3H3ZA

Crystal structure of a putative cyclic nucleotide binding protein (spoa0323) from ruegeria pomeroyi dss-3 at 2.35 a resolution
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
226
structure length
226
Chain Sequence
b'MAHEAQKAIARNSLLIRSLPEQHVDALLSQAVWRSYDRGETLFLQEEKAQAIHVVIDGWVKLFRMTPTGSEAVVSVFTRGESFGEAVALRNTPYPVSAEAVTPCEVMHIPSPVFVSLMRRDPEICISILATTFGHLHSLVAQLEQLKAQTGAQRVAEFLLELCDCDTGACEVTLPYDKMLIAGRLGMKPESLSRAFSRLKAAGVTVKRNHAEIEDIALLRDYAESD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclic nucleotide-binding protein
publication title Crystal structure of PUTATIVE CAMP-BINDING REGULATORY PROTEIN (YP_165150.1) from SILICIBACTER POMEROYI DSS-3 at 2.35 A resolution
rcsb
source organism Ruegeria pomeroyi dss-3
molecule tags Cnmp-binding protein
total genus 63
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3h3zA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3h3zA01
1MZBA 1RGSA 3PNAA 5FDBA 1HQCA 2FSWA 4KL1A 1G3SA 2UWMA 2Q0OA 1MD0A 3QPHA 1J5YA 1DP7P 5HLIA 4HSJA 5JSPA 4GGGA 2K4BA 2ZKLA 2KIUA 3R61A 1EP0A 3SZTA 3D5LA 4EWAA 3CDHA 4IJAA 2KIMA 1JGSA 1BI0A 2LF7A 5CVVA 5KK1A 5LLQA 4CXFA 3CJXA 3KP2A 2M87A 3CO7C 4OOIA 3EHKA 2PG4A 2RNJA 1FLIA 4OLLA 1XCVA 1QPMA 1GXPA 1C0WA 2J5PA 4EVIA 1QQIA 3HYIA 3QPTA 1H9GA 1IXSB 2GC3A 3RJPA 1BBYA 3RYRA 2PMHA 1QZYA 2QJVA 3F8CA 5J8CA 4XF4A 4OMZA 5F1RA 3KMHA 1F9NA 4MEYF 2GC1A 1D5VA 4ON0A 1FYKA 2MC3A 2BNNA 3DKWA 2VOPA 2KXLA 2F5DA 4RB1A 1IN4A 2FE3A 2E1NA 1CX4A 4MGRA 4GXOA 2IJLA 3NSTA 1XGOA 2D1VA 2HFHA 3KEOA 2WC2A 2XRNA 1AWCA 3REOA 4R79A 4LLOA 4WZCA 3ABTA 1YFYA 1HW1A 1X8EA 1G3YA 1YFUA 3WGGA 4LEJA 2AS5F 2MHFA 1EH7A 4MZUA 3F8FA 3GYHX 2DI3A 2D93A 2DPDA 3WE2A 4EM0B 5KVRA 2EV0A 1S3JA 2P4WA 4ORFA 2H27A 3KP7A 3KZYA 2NS0A 5DCMA 1QNTA 5E20A 1ZVFA 3TO6A 5DUIA 1BJAA 3WTSC 3SHRA 5D4SA 3ZMUA 2ET7A 1ZHFA 2Q2EA 3ZMZA 4LB5A 5J3UA 5DEQA 3FM3A 2WWYA 1VTNC 4KWLA 5FPZA 4BYYA 3DP7A 3U1DA 2VONA 4I0BA 5L3FA 4ESFA 1RL3A 2GQQA 1I1SA 4K2EA 1J58A 3COAC 2JRTA 4FHTA 1FYLA 1FI2A 2ACJA 2HWVA 3WTTC 3KP3A 3IKTA 2C6YA 3ZPLA 1SFXA 2XLGA 3ES1A 2A07F 2C0ZA 2OZUA 2F4PA 2LF8A 4QMAA 3GXOA 3Q5FA 5K8SA 3EUHA 1BI2A 5EFUA 4KIGA 1XDSA 1O5LA 4AVPA 3SQNA 2HTJA 3WW2A 3M3IA 3ABUA 3L09A 4ZU5A 2XVCA 2B9UA 4LUMA 2Q8KA 1YYVA 3EQLF 4L0YB 2XHKA 2QBYA 3JSOA 1OFNA 1B9NA 1J9IA 5FFZA 3MAJA 1VP6A 1YO5C 3F22A 1UB9A 4HLXA 4P9FA 3V8LA 1F5TA 4NHJA 4KWJA 2FEZA 3L2CA 1L3JA 4L9VA 3RKYA 2V6CA 1QGPA 1YW7A 4KU7A 2X0LA 3CUQC 3RI4A 2O0YA 3QP5A 5BV6A 4OFGA 4D0PA 2LKPA 4P96A 5FD6A 3WTXC 3L7WA 4META 1FBUA 2P5LC 3HTUA 4KUMA 1ZX5A 4UXAA 1XE7A 3CUQA 2OPKA 1FY7A 1CAWA 2YX4A 1FXZA 4I09A 4IEXA 1ZG1A 2FRHA 1ODDA 4AQ2A 2JT1A 4Q4ZF 2O8XA 2A3SA 5I93A 4QGMA 4CYDA 3SCGA 4AWXB 4ZU7A 3O6BB 3VODA 2NRAC 1UHMA 2GXGA 2EVXA 2IA0A 3GW2A 1ON2A 4E70A 1T0FA 1XD7A 1UIKA 4F8AA 1KQ8A 3HSRA 3D82A 3Q9SA 2MLKA 2PJPA 1WA4A 1IXCA 2V79A 3GFMA 5H6QA 5ICFA 2XL9A 3LZZA 5I8YA 2MLGA 5CU1A 2FQ3A 4IRHA 4AD9A 4ZZDA 2L3DA 2STWA 1BIBA 3ISPA 2IXCA 2HTSA 3MZHA 1BIAA 1RIOH 5T3NA 3R0AA 2IXIA 4OIRF 3V8JA 3IL2A 3RYKA 5AIQA 4LUKA 2RKHA 2GAUA 4UXNA 1DZTA 3QOPA 2F2EA 2Y0MA 3U2RA 2VBZA 1WLTA 2Z69A 2DBBA 4XFBA 2M5WA 1R1VA 4HA8A 3H1WA 1S7AA 3ML6A 3CUOA 5F6FA 3RIRA 3DEUA 4XBFA 1CAVB 2ESHA 2V1DA 1OYIA 1P4AA 4P55A 2ZMEB 3LOIA 2ZFWA 3EYIA 1MGTA 4KIFA 1UHWA 4N9IA 4X6QB 3W6JB 3DF8A 1ZRCA 1IAWA 1QO0D 1UCRA 4MGZE 1H0MA 2FA5A 2KIFA 3TO9A 5DUKA 4QX5A 5I0TA 2K27A 3DQVC 1FT9A 4WWCA 2HKOA 2DQLA 3ACLA 4J1WA 5FLHA 2Z3YA 3BB6A 3H50A 3P7NA 2PN6A 3ES4A 1T39A 4G8XA 1U2WA 5FQ0B 2Q1ZB 1MJ9A 3RZZA 3WU1B 2HR3A 5D6FA 3BU7A 5LGUA 1OMIA 1P6RA 4KYWA 1PMIA 2CV6A 2PHLA 4XEZA 2XLFA 2Z9OA 3MPBA 2A68F 3U10A 1IF1A 1E17A 2CGPA 2MH9A 4M9XA 1UFMA 3P9CA 4O5VA 1NZCA 3LA2A 3J81Z 1RI7A 5ICGA 1ZZCA 1NXMA 4CICA 3VOEA 4GCVA 2GZWA 3DFGA 2V1UA 5D5VB 4G6DA 1IN5A 4HX7A 2PI0A 3T5XA 3BCWA 2UXNA 3UKNA 2JSCA 4XFIA 2ZKZA 3C7JA 1T6SA 4KMUX 5D8KB 1LEAA 3TOAA 3M9AA 2PQ8A 5FB2A 2EA2A 2OAZA 3VFZA 4QXKA 2RV8A 3T0YA 4KWKA 3WE3A 3ZMDA 2EK5A 4HZFA 1HW2A 3I0TA 2EV5A 1YQAA 1TQMA 4WF2A 1Q43A 1TTYA 2BNMA 2EWNA 1XN7A 4IETA 3I4PA 5DCFA 4P5OA 4XSZF 2EA7A 3JAMZ 3KE2A 1ZRDA 2RDPA 3GF2A 4HVOA 3TDZC 3SHFA 4WXCA 2G9WA 3EYYA 2L4AA 4LK1F 2EFNA 2M8EA 3V4GA 5FCCA 3IDCB 4ESJA 3JTHA 5ILSA 2JTVA 3N97A 2E7XA 4HVQA 5BPDA 1X7NA 4EROA 3SFZA 2VT2A 3GWZA 1IZ1A 1FSHA 2VOOA 1XMAA 3GEZA 3CO6C 1RTVA 5I8SA 5HI0A 3DPTA 3FZ3A 2ELHA 4RD7A 2HOEA 3FMQA 5BPIA 2IA1A 4GYIA 1F1ZA 1G6NA 5K5OA 1ZZ9A 5JR7B 2ZBKA 5DYMA 2O8QA 1D8KA 1BC7C 3MYXA 4YIIA 4B09A 3GFIA 1LQ1A 3TO7A 4Q29A 1TW2A 5HS9A 1WRJA 2BGCA 1SFUA 2XL7A 5LHHA 3S2WA 5ICEA 1IRGA 1XGSA 4DQ2A 4ZYGA 2A6EF 4FX0A 1MJAA 4GULA 4QGNA 1XRUA 3TQNA 2WV0A 5CVUA 4ESBA 1D8JA 1W5SA 3HHHA 2QUFA 2QZ8A 3QAHA 3IKVA 1Y9QA 2D5HA 4ZYHA 3M70A 3TGNA 3FXUA 4LA3A 2ZNYA 2QDRA 3S7IA 4NQWA 5BMZA 4G7OF 1IN7A 3V7RA 2DW4A 2P6SA 1CAUA 1O7LA 2D40A 3V7CA 4HBNA 4JVAA 2P5VA 1QY4A 3JW4A 3UKVA 2G7UA 3R0JA 4Q0PA 4Q5SF 3OD0A 4A6EA 5HLHA 1LR5A 3IHUA 2CSOA 2XAGA 5LEJA 2OZJA 4LTAA 1W5TA 2R3SA 3HT1A 4YFXF 2XAJA 5D6EA 1ZZ6A 2ZJ2A 4D7TA 4HSLA 3ZP5A 1LVAA 1SD5A 3KP5A 3FHZA 2GXBA 2ADUA 2XUBA 4QGLA 4LLNA 2F5CA 5D5XB 3RKWA 3ECHA 4L2NA 3EBRA 1NYWA 4YARA 3R60A 1G4DA 2IW5A 4QM8A 2HQNA 4AIKA 5AIPA 2H6CA 2JZYA 2P7VB 2N7GA 3LFKA 1WSUA 4CO8A 1XSVA 2VBYA 2P5KA 2Y48A 1IPKA 5D1IA 4LD5A 3SCHA 5FO5A 1J1LA 4JV4A 3FXQA 3IWZA 3K0LA 4A0ZA 4EJTA 2XV4S 3T1BA 3E6DA 1KQ0A 2O3FA 1XDUA 3ULQB 5EEGA 2GC2A 1U5TB 1R5GA 3L00A 3BPXA 3ETQA 4IEPA 5H20A 3E5UA 1FYMA 3O2PE 4IEWA 4HAMA 3U11A 1B1BA 3LQRA 3E5QA 1J75A 1O4TA 1KU2A 1Y0UA 4L9NA 3OV8A 1ZNPA 2QQAA 5IT9Z 2KJCA 1J3QA 4EV0A 4A5MA 3E6CC 1Z91A 1H1MA 4MH0E 4AIJA 4O9EA 5E8GA 2PHDA 2VT3A 4HDVA 1MDMA 3QRFF 5K1YA 1MJBA 2ETHA 2A5YB 4FAGA 1RUNA 4RS8A 1ZREA 1LRHA 4F7ZA 2P6TA 3MWMA 4X6RB 5LRRA 2UXXA 1SMTA 3LAJA 2HYFA 4EGYA 3D0JA 1R36A 3RKXA 1XMKA 1B6AA 3HIFA 1H9TA 4MNUA 3OGJA 1Z1DA 4TLFA 1SD6A 2D45A 3AAFA 1O5UA 3GYDA 4LGWA 2GIVA 4LG0A 4IRIA 4S05A 4RGRA 5LGNA 3TNQA 1SFEA 2IA2A 3FX3A 5L3BA 1YIOA 1CF7A 4M71A 2IPQX 3LWCA 5BPXA 2MBFA 5CYVA 4MHGA 4KMFA 4WXDA 1RZ4A 2W84A 2NNYA 4XFCA 2HYGD 4XF0A 1SEFA 4JBAA 2OYZA 1X82A 4M72A 1KGSA 3J81K 1AOYA 4M9SA 4XLPF 3RYPA 3WODF 4S04A 2Z33A 4IEVA 5JHUA 1WQ2A 4PGHA 1IXRC 1CGPA 5ILUA 5LHIA 4XFFA 4XF9A 1B59A 2Q4SA 2L02A 4EM2A 3F6OA 3DPLC 4R1HA 4IEUA 2VC1A 4BHCA 5FPXA 3CLOA 1ZG3A 1R7JA 3MDPA 1TNTA 1Z6RA 3KZZA 2O1QA 2L54A 4IERA 1EY2A 1IN8A 3GZ6A 1WI9A 1DPUA 3V7SA 2GC0A 3F23A 5FLIA 4HYEA 1OD5A 3JAMK 1YS6A 2UZKA 1H1IA 3QU6A 1ZLKA 3H1MA 3I5UA 1R1UA 5HOOA 4LMYA 4WXHA 1S8NA 1QBJA 3JSPA 3WTWC 3LA7A 4WCGA 2XIGA 1ZG5A 2YX7A 2NAZA 2DK5A 3HUGA 4JTNA 4IRGA 1YHFA 5DCMB 1O7FA 5LRSA 3GO5A 1ZARA 2DAOA 1JE8A 3LA3A 1WGPA 2WTEA 3BY6A 4MEXF 1HKQA 3WTYC 1J59A 2LDUA 4ENMA 5ED4A 4OIPF 2B0LA 1UPIA 1D3YA 4HX4A 3QU3A 1S7OA 1RNLA 3H7JA 3F6VA 3FJSA 3L9FA 1R23A 2DO7A 3M8FA 4PCQA 5D5UB 3SCFA 2XROA 2DFIA 4KA4A 3C1DA 4FT8A 4I0AA 2EB7A 1IW7F 2FU4A 1TW3A 4KIBA 2FNAA 4HLYA 3PQJA 1XSDA 3ZMTA 3SZPA 4MQ9F 1W7PA 4IEZA 4DNCA 2UY8A 2UYAA 3SXYA 3OCPA 1GQGA 2JPCA 4XFAA 1BM9A 2D1HA 1HKSA 5KHHA 3H3ZA 2QBYB 2BYVE 3KFWX 4IVNA 4N9HA 3WGIA 1R58A 1T2KA 1ZZ7A 3RNSA 2LSOA 2HQRA 3C18A 4ASNA 4E2SA 1OYWA 4AVCA 2VE9A 3R4KA 6PAXA 3U0ZA 4PIXA 2HZTA 3RPUA 3J80Z 3GVAA 5HS8A 5E8IA 1K78A 3IBMA 1FSEA 3B73A 5J7MA 1U8RA 4PIYA 3ZN0A 2IC1A 4ENKA 4HQEA 1R00A 3MCZA 1FP1D 3WTUC 4EGZA 2OD5A 2IXKA 4AXOA 1USSA 2OA4A 2BV6A 1QXRA 3PVBB 1TLHB 3CUQB 3P9IA 2CQKA 1CAWB 4AQ6A 2FXAA 2B8MA 2WFPA 2YSRA 2PBIA 4M9ZA 2MD5A 4BNCA 4G6QA 1YW9A 3CO2A 4EWEA 4I98B 3TKYA 4Y17A 4I02A 4YRDA 2VC0A 4IXAA 4L5JA 5FD5A 4O3MA 2VQAA 3FXRA 3BJ6A 1EPZA 2PMUA 4IEQA 3KSCA 1ZZBA 3C3VA 4YFNF 1T38A 4UV8A 4B29A 2H09A 1KA8A 1DDNA 3HRTA 4Z07A 4YFKF 3NL1A 1IUYA 3I59A 3OF1A 1J0RA 2H0VA 5HLGA 2KJBA 2QVOA 1A04A 3W6KB 1IN6A 2VECA 4XRFA 2DK8A 1ZGJA 3HQXA 2CG4A 2DT5A 4U7BA 4JQFA 2O03A 2GWRA 1O3SA 3HOTA 2XKPA 4Q0UA 1SMYF 4BHPA 2M30A 2ET1A 4FX4A 5E1XA 3KLOA 1SQ4A 4L11A 4ZYDA 1P92A 4RGSA 3T8TA 3VB2A 2A69F 3SXWA 5TRDA 2ATFA 3ELKA 5IT9K 3S0MA 2H94A 1HSJA 4NVPA 3D0SA 5JI6A 3IRRA 3BJOA 1EV7A 3F8MA 2ISZA 1J3PA 4JK1X 4UVAA 5K5RA 3OTFA 1ZGAA 5D8LB 1O3RA 4EQQA 4UBHA 4Q0SA 4QM9A 2CO5A 1K79A 1JXSA 4P9GA 1SAXA 4RGUA 4B8XA 1PP8F 4KN4X 5JSOA 4KICA 3R6SA 2I45A 4Y13A 2E9QA 4TV7A 3GFJA 2QNKA 4U7DA 4G9YA 5HVQC 2E7WA 1JUHA 4QLCU 5I0RA 4KDPA 5LEKA 1YFXA 2IXHA 4BH9A 1FBSA 3KGLA 1JHFA 3NKTA 4FAHA 4IF4A 2VE8A 2BE5F 1YG2A 5A2QZ 1KYZA 4RGXA 2NNNA 4IEYA 3H7YA 5E1ZB 2V1XA 3JTGA 1PDNC 5J8FA 1NHAA 3BPZA 2OQGA 3WTVC 1IRFA 5KHJA 1FBQA 1GXQA 1J3RA 4FBFA 1PP7U 4GYGA 3H92A 2EFPA 4UBGA 1TQPA 1P4XA 5EEHA 3M1EA 1G3TA 1LDKB 1YFHA 1S6LA 2W85A 3I54A 1TQ5A 4U88A 1Z6TA 4A6DA 3I59B 1VJ2A 4Z82A 4UUVA 2ESNA 2J5OA 3KEQA 4WK8F 2MNGA 3SMHA 4YNIA 3HRSA 1QWRA 5JSRA 2DLLA 1O57A 1UD1A 4EJOA 1Z9CA 2LNBA 4OINF 2PAEA 3ZMSA 4KFCA 5AONA 3K9TA 1QZZA 3BP8A 2CFXA 3T8RA 4EWDA 1K7AA 3E3VA 4MUVA 1YUDA 3MQ0A 2EAAA 4KN7X 3EQEA 1I27A 5DD4A 4ENJA 5AVPA 2Z2SB 1ZRFA 3BWGA 5KBFA 3WU0A 1FP2A 1B4AA 4Q0QA 2IP2A 3CLPA 4AVAA 2A61A 1BOAA 5BS6A 1NE4A 3FE5A 5E1WA 3BPVA 4U0WA 2O61A 2GU9A 2FBKA 1YS7A 4HN0A 2DTRA 5IT3A 4KT5C 3KP6A 2HKXA 3I7DA 1XE8A 5LBQA 4UVCA 1XB4A 3ST7A 3K1NA 3KP4A 1FWZA 1T98A 4L0ZB 4UV9A 3IC7A 2D2WA 1OKRA 4OMYA 1UIJA 2XAQA 1XCBA 4ENNA 5L3DA 3HHGA 5BUVA 3ECOA 2FQPA 4BXUA 5HDGA 3NEUA 1JHHA 5K5QA 3NW4A 2VODA 3GX4X 2PFWA 2IVMA 5J6XA 4MQVA 3IDBB 2M45A 5I8TA 4I01A 5H6RA 1OPCA 3H3UA 2OU2A 2KRFA 1ON1A 2ZO4A 4MTEA 3G3ZA 2EFWA 5HS7A 3BALA 4H7LA 4KNYA 3WW3A 3WGHA 3RDIA 2VPVA 3DN7A 3M8EA 2JPBA 4XF3A 2VN2A 4I2OA 2FMLA 3E6MA 5FLXZ 2RN7A 2Q30A 3J7AO 2UY9A 3CL1A 5BY5A 2DU9A 3JZVA 4DINB 1I5ZA 5TJJA 1BN5A 5D5WB 1KU7A 4RB3C 1W4MA 4Y15A 4WX9A 3BROA 3HRUA 5CLSA 4BHBA 3PFIA 3OOPA 4RAZA 1I1GA 3GLXA 4HF0A 5KHGA 1MKMA 1KYWA 2FOKA 3TDUC 2GH2A 4O6JA 3HTSB 5L3GA 1V3FA 4YYOA 1J2XA 5DV5A 1R1TA 1U3EM 2B5HA 3CF6E 2R7DA 1KQ9A 5I0SA 1CAUB 4ZZLA 3J80K 4G7HF 4UHTA 3IRQA 3H8UA 2K9ZA 2Y0OA 1LEBA 2BBYA 3FMRA 1TBXA 5E18F 4PDKA 1FNNA 1U12A 3O14A 4UVBA 1BI1A 5KHIA 2VBXA 4JTOA 4RB2C 3QACA 2F5FA 1P2FA 4HBLA 2EA4A 2IXLA 1YLFA 3E97A 5DD8A 3B02A 4MTDA 4A2UA 4RAYA 3BZ6A 5HDKA 1UCXA 4U0YA 3GZ5A 1Z7UA 3KCCA 1ZN2A 1WKMA 4J1XA 1GQHA 1R22A 2FBHA 2D5FA 2RQPA 2EJRA 4L9TA 3ZMVA 1LKNA 3HT2A 2QENA 5CJ9A 1RUOA 2F5EA 4A0XA 4HF1A 4H0EA 4RB0A 1SD7A 3ZDSA 3MEXA 3KGZA 2EFOA 4L18B 4M73A 1LNWA 2P17A 2PTMA 5BXXA 3N4MA 2OZ6A 4HF2A 2K02A 5ICCA 3K1MA 2XGXA 4M74A 3H9AA 1L3LA 4ETSA 4R52A 2PEXA 3K69A 3F8BA 1Q1HA 4IPAA 4EM1A 4CZZA 4XF1A 1LJ9A 4LULA 2PLYA 3I71A 1NE6A 2Z99A 2FF4A 5FLJA 1CAVA 3EETA 2ZMEA 3NRVA 4Z2YA 5J48A 1O3QA 1FX7A 3CJNA 4XSXF 2YPRA 4L9JA 1S29A 4YSFA 4Q47A 2PA7A 3TOBA 1MDMB 2BNOA 2CWEA 5CADA 3LQQA 1VR3A 3E5XA 5F64A 4K8FA 5FQ0A 2V09A 1ZYRF 1OI6A 1HKTA 5E16A 4EMSA 4GO1A 3HOSA 1DGWA 3U9GA 4CHUA 1OR7A 2W24A 4NB5A 4LG0B 2HEOA 5ERIA 1J7KA 4HLTA 2DQRA 2VXZA 2A6HF 1XSXA 2GA2A 5A2QK 1CF7B 2PQQA 2ISYA 5E17F 4LK0F 4LFUA 2PAKA 2DPUA 5FFXA 3O3KA 2ZXJA 1HSTA 1DZRA 2HGCA 3ERED 1B9MA 2IRFG 3PLQA 1ZRRA 4LLLA 3LAGA 3I58A 2RC4A 3PQKA 4HMZA 1HBXG 5JCTA 1DUXC 5I0UA 1F4KA 2KKOA 2OQRA 1UW8A 1Z05A 1QXJA 1O3TA 2EFQA 3WW1A 1YTYA 1K6OA 3LSTA 3UKTA 5EZWA 4HW0A 3MFKA 2XKOA 2FBIA 2IT0A 3HRMA 5D4RA 4BIFA 3E6BA 4HV6A 2K4JA 4M6YA 4XFHA 3GBFA 2AXLA 4HV5A 1XGMA 2K0GA 3GFLA 2PAMA 3F8NA 3F3XA 3IWFA 2NYXA 3FFQA 1EH8A 3S7EA 5LHGA 4PIZA 1HXDA 5E1RA 4AIHA 3EDPA 1Q5OA 2OBPA 4MGYE 1DGRA 5JR3A 4M6XA 4WVZA 4A0YA 3FHIB 3LAPA 4L5IA 2IXJA 4I3PA 1FOKA 4OIQF 1V4RA 2L4MA 2ZNZA 4IESA 1YWKA 3LWFA 3K1PA 2TDXA 5CVRA 3F21A 2R7FA 1ULYA 3NJZA 1BI3A 2RGVA 1REPC 3ZN1A 4CDGA 1TNSA 3WTZA 2YR2A 4MGIE 1HW5A 1PUEE 1CAXA 3I64A 4ZYEA 4R8HA 2XAHA 4HOBA 4IEOA 3I53A 3EO6A 5BQTA 4I7HA 4KU8A 1XGNA 2ETEA 1RC6A 1FC3A 4IHTA 4HQMA 5L3CA 4U0VA 1ONVA 2M1BA 2COMA 1IPJA 3F72A 5CVIA 1V70A 4PZJA 1FZPB 3FM5A 5JVTA 4CGZA 1EYBA 1LDDA 2W25A 2CAUA 4OIOF 1E2XA 2P7CB 3GUDA 1ZZ8A 3DXJF 3TNPB 3KLNA 4MV2A 2GA1A 2QWWA 3C3WA 2QQBA 2HJIA 1WWXA 1LDJA 5I91A 3ZQ7A 2FNPA 4LA2A 4ZH4F 2K86A 5HDNA 1DPRA 5FLXK 5JAXA 4LLGF 2QLZA 1W7PB 4HX8A 4AVBA 4EJVA 4N0BA 4E2GA 4A5NA 3RPQA 1W7PD 2MH2A 1STZA 3FMSA 3NVCA 2K7LA 5CVJA 5JFRA 2G7HA 4LJZF 2OA2A 2PYTA 2MA3A 3VEPA 5BOXA 3P9KA 5FGMA 2MPFA 3WG9A 2W57A 3G73A 1EH6A 1LB2A 3FF5A 1X8MA 2UYBA 3QP6A 1K78B 2L01A 1U6GA 5KHKA 4LB6B 2RVCA 4XLNF 4PGGA 4BAYA 1OYYA 1USTA 2XLAA 3BDDA 4EJUA 1G3WA 1X3UA 4G94A 3K2ZA 2E1CA 2V9VA 2Z5UA 5LGTA 2QM3A 4XETA 2ZCWA 3NQOA 3HSFA 4D7SA 4MGKE 1U5TC 1I6XA 1ZH5A 3RTRA 3FWEA 3M7GA 1YW8A 4EJWA 5L3EA 3DL3A 2CYYA 3ELNA 1SFNA 4E2QA 2STTA 4HVRA 3EJKA 2X4HA 2QVSB 3FZVA 3CEWA 1CAXB 3USSA 5ILVA 4Q0VA 3L2HA 2HS5A 3DV8A 4G7ZF 1YFWA 2XAFA 4HN1A 1FPQA 1YLLA 4ONUA 1Y3TA 1GVJA 4A12A 1U5TA 2VBWA 3ROUA 3IIAA 2P8TA 4O9GA 4Q48A 3V8KA 3HSEA 2Q0AA 4ZU4A 3WW4A 1PM7A 5C6CA 2H6BA 2Y75A 4HDUA 1R5HA 2YU3A 2O6GE 3H1YA 4PJYA 3G7DA 1TQIA 1BC8C 1L0OC 3MZYA 3KETA 4YIFA 2QYOA 3BOQA 2XASA 2CAVA 4IHSA 4QWQA 5DDGA 2EV6A 3CTAA 4OU0A 4MX3A 1ZLJA 4BQAA 3Q9VA 1KU9A 2PFBA 2FMYA 4P9UA 1U78A 1P4WA 3BJAA 1GHCA 2DCTA 4WBBA 2QCSB 1KU3A 4YG2F 4UNOA 5C8WA 1Q3EA 1SD4A 3VHRA 4XFGA 1ZAOA 2HDCA 2CW0F 2QQ9A 2BEOA
chains in the Genus database with same CATH superfamily
1RGSA 3GCWA 1GUIA 4J01A 2C5DA 1G3SA 2JICA 4A44A 2GOMA 3M3EA 2Q0OA 1MD0A 4B3XA 1CVNA 4AVZA 1DP0A 4OMCA 1G9CA 3THPA 2CDOA 1JZ4A 3D5LA 2C9AA 2M7AA 3CDHA 2RM23 4JQRA 1BYHA 1JGSA 2MW8A 5KK1A 1FPN3 1VQLI 5LLQA 3LB9A 1U5YA 4OOIA 2PG4A 4CE8A 1QPMA 3W2VA 3ZXSA 1GXPA 4BA6A 2J5PA 5LK7B 4EVIA 3D4KA 4MGQA 1LGNA 5DDJ2 5LWBA 1H9GA 2GC3A 5GZFA 1QZYA 2QJVA 2DDBA 4JHTA 3S16J 1SLAA 4XF4A 3NWSA 1F43A 3W20A 3ABZA 1XU1A 1H2MA 4Y22B 5IYYA 4JGZC 4UI9L 1JXNA 3DKWA 3K3OA 1K45A 3LOBA 4Y5TA 2F5DA 2XPVA 3T2PA 3SLIA 3KD4A 2NVQJ 1YYNA 3WXPA 1KEXA 3NSTA 5CFCC 3LGRA 2WC2A 3VYTB 3RKQA 4DIQA 1CJDA 3H42B 1OH4A 4LE4A 4E8DA 3IP4B 1PO13 3ABTA 2BVBA 4BY1J 3OYBA 4U36A 2Z1DA 1ETKA 3I4NJ 1NQDA 3DTIA 4ORFA 3KYLA 3KZYA 2NS0A 4DXZA 5DCMA 1QQP1 3ZSJA 1LGCA 4A7ZA 3SHRA 4WVVA 5D4SA 3ZMUA 2XAUA 2ZHKA 4PQ9A 5J98B 1NCQA 2DCYA 4YVWC 1DU0A 5C9AB 4BYYA 1CESA 1UU6A 2XJPA 3MF9A 3Q8AA 2K9SA 3U4SA 4ESFA 1POV0 5LBEA 4BE3A 2KLOA 3OSFA 3TN91 5IY5H 2OUJA 3KP3A 3BCBA 1SFXA 2XLGA 2VMFA 3T4HB 4NHMA 3ES1A 2VNRA 1AL23 4NRMA 2VJJA 2OZUA 3I3EA 2YU2A 1W8NA 2FZ1A 4QMAA 2DA6A 3Q5FA 1CIWA 3AZYA 3SQNA 4OAZA 3O1MA 2HTJA 3HPHA 2VBDA 3WW2A 1W9FA 4MLOA 1WPKA 4LUMA 3PNTA 4L0YB 2ZOEB 1QNYA 5L7OB 5FFZA 2LLKA 3BR1A 1UB9A 3V8LA 1SLIA 2FEZA 1AX0A 1DU3D 5A7NA 1R1A3 4UFHA 4A3XA 2COBA 2JD4A 1QH6A 4Y52J 3SNMA 2OF7A 2O0YA 3QP5A 1UOBA 4PLOA 3KT7A 4OFGA 1RUE3 2DODA 2KZGA 3I2FA 3OR2C 1ETVA 1L7LA 1H6YA 3U4XA 2P5LC 5M5YJ 4BZ4A 2JUCA 3CUQA 1F5FA 5C8CB 2C6SA 2RREA 4I09A 4IEXA 1ODDA 4FP3A 2K3FA 1NCRA 3USUA 4MGSA 2FCUA 2O8XA 5A70A 2Q2EB 2VY0A 3ZFFB 4HKLA 4LKEA 4M3EA 4F52A 3O6BB 1H4GA 2R16A 5DS9A 5FJKA 1SLLA 4Y26A 1X2NA 1UIKA 4LPLA 2YFZA 3MV11 1U8BA 4GWMA 1W3VA 3OJBA 2PJPA 3GFMA 5H6QA 3RI9A 4MHRA 3LZZA 1ODMA 1RUD3 5E89A 2FDKA 2MLGA 3DYMA 2LVSA 1AX2A 5CU1A 4AD9A 1YJWI 3AKZA 1BIBA 2IXCA 2HTSA 3ZXDA 4HEA2 4LO4B 1HJFA 1WW6A 2YU1A 2VVEA 3K2AA 1QJY1 2K3PA 2HVRA 5T3NA 2CRGA 4QX2A 1VBC3 2QQJA 2BV4A 2WR9A 2IGOA 1LECA 2Y0MA 2Y30A 1WLTA 2Z69A 1TME3 3H1WA 3CMGA 4CP9B 4XBFA 1LE8A 3IPVB 1OYIA 2LBFA 4P55A 5FY7A 3PTYA 3LOIA 5F8PA 3EYIA 2AHQA 1DYKA 1UHWA 4X6QB 4FASD 3GTQJ 3PU3A 4Y20B 5K7FA 1ZRCA 1IAWA 1QO0D 1UCRA 2FA5A 1NG6A 3RRDA 3ME2A 2HKOA 2JMWA 3ACLA 4XUNA 4XHXA 4BQWA 2L5QA 1T39A 3LSDA 1MS9A 1GV5A 5HBAA 4XC9A 1UQXA 3BU7A 1GICA 2RS53 4XEZA 5JZGA 5DUXA 3VUOA 4FPHA 1A8DA 4Q4V3 1C8NA 5GLTA 1E17A 4DO0A 2VPLA 2QF7A 3WG3A 3DTKA 3CLQA 2P34A 4UYBA 1BCXA 3M3OA 3LA2A 2R0QC 1OA2A 3JBG2 4Y1UA 1NXMA 4DNYA 4CICA 3VOEA 4GCVA 4QX7A 4M0HA 2GZWA 3OYHA 2A1XA 4G6DA 1IN5A 3I56I 5FZ4A 5BNOA 3T5XA 3DKXA 3MZ8A 2ZMLA 3HD8B 4XFIA 1OSGA 3WV6A 2MABA 1SLTA 5G04L 1SFOJ 1HX6A 3E1F1 3B93A 2PQ8A 5F1JA 1AUYA 2OAZA 3VFZA 4QXKA 2LR8A 3D1NI 3T0YA 5FIXA 1X1DA 4WF2A 1D1CA 1TTYA 2P0WA 3DWLE 1DGLA 4GH4C 2KR2A 5BYNA 3BYWA 3SHFA 3S1NJ 4IE7A 2R063 4OHYA 4A41A 4Z8BA 3EYYA 2VKDA 3H3VK 5A3TA 4Y1XA 4JRLA 3UGFA 1ULFA 3FC0A 5FCCA 2HWB1 4ESJA 1QA6A 3JTHA 3PVOA 5IVJA 1X7NA 2ZXWH 5FP9A 1PX4A 5C5UA 5BNNA 5HV4A 4UAPA 3TBIA 5FZFA 5IVVA 3DPTA 3WNKA 5BPIA 4CEWB 4IHYA 3O1SA 4GYIA 5C3PA 3DPUA 1F1ZA 2HEWF 1PZ9A 4BQYA 3UT0A 2L7KA 3T2QA 4YWAA 5DYMA 2JRMA 1H2KA 2CWMA 3MYXA 1VBE3 3TO7A 3GHNA 1TW2A 1WRJA 3UV9A 2XL7A 3S2WA 1OT5A 3RI8A 5DAPA 1XGSA 4M00A 3AK0A 4DQ2A 1COV3 4JHZA 2KZVA 4FTBA 1HLVA 1XRUA 2WV0A 3QD6A 1YE9A 4W97A 5LBFA 3VDDB 1D4M2 2GH8A 3HNBM 3IKVA 2WAEA 5LZ6A 4C2TA 4ZYHA 2G4IA 4DUVA 3M70A 1POV3 3FXUA 3TN92 2ZNYA 2XB5A 3AKRA 3CJIB 1AR82 1CN1A 3A0HC 4DZPA 4YW4A 4FQGA 4YGCA 1Z67A 2CV0A 4XRSA 2G9FA 3T08A 4IV1B 4FQZA 1DGWX 1CAUA 2CGNA 5ERLA 1OURA 3B94A 2P5VA 3ZXLA 1JTZX 3OYCA 1LR5A 3IHUA 2W48A 2CSOA 2KT0A 3HT1A 1K5MA 4YZ1A 4K1ZA 4LOCA 1YRNB 1QH7A 1SD5A 3KP5A 2ADUA 4KG0A 1ZM1A 3RKWA 2VCAA 4JAAA 4YW3A 4YARA 3R60A 1G4DA 1SHWB 1Z7S1 4B4PA 3CZ6A 5AIPA 4JDNA 5GPCA 1UKRA 4CO8A 1XSVA 5JPNB 3GCXA 2LG4A 5DQ0A 5CB7A 4BBRJ 1MMDA 5F04A 5ANNA 3SCHA 4JV4A 4BDZA 4XCAA 3F0CA 3IWZA 3ZRGA 2EAKA 3MKYB 1W6OB 3GCMA 3POEA 2D3RA 2SLIA 3BN6A 1XTAA 1LJ7A 4NIGA 3L00A 5A3UA 1YJKA 1K12A 2HWF3 1JT6A 4O61A 1B1BA 1J75A 2WQZC 1VBD3 1KU2A 2JE7A 4JGZA 3OV8A 2QQAA 5IT9Z 2KJCA 1J3QA 3ZYFA 4YM2A 1WMDA 4A5MA 2UWBA 2D43A 1H1MA 4OI0A 5FYHA 4LOTA 2WAFA 4DZJA 5FRNA 4MH0E 4O9EA 5C8CC 4UWDA 5CFCA 1MDMA 3W6VA 1LAJA 1IG7A 2VCCA 2ETHA 2A5YB 1Y8QB 4RS8A 1ZREA 1LRHA 2HQAA 2P6TA 3MWMA 2MD0A 5CFDB 3JRCA 2C24A 4EGYA 3TBDA 2Y69H 1XMKA 1H9TA 4TLFA 1UMZA 3WVJA 1MR5A 1O5UA 3GYDA 1E3PA 4LGWA 2GIVA 5DAXA 4IRIA 3S2HJ 4S05A 3N9QA 5LGNA 4NPLA 4UUSB 1XXNA 2RDQA 1SFEA 3M3YJ 1LESA 2IA2A 1PIV3 2WKKA 1MBFA 2IPQX 5BPXA 4OQ8A 4F92B 3VSKA 4EEFG 3RGBA 1SBFA 4V2FA 4PHZA 2GNDA 4M72A 1EAH3 4PCRA 2ZEWA 3OMYA 4M9SA 2BTVC 3LPGA 2Z33A 3N9NA 1TMF2 3N7KA 1SBEA 4IEVA 3VKMA 3C8XA 3M1CA 4V2GA 1H1AA 4FOWA 5L9VA 2NPIA 2VG9A 2GMEA 5HPOA 2FDIA 1R5ID 2AGSA 4IEUA 4E7ZA 2JB4A 4BHCA 1OD3A 4RFRB 1ZG3A 5A1FA 1JYIA 4MGTA 1R7JA 1RETA 3GTLJ 1Z6RA 3KZZA 2RVAA 2RMU3 2JG8A 3DBRB 3KQRA 1EY2A 3SEEA 1YC61 3B01A 2X51A 5K0UB 2A6XA 5FLIA 4AEMA 1KDMA 4NR1A 2R7RA 1H1IA 1UXZA 4A3GJ 4RM3A 4DYQA 2E7AA 3I5UA 4LMYA 3JSPA 2DBNA 1E5HA 1MS8A 1TG7A 2E1MC 3WTWC 2X05A 5D8AC 3LA7A 4WCGA 2DFHA 3OUHA 1W6QB 3TL4X 1FV2A 4R4XA 2HBUA 3HUGA 1W8WA 1IV8A 2WDBA 1ENSA 1A3KA 2DAOA 2B46X 3KZIC 4PF1A 3QYFA 1JTXA 1FOD3 3VL8A 1HKQA 2QEXI 2LDUA 2D97A 1WCMJ 1F9KA 5F9TA 4RR3B 1MACA 1D3YA 1H2LA 4D5CA 1FIPA 3L9FA 3TEWA 3AL0B 3SCFA 2F4OB 1RVF1 4OI1A 1X58A 5C3SA 4FT8A 2EB7A 2FU4A 1TW3A 4HLYA 3HWJA 1SCRA 1BKZA 1N1TA 3V0BB 4Y7NJ 3AKQA 4IEZA 4LKFA 1H4HA 2UY8A 1UU4A 4AR2A 2UYAA 5HLTA 2KIQA 3FISA 2JVGA 1NXD1 2VZRA 1V6LA 3JXSA 5KHHA 2QBYB 4LK6A 1V6IA 1UZZA 1ZZ7A 2O8OA 4LG3A 2HQRA 3C18A 4NN0A 2E2HJ 1HQNA 1OH3A 3R4KA 2ZAAA 2HZTA 2A7AA 1CWPA 3J80Z 2R7SA 2Z79A 5HS8A 1S0CA 2PHXA 3VBSC 1K78A 2CJJA 2WV1A 1G9FA 3K4MA 2YXSA 1XMXA 2D7FA 1AL21 1PK6B 3MCZA 1FP1D 1WZXA 5FROA 2NZ9A 1MZ5A 5FXZA 2PLV2 2ARAA 4XE9A 4AXOA 2OA4A 2V26A 3I2KA 1HB3A 2CQKA 4AQ6A 2WFPA 5A1AA 1XNDA 2ZJRF 2YSRA 1VALA 4G6QA 5GTHC 3NRUA 3CO2A 3LCPA 2LH9A 4NPRA 3RZLA 5ABJB 4I02A 3TEYA 2VQ0A 3LMMA 2ZACA 2VQAA 5IP7J 5FKCA 2FMDA 1JODA 5KXBA 4IEQA 3POJA 1VQKI 4UV8A 2QQWA 2WADA 1DZQA 2WYSA 2R7QA 1YI9A 1W9SA 3NARA 2R4GA 4YFKF 3NL1A 2HWC1 1RUE1 5HLGA 3CJIC 2KJBA 1F4HA 1QU0A 3W6KB 1OLQA 1MQTC 1BEV3 5IK5A 3J7MA 2DK8A 1E0EA 2RDNA 4CCDA 2CG4A 2DT5A 2PMZA 4U7BA 5J4VA 1O3SA 4IV1C 3CMAI 5EF6A 2D3PA 2R5YA 1ORKA 4XURA 3KLOA 3N7LA 1SQ4A 1P92A 3VB2A 1QVUA 4W6XA 1WFXA 5IT9K 4LO6B 1RR8C 1P9QC 3IRRA 2ZX0A 4E7HA 4FPCA 3AZVA 4KISA 3WDUA 3OTFA 1BXHA 4GMP0 1ZGAA 4A3IJ 3VSLA 3CIHA 5D8LB 3PHMA 2BZDA 3K6GA 1S2EA 4UBHA 4QM9A 3WX5A 2CO5A 4GH4A 1PVC1 1K79A 3GGLA 1X4OA 1WLCA 1AL0G 2ZX4A 3WF2A 4B8XA 5JSOA 1IQAA 2I45A 4BUPA 4AHZA 3ZQGA 2EINH 1JUHA 2WBMA 3I4MJ 4X0GA 1RUH2 1YFXA 4BH9A 5FZ9A 2OQ7A 2XBO1 4FAHA 3IUOA 2VE8A 2Y64A 4XZUG 3TAYA 2BE5F 1MH3A 1MZFA 2TEPA 4U2AA 2NNNA 5E1ZB 1SBDA 4ITVA 1TME1 3NQHA 2V1XA 1NK3P 2DF7A 1LEDA 1WD4A 3PJYA 3RVHA 3HGGA 4XKWA 2OQGA 5KHJA 4PI2A 1PP7U 3K4ZA 3PNYA 4FP2A 3VN4A 1TQPA 2VUMJ 2QSGX 4LHSA 2PJRB 3VZJA 2A3WA 1G3TA 1LDKB 1YFHA 1S6LA 1S4CA 1TQ5A 1YI7A 2VQHA 1XNCA 1Z6TA 1DF0A 2V9PA 1VBB2 1U5IA 1Y0NA 4KGGA 4C9YA 1QDOA 2VBPA 4I0WB 4YNIA 4OINF 1MZ6A 4L8QA 1JZ3A 1WW5A 2B9SA 1V6JA 2CFXA 3T8RA 3I3DA 5IW0A 3L2VA 3DXTA 4MUVA 1YUDA 2HXOA 4ZZ5A 4A3MJ 4KN7X 2OXBA 3W21A 5AVPA 2Z2SB 3WU0A 1T2XA 3M07A 1FP2A 1V0AA 3BTZA 1LHNA 4Q4Y1 2A61A 1BOAA 4BQOA 4AI9A 4YG6A 2O61A 3ZXEA 3KP6A 4PDWC 4XOGA 5LBQA 3I49A 2XF7A 2DMPA 3CQOA 4UVCA 1XB4A 2X6OA 3K1NA 4PJNA 3CZUA 1FWZA 4UV9A 1DQUA 3ZQQA 2XJTA 1H6XA 3HHGA 4DEVA 4RS5B 2NS7A 4NIAA 3IH2A 3KV9A 5EZGA 4UFJA 2ME6A 5J6XA 4AEKA 4CP2A 2P3KA 3IDBB 2KPMA 5FPAA 3GTJJ 1EUUA 3POWA 4AFDA 3RQ4A 2EXIA 2LTPA 3LD8A 3KB5A 3AYDA 2KRFA 1ON1A 4FPOB 3G3ZA 2ZSHB 4KNYA 3WW3A 2VPVA 4FETA 4IDZA 4YVSB 5EHDA 1DBNA 1MEC2 2D6OX 3I9V2 5DXDA 4UUTA 2DA3A 4Q4W1 1W0TA 2UY9A 5K0UC 3A2KA 2ZGPA 3JZVA 4FISA 5D5WB 4RB3C 1W4MA 3BROA 3HRUA 5CLSA 3WCRA 2TBVA 3OOPA 5J1RA 4L99A 2RJLA 3LSRA 3VZMA 4ZHNA 3BTXA 2X6YA 4CU8A 5T55A 4BIOA 1W8OA 1KQ9A 2BOLA 3HVDA 1WVRA 3J80K 1RJ8A 1Q1VA 3WNNA 1MNMC 3H8UA 4YZ4A 2K9ZA 2Y0OA 2BBYA 1CIYA 5C8CA 1FNNA 3MD2A 1IDYA 4UVBA 4Q4X1 1MBJA 3QACA 2F5FA 2L7ZA 1D0ZA 5FYCA 2IXLA 3B02A 2V1NA 1MW7A 1UCXA 4LOSA 3FN9A 1WKMA 1ZBA3 1GQHA 5F6KA 2D5FA 2RQPA 3TB0A 1ITYA 2EJRA 1QEXA 2Y6GA 3UL2A 1M1EB 1WMEA 2QENA 4YFWA 5CJ9A 2DUPA 4FE4A 1RUOA 1YQCA 1I9RA 3PFYA 4RB0A 2QQIA 3ZDSA 2EFOA 1LNWA 3N4MA 1EA3A 2OZ6A 2DURA 3EUKL 2WZ8A 3IIIA 1VQ5I 4W50A 1NT0A 2NXNB 4ETSA 2PEXA 2ZGTA 3ZYJB 3F8BA 1I6HJ 1IJWC 1T33A 4CZZA 4XF1A 3VBHB 2YV8A 4CP9A 2HWC2 2Z99A 2ZX2A 5A3MA 1IKPA 1IO2A 1BR1A 5CEHA 4Z2YA 2RJ2A 5C3EJ 3CCLI 2ZFUA 4HNUA 2PA7A 4WM7B 3V64A 1G2HA 2YHJA 2BNOA 1S5LC 4PSWA 4GWIA 3LQQA 3S93A 2ENRA 1Z21A 4D69A 3CZJA 4B4RA 1ZYRF 4NIIA 1L7RA 5E16A 3FHQA 4EMSA 3VDXA 5GLWA 4GO1A 4CCEA 5D8AA 4CHUA 4NB5A 2W24A 4P9LA 1HB4A 1UWWA 2ZPXA 4GMP3 4NMIA 4AFMA 1PZ7A 4KJZA 5BNGA 4XL9A 5EEAA 1KQRA 1S0FA 2ISYA 3HN3A 1P7IA 2NVYJ 4LK0F 5FUPA 1UYZA 1YJ9I 2VCBA 3HOZJ 4QHZA 5M5XJ 3DCQA 3C2BA 1IQDC 1RUF3 3MLLA 2IRFG 1WMFA 2XBO2 3I58A 3PQKA 1HBXG 2DA5A 1DUXC 1AVBA 2OQRA 1Z05A 1QXJA 1P7JA 2IZWA 5GJ6A 1W2UA 1K6OA 1UG0A 3UKTA 2X1EA 2XKOA 3BG5A 2FBIA 2F48A 2IT0A 4C8DA 2VQGA 1HQWA 3E6BA 3G1MA 4YLZA 2YFUA 2RAEA 3GBFA 3OOUA 2E5ZA 2FDJA 4BGDA 2K0GA 4IHWA 2NYXA 2XQRA 4XUTA 3OPTA 2VXJA 5B4NA 5LHGA 4QB2A 5B66C 3U1KA 5FUIA 3EDPA 1SPPB 1Q5OA 1NLQA 4J6GA 3CDIA 1DGRA 5EJCA 3LF7A 4WVZA 2JKBA 3FHIB 2IXJA 1AYN1 2DYSH 2DTWA 5HODA 4I3PA 5FY0A 1BR2A 3J8F2 2L4MA 1S55A 3AJYA 2CMPA 3PIJA 1UXXX 4IESA 5F7UA 1W36D 2EICA 5CVRA 5FZGA 5C4WB 3A01B 3Q9OA 3BUCA 1KS5A 4NC7A 1BI3A 3QYBA 3ZN1A 1DLCA 4Q4Y2 4I30A 4A6SA 2NMOA 5HNFA 4ZYEA 3IAM2 1D1BA 3O1PA 4WZFA 5A7SA 4AE2A 4K6BA 1H30A 2LS6A 1RC6A 1FC3A 3ZCOA 1N25A 2RMU1 2Q5TA 4AYBA 3HNYM 4YEJA 4D1QA 4LBKA 4B7KA 1ETXA 4PZJA 2WN2A 3QBQA 3AG1H 3CD6I 4CGZA 4GJYA 2P1BA 4OIOF 4ZPIA 3ERMA 4V2WA 3DXJF 3TNPB 2QWWA 2YBKA 3C3WA 2RDSA 5FYTA 3K4AA 1LDJA 5JOWA 1ENXA 4ZH4F 1DPRA 1WMXA 3HEFA 1W5CC 3CJIA 1B35C 3RPQA 2E33A 2VNGA 1MQTA 3FMSA 5CVJA 1Z3YA 2G7HA 1HB2A 2LROA 4XMIA 4IV1A 4C2MJ 3GZEA 2BWAA 3KCYA 1H8TB 3F9KA 3P9KA 5FGMA 2ZC2A 3KWVA 2RR13 4P08A 2HVQA 1RUJ3 4A4AA 1JYNA 1X2MA 3QP6A 1HCRA 2L01A 3K48A 1KRIA 2RVCA 4RS5C 3JRBA 1IDZA 1RMU3 2R93J 3KT1A 2NOGA 2KL4A 2WS92 4G94A 3CP8A 3HGYA 1FJLA 3H5RA 4DZGA 2YC4A 4Q5OA 3HSFA 4D7SA 3W5NA 2XH6A 4RHV2 3I3BA 1U5TC 2JN6A 1XG1A 1ZH5A 5FY4A 4EJWA 3HQRA 3EXUA 1EJ9A 2XWBB 4E2QA 2UURA 2QVSB 4M4RA 3FZVA 1PNGA 1CAXB 5FXVA 3USSA 5ILVA 5C3QA 2XB0X 4Q4X2 3L2HA 3MIEA 4BQXA 3NWTA 2GSYA 2WZPP 2J1SA 1SFKA 3BOWA 1GVJA 3WLUA 4W6YA 2VBWA 5CQGA 5FMOL 3ZDVA 2P6HA 1MBEA 4Q48A 2A73B 3HSEA 2Q0AA 4ZU4A 3FHAA 5C6CA 4HDUA 3H1YA 5JXIA 5LATA 1WCDJ 3B5LB 2R7ZJ 2E34A 3BOQA 4QX8A 3PJRA 1PJRA 1RHI2 2FZ2A 5KC5A 2FDGA 1KU9A 2PFBA 4Y33A 5GADJ 2FMYA 3MVPA 2R072 2ME0A 5JXHA 1U78A 3PO3J 2HI3A 2XXZA 1Y43B 3ILNA 1Q3EA 1SD4A 1ZAOA 4BQNA 4MHUA 1KJRA 2HDCA 5CFDA 4ZXKA 4DRRA 5TSWA 3CCQI 1MZBA 1NUKA 5CKNA 2FSWA 4KL1A 2RNGA 3D5OA 3RSNA 1HDKA 4XKBA 4YRVA 3RS6A 5GZDA 2QKDA 1YJLA 5KAFC 4HSJA 5DABA 1XS9A 5JSPA 4UUSA 5FZBA 3R61A 1EP0A 5CQEA 3SZTA 2MEV3 5BNPB 2FCTA 3R4UA 4EWAA 1W2NA 5CISA 5AVAA 4HG2A 2BXZA 1IS4A 3L9JT 1JZ7A 4P02B 2M87A 3W3CA 3EHKA 1S7EA 2F5VA 3RWNA 5FZMA 3HYIA 3QPTA 3O0WA 2CDPA 3RJPA 1BBYA 5F39A 2X1DA 5GTIC 4FTSA 3F8CA 1OC1A 4KI5M 4OMZA 2RS31 2WLQA 1LOAA 1F9NA 2GC1A 2YS9A 4DYCA 1X1PA 2JA2A 1CZSA 2BNNA 4MXWB 4K9SA 5DDJ3 5FAXA 5GAEJ 3BVCA 2E1NA 3CCUI 4CP1A 2D1VA 4XOPA 1X1BA 5K0UA 1GOHA 3REOA 1W6NB 4R79A 1S2KA 3TW7A 1YFYA 1O8SA 1X8EA 4AHWA 4JGYC 1G3YA 4ASKA 1YFUA 2Y38A 2W7NA 5IP9J 2XQXA 2DI3A 4K20A 2D93A 3WP6A 1U5ZA 4QQOA 4XABA 4E8CA 5KVRA 2CNAA 3DXUA 2P4WA 1W6QA 2KM2A 1C1FA 1FATA 3UR3C 2LUWA 2QFEA 5DUIA 1W2TA 5LBCA 2ET7A 1LTEA 3I55I 4LB5A 1ASJ2 5J3UA 5DEQA 3OYFA 3AZZA 3FM3A 4KWLA 4X1EA 2KQRA 1OLRA 2YUEA 2QQVA 2V9KA 3S5AA 4RR3A 1AYN2 3WNMA 3P5JA 2JG9B 2X10A 5CYYA 1VQ7I 4V19K 3EUHC 3RZDJ 4YGBA 1RL3A 2GQQA 1Q8SA 1RUG1 1KXGA 1R082 3RJRA 3COAC 5IYCJ 4ZKTB 4W1UA 2HOAA 3LL7A 1K5JA 2HWVA 3WTTC 3T3YA 3IKTA 5FZ8A 2BXYA 3HOXJ 1NAEA 4OI4A 1JOBA 2A07F 2EIGA 2VOXA 2ARCA 3WDXA 4D7YA 3ITQA 2C0ZA 1HDDC 2LF8A 4FPFA 2I10A 3GXOA 1UO9A 4E4SA 1BI2A 2RS11 2EH3A 1RITA 2KFDA 4KIGA 1O5LA 4AVPA 4E4DX 2J1VA 5GAHJ 3PJQA 4PBPA 2XVCA 4HSTA 1XYPA 2Q8KA 1YYVA 2XHKA 2QBYA 1JU3A 2QQ8A 3JSOA 1X3WB 4OQ9A 3S5QA 1YO5C 2A3XA 2BGPA 1F5TA 2V4AA 3HM5A 2HWD1 1RUC1 2A6WA 1BJZA 5FY5A 2EZHA 2R041 4LK7A 1A6QA 4FTHA 4XDPA 1QGPA 2VVFA 3U75A 5FMBA 4KU7A 2X0LA 2AACA 4AHXA 4ZXEA 1I3QJ 5C4WC 3AMQA 5DZEA 2R1BA 1OJLA 4TXWA 3WTXC 1QOOA 1OKOA 1CR7A 3MIFA 4KUMA 1CPMA 1RB8G 1ZX5A 5A32B 3H8XA 1GP6A 1ZBE3 1NX9A 3PMSA 2D44A 4OWRB 3BU0A 4CYCB 2CUEA 1FNZA 1W2OA 5EWSA 5A3WA 4AFCA 5ABJA 1T6BX 5GLZA 3X29B 1SAUA 2A3SA 4M3CE 2E19A 2EVXA 5FZ0A 3AP9A 2EIBA 3D82A 4LNVA 1IXCA 2DFCA 1NH3A 5FKKA 5CKMA 3ZOIA 5C5TA 4IRHA 3OG2A 3ISPA 2HWE1 1BBT1 1OFSA 3K10A 2N8GA 1RIOH 3R0AA 2H1KA 4OIRF 1SDWA 3IL2A 3RYKA 3B00A 2GAUA 3WUDA 5DZFA 5IYDJ 2ZGKA 1DZTA 3QOPA 5EYYA 4MFEA 1Y1WJ 1WCKA 4OUMA 4IQ4A 4XFBA 2YROA 1R1VA 1ZBA1 3ML6A 3CUOA 3B7MA 3RIRA 3DEUA 3ZYPA 5FJHA 4XOTA 4N9IA 4PF5A 1Y9GA 2PQSA 2GLOA 4X8PA 3RCOA 3TO9A 4QX3A 5I0TA 4BEHB 1EV11 3BB6A 2PN6A 4K40A 3BTLA 4G8XA 5KCMA 1E5IA 3ZKUA 2Q1ZB 1MJ9A 1Y8RB 1ND2C 1IC8A 3J26N 3RZZA 3WU1B 1OQ1A 1UY4A 2ZZQA 3BQZA 2TCTA 2VZPA 1ND3C 2Y6JA 4CDWC 4NE9A 1P6RA 1IGNA 2AREA 1WLWA 1PMIA 5FKLA 2PHLA 2CFOA 1OCOH 1O8PA 1NCRB 3USUB 2CGPA 2MH9A 1XYNA 2E6VA 3P9CA 1NZCA 3J81Z 3LFIA 5ICGA 2MYSA 5CBLA 1NLRA 4B4CA 1V9U1 3MPPG 4XKCA 4ES9A 5A7QA 2XG3A 3BCWA 3UKNA 2R92J 3LPFA 3K75B 4DMIA 1T6SA 5J96B 1VE0A 4G6TB 3TOAA 3M9AA 1TE1B 5FB2A 3ZQHA 5K4LA 3JBG3 5FOJB 1GBGA 3ZMDA 2EK5A 4HZFA 4KMQA 3I0TA 1YQAA 1TQMA 3I4IA 2RS32 3S8PA 1PX3A 1Q43A 4NAOA 2A6YA 3G6JB 4UFKA 1DQ1A 4P5OA 4D6SA 3JAMZ 3KE2A 2YPJA 3ZOBA 2RDPA 4QQPA 3TDZC 3L2YA 2CY6A 4GA9A 4D6RA 4QPQA 5FP8A 4IW3A 5FYSA 1LE8B 1POGA 3AMHA 4AAXA 2L7FP 5J1UA 4OUEA 4GWJA 2EFNA 4P00B 4TZDA 3V4GA 4CPBD 3IDCB 2QE3A 3MIBA 3CESA 2JTVA 4M3DA 3N97A 3N36A 3DU6A 5BPDA 3SFZA 5L36A 5FKOA 2VOOA 2R7TA 4M3CA 2BVLA 4RBOA 4HNTA 3GEZA 4RS5A 5JIAA 3VHNA 3CO6C 5LD2C 5I8SA 5HI0A 3RZHA 4B48A 2GN7A 3L1PA 4P9WA 4CDXB 1ZK8A 3LOCA 4TYSA 3ZM8A 1G6NA 3Q3SA 2ZGOA 5JR7B 2JIGA 4XACA 3TYJA 2VKEA 1GWKA 3AMMA 1D8KA 1YO8A 1I5PA 4GB31 2PHFA 2X8KA 2R5ZA 5JZGB 3GFIA 3VV1A 1O6UA 4Q29A 2BGCA 4YVSA 5LBBA 4KQ7A 5FREA 5ICEA 1FMD1 2ZA9A 4ZYGA 4FX0A 1MJAA 3TQNA 3IZOA 1XC6A 4ESBA 3PDQA 4UOJA 1WWYA 3QLQA 2VOWA 1QQP3 1H0BA 1GLHA 2WNVC 4GWNA 2QDRA 1VQ6I 4NQWA 5BMZA 1R4NB 1XX5A 2VAUA 4QKDA 4G7OF 3V7RA 5FYZA 3OYAA 4H3WA 2XVLA 3CF5F 2DW4A 1JOPA 1BW5A 1O7LA 5CZKA 2GOXB 3V7CA 2XDVA 1X9TA 4HBNA 2RM22 4AQSA 4HT1T 1QY4A 5A3NA 3TN93 2YY1A 3JW4A 3UKVA 4Q0PA 3R0JA 2NQYA 4HONA 1FPN2 2OZJA 4LTAA 4D8MA 1KS4A 1L7QA 3W2WA 2X5IB 1IRXA 5GAGJ 2XAJA 5D6EA 2HWD2 1RUC2 2ZJ2A 4P9XA 4HSLA 4FOQA 1LVAA 2GXBA 2XONA 1RRJA 2F5CA 2VUJA 4DBRA 3ECHA 4L2NA 5LA9A 2JDMA 1NYWA 3BTCA 3IB3A 2VW0A 4QHOA 4W4ZA 3K4BA 2K85A 4QM8A 2HQNA 4AIKA 4NAMA 2LC2A 5FZEA 2JZYA 3LFKA 4TSVA 5BNNB 2P5KA 5AC91 1UAIA 2OJED 2VC9A 4COWA 1VMFA 3CCRI 3K51A 5GM0A 1MBKA 2LP0A 3FXQA 1BK1A 4JDOA 3K0LA 4A0ZA 1DP3A 1X33A 1LOFC 1Y9MA 2E2JJ 2GC2A 2IXSA 3TOJA 4ZDOA 2VMDA 3BPXA 3ETQA 1BR4A 4A69C 4XTPA 3A21A 3O2PE 1RMU1 4LMFA 3E5QA 1LENA 4DGWB 2NYYA 4O65A 2JWPA 4AF9A 2Y2ZA 3A0KA 4NHLA 3SEPA 1OCCH 2PHDA 2C9KA 3AFKA 5K1YA 1MJBA 1H9PA 4QPGB 4OVEA 1RUNA 2HYJA 1FOWA 2B7YA 4IX7A 5EYXA 4X6RB 2A6VA 4DJAA 5LRRA 1R71A 3JQXA 4JGYA 3LAJA 2OCCH 3ZKYA 4XMAA 3H9JA 1B6AA 3HIFA 4UF0A 2VQLA 4RL7A 4A42A 1QJY3 1K5MB 2P4EA 2X9DA 2D6NA 5IYBJ 5IK4A 5A80A 5J37A 2WZEA 3PUBA 3Q8BA 5L3BA 4P9IA 2KDZA 1EV12 2O8KA 2MBFA 4MHGA 1GV9A 2ZGQA 4WXDA 1RZ4A 2FX0A 2W84A 4XFCA 2HYGD 5C44J 2ZKNA 2OYZA 4N53C 3CNAA 1KGSA 1GMMA 3J81K 4FTEA 4S04A 3LSIA 2R49A 1K83J 5JHUA 4JOMA 4WM8C 4XFFA 1DG6A 2W2IA 2CQXA 2KD7A 1B59A 1DIWA 1B09A 5CA6A 4R1HA 4J00A 3CLOA 3EUAA 5FZ3A 3MDPA 2R7EB 1OF3A 2IVIB 3P3PA 4A3CJ 2L54A 1JKOC 3HBLA 3Q0VA 5HV0A 3SKJE 3V7SA 2E71A 1GP4A 3LSEA 2BW3B 3CCMI 1SPPA 1AKHB 3JAMK 3QU6A 3H1MA 2ZEYA 4J25A 1X50A 1QJU2 1S8NA 3T09A 4CU7A 4AU7A 2ECBA 2E7QA 1OR7C 2VR4A 2XIGA 3S1MJ 5C4WA 5A7OA 4BDVB 4IRGA 4AYUA 3DKYA 1O7FA 3RZKA 4XBQA 3OYNA 1RUD2 1ZARA 1JE8A 4B3AA 2IGMA 3BY6A 1UNBA 2DDAA 3BTJA 5ED4A 4OIPF 4FOYA 4X6AJ 2B0LA 1VBC2 1RXGA 1B72B 1H8VA 4ZDPA 1QHHD 3O8HA 3TEDA 3QU3A 1S7OA 4UT5A 2VUDA 2Q8DA 3M8FA 4PCQA 4M3CF 2WAAA 3AL5A 1D0XA 4YVWB 4LBQD 4XQFA 2LY9A 4YW7A 1YITI 4CCKA 1W9TA 5A6YA 2M0MA 1VRH1 3ZLIA 1W28A 3E0JB 3N3HA 2HWB3 3ZMTA 5LCWL 3OCPA 2JPCA 3TMOA 3K2OA 3LIHA 1CZVA 2PHRA 3H3ZA 1GZWB 3MO4A 4N9HA 3FFZA 3RNSA 1R58A 1FMD2 1H8TA 5CG9A 4S0HB 4ASNA 4YZ2A 1Y4WA 1OYWA 4AVCA 1FNYA 1ST8A 5FZHA 3U0ZA 1W8FA 3AG3H 1FSEA 3B73A 5J36A 4DB5A 3DUIA 5JWPA 2RS52 1SVOA 3ZN0A 4BJ0A 2IC1A 3K77A 5EZHA 1SFPA 4ENKA 4Q4V2 2D3SA 3MUY1 2V5YA 3WTUC 2ZAHA 3H8OA 4EGZA 2OD5A 1BA5A 1USSA 1OA3A 4BXXJ 1XOYA 5C4XJ 1UOJA 1TLHB 4C3JJ 3ZXJA 1CAWB 1KJLA 5JMOA 3ZFGB 1V00A 2CSGA 4CUAA 4M9ZA 4BNCA 1CONA 1YW9A 4QB6A 1ZRIA 3RZMA 4I98B 1V54H 4Y17A 1ND2A 4O3MA 1MS1A 3BJ6A 4XTMA 5K7PA 3OL3A 2PMUA 4N4NB 1ND3A 3C3VA 2H09A 1NOVA 4A3BJ 3I59A 4LIVA 2X48A 1IN6A 1BK0A 3S32A 4OULA 1ZGJA 4AI1A 3HQXA 4DOZA 4FPLA 2R062 3VBUB 2XKPA 5IAXA 2PHWA 4BHPA 1A6IA 4FX4A 2NOJB 4NWWA 2V7FA 4AL9A 4EZ4A 5LA0A 4PFPA 3SXWA 5TRDA 2WSVA 1MVEA 3F95A 2H94A 3IH4A 3SEQA 4SLIA 3F8MA 2ISZA 3N05A 3T2TA 3CJRB 3CKHA 4JK1X 4AC0A 2QTWB 4XR6A 1IZ3A 5F5IA 3SQOA 4ITCA 3ABKH 3HOVJ 1JXSA 4IV3B 4PK4A 3SISA 4P9GA 1SAXA 3W5MA 4FCAA 4INDA 1JKRC 4RGUA 1W04A 4KN4X 4KICA 5EGOB 1VBE2 1YQ5A 1G8XA 1HIXA 4TV7A 1K3IA 4U7DA 4NJ4A 2NP0A 3SH3A 4G9YA 3TP3A 4R4ZA 5I0RA 3G4SI 3RSJA 4Y1YA 1CZTA 2IXHA 1FBSA 1COV2 4XPVA 2A5WA 4RGGA 4M4PA 1BZWA 1YG2A 5A2QZ 4BL0B 1YRZA 4C3HJ 2LREA 4BMBA 4Y4YA 5BNQA 2EIMH 3T30A 1FBQA 1GXQA 5E88A 3BOPA 4HOOA 1JI6A 2H8WA 1P4XA 5EEHA 2UU8A 2A70A 3MFCA 3MW2A 3VYSB 2LK2A 2HDWA 4MXWA 3I54A 4A6DA 5E79C 3KEQA 1IS3A 5T52A 1DQ2A 4RQPB 2V72A 4WK8F 2MNGA 5FXWA 1QWRA 5JSRA 3DKQA 4EJOA 1Z9CA 4QPGC 4HKWA 4L0PA 3WG1A 3ZMSA 4KFCA 2YG0A 4Q2FA 5F5CA 3BP8A 2RDRA 2R5YB 2LTNA 4E7JA 2RE9A 3AKPA 3MQ0A 1VBA1 2HQ5A 4L5EA 2WNVA 3EQEA 4SBVA 1I27A 4ENJA 1TWFJ 3KYCB 5FYBA 1ZRFA 3BWGA 3QOEA 5KBFA 1JTYA 4Q0QA 2IP2A 3VBFC 3CLPA 5ISLA 5JDBA 3BZKA 2VMGA 5JI7A 5BS6A 3FE5A 3BPVA 3I8TA 3QQAA 1YS7A 3VD5A 5A1LA 4IKFA 2VCMA 2HKXA 3I7DA 4OHVA 1XE8A 4EN0A 3LDRA 1HA8A 4GH4B 3FXJA 4L0ZB 4CU6A 1AR72 2XAQA 2MG4A 2LALA 1RIRA 1XCBA 3SH4A 3JBG1 4P1WA 4LO7A 2JG9A 2FQPA 4BXUA 5HDGA 1JHHA 4QTRA 5K5QA 3NW4A 4HXCA 2VODA 5FTTC 3NNLA 1GWLA 2HWF2 5I8TA 2CQNA 4IZZA 3N7MA 1LFUP 4IXLA 1VAVA 3M8EA 4XF3A 1CD3G 3OBAA 5FPLA 2VTXA 2DJNA 2JXAA 1K4TA 2CV1A 2Y6FA 3UK9A 2QQNA 2WSUA 3E6MA 2Q30A 4FXGB 3LSGA 2G9GA 3J7AO 5BY5A 2DU9A 2RV9A 3HBKA 4DINB 1WBLA 2L2OA 5TJJA 4Y15A 5DPNA 1YXWA 4KGQA 1BHGA 3A0NA 4RAZA 3GLXA 2LYCA 1UZYA 4O6JA 3G2BA 1V3FA 4YYOA 1VRH2 2HZDA 1R1TA 1U3EM 3KZ4C 3V65A 2R7DA 5H9PA 2HXIA 3BKZA 5I0SA 4ZZLA 4E4HA 4G7HF 1PIV2 5FRAA 2Y6KA 2WWSA 4Q8LA 1VQOI 1I3HA 1RVF3 2ID4A 5A32A 1HXS1 3P5BA 3BTIA 1D2QA 2M34A 1AXKA 4QPIC 2BDRA 4CYCA 2VBXA 5DAWA 4JTOA 1EAH2 4HK9A 1P2FA 4HBLA 2EA4A 1E5SA 4IE6A 3LFMA 4DY5A 4MTDA 2BHYA 4ASMB 1NG7A 3K4NA 1BVVA 5L9BA 3KIOA 4MSVA 1R22A 2DCZA 3MKZA 4Z2AA 4GKYA 3HT2A 1D4M1 3OYKA 1JZ8A 1HRI1 4QB1A 3NNMA 2NVUB 5F0FA 4A0XA 1H8AC 2IVJA 3A4UA 1SD7A 1HDPA 1AXYA 4H14A 3JB8A 2KISA 1AR81 4L18B 4M73A 1OUSA 2JDNA 5BXXA 4JX0A 2GNMA 5ICCA 3K1MA 2VLAA 1HJGA 2P3JA 5FJ8J 2I5UA 2WFF2 1RUI1 4B3NA 2G19A 5ACA1 1VRBA 4JRAA 1QJZA 1OOPB 4OZXA 4WVMA 1LJ9A 1UPSA 4XJ8A 3QYEA 2PLYA 3I71A 3AP4A 4AK3A 1ETQA 3WF1A 1AXZA 2YGMA 3CJNA 1S29A 3J7LA 4LKDA 4S2GA 1GR3A 4Q47A 1FOD2 1VB2A 5A7WA 3JD71 2BVVA 4BEHA 3ZFGC 5CADA 1VR3A 5FZ6A 3E5XA 3FXMA 1BLZA 2HWC3 2KP6A 1GNZA 2JDAA 4XW3A 4CDUC 5M0TA 1W0NA 1F35A 3M2MA 3H36A 3KT4A 1GQPA 5J3LA 1OR7A 4LG0B 1U5XA 4HLTA 5A33B 2VUAA 1ZKGA 4FFGA 5A2QK 3C7HA 4EN9B 5B1BH 2W94A 1XYOA 4HL0A 4CEYB 2DV9A 4BDYA 3S3OA 1OXCA 3VBUC 4E7KA 4LFUA 3UYJA 4XMYA 1UZ0A 2PAKA 1GVDA 4F55A 3I3LA 3ERED 1FTZA 3FL7A 4QHBA 1ZRRA 4JKLA 1PVC3 2RC4A 4GALA 5EG0B 5T54A 4HMZA 1GNHA 4CH7A 1P8JA 2BY1A 3H1CA 3T4VA 3VZLA 4PJ0C 1UW8A 3OSDA 3VLBB 1X3ZB 3WW1A 2EFQA 1NKGA 5FWJA 5EZWA 4NC6A 3HRMA 5J40A 4BQQA 4BIFA 2K9MA 3CCYA 3AX4A 1VMHA 2QQLA 5IAVA 1R092 4XFHA 3FBIB 1LOBA 1Z7LA 3ZR8X 4HV5A 5GP9A 2XBO3 3OY8B 2L9VA 4IV3C 4QPYA 4B7EA 3GFLA 1GDTA 4CP0A 2Y26A 2VB6A 2WIIB 3OOXA 3IWFA 2Z5WA 3ABLH 1FMWA 2CW8A 5FY1A 1SC7A 1W9WA 5E1RA 2DVAA 5FYIA 5D21A 1I1EA 3BG7A 2TNFA 4NHKA 2HU9A 4XDQA 3LAPA 4FFFA 2AQFA 4GIQA 2EPFA 3R0RA 1YWKA 1VBA2 3PM1A 3M4FA 1TNRA 2VXRA 1IS5A 2IWGB 1ULYA 1HRV1 3UGGA 3PUQA 2ICWG 3AL6A 4ZC3A 2A3YA 1TNSA 1OBNA 4CDXA 1PUEE 4XAAA 3I64A 1BEV2 3O1UA 1MBGA 2XAHA 3WQ0A 2E1MB 3I53A 5BQTA 5D8AB 1TMF1 5FYYA 4IHTA 4D3WA 1MS0A 4HQMA 1NA1C 4HPKA 2WL1A 1IPJA 5IOZA 3TEXA 2JJ7A 1W8TA 5JVTA 1EYBA 1LDDA 4Y4RA 2W25A 1W2AX 4RQPC 2CAUA 4Q4Y3 4AWDA 1PZ8A 2M7BA 2P7CB 1O91A 1W1WE 2WO1A 1HQLA 3SC7X 4IE0A 3P3NA 4ZS2A 1ZZ8A 1NY71 2GALA 4MV2A 3U1XA 2VNVA 5I91A 2Z42A 1OISA 1IS6A 1GOFA 3BG9A 1ONAA 5HDNA 4Q1RA 4KBBA 4XN3A 3RZJA 4K3UA 2VOVA 2VGDA 1W7PB 3JR9A 2F6BA 4E2GA 1JKQC 1FYUA 1W7PD 1STZA 4M01A 2K7LA 1UAAA 3APBA 3S1RJ 2PYTA 2MA3A 2OX0A 1I39A 4RFT0 3VEPA 5BOXA 2XJVA 2W57A 2KRHA 2E31A 1LB2A 1PGL1 1FTTA 5KC6A 2UYBA 2X5IA 3RPUD 2YGLA 4QD2A 2VJIA 4TN7A 5EJ3A 1U6GA 5KHKA 4LB6B 5JPMB 4RDUA 4XLNF 2WNOA 4BAYA 3ZFEC 2ZHNA 2WZR2 4CA9A 4XYXA 1OYYA 2DWRA 2GMMA 4BLIA 2AEYA 2XLAA 3FBMA 4FFIA 1UL9A 3BDDA 4Q4W3 1Q8OA 4LQRA 3K2ZA 1UZWA 3VBSB 3SKVA 4MGKE 4A3DJ 2VZ1A 1YW8A 2BY0A 1HXS2 1LOCA 1S0JA 2WWUA 3EJKA 5FYUA 2JKXA 3I2HA 4Q0VA 1WI3A 1YFWA 2XAFA 2PX9A 2WBKA 4B1LA 4ONUA 3H0DA 2QCOA 1Y3TA 1W6PB 2JEMA 4NHXA 1MPXA 4A12A 4FXKB 2X53S 3IIAA 3W59A 5F3GA 4O9GA 5APAA 2YC0A 4ZY9A 3RJ2X 3MFAA 3V8KA 5IPAA 5CNAA 4I76A 1RYYA 2DFFA 1XNBA 1R5HA 2YU3A 2O6GE 4Q4X3 4PJYA 3G7DA 4S2FA 3SEZA 1WD3A 1HRI2 3BIWE 4YIFA 1LHUA 2EBIA 4YW1A 2CAVA 4HETA 5DDGA 2EV6A 2WY8Q 1PMJX 5L73A 1IHMA 2PHTA 1PMHX 4G4FA 3GJBA 3O1RA 1GHCA 2DCTA 3OUIA 4AM3A 1MQTB 3HPGA 1JW6A 4QPGA 2PLV1 1LPQA 2VOKA 1RUI2 3K7AJ 3VHRA 3I3QA 4XFGA 1N1VA 5ACA2 2B42B 2QQ9A 3BODA 2BEOA 2HLEA 3SDGA 3H8RA 2BJSA 3PNAA 5FDBA 3B6CA 5IVBA 2UWMA 5GZCA 3PUHA 4WV8A 1AX1A 2IS6A 4MYEA 3AP7A 3NJYA 1DP7P 3NJVA 5HLIA 3VZNA 2X6XA 3J7HA 4GGGA 2ZKLA 1YCIA 2KIUA 2YPDA 4PI0A 2M2EA 3JD72 1LU2A 4IHVA 2KIMA 4FSJA 1BI0A 2LF7A 2WLPA 2FDHA 4CXFA 2AEZA 3POFA 3KP2A 1S9HA 2RNJA 2YZ4A 1FLIA 3ATGA 1XCVA 2VQUA 3KLSA 3D5SC 1QQIA 1IXSB 3RYRA 2PMHA 2VBBA 3LSHA 5J8CA 5L19A 3SH5A 4BISA 3KMHA 3RMYA 1OOPC 2W3JA 1D5VA 4QQLA 4ON0A 2WA3A 1VF9A 1J84A 1FYKA 2MC3A 1ZQ3P 2O14A 4AEJA 4XLAA 3CJQB 4C90A 2IAIA 1X1CA 1IN4A 1ULDA 4GXOA 5HCHA 4D7MA 3KEOA 1AWCA 2ILMA 1LEMA 2Z16A 1I3AA 2DCKA 2LRDA 2VXDA 1RXFA 1TC3C 2BW3A 1AKHA 2J42A 1HW1A 2J22A 1APLC 5FXXA 2Q1MA 5F0HA 1IOAA 3H0OA 4LEJA 2AS5F 1TWHJ 2W5FA 5FYMA 2WAQA 3SZGA 2LM3A 5KR7A 4MZUA 2HPIA 3F8FA 3GYHX 4CA0A 3INAA 5TGTA 1EKEA 1NCQC 5EV7A 1RUH1 3DECA 1XNKA 3W2AA 1QNTA 1ZVFA 3TO6A 1BJAA 4LBNA 3WP4A 1UHSA 3J7ZI 4AGRA 1ZHFA 1QDCA 2O7OA 1TZLA 4CEYC 1AYM1 5JR2A 3DP7A 5FP4A 4QPIA 2VONA 1B72A 3HPNA 3JCUC 4I0BA 5L3FA 3LEIA 2L7MP 4UB8C 4PDWB 1J58A 3O8GA 4FHTA 3JRAA 1O4YA 1VBB1 1FYLA 4LBQA 4X8NA 2ZHLA 3ZPLA 1MMSA 1N75A 1HRV2 4YVWA 2D6KA 3WDVA 2BPA2 2QBXA 1DYPA 4XAEA 1ALYA 5TISC 2ORXA 3LEMA 3U14A 5K8SA 1AYN3 1DCSA 3WQ7A 1XDSA 4LT5A 2CQQA 2DVDA 5EJZB 2WT0A 2W9XA 3M3IA 2DCJA 3WG2A 3L09A 2B9UA 2CH0A 3VBOC 5IOYA 1GZWA 1B9NA 4XILA 1J9IA 1C5HA 3FDYA 3F22A 2XRLA 1L3JA 2Y6HA 2R6QA 2J1AA 1NY72 5FOBB 3KVBA 1AJKA 5DAQA 3ZVXA 1YW7A 1JHNA 3OGGA 1W0UA 4Q26A 1E3HA 2WAOA 3N9LA 3CUQC 3RI4A 2XGCA 1S0EA 4XQDA 5BV6A 3PIOF 3OYWA 4KNCA 4D0PA 4P96A 3MLJA 3V56A 5FD6A 2F4MB 3L7WA 4META 1WJEA 5A3OA 4YG3A 2Y34A 4OYUA 5FLMJ 3HTUA 1XE7A 3NJXA 4IUGA 2OPKA 3MUZ1 4QKFA 3D3AA 1KFUL 1CAWA 3ILFA 3ZFGA 1FXZA 2FRHA 1S0GA 3BTAA 1PGL2 4XNFA 1MSFC 1OHFA 4CDUA 4Q4ZF 2OC6A 1JZ2A 5I93A 3SCGA 4AWXB 3L2WA 4ARYA 4BQ5A 3VODA 4E9KA 3ZGKA 1MEC1 1NZIA 2DA2A 3G71I 4E7SA 2GXGA 3S14J 3GW2A 3RQIA 5LW9A 1ON2A 4E70A 1XD7A 2BUKA 5JVGF 2Z4FA 1KQ8A 3HSRA 1QVTA 3Q9SA 2MLKA 2XL9A 5I8YA 4JZRA 3N35A 3BTYA 1IPSA 3AXDA 2CL2A 3UETA 2IEKA 3L2UA 3VBUA 1BIAA 3MBWA 1BQPA 3V8JA 1OQEA 5AIQA 2RKHA 4C30A 1OUXA 3BPSA 2Q8EA 1Q8PA 4UXNA 2BBVA 3KYDB 3IMNA 4QU2A 2DFEA 2VBZA 1UELB 2DBBA 2QQUA 3IH3A 1KZHA 3DF0A 2M5WA 4HA8A 1QJEA 1S7AA 4Q27A 4PFOA 2ESHA 2V1DA 4XLHA 1P4AA 3EB7A 2ZMEB 2ZFWA 4II3A 5C3OA 1MGTA 4KIFA 3RQ0A 4MXVA 4XICA 3VHPA 1A36A 4IV3A 4MGZE 1H0MA 2KIFA 3A03A 3GALA 5DUKA 3WD5A 4QX5A 5FO8B 3AKTA 1DQ4A 1JMUB 3DQVC 4WWCA 3OS0A 5EGOA 4J1WA 3CMMA 3O7OA 3H50A 4HSRA 1VAKA 5FQ0B 2OQ6A 1U9OA 2B9VA 3LSMA 2GIZA 1ZGWA 4BE1A 2HR3A 5D6FA 5FPVA 3HC7A 4YM0A 3FBNB 4KYWA 1WCUA 2CV6A 3H3LA 5HXVA 4IOAF 2XLFA 4RLFA 2E26A 3ONQA 3KV4A 4M9XA 1UFMA 2DT7B 4PJMA 1MS4A 4NROA 3NV4A 3QCWA 3BQYA 2E2IJ 2XGEA 1RI7A 2CYFA 1ZZCA 4E27A 2FUG2 4EE2A 4N43C 1MNDA 1C8M2 1KITA 4FFHA 2JSCA 2Q8CA 2XUMA 3C7JA 2RR12 4KMUX 5D8KB 4RQPA 1RUJ2 3HN1A 2ELJA 1U9NA 2DBIA 3LSKA 2BFUS 4LIUA 2RV8A 4C2UA 2XR4A 1HW2A 3VYRB 3OPZA 1YEWA 1WJ5A 5C70A 1XN7A 3URFA 3MICA 2VJ4A 2ZEZA 2NLRA 4XSZF 3MI8A 1ZRDA 3C2GA 3NNFA 2F17A 2E1OA 2PMZN 5HXMA 4WXCA 4JCKA 2PN5A 2TRTA 1RJ7A 3K3NA 2RS33 4LK1F 5IJRA 4CXYA 3LDKA 1ULEA 1IGOA 5FP7A 3CU7A 4HK8A 2LRPA 1RINA 1FV3A 1N3PA 3CF2A 1TZOA 3S3NA 4EROA 3GWZA 1IZ1A 5K9YA 2VI6A 4MFDA 3IT8A 3BR0A 4CVUA 4ZJZA 2WYFA 1RTVA 1UZCA 2ELHA 4NRPA 3FMQA 1YNAA 3BCAA 2EF6A 3IAS2 5K5OA 4HNVA 4LBJA 3QH6A 2ZBKA 2O8QA 3F2ZA 1W0PA 1LFBA 1SEUA 1BC7C 1A8MA 4CUBA 3GTMJ 2HOSA 1LQ1A 4Q1PA 1QIQA 2Y8KA 1X36A 5HS9A 5J4YA 1UMQA 4GXLA 5DN2A 4EQVA 5LHHA 2ID6A 3UESA 1AYM2 5GLUA 1IRGA 1POQA 2P3IA 3BZCA 2WNUB 1ENQA 4HANA 2A6EF 3VD7A 4QGNA 4URTA 5CVUA 4DXTA 1BL0A 1W5SA 3HHHA 3DBHB 2QZ8A 1Y9QA 2AXTC 2G0EA 4BU2A 2D5HA 2VL4A 4LXLA 4BE0A 3S7IA 1H9WA 3GTGJ 4GQ7A 4ZDLA 5FZOB 3VZKA 3VPRA 1LOGA 2EXHA 2XUEA 3J8F1 3O0XA 2EIJH 3ZQIA 5JLWA 1RUG3 2D40A 4XJAA 1LHVA 5DTDA 1R64A 3WQBA 4OCTA 2G7UA 4Q5SF 4XORA 3OD0A 4A6EA 1B35B 5HLHA 3SYTA 2XAGA 1GZTA 1W5TA 1LGBA 1WJBA 2FOWA 3A4CA 1ZZ6A 2RS13 5F5AA 4D7TA 2WT1A 4A3JJ 1PYVA 4IOCF 3ZP5A 3S2DJ 2DA7A 4QGLA 1BW6A 5AFBA 2FD5A 4LLNA 4M3BA 2NMNA 1W39A 3EBRA 3K46A 1VQ4I 2IW5A 4YW2A 4FVVA 4RM2A 2ZGLA 3MIGA 3KX2A 1WSUA 4LLFA 2HWD3 2ZGMA 4M3CB 2V6EA 1RUC3 5IVFA 3ZN5A 3PMEA 5D1IA 2R043 5FO5A 1J1LA 2W39A 3ORJA 1ERDA 2R0FA 2XV4S 5DAVA 2EZLA 2R7UA 4C3IJ 2K46A 4XVHA 5EIYB 2O3FA 3PTRB 3ULQB 1YOVB 1FEXA 5EEGA 2GP5A 1U5TB 2R5ZB 1R5GA 1GT0C 3BLYA 3BR2A 5FP3A 3E5UA 1F31A 3UGHA 4DQAA 3DGTA 4IEWA 4HAMA 4IEJA 4F3QA 1OOPA 1O4TA 3IDEA 1C28A 1Y0UA 1ZNPA 3V0AB 1VZ0A 1Q8QA 3E6CC 2A6ZA 1Z91A 3K4JA 4NQWB 1K6YA 5J1YA 2G9ZA 5E8GA 2VT3A 4HDVA 1W90A 1DQ0A 2KDOA 1OKQA 3KHBA 5FWEA 3HOYJ 1MSEC 2JA5J 2WS91 4FAGA 3AYAA 2UXXA 4RHV1 2EIKH 4PBOA 1R36A 2ES3A 3RKXA 2ZS6B 2HWE3 4AEDC 1BBT3 2H0BA 4XK4A 4MNUA 2ADEA 3AAFA 2Y33A 3ACIA 5HCFA 3R4SA 2JDHA 4Z2WA 4LG0A 2XVGA 4RGRA 4IGPA 5A33A 4N8MA 3FUQA 1Z0XA 5FKBA 3B9CA 3UNPA 2I8DA 1JT0A 1YIOA 3HOWJ 4MVTA 4EJRA 3LWCA 5KXEA 4CEYA 5CYVA 4UFLA 2NNYA 1NK2P 2VH9A 2QGUA 2CQ7A 1SEFA 4JBAA 1QGLA 1JN2P 3ZSKA 5EG0A 4XLPF 4XZPA 1WLDA 1S0DA 1RHI1 1WQ2A 4PGHA 1G7YA 1EV13 2PHUA 1IXRC 1CGPA 5ILUA 2JG8C 3WT3A 4CCNA 2R071 4QPWA 4XF9A 3D8CA 2Q4SA 2ZMEC 2VMHA 2L02A 4WVWA 5M5WJ 2XB6C 4B8EA 1Z3XA 2P5BA 2VC1A 4HG6B 1UY2A 2K40A 2P2KA 1F4AA 1SZBA 3VBRB 5FPXA 3OY8A 4RAFA 1X9PA 2VJXA 3AVRA 4A7KA 1ZBE2 3WR0A 2O1QA 1Y56A 4IERA 3VBOA 3GZ6A 3ASNH 1WI9A 1DPUA 2EALA 3G6EI 4GD4A 4M6VA 3F23A 2GC0A 1OD5A 3WOGA 1YS6A 2X1CA 4XIDA 1ZLKA 1R1UA 4WXHA 2VZVA 2OUMA 5T50A 1V9U3 3N9OA 4KBZA 4Y5SA 2ZGSA 1Y7BA 1YI2I 1ZG5A 2YX7A 2J1TA 2X09A 1WGXA 2DK5A 2E53A 1YHFA 3MGUA 5LRSA 4JGYB 4A93J 3KV5A 3ETPA 1V5EA 3ZMNA 4CUGA 1WGPA 2R32A 1OPMA 3U37A 1QKQA 4UF0B 2ZHMA 1QJU3 3SITA 4MEXF 3WTYC 2WRAA 5T5LA 5FK8A 1KONA 3VZOA 4HX4A 4YPJA 1RNLA 1UF2C 3F6VA 1AR61 3FJSA 1R23A 2BP6A 5D5UB 2XROA 3ZR6A 2HEYF 2BOJA 2GBYA 4KA4A 2XJQA 3C1DA 1AR91 2L0KA 2MGQA 1AZDA 4KG8A 2VPRA 1QJX1 4QX0A 4W8JA 2FJ1A 1PGSA 3NNGA 2YBSA 4FI9A 2FD8A 1NTCA 4TWTA 1XSDA 1W7PA 4DNCA 3MF6A 2ZX3A 1SCSA 3SXYA 1SDDB 1GQGA 3WQ1A 1LCLA 1ZA4A 3M3QA 3GDBA 4CRQA 1BM9A 2D1HA 1HKSA 2BQPA 3ZXKA 4CZCA 4AAPA