1WLWA

Congerin ii y16s single mutant
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
134
structure length
134
Chain Sequence
DRAEVRNIPFKLGMSLTVGGVVNSNATRFSINVGESTDSIAMHMDHRFSYGADQNVLVLNSLVHNVGWQQEERSKKFPFTKGDHFQTTITFDTHTFYIQLSNGETVEFPNRNKDAAFNLIYLAGDARLTFVRLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In vitro evolutionary thermostabilization of congerin II: a limited reproduction of natural protein evolution by artificial selection pressure
pubmed doi rcsb
source organism Conger myriaster
molecule tags Sugar binding protein
molecule keywords Congerin II
total genus 28
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1wlwA00
1W0OA 1H9PA 1IOAA 2E7QA 3UL2A 2DV9A 1VAVA 4UW3A 4K20A 4DFSA 5JVVA 3FFZA 4YLZA 2OUJA 4LBNA 4LBMA 1V00A 2NZ9A 1WW5A 4PCRA 5DZEA 3WG4A 1XQNA 1O4YA 3AZWA 2GN3A 5EYXA 4AGRA 5JOXA 2ZGLA 2ZGRA 4XMIA 4FOWA 1UAIA 1S0GA 1G9CA 1G7YA 4YZ5A 3KQRA 1UZZA 2WT1A 1H30A 4NO4A 4XTMA 2TEPA 3A4UA 2NYYA 1AXKA 4HANA 1C57A 4PQ9A 3ZXJA 3I8TA 3NV3A 2YV8A 4JC1A 4LBKA 3WCRA 2R49A 3N7MA 3WUDA 1CR7A 2ZHMA 4BOWA 1FYUA 3R05A 1Y7BA 4YZ1A 3O12A 3DUIA 1ZM1A 3OJBA 2E53A 2LTNA 2SBAA 2WLQA 3LSEA 1IS4A 1ENSA 3ATGA 2EIGA 4I30A 2UU8A 4Y24A 4Q1PA 1G9DA 3I4IA 1FX5A 1F5FA 5GJ6A 2P37A 3WDVA 4FQ4A 3BOPA 4Y1UA 5DUUA 1IKPA 5EYYA 3VKLA 1YI7A 2D6PA 2EAKA 1MS8A 4DPNA 4Q8LA 2GALA 1WBLA 3OBTA 1V6LA 1V6OA 4XHBA 5DUVA 5T55A 1W6QB 1WUVA 4XJAA 5HCBA 3SH3A 1IS6A 2D43A 1TEIA 3RMYA 1B09A 4ASMB 3AFKA 3QCWA 2ZGSA 5CNAA 1JOJA 3ZSLA 4W65A 1GICA 1F9KA 1UL9A 5GM0A 1OFSA 1ULEA 3NV2A 3OPZA 2VXRA 5SV8A 4YFZA 3QLQA 4TYSA 2ERFA 1AXYA 3NWKA 2ZZJA 2R0HA 2D44A 2ZMLA 2HYKA 4TZDA 3UJQA 1I1EA 2AH2A 3VKNA 3MPPG 4OZXA 1GYKA 1LOCA 4YZ4A 1W6MA 4CTEA 3FUOA 4F83A 1N3PA 1DIWA 3B9CA 1DQ2A 3R4UA 1Z0HA 2Z42A 4IQPA 4P9YA 3ZXKA 4YW1A 4WZFA 2JE7A 1DQ5A 3M2MA 1LHNA 1WW6A 2R16A 4M01A 4YW3A 1BJQA 1MVQA 2ZHNA 3OY8A 4GA9A 1LODA 4GXLA 4D69A 1H9WA 1LCLA 3N7LA 1GZCA 2R0FA 4FPEA 5HCAA 4XIOA 4AVVA 2DUQA 3O0XA 2E7TA 3GNEA 1V6IA 1DQ4A 3V65A 1AF9A 3SLIA 3N7JA 4GKYA 1BZWA 2AUYA 4YW5A 5KXDA 4FPFA 1JW6A 3ILNA 3WG2A 3HN1A 1N3QA 1FATA 2KM2A 3RSJA 4BM8A 1MS3A 3D5OA 1QDCA 3M1HA 3WDUA 2EXHA 4FOYA 1MZ6A 3WNXA 1MS4A 2JECA 3AP9A 3HMYA 2W08A 2LALA 4CZSA 1QNYA 4R9DA 4XJZA 1UN1A 2E6VA 2W52A 1U0AA 2GNDA 1WD3A 1WLWA 2GNMA 3DGTA 4Q1RA 1S0FA 3IM0A 1MS0A 4JRAA 3PVNA 1MACA 4LBJA 2FMDA 1RINA 1Q8SA 4FPKA 5GLUA 2P3JA 3BIWE 5H9RA 1KITA 2DTYA 3C2UA 3IPVA 5T54A 3L2YA 4R9BA 2D6OX 2P3KA 5JLVA 3LSDA 1UZYA 2YXSA 1LGBA 2WSVA 4Y22B 1AJOA 5GLTA 4NOTA 3WHUA 1W6MB 1DZQA 2AYHA 1LHOA 3SISA 3MEPA 5IK8A 3ENRA 3SH4A 2DUPA 1GANA 1QMJA 2BQPA 3SITA 1LHUA 1UMZA 1Z78A 2YY1A 5T52A 2A6VA 5AVAA 3T1LA 3Q9OA 4H55A 4FPJA 3ZVXA 2DWRA 1SLCA 2W39A 2NMOA 5BYNA 4YZ2A 2NN8A 1GBGA 3AJZA 3AZVA 3USUA 2ARBA 2CL2A 1FAYA 2GMEA 3ILFA 1DQ0A 2A3YA 3NV4A 4YM1A 1LOBA 4ISQA 1F31A 5JDBA 1MS1A 1WW7A 4LBQD 2D3PA 5IK4A 2ZGOA 4FPOB 3A0NA 4FVVA 3BODA 4M3CE 1LGCA 1KQRA 2PHWA 2JJ6A 1LOAA 2CTVA 1ULCA 4KBBA 3VV1A 2A6XA 4ZXKA 2WQZC 5T5PA 3POYA 2WJSA 2I2SA 4M3CF 3RQ0A 2NM1A 3OYWA 1LOFA 1SBEA 2DVGA 4FOQA 5DXDA 1J1TA 1W0PA 3WZ1A 4GWNA 4P14A 4ITCA 2V73A 1W6OA 4P9WA 5L73A 2Q5TA 1WLCA 3AXDA 5EWSA 4YFWA 1URXA 1SBFA 2WKKA 1G9BA 2NMNA 1NXD1 2ZGPA 3SNMA 4AVSA 4M3CB 2P34A 1Q8PA 1QGLA 3FLPA 1A78A 4XXAA 1YO8A 2P3IA 3ZXLA 4BQ1A 4XXPA 1YRZA 4YM3A 1G9AA 1BXHA 1DHKB 1KJLA 3R4SA 2ARXA 4ATFA 4YG3A 1G9FA 1KDMA 3O0WA 1S0BA 2CNAA 1LOFC 1JN2P 1W6PB 1WD4A 1WLDA 1LHVA 4K21A 4XJ9A 2ZMKA 4Y1YA 5GALA 5HCFA 3JUUA 1VIWB 1AX1A 5GLWA 4WV8A 5F9TA 4Q27A 2AR6A 3MW4A 3VKFC 2JD4A 2EALA 4XJ8A 4XZPA 1MZ5A 3OGGA 4UW4A 4Y20A 3WDTA 1ENRA 2PHUA 3D4KA 5KXBA 5GLZA 2ZABA 3V64A 4Q26A 1CPNA 3V0AA 1S0EA 5DUWA 4YG0A 2UWBA 2ENRA 3PVEA 1Q56A 3USUB 1R1ZA 1QOOA 3N7KA 2D6KA 4YM0A 2R1BA 2H0BA 1OQ1A 5DZGA 2EXJA 4Q8KA 1ULFA 1C1FA 1SACA 2A70A 3AX4A 1O4ZA 1A8DA 2WT0A 1APNA 4K1YA 3TAYA 3AZXA 3ZYRA 3KM5A 1N3OA 3RS6A 1CVNA 4C1WA 5GLVA 3V0BA 3O0VA 4PF5A 4U36A 4XMAA 1QOTA 1JYIA 1CN1A 2EF6A 1G86A 1FV2A 4FPCA 3WV6A 4Q2FA 2DURA 1LENA 2D6NA 4WVWA 1Q8OA 3ZXFA 1X50A 1KJRA 1G8WA 3JU9A 4LBQB 4RL7A 4UW5A 3H0OA 5IK7A 3B3QE 1DGLA 4YGEA 1N1TA 3FBYA 2JDZA 2A71A 2DVDA 4PBOA 3APBA 1MVEA 1SLTA 3WG3A 3AYCA 3NV1A 5H9SA 3WG1A 1JYCA 5IK5A 1UPSA 1W6QA 1QU0A 4GWMA 4FOVA 2ZACA 4GALA 1AJKA 1LU2A 2D3SA 3VKOA 1D0HA 1QKQA 1S0JA 2FHRA 3FUQA 1ZA4A 2ZKNA 4XJWA 2GMPA 1YYNA 2W68A 5H9PA 1SLBA 2CY6A 2XB6C 4FP3A 2OW4A 3UK9A 1V6MA 2C9AA 4DS0A 3PVOA 1VAMA 4Y1ZA 3WLUA 5CAZA 5GZGA 3WHTA 1N1VA 1SFYA 4WVVA 4XBLA 3IKWA 2PHTA 4R9AA 3HR9A 2GNTA 2VW2A 4AGVA 5JOYA 4AYUA 4R9CA 1W6OB 2C5DA 1CJPA 2A75A 1BKZA 2UWCA 2EXIA 3D6EA 4LBLA 2D6MA 2A6WA 2RHPA 2ZGNA 3AP5A 4YM2A 5FRAA 3V0AB 4Y20B 2D6LX 3WCSA 1SLIA 2G4IA 3B00A 4AGGA 3ASIA 3VKMA 4XBNA 5T5JA 5GZCA 1LOEA 2CWSA 1PZ9A 1AX2A 4AVTA 3ILRA 2WNEA 4Y26A 1QOSA 1D2SA 1S0CA 4XYXA 2SLIA 3M3OA 3V0BB 1RITA 2VW0A 1JUIA 1W6NA 2PHXA 3POWA 1LGNA 2ZGUA 4XBQA 3ZSJA 1ULGA 4CRQA 1FNZA 1BYHA 3A0KA 1LECA 4FPHA 2XG3A 4XOGA 5T5OA 2DU1A 4YG6A 4LBQA 2DTWA 2V5YA 1CONA 1CQ9A 3INAA 1GNZA 1LEDA 3M3QA 1FNYA 2DYCA 2ZMNA 1SCRA 2ZHLA 4L8QA 2GDFA 1GSLA 2YMZA 1MR5A 1YXWA 3M3EA 4LBOA 3OY8B 3WUCA 4XDQA 3ZSMA 5CBLA 1DQ1A 2B7YA 1Q8QA 1RIRA 3AZYA 1HDKA 3LCPA 1S0DA 3T1MA 1PZ8A 1HKDA 1DQ6A 2JE9A 2WSUA 3VUOA 1LEMA 3AYAA 2JKBA 3ZYPA 2YROA 2PHRA 2AREA 2ZGQA 1PZ7A 3MW3A 2ZBJA 1GLHA 4YGDA 1MS9A 2A3WA 4FPGA 3MW2A 3IPVB 3TB0A 4DRVA 2E51A 2CYFA 1FV3A 2ZHKA 1JXNA 2OUHA 1EPWA 1LOGA 1DLLA 3B01A 1IKQA 1AX0A 2DVBA 3AJYA 4U2AA 4Y22A 3SH5A 1DBNA 3UJOA 2OVUA 4MYEA 3U4XA 1GZWB 1V6KA 1QF3A 4ATEA 2EXKA 3BTAA 5EXOA 3WVJA 4YGCA 3N36A 1AVBA 1CESA 4YW4A 4GKXA 3W59A 1YIFA 4ZKTB 1JBCA 1V6NA 5GZEA 3O5SA 5LK5A 1SCSA 1BQPA 2VUAA 2DUOA 3FLTA 1GKBA 4XE9A 5IUQA 1LULA 1UX6A 4FP2A 2WT2A 3ZPYA 2DU0A 4DRRA 1IS5A 1CPMA 1HQLA 3IMNA 2P2KA 3T2TA 2VH9A 2ZGKA 3WOGA 3B69A 1N1YA 4YW2A 2VY0A 2ZA9A 4XIKA 1LTEA 1HLCA 4BPZA 5E8AA 5IT6A 1ULDA 1ENQA 1N1SA 3AXEA 3ZXEA 1S1AA 2VW1A 1UKGA 2A5ZA 1V6JA 4BLJA 4DQAA 1KDKA 1AXZA 3OYWB 5DZFA 1VLNA 4FQZA 2D7FA 3W58A 4K1ZA 3WDWA 2ZGMA 2UWAA 5T5LA 4PBPA 3N35A 5DG1A 5JMCA 5T50A 3WDYA 3PMEA 4YGBA 4P9XA 3RG0A 4HL0A 4XJUA 3WDXA 1I3HA 1Q8VA 1GV9A 4UW6A 4Y1VA 1N47A 1GNHA 2ZAAA 5H9QA 3OBRA 1QDOA 5KXCA 5E88A 2PHFA 4JCKA 2GMMA 3AYEA 4XHXA 4XILA 2PELA 5FREA 4Y1XA 2D3RA 1LU1A 1MS5A 4BLIA 1SBDA 1HQWA 1GZ9A 3POSA 2GNBA 4AWDA 1ONAA 4FPLA 2NP0A 1OKQA 1W6NB 1W6PA 3IN9A 3AZZA 3PJQA 4FPYA 1WW4A 3M3CA 1SLAA 2A6YA 1VALA 4XTPA 1GZWA 2A6ZA 1CIWA 1KRIA 3AP4A 1LESA 2UURA 2YZ4A 1JHNA 2AGSA 3AK0A 3GALA 1C1LA 5F5QA 5DUXA 4BMEA 4M00A 5E89A 2ZGTA 1AZDA 1SLLA 3RRDA 3N3HA 5GZDA 1A3KA 5CB7A 4M3CA 2DVAA 4Z8BA 4ISRA 5KXEA 1WCSA 1NLSA 4RA0A 1S0IA 1IS3A 4SLIA 3AP6A 3CNAA 4YZ3A 5DG2A 3ZSKA 1C4RA 3AP7A 2DVFA 1LHWA 1LJ7A 1WBFA 3RMXA 2ES3A 5JOZA 4C1XA 3AYDA 2AENA 3FLRA 1DYKA 1DFQA 2CWMA 2R1DA 5JOWA 5GZFA 1QNWA 2A7AA 1DYPA 2A3XA 5CA6A 2VU9A 2GN7A 4BMBA
chains in the Genus database with same CATH superfamily
5IJRA 1O91A 2BOJA 4RFT0 3DECA 2H6CA 2RS33 4E4HA 2X5IB 4LEJA 3RDIA 4DFSA 4DB5A 5C3OA 2OUJA 3FHAA 4LBNA 1V00A 2JE8A 5FCCA 3PDQA 2ARCA 1WW5A 4ZHNA 1O4YA 1RYYA 2GN3A 5EZWA 1FMD3 1S0GA 1G9CA 2D40A 1UZZA 5FWEA 2VMGA 1WCQA 3G7DA 1W2OA 4NO4A 2TEPA 1VRBA 3A4UA 4JZRA 2GSYA 5ACA1 4HANA 5FXXA 3ZXJA 3I8TA 3KT4A 2YV8A 2QQVA 4LBKA 4Z07A 3EO6A 3WUDA 3EJKA 5A1LA 1FYUA 3R05A 2SBAA 2LTNA 3GZTB 3LSEA 3TBDA 5JCTA 1ENSA 2D5FA 2RS31 4B4RA 3ATGA 2J1SA 4ARXA 4DO0A 3TEZA 4NIAA 4IV1C 2VOKA 5A32A 1O5UA 4QQOA 3GJAA 3HNYM 3MV11 3I3MA 1F5FA 4GB31 4TLGA 4C1XA 3NNGA 1COV3 2P4EA 3VKLA 2D6PA 4LIUA 5J7MA 4NIIA 3CKHA 3AMMA 1QJY1 3OBTA 3U11A 5DUVA 3PUQA 3IDEA 4XETA 4AF9A 5T55A 2WYFA 3JQWA 1RUJ2 2I07B 3NJVA 1F8VA 1JUHA 2P17A 3UV9A 4AI1A 3S0MA 3UT0A 3PIJA 4RS5C 3QCWA 3VHRA 1W39A 4QKNA 2WO2A 5CKMA 1J1LA 2FDGA 1ZRDA 1A8MA 3BPSA 3MO4A 4D6RA 4DY3A 3B93A 4YFZA 1K5MC 2VQTA 3T4VA 5FQ0B 5JR2A 1AXYA 3NL1A 4QHBA 1GFF2 2HYKA 1I1EA 1PVC3 2W47A 1JMUB 3FMGA 4D6SA 4CTEA 3FUOA 1DIWA 4QX0A 4IUGA 1AL21 1F2NA 1QJY2 2ZPXA 3ZYBA 1IG3A 1E57A 2HYXA 4QHZA 4WZFA 3E6BA 1NA1C 3M3IA 3FFQA 1HN0A 1DQ5A 4EE2A 3GXUA 1HJGA 1CAVA 1LHNA 4E2SA 3ZYHA 1MVQA 1W3VA 1D2QA 1RUD3 1W8OA 4GA9A 2JG9C 3WNNA 1NOVA 1VMJA 3FJSA 3H42B 4OI4A 2VMDA 4R8HA 1PMHX 3TEXA 2R30A 4FAGA 5LB6A 4AVVA 1ND3B 1AR62 4KG0A 1LB2A 2E7TA 3GNEA 1SEFA 5KC5A 1V6IA 1DQ4A 1CAWA 1UY4A 1AF9A 1D7PM 3PUHA 5DN2A 3N7JA 4GKYA 2AUYA 2EA7A 5KXDA 1JZ5A 4DXZA 3ILNA 4QWNA 3WG2A 1OXCA 2EIBA 1FATA 4XFHA 1GQPA 5A32B 4M4RA 4XZUG 3KWVA 1EUUA 3EMRA 4O61A 2Q1FA 3WDUA 4AI0A 4EYUA 1CJDA 4RD7A 1MQTC 3HMYA 4WM7B 2LW8A 3BU7A 4CP2A 1JU3A 3I54A 3OB8A 3WF1A 3PUAA 5I8SA 2FMYA 1D4M2 1GR3A 4CDWB 1OFNA 2O8OA 5LY2A 3MUZ1 1U0AA 2CDPA 1UY3A 2GNDA 1MQTB 1WLWA 4QDSA 4CUBA 5JZGA 2I74A 2FDFA 3HT1A 3VDDB 3BIEA 5LWBA 1CZVA 2B9VA 4RQPC 2RMU1 2VZSA 5BNPC 2B8MA 4NWVA 1V9U1 5LW9A 5F39A 4R9BA 2P6CA 2P3KA 2OS2A 1UZYA 2VNRA 1UXZA 5T3NA 1AJOA 5GLTA 4NOTA 3GM8A 4PLOA 1W9YA 2Q4SA 3MEPA 4P5YA 2XGXA 2B5HA 3ENRA 5TSWA 2DUPA 3AKSA 2EIDA 3P3NA 1Z78A 4RGGA 5T52A 5C5UA 5IFPA 3T1LA 4CP1A 2ZX1A 1TMF3 1VBC2 2W0XA 1C8NA 3H7JA 1VJ2A 2W39A 2NN8A 3AJZA 5F3EA 3A7QA 3USUA 3NV4A 2GMEA 1DQ0A 2A3YA 4Q4Y1 2JEMA 3RZJA 3K75B 1F31A 3LDKA 4LO5B 1WW7A 2Y6JA 2HKXA 2PA7A 1XE7A 1YQ5A 1JH5A 1UW8A 3VZKA 4CE8A 3A0NA 4ASKA 1EYBA 4FVVA 4E4DX 4ES9A 4PIYA 1PGW1 1OI6A 1LGCA 1KEXA 1R1A3 4CCMA 1YI9A 3DCQA 2RG4A 4E9KA 4D94A 4AQTA 2JG9B 2A6XA 4LK6A 2RMU2 1ZZ7A 4HBNA 5T5PA 4CDQC 2NM1A 3OYWA 1ZBE1 2D93A 4XW3A 2UY9A 1NCQC 3LQCA 3O1SA 3X29B 1L7QA 1W0PA 3RZGA 2AC1A 2WL1A 4GWNA 2J1TA 4CEWC 2FDHA 1GQGA 1C8M2 4LNVA 2VZOA 5A6QA 1ACCA 5EWSA 4IEXA 2QJVA 1QWRA 2W1WA 3VBOB 3C7HA 1PX3A 1NXD1 4HPKB 3SNMA 5FXZA 3DKQA 2QDNA 3JD72 1DU3D 1QGLA 5AC92 3FLPA 3NNFA 1I5ZA 4A3XA 1RL3A 4YM3A 1BXHA 1GUIA 5BNQA 2BBAA 3GZAA 2XQXA 4CA9A 4JAAA 1VE0A 3O0WA 1PO12 2WIIB 4LE3A 4LQRA 1JN2P 1WD4A 2EAAA 3KV4A 4DZGA 1PGW2 2LS6A 3NJZA 3MFAA 2WFPA 3N9MA 5FPZA 1RTVA 2LROA 4AW7A 1AR83 2JICA 5ISLA 4EJRA 4AI9A 1XNTA 4QX5A 2Y64A 4XJ8A 1ZZCA 3HJRA 2GZWA 1MZ5A 2XKOA 4W50A 3UKNA 1BVVA 3D4KA 2ORXA 3J8F3 2ZABA 2V4AA 3PNAA 4B8EA 4YG0A 4CDXA 1JZ7A 1ULPA 1MQTA 1POV3 2BERA 2DCKA 3PVEA 4MGSA 4E2QA 3WP6A 1U5IA 1FMD1 4Q0PA 5FBZA 3GJBA 2XVGA 1OQ1A 4I0WB 4QGNA 2XHNA 1XNKA 1F35A 2X53S 3ST7A 3J8F2 1SACA 2A70A 3LPGA 4QKFA 1VR3A 5JXJA 4OUMA 1HRV2 4NIGA 1A8DA 2WT0A 5JAXA 4F7ZA 3H3ZA 2QUOA 3LF7A 3AKTA 1NY72 2VMEA 3HPNA 4HXCA 5FUIA 3KM5A 4AFAA 5C3PA 1HRI2 5JSPA 1AR91 3MF9A 1H4GA 2BFUL 4JQRA 4PF5A 3BN6A 1VBA1 2VZQA 1JYIA 1WA6X 2RM21 3Q8CA 1FV2A 2J22A 3WV6A 1AYM1 1QXRA 1STMA 1Q8OA 4XVHA 3S30A 4L99A 3ZLIA 3H0OA 5CU1A 3T2PA 4E8DA 1UWWA 3PUIA 4YGEA 2RS52 2QQKA 5IK7A 4PBOA 2VE1A 3APBA 2YG0A 4NHYA 1X36A 5JIUA 3WP5A 1UPSA 5FDBA 1OH4A 4GWMA 1L7LA 4GALA 3S6PA 2IVIB 5D21A 4WVMB 1AJKA 1MEC1 1YCIA 1W8UA 2PHLA 3S5AA 2ZKNA 3AB0A 5FJKA 5H9PA 4NIHA 2XB6C 4FP3A 2YUEA 2C9AA 5LASA 1W0NA 3LD8A 1ZBA1 1VBA3 1ODMA 2VC9A 1UZVA 4R9AA 1NXMA 5KWRA 2GNTA 2VW2A 3FN9A 4B1MA 5JOYA 1H0BA 1TE1B 4IGPA 4MH0E 5FPLA 4R9CA 5F37A 5I8YA 2YHJA 2QNKA 3D6EA 4AEDC 4BISA 2D6MA 2RHPA 2VXJA 2XWBB 4NAOA 4O65A 4Y20B 2D6LX 1SLIA 1QJU2 2VD7A 4RR3A 3ASIA 3ACGA 4DEVA 1I5PA 4IE6A 4QM8A 1J59A 1PM7A 1RMU3 4PDWA 5BNNC 5LA1A 4LXLA 4LHNA 3RZMA 1TNRA 3JCIA 2RM22 3ZPOA 1RUI1 2MEV3 3ILRA 2PMWB 4EZHA 1ZBE2 1GOGA 4Q4W3 5A3NA 2OT7A 1OLME 4XYXA 3UGFA 5I8TA 2SLIA 2GH8A 2PFWA 2WFF3 1EV12 4IL7A 4XBQA 4RHV2 4TWTA 3K4ZA 1FNZA 2CGPA 5EPAA 4E2GA 3SCFA 1LECA 5DABA 1OSGA 4UOJA 2Q1MA 1CONA 4EN0A 3M3QA 4S2FA 1Q43A 1VB4A 4HVRA 5A1FA 2RS51 3CU7A 1AHSA 2HWF3 3VBSC 3LFMA 1YWKA 4WM7C 2YMZA 1GSLA 3WNLA 4A41A 2ZZQA 3LEKA 4XDQA 1DGWA 1RIRA 4JGZA 3PVBB 3LCPA 1S0DA 2WSUA 2YC2A 4KH9A 1LEMA 4XF3A 3VUOA 3IZOA 3DV8A 1K42A 3ZYPA 5IFTA 1JZ3A 2IXKA 1YJLA 2QQOA 3CQOA 4I2OA 3ETQA 4KWJA 1GLHA 2FZ1A 5FY4A 2BGCA 4FPGA 3IPVB 4IEPA 4CCEA 3WNPA 5C9AC 4NPRA 1DGRA 2ZHKA 2BU9A 4RYDA 3BI3A 1EPWA 1LOGA 3HBKA 3AVSA 2QQNA 3AJYA 4QPGC 1K3IA 4IETA 4FFFA 2G19A 1HX6A 4Z2WA 4YVSB 1XE0A 1NUKA 2XXZA 3U4XA 2P5BA 3RYRA 4ATEA 2XJVA 4LKFA 5EXOA 3OUJA 4YGCA 3WW2A 2VMFA 3LAGA 2Y8KA 1FPN3 3N36A 3KZ4C 5A6ZA 3H7YA 2FCUA 3W59A 1OLQA 4ZONA 5J98B 1V6NA 5ERLA 2QQPA 5GZEA 2W94A 1BQPA 2DUOA 1LULA 1HRI3 2WT2A 5BV6A 1IS5A 3PL0A 4XFAA 3T2TA 3WOGA 2FBEA 1DGWX 1N1YA 3B69A 4FFGA 4KWKA 4LOSA 3BB6A 2ZA9A 5FV3A 4JKLA 3THCA 3LFIA 3ZMNA 5IT6A 1UOBA 2PLV3 4ZPIA 1RVF1 2QTWB 2WNUA 4LO4B 5FKBA 2VTXJ 4KG8A 1V6JA 3CLPA 1KDKA 3OYWB 1IG0A 4L9BA 1VLNA 5BNPB 2E26A 3W58A 1R093 4WBBA 3IDBB 3K51A 5M0TA 4JGZC 5T5LA 1Y9MA 5JMCA 1RVF3 2V4VA 4YGBA 5FZ3A 1RUC1 4HL0A 1A34A 5CKQA 5FUNA 1GV9A 4Y1VA 4B4QA 5JPMB 5FZGA 1O3SA 3KQ4B 1HXS3 1YFWA 3OBRA 3KV5A 3URFA 5KXCA 3VDCA 3DXUA 1QHDA 5JXHA 3D8CA 1R092 1OF3A 3SXWA 3TNPB 3POBA 5LY1A 3AL6A 5CFCA 4L0PA 5FPUA 1HN1A 5FZ4A 3RVHA 4BLIA 4CUGA 1S55A 5JSOA 3NJYA 4XF0A 1DZTA 4XQWA 2W1QA 1OKQA 2NP0A 3TOJA 3B94A 3T0AA 3UKTA 1SPPB 3PJQA 1ASJ1 3OBAA 1WW4A 1SDDB 1K5MA 3M3CA 3ZDSA 3K4DA 3RZLA 1PGL2 4YRDA 1VALA 2XMLA 2WNVC 4MGKE 4NRQA 2Y0OA 4G9SB 1LESA 4OQ8A 4P02B 2YZ4A 4E4SA 2AGSA 3GALA 3OF1A 5DUXA 1ZZ8A 5A3PA 1MZFA 1AZDA 1SLLA 3POIA 4MGYE 4N90A 3RRDA 2XLFA 2JXAA 3F2ZA 2VOVA 4M3CA 4NVPA 4CU9A 2DVAA 3QH7A 2BFUS 1ZREA 1WCSA 2XVKA 5EQUA 1NLSA 3CJIA 1U5ZA 2IVJA 2VUDA 3ZFGC 4QXCA 3J7NA 1O8PA 2VZ3A 2DVFA 1LHWA 1LJ7A 1WBFA 4TXWA 5FZBA 3ZFFC 3ZN4A 4CDWC 3NNMA 5EIYB 5FQ0A 1YJKA 4Z1VA 1R64A 3H8XA 2VTFA 5EJ1B 3DPRB 3H8RA 1QNWA 1W8NA 4CDUA 1DYPA 2A3XA 3ZYFA 2MPFA 1B35B 1CGPA 2BVVA 2R042 2RVAA 1IOAA 4HOOA 2E7QA 2IZWA 5FLJA 3LE0A 4I3GA 4F3JA 4GMP0 4C91A 1H2NA 1B35C 1FI2A 4LKSA 4YLZA 3BUCA 1XJAA 5HV0A 1H1MA 4J1XA 1D0GA 2RJLA 4LBMA 1C8M1 4AI3A 4YW6A 3IIAA 5DZEA 4BK4A 4D3WA 5EYXA 2Y6LA 2ZGLA 3EQEA 2ARAA 2OX0A 2QE3A 3HAGA 1T6GC 4KBZA 5C8CC 1G7YA 2UYBA 2ZX2A 2O1QA 2YBSA 1J3QA 3WR0A 4QMAA 3RPQA 2VZTA 1W8ZA 1AXKA 3U10A 5LZ6A 1F4HA 1C57A 1RUE3 4JC1A 2VOWA 3O1UA 4AFDA 1H8TB 4NRMA 2I45A 5F5CA 5FYBA 3RZZA 4EWAA 1WLTA 2JENA 3MIHA 5IVBA 4CCJA 3VBRB 1X8MA 2WA3A 1D4VB 3DUIA 3AMPA 4I3PA 4A45A 4CYDA 1NCRC 2WLQA 3POFA 5CFDC 3A23A 5KHJA 1E5IA 1IS4A 4CVUA 3EBRA 4HETA 4BB3A 3OCPA 1LR5A 2UU8A 1RUE2 3IAPA 5K9YA 4Q1PA 5L9VA 3I4IA 2XOMA 3T2OA 3VD5A 3WDVA 4FQ4A 3BOPA 4OFGA 4A6OA 1IKPA 5A3UA 4Q0SA 3HIFA 2IXLA 4DPNA 4EROA 1UCXA 3I2GA 4CDWA 2GALA 2RS12 1V6OA 4XHBA 1RB8G 4MOAA 1WUVA 4K3UA 3SH3A 1IS6A 5D1IA 2VM9A 3RMYA 1B09A 4LKDA 4NAMA 1J3RA 1XE8A 5FYMA 3HWJA 4RSUA 3U0ZA 5JI7A 1F9KA 1TME2 3OG2A 4XFBA 2Z5WA 5FZHA 2RS13 1REDA 2KXLA 2VXRA 5FZEA 3BGAA 5SV8A 3OGJA 1B35A 3NWKA 4XDOA 2D44A 3ZFGB 2RJ2A 1DGRN 2NPIA 4TZDA 2G9GA 2F17A 3UJQA 1W8FA 4A6SA 3MF6A 1GYKA 1LOCA 4IE0A 4LHSA 5BPXA 4TSVA 1A6CA 3B9CA 1GQHA 2DBNA 1E5SA 1OPOA 2Z42A 4IQPA 1DP0A 1X82A 2VO5A 3L2HA 5FP4A 3S5QA 3M2MA 4XUNA 2ORZA 4FSJA 4YW3A 4YPJA 5F3GA 3Q8AA 3WY6A 1TVGA 2ZJCA 3RJ2X 2XBO2 1LODA 1AR73 1H9WA 5FYHA 1GZCA 5FZDA 2W9XA 4FPEA 4Z2AA 3E97A 5HCAA 4AVAA 2J7MA 4R52A 5FTTC 3V65A 1C5IA 1COV2 2HEVF 3I7DA 1BZWA 4LOTA 3SLIA 4RS5B 3H3LA 4AXOA 2OYZA 1JW6A 2JG9A 1UU5A 1WMDA 1N3QA 4A7YA 3USSA 3D3AA 4AG4A 1AR81 3ZFEB 1W03A 4TN7A 3M70A 2EXHA 2X5IA 1MZ6A 4FOYA 3TEWA 3WNXA 2Q0AA 4BQ2A 2PXJA 2VCCA 3IB3A 2AZ5A 2OXBA 4XAEA 4AI8A 2RMU3 3ETPA 1W06A 1PMJX 5E6HA 1LKNA 3ZKYA 2Z2SB 5HXMA 1QXPA 1SFNA 1C3HA 4WM8C 2W52A 4DOUA 3KVBA 4Q4V1 4NPMA 4E4ZA 2J1AA 4A2UA 2XUEA 1BEV1 3IM0A 1CD3G 2WS92 3RZHA 3KCYA 1MS0A 2K2SA 3PVNA 4IEUA 1MACA 4LBJA 4QT6A 2FMDA 1TQ5A 5C3RA 1SFPA 2CSGA 3TN93 1XPWA 3BIWE 5H9RA 1H8TA 4UI9L 1VBB1 3L2YA 5DAQA 1SZBA 4FAHA 2VNGA 5FZ8A 1X7NA 2HJIA 2Q30A 4HSLA 2YXSA 2WS93 2WSVA 5D8AC 5JLVA 4LLOA 2HWE1 4GWIA 2L9LA 2AYHA 5FYYA 3SISA 5I93A 5FUPA 4CDQB 2IUWA 5IK8A 3SH4A 3MUY1 5BNPA 1QMJA 2BQPA 1WCDJ 4Y5TA 1Y3TA 1LHUA 1UMZA 2WABA 3QH6A 3SITA 5AVAA 1GU3A 1NQJA 1R091 4H55A 4Y5SA 2DWRA 2WQ8A 1SLCA 3Q8BA 4X6RB 3VL9A 5FZFA 4YZ2A 5A3LA 3O1TA 1HRV3 5IVJA 2CL2A 2GP3A 1WMXA 3JBG3 1TG7A 3OBZA 2D3PA 2PAKA 2VQUA 5IK4A 2LM3A 2ZGOA 4FPOB 4M3CE 4Q4V3 3J7LA 2PHWA 1DZRA 1ULCA 2CTVA 2HWF1 1H6XA 4KBBA 4N7UA 5J3UA 2JDKA 2VQ0A 4ZXKA 2WZPP 1CZTA 2WJSA 3POYA 5FMBA 2VVDA 2GAUA 5EP9A 2VQAA 3GCXA 1AYN3 1LOFA 2X05A 3RQ0A 3UGGA 1FPN1 5BNOB 4FOQA 4CUAA 5DXDA 2WAAA 3OPTA 5HCHA 3WZ1A 2WAOA 3LEGA 3O1MA 1BHGA 5LBFA 5LBCA 2V73A 5FY8A 3D82A 4C8DA 3DKWA 2VCBA 4IV3A 2C4XA 3AXDA 3SKVA 4PLNA 1HB2A 4YFWA 1URXA 1SBFA 1OMIA 4DXSA 1G9BA 2OIIA 2NMNA 3FHQA 2ZGPA 1OOPC 1AYM2 4M3CB 1OLRA 1TNFA 1A78A 4XXAA 4BQ1A 4GWJA 5C70A 4FT8A 2W46A 5A80A 2OPKA 2PYTA 3CJIB 4RR3C 3VD3A 4NIDA 2DF7A 2XH6A 4ATFA 3N9QA 1H2MA 1S0BA 4MSVA 3IDAA 4RQPA 1CAWB 4P9JA 1ZNPA 4CP0A 2CNAA 3T3YA 1QJX3 1W6PB 4K21A 2ZMKA 1QJFA 2XVLA 3JUUA 3DPRA 2D5HA 3PLQA 3WW1A 1RXFA 4CCNA 2OQ7A 2AR6A 5SV5A 2OPWA 3VKFC 2B45X 2IFRA 4BQ4A 4EWEA 2WFF1 2GH2A 4Q4Y2 3J4UH 4Q4X1 1W8WA 3UYJA 3E5QA 5JSRA 5BXXA 4UW4A 5C7GA 4RFRB 3S7IA 4MXWA 4QXHA 3LGRA 4YVWC 2XHKA 4AOCA 1GWKA 1CPNA 1R1A2 4DUVA 2R071 3I2JA 4B1LA 3ACHA 4A7KA 3VBSA 4C0HA 2D6KA 2ADDA 4YM0A 2H0BA 4OYUA 4JQTA 1VP6A 3MYXA 4GQ7A 3AMQA 4AVCA 3C8XA 3AX4A 1W9SA 1WGPA 5FMDA 2PQSA 2WQ4A 4K1YA 4PLMA 3TAYA 4AHWA 5F7UA 1ND2A 2XLAA 3DN7A 4AEMA 3OGVA 1JYTA 4C1WA 2YPDA 3V0BA 5GLVA 2VMIA 4NHMA 4CDQA 4FCAA 1OH3A 2RR11 2EF6A 1G86A 2BWAA 2DURA 3JD71 3U37A 4WVWA 1X50A 1KJRA 4IV1B 1RC6A 5FP3A 1DGLA 1UYYA 3IAQA 3TN92 1N1TA 1XSQA 4N53B 2WA4A 4HT1T 5IAXA 3MI8A 4XF9A 1ST8A 1OVSA 3WQ1A 1QQP3 1O59A 1FOD3 3WG1A 5IK5A 1QU0A 4N43B 4FOVA 3DPRC 4UWDA 4AHXA 2VBDA 2WR9A 2ZACA 4OI1A 2BRTA 2R061 2R6QA 2JDMA 1LU2A 1PK6B 1XYOA 3VKOA 1QKQA 1PGSA 5BUVA 1AR71 3C7OA 2GMPA 1YYNA 4JTNA 1W2TA 1X9PA 2E9QA 4BQYA 2XPJA 1SLBA 5FP7A 3UK9A 4DS0A 4CU7A 3SCGA 3WNKA 3PVOA 5FK7A 5CAZA 4UFLA 1W05A 5ABJC 1N1VA 4WVVA 4Y4RA 4HG6B 5CZKA 4F8AA 3HR9A 4NN0A 1OVPA 5FPVA 2XBO1 1NLQA 4Q29A 1S2BA 2C5DA 5LEKA 2A75A 4MLOA 3V0AB 4CCLA 1QJX1 2A6WA 2RR13 2RV9A 4YM2A 1AR93 4GH4B 4FTBA 2G4IA 3B00A 3VBSB 2GP5A 2YC0A 3VD9A 3S57A 4B29A 3I3BA 4IV3C 4XBNA 3MICA 4CP9B 5T5JA 3P3PA 1O8SA 5CG8A 1LOEA 1SDWA 2HH9A 3JB4C 3VBFC 4AEDA 2PAMA 2CWSA 1UY1A 4AVTA 4Y26A 4RGKA 3RYPA 3KT7A 2JB8A 2C26A 3LZZA 4LKEA 1RUH1 1QH6A 4JTOA 4COWA 1JUIA 1XNCA 2PHXA 4QHOA 1RXGA 1US3A 2F4LA 2ZGUA 5BNNA 1ULGA 1XNAA 4OULA 5LA2A 2FDKA 3IMMA 3IIIA 1AYM3 1UOJA 1NYWA 1HB4A 1UZWA 3KS7A 4LHKA 1CAUA 1RGSA 4LBQA 3T4HB 2V5YA 3ZFEC 2R7EB 1LEDA 4IESA 1FNYA 1XYPA 4Q0VA 4QDRA 4MXWB 1JS9A 1QEXA 2ZMNA 2PQQA 1SCRA 3KT1A 2XONA 2DDUA 3KHBA 1R081 2ZHLA 4OUSA 3ZN5A 4IE5A 4LBOA 3LDBA 3OY8B 1JYWA 3I59A 2Y38A 1W9WA 5J37A 5CFCB 2HWD2 4QDQA 1HDKA 2RDSA 4CSWA 1RUE1 5IVVA 1DQ6A 2JE9A 4BWOA 2DBIA 3ORJA 3ZIWA 4CEYA 3AYAA 4W8JA 2ZGQA 3NNLA 3VBHA 4I02A 4DUWA 2ADEA 4B3NA 4YGDA 4FTEA 3VL8A 4IGOA 3MW2A 1CX4A 2WLPA 2MHFA 4CPBA 3WX5A 2DCJA 4L2NA 5ACA2 5FYCA 1SPPA 3OUIA 2O0OA 1AX0A 5FXVA 3SKJE 4EQVA 3OSDA 4Y5Z0 3SH5A 5KBFA 3H1WA 1OD5A 4HKLA 2ZX0A 5C9AA 4JKKA 3HT2A 2JDUA 4GH4A 4JHTA 5L9BA 4QKDA 1AVBA 2B42B 1QJEA 3MHZA 1JBCA 4RN5A 3ZYIB 4ARYA 5A1AA 4CP9A 3O5SA 5FZKA 4XE9A 4MV2A 3I3QA 3HOBA 4FP2A 4HKWA 4PDWC 4IW3A 4NUBA 3ZPYA 2DU0A 4OHWA 4DRRA 1UU4A 1CPMA 2R043 3EXUA 3IMNA 2OA2A 2P2KA 4INDA 5A7QA 2BEOA 2ZGKA 4XFIA 3J9SA 5J09A 4YW2A 4MHRA 3P5BA 1LTEA 1HLCA 5FMOL 4CDUB 4LT5A 1ENQA 1N1SA 1VBD1 3AL5A 4XF4A 3ZOIA 2IC1A 1HRV1 1VRH1 2ZEWA 2XR4A 3MDPA 1UKGA 1QQP2 2XUMA 4LO7A 1QH7A 4ZS2A 5IHRA 5FYSA 5FOJB 3CO2A 2PTMA 3GYDA 3GBGA 5DPNA 4BIOA 1DLCA 1O4TA 2JIGA 2ZGMA 2VBBA 3WDWA 4HFSA 3WDYA 3BVCA 1QJU1 2OQ6A 2VNOA 4LUKA 3RG0A 1I3HA 1Q8VA 2VZRA 3A21A 2GC1A 1KGYA 1N47A 4X8PA 3I59B 2HWC2 2IXJA 2PHFA 4JCKA 1BBT3 1UOGA 2B46X 2GMMA 3I3EA 2B39A 4XHXA 1VBB3 3LIGA 2XL7A 5FZCA 3BTXA 2H0VA 2V09A 1H4HA 3POSA 4LO6B 1NY71 2VG9A 1Y9QA 3I2HA 3Q8FA 4KQ7A 4NHLA 1GWMA 3ZSEA 4L92A 1ONAA 4RQPB 4GMP3 1UIJA 5BNNB 1W6PA 3HQUA 3IN9A 4FPYA 2A6YA 1TMF1 3FZ3A 3VHNA 4XTPA 1GZWA 1REEA 2A6ZA 3W9AA 3DYOA 2V5DA 3AP4A 4XCAA 1JHNA 4COZA 1SG3A 5I0SA 4GJYA 1ZZBA 3T08A 4K6BA 3W5MA 4AVBA 2FCTA 3N3HA 5B2GB 1GOFA 1A3KA 4PI2A 5CB7A 4LUMA 1HW5A 4WVZA 4Z8BA 5KXEA 1IQAA 3J26N 4W4ZA 2XLGA 1OLMA 4JGZB 2QFEA 5JXGA 1W9FA 3TRSB 1IS3A 4SLIA 4UF0A 4HONA 4H14A 4N9IA 4YZ3A 3RMXA 3AMNA 1W99A 1CWPA 3AYDA 2VJXA 2AENA 3FLRA 2NLRA 2YC4A 3TYJA 1D4M3 3AFGA 4BK5A 1PGL1 3WQ7A 4J6GA 3MIGA 2JD9A 5GZFA 3WEZA 5CA6A 2VU9A 4UYBA 2GN7A 1LNSA 4JX0A 4LJHA 3NVCA 3ZFGA 1W0OA 3VBHC 4BXFA 1F4AA 1TZOA 4BDVB 4JDMA 3U14A 4IEZA 5F5AA 2HWB1 3ZM8A 1VAVA 2YB7A 4N43C 4K20A 2ETEA 3FFZA 2AEYA 4IV1A 3I3DA 3IBMA 2DFCA 1XU1A 3NO8A 3IT8A 1PK6C 4H7LA 4PCRA 2HWC1 3WG4A 2VECA 2WZR3 5CIRA 2W1SA 5HPOA 2G9FA 2UYAA 4FOWA 1UAIA 4YZ5A 2VUJA 4CCKA 3KQRA 4QU2A 2WT1A 3O14A 3ZDVA 3I2KA 2HWB2 2VTXA 2ZX3A 1US2A 2VAUA 4JRLA 4LMFA 3NV3A 2JG8A 2R49A 2WDBA 1CR7A 3CMGA 2RE9A 4Q4X3 3OPWA 3F95A 3T30A 1Y7BA 1U5YA 4QGLA 3O12A 1V9U2 2XBO3 1ZM1A 3OJBA 2TNFA 3SHRA 3E5XA 5C8WA 2LUWA 1OUSA 2WWSA 2D97A 4BE3A 5FPXA 4MGTA 4Y24A 4QB6A 1ZZ9A 1G9DA 1FX5A 1BEV2 1AUYA 2P37A 4IEWA 4Y1UA 5DUUA 5EYYA 3SMHA 4BJ0A 1YI7A 2XQRA 1MS8A 3HNMA 4Q8LA 1J58A 1WBLA 1V6LA 4AHYA 5JZGB 1P8JA 3LOBA 1W6QB 1MEC3 1RUC2 5FZ9A 2KD7A 5HCBA 4COVA 5JPNB 3MLJA 2Q8CA 3AFKA 2G9ZA 3OD0A 5FBJA 5F8PA 3ZXAC 1PVC2 1JOJA 1HB1A 1WKYA 3HVDA 3ZSLA 1RUI3 1C8M3 3THPA 2FDJA 3D0SA 3LWCA 4W65A 1GICA 1QQP1 4DINB 5GM0A 1YHFA 2V72A 3OPZA 5I0TA 1JYXA 5LBBA 2GC3A 1PIV1 2XJUA 3QLQA 4I0BA 5I0RA 2R0HA 1HB3A 3ZN6B 3ZKUA 1ZRRA 4K8FA 2HWC3 4XUQA 2AH2A 1AYN1 3VKNA 3MPPG 4OZXA 4YZ4A 1T2XA 4EV0A 2W2IA 4UFHA 1XYNA 3THDA 1ASJ3 1KS5A 1DQ2A 1D4M1 4XQ4A 5CKNA 1Z0HA 4NROA 3VBRC 4CXWA 1R1A1 5DAPA 1DG6A 1OC1A 5A7OA 2K46A 1I6XA 3LIHA 4ASLA 3OD4A 1UIKA 3VN4A 2VPVA 4YYOA 1NE6A 3O1PA 1BJQA 3OY8A 2ZHNA 5JR7B 5C8CA 1J84A 1VAKA 4D69A 1BCXA 1LCLA 2R0FA 3MLKA 4URAA 2DUQA 4XCBA 2Z4FA 3O0XA 5B4XA 2CAUA 2WZR1 4G3YC 1ALYA 3B7MA 1RUD2 4YW5A 4CCDA 4QGMA 2KM2A 5FO7B 4BM8A 3D5OA 1GOHA 1L7RA 1VB2A 3I2IA 1W8HA 1QDCA 3GZUC 2OZ6A 3M1HA 4YVSA 4Q4V2 4CUCA 4W6WA 1CAXB 1MS4A 5FPBA 4BCUA 2LALA 3DYPA 3AC0A 3ZO0B 1QNYA 3FL7A 1ZVFA 5HXVA 3ZXGA 5LRRA 4XJZA 1OHFA 2ZX4A 2K0GA 1NE4A 1QJX2 5DQ0A 3AKQA 1WD3A 4L97A 2GNMA 1KS4A 4Q1RA 2VMCA 2HBTA 3U1XA 1OUXA 4EWDA 1OA4A 1KFUL 2J42A 4KI5M 4P00B 3VZOA 5A70A 2ZAHA 4JRAA 1BMV2 1U12A 1VRH2 1RINA 1Q8SA 5GLUA 5LA0A 2P3JA 3FC0A 5FYIA 2DTYA 2ET1A 3C2UA 3SCHA 3W21A 5L7OB 4XURA 3VBRA 3IWZA 4IEOA 2D6OX 3ALQA 2JIJA 4R4ZA 2QKDA 3LSDA 1YC61 1LGBA 4UT5A 2WNUB 4Y22B 5G05L 1W6MB 1LHOA 2BV4A 1VRH3 1QIQA 5FZ7A 3NRUA 1GANA 2JDHA 4BQ3A 2RDNA 1UNBA 2XJRA 5IATA 5KHKA 5FIXA 3JXSA 1NCQA 4FPJA 3ZVXA 3PUSA 4V2WA 3SEPA 3W20A 3O1VA 3R6SA 5L19A 2YYOA 1GP4A 4Y33A 5CG9A 1GBGA 3AZVA 5FP9A 4EN6B 4CEWA 4OHVA 2B9UA 2ARBA 4N7IA 1FAYA 2H6BA 3KV6A 4P9IA 4YM1A 5APAA 1CAVB 3ACLA 1RJ8A 4ISQA 5JDBA 1MS1A 5C4WA 4WM8B 4GIQA 2IXHA 1TMF2 1VBC3 5JWPA 2BBVA 5FZAA 4MGZE 1XSRA 3BODA 4YVSC 4GD4A 4S2GA 2JJ6A 3M8LA 1R083 2WZ8A 4CXYA 5LA9A 3WQ0A 3KMHA 3LA3A 2ZCWA 1AR72 4MZUA 4LPLA 1ND2B 3EHKA 4D8MA 1SBEA 4KNCA 2DVGA 1M06G 1JZ2A 5D8AB 1RJ7A 2HWE3 2QQMA 2R062 5FY9A 1J1TA 4IE7A 3VBUC 4BQWA 3WP3A 5C5TA 4P14A 4ITCA 1G6NA 4P9WA 2Q5TA 5I0DA 4RHV3 2WKKA 2G1MA 4QB2A 3BALA 5CYYA 3CBNA 4K7JA 1Z7S1 1UKRA 2FCVA 1Q8PA 4OHXA 2HLEA 1RUNA 2P3IA 3ZXLA 4AQ2A 5FJHA 4CDXC 3HQRA 1DHKB 1KJLA 3R4SA 3N9OA 2WO7A 5A7WB 1HRI1 3VDDA 2BVBA 4YG3A 5HV4A 1IPKA 5A7PA 5I91A 2Z69A 2XKPA 1H2KA 3DL3A 4O9EA 3KHCA 1WLDA 3IDCB 4Y1YA 5HCFA 1LHVA 4XJ9A 1VMHA 5F1RA 4BIFA 3JQXA 1NT0A 3V56A 5LBEA 2NQYA 2WWJA 4CU8A 2QZ2A 4WZCA 4NHKA 4WV8A 4E27A 3N9PA 2CAVA 4MO3M 4Q27A 3MW4A 4QQ2A 5F9TA 2JD4A 4ZZ8A 2PHDA 1YFYA 3MFCA 1PVXA 2EALA 1NCQB 5CFDA 1RHI1 1O7FA 3KF3A 4Y20A 5A7NA 3WDTA 1RUG3 4PJYA 5A3OA 1XB9A 4B7KA 1ENRA 2PHUA 4QQLA 2VGDA 4X6QB 5GLZA 4CEWB 3V0AA 1EY2A 4J1WA 1KXGA 3PJYA 3NNJA 5FO8B 1PIV3 1IHMA 2DCZA 2UWBA 2YGMA 3MIBA 3C7GA 4XFFA 3WW3A 4ES8A 1Q56A 4PIZA 5FK8A 3N7KA 1UPIA 3CJXA 1E5HA 4AEDB 4IE4A 2R1BA 4Q4W1 2K9ZA 5DZGA 2EXJA 2RR12 4Q8KA 1ULFA 3ACIA 1C1FA 1XOYA 4LK7A 4RGAA 1O4ZA 1PO22 4L11A 4QPYA 2Q8OA 1GP6A 2RS53 4ZU4A 4COUA 5KR7A 1BMV1 2VR4A 2YFZA 1CVNA 3O0VA 3VD4A 5CVRA 4AEKA 4XMAA 1QOTA 4NMIA 1DF0A 4XQDA 4AQ6A 4FPCA 5IAVA 2HWD3 5FKCA 1ZA7A 2C6SA 4IEYA 1PO23 4CU6A 1CAUB 1G8WA 1UYXA 4LBQB 4RL7A 4UW5A 4XF1A 2P6HA 3POGA 1ND2C 2PN5A 3FBYA 3Q8EA 4B4PA 2A71A 2DVDA 5LATA 1LRHA 1SLTA 5LK7B 4AAXA 2BNNA 2WUHA 3AYCA 3VBOA 3NV1A 2WINB 5H9SA 5IVYA 1JYCA 4DEQA 1W6QA 5FYUA 1CX1A 2Y6KA 1S2EA 3VGIA 4K40A 5IWFA 1POV1 4DMIA 1D0HA 1S0JA 2VVEA 2FHRA 1ZA4A 4XJWA 5DAXA 1OOPB 3UGHA 2CV6A 4FTSA 3HNBM 1UY2A 1S2KA 3I2OA 4XUPA 2OW4A 2FDIA 1VAMA 4Y1ZA 4FO9A 3WLUA 5GZGA 1ZRCA 3D0JA 2VZUA 3WHTA 3KLSA 1SFYA 2WNVA 3IKWA 2Q8EA 4XAAA 4NRPA 3MPBA 1KFXL 1UMHA 1BKZA 2UWCA 2EXIA 2RM23 2BPA2 3AP5A 3GZEA 5FFOC 2RDRA 2WNOA 2YFUA 1LAJA 3HEIA 4AGGA 3CZJA 3VKMA 3QOPA 2BOIA 4PIXA 1NAEA 3A22A 2A1XA 4D0QA 1Y9GA 5C8CB 5GZCA 1JZ8A 3BKZA 1ZRFA 5FLHA 5A7WA 3ZFFA 5BY5A 1HXS1 1PZ9A 1JZ6A 1RUG1 1SQ4A 4A4AA 1QXJA 1FOD1 3B5LB 1D2SA 1VBE3 1S0CA 2BZDA 4N8MA 4AEJA 3U78A 4DIQA 2VNVA 1RMU2 3FE5A 3POWA 2HWF2 4UFKA 5J1XA 4X8NA 3ZSJA 3HD8B 1BYHA 3A0KA 2WO3A 1PM4A 3JD73 4XOGA 3ZXDA 4MG2A 5AC91 2DU1A 4YG6A 2DTWA 3INAA 4YVWB 4M0NA 1RUJ1 4LORA 4BH9A 2QQLA 1ZYBA 3FBMA 3C3VA 1EV13 4L8QA 1NKGA 3THTA 2GDFA 2UY8A 1PO13 1UX7A 3FHIB 2B7YA 2QQJA 3T0DA 1RHI2 5K4LA 5JUVA 4M0HA 4S2HA 3T1MA 1HKDA 2BGPA 4GZ9A 4P5HA 1AR82 4WVMA 2JKBA 4XDPA 5HBAA 2YROA 2P1BA 4HMZA 1PZ7A 4YNIA 3ECQA 1BBT1 2A3WA 1RUG2 2E31A 5K8SA 1JXNA 4M4PA 1DLLA 4HK9A 1JOBA 1IKQA 4Y22A 2DVBA 1GZTA 1X9TA 3OGSA 3UJOA 1OF4A 5IYYA 2XL9A 2OVUA 2ZTNA 4MYEA 2Q1ZB 4C90A 1GZWB 3AKRA 4LLFA 4WM7A 3H8UA 1QF3A 4P08A 1WWYA 3BTAA 3MGUA 3WVJA 4A7ZA 4LIVA 4KWUA 1AL0G 1VBC1 2BW8A 3OTFA 1AL22 3KSCA 4GKXA 4QX2A 4ZKTB 5FZMA 4DY5A 4FXKB 5LK5A 1SCSA 4AQSA 2VUAA 3CDZB 1OPMA 3FLTA 3JBG1 4COYA 1UX6A 5FP8A 5C4WB 1YUDA 1CZSA 4JDOA 4UXAA 2XDVA 2VZVA 2A73B 1OOPA 1NLRA 1AR92 2YDEA 4GH4C 4HK8A 2VY0A 4XIKA 3BU0A 4BPZA 5E16A 5E8AA 5ABJB 2X10A 3C7FA 4KWLA 1ULDA 3AXEA 3RI9A 4OLLA 3ZXEA 3KD4A 3VB9A 5A3MA 4HN0A 1S1AA 1OA3A 4K9SA 4OHYA 5I0UA 2VW1A 4FFHA 2A5ZA 4BLJA 1REFA 3UKVA 2JKXA 3CZUA 4FQZA 1O5LA 2BDRA 4K1ZA 4Y3OA 3E1F1 4V1PA 3K48A 1YEWA 5DG1A 5T50A 4JGYC 4P9XA 1VMFA 3WF3A 4CCOA 2PLV2 1Y4WA 1GNHA 2W87A 2ZAAA 3LEMA 4QPWA 2N7GA 3FX3A 4GB32 3AYEA 1H1AA 2PELA 4UFJA 1WZXA 2D3RA 1MS5A 2ZEYA 1UZ0A 3K3OA 1SBDA 3GBFA 4P9GA 4IGQA 1HQWA 1GZ9A 2JG8B 1HJFA 1XU2A 3J7HA 4OCTA 4FPLA 1NQDA 3BTZA 2ATFA 2Z79A 4S2DA 4UFIA 5A33B 3VDBA 3N4MA 2Y6HA 2YU1A 3GGLA 2X8KA 2WN3A 1SLAA 2WYSA 3NAPA 3QBQA 1MEC2 1RUC3 2BTVC 3R4DB 2X5IC 4BQ5A 1PVC1 2BJSA 2BP6A 3K46A 1KRIA 3ES4A 1IQDC 5CFDB 3HQXA 5F5QA 3KF5A 4BMEA 2ZGTA 3N9LA 5GZDA 3TWIA 4H2AA 1Q5OA 5FZOB 1VBE1 2PLV1 3BPZA 4P9LA 3AM2A 3MIFA 4KGGA 1ZZ6A 3VDAA 5JIAA 1HIXA 1PMIA 1JZ4A 1S0IA 5DG2A 3AP6A 3CNAA 2WZEA 3ZSKA 4CEYB 1C4RA 3AP7A 4AAPA 5JOZA 2FZ2A 2ES3A 5FPAA 5F2WA 4EN7B 4G4FA 4QXBA 4D7YA 1ASJ2 2JB4A 1DYKA 1DFQA 2CWMA 1YQ8A 1RUJ3 1C28A 2A7AA 2IXIA 3RGBA 2QQWA 3K3NA 2WWUA 3OEBA 5ANNA 4BMBA 2XJSA 1H9PA 3VZJA 1W90A 2CDOA 3UL2A 4JKMA 3VZMA 5IW0A 2DV9A 5C71A 1F15A 4UW3A 4W6XA 2CU5A 1RUF2 4AFMA 4Y4YA 3BOWA 2RS11 4EN8B 4ZU7A 5JVVA 4QM9A 1XC6A 2Y34A 3PU8A 2VOXA 2NZ9A 3WT3A 4AGRA 1RUOA 4N53A 1XQNA 4ZY9A 3AZWA 5JOXA 2W95A 4OI2A 2ZGRA 4XMIA 4N9HA 4ORFA 4KU7A 4Q0UA 4Z82A 4ONUA 4N43A 5KC6A 5FO9B 3NAPC 1H30A 1QJY3 4XTMA 2NYYA 3H1YA 1GNYA 3CIHA 3NKGA 4PQ9A 1PK6A 3RNSA 3P1IA 3VD7A 3VZNA 3WCRA 4CDUC 3N7MA 3QACA 1BBT2 2ZHMA 4BOWA 4PT6A 4Z92B 4YZ1A 2JDAA 3NAPB 4IERA 4IDZA 5F6KA 5FYVA 5CADA 1PO11 2E53A 2X09A 3O7OA 1DYOA 5ANQA 3ABZA 1S4CA 1X8EA 2CGOA 2EIGA 2ID4A 4I30A 2W91A 5A6YA 3ELNA 2KR2A 5F32A 4A42A 1QJZA 5GJ6A 3WF4A 4PF1A 1PNGA 1CAXA 4Q5OA 3CF6E 3VHOA 2EAKA 5FMOS 1UXXX 5BNOC 3B9IA 2QCSB 3C7EA 4XJAA 1SMVA 3HBZA 5FYTA 2D43A 4JGYA 3TNQA 3ZR5A 1TEIA 3GHNA 4CPBD 4ASMB 4QX1A 2ZGSA 5CNAA 4XFCA 4BHPA 1UO9A 1JU4A 2Y6GA 3MBWA 1QY4A 1UL9A 1OFSA 1ULEA 3NV2A 3UETA 2YGLA 5A33A 4LHLA 4TYSA 2ERFA 4YARA 2ZZJA 1PO21 3J8F1 3ZR6A 1OQEA 4CEYC 5CEHA 2ZMLA 3K4AA 3PMSA 2W92A 4H3WA 4GB33 3M7AA 5FZ6A 1YFXA 1FMD2 2QQIA 2WC2A 2J1UA 4LO8A 1W6MA 3S7EA 3B02A 4EZ4A 3NQHA 4F83A 1N3PA 4B7EA 2Y33A 1JTZX 1F5JA 1DCSA 2BGOA 2HWB3 1Q3EA 3R4UA 5F5IA 2C9KA 4P9YA 3ZXKA 5C6CA 1WCUA 4YW1A 5F6LB 2JE7A 3ME2A 1POV0 2QVSB 4BZ4A 4D7TA 1WA4A 1WW6A 2R16A 4M01A 2E33A 4Q4X2 2VCMA 2VUCA 5AFBA 5FY0A 1PHMA 5J96B 2ZEZA 4Q4Y3 2ZS6B 2ZKLA 4GXLA 4UF0B 1DDLA 1FXZA 3RWKX 4V2VA 2HEWF 3N7LA 4WM8A 4MHUA 2FD8A 4XIOA 2DFBA 2Y0IA 5EJZB 1ZX5A 2HWE2 2R063 4J25A 2F4PA 1UF2C 2WBKA 2JG8C 4FI9A 3V0BB 4FPFA 3ZYJB 5BNOA 3HN1A 1W2NA 1YFUA 1O3QA 3RSJA 1MS3A 5DDJ2 3RWNA 4JV4A 1YNAA 4CXXA 2JECA 3AP9A 3L9JT 2HBUA 2W08A 1UU6A 5FLIA 1HV0A 4CZSA 1PNFA 1W8TA 2B4KA 4A44A 1OBNA 4DXTA 2JDYA 4R9DA 1JI6A 1UN1A 4CDXB 2E6VA 5DDJ3 5DMYA 1GMMA 3DGTA 4OUEA 5DDJ1 1S0FA 3NW4A 3O1OA 5FYZA 4N53C 4FBFA 4META 3CL1A 4FPKA 4ET7A 1H6YA 2YU2A 4RHV1 4URTA 1KITA 3K2OA 4KL1A 1C5HA 1RUF3 4HKOA 3WXPA 3E6CC 3IPVA 1EAH3 5T54A 1FOD2 5L9RA 3GHMA 4HLTA 3GF6A 3VHPA 3JB8A 3WHUA 2Y26A 4JVAA 4AFCA 4XC9A 1BLZA 1DZQA 4MVTA 5K0UA 1X33A 2RDQA 3PTRB 3KCCA 4KGQA 4ZU5A 2YY1A 2A6VA 3KGLA 3VBUB 2WO1A 3Q9OA 4MX3A 1JODA 1AR63 3MLLA 1EPZA 2NMOA 2E32A 5A3WA 5BYNA 4JDNA 4XACA 3OUHA 5JMOA 4YWAA 3ILFA 2GU9A 1VBD3 2JDNA 1GP5A 2VULA 1LOBA 3WF2A 2C0ZA 4I01A 4LBQD 4OMDA 3I97A 3GCWA 4CCCA 1UYPA 4O7XA 1OD3A 1T6BX 2GC2A 3WINE 2OZJA 2P3YA 2O14A 4QKBA 3U4SA 1KQRA 4QPGA 4PI0A 1LOAA 1EV11 5EFUA 1J3PA 1VBD2 3VV1A 1NG0A 3RI8A 2Y6FA 4OI0A 2VBPA 1W2UA 1OQDA 2WQZC 1XNBA 4W6YA 5C4WC 2I2SA 4M3CF 2W5FA 5D2AA 4MGIE 1TME1 4XABA 1EUTA 2QZ3A 4C0BA 1YQCA 2E63A 3T0BA 3ZYGA 2VCAA 2WS91 3MIEA 5L7OC 2XJPA 1W6OA 4OHZA 4KU8A 5L73A 1W2AX 1WLCA 4QQHA 1TME3 5FWJA 2MNGA 4FXGB 3UESA 3NKTA 3SQOA 5FY7A 4I09A 3KVAA 3J7MA 4AVSA 5FR3A 2MEV1 1E5RA 2YBKA 4LA3A 2P34A 5FZOA 3ROUA 4AR2A 1YO8A 3POJA 5L36A 5FZIA 4XXPA 1YRZA 1W28A 1G9AA 5A7SA 2VL4A 4AK3A 5K0UC 2J1EA 2WNUC 2ARXA 3AMHA 2JX9A 4DUXA 3AKPA 3LB9A 1G9FA 1KDMA 4QX7A 1COV1 1O3TA 4KMQA 3G6JB 1LOFC 1ZBA2 5GALA 4NE9A 1K5MB 3JZVA 5KHGA 5K0UB 1VIWB 3WP4A 4DXRA 2ILMA 2WNVB 4QPIA 1AX1A 1NA1B 5E1RA 5GLWA 3DEMA 1K45A 4R4XA 4UFMA 1JYVA 1V70A 1ZBA3 4XZPA 2Y60A 5FZ0A 4AL9A 3OGGA 3ITQA 5JZGC 2MEV2 4GJZA 2VZ1A 5KXBA 1ND3C 3BCWA 2ZOEB 3PTYA 4Q26A 1XNDA 1S0EA 3CEWA 5DUWA 3V64A 5ACA3 1R082 3RFRA 1YQ6A 2ENRA 3H8OA 3USUB 1JOPA 1R1ZA 1QOOA 3ZMOA 1CIYA 3WSOA 5DAWA 3RYKA 4HVOA 2XWJB 5K7PA 3P6BA 4BU2A 2W1UA 4UBHA 1W3XA 4AFBA 3KGZA 3ACFA 4MGQA 5L7OA 1KD7A 4NPLA 1JHJA 1RMU1 2CHHA 1APNA 1I9RA 2E7AA 3AZXA 5KHHA 1UYZA 3ZYRA 5IVCA 1UD1A 5AVPA 1N3OA 3RS6A 5HI0A 2R32A 1W9TA 2QBXA 3H3UA 3LPFA 4NR1A 4U36A 4LITA 3EB7A 3H50A 1CN1A 5AC93 3M4FA 1ENXA 3NSTA 4Q2FA 4E8CA 4YVWA 1LENA 3WF0A 2D6NA 3MV01 3VBUA 3ZIXA 2VVFA 5F2SA 1VBE2 3ZXFA 3JU9A 2BUKA 1JYNA 3LDRA 3WD5A 3B3QE 1RUH3 2JDZA 4NWWA 1MVEA 4NHXA 2XJTA 2AACA 3WG3A 5CISA 1EAH2 4GULA 2IFWA 4EN9B 3QD6A 4HPKA 5C33A 1BVP1 5C3QA 3VBFB 4JGYB 2TUNA 4YW7A 1NZIA 3VLBB 2KA3A 3LKJA 5A3TA 3POEA 2D3SA 2JDPA 3VBHB 3FUQA 3K77A 1RUH2 4QPGB 4AE2A 2W68A 2BNOA 1NX9A 4I0AA 1RUD1 2IXCA 4LE4A 2CY6A 2YBPA 1V6MA 4QPIB 1WMFA 1RHI3 2EVXA 2VOTA 4MUVA 2CGNA 1SHWB 3GBWA 5D8AA 4O9GA 2J1RA 4XBLA 2PHTA 3LEIA 3ZX7A 4DNYA 3JBG2 4AGVA 1BK1A 4AYUA 4QU1A 3W5NA 4GMP1 2WN2A 1W6OB 5C9AB 1XBFA 2DCYA 4FFIA 1CJPA 5FXWA 4LBLA 5IVEA 2QQUA 4HN1A 2ZGNA 5FRAA 3WCSA 4OVEA 4IEQA 2YPJA 3I49A 3OOXA 2J1VA 2QDRA 5FY1A 2O8QA 1AYN2 2RJKA 4LA2A 1L3JA 3KB5A 1AX2A 5FMCA 1NCRA 2WNEA 4PHZA 5FZ1A 1FPN2 3FWEA 2Q8DA 1O6UA 1QOSA 5ABJA 1PIV2 3LA2A 1M4WA 1RVF2 4OMCA 4TLFA 3U07A 3M3OA 1RITA 2HEYF 2VW0A 1W6NA 4OZOA 2R073 1LGNA 4CRQA 4QB1A 1OA2A 1HXS2 5JXIA 5EHDA 2HWD1 5FOBB 4FPHA 2XG3A 1ODNA 5T5OA 1FT9A 2X29A 1CQ9A 2DCTA 3T09A 1GNZA 3U75A 1OKOA 2DYCA 1UOFA 3H9AA 4JHZA 4QPIC 3OGRA 5F3CA 3T2QA 3WW4A 1BK0A 2R072 1OT5A 4XEZA 5F3IA 1MR5A 1YXWA 3M3EA 5FY5A 3TEYA 3WUCA 4BA6A 3VBFA 3ZSMA 5CBLA 1DQ1A 4XFGA 3R0RA 3SC7X 1Q8QA 3DYMA 4H7MA 1VBA2 3AZYA 3MIDA 5EJ3A 3WNOA 1U5XA 1PZ8A 1ND3A 4Q0QA 4QAWA 5AFEA 1WCKA 4BXSV 4NJ4A 5FAXA 4OQ9A 1POQA 2PHRA 2AREA 2ZXQA 3MW3A 2WZR2 2ZBJA 4D7SA 4MADA 1O3RA 5GKAC 1W04A 4AI2A 1MS9A 3TB0A 1IPSA 4ZZ5A 3AVRA 4LULA 1Z7S3 2E51A 4DRVA 2CYFA 1FV3A 3DXTA 2OUHA 2TBVA 4QXKA 4PQQA 4HVQA 2XJQA 3B01A 1QJU3 4U2AA 3ZFEA 1IZ3A 1DBNA 3E5UA 4QX8A 1WMEA 5J48A 4AZZA 3E6DA 3I2DA 4XUTA 1V6KA 1UMIA 3HN3A 2EXKA 1Z7S2 3DF0A 4QD2A 3NJXA 1EAH1 1V9U3 2IWGB 2EICA 2PAEA 1CESA 1ZBE3 2W3JA 3PU3A 4QX3A 1H1IA 4YW4A 1K5JA 1YIFA 4PDWB 1ULOA 4HZFA 2WFF2 1GKBA 3CJIC 4RR3B 3H1MA 5IUQA 1VPHA 4IEVA 4QQPA 1BEV3 2JWPA 3WQBA 5IVFA 1NCRB 2R041 1HQLA 3PURA 2LRPA 1H2LA 2VH9A 2VMHA 2ET7A 4UBGA 2WRAA 1V0AA 2BWCA 5JI9A 1IGOA 4K8RB 2BNMA 5EV7A 2F6BA 4HSJA 3I2FA 2C1FA 3VDDC 1YLLA 4BYYA 4D6QA 4DQAA 3LA7A 5FZLA 1AXZA 2GC0A 5DZFA 1RUI2 2D7FA 2D98A 1XRUA 3N9NA 3ES1A 4Q4W2 5A6XA 4ZXEA 2UWAA 3CHXA 4PBPA 3N35A 1J83A 4XUOA 1MPXA 1GWLA 1K12A 5CFCC 3PMEA 5KHIA 5LCWL 3WDXA 4XJUA 2BYVE 3TN91 4UW6A 5H9QA 1QDOA 4GAZA 5E88A 1Y43B 3OEAA 1H8TC 4XILA 3RJRA 5FREA 3LOIA 4TTGA 4Y1XA 5J36A 1OURA 4XPVA 3ZFFB 1LU1A 4ZS3A 1UQXA 4LTAA 2AEZA 3EYPA 3UNPA 1YQ2A 2GNBA 4AWDA 1H8VA 2VZPA 1ZRIA 3PHMA 3PIGA 5LEJA 3KCXA 2FQPA 3KV9A 1W6NB 1VBB2 3AZZA 1AR61 3GDBA 1EP0A 2OKXA 1NA1A 2EIEA 5G04L 1IPJA 3ON7A 4A3ZA 1CIWA 3VZLA 2C24A 3NMBA 3RZKA 2UURA 4IV3B 3AK0A 1MZEA 4BQXA 1C1LA 3O1RA 5DAVA 1HV1A 4M00A 4MXVA 3BYWA 5E89A 1PX4A 1XXNA 5LRSA 4LR4A 1RUF1 4ISRA 4UAPA 4AHZA 4SBVA 4RA0A 5B4NA 1NZCA 3BTYA 3VBOC 2RS32 1HQNA 1UY0A 1AL23 4IXLA 2R1DA 3SEEA 3ZN6A 5JOWA 3MZHA 4YSFA 2ZEXA 5C3SA 4RS5A 3WNMA 1YIPA
chains in the Genus database with same CATH topology
1O91A 4RFT0 2H6CA 2RS33 2X5IB 4LEJA 3RDIA 4DFSA 4DB5A 2OUJA 4LBNA 1V00A 5FCCA 1WW5A 1O4YA 2GN3A 5EZWA 1FMD3 1S0GA 1G9CA 2D40A 1UZZA 2VMGA 3G7DA 4NO4A 2TEPA 3A4UA 5ACA1 2GSYA 4HANA 3ZXJA 3I8TA 3KT4A 2YV8A 4LBKA 4Z07A 3EO6A 3WUDA 3EJKA 1FYUA 3R05A 2SBAA 2LTNA 3GZTB 3LSEA 3TBDA 5JCTA 1ENSA 2D5FA 2RS31 4B4RA 3ATGA 4IV1C 2VOKA 5A32A 1O5UA 4QQOA 1F5FA 4GB31 4C1XA 3VKLA 1COV3 2D6PA 5J7MA 3AMMA 1QJY1 3OBTA 3U11A 5DUVA 4XETA 3IDEA 4AF9A 5T55A 3JQWA 1RUJ2 2I07B 1F8VA 1JUHA 2P17A 3UV9A 4AI1A 3S0MA 4RS5C 3QCWA 3VHRA 1W39A 1J1LA 1ZRDA 1A8MA 4DY3A 3B93A 4YFZA 1K5MC 5FQ0B 1AXYA 3NL1A 4QHBA 1GFF2 2HYKA 1I1EA 1PVC3 3FMGA 4CTEA 3FUOA 1DIWA 1AL21 1F2NA 1QJY2 2ZPXA 1E57A 4WZFA 3E6BA 1NA1C 3M3IA 3FFQA 1DQ5A 1CAVA 1LHNA 4E2SA 1MVQA 1D2QA 1RUD3 4GA9A 2JG9C 1NOVA 3FJSA 4OI4A 4FAGA 4R8HA 2R30A 1AR62 4AVVA 1ND3B 4KG0A 1LB2A 2E7TA 3GNEA 1SEFA 5KC5A 1V6IA 1DQ4A 1CAWA 1AF9A 3N7JA 4GKYA 2AUYA 2EA7A 5KXDA 4DXZA 3ILNA 3WG2A 1FATA 4XFHA 5A32B 3WDUA 4AI0A 1CJDA 4RD7A 1MQTC 3HMYA 4WM7B 3BU7A 4CP2A 3I54A 5I8SA 2FMYA 1D4M2 1GR3A 4CDWB 1OFNA 2O8OA 1U0AA 5JZGA 2GNDA 1MQTB 1WLWA 2I74A 3HT1A 3VDDB 4RQPC 2RMU1 5BNPC 2B8MA 4NWVA 1V9U1 4R9BA 2P3KA 1UZYA 2VNRA 5T3NA 1AJOA 5GLTA 4NOTA 4PLOA 2Q4SA 3MEPA 2XGXA 2B5HA 3ENRA 5TSWA 2DUPA 3AKSA 3P3NA 1Z78A 4RGGA 5T52A 3T1LA 4CP1A 2ZX1A 1TMF3 1VBC2 2W0XA 1C8NA 3H7JA 1VJ2A 2W39A 2NN8A 3AJZA 3USUA 3NV4A 2GMEA 1DQ0A 2A3YA 4Q4Y1 2JEMA 1F31A 4LO5B 1WW7A 2HKXA 2PA7A 1XE7A 1JH5A 1UW8A 3VZKA 3A0NA 4E4DX 1EYBA 4FVVA 4ES9A 4PIYA 1PGW1 1OI6A 1LGCA 1R1A3 4D94A 1YI9A 4E9KA 4AQTA 2JG9B 2A6XA 2RMU2 1ZZ7A 4HBNA 5T5PA 4CDQC 2NM1A 3OYWA 1ZBE1 2D93A 4XW3A 2UY9A 1NCQC 3X29B 1W0PA 2WL1A 4GWNA 4CEWC 1GQGA 1C8M2 4LNVA 5EWSA 4IEXA 2QJVA 1QWRA 3VBOB 4HPKB 1NXD1 3SNMA 2QDNA 3JD72 1DU3D 1QGLA 5AC92 3FLPA 1I5ZA 4A3XA 1RL3A 4YM3A 1BXHA 5BNQA 3GZAA 4JAAA 3O0WA 1PO12 2WIIB 4LE3A 1JN2P 1WD4A 2EAAA 4DZGA 1PGW2 3NJZA 3MFAA 2WFPA 5FPZA 1RTVA 4AW7A 1AR83 2JICA 4EJRA 4QX5A 4XJ8A 1ZZCA 2GZWA 1MZ5A 2XKOA 3UKNA 1BVVA 3D4KA 3J8F3 2ZABA 3PNAA 4B8EA 4YG0A 4CDXA 1MQTA 1POV3 3PVEA 2DCKA 4E2QA 3WP6A 1U5IA 1FMD1 4Q0PA 5FBZA 2XVGA 1OQ1A 4I0WB 4QGNA 1XNKA 2X53S 3ST7A 3J8F2 1SACA 2A70A 1VR3A 4OUMA 1HRV2 1A8DA 2WT0A 5JAXA 4F7ZA 3H3ZA 2QUOA 3AKTA 1NY72 3KM5A 4AFAA 1HRI2 5JSPA 1AR91 3MF9A 1H4GA 2BFUL 4JQRA 4PF5A 1VBA1 1JYIA 2RM21 1FV2A 3WV6A 1AYM1 1QXRA 1Q8OA 3S30A 4L99A 3H0OA 5CU1A 5IK7A 4YGEA 2RS52 4PBOA 3APBA 1X36A 5JIUA 3WP5A 1UPSA 5FDBA 4GWMA 4GALA 3S6PA 4WVMB 1AJKA 1MEC1 1YCIA 2PHLA 2ZKNA 3AB0A 5H9PA 2XB6C 4FP3A 2YUEA 2C9AA 1ZBA1 1VBA3 4R9AA 1NXMA 5KWRA 2GNTA 2VW2A 5JOYA 1H0BA 1TE1B 4MH0E 4R9CA 5I8YA 2YHJA 2QNKA 3D6EA 4AEDC 2D6MA 2RHPA 2XWBB 4Y20B 2D6LX 1SLIA 1QJU2 4RR3A 3ASIA 4QM8A 1J59A 1PM7A 1RMU3 4PDWA 5BNNC 4LHNA 1TNRA 3JCIA 2RM22 1RUI1 2MEV3 3ILRA 1ZBE2 4Q4W3 4XYXA 5I8TA 2SLIA 2GH8A 2PFWA 2WFF3 1EV12 4IL7A 4XBQA 4RHV2 4TWTA 2CGPA 1FNZA 4E2GA 3SCFA 1LECA 1OSGA 2Q1MA 1CONA 4EN0A 3M3QA 4S2FA 1Q43A 1VB4A 4HVRA 2RS51 3CU7A 1AHSA 2HWF3 3VBSC 1YWKA 4WM7C 2YMZA 1GSLA 2ZZQA 4XDQA 1DGWA 1RIRA 4JGZA 3PVBB 3LCPA 1S0DA 2WSUA 4KH9A 1LEMA 4XF3A 3VUOA 3DV8A 3ZYPA 2IXKA 1YJLA 4I2OA 3ETQA 4KWJA 1GLHA 2FZ1A 2BGCA 4FPGA 3IPVB 4IEPA 5C9AC 4NPRA 1DGRA 2ZHKA 1EPWA 1LOGA 3AJYA 4QPGC 4IETA 1HX6A 4Z2WA 4YVSB 3U4XA 3RYRA 4ATEA 2XJVA 5EXOA 4YGCA 3WW2A 3LAGA 1FPN3 3N36A 3KZ4C 3H7YA 3W59A 1OLQA 5J98B 1V6NA 2QQPA 5GZEA 1BQPA 2DUOA 1LULA 1HRI3 2WT2A 5BV6A 1IS5A 4XFAA 3T2TA 3WOGA 3B69A 1DGWX 1N1YA 2FBEA 4KWKA 3BB6A 2ZA9A 3ZMNA 5IT6A 2PLV3 1RVF1 2WNUA 4LO4B 4KG8A 3CLPA 1V6JA 1KDKA 3OYWB 4L9BA 1VLNA 5BNPB 3W58A 1R093 4WBBA 3IDBB 3K51A 4JGZC 5T5LA 5JMCA 1RVF3 4YGBA 1RUC1 4HL0A 1GV9A 4Y1VA 4B4QA 5JPMB 1O3SA 1HXS3 1YFWA 3OBRA 5KXCA 3URFA 1QHDA 3D8CA 1R092 3SXWA 3TNPB 5CFCA 4BLIA 1S55A 5JSOA 4XF0A 1DZTA 4XQWA 2NP0A 1OKQA 3TOJA 3B94A 3UKTA 3PJQA 3ZDSA 1ASJ1 1WW4A 3M3CA 1K5MA 1PGL2 4YRDA 1VALA 2WNVC 4MGKE 2Y0OA 4G9SB 1LESA 2YZ4A 4E4SA 2AGSA 3GALA 3OF1A 5DUXA 1ZZ8A 1MZFA 1AZDA 1SLLA 4N90A 4MGYE 3RRDA 2XLFA 2JXAA 2VOVA 4M3CA 4NVPA 2DVAA 3QH7A 2BFUS 1ZREA 1WCSA 2XVKA 1NLSA 3CJIA 1U5ZA 3ZFGC 3ZFFC 2DVFA 1LHWA 1LJ7A 1WBFA 3ZN4A 4CDWC 5FQ0A 1YJKA 4Z1VA 3DPRB 1QNWA 4CDUA 1DYPA 2A3XA 2MPFA 1B35B 1CGPA 2BVVA 2R042 1IOAA 2E7QA 2IZWA 5FLJA 4I3GA 4F3JA 4GMP0 4C91A 1H2NA 1B35C 1FI2A 4YLZA 1H1MA 4J1XA 1D0GA 2RJLA 4LBMA 1C8M1 4AI3A 3IIAA 5DZEA 4D3WA 5EYXA 3HAGA 2ZGLA 3EQEA 2QE3A 5C8CC 1T6GC 1G7YA 2UYBA 2ZX2A 2O1QA 1J3QA 3WR0A 4QMAA 3RPQA 1AXKA 3U10A 1C57A 1RUE3 4JC1A 2VOWA 4AFDA 1H8TB 2I45A 3RZZA 4EWAA 1WLTA 2JENA 3MIHA 3VBRB 1X8MA 2WA3A 1D4VB 3DUIA 3AMPA 4I3PA 4CYDA 5CFDC 1NCRC 2WLQA 5KHJA 1IS4A 3EBRA 4HETA 3OCPA 1LR5A 2UU8A 1RUE2 5K9YA 4Q1PA 3I4IA 3WDVA 4FQ4A 3BOPA 4OFGA 1IKPA 4Q0SA 3HIFA 2IXLA 4DPNA 4EROA 1UCXA 4CDWA 2GALA 2RS12 1V6OA 4XHBA 1RB8G 1WUVA 4K3UA 3SH3A 1IS6A 5D1IA 3RMYA 1B09A 1J3RA 1XE8A 3HWJA 4RSUA 3U0ZA 5JI7A 1F9KA 1TME2 4XFBA 2Z5WA 2RS13 1REDA 2KXLA 2VXRA 5SV8A 3OGJA 1B35A 3NWKA 2D44A 3ZFGB 1DGRN 2NPIA 4TZDA 2G9GA 3UJQA 3MF6A 1GYKA 1LOCA 5BPXA 4TSVA 1A6CA 3B9CA 1GQHA 1OPOA 2Z42A 4IQPA 1X82A 3L2HA 3M2MA 4FSJA 4YW3A 3WY6A 2ZJCA 3RJ2X 2XBO2 1LODA 1AR73 1H9WA 1GZCA 4FPEA 5HCAA 3E97A 4AVAA 4R52A 5FTTC 3V65A 1C5IA 1COV2 2HEVF 3I7DA 1BZWA 3SLIA 4RS5B 4AXOA 2OYZA 1JW6A 2JG9A 1UU5A 1WMDA 1N3QA 4A7YA 3USSA 4AG4A 1AR81 3ZFEB 3M70A 2EXHA 2X5IA 1MZ6A 4FOYA 3WNXA 2Q0AA 2AZ5A 4AI8A 2RMU3 1LKNA 2Z2SB 1QXPA 1SFNA 1C3HA 4WM8C 2W52A 4DOUA 4Q4V1 4E4ZA 4A2UA 1BEV1 3IM0A 1CD3G 2WS92 3KCYA 1MS0A 2K2SA 3PVNA 4IEUA 1MACA 4LBJA 4QT6A 2FMDA 1TQ5A 3TN93 3BIWE 5H9RA 1H8TA 1VBB1 3L2YA 4FAHA 2VNGA 5JLVA 1X7NA 2HJIA 2Q30A 4HSLA 2YXSA 2WS93 2WSVA 5D8AC 4LLOA 2HWE1 2AYHA 3SISA 5I93A 4CDQB 5IK8A 3SH4A 5BNPA 1QMJA 2BQPA 1WCDJ 1Y3TA 1LHUA 1UMZA 3QH6A 3SITA 5AVAA 1NQJA 1R091 4H55A 2DWRA 1SLCA 4X6RB 3VL9A 4YZ2A 5A3LA 1HRV3 2CL2A 3JBG3 2D3PA 2PAKA 5IK4A 2LM3A 2ZGOA 4FPOB 4M3CE 4Q4V3 2PHWA 1DZRA 1ULCA 2CTVA 2HWF1 4KBBA 4N7UA 5J3UA 2VQ0A 4ZXKA 2WZPP 3POYA 2WJSA 2VVDA 2GAUA 2VQAA 3RQ0A 1AYN3 1LOFA 1FPN1 5BNOB 4FOQA 5DXDA 3WZ1A 2V73A 3D82A 3DKWA 4IV3A 3AXDA 4PLNA 4YFWA 1URXA 1SBFA 1OMIA 1G9BA 2OIIA 2NMNA 2ZGPA 1OOPC 1AYM2 4M3CB 1OLRA 1TNFA 1A78A 4XXAA 4BQ1A 4FT8A 2OPKA 2PYTA 3CJIB 4RR3C 2DF7A 2XH6A 4ATFA 1H2MA 1S0BA 4MSVA 4RQPA 1CAWB 4P9JA 1ZNPA 4CP0A 2CNAA 1QJX3 1W6PB 4K21A 2ZMKA 2XVLA 3JUUA 3DPRA 2D5HA 3PLQA 3WW1A 2AR6A 5SV5A 3VKFC 2B45X 2IFRA 4EWEA 2WFF1 2GH2A 4Q4Y2 3J4UH 4Q4X1 3E5QA 5JSRA 5BXXA 4UW4A 3S7IA 4MXWA 3LGRA 4YVWC 2XHKA 1CPNA 1R1A2 2R071 4A7KA 3VBSA 4C0HA 2D6KA 4YM0A 2H0BA 1VP6A 3MYXA 4GQ7A 3AMQA 4AVCA 3AX4A 1WGPA 2WQ4A 4K1YA 4PLMA 3TAYA 4AHWA 1ND2A 2XLAA 3DN7A 4AEMA 4C1WA 3V0BA 5GLVA 2VMIA 4NHMA 4CDQA 4FCAA 2RR11 2EF6A 1G86A 2BWAA 2DURA 3JD71 4WVWA 1X50A 1KJRA 4IV1B 1RC6A 1DGLA 3TN92 1N1TA 4N53B 2WA4A 4HT1T 3MI8A 4XF9A 3WQ1A 1QQP3 1FOD3 3WG1A 5IK5A 1QU0A 4N43B 4FOVA 3DPRC 4AHXA 2ZACA 4OI1A 2R061 2R6QA 1LU2A 1PK6B 1XYOA 3VKOA 1QKQA 1PGSA 5BUVA 1AR71 2GMPA 1YYNA 4JTNA 2E9QA 2XPJA 1SLBA 3UK9A 4DS0A 3SCGA 3PVOA 5CAZA 5ABJC 1N1VA 4WVVA 4F8AA 3HR9A 4NN0A 2XBO1 4Q29A 1S2BA 2C5DA 5LEKA 2A75A 4MLOA 3V0AB 1QJX1 2A6WA 2RR13 4YM2A 1AR93 4GH4B 4FTBA 2G4IA 3B00A 3VBSB 2YC0A 4B29A 4IV3C 4XBNA 3MICA 5T5JA 3P3PA 5CG8A 1LOEA 1SDWA 3JB4C 3VBFC 4AEDA 2PAMA 2CWSA 4AVTA 4Y26A 3RYPA 3KT7A 3LZZA 1RUH1 1QH6A 4JTOA 4COWA 1JUIA 1XNCA 2PHXA 5BNNA 3V0BB 2ZGUA 1ULGA 4OULA 1AYM3 1NYWA 3KS7A 4LHKA 1CAUA 1RGSA 4LBQA 2V5YA 3ZFEC 1LEDA 4IESA 1FNYA 1XYPA 4Q0VA 4MXWB 2ZMNA 2PQQA 1SCRA 3KT1A 3ZN5A 1R081 2ZHLA 4OUSA 4LBOA 3OY8B 3I59A 2Y38A 5J37A 5CFCB 2HWD2 1HDKA 1RUE1 1DQ6A 2JE9A 4BWOA 3ZIWA 4CEYA 3AYAA 2ZGQA 3VBHA 4I02A 4B3NA 4YGDA 4FTEA 3VL8A 3MW2A 1CX4A 2WLPA 2MHFA 3WX5A 2DCJA 4L2NA 5ACA2 1AX0A 2O0OA 5KBFA 4Y5Z0 3SH5A 3H1WA 1OD5