3H3ZA

Crystal structure of a putative cyclic nucleotide binding protein (spoa0323) from ruegeria pomeroyi dss-3 at 2.35 a resolution
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
226
structure length
226
Chain Sequence
MAHEAQKAIARNSLLIRSLPEQHVDALLSQAVWRSYDRGETLFLQEEKAQAIHVVIDGWVKLFRMTPTGSEAVVSVFTRGESFGEAVALRNTPYPVSAEAVTPCEVMHIPSPVFVSLMRRDPEICISILATTFGHLHSLVAQLEQLKAQTGAQRVAEFLLELCDCDTGACEVTLPYDKMLIAGRLGMKPESLSRAFSRLKAAGVTVKRNHAEIEDIALLRDYAESD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cnmp-binding protein
molecule keywords Cyclic nucleotide-binding protein
publication title Crystal structure of PUTATIVE CAMP-BINDING REGULATORY PROTEIN (YP_165150.1) from SILICIBACTER POMEROYI DSS-3 at 2.35 A resolution
rcsb
source organism Ruegeria pomeroyi dss-3
total genus 63
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3h3zA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3h3zA01
3SZTA 3WGHA 4LLGF 5ERIA 5DYMA 1U3EM 2MLGA 3H3UA 2B9UA 1Y0UA 4D7TA 2CYYA 3I4PA 4QX5A 4U88A 1ZX5A 1W7PB 2OPKA 5FQ0A 2XRNA 1ZVFA 3F3XA 4XSXF 1WWXA 3L09A 4UV9A 3K1NA 3ZDSA 4O3MA 2M5WA 3K1MA 2FOKA 1Y9QA 1YS6A 2GWRA 3ELNA 3BPZA 3KE2A 3ABTA 1YFXA 1RTVA 3F8BA 1ZYRF 3WU1B 4F7ZA 4XBFA 1LKNA 2PFBA 1HXDA 2ISZA 2HWVA 3PFIA 1FI2A 5FDBA 2ET1A 5J6XA 3M7GA 4RAZA 1KU2A 2MH2A 4X6QB 3KGZA 5LGUA 3E5QA 2IA2A 5E16A 3WU0A 2IXKA 3J81Z 2RN7A 2B0LA 1OR7A 2GZWA 4P96A 4LK0F 4KDPA 1YYVA 4XF1A 2XGXA 3CUQA 1LR5A 1RI7A 3F8NA 1FWZA 1ZLKA 5CVJA 1IN5A 2ELHA 4LULA 1IXCA 4MQ9F 2I45A 1HSJA 4MGKE 1FT9A 2X4HA 4WWCA 1CAWA 3R60A 2VOOA 2ZNZA 4PGHA 4EMSA 1LNWA 5TJJA 3BJOA 2NRAC 2IXCA 1TLHB 1UHWA 1CAUB 4QM9A 1OMIA 5D1IA 3BY6A 5FLHA 5EFUA 2MA3A 3WW4A 4RGUA 5CVUA 1FPQA 4AIKA 2XAFA 2HKOA 4WVZA 4R79A 3WTSC 4IESA 4OMZA 2GC2A 4X6RB 3FZVA 4H7LA 2O03A 3FXRA 2D2WA 2VE8A 5J3UA 1IUYA 3OCPA 4L9JA 2IRFG 4KWJA 2MH9A 3J7AO 1U8RA 1XE7A 4Q0QA 2X0LA 5J48A 3EHKA 4OLLA 5TRDA 2EV0A 3LQQA 3I54A 2UYAA 1VJ2A 3HSEA 1HW1A 1OI6A 1QNTA 1QZZA 4OIPF 1BBYA 2DQLA 1PP7U 2A6EF 3IDCB 1RIOH 1FOKA 4MEYF 1XGSA 3LAGA 3EYIA 5E1WA 4LJZF 1CAXA 2VN2A 2MPFA 1R7JA 1OYYA 2D45A 4Q4ZF 3QU6A 1Y3TA 5HLHA 2R3SA 3F8MA 1KQ0A 2EFNA 5D5XB 5LHGA 2IXLA 2FBHA 2Z5UA 4ORFA 3R6SA 3QPHA 1EH7A 3KP5A 4IF4A 3CO7C 5JSRA 2EFPA 3WW2A 3WODF 4IETA 3E3VA 2RC4A 3K0LA 4I2OA 5E8IA 3M70A 3QP5A 3EYYA 3KEQA 5I0RA 4XF3A 3W6KB 2A3SA 4L2NA 3V7RA 2HTSA 3IKVA 3E5XA 2V1DA 4OIQF 5AIQA 2QBYB 3SXWA 2PHLA 4KNYA 3TGNA 5BV6A 4YIIA 1Z7UA 3LAPA 5JR7B 5H20A 4AD9A 2ETHA 1OYWA 2XROA 2GA2A 2M30A 4JV4A 5KHHA 4XLPF 3LA7A 3T8RA 1XGOA 1K6OA 2OU2A 4CHUA 4ZYGA 1ZGJA 4ENMA 3ZP5A 4LA2A 5JR3A 3FHIB 4KN7X 2M8EA 1PUEE 5DDGA 3C3WA 1BC7C 2P7VB 2MC3A 1D8KA 1GHCA 4HF0A 4HZFA 4XFAA 1KYZA 2VBZA 3TNPB 1J5YA 4WZCA 3EETA 2B5HA 3T8TA 2JTVA 3C7JA 3ETQA 4LUKA 3C18A 4A5MA 1CAVA 1S3JA 1RL3A 3KSCA 1ZRDA 4O9EA 1WGPA 1IXSB 5HS7A 3WTZA 3D0SA 1XSXA 4A0YA 2Q30A 1J3RA 4B29A 1QPMA 1Z91A 3U1DA 4IEUA 3NRVA 4E2QA 1LDJA 3OOPA 1ZG3A 2KIUA 4A2UA 1B9NA 3HSRA 1J9IA 5H6RA 1FSEA 4YYOA 4M6XA 2VBXA 3GEZA 3LA3A 1KA8A 4U7DA 2NAZA 1OFNA 4HW0A 2P8TA 3I59B 3ULQB 1W5SA 2FEZA 2COMA 1J7KA 4AVCA 1L0OC 1UIJA 3R0JA 2ZCWA 3GO5A 4KA4A 2PI0A 4M6YA 1X7NA 5FPZA 3JSOA 2HS5A 3H3ZA 4IRIA 3GYDA 4HX8A 3GBFA 1XE8A 1O57A 1F5TA 4RGSA 5ICFA 1FBSA 1EPZA 2C0ZA 1O7FA 5CVVA 3OTFA 5ICCA 4EQQA 4EJVA 1Z1DA 5LRSA 3ELKA 1T98A 3E6CC 3E97A 3HTUA 1JHHA 3BPVA 2ZKLA 2PMUA 1P4AA 1ONVA 4GYGA 2QDRA 1ZG1A 3REOA 3U11A 3GF2A 4LEJA 3F8CA 4G8XA 4I0BA 1RC6A 5LGNA 2V9VA 3BZ6A 2WV0A 5JHUA 3UKNA 2GA1A 3HRUA 2KXLA 1NHAA 3EQLF 2A6HF 1J3QA 1TQ5A 3ROUA 4L5JA 4YG2F 4IEYA 1X82A 3JW4A 1MGTA 4QMAA 4HSLA 3LOIA 3CEWA 5ILVA 4HLTA 4AIHA 2P5LC 4P5OA 4JK1X 4MGRA 3V7SA 5D8LB 4MH0E 3ABUA 3TOAA 3MQ0A 4PDKA 1T38A 3D0JA 2ATFA 4HDUA 2CAUA 3SCFA 1TTYA 2EFWA 4YFKF 2D40A 4MGZE 1HKSA 3O2PE 4NHJA 4IEZA 1X8MA 3BCWA 4R1HA 1OYIA 3H7JA 3WW3A 5DUKA 3K1PA 4HMZA 4KN4X 4EGZA 2ZMEA 1FC3A 3U9GA 1DZRA 3MAJA 1G3TA 4ZZDA 3JSPA 3V8LA 4BHCA 3BJAA 2CFXA 4KWLA 4MX3A 4JQFA 4E70A 2XAQA 5HS9A 5IT3A 1G3YA 3RKXA 5DUIA 4LLOA 2O8QA 2D5FA 3PQJA 4RB2C 4ESFA 2MBFA 1YIOA 3LFKA 3VFZA 1ZLJA 3QAHA 4L5IA 1ZARA 4Q5SF 3BALA 2M45A 3CJNA 2F5FA 4JBAA 1PM7A 2OAZA 3BPXA 3FXUA 3KP2A 1YO5C 3CTAA 1REPC 4Y17A 1WRJA 2PAMA 1O7LA 4MGIE 1ODDA 2A07F 3F22A 3KP3A 1ULYA 1R22A 2GQQA 4DINB 4ENKA 2EV6A 4XSZF 1HW5A 1Z6TA 2RGVA 2ZO4A 4BYYA 3VOEA 3DP7A 3LA2A 3ZQ7A 2KJBA 2H6BA 2P4WA 2P6SA 1QXRA 3F21A 5I0TA 4HYEA 2OBPA 2A69F 1IPJA 4M71A 2QWWA 2UY9A 1ZG5A 2XAJA 4META 4WXHA 5KHJA 5D5UB 4Q29A 1H0MA 4AQ2A 3IIAA 4IEWA 1BJAA 1HSTA 1T0FA 1TQMA 1ZNPA 2ACJA 1G3WA 5FFZA 2CQKA 5LEJA 4PIYA 2CG4A 2Q4SA 4EWAA 3ECOA 4AXOA 1O3RA 2IJLA 1I27A 4OOIA 3QRFF 3PLQA 1AOYA 3C1DA 4HN1A 4TV7A 4IHTA 1DPUA 3I71A 1G4DA 4EV0A 2P5KA 5HI0A 5FLIA 1R5GA 2HQRA 3MWMA 3P9KA 3U0ZA 4HBLA 3RYRA 4LB5A 3QACA 1FLIA 1AWCA 4FAGA 4KU7A 4E2SA 3WTXC 4N9HA 5L3CA 1GVJA 2OQGA 2YSRA 2WWYA 4GYIA 1XN7A 4PCQA 1XDSA 4WBBA 2FMYA 4QWQA 4EGYA 1O4TA 1OPCA 3SMHA 3ES4A 1UIKA 5T3NA 4KMUX 3RNSA 2LNBA 2B8MA 4KIBA 3IDBB 4E2GA 3N4MA 3SCHA 3OD0A 2CW0F 3WGGA 4L18B 2XV4S 4KUMA 1LEAA 1VTNC 5HDNA 1UPIA 5FFXA 3BB6A 5L3BA 5DCFA 1S6LA 2HZTA 4ON0A 4P9UA 4L9TA 1LJ9A 2XLGA 3TO6A 2HGCA 1U12A 3EDPA 1R1TA 1XSVA 2AXLA 3UKVA 4HN0A 2EB7A 2EV5A 4CYDA 2K02A 2NS0A 1J3PA 4IVNA 4AWXB 1QO0D 2HOEA 2VECA 3EUHA 4B8XA 2OZUA 1CAUA 4ENNA 3ZMDA 2PN6A 4EM1A 5E1XA 4A0XA 1MDMA 4CO8A 1XDUA 4U7BA 4UXAA 3M8EA 3RI4A 2DAOA 2XLAA 3GFLA 3I64A 2NNYA 3M8FA 2RVCA 4LFUA 5FD5A 2XKPA 4XLNF 2PAEA 3S7EA 1YFUA 2YPRA 3S7IA 1ZN2A 3TKYA 4M74A 1O5LA 3FFQA 2YX7A 2OZJA 4OU0A 4U0YA 3GX4X 2Q8KA 2L3DA 4HVRA 4HX4A 3TQNA 2UZKA 1FYKA 2K4BA 4I7HA 3NKTA 1V4RA 3B02A 1STZA 4EM2A 4K2EA 4KFCA 3HYIA 2DK5A 4FT8A 2Y75A 3MYXA 2ZFWA 4RB1A 1QY4A 3IRQA 3J80K 3V8JA 4IRHA 3ZMVA 1VP6A 4OIOF 5K5OA 3FMRA 4NQWA 3VHRA 1ZZ7A 1FY7A 2UWMA 4ESJA 4RB0A 3PNAA 4IEPA 1YG2A 4LB6B 1OKRA 5DCMA 2QYOA 3WE3A 3LAJA 2FXAA 4RB3C 3HQXA 1NYWA 1SQ4A 4EROA 3B73A 2Q0AA 2FSWA 1WQ2A 3TOBA 1IN4A 2D93A 1IPKA 2VQAA 1G3SA 2FBKA 2NNNA 4OIRF 4EJWA 1U2WA 4EJUA 1WKMA 1CAWB 1FP2A 3GW2A 2V1UA 4IEXA 1WI9A 1SD5A 1Z9CA 5E20A 3WTYC 2QBYA 4IHSA 4A0ZA 4RAYA 5LGTA 2BEOA 5KHGA 2QUFA 4LLLA 2GC3A 2W25A 5E8GA 5CVIA 3DPLC 5DV5A 5J7MA 5JI6A 1NZCA 3H1MA 3ZMZA 5CVRA 3F23A 3WE2A 4NB5A 4GO1A 3V4GA 4CICA 3DEUA 1T2KA 2WTEA 2L01A 4FX4A 4O9GA 3ML6A 2MNGA 3H50A 1SFNA 1BI1A 2IA0A 2PEXA 1D5VA 2N7GA 3MEXA 2QENA 2DPDA 4LLNA 1MJAA 2L4MA 3RKYA 5K5RA 5DD4A 1UCRA 2W84A 3NL1A 1FBUA 3BDDA 4XF4A 1PDNC 1BI2A 1F1ZA 5LEKA 2GXGA 2XKOA 4M73A 4IEQA 1YLFA 1CAXB 4CZZA 5D4SA 4EJOA 5LHIA 1SMYF 1KU3A 1XMKA 2H09A 1K7AA 4XEZA 1S8NA 1QGPA 1WA4A 2VT3A 1Q43A 2VONA 3USSA 3HRTA 2R7DA 2Z3YA 1A04A 2OA2A 2GAUA 1JE8A 2PA7A 4O5VA 3TDUC 4RS8A 4GGGA 5K8SA 5D5VB 3AAFA 1T6SA 3M3IA 2HR3A 2FRHA 3I59A 5E18F 5L3DA 3H9AA 5HOOA 3MCZA 3KEOA 3E6BA 4I0AA 4XETA 5HS8A 5BPIA 3FJSA 4ZYDA 3SHRA 1LQ1A 2O61A 4FBFA 1FZPB 2QCSB 1EH8A 4AQ6A 4OFGA 1K79A 1R23A 4LMYA 3KMHA 2DQRA 4HLXA 4UBGA 5FPXA 3HTSB 4QXKA 1T39A 1J75A 3HOTA 2PQ8A 3RDIA 4HQEA 4IXAA 3J80Z 3S0MA 2STTA 3DF8A 4EVIA 2G9WA 3SQNA 4G7HF 2EA4A 2QVSB 1FYMA 4FAHA 2KJCA 4XFFA 3OGJA 2PBIA 2XAHA 3O3KA 2IC1A 3DKWA 2HTJA 1DGRA 3HUGA 1TQIA 2NYXA 2GH2A 4ZU4A 1EH6A 1SFUA 1YLLA 1V70A 4Y13A 5D6EA 4KWKA 4BH9A 3ZN1A 1J1LA 4HX7A 5BPXA 3L9FA 3F6OA 3O6BB 4BAYA 3V7CA 1U5TA 4L9VA 5JAXA 2A61A 4BIFA 3HSFA 2O6GE 1IRGA 3DPTA 3IL2A 2FQPA 4QGLA 2IPQX 4HF1A 2P6TA 2VT2A 3BWGA 1HKQA 1SD4A 4AVBA 3KCCA 1UHMA 5KHIA 1U6GA 2QQAA 1BI3A 4LA3A 2PFWA 5ILUA 4AVPA 5E17F 3Q5FA 2MHFA 4QM8A 1S29A 5FD6A 3MDPA 3CLOA 2PMHA 1R36A 3HHHA 3S2WA 1WSUA 1J0RA 5C8WA 2HKXA 3PVBB 2KRFA 5D4RA 2DPUA 1YTYA 2JSCA 3MPBA 2BNOA 3G7DA 1V3FA 3KP6A 2OQRA 3LSTA 1F4KA 4UNOA 2V6CA 2WFPA 5I0UA 2BV6A 1DP7P 1UB9A 2Q1ZB 4WXCA 3H8UA 4MTDA 1XCBA 2QLZA 4PIZA 5HDGA 4I02A 2QNKA 4I3PA 4B09A 3ES1A 3CUOA 1EP0A 1XB4A 4R52A 4P55A 1DGWA 1MKMA 1MJ9A 2BBYA 4LG0A 1CGPA 5KBFA 5L3EA 3IWFA 1U78A 2BNNA 4M9XA 3KLNA 1EY2A 1W4MA 4NVPA 2RDPA 1R58A 2Q0OA 3GZ6A 5DD8A 1ON2A 4ONUA 4ZU5A 3GLXA 2FU4A 3KZYA 2E1NA 1DDNA 3R61A 3T0YA 1CF7B 3C3VA 3GYHX 2GC1A 1XRUA 1ZAOA 2PHDA 4KIFA 3IHUA 1H9TA 3I7DA 3H7YA 1K78B 3HT2A 2JPBA 2O1QA 4A6DA 2VXZA 1RGSA 2DU9A 1XGMA 4UXNA 2D1VA 3CF6E 1QQIA 5CJ9A 4UUVA 4YRDA 4G6QA 3KP4A 2ZMEB 3FMSA 2OD5A 2VBWA 4FHTA 3IBMA 3KP7A 5CADA 3L2HA 4ZU7A 3FF5A 3VB2A 3P9CA 3R4KA 4Q48A 5ICEA 2O3FA 3CO2A 3CL1A 1J58A 1TW2A 1DUXC 4YIFA 1ZRCA 1IN6A 5D5WB 1JHFA 1LDKB 3WG9A 4QGNA 2H27A 1LEBA 4KIGA 5FGMA 5FB2A 1R1VA 1SAXA 4XFCA 1I6XA 2WC2A 4G9YA 4P9FA 2ESHA 1ZGAA 3NEUA 4MTEA 3RYKA 2RQPA 2M87A 4G7ZF 4A6EA 4CDGA 2M1BA 4UV8A 3E6MA 4JVAA 2CGPA 6PAXA 5ILSA 2QM3A 2QZ8A 4Q0SA 3GWZA 3HHGA 1GQGA 2VC0A 3BJ6A 4AVAA 1XMAA 5I91A 1P6RA 2IT0A 5EEGA 2DK8A 4BNCA 4WF2A 1W7PA 2XUBA 1HQCA 2Y0OA 3JTHA 2Y0MA 2FNPA 2PYTA 2ISYA 1ZRFA 4J1WA 1YW8A 5BOXA 1BN5A 4HBNA 3TO9A 3JZVA 4MEXF 1G6NA 4ETSA 3MZYA 3U10A 1BC8C 1MD0A 3G3ZA 4UVCA 5BXXA 4D7SA 5I8TA 3M9AA 2P5VA 2J5OA 4MNUA 4FX0A 4RD7A 3BROA 2G7UA 2UY8A 4HVQA 3FWEA 2FMLA 3WTVC 1LB2A 3KGLA 4A5NA 2XL9A 2H6CA 4KYWA 2DW4A 1QWRA 1LRHA 2YR2A 3HT1A 4KT5C 2DLLA 3QP6A 2PLYA 3VEPA 4OMYA 4Y15A 2Z99A 5L3FA 2O0YA 2FF4A 4WX9A 2IW5A 4MZUA 2L4AA 4IEVA 5EEHA 3WTWC 1YUDA 2ZXJA 2UXNA 1TBXA 5BPDA 2Z9OA 1B1BA 2GXBA 2HYFA 3IRRA 1O3TA 2V1XA 3ST7A 3BOQA 4DQ2A 2DI3A 2E1CA 1S7AA 1DPRA 2PJPA 1YWKA 1YW9A 1HBXG 3I0TA 4Q0PA 1ZH5A 2ZBKA 4RGXA 4J1XA 5D8KB 2V79A 1P92A 4XFHA 2DFIA 4LD5A 5FQ0B 3RPUA 1FSHA 3ZMTA 4HV5A 4AIJA 2L02A 5C6CA 2PG4A 1O3QA 5BQTA 3QPTA 1R00A 4KMFA 5I8YA 3WTUC 2ZNYA 1XSDA 1Q3EA 1IW7F 2K4JA 1BI0A 2YX4A 3EBRA 3GXOA 1YFHA 5LBQA 4LK1F 1B59A 4CGZA 2GC0A 3CUQC 5ICGA 4HVOA 2DBBA 3KETA 1FBQA 1BIAA 2ZJ2A 4KICA 4OINF 1ZREA 2XLFA 1NE4A 5KHKA 4QLCU 2LF8A 3ZMSA 1JGSA 1MDMB 5BS6A 1ZRRA 3GFMA 1MJBA 4YARA 3WTTC 4TLFA 2CWEA 3GFIA 5DEQA 5HLGA 1YS7A 1X8EA 3CUQB 2C6YA 4D0PA 3ACLA 3FHZA 5D6FA 1YFWA 2EAAA 2ETEA 5F64A 3VODA 3GUDA 3I53A 2J5PA 5LRRA 2HFHA 4XFGA 2IVMA 1Q5OA 3JAMK 3RYPA 3W6JB 1Z05A 4MGYE 3L2CA 2HDCA 3TNQA 1XCVA 4Q0UA 4Z2YA 4L11A 4XRFA 1OD5A 1C0WA 1JXSA 2Q2EA 4IJAA 2PTMA 4JTNA 3EJKA 1I1GA 2AS5F 3SXYA 1KQ9A 2LDUA 3FM5A 5CLSA 1BM9A 1ON1A 2F2EA 2GIVA 1KGSA 1KU7A 4ZYHA 3H1YA 3G73A 5DCMB 3N97A 5IT9K 1EV7A 1UD1A 1QXJA 5AONA 4WCGA 1ZZCA 3BU7A 2F5EA 2CV6A 2H0VA 3LZZA 3R0AA 1EYBA 2LSOA 3RIRA 4BHPA 3O14A 2Z2SB 2MD5A 5J8FA 4ZYEA 1YQAA 1P2FA 3HRMA 2HJIA 2Z69A 1VR3A 1SFXA 1ZHFA 1F9NA 1MZBA 2PAKA 2E9QA 2FE3A 3NVCA 1YHFA 2RV8A 3IC7A 4G94A 5BY5A 1ZZ6A 3SZPA 5L3GA 2A5YB 4MUVA 3WGIA 4YSFA 5F1RA 4HOBA 2H94A 2RKHA 4Q47A 1P4XA 1SMTA 2HYGD 1SFEA 3E5UA 4HAMA 2FA5A 2TDXA 1IRFA 3OF1A 2W85A 2W24A 3JTGA 4PZJA 1B9MA 1HW2A 4N9IA 4PJYA 2EJRA 4PGGA 4HDVA 4EJTA 2E7XA 3MFKA 1SEFA 5FLXK 1FX7A 4MHGA 1IF1A 4K8FA 3FXQA 1SD6A 1IAWA 3GVAA 2G7HA 2RNJA 2BNMA 1LDDA 4Z82A 4I09A 2JT1A 3D82A 1NXMA 4L0ZB 1GXQA 2VOPA 5E1RA 4BHBA 3LQRA 2F5CA 2QQBA 1TQPA 2EVXA 1FNNA 2OYZA 1GXPA 4HV6A 4ESBA 5I0SA 4ASNA 1D8JA 3DL3A 3NW4A 3HRSA 3IWZA 5J8CA 2ESNA 4YFNF 3PQKA 1B4AA 3I5UA 4YFXF 4XFBA 3BP8A 2BGCA 2BYVE 3F8FA 4UBHA 1X3UA 2KIFA 1BIBA 2XVCA 3TDZC 1H1IA 2VC1A 5JVTA 3FX3A 3RTRA 1LVAA 4S05A 4QGMA 2KKOA 1IZ1A 5H6QA 2CSOA 3K69A 2K27A 3HOSA 5FO5A 4IRGA 1UCXA 1CAVB 1TNTA 4RGRA 5KK1A 3U2RA 2HEOA 3NSTA 1FP1D 3KFWX 2O8XA 3EO6A 2EA7A 5E1ZB 4IPAA 5EZWA 1FXZA 2IA1A 4KU8A 4A12A 2YU3A 4L0YB 3WW1A 2QVOA 3KZZA 3LWCA 1R1UA 3P9IA 2XIGA 3JAMZ 1QBJA 4I01A 2P17A 2XL7A 4BXUA 3CJXA 5HDKA 2EA2A 1O5UA 1HKTA 5A2QK 1ZZBA 4ZZLA 1XGNA 1GQHA 1JUHA 4LUMA 3IKTA 1J2XA 2IP2A 4HF2A 4PIXA 2QQ9A 2GU9A 3QOPA 5FLJA 1W7PD 5JSPA 2A68F 3RPQA 5LHHA 4R8HA 5F6FA 5CYVA 5LLQA 1USTA 4HA8A 3SHFA 2VPVA 4M9SA 1I1SA 1I5ZA 1IXRC 2PQQA 4IEOA 1KYWA 4Q0VA 2K86A 2Y48A 1RNLA 5IT9Z 3K9TA 2ZKZA 2F4PA 1U5TC 2FNAA 2D1HA 4UHTA 4BQAA 3FM3A 2OA4A 4L9NA 2F5DA 2EWNA 4GXOA 1O3SA 2Z33A 1J59A 4WXDA 2VODA 1SD7A 3D5LA 3M1EA 3EQEA 1S7OA 2DT5A 4CXFA 3NJZA 5K1YA 2HQNA 2MLKA 2LF7A 2OZ6A 2K7LA 3ECHA 3DFGA 1WLTA 4HSJA 3SFZA 1U5TB 1CF7A 1UFMA 2XAGA 2K0GA 2FBIA 4GCVA 4S04A 2ADUA 1XD7A 1D3YA 1KU9A 1USSA 1K78A 2EK5A 3RJPA 3RKWA 3V8KA 3ZMUA 1YW7A 3UKTA 1PP8F 3F72A 2L54A 5HVQC 3CO6C 3LWFA 3FE5A 3L00A 4U0WA 1IN8A 4IERA 1RUOA 2QJVA 1TW3A 1Z6RA 5BUVA 2BE5F 1DZTA 5ED4A 2D5HA 5CU1A 3Q9VA 5FLXZ 1ZZ8A 2CAVA 3COAC 2IXJA 3H1WA 5AVPA 4EM0B 4LTAA 4ENJA 3F6VA 1W5TA 4N0BA 3T1BA 3J81K 2JPCA 4LGWA 5K5QA 3DXJF 3ZPLA 5FCCA 2DO7A 2E7WA 4UVAA 3GFJA 5AIPA 5I8SA 4HQMA 5KVRA 5JSOA 3ISPA 5JCTA 4XF9A 4Z07A 3I58A 4MQVA 4JTOA 3DN7A 1BOAA 4F8AA 2XASA 3P7NA 4KL1A 1KQ8A 4EWDA 2JZYA 3DQVC 2ET7A 2EFOA 3GZ5A 2P7CB 4WK8F 3CDHA 1P4WA 1FYLA 3L7WA 4LG0B 1NE6A 4EWEA 1H1MA 1PMIA 3SCGA 5BMZA 3NQOA 3Q9SA 1E17A 3FMQA 3E6DA 4G6DA 2STWA 2VBYA 2IXHA 4U0VA 2IXIA 2DCTA 4H0EA 1H9GA 2V09A 4O6JA 4UVBA 3K2ZA 1TNSA 1E2XA 3KLOA 4M72A 4M9ZA 1Q1HA 2K9ZA 1RUNA 2JRTA 1QZYA 1R5HA 1CX4A 4XF0A 4P9GA 4GULA 4HLYA 3T5XA 4G7OF 3FZ3A 5A2QZ 3QU3A 1YFYA 2UXXA 2FQ3A 2W57A 1IN7A 3CLPA 5I93A 2LKPA 3HIFA 2XHKA 4DNCA 1L3JA 3RZZA 3DV8A 2UYBA 4I98B 5JFRA 4XFIA 3TO7A 1ZZ9A 2CO5A 3ERED 2VE9A 2EFQA 2R7FA 1L3LA 5HLIA 3H92A 4MV2A 1B6AA 1RZ4A 2DTRA 4YNIA 1UW8A 3MZHA 4ZH4F 3OV8A 2KIMA 3ZN0A
chains in the Genus database with same CATH superfamily
3K46A 1XXNA 2NMOA 1ETKA 2HZDA 5ERIA 4AK3A 1U3EM 1W2AX 2Y0IA 3BTLA 4S2FA 1Y0UA 4D7TA 2Q5TA 1W06A 3GDBA 3W5NA 3MKWB 4XDPA 1GZWA 3OUHA 1LOFC 5GZGA 4XKCA 3SKJE 1D5YA 1N25A 1Y9QA 1IGOA 4QTRA 3AKTA 3HVDA 1JI6A 1QJU1 1YI9A 4OI4A 4D8MA 2VW0A 4A3CJ 4CZCA 2JXAA 3F8BA 5C7GA 1ZYRF 2OCEA 4AW7A 4XBFA 4XILA 3I49A 1HXDA 2HWVA 2VI6A 4X1EA 4KBBA 5F5AA 3WV6A 1PO11 3PFIA 1FI2A 5EJZB 5FPUA 5FDBA 2ET1A 1EAH2 3W59A 4UB6C 4DOUA 4XOPA 2RDRA 2MH2A 4X6QB 1TG7A 4B48A 2EILH 2B9SA 3WU0A 3GTGJ 2IXKA 1WI3A 4KJZA 2RN7A 3J81Z 2DF7A 5GLZA 4BXFA 3LQCA 2VU9A 5EYRA 2XQRA 4CDWB 1LR5A 3F8NA 4XABA 5CVJA 1XOYA 3PURA 4QXBA 1UYPA 2BDRA 4MQ9F 1HSJA 5GJ6A 4TLGA 2DVBA 2RS52 2HVQA 1CAWA 1JI8A 1DBNA 4RS5A 3VBOB 3R60A 2IS4A 3GM8A 2ZNZA 4PGHA 1G59A 2VZQA 4B4PA 1LNWA 4OWRB 4AQTA 2NRAC 1CAUB 2ELJA 2XJQA 1WJCA 4DNYA 2K85A 2MA3A 3LSMA 4CCMA 1ETOA 4AIKA 4BZ4A 4WVZA 2RJKA 4X6RB 2HEVF 3FZVA 4H7LA 5FIXA 2O03A 2D2WA 2VE8A 2IEKA 2VMDA 3AM2A 4Q0QA 5FYZA 3ZQHA 3O12A 4YGBA 3PNTA 1W8ZA 1WMEA 5TRDA 4BS9A 1XJAA 3I54A 2UYAA 1QF3A 2W9XA 2A6ZA 1WJEA 1DGLA 4OUEA 4PI0A 2VOVA 5EPAA 4KITB 1PP7U 3IDCB 2VPRA 1R093 3WNOA 3ZKYA 3K4ZA 3SDGA 2AH2A 4OI0A 4MEYF 3LAGA 5E1WA 1XNAA 2LALA 2EIKH 5DG2A 3D3AA 3QU6A 5HLHA 4CP1A 2IXLA 2RJLA 4NIHA 3KP5A 4IF4A 2KDZA 1FV3A 1F43A 2N8GA 2RC4A 3K0LA 3F2ZA 5E8IA 3QP5A 4FQZA 3W6KB 1VBA3 1ERDA 4XLAA 4L2NA 3VBRA 2HTSA 1RXFA 2V1DA 1N1YA 2QBYB 1KZHA 2PHLA 2OKXA 1W90A 1HB4A 2DVGA 4LBLA 4GWMA 5H20A 2Y6FA 1OFCX 2OIIA 2XROA 3JREA 1DYKA 4JV4A 4KG0A 5FK8A 4XLPF 3T8RA 2IUWA 4CHUA 2OU2A 2XWBB 5FZ9A 1HB1A 3PUIA 3ZP5A 1PGL1 1K45A 1H8VA 2M8EA 1PIV3 1QJX1 1XNKA 1BC7C 5JVGF 3WCRA 3V56A 2NS8A 2FZ1A 3DBRB 1DGWX 1KYZA 1YIFA 3TNPB 3EETA 1V6LA 4P9XA 3GCMA 2DOAA 1BEV3 4RAGA 3CCLI 2P3YA 4A5MA 3ZYBA 3KEYA 4LBMA 5DAXA 1RL3A 5IY5H 1B35A 9ANTA 1ZRDA 5EWSA 2IGMA 3I4MJ 4XORA 1MMGA 1IPSA 4RQPC 3VBHB 2ZMLA 4AWDA 4AU7A 3VHOA 1RMU1 2HOSA 1QPMA 1Z91A 2NVYJ 3NRVA 2F6BA 3OOPA 1ZG3A 2KIUA 5C70A 5HNFA 1JMUB 4A2UA 4H55A 1B9NA 5H6RA 3AL6A 1NX9A 5FPAA 1PYVA 4M6XA 4XN0A 1NQJA 3N9PA 1OFNA 1K42A 2P8TA 3ULQB 3OPTA 5CEHA 5AVAA 2VBDA 4AVCA 1W8OA 5GLWA 4XDOA 4N43B 1VI0A 1UU4A 4ASKA 3H3ZA 4IRIA 3GYDA 1O57A 3ZQGA 1W28A 1RR7A 1OOPC 5EJCA 5ICCA 2XSDC 4EJVA 4U87A 1IRXA 4AVZA 3OYCA 4XL9A 3E97A 3GHNA 3RZKA 1F4AA 3LSKA 1VPHA 1JHHA 3I4NJ 5FYCA 1ONVA 4GYGA 2LROA 3OYWA 4FOYA 5C3OA 3JXSA 4G8XA 4JDOA 2FBEA 1QOOA 2V9VA 3AG2H 3BZ6A 2WV0A 3DBLB 1N1VA 1R081 3UKNA 3HRUA 5IAXA 2HEYF 2DMTA 1NHAA 1LEDA 1QEXA 3EQLF 4Z92B 3PL0A 4C2TA 1ENSA 1J3QA 3ROUA 2E71A 4LO5B 4L5JA 4CCDA 2R30A 4S2GA 4IEYA 2ECCA 4HSLA 4J6GA 2P5LC 4MGRA 3V7SA 1K5MA 3CDLA 1YEWA 4A7YA 4D5FA 2QKLB 1T38A 3P5BA 1Q8QA 2ATFA 3ACFA 4HDUA 2VKHA 2KQRA 2CAUA 3ZFGB 3RG0A 3SCFA 1TTYA 3VBFC 1FOWA 4BJTA 1MZ6A 2NQYA 2D40A 1OA4A 1WCMJ 4IEZA 4R1HA 4MGSA 3OBRA 3WW3A 4XXAA 1R1A3 2B46X 3H9GA 4FFGA 2RS12 4XBQA 1J84A 2ZMEA 1FC3A 3OYIA 1ZA7A 4HEA2 3UT0A 3JSPA 4YRVA 5JXGA 4QPGB 4KWLA 4JQFA 1BK1A 3RKXA 4LLOA 2O8QA 2D5FA 5LA2A 1N75A 2XGCA 4Q1RA 5C33A 3PQJA 2LC2A 4RB2C 1JYVA 3E7LA 1B8IA 2DU1A 2FDJA 1PVC1 1PGW1 4G12A 3NWTA 2K9MA 4NO4A 5JXHA 3A0HC 2IGNA 1UY4A 4X8PA 1NTCA 2ARBA 3WQ7A 4OHXA 3KP3A 2MW8A 1R22A 1V5EA 4DINB 1W1WE 2BOIA 5FBJA 5DS9A 3WUCA 5JWPA 4OVEA 3RQ4A 1I3QJ 3IAM2 1WBFA 4GMP3 3LA2A 2BXZA 1JKOC 2H6BA 2LY9A 2P6SA 2P4EA 3F21A 3IZOA 1BXHA 2W52A 2XUMA 5I0TA 2E2JJ 3HR9A 1UMZA 3WHTA 5FZBA 5ACA3 1URXA 1WJAA 1ZG5A 1H2MA 2JK3A 4WXHA 4ZKTB 3L2WA 3I4IA 2ZOEB 2WABA 4P9JA 1T0FA 1ZYBA 5E79C 5FFZA 5LEJA 1MBKA 1NCRA 1P8JA 2Q4SA 2OUMA 4MO3M 4M3EA 4PCRA 3WG2A 3QRFF 4TV7A 2WYFA 3LEIA 5A1AA 4E9KA 1R5GA 2HQRA 2BFUL 3DUIA 3AYDA 3P9KA 3VDAA 1ZGWA 2NS7A 1CJPA 4KU7A 2EZIA 1LHVA 3SC7X 4N9HA 1GVJA 3BKZA 2YSRA 4GYIA 4AEDB 4QWQA 3DU5A 1OPCA 3NNGA 3SMHA 1PK6B 3ES4A 1X19A 3RNSA 2LNBA 3IDBB 3IH2A 5FJKA 4IQPA 4CZSA 2E2IJ 3N4MA 1WUVA 2ZC2A 3OD0A 3GJAA 3WGGA 4L18B 3AJYA 1VTNC 5IFTA 5HDNA 3I3EA 1W9YA 4ARYA 4FTHA 2VQTA 3UK9A 2BW3B 4M0NA 2GNMA 3BB6A 1CVNA 2A5WA 2D7FA 4P9UA 3PVNA 3TO6A 2HGCA 2VNRA 5F27A 1U12A 1MMDA 2WT2A 2X85A 4F52A 1XSVA 4QHZA 4ATEA 3LPGA 3VBUC 3VBOA 4XR6A 2K02A 4XIKA 4AWXB 3FLTA 2IGKA 3EUHA 4B8XA 1CAUA 3ZMDA 2ECBA 5BNOC 2Z42A 2AQEA 4CO8A 2C4XA 4AFCA 2X9DA 4KNCA 3I64A 1OH4A 3VV1A 2ZJRF 3NNJA 5KNLA 4IV1C 4LFUA 1TE1B 2XKPA 1KJRA 1M4WA 3PSFA 1ZN2A 4HKWA 1ND3B 4Q2FA 1BMV1 4OU0A 5CBLA 4BL0B 4U0YA 1MSEC 4IE5A 1S0JA 4ASMB 3FKIJ 4HVRA 4HX4A 3VPRA 3BGAA 1IUFA 1R091 4I7HA 2FJ1A 3NKTA 3GTOJ 3J7HA 3SEQA 4DXSA 4BK4A 4EM2A 5C8CB 3VHNA 2IZWA 3HYIA 3NV4A 2ZMKA 2ZFWA 2QA4I 3IRQA 2WNVB 1NCQB 1ASJ2 2KP6A 4LJHA 1ZZ7A 2QZ3A 4ESJA 3DECA 4FPLA 4RB0A 2WO3A 2ZJPF 4E8CA 2ZACA 5DZFA 4B1MA 1YG2A 1MS8A 3OSDA 3VUOA 2L0KA 1A6QA 2FQ4A 2I8DA 4LLFA 2JG8B 3U1XA 4NRQA 2FSWA 1WQ2A 2BWAA 3OY8B 1IN4A 2D93A 1SG3A 1VBA1 2VQAA 5HCFA 3PTYA 4GH4A 3TN93 3ERMA 4AF9A 2FBKA 3AKQA 4II3A 1RRJA 4JGZC 3GW2A 3K75B 3B3QE 2JWTA 2QBYA 2ID4A 4IHSA 4A0ZA 1JZ5A 5FOBB 4ZHNA 5DM7F 5L19A 2HLEA 3DPLC 4LBQA 2HOAA 3ZFFA 3M4OJ 3RVHA 3HMYA 2NM1A 3OSFA 4YVSB 3OYFA 3C7GA 3F23A 3LDKA 4NB5A 4GO1A 3V4GA 2HWF3 2ZXQA 1RPWA 3ONQA 3LSGA 4EATA 2L01A 3FUOA 1SBEA 1UG2A 2DOEA 3RI9A 3H50A 2K9NA 3PIJA 1BI1A 1D5VA 3AG1H 2A7AA 4XMAA 1BEV1 3G1OA 3VN4A 5GPCA 2CQQA 2QF7A 2XPVA 1NAEA 1FBUA 1PDNC 2CJJA 1F1ZA 1UY0A 1S0CA 5LEKA 3HBLA 3G71I 2GXGA 4A7KA 2F4IA 4LIUA 4M73A 4PI2A 3VBHA 1CAXB 4EJOA 5LHIA 3AB0A 2ZGPA 1K7AA 5J1UA 2UV1A 1S8NA 1DG6A 3IIIA 4XKBA 2X53S 1PJRA 1Q43A 3UESA 3ZFEC 3USSA 2Z3YA 2OA2A 2Q1FA 4RS8A 2A6VA 4MSVA 5E18F 1Y43B 1HB2A 3BI3A 2MEV3 1NG7A 3WDWA 5F3CA 2IAIA 3E6BA 3H42B 5HS8A 2HI3A 2VQCA 1LQ1A 3HEFA 3W5MA 3K7AJ 2I10A 1K79A 3OYAA 4JX0A 3KMHA 5JLVA 5FPXA 2DMNA 4XRSG 1T39A 4AZZA 5FZDA 4MLOA 2PQ8A 3RDIA 1LFPA 2OJED 1HQWA 2XHNA 3MLKA 2JE9A 1NY71 3AFGA 4YVWC 4ES9A 4IX7A 3I56I 4JQTA 5TSWA 2P3JA 3DF8A 1TWGJ 3SQNA 2QVSB 1FYMA 2JDKA 2DDBA 5CFDA 2OV7A 4IHYA 1KXGA 1TME3 4XFFA 3H1CA 3DKWA 3KYDB 5FXZA 3T30A 1F2NA 4XLFA 3CJQB 4CCOA 2COBA 4FE4A 4E7SA 2GH2A 4OI1A 4XKVA 1MH3A 4ZU4A 1AXZA 5FV3A 2VMCA 3K4LA 4JGYB 1EV12 4DZPA 3RRDA 5BPXA 2DYSH 2XB6C 4YFWA 3O6BB 3V7CA 2TBVA 4YGEA 4ZDLA 2A61A 4JRAA 4IV3C 2VQGA 2O6GE 3DPTA 3RZJA 2VLAA 4QGLA 2IPQX 4HF1A 3OB8A 1HKQA 3A01B 3L2RA 1R1A1 1IJWC 4V1PA 3KCCA 1XB9A 5KHIA 2XJPA 3MIFA 2G0EA 4LA3A 5D8AC 4D7NA 5E17F 3ZCOA 1A35A 4PFOA 2E7AA 1S29A 4AUXA 3MDPA 3I2KA 1RKWA 5C8WA 2HKXA 4ZPIA 3OYBA 2KRFA 4W8JA 2D6NA 2G19A 1G8XA 3IM0A 2JSCA 4AM3A 1XNBA 2BNOA 5FZKA 5EYXA 3WZ1A 3KP6A 1HJGA 4AYBN 2X1DA 3CCUI 4UNOA 1Z7S3 4AOCA 2YGLA 5I0UA 3H8UA 5JLXA 3QH6A 2E1OA 5IYDJ 4LO6B 4PIZA 4I02A 3HKZA 2NP0A 4LE4A 4B8EA 2FDIA 1WH7A 1EP0A 4ZDOA 3HBKA 4R52A 1EJ9A 2J1EA 4BQXA 3BG6A 2DCYA 2D3RA 3ZGKA 3OIPA 2E51A 2GLOA 4M9XA 4GMP1 1GBGA 1KITA 1MSFC 1HXS2 2Q0OA 3ZPOA 4BQ1A 3GLXA 5KHDA 2IFWA 1DDNA 4W6WA 4WVVA 3AFHA 5ACA1 4AVSA 3GYHX 4GRIA 3WDXA 2GC1A 4BQYA 1H9TA 1MQTB 3VD9A 2VXZA 2OQ7A 3BU0A 1XGMA 1AR72 1QQIA 5CJ9A 4K6BA 3ZM8A 2YU1A 2OD5A 2KZGA 4FHTA 4BJ5C 1Z77A 1X3WB 1UXXX 3P9CA 4O61A 4CU6A 3B94A 3I3MA 1J58A 3UNGC 4OHYA 3ZYIB 2HWB2 1IN6A 3JQWA 1JHFA 4QGNA 4RA2A 5BNGA 1OQ1A 5FGMA 5FB2A 1RYYA 3EUAA 1NKGA 2XMLA 2ZXWH 3RYKA 4CUCA 1R64A 4G7ZF 3TEZA 4CDGA 4AHYA 1H2LA 3MZ8A 4JVAA 3ZSJA 6PAXA 2HH9A 2ZHNA 3IPVA 4RLFA 3GWZA 3HHGA 1PK6A 4JCKA 5I91A 2IT0A 3DF0A 4MG2A 2YZ4A 1Q8PA 4WF2A 2FDGA 3BR0A 4BEHB 2DFCA 1HQCA 2FNPA 3NAPC 2PYTA 3ZYPA 1F36A 3BIWE 3FXJA 1RUG2 4QWNA 1BN5A 4XKWA 2XONA 2TEPA 2YFUA 1AYN3 3AMPA 4HBNA 1FYUA 5A6QA 1JZ2A 1H88C 3AFKA 3HJEA 1BLZA 3U10A 1BC8C 1MD0A 4CEWC 2E36A 1J09A 1YQ5A 3TEWA 1SLCA 1E5IA 4RD7A 4NNJA 4GXLA 3SFIA 5LASA 2VBPA 4Z2WA 5KXBA 1FAYA 1H6XA 3CHXA 4NBQA 3J26N 3NWSA 3I2HA 3MI8A 3O0WA 2QQVA 2XC7A 3PJYA 1VNDA 3L1PA 1REEA 1GFF2 3QP6A 1X9PA 1ND3A 1E5SA 2ZGSA 3RMYA 4Y15A 3ORJA 3SKVA 3MVPA 4NIAA 4HONA 2Z99A 1S2KA 3HNYM 2NVTJ 2L4AA 1O91A 2Y0SA 2XRLA 2C24A 2VZ3A 4P9LA 5M3MJ 1YUDA 2UXNA 3JD73 3WCSA 5FO9B 1V9U3 2Z9OA 1B1BA 2XSJC 4BMEA 2EPFA 1VFCA 3PIOF 4EN7B 3IRRA 1X58A 2V1XA 4M4RA 3BR5A 1S1AA 4DQ2A 1GZTA 3E1F1 2E1CA 1NCQA 1OLQA 2JA2A 4QPIB 4Q0PA 4GB32 2ZBKA 1VB2A 3JRDA 3HQRA 4URTA 2K9LA 2DFIA 2WLPA 5FQ0B 3FXOA 3BOWA 1CWPA 1QU0A 2W3JA 1CR7A 2HBTA 5C6CA 2JG8A 4AI0A 3B6CA 4FI9A 5B3SH 4CDUC 3TN91 1G9DA 4BQOA 3OY8A 2K4JA 1BI0A 3GXOA 2O8KA 4EYUA 5FKOA 3T0BA 4NC8A 2ZJ2A 5KWRA 2JA7J 4QDSA 1NE4A 3U37A 4PLNA 2EINH 1W8FA 1GUIA 3DU6A 3T08A 2ZGOA 4AL9A 2R042 4YVSA 3WTTC 1WW4A 1OBNA 2HWF1 2RR13 1WMDA 2TNFA 1C8M3 2C6YA 3HN1A 2CV1A 3FHZA 3VODA 2D6LX 2J5PA 5LRRA 2HFHA 4CUAA 1K12A 3ACHA 5A1FA 1YIJI 3W6JB 3L2CA 4Q4Y3 3TNQA 5BNPC 1Q56A 2LS6A 2R1DA 4L11A 2MSYA 3HPGA 3AP4A 2K3PA 3CMGA 5EJ1B 3IDEA 3AYAA 1UF2C 4LBKA 2EXKA 1LOBA 5JR2A 1K4SA 4JTNA 2R7EB 1Y7BA 4W50A 2QSFX 4N8MA 3P1IA 2JDAA 3FHQA 1KGSA 2DCJA 2WWUA 1JTZX 1U9NA 3FC0A 4K8RB 2VZ1A 2GP3A 5DCMB 5LFAA 2EIBA 4IHXA 4RMNA 3P3NA 5AONA 1W6NB 1U5IA 3BTAA 1H8TB 1EYBA 3HBZA 1YHQI 3K4MA 4ZYEA 4GMP0 3H5RA 4M3CF 3HRMA 1W36D 2HJIA 2Z69A 2ME6A 3RZDJ 1JHNA 1ZHFA 2MEV1 3A21A 1TWHJ 2KDOA 1S0DA 2DFHA 1DYPA 4PT6A 2FE3A 3CF5F 2AR6A 3WU2C 3ZN4A 1OCCH 3PSIA 3SZPA 3H3VK 4YSFA 4XAEA 3VBRC 1POGA 5EXOA 2RKHA 1EUTA 2VMHA 4MO7A 1P4XA 2HPMA 2HYGD 1W03A 4HAMA 2ADEA 3N9LA 4E4ZA 3GCXA 3JTGA 4ZZ8A 4I3GA 4PZJA 3WR0A 3AP6A 2FD8A 2P3IA 1B9MA 4G3YC 1HW2A 1G7YA 4I0WB 2EJRA 2GN3A 4BY7J 4NWWA 4HDVA 5F3GA 2E7XA 3MFKA 4MHGA 1JGGA 4K8FA 1ZKGA 2DCEA 4DIQA 3POEA 1TME1 4QQLA 1PHMA 3R0RA 2JT1A 4YGCA 2KFDA 4UFKA 1NXMA 4L0ZB 1F9KA 5DQ0A 5CNAA 4H7MA 2EVXA 2F5CA 2QQBA 2WB1N 3PU8A 1SCRA 2DV9A 4HV6A 4ESBA 3BG3A 4YEJA 3DL3A 1MNMC 2A75A 4YFNF 4RM3A 1GWLA 1OURA 4J00A 2BGCA 4IKFA 2WSVA 3HDDA 1U5XA 2KIFA 3NO8A 5J3LA 1H1IA 4WM7B 2CU7A 3X2QH 4S05A 2FCTA 3R4DB 1IZ1A 4Q27A 1CAVB 2YPDA 1TNTA 1HF0A 4RGRA 1PGSA 4BQ5A 4QX0A 5AC92 3NSTA 5FKLA 4K1YA 3LEMA 5LY2A 4KG8A 3CLQA 2RNGA 4P5HA 4QT6A 3CQZJ 4QQ2A 3GTKJ 3SNMA 1UL9A 2A71A 2WA4A 4YG3A 1YRZA 3WW1A 5FY0A 1MVEA 4ITCA 3CZJA 3CJXA 2DTYA 3LDRA 3NKGA 2UUZA 4LHSA 2KISA 1HKTA 3ZXJA 5A2QK 1S2EA 4ZZLA 1OLRA 5KC5A 4DW6A 4LUMA 3IKTA 5H9RA 1Z7S1 4PIXA 5GZEA 2QQ9A 1B72A 3GZAA 1W7PD 5JSPA 3J7LA 3RPQA 2A6XA 5FLMJ 2LH9A 3GBGA 1PX3A 2EF6A 2HNHA 1C8NA 2DFEA 1I5ZA 2XH6A 2CUJA 2Y48A 1RNLA 5IT9Z 2XXZA 3HG9A 1U5TC 2LUWA 2FNAA 1PO23 1VQ8I 4MYEA 4BQAA 4XUPA 2OA4A 4L9NA 1LU2A 2KRCA 1QJU2 5A3PA 1OPOA 3HOWJ 2LD5A 2VODA 1SD7A 5KXEA 1IDYA 4YELA 2ZX0A 2P34A 3BUCA 3VZJA 2HQNA 1LENA 2OQ6A 1XBFA 1JYCA 1WLTA 4RR3C 3U14A 4TZDA 1FMWA 3N7JA 1UFMA 2OS2A 1VBE3 1H2NA 5DDJ3 4GCVA 1K5MC 1W6OB 1D3YA 5FWEA 5GLUA 3B01A 4NR1A 4PDWB 5L7OB 4W97A 2CV0A 1IOAA 2L54A 2PQSA 1SBDA 3LWFA 3FE5A 2M9HA 1XPWA 2VUCA 1N77A 1SACA 4IERA 1Z6RA 2GSYA 4K9SA 1DZTA 5CU1A 5EZGA 5FLXZ 2JWPA 2CAVA 2X6YA 4BE1A 4YGDA 4ZXKA 3F6VA 3J81K 2JPCA 4LGWA 1GZCA 5FCCA 2DO7A 2XPJA 4R9AA 5AIPA 5I8SA 4HQMA 4MADA 4M4PA 3OMYA 1GZ9A 4Z07A 1CJDA 3OY9A 5F04A 4JTOA 3DN7A 1BOAA 4F8AA 2XASA 1KQ8A 4YZ3A 2JZYA 2ET7A 4Z1VA 3SEEA 2NN8A 1P4WA 4W4ZA 4MVTA 1GU3A 4AVTA 1TC3C 4DRVA 3SCGA 3FMQA 1MZFA 2VBYA 3J4UH 3AKSA 1AKHB 5H9QA 3OGGA 2V09A 2WO2A 1AYN1 2GNBA 3K2ZA 1TNSA 2VJJA 3KLOA 1UOGA 1BA5A 2JUGA 1R5HA 3J7NA 2J1UA 3KF3A 1CX4A 2E5ZA 4QDRA 4AHZA 4DJAA 4P9GA 3HNBM 4HLYA 2WB1A 3NV2A 3KIOA 1W8UA 5JUVA 4DNCA 4BOWA 1GT0C 5GPAA 3ZQLA 3LEGA 3RZZA 1T0FC 3DV8A 2JDMA 5E3MA 2VE9A 2A3XA 2R7FA 1RZ4A 2JN6A 1FATA 4NHMA 5BNNA 1UWWA 2J7MA 5FYBA 4ZH4F 3U78A 1W0PA 1JW6A 2BZDA 1SDWA 2KIMA 2W00A 3JD71 1V9U1 4CCCA 4F55A 4NC7A 4LLGF 3W21A 3RSNA 3BR2A 1PGL2 4QXCA 1QJX2 4NN0A 2P3KA 4PBOA 5CG9A 4U88A 5DAVA 4A41A 2WY7Q 5IUQA 1ZX5A 2D6OX 2OPKA 5FQ0A 2KD7A 1WWXA 3L09A 3HWJA 1MEC3 2FDKA 3SDBA 4QX3A 1CPMA 1ENRA 5DZGA 2GWRA 2W7NA 2DVAA 1VQLI 1GOFA 2VG9A 5LA1A 3GZTB 2WZEA 2PFBA 4LR4A 1RMU2 4CDWC 3NNFA 3VKLA 5J6XA 1HDPA 2VMEA 3RZHA 3JCIA 1KU2A 2X5IB 5H9SA 3KGZA 1WD4A 4CTEA 2GOXB 4A3KJ 1OR7A 2GZWA 3QPLA 3EUHC 2RR11 4P96A 5JIUA 5KCMA 1KEXA 1C8M1 4KDPA 1YYVA 1VBC3 2NVUB 4FOQA 1ZLKA 2Y33A 4C91A 1IN5A 2JB4A 1FT9A 3DTEA 3IB3A 3BIEA 3AJZA 3IUOA 1IQAA 3KT7A 2VNVA 4Q4Y1 4P08A 4EMSA 4P14A 3C7OA 2JEMA 1VRBA 1XE0A 3LE0A 2IXCA 3H8RA 1UHWA 4QM9A 2BPA2 4XCBA 3BY6A 5FLHA 1PVEA 1BOBA 3J7MA 1D4VB 5CVUA 2HKOA 4R79A 2PHRA 2X10A 3WTSC 2GC2A 3PVEA 2JSPA 3BG9A 3FXRA 4CUBA 2ELKA 4CCLA 2R7XA 1XE7A 4IUGA 3S3OA 3BTXA 5J48A 1R082 1D1CA 2QBXA 4V2VA 1YCIA 4OLLA 2EQRA 4B4RA 3VWBA 3LQQA 2E6VA 5C9AA 1VJ2A 4W1UA 3MFCA 4OMCA 1JZ4A 4BLIA 4BMBA 1UOJA 3PMSA 1H8TA 1K61A 1QZZA 1P9QC 1BBYA 1S0BA 3CESA 3S17J 2E31A 3TEDA 2FCUA 3RFRA 4ZTFA 4YLZA 4WV8A 3S5AA 3FK7A 2ARAA 1XGSA 3EYIA 3WDTA 5JXIA 1DQ4A 3Q8EA 4DY3A 3WG1A 4E7HA 3W2VA 1Y1VJ 4FTBA 2YB7A 4Q4ZF 1SMVA 1RUC3 2LG4A 4YPJA 4DZGA 5A6ZA 1KQ0A 1GQPA 2EFNA 3H5NA 1UU6A 4GIQA 1AX2A 1N1SA 4QD2A 1AXKA 3QPHA 3ZR8X 3CO7C 1S4CA 3WODF 3E3VA 3WF3A 4QHBA 4I2OA 3K4KA 3M70A 2FDHA 4COZA 5CFCB 3KEQA 4XF3A 3LIHA 3V7RA 3HOVJ 4EEFG 2XBO3 4XBLA 1VQ7I 1DQ1A 4OIQF 3SXWA 1V6JA 4KNYA 3TGNA 2G9GA 4AHWA 2WNUB 4UOJA 2B7EA 2BOLA 3OG2A 4AD9A 1OYWA 5CG8A 5KHHA 3LA7A 1PVC2 1OVPA 3B7MA 1POV3 1PGW2 1ZGJA 4ENMA 1N3QA 1PNGA 4KN7X 1VMJA 4BQ3A 1PUEE 3BODA 3A4CA 3VBHC 3AL0B 1GHCA 4HF0A 4WZCA 4BGDA 3T8TA 2Z5WA 2D3PA 4DBQA 1QDOA 4LUKA 3SH3A 1CAVA 4DQAA 1S3JA 4GDFA 1G9CA 1Y39A 3QQAA 3W20A 4BWOA 3LSPA 1WGPA 4RFT0 4ZDPA 2WT0A 3RCOA 3OEBA 3KV9A 1S0FA 3K4AA 2Q30A 4IEUA 5A6XA 3ILFA 3ATGA 4N43C 3HSRA 2R7TA 3WHCA 3MW4A 2R063 3CCVI 1LGCA 3LA3A 3T0DA 4I30A 5HODA 5FZAA 5KAIC 3FLRA 4HW0A 2W48A 3PUBA 1UYZA 3I59B 1VQNI 5IOZA 4Q4X3 3N3HA 3OL4A 4UFMA 2UURA 2COMA 2TRTA 2QZ2A 1RUH3 4N7UA 1VAMA 3HGYA 1UIJA 1RUD3 3R0JA 4D6RA 2G9FA 4TTGA 4M6YA 1PO21 5FPZA 5J47A 2V5YA 3GBFA 3A4UA 3OS0A 2RDSA 3FIWA 2VZOA 5CVVA 5FJ8J 3RS6A 4EQQA 4A45A 1Z1DA 2V72A 4YM1A 1T98A 3E6CC 4CDQB 4GA9A 4R9DA 3OYHA 2RDNA 3BPVA 1SVOA 2JDPA 2ZKLA 2LY1A 3REOA 3S8PA 4WZFA 1VBE1 3GF2A 3DYOA 5DDJ1 3F8CA 4LK6A 1PX4A 1W6OA 2KXLA 3WEZA 3SLIA 1UZYA 4XQFA 3M8LA 2Z1DA 3ZFGC 4PDWA 1RUF3 1OLTA 4N53C 1TQ5A 1T33A 3B9IA 3C7HA 2LK2A 4YG2F 1X4OA 3JW4A 1MGTA 4QMAA 3LOIA 3CEWA 5ILVA 5DUVA 2DA6A 4QU1A 4JK1X 3WINE 5D8LB 4MH0E 4P5YA 5E6HA 3MQ0A 3O1OA 3D0JA 4QPGC 2DUPA 4PQQA 4YFKF 1IG0A 3L2YA 5JDBA 2DA1A 1X8MA 1NA1B 2BU9A 1LCLA 2ARCA 4UYBA 4M3BA 4FFIA 1XU1A 4NPLA 3NV1A 4PHZA 4XOTA 3K4BA 2E19A 1BMV2 1DZRA 1PZ7A 5K9YA 4DYCA 3V8LA 2O14A 4BHCA 2X6XA 3BJAA 4AC0A 3MKZA 4Y3OA 2XAQA 1R092 1AYM2 1G3YA 5DUIA 3OYGA 4M3DA 1RINA 2H1KA 3B93A 2YUEA 4E7IA 4ESFA 3PVOA 2MBFA 1YIOA 4CSWA 1AKHA 1WZXA 1AF9A 3DXUA 4CA0A 1WLCA 4L5IA 3CJNA 1QDCA 3I3DA 3FXUA 4LITA 4QPQA 3OPWA 2VUJA 1WRJA 2PAMA 4KH9A 2ZXIA 4C2MJ 2R7OA 3CJIB 1ODDA 4WVWA 1ULYA 5HNHA 1A6IA 2GQQA 1TZLA 3PDQA 1VBA2 4XUNA 4XSZF 1Z6TA 2RGVA 5HCAA 4YWAA 4KQ7A 2QKDA 2YY1A 4AGVA 4JYKA 1TT0A 2P4WA 4B3NA 2L9NA 3CIHA 4HYEA 1W0OA 5A32B 3N36A 2QWWA 1IKQA 2UY9A 4DFSA 1TEIA 1D1AA 2CWMA 2XAJA 4META 4AE2A 1ZR4A 3EUKL 2WWSA 1W2UA 2WZR3 5KHJA 1W3XA 4Q29A 3VB9A 3WLUA 2BFUS 4AQ2A 2W94A 1YXWA 1JJ8C 1PIV2 1HSTA 2IGOA 1ZNPA 5APAA 2ACJA 4P02B 1G3WA 2LOOA 4JP0A 4PIYA 1JKPC 1X33A 2EZKA 1O3RA 2IJLA 4F3QA 4AEDC 3I9V2 3PLQA 3DKXA 1BEV2 4IHTA 1PK6C 1MEC1 5JZGB 5HI0A 5FLIA 3MWMA 1G9FA 4JC1A 5T5OA 5FRNA 3U0ZA 5FYIA 2DUQA 3RYRA 1D7PM 4FAGA 2DYRH 1KD7A 3WTXC 4JOMA 4B47A 4PCQA 2M3AA 2VW1A 2VZPA 3VZLA 1XDSA 1OHFA 2X1CA 1JOPA 4KMUX 2ES3A 4ASLA 5DPNA 2B8MA 3VGIA 5FTTC 2VTXA 2X5IA 1ODNA 1F8VA 2XV4S 2YYOA 1JYNA 3JCUC 3UKGA 4XTPA 4XLCA 5D21A 1VBC1 4XC9A 3OYLA 3S30A 1UKRA 4C1WA 2XLGA 4HSRA 4IE4A 3KV5A 3UV9A 4CYDA 2NS0A 4XHBA 1ND3C 2VECA 1OF3A 2WV1A 2OZUA 4ENNA 1X1PA 2YROA 1FIAA 4OQ8A 5E1XA 5ERLA 1XDUA 4PLMA 4UXAA 2DAOA 4A6OA 4RM2A 1H9PA 3AZWA 1NY72 1ND2B 5C8CC 1O4XA 3M8FA 2Q8EA 2PAEA 2CQNA 2YPRA 4IZZA 2WNVC 3EXUA 1NCQC 4M74A 1O5LA 3S93A 3GX4X 2NOJB 1A8MA 2L3DA 3VKMA 1CN1A 4CRQA 2UZKA 1CQTA 1RUJ3 1W9FA 3TBIA 3ABLH 2K4BA 2R5YA 3BLYA 4K2EA 1BKZA 1UPSA 3CZ6A 2Y75A 2E35A 1DGWY 4RB1A 1NLSA 1QY4A 3H8OA 2F6CA 3V8JA 3ZMVA 1SLAA 2MG4A 4QPWA 2VXJA 3RI8A 2ZZQA 3VHRA 2UWMA 1RUC1 3PUAA 3PNAA 4XM3A 4PBPA 3WQ1A 2BTVC 2Q8OA 2YBSA 5G04L 5F3EA 3OBZA 2XQXA 5IHRA 5IATA 2FXAA 3CMAI 1R1A2 3A03A 4QU2A 3SH4A 1K4TA 4YVSC 1IPKA 2IS2A 1WMFA 3MKYB 3LDBA 5LA0A 4AI9A 2XBO1 4OI2A 3ITQA 4OIRF 1U2WA 4EJUA 3WX5A 2I07B 1CAWB 1F5FA 1FP2A 4RS5B 3ZSLA 3WQ0A 1FOD3 2NXNB 2JD4A 3LSEA 4TSVA 3EPZA 1RUI3 2HYJA 3FUQA 2WNUA 1VQ6I 4BM8A 2W1OA 2W25A 2B42B 1UG0A 4E7LA 5CVIA 4K3UA 5FXWA 2CY6A 2QGUA 2JIJA 5CVRA 2BXYA 3WE2A 1XSRA 5IK8A 3T1MA 5CQEA 4XOGA 5A6YA 3B9CA 5C44J 1SLBA 3PM1A 5F7UA 3VDDB 4YFZA 4U36A 2QQPA 1W39A 2XF5A 1CIWA 2PJRA 4LLNA 1MJAA 2G9ZA 2L4MA 2CU5A 3RKYA 1UZVA 5K5RA 3NL1A 4XF4A 2VC9A 2ZGTA 1K6YA 2A05A 1KQRA 1NLRA 1VIWB 5B4XA 4HT1T 4V2WA 1Z67A 5ACA2 3G6EI 2H09A 1VQMI 2WQZC 3GJBA 3ZXKA 1F15A 1WA4A 2R061 4E4HA 2VONA 1QHGA 3HRTA 1GICA 3J8F3 2V26A 1ALYA 2GAUA 2PA7A 4YZ1A 5K8SA 5D5VB 5DABA 5FZEA 2LLKA 4Q4X1 4C30A 3I59A 1UNBA 3F9KA 1RUH1 3MPPG 4E7ZA 2F4LA 1SPPB 1Z3XA 5EIYB 5HOOA 1RUD1 2PHUA 3MCZA 3LNQA 4XETA 3FJSA 3SHRA 2O61A 4XJAA 4FBFA 4AQ6A 1ZQ3P 4OFGA 2VVDA 1R23A 1CIYA 3RJ2X 1LOEA 1K3IA 2QQOA 1MACA 5F3IA 4MXWA 3NWKA 1J75A 3H0GJ 4CDQA 5FZIA 4HQEA 2VQ0A 2DFFA 2V5DA 4CDXA 4I99C 5A7QA 1Z7LA 1LVKA 2WQ8A 1ST8A 2Y2ZA 4JGYC 2G9WA 4IGPA 2K46A 4G7HF 5C5TA 2EA4A 5HXMA 3AMQA 4AI8A 4FAHA 1RVF3 2CW8A 3OGJA 1RUF1 3O1TA 2XAHA 5JMCA 5L73A 4IGOA 1Y1WJ 1B35B 1R1ZA 2HTJA 2GH8A 4YW3A 1B09A 2E7TA 1DGRA 3HM5A 2BVBA 1TQIA 1YLLA 2VR4A 4Q4W3 2EALA 2XVLA 4WM8A 4BH9A 3ZN1A 4HX7A 5TGTA 3L9FA 4HNUA 4BAYA 1AR83 2KM2A 1RB8G 2YS9A 1H89C 5FZGA 4L9VA 1DHKB 3HSFA 2FDFA 1V6OA 3IL2A 5FKCA 1HDKA 3T0AA 2YGMA 3B5LB 2P6TA 1QVTA 5ABJA 3BWGA 2FOWA 3DXTA 1NA1A 4AVBA 2VMIA 3AZYA 3IT8A 4XVHA 2PFWA 5ILUA 3I8TA 4QPYA 5HPOA 4H3WA 3BG5A 3Q5FA 5FD6A 1E57A 3PJQA 3OYEA 2NZ9A 1R36A 1GSLA 1WSUA 4A3GJ 2R1BA 1OC1A 2DPUA 3TP0A 1YTYA 1IS4A 4IOCF 4AFBA 5J1XA 3F95A 2OQRA 3K77A 3OYWB 1BR2A 4M01A 3KV6A 2BV6A 2DTWA 4WXCA 1XCBA 1C5HA 2XVGA 3AYCA 3KWVA 1C28A 4I3PA 2BHYA 4B09A 3ES1A 1RJ7A 2Y6GA 4UFJA 3K4JA 4FPFA 3KQRA 3VBSB 1KGYA 4IEJA 1MBGA 4LG0A 1CGPA 1POQA 1YJLA 1VAKA 3TN92 2BNNA 1HRI3 1EY2A 1MQTC 4NVPA 5FRMA 4ONUA 2CQ7A 1QPIA 3KZYA 5C3PA 3R61A 5IWFA 1CF7B 2K9SA 2VJIA 1XRUA 2WZR1 1ZAOA 4ZONA 2PHDA 3IHUA 5EGOA 3HT2A 3FXLA 2R93J 2O1QA 4A6DA 2RDQA 2ZAAA 2HWF2 1JOJA 4UXNA 3OL3A 4UUVA 2JE8A 4YRDA 4XQDA 4G6QA 4DUVA 5FJHA 3ZIXA 4A42A 2ZMEB 4CU9A 3IBMA 2MFZA 4BB3A 4XLEA 2VCCA 4Q48A 2D5VA 2O3FA 2LW8A 3CL1A 5SV5A 5CKQA 4IOAF 1KS5A 2HWE3 4J25A 2HWC2 2OX0A 5JZGA 3ZYFA 1LDKB 3WG9A 4GKYA 2H27A 1W6PB 2OUHA 1CONA 4NE9A 1R1VA 1POV0 2WC2A 2WSUA 2AACA 1TWFJ 3IP4B 3L9JT 4C3HJ 4FVVA 2M1BA 3NNLA 5CZKA 3OR2C 5ILSA 1XNTA 2QZ8A 1N47A 2A1XA 2LY2A 2CUFA 1GQGA 3IAPA 2VC0A 1XMAA 2CL2A 3OIQA 3HOXJ 4XHXA 2E7QA 1P6RA 1FOXA 5EEGA 2DTZA 3ZQFA 2DK8A 4BNCA 2ZSHB 1W7PA 5FMDA 3N9NA 1PMHX 4OULA 2CUZA 2VXDA 3JTHA 4UW4A 2MEV2 4PUSA 3LSDA 3JBG3 4YW6A 5BOXA 3I2OA 4R9BA 3TO9A 4MEXF 3MF6A 1YJNI 4TN7A 3P6BA 1LOFA 2BJSA 5HCHA 3POGA 5FLVA 4LO8A 4V19K 2P5VA 2WQ4A 4YM0A 2WAEA 4ZC3A 3O1SA 5A3NA 3LSHA 1YQ8A 4X0GA 2JG9B 4HVQA 3FWEA 3WTVC 1NCRB 3KV4A 1ND2A 5IVEA 4KYWA 3T2TA 1LRHA 2YR2A 3Q0VA 4KT5C 4UFHA 4NIGA 3VEPA 2DT6A 1TME2 4OMYA 3OD4A 1GNHA 5FUPA 5FXXA 4QPIC 4OUMA 4GZ9A 4YZ4A 1RUJ1 4MZUA 2XAUA 1YE9A 5EEHA 3CDIA 5DMYA 5BYNA 1TBXA 5BPDA 2W82A 2GXBA 3KT4A 5JOZA 1OCPA 4FCAA 3ST7A 3ZPYA 3BOQA 2DI3A 2IS6A 2JKXA 1DPRA 1K83J 1YW9A 3I0TA 3VBUB 5E88A 1DQ2A 3SZGA 4J1XA 1Y0NA 4LD5A 3IH4A 2VTXJ 4Y33A 1UJ8A 5B66C 4LKDA 3Q0WA 2CGNA 1BW6A 1R00A 3QPTA 3PO2J 3JRGA 2EZLA 3WTUC 4YW7A 1Q3EA 1IW7F 1YFHA 3M1CA 1B59A 1OUXA 4CGZA 1ULDA 1S0IA 1FOD1 3KETA 5E3OA 1QHDA 1BIAA 4XQWA 1IV6A 4KICA 2XLFA 3H5AA 3BZCA 3OUJA 2GIZA 1DU6A 4QLCU 5LBBA 5A3OA 1OLME 4KT6A 3BPSA 2PLV3 1Z7S2 2XB5A 1LKXA 4YARA 1KONA 4CA9A 4LPLA 3GFIA 1WCSA 3H36A 2WA3A 3CUQB 4CP2A 4D0PA 1WKYA 1YFWA 2ETEA 5F64A 5FYYA 3GUDA 3OPZA 3U4XA 1HLCA 4XFGA 2BZTA 2IVMA 2ZJQF 1W0UA 1Q8VA 1VQ9I 1D4M3 1I5PA 1VLNA 3VDDA 1QU3A 2ZJCA 1ULPA 1D1BA 4HNTA 1QH7A 1AYM3 5A70A 1WHUA 4B43A 1H8TC 4XRFA 2ID6A 1F31A 2K40A 3A22A 5IPAA 2Q2EA 5EDNA 1W6MB 2GMMA 1FMD3 4NWVA 3HGGA 2AGSA 1E0EA 2GALA 2GIVA 2UWCA 3D5SC 5GLTA 3JRCA 4ZYHA 2YG0A 3G73A 1Z21A 5IT9K 3N97A 1EV7A 1UD1A 3J8F1 1MZ5A 3BU7A 1F5JA 1VMFA 1ZBA3 2GMPA 4SBVA 2H0VA 3WNPA 4N4NB 5J8FA 2XG3A 1C5IA 1P2FA 3J7AY 3V0AA 1U9OA 4GH4B 4BU2A 4P9YA 1NG0A 1MS1A 1SPPA 4Q8LA 5C4WC 3IC7A 1O6UA 3T3YA 5BY5A 1ZZ6A 4Y4YA 5L3GA 5DG1A 1OCRH 3Q0UA 5F1RA 3W2AA 4Q47A 2K2SA 2DMQA 2XJVA 2CS3A 3IDAA 4LBQB 3ZFFB 1SMTA 3CZUA 4DEQA 2TDXA 1IRFA 3OF1A 2W24A 4B1RA 1TWCJ 4GD4A 4UW6A 3L2VA 4PJYA 3S57A 5IVFA 4PGGA 4LK7A 1R49A 2PELA 2LP0A 1GNYA 3OYNA 1US3A 5FLXK 2I5UA 3S3MA 1IF1A 1STMA 2Y6LA 2DXIA 5FP7A 5ISLA 1RVF1 2QQJA 4CUGA 2HVRA 1FEXA 1LDDA 4Z82A 4I09A 3ZO0B 4CXWA 5A33B 3D82A 4EQVA 4WM7C 3FDYA 3POWA 2BW8A 2G4IA 3LQRA 4BHBA 1OQYA 5B4NA 2H1LA 4CP0A 3MF9A 5I0SA 4XLHA 4FTSA 5DUUA 1AYN2 2GN7A 1B4AA 4Q4W1 3I5UA 5FMBA 2OTJI 3M3EA 1WJBA 4XFBA 1YYNA 4DMIA 4HANA 4GWNA 1AR81 2WNEA 2EIGA 2OTLI 1BIBA 3TDZC 3CCJI 2VC1A 5JVTA 4E8DA 2L7KA 3RTRA 2VCBA 3LIGA 4JKKA 4NJ4A 3C8XA 1OOPA 3HOSA 5FO5A 1S55A 2GNDA 1OISA 3BTIA 1UHSA 5D2AA 2W1SA 5BNQA 3K2OA 4YVWB 2EA7A 1I39A 1LE8B 1FXZA 1AR93 3CU7A 3FN9A 4QX8A 4L0YB 2ORXA 2QVOA 4UUSA 2XIGA 4UW5A 5IYBJ 4I01A 3JD72 4IQ4A 2DBIA 4BXUA 3GZEA 4AEMA 1V9U2 1VQOI 4LXLA 1WD3A 4MOAA 4NC6A 3D5RC 4B4CA 2DOFA 1GQHA 4SLIA 3WSOA 1QNWA 1NOVA 4HF2A 3POFA 3DEEA 3QOPA 4WVMB 2VPLA 3BTJA 4R8HA 5CYVA 4IO9F 5LLQA 1USTA 5FPVA 4M9SA 2WAOA 5CFDB 1KYWA 4Q0VA 1DZQA 4AHXA 2ZKZA 3VBSA 1E5RA 3VBFA 3NJYA 3KB5A 1HRI1 2OPWA 3THDA 3VL8A 4PDWC 2AYHA 5L7OC 3PJRA 3BZKA 2V9KA 4CXFA 2VUDA 4NHLA 1OCOH 5K1YA 4LO7A 1CZSA 4HETA 4P00B 4ZS3A 1CF7A 4OHWA 1TNFA 4DO0A 4S04A 2CHHA 1XD7A 5JOXA 1USSA 2RR12 2HDDA 2BP6A 3ZMUA 1YW7A 1C8M2 1IG3A 3AMMA 2ZGQA 4H14A 5FPLA 3ZOIA 3E0JB 1IN8A 3MN2A 2QJVA 1TW3A 4QB6A 2YHJA 3LKJA 5ED4A 2D5HA 3Q9VA 2P5BA 4Q4Y2 2HWE1 1ZZ8A 3Q9OA 2E1MB 3FBNB 3H1WA 3S1MJ 4ENJA 2VZTA 4OHVA 3O0XA 2R0HA 4BXSV 4N0BA 3T1BA 3FMGA 1W6PA 1W6QB 2J1AA 3WHBA 3RPUD 3PUSA 3ISPA 1XC6A 3PIGA 4AR2A 4CE8A 5LATA 4EWDA 1OT5A 2EFOA 5TISC 2P7CB 4WK8F 3CDHA 4A3IJ 1LTEA 5LCWL 2OCCH 1FYLA 3ZR6A 3L7WA 1NE6A 4EWEA 1H1MA 3URFA 2BVLA 3MV11 3H0DA 1MS0A 5H2FC 3Q9SA 3JBG1 3ILNA 4HOOA 2STWA 4XE9A 3KLSA 1H9GA 4FSJA 1YX5A 4CU8A 5J96B 1JKQC 1XNDA 4CXXA 4QAWA 4M9ZA 1T56A 1RUE3 1VALA 1RUNA 3F0CA 4RN5A 1QZYA 2GP5A 1QQP3 3WDVA 2A6YA 5JOYA 3MV01 1SFPA 3K6GA 1IGNA 3HPNA 4Q1PA 1YFYA 2JG9A 1HJFA 3TP3A 1L3JA 1S7EA 3WY6A 2VNOA 2XPUA 4XFIA 1ZZ9A 2CO5A 2DJNA 2R49A 3H92A 5FY7A 1B6AA 1OCZH 3DEWA 4YNIA 5IFPA 1UW8A 3MZHA 3KVBA 4LE3A 2D97A 3W9AA 3WGHA 5G05L 2WRAA 4BE0A 2J1RA 1BVP1 1HN1A 2MLGA 3H3UA 2B9UA 2WN3A 4JHZA 3IPVB 2CYYA 2Y9YA 4KISA 3I4PA 4QX5A 3VBUA 1MR5A 1FJLA 3WG3A 2XRNA 5EF6A 1LOCA 2QQMA 1ZVFA 4XSXF 4UV9A 2AUYA 4FPGA 3K1NA 1QJEA 1WCQA 2M5WA 3K1MA 5BNOA 1I3HA 1YS6A 4QX7A 4PK4A 5LB6A 5E89A 3APBA 3ABTA 5F6LB 4F7ZA 4IV1A 5GLVA 1SVMA 2ISZA 5FP4A 3IN9A 2M4KA 4RAZA 5LGUA 4IGQA 3E5QA 2IA2A 5E16A 2PLV1 5DAWA 5DN2A 2KT0A 2R7ZJ 2B0LA 1QJZA 3KZIC 2BQPA 4IE7A 4LK0F 2XGXA 3CUQA 1FWZA 1ULCA 3AP5A 1A78A 2ELHA 5F2SA 4A6SA 1IXCA 2I45A 4MGKE 4RGGA 4IQJA 4XMYA 2L2OA 2X4HA 1D4M1 3QLQA 1F35A 1PO22 1XNCA 3L2QA 2VOOA 3IMNA 4FP3A 1PO13 1CZVA 3T4VA 3BJOA 1LHWA 1AYM1 3BYWA 4Y20B 2IBDA 4PSXA 1OMIA 4XBNA 3WW4A 5CKTA 1Y9GA 2O9LA 4RGUA 1UKGA 1FPQA 3WG4A 5M3FJ 2XAFA 4CCJA 1FMD1 4IESA 2KMUA 1W6MA 1JODA 4N7IA 5FZCA 2XUEA 4O7XA 1VBE2 2ZA9A 3OCPA 4JGZA 4KWJA 5DDJ2 2MH9A 3J7AO 2X0LA 3GTQJ 4N4OB 5FO8B 1GMMA 3UGGA 2EV0A 1ZBA1 2BERA 4AEJA 1UZ0A 4NHXA 4FASD 3VD3A 2WZ8A 4D5CA 1OI6A 1QNTA 5B1AH 3AKRA 2A6EF 4RYDA 3O1MA 1S5LC 1JXNA 1TMF2 1FOKA 4CPBA 4OAYA 5FMOL 5CFCC 3INAA 3DLAA 2B39A 2VN2A 1R7JA 5HV0A 3MW2A 3U07A 2D45A 3BTYA 2R6QA 2L7FP 5IK5A 2XGEA 5B1BH 1Y3TA 2R3SA 3F8MA 5D5XB 2FBHA 2Z5UA 2WNUC 3R6SA 4QB2A 1EH7A 3LSRA 3A02A 3CCRI 1ITYA 1V6KA 1XMXA 5JSRA 2EFPA 1PIV1 4IETA 1KFXL 2W08A 2O8OA 2PMZN 1QNYA 3NNMA 2A3SA 1UYYA 3OEAA 4DBRA 1H9WA 3LD8A 2OW4A 4ET7A 3E5XA 3MW3A 1LULA 3KS7A 4B1LA 3K2AA 1GOHA 5AIQA 1AL0G 4YIIA 3AL0C 5A33A 4IHWA 1UN1A 2ZEYA 5JR7B 2HWC3 5LD2C 2ETHA 1HV0A 1U0JA 2GA2A 4TXWA 2M30A 5FY1A 5GTHC 1Q1VA 2VAUA 4LKEA 4DPNA 1XGOA 1K6OA 4QB1A 4ZYGA 3ZXLA 4E7JA 4EZ4A 4LA2A 5JR3A 2XJSA 2J22A 4V2FA 2HYKA 2WS93 2M4GA 1C4RA 4FPHA 4AVVA 4M3GA 1QHHD 1JU4A 4B7EA 1J5YA 2LKSA 2VTFA 2JTVA 3ETQA 3QYBA 3C18A 2IXSA 2R7WA 3KSCA 3DCQA 1IXSB 5HS7A 1LEMA 2C26A 1AX1A 1AR91 2Y26A 4YVWA 3WTZA 3C2UA 2WNOA 1XSXA 1Z0HA 1LE8A 5JI7A 2DMPA 4DS0A 1NQDA 1J3RA 5E8AA 1LDJA 1A8DA 1J9IA 1SFKA 4HFSA 1FSEA 3S14J 4NROA 1ACIA 4QDQA 2VBXA 1KA8A 3JU9A 4U7DA 5GM0A 4WVMA 1DCSA 1ODMA 4CDQC 1W5SA 4FE7A 5FXVA 3DPRB 2FEZA 3WP6A 1JYIA 1OQDA 1SANA 2J42A 3A2KA 5FBZA 3Q8FA 1J7KA 1MEC2 2ZCWA 3GO5A 2PI0A 4UB8C 4F92B 4IV3A 3QYFA 4HX8A 3PUHA 1XE8A 1F5TA 4RGSA 5ICFA 1EPZA 1UO9A 3OTFA 4IHVA 1WWYA 5LRSA 1EUUA 2OF7A 3HTUA 3PU3A 3V42A 1P4AA 2D6MA 5D8AA 4XIOA 1ZG1A 3CCYA 4AI2A 3N7KA 3T2OA 2F5VA 4LEJA 4I0BA 4LG3A 1RC6A 5LGNA 5JHUA 1A34A 4ARXA 2FUG2 3I2GA 3GTPJ 1VBC2 4S2HA 1HQNA 2A6HF 2DFBA 3HUGB 4A3EJ 4JRLA 1X82A 1GP5A 2R073 1BW5A 2FD5A 1HCRA 1GUUA 2Y8KA 4P5OA 4FPEA 3ABUA 1MS9A 3VHPA 4OAZA 4PDKA 2CWSA 4FFHA 1LUJB 2DDUA 2E2HJ 4FPKA 3WF2A 1W6QA 4NAMA 1UOFA 5CA6A 1HKSA 1B72B 3HZJA 3O2PE 1QXPA 4NHJA 2BGPA 1JOBA 4F83A 2EXIA 4BCUA 3H7JA 2VOKA 2VVFA 5DUKA 3DCFA 2CNAA 5J4YA 5E3NA 4KN4X 4EGZA 5IT6A 3U9GA 1JYXA 5K4LA 1FV2A 4YM3A 5JHFA 4MX3A 4E70A 1AL23 1LHNA 5IT3A 3LOCA 5EHDA 3CJIC 3PTRB 3KD4A 2AEYA 3M3CA 2QQLA 2WBMA 1MZEA 1IKPA 4GALA 2VD7A 2VH9A 2JD9A 2RM23 2JENA 4Q5SF 3BALA 2M45A 4COYA 1RUE1 2F5FA 2VBBA 2M7AA 4XIDA 2OAZA 1RUC2 3WOGA 2JE7A 3KP2A 1YO5C 1QQP1 1REPC 4Y17A 1DIWA 2ZX1A 1R4NB 1O7LA 4MGIE 4DGWB 2E5NA 3FXMA 3F22A 3L2UA 3I55I 4ENKA 1LHUA 4Q4V3 4IL7A 2ZO4A 2XBO2 3DP7A 3WNLA 2HEWF 1QXRA 3ECQA 2W1QA 1PM4A 4XQ4A 1IPJA 4X8NA 1DFQA 1JUSA 1WLDA 1N3OA 2XJTA 5JZGC 5D5UB 1H0MA 4DZJA 2O7OA 2GDFA 3NAPA 3HOBA 2B9VA 4OYUA 1V6IA 2DA5A 3CCQI 1TQMA 1TNRA 3FHNA 1BK0A 2GMEA 4XURA 2CG4A 3JB4C 5M5WJ 3ZSKA 1I27A 2AO9A 5FUIA 3ZQCA 3LGRA 4OOIA 1DGRM 3RZLA 4Y4RA 2BY1A 1AOYA 3UJOA 5E3LA 4HN1A 1FPN3 1DPUA 3U4SA 3A7QA 1G4DA 1S2BA 3R05A 4L99A 4HBLA 4LB5A 1FLIA 4Z2AA 4GWJA 1A36A 3CMEI 1W2NA 4E2SA 5L3CA 3ZDVA 2DA7A 3T09A 2EXHA 2WN2A 3T4HB 4WBBA 5C71A 4EGYA 4PFPA 4JX4A 3OS1A 4X6AJ 1RETA 3SJMA 1LGNA 3H3LA 3S5QA 4Y1VA 4CEYB 5T3NA 1UIKA 1ZBE2 4RHV3 2R062 2BUKA 3PNVA 1VRH3 4KUMA 1LEAA 1BBT3 3PHMA 5HXVA 3ASOH 4Q4X2 5FFXA 2WAFA 2DVDA 1RUH2 1HB3A 2J1TA 3UGFA 1RUD2 1S6LA 4HK8A 4ON0A 4L9TA 1ND2C 5T5LA 3EDPA 1C1FA 5BNNB 1AR63 2AREA 2QSGX 2EV5A 1J3PA 1YIPA 5A3MA 2KL4A 2XGDA 2HOEA 4Y20A 1RKTA 2E63A 2VCMA 5GZCA 1MDMA 2RREA 4U7BA 4JQRA 3RI4A 4CDUA 2XLAA 3GFLA 1UXZA 1H4HA 3AXEA 4RGKA 4DY5A 2YPJA 2RVCA 4XLNF 2L5QA 2DURA 3S7EA 4P1WA 4XZPA 5IYYA 5T5PA 5FZOB 3S15J 2YX7A 2OZJA 2Q8KA 1RUF2 4F91B 2VZUA 3D1NI 3TQNA 4D1QA 3BN6A 4AYBA 4CCKA 3B02A 1STZA 4KFCA 4FT8A 3MYXA 1AZDA 3JRIA 4A69C 2W47A 1VP6A 3I2FA 4OIOF 4NPMA 2RAEA 3OIOA 3BVCA 2X05A 2P6CA 2EIDA 3FMRA 4NQWA 5FRAA 1QVUA 4RS5C 4OQ9A 5L36A 3M7AA 3K70C 5BNPA 1IC8A 3LAJA 4RB3C 5M5XJ 1NYWA 2VASA 1SQ4A 2HDWA 4EROA 1Y9MA 2Q0AA 1G3SA 5J4VA 3UGHA 1XQNA 5J40A 5F8PA 5IVJA 1WKMA 3I2IA 4FFFA 2X1EA 1UMQA 4IEXA 3MO4A 4BDYA 3JRBA 1Z9CA 1GOGA 1MBJA 5E20A 3WTYC 1X1CA 2HWC1 5LGTA 4DYQA 2BEOA 3O1RA 3VDDC 4LLLA 2GC3A 1WVRA 1Y8RB 4C0HA 5E8GA 5DV5A 3NMBA 5J7MA 5JI6A 1UY3A 3H1MA 4OHZA 2UWBA 3TEYA 5F5IA 4CICA 2WS91 1T2KA 1MBHA 4QKFA 5IVBA 2ZHMA 4ZJZA 1D2QA 3AZVA 2KRHA 4FX4A 1W2OA 4L9BA 4O9GA 2WR9A 1VZ0A 5FY4A 2MNGA 1SFNA 2JDHA 5C9AB 2IA0A 5FREA 4Q8KA 5LBFA 3MEXA 5CKMA 2DPDA 1VQ4I 4AEKA 2XPWA 3A23A 3VZKA 1ZA4A 4E4SA 1XYOA 1UCRA 2W84A 1BI2A 2CSGA 3MLLA 1YQ2A 1YO8A 1ULEA 3IAQA 3K3OA 3S6PA 1YLFA 4CZZA 3CMYA 5D4SA 1I6HJ 4HK9A 2JB8A 4AG4A 2NPIA 4C3JJ 2XR4A 4XEZA 3HL2A 1XTAA 2ZGMA 2WZR2 4XXPA 3TL4X 5A7NA 2ZS6B 2JMWA 4M0HA 1DF0A 1GKBA 5KXDA 5FKNA 2JQ7A 4XRSA 2VB6A 1YC61 4AI3A 1MIJA 1I1EA 4O5VA 4GGGA 1BL0A 1T6SA 2ENRA 3M3IA 1DU3D 2HR3A 4A3ZA 1AHSA 2FRHA 1WZ2A 5L3DA 4DB5A 2ZFUA 3DPRA 3W2WA 1HA8A 4QXHA 1UU5A 3KEOA 4I0AA 3FHAA 5BPIA 4FOVA 4ZYDA 3HD8B 5FZ1A 1RXGA 2M8GX 2QCSB 3SEZA 3WF4A 3ZXFA 1WFXA 4LMYA 3RZGA 2DQRA 4HLXA 2DYCA 3HTSB 4QXKA 2GM4A 1AVBA 4ZZ5A 3A0NA 3GCWA 1QGLA 2Y69H 1B35C 2JUCA 2CFOA 3J80Z 5F39A 3S0MA 1RHI3 2WO7A 2F17A 4EVIA 2XF6A 1BR1A 5DZEA 3QYEA 3ME2A 1SFOJ 4CU7A 3EMRA 2R4GA 2JVGA 1YRNA 5IK7A 2KJCA 3VD4A 2IC1A