3H3ZA

Crystal structure of a putative cyclic nucleotide binding protein (spoa0323) from ruegeria pomeroyi dss-3 at 2.35 a resolution
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
226
structure length
226
Chain Sequence
MAHEAQKAIARNSLLIRSLPEQHVDALLSQAVWRSYDRGETLFLQEEKAQAIHVVIDGWVKLFRMTPTGSEAVVSVFTRGESFGEAVALRNTPYPVSAEAVTPCEVMHIPSPVFVSLMRRDPEICISILATTFGHLHSLVAQLEQLKAQTGAQRVAEFLLELCDCDTGACEVTLPYDKMLIAGRLGMKPESLSRAFSRLKAAGVTVKRNHAEIEDIALLRDYAESD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of PUTATIVE CAMP-BINDING REGULATORY PROTEIN (YP_165150.1) from SILICIBACTER POMEROYI DSS-3 at 2.35 A resolution
rcsb
source organism Ruegeria pomeroyi dss-3
molecule tags Cnmp-binding protein
molecule keywords Cyclic nucleotide-binding protein
total genus 63
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3h3zA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3h3zA01
1CAXB 3H92A 1CX4A 4OOIA 4GCVA 2RVCA 4Q48A 4FX4A 3SFZA 3PLQA 3TQNA 2KIMA 4U88A 4AWXB 1DDNA 2DFIA 4XF4A 1TQPA 1YIOA 3WU1B 3MPBA 4AQ6A 4HA8A 5EEGA 4WCGA 3IKVA 3DV8A 2HYFA 4HQMA 2TDXA 5DD8A 1YG2A 4HLYA 5TRDA 5KK1A 3BPVA 1WKMA 1O57A 4HX8A 1MJBA 2IC1A 4L9NA 2QVOA 3IDBB 2V1XA 4FHTA 4YFNF 1B6AA 2ETHA 3CL1A 3WTVC 2HWVA 4HN1A 3HTUA 4Q0PA 5FLXK 1Z6RA 3KP6A 1EPZA 1OMIA 3P7NA 2VECA 5LBQA 1F1ZA 3CUQC 5D4SA 1Z05A 5E8IA 2DPUA 1O3SA 1MDMB 4WVZA 1KU2A 3T1BA 3IWZA 1WQ2A 4AD9A 1Z9CA 4OLLA 2ZJ2A 3GYDA 2J5OA 3DP7A 4I98B 3IL2A 4UVBA 2CSOA 1L3JA 4OIPF 1D5VA 2OYZA 1IN6A 3B02A 2NRAC 4MGYE 1Y9QA 2FA5A 1LB2A 4MGKE 3K1PA 5E1XA 1NHAA 3EYYA 5FB2A 1QGPA 2FQPA 1CGPA 2F5FA 2EV5A 3M3IA 1J59A 3GEZA 1SFUA 1KA8A 4KICA 4YFXF 3BJAA 3EQLF 4RB0A 1ULYA 2HOEA 3U0ZA 2DLLA 4E2GA 4AXOA 2Q0AA 2GXBA 2I45A 3C1DA 4P9UA 3OGJA 3ZMSA 4L0YB 5BOXA 1G3YA 1LKNA 2EFOA 3HSFA 3K2ZA 5ILSA 2EK5A 3V8LA 3DF8A 3ZDSA 1IW7F 2K86A 1FSEA 2XRNA 4IEVA 1K6OA 3D0JA 1BI2A 4PCQA 5I8YA 5BMZA 3V7RA 1YWKA 1ZZ8A 3RYKA 2LF7A 4EGYA 1HKQA 3GWZA 2VODA 3MZYA 3JTGA 5DDGA 4MGRA 1OI6A 2HGCA 3T5XA 4GGGA 3HTSB 1LDKB 2ADUA 4ZYDA 2HTJA 2VT2A 1GQHA 3HUGA 3O2PE 3LAGA 4GYIA 5A2QK 3SHFA 4RB1A 5JSRA 3QU6A 5AONA 1UCXA 4GO1A 5DUKA 1MJAA 5FLJA 3E6BA 2XL7A 5C6CA 4HN0A 2M30A 3QRFF 1EP0A 3FZ3A 4L9JA 1L0OC 2EFWA 1XMKA 5DYMA 5CVIA 3RYPA 1J75A 4M72A 4LK0F 4ENMA 4M71A 2PHLA 2YPRA 2WWYA 1A04A 1QXRA 4EM1A 2IXCA 1WRJA 2ZNZA 1SFXA 3GF2A 1P4AA 3T8TA 4HLTA 4YG2F 5FLXZ 1ONVA 2HQNA 2OAZA 2L01A 2PAEA 1J0RA 2Y75A 1T0FA 3VOEA 3RZZA 2DW4A 5CVRA 2AXLA 2QQ9A 4L11A 1JE8A 3ABUA 5LRRA 2PMUA 1ZN2A 2F5EA 1Y0UA 1VR3A 1ZYRF 2FNPA 2Z2SB 5FD6A 4U7DA 3FXRA 5IT9K 4JTNA 1T98A 3HHHA 2FE3A 4XFBA 1LEAA 4PIYA 2DCTA 1IN5A 2EA7A 3RJPA 1P92A 1HSTA 1FSHA 2P5VA 4P9FA 4BQAA 3IIAA 3RNSA 2JZYA 4B8XA 4I01A 4K8FA 1NYWA 4MV2A 2PTMA 3HIFA 1VJ2A 4I3PA 3ULQB 4A5NA 4Q0QA 1XRUA 2CGPA 4M9ZA 4MEYF 3W6JB 3ZN0A 1EV7A 2FBIA 3REOA 5KHGA 1BC7C 3M70A 1S29A 2M5WA 3HQXA 2LKPA 1PM7A 4LGWA 4DQ2A 4KN7X 3GYHX 2OZUA 1UIJA 4Z2YA 5I93A 3GFLA 3GFMA 3F23A 4HYEA 1CAWB 1YHFA 4PDKA 1D3YA 1LNWA 2VE9A 3JSPA 2KIUA 4IHTA 5BPDA 5BXXA 4QWQA 4ESFA 5IT9Z 4M6YA 1ZGJA 4UNOA 2C6YA 4S05A 4RGUA 2UWMA 3OCPA 2K4BA 4ZH4F 1QXJA 4ENNA 5HDKA 2PQ8A 4Q29A 2HTSA 1FNNA 2STWA 3FHZA 5K5QA 4CDGA 2NNNA 3G3ZA 4JVAA 1QZYA 3LWCA 4LJZF 5E1ZB 2O03A 4WF2A 3GZ5A 2B8MA 3EETA 4Q0UA 3J81Z 3BP8A 3GZ6A 4CXFA 1MD0A 4LA3A 2OD5A 1UFMA 3WTZA 4HVRA 1ZREA 4XEZA 1U5TB 2P7VB 2Y0MA 4N0BA 3IDCB 3PQKA 4EJOA 1YFWA 4DINB 2QBYA 2Y48A 4ENJA 4J1WA 1IXCA 1SQ4A 2HJIA 3Q9VA 1B9MA 3V8JA 2VQAA 2M1BA 1XD7A 3VB2A 4QM8A 2DU9A 3QPHA 1OR7A 3DKWA 2KXLA 1QQIA 3ES1A 5E8GA 2GA1A 1RL3A 1ZG3A 5ICCA 2YR2A 4UHTA 2K27A 4HMZA 4AVPA 2NAZA 1KU7A 4KN4X 2VPVA 1TQMA 2V1UA 3VHRA 4LLNA 5J3UA 3ZN1A 2OBPA 3RTRA 3WTSC 5I8TA 1KU9A 3H3ZA 2D93A 5E16A 2ESNA 1MZBA 2Z99A 4XSXF 5I0UA 5BPIA 1UW8A 3NKTA 3DQVC 3KGLA 2CO5A 5L3GA 1R23A 2DK5A 2GQQA 1TTYA 3WGHA 1E17A 3CLPA 2HEOA 2MA3A 2RC4A 1EY2A 4E2SA 3NW4A 4AIHA 5HOOA 5BQTA 3BDDA 2MH9A 3Q9SA 1WI9A 1XE8A 2KRFA 3O14A 2QVSB 1UPIA 2HYGD 3KP3A 3WTUC 3E5QA 3F8MA 3U10A 1FOKA 1GHCA 4YYOA 1F5TA 1XDUA 2L4MA 2MPFA 4RAZA 5FLHA 1YS7A 2YX7A 4RB3C 4MQVA 3TO6A 4TV7A 5KBFA 2EJRA 3IKTA 1IXSB 2F5CA 5DUIA 4G7OF 1ZH5A 1HW1A 2ACJA 5ICFA 2DQRA 4OIOF 5FLIA 4E2QA 2E1CA 3R6SA 3K9TA 4A6EA 5HI0A 3JTHA 2DPDA 1LR5A 1O3QA 3LFKA 2FMLA 4KDPA 4EWEA 2CAVA 2PG4A 3GFJA 3BCWA 4DNCA 4WBBA 1ZRRA 3O3KA 1S3JA 5JHUA 3CUOA 3EJKA 4ZU4A 1BJAA 3UKVA 3ERED 2L3DA 3K69A 1OFNA 4IETA 3DFGA 1YFXA 3I58A 4HQEA 1R58A 1J3PA 5DCMB 5JAXA 4HVOA 3I71A 1J5YA 2COMA 2H6BA 5TJJA 2Z33A 1KYZA 1D8JA 2C0ZA 2XLFA 5D5VB 1XSXA 1G4DA 2QNKA 2HKXA 3MQ0A 5FD5A 2P6SA 2XL9A 3WW4A 3IHUA 2YSRA 2QWWA 1RUNA 4XFIA 2A07F 4H0EA 1IPJA 1YFUA 1WLTA 1UB9A 3J80Z 4HF2A 1OYWA 5A2QZ 4HSJA 1BI0A 4ZZLA 2D40A 3EUHA 2QJVA 4UBHA 2QQAA 3TKYA 3I64A 5HS7A 3TOBA 2Z9OA 3ROUA 2GC1A 3FM5A 1Q1HA 5LHHA 2EB7A 2PI0A 3H7YA 4P55A 1T2KA 3VODA 3MZHA 3CUQB 5D6EA 3JZVA 4O9GA 1JXSA 4CO8A 1FP1D 2XAQA 1ZZ9A 1J9IA 5LGTA 2ZXJA 4G94A 4IESA 2Q1ZB 3IBMA 4XF0A 5JI6A 5J8CA 3KE2A 3FFQA 3K1NA 3M7GA 3HSRA 4PIZA 5DCMA 1OYYA 1UHMA 2GU9A 5L3BA 4AVBA 2FBKA 2Q0OA 2D1HA 4LMYA 1ZGAA 4MQ9F 4YIIA 4KWKA 4XFHA 5CJ9A 1FP2A 3V7SA 1QY4A 1J3QA 5DV5A 1ZZBA 5LEJA 4FBFA 4Q5SF 5BS6A 4YNIA 4XF3A 2UY9A 4ZYHA 4D7TA 4G9YA 2IXLA 4KIGA 4EM2A 4LK1F 3HRSA 1GQGA 5L3CA 4YARA 1H9TA 1O3TA 1DZTA 3HRTA 1O3RA 1TW3A 2P6TA 2A5YB 2QUFA 4HDVA 1U78A 1QWRA 4KIBA 2Q2EA 2EA2A 3SQNA 4O9EA 5I0RA 4IRHA 1O7FA 4Q0SA 1KYWA 4IEOA 1YO5C 3P9KA 2BGCA 1BIBA 2IT0A 1T6SA 2VBYA 4ON0A 2HQRA 3LAPA 5D4RA 2MD5A 5E1RA 3OTFA 2GXGA 5I8SA 1LDJA 1R1TA 1NE6A 4IEZA 4LG0B 3E3VA 1XGSA 3OV8A 4XRFA 1I27A 3P9IA 5D5XB 2DQLA 3TO7A 1ON2A 5AIPA 1UIKA 1YW8A 4EROA 2VOOA 3KSCA 4L9VA 3M8FA 3E6DA 2VONA 2XAGA 3Q5FA 2VE8A 5FGMA 1FY7A 4CZZA 4P96A 2P7CB 4CYDA 4I0AA 3BPXA 1STZA 1YS6A 1B9NA 4HV5A 4KT5C 1PP8F 2FU4A 4Z82A 5I0SA 2UXXA 1OPCA 2XUBA 3ACLA 5FFZA 3ZMVA 4EWAA 2UXNA 5J7MA 5LHIA 5E1WA 1RC6A 3ECOA 5LHGA 1SD6A 1SD4A 3PVBB 3EYIA 4JV4A 5KHHA 4LB6B 3WTTC 2P4WA 2BEOA 2MLGA 2PEXA 4AIJA 3UKTA 4IVNA 4LULA 3CO7C 2G7HA 3LSTA 3ZMTA 5KVRA 2ZMEA 3NVCA 2F2EA 1FPQA 1QPMA 3CEWA 5DD4A 2FBHA 2FRHA 3TGNA 3FMSA 1LJ9A 3KLNA 4N9HA 4IERA 1O7LA 4HAMA 1IRGA 4EGZA 2QDRA 3N97A 1G3WA 4HZFA 1S7OA 1HSJA 2VOPA 2R3SA 5LGNA 3F22A 3ETQA 3C18A 2IPQX 4B09A 1JHHA 1K78B 2BNOA 1IRFA 3MCZA 3F8FA 1RNLA 1W4MA 2A6HF 1USTA 4KIFA 2ISZA 4Z07A 4EQQA 4MZUA 3F3XA 4I2OA 3FJSA 4ZU5A 1XSVA 2XROA 4IHSA 1U12A 1Z91A 1NE4A 4M73A 2XAJA 2XIGA 4YSFA 4BHPA 1J3RA 2EVXA 1H1MA 2MC3A 2VN2A 1H1IA 4IJAA 4JQFA 3FMQA 5EEHA 1YUDA 4F7ZA 3K0LA 1O4TA 3U11A 3QP5A 4A6DA 5CADA 4AVCA 2OA4A 3MFKA 4QGLA 1SFEA 2BNMA 4EJUA 4MUVA 1FYKA 3SHRA 2VBXA 1F4KA 2K9ZA 1CAXA 1W7PD 3WGGA 4KA4A 4R52A 3R61A 3LAJA 2W24A 2BYVE 2O0YA 2QLZA 5ED4A 1JGSA 4Q4ZF 3F6OA 1DGRA 2XLAA 3EBRA 2G7UA 4HX4A 1IUYA 3EHKA 3PFIA 1DZRA 3V7CA 3BWGA 3F8BA 3KZYA 1XDSA 1R36A 3HSEA 1V4RA 4UV9A 3GO5A 5ILVA 1P6RA 2V1DA 1BOAA 2FXAA 1FI2A 3WU0A 1LEBA 4EJWA 1QO0D 1QBJA 2P5KA 4X6RB 4RGSA 3W6KB 2W25A 4WXHA 1XGMA 5D8KB 1NZCA 3NQOA 5J8FA 2K02A 5CVJA 4LLGF 3RPQA 2PYTA 4LB5A 3WW2A 3AAFA 2IA0A 3ZMDA 2CYYA 4HBNA 3CF6E 3KETA 4D0PA 3GFIA 4A12A 5AVPA 5FDBA 1S8NA 4OMYA 4LLLA 4ENKA 3DPLC 1PDNC 4WZCA 1YFHA 2VBWA 3U2RA 1XMAA 2BE5F 1YTYA 4IEYA 3F8CA 4IEPA 5HDNA 2CQKA 5K5RA 1SMYF 2MNGA 2GC2A 3IWFA 1VP6A 5K5OA 4O5VA 1FYMA 1K78A 4UBGA 4IEXA 1LRHA 2IXJA 1NXMA 3FM3A 2A3SA 2ELHA 1X8EA 3WE2A 1KGSA 4MX3A 3SCFA 2FEZA 3OF1A 4BXUA 4CICA 1U3EM 3BB6A 1HBXG 4P9GA 2A68F 1PMIA 4ZU7A 3V8KA 1IPKA 3TDUC 5KHJA 5ERIA 2ZKLA 4L18B 5J48A 2EV0A 3IRQA 2R7FA 5L3EA 3HOTA 3E5UA 3GX4X 1BM9A 1TW2A 4HW0A 1J2XA 3SXWA 2LDUA 3E5XA 1QNTA 1TBXA 1MGTA 4UVCA 4EMSA 3KP7A 5D6FA 1YQAA 3JAMZ 4I0BA 2IRFG 3JAMK 1IAWA 3LQRA 2XHKA 2M8EA 5AIQA 1XSDA 2BNNA 3WODF 3D0SA 3HHGA 1I1SA 4OU0A 3RI4A 4WXDA 3KMHA 4QX5A 4NHJA 3MYXA 1WA4A 3ELKA 2ATFA 1DP7P 1BBYA 2W85A 3RYRA 2Z5UA 5LLQA 5HDGA 1U5TA 5HLIA 1EYBA 1SFNA 5DCFA 1SD5A 2OZJA 1OYIA 2VC1A 1ZG5A 3U9GA 4KFCA 4ESBA 5KHIA 1FLIA 2V6CA 1ZRDA 1RZ4A 3HOSA 3D82A 4QM9A 1LQ1A 3S7EA 2DK8A 2XKPA 1O5UA 2WTEA 2BV6A 1E2XA 5J6XA 3FZVA 4KNYA 3FWEA 2QQBA 3DEUA 1QZZA 3KZZA 2DBBA 3WGIA 4XFAA 1ZHFA 1YFYA 1TNSA 4HX7A 4QLCU 1RUOA 4BNCA 1ZARA 4G6QA 3BY6A 1I5ZA 4WWCA 1JHFA 1ZG1A 1S6LA 2V79A 3QOPA 2FQ3A 2WC2A 2E7WA 3SMHA 1AWCA 2G9WA 1B59A 2IP2A 3BJ6A 2IA2A 2ESHA 2GA2A 2KJCA 3KCCA 5F64A 3T0YA 5D5UB 2N7GA 1EH6A 4PJYA 1XGOA 1IZ1A 3N4MA 2D5FA 4N9IA 3WTYC 5HS9A 4IEUA 1YLFA 2KJBA 4FT8A 1EH7A 1BI1A 1Q5OA 1F9NA 3HYIA 2OZ6A 3BPZA 2AS5F 3NEUA 4IRGA 5HLGA 3L9FA 4XLNF 1FT9A 4XETA 1J7KA 2RV8A 2YX4A 1WWXA 3UKNA 2IXIA 5JCTA 4BHCA 5CYVA 3DPTA 3C7JA 5JVTA 2JPBA 4A5MA 4WXCA 1BI3A 1UD1A 4BAYA 4G7HF 2B5HA 2E9QA 1TNTA 3LQQA 5CVVA 4MH0E 2OQRA 4JK1X 1DPUA 2QYOA 3SXYA 1ZLJA 4GXOA 1KU3A 4EJTA 3LWFA 4G6DA 5D1IA 2LSOA 1C0WA 3RKXA 4EVIA 4IXAA 4U0WA 3BROA 1G3SA 3B73A 4EM0B 5HLHA 5KHKA 2CFXA 3BZ6A 2HR3A 5F6FA 2DI3A 2MHFA 3CDHA 2NS0A 3GVAA 3QU3A 5E17F 3OOPA 1DPRA 2IW5A 1B1BA 5H20A 2VC0A 2DAOA 1DGWA 4XFFA 4U0YA 1P4XA 2ETEA 4QGNA 2DO7A 4R1HA 3F8NA 3NSTA 5IT3A 4L9TA 3I4PA 4JTOA 2M87A 1KQ0A 5BY5A 2BBYA 1B4AA 4O6JA 1X7NA 1ZAOA 3FF5A 1ZZ7A 3GLXA 4RGRA 1HW2A 2X0LA 3DN7A 4F8AA 2GAUA 3BOQA 1U8RA 4H7LA 3LA2A 3SCHA 1ZZCA 3GXOA 2JTVA 5K1YA 4BH9A 3SCGA 5ICGA 1XGNA 2PN6A 3I53A 3FXQA 1IN8A 1TQIA 3ELNA 2EAAA 3VEPA 1P2FA 5BPXA 1XB4A 2H6CA 2V9VA 3J81K 2P17A 2ZCWA 4META 4UVAA 4QXKA 3IC7A 1J58A 3ZPLA 2NNYA 4HSLA 2ZFWA 3ECHA 2OU2A 1TLHB 3C3VA 4LLOA 4XFCA 2O8XA 2CWEA 2D5HA 5H6QA 1K7AA 1XCVA 1K79A 4AQ2A 1GXQA 1FC3A 1X3UA 1WGPA 5I0TA 4A0XA 2B9UA 3GW2A 2ZMEB 1UHWA 3KP4A 3SZTA 3L7WA 1SAXA 3TO9A 4I02A 2XLGA 4IEQA 3FX3A 3BJOA 3I0TA 2FMYA 2ZKZA 4EWDA 2XKOA 1D8KA 1FBQA 1FBSA 2UZKA 2HDCA 5FQ0B 2RKHA 1OD5A 2CG4A 2F5DA 3CO2A 2STTA 3MAJA 5L3DA 2IJLA 1ZVFA 1H0MA 3RIRA 2RNJA 3WW1A 3PQJA 1G6NA 3H1MA 2FOKA 2ZO4A 1Y3TA 4BHBA 2UYAA 4HDUA 2ZNYA 3H1YA 4OMZA 2JT1A 1RGSA 2PJPA 3S2WA 4HF0A 4UXAA 2FSWA 2E1NA 4ASNA 3KFWX 4IPAA 1FZPB 2CAUA 3H8UA 2EFPA 1I6XA 3ZMZA 2JPCA 4NVPA 3LZZA 1DUXC 2PBIA 4M9XA 2W57A 4L5IA 2PQQA 4R8HA 5FPXA 5DEQA 2HS5A 2MLKA 2EV6A 4XF9A 3WW3A 1ZZ6A 3D5LA 5EFUA 2OA2A 5FFXA 3E6CC 1U6GA 4RGXA 3G7DA 2IXHA 4LA2A 3G73A 3CTAA 1YW7A 4EJVA 2XASA 4LFUA 4R79A 3HT1A 1S7AA 2ZBKA 2KIFA 1CAUA 1Q3EA 2PAKA 3QACA 4TLFA 1ZX5A 2O8QA 2Q8KA 3F21A 3IRRA 4XSZF 1FWZA 5T3NA 4EV0A 3FXUA 4ZYGA 5FO5A 3ZP5A 3FHIB 1FYLA 6PAXA 4IEWA 2WFPA 3KP5A 4LUMA 2L02A 3RKYA 1ODDA 4XF1A 5EZWA 4MEXF 4IRIA 3HRMA 3WG9A 3HT2A 3SZPA 1U5TC 3O6BB 1HXDA 1BIAA 4KU8A 3NRVA 4BIFA 4JBAA 2GWRA 2Y0OA 1RTVA 4LD5A 3TDZC 1GXPA 1O5LA 1Z1DA 2GH2A 3JSOA 1XE7A 4NQWA 4PIXA 5E18F 3H50A 1R7JA 5LGUA 2VT3A 3QAHA 1CF7A 2LNBA 4L0ZB 1FX7A 3I59A 3NL1A 4MHGA 2QM3A 4E70A 4KWJA 3TOAA 5LRSA 4OINF 4P5OA 4HLXA 2IVMA 1R1UA 2DTRA 2MH2A 4YIFA 1RIOH 1MJ9A 2A61A 2Z3YA 3TNQA 3V4GA 3NJZA 4PGHA 4RB2C 1SMTA 3I5UA 4HBLA 2RQPA 2O3FA 4I7HA 4CHUA 2M45A 2XVCA 4UV8A 4M6XA 2PMHA 1X8MA 2XV4S 1W7PB 1LVAA 2H94A 5L3FA 1HKSA 1RI7A 5ICEA 4QGMA 4D7SA 3E6MA 1YYVA 2R7DA 4J1XA 4UXNA 1KQ8A 1V3FA 5H6RA 2PA7A 2HZTA 3J7AO 1KQ9A 4LUKA 5HS8A 2FNAA 4ZYEA 2Q30A 2O61A 2PHDA 4S04A 3R60A 3CUQA 4WX9A 4AIKA 1CAVA 4IF4A 4ONUA 3QP6A 1ZRCA 3WE3A 3ZQ7A 2PFBA 2O6GE 1FBUA 3FMRA 4MGIE 4HF1A 4RD7A 4MTDA 4L5JA 2XAFA 1ZNPA 3WTWC 4U0VA 3PNAA 2Q4SA 2EFNA 1CF7B 5D5WB 5FQ0A 1V70A 2PLYA 4G8XA 2KKOA 3LA7A 3USSA 2V09A 4AVAA 2EA4A 1R5GA 4HV6A 4A0YA 4UUVA 5F1RA 4ESJA 4GYGA 2PAMA 2QBYB 3R0JA 2X4HA 2XGXA 4PGGA 3ES4A 4G7ZF 3I54A 5CVUA 5D8LB 1VTNC 3T8RA 2J5PA 3RPUA 2WV0A 2ISYA 3F6VA 4Q0VA 3F72A 5JR3A 2EFQA 4Q47A 3OD0A 3HRUA 1SEFA 4FX0A 3U1DA 2D45A 2NYXA 5K8SA 1CAVB 2XAHA 4I09A 1UCRA 2RDPA 5JSPA 4RAYA 1Z6TA 1ZRFA 1R1VA 4O3MA 3ST7A 2K0GA 4L2NA 2H27A 4KL1A 3BALA 3L09A 1L3LA 1FXZA 1R22A 3L2CA 4HOBA 2JSCA 3COAC 3DXJF 1W5SA 3L00A 1W7PA 2HKOA 3M8EA 1CAUB 2B0LA 4KWLA 1MKMA 3M1EA 1ON1A 2PFWA 4KMUX 2VBZA 2FF4A 1I1GA 2CV6A 3DL3A 5I91A 5BV6A 4HVQA 5LEKA 1H9GA 4Y13A 2D2WA 4A0ZA 3JW4A 2IA1A 3J80K 4U7BA 3KEOA 4M9SA 1J1LA 4MTEA 4LEJA 3ABTA 3KEQA 3EO6A 2ET1A 3MDPA 5JSOA 5JR7B 4A2UA 3FE5A 5FCCA 1CAWA 3ML6A 2OPKA 3LOIA 3I59B 4X6QB 1XCBA 4MNUA 3H7JA 5JFRA 2VXZA 3MWMA 4FAGA 5C8WA 1U2WA 2UY8A 2H09A 1PP7U 2UYBA 4B29A 4WK8F 4Y17A 1YLLA 1IN4A 2GIVA 3R0AA 1R5HA 1P4WA 3KLOA 3BU7A 3K1MA 1USSA 1T38A 3KP2A 3S7IA 1Q43A 1HKTA 3M9AA 4OIRF 4OIQF 4KUMA 1Z7UA 2A6EF 2E7XA 4OFGA 1EH8A 4YFKF 4KU7A 2H0VA 4LG0A 2Z69A 4KYWA 2A69F 3C3WA 4K2EA 1BN5A 3QPTA 3TNPB 1R00A 1OKRA 1YW9A 2GC3A 4FAHA 4XBFA 2IXKA 2O1QA 2HFHA 2D1VA 1HW5A 3KGZA 4YRDA 3E97A 2K4JA 5ILUA 3CO6C 2JRTA 3GUDA 1AOYA 2DT5A 2RN7A 2ET7A 4XFGA 3ZMUA 1G3TA 2QZ8A 2GZWA 2RGVA 1W5TA 4KMFA 5FPZA 1XN7A 3CJXA 1JUHA 2MBFA 3EQEA 4M74A 3H1WA 3I7DA 3H3UA 3L2HA 3ISPA 2P5LC 4NB5A 4CGZA 3MEXA 3WTXC 1LDDA 4ORFA 1IXRC 2CW0F 4PZJA 4LTAA 3S0MA 1WSUA 2W84A 4ZZDA 1GVJA 5CLSA 1T39A 3RDIA 1IF1A 3CLOA 4Y15A 3LA3A 3R4KA 2L4AA 4ETSA 1MDMA 1REPC 2LF8A 3VFZA 1TQ5A 1SD7A 3RKWA 2P8TA 4QMAA 4BYYA 3GBFA 1IN7A 1ZLKA 5BUVA 2QENA 5E20A 1PUEE 3H9AA 2YU3A 2EWNA 2QCSB 5HVQC 2F4PA 4XLPF 1HQCA 4RS8A 2L54A 4MGZE 3CJNA 4GULA 1BC8C 3EDPA 3P9CA 2K7LA 2OQGA 1X82A 5CU1A 2GC0A
chains in the Genus database with same CATH superfamily
3H92A 1CX4A 2FCVA 5HLTA 5FWJA 5JDBA 1LTEA 3FXKA 4GCVA 4FTHA 3VBOA 3SFZA 3WDYA 3GJAA 4CXWA 4U88A 4AWXB 1LUJB 2DFIA 4DEQA 4XF4A 2WT0A 1FOXA 4OHYA 1WW4A 1HXS1 1J09A 4XRSA 2VH9A 3O1SA 2M0MA 1G9FA 2XB6C 2E2HJ 3ZQLA 2A73B 4WCGA 1Y6IA 4RBOA 4HQMA 5LBFA 5DD8A 4SLIA 1W9SA 1D1CA 1UYZA 1NCRB 2EXIA 3IDBB 2V1XA 1MMDA 4FHTA 2CQXA 5FY1A 4YFNF 3WCSA 2R5ZA 5HV4A 3MD2A 2HWVA 2WAQA 4Q0PA 5FLXK 1JHNA 4DRRA 2W94A 2KDOA 1OMIA 2WS92 2Z16A 2DYCA 2RAEA 5GZCA 4IQJA 3LFUA 5FMOS 1NK3P 3MZ8A 5LBQA 5FZ8A 1BW6A 1OKQA 1RUF2 1QQP2 5A3LA 2OVUA 2RDSA 1X58A 3E1SA 5TISC 3GTKJ 4BPZA 5L7OA 3K7AJ 2ZJ2A 3GYDA 1KFUL 4IKFA 2XSJC 2E60A 3DP7A 3IL2A 2CSOA 2MG4A 1D5VA 2OYZA 1MS4A 4MXVA 3QPSA 3B02A 3OEBA 4MGYE 4KJZA 2ZJPF 4MGKE 1DZQA 1UX7A 3JB8A 5FB2A 1QGPA 1ULEA 2FQPA 3BTLA 4K9SA 5A3PA 2F5FA 4JRAA 1LU2A 1CJPA 1J59A 1KA8A 4HPQA 1MNDA 4KICA 1WMEA 3JD72 1JT6A 4AGVA 1WW7A 4P9WA 1VB4A 4O65A 4AXOA 2I45A 1UU5A 3NNJA 4LBJA 2L9VA 1RJ8A 3ZDSA 3WR0A 1IW7F 1IG7A 2YROA 2FDIA 1K6OA 3JQWA 2DFEA 2E71A 2DA2A 1TEIA 4S2HA 2R5YB 3LB9A 5JOWA 3V7RA 1H8VA 3W5MA 3RYKA 2WADA 4NHMA 3AZWA 3GWZA 4UW4A 3W2AA 2VODA 3MZYA 5DDGA 4JDMA 5EJ3A 3S32A 1AJOA 4PI2A 1QXPA 5CG8A 2B9SA 2ADUA 2NOJB 1SAUA 4A3EJ 2AACA 3KLSA 2AQFA 3HUGA 4GYIA 2W0XA 3ZYGA 4EN7B 3PFYA 5JSRA 3AYCA 1W99A 2WLQA 1MJAA 5FLJA 2XL7A 3QRFF 3O0XA 3FZ3A 3SH5A 1FMD2 2EFWA 1SEUA 5EWSA 2W1OA 3BOPA 2G4IA 2COBA 4M72A 5GLUA 3GNEA 3L2WA 1V5FA 2PHLA 4R9BA 1QXRA 3FXLA 1WRJA 5KWRA 4CXYA 1SFXA 1W6PA 5KXBA 1BKZA 4HLTA 4YG2F 1RUG3 2HQNA 5GPCA 4C1XA 5EXOA 2L7MP 1J0RA 1T0FA 1XNTA 5FO7B 3WXPA 3N7MA 2QQ9A 4L11A 3KCYA 4C0HA 2JUGA 2PMUA 4CCKA 2BERA 5A7WA 3I2JA 1ZYRF 2Z2SB 4OI2A 3VZOA 5A3TA 3H8XA 3TYJA 3VZNA 2NOGA 4U7DA 3FXRA 4N4OB 1AR93 1S0CA 1RUE2 1W05A 2BUKA 3G6EI 3N7KA 4XFBA 2F4IA 3URFA 4PIYA 4TXWA 2EA7A 3RJPA 4MADA 3IIAA 1FJLA 2ZJQF 4B8XA 4MV2A 5A3NA 1OXCA 1X2NA 2GSYA 1R1A3 5HV0A 1VJ2A 4XMAA 4I3PA 5T50A 3MV01 3M4OJ 4A44A 3VBSB 1ZK8A 2CGPA 4BQ5A 3W6JB 4GIQA 1X3ZB 3MIFA 3OL3A 3A0HC 1EV7A 4D7MA 3WG3A 4C1WA 3REOA 5KHGA 4PCRA 1FAYA 1S29A 3POIA 5A32B 2M5WA 2WYSA 3V64A 4V2WA 1Q8SA 1XQNA 4KN7X 4IV1A 3MUZ1 4Z2YA 2KRHA 1TMF2 3GFMA 3LEMA 4RLQA 1CAWB 4PDKA 1D3YA 1VLNA 5F0HA 3JSPA 1COV1 4D7YA 3B9CA 1RMU3 4HRIA 2P3JA 3KV6A 2KL4A 5BPDA 3I56I 4ESFA 2R041 4M6YA 4BMEA 5F37A 1K5MA 4Y1XA 4WM8C 1WCSA 2UWMA 3JRDA 1UZYA 1DYOA 5JVGF 2HTSA 2M4KA 2E1MC 4CDGA 2QQJA 2HWC2 3PIJA 1VRBA 1UOBA 3B9IA 3S3OA 3CJTB 2M4GA 1QZYA 3LWCA 1OISA 4QPYA 2JJ7A 2ZXIA 3GZ5A 2ARXA 4LE3A 3EETA 3NV3A 4YVSB 1MS9A 1UNBA 1QNYA 3K75B 4FXKB 4CXFA 1PVEA 4YZ5A 2XUMA 1ND3C 2OD5A 3H5AA 4HVRA 2XJSA 3PIGA 5FY9A 2Y0MA 3ZYJB 1TME1 2L2OA 1YFWA 3SH3A 3ALQA 3ZIWA 4FPKA 3RFRA 3MI8A 2X6YA 1N3OA 4LBQD 3T4HB 2IFRA 3ZYBA 5FP8A 3HOWJ 4A3ZA 1SQ4A 5F3CA 3V8JA 4MGSA 2VQAA 4XN3A 4QM8A 4XXAA 5HCBA 3ZPOA 2KXLA 1OURA 3KT4A 1BBT1 1Q8QA 1VBE2 4QKFA 1ZG3A 3UESA 4XN0A 5H2FC 1JHJA 4A6OA 1LJ7A 2D6MA 1O6UA 2IEKA 1KU7A 2E7TA 4ARYA 1TQMA 3I2OA 2V1UA 2ZX3A 2RM22 5J3UA 4L0PA 1H8AC 3H3ZA 2ESNA 4QPGC 4G9SB 4D69A 5FK7A 2JN6A 4LIVA 3NKTA 2ZB9A 3L2UA 2F17A 2JIJA 1EPWA 2M7BA 3QH6A 2VQTA 4C9YA 1BCXA 2MA3A 1D2QA 4FXGB 2E19A 4P5YA 5L7OC 1ASJ1 3AP4A 1TWAJ 4TWTA 1V6NA 3IUOA 4F52A 3Q9SA 1SLLA 1WI9A 3PUHA 2P5BA 2EXHA 1ST8A 5LA2A 2HYGD 1H30A 2MYSA 3E5QA 3WF4A 3U4XA 4YYOA 1XDUA 4YELA 5FLHA 4RAZA 5GTHC 2IFWA 2YX7A 3OSGA 4BE1A 1R1ZA 1DGLA 4TV7A 2EJRA 1P9QC 3WCRA 4C3HJ 2F5CA 1JYNA 3BLYA 3L2QA 1ZH5A 1HW1A 2W9XA 4BXXJ 5ICFA 3R6SA 5HI0A 3JTHA 1H8TC 1O3QA 1YX5A 3VBFB 4CDUC 4YW2A 2HWD2 1LOFC 2PG4A 4TZDA 4BB3A 1K3IA 4HG2A 1G2HA 1SVMA 1F43A 3EJKA 1BJAA 3AJZA 3N9OA 2ORXA 4AFDA 1OFNA 1R4NB 4IETA 1YFXA 2OX0A 1R58A 2XOMA 1J3PA 4TYSA 1B72A 4YWAA 4K8RB 4MXWA 4BQ3A 1JW6A 2VUCA 5FRNA 4HVOA 3HOBA 3I71A 2WBMA 2H6BA 5TJJA 1D8JA 2UWCA 5D5VB 4WM7B 3MQ0A 5FD5A 2O8KA 2P6SA 3LDKA 1E5IA 4RGGA 4FTSA 3S93A 4OVEA 4QIWN 1V6IA 5CB7A 1HIXA 4H0EA 1YFUA 1VBA2 3SFIA 3VDDB 2X1CA 2TNFA 4V19K 1BI0A 2NYYA 4RS5B 1XJAA 3AL0B 3HPHA 1Z3YA 3TOBA 2Z9OA 5EDNA 3ROUA 4COZA 2EB7A 4P55A 3VODA 4O9GA 1DU6A 4FOYA 2HU9A 4CO8A 1FP1D 2D6PA 2R7ZJ 2RS32 3T08A 4RAGA 1UQXA 3IPVB 1LGCA 2ZSHB 4ZDOA 2J1EA 5IK8A 3M7GA 4OQ8A 4MXWB 2VL8A 4CCCA 5L3BA 4Z1VA 2D1HA 4WM7A 4FASD 2RJKA 4YIIA 2BP6A 3GTMJ 1J3QA 4Y33A 1VBA1 5DAWA 3MFCA 3ZQFA 5BS6A 4YNIA 4MO7A 4PDWA 4ZYHA 5FZGA 4CA0A 1AL0G 2HBTA 3T2PA 4Q26A 3ZFFB 3HRSA 3NNGA 4PJJA 5JLVA 1CIYA 1O3TA 1MQTB 1UY1A 5EIYB 3HRTA 2QUFA 5J4VA 1QWRA 3X29B 4OCTA 4KIBA 4XIKA 3ZR6A 5FKLA 3SDBA 1GZWB 3FDYA 4BDVB 5F5AA 1PZ8A 5EV7A 4Q0SA 1KYWA 1B35A 2WS91 2BPA2 1OPMA 4LO7A 2VBYA 3WZ1A 1YJKA 5D4RA 1HQWA 2RMU3 4IGPA 1W2UA 3OTFA 2Z5WA 4FCAA 3H1CA 4IEZA 3OV8A 1HN1A 2G9ZA 4YFZA 5D5XB 4LR4A 2EIJH 1UIKA 3I2IA 2VOOA 5FY4A 3M8FA 1UY0A 3E6DA 3E0JB 4A69C 2XAGA 2R1DA 3NJXA 4ASKA 3IV5A 5FGMA 3LDRA 1W2TA 3RQ4A 1IPSA 3BPXA 3WHCA 1QJU1 3AMMA 1XU2A 5FO9B 4Q4X3 2J1SA 2FU4A 3O8GA 2WZEA 3IPVA 2FDHA 3FBMA 4KG0A 3MLJA 2JWPA 1X50A 3W5NA 5K0UB 3OEAA 4PT6A 1T6GC 3ECOA 1H2NA 3DEWA 1SD4A 3EYIA 4CPBA 2WUHA 4FPFA 2V72A 4E6KG 4FPOB 5KHHA 4LB6B 3WTTC 4BACA 2FZ1A 2P4WA 2MLGA 3OBAA 1WMDA 5KR7A 3CO7C 5GLWA 5M5YJ 2DOEA 3ZMTA 1XNAA 2XF5A 3CEWA 5JZGC 2XRLA 3Q8CA 2ZXQA 3OYGA 2QDRA 3H9GA 1S7OA 2Y0SA 4D6RA 2R3SA 5LGNA 4OZXA 1UZWA 5F9TA 2DA3A 2BNOA 1GZCA 2A6HF 1YQ5A 3VHOA 1USTA 5FZ1A 4AHWA 4Z07A 4EQQA 1POV0 1US3A 5LA0A 1BVP1 3W59A 2BZDA 5IP6A 2XAJA 2LMDA 4C90A 1FMD1 2ZMLA 2GNDA 4YSFA 4BHPA 2VN2A 2BDRA 3I9V2 4PSXA 2DDBA 3AG4H 1X33A 2OS2A 4ZPIA 3PTRB 4C0BA 4JQFA 5C3PA 4AFBA 2FOWA 2ECCA 5A3MA 1W04A 1A3KA 2DBIA 2CUZA 2OA4A 4W65A 1DQ5A 1SFEA 3L2YA 2JA6J 1FYKA 1FATA 5FXXA 1S0BA 4F83A 4KA4A 3POGA 1R9TJ 4FQZA 3K4DA 1V54H 5DUXA 1AA7A 4NWWA 1U9OA 1IGOA 5FROA 4CUGA 3CMEI 1XDSA 1V4RA 3GO5A 3JRGA 1BOAA 1R71A 1FI2A 4GWMA 2RE9A 4JOMA 4CDUA 4RGSA 2FD5A 1VMJA 1LOFA 3VBRC 2WQ4A 4WXHA 1E0EA 2RS12 5D8KB 2NXNB 1NZCA 3ZN6A 3PU3A 2WB1A 3AAFA 4ZZ5A 2IA0A 2CYYA 4HBNA 2R0HA 5LY2A 5DZFA 3SC7X 1G7YA 2Y33A 5HCHA 5FXVA 1DLLA 4XNFA 3NAPC 4LLLA 2JUCA 2NPIA 3Q9OA 4XKWA 3I49A 1UYYA 4CCMA 2JWTA 3HD8B 2VBWA 4XLAA 1JJ8C 5LBCA 2XQXA 1AR72 5GLVA 2FBEA 5HDNA 2XGCA 2DN0A 2MNGA 4KGQA 1JU3A 3DEMA 4QD2A 3IWFA 4AVZA 1VP6A 5FPUA 1LEMA 4HNVA 2DA6A 1S1AA 2A3SA 4BOWA 1JUSA 2R7EB 3VSLA 5T52A 3NV2A 5EZHA 5FKNA 2WO1A 1ETXA 2DA7A 1WGXA 1SCRA 1UZVA 2RS11 4LBKA 4J00A 3PO3J 2GXAA 5DTDA 2R49A 5F7UA 1ZBA2 4RAFA 4F3JA 1OOPB 3POJA 4ZDLA 1J2XA 1EF4A 3E5XA 1MGTA 4EMSA 2Z42A 3KP7A 1UL9A 1XNBA 3VZJA 4I0BA 5E3MA 2WZR3 5AIQA 2BNNA 1AVBA 2H1KA 1RUD3 3HHGA 1I1SA 5GP9A 3RI4A 2VZPA 1QZEA 4WXDA 2HVQA 3WQ1A 1JGGA 4NHJA 1VQ9I 1STMA 1BBYA 2O8OA 5GAHJ 5IUQA 3SQOA 4QXCA 5ABJB 2I10A 4J19A 2BOLA 5BNQA 1BK0A 3VBFC 2FDFA 3S5AA 2KDZA 4IV3B 4ESBA 2HH9A 1FPN3 4GRIA 1RZ4A 3WDWA 3ASOH 5EJCA 1K6YA 2GOXB 1Y0NA 4QM9A 1HQLA 4QTRA 3FBNB 3AMHA 2WL1A 4XBNA 2XKPA 4F55A 2BV6A 4CP9B 3FWEA 3BZKA 1LFBA 4QQPA 2KMUA 3DEUA 4PLMA 4DZGA 1GWKA 1QZZA 1GKBA 3KZZA 3ACIA 3AP9A 4J01A 1IDZA 3DWLE 3FKJA 4HOOA 4UAPA 3I4MJ 2JDAA 1MQTA 1ZHFA 3VYTB 1YFYA 2YU9J 4QLCU 1OCCH 2Y0SN 4G6QA 1ULPA 4WWCA 1V6MA 2E32A 4Y22B 1S6LA 1ZBE3 4JX4A 1NA1B 1VQKI 3SH4A 2IP2A 3BN6A 2IA2A 2R30A 5FZLA 3T0YA 5D5UB 2VGDA 3WG1A 1K5MB 1K12A 2IGNA 3WTYC 5CFDA 5FYVA 1YLFA 5JIAA 4FT8A 3PJRA 1BI1A 2OW4A 4IE4A 1UWWA 2DFBA 3OYIA 3HYIA 4DRVA 2OZ6A 2P6CA 3BPZA 5HLGA 5CBLA 3H0OA 1TT5B 3UKNA 3WNLA 4KBBA 5F27A 1MNMC 3VYRB 1JTYA 4IV3C 3ZX7A 1C57A 3VKFC 4DMIA 4IDZA 2HWB3 2NZ9A 2E9QA 5J1XA 1VI0A 1W3XA 1TNTA 3LQQA 1ITYA 4DUWA 2V1NA 5JZGA 1DPUA 4FCYA 4DY5A 4YVSC 2M8GX 1TZOA 1RUD2 5FUPA 2IZWA 3RKXA 5FZOB 1UHSA 4IXAA 4M0HA 3RZHA 1G3SA 3B73A 4A3MJ 2HPIA 3BZ6A 3KIOA 3JRHA 2DBNA 2QQ8A 4IHWA 2MHFA 3GVAA 3QU3A 2D6LX 5LCWL 3DPRC 4XAAA 4BZ4A 1DPRA 4E7LA 3X2QH 3AMNA 1B1BA 4U0YA 1NOVA 3IIIA 2XJVA 2DO7A 1XG1A 4R1HA 3OYNA 2WN3A 3NSTA 3I4PA 4JTOA 3KYCB 2VNOA 5BY5A 4CPBD 4O6JA 2IBDA 3FF5A 1PO11 1PK6B 1WKYA 1WCUA 5J47A 5FBZA 1GP4A 5BNNA 3FISA 4ASLA 2VO5A 3RZJA 1JUIA 2JTVA 5K1YA 5FZBA 3S1RJ 1G9CA 5DDJ2 1WH5A 3SCGA 1ETKA 1RUH3 4AW7A 1AR61 3I53A 1Z3XA 1TQIA 2XDVA 2XB0X 3CCUI 4CEWA 1POGA 2YUSA 2K40A 3WF1A 1XB4A 2CW8A 3FN9A 2V9VA 3OY8B 4CYCB 1CVNA 1NCQC 1LECA 3IC7A 2NNYA 2ZFWA 5CFCC 3POEA 3H35A 1OD3A 5FY7A 2KIQA 3U75A 1VRH3 4AHYA 2EILH 4XFCA 1XSQA 1UELB 2HWF1 2D5HA 1K7AA 2VVEA 1ACIA 1GXQA 4B1LA 1WGPA 1JS9A 4JKLA 1X9TA 4NMIA 4Y4YA 2ZMEB 1UHWA 3L7WA 1IRXA 1YE9A 3TO9A 1OA2A 1V9U2 3K70D 4ZS2A 4YM1A 3FX3A 5KC6A 3BJOA 1S0JA 5FYIA 2XKOA 1JI6A 3NWTA 4AE2A 1NG7A 3R4DB 3OSFA 1FBSA 2UZKA 2BGOA 5FQ0B 5BNPA 4Y26A 2RKHA 1OD5A 1RVF3 4OI0A 3PUAA 1RHI3 3A4CA 5L3DA 4B4RA 2L0KA 1ZVFA 1MPXA 1O4YA 3RIRA 3MF9A 3ZFEA 1QF3A 2ZO4A 1Y3TA 3CMAI 4HDUA 3ZKYA 1KXGA 1W6NB 4UW5A 3AK0A 4N53B 3S2WA 4HF0A 1WJDA 3BIWE 4UXAA 3ZXAC 5B1BH 1C5IA 3DUIA 2D43A 4ASNA 4Y3OA 3KFWX 4IPAA 1FZPB 4XDPA 4YZ2A 3H8UA 3HNMA 3ZMZA 4N90A 2CL2A 3B6CA 3HEFA 1DUXC 2PBIA 1WA6X 2W57A 4W6YA 1RESA 3DYPA 4QPIA 1RPWA 4BQYA 4BK5A 2EV6A 1VQ5I 3WW3A 1ZZ6A 1JOBA 3QWLA 2OA2A 3OWTA 4YW1A 3RZOJ 4RGXA 4DXZA 4U36A 3G73A 4LFUA 3HT1A 1S7AA 2ZBKA 3T2QA 1Q3EA 3UGHA 3M1HA 3MMYB 2ZGSA 2PMZN 4TLFA 1ZX5A 1R1A1 1H1AA 1U0JA 1LHOA 3AB0A 3F21A 2ZOEB 1FWZA 5T3NA 4CEWB 5H9PA 2CV2A 5FO5A 3FHIB 4QB2A 2ZGNA 1IQDC 5IOZA 5C9AA 3M3QA 2TCTA 1QDOA 2ZGKA 4NDLA 3MKYB 1DQUA 2EICA 2HYXA 3VBUA 3V65A 3OUIA 2PLV2 3SZPA 3IMNA 2R043 4YG6A 4XQ4A 4BIFA 5IWFA 4JGZC 4DGWB 2GWRA 4DO0A 1MACA 4IZZA 1GLHA 3H3LA 3AFGA 5CKNA 2A6TA 1GV9A 3TL4X 3TDZC 4M3GA 2DFHA 1D4M3 3JSOA 2RVAA 4PIXA 2JA8J 1R7JA 4LBQA 4XJZA 1XC6A 4MFEA 1FX7A 3I59A 1IS5A 2JDKA 1ZELA 4XORA 2QM3A 4MHGA 2W1SA 3OYJA 2V26A 4CCNA 2IVMA 1R1UA 2ES3A 1D4VB 2A75A 2VMCA 1FMVA 2A61A 5DG2A 3V4GA 1QEXA 3NJZA 5J1UA 4JGYC 3ZQGA 4RB2C 4P02B 4GAZA 1VBD3 2RQPA 2FZ2A 2YG0A 1AUYA 4RM2A 3WU2C 4IHXA 5FMOL 2GALA 4QX0A 2XVCA 5FYYA 2JG9C 4XMYA 1PIV3 1W7PB 5FRMA 4JQRA 1QOTA 4R9CA 2H94A 4QGMA 1RUH2 2E7AA 4CP9A 2VCCA 2X5IB 2DVBA 4UXNA 2FDGA 1ORKA 5H6RA 2PA7A 2HZTA 2HBUA 1XNCA 3S6PA 2W5FA 1T0FC 1REFA 1CAVA 4ONUA 4NHYA 1T08B 1MSFC 2YYOA 4QQLA 1FBUA 3FMRA 1PVC3 4MGIE 3MKZA 4WM8B 1YC61 2XQRA 2V4JC 2XAFA 4Y4RA 1ZNPA 4U0VA 3K10A 3NKGA 4U2AA 3VD4A 4HKOA 3HJEA 4PF1A 2EFNA 2P6HA 5D5WB 3UL2A 2AC1A 1A8DA 1H2MA 5FQ0A 1KD7A 2BXZA 2P34A 1UJ8A 2BVVA 3N9NA 5APAA 5FZOA 4KG8A 3QODA 4A7KA 4ZTFA 4G8XA 3H0DA 4CEYA 1RHI2 5FJHA 4HSTA 3CC7I 5E89A 4LBOA 4X0GA 3SJMA 4UUVA 5AC91 5DAPA 5FPVA 4L5EA 4I6ZA 1I3AA 2Z79A 2QBYB 2W87A 2DOAA 2X4HA 1WJ5A 2XGXA 1W6MB 1LOEA 5EPAA 5K9YA 3ES4A 4G7ZF 2L9RA 3FHQA 1QGLA 1PJRA 3F6VA 2ISYA 3ZYPA 1K5MC 2MSYA 4HNTA 5CFCA 3PIOF 4WM8A 3HR9A 3DBRB 3BVCA 4AR2A 4N7IA 5C3OA 1SEFA 5ANQA 1QRYA 2RDPA 2HVSA 5JSPA 4RAYA 2YC4A 5ACA3 1OLRA 4O3MA 5A6ZA 5ISLA 1Z0HA 4L2NA 4KL1A 3BALA 1SVLA 3GTJJ 1UOFA 2RM21 3WP3A 2VBDA 3L2CA 4H14A 5IK4A 3COAC 3JRAA 2ENRA 4Y20A 1MVEA 2WSUA 1YX3A 3J4UH 4LOTA 1WCMJ 1AYN3 1G59A 1X1BA 3ZSKA 1ON1A 3MW4A 2W39A 3ZMNA 5DABA 3UYJA 1DQ1A 3DL3A 5I91A 4XLFA 1ND3A 5BV6A 3CP8A 5LEKA 2IGKA 4Y13A 3HM5A 2D2WA 1JI8A 2VQUA 2LKSA 4LBNA 3J80K 2DDUA 2A1XA 1J1LA 4MTEA 4LEJA 5DQ0A 4XOTA 2Q1FA 4A2UA 4LHKA 4URTA 2OPKA 2PLV3 4EJRA 4M0NA 1HRV3 1OKOA 5JFRA 2VXZA 4AEDA 5A80A 3S2HJ 3FLTA 1ULGA 3I2DA 1LENA 2UY8A 5GAEJ 1CZVA 5DAXA 3ME2A 4QHOA 2H09A 2C9AA 2CDOA 1PP7U 5M3MJ 2HDDA 2LS6A 3GTGJ 3IAS2 3CKHA 4M3DA 3BQYA 1AR63 1IN4A 1S7EA 2L7ZA 2ZMKA 1R5HA 2BZTA 1P4WA 4GH4B 1USSA 2WY8Q 1T38A 1HKTA 2E5NA 1MZ5A 5FKBA 2A6EF 2RQQA 4OFGA 5JR2A 2ID4A 3HDDA 2YDEA 2H0VA 4V1PA 3OIQA 4DOZA 3OYBA 3QPTA 4LORA 2AEYA 3WQ0A 4IX7A 3TEZA 4M6VA 4YG3A 2GC3A 5JMCA 3HNYM 3I3BA 2O1QA 2HFHA 1O91A 4YRDA 4E7JA 4CDXA 1DHKB 5IYDJ 2FDKA 1UMZA 2JRTA 2ET7A 5CYYA 4W6XA 2B63J 2C24A 2R7RA 5FRAA 3LMMA 4YIRX 2WQZC 3UGGA 5FPZA 3CJXA 1HDKA 4EN9B 4M74A 3M3YJ 2AZ5A 4RA2A 1GNHA 2E2JJ 2P5LC 3K4BA 1W2NA 3WTXC 1H8TA 4LTAA 2OV7A 5CLSA 5G04L 4BDZA 3UKGA 1T39A 4CDWA 2WKKA 3K48A 3WHUA 3CLOA 4Y15A 1NT0A 3KCXA 1KONA 2ZC2A 2JECA 1PUFB 1LHWA 2LF8A 4BYYA 5C5TA 4CE8A 1D7PM 3JRFA 2YU3A 2EWNA 2TBVA 3FIWA 2QCSB 3THCA 2XPVA 2F4PA 4XLPF 4CDQA 1QJEA 4MGZE 2BOIA 4INDA 2JICA 1S5LC 3WDTA 2C5DA 2Y69H 5C4WB 3V0AB 4B48A 5AFEA 1CAXB 1I5PA 4OOIA 3RZMA 5EF6A 1EA3A 2RVCA 4XAEA 4MFDA 4XABA 3TQNA 2WWSA 1FOD1 4ZKTB 1W8OA 4ASMB 2K3PA 3IH3A 2DYSH 1YQCA 1LE8A 4NIAA 3N05A 5IPAA 2D97A 3IKVA 1GICA 2L9NA 2TDXA 1HKDA 3J7ZI 5EQUA 1YG2A 5KK1A 3UR3C 5FZHA 3BPVA 1HRV1 1O57A 1MJBA 1BZWA 1OUSA 2ETHA 1SLCA 1W1WE 3WTVC 4HN1A 1VQ6I 1A5JA 2IGMA 3L9JT 2A71A 5L7OB 1U0AA 1GU3A 1XYOA 2WO2A 1VBB1 4UW3A 1CR7A 5CZKA 1Z05A 5E8IA 2DPUA 3TP0A 2Y9YA 2QZ2A 1WQ2A 2YC0A 2QSHX 1ONAA 2K9LA 1G9BA 3H9JA 4OI4A 2VJ4A 1Z9CA 4OLLA 4P9YA 4I98B 2OF7A 4CZCA 4UVBA 3ONQA 4OIPF 4P08A 2HEVF 2NRAC 1WCDJ 3DECA 4HK8A 5K4LA 1ZKGA 4BE3A 3ATGA 5HXVA 5KC5A 2X85A 4YZ4A 4QPWA 5K0UA 3CMMA 3WHBA 2EV5A 3M3IA 4E7IA 4XONA 3GEZA 1SFUA 1W9TA 4JCKA 4XW3A 1SLAA 1XBFA 4RB0A 1ULYA 3O12A 4P9UA 2A6ZA 4L0YB 5BOXA 1LKNA 3HSFA 4XDOA 2R7UA 5ILSA 3V8LA 3OGRA 3DF8A 3T0DA 2LREA 2UURA 2C26A 1M4WA 3VZLA 1YNAA 1VBB2 1SG3A 3T0AA 2XRNA 3AX4A 2VMFA 2QQLA 3D0JA 3PHMA 4NPLA 5I8YA 3MIBA 3VKOA 5BMZA 3PURA 1WWYA 1D4M2 1YWKA 1QNWA 4QX7A 2LF7A 5FFOC 4GMP3 4NIIA 1AHDP 4LO5B 2R072 3JTGA 5IT6A 4LJHA 4MGRA 1DP3A 3BKZA 3ERMA 1LDKB 3EPZA 1W9YA 3LEIA 4M3CB 4LHLA 4ZYDA 2HTJA 2VT2A 3D1NI 4QPGB 3O2PE 3LAGA 2GMEA 5A2QK 2XF7A 3SHFA 1BEV2 3MIHA 4E4SA 3VBHC 2VZQA 3QU6A 5AONA 1UCXA 3KYDB 3E6BA 3ZSLA 5C6CA 3JBG2 1GOGA 4Q4X1 1L0OC 1CN1A 2ELJA 1MMSA 1RKWA 5CVIA 1VBD2 1J75A 1F5FA 1YEWA 1WW5A 4M71A 2YPRA 1ULDA 4M01A 4BQXA 2WWYA 1A04A 1VBE1 4A42A 2IXCA 3O1UA 4ES9A 3GF2A 3BT9A 1PO22 1FOYA 1TWHJ 3A02A 5FLXZ 4AHXA 4B3NA 2QKDA 3HVDA 2L01A 4FFFA 2PAEA 3U21A 2DW4A 2AXLA 3I4NJ 1GZTA 2O5RA 1ZN2A 1Y0UA 1VR3A 3JCUC 1AYN2 2FNPA 4FOVA 4GMP0 1BXHA 2EIKH 2BOJA 1UPSA 3OYLA 1S72I 5L9RA 1RJ7A 5IT9K 4JTNA 3HUGB 2ZJRF 5FLVA 5T54A 1T98A 1IV6A 2QKLB 2FE3A 1LEAA 2DCTA 1IN5A 3B94A 3M8LA 3K70C 1P92A 3ZXGA 1VBA3 1RUC3 2MGQA 5C7GA 2JZYA 3M3OA 4IXLA 5D2AA 2XGDA 2AHQA 2A6WA 1VBD1 2KA3A 1JYVA 5BNPB 4MEYF 3ZR8X 3LQCA 1ODNA 5J40A 4XTPA 4FPCA 1H9WA 4C30A 4D5CA 1OCOH 1LOAA 1BC7C 5DUWA 4XKVA 1SHWB 2LKPA 4IL7A 2VNVA 4LGWA 3OS1A 5CEHA 3GYHX 2RJ2A 1V6JA 4XXPA 3GFLA 2XJTA 1H89C 3W6VA 4LBMA 1YHFA 1LNWA 4R9AA 4UFJA 1W8FA 2VUDA 4NIGA 4IHTA 1LPQA 2WNVA 1NY71 2ZAHA 1HV0A 1OCRH 1QJZA 4RGUA 4UFKA 2WWUA 1MH3A 3NARA 2WFF3 4ZH4F 2XC7A 2MEV2 4I0WB 5HDKA 3VBRA 1XMXA 3KB5A 2STWA 2VZVA 1BEV3 2NNNA 2CQQA 1SVOA 4JVAA 3ZYRA 1FTTA 2JDHA 5E1ZB 1EKEA 4GFBA 4A3GJ 1H88C 4A45A 4CDQC 3MEPA 3BP8A 3GZ6A 3BODA 1JZ4A 3MN2A 2NMNA 1MD0A 3CMGA 3WTZA 2VJJA 3KZ4C 2JB4A 3M3CA 1ZREA 3B7MA 4KH9A 2RG4A 1U5TB 3IDCB 3PQKA 1WBFA 4QX2A 1NAEA 4ENJA 4EN6B 4J1WA 1W8WA 2DF7A 5CG9A 2HJIA 1B9MA 2BBVA 2YB7A 1LOGA 1XD7A 3VB2A 4C2UA 1OSGA 1Y1WJ 2WNOA 2DU9A 4COWA 4XL9A 4H55A 5A6YA 1QQIA 1Z7S3 1RL3A 4XZPA 4N7UA 3VBSC 1VB2A 4UHTA 4AVPA 2VTXJ 4M3CA 5B1AH 2VPVA 3VL9A 2ME6A 1R091 4LLNA 3ZN1A 5I8TA 2XBO1 5E16A 1WLDA 1MZBA 5FLMJ 2WNVB 4XSXF 3QQAA 2CV0A 2W3JA 1N1SA 2XVKA 3D3AA 1AKHA 1TTYA 1AL22 2EIGA 3CLPA 5FYBA 1T2XA 4GDFA 1YJNI 2K9NA 4E2SA 4AIHA 5HOOA 2MH9A 3DCFA 2ZEXA 4DYRA 3PU8A 1UPIA 1XS9A 1I39A 1MBEA 3KP3A 3DU6A 4OHVA 2EZLA 3U10A 1GHCA 2VKDA 4RN5A 2LFBA 3LF7A 3TO6A 2LG4A 2L7FP 1RUJ2 3S1MJ 3AKZA 4CP1A 1BMV1 3PNTA 4KITB 2DQRA 1MBJA 4A6EA 2DPDA 3LFKA 1GUUA 3CLQA 5DXDA 1LU1A 3GBGA 4EWEA 3ZQCA 2CAVA 3GFJA 3BCWA 4GB32 5J37A 2CU7A 1C8M3 4XJ9A 2UWBA 4WBBA 2ZEWA 3ZRGA 1JT0A 3PUQA 4YVWC 5JHUA 2LW8A 3I8TA 5DUVA 3ZOIA 1DIWA 3UKVA 4NIDA 3VHPA 3KT7A 1K45A 3INAA 2LM3A 3DFGA 3I58A 4HQEA 2DUOA 1A6QA 4GALA 5T5PA 4FE4A 3TP3A 3VZMA 3VKLA 2X1EA 2NM1A 1YCIA 2QNKA 2PHUA 5CFDC 3IHUA 1FV3A 1DQ4A 5FZ0A 2ZS6B 4XFIA 1HRV2 1NA1C 1UB9A 1R083 4AGGA 1N3PA 1IZ3A 1IOAA 2MFZA 3VBHA 3TKYA 2VVDA 2DCYA 2JB8A 4ZXKA 3WNKA 3I64A 5HS7A 1AR62 4IV3A 2GC1A 3FM5A 1BA5A 5LHHA 3K2AA 5K7FA 2VB6A 4ISRA 3MZHA 4Y5Z0 3JZVA 4ZS3A 2XAQA 3S1QJ 1ZZ9A 2YZ4A 1KS5A 2HWE1 5LGTA 2ZXJA 4G94A 1OCTC 3FLPA 3PUIA 4IESA 1UAIA 1V00A 2RS13 3MW3A 1L7LA 2PHRA 4BQ1A 3KE2A 1OFCX 1WZ2A 3CF5F 3WNNA 3TRSB 4PIZA 1MS0A 2GU9A 2VJIA 1KS4A 4IOAF 5FY5A 3HN1A 2ZA9A 1EUUA 3WG4A 2XWJB 4AI2A 3G1MA 1ZGAA 2ICWG 1VZ0A 5FYCA 1MMAA 4UUTA 2A05A 3HOUJ 2JENA 4L92A 1ZZBA 5A7QA 1SACA 2ERFA 4AYBA 4Q5SF 1HB3A 4HL0A 2UY9A 4MSVA 4G9YA 4KIGA 1YIJI 4B4QA 2UV1A 3DLLF 1I3QJ 5LATA 2B4KA 5IAVA 1ETVA 1H9TA 4HETA 4S2DA 3CCRI 2CUJA 4HANA 1W9WA 4CU9A 1WFXA 1S4CA 4B47A 2X6WA 3A03A 1SLIA 1C8M2 1SLBA 4D6SA 4O9EA 4IEOA 4NPMA 4Q4Y2 1YO5C 3P9KA 3BU0A 2BGCA 1G8XA 2HQRA 3LAPA 1R6RA 2MD5A 1UMHA 5E1RA 1WJBA 1WZXA 2A5WA 4B3AA 1LDJA 1R1TA 3POSA 4LG0B 3D4KA 3LEKA 1RUE3 1BL0A 4XRFA 1ACCA 5FKOA 2GNBA 1ON2A 2R5ZB 1NX9A 3TEXA 1UXZA 2VONA 3J9SA 2VR4A 4B7KA 2VE8A 1FY7A 4CZZA 4P96A 1E3OC 4I0AA 1QU3A 5FBJA 1DQ2A 1I9RA 2QA4I 2JG8B 1W39A 1B9NA 1PP8F 1RUI3 2UXXA 2XUBA 5A1AA 3ZMVA 3S17J 2CQNA 1U5YA 4OHWA 2QQPA 5BNOC 1Y8QB 5J7MA 1IUFA 4DY3A 5E1WA 1ND2A 5TGTA 5LHGA 4COUA 1SD6A 1HF0A 3ZFEC 3M7AA 1TMF3 4JAAA 3LSMA 2NVXJ 1I50J 2ADEA 4JV4A 3ITQA 1KGYA 1OLMA 4H7MA 3CQZJ 5C4XJ 4IVNA 2LRPA 2G7HA 3LSTA 1V5EA 5KVRA 2PELA 2F2EA 4LQRA 1FPQA 2FBHA 1QJX3 3ABZA 3TGNA 2W46A 1MR5A 1W28A 1LODA 1FTZA 2R7OA 1VQOI 1LJ9A 1MZEA 4XJAA 1XXNA 1ZBA1 1S9HA 3N97A 4HZFA 2VOPA 1TZLA 5IJRA 1GZWA 1JHHA 3S1NJ 1RHI1 1K78B 1H8TB 3MCZA 3CNAA 1RNLA 1W4MA 4KIFA 2ISZA 4WVVA 4MZUA 5IVVA 4I2OA 4ZU5A 1GFF2 2XROA 4O61A 3NNLA 1NE4A 2DVGA 5CISA 1AJKA 1J3RA 2R93J 2MC3A 1ZBA3 2WA4A 4IJAA 1BR4A 1KQRA 4C91A 5C9AC 1JTXA 1YUDA 4F7ZA 5CAZA 1O4TA 3U11A 4LE4A 4A6DA 5BNOB 5L73A 2ZSIB 1NY72 4RS5A 3JRCA 3SHRA 1F4KA 1DGRN 3PJQA 4D1QA 2WNUA 3R61A 2W24A 5E88A 2BYVE 3K4CA 4P5HA 1QJFA 4TTGA 3EBRA 1UG0A 2ZACA 4Q27A 5DZGA 3IDEA 3PFIA 1RUH1 1DZRA 3V7CA 2EIMH 5JVVA 4Q2FA 3RGBA 1BR2A 2CFOA 5ACA1 3WU0A 1VRH1 2L7KA 1EAH3 2DT7B 4DUVA 2W25A 2VPLA 1HN0A 3I3MA 4Y7NJ 1RMU2 1XU1A 3NQOA 3PVEA 5A6QA 1FEXA 2PYTA 4LB5A 4FFGA 5GZDA 4LMFA 1SFKA 1V5GA 2IGOA 3ZMDA 4DBQA 3KETA 2LTPA 3ZQHA 1VBC1 1HB1A 5IYYA 5AVPA 3CHXA 5FDBA 2AXTC 2A6YA 3GMEA 4L97A 4KWUA 2IWGB 1PDNC 4WZCA 1YFHA 3QYBA 1QU0A 5C9AB 3U2RA 2BE5F 2CQKA 1SDWA 2JG9A 3V56A 2YV8A 3V0BB 1FYMA 2WAQN 1K78A 5JLXA 2OPTA 4C3IJ 1PGSA 2IXJA 1ENXA 3FM3A 2ELHA 1KGSA 1LULA 2FEZA 4XUNA 3OF1A 1AF9A 4CICA 2WFF1 2EZHA 1CPMA 4GMP1 5IYBJ 4L8QA 2A68F 2QQUA 2KZGA 4IL6C 1AR83 5KHJA 4YLZA 5J48A 5L3EA 5ABJC 3B00A 3KPHA 5LZ6A 1BM9A 4CRQA 4QQOA 1LAJA 1EUTA 2LDUA 2RS31 4D0QA 3N9LA 4UVCA 1D0HA 5D6FA 3BR2A 3CC2I 4RR3B 4MHRA 3JAMK 1LHVA 2M8EA 1XSDA 1C8NA 2QQMA 2V9KA 2VZ3A 1QQP1 3WF0A 3P5JA 3WEZA 3A0NA 3ELKA 2JG8A 1DP7P 3PNYA 2BHZA 3H0GJ 3ZOBA 3LE0A 3C7OA 3RYRA 2VI6A 2Z5UA 2JK3A 5LLQA 5HLIA 5DAQA 3QOEA 3AMPA 1OYIA 3BR3A 2VC1A 2JE8A 3U9GA 2ZAAA 5KHIA 2WR9A 3HOSA 3BTJA 2WFF2 1CIWA 1ZYBA 2H1LA 5C44J 5J6XA 2Y9ZA 2IUWA 3POYA 3OG2A 3LDBA 5FO8B 2GLOA 2XB5A 1H4GA 4ZONA 4JDNA 4XFAA 4UFLA 3BTIA 2MD0A 4RDUA 4HX7A 2PHXA 5A33A 2M0CA 5DS9A 1UU6A 3BY6A 1S2BA 1F9KA 1JHFA 2B45X 3JCIA 1W5CC 2E7WA 4E7HA 1VAKA 2R063 1B59A 5JI7A 2ESHA 3KCCA 5F64A 3W21A 2JG9B 3OD4A 5F2SA 3N4MA 3DXUA 2BW3B 2D5FA 3J8F2 1N47A 4IE7A 3WINE 5HS9A 4IEUA 5FR3A 1EH7A 4IV1B 4FP2A 3LGRA 1Q5OA 5IVBA 3W2VA 3SKJE 3MO4A 4YW7A 2YX4A 1QHGA 1WWXA 2JJ6A 2IXIA 4CEYB 5CYVA 4UWDA 1GUIA 1XC5A 2R7TA 1AX0A 3RWNA 1AR82 5F5CA 1XX5A 3C7JA 5JVTA 3WSOA 1UD1A 3AM2A 2B5HA 2DCKA 4OYUA 2EIBA 3T4VA 2LALA 1QJY2 2ZZJA 2R6QA 4MH0E 5J4YA 4KQ7A 4NO4A 2IAIA 2LKXA 4G6DA 1GOHA 1RUF1 1G9DA 1C0WA 3OMYA 2OTJI 3BGAA 3BROA 4EM0B 4A7ZA 1W8UA 3CDHA 4DW6A 5E17F 3F2ZA 3V0BA 5E79C 2VC0A 1DGWA 4XFFA 1P4XA 1AYM3 3EXUA 2HDWA 1WMFA 2BY1A 1KQ0A 3GF6A 2BBYA 3SITA 3BG9A 4BE2A 2B9VA 3CMYA 2X0LA 3DN7A 4IV1C 2GAUA 4YM0A 3PUFA 3LA2A 3SCHA 1ZZCA 4P9LA 3KZIC 1D4M1 4BH9A 4BDYA 2HWD3 1XGNA 5HBAA 2NVQJ 2PN6A 4AAXA 1IN8A 4RS5C 3ELNA 2KQRA 1OT5A 3IAM2 1YI9A 2H6CA 3MUY1 3LFMA 3J81K 4UB8C 2AR6A 2W68A 4E4ZA 3LSKA 4FFHA 1J58A 4AL9A 1ZQ3P 4PDWB 4QX8A 2BHYA 2W92A 4Z92B 2OU2A 1TLHB 3IMMA 2HZDA 2Q5TA 4BA6A 1TNFA 4Q4Y3 1AR92 1PMHX 2CWEA 3CESA 1K79A 2R042 2NVTJ 5I0TA 2I8DA 5FP7A 3SZTA 2OT7A 3ZFGB 4I02A 4IEQA 4OHZA 1Z67A 1TWGJ 4B43A 4EWDA 1DYPA 1D8KA 2P3IA 4AM3A 3GBWA 1N1TA 4YZ3A 4D9JA 4RGAA 2R92J 2F5DA 3U1KA 1JMUB 3CO2A 2STTA 4Q4Y1 5G05L 2IJLA 4ARXA 3AYAA 3WW1A 3PQJA 1VF9A 1LGNA 2KD7A 2DMPA 4M3CF 2WNUB 2ZNYA 2JT1A 3KV4A 2ZMNA 2CQ7A 3FL7A 2LD5A 3HOXJ 2FSWA 2PMWB 3N9MA 3ZM8A 2VMDA 2XH6A 2J22A 3M4FA 4FQ4A 2IS2A 3J26N 2J1VA 4AFAA 2JPCA 1IO2A 1N25A 2LR8A 2ZABA 3LZZA 1MS3A 3VD3A 2GOMA 2VCAA 1XOYA 2RR13 2MLKA 1M1EB 1QJX2 1PX4A 4Q1PA 5EFUA 2XPJA 2AYHA 1HJFA 3WNXA 3E6CC 2IXHA 4LA2A 2X1DA 4NROA 2K3FA 2ZGOA 4UOJA 3VB9A 3DYMA 2CGNA 5GZGA 3QACA 3OBZA 3FBIB 3DBHB 2Q8KA 3IRRA 1JUMA 4XSZF 1D0ZA 4QXHA 3KV9A 4EV0A 4UF0A 2W00A 3OY8A 1T56A 1EAH1 5IYCJ 2WFPA 4LUMA 3OR2C 3RKYA 2AGSA 2DVDA 3WF2A 5EJZB 4IRIA 3Q8EA 2FUG2 4E4HA 1UF2C 3JQXA 5K0UC 1QHDA 1COV2 3WG9A 3HT2A 1BIAA 4B1RA 4JBAA 4MLOA 2BWCA 4YFWA 1RTVA 3IDAA 4TN7A 1A31A 3LSIA 1O5LA 3AXEA 4QPOA 4GH4A 2DDAA 5FJ8J 1W2AX 4ZJZA 3QAHA 2LNBA 3V42A 4L0ZB 1S0GA 2Y26A 5M3FJ 5FY8A 5CKQA 3P1IA 4DQAA 1BHGA 1CZTA 1U5IA 4YGCA 1SMVA 5KAIC 3SYTA 3THDA 3VYUB 4E70A 4IUGA 4G6TB 3TOAA 1W0NA 5LRSA 1C5HA 2VMEA 3S5QA 2DTRA 2MH2A 4YIFA 1CQ9A 1RIOH 3S15J 5KCMA 2D3SA 2Z3YA 3A21A 4Y24A 4BBRJ 3I5UA 1B35B 3OOXA 2CUEA 2QSGX 2VVFA 2O3FA 4CHUA 3RZGA 4PFPA 2VMHA 2XJUA 2X48A 3BCBA 2E26A 4QWNA 2DMUA 4XBLA 1LVAA 2QQKA 1OCPA 5IFTA 5L3FA 5ICEA 2UWAA 1IGNA 3E6MA 2WV1A 5DG1A 1W6QB 4AQTA 1O4ZA 4CCEA 4V2FA 2HXIA 4OUSA 4FSJA 5LFAA 2ZFUA 1PZ9A 5B66C 3J7AO 4LUKA 1YXWA 3DTIA 2DU0A 2LUWA 4ZYEA 2PHDA 2DMNA 4S04A 3AC0A 1LVKA 3AG1H 2VCBA 1Y9MA 4WX9A 1A35A 3QP6A 4OMCA 1BLZA 4LK7A 3ZQ7A 3POFA 5EGOB 2YPDA 2HWD1 4R4ZA 5C4JJ 1OQDA 4AI9A 1TL8A 1BMV2 4IE6A 4UY8I 4L5JA 4KISA 2X51A 1H4HA 4A3DJ 4YG0A 1WD3A 4YM3A 5IVCA 2R7SA 3UETA 2JDUA 5F04A 1P8JA 2WZR2 2WY7Q 5H9QA 1MBKA 3TAYA 1REEA 1F36A 2PLYA 1B35C 3ZLIA 2A5ZA 3K4AA 4AVAA 1RINA 4LKDA 3WHTA 3I4IA 2Q1MA 3U1XA 5A7WB 4HSRA 2VQGA 2XG3A 3TW6A 2CHHA 3I54A 1OQYA 4GWNA 5CVUA 2R0FA 3RPUA 2HOSA 3J8F1 3IKWA 2KP6A 2FCTA 3HPGA 3CJQB 2ZTNA 5FUNA 3ZYIB 5JLWA 3U78A 4Q47A 3OD0A 3HRUA 1MBGA 3K6GA 2D45A 1X1CA 2ZX1A 1GP6A 1UCRA 1WVRA 4XUQA 3N9QA 1ZRFA 3ST7A 3OYWB 3B69A 2HWE3 1AR73 2DFFA 1HC8A 1W8NA 2WZR1 4F93B 4XM3A 2XBO2 4W50A 3ZR5A 4YPJA 4RQPC 4JHTA 5DDJ3 3DXJF 3L00A 1W7PA 2WT2A 1CAUB 3CJIC 4YW4A 1MKMA 3M1EA 1OQ1A 4XKCA 1VIWB 2PFWA 2VBZA 1V9U1 1W6MA 4A93J 2DOFA 2WIIB 5CNAA 4HVQA 3ZDVA 4M3FA 4FETA 4GJYA 2G9GA 4U7BA 5F3GA 3EO6A 2ET1A 4OQ9A 2V4AA 1ZR4A 1CAWA 2VZTA 3ML6A 1PIV1 4MNUA 3H7JA 1MS1A 4QB1A 2Y38A 5FXWA 2EF6A 3PJYA 4BQWA 2UYBA 4RLFA 1YLLA 1J1TA 1MZ6A 1JZ7A 3R0AA 2XJPA 1DYKA 3NV1A 4V2GA 3KLOA 3RKQA 1Q43A 3M9AA 1IQAA 3ZXFA 3TWIA 1FIPA 1Z7UA 4K1YA 2X10A 1AHSA 4YFKF 2A3XA 1CZSA 2IS4A 3C3WA 4UUSB 4WM7C 3BG6A 3TNPB 1R00A 5DN2A 1YW9A 2VCMA 2IXKA 2W48A 4XMIA 2WZ8A 1QJU2 2BU9A 2ZGMA 2ZX4A 1NKGA 2BVLA 2K4JA 3KQRA 5ILUA 4B8EA 4FPGA 5ANNA 1AOYA 4PDWC 1YJ9I 5GALA 5FOJB 1G3TA 1YQ8A 2V73A 3GCWA 4KMFA 1JZ3A 3I2GA 4AYBN 3BR6A 3H1WA 3I7DA 4XOPA 3L2HA 4JKMA 3ZCOA 3MEXA 4II2A 1CD3G 1HLVA 1IXRC 3S0MA 4PZJA 2VBBA 4XIDA 3J8F3 2L4AA 4ETSA 3GALA 2ZGLA 2ZZQA 4QMAA 5SV8A 3GBFA 1S0DA 3I55I 1PUEE 3H9AA 3K77A 2BXYA 3LCPA 3BC8A 3USUB 4BQ2A 1DU0A 1AKHB 4IHYA 2JEMA 5H9RA 1C1FA 4R4XA 2ZEYA 1HB2A 1K61A 3HB9A 4QXBA 1X82A 3HN3A 4Q4X2 5F5IA 2VG9A 4E4DX 4RR3A 2DXIA 4KI5M 2VXDA 1Y1VJ 2DTZA 2FHRA 4BY1J 1AR91 5E3LA 2P2KA 5EEGA 3B6AA 3DV8A 4K3UA 2LC2A 2HYFA 2YPJA 3ILFA 1JYIA 3CCJI 2A7AA 2IS6A 4HX8A 4Y20B 4L9NA 4K7JA 2QVOA 4OI1A 1B6AA 2ARCA 2ZJCA 2VPRA 4Y5TA 3KP6A 1EPZA 2VECA 3RMXA 2KT0A 1FNYA 4II3A 3R0RA 5JOYA 4Y1ZA 4A3KJ 1MDMB 5GLTA 3RWKX 1LFUP 4AI3A 4Y22A 1KU2A 4QDSA 4RL7A 3T1BA 3IWZA 2YGMA 3VBFA 5CQGA 1Q1VA 2J5OA 1Y9GA 1L3JA 1PUFA 4QPIB 1F5JA 3K4NA 1ZA7A 1GVDA 2LVSA 4IEJA 4XILA 2FA5A 1LB2A 2OCEA 3K1PA 5E1XA 2D44A 3JRBA 2YBSA 1MZFA 3GHMA 4BEHB 4YGBA 4LT5A 2GNTA 4YFXF 1E5RA 2J1RA 1FV2A 1FPN1 1AR71 1QOOA 4IE5A 2DLLA 4DIQA 4YRVA 4E2GA 3KYLA 2GXBA 3ZGKA 3OGJA 4A3IJ 3ZMSA 1O8PA 2EFOA 4PBOA 4BLJA 1GWMA 4A4AA 1VQLI 5FJKA 1N75A 1IKPA 2K86A 1FSEA 5AC92 5FREA 2CY6A 1Z77A 3P6BA 1T6BX 5F8PA 4NAMA 4AAPA 1BI2A 2E5ZA 4NUBA 1DBNA 4Y1VA 1ZZ8A 2YMZA 3A1YA 2V5DA 4EGYA 1HKQA 1RVF2 1X9PA 1KJRA 1N78A 2P3KA 1OI6A 4AQSA 2HGCA 3T5XA 5EYRA 4GGGA 3QH7A 2VOTA 2Z4FA 4BIOA 2V7FA 3Q0WA 1I1EA 3IAQA 1W03A 4AI0A 4BY7J 2F4MB 4GO1A 3H8OA 1HDDC 3ESWB 4L9JA 1XMKA 3D5RC 5DYMA 1QQP3 3M3EA 3RYPA 4ENMA 1VQ8I 3I2FA 3K4JA 3Q8AA 2EH3A 2VZ1A 5A3OA 4EM1A 1ETOA 3L2VA 1P4AA 2ID3A 2P4EA 3F0CA 2SLIA 2OAZA 3DPRA 2Y6FA 3JXSA 2Y75A 3THTA 1R092 1BW5A 3RZZA 4ES8A 1Q56A 4LKEA 3OYCA 1JE8A 1QMJA 5LRRA 3TB0A 4EE2A 1HQNA 3LOCA 4PF5A 3NAPB 5FD6A 3PTYA 4W6WA 5HCFA 2D3PA 1BOBA 1JJ6C 1HXS3 3HHHA 2WINB 2VIXA 3ACGA 3TN92 2E63A 3B5LB 1FYUA 2OUJA 5EYXA 5FMDA 1IC8A 2WA3A 1FSHA 2P5VA 4P9FA 2ZEZA 3RNSA 4I01A 1NYWA 2R0QC 3HIFA 2W08A 1YQ6A 1NK2P 3ULQB 2X29A 1XRUA 4XR6A 4M9ZA 5LA1A 1JZ6A 1SLTA 3DKQA 1F31A 4H3WA 2FBIA 3M70A 3OYEA 3PMSA 4LNVA 1PM7A 3S30A 4CZSA 2OZUA 2VNRA 3OUJA 5I93A 3WX5A 3QLQA 4HYEA 4GA9A 4Q1RA 1LOCA 2VE9A 2KIUA 2VOVA 1FOWA 2GP3A 4NC7A 5BXXA 4QWQA 2XVLA 1Y8RB 4EEFG 3MPPG 4XZUG 3SLIA 4DOUA 2C6YA 3JBG3 3I2KA 4FPYA 2F48A 2K4BA 4W4ZA 5J09A 1QXJA 4ENNA 5D8AB 1FOD3 1MMNA 5FZDA 1E5SA 1B8IB 1X19A 1IJWC 2J42A 4DB5A 2WYFA 3ZPYA 2X5IA 2FD8A 4QT6A 3NV4A 5FZ7A 4KBZA 2VY0A 4BQOA 2O03A 4ISQA 1XB9A 3VD9A 4TSVA 3GTQJ 3I3EA 2B8MA 1PIV2 2EPFA 3CCVI 1U8BA 3U07A 1DQ6A 2BQPA 3WOGA 4JYKA 2OUHA 1OJLA 3G71I 1JKRC 2PXJA 2R32A 4LA3A 4K20A 1RRJA 1UFMA 2DJNA 1YITI 3BUCA 3TEYA 2IVIB 1ETYA 4ANJA 4N0BA 4EJOA 1KJLA 2TEPA 2DVAA 1OH3A 4XYXA 3LKJA 2Y6GA 2QBYA 2QDNA 4XTMA 2CMPA 1APNA 4QPQA 5C8CB 2M1BA 3QPHA 4Y1UA 1OR7A 2RS52 3IP4B 2OPWA 4BJ5C 1LNSA 5ICCA 1PVC2 1RYYA 4K21A 4HMZA 4BJ6C 4KN4X 3MICA 2ID6A 1AYM1 3MLLA 2K9SA 2GMPA 4FVVA 2BW8A 2OBPA 5C5UA 4A3FJ 2OCCH 2D93A 3MV11 5JXJA 1EJ9A 4GQ7A 5BPIA 3G1OA 1UW8A 5A3UA 1TWCJ 3VBUC 5F6LB 3CJRB 2HEYF 1E17A 2I74A 1NLRA 1SC7A 2HEOA 4HKWA 2RC4A 1EY2A 1X1DA 5EGOA 3NW4A 2SBAA 2Q8CA 3BDDA 3RQIA 4F3QA 1RUC1 2RS33 1LGBA 4PQQA 2QVSB 3S2DJ 1LHUA 3WTUC 3IT8A 1FOKA 1F5TA 1PGL2 2MPFA 2L4MA 4CA9A 5DMYA 4RB3C 3PSIA 4LOSA 4XVHA 4MQVA 2B39A 3SKVA 3IKTA 4ATEA 3PMEA 1LESA 2Y64A 4G7OF 1OOPC 4XK4A 3LD8A 5A7NA 3OBTA 4CEWC 1OC1A 2E1CA 3K9TA 1IRZA 3HOYJ 2WABA 1S55A 3GZEA 2FMLA 2AQEA 2JRMA 5GAGJ 2F4OB 1ZRRA 1S3JA 1DQ0A 3UJOA 3CUOA 3ERED 2PJRA 2L3DA 4JKKA 4PJLA 1TMF1 3C7EA 1GQPA 4NIHA 3CDZB 4NHKA 4C3JJ 1E3HA 5DCMB 2KHMA 2QTWB 3AKSA 5TSWA 4AWDA 3AKPA 1KYZA 2C0ZA 1JUPA 2XLFA 2RDQA 4DXSA 1XSXA 3WW4A 2HKXA 2YSRA 3FXJA 4XRMA 1M06G 3T2TA 1RUNA 2Z1DA 2AO9A 1IPJA 2A3WA 2WRAA 2DT6A 3J80Z 1OYWA 5A2QZ 1MH4A 3T1MA 2DYRH 4ZZLA 2D40A 5J36A 3EUHA 2QJVA 2QQAA 1UYXA 2E35A 1QA6A 4QDQA 3UV9A 3CDIA 4BCUA 1ALYA 1SFOJ 1BEV1 3KHBA 4WVMA 4D5FA 3H3VK 1T2KA 2B46X 3CUQB 1J84A 1JU4A 3M2MA 4JQTA 4LHSA 2Q1ZB 1UN1A 2DFCA 5JI6A 3K46A 2GH8A 4HT1T 4KNCA 5J8CA 4OZOA 4QPIC 3OL4A 1GDTA 3HSRA 3RSNA 2LK2A 5DCMA 1UHMA 4F91B 3HBLA 1GR3A 3TW7A 4AVBA 4G4FA 2DTWA 1TNRA 3RJRA 4JX0A 2E2IJ 1G86A 2BJSA 4KWKA 4XFHA 5CJ9A 4PJMA 3V7SA 1QY4A 4ITVA 4FBFA 3ZN5A 3WP4A 4IO9F 4YARA 2LP0A 4CUBA 3FMGA 2LROA 2P6TA 4HDVA 1U78A 4FOWA 2LTNA 5KXCA 3HG9A 4AU7A 1SFYA 3SQNA 3A23A 4IRHA 3HNBM 2HVRA 3QBQA 2XJQA 2GDFA 4CCDA 3O1OA 1IS3A 1JZ2A 4GD4A 1ASJ3 1BIBA 2IT0A 1T6SA 2GNMA 3T2OA 2RDRA 4GXLA 5I8SA 2KRCA 4DNYA 1NE6A 3HQRA 1HCRA 1YHQI 3E3VA 1XGSA 1ULCA 4ZY9A 4M3CE 1I27A 1UY4A 2WAFA 3TO7A 1NCRC 3KSCA 1MMGA 2CDPA 1A34A 3EYPA 3CCSI 3U14A 1A6CA 3Q5FA 1UY3A 5IVFA 4CYDA 1STZA 3KF5A 2R061 4CSWA 4HV5A 5A3WA 4Z82A 1V6LA 1OPCA 2E53A 3ACLA 5FFZA 4ZC3A 4EYUA 4H4KC 5EYYA 3KD4A 1AZDA 3C7HA 1RC6A 3CZJA 2EXKA 4JGYA 1D5YA 2W4SA 4E8DA 2PEXA 2FDJA 3UKTA 4LULA 1WJCA 1VQNI 2PJRB 4JGZB 4N8MA 2JVGA 3VDXA 1N3QA 2ZMEA 2GM4A 1QPMA 5DD4A 2FRHA 3IH4A 2VKVA 3LIGA 2W1WA 5A33B 5F6KA 3FMSA 3CJIB 4N9HA 4IERA 4HAMA 3DXTA 3IB3A 3RZLA 3GZNB 3WVJA 1HSJA 1RUD1 2GBYA 4MVTA 4B09A 1J83A 3N9PA 2KISA 1GV2A 1IRFA 1X2MA 1RMU1 2KFDA 2IVJA 3KT1A 3VUOA 4JRLA 1UKGA 1GOFA 2IXSA 1YRZA 4ZZ8A 3F3XA 4UFIA 4MGQA 2ZPXA 2W1QA 5IVEA 1D0GA 2I5UA 1U12A 3OYWA 4CDXC 1Z91A 2LBFB 1CJDA 1W6PB 2Y30A 2XIGA 1OLQA 2EVXA 2L9SA 3Q0UA 5FYHA 3FMQA 1MNEA 2M2EA 5FZAA 3NMBA 5EEHA 1WHUA 2E1MB 1ASJ2 3Q8BA 1N1VA 3QP5A 2ADDA 2X53S 3VD5A 1HLCA 4AVCA 5CADA 3BG3A 1ZBE1 2CNAA 4EJUA 4MUVA 3CC4I 3BIEA 2VBXA 1F35A 2K9ZA 1CAXA 4HG6B 2ME0A 1W7PD 2LY2A 4LIUA