1WLWA

Congerin ii y16s single mutant
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
134
structure length
134
Chain Sequence
DRAEVRNIPFKLGMSLTVGGVVNSNATRFSINVGESTDSIAMHMDHRFSYGADQNVLVLNSLVHNVGWQQEERSKKFPFTKGDHFQTTITFDTHTFYIQLSNGETVEFPNRNKDAAFNLIYLAGDARLTFVRLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Congerin II
publication title In vitro evolutionary thermostabilization of congerin II: a limited reproduction of natural protein evolution by artificial selection pressure
pubmed doi rcsb
source organism Conger myriaster
molecule tags Sugar binding protein
total genus 28
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1wlwA00
2PHWA 4UW5A 1WW5A 1VAMA 1LU1A 2ZZJA 2R1BA 4PBPA 4DQAA 4Y1YA 2FHRA 1BKZA 1YO8A 2VU9A 2PHUA 2ZBJA 4ISRA 1LHOA 5AVAA 2HYKA 2A6YA 2VY0A 3MPPG 2DTWA 3WG2A 1UAIA 1JYIA 1LU2A 3KQRA 3WG1A 2EF6A 1GNZA 1C1FA 4AVSA 3N7MA 4XHXA 3RQ0A 1QMJA 1WD3A 1D0HA 2DU1A 5H9SA 1LOGA 2C5DA 4XDQA 5IUQA 1AZDA 3ENRA 2UWBA 4Q27A 1MS4A 3WDVA 4XMAA 4RL7A 2DUPA 4WZFA 4NO4A 1KDKA 1FX5A 1AXZA 3VKMA 1XQNA 1GSLA 1DYKA 3O0XA 5GZCA 2DV9A 2ZHNA 1W6OA 2ZGOA 3IM0A 1Q8QA 4YGCA 3SNMA 3AYCA 4M3CE 1QU0A 4ATEA 4Y22B 1GV9A 4ZXKA 1V6OA 2WKKA 4XBNA 4XJ9A 3O0VA 2D3PA 2WT0A 1A3KA 4FOVA 2ZGPA 3A0NA 2ZAAA 1WBFA 4P9YA 1WCSA 2EIGA 4FOYA 3OJBA 4K20A 2W52A 4Y26A 2W39A 1SBFA 4I30A 2E7TA 4K1YA 4LBQD 4Q2FA 2ZGUA 2CL2A 1UN1A 4LBQA 4Q1RA 1SCRA 1S0IA 1SLIA 5T50A 3WV6A 3VKLA 5GLUA 5HCFA 2OUJA 3USUB 1DQ5A 3OY8A 5GJ6A 2FMDA 2NYYA 3OPZA 3Q9OA 4XIOA 1LOCA 5T55A 3V65A 3ZSKA 1G9FA 3JU9A 2GN3A 4MYEA 1G9CA 1LEMA 5H9RA 2LTNA 5IT6A 4FPJA 4R9AA 1WLCA 4RA0A 5F5QA 1LENA 3UJQA 2YY1A 5IK8A 2AUYA 2ARXA 1DFQA 5KXCA 2ZGLA 1N1SA 5GLVA 1DLLA 4TZDA 1H9PA 2NZ9A 3SLIA 3ZSLA 1HDKA 1CPNA 1MR5A 1QF3A 1LODA 5EYXA 4F83A 1BXHA 3NV1A 2CTVA 3IPVA 4H55A 4HANA 2D3RA 5IK7A 2A70A 4L8QA 1VLNA 3BODA 5CA6A 4ZKTB 3FLTA 3B69A 3VKNA 2C9AA 3FLRA 4K1ZA 4UW6A 2PHRA 3RRDA 1IS3A 1MVEA 1UX6A 1Z0HA 1JN2P 2CNAA 1C4RA 2G4IA 2PELA 2TEPA 3WCSA 4XJAA 1LGNA 4NOTA 4W65A 4FPOB 3RG0A 3GALA 3M3OA 2ERFA 3BIWE 4YZ4A 1AXKA 1BYHA 4YM3A 1UKGA 3NWKA 2AREA 1TEIA 4PQ9A 3IN9A 4XTPA 3ZXEA 4XOGA 2PHTA 5JVVA 1MS1A 3JUUA 1H9WA 1G8WA 1V6NA 1I3HA 5JMCA 2D6KA 1Q8OA 1LJ7A 5CNAA 1ULGA 3B3QE 1VIWB 2JD4A 2D6OX 1BJQA 2SBAA 2Q5TA 5DZEA 5GZDA 5HCBA 4BLIA 4PCRA 2NMOA 1JYCA 1N3OA 3MW2A 3W59A 2DWRA 1F9KA 2NP0A 2DURA 3M1HA 4M3CF 2R16A 5L73A 3TB0A 5CB7A 2A3XA 2YXSA 5DZGA 3TAYA 1NLSA 5GZGA 4U36A 1LHNA 1DQ1A 1MS8A 1BZWA 5T54A 1V6JA 4UW4A 2CWSA 4GKXA 3VKFC 1Q8PA 4ITCA 3ZXFA 3OBTA 4BOWA 5CAZA 4GKYA 2E51A 4OZXA 2PHFA 1HLCA 5F9TA 1Y7BA 2R49A 3LCPA 2E53A 3UJOA 5T5LA 1W6OB 3WCRA 3N36A 4FOQA 2A6ZA 5IK5A 1CPMA 1SLLA 2P3IA 3FUOA 1N3QA 1KJLA 3AZVA 4GWNA 2NMNA 1WD4A 2AH2A 4GXLA 2WQZC 1SLCA 3B01A 2P37A 2GNTA 1GKBA 5DUVA 2XB6C 3ZSJA 2ZGTA 4M3CB 2DVDA 1JUIA 2D6LX 2E7QA 1ULEA 2A6WA 1YXWA 5DG2A 3B00A 2EXKA 1ULDA 2P34A 4YZ1A 3ILRA 4FPGA 3OY8B 5CBLA 1URXA 4FPHA 2D6NA 4C1XA 1Z78A 4R9BA 1IKPA 3AXDA 3OYWA 1RIRA 2VW1A 5GALA 3D6EA 1MS9A 1J1TA 4CTEA 2ZABA 5DUUA 4ASMB 5JLVA 4YM1A 1GZ9A 3AXEA 1LHUA 2D6MA 1PZ8A 4FPLA 4DS0A 1DQ6A 2JE9A 4FPYA 4WVWA 1VAVA 3AP9A 2KM2A 2V5YA 5GLWA 3OGGA 2ZGNA 4D69A 3LSEA 1Q56A 3NV4A 2VXRA 4BMEA 1Q8SA 3BOPA 2ZHMA 3FFZA 1W0PA 4BM8A 1SLTA 1W0OA 3PJQA 1PZ9A 5EYYA 5LK5A 3V64A 5IK4A 1MZ6A 1DGLA 2WT2A 3UL2A 1FV3A 1W6PB 2WSUA 3WNXA 1V6LA 2ZMLA 4XJWA 3AZYA 4M01A 3V0AA 1AVBA 2SLIA 5JOWA 1AX2A 1MS3A 2D7FA 3QCWA 5KXBA 4YGDA 1QOOA 1VALA 1FNZA 1S0DA 3D4KA 1IS4A 2AR6A 5T5OA 1MZ5A 2CYFA 5EWSA 2GMMA 3ZVXA 1ZA4A 2A3YA 3WUCA 1WW7A 2CY6A 4JC1A 3RSJA 2ARBA 1PZ7A 4GWMA 2R1DA 3WDYA 4C1WA 3BTAA 5GZFA 3R4UA 4M00A 2W08A 4XXPA 1Q8VA 1QKQA 4YW1A 4FQ4A 4TYSA 4DPNA 1JOJA 2NN8A 3N35A 3PVNA 3SITA 3WHUA 3UK9A 1KJRA 1UMZA 4Q1PA 3WLUA 5DZFA 4YM0A 4PBOA 2P3KA 2DVBA 4BLJA 4DRVA 3ZXKA 2D3SA 4R9DA 1AX1A 2ZGKA 2R0HA 3AP4A 1CN1A 1CQ9A 4Z8BA 4XE9A 1JHNA 1D2SA 1LHWA 1OFSA 4AYUA 1LECA 1W6QB 5E89A 2D6PA 1C1LA 1FNYA 3B9CA 5FRAA 5GLTA 4LBNA 1F5FA 1WW6A 2EXJA 4YG6A 2GMPA 3W58A 1R1ZA 5SV8A 5GZEA 3O5SA 3PVOA 1SBEA 2JE7A 2WNEA 4YG0A 2DVFA 2DVGA 2JKBA 3R05A 1MVQA 2EALA 1RINA 3ZXJA 5JOXA 2I2SA 1G9DA 3HMYA 2A75A 2GMEA 3SH4A 1I1EA 3AZZA 3ASIA 3ATGA 4XMIA 1V6MA 3WZ1A 2ZGSA 2YV8A 3POWA 3M3CA 1S0JA 2GNDA 2OW4A 3AX4A 1QOTA 5FREA 1QOSA 1O4ZA 5H9QA 3CNAA 4WVVA 3USUA 3AYDA 4XIKA 3ILNA 1QNYA 3HR9A 2UU8A 3M2MA 1JW6A 4Y1ZA 1UL9A 3V0BA 2E6VA 1AX0A 1YRZA 4FPEA 4AGGA 3WDXA 1BQPA 1NXD1 3OYWB 1LTEA 1O4YA 1YYNA 2DUOA 1WW4A 5JOYA 3H0OA 3R4SA 1S0EA 1W6MA 3N7JA 3AP7A 3T2TA 4XTMA 1GZWA 1QGLA 1HKDA 1FAYA 2XG3A 3MW3A 1DBNA 3SISA 4FVVA 3RMYA 4KBBA 4Q8KA 1HQLA 3AP5A 4XJ8A 1AJOA 3T1MA 1AJKA 1JBCA 4FP3A 5H9PA 4YGBA 3MEPA 2YROA 3KM5A 1YI7A 1LESA 2VH9A 1G9BA 4Y20A 1G86A 2ZMKA 4CRQA 4FP2A 1N1TA 5KXDA 4XZPA 1ENQA 1FYUA 2JECA 1FV2A 1LOAA 4LBQB 5JDBA 3APBA 1IOAA 1FATA 2P3JA 3MW4A 1KQRA 1ENSA 4UW3A 1IS5A 1AF9A 2LALA 4LBOA 1WBLA 3O0WA 2JJ6A 4XHBA 2ZKNA 1V6IA 4LBJA 3WG3A 3M3EA 3NV3A 1B09A 1MS0A 3VKOA 2ZGRA 4U2AA 1X50A 1V6KA 4DFSA 1V00A 3AYAA 5JOZA 1HQWA 1F31A 2RHPA 2V73A 4YZ5A 1N1VA 3POYA 1S1AA 4P9XA 4YLZA 2DTYA 4Y1XA 1SACA 1W6NA 4JRAA 1DQ0A 2VW2A 3WVJA 3OBRA 3M3QA 1WLWA 3IPVB 1DYPA 2OUHA 3AJZA 1MACA 5HCAA 1LHVA 1S0GA 1WUVA 4GA9A 2DYCA 2UWCA 2A5ZA 4GALA 1H30A 1DIWA 2EAKA 3AFKA 4XBLA 2A3WA 1OKQA 1IS6A 4FQZA 1GYKA 2WJSA 3DGTA 3N3HA 4XILA 2ZGQA 5DG1A 2ZA9A 5E88A 5GLZA 4HL0A 1APNA 3FBYA 4SLIA 2WT1A 2YZ4A 2AGSA 1SLAA 3FLPA 2CWMA 1S0BA 1S0CA 4YW3A 2B7YA 5GM0A 1ZM1A 5DUXA 3FUQA 1SCSA 2DVAA 3IKWA 1AXYA 1LOFC 1LEDA 1U0AA 4XJZA 1A8DA 3SH3A 2YMZA 1SFYA 2EXIA 5E8AA 3WHTA 2A6XA 4M3CA 1RITA 1QNWA 4WV8A 4XBQA 3RS6A 3VUOA 1WLDA 1GBGA 4ISQA 4ATFA 4Y1VA 3HN1A 1EPWA 2ES3A 2P2KA 3WDWA 3WG4A 4YZ2A 1CVNA 2ZHLA 4Y24A 3WUDA 2Z42A 4BQ1A 2ZACA 2JDZA 1DQ4A 1KDMA 1C57A 3T1LA 1ULCA 3AJYA 3ZXLA 2AYHA 3V0BB 3RMXA 1LOBA 3AZWA 3L2YA 5EXOA 3SH5A 2VUAA 2DU0A 3WDTA 1W6MB 3GNEA 4K21A 4AVVA 2ZGMA 2R0FA 4FPKA 1GZWB 2GN7A 4AVTA 4FPFA 5T5PA 4FOWA 2D43A 3WDUA 1N1YA 3QLQA 1GZCA 4Y22A 2DUQA 3DUIA 3POSA 1CJPA 1UZYA 1G7YA 4FPCA 5DXDA 4BPZA 2VW0A 1JXNA 1LULA 3U4XA 1DZQA 1MS5A 2BQPA 4P9WA 1UPSA 3ZPYA 3WOGA 2A71A 4CZSA 4XYXA 1LOFA 1SLBA 3ILFA 1UZZA 4Y20B 2EXHA 1DQ2A 1N3PA 1G9AA 2NM1A 2ZHKA 1GLHA 3C2UA 4Q8LA 1W6PA 4P14A 2AENA 4YM2A 1QDCA 1CR7A 1QDOA 2WLQA 3IMNA 5T52A 4YFWA 1S0FA 2ZMNA 3ZSMA 4Q26A 4AGRA 3O12A 1CESA 1CONA 4PF5A 4YFZA 1KITA 2GNBA 3A0KA 5BYNA 2A6VA 4YW4A 4LBKA 2ENRA 4IQPA 3ZYPA 3LSDA 2OVUA 2W68A 4XJUA 4YW5A 3A4UA 1ENRA 1LOEA 2D44A 2GALA 3N7KA 1A78A 3AYEA 1GICA 4JCKA 4XXAA 3PVEA 3NV2A 4AGVA 1LGCA 1SBDA 4R9CA 1GANA 1YIFA 2PHXA 1DHKB 4YG3A 1LGBA 1W6NB 1LCLA 3AP6A 3N7LA 3ZYRA 1N47A 1CIWA 3AZXA 5T5JA 5DUWA 1OQ1A 2GNMA 4AWDA 4LBLA 4YZ3A 2UURA 1IKQA 2WSVA 2GDFA 3PMEA 4BMBA 2UWAA 1ONAA 1KRIA 2H0BA 3INAA 1W6QA 4LBMA 1ULFA 4Y1UA 4YGEA 3AK0A 3I4IA 3D5OA 4YW2A 3V0AB 2A7AA 1GNHA 3I8TA 3VV1A 4DRRA 5KXEA
chains in the Genus database with same CATH superfamily
4UW5A 1RUE1 2WWUA 1UOFA 4P9GA 3UGGA 3VBRB 3VGIA 1QQP3 4PBPA 1W06A 1V70A 1PNFA 1D7PM 4DQAA 4CU7A 4ET7A 4PDWA 4ISRA 4UBHA 2RVAA 4XFFA 1CAUA 1C8M3 4QB6A 2HYKA 2JDHA 1UZVA 4QQPA 2DTWA 2WNUC 3S6PA 1UAIA 4AI2A 4BA6A 3ACLA 1QJY2 2PHLA 3WG1A 1C1FA 4XVHA 3ROUA 4AG4A 4GB33 4UOJA 1WD3A 1S2KA 4KMQA 1RUI3 4BQXA 2HBUA 4HKLA 5CFCC 2TNFA 1XBFA 5FUNA 1W8WA 2YC2A 2XBO2 4B4PA 4AK3A 5FYCA 1VBA2 5K9YA 1FI2A 4M4PA 4HN1A 1RL3A 3WDVA 1XE7A 1VBB2 4N53B 4XMAA 5FLJA 1ULOA 1OQDA 3AM2A 1W2OA 2WDBA 5A7QA 5IAXA 1AXZA 3GZAA 3WD5A 3OPWA 1XQNA 3VL9A 1H2NA 5I0RA 2I45A 2RS51 5B4NA 4W6WA 5F32A 4IERA 1MZEA 1RXFA 1W6OA 2ZHNA 3IM0A 1Q8QA 4I01A 4YGCA 3FWEA 3UV9A 4O9EA 4M3CE 1DDLA 1M4WA 5BNOA 3RWNA 1RHI2 2D3PA 1OF3A 4GH4B 4BK4A 1A3KA 4YSFA 2OIIA 5JXHA 1OPOA 5LW9A 5LY1A 2PLV1 4FOYA 3W5MA 1FOD3 1TNRA 2YUEA 3H3UA 1AR81 2PAEA 4URTA 4Y26A 1SBFA 1PIV1 4F7ZA 2VCMA 5HCHA 1XNAA 1SCRA 1UW8A 3LQCA 5FP3A 3VKLA 5HCFA 1UCXA 3RGBA 5BNPB 3EQEA 2BW8A 4HFSA 1X33A 3OY8A 4CU8A 4GIQA 2RR11 4E2SA 1J59A 3U07A 4IEZA 4CUBA 2MNGA 2RDSA 1UZWA 5FLIA 3IB3A 4G4FA 1BBT3 1NCRA 4XCAA 1WLCA 1I9RA 1LENA 4CDQB 2YY1A 5SV5A 1DFQA 1OQEA 2ZGLA 1N1SA 2OZJA 2XONA 2XLGA 4JGZB 1D4M1 4TXWA 2QQKA 4TZDA 1H9PA 4I02A 1Y43B 5HCAA 5EYXA 2YBPA 5FYYA 1F4HA 1RUG1 2CTVA 4H55A 1NLQA 5FY1A 1HV0A 4K8FA 3QH6A 2RM21 1ND3C 2HWD3 4IW3A 3BTYA 5FY0A 3RRDA 3ZFGC 1DLCA 4LHSA 4QPGC 1PM7A 4DXZA 1XRUA 2TEPA 1NE4A 3WCSA 4Y4YA 3UYJA 3CF6E 1BYHA 3RZGA 4YM3A 4CP9A 1Y4WA 4IETA 4UFHA 2P3YA 2J1EA 4XTPA 1NLRA 2R30A 1MS1A 4CDWA 4JHZA 1JHJA 3JUUA 3KGLA 3P3PA 5FZAA 1Q5OA 1BK0A 1TMF1 1V6NA 2HWF2 2GU9A 1Q8OA 4A7YA 2HEWF 4BXFA 1MEC2 2D6OX 1BJQA 2SBAA 1D2QA 5DZEA 3POIA 5AFBA 2E9QA 1O3TA 1N3OA 1HRV1 4D0QA 1CJDA 3W59A 4COZA 4M3CF 1UWWA 2WBKA 3KT4A 5FYVA 1W9TA 2K9ZA 5FQ0B 1VP6A 2R063 3TB0A 4AI9A 4XUQA 3ECQA 4QXCA 5A6QA 1B35A 1RC6A 3VZLA 4V2VA 4ORFA 1DQ1A 3KF5A 1Z7S1 1MS8A 3BYWA 2VBDA 5T54A 4GKXA 3VKFC 3BALA 4Z2AA 2HWB2 1JZ6A 1EP0A 1REEA 5C6CA 3HT1A 2PHFA 3HOBA 1H1AA 4G9SB 4QQHA 2E53A 4YWAA 5T5LA 5JXGA 1W28A 3WCRA 2JG8A 1W03A 1DU3D 4CCOA 4QM8A 2WR9A 4H14A 1JOBA 4WM7A 4BIFA 1TME3 1NCQB 3J7MA 4GWNA 5C33A 5I0DA 1QJEA 2NMNA 1H6YA 1SG3A 1WD4A 4HETA 3O1UA 2GNTA 1L3JA 1ZBE2 4S2FA 2WNVB 3ZSJA 1RUC2 4B4QA 3BPSA 2CSGA 2Q1ZB 1JUIA 1A8MA 4AFBA 2D6LX 1HRI1 4XQWA 1ULEA 1ZBA1 2MEV3 5JXIA 3IIIA 2FQPA 4D3WA 1KD7A 2BBAA 5JWPA 2XHKA 1UX7A 1EV13 2FBEA 1NUKA 5JIUA 4FPGA 5J36A 3LA2A 4FO9A 5CIRA 3VDDA 2XJPA 2WO2A 5HXVA 3O14A 4LE4A 1RIRA 4AZZA 3ZDVA 2RDNA 5FMCA 3RVHA 3I97A 3SMHA 2ZABA 3CU7A 3I7DA 4ASMB 5LRSA 4YM1A 1STMA 5EP9A 1RYYA 5G04L 3FJSA 4FFFA 4BDVB 1LHUA 2RMU1 4A2UA 1YFYA 1GWKA 3EHKA 4FPYA 2Y6FA 4LKEA 3WY6A 4IV1B 4XFGA 3OGGA 1NG0A 4LMFA 2BU9A 2Y0IA 4D69A 2H6BA 2W9XA 3WW1A 3DCQA 4PIXA 2W94A 2IXKA 2W1QA 4D8MA 1GOFA 2ZHMA 5C8CB 4OMCA 4R4XA 5EYYA 4QPWA 5D1IA 5IAVA 4QPIA 5BNNC 5G05L 4ZY9A 1ULPA 4I0AA 4P5HA 5A33A 3WNXA 4CEWB 2DBIA 2PMWB 2ZMLA 4M01A 1PM4A 3ALQA 5F2SA 2WFF1 3I59B 1NQJA 1U5IA 5K4LA 1YI9A 1ST8A 1AX2A 1MS3A 2QDRA 3HBZA 3K4ZA 4NHLA 2XL9A 1YIPA 4LIUA 4QX7A 1XU2A 3J9SA 1IS4A 1MZ5A 3ZFEA 1VBD3 2A3YA 1AR72 2X5IC 3WUCA 1WW7A 1R081 3S0MA 3WDYA 3VB9A 5GZFA 4C1WA 4JKKA 1JODA 1QKQA 2IFRA 4Q4W3 4QDQA 1R093 4YW1A 4I2OA 3PVNA 3O1RA 4DIQA 4BQ5A 1P8JA 5A7WA 2ADEA 4Q1PA 4GMP1 2ZZQA 4KGGA 4YM0A 4PBOA 2P3KA 1VE0A 3ZFFB 1MQTA 4DRVA 1DGWA 4YVWA 1GZTA 1RJ7A 2W91A 4KNCA 1BHGA 5FPUA 3AP4A 1EUTA 4XE9A 5FR3A 1D2SA 4HKOA 1OFSA 3VBSA 3AFGA 3OUHA 3VBOA 2YU2A 4CEYA 1C1LA 1OFNA 1KS4A 2HWE1 3WQBA 2EXJA 4XFIA 2GMPA 4YG6A 4J6GA 2XGXA 5SV8A 4AI0A 4Z2WA 3TEZA 2B8MA 1VJ2A 4UAPA 4PLMA 1MVQA 2Q8EA 5KHHA 4JAAA 1G9DA 3G6JB 1XSQA 1TQ5A 2GMEA 2HEVF 5IVEA 3AZZA 5FYHA 4IDZA 3ATGA 4N8MA 1V6MA 4NPRA 4XMIA 2ZGSA 4PDWB 5K0UB 3PVBB 1POV3 4WM8B 1ND2C 1EPZA 4P02B 4IEPA 5LATA 1J3RA 3T2PA 5J7MA 3KQ4B 3N9PA 2PQSA 2WS92 1IHMA 1IQAA 1GFF2 1QNYA 4XUTA 1OXCA 2EVXA 1UIKA 1W8UA 3U37A 1OUXA 3GF6A 1HB2A 1AX0A 3ELNA 1RUJ3 3RNSA 3DECA 3WDXA 1NXD1 3ACHA 2RS31 3ZYFA 2DUOA 2IXJA 5FZFA 2BGOA 3J8F3 3WW2A 5JOYA 4Q4X3 1ASJ3 1PGSA 3T2TA 3GJBA 4QKDA 4XTMA 2XJSA 4JKMA 4OYUA 1SDWA 1MZFA 2XG3A 3MW3A 2QE3A 5FP7A 1DG6A 3RMYA 4KBBA 4Q8KA 1HQLA 3FFQA 3H9AA 4LHKA 4CCLA 4A42A 1AJOA 4OCTA 5BNOB 3T1MA 1W8NA 4DINB 4O7XA 1YFXA 4FXGB 2QZ3A 1QJY1 4AQSA 3AC0A 1XJAA 3BOWA 2H6CA 2YROA 4IGQA 4Q4Y3 4QAWA 4COUA 1YI7A 1LESA 1OLQA 3MF9A 3MFCA 2CGPA 1VBC1 2DF7A 4EQVA 4Y20A 4FTSA 2WN2A 2ZMKA 4CRQA 4CDUA 2XBO1 4XFCA 3CQOA 4XZPA 5LBBA 1VBA1 3MIGA 4YW7A 1CAWA 1VBE2 3VZNA 2YGLA 5C4WC 2WO3A 1NOVA 3H42B 4CCDA 2LM3A 3MLLA 5JDBA 3UETA 4N43A 1PVC2 1IOAA 1FATA 1NA1B 1QJU3 3GHMA 2L9LA 4HPKB 4RR3C 4UW3A 5CFDA 3OEBA 1QH7A 1IS5A 1AF9A 2KR2A 4LBOA 2J1AA 2JJ6A 1LR5A 4XHBA 1RUOA 4LKSA 3WG3A 2PHDA 3M3EA 3CJIA 1AL23 2J1TA 3NV3A 1MS0A 1JTZX 3ZYIB 1UMIA 4AQ2A 4YRDA 5IVVA 2B39A 4I3PA 3WT3A 3WW4A 4F3JA 1F31A 3VBUA 4E4SA 3BPZA 4RS5A 1UY4A 2Q8OA 1N1VA 3POYA 3Q8EA 3VHPA 4IEQA 3T30A 3J7LA 2JDNA 2HYXA 5HPOA 5FKCA 2UYAA 3CJXA 5C9AC 1IPKA 1GQPA 4MGQA 3WNLA 1LHVA 1UMHA 4GA9A 2UWCA 3B94A 4XBLA 1IS6A 2JIJA 1O5LA 1GYKA 4XQDA 3VD5A 1BEV1 2XOMA 2V5DA 3H50A 4HL0A 3FBYA 3NNGA 4YVSC 2WT1A 4IE0A 4AFDA 5ACA2 2VTXJ 4CP9B 3R6SA 1RMU2 1SLAA 2CWMA 1S0BA 5DUXA 4H3WA 2WFPA 3IKWA 3WF0A 3SH3A 1KXGA 1WCKA 1A8DA 3CBNA 3KV6A 3WHTA 5J98B 4MGTA 1UO9A 4XAEA 4GJZA 4LULA 1QNWA 4DXTA 1NYWA 3I2FA 2J42A 3RS6A 2XKOA 1GBGA 3LZZA 1OOPC 4XUNA 2P2KA 2WWJA 2DDUA 4YZ2A 2NQYA 4DZGA 2QQLA 3C7OA 1X36A 2QCSB 3H7JA 4IEWA 5DAXA 1C57A 3U11A 2JWPA 3GZUC 3JQWA 4BISA 5CFCA 1B35B 4NIHA 3ZKUA 1PO22 3NW4A 3T09A 3V0BB 5EJ1B 3RMXA 4OQ8A 5CG8A 3L2YA 4CDXC 2VUAA 3NO8A 2XLFA 1SZBA 4N53A 3URFA 1ZZ7A 4UF0A 1C8NA 1GQHA 1W6MB 4K21A 2E63A 4ZXEA 4AVVA 1FMD1 1XYNA 2GN7A 2HWF1 2RR12 3H8XA 1JS9A 2R071 5BV6A 2K46A 1N1YA 1W2AX 2BWCA 2QBXA 4RGGA 1MEC1 1GZCA 4QMAA 2DUQA 5DXDA 3VN4A 1HN1A 2F4PA 1DZQA 2VE1A 2OT7A 1UPSA 1VR3A 4XYXA 1LOFA 2ZX3A 2XDVA 1D4M2 1REFA 4J1WA 1JYNA 5LA0A 1QQP2 2ZX1A 3PDQA 4HBNA 4Q8LA 1RUG2 4ASLA 2VTFA 3JCIA 1QHDA 2WLQA 1RVF3 3IMNA 4QXHA 4YFWA 3ZM8A 1C8M2 4FBFA 5BNPA 1OLRA 1QWRA 4PF5A 5A1AA 3O1SA 4YFZA 3WINE 5FO9B 2HWB1 3KD4A 3ACFA 3W21A 2ENRA 4GB32 2WZR2 4CCNA 3VDDB 3OGSA 1IGOA 3VHOA 1LOEA 2GALA 1OLME 3K75B 5A1FA 3WQ0A 5FYIA 3MGUA 1J83A 5D21A 3AL5A 4Z82A 2K0GA 2Q8DA 4B3NA 3D0SA 2FCUA 1YIFA 1ZBE1 1TMF2 1DHKB 1LB2A 1RUC1 1CZSA 5D8AB 4L2NA 4OHVA 3ZYBA 4C0HA 1ACCA 3LOIA 2JG9C 5JZGA 4Q0SA 4LA3A 5FWEA 3UESA 5IVBA 4AWDA 1AR62 4NWVA 5AC92 2GC0A 1ND3A 2IFWA 5BY5A 3LB9A 3PMEA 4BMBA 2H0BA 3KVAA 2RS12 3MIHA 4K6BA 5A3NA 5AFEA 5A33B 4Y33A 4YW2A 3W5NA 1OVPA 5A7OA 2A7AA 4QKBA 4JQRA 1YEWA 5FKBA 4A6SA 1QH6A 4E8DA 3I8TA 3VV1A 2HWC3 3UNPA 4DRRA 2C4XA 3O1TA 2PHWA 1PK6A 1W05A 4BU2A 1WW5A 1VAMA 3ZFEB 1VB4A 4KG8A 2R1BA 4COWA 3HIFA 4R4ZA 1DGWX 4CYDA 3UT0A 2VU9A 2E33A 4Z92B 3I2HA 3HAGA 5LASA 1RB8G 5BNQA 3FMGA 1LU2A 1YNAA 1DGRN 5FJHA 4JTOA 3I3MA 5FMOL 4AVSA 1VRBA 5A7WB 5FQ0A 2Y8KA 5AVPA 3RQ0A 4CUCA 1D0HA 2DU1A 5H9SA 4OLLA 3C7HA 2XHNA 1MQTB 1W99A 1I5ZA 2C5DA 2N7GA 4YVWB 5ABJC 1HRI2 4GWJA 1ZBA2 2QQIA 4YNIA 4AHXA 1MS4A 4FI9A 3O1PA 2DUPA 4AHWA 1XE0A 3DN7A 4MGSA 1FX5A 3VBOB 2RJKA 1KS5A 4C8DA 5L9BA 1IPJA 1WMEA 4W4ZA 4OQ9A 1BMV2 4IEVA 4HZFA 2G9GA 2X05A 5FWJA 3SNMA 1WCUA 3LGRA 2C24A 3NJZA 1OPMA 2G9FA 3MPBA 4XBNA 4XJ9A 1NCQA 3IDCB 3O0VA 1UQXA 3NRUA 4RHV3 4FOVA 2RMU2 4LUKA 2ZGPA 3E6CC 4J25A 2WNVA 1WCSA 3MBWA 2E31A 2Y60A 4MADA 2W52A 3RFRA 5A3TA 2E7TA 4LBQD 2J1VA 3R4DB 2ZGUA 2QKDA 5T50A 3WV6A 2QQOA 1S0IA 2TUNA 5FP4A 2Y26A 3U4XA 1H6XA 4PJYA 4DEVA 4RFRB 2HLEA 4LNVA 2FMDA 3DL3A 4XIOA 5T55A 4A7ZA 4E9KA 3JU9A 3LIHA 4IESA 4C0BA 3SHRA 3I54A 1G9CA 3ITQA 3O1OA 3PL0A 4B7EA 5DDJ1 2GH8A 5FZ1A 5H9RA 1AR92 3H7YA 3UJQA 5IK8A 4EWDA 2ARXA 4YARA 5JXJA 2P6CA 3FX3A 4XABA 5FZMA 2XJUA 1DLLA 4FT8A 3FHIB 2NZ9A 1CWPA 4F83A 1CPNA 2PAMA 1NZCA 1X8MA 1SEFA 3IPVA 5CADA 2BOIA 2Z4FA 2XVLA 2ZX4A 4LO8A 2D3RA 5J09A 2W5FA 2A70A 2VNRA 3TRSB 5IK7A 2VVDA 2WS91 1TME2 5KHKA 4QKFA 2O8OA 3B69A 5C8CA 1PX4A 2VNOA 3ES4A 3FLRA 4XETA 4BHPA 2R7EB 4BWOA 1MVEA 1Z0HA 1UX6A 2CNAA 1JN2P 2G4IA 1NAEA 5GKAC 3UKTA 5AC93 4J1XA 4XJAA 4CEWA 5BNNA 5CYYA 1RUE3 3GALA 3ZIWA 2WYSA 1AXKA 4N43B 4ZU5A 1PMJX 3NWKA 2C26A 4FFGA 3GZEA 4XFHA 2PHTA 4LT5A 4LJHA 3S7EA 5KHJA 1Y9MA 5JMCA 4NHKA 5CG9A 4CCJA 4BIOA 1JU3A 2R32A 2VBBA 2PA7A 3K77A 3MF6A 4PCRA 3VBUB 3VBHA 1GOHA 1JYCA 4RS5B 3MW2A 4HVQA 2VTXA 2IXLA 5F2WA 1F9KA 2NP0A 3W9AA 5FPZA 4AEDC 2R16A 3VHRA 2YXSA 4ZONA 2VZ1A 1CD3G 1VBE1 3SQOA 3VBFB 1UZ0A 2RS53 3T0DA 2RG4A 1PVC1 2NLRA 3OBZA 4AL9A 4HK9A 3RZKA 1PVXA 2CHHA 3J7HA 2CWSA 2Y6HA 4UW4A 2VOVA 4WBBA 4GKYA 4LA2A 4XAAA 2R49A 3LCPA 5LEKA 1YLLA 3UJOA 4QQLA 4TWTA 4HSLA 2EAAA 2PLV3 2G19A 2A6ZA 1SLLA 1AR83 1DCSA 2P3IA 3MDPA 2LW8A 1PIV3 4N9HA 5FP8A 5A70A 1OVSA 1SMVA 4GXLA 1W2UA 2LRPA 3RZLA 3U14A 5DUVA 2ZGTA 1OUSA 2QUOA 4MSVA 4EZHA 4WM8A 1SPPB 2YGMA 2B46X 3KV9A 3ZYJB 4AAXA 4NIGA 4IXLA 3ZXGA 4AR2A 2WNUB 1YXWA 5DG2A 4ES8A 1VBC2 4WVZA 4LOSA 4COYA 3GCWA 5LA2A 5FXXA 5CFCB 4FPHA 2D6NA 4I3GA 4R9BA 3U10A 2JDPA 2Y6JA 3AXDA 5ACA1 2VW1A 4PF1A 4QDSA 1RMU1 4UF0B 2VECA 3HVDA 3NAPA 4QHBA 2I74A 4IE7A 1ALYA 1PZ8A 4FPLA 3MHZA 4NRPA 5FXVA 4LO4B 4IE6A 3A21A 3OCPA 5GLWA 2V5YA 2Q8CA 5DN2A 4NMIA 3ZIXA 5F5CA 5LBFA 2OS2A 3NV4A 3KV5A 4GULA 3N9NA 4C91A 3OB8A 2FDFA 3BOPA 3CLPA 4WZCA 1SLTA 1W0OA 3PJQA 4LXLA 5IK4A 3RZHA 1HIXA 3T2OA 1DGLA 2WIIB 1PO21 4MXWA 2WZEA 4LE3A 2WSUA 4JTNA 1V6LA 2JDUA 3AZYA 3Q8BA 1PO13 3JBG2 3VZKA 3V0AA 1HXS3 1NA1A 4KH9A 5C5TA 2D7FA 4HPKA 2WRAA 4FCAA 5FZ8A 3GDBA 1U5XA 1QOOA 4YGDA 3IT8A 2B9VA 1JYXA 1S0DA 3D4KA 4GH4C 1HRV3 5T5OA 5FZGA 2GMMA 2BTVC 3ZVXA 1BEV2 2VUJA 2BNOA 2BVBA 1RUJ2 2KA3A 5KBFA 2Q4SA 3C3VA 3A23A 3WQ7A 3BTAA 4DMIA 3J8F2 5F3EA 4JZRA 2JXAA 5FBJA 4CCKA 4DPNA 3KS7A 4FQ4A 2NN8A 3WHUA 3SITA 2JENA 4LQRA 1AYN3 1Z7S3 4XZUG 2OPWA 5LCWL 2YB7A 1QQP1 3WLUA 1EAH3 1RJ8A 4S2GA 3OD4A 3U4SA 1UPIA 4BLJA 5FFOC 3ZXKA 5C9AA 5FO8B 1C8M1 2A73B 2YG0A 4LO6B 5JZGB 4R9DA 1AX1A 2ET7A 4TTGA 3VD9A 2XR4A 1ND3B 3VZOA 4Z8BA 5J1XA 1JHNA 1LHWA 4GB31 3WP5A 2WZR1 4W50A 4ZU7A 5JSPA 2EIDA 2IXCA 2VZ3A 2XL7A 4M4RA 2D6PA 1FNYA 4QPGB 2B5HA 5FRAA 3EYPA 5GLTA 3KT1A 1JYTA 1BCXA 1F5FA 1WW6A 2GC3A 3W58A 5FYSA 1QEXA 3RZMA 1R1ZA 2HKXA 4KU7A 2VM9A 4KWJA 4PIYA 3O5SA 3PVOA 1SBEA 2WNEA 4YG0A 5EJ3A 2EICA 2DVFA 1FMD2 1PK6B 3ZXJA 4KBZA 2R072 1PMIA 1I1EA 3SH4A 3K3OA 3UGFA 3BI3A 3ASIA 3LPFA 5D2AA 4EWEA 3GCXA 4LUMA 3BUCA 1OD5A 2ZCWA 2G1MA 2YV8A 3A7QA 2GNDA 2OW4A 1AR61 1ZRCA 5AC91 1YC61 3MIBA 3CZJA 1PX3A 1OOPA 3FL7A 1O4ZA 3NSTA 3CNAA 3USUA 3IAQA 1R1A2 3OEAA 4H2AA 2RS11 1FXZA 1FOD1 3DKWA 4NVPA 3M2MA 3HD8B 3AB0A 1UL9A 3H8RA 1CIYA 3V0BA 2E6VA 3I2GA 1YRZA 4FPEA 5FXWA 5JPMB 3I2DA 1BQPA 4CDXA 1E57A 1PNGA 3OYWB 1LTEA 1YYNA 4D6QA 5A6XA 4YYOA 4MGKE 1W6MA 2ORXA 3IAPA 3I3BA 1QGLA 2AZ5A 4MV2A 1FAYA 1GR3A 2EA7A 2VQAA 3ACIA 3SCHA 1IQDC 3LFMA 4ARYA 1KEXA 1K5MC 4NPMA 5LBEA 2JEMA 1BBT1 3ZPOA 2ZPXA 4B1MA 1JBCA 5H9PA 3BU7A 3ACGA 2Y0OA 3ZSEA 1WZXA 2ZS6B 3ZO0B 3LOBA 5IVCA 1W8TA 3RDIA 3U75A 2VH9A 2WFF3 3TOJA 3RI8A 5LA1A 1M06G 4QM9A 4FP2A 3WF1A 4QGMA 4BQYA 1FYUA 4BQ3A 1WMXA 1QJZA 4EN6B 4D6RA 4EYUA 4EN8B 3E5UA 1R083 3T08A 3APBA 3GBWA 2HWD1 1KQRA 1COV3 5CVRA 3TN93 2VAUA 1JH5A 3LFIA 3S57A 3AMNA 5A1LA 1BMV1 1RUF2 4UFKA 1O3QA 3H8UA 3TEWA 4IEUA 4UFLA 2IZWA 3VKOA 3DXUA 4U2AA 1X50A 1X82A 1E5RA 3AYAA 3NMBA 1HQWA 4YZ5A 2RHPA 1QJX3 2JDKA 2V73A 3POEA 1VRH3 4NPLA 4P9XA 3POGA 2DTYA 4LK7A 5F6LB 4ZU4A 1SACA 4JRAA 3X29B 1DQ0A 1H4HA 3P5BA 5D8AA 1ODMA 3UKVA 2IWGB 1YFUA 1F2NA 3JB4C 1QY4A 2WUHA 2WC2A 1WLWA 1QXPA 3IPVB 4DNYA 3WNPA 1TVGA 2HWE3 5C5UA 1FPN3 3HQXA 1WUVA 2DCJA 1ZRIA 4GALA 1KFXL 1H30A 1WCDJ 2D93A 2VO5A 3AFKA 3AVSA 1OKQA 5A6ZA 1H2KA 1PGW2 2R043 4RFT0 4XILA 5BNNB 5DG1A 2HBTA 2VULA 1O3SA 3PLQA 5C3PA 2BP6A 3EO6A 1AR91 4SLIA 4A7KA 5FZ3A 1RVF2 5FZBA 2YZ4A 2OYZA 4YW3A 1YFWA 4QT6A 2DCZA 3T4VA 1W8FA 1O8SA 3G7DA 5HBAA 3HNBM 3NNJA 2DVAA 4CP1A 4LPLA 1U0AA 2CDPA 4QX1A 3P3NA 4XC9A 5E8AA 3WEZA 3MIEA 1RITA 3B9IA 2VJXA 3LE0A 3VBHB 3T2QA 1WLDA 3MIFA 4AW7A 3VUOA 1TME1 4KWLA 4Y1VA 3HN1A 3CL1A 3QD6A 3WDWA 2IUWA 4HVOA 2RS33 4CXYA 1O91A 4AVCA 3WUDA 3CDZB 5DAVA 3HBKA 1ULCA 1GP4A 5F5AA 5ABJA 2AYHA 5IYYA 4OHWA 5C3RA 4FAHA 1BK1A 4DUWA 1RUH2 4OULA 3THPA 5IFPA 4CPBD 3MICA 3MYXA 3GM8A 1GZWB 4A45A 4EV0A 3ZOIA 5FZ4A 4NRQA 5T5PA 1LNSA 2D43A 2P17A 4FOWA 2VCBA 4H7MA 4I09A 3WDUA 1VMJA 2F17A 5JIAA 3JD72 1CJPA 5DDJ2 1YJLA 3R0RA 1VBA3 4JDOA 2JDMA 2QQMA 4LKFA 1MS5A 1H8TC 3WOGA 4CZSA 1DF0A 2I07B 3TYJA 4AF9A 1VBB3 1SLBA 2OX0A 3KZ4C 1US3A 1XB9A 3ETPA 3MV11 4I0WB 5BUVA 3LDBA 1W6PA 4CCCA 4PT6A 5DAWA 4K9SA 3VD4A 1CR7A 2B4KA 1ND2B 1T6GC 1S0FA 3ZSMA 4Q26A 1UKRA 3O12A 4BB3A 1D4VB 5FZDA 1ZYBA 1RHI3 2P4EA 4GAZA 3D82A 3ZYPA 2WO7A 4CXXA 2QQPA 2OVUA 2W68A 3HPNA 4YW5A 2D44A 3N7KA 3IMMA 1XXNA 4CU9A 4OHXA 1GICA 2J22A 3NAPB 4PDWC 3AKRA 5CU1A 2VQ0A 3CO2A 3W20A 4AGVA 4D7SA 2Z5WA 1WMFA 2PTMA 1LGCA 2VZVA 1GANA 2Z79A 1W2TA 4FFIA 1LGBA 4AFCA 1W6NB 3AP6A 2JDAA 3N4MA 4NIDA 4CA9A 1N47A 3GHNA 1CIWA 5DUWA 3F95A 4LBLA 5FY8A 5IVJA 5I0TA 2UURA 4K40A 1IKQA 4Q4W1 1XNTA 3INAA 1W6QA 2ZX0A 1O8PA 2RE9A 4LBMA 4MXWB 4EN7B 1V9U3 3I4IA 3FC0A 3D5OA 5C4WB 3V0AB 2BNMA 5IWFA 4PQQA 1GNHA 1XYOA 3E97A 2VL4A 4IV3C 4HOOA 1C28A 4RR3B 1F35A 1HB3A 4NIAA 3ZXAC 2FZ2A 4L9BA 1SFNA 2JD9A 3NKGA 4ZHNA 1LU1A 2XXZA 2YPDA 1OC1A 4RGKA 1WGPA 4EZ4A 2VZSA 4HG6B 4XF1A 1BKZA 1YO8A 2ZEXA 2PHUA 2ZBJA 1ZZBA 3WF4A 5AVAA 2A6YA 2VY0A 1UF2C 4QQOA 3WG2A 5KWRA 5ANQA 2K2SA 2W3JA 2WL1A 3N7MA 1QMJA 2GC2A 3NNLA 3F2ZA 1LOGA 1RUD2 4XFBA 3M3IA 3VBFA 2HWF3 3JBG1 3WSOA 5C9AB 1AUYA 2B42B 5IUQA 3ENRA 2LUWA 4UWDA 1C3HA 2WQ8A 2UWBA 2XKPA 1MEC3 1YWKA 4Y5Z0 4BXSV 4RYDA 2YYOA 4EROA 2CU5A 1NXMA 4IEXA 3BN6A 1NCRC 1OURA 1KGYA 2VD7A 5IW0A 3VKMA 4OVEA 3RZZA 1GOGA 1DYKA 3O0XA 3GJAA 1UU6A 3OD0A 5GZCA 1RUJ1 2DV9A 1JYVA 2W0XA 2ZGOA 3AKSA 4AEKA 2FDGA 3KCCA 4NWWA 3AYCA 5FZ7A 1QU0A 1ZZ6A 4Y22B 1GV9A 3J8F1 4ZXKA 1V6OA 4RN5A 3C7FA 1ASJ1 3N9MA 4XPVA 2FDKA 3PIGA 1AYM3 1HN0A 4EN9B 3A0NA 1YUDA 2GH2A 1O3RA 2HWB3 5F8PA 3OJBA 1W9FA 1SPPA 1OT5A 2UY9A 2W39A 2CGNA 2B9UA 4S2DA 1NE6A 5JPNB 2WNUA 1UN1A 4LBQA 4Q1RA 1PHMA 4MUVA 1OOPB 5GLUA 2XPJA 1K42A 5FIXA 3USUB 3KF3A 2C1FA 5L7OC 5GJ6A 3V65A 2IVJA 3OPZA 3Q9OA 1LOCA 4QWNA 1US2A 2XVGA 3ZN6B 3ZSKA 4CDWC 2GN3A 3GBGA 4MYEA 5FUIA 3N9OA 2AACA 1ZBE3 4RQPC 4E2QA 4LIVA 4F8AA 4CDXB 2BERA 3OGRA 1QJFA 5CZKA 3WXPA 3KLSA 4WVMB 2LTNA 5APAA 5IT6A 4FPJA 1UU5A 4R9AA 5F5QA 1O6UA 1WA4A 2AUYA 3MO4A 3FZ3A 1L7LA 2DCTA 3SLIA 1AL21 3ZSLA 1MR5A 2VR4A 1QF3A 4BH9A 1BXHA 3GXUA 3NV1A 3HWJA 5FPAA 3J4UH 4CUAA 1B35C 5FZ6A 4PI0A 4L11A 4L8QA 1IG3A 4GWIA 3BODA 2BVVA 3IDAA 1R1A1 3AVRA 3VKNA 1G6NA 3K4DA 4K1ZA 3U1XA 3RYKA 4AFMA 2OQ6A 2YBSA 1LGNA 1POV0 4NOTA 4V1PA 4X8NA 1W2NA 4AFAA 4FPOB 2J7MA 3RG0A 3SEPA 4BQ2A 2GSYA 2ERFA 3BIWE 4YZ4A 1OD3A 1UKGA 1SQ4A 2JG8C 2AREA 3P6BA 4B1LA 1BLZA 5FV3A 3ZXEA 3PUAA 5A3LA 2PFWA 3RZJA 4GQ7A 2XJRA 4WM7C 5JVVA 1RUI2 2XJVA 4P9JA 5EIYB 1H9WA 3CEWA 2D6KA 4N9IA 1A34A 1LJ7A 3RJRA 3B3QE 3WNMA 1VIWB 2CV6A 5FZIA 5HCBA 4A6OA 1I6XA 4BLIA 4Q4V3 1OKOA 2AEZA 2NMOA 1HW5A 1TG7A 1W90A 4QX0A 3FHQA 1ZRFA 1V0AA 4FXKB 1HV1A 4KQ7A 2V09A 4QU2A 5L73A 2DCKA 2YDEA 5CB7A 4NROA 1WWYA 3TAYA 1AR73 3VDDC 1NLSA 3MI8A 2Y6KA 5DPNA 3PNAA 2ARAA 5A32B 1BZWA 4CCEA 3ZFGA 1JUHA 1V6JA 4JDNA 3SEEA 4QPGA 4JGYC 1Q8PA 3HN3A 4ITCA 3ZXFA 1RUF1 1FOD2 4BOWA 3VHNA 3WP4A 4LHLA 1BVP1 2VMFA 4UYBA 1HLCA 4PHZA 1Y7BA 5F9TA 1W8HA 3NJYA 4FOQA 2Y64A 1CPMA 1HXS2 1R64A 3HQUA 5FPBA 4E8CA 4URAA 1JZ2A 1CZVA 3H1YA 3HNYM 2AH2A 4DY5A 1XOYA 2WQZC 3IIAA 5KC5A 5DMYA 1LRHA 1GP6A 1Y9GA 1BBT2 4QPIC 1I5PA 3LEMA 2ZTNA 2DFCA 3BGAA 3B00A 1F8VA 2EXKA 1PGW1 1C5IA 3POFA 1UY3A 3IBMA 3ILRA 4IE4A 4QXBA 5CBLA 1NZIA 2DBNA 4C1XA 1EAH2 5LBCA 5ABJB 3RYPA 3ZFEC 5K7PA 2A1XA 3OYWA 4E4HA 1GU3A 1RVF1 3D6EA 3SC7X 1MS9A 1S2BA 4CTEA 4NJ4A 3KHCA 2ZEYA 5DUUA 2HWD2 2PAKA 3I3QA 2WZ8A 4O65A 3AXEA 2ZAHA 4CP2A 4ZS2A 5FYBA 1UXXX 4ZPIA 2VUCA 2F4LA 4E4DX 1DQ6A 4L0PA 4LLFA 2Z2SB 4WVWA 1VAVA 2ID4A 2KM2A 3AP9A 5IVYA 4AOCA 4LHNA 2EIEA 2JDYA 4K8RB 3MLKA 2VXRA 2XJQA 3M4FA 3ZYHA 4BMEA 5A3MA 2ATFA 5FZEA 3FFZA 1W0PA 4BM8A 5I91A 4LITA 3VBSC 1MZ6A 2WT2A 4LOTA 4CEYC 1W6PB 2MHFA 4IGOA 1RUH1 4GJYA 1JZ7A 5FZ9A 5KXBA 3Q8AA 3QCWA 4BK5A 2BGCA 2XQRA 2YHJA 4KWUA 5L36A 3BTXA 2R062 3EB7A 1FNZA 2OXBA 1ZRDA 2AR6A 2CYFA 1Q43A 4UT5A 1ZA4A 3JD71 3DPRC 1ZZ9A 4XFAA 2KXLA 2ARBA 3KMHA 4GWMA 2GZWA 5C8WA 5LY2A 3RYRA 4CUGA 1UYPA 2P6HA 4M00A 4NUBA 3OUIA 1PVC3 2VZTA 1JOJA 3N35A 3SKJE 5FYMA 5KR7A 4AHYA 1L7QA 3THTA 4AVBA 1J1LA 3I2IA 3AMPA 2Y34A 1F15A 2BGPA 2WAAA 4NR1A 3T0BA 2X53S 5FY5A 4L97A 3OGJA 4MOAA 2R0HA 4XF3A 1CN1A 1CAXB 3AMMA 2D97A 2C0ZA 4AYUA 4OFGA 2VZRA 1W6QB 3KWVA 5E89A 4BYYA 3B9CA 2VMEA 5FZKA 2GP5A 4LBNA 1K3IA 4P00B 4NHMA 2MEV2 5C3QA 2W95A 3Q8CA 5GZEA 5EPAA 4C90A 3GZTB 3QOPA 1H8VA 2JKBA 4IGPA 4JKLA 5FZHA 5LRRA 1EV12 1RINA 1TZOA 4W8JA 5JOXA 2I2SA 1JZ8A 2X5IA 3HMYA 5FJKA 2A75A 4Y5SA 3PUQA 1A6CA 1F5JA 4CDUC 2WABA 2VXJA 2XWJB 1W9WA 4AEMA 5I93A 4LK6A 2VOTA 1S0JA 1UY0A 1ZRRA 4OMDA 5I8SA 4RHV1 5ACA3 2C9KA 1QJX2 5FREA 1QOSA 1VRH2 3T4HB 2AEYA 3E5QA 4WVVA 5H9QA 4AEDB 1OA3A 2W2IA 4ARXA 4FAGA 4P08A 3LEGA 5CFDC 4Q0UA 4FTEA 1JW6A 4QX3A 1ZX5A 4AGGA 5EHDA 3CJIC 1H0BA 3H0OA 3R4SA 1S0EA 3N7JA 3K2OA 5FY9A 4JVAA 4CE8A 1GZWA 4ZZ5A 3VZJA 1WKYA 3OOXA 2VMHA 2W46A 3MUZ1 1DBNA 5FAXA 4OZOA 4LTAA 2UY8A 5FMBA 3SKVA 4DXSA 4NAMA 4AI1A 3MFAA 4IL7A 4XJ8A 2GP3A 1AJKA 4FP3A 3LA7A 5KHGA 4YGBA 3BKZA 1H8TA 3EJKA 4Y5TA 4QGLA 1YJKA 4B29A 1OBNA 5A3UA 4B8EA 5C3SA 1JU4A 2QQNA 1VBD2 4YW6A 1RUD1 3P1IA 4BZ4A 2RR13 3EXUA 5KXDA 1ENQA 3JB8A 1UU4A 1ND2A 5IVFA 2JECA 1FV2A 1LOAA 4LBQB 2BRTA 4K7JA 2WQ4A 5LEJA 4Q4W2 1FT9A 1R092 1YQ6A 3MW4A 1XNKA 5A3WA 3EBRA 3TNQA 1WBLA 1L7RA 3O0WA 4XQ4A 4E2GA 2ZKNA 1ZA7A 4JDMA 2FCVA 4LBJA 3VBRC 1D4M3 5C7GA 4EE2A 3C8XA 4AI8A 1RUG3 1W3XA 3VZMA 3MIDA 5JOZA 4QB1A 4AE2A 4MGZE 3WR0A 1OA2A 2RM23 1S1AA 4LLOA 3U78A 1J58A 1WLTA 4Y1XA 1W6NA 3JXSA 4QB2A 4FSJA 1ZNPA 2WZR3 1ZZ8A 3M3QA 4A3XA 5FZCA 1DYPA 2OUHA 1MACA 3BB6A 5C71A 2DYCA 3OSDA 1OH3A 3D0JA 2V4VA 2ZJCA 2XUEA 4H7LA 4N53C 2A3WA 1ZZCA 2OQ7A 4ONUA 5EV7A 2FZ1A 3JQXA 4KWKA 3KCYA 2RJLA 2JB4A 1CX4A 2ZGQA 1TMF3 3LDRA 2ZA9A 2QQUA 5E88A 2Z69A 5C4WA 3A22A 2QQJA 2BV4A 3BIEA 1OA4A 4RR3A 2IXIA 4IV3A 3WP6A 2AGSA 2Y38A 3FLPA 1S0CA 3N9QA 1NX9A 1AR63 2B7YA 5FTTC 4AEJA 2BYVE 1XNBA 1WCQA 1ZM1A 1UY1A 3FUQA 4N7IA 1SCSA 4XJZA 1GWMA 1LOFC 3LEKA 1LEDA 1SFYA 1YQCA 5A80A 4M3CA 2RS13 3DF0A 4BE3A 4XBQA 1W8ZA 2VMIA 1J3QA 3H1WA 2WA3A 3QBQA 4MLOA 4Q4X2 1ASJ2 4Y3OA 4ISQA 4ATFA 3NKTA 1EPWA 2ES3A 5FY4A 4AVAA 3WG4A 5BNPC 1CVNA 4Y24A 5ANNA 2GAUA 2JDZA 3D8CA 4DUXA 1KDMA 2NPIA 3S7IA 2YBKA 4FTBA 3ON7A 5JMOA 2VQTA 3ZXLA 2Y6LA 1UYYA 5A3OA 1RXGA 1XNCA 4Q4Y2 5EXOA 5JI7A 3SH5A 4MZUA 2DU0A 2KD7A 3ZFGB 4I0BA 1RUI1 1VMHA 3GNEA 4CDQC 3O1VA 4P9LA 2R0FA 3FE5A 4CPBA 2VG9A 5F39A 1D0GA 4FPFA 4JGZC 2QTWB 3FN9A 3VDBA 4N90A 4YVSA 1V9U2 5IFTA 1HB1A 4Y22A 1NY71 3POSA 1UOJA 4OI1A 1G7YA 4FPCA 1H1IA 4UFJA 2VW0A 1JXNA 1LULA 1QJU2 1HRI3 1IPSA 2ZOEB 1PGL2 1ZBA3 1HJFA 1E5IA 5DAQA 3ZMOA 5JZGC 2BFUS 4IEOA 3ZPYA 4MO3M 3TEXA 1X8EA 2QVSB 3LKJA 1UZZA 5BPXA 5FYZA 5ISLA 1DQ2A 1AL22 2NM1A 4MX3A 2D40A 5J37A 1LAJA 3C2UA 2AENA 4BQ4A 4YM2A 1QDCA 2F6BA 1QDOA 3CKHA 2XWBB 4W6XA 1ZVFA 1HB4A 2ZMNA 3LA3A 4QGNA 1DZRA 3K48A 4CXWA 1CESA 1CONA 4Q29A 3A0KA 3N9LA 2A6VA 3I2KA 3SCGA 3TBDA 5L7OA 3ZN6A 4IQPA 4N7UA 2RMU3 1CAVB 2O1QA 3ME2A 2EIBA 1PK6C 1GP5A 5FCCA 3PIJA 1ENRA 1GUIA 3VL8A 4RQPA 1PO11 1KFUL 1HXS1 4WVMA 5IHRA 1IG0A 3ZMNA 2BZDA 4A4AA 2JKXA 4ASKA 5JSOA 3PVEA 5HV4A 3NV2A 3PMSA 4COVA 3CZUA 4DOUA 3IZOA 1SBDA 4MH0E 4R9CA 4EJRA 2VZUA 3QACA 4YG3A 4HKWA 5HV0A 3NNFA 1K5MB 4JV4A 1OHFA 3ZYRA 2ZKLA 3AZXA 4CU6A 2X09A 1W04A 3DYOA 2D5FA 3WW3A 1AR93 2GDFA 1MPXA 1AYN1 1AYM2 1ONAA 2VOKA 5C70A 2BPA2 1KRIA 5F1RA 1EAH1 3RJ2X 4PLNA 4TLGA 4MHRA 4NAOA 2VBPA 4Y1UA 4YGEA 2UYBA 3RI9A 3ABZA 3AKTA 5F5IA 5FO7B 1S2EA 3AKQA 4IEYA 4TSVA 4E27A 2J1RA 4A41A 1NCQC 1XC6A 2D5HA 4M0HA 3UGHA 5KXEA 4DB5A 4IE5A 2R6QA 4OUMA 5J3UA 2ZZJA 4GMP3 3DV8A 2WNVC 1O7FA 4Y1YA 3PURA 2FHRA 4PLOA 5FPLA 1X9PA 2OA2A 1LHOA 1Y3TA 2P1BA 2PXJA 3MPPG 4LR4A 1JYIA 3KQRA 2EF6A 2PYTA 1GNZA 2X10A 4XHXA 5EJZB 1XYPA 2RV9A 4HLTA 4AQ6A 1QXJA 5LK7B 1H2LA 1T6BX 2JG9A 3B5LB 2Q1MA 5FPVA 4XDQA 1AZDA 5JR7B 2E26A 4QKNA 5A32A 4Q27A 2Q30A 3AMHA 1H1MA 1Y9QA 3NJXA 1WMDA 2R061 4RL7A 5FPXA 4WZFA 1DYOA 4NO4A 1KDKA 4JGYA 1XE8A 3E5XA 1GSLA 3U0ZA 5FZOB 4XF4A 2V72A 3BVCA 3O7OA 4IV1C 4ATEA 4HVRA 1W9YA 2WKKA 4XCBA 2XUMA 5CKQA 3DYMA 2WT0A 2VNVA 4BCUA 3NNMA 5M0TA 4PI2A 2ZEZA 3VDCA 2OZ6A 4AAPA 2X5IB 1DZTA 2ZAAA 1UY2A 4JX0A 4NIIA 4LO5B 1WBFA 2QQVA 4P9YA 1UIJA 2EIGA 5C8CC 4KI5M 2WNOA 2VZOA 4K20A 2W1UA 3CHXA 4I30A 4K1YA 2VZQA 2YC0A 2HEYF 4Q2FA 3VD7A 4CEWC 2O0OA 2CL2A 5KHIA 4Q4V2 1SLIA 2VCCA 2OUJA 1EYBA 5T3NA 1DQ5A 4ZS3A 1LKNA 3PJYA 1QIQA 2NYYA 4XF0A 1UYXA 1G9FA 2MEV1 1QXRA 2VPVA 2XLAA 1W3VA 1LEMA 1C5HA 2W47A 2HJIA 2P5BA 3HQRA 1EV11 2IVIB 4XACA 2B45X 1COV1 1QJY3 3OTFA 3PU8A 4RA0A 5DQ0A 3TN91 3OBAA 2ADDA 3VBHC 5KXCA 2IXHA 5GLVA 1VBC3 2FDJA 1VPHA 5CISA 1HDKA 2XBO3 1LODA 5F7UA 4W6YA 3OPTA 4NE9A 3ZFFC 4HANA 2HWC2 5HXMA 1QJX1 1VLNA 1H8TB 1VRH1 5JCTA 1CX1A 5CA6A 4ZKTB 3FLTA 2C9AA 3BCWA 3J26N 4UW6A 2PHRA 4XEZA 1IS3A 2DFBA 2PELA 1C4RA 4R8HA 3TNPB 5I0UA 2GC1A 4W65A 1JI6A 3TEYA 3TWIA 3M3OA 4DXRA 1FPN1 3KT7A 3LF7A 3L9JT 1TEIA 3GYDA 4PQ9A 3DKQA 4IUGA 4B7KA 3IN9A 3LDKA 1REDA 4XOGA 4CP0A 2R041 4R52A 1G8WA 1I3HA 5CNAA 1YQ5A 1ULGA 3DPRA 3I3DA 2ET1A 1OI6A 4MXVA 2JD4A 5FBZA 5K0UC 2Q5TA 1YCIA 5GZDA 1DGRA 4WM8C 3K46A 3JBG3 1CAUB 1PMHX 3PU3A 2DWRA 1VBD1 3LAGA 2DURA 3M1HA 2O8QA 3RPQA 4D7YA 3H1MA 2A3XA 5L19A 3K3NA 4CDUB 4MHUA 5LZ6A 5DZGA 1BEV3 3MV01 5GZGA 4U36A 1LHNA 5L9RA 1R091 4RHV2 5B4XA 5A6YA 2JX9A 1CAXA 3PUIA 1J3PA 1X9TA 2HH9A 5ERLA 2E32A 5F3CA 2E7AA 3NAPC 4UBGA 3OBTA 5CAZA 4OI4A 2E51A 4OZXA 5HI0A 4XUOA 1UNBA 1W6OB 2CAVA 3N36A 5BNOC 4ZZ8A 2XQXA 5IK5A 4IV3B 3FUOA 3OF1A 3ORJA 1N3QA 1KJLA 1JOPA 3AZVA 3E1F1 3OGVA 4A3ZA 3T3YA 3I3EA 2VCAA 4X6QB 1SLCA 3B01A 2P37A 3ES1A 1GKBA 4GMP0 4QX5A 3AL6A 2XB6C 4O9GA 4M3CB 1UXZA 2DVDA 4MVTA 3QH7A 3HNMA 3I2JA 2E7QA 5K8SA 5K0UA 4LO7A 2A6WA 4GZ9A 3USSA 5B2GB 1NA1C 4AEDA 1ENXA 1VBB1 2RJ2A 1ULDA 4Z07A 2P34A 4YZ1A 2YPJA 4ES9A 1FMD3 3JZVA 3OY8B 2YFUA 1URXA 4META 2R073 1POV1 1Z78A 4AI3A 1E5HA 3B93A 3LIGA 5TSWA 1IKPA 5GALA 2Q0AA 3M7AA 3PTRB 1J1TA 3DEMA 5JLVA 4D7TA 4D94A 4FFHA 1GZ9A 3KGZA 1RHI1 1NCRB 3KVBA 4P5YA 5E6HA 2PN5A 1NT0A 1T2XA 5F3IA 5FYTA 5FUPA 2D6MA 1WA6X 4DS0A 4P9IA 1R1A3 4YVSB 1RUE2 2JE9A 2BJSA 2RDQA 2VNGA 4LEJA 2ZGNA 4Q4X1 3RWKX 2XH6A 2JICA 1Q56A 3LSEA 4QDRA 1S4CA 1OSGA 3VD3A 5DAPA 1HX6A 1Q8SA 2RDRA 3K4AA 5FZLA 5IJRA 3H8OA 3L2HA 5LK5A 5KC6A 1PZ9A 3V64A 1XU1A 1GNYA 3UL2A 4QXKA 1FV3A 4OUEA 3KV4A 4Q4Y1 4QPYA 4NHYA 4XJWA 3THDA 5F6KA 4BQWA 1AVBA 2SLIA 5JOWA 3GBFA 4AXOA 4X6RB 1NQDA 3BTZA 5L7OB 1VALA 2C6SA 2QQWA 2ZXQA 3PUSA 4KL1A 4CDWB 3GGLA 4MG2A 5EWSA 2BUKA 1V9U1 3VBRA 1RUC3 2JB8A 4XUPA 3D3AA 2RS52 4RQPB 3ZN5A 2CY6A 1QJU1 3HJRA 4JC1A 2XMLA 2VC9A 3RSJA 3WNOA 1OMIA 1PZ7A 2FMYA 1PGL1 2R1DA 2Y6GA 3S30A 2H0VA 3R4UA 4XXPA 2W08A 5FP9A 1AHSA 1K12A 1Q8VA 4JRLA 3WP3A 3DYPA 4TYSA 1S55A 3B02A 1GQGA 5BXXA 3PTYA 3UK9A 1KJRA 1UMZA 2ZEWA 5DZFA 3WNNA 2PLV2 5A7PA 5CEHA 1RUF3 2BNNA 2J1UA 2DVBA 1AR82 3NJVA 2D3SA 2X8KA 2WINB 1PIV2 5E1RA 2ZGKA 4CVUA 5I8YA 1CQ9A 2PQQA 4HONA 2FDHA 4MGYE 4RSUA 2VMDA 5FDBA 1UYZA 1LECA 4KG0A 3C7GA 3WQ1A 1VB2A 3KSCA 3WF3A 3E6BA 3T0AA 2VOWA 3NVCA 2ARCA 2BDRA 4Q0VA 3V56A 1SDDB 2JG8B 2JE7A 2XVKA 2DVGA 2FCTA 3R05A 1K5JA 1XSRA 2EALA 4GH4A 1SHWB 4V2WA 4WM7B 5A7NA 4UI9L 1JZ4A 3WZ1A 1NY72 2ILMA 3ZX7A 5JSRA 2JE8A 3POWA 3M3CA 4QHOA 5FK8A 4KGQA 2V4AA 3THCA 3C7EA 4MGIE 4E4ZA 4LKDA 1CGPA 3IDBB 2Q1FA 1CZTA 1VMFA 3AX4A 1AYM1 1QOTA 3J7NA 5F37A 1E5SA 2RM22 2WWSA 1W9SA 4O61A 5EFUA 3AYDA 4JHTA 4XIKA 1RGSA 3ILNA 3HR9A 1EY2A 2UU8A 3WF2A 3CMGA 4XDOA 2JG9B 4Y1ZA 2TBVA 3LEIA 3KHBA 5J96B 1ODNA 5C3OA 2FDIA 5DABA 1O4YA 4OI2A 1WW4A 3Q8FA 1J84A 3PUHA 3AP7A 3HEIA 3MUY1 4CDQA 4JGYB 1HKDA 1TE1B 1NKGA 1HJGA 2VVFA 4JGZA 4FVVA 4RGAA 3SISA 5CKNA 1OLMA 2CDOA 3AP5A 5D8AC 1PO12 2W1WA 1XPWA 5FK7A 3ETQA 1O5UA 5JAXA 2QZ2A 2ZX2A 3MEPA 3KM5A 4QX2A 4Y4RA 2WO1A 4XDPA 1HRV2 1RUH3 1G9BA 2BBVA 2X29A 3POBA 4HXCA 1YQ8A 5IATA 1G86A 1N1TA 4CCMA 2WYFA 1JZ5A 2WZPP 2QNKA 4QPIB 4X8PA 3SCFA 1DP0A 4EN0A 3JD73 5DDJ3 1K45A 2W92A 2P3JA 1ENSA 2CAUA 1AYN2 1Z7S2 4S2HA 5FLHA 4DO0A 2LALA 1ZREA 1CAVA 2ORZA 2ETEA 1V6IA 2YU1A 5F3GA 4YPJA 2YFZA 5I8TA 1B09A 2ZGRA 3AMQA 1V6KA 5I0SA 4DFSA 1W39A 1V00A 1UOBA 3H3LA 4EWAA 2WS93 1U5ZA 4YLZA 5LB6A 4L99A 4DEQA 2XJTA 1K5MA 1O59A 2VW2A 2DCYA 1XNDA 4K3UA 3WVJA 3OBRA 3ZN4A 3MZHA 1MQTC 2FD8A 4Q4V1 4YVWC 3AJZA 1S0GA 1GWLA 3OUJA 2A5ZA 1DIWA 2BEOA 2EAKA 4XF9A 1AL0G 2AC1A 4FQZA 4TN7A 2VVEA 3VBOC 5EQUA 2WJSA 3DGTA 3N3HA 4G3YC 3VBSB 1JZ3A 4CEYB 4A44A 1AR71 2BWAA 5GLZA 4KU8A 1APNA 2VZPA 4NN0A 4D6SA 4L92A 4QU1A 3S5AA 3FBMA 4Q5OA 1X7NA 2JIGA 5GM0A 3ZKYA 4AHZA 3I49A 4M0NA 4B4RA 4DUVA 1AXYA 1F4AA 4QD2A 3SXWA 2YMZA 3DPRB 2EXIA 1JYWA 5FZ0A 2A6XA 1VBE3 4WV8A 5L9VA 2HWC1 2BOJA 4HN0A 1OF4A 4AQTA 4HK8A 1YQ2A 3LWCA 2LS6A 2VUDA 4Q0PA 4XW3A 3BU0A 3POJA 3E6DA 2QJVA 4RD7A 2ZHLA 4OI0A 2QFEA 1H4GA 2Z42A 4BQ1A 1POQA 1VAKA 2ZACA 1DQ4A 5E16A 3IDEA 3KCXA 4HSJA 3AJYA 1EUUA 3T1LA 3NQHA 1H2MA 3FHAA 2WA4A 5A3PA 2LROA 1LOBA 2VQUA 3AZWA 3S5QA 1HQNA 3HT2A 2WFF2 3ST7A 3UKNA 2VOXA 2W87A 3WDTA 4DY3A 2ZGMA 4FPKA 5FZOA 3LD8A 3DXTA 1JMUB 4AVTA 4XURA 4HT1T 5JI9A 2VMCA 4PIZA 3EMRA 1UOGA 3QLQA 3CIHA 3ZR6A 1RUD3 4CSWA 3O1MA 3DUIA 1W8OA 1UZYA 4IV1A 1R082 5A7SA 4BPZA 3VLBB 2J1SA 2W1SA 1COV2 3TN92 5FOBB 4P9WA 2BQPA 3ZYGA 1IZ3A 4BJ0A 2A71A 4NHXA 4LORA 5LWBA 3ILFA 2G9ZA 4Y20B 2EXHA 1N3PA 4Z1VA 1G9AA 4SBVA 2ZHKA 3LPGA 3PHMA 4HMZA 1GLHA 4OUSA 1RUNA 4P14A 3K51A 5T52A 1CAWB 1RTVA 3I59A 4N43C 4AGRA 2WAOA 1RMU3 1SFPA 4Q0QA 1KITA 2GNBA 3AKPA 5CKMA 5BYNA 4YW4A 5FMOS 4LBKA 2YC4A 4UFIA 5CFDB 2IC1A 3LSDA 4INDA 5LA9A 4XJUA 5EZWA 3B7MA 3A4UA 2HWE2 3CJIB 1A78A 1FPN2 3IWZA 3MLJA 3AYEA 4QQ2A 3ZDSA 1GMMA 3H3ZA 5FXZA 1U12A 4JCKA 4XXAA 3VBUC 1OH4A 4RS5C 3ZR5A 2Y33A 3NL1A 2MPFA 2R042 2PHXA 1U5YA 3KB5A 1LCLA 1YHFA 2VGDA 3M8LA 3N7LA 1UD1A 4GD4A 5FMDA 1PO23 2WLPA 4UXAA 3VBFC 3VDAA 2OPKA 3M70A 3ZFFA 5T5JA 3ZXDA 4OHYA 1OQ1A 5FOJB 2GNMA 5J48A 5JUVA 4YZ3A 3WNKA 2WSVA 3OG2A 2OKXA 2UWAA 2D98A 4QHZA 5FY7A 2VMGA 2O14A 2WN3A 3WX5A 4UFMA 4TLFA 1TNFA 1ULFA 1W0NA 3AK0A 1Q3EA 4OHZA 3I2OA 2QDNA 4QX8A 4JQTA 3ZLIA 1O4TA 4NRMA 2RS32 5FYUA 2BFUL 5JR2A 2CGOA 1BVVA
chains in the Genus database with same CATH topology
4UW5A 1RUE1 4P9GA 3VBRB 3VGIA 1QQP3 4PBPA 1V70A 1PNFA 4DQAA 4PDWA 4ISRA 4UBHA 4XFFA 5K0UA 1CAUA 1C8M3 3S6PA 2HYKA 4QQPA 2DTWA 2WNUC 4AI2A 1UAIA 4BA6A 3ACLA 1QJY2 2PHLA 3WG1A 1C1FA 3ROUA 4AG4A 4GB33 1WD3A 1S2KA 1RUI3 5CFCC 4HKLA 2TNFA 4B4PA 2XBO2 4AK3A 1VBA2 5K9YA 1FI2A 4HN1A 1RL3A 3WDVA 1XE7A 1VBB2 4N53B 4XMAA 5FLJA 1OQDA 3AM2A 1AXZA 3GZAA 3WD5A 1XQNA 3VL9A 1H2NA 5I0RA 2I45A 2RS51 4W6WA 4IERA 1MZEA 2ZHNA 1W6OA 4YGCA 3IM0A 1Q8QA 4I01A 3UV9A 3FWEA 4O9EA 4M3CE 1DDLA 1M4WA 5BNOA 3RWNA 1RHI2 2D3PA 4GH4B 1A3KA 4YSFA 2OIIA 1OPOA 2PLV1 4FOYA 1FOD3 1TNRA 2YUEA 3H3UA 1AR81 2PAEA 4URTA 4Y26A 1SBFA 1PIV1 4F7ZA 1SCRA 1UW8A 3VKLA 5HCFA 1UCXA 5BNPB 3EQEA 2BW8A 4HFSA 1X33A 3OY8A 4GIQA 2RR11 4E2SA 1J59A 3U07A 4IEZA 2MNGA 5FLIA 4G4FA 1BBT3 1NCRA 1WLCA 1I9RA 1LENA 4CDQB 2YY1A 5SV5A 1DFQA 1OQEA 2ZGLA 1N1SA 2OZJA 4JGZB 2XLGA 1D4M1 4TZDA 1H9PA 4I02A 1Y43B 5HCAA 5EYXA 1RUG1 2CTVA 4H55A 1HV0A 4K8FA 3QH6A 2RM21 1ND3C 2HWD3 3RRDA 3ZFGC 4QPGC 1PM7A 4DXZA 1XRUA 2TEPA 1NE4A 3WCSA 4Y4YA 3CF6E 1BYHA 4YM3A 4IETA 4XTPA 1NLRA 2R30A 1MS1A 4CDWA 3JUUA 3KGLA 3P3PA 1Q5OA 1TMF1 1V6NA 2HWF2 4A7YA 2GU9A 1Q8OA 2HEWF 1MEC2 2D6OX 1BJQA 2SBAA 1D2QA 5DZEA 5AFBA 2E9QA 1O3TA 1N3OA 1HRV1 1CJDA 3W59A 4COZA 4M3CF 3KT4A 2K9ZA 5FQ0B 1VP6A 2R063 3TB0A 3ECQA 1B35A 1RC6A 3VZLA 4ORFA 1DQ1A 1Z7S1 1MS8A 5T54A 4GKXA 3VKFC 3BALA 2HWB2 1EP0A 1REEA 5C6CA 3HT1A 2PHFA 1H1AA 4G9SB 4QQHA 2E53A 5T5LA 3WCRA 2JG8A 1DU3D 4QM8A 4OHYA 4H14A 4WM7A 5C33A 1TME3 1NCQB 4GWNA 4HETA 2NMNA 1WD4A 2GNTA 1L3JA 1ZBE2 4S2FA 2WNVB 3ZSJA 1RUC2 4B4QA 2Q1ZB 1JUIA 1A8MA 4AFBA 2D6LX 1HRI1 4XQWA 1ULEA 1ZBA1 2MEV3 2FQPA 4D3WA 1KD7A 5JWPA 2XHKA 2FBEA 1EV13 5JIUA 4FPGA 5J36A 3LA2A 4FO9A 5CIRA 3VDDA 2XJPA 5HXVA 3O14A 4LE4A 1RIRA 3SMHA 2ZABA 3CU7A 3I7DA 4ASMB 5LRSA 4YM1A 3FJSA 1LHUA 2RMU1 4A2UA 1YFYA 3EHKA 3WY6A 4FPYA 4IV1B 4XFGA 3OGGA 1NG0A 2Y0IA 4D69A 2H6BA 3WW1A 4PIXA 2IXKA 2ZHMA 5C8CB 4R4XA 5EYYA 5D1IA 4QPIA 5BNNC 4I0AA 4P5HA 5A33A 3WNXA 4CEWB 2ZMLA 4M01A 3ALQA 2WFF1 3I59B 1NQJA 1U5IA 3ZXGA 1YI9A 3HBZA 1AX2A 1MS3A 2QDRA 4NHLA 2XL9A 1YIPA 1XU2A 3J9SA 1IS4A 1MZ5A 3ZFEA 1VBD3 2X5IC 1AR72 2A3YA 3WUCA 1WW7A 1R081 3S0MA 3WDYA 4C1WA 5GZFA 2IFRA 1QKQA 4Q4W3 4YW1A 1R093 4I2OA 3PVNA 4Q1PA 4GMP1 2ZZQA 4KGGA 4YM0A 4PBOA 2P3KA 3ZFFB 1MQTA 4DRVA 1DGWA 4YVWA 1RJ7A 4KNCA 3AP4A 4XE9A 1D2SA 4HKOA 1OFSA 3VBSA 3AFGA 3VBOA 4CEYA 1C1LA 1OFNA 1KS4A 2HWE1 2EXJA 4XFIA 2GMPA 4YG6A 4J6GA 2XGXA 5SV8A 4AI0A 4Z2WA 2B8MA 1VJ2A 4PLMA 1MVQA 5KHHA 4JAAA 1G9DA 3G6JB 1TQ5A 2GMEA 2HEVF 3AZZA 3ATGA 4XMIA 1V6MA 4NPRA 2ZGSA 4PDWB 5K0UB 3PVBB 1POV3 4WM8B 1ND2C 1EPZA 4IEPA 1J3RA 5J7MA 2WS92 1IHMA 1IQAA 1GFF2 1QNYA 2EVXA 1UIKA 3GF6A 1AX0A 3ELNA 1RUJ3 3RNSA 3WDXA 1NXD1 2RS31 5JOYA 2DUOA 2IXJA 3WW2A 3J8F3 4Q4X3 1ASJ3 1PGSA 3T2TA 4XTMA 2XJSA 1SDWA 1MZFA 2XG3A 3MW3A 2QE3A 1DG6A 3RMYA 4KBBA 4Q8KA 1HQLA 3FFQA 3H9AA 4LHKA 1AJOA 5BNOB 3T1MA 4DINB 1YFXA 4FXGB 2QZ3A 1QJY1 4AQSA 3BOWA 4Q4Y3 4COUA 2H6CA 2YROA 1YI7A 1LESA 1OLQA 3MF9A 3MFCA 2CGPA 1VBC1 2DF7A 4Y20A 4FTSA 2ZMKA 4CRQA 4CDUA 2XBO1 4XFCA 4XZPA 3VZNA 1VBA1 3MIGA 1CAWA 1VBE2 2YGLA 5C4WC 1NOVA 2LM3A 3MLLA 5JDBA 4N43A 1PVC2 1IOAA 1FATA 1NA1B 1QJU3 3GHMA 4HPKB 4RR3C 4UW3A 5CFDA 1QH7A 1IS5A 1AF9A 4LBOA 2JJ6A 1LR5A 4XHBA 1RUOA 3WG3A 2PHDA 3M3EA 3CJIA 1AL23 3NV3A 1MS0A 1JTZX 3ZYIB 4AQ2A 4YRDA 2B39A 4I3PA 3WT3A 3WW4A 4F3JA 1F31A 3VBUA 4E4SA 3BPZA 4RS5A 2Q8OA 1N1VA 3POYA 3VHPA 4IEQA 2UYAA 3CJXA 5C9AC 1IPKA 1LHVA 4GA9A 2UWCA 3B94A 4XBLA 1IS6A 1O5LA 1GYKA 4XQDA 1BEV1 3H50A 4HL0A 3FBYA 4YVSC 2WT1A 4AFDA 5ACA2 3R6SA 1RMU2 1SLAA 2CWMA 1S0BA 5DUXA 4H3WA 2WFPA 3IKWA 3SH3A 1KXGA 1WCKA 1A8DA 3WHTA 5J98B 4LULA 1QNWA 1NYWA 3RS6A 2XKOA 1GBGA 3LZZA 1OOPC 2P2KA 4YZ2A 2NQYA 4DZGA 1X36A 2QCSB 3H7JA 4IEWA 4FAGA 1C57A 3U11A 5CFCA 3GZUC 3JQWA 1B35B 1PO22 3NW4A 3V0BB 3RMXA 5CG8A 3L2YA 4CDXC 2VUAA 3NO8A 2XLFA 4N53A 3URFA 1ZZ7A 1C8NA 1GQHA 1W6MB 4K21A 2E63A 4AVVA 1FMD1 1XYNA 2GN7A 2HWF1 2RR12 2R071 5BV6A 1N1YA 2BWCA 4RGGA 1MEC1 1GZCA 4QMAA 2DUQA 5DXDA 3VN4A 2F4PA 1DZQA 1UPSA 1VR3A 4XYXA 1LOFA 2ZX3A 1D4M2 1REFA 4J1WA 1QQP2 2ZX1A 4HBNA 4Q8LA 1RUG2 4ASLA 3JCIA 1QHDA 2WLQA 1RVF3 3IMNA 4YFWA 4FBFA 5BNPA 1C8M2 1OLRA 1QWRA 4PF5A 4YFZA 3WINE 5FO9B 2HWB1 3KD4A 2ENRA 4GB32 2WZR2 3VDDB 1IGOA 3VHOA 1LOEA 2GALA 3WQ0A 3MGUA 4Z82A 2K0GA 4B3NA 3D0SA 1YIFA 1ZBE1 1TMF2 1DHKB 1LB2A 1RUC1 5D8AB 4L2NA 4OHVA 4C0HA 3LOIA 2JG9C 5JZGA 4Q0SA 4LA3A 4AWDA 1AR62 4NWVA 5AC92 2GC0A 1ND3A 2IFWA 5BY5A 3LB9A 3PMEA 4BMBA 2H0BA 2RS12 3MIHA 4K6BA 5AFEA 5A33B 4YW2A 2A7AA 4JQRA 1QH6A 3I8TA 3VV1A 2HWC3 4DRRA 2PHWA 1PK6A 1WW5A 1VAMA 3ZFEB 1VB4A 4KG8A 2R1BA 4COWA 3HIFA 4R4ZA 1DGWX 4CYDA 2VU9A 4Z92B 3HAGA 1RB8G 5BNQA 3FMGA 1LU2A 1YNAA 1DGRN 4JTOA 5FMOL 4AVSA 5FQ0A 5AVPA 3RQ0A 1D0HA 2DU1A 5H9SA 4OLLA 1MQTB 1I5ZA 2C5DA 2N7GA 4YVWB 5ABJC 1HRI2 1ZBA2 4YNIA 4AHXA 1MS4A 2DUPA 4AHWA 3DN7A 1FX5A 3VBOB 2RJKA 1KS5A 1IPJA 1WMEA 1BMV2 4IEVA 4HZFA 2G9GA 3SNMA 3LGRA 3NJZA 1OPMA 2G9FA 3MPBA 4XBNA 4XJ9A 1NCQA 3IDCB 3O0VA 4RHV3 4FOVA 2RMU2 4LUKA 2ZGPA 3E6CC 2WNVA 1WCSA 2W52A 2E7TA 4LBQD 3R4DB 2ZGUA 2QKDA 5T50A 3WV6A 2TUNA 1S0IA 2Y26A 4PJYA 4LNVA 5T55A 2FMDA 3DL3A 4XIOA 4A7ZA 4E9KA 3JU9A 4IESA 4C0BA 3SHRA 3I54A 1G9CA 4B7EA 5DDJ1 2GH8A 5H9RA 1AR92 3H7YA 3UJQA 5IK8A 4EWDA 2ARXA 4YARA 3FX3A 2XJUA 1DLLA 4FT8A 3FHIB 2NZ9A 4F83A 1CPNA 2PAMA 1NZCA 1X8MA 1SEFA 3IPVA 5CADA 2XVLA 2ZX4A 4LO8A 2D3RA 5J09A 5IK7A 2A70A 2VNRA 3TRSB 2VVDA 2WS91 1TME2 5KHKA 2O8OA 3B69A 5C8CA 2VNOA 3ES4A 3FLRA 4BHPA 4XETA 4BWOA 4CDUB 1MVEA 1Z0HA 1UX6A 2CNAA 1JN2P 2G4IA 5GKAC 3UKTA 4J1XA 4XJAA 4CEWA 5BNNA 1RUE3 3GALA 3ZIWA 1AXKA 4N43B 4ZU5A 3NWKA 4XFHA 2PHTA 4LT5A 3S7EA 5KHJA 5JMCA 4NHKA 5CG9A 4BIOA 2R32A 2PA7A 3MF6A 3VBHA 4PCRA 3VBUB 4HVQA 1JYCA 4RS5B 3MW2A 2IXLA 1F9KA 2NP0A 3W9AA 5FPZA 4AEDC 2R16A 3VHRA 2YXSA 1CD3G 1VBE1 3VBFB 2RS53 1PVC1 2NLRA 4HK9A 1PVXA 4UW4A 2CWSA 2VOVA 4WBBA 4GKYA 4LA2A 2R49A 3LCPA 5LEKA 1YLLA 3UJOA 4QQLA 4TWTA 4HSLA 2EAAA 2PLV3 2A6ZA 1SLLA 1AR83 2P3IA 3MDPA 1PIV3 4N9HA 1SMVA 4GXLA 1W2UA 5DUVA 2ZGTA 2QUOA 4MSVA 4WM8A 2YGMA 2B46X 3ZYJB 4IXLA 2WNUB 1YXWA 5DG2A 4ES8A 1VBC2 4WVZA 4COYA 5CFCB 4FPHA 2D6NA 4I3GA 4R9BA 3U10A 3AXDA 5ACA1 2VW1A 1RMU1 2VECA 3NAPA 4QHBA 2I74A 1ALYA 1PZ8A 4FPLA 4LO4B 3OCPA 5GLWA 2V5YA 3ZIXA 3NV4A 4GULA 4C91A 3BOPA 3CLPA 4WZCA 1SLTA 1W0OA 3PJQA 5IK4A 1HIXA 1DGLA 2WIIB 1PO21 4MXWA 4LE3A 2WSUA 4JTNA 1V6LA 3AZYA 3VZKA 1PO13 3JBG2 3V0AA 1HXS3 1NA1A 4KH9A 2D7FA 4HPKA 4FCAA 1U5XA 1QOOA 4YGDA 3IT8A 1S0DA 3D4KA 4GH4C 1HRV3 5T5OA 2GMMA 2BTVC 3ZVXA 1BEV2 2VUJA 2BNOA 2BVBA 1RUJ2 2KA3A 5KBFA 2Q4SA 3C3VA 3WQ7A 3BTAA 4DMIA 3J8F2 2JXAA 4DPNA 3KS7A 4FQ4A 2NN8A 3WHUA 3SITA 2JENA 1AYN3 1Z7S3 1QQP1 3WLUA 1EAH3 1RJ8A 4S2GA 3OD4A 1UPIA 4BLJA 5FFOC 3ZXKA 5C9AA 5FO8B 1C8M1 2A73B 5JZGB 4LO6B 4R9DA 1AX1A 2ET7A 1ND3B 3VZOA 4Z8BA 1JHNA 1LHWA 4GB31 3WP5A 2WZR1 4ZU7A 5JSPA 4QPGB 2IXCA 2XL7A 2D6PA 1FNYA 5GLTA 2B5HA 5FRAA 3KT1A 1BCXA 1F5FA 1WW6A 2GC3A 3W58A 1R1ZA 2HKXA 4KU7A 4KWJA 4PIYA 3O5SA 3PVOA 1SBEA 2WNEA 4YG0A 5EJ3A 2DVFA 1FMD2 1PK6B 3ZXJA 2R072 1PMIA 1I1EA 3SH4A 3ASIA 4EWEA 4LUMA 1OD5A 2ZCWA 2YV8A 2GNDA 2OW4A 1AR61 1ZRCA 5AC91 3MIBA 1OOPA 1O4ZA 3NSTA 3CNAA 3USUA 1R1A2 2RS11 1FXZA 1FOD1 3DKWA 4NVPA 3M2MA 3HD8B 3AB0A 1UL9A 3V0BA 2E6VA 4FPEA 1YRZA 5JPMB 3I2DA 1BQPA 4CDXA 1E57A 1PNGA 3OYWB 1LTEA 1YYNA 4YYOA 4MGKE 1W6MA 1QGLA 2AZ5A 4MV2A 1FAYA 1GR3A 2EA7A 2VQAA 3SCHA 1K5MC 2JEMA 1BBT1 2ZPXA 1JBCA 5H9PA 3BU7A 2Y0OA 3ZSEA 2ZS6B 3ZO0B 3LOBA 3RDIA 2VH9A 2WFF3 3TOJA 3RI8A 1M06G 4QM9A 4FP2A 4QGMA 1FYUA 1QJZA 4EN6B 4EN8B 3E5UA 1R083 3APBA 3GBWA 1KQRA 2HWD1 1COV3 5CVRA 3TN93 1JH5A 3AMNA 1BMV1 1RUF2 1O3QA 3H8UA 4IEUA 2IZWA 3VKOA 4U2AA 1X50A 1X82A 3AYAA 1HQWA 4YZ5A 2RHPA 1QJX3 2V73A 1VRH3