3H3ZA

Crystal structure of a putative cyclic nucleotide binding protein (spoa0323) from ruegeria pomeroyi dss-3 at 2.35 a resolution
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
226
structure length
226
Chain Sequence
MAHEAQKAIARNSLLIRSLPEQHVDALLSQAVWRSYDRGETLFLQEEKAQAIHVVIDGWVKLFRMTPTGSEAVVSVFTRGESFGEAVALRNTPYPVSAEAVTPCEVMHIPSPVFVSLMRRDPEICISILATTFGHLHSLVAQLEQLKAQTGAQRVAEFLLELCDCDTGACEVTLPYDKMLIAGRLGMKPESLSRAFSRLKAAGVTVKRNHAEIEDIALLRDYAESD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclic nucleotide-binding protein
publication title Crystal structure of PUTATIVE CAMP-BINDING REGULATORY PROTEIN (YP_165150.1) from SILICIBACTER POMEROYI DSS-3 at 2.35 A resolution
rcsb
source organism Ruegeria pomeroyi dss-3
molecule tags Cnmp-binding protein
total genus 63
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3h3zA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3h3zA01
2L54A 2Y75A 1J0RA 3BY6A 2XUBA 1P92A 1EP0A 4LJZF 3I64A 1PM7A 4UXAA 2JPBA 1ZRDA 5HDGA 4YFKF 2GWRA 1EPZA 2ZKLA 1KQ8A 3EYIA 1FPQA 4LULA 1MZBA 5D5XB 1FSEA 2PQ8A 2NAZA 2VBZA 4BHCA 5ICFA 2DI3A 3GYDA 4HDUA 1OFNA 3SQNA 4ZH4F 1NE4A 3FFQA 3FJSA 1MDMA 1ZNPA 2P7CB 3WG9A 3JW4A 1K78A 1S8NA 3LZZA 4EM0B 2PLYA 2RV8A 1FNNA 5HDKA 4EGYA 5AONA 2V1UA 2O8XA 5DD4A 2R7DA 1BIBA 4ON0A 4XLPF 1OI6A 3SHFA 4YARA 3CTAA 1OKRA 2EFNA 1QZZA 3GFIA 1XE8A 1YG2A 2E1CA 5I8YA 1R5GA 3GW2A 1YLFA 1U2WA 2EFOA 4L5JA 5JSPA 4HSJA 3GFJA 1T39A 4Q0SA 4O3MA 2E7WA 1D5VA 2D1VA 4CXFA 1XGNA 2B9UA 4XSZF 4KICA 3U11A 1J1LA 1HXDA 1J3QA 4PIZA 4L5IA 3EETA 5D5VB 4A0ZA 1L3LA 4Y15A 3CUQB 4HVOA 2W84A 3MZHA 4IF4A 4LG0A 2NNYA 1SAXA 1R58A 2CAVA 4NQWA 1A04A 3V4GA 1AOYA 2BNOA 4ZZDA 3FXUA 4LEJA 3K1MA 4DQ2A 3K0LA 4FX4A 2E1NA 2K0GA 3GXOA 4R8HA 3SCHA 4KIFA 1QO0D 4IRGA 3H7JA 1DZRA 4IJAA 2MLKA 2PMUA 4LGWA 4RAZA 1K79A 2O61A 4AIJA 2QYOA 2V1DA 1TNTA 2LF8A 3BPZA 3BOQA 3CLOA 1XGOA 4MHGA 1UIJA 4MX3A 3J81Z 1U5TB 4FT8A 4M9ZA 2DAOA 1CF7A 4UBGA 1B4AA 4BQAA 3KP5A 4I7HA 4BNCA 3DF8A 1R5HA 4ENNA 4EQQA 1EH7A 1H1IA 3NQOA 1IXRC 2DT5A 5J3UA 1V3FA 3HHHA 3OV8A 4G7OF 4WXDA 1EH6A 1QPMA 4FAHA 1VJ2A 3KEOA 1USTA 4DNCA 3F8NA 1FT9A 4QXKA 1SD7A 4QWQA 2MC3A 3H1MA 4WK8F 5HS8A 4U0WA 4IHSA 3PFIA 2DPDA 4XFFA 2EK5A 3RKXA 1H1MA 3L09A 2FQPA 2P5KA 4RB0A 3IBMA 2A69F 5BUVA 3S7IA 3L7WA 4OIRF 4RD7A 3E6MA 1LKNA 3IDCB 2Q4SA 5BXXA 3VB2A 3NJZA 1E2XA 1ZZBA 1ZZ6A 1SEFA 4IEZA 2XHKA 1I6XA 4WCGA 2WC2A 1CAXB 1Z6RA 3DQVC 5DDGA 2RN7A 4D7TA 2V79A 1O7FA 1HKTA 5A2QK 3QOPA 5LGNA 5JI6A 3R4KA 2GC2A 2E7XA 1SFNA 2GZWA 2DTRA 5D5WB 2PQQA 1NYWA 2XAGA 5HLIA 4WWCA 3LQRA 5D8LB 4YFXF 4ENMA 4OFGA 3LWCA 5FDBA 2RVCA 4BYYA 1ZX5A 1LRHA 4HBNA 2JPCA 3USSA 3KP2A 1U3EM 1BC8C 4ZZLA 1XGMA 2QBYB 5E1XA 3GEZA 2XAHA 5I0UA 3IWZA 5J8CA 3TNPB 1J2XA 3F8MA 3EDPA 3E3VA 3IRQA 3LFKA 3MPBA 5LEJA 4I98B 2IC1A 3WGGA 3S2WA 3CUQA 4D7SA 2CYYA 4GXOA 1J3RA 2XGXA 3ELNA 2CV6A 5FD6A 2GC0A 2LSOA 4HF1A 2K4JA 4YSFA 3V7SA 2VOOA 2ZMEB 1RUOA 4OLLA 3CUOA 3PNAA 1R23A 2Z99A 3R61A 1TQPA 2FSWA 3MYXA 2PAEA 1T38A 1F9NA 5KHJA 1ZGAA 4HZFA 4NVPA 1F1ZA 3MFKA 3MDPA 2W57A 2QLZA 3ECHA 2D5FA 2G7UA 3B02A 4Q0VA 3K2ZA 3OOPA 1QY4A 3WE3A 1QXRA 5F6FA 2PJPA 2X0LA 1GVJA 1JUHA 4PGHA 3GLXA 1IPJA 1U78A 1W7PB 3ZP5A 3WTYC 1TW3A 2IXCA 3CO2A 3SZPA 2F4PA 2MD5A 2IXHA 4BIFA 4XEZA 4NHJA 3QU6A 4M6XA 2P6SA 2Z3YA 4CDGA 2IT0A 3HOSA 1CAUB 4P96A 2FOKA 3P9CA 4L2NA 3VFZA 1IRGA 2O0YA 4LLNA 1FYMA 4Q5SF 1OYYA 3MCZA 1ON1A 2ISYA 3FF5A 3O2PE 5E1ZB 3FM5A 1X7NA 3LA3A 4Y13A 2XLFA 2HKXA 3FHIB 2E9QA 2FBHA 4AVCA 5IT9Z 4MGRA 4KDPA 2GU9A 4HX7A 4PGGA 1UCXA 3IRRA 2VBXA 4JTNA 3UKTA 3BZ6A 4HLYA 1H0MA 4UV9A 1E17A 3HSFA 5FFZA 3RPQA 2UXXA 5LRSA 4QGLA 4UXNA 3HSRA 4XFCA 3E97A 4HN0A 4ZYHA 5FPZA 1O5LA 1XN7A 3I4PA 3U0ZA 3I0TA 4HV6A 5I0RA 2GXGA 4A12A 4MTDA 2I45A 4LUMA 4A2UA 4HF2A 4MNUA 3C7JA 4N9IA 5BQTA 1WI9A 4XLNF 5DV5A 3WTTC 2CO5A 2ZNYA 1IXSB 1KYWA 1SQ4A 5L3EA 4Q4ZF 1O57A 4IEOA 3ZDSA 2MA3A 1RGSA 3C18A 3T8RA 1YFUA 4AQ2A 3KGLA 4ESFA 3RYPA 4KWJA 4EM1A 1GQGA 2IA1A 1O7LA 3GF2A 5KHGA 2QBYA 2PHLA 2Q8KA 1GHCA 3GZ5A 3ES1A 2HR3A 3C3VA 4IEVA 4IRHA 1J59A 3Q9VA 2RNJA 4Y17A 3JSPA 2O1QA 1FBSA 2H27A 4MQVA 2WWYA 4G7HF 4G94A 4FBFA 3KLOA 3P9IA 1FLIA 5BY5A 4KL1A 3KCCA 2ZMEA 3CDHA 3U1DA 1MDMB 5H20A 3EUHA 2RKHA 5HLHA 4E2QA 3ZPLA 1K78B 1YFXA 1JXSA 4QMAA 4EROA 5FCCA 2XVCA 3K1NA 5K5RA 2OBPA 5CVVA 2A6EF 5I0SA 4EJOA 2QNKA 4Q0UA 4XRFA 2D5HA 4XSXF 4BHBA 4EJUA 4LK1F 2QQAA 2OQRA 4YFNF 5AIQA 4XETA 3J80K 2OAZA 1MD0A 1IN7A 1IW7F 2DQRA 3ZMZA 2UY9A 3TNQA 2ZO4A 2Y0MA 1LDJA 4IEQA 3FMQA 1I27A 1YO5C 3NW4A 1QNTA 3IC7A 3NRVA 3DPTA 6PAXA 1X82A 3HRTA 1GXQA 2EA7A 2IP2A 4IPAA 1YW8A 3WTVC 2IA0A 1Q1HA 2A3SA 2XASA 2XAQA 5E8IA 3LSTA 4A5NA 2OA4A 4ZYGA 5BPXA 4LLGF 4F8AA 4RGUA 3ZMDA 3WW4A 2Q0OA 4LG0B 2PG4A 2L3DA 2PMHA 3Q5FA 1TQMA 1J75A 2R7FA 4U0VA 4GGGA 3LA7A 1QXJA 3SXYA 4EV0A 4PDKA 1LR5A 3E5UA 2W25A 1WSUA 4LB5A 2K02A 3EQEA 3M8EA 1RTVA 2ATFA 5IT3A 4A6EA 2GC1A 4UHTA 4IEYA 1I5ZA 3K1PA 4META 1IAWA 4CZZA 4ZU5A 2HGCA 3T1BA 1G6NA 3ES4A 1UHMA 2KJBA 2FE3A 5L3GA 4OU0A 3HHGA 4RB1A 3RYKA 1CF7B 4P9FA 3RTRA 2BYVE 3QPTA 3EJKA 4K8FA 3GFMA 2PN6A 2CFXA 3DN7A 3B73A 1MKMA 3SHRA 1D3YA 2XRNA 3JAMZ 5FPXA 1Q5OA 1CAWA 2HTJA 1FBUA 4L18B 4BHPA 1MJAA 2FNAA 2O03A 1HQCA 3HIFA 2D93A 2EVXA 1GXPA 3CL1A 3BU7A 4M74A 3OF1A 1HW1A 4KN7X 5KHHA 3BCWA 2DK8A 2ZKZA 1B59A 3C1DA 1W5SA 3L9FA 1BBYA 2OZUA 1RUNA 2QWWA 3ERED 4O5VA 2HQNA 3BPXA 2QVSB 2NRAC 1YW9A 3DL3A 2COMA 4M73A 5E17F 5CVRA 3QAHA 2M30A 3ECOA 3CLPA 5D4SA 1V4RA 1QQIA 1UFMA 2BEOA 2VQAA 2D1HA 2K7LA 3BDDA 3OCPA 1T0FA 4XF0A 3ZMTA 3LAGA 5F1RA 4H0EA 4MV2A 2FBKA 1PMIA 3R0JA 3NSTA 3GVAA 3MAJA 5ILSA 2ELHA 1KGSA 3SFZA 1BM9A 5C6CA 4PIXA 1ZZ9A 4L11A 3G3ZA 4EJWA 4MGKE 1B1BA 1EH8A 4F7ZA 2PAKA 2EV6A 2ISZA 2JZYA 3IWFA 4MH0E 3GX4X 2GAUA 4ETSA 1S3JA 3WW1A 3H3ZA 1L0OC 1UB9A 4KUMA 5EFUA 5T3NA 2DO7A 3D0SA 3HOTA 3LOIA 4HN1A 2ESNA 3NKTA 1TBXA 5HI0A 4BAYA 1FZPB 1KU9A 4IRIA 3H8UA 3S0MA 2FXAA 3LAPA 2DCTA 2KJCA 5BOXA 2ET1A 5CJ9A 3V7RA 4G6DA 4HF0A 2CGPA 4A0YA 1PP8F 2FA5A 2NS0A 1WA4A 2Z2SB 4M6YA 3F8FA 5ICGA 2HS5A 4AQ6A 2BBYA 5J48A 3IHUA 1KQ9A 2ZFWA 1EY2A 2HDCA 4AIKA 2F5CA 4TLFA 2LNBA 4E2SA 1JHFA 1RNLA 4JVAA 3OTFA 2QQ9A 5FGMA 3J81K 2VE8A 5JAXA 4LA2A 2Q2EA 2XIGA 5JHUA 4IXAA 5JR3A 3CF6E 1Y9QA 1XMKA 4K2EA 3W6JB 4L9TA 2H09A 1OMIA 3KETA 1CAVB 2VC0A 1Y0UA 4UV8A 1ZVFA 2P8TA 2VC1A 4L9JA 3ULQB 3E6BA 1IUYA 5CU1A 1DP7P 2GC3A 4I01A 2R3SA 3O14A 3RPUA 1JHHA 2JTVA 4YRDA 5CADA 1FY7A 1LEBA 1WQ2A 4AWXB 1IN5A 5E20A 5D5UB 4JK1X 2BE5F 1Z6TA 3DKWA 3FM3A 1SD4A 2VONA 4HSLA 3RI4A 4RB3C 4QGMA 1SMTA 3JZVA 3MZYA 4Q48A 3JTHA 2KRFA 2Z69A 2FNPA 3F21A 1GQHA 2L4AA 4XFAA 2NNNA 1ZAOA 3TQNA 2GA1A 1W7PD 4A6DA 4G9YA 3P7NA 3DXJF 3BJAA 3ABUA 1ZN2A 5HLGA 1J3PA 3HRSA 4GCVA 4A5MA 4HX8A 1J9IA 1RC6A 2FEZA 5HVQC 1MGTA 5FLXZ 4KFCA 3KSCA 1YLLA 3WW2A 1OYIA 2V1XA 3LA2A 1XD7A 1R7JA 5C8WA 4PIYA 4O9GA 4ASNA 2B0LA 2EA2A 5KHIA 5HS7A 5FLIA 1QGPA 4IVNA 3J7AO 4Z82A 5JCTA 3H1WA 4NB5A 2C0ZA 2DW4A 2OYZA 3T0YA 3AAFA 4R79A 3GZ6A 4KYWA 1CGPA 4HQEA 3VOEA 4X6RB 1FI2A 2M8EA 2TDXA 5I91A 2KKOA 3HYIA 3RDIA 4R52A 3GO5A 1FP1D 1O3RA 3ABTA 2ACJA 4B8XA 2OZJA 3WGIA 4PZJA 3IIAA 4I3PA 3BPVA 1ZLKA 3KP3A 3RYRA 1BIAA 4X6QB 1BI2A 1IN8A 2A07F 4S05A 4G7ZF 3JTGA 1HBXG 4GYGA 3QPHA 4IHTA 1UD1A 2XAJA 4QLCU 1MJBA 4WX9A 1AWCA 2EB7A 5D1IA 1WWXA 2H94A 4LB6B 2KXLA 4LLOA 5AVPA 1ODDA 1PP7U 2PI0A 3RKYA 1XCVA 4P9UA 4U88A 4CICA 5CVJA 3F6VA 3HRMA 2XL7A 3FZ3A 3R6SA 2STTA 4J1WA 5I0TA 1XGSA 2PFBA 3WTWC 1HSJA 1ZH5A 1CAVA 2O6GE 5E18F 1XSVA 2CG4A 3P9KA 3H92A 2Z5UA 1ULYA 2K86A 2DFIA 5I8TA 2P7VB 2VE9A 5JR7B 1K7AA 5ILUA 2VT2A 1OD5A 3MQ0A 4U7BA 2LKPA 2FRHA 4CYDA 4N0BA 3DP7A 4M9SA 3BJOA 2HYFA 2CSOA 3KFWX 2UYAA 4A0XA 1QWRA 1G3TA 5H6RA 1XSXA 2IVMA 2HKOA 3CJNA 1OYWA 5LBQA 1O3TA 1ZRCA 3KZYA 5HOOA 1EV7A 1LQ1A 1FYLA 3RKWA 5JFRA 4KT5C 3I53A 4E2GA 5BV6A 5K5QA 2ETHA 2L02A 5DYMA 1SFUA 3ZMSA 2RDPA 3E5XA 4I09A 3T5XA 4AD9A 2W24A 4RGSA 1R36A 4GO1A 1P6RA 2IA2A 1Z1DA 2GXBA 2JSCA 4EJTA 2JRTA 4BXUA 4MEYF 4HMZA 4XF3A 2AXLA 1CAWB 3GFLA 3PVBB 1XRUA 3REOA 3LQQA 4JQFA 4HVQA 4KWKA 2EWNA 1JE8A 3BP8A 2FMYA 1S6LA 3CJXA 1PUEE 5K8SA 5KK1A 2IXKA 2F5DA 3M3IA 5FLHA 1S29A 4HLTA 3TDUC 2OQGA 2VPVA 3WTUC 5ED4A 4OMZA 1O3SA 4KNYA 2QZ8A 4IEPA 4UVAA 5KVRA 3I59A 3TGNA 3L00A 4HAMA 4HW0A 4P55A 5J8FA 1ZGJA 2H6CA 1ZARA 4ZYEA 2DLLA 2B8MA 3WE2A 3V8JA 2GH2A 2EFQA 3I54A 2ET7A 5EZWA 2UY8A 4JTOA 2HQRA 1BN5A 5FLJA 1ZZ7A 2PEXA 3BWGA 3I71A 3WODF 2XAFA 1FOKA 4XBFA 2WFPA 3GWZA 3O6BB 2ADUA 4P5OA 1XCBA 4HVRA 3R0AA 3R60A 3ACLA 5I8SA 1XMAA 1IPKA 2J5PA 4I02A 1ZRFA 1YUDA 4CO8A 2EV5A 3ST7A 2YU3A 3KLNA 3QRFF 1O5UA 2HZTA 4WXCA 2VT3A 1VTNC 1V70A 2Y0OA 1FXZA 5BPDA 2P17A 1DPRA 3N4MA 4L9VA 4XF1A 5CYVA 4XF9A 4UNOA 4RB2C 1K6OA 5KBFA 2DK5A 2VECA 1YS7A 3VHRA 4O6JA 5BPIA 2F5EA 1R00A 4LTAA 1W4MA 3ROUA 1TQIA 1J7KA 4HYEA 4KWLA 3CEWA 1H9TA 1DPUA 2MNGA 1XB4A 1H9GA 3K69A 5D8KB 4L0YB 2BNNA 2F5FA 2CAUA 4BH9A 1TTYA 1BI3A 3FMRA 3L2CA 4H7LA 2C6YA 5HS9A 4GYIA 4RAYA 2V09A 3KZZA 4MZUA 1LDKB 5K1YA 5D6FA 3V8LA 1XDSA 2W85A 3H7YA 1FBQA 1YQAA 5BMZA 4CGZA 5LHHA 1FWZA 4LUKA 1HW2A 1CX4A 4HBLA 4WF2A 5CVIA 5ICEA 5TRDA 2MH9A 1UHWA 5D4RA 3TKYA 3JAMK 1LB2A 2VOPA 2UYBA 4EGZA 4PJYA 2O3FA 4Q0PA 1IZ1A 1ZLJA 4KN4X 4I2OA 4HOBA 2Q0AA 5L3DA 2KIUA 3F72A 1TQ5A 3KP6A 1YFWA 4EWAA 3FE5A 2YR2A 3F6OA 2ETEA 1YS6A 1NZCA 4YYOA 2P4WA 4LK0F 4TV7A 2FF4A 1HSTA 5LRRA 5JSOA 4YIIA 4KU7A 4KIGA 2DBBA 1ZG1A 4U0YA 2YSRA 3I7DA 1QZYA 3G7DA 1HKQA 2Z9OA 3IKVA 1B9NA 3H9AA 2V9VA 4GULA 3L2HA 4XFBA 4RGRA 1QBJA 3V7CA 1OPCA 2PA7A 2MH2A 5D6EA 4N9HA 1FC3A 1ZZ8A 1S7OA 1X3UA 3LAJA 4MGYE 2OU2A 1ZHFA 2BNMA 3D5LA 4DINB 5FQ0B 3PQJA 1XSDA 4HLXA 2FMLA 2FU4A 3HUGA 4ZU4A 2OPKA 4Q0QA 3ZMUA 4M9XA 4OOIA 5DUKA 3COAC 1J58A 1BJAA 4Q29A 3LWFA 2A5YB 3H1YA 3NVCA 3F23A 2RQPA 4HA8A 1FP2A 3ZMVA 2AS5F 2IJLA 4G6QA 4D0PA 5KHKA 3M7GA 1DGRA 2UWMA 4MUVA 5LGTA 2ZCWA 3RNSA 1LEAA 3RIRA 4G8XA 1SFEA 4QM8A 3FZVA 3DPLC 4ONUA 3ZN1A 3WGHA 4HQMA 3TO6A 1DZTA 4UUVA 2WTEA 2P5VA 1KU2A 2VN2A 3FXQA 1REPC 1RZ4A 3QP5A 2PFWA 2EFWA 3WW3A 1KA8A 1BC7C 4OINF 2V6CA 2MHFA 3NL1A 1UIKA 5F64A 1ZG5A 1DGWA 1U8RA 1Z9CA 4I0AA 1T6SA 5H6QA 2QDRA 3FX3A 3FMSA 5J7MA 1SD6A 4Q47A 2XLGA 3F3XA 1P2FA 2QJVA 2ESHA 2KIMA 1HKSA 5DCMA 2M1BA 3ETQA 3MEXA 1TNSA 2G9WA 2XL9A 5L3BA 2ZXJA 2A68F 2A61A 3E5QA 2H6BA 1W5TA 4OIQF 3H3UA 4S04A 5CVUA 3O3KA 3EYYA 3M9AA 1I1SA 3WTXC 1ONVA 1B9MA 4HDVA 3VODA 3PQKA 1LJ9A 3ZQ7A 2XROA 2QCSB 1G3WA 2DQLA 2P6TA 3EO6A 4OIPF 4UVBA 4FX0A 1Z91A 1WGPA 2CWEA 1MJ9A 3GYHX 3BB6A 2L01A 3HQXA 1LNWA 3PLQA 5JSRA 5FFXA 2M87A 1RI7A 1VP6A 1ZYRF 2EJRA 4WZCA 2P5LC 2Y48A 2QQBA 3D0JA 3Q9SA 3SXWA 2IXIA 5LGUA 1O4TA 1KYZA 1R1TA 2Q30A 3RZZA 4EM2A 4IETA 2Z33A 5DD8A 2DU9A 4KMUX 5A2QZ 1UW8A 1U6GA 3SCGA 2D40A 1X8MA 3UKNA 4ENJA 4XF4A 1STZA 1R1VA 5FQ0A 4AVAA 2GA2A 5I93A 3HTUA 4OMYA 1UPIA 5FLXK 1KU3A 4MQ9F 1R22A 1VR3A 2FBIA 3WU1B 2L4MA 5LHIA 3U10A 4LMYA 3I59B 3E6DA 2PBIA 1Z7UA 2IRFG 5LLQA 2G7HA 3RJPA 2CW0F 3M8FA 4KA4A 1FSHA 5ICCA 3DEUA 3WTSC 2HWVA 4WBBA 2B5HA 2VODA 5DCFA 2O8QA 2KIFA 1SD5A 1X8EA 3SCFA 3WU0A 4ORFA 1IN4A 3F8BA 3IDBB 4RS8A 4ZYDA 4QX5A 4HV5A 4KMFA 2H0VA 5TJJA 3DFGA 4ENKA 4YNIA 5E8GA 4EJVA 3H50A 1BOAA 3UKVA 1TLHB 4J1XA 3HTSB 1JGSA 4AIHA 1P4WA 1RL3A 5CLSA 3SMHA 1Y3TA 3T8TA 5L3CA 4B29A 5EEGA 3E6CC 4ZU7A 3CO7C 1U5TA 4EWEA 3TOAA 1NHAA 3ZN0A 4IESA 4JBAA 2HEOA 3V8KA 2OD5A 1D8KA 2IXJA 3ML6A 2UZKA 2FQ3A 1YIOA 2M45A 4LD5A 4M72A 2PYTA 1T98A 4FAGA 3HSEA 1KU7A 1SFXA 2PHDA 5IT9K 1S7AA 4EWDA 2XKPA 5EEHA 1LDDA 3TOBA 1T2KA 4XFHA 4RGXA 2HFHA 3U9GA 2XV4S 4JV4A 4EMSA 3IL2A 4WVZA 1YYVA 3KP7A 1Z05A 2QM3A 3M70A 4KIBA 5LHGA 2HTSA 4U7DA 4PCQA 4IERA 2IW5A 2EFPA 3FHZA 1USSA 3M1EA 4UVCA 4ESBA 3U2RA 4YIFA 2X4HA 3BJ6A 5DEQA 3MWMA 1KQ0A 2YPRA 1DDNA 2LDUA 4AVBA 3EHKA 1CAXA 5E1WA 1L3JA 2IXLA 5DUIA 2UXNA 5ILVA 3DV8A 1EYBA 2EA4A 4CHUA 1BI1A 4QGNA 1DUXC 5LEKA 4LA3A 3N97A 2GQQA 2HYGD 1C0WA 2XKOA 2RGVA 2VBWA 4ESJA 1G3SA 4L0ZB 2BGCA 4IEUA 3BROA 4Z2YA 3ISPA 5K5OA 2QVOA 1J5YA 2VXZA 1LVAA 3I58A 3FXRA 1I1GA 3QACA 4MGIE 1HW5A 2DPUA 2ZNZA 2K27A 4AVPA 4XFIA 1YTYA 1U12A 3TO9A 1F5TA 1FYKA 1ZRRA 2QENA 2F2EA 3EQLF 2OA2A 4O9EA 4M71A 1ON2A 4L9NA 4YG2F 5FB2A 5E16A 5AIPA 4UBHA 1R1UA 3OD0A 2HOEA 2D45A 1G4DA 1NXMA 3IKTA 5FD5A 2GIVA 2N7GA 3G73A 3QP6A 1SMYF 3W6KB 2WV0A 1F4KA 3K9TA 1OR7A 2YX4A 1ZZCA 4FHTA 4LFUA 1UCRA 3GUDA 3NEUA 3ELKA 2K9ZA 5FO5A 3WTZA 3TO7A 3CO6C 3S7EA 1IN6A 2D2WA 3C3WA 2PAMA 3GBFA 1ZG3A 3J80Z 2CQKA 1NE6A 1ZREA 1Q3EA 1W7PA 4AXOA 3BALA 4E70A 2A6HF 1PDNC 1YW7A 3JSOA 4P9GA 4IEWA 2ZJ2A 2Q1ZB 3F22A 2RC4A 2VBYA 1D8JA 4Z07A 2IPQX 2PTMA 1RIOH 4WXHA 1WLTA 1BI0A 1FX7A 1CAUA 1YFYA 3TDZC 3KP4A 2LF7A 4MGZE 2XLAA 1O3QA 2YX7A 1IRFA 4QM9A 1Q43A 5ERIA 1B6AA 1WKMA 2QUFA 5L3FA 2STWA 3CUQC 3HT1A 2OZ6A 3KEQA 1YFHA 1IF1A 2NYXA 3HRUA 1YWKA 2MPFA 4MEXF 4IEXA 5JVTA 3QU3A 4OIOF 1YHFA 2M5WA 3EBRA 4LLLA 1IXCA 2J5OA 4XFGA 4EVIA 5E1RA 3I5UA 1P4AA 3FWEA 4R1HA 4MTEA 4KU8A 5BS6A 3OGJA 5HDNA 5DCMB 2HJIA 3F8CA 5J6XA 4HX4A 2ZBKA 2BV6A 3KE2A 2EV0A 2MLGA 1G3YA 1XDUA 3VEPA 1XE7A 2EAAA 2JT1A 1P4XA 1U5TC 1WRJA 2K4BA 3D82A 2MBFA 3KMHA 3HT2A 4B09A 1TW2A 3SZTA 4I0BA 3KGZA
chains in the Genus database with same CATH superfamily
2L54A 2VTFA 3I3MA 1H8TC 4COZA 4UXAA 3GJBA 1MS1A 2ZSHB 4YZ4A 1ZRDA 3O0WA 4WVVA 3QD6A 4YFKF 1RUD1 3TBIA 4LBLA 1KQ8A 4AFCA 3EYIA 1QEXA 1R1ZA 5B1AH 2MW8A 4BHCA 5LA0A 3ZSKA 5IOYA 5J4VA 3TN93 3U37A 2D3RA 1E3PA 3FFQA 3BG7A 1MDMA 4IV3B 2BVMA 1ZBE3 3OYKA 4CYCB 3WG9A 4B44A 3THPA 3JW4A 1ETYA 4EM0B 4E7HA 2WAEA 1FNNA 5AONA 2V1UA 2VNRA 5DD4A 4F3JA 4LBQA 3CLQA 4ON0A 4XURA 1V6KA 4YARA 1OKRA 3VYTB 1YLFA 1ZTRA 1U2WA 3JRHA 2BXZA 3NRUA 4NJ4A 4L5JA 1TMF2 1ACIA 5JUVA 3TMOA 4HSJA 3IMMA 3JB4C 3N9PA 4XIOA 5F2WA 1US3A 4P9WA 4OHYA 5F32A 4X8NA 1D5VA 1REFA 5IK5A 5HXMA 2B9UA 2YU2A 3WT3A 3HJEA 4CXWA 1LOBA 1HXDA 4IQJA 1J3QA 4D94A 4PIZA 5C33A 3ZFFA 4A0ZA 2OIIA 3CNAA 2RDNA 1T95A 1R58A 4XJAA 4NQWA 3MI8A 1QGLA 4M3CB 4PQQA 2G0EA 1UOJA 1R1A2 4LEJA 2XJTA 3OEAA 4FE4A 5GADJ 3BZCA 3A0KA 3MW3A 4LQRA 1QVUA 1RUG3 4CCCA 1ASJ2 1PNFA 3SCHA 4JX6A 2VZOA 1BBT2 4LGWA 1K79A 2QSFX 3LB9A 4NUBA 3D3AA 3BOQA 4BY1J 3BIWE 5E89A 4XKVA 5APAA 4XONA 5LZ6A 2GP5A 2IS6A 4GWJA 1DLCA 4UBGA 1GNHA 3PVEA 4ENNA 4EQQA 4COVA 3MD2A 3O1VA 5DMYA 3RWNA 5IP7J 3ZQLA 3AMPA 2F6CA 3CCVI 1LULA 3OPWA 1GICA 3KEOA 1RXGA 3LSGA 3FXJA 5KXEA 5C4JJ 2D98A 2MC3A 4U0WA 2QQUA 1RUI3 2K9QA 1BEV3 4V2VA 3AMNA 4XFFA 2EK5A 2WZR1 4AQSA 4RB0A 3IBMA 4HKWA 4A44A 4MGTA 1JOBA 3L7WA 4AVZA 4CEWA 2JJ6A 1I50J 5JHFA 5E6HA 1OCZH 1CN1A 4MYEA 5F8PA 1BA5A 3LSRA 1VRH1 1E2XA 1ZZ6A 1SEFA 4IEZA 4IE6A 1VQNI 3R4DB 3WF3A 1O7FA 2M3AA 5F3EA 3R4KA 4NIGA 2E7XA 1SFNA 2DTRA 1QA6A 3AP4A 2DA5A 3ZSMA 4WM8B 3F9KA 3TW7A 3LWCA 3LEGA 4LO4B 4BYYA 1LRHA 2DCYA 3USSA 2IUWA 3DEMA 3MHZA 1BC8C 1POGA 4FXKB 4RQPB 5E1XA 4NWWA 2XAHA 5I0UA 4IHXA 2WN3A 1UY4A 2RS11 5C71A 2XB6C 3NV1A 3AJYA 2IS2A 3IRQA 2HEYF 2R0FA 5IP6A 3D6EA 4XPVA 3I2DA 4M3BA 5A1LA 2DOEA 3S2WA 3ELNA 3M4FA 5FD6A 2GC0A 2LSOA 4YSFA 4OLLA 4W50A 2JG9B 2ZTNA 1FTTA 2PAEA 4EN0A 5HV4A 1R083 3AMQA 3VLBB 3OYFA 4A7KA 4XNFA 5C7GA 3VZLA 2AREA 4LOCA 5FJKA 2RQQA 4AGRA 1X1PA 1TME3 3N9NA 1VBC2 1IPJA 1TW3A 5FUIA 2PXJA 2IXCA 3A7QA 2IXHA 2DTZA 3ECQA 5J1XA 3LGRA 2E7AA 4M6XA 2Z3YA 5GAGJ 2IT0A 4B7KA 4CDUB 1CAUB 4P96A 4JRLA 1QF3A 1RC9A 4H4KC 2V4AA 2GOXB 1FYMA 4AFAA 4GWIA 4C91A 1OYYA 2ISYA 3FF5A 4AEDB 1D0ZA 5E3LA 5HXVA 3AL6A 1WI3A 3FM5A 3WNKA 1X7NA 2XLFA 2HKXA 2E9QA 1OLQA 4QHOA 3CC4I 1OXCA 3JD71 2GU9A 4PGGA 1UCXA 4JTNA 1REEA 2JDMA 1KS4A 3LD8A 4GH4C 4HLYA 4UV9A 3ME2A 2DCZA 1ETOA 3RPQA 3MW4A 2HDDA 4TWTA 2NM1A 4AF9A 1AYN2 4XFCA 4ZYHA 4FSJA 5FPZA 3I0TA 4HV6A 1OCCH 3M3CA 1JI8A 1AA7A 1H1AA 4LUMA 3GZNB 2CUZA 1GZCA 3RZMA 3IH3A 3WTTC 1OF4A 1YITI 1TWCJ 2RJKA 5JXJA 2B45X 2ZNYA 1IXSB 4Q4ZF 1WCDJ 4NPLA 2MA3A 1RGSA 2WFF2 1YFUA 3VDCA 4BXXJ 3RYPA 3DUIA 2IA1A 3GCMA 2JVHA 3OYLA 1W6QA 2Q8KA 2HPIA 2HR3A 2DDUA 3ZN4A 3C3VA 1SCRA 4IRHA 3W6VA 2LR8A 4M6VA 2RNJA 3MIDA 1Y1VJ 4Z2AA 4UUSB 2DUQA 2ZEYA 1Z0XA 4G7HF 1BVVA 1MS8A 2O8OA 4AIDA 2WYSA 3CDIA 3KCCA 3U1DA 1MDMB 2VKHA 5CKQA 3ZPLA 1Z7S2 4WM7A 4YZ5A 1JXSA 2L2OA 3EMRA 4EROA 2NXNB 2R073 1W0PA 3PJQA 4Q0UA 3RI9A 1JS9A 2AUYA 2D5HA 4LBQB 1N1SA 2QQAA 1XXNA 2VXDA 2OQRA 3BR0A 3U1KA 4NIIA 4ES8A 1DG6A 5BNOC 4D6RA 3J80K 3CCYA 1MD0A 1IW7F 1K3IA 2FCVA 1A6CA 1NA1C 3TNQA 2Y0MA 3UKGA 1YO5C 3CCQI 3OYGA 3DPTA 3RZLA 2WSVA 1S2BA 3R4UA 1GXQA 2IP2A 5F37A 3WTVC 2IA0A 1Q1HA 1TMF1 3QH6A 3GZUC 3J7ZI 5FP8A 4EEFG 3RZDJ 2CS3A 3LPGA 2VCMA 5BPXA 5CFCA 3WDYA 4M3DA 3RWKX 3GCWA 4LIUA 1NCRC 3K2OA 4LLFA 3HEIA 1FMD3 2L3DA 2PMHA 3M3OA 5K7PA 3LA7A 1GWMA 4LHLA 1GT0C 4EV0A 4C90A 2FDFA 3PM1A 3E5UA 2XJUA 4LB5A 1R1A1 2K02A 5F6KA 4A6EA 1ASJ1 4IEYA 3RI8A 1NQDA 1LE8A 2VIXA 1PJRA 3TBDA 1G6NA 3KT7A 1UHMA 2KJBA 1OPOA 3ZIWA 1D4M1 1SFYA 5L3GA 1V5EA 1X1CA 3RTRA 1SFOJ 1RUF3 4WVWA 2JA2A 1D3YA 3HOBA 1H88C 3WQBA 2L0KA 2AEZA 1CAWA 2P34A 3EXUA 1FBUA 4H7MA 3C2BA 4L18B 3W21A 2CUJA 4XQ4A 3TN92 2EVXA 3BTIA 4XJ9A 2XJPA 2XBO1 3BU7A 3OF1A 3ACGA 4QXBA 1W6NA 1ZBE2 3BCWA 2DK8A 2K46A 1B59A 3H3VK 4B1MA 4LMFA 3BUCA 2VNVA 2RREA 3WF2A 5K7FA 2QKDA 4RBOA 2EBIA 1BBYA 5JMOA 5GM0A 2VNGA 2X5IC 2GBYA 2X1EA 1VQOI 4MLOA 3ERED 3OIOA 4NRPA 4B1RA 5FTTC 4LO7A 1WLWA 1VE0A 1VQ9I 5FKNA 1ETKA 4CEWB 2GALA 2QVSB 1YW9A 2EIJH 1LGBA 4FCYA 2PMZA 1IV6A 3WNPA 5JOXA 3ECOA 1QJU1 3MZ8A 4FFIA 1KRIA 1UYZA 3FL7A 2ZS6B 2BEOA 5A3TA 2KDOA 1UU5A 2AH2A 2DVFA 5F1RA 5JWPA 4H0EA 5FZLA 3DWLE 3GVAA 5FY8A 3SFZA 2PLV3 1HV1A 3G3ZA 3ZOIA 2LKSA 5G05L 4MGKE 4CP0A 3OD4A 4MADA 1EH8A 1DGRM 4F7ZA 3AL5A 4OQ9A 3KCYA 1X36A 1RUG2 2GAUA 5FYYA 3VBFA 4XMYA 2FD8A 2DO7A 3MKWB 1OLME 2WB1A 4HN1A 5LBCA 3NKTA 5HI0A 3A2KA 4QQLA 1D0XA 2VOWA 3ZVXA 3S0MA 2ZZQA 4Q4X1 4NMIA 2DCTA 4UB6C 5BOXA 3BG6A 4R9BA 5FKBA 4HF0A 5C8CB 1OCTC 2GP3A 1N75A 4CCEA 3WF1A 2CJJA 2R30A 4GQ7A 3IHUA 4G9SB 3KQ4B 5IK4A 1JHFA 2RR13 1JHJA 2PELA 3OTFA 2QQ9A 3ZKYA 4M0HA 2VE8A 3PSFA 4CSWA 4YVWB 2XIGA 1RUI2 4IXAA 1BEV2 2VTXJ 1MS0A 1PVC1 4K2EA 1V6LA 3SISA 1OMIA 3CF2A 2NPIA 4BDZA 3FFZA 3NAUA 5D8AC 2VC1A 4L9JA 3B3QE 2R32A 3CZUA 4LKDA 1N77A 4G12A 1UL9A 3M8JA 4ZONA 4EZHA 5CADA 4ZDPA 3OY8B 2E53A 1UYXA 1IN5A 1QVTA 2CWSA 1OOPC 1HLCA 2VKEA 5IYDJ 2BHYA 1IRZA 2VONA 2HEVF 5E3OA 4DUWA 1OUSA 4Q48A 1X2MA 3TL4X 2FNPA 4YZ1A 1RHI3 5JLVA 4XDQA 1AYN1 4AWDA 4JZRA 3PIGA 4XKWA 4A6DA 3R0RA 2XJQA 1DP3A 3P7NA 3LSHA 4ABZA 2H1LA 2ARBA 3K77A 1V5FA 2VUCA 1R091 4KWUA 2WFF1 4NBQA 1RC6A 1W6QB 5IATA 4P9JA 5ACA3 1MGTA 5FLXZ 1WMXA 3WP6A 4DXTA 4IGQA 4QQHA 1X4PA 1R082 2ZGPA 4ASNA 1K5MC 2EA2A 3CMEI 5FZFA 3OYJA 4XCAA 1VFCA 3S6PA 4CEYA 3T30A 1TME2 3T0YA 2OYZA 4R79A 4KYWA 3I97A 1F15A 1SHWB 3I3EA 1JW6A 5JR2A 4XLHA 1UOBA 4JKMA 2R16A 4DB5A 3LSJA 4I3PA 1HRI1 1ZLKA 3BYWA 4X8PA 1EA3A 4X6QB 1IN8A 5A1FA 2JIJA 3U4XA 1H2MA 4HNVA 5B5EC 5FO7B 2VJXA 3QPHA 1ZKGA 2H1KA 3K7AJ 2EB7A 5D1IA 4BDVB 1QNYA 2KXLA 4ZTJA 2PI0A 3RKYA 1J83A 3HRMA 2XL7A 3FZ3A 3R6SA 3UGFA 4J1WA 1XGSA 3WTWC 1HSJA 2KQRA 2Y9YA 3TYJA 2O6GE 3LIGA 5LY2A 2YU1A 1JYWA 2LKXA 4A3JJ 5CFCB 4XLAA 4XL9A 2Z5UA 1C28A 1ULYA 2DFIA 2VCAA 2DFFA 1MH3A 2VT2A 3MQ0A 1SBDA 5H9QA 3N36A 4E7IA 3W3CA 3BJOA 2J1VA 1XMXA 2CSOA 4OMCA 4QPIC 3CQOA 4JQTA 1XSXA 3MVPA 3AM2A 2HKOA 3BG9A 5DTDA 5FZ4A 3SKJE 1LQ1A 5JFRA 2WZ8A 3KT1A 1LE8B 2DVDA 4LBQD 3HPNA 2L02A 5DYMA 1SFUA 4CCJA 4I09A 3ZQHA 3LFUA 4AD9A 3P5BA 1K4SA 3WY6A 4Q27A 4D6SA 2GXBA 4Y5Z0 2JSCA 3LPFA 4DPNA 1FATA 4XF3A 2VUDA 2R7EB 4I30A 1CAWB 3ACHA 1PGL2 1GWKA 4A3DJ 3PVBB 1FJLA 3ZXGA 1FOD1 1K6YA 4KBZA 2JECA 1W6NB 5JVVA 5F08A 5KK1A 2IXKA 4MXVA 2F5DA 3M3IA 2R072 4RA2A 4Y1VA 5C3EJ 4IKFA 2XRLA 1O3SA 3JXSA 2PQSA 2ZAHA 3WINE 2VTXA 4XACA 3TGNA 5LBBA 2QKLB 1MPXA 4RR3A 5FK8A 4L0PA 3KV9A 3KEYA 1ZARA 1GZTA 4ZYEA 5EV7A 2DLLA 1JKRC 3WQ7A 1FIPA 3WE2A 2GH2A 3L2UA 2IZWA 5CKTA 3JBG3 3JB8A 3ZMOA 1Z0HA 1V6JA 4GALA 1JZ4A 2WQ8A 4E7JA 2XAFA 4HXCA 3OY9A 2JD4A 3VZOA 1ETQA 1JT6A 1FOKA 4IW3A 3JQXA 3O6BB 4KG8A 4DXZA 2BOLA 1XCBA 4HVRA 4CDWA 1XNCA 1N1VA 5I8SA 1IUFA 2DA1A 3PTRB 1FMD2 4MXWB 2LOOA 2NOJB 1ULOA 1PO21 3B93A 2VZQA 4CO8A 3KLNA 1QJZA 4E9KA 3AKTA 1V70A 5GLUA 1FXZA 3VL8A 3VBFB 4LBNA 5M5WJ 2J1AA 3SH3A 3GTMJ 5A80A 1K6OA 4FFGA 5DAQA 2R0HA 3LSMA 3ZFEA 3KGZA 1J7KA 1D0YA 4G6TB 4KWLA 1OCOH 2NMOA 4C1WA 2MNGA 4N90A 4KNCA 1XB4A 5IP9J 1RUF2 5D8KB 2F5FA 2CAUA 3URFA 1TE1B 3POFA 5HS9A 5FZ7A 1DU6A 1YQ6A 4K20A 4PSWA 5HCHA 4YGCA 1FBQA 2GM4A 1YQAA 4DGWB 5BYNA 1SLBA 2J1UA 5LHHA 2R043 1PYVA 4HBLA 5CVIA 5ICEA 5DAPA 1HIXA 2RVAA 3I2JA 1AHSA 4A3CJ 3TKYA 3LSPA 3VHPA 3ASIA 2ZJCA 2W47A 3ZKUA 5J36A 1A3KA 2O3FA 4Q0PA 1IZ1A 1IDYA 1Z7LA 1ZLJA 2X6XA 4KN4X 4I2OA 2Q0AA 2QBXA 3GMEA 1AR82 1PHMA 3RSJA 3AFHA 3KP6A 3H35A 4BQ4A 2YR2A 3F6OA 3V64A 2PLV2 2XXZA 2P4WA 1R6RA 3OYBA 4JP0A 1PM4A 4LK0F 2CYFA 3SKVA 2DDBA 3D5SC 5JSOA 2X6WA 3LNQA 3C2HA 4DNYA 2WV1A 3N9LA 3HNBM 4XORA 2Z9OA 1UWWA 1B9NA 4M0NA 4GULA 3D4KA 5AC91 3NV2A 1DFQA 1QBJA 3V7CA 5D6EA 3HWJA 2A7AA 4RGKA 4CCOA 2CQQA 3LAJA 4B48A 1UMZA 1GVDA 2OU2A 4LNVA 2BNMA 2ZXWH 2WY7Q 3N7JA 1AF9A 2A6VA 5FPUA 3HUGA 2M4GA 2E6VA 3AZZA 3M3EA 3B94A 2OPKA 3ZMUA 1H9PA 2RS52 3H9QA 4OOIA 1AR63 3M1CA 1BJAA 4Q29A 1NG0A 4CDQA 1NLQA 3LWFA 4HA8A 2JE7A 2AS5F 3WNNA 2TEPA 5KHKA 4Y20A 2BVLA 1I39A 2UWMA 3BCBA 4MUVA 2RR12 1M4WA 2ID4A 3RIRA 4W65A 4RQPC 4QM8A 2FDJA 4R4ZA 3I2FA 1JZ3A 3AG4H 3PU8A 2K9LA 4HQMA 4IQ4A 2WTEA 4IUGA 2ELKA 1VMJA 2KP6A 4GWNA 4XUOA 4Y5SA 1GU3A 3RRDA 1AXKA 1REPC 4LPLA 3QP5A 3OGRA 1X50A 5F39A 2EFWA 3WW3A 5GAEJ 2V6CA 1OR7C 5H6QA 1U8BA 4Q47A 1VB2A 3N7LA 3NWSA 1HCRA 1CZTA 2ESHA 3SJMA 3MEXA 1RMU1 2ZXJA 3MIFA 4A4AA 1WCMJ 1X3ZB 1IG3A 1K83J 4OIQF 3H3UA 3VBHA 2D6PA 1DZQA 4S04A 2QFEA 3O3KA 1RUE1 4X0GA 4PFOA 3N7KA 3WTXC 1RHI2 2YROA 3KQRA 5HNFA 2M9HA 4FTBA 3ZQIA 2WR9A 4R9CA 2P6TA 3VZMA 4FX0A 4CDUC 3SEZA 1WGPA 1TT0A 5HODA 2Q8CA 1RI7A 5LA9A 4FFHA 4AEDC 2P5LC 4LHSA 3HBZA 4IGOA 5C9AB 2Y48A 2VCBA 5ACA2 4Q1PA 5L36A 2XR4A 3SDBA 4HL0A 1KYZA 1PIV3 1VBD1 2Q30A 2P1BA 3RZZA 5FRMA 5FZ9A 2KD7A 4LKFA 1BVP1 4IETA 2LH9A 5B2GB 5DD8A 5E8AA 3WD5A 1JJ8C 2ME6A 4G4FA 4LKEA 1I3HA 4ENJA 3EYPA 4XF4A 4KH9A 4AVAA 4ZXEA 1H6YA 4OMYA 4YG0A 2CY6A 1VBE3 1OD3A 4ZKTB 1KU3A 2W68A 1VR3A 3WU1B 4XOPA 2E32A 1YI2I 3HOWJ 3B6CA 5LLQA 2CW0F 2DA7A 5J1UA 5ICCA 3DEUA 5ANNA 3UNPA 1L7QA 2VODA 3HOYJ 4IOAF 3L2YA 3PIJA 1MBGA 3F8BA 3WOGA 4WV8A 3AG1H 4AI3A 4QKBA 1IS4A 1ZRIA 4BOWA 1YJWI 2JDNA 1QDOA 3T4VA 3H50A 2Q1MA 2L7ZA 2QQ8A 3E0JB 2VXJA 3SMHA 3K4NA 1QPIA 2WSUA 5CISA 4PT6A 5EEGA 1XC6A 1JYIA 1FMD1 3ALQA 3ZN0A 2Y64A 3UK9A 5IPAA 4XHXA 2OD5A 5D21A 1ST8A 2YHJA 3ML6A 3WLUA 2JDPA 2FQ3A 3AP9A 3ZFEB 1H8TA 5C3OA 4BE3A 2EZHA 4N43A 3HSEA 2WT0A 4YW2A 3VD4A 1S7AA 4PSXA 2CWMA 1OLRA 1XYPA 3AXDA 3RJ2X 2R92J 3OBTA 4EMSA 3IL2A 3IPVA 1H30A 4YZ3A 3ZFFC 3KP7A 3C7FA 1G2HA 3M70A 3K4BA 5LHGA 4U7DA 1RUF1 4PCQA 4IERA 4XVHA 2IW5A 3FHZA 4OVEA 4K1YA 2E1OA 4YIFA 2X4HA 1UZ0A 3POBA 3S1NJ 2DA4A 2MC4A 2LDUA 2AENA 1SC7A 3O1MA 5CFDA 4AYBA 5T50A 2UXNA 4PQ9A 3PUSA 4CHUA 4QGNA 1DUXC 2KT0A 3N97A 3ACIA 3EUKL 4AK3A 5JMCA 4HFSA 2VBWA 4ESJA 4JC1A 3JBG2 2DURA 2IS4A 3FUQA 1J5YA 2JB4A 1VNDA 1HRV3 3I58A 2EIDA 4YVSB 2NLRA 4ZDOA 5C5UA 1SANA 3ZGKA 3INAA 1MR5A 2ZNZA 4UFLA 3NWKA 2ARXA 3OMYA 3O1SA 2F2EA 1AR81 1ON2A 4YG2F 2XQXA 5E16A 5AIPA 3CJIB 2W4SA 5F5CA 2PLV1 5FD5A 2Y6LA 4BL0B 5FYHA 1Y9GA 3W6KB 3MUZ1 3K9TA 2YX4A 1AR73 1ZZCA 5FUNA 2VM9A 3U75A 3VKMA 4CEWC 3VD5A 3QYFA 3WG1A 1DQ4A 5FO5A 1YRNB 1OURA 2BZTA 2PAMA 5B3SH 1GP6A 1ZG3A 3J80Z 2HWD3 5GTIC 1V54H 1ZREA 2FDIA 3HUGB 3H5AA 3VSLA 1YJKA 3BALA 4OZXA 3A01A 4XMIA 3H5NA 2XGDA 1SZBA 1PDNC 4UWDA 2ADDA 2D3SA 4CDQB 2RC4A 2QCOA 4B3XA 4COWA 3ZYPA 2RS51 3H42B 4Y20B 5L9BA 2EIGA 1CQ9A 3CDLA 1KGYA 3K3OA 4B3NA 2QGUA 4M01A 3A0NA 2LBFB 3TDZC 2CQ7A 3DYOA 4CP2A 2O9LA 2LF7A 4MGZE 3OYEA 2R042 1F8VA 1ZR2A 2ZFUA 1O3QA 1W36D 1IS3A 3J7HA 3JR9A 4CE8A 4V1PA 5L3FA 2LY9A 3HT1A 1IF1A 1BJZA 1YWKA 4PCRA 3I3QA 1LOEA 4P9XA 5DN2A 4MEXF 2QQNA 2FX0A 2ES3A 5JVTA 2LG4A 3QU3A 4EQVA 4MHUA 2M5WA 3UL2A 4XFGA 3IAQA 3ZR6A 2FD5A 1AX2A 1H2NA 2VQCA 2KZGA 4MTEA 4W6WA 3OGJA 1BMV2 4HX4A 4XC9A 2FHRA 2VW1A 4QQ2A 1I3AA 4K1ZA 1XE7A 3A0HC 4LT5A 2JT1A 3VBHB 3I2KA 3POWA 3P3NA 2DOFA 1P8JA 4L8QA 4CU6A 3ZM8A 3D82A 1W06A 2MBFA 3B9CA 4QPGC 1GDTA 1TW2A 3SZTA 5ISLA 3JU9A 2Y75A 1VBA2 3NQHA 2F6BA 3ZSJA 1VLNA 3I64A 1W8UA 2O5RA 2QQMA 2R7UA 1EPZA 1H0BA 1MBKA 3WEZA 5EZHA 1CQTA 3PJYA 4Z6YA 1GLHA 4AI8A 2PQ8A 2NAZA 5IHRA 1HN0A 3GYDA 4HDUA 3HQUA 3SQNA 4I0WB 1NE4A 3FJSA 1ZNPA 3A22A 2A6TA 2O8KA 2CL2A 3LZZA 1AR62 1QOSA 4UI9L 3VYSB 3DPRC 4EGYA 3C2GA 2JD9A 1S4CA 4CUBA 1BIBA 5FOJB 2DT7B 1IO2A 5A32B 3MLKA 1GANA 2EFNA 1VQPI 1QZZA 1XE8A 1YG2A 2KR2A 5I8YA 1R5GA 3GW2A 2VUJA 3LFIA 3ZSLA 4NC6A 4J25A 2E7TA 1JZ8A 4Q0SA 1E5RA 1Y1WJ 4Q4W3 4O3MA 2E7WA 2HVRA 4LG3A 2RG4A 4XICA 3U11A 1J1LA 3VB9A 3WDUA 2OCEA 4MVTA 2R4GA 1FIAA 5D5VB 1XNBA 1W1WE 4M3EA 4OMDA 3CUQB 2W52A 4FO9A 2LRDA 4IF4A 2BFUS 1A04A 3V4GA 1AOYA 2RS33 4ZZDA 1DYKA 3K1MA 1KQRA 1RVF1 1Y7BA 4DQ2A 3OYNA 1EJ9A 1QH7A 4R8HA 4F93B 5M3MJ 2MLKA 4WM7C 2R7SA 1LOFA 4RAZA 4N53B 3LSIA 1XGOA 4MHGA 1UIJA 3Q8FA 1YIPA 1LFBA 1CF7A 1O4ZA 3LEMA 2EZLA 4BQAA 4I7HA 3S1QJ 4A3BJ 3LMMA 1POQA 5LK7B 1EH7A 2LC2A 5FKMA 1IXRC 4XQDA 1V3FA 3HHHA 1H8TB 4COUA 4G7OF 1NLSA 4WXDA 1QPMA 4PLOA 4CCDA 3K4CA 4DNCA 1MQTC 4NHKA 1PIV2 4P9IA 3F8NA 1SD7A 3EPZA 5HS8A 1BW6A 4IHSA 4P02B 3IPVB 2DPDA 4RAGA 5CFCC 4BBRJ 1GSLA 3IIIA 3OWTA 3RKXA 3L09A 2FQPA 2A6XA 3S7IA 4FPJA 4RD7A 3E6MA 1LKNA 3IDCB 1UELB 4Q2FA 2BBVA 1VBE2 1UMHA 2OT7A 4WCGA 5EGOB 1S0FA 3DQVC 4AGGA 5H9SA 5LGNA 5JI6A 1VI0A 2W48A 2GZWA 1NA1A 4B4CA 5HLIA 1FX5A 1MZFA 3AKZA 2HYJA 5D8LB 4YFXF 3WDTA 5FDBA 5C4WA 1ZX5A 1NAEA 4QB2A 2BY1A 3ABLH 1U3EM 3MF6A 5FAXA 1XGMA 4YELA 2QBYB 2WB1N 4E4ZA 1VRBA 1WA6X 2WJSA 5J8CA 1WBLA 3JCUC 3F8MA 3EDPA 4AM3A 3LFKA 2WWUA 5LEJA 3JQWA 4W8JA 4JRAA 3SITA 2MEV3 4W6YA 4OI4A 4D7SA 5EJCA 5SV5A 2E33A 2FUG2 5LA2A 2XGXA 2G19A 2QEXI 1LECA 2K4JA 1WGXA 1RUOA 3AKSA 3TP3A 1VF9A 1MEC1 2VU9A 1NY72 1TQPA 3ZXFA 1NG7A 3LDKA 4HZFA 4NVPA 1F1ZA 2BY2A 3C8XA 1I9RA 3ECHA 2D5FA 2G7UA 1MNEA 3B02A 4Q0VA 3K2ZA 3PUBA 1QXRA 4EN7B 4UFJA 1CPMA 1VB4A 2X0LA 1GVJA 4QHBA 3WTYC 3A01B 4BPZA 2JA8J 2EF6A 2W1SA 3SZPA 4BIFA 3AG3H 1J1TA 2H0BA 1GV9A 2P6SA 3ZQCA 1GBGA 3VD9A 4PDWA 3UGHA 2DMQA 2EICA 4JGZA 3DBLB 4ITCA 4L2NA 3HD8B 1W9WA 2WWSA 3CC7I 3ZQGA 1NXD1 2X5IA 4Q5SF 2RJ2A 3MCZA 1ETWA 3PMSA 3VBUA 4HNUA 3TRSB 1QJX3 2PHTA 1LCLA 1X19A 5FZGA 2FBHA 2WO7A 1LAJA 5C3PA 3IRRA 2VBXA 2E63A 2R041 2LW8A 4BQ2A 2DCKA 4NOTA 4HN0A 1HF0A 3I4PA 1HRV2 1LOAA 4CCMA 2GXGA 4A12A 3THTA 2OUJA 4MNUA 5BQTA 1U5YA 4WZFA 5DV5A 1QOTA 5L3EA 1O57A 2W00A 1BMV1 2MG4A 3KGLA 4QPYA 5TSWA 4CUAA 4EM1A 1SFPA 4YW4A 1DQ0A 1O7LA 1GHCA 1AR72 3S93A 2XJVA 1Q8QA 5LY1A 4OI2A 2A75A 4BQOA 2Y6KA 4Y17A 1VBA1 3JSPA 2V26A 2O1QA 4Y24A 2H27A 2WWYA 4G94A 3KLOA 1MMSA 2G9GA 5BNNA 1MBJA 5LD2C 2HWD2 2Y2ZA 2ZMEA 3CDHA 1L7RA 2RKHA 2JE9A 1WCQA 1XC5A 1YFXA 1DLLA 2VOTA 3GBWA 2P3IA 2XVCA 2OBPA 3S8PA 5I0SA 1HA8A 5DZFA 2LVSA 4J00A 2OPTA 2OAZA 2DQRA 4XW3A 5A1AA 2M2EA 2UY9A 2W95A 4IEQA 3TB0A 3NRVA 4GZ9A 3LEIA 1DQ1A 3AYAA 5D8AA 4AAXA 1M1EB 2A3SA 1D2QA 2XASA 2XAQA 5E8IA 1WCUA 3IZOA 2OXBA 2AHQA 2OA4A 3IH4A 3RQ0A 1V9U1 3KV5A 4FETA 5DS9A 4FOVA 3ZXJA 2PG4A 4V2GA 3NAPA 2MGQA 1YRZA 2HBTA 5F5QA 1TQMA 1CPNA 4UFMA 3BR2A 4B4PA 4CEYC 1WZ2A 1Z3YA 4PDKA 1XTAA 2Y38A 5M3FJ 2W25A 4U36A 4ANJA 1AXYA 5JLXA 1RTVA 2OTLI 2JKBA 4A69C 4DZPA 5IT3A 3LIHA 1I5ZA 4CZZA 4ZU5A 3T1BA 3V0AB 1AX1A 3SC7X 2FE3A 4OU0A 3HHGA 4A45A 2EILH 1CF7B 4P9FA 3JRIA 1BR1A 2BYVE 4QU1A 1O8SA 2RDQA 3GFMA 3FDYA 2CFXA 1ZYBA 1X4OA 3N05A 3SHRA 5FPXA 2JX9A 2WO3A 1GNZA 1MJAA 2K2SA 5KC5A 1JZ2A 1GXPA 3CL1A 1DIWA 3AJZA 1HW1A 4KN7X 5KHHA 2ZKZA 1E5SA 1W5SA 4MFDA 2P6HA 1OFCX 2QUOA 2OZUA 1SMVA 1Q8SA 5LASA 4HG2A 4O5VA 2L7FP 2E5ZA 3G6JB 1UAAA 2M7BA 3WZ1A 2HNHA 1Y43B 4LBMA 1D5YA 2EPFA 1PX3A 1JUSA 2LMDA 5IYCJ 3QBQA 4PF1A 4BWOA 4YGDA 4Q4W2 1JKPC 2D1HA 2K7LA 3OCPA 3OS1A 2PJRA 2W91A 4XF0A 4DXRA 1F2NA 3I3DA 1NA1B 1VQKI 4MV2A 2FBKA 1QIQA 4JX0A 3MAJA 1LUJB 1KGSA 1BM9A 5C6CA 1OHFA 4L11A 5C4WB 2VG9A 3C2UA 3IAPA 5C44J 5IT6A 5FYVA 9ANTA 3AVRA 4XZUG 1ERDA 3WDVA 2RS32 2TUNA 4LHNA 3VHNA 2ISZA 4D0QA 4QAWA 4BIOA 1NCRB 4F55A 4XTMA 2D43A 5IAVA 3WW1A 1L0OC 1UB9A 4KUMA 5EFUA 4AU7A 3FXLA 1C8NA 1OA4A 1ULPA 2ESNA 4CXXA 2PN5A 2L9LA 4JHZA 1WD4A 4BAYA 4HONA 4IRIA 3H8UA 3VDDC 1BYHA 1CJPA 4QPIA 2ET1A 5FYTA 4XBNA 1VMHA 3V7RA 1CZSA 2LD5A 3BODA 4A0YA 1PP8F 4HKLA 4MGSA 1QHGA 2NS0A 5KCMA 2FMDA 4RR3C 1YNAA 4CA0A 5FMCA 2GOMA 5ICGA 4AQTA 5FMOS 2HS5A 1C3HA 5GPAA 2BBYA 2HLEA 5F0FA 5J48A 1KQ9A 2BRTA 2ZFWA 2J1RA 4I76A 2F5CA 3POJA 5A6ZA 4FPYA 2DF7A 2LNBA 2YS9A 4V19K 3B01A 2AGSA 4MO3M 5FGMA 3J81K 4LA2A 3ZYRA 4E4DX 3W5NA 5JHUA 4XOGA 5JR3A 1LU2A 4LK7A 4DUXA 2KM2A 1TWAJ 4CDWC 4PDWB 3T4HB 5FPBA 3RVHA 3KV4A 4A3GJ 3MFAA 1ZVFA 4CPBD 1BZWA 4QB6A 2X5IB 2I10A 3FMGA 2JN6A 3P6BA 3ULQB 1IG7A 1ZA7A 4EN6B 2Z1DA 1S5LC 3LKJA 1ZR4A 4I01A 3O14A 1JI6A 2KRHA 1Y8QB 1JHHA 2JTVA 2WYFA 5ABJA 1FY7A 1X1BA 1WQ2A 2W5FA 4RFRB 5E20A 5D5UB 2WZPP 2KL4A 1Z6TA 5LA1A 3DKWA 3FM3A 1SD4A 4N8MA 4XDPA 5F27A 2UV1A 3I9V2 4XUQA 1PGSA 1A78A 3KX2A 2AEYA 3SFIA 3OJBA 2KRFA 4NAMA 2EXIA 3OB8A 1VIWB 1GQHA 3ABMH 1CD3G 1V6MA 1ZAOA 2JA6J 2VCCA 1HRV1 2HWC3 4E27A 5B66C 1S0DA 3ABUA 5HLGA 4L97A 3HRSA 2R5ZB 2YMZA 2MEV2 1COV3 4BXSV 3HPGA 3AKPA 4HX8A 3H1CA 3GBGA 2F4OB 3ASOH 5HVQC 3OYWB 2WL1A 1ENRA 2V1XA 1UY3A 3R05A 3LA2A 4XLCA 3JRGA 5G04L 1VBB3 2CV2A 2WNVC 1XBFA 5A3LA 5HS7A 5FLIA 3PUFA 4QPQA 3J7AO 2XOMA 5JCTA 2C0ZA 2BVBA 1HOMA 3VOEA 2ZXIA 1FI2A 2M8EA 1BW5A 2TDXA 5EDNA 2CTVA 2KKOA 4YGBA 4R52A 1D1CA 2FDKA 3GO5A 1GWLA 4FXGB 3ABTA 2HWD1 3KHCA 4A42A 3BPVA 2NVUB 4DO0A 4OAYA 4XM3A 2A07F 1UOGA 3U07A 3JTGA 4RM2A 1HBXG 4GYGA 3HVDA 3GTOJ 3OUIA 1MJBA 1SAUA 4Y4RA 4WX9A 1DYPA 2HYXA 4Q8LA 2H94A 2Y9ZA 4XLFA 4F52A 1XSQA 1QJX2 5JI9A 5AVPA 1PP7U 2CFOA 1EKEA 1XCVA 1LOCA 2J1EA 4U88A 5D8AB 3BQZA 1CAVA 5FUPA 1BHGA 1XSVA 2CG4A 5EG0A 3S3MA 2VJJA 5I8TA 2P7VB 2VE9A 1F9KA 1G59A 3S5AA 3LOBA 4JAAA 2FRHA 1EV11 2ELJA 4N0BA 4CDQC 4GFBA 1X1AA 1OOPB 2D6NA 4M9SA 2H8RA 3KFWX 4DOZA 4A0XA 4N4NB 1G3TA 1B8IB 1X3WB 5H6RA 3KYDB 3CJNA 2W1OA 3HKZN 4IGPA 5LBQA 1O3TA 1TEIA 5CZKA 5TISC 1IZ3A 2P6CA 3O1OA 3C7EA 4E2GA 5K5QA 1MS9A 5FKOA 1VAKA 3E5XA 3ZXSA 1FOYA 1SLCA 3HEFA 4YW7A 4W97A 1N47A 3ZPYA 4SBVA 1R36A 4GO1A 2FOWA 2WA0A 1P6RA 2VJ5A 1Z1DA 2QF7A 1YIJI 4EJTA 2N8GA 5IVEA 4E6KG 4ZZ5A 4B8EA 1AUYA 3MUY1 3RJRA 1XRUA 5A3PA 2VQHA 2KPMA 4JQFA 4HVQA 4KWKA 3J4UH 1JE8A 2L5QA 3K75B 3MIBA 4XABA 2RM21 4KG0A 4A6OA 1S29A 2DU0A 3WTUC 4M3GA 4KNYA 2JDUA 1E57A 3VBHC 1Z67A 1KJRA 1SEUA 4ZTFA 5J8FA 5GTHC 1JZ6A 1ZGJA 3C7GA 4BLIA 3ZLIA 3PNTA 2XSDC 2B8MA 2ZAAA 4Y1ZA 3I54A 1GOHA 1NT0A 2ET7A 4RL7A 2DA6A 5FYSA 3BWGA 5M5XJ 1RPWA 2KLOA 2PJRB 2YZ4A 5E3NA 5JOZA 3VBRA 3BR6A 3WQ0A 1JT0A 3GWZA 2WFPA 4OQ8A 4C0BA 4HOOA 2CV1A 1PZ8A 2HWE2 4BQNA 3R60A 4N7UA 4D3WA 2X09A 3AKQA 4I99C 1XMAA 1IPKA 3APBA 3E7LA 3D5RC 2KHMA 4I02A 1ULFA 2WUHA 2EIMH 1YUDA 2P3KA 5LWBA 3S5QA 4HPKA 2HZTA 4WXCA 2VT3A 1BJQA 2Y0OA 5A70A 4L9VA 3UETA 3K3NA 4UNOA 2BQPA 4XF9A 5FMDA 3POGA 2IEKA 4FOQA 3VSKA 2VECA 3J8F3 4QPIB 3S2DJ 3VHRA 1TNRA 1UPSA 3W58A 1W6MA 5IOZA 1NOVA 5HPOA 4LTAA 4AZZA 1W4MA 1TQIA 4HYEA 1AYM1 2B42B 2DYRH 3W5MA 1MZ6A 3AVSA 4NO4A 3I3LA 1DPUA 1H9GA 1Y56A 1TTYA 1UZZA 3FMRA 4RHV3 4H7LA 1KZHA 2C6YA 2V09A 3KZZA 4IV1A 1W9YA 5D6FA 1GOFA 2I8DA 2PHUA 3MGUA 3V8LA 1XDSA 4FOYA 5CEHA 2VVDA 1JODA 4CU9A 1FWZA 1KJLA 4LUKA 1HW2A 4WF2A 2L9VA 2EINH 1RYYA 5KXBA 5A6QA 4UB8C 2VOPA 1MVQA 3KS7A 3VL9A 4Q4Y3 2ZABA 4NIAA 1XB9A 1W3VA 1XU2A 2RHPA 1WD3A 4HOBA 3FUOA 3X29B 1XNDA 5FMBA 3O0XA 4EWAA 2M0MA 4N43C 2VMFA 3RS6A 1ULDA 1YS6A 2L7KA 1NZCA 3L1PA 2VMCA 1QH6A 3AXEA 5IFPA 4FPEA 5FY7A 1HSTA 3VV1A 2EXHA 1G7YA 3FXKA 1OBNA 4JHTA 5K7HA 3CCUI 4KU7A 3Q8AA 4AGVA 4U0YA 2YSRA 3I7DA 2XF6A 1HKQA 3IKVA 2OC6A 1LJ7A 5JZGA 2MH2A 4N9HA 1APLC 3A1YA 1XQNA 3VBOC 5CFDC 1ZHFA 5B4XA 3D5LA 5C3SA 4DINB 3ILRA 3W9AA 4HLXA 2NOGA 1QHDA 4M9XA 4YWAA 1OLTA 2R061 3H1YA 3BI3A 3ZMVA 2FCUA 1MNDA 2IJLA 3A21A 2Y8KA 1CJDA 3RNSA 4LOTA 2VZTA 5EWSA 3FZVA 3DPLC 1FYUA 5FRAA 1D0GA 4MSVA 2VMGA 2HWF3 1W03A 2YXSA 3K6GA 3CCMI 1HXS1 1UHSA 1ZBA3 2NS7A 3VZJA 1BR4A 4OINF 3OS0A 2MHFA 1UIKA 1DU3D 2WA4A 2NVXJ 4OWRB 1T6SA 2YUSA 2IVIB 2V73A 1SD6A 4B1LA 5J7MA 5GZFA 3I3BA 3H0DA 1PMHX 1HKSA 4YW6A 5DCMA 1ONAA 5FFOC 1OVSA 4NDLA 3RZOJ 2BV4A 2A61A 3TAYA 1W0UA 2HQ5A 1REDA 2BOIA 5L9VA 1G9FA 5J1YA 3LE0A 1IKQA 2J7MA 1MNMC 5CVUA 1KFXL 1ACCA 2W82A 3BG3A 3EYYA 3M9AA 1I1SA 3T09A 3CMGA 3W2AA 3VODA 3PQKA 1LJ9A 3GTJJ 1G3WA 4OIPF 3AMMA 1UMQA 3K2AA 2ZEWA 4IE0A 2Y26A 2JQ7A 3PLQA 2Z5WA 1WW7A 1COV2 5JSRA 2OCCH 1VP6A 1ZYRF 2EJRA 3ZXEA 2GN3A 4NHMA 3H0OA 4ITVA 1W2UA 1RUD3 3BR5A 2J42A 1Y6IA 3Q9SA 2LM3A 5T54A 4EM2A 3CCLI 1VBB2 5M0TA 2E26A 1HV0A 5DUWA 1XU1A 3ZR8X 4GB31 1AX0A 1O59A 2D40A 1X8MA 2ENRA 3FXMA 5EZGA 2Y6HA 2VBPA 3ZSEA 2XPUA 5J37A 5FQ0A 5I93A 1V6OA 1HQNA 4C3HJ 1UPIA 4HNTA 4MO7A 2Z4FA 3OGVA 4AC0A 4XN3A 4E8DA 1R22A 3G1OA 2QSHX 4A3XA 5LHIA 4LMYA 5FZ0A 3I4IA 2PBIA 4F83A 1KS5A 2IRFG 2VOXA 4Y5TA 2VZUA 3B5LB 3WTSC 1PUFB 1IC8A 4OI1A 4WBBA 4UUTA 2VMIA 1SCSA 2LTNA 1JYVA 4LOSA 4ASKA 3WU0A 2FDHA 4NNJA 4RS8A 4ZYDA 2YFUA 4KMFA 2H0VA 4BK4A 2AC1A 4E7KA 4ENKA 2TBVA 1DQUA 4YNIA 5CG8A 5E8GA 1DGLA 1BOAA 3VD3A 3OSGA 3HTSB 2OF7A 1P4WA 2B39A 1IPSA 1IDZA 5JLWA 2HWE1 3K10A 4H2AA 2C1FA 2NZ9A 5JOYA 1T6GC 4QPOA 3VPRA 4NC7A 3E6CC 4XTPA 3TOAA 4H3WA 1NHAA 1VPHA 4IESA 4JBAA 4QPGA 3DCFA 5FP9A 2IXJA 2UZKA 1G8XA 1W6MB 2PYTA 1T98A 4FAGA 4A3EJ 2PHDA 2G9ZA 2XKPA 5EEHA 3TOBA 1T2KA 3CJQB 2C6SA 3RKQA 2R7TA 5HCAA 2HFHA 1S0EA 3KIOA 3PDQA 5FZOB 4QDQA 3MIHA 1ND2A 4WVZA 4FE7A 4Y1XA 1Z05A 2DXIA 2JB8A 5JVGF 2GMMA 2ZHNA 2ZBJA 4UVCA 4ESBA 3DPRA 1EPWA 4ZS2A 3BJ6A 2R7RA 3K70D 2WZR3 4HK9A 4AFDA 4A3KJ 2YPRA 1EAH2 2WNUA 1D4VB 3NNLA 2IXLA 4GWMA 4Q5OA 5DUIA 4UW4A 1LOFC 3GHNA 1KXGA 1S0GA 2GQQA 4AFBA 3O5SA 2JE8A 2RMU1 5DAVA 1V6NA 4KT6A 5ANQA 3NNMA 2JXAA 3T2QA 3FBIB 3K4KA 2ORXA 4MGIE 5FO9B 2K27A 1YTYA 4AL9A 1F5TA 1LKXA 1SVOA 2GMPA 2KDZA 1XNTA 4FASD 3BIEA 4O9EA 4M71A 3WVJA 2VZPA 1DBNA 1R1UA 3OD0A 1W9TA 4DBRA 2XQRA 1G4DA 3S14J 2DWRA 5F5IA 3G73A 3QP6A 2WV0A 5F1JA 4JGYC 2E31A 3FHAA 3J9SA 4DY5A 2DFCA 5SV8A 3NEUA 1VQ7I 2DODA 1K42A 1OLMA 4GKXA 4C8DA 5HV0A 1QQP3 2WS93 2HOTA 3J8F2 2R7ZJ 2WADA 1XS9A 4AEMA 3WNMA 5FKKA 1JUIA 1QJY3 1AKHA 2CV0A 4P9GA 3PMEA 1OCRH 1SLLA 1VALA 3KV6A 4ARXA 3PU3A 2VBYA 5C4WC 4RHV2 3SZGA 2A6ZA 3ZYBA 2ID3A 1MQTA 1RIOH 4WXHA 1WFXA 1BI0A 4W6XA 2UURA 2J1TA 3ATGA 3S57A 3BVCA 3ZFFB 1UQXA 1MW7A 3HMYA 3JRFA 4CA9A 2XLAA 4NQWB 1LGCA 1WHUA 5FP7A 4BISA 2OZ6A 3POIA 1YFHA 3K4LA 4Q4Y2 2NYXA 3HRUA 1JOPA 2MPFA 1UG2A 1VQ5I 1YI9A 3VKOA 2VZ3A 4BQ1A 4Z8BA 3HGYA 2G9FA 3BGAA 3JD73 3PNVA 1OA3A 3EBRA 4LLLA 1IXCA 1N78A 5H9PA 1A35A 4KITB 5LBEA 1P4AA 3Q0VA 2WRAA 1MMGA 3HOXJ 1BBT1 4QX1A 4S2DA 5DCMB 2DTWA 2ZBKA 4XDOA 4NC8A 4Y26A 2OQ6A 1ZA4A 1I1EA 2WINB 4R9AA 3VEPA 3KYLA 2R7QA 1YI7A 1U5TC 3FBYA 4NN0A 3M07A 3ZMNA 5FZMA 3HPHA 5JXHA 1J0RA 4CUGA 5A3OA 2XUBA 3FC0A 4A3IJ 5IFTA 4PDWC 2DU1A 1PM7A 4JGZC 2JPBA 1Q8OA 2HVSA 5HDGA 4PJJA 3CCJI 2GWRA 2QTWB 1WJEA 2ZKLA 3OYMA 1CIYA 3OS2A 5EPAA 3F0CA 3RMXA 4M4PA 1W39A 1FPQA 4LULA 1MZBA 5D5XB 4GMP3 2VBZA 3AL0B 1OT5A 1W8OA 3VBUC 3DBHB 3MBWA 5GLTA 5J1RA 5ICFA 2OPWA 2DI3A 2RJLA 1OFNA 3OYCA 3O0VA 3V42A 4U87A 2ZX2A 3BZKA 1SBEA 4RDUA 1BKZA 5C4XJ 2PLYA 2NVTJ 3THCA 4BJ6C 5A3UA 1X1DA 5HDKA 5IW0A 2O8XA 5J98B 1R64A 2A6YA 1V5GA 3HJRA 2DUOA 2JEMA 1OI6A 2C26A 3SHFA 4S2HA 3CTAA 3PL8A 3GFIA 2EFOA 2VULA 2XMLA 1POV0 3IP4B 2AYHA 2XVLA 2GN7A 3GFJA 1T39A 2HWF2 4I3GA 2B46X 1PVEA 4CXFA 1ZBA2 3BOPA 4XSZF 3OPZA 4KICA 2M34A 5GP9A 2ZEZA 5FPAA 2JJ7A 3EETA 4AHXA 3ENRA 4CDXA 4LG0A 2NNYA 2CAVA 2BNOA 2WKKA 2GNMA 3FXUA 3VD7A 4ASMB 1FMWA 3PO2J 3K0LA 4FX4A 5BNNC 2K0GA 3AZXA 3GXOA 1D1AA 1ETXA 3TP0A 2ZMEC 4KIFA 1T56A 1XNAA 1QO0D 4IRGA 3H7JA 4IJAA 2PMUA 2O61A 3AC0A 3WHTA 1DGWY 2V1DA 1TNTA 1LEDA 3BPZA 4XJWA 5FXZA 3RZKA 3CLOA 2EIBA 5JPMB 5GKAC 4MX3A 3J81Z 4CVUA 3S16J 3VGIA 2BTVC 1ND3C 4QPGB 1VBC1 2WAAA 5EYRA 2A1XA 1D4M3 3GLLA 1H1IA 2ERFA 1E3OC 4KJZA 2XB5A 2P81A 5FY5A 4A6SA 4BJ5C 1RUD2 4FAHA 1E5HA 2R7WA 2BW3A 1USTA 3CZJA 4GA9A 4QXKA 4QWQA 2HWB3 4WK8F 3AB0A 1R4NB 4QHZA 3AKRA 2XBO3 5DG2A 1QXPA 1W0NA 4PI2A 4OZOA 2A69F 2BY3A 3NAPC 5BUVA 1NKGA 4BQWA 4OIRF 4QWNA 1ITYA 3PO3J 2Q4SA 1W99A 3VB2A 3DPRB 1IGNA 1Q56A 4NHXA 1ZZBA 2WNUB 5L73A 3WHCA 2CU5A 2AO9A 3D1NI 1MVEA 2CRGA 1QZEA 3DLLF 2LROA 3H0GJ 5DDGA 4M3CF 4BQYA 2ZOEB 2SLIA 3QOPA 5T5PA 1I3QJ 1EAH1 1N3QA 5FYUA 2GC2A 1QJU3 4AI2A 2WABA 2VR4A 2J1SA 2JG8C 1NYWA 5FJHA 4BUPA 1JYNA 1GV5A 4K8RB 4OFGA 4DW6A 2DFEA 4HBNA 4OULA 1W8WA 1GNYA 3MPPG 2L9SA 2YFZA 2K9SA 4OHVA 1CESA 4KI5M 3GEZA 3IWZA 1TL8A 1J2XA 2VZVA 2F48A 3E3VA 2F4MB 4C3IJ 1WPKA 1YOVB 2X1CA 3MPBA 4I98B 3WGGA 2DFBA 5EXOA 5KXCA 4GXOA 1J3RA 3OEBA 3UJOA 4E7ZA 1F31A 1W8TA 1VMFA 2W0XA 2CV6A 4KBBA 3BR3A 3DKQA 3CUOA 3HC7A 3PNAA 4ASLA 1R23A 2A70A 3R61A 4WM7B 2FSWA 3NNFA 3RZGA 1T38A 4Y33A 2IGNA 1F5JA 4Q4X3 3CHXA 3MF9A 1JOJA 4V2WA 4RFT0 4D7MA 2WAQN 3KB5A 1MS5A 1Z7S1 4IZZA 2WBKA 2XPVA 3OOPA 3WE3A 2ECCA 1APNA 5F6FA 1B09A 1JUHA 4PGHA 3PUHA 4BJTA 2M0CA 1U78A 3ZP5A 3J8F1 5KHDA 3CO2A 3ITQA 2F4PA 1PMJX 2KZVA 5CQGA 4NHJA 4QD2A 4XEZA 4UW6A 2YPDA 4OI0A 4IL6C 3K70C 1FEXA 2AXTC 5FXXA 1MQTB 4XXAA 3HOSA 3M4OJ 2FOKA 2QQKA 2IFRA 3VFZA 4B7EA 2O0YA 4YFWA 5J40A 4QX2A 1PVC3 2WZR2 1ON1A 3O2PE 5FZ6A 2IWGB 2CUFA 5J47A 3GALA 1GYKA 5JOWA 3VZNA 4ARYA 3ZXKA 4AVCA 5IT9Z 4MGRA 4KDPA 4HX7A 3HXLA 1N1YA 5C5TA 1JH5A 3HSFA 1JU3A 2ZGTA 2AQEA 4OUMA 2UXXA 5LRSA 4QGLA 3WCRA 4UXNA 3HSRA 4Q4Y1 2JMWA 3E97A 2E19A 1V00A 4Y1YA 3U0ZA 1QDCA 1NUKA 1ENQA 4MTDA 4GD4A 2YV8A 3C7JA 4DXSA 1WI9A 3MN2A 3O7OA 2CO5A 4DMIA 4WM8A 3BTAA 1KYWA 1SQ4A 3DKYA 3WP5A 3RQ4A 4QKDA 1AYN3 3BTZA 2X10A 4BA6A 1H89C 1SVMA 1GQGA 2BVVA 1QU0A 5KHGA 3ZPOA 4IEVA 1R093 1VQ8I 4CH7A 3TN91 2PHXA 3VDDA 2KISA 1XX5A 5FREA 2C5DA 1ZBE1 1WWYA 1QQP2 2WS92 2CH0A 1FLIA 1IS5A 4QX8A 2EIKH 2W3JA 5H20A 3EUHA 5ABJC 2Y69H 5FZ3A 5HLHA 1QJY2 4Y7NJ 2E2IJ 5J3LA 2W2IA 4YW1A 2DMNA 5FCCA 4FPGA 3I56I 1QJFA 3T1MA 5K5RA 3U78A 2A6EF 3VYRB 5F9TA 1DGWX 2QNKA 4MG2A 4D9JA 4XRFA 3L2QA 2MSYA 1HDKA 3HM5A 2R1BA 3SH4A 4YFNF 5T5LA 1HRI3 1IN7A 2BWAA 3ZMZA 5FXWA 3KYCB 1LDJA 3FMQA 5FY0A 3NW4A 3IC7A 4TLGA 2ZEXA 1YW8A 4M3CE 2LLKA 4AI0A 4BEHA 4ZZ8A 5E79C 3AP5A 5K4LA 4PBOA 4ZYGA 2FZ1A 3PUIA 1R5ID 1EF4A 4BE2A 2B7EA 3JD72 3DKXA 1STMA 4F8AA 4RGUA 1RUG1 3WW4A 4LG0B 3MV01 5IVFA 3VUOA 3AMHA 2CDOA 3N9QA 2DFHA 2R7FA 4U0VA 2OUMA 1QXJA 1WCSA 2P37A 2IAIA 3B00A 3DEEA 1OQYA 1LR5A 3EQEA 3M8EA 2ATFA 2GC1A 4KGQA 4META 1IAWA 3P1IA 2HGCA 3ES4A 2VKDA 4RB1A 3FHNA 1RXFA 5B4NA 3EJKA 1C4RA 1NX9A 4K8FA 3BC8A 2PN6A 2X6OA 1Y39A 1B35A 1MKMA 3G2BA 2OVUA 1FV2A 2IGMA 3A4UA 1K5JA 4BHPA 2FNAA 3CMYA 1RUI1 1BEV1 5GJ6A 2BW3B 2Q1FA 2TNFA 4M74A 2WNVA 2JDHA 3C1DA 4YGEA 2L9NA 1VAMA 2GNBA 3V0BA 3AYCA 4LHKA 3BTLA 4UUSA 1FOD3 2QWWA 2HQNA 5LFAA 4EN8B 3BPXA 1W9SA 1UZCA 2COMA 2P4EA 4M73A 5E17F 1MBFA 2M30A 2D5VA 2PHFA 5D4SA 1V4RA 3BDDA 4C9YA 3ZMTA 2UU8A 1DCSA 4GXLA 5FO8B 1PMIA 3R0JA 3NSTA 5ILSA 2ELHA 1OH4A 4PIXA 1CIWA 2DA2A 3OIQA 4D5FA 3LDBA 2PAKA 4DFSA 4NHYA 2EV6A 2JZYA 2VB6A 3CIHA 4LORA 3IWFA 4MH0E 2VNOA 2VQUA 1TG7A 3GX4X 4ETSA 1S3JA 2EXKA 3H3ZA 2XPJA 1PO23 1RINA 2YC4A 3DU5A 1PK6A 4QKFA 3DF0A 1LHVA 1FZPB 2D6LX 2E34A 1R081 3OUHA 4CEYB 1XYNA 3RFRA 4DJAA 3LAPA 3Q3SA 5HLTA 1YJLA 1UN1A 1ULGA 1WMDA 3DU6A 5CJ9A 3VDXA 4XJUA 3CMMA 2CGPA 1K45A 1TME1 1WA4A 1WJDA 2Z2SB 1MS3A 5EHDA 5JI7A 2I5UA 3DEWA 1D4M2 1UNBA 2P0WA 4R9DA 1LFUP 1EY2A 2HDCA 3L2WA 4FPKA 1G8WA 4KGGA 3OPTA 4E2SA 3VBRC 3O12A 4JVAA 4AFMA 3OL4A 2C24A 2HWB2 3DTIA 5JAXA 2OKXA 2Q2EA 2ZJRF 2W1WA 3CF6E 4ZC3A 1VZ0A 3CKHA 2B63J 2XBO2 1Y9QA 5F0CA 2UWBA 1T6BX 3W6JB 3GTKJ 2H09A 2VQTA 2XF7A 2Y34A 1WJ5A 2XF5A 1Y0UA 3HBLA 3ABKH 3WDWA 3E6BA 2JA7J 1IUYA 5CU1A 3RGBA 3I8TA 4FPLA 2R3SA 2W7NA 4YRDA 4OUEA 5A7WA 1YC61 4BQ3A 4A7ZA 3GXUA 1LEBA 1QJU2 4AWXB 1KD7A 2ZACA 4BCUA 1IKPA 3IDAA 4CUCA 4BY7J 4HSRA 4PHZA 4HSLA 3DXTA 3THDA 3RI4A 4RB3C 1AL0G 4KMQA 4QGMA 3JZVA 3MZYA 2Z69A 3JTHA 5JIUA 4UOJA 3F21A 2BPA2 2R5YA 1OVPA 4UFIA 4XFAA 3TQNA 2GA1A 1S55A 3IMNA 4G9YA 3L2RA 4IV1C 2LRPA 4V2FA 3OGSA 3H36A 1J3PA 5AVAA 3HL2A 5FZKA 4NPMA 4XKCA 1VQLI 2VI6A 3QCWA 3KVAA 2K5CA 1QNWA 2FEZA 5AC93 2Q8EA 4PJMA 4AW7A 5A6YA 3WW2A 1YLLA 1PGL1 4LXLA 1OYIA 4L9BA 2W08A 2L7MP 1TWFJ 4Q4X2 3VDDB 4PIYA 2B0LA 1QKQA 3O1UA 5KHIA 1GUUA 1QGPA 4Z82A 2R071 4NB5A 3QPLA 4RR3B 1CGPA 3MKZA 3CCSI 3QLQA 3U21A 1QQP1 2WS91 5FWEA 3HYIA 5C8CA 1FP1D 3BU0A 3ZQQA 1JU4A 2ACJA 4LIVA 1LEMA 4PZJA 3CU7A 3HOZJ 4LJHA 1YQ5A 1QJY1 3KP3A 2Q8DA 3OSFA 1BI2A 4XN0A 1TNFA 4G7ZF 3CCRI 1US2A 1S0JA 3FLTA 1T0FC 1UD1A 3IKWA 2XAJA 4INDA 4L92A 4QLCU 1AWCA 1PVC2 2AQFA 4CDWB 3HB9A 1ODDA 4YVWA 1UJ8A 5JZGC 4ISQA 3M7AA 5CVJA 3F6VA 3CD6I 5K0UA 4BEHB 2STTA 5KNLA 4IXLA 3EB7A 3P9KA 3ESWB 2K86A 1JZ7A 4FI9A 3U4SA 1K7AA 5ILUA 1OD5A 4YEJA 4U7BA 3O1RA 2VOKA 5FR3A 2A3XA 3BKZA 1RMU3 2MYSA 2P5BA 1UXXX 4YPJA 2NS8A 3DP7A 4IQPA 4ATEA 4DYQA 2QQWA 3OY8A 1N3PA 2UYAA 3ZFGC 4JX5A 4UFKA 1OYWA 1RUE3 4LE4A 3F95A 1ZRCA 5HOOA 5FP4A 2V5YA 4XUTA 2TRTA 4KT5C 2K40A 5LCWL 2WT2A 3KT4A 2ARAA 2JDAA 1S1AA 4K21A 3NMBA 2RE9A 5F3GA 2CDPA 5FPVA 4RGSA 1R092 4S2GA 4CP9A 3DXUA 3HZJA 4PJNA 2IA2A 5KAFC 3VBOA 2Y0IA 4IE4A 2YBKA 4BXUA 2ZGUA 1B35B 4HMZA 3POYA 3WQ1A 1BL0A 2D6OX 1XYOA 2CMPA 1OQEA 1VBD3 3GFLA 1G9DA 1R4MB 5L19A 3REOA 5L7OA 1N25A 3VN4A 3LQQA 3ZYFA 3H8XA 2XJSA 3AYDA 3ZN6A 2WNVB 4GMP1 2FMYA 3IAM2 3CJXA 1PUEE 3UGGA 5K8SA 2HBUA 2F4LA 4HLTA 5DAWA 3S1RJ 3V0BB 5IUQA 5A7PA 1A34A 2W92A 2ECBA 1XG1A 3A03A 3AP6A 4UVAA 2OW4A 2E71A 4IL7A 3I59A