIA 4QGNA 3T2QA 4FTBA 1F2NA 2VZPA 1K3IA 4XFGA 2XXZA 1FNYA 5IK5A 4ORFA 2A73B 3J26N 3ZM8A 2D6MA 1MS4A 2CL2A 2WR9A 5A7PA 2ZABA 3GZEA 5DUWA 2IWGB 4TLFA 1T2XA 4ET7A 4DXRA 1VBA3 3PURA 3WQBA 3I2HA 1D7PM 1WMDA 2VPVA 2JKXA 3HMYA 4RS5A 4YRDA 1CAXB 3DPRB 4HONA 4XJWA 5D1IA 3HNYM 4ARYA 1W3VA 5CFCA 4NIIA 1ASJ2 5JI9A 4OI0A 4LXLA 4MZUA 1X50A 4EWEA 1UY4A 5E16A 2WQZC 1MZFA 1C8M3 4R9AA 4QX3A 4FPYA 3DCQA 1VE0A 4NUBA 4TSVA 4AHWA 2QKDA 2JB4A 1WA6X 1DQ5A 4D6QA 3WP5A 1ND3B 1UZZA 3IMNA 2V4VA 3AP4A 1CAVA 4IQPA 5FPUA 3J8F2 5JZGB 1SLCA 1PNFA 4O9EA 4CCKA 1CONA 4GKXA 5AC91 2ZXQA 3WV6A 5ERLA 2VQUA 1O4ZA 3WHUA 1NAEA 2DVBA 5E1RA 4DY3A 5EJ3A 5FZ0A 1LEDA 4IE0A 2DDUA 5GZFA 1NZIA 3WHTA 3OTFA 3EB7A 1W6QA 3DKQA 1CR7A 1OQ1A 3EBRA 4K8RB 4QX5A 2ZA9A 1H2MA 4Q4X2 2VE1A 4C1WA 4NHLA 5F5CA 3ES1A 4CDQC 5F3CA 4LO8A 5L9RA 1RITA 2EIBA 1WWYA 1XYNA 1GKBA 2WNVB 5IVVA 2AYHA 2BGOA 4I0BA 5FPXA 3DGTA 1SPPA 1U12A 4K3UA 3HEIA 3ON7A 4KU7A 4WM7A 2YU2A 4RGAA 1R1ZA 2WT0A 4DEQA 1FOD2 5JXHA 2V4AA 3MI8A 1RMU1 4C90A 2BEOA 2EXHA 3OBTA 1GWLA 4M01A 5EPAA 5C7GA 4NRMA 5HCBA 2A71A 4JGZB 1TNRA 2C1FA 1GQPA 2BJSA 4A45A 2VR4A 3V56A 4A7YA 2PQQA 4A41A 3P3NA 1R093 3USSA 4DRRA 1UIJA 2I2SA 3ZFEB 2Q5TA 3N3HA 3O14A 2YU1A 5FY4A 3B3QE 3P3PA 1YFYA 3MDPA 3I3QA 3PJQA 5JR7B 2D43A 1NX9A 2ES3A 3L2HA 4OYUA 1PVC3 2PXJA 5EJ1B 1W8OA 1YC61 5FWJA 2BVVA 3NV4A 1NG0A 1NUKA 4AVSA 5FZLA 4CEWB 1W6QB
chains in the Genus database with same CATH topology
4XIKA 4FTSA 2AZ5A 2R041 5EXOA 4LNVA 3NW4A 2ZOEB 1HRI3 1X8EA 2ZGOA 2RS31 1AR92 3NAPC 4INDA 5KBFA 1LHUA 4RD7A 4LT5A 1AHSA 1VBD2 1LKNA 1QQP2 1EP0A 3EO6A 2GMPA 1U5YA 1H4GA 2ZPXA 4IEZA 4WM7B 4COVA 5CFDB 2W52A 3ME2A 2XJVA 1YI7A 2ZCWA 5T5JA 1RGSA 1ALYA 1AR73 4Q1RA 4DB5A 4ZKTB 2K0GA 3JD71 1MS0A 3RRDA 1V6OA 4XFFA 3KZ4C 5JIAA 4YM3A 1UPIA 3AJZA 3SLIA 1GYKA 2RS12 1LU1A 4XYXA 1VBC1 1O91A 1W6PA 1ZNPA 4RHV2 3AKTA 4JV4A 3ZN4A 2ZGTA 4IEOA 3ZYRA 1DQ2A 1AXZA 3S7IA 1OKQA 5T5PA 2BBVA 1QH6A 1S0DA 3B94A 2CYFA 4Q0SA 3BU7A 1Z0HA 2OIIA 5IK4A 1UN1A 3LSDA 3MFAA 3UKTA 2QVSB 1WUVA 4RGGA 3RJRA 2H6CA 5KXCA 3WY6A 1WW5A 4N53C 1CVNA 3KT1A 3S0MA 1Q43A 4MVTA 1DQ1A 4Q0PA 4AEDA 4DQAA 2PYTA 3I7DA 1EV11 2IFWA 4OHVA 1PK6B 2P37A 3SHRA 4AI1A 4ISQA 4HZFA 4QQ2A 4P9XA 2VXRA 1SLBA 1Z7S1 1LOBA 4Y20B 1JW6A 1W6NB 4X8PA 5GLUA 4PCRA 4IEYA 3ZFFA 1OMIA 4JDOA 4PBPA 4R9BA 3ZN6B 4G9SB 2WFF2 1A8MA 1OLQA 2CTVA 4AI8A 1LOFA 2WNUC 5JAXA 2WA3A 3FUOA 4COZA 1M06G 4YW3A 5KC5A 4FPEA 1BVP1 4LBOA 1TNFA 1KS4A 4ES8A 4JAAA 1H30A 1H8TC 4OZXA 2A5ZA 1HV1A 1U5XA 1ZA4A 4ES9A 1BQPA 5BNOC 3EHKA 4Y1VA 4FOYA 3E97A 2K9ZA 4AEDB 1BMV1 1BJQA 2ZAHA 1YIPA 3ALQA 4E4DX 1AYM2 3MW4A 4BLJA 2PHTA 3B00A 1GZWA 4AQSA 4B4PA 1ZRCA 1FAYA 1HIXA 2E7TA 3QD6A 3AP7A 5L7OC 4P9JA 5CG8A 1YXWA 3E6DA 1DGWX 1HX6A 4NR1A 2DCZA 3ST7A 4S2DA 4Y22A 5FDBA 2RM22 2ZZJA 5C8CA 1RUD2 3ZSMA 2XLGA 1LR5A 4XFAA 3RNSA 4Q4W2 3NV2A 1N47A 3LWCA 3KGZA 2SBAA 1RHI2 4ITCA 5FLHA 1JXNA 3VHOA 4NPRA 4B29A 2O8OA 1V9U1 4XOGA 4I3GA 1KD7A 3VKOA 4LULA 1RUI3 5FRAA 1ULCA 2AUYA 3R4UA 4EV0A 1LB2A 1U5IA 2RMU1 1I9RA 3AP9A 1X82A 2E7QA 2ZBJA 4DOUA 3DPRC 1OFNA 3AM2A 1TMF2 1YFUA 2GNMA 1O4YA 1NE6A 3D8CA 3DL3A 4XJAA 1OD5A 1SBFA 4JVAA 1BK1A 2WZR2 3APBA 4NHMA 1OLRA 1RJ7A 1LULA 2Y0IA 4Q0QA 1MS1A 2DWRA 1ND3C 4CZSA 4Z1VA 2JE9A 5JZGC 1MZ6A 4Y22B 3VLBB 1RUC3 2DV9A 1EV12 3V0AB 2BWCA 4N43B 4YVWB 3WP3A 1VLNA 4PIYA 5GLWA 1S0IA 1WLTA 1C8M2 4IEPA 1IGOA 1GQGA 4AXOA 5I0RA 3RMXA 5DUXA 2GC1A 1ND2A 3W59A 1LOAA 1JTZX 2JG8A 3MYXA 3S6PA 4XJUA 5JPNB 2RR11 3NV3A 4AEMA 2WNVC 4OHYA 4F83A 4MGYE 5I0TA 2K2SA 3L2YA 1QJX3 4L9BA 1LODA 2QNKA 3R6SA 1WW4A 1TME3 2RS53 5J09A 1LGNA 1AYN3 3OPZA 4XEZA 4XF4A 4JGYB 4W6YA 4L2NA 1HW5A 3T1MA 3MICA 3ETQA 4JGZC 1PO21 3KCYA 1OPMA 4P9GA 3PLQA 3RPQA 3VUOA 4I0AA 3UL2A 1RVF1 3KCCA 1OI6A 5SV8A 4GMP0 4AFCA 3ZFEC 4N7IA 1LHOA 1Z78A 2NPIA 2HEWF 2YGLA 1Y3TA 2XKPA 1RUJ3 3MFCA 2MNGA 1X33A 3RWNA 1R1A3 1WLCA 5KHHA 4CEWC 3V0BB 2XHKA 5GLZA 4UW3A 4WM8B 4IV1A 1ND2B 3FLPA 1REEA 1WMEA 1R092 3I59A 3AX4A 2JG8B 2C0ZA 4D7TA 1O5LA 2ZJCA 3FFQA 2NM1A 1UU6A 3VBSA 5BNQA 4G3YC 1PZ8A 1MEC1 4W6WA 4WM7C 4B4RA 1BKZA 2ZGRA 4MUVA 5CFDC 3ZFGB 4EWAA 3BPZA 3ZPYA 1HV0A 5DZGA 1REDA 1XNKA 4OHWA 1PO12 2ZAAA 4LHNA 3SCHA 2WS91 3G7DA 3M70A 2HWE1 4Z2WA 4FT8A 3WXPA 1FV3A 1ZBA2 1RL3A 1J3PA 2VVFA 3R05A 4OI1A 1RUG1 2FMDA 1CN1A 4PIXA 1W6MB 3U0ZA 1LTEA 1OA3A 2JECA 3FBMA 3FX3A 3HT2A 4L97A 5L19A 5J37A 2ZKLA 4CEYB 2YDEA 1M4WA 5HI0A 1MS9A 3VZMA 2UU8A 2QJVA 2Z79A 4QM8A 3OCPA 1PZ9A 2FHRA 4GALA 3MW3A 3VDDB 3DN7A 4IXLA 3FFZA 1ONAA 1QJU1 2H0VA 1A3KA 2R062 2YY1A 4DPNA 4S2HA 2XH6A 1PIV3 5EYYA 1PK6C 1UMZA 3IIAA 5I8SA 3H1MA 2R32A 4RQPA 4LA2A 2RR12 3H3ZA 2BPA2 1N3OA 1POV3 2YV8A 1EPWA 1D2SA 3IDBB 4XF3A 5EV7A 5T50A 3WVJA 4FBFA 5I8TA 1D4M2 2D97A 4HN0A 5ABJB 4LO4B 2BNMA 3SISA 3J9SA 3MW2A 5I0SA 2YUEA 2I74A 5FO9B 3WQ7A 5FCCA 4FAGA 4J1XA 5BNNA 1H0BA 4M3CA 2XKOA 4LLOA 1BBT3 3BOPA 1FPN2 2Z69A 2E51A 5FREA 1MQTA 4XW3A 1CAUA 2DUOA 1RUH2 3WQ1A 1LHNA 4EROA 4YW4A 4QQOA 3QLQA 4P9WA 1S55A 2Z5WA 1PNGA 3N7JA 1AL22 3WW1A 3WUDA 2G4IA 1QWRA 1IKQA 1EPZA 4OUMA 4Y4YA 5JOXA 5DZFA 4AEDC 4K8FA 1R081 2ZTNA 2ZX4A 2HWD2 4MXWA 2B46X 4GB31 2VOXA 4YSFA 4RQPB 1H1AA 4Q1PA 2HKXA 2PLV1 1AXYA 2QQPA 2A70A 1J3RA 3ZYGA 3MF9A 4AEKA 1AX2A 4CRQA 3GBFA 1CQ9A 3VBOC 5KXEA 1NCRA 2BYVE 4YARA 3ZO0B 2IC1A 1VBB3 1H8VA 1WCKA 4H14A 5E88A 1RUF3 4QU2A 4QPIB 5JI7A 4IEVA 3TN92 4DINB 1RUE1 4HT1T 4GIQA 1CAWB 1J59A 3MF6A 1YJLA 4YGBA 5A33B 3VBFA 4CDXB 2HEVF 2R16A 3W9AA 4IEQA 5EZWA 2AR6A 3D0SA 3B93A 4WV8A 3TAYA 3S30A 4YGCA 3S7EA 1ASJ1 4JRLA 3LA2A 4KWJA 5IUQA 1Q56A 5AVAA 3ZXKA 3JQXA 4LO7A 1DFQA 1WD3A 3M3QA 2GDFA 4PDWB 2PA7A 1C57A 3B69A 1XYOA 3WCSA 3J8F1 1SCRA 2A6VA 3H0OA 1RUI2 2O8QA 3WW2A 1ENRA 3FC0A 4FSJA 5F6KA 1NCRB 3AK0A 2DVDA 2X5IA 3U4XA 5DXDA 3BB6A 3N7LA 4GA9A 4KH9A 5FQ0B 4UW5A 3SH5A 4XF0A 2XJUA 3VBRA 4LHKA 4N43C 4YVWC 2PHFA 4FOQA 5KC6A 4Q4X1 3VKFC 1GICA 3B9IA 2UWCA 4K21A 1J58A 3VHPA 2R0HA 2HWB3 5FTTC 3R4SA 1NCQB 1CX4A 4YM0A 2P3JA 4GH4B 2PAKA 5H9SA 1QGLA 4R8HA 3TYJA 1ZZ6A 3OJBA 2XG3A 2Q1MA 3SNMA 2ZZQA 4IEXA 3WP4A 1LGCA 3HN1A 2CWMA 3ZSJA 4UW4A 5LEJA 2XBO2 4FXKB 2D7FA 4NVPA 2CAUA 2B39A 4JGYC 1D2QA 3VBUA 5A32B 2VW2A 3MLJA 4Q29A 4A7KA 1PHMA 4M0HA 2HWF3 2NZ9A 1V6JA 3GZUC 2X5IB 3AP5A 2IXHA 4MSVA 4AG4A 5JOWA 4KGGA 3RI9A 4CP2A 1COV2 2D6PA 3C2UA 2RS33 4I01A 3Q9OA 1QOTA 3ES4A 4XF1A 1UL9A 3B01A 4NWVA 1RTVA 2VMIA 1AR91 5JLVA 4WM8C 3LSEA 1QOOA 1TQ5A 1QQP1 2VW1A 1BEV2 2JG8C 2GNDA 2V73A 1IQAA 4XBQA 1RUJ2 3AZYA 5GLVA 4HPKB 3RQ0A 2GC2A 4X6RB 2QFEA 1R1A2 2ZHNA 2UYBA 5LEKA 4LBMA 2BFUL 1LOCA 2I45A 5J3UA 1IKPA 4URTA 1OA2A 3ZFGC 3PMEA 4JTNA 5E8AA 4FP2A 1TEIA 4P5HA 4XQ4A 1WLDA 3M4FA 2EAAA 3ROUA 3UJOA 2RS11 4Q0VA 1UF2C 5EFUA 4UW6A 3BALA 1WBFA 2EVXA 2HWC2 4OUSA 4DS0A 5C8WA 2XPJA 3E5QA 4TYSA 3WQ0A 4I09A 4RHV1 4ASMB 4XBNA 4QHBA 2DVAA 1YWKA 3AZXA 4JQRA 4CP1A 5CADA 2VOKA 2XL9A 4B8EA 3JQWA 3CJIA 3SCFA 2GC3A 4XFBA 2UURA 2VY0A 4QPGB 2JENA 1GQHA 1S0BA 2V09A 4KG0A 4CEYC 3IPVB 3A0KA 1CESA 4AVTA 4EN9B 4UBGA 2R1DA 3JB4C 4K7JA 2CV6A 4IV3A 1VBE2 1ZBE2 1Z7S3 3VDDC 1Y9QA 2GNBA 3OBRA 2AENA 1SBDA 5SV5A 2Y0OA 1OPOA 1F5FA 2E53A 3FWEA 4BHPA 4YNIA 4YFZA 3LA3A 1HRV2 2DFCA 4RS5B 3ACLA 5CFCB 4XE9A 2WFF1 3RYPA 1SDWA 5JIUA 3RS6A 2IFRA 3AKRA 5ABJC 4OFGA 1XNDA 1CAVB 2XWBB 3AFGA 2W68A 2R073 2Q4SA 2IXJA 4DMIA 1QJY2 2UY9A 4HVOA 4XJZA 1QOSA 3H50A 4QGLA 1DGRN 3KS7A 4OLLA 1UZYA 2WL1A 1O3QA 2D6KA 3NV1A 4M3CE 5GZCA 1AYM1 1S0JA 1AUYA 4FO9A 2HJIA 4E2QA 3AXDA 4HBNA 3GF6A 3N36A 1VRH2 2XWJB 1HXS3 4BOWA 1VAKA 3H1YA 4EWDA 4W6XA 1YIFA 4RQPC 5ACA2 3R4DB 1UD1A 3ZSKA 1FMD2 2X29A 4HKOA 4BPZA 3ILNA 3RYKA 2P3IA 1VALA 2RM21 4Q27A 1AX0A 1RUD1 3FMGA 4QXKA 4YZ1A 1GZCA 1DU3D 4Q4W1 1CIWA 1IS6A 1RHI1 4QPIC 1G9CA 1V9U3 5BXXA 4D3WA 1JH5A 1BYHA 5K0UA 1GNHA 1WCSA 5K8SA 3PJYA 2RMU3 1LOGA 1SEFA 4LBLA 3PTYA 4Q4Y2 1ENSA 3NL1A 4FPHA 2W08A 2CGNA 4XMAA 4CDXC 3PMSA 4EN6B 4AFMA 1RUF2 2D3SA 4Q4V2 4YG6A 2WLQA 1TMF1 2YYOA 2F4PA 3D5OA 1HQLA 2ATFA 3PNAA 2WZR1 1JUIA 4AFBA 2VUJA 4PDWC 2PTMA 4HN1A 4O9GA 1CD3G 1CPNA 3JBG2 4DZGA 2GMEA 4F7ZA 4Y26A 5GLTA 2Y26A 3H8UA 1H4HA 4FCAA 1LESA 1NCRC 4D7SA 1C8M1 3AZVA 2EF6A 5J36A 3FE5A 2DCJA 2PHWA 1VB2A 2MHFA 5CNAA 4TZDA 1QHDA 1OOPA 1W6PB 3AYDA 3FHIB 1X7NA 1DGRA 1ZZ7A 5BPXA 5GJ6A 1NZCA 5C9AA 4Y1ZA 1NCQC 4GH4C 1PGW2 2ILMA 2WA4A 4GKYA 4AGGA 1FATA 1LENA 5CBLA 1PO23 4LBJA 4LE3A 2ZHKA 1I1EA 1RVF3 2A75A 2HWB2 4BWOA 2WSUA 5GALA 4ZU4A 5FPZA 4BQ1A 4KL1A 3O0XA 2AH2A 4FTEA 3DUIA 3H7YA 1CJPA 5LRSA 3VZJA 4IETA 2X5IC 4FPGA 4EJRA 1DIWA 3ZFFB 3TWIA 1R091 4DXZA 1I3HA 2V5YA 1AR83 1OOPB 1ZZBA 5GZEA 1MEC3 2HWF2 2PHDA 3GYDA 2BTVC 5I8YA 4PBOA 2H0BA 4GXLA 5C9AB 3WW3A 1ENXA 1BVVA 2B9UA 2GU9A 1AJKA 1LEMA 4YM1A 4E4SA 4B4QA 5EYXA 1SLAA 4Z07A 3ZXDA 1GNZA 4AE2A 4RFT0 3HD8B 4DFSA 2WS93 2DVFA 2HWE3 1S2KA 1X8MA 5DDJ3 4HVRA 1PO11 3LZZA 1MZEA 3WOGA 1V6KA 1G86A 1SFNA 3N7KA 1MACA 1N1TA 2A3YA 1QDOA 1RUG3 3TB0A 1S0FA 4BA6A 1ZBA1 3N35A 4XFCA 1EAH3 3HQXA 1JYCA 1KS5A 4LBQD 1FV2A 4CDWA 4F3JA 1GZWB 4I3PA 4YZ2A 4WVVA 1S0CA 2UWAA 3T2TA 1IS4A 1KJRA 2Z42A 4H3WA 5FLJA 5FO7B 3IBMA 2D5FA 1RUOA 1VBA2 3ZYIB 2A6WA 3OYWA 4M3CF 5C4WA 2NLRA 2EA7A 5JMCA 2XJSA 4QPGC 5C8CB 1C3HA 2P3KA 1QJU3 2OYZA 3WG3A 5DG1A 4QQLA 4OHXA 1QF3A 4WVMA 2PHUA 2R061 4QT6A 1S2BA 5JDBA 3VN4A 3HBZA 1UPSA