3H3ZA

Crystal structure of a putative cyclic nucleotide binding protein (spoa0323) from ruegeria pomeroyi dss-3 at 2.35 a resolution
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
226
structure length
226
Chain Sequence
MAHEAQKAIARNSLLIRSLPEQHVDALLSQAVWRSYDRGETLFLQEEKAQAIHVVIDGWVKLFRMTPTGSEAVVSVFTRGESFGEAVALRNTPYPVSAEAVTPCEVMHIPSPVFVSLMRRDPEICISILATTFGHLHSLVAQLEQLKAQTGAQRVAEFLLELCDCDTGACEVTLPYDKMLIAGRLGMKPESLSRAFSRLKAAGVTVKRNHAEIEDIALLRDYAESD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclic nucleotide-binding protein
publication title Crystal structure of PUTATIVE CAMP-BINDING REGULATORY PROTEIN (YP_165150.1) from SILICIBACTER POMEROYI DSS-3 at 2.35 A resolution
rcsb
source organism Ruegeria pomeroyi dss-3
molecule tags Cnmp-binding protein
total genus 63
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3h3zA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3h3zA01
4CXFA 2L4AA 1PMIA 2EFOA 2CYYA 4I09A 1FSHA 3S2WA 2JT1A 1XE8A 2FEZA 1GQHA 4LD5A 3GO5A 3CO6C 4KICA 4UV8A 5LBQA 4KUMA 2OA4A 1DDNA 2V6CA 1AWCA 4UVCA 2D93A 4XETA 5DV5A 1STZA 4EJOA 2XLGA 4HSJA 1FXZA 3KFWX 2IP2A 5AIPA 3IRRA 3HSFA 1OYWA 5LEJA 2V09A 1J7KA 1OPCA 4EWAA 1QZZA 4MV2A 2FOKA 1UD1A 4RB0A 1QZYA 4LGWA 1YFUA 4HX7A 4META 5F1RA 4XSXF 3VB2A 4IEUA 3RPQA 1S8NA 3WU1B 1FC3A 1SFEA 4L2NA 4HX8A 4FAHA 2HWVA 4U7DA 3FF5A 2EB7A 4EVIA 1UPIA 1XN7A 3JSOA 3ERED 5I0SA 3F23A 4X6QB 1DP7P 3HUGA 2QVOA 3CO7C 4LLNA 5J8FA 3DF8A 3WTTC 4H7LA 1SEFA 5HVQC 4Q0UA 3GX4X 4PGHA 1TTYA 1USSA 2L4MA 3BP8A 2A68F 1HW2A 2C0ZA 2QBYB 2HYFA 4Y17A 2EJRA 5HLIA 4KFCA 1CX4A 5BXXA 1J59A 4XRFA 2PAKA 2ZMEB 1SMTA 4G6QA 4HLTA 3U2RA 1HW1A 1ULYA 2YSRA 4HV6A 5E17F 2FF4A 1RGSA 4E2GA 5ILSA 1RUNA 2DK5A 3SXYA 4HN0A 2K0GA 5K5QA 1EH7A 3KE2A 1B9NA 4EM1A 3L09A 5I93A 3FJSA 2V1XA 3WTWC 2HKOA 1RC6A 2DT5A 4EQQA 3LQRA 4F8AA 2OBPA 3H1MA 3DL3A 2DCTA 3FMRA 1X3UA 1H0MA 3C18A 1HQCA 2XLAA 3O2PE 3F21A 4HF0A 1QWRA 4MH0E 3GXOA 3CJNA 3ECOA 4Q29A 1S7AA 1XGNA 1ON1A 3KP7A 3VFZA 1JE8A 4O9EA 2RDPA 3I7DA 5I8YA 1TQIA 3FMSA 5KHKA 3LQQA 3WGGA 1BI1A 2PEXA 5FO5A 3E5QA 1K78A 2DPDA 1YW7A 2X0LA 5CVJA 2XRNA 3V8JA 5FLIA 4EWEA 2FU4A 2XL7A 4J1XA 2QWWA 2EWNA 2K4BA 1U5TA 1QY4A 1CF7A 4Q5SF 4PZJA 4OU0A 4HDUA 4HF1A 3RDIA 4G6DA 5L3GA 5T3NA 1FBSA 5LLQA 1IZ1A 2W24A 4L9VA 4HVQA 2K9ZA 1Q43A 3LAGA 1GXPA 2QZ8A 1DUXC 4OIQF 4JQFA 4AVAA 5BY5A 4XSZF 4XFFA 2O0YA 1SD7A 1QGPA 4IEXA 2CSOA 4EROA 2D5FA 1OYYA 2D2WA 3KGLA 3KGZA 1BC7C 4BHBA 4AXOA 1U8RA 1I6XA 2MPFA 4HQEA 2BNMA 4A2UA 3SFZA 2YX7A 3NKTA 1R36A 4A5MA 1CAVB 3EO6A 2OZUA 1RL3A 1T38A 3HOTA 3T1BA 2FMYA 2BV6A 4ZYGA 3RKWA 3RYRA 4OIPF 3SHRA 2HJIA 4YRDA 3R0JA 3PLQA 4O3MA 1DGWA 4ZYDA 4ETSA 5ILVA 3PQKA 2VE9A 3IWZA 2R7DA 3HRTA 4I01A 2Y48A 3CUQA 4AVBA 4EJUA 3U0ZA 2CQKA 1XGOA 4E2SA 4Q4ZF 5ICEA 5K5RA 1XDUA 4RB3C 4J1WA 5FLJA 4HA8A 2RNJA 2QQBA 1KU9A 3HTUA 4XF0A 4NB5A 2WV0A 4WVZA 4IEZA 4U0YA 1KA8A 4KA4A 5K8SA 4L9TA 4XF4A 2DTRA 1P2FA 3SZPA 1FI2A 2GAUA 4IEYA 1VP6A 1XD7A 6PAXA 4AIKA 1ODDA 4XF1A 2PQQA 3EDPA 2Q1ZB 2MH9A 2V9VA 2GC3A 1EH6A 3EETA 3DPTA 2VBZA 1FWZA 1LDJA 2EV0A 3G3ZA 4QX5A 2PHLA 4KN4X 5HS7A 2DBBA 1ZHFA 5D4SA 2Q0OA 1FSEA 4P9FA 1U3EM 5LHGA 2EFPA 2OD5A 3CJXA 2OZ6A 5I0TA 4LFUA 2PQ8A 3D0SA 5BQTA 4K8FA 5CU1A 1EPZA 2HGCA 4P5OA 4HX4A 1HKTA 3MDPA 3FWEA 4ESJA 3QRFF 1RI7A 2Q8KA 2FA5A 2R7FA 1TQMA 2VBWA 1FNNA 2MLKA 4L9NA 4A0XA 4G9YA 2H0VA 4X6RB 1USTA 1J5YA 5D6EA 3EBRA 1G3TA 5FGMA 2V1UA 2B5HA 3UKTA 1P6RA 1ZRFA 1V3FA 2F2EA 2PFWA 1IXRC 3E5UA 3BALA 4IJAA 5JCTA 1I1GA 4MUVA 5FLHA 5D8KB 4IPAA 2FBIA 2PLYA 5HDNA 3GFLA 3GEZA 3I54A 2XGXA 4KIBA 5JVTA 1K6OA 4LUMA 1O3TA 4BNCA 2GA1A 4MGIE 1R5HA 3SHFA 4E2QA 2XUBA 4KDPA 1ZZBA 2M8EA 1Z6RA 1TBXA 4KT5C 1EY2A 2LDUA 2ET7A 2VT3A 2FQ3A 2VECA 4ZZLA 2HTSA 1KQ8A 5C8WA 3JAMK 3BJ6A 4AQ6A 3HT1A 1ZARA 3GZ5A 5F6FA 3BPZA 3F8NA 3GYDA 2GA2A 4LB5A 3CLPA 4QGMA 4CYDA 3ACLA 4RB2C 2G7UA 3P7NA 4EWDA 4R52A 3WODF 2QENA 4IESA 1ZG1A 4LG0A 3JSPA 1O7FA 1BJAA 1I5ZA 4AQ2A 1UCRA 2Z69A 4TLFA 1NHAA 3LWCA 3CF6E 1P4WA 4OINF 1FBUA 3ULQB 1CAWA 1L0OC 2VOPA 4IHSA 1IF1A 2O61A 4M9XA 3HHHA 1OMIA 4IVNA 3RKYA 1YIOA 2CWEA 4AIJA 3M3IA 1J3RA 2E7XA 4I0AA 2XLFA 5LGTA 1MD0A 2XIGA 4UV9A 1NE4A 4HZFA 2G7HA 2IXHA 4OIRF 5E1XA 3BPVA 2BEOA 1R22A 4D7TA 4Z2YA 4R8HA 2HDCA 2PYTA 2GXGA 1GVJA 3L2HA 3LSTA 1PM7A 5DCMB 5E1RA 1ONVA 3I5UA 2J5OA 1O7LA 2ZCWA 2A5YB 2O3FA 3FZ3A 4IEQA 2RKHA 3SCFA 3KZYA 4IF4A 5E8GA 2BNNA 1XDSA 1J75A 5DDGA 2A61A 4FBFA 3I4PA 4XF3A 2DLLA 2H09A 2FNPA 4JBAA 4BHCA 3D0JA 3IDBB 4MGRA 4Z07A 2KKOA 3C1DA 5CADA 2QLZA 3H3UA 1KQ0A 2K7LA 4MTDA 2GQQA 1OFNA 3FHZA 1ZX5A 2E7WA 3WTSC 4ASNA 3VHRA 4BHPA 4B29A 3L00A 2QQAA 1T39A 4QGNA 3O6BB 3BU7A 3TO7A 1BBYA 1ZG5A 2Z3YA 1J2XA 2ZXJA 2B0LA 5FLXK 1L3JA 3QPTA 1YYVA 3V8KA 3WE2A 5LHHA 1BC8C 2CAVA 4EJVA 4L5JA 4CHUA 5ICFA 1UIKA 2WWYA 4WCGA 2GC0A 5KK1A 4XFHA 2B8MA 1LR5A 2KJBA 5KHHA 5E16A 1JXSA 2GIVA 1O5UA 1O4TA 1ZZ9A 2HR3A 1G3SA 1BOAA 2Q30A 2VPVA 4H0EA 5HDGA 4MGYE 1EYBA 4NHJA 5FPXA 4I7HA 2MA3A 2FMLA 2OAZA 4LLOA 3JAMZ 1R58A 3F8MA 4K2EA 2ESNA 3HSEA 4MGZE 3SMHA 5HI0A 2HYGD 1B59A 3W6JB 3NRVA 1KGSA 4HAMA 4M71A 5IT3A 2XHKA 3ZDSA 1CAXA 4AIHA 4MZUA 2ATFA 5A2QK 5DUKA 4YFNF 3SZTA 4B09A 3TO9A 3N97A 2V1DA 4O9GA 3HRMA 1E17A 2GZWA 1KYWA 4EV0A 2KJCA 5AVPA 5F64A 3U9GA 4A5NA 1Y9QA 3IDCB 2ETEA 4MNUA 1U12A 4CO8A 4NQWA 4HDVA 3H7YA 2V79A 5D1IA 4Y15A 1FP2A 2G9WA 3C3WA 3F8CA 2ISYA 3U10A 4MQVA 2D40A 2EFQA 2RN7A 5D5WB 4LK1F 4HYEA 5EZWA 4JV4A 4IERA 3QU6A 4HOBA 2UYAA 3RTRA 3DPLC 2VONA 1MKMA 4IEVA 4MGKE 2VXZA 5IT9Z 2PHDA 4L9JA 4WF2A 3Q5FA 3UKNA 3MYXA 4EMSA 2DW4A 3KETA 5DYMA 3KP5A 4KWKA 2Z2SB 3BCWA 2IXLA 3V4GA 4YIFA 2XAJA 5C6CA 1G3WA 2D1VA 4BXUA 4LB6B 1ZNPA 2JTVA 2I45A 1CF7B 3RYPA 3Q9SA 3TO6A 3PNAA 3CUOA 1QBJA 4WX9A 4RGUA 4GYIA 1DZRA 4NVPA 3LFKA 1WI9A 2QM3A 2EFWA 4EGYA 1FOKA 2QUFA 3E97A 5HLGA 3GWZA 3ELNA 3PFIA 1ZYRF 3FXQA 4I98B 4KU7A 4AVCA 3H1YA 1YW9A 3ZP5A 2H6BA 4HMZA 3T8RA 3RIRA 3WTXC 2UXNA 5BOXA 1MDMA 5D5VB 2XAQA 5FPZA 1T98A 1LVAA 1XCVA 3HSRA 4ZU4A 2K86A 3V7CA 1IUYA 4JK1X 4ENJA 1EV7A 1IPKA 3O3KA 2H94A 5L3CA 2DK8A 3BROA 2UXXA 1TLHB 2O8XA 4PGGA 1WKMA 2P5KA 1F1ZA 1A04A 3TNPB 3H9AA 1XSVA 2ETHA 2IA2A 2HS5A 3MPBA 4KMFA 4Q0VA 3F6VA 2ZJ2A 5J48A 1SFXA 2JPBA 2PMHA 4HVRA 1R5GA 1FX7A 1V70A 4M73A 3EYIA 1D3YA 3CLOA 1P4XA 3LOIA 5BPIA 5HOOA 1B9MA 2YPRA 1XMAA 1AOYA 2OZJA 3RKXA 5E20A 4P9UA 1LEAA 3CTAA 3BPXA 2LNBA 1VR3A 4L11A 3E6MA 4M9SA 4U7BA 1IN5A 3CUQB 3OGJA 3KP3A 4LEJA 2AXLA 4ZU5A 5HS9A 1NE6A 1RNLA 3EHKA 2RV8A 4HSLA 5ICCA 3P9KA 3GFJA 1IPJA 2YR2A 5JHUA 1DZTA 1J58A 1CAUB 3R0AA 4PIZA 3REOA 1FYKA 1Z6TA 2EFNA 1HSTA 3D5LA 5DCFA 4FHTA 5E1ZB 2NNNA 1O5LA 3MCZA 1B1BA 1D5VA 4YNIA 1UHMA 4IEOA 1YG2A 2UWMA 3BWGA 1YUDA 3VEPA 2W85A 2ZFWA 4ZZDA 2BGCA 4HBNA 1WWXA 3WTYC 4QM8A 2EA4A 2EVXA 5JSRA 3H50A 1J3PA 2PG4A 2QQ9A 2ZNZA 2B9UA 4Q48A 4I02A 4G7OF 2P5LC 2CAUA 5FQ0B 2Y0MA 1U5TC 1UFMA 2NYXA 2GWRA 3IWFA 2UYBA 5KVRA 4QGLA 1BIAA 3EUHA 1ZVFA 4UNOA 1FYMA 3LWFA 3F8FA 4U0WA 1YLFA 4WK8F 1ZLJA 3ZPLA 3DXJF 3IBMA 4KIFA 2K02A 1LDKB 2P6TA 1I1SA 3I64A 2PTMA 1SQ4A 5I91A 1HW5A 2PFBA 3ZMTA 1XCBA 3KP2A 4OOIA 3TDZC 2IXJA 5I8SA 4O5VA 3K9TA 2ZBKA 2FBHA 5TJJA 2MC3A 3W6KB 2EAAA 5DEQA 1HKQA 4G94A 3QU3A 1X7NA 3S7EA 4EJWA 1G4DA 4YG2F 2F4PA 3IIAA 5CVVA 2CFXA 1YFYA 4GO1A 3ZMZA 1TW2A 3ELKA 4M6YA 5LEKA 2CW0F 4PDKA 2EA7A 4BYYA 2VQAA 2KRFA 3QP6A 5CYVA 4AWXB 2F5EA 3NSTA 1EH8A 3FM3A 3CDHA 1GQGA 5TRDA 2XV4S 3F22A 2VE8A 4LK0F 4YFKF 4KU8A 1MJBA 1FPQA 4R1HA 3WW3A 4BH9A 4FT8A 3UKVA 2FBKA 2JRTA 3KZZA 1IRGA 4GGGA 1LNWA 3BOQA 3MWMA 4HV5A 3CUQC 4QM9A 4CZZA 2P7VB 2DPUA 4I2OA 2MBFA 3WTUC 4HQMA 3WG9A 3WW1A 4Q0SA 4WZCA 2XKPA 3RJPA 3J80K 1V4RA 1YQAA 2XKOA 2K4JA 3BJAA 2XAFA 1BN5A 4OMYA 1CAWB 5I8TA 2D5HA 4KIGA 3MZHA 4HF2A 3EQEA 2P7CB 3R6SA 1GHCA 4Q0PA 4G8XA 4MEYF 4FAGA 4KWLA 3I59A 3MEXA 1IN6A 3WTVC 1PP8F 3MAJA 1TNSA 4ENKA 4KL1A 2QDRA 3ZMSA 4ZH4F 3CO2A 4WXHA 4RD7A 3G73A 2O6GE 4KN7X 2Y0OA 1ZZ6A 1YW8A 2IA0A 3LA3A 3ST7A 4D7SA 2MNGA 1RZ4A 1MJAA 2XVCA 2ISZA 4IXAA 2Z5UA 4M74A 3EYYA 5EFUA 2E9QA 4ORFA 4IEPA 5H20A 4I3PA 2LF8A 4ESFA 2RQPA 4D0PA 1Z1DA 4ZYHA 3K2ZA 5DUIA 1RTVA 3DFGA 3R4KA 1H1MA 2BNOA 5JI6A 2OQRA 2L3DA 3HIFA 4UXNA 3NL1A 3B02A 4A6DA 1B6AA 1G3YA 2EA2A 2ADUA 2KIMA 1QQIA 4L0YB 1ZLKA 2IRFG 3NW4A 4BQAA 2A6EF 3HT2A 3C7JA 2PAEA 4QLCU 4BIFA 3K69A 5CJ9A 1U2WA 3OOPA 5AONA 2Q4SA 1J0RA 1TW3A 2RVCA 2MH2A 1XRUA 1R1TA 2QCSB 3TKYA 2Y75A 1P4AA 1F9NA 2WFPA 1MGTA 4S05A 3ABUA 1T6SA 1X8EA 3HYIA 3WW4A 1HKSA 1H1IA 2PAMA 3LA2A 4BAYA 3WW2A 1W4MA 1BI2A 2UZKA 4HLYA 2M45A 1OYIA 2OU2A 4PJYA 1C0WA 1WLTA 4CICA 5ILUA 3NJZA 2C6YA 4XFGA 3G7DA 4AD9A 1CAXB 2FSWA 3MZYA 3V7SA 5FCCA 1OKRA 4EM2A 4L5IA 1KU3A 1ZREA 1KU2A 2NS0A 5JAXA 1Y0UA 4UUVA 4HLXA 2NAZA 1J3QA 3I0TA 2A07F 5FFZA 4ESBA 1JUHA 4JTOA 5JSPA 2STTA 3J81K 3GW2A 2O03A 1MJ9A 1OI6A 1PDNC 4PIYA 3L7WA 4RB1A 5DD8A 4LMYA 1T2KA 4IRIA 1JGSA 3JZVA 4EM0B 1W7PA 1F5TA 3TOBA 1LB2A 3GF2A 1X8MA 2PI0A 4LULA 3KCCA 4XLNF 5LHIA 1LJ9A 5K5OA 3BZ6A 1U6GA 2QVSB 2F5DA 3OCPA 2YX4A 4MEXF 3DKWA 1FT9A 2HOEA 1ZGAA 1VJ2A 1Q1HA 1L3LA 2DFIA 4HBLA 3M1EA 4QWQA 2NRAC 1ZZ8A 1QO0D 3FZVA 3USSA 4XFIA 3N4MA 2HEOA 4XFCA 1TQ5A 3QACA 1FBQA 5KBFA 1UHWA 1WGPA 5DCMA 4UBGA 1S3JA 3SCGA 2H27A 4WXCA 1O3QA 2P5VA 1O3SA 3O14A 4DINB 3E3VA 1D8JA 4Z82A 1R1UA 5CLSA 2EV5A 3M9AA 2Z9OA 4P96A 2FE3A 1IAWA 3P9CA 3KMHA 5BS6A 2F5CA 1IN8A 3VODA 4ZYEA 1SD6A 4U0VA 3IRQA 4LA2A 1UB9A 1FY7A 3RPUA 1WQ2A 1YFHA 4ONUA 1IN7A 1Y3TA 3IL2A 1E2XA 3HHGA 4GULA 2BE5F 1WRJA 1OD5A 1YLLA 4TV7A 4N0BA 1Q5OA 1MDMB 4KMUX 4MX3A 3C3VA 5CVRA 1KQ9A 3RI4A 4ON0A 3QPHA 2XAGA 4KNYA 2OYZA 4S04A 2LF7A 1REPC 3NQOA 3ROUA 2JZYA 3TQNA 1IRFA 3BY6A 3GLXA 5CVUA 5J6XA 2VOOA 4XFBA 2M87A 3IC7A 1RUOA 1EP0A 3OTFA 1K78B 5JR3A 1ZRCA 3TDUC 1JHHA 3GUDA 3H3ZA 4XEZA 2HKXA 2VC1A 2FRHA 1BM9A 5HDKA 1Q3EA 4YARA 3VOEA 1ZRDA 1LRHA 3ES4A 1U5TB 1D8KA 3TGNA 5CVIA 5LRRA 2CV6A 4JVAA 4A0ZA 2PBIA 1H9TA 5FLXZ 1P92A 3FM5A 3J81Z 2IW5A 2UY8A 3T0YA 3EJKA 2ACJA 1TQPA 3ZN1A 1G6NA 2P17A 3CL1A 3GVAA 4FX0A 4N9HA 5L3EA 2KXLA 2MD5A 1J9IA 1ZGJA 3KP4A 2Q0AA 3V8LA 5E1WA 3HQXA 2A69F 1T0FA 4YYOA 5LGUA 2H6CA 4YFXF 3E6DA 5D8LB 5FB2A 1SFNA 3L2CA 3S7IA 4P9GA 5J7MA 1XGSA 3COAC 3H8UA 4XBFA 3BDDA 4GXOA 1B4AA 2YU3A 1KYZA 3KEOA 5ICGA 2TDXA 4QMAA 1ZH5A 2QYOA 5ERIA 4L18B 1XGMA 1PUEE 4RGSA 1BI3A 3LA7A 4G7HF 1FLIA 1DPUA 5L3FA 3SQNA 2QJVA 2COMA 3KLNA 2CGPA 1YFXA 5A2QZ 1QXRA 3OF1A 4UVAA 2QBYA 4UBHA 2JPCA 4O6JA 1J1LA 1IXCA 1SMYF 2ZMEA 3JTHA 2VC0A 4PCQA 4B8XA 4IRHA 5KHIA 2ZO4A 1Z7UA 2VBYA 3D82A 4LLGF 1LDDA 4IRGA 3KLOA 2W84A 1VTNC 2FNAA 3RYKA 2J5PA 4KYWA 4HW0A 3ZMUA 1UIJA 4A6EA 3NVCA 1DGRA 2OQGA 4XFAA 3I53A 4XF9A 3IKTA 2XAHA 3H1WA 3FFQA 2PN6A 5D5XB 3GZ6A 2VT2A 3AAFA 3FX3A 2BYVE 4LLLA 1ZRRA 5H6RA 2XL9A 2WC2A 2CO5A 1LEBA 4XLPF 5DD4A 3R60A 3BJOA 4JTNA 4HN1A 3ES1A 1I27A 3WU0A 4RAZA 1YHFA 4Q0QA 3ISPA 1R23A 3U11A 3NEUA 4F7ZA 2VN2A 3E6CC 1WA4A 2K27A 3ECHA 4LA3A 2HFHA 2VBXA 2O1QA 3WGHA 3HRSA 1IXSB 5FD6A 1YFWA 2BBYA 3GFMA 4CGZA 2OPKA 3E5XA 4DQ2A 3FHIB 4MTEA 2VODA 2FXAA 4A12A 4QXKA 2UY9A 1Z9CA 2RC4A 1NYWA 3I59B 1XSDA 2Q2EA 4WWCA 3HRUA 4WXDA 2HQRA 1GXQA 1HBXG 1U78A 2X4HA 2XROA 2GH2A 4IETA 1R7JA 3H7JA 3I58A 3IHUA 3QP5A 4Q47A 4L0ZB 2RGVA 5AIQA 2GXBA 3ZQ7A 2O8QA 5J8CA 3S0MA 1CAUA 2L02A 2F5FA 4UVBA 4OIOF 1TNTA 1K79A 2W57A 3DEUA 3M8EA 3IKVA 3PQJA 4ENMA 1FZPB 1KU7A 3F3XA 3FE5A 4RAYA 1OR7A 5EEGA 2WTEA 2HZTA 3FXUA 3U1DA 5BUVA 3ZMVA 3KEQA 2JSCA 3SCHA 5L3DA 1HXDA 2IPQX 5FFXA 2FQPA 3MQ0A 2QNKA 5I0RA 4PIXA 2ESHA 1ZAOA 2Z33A 2EV6A 2P8TA 1RIOH 4LG0B 4OLLA 3GFIA 1CAVA 1WSUA 5EEHA 4M72A 1W5TA 1S29A 2NNYA 2IC1A 2D1HA 3DN7A 2DQRA 5FQ0A 1Z05A 2XASA 1W5SA 2IVMA 3DV8A 3FXRA 4OMZA 1YS6A 5KHGA 2HQNA 2DU9A 2LSOA 5FD5A 1XMKA 3RZZA 1O57A 1FP1D 2M5WA 2AS5F 2KIFA 1S7OA 5BPDA 2DAOA 1NXMA 2KIUA 2E1NA 1LQ1A 2CG4A 2LKPA 3GBFA 4KWJA 2W25A 3DQVC 3I71A 4FX4A 3JW4A 1QXJA 4EJTA 5KHJA 2GC2A 3V7RA 1Z91A 3KSCA 4ENNA 2ZKZA 1UW8A 3M7GA 4YSFA 2P6SA 3BB6A 3QAHA 1SAXA 1BIBA 3OV8A 4HVOA 1ZZ7A 2IXKA 4DNCA 5L3BA 2ET1A 4YIIA 1MZBA 1FYLA 5LGNA 3HOSA 1F4KA 2D45A 2L01A 2P4WA 5I0UA 3ML6A 2DQLA 2E1CA 5JFRA 4GYGA 2L54A 4RGRA 3K1NA 3ZMDA 2R3SA 2A6HF 4LTAA 2M1BA 3L9FA 2DI3A 5BMZA 4LJZF 4I0BA 2DO7A 1PP7U 5D4RA 2IA1A 3WTZA 1ZG3A 3WGIA 1H9GA 4RS8A 3WE3A 5E8IA 2MLGA 4N9IA 3Q9VA 4M6XA 3SXWA 1UCXA 2N7GA 3HTSB 2PMUA 3DP7A 2PA7A 3ABTA 1W7PB 4WBBA 4LUKA 5ED4A 2PJPA 2OA2A 1XSXA 2GC1A 1DPRA 1ON2A 5JR7B 4UXAA 1ZN2A 3R61A 4IHTA 1SD4A 3P9IA 5D6FA 2IJLA 5H6QA 3LAPA 1R00A 1YTYA 4CDGA 4IEWA 1JHFA 1SD5A 1YS7A 5J3UA 1W7PD 4G7ZF 3LZZA 4EGZA 5BPXA 3TNQA 3F8BA 3K1PA 4A0YA 5D5UB 1HSJA 4E70A 2IXIA 2MHFA 3F6OA 2IXCA 2IT0A 2STWA 3RNSA 5HLHA 4RGXA 5IT9K 3M70A 4Y13A 3CEWA 1S6LA 1IN4A 3EQLF 3J80Z 4UHTA 1YWKA 1CGPA 3E6BA 1X82A 5E18F 4R79A 3PVBB 5K1YA 3H92A 3JTGA 2EK5A 3K1MA 3B73A 5BV6A 3K0LA 2ELHA 3LAJA 3ZN0A 3J7AO 2HTJA 4MHGA 1NZCA 2ZNYA 3GYHX 3T8TA 1XE7A 3KP6A 2A3SA 1XB4A 3MFKA 1LKNA 4P55A 2Z99A 5FDBA 2M30A 1QNTA 1K7AA 3T5XA 3FMQA 1R1VA 4GCVA 2ZKLA 3QOPA 1ZZCA 4AVPA 5HS8A 2GU9A 4U88A 1O3RA 1QPMA 1BI0A 5LRSA 5JSOA 4MQ9F 4ZU7A 3TOAA 3ETQA 1IW7F 3M8FA 4OFGA 3F72A 1YO5C 1SFUA 3OD0A 4M9ZA
chains in the Genus database with same CATH superfamily
1UL9A 4GKYA 3VDXA 3NWKA 1PMIA 2EFOA 4UAPA 1FSHA 4LHSA 4LO7A 2QQNA 3DCFA 4XQ4A 4C2TA 4LD5A 5EYXA 2X6YA 4D6RA 3GO5A 1RPWA 5LBQA 2E51A 5GAEJ 5H9RA 2RM23 1JOBA 2D93A 2E2JJ 5DV5A 3VDBA 1STZA 2CWMA 4XRSA 3H5RA 5AIPA 1XU1A 4B1RA 2R5ZB 1OYWA 1J7KA 4LBLA 4YZ2A 3OBTA 4EWAA 1QZZA 1ODNA 3PJRA 3VD9A 1YFUA 5A7WA 5F1RA 3ZSJA 3S93A 5JI7A 4IEUA 3LDRA 5LBEA 2ERFA 4RSUA 3ZN6B 2WSUA 1DGRM 5DPNA 1UMIA 1PNGA 4H55A 2HWVA 1Z7S3 4NDLA 2FDGA 2EB7A 1UPIA 1XN7A 1JTYA 1BR2A 3AC0A 3OYMA 1DP7P 3NV4A 1Z7S2 2BW8A 1MBHA 4ITCA 1K4SA 5J8FA 4B1LA 3PO3J 4JZRA 3ACGA 3K77A 2Y60A 3BP8A 4DUXA 3B6CA 2HYFA 2EJRA 2QBXA 3N36A 4OUMA 1CX4A 1HRV2 2VNGA 5BXXA 2WDBA 2K46A 1DQUA 3DYOA 2GMPA 3OUJA 2KDZA 3BCAA 1RINA 2LBFA 2YSRA 4PJNA 5E17F 4XJ8A 1W90A 2GALA 3OGGA 2DK5A 2VBBA 1HC8A 3SXYA 2AEZA 2FDFA 2VR4A 3SEPA 2WAOA 3K4ZA 5GZFA 2LVSA 4M3GA 1C8M1 5B4NA 4B47A 5KWRA 3CKHA 4NPRA 5A1LA 4EQQA 2WN2A 2OUMA 5FWEA 3FMRA 1X3UA 1CPNA 3F21A 4HF0A 5FAXA 3OYAA 5FPLA 3AP9A 4Q29A 4WM8A 2JX9A 1EUTA 3VFZA 1ETOA 3UV9A 3F2ZA 3I7DA 2VO5A 4YW4A 3T2QA 4IE4A 2W47A 4MG2A 3MEPA 1JZ6A 2KZGA 1AHSA 5TGTA 2X0LA 3IAPA 3H9GA 5CVJA 1O59A 5CB7A 1WJAA 1MEC1 4AG4A 3TOJA 3ZIWA 2G0EA 2FU4A 1SHWB 2XL7A 2ZGMA 3W5MA 2EWNA 3OS0A 4HF1A 3H3VK 3VZLA 2AEYA 5L3GA 5T3NA 4AL9A 4V1PA 1IZ1A 2YZ4A 1FOWA 3AJZA 4HVQA 1DGLA 2HVQA 1GXPA 4A3FJ 4LJHA 3H5NA 1IOAA 3RQ0A 4XFFA 2O0YA 2RM21 4YM2A 5A70A 3JBG2 2D2WA 1NG6A 2Z5WA 3DTKA 1K61A 2A6XA 4AEMA 5FXVA 5F3CA 3HWJA 4AXOA 4BLIA 3BTJA 2OCEA 3SFZA 3VD5A 2VUMJ 1UPSA 1GOFA 1R36A 1CAVB 4RR3A 3LSGA 1QHHD 1H1AA 3ZFGB 2FMYA 3RKWA 2EAKA 4V2VA 2Z42A 3SHRA 2HJIA 4BCUA 4YRDA 5FV3A 4TLGA 2ZSIB 4BWOA 1Q56A 3J7YJ 2BP6A 2VE9A 3IWZA 3B6AA 3ZOBA 2JUGA 1I39A 2Y48A 2BWCA 1KITA 3U0ZA 1XGOA 4NHLA 3VKLA 2NVXJ 2R7VA 3OEBA 3CDIA 4RB3C 3NNMA 2X6OA 4CUBA 2QQJA 3HJEA 1XNAA 1DQ4A 4I0WB 1NA1B 1G9BA 5IK7A 4ISRA 1AZDA 3S5AA 4KA4A 3KF5A 1N3OA 5FZLA 4PSXA 5K8SA 3ASOH 4XF4A 1P2FA 2I8DA 3AZVA 4N7IA 1QU3A 1RR7A 1OH3A 1V9U1 4XF1A 3OYLA 2DDBA 4QKFA 2OT7A 2XPUA 2Y2ZA 1RXGA 3EETA 2DVDA 2F4MB 4UW4A 1W0PA 2EV0A 4YZ1A 3G3ZA 1WW7A 1JGGA 3DU6A 3Q8BA 3AKPA 4AI0A 3UGHA 3VKMA 2Q0OA 1RESA 3VYTB 2EFPA 1HCRA 1N25A 2HGCA 4P5OA 4P02B 4HX4A 1HKTA 4FTSA 2HYKA 1MNMC 3QD6A 4LT5A 1RMU3 5IWFA 2GNBA 4II2A 3K48A 4X6RB 4BMBA 3CCYA 3G4SI 3S8PA 1XE0A 3OD4A 5AC93 4BLJA 1P6RA 3K2OA 2ZFUA 3BALA 5JCTA 5AC92 3VZKA 4OUSA 1F35A 3ITQA 5HDNA 4ZYAA 1IRZA 1ZKGA 2CRGA 4KT6A 1D0XA 1HOMA 4IGOA 2GA1A 5C5TA 2O5RA 4XMIA 3K4LA 3VD7A 5JXIA 4Y1UA 1WJ5A 2KZVA 1YRNA 1ZZBA 1GICA 1W8NA 1UY3A 1A6IA 4R4ZA 1KS5A 3KV9A 4E9KA 2HTSA 4FVVA 5K0UB 3ZQGA 3DLLF 2DJNA 3BR6A 4HKWA 5JDBA 1JOPA 3CLPA 4QGMA 5HV0A 4CYDA 5F39A 3RMXA 3W59A 2DTYA 3IH3A 4R52A 5JUVA 5FZMA 5CKQA 1BJAA 5KXBA 1QJX3 1MMAA 1JZ3A 4TLFA 4LK6A 4LHLA 1BJQA 1NHAA 2D3PA 2LALA 3ABKH 5E3OA 3I4MJ 3DTEA 1NA1C 1QJX2 5E88A 3P6BA 3O1UA 2E2IJ 2WB1N 3IH2A 1R093 3GZTB 4IUGA 3HHHA 5C9AB 1OMIA 3RKYA 4AIJA 4IV1C 1TWGJ 3PL0A 1R092 3CU7A 2XIGA 5LA2A 1MMDA 3RZLA 2CH0A 4FCAA 5EWSA 2AYHA 1R4MB 1X2MA 1SFPA 1GKBA 5BNGA 2WNEA 5CNAA 3WY6A 1MMGA 4UFHA 1TWCJ 3O12A 1LOGA 3RZDJ 1PIV3 3L2HA 3LSTA 3I5UA 2J5OA 2EZIA 3FZ3A 4IEQA 3TYJA 4Q1RA 4CDWA 3KZYA 1X3ZB 4NPMA 4LBQD 4INDA 5DZFA 4FBFA 1V6JA 3I4PA 1MBFA 3BGAA 4HRIA 3OBRA 4PJ0C 4LHKA 4BHCA 3VBUB 2LG4A 4Z07A 2KKOA 4MGTA 3C1DA 5CADA 4BPZA 2VW0A 2RS11 2QLZA 1MSFC 2CTVA 4CEYB 2K7LA 2RMU3 1D1CA 4A3DJ 5FIXA 4XM3A 4JAAA 3SEZA 5D8AA 1XC5A 1ZX5A 3UESA 2RMU2 3I49A 4BHPA 1DQ1A 2OTLI 2HBUA 2WNVA 1CR7A 1JT6A 1R49A 4K9SA 1WBFA 1K5MA 1YYVA 2BHZA 3HAGA 3BZKA 2CUZA 1W9YA 5FK7A 2CAVA 1Z3XA 4JRLA 4L5JA 5ICFA 5JZGA 4A7ZA 3BQYA 4WCGA 3T08A 4AR2A 2GC0A 1LGCA 1TME3 5E16A 3E1SA 1TME2 2HR3A 5B2GB 4CDWC 1AXYA 2VPVA 1WCSA 4K1ZA 2Y8KA 5GLVA 4AHXA 4EE2A 2M8GX 4K6BA 3LSRA 2R7RA 1RUI1 2WINB 2IZWA 4K2EA 3F8MA 3POIA 3PJQA 2HYGD 1B72A 3VBOB 3W2VA 1WD3A 1WWYA 4M71A 3RKQA 1JHNA 2VASA 2ID3A 2XHKA 5D8AC 4FETA 1K5JA 5IYDJ 4XAEA 5JLXA 2LY2A 1Q8SA 1YOVB 1OD3A 4ZONA 3UYJA 4IV3B 5A2QK 2WNVC 1JTXA 4YFNF 1BQPA 4NC8A 3GALA 4M3DA 2V1DA 3SDBA 4O9GA 1N1VA 4FFHA 3HRMA 1E17A 5FMBA 5JZGC 4OI2A 2KJCA 5AVPA 5F64A 1NAEA 5B4XA 1ACCA 1Y9QA 1UNBA 1U12A 2AZ5A 4CCEA 1ZM1A 4DPNA 4A6OA 1PGSA 4PLNA 1D4VB 3C3WA 2ISYA 3U10A 1BKZA 2RN7A 5D5WB 2HU9A 1XJAA 4PDWB 1W6MA 2BOLA 1D0HA 4HOBA 3RTRA 3OYHA 4IEVA 3ZN4A 3VBUC 1CWPA 3UKNA 2VY0A 1AR71 2DW4A 2NVTJ 5DYMA 3KP5A 2Q1MA 4TZDA 4CEYC 4UY8I 3E7LA 1UZZA 1HB2A 5C6CA 4YVSA 4FPKA 1G3WA 3KV6A 3TO6A 3PNAA 3VDDA 2J7MA 5LY1A 2ELKA 2EXKA 3NO8A 3I56I 4NVPA 4RAGA 5A3NA 1WI9A 2BZTA 2W08A 4EGYA 1T95A 1D1BA 3E97A 1VB4A 1W5CC 3GWZA 2JDZA 4BUPA 1IDZA 4A93J 5EYYA 2WYFA 4XHXA 3K2AA 3FXQA 4I98B 4JGZA 1OFCX 4LG3A 3GXUA 3ZP5A 4ZS3A 3RIRA 2DUOA 2UXNA 3PDQA 3VBRC 1XCVA 3SH4A 1KXGA 2K86A 3V7CA 5J4YA 5JVVA 2H8WA 2VTXJ 4XABA 2UXXA 1HB1A 1N1TA 2WO1A 3VBOC 2QA4I 1XSVA 2LTPA 2XOMA 4HVRA 2PMHA 2ZHNA 1FX7A 1M06G 1NTCA 2CUJA 1V70A 4YW2A 3EYIA 3EMRA 1W2NA 1P4XA 5BPIA 3GZEA 5HOOA 1EAH1 2CMPA 1B9MA 1XMAA 1AOYA 1ULCA 5EZGA 1VR3A 4L11A 2QQKA 3E6MA 4M9SA 4U7BA 2VMFA 3CUQB 3ZSKA 3NNJA 2AXLA 1MZFA 3VYSB 3KZIC 3IMMA 3P9KA 5TSWA 4BA6A 1IPJA 2KRHA 1PK6B 2O7OA 1DZTA 1STMA 4E4DX 4QSHA 3OUHA 2PX9A 1SLLA 2R061 3ZYFA 4M3CB 1I3HA 1FYKA 3VUOA 3V0BB 4FHTA 4XK4A 2JEMA 4MVTA 1TNFA 2XJQA 3DYPA 2LY1A 1R1A2 1YG2A 1GYKA 1LEMA 1YUDA 3A0HC 2W85A 1AVBA 2NN8A 1F4HA 1H89C 5EJ3A 4GJYA 3GTJJ 2EA4A 2HXOA 1IQDC 1C5IA 1B8IA 4LOTA 4I02A 2YDEA 1Y39A 3IT8A 1UQXA 4QGLA 1TWHJ 1BIAA 4UNOA 4U0WA 1YLFA 3HN3A 1ZLJA 2R071 5FKCA 3SKJE 1SFKA 1I1SA 4AAXA 4XBLA 2PTMA 4EN6B 4XUNA 3NNLA 2VNOA 5BNPC 4OI1A 3LFIA 3NV3A 3TDZC 1IGNA 5I8SA 2LTNA 1K83J 4RGAA 4D3WA 2FBHA 1NT0A 2HWF3 4QU2A 2CSGA 2EAAA 1I50J 1X7NA 1KEXA 1SVMA 2HWF2 4JX6A 4XAAA 1JUSA 4ZC3A 4EJWA 4YG2F 1UX6A 4IL7A 1UY1A 4GO1A 4HSTA 1UOGA 1ONAA 5LEKA 2CW0F 1DYKA 3I3EA 3BI3A 4G3YC 1KS4A 5FMOS 5E3NA 1FNYA 3CZJA 2F6CA 2CUFA 2XV4S 1SVLA 5TRDA 4FO9A 4LK0F 1FPQA 4R1HA 1VBD3 1GV9A 1ENXA 2E7AA 3KZZA 4GGGA 3BOQA 2NPIA 3MWMA 4BE1A 3RSJA 4HV5A 3CUQC 1BEV2 2P7VB 2VE1A 1OQ1A 2WR9A 2MBFA 2WADA 4Y4RA 4XN0A 2GLOA 2XKPA 3ACHA 3RJPA 1RKWA 1PK6C 5A6YA 2DOAA 3CZUA 2XDVA 1YQAA 2XKOA 4YZ5A 3GTKJ 1CAWB 1TT0A 5IP7J 2D5HA 1GP4A 3MLKA 2P7CB 3R6SA 5AFEA 1N75A 4FAGA 4KWLA 1IN6A 3WTVC 1QOSA 3NQHA 4KL1A 4K3UA 1SMVA 2QDRA 4BEHB 1B35B 1XTAA 1SBFA 3ZMSA 1LODA 5FZ7A 2OPWA 1WLWA 3K4AA 3WQ7A 2XPVA 4N4NB 3AKTA 1ZZ6A 1YW8A 5FYHA 3HOYJ 5LATA 4D7SA 4FPHA 1JN2P 3G1LA 3B5LB 4BKXA 4CDXB 2E9QA 1UYPA 4ORFA 2KT0A 2JG8B 3N7LA 5H20A 4CEWA 1G8WA 4Y5SA 4ESFA 2RQPA 1O4ZA 1W8UA 2Y9ZA 4GB32 1JYIA 1S9HA 1RUG3 3BYWA 3R4KA 4PI2A 4IGPA 4AK3A 2RDNA 2R30A 3LSJA 1LULA 2ZABA 2KIMA 2M7BA 2IRFG 4P5YA 3NW4A 4BQAA 2PAEA 5TISC 3ZXAC 4XOTA 4QLCU 3ZYIB 4EN9B 3K69A 5AONA 1DP0A 2Q4SA 1GSLA 2RVCA 2MH2A 1UELB 2V6EA 4COZA 4XHBA 1R1TA 3D5SC 1VMFA 2Y75A 3VYRB 2WFPA 1W05A 5JWPA 5EJZB 3T09A 2ZJCA 4L99A 1WLDA 1X8EA 3HYIA 2W7NA 4CCNA 5FP3A 2A73B 4CEWC 1JJ8C 2PAMA 4BAYA 3LMMA 4C91A 2M3AA 1OYIA 2XPWA 4CDQA 4CZCA 2DA4A 3S1NJ 4RA0A 1A78A 2A75A 1JUPA 4CICA 3DF0A 3SNMA 3V7SA 1RUD1 2XUMA 1LHOA 5FZOA 3WDWA 2NS0A 5F7UA 4BB3A 3SJMA 4UUVA 4HLXA 1WCQA 1MS3A 3RS6A 3DKXA 1VBD1 4IOAF 1B35C 1PJRA 4GWMA 3BR1A 2O9LA 1REDA 3N9MA 3J81K 2VXDA 4AHZA 2O03A 3Q8AA 4CDUB 3PVNA 1W7PA 2VD7A 3TOBA 3PJYA 1Q8VA 5K5OA 1LJ9A 4PQQA 1U6GA 4IQPA 2MD0A 4QHZA 1ZBA1 2LROA 3FKIJ 1L3LA 2DFIA 4HBLA 1YQ2A 3M1EA 3ZFFB 4XFIA 4A3JJ 2EILH 2QSHX 4XFCA 3ZXJA 1FBQA 4MGQA 1UHWA 5KBFA 5H9QA 3SITA 3S32A 4GA9A 1S3JA 3SCGA 2H27A 5FZ9A 2VMEA 3BR0A 1D8JA 3WG4A 3HKZA 4CP9A 3WQBA 2XR4A 5K9YA 2Z9OA 4FE7A 1LJ7A 5C4JJ 1Z3YA 5FZDA 1BK1A 1IAWA 4J01A 3CQZJ 5BS6A 1WJBA 3SH3A 2F5CA 5IVBA 2CJJA 3S1QJ 1TNRA 1WCDJ 5DZGA 1L7RA 4ZYEA 2WAFA 3VN4A 5CKNA 3IRQA 4RL7A 3OYJA 1FY7A 1OUSA 3RPUA 3WVJA 1WQ2A 4H3WA 2B7YA 1W3VA 1PO13 1QQP3 1E2XA 4GULA 1WRJA 1PO12 3ZLIA 1OD5A 1YLLA 1QQP2 4TV7A 3ME2A 4M3BA 3C3VA 1FPN3 1WZXA 5CVRA 4OHYA 2DVBA 1KQ9A 4DXTA 3QPHA 4AGRA 4D0QA 2HLEA 3GTLJ 2JWTA 3BY6A 4YIRX 4XFBA 5LA9A 1JH5A 1NY72 1RUOA 1UYZA 1EP0A 5A7PA 2QKMB 5JR3A 3TDUC 1JHHA 2J1SA 4HNUA 1A5JA 3GUDA 3K4KA 2ZA9A 3ILFA 2VC1A 3POJA 1X1AA 1LRHA 2EINH 3AG3H 5LRRA 3F0CA 4COWA 4P9JA 1ULFA 2VNVA 4JVAA 1OF4A 1IG3A 2PBIA 2WZR2 2R041 4CDUC 4LOCA 5FLXZ 2HWE3 5F6LB 3LQCA 3FM5A 1W8WA 3ABZA 3EJKA 2HWE2 4NIAA 2X05A 1G6NA 2VZUA 1Y9GA 3NJVA 2HWB2 3RSNA 1VQLI 5FLMJ 2Q0AA 5FWJA 5E1WA 3HQXA 1T0FA 3U1KA 3ZFFC 2H6CA 1PGW1 3OPWA 1AR83 4UW5A 4N53A 3PIGA 4CU6A 5FB2A 3D4KA 1UF2C 4OULA 3H8UA 3NV1A 3BUCA 1UMHA 5LZ6A 3J26N 2XHNA 1C57A 3MD2A 5ICGA 1KONA 4RGSA 1BI3A 3A23A 3HPHA 3LA7A 1FLIA 5A7NA 1DF0A 5L3FA 3HOVJ 3SQNA 2QJVA 2COMA 2V9PA 3H9JA 5A6QA 4FASD 4UVAA 2QBYA 3KYDB 5KXDA 1W6NB 5F2SA 2VZOA 1J1LA 1IXCA 1SMYF 2ZMEA 3JTHA 5A7QA 2VC0A 4IRHA 3W3CA 3QH6A 1VBE3 1A31A 1T0FC 2WB1A 1VBE2 3KLOA 2HDWA 1PMHX 1VBA1 2FNAA 2J5PA 2RAEA 4KYWA 3ZXKA 1WJCA 3ZMUA 2D5VA 3B7MA 2GNDA 2QSGX 4XFAA 1H8TC 3I53A 2XGEA 3AFHA 2R7XA 3H1WA 3FFQA 3GZ6A 1EA3A 2GBYA 1OBNA 3GTMJ 4A42A 1AUYA 2OUHA 2PHTA 1ZRRA 1LEBA 5JOWA 1TZOA 2PHUA 3R60A 4BJTA 3GF6A 1FPN1 4HN1A 5DMYA 3OL4A 2C6SA 3UT0A 3QWLA 4RAZA 1YHFA 3ISPA 2BU9A 3G71I 1E57A 1XOYA 1WA4A 4LA3A 2YGLA 4MSVA 3WGHA 2YFUA 1OPOA 1GUIA 4AEDA 2P3KA 4NC6A 4AHYA 2VODA 2FXAA 1MBEA 2DMNA 3GZNB 1HRV1 2CV1A 2HI3A 4XW3A 1NYWA 2VW2A 3AMPA 4Z2WA 2HQRA 2OJED 2JB4A 4JKLA 4IETA 1R7JA 3RG0A 1SEUA 4Y33A 2GNTA 3KV4A 5DUVA 2PJRB 3NMBA 3HD8B 1WW6A 3WUDA 2MABA 3AMQA 4UVBA 3I2DA 2JA8J 2ZHMA 1Y1VJ 2N8GA 1OOPB 1K79A 1WMXA 5DAWA 3DEUA 1YO8A 1FZPB 1KU7A 1I6HJ 1OR7A 1UOJA 3ZQQA 4GQ7A 4XCBA 4YVWC 2WTEA 2DCKA 5DDJ3 4XZPA 5FFXA 5KNLA 4Q4X2 1PNFA 2FQPA 3MQ0A 4BE0A 4PIXA 1UG2A 2XGCA 2ESHA 3DECA 1WMDA 1DQ2A 1RIOH 3ON7A 4HONA 3GFIA 5F5CA 2AQEA 3RFRA 3I8TA 5F32A 2JJ6A 3DN7A 5FQ0A 3I3LA 4XICA 2E19A 3BTIA 2IVMA 1PX3A 2NOGA 5IVFA 2Q8OA 3QOEA 5FD5A 1XMKA 2L5QA 3ZMOA 2AS5F 4RS5B 1D0GA 1S7OA 4MYEA 2XF5A 2DAOA 2JVHA 1W9TA 1T6GC 2E1NA 1S2BA 2W25A 1DIWA 3L2QA 3DQVC 2CGOA 1GMMA 1OR7C 1OC1A 2GC2A 4XLAA 5CQEA 1FEXA 5T55A 5CKTA 3KSCA 4GH4B 1NQJA 1UW8A 2W00A 2LH9A 1RIRA 1H6XA 2P6SA 5DS9A 3W5NA 1AF9A 4UB6C 1YJKA 2RS33 3QAHA 4WM7A 3VBSA 1BIBA 1WHUA 1RUE3 2IXKA 4A4AA 1RUE2 1W36D 3NRUA 3OWTA 2VOXA 1W8TA 4ZKTB 2AH2A 4FPEA 2P4WA 4YWAA 1BW6A 3O1MA 3ML6A 2DQLA 5JFRA 2BY0A 1G2HA 1H2NA 4Q8KA 4GYGA 4CYCB 2L54A 2VMGA 2R7SA 2FCVA 3ZMDA 5EF6A 1W0UA 1QDCA 5BMZA 3TRSB 2L9VA 1SPPA 5EJ1B 2DO7A 3ZDVA 3TEZA 3V64A 3BTCA 1EV13 2YU2A 2N7GA 3UJOA 4RGGA 4NRPA 2G19A 2PA7A 2VQ0A 5FY5A 3HG9A 5FUIA 5ED4A 3KCXA 1HV0A 3JRBA 4UXAA 2X85A 1D4M3 4Z1VA 4DIQA 4WVVA 3B9IA 1YTYA 3VBSC 1D4M2 1A8DA 1JHFA 2VQHA 3K4CA 3KWVA 4DZPA 1W7PD 1ND2A 5J3UA 3KEYA 1WH7A 3K1PA 2IXIA 3F6OA 3RNSA 5FKKA 2STWA 4IDZA 5LWBA 1ULGA 2HWD1 5D21A 2BW3B 5F1JA 3OB8A 5GPCA 4UHTA 1YWKA 1MBGA 2ZACA 3FXMA 3OIQA 1S2KA 2VKVA 4UFLA 2VKEA 3PVBB 1PO21 1X1PA 3JTGA 3K1MA 5DDJ1 3B73A 5M5XJ 3GMEA 4CA9A 3LAJA 3ZN0A 2HTJA 1H30A 3O1SA 3Q8EA 2A3SA 5FPUA 1XB4A 3MFKA 4GH4C 5FDBA 2M30A 3RPUD 2VUJA 4BK4A 4KH9A 4GCVA 2BXZA 1ND2C 1O6UA 4GIQA 1XC6A 1QVUA 3DGTA 3M7AA 3VHNA 2JA5J 1O3RA 5LRSA 3M3OA 2HDDA 2IBDA 3TBDA 2I2SA 1F9KA 1YI9A 1UMQA 3M8FA 1SAUA 3OD0A 4IXLA 3C8XA 1HJFA 2CYYA 2DTWA 2VMIA 2JT1A 1YJLA 2CNAA 1XE8A 2AQFA 3WSOA 3HZJA 1RUJ3 3ZXFA 4KICA 5J36A 3WHUA 3BIEA 5FYYA 2C5DA 2OA4A 3GM8A 2RS31 2ELJA 1RITA 2HEYF 4LE4A 3I9V2 1RUH2 3KFWX 3CMAI 2GDFA 2H1KA 1UY0A 5LEJA 2Y6GA 2VQTA 4XL9A 2HNHA 5C3OA 1K45A 4MV2A 1ND3B 1JS9A 3V56A 2EIGA 3OGSA 4HX7A 4META 1X33A 2JIJA 1U0AA 3VD4A 3VB2A 3BG9A 1H6YA 4LBKA 3RPQA 3LOCA 1S8NA 1FC3A 3W9AA 1MBKA 2LR8A 2XG3A 3LE0A 3ZXGA 2A3WA 1MVQA 5I0SA 1ST8A 3J7MA 1CONA 2VCAA 1ALYA 1NUKA 4AC0A 2QVOA 3ACIA 4FQZA 1TMF2 4PSWA 3MLLA 4H7LA 1HLVA 1ULEA 2W92A 4X8NA 3HBKA 3GX4X 4PGHA 2HH9A 1USSA 3IAQA 3VD3A 2L4MA 2C0ZA 2I07B 5J1RA 3O8HA 2MGQA 3VKFC 3I3BA 2A6ZA 4XRFA 1F36A 3A0KA 3CCEI 1SMTA 4G6QA 1R6RA 5DUXA 3O1RA 3RVHA 2FF4A 3VBFB 1LKXA 3UNPA 4DUVA 3S14J 3HBZA 1RUNA 4CTEA 3CC2I 4CCLA 4XZUG 1F4AA 1EH7A 3KE2A 3HBLA 1OKQA 2K9NA 1B9NA 1MW7A 3FJSA 5ACA1 3AX4A 4F8AA 2OBPA 4IW3A 5EIYB 3J7AY 2DCTA 5GZEA 2XLAA 4XCAA 1B8IB 1U5IA 5E79C 3AXDA 1D2SA 3NV2A 1S7AA 1XGNA 5BNNA 3KP7A 3AL0B 4KISA 2XPJA 1VQ8I 4O9EA 5I8YA 1C8NA 2DWRA 1GNHA 3LQQA 3FIWA 3NWTA 1BI1A 5FO5A 5EEAA 4RHV3 1FATA 3IAS2 3V8JA 5FLIA 5IHRA 4FPCA 3AYAA 2K4BA 4DY3A 2D6MA 1ND3C 2K9LA 3NNGA 4G6DA 4BBSJ 5LLQA 3NAPA 3M1HA 1Q43A 1DUXC 4OIQF 3PO2J 4KG0A 1RUJ1 3M4OJ 5BY5A 1R5ID 1DHKB 4LIUA 4I6ZA 1SCSA 4XURA 3AKZA 2F48A 2UWAA 3JU9A 4QQ2A 2YG0A 2PLV3 4QPGB 2WA4A 1UKGA 1NKGA 1JZ2A 3H1CA 3KGLA 1GWKA 1AYN3 4DJAA 4E8CA 4BHBA 5HCFA 3TL4X 4E7ZA 1U8RA 1I6XA 2MPFA 2BNMA 4A2UA 1YX3A 2TBVA 3EO6A 2OZUA 1RL3A 4IGQA 3RI8A 3VDAA 3AG2H 4X1EA 3PLQA 2CV0A 4JGYA 4ETSA 3PQKA 2E60A 4GAZA 3KIOA 3BTAA 4CXWA 3HRTA 1JI6A 1HRI3 4AVBA 5DAVA 2PELA 5M0TA 4Q4ZF 3NWSA 1IG0A 3DXTA 3AMNA 4IL6C 4HA8A 4XE9A 2QQBA 1W28A 5CFCA 2ZGKA 3RJ2X 2CGNA 2WL1A 4DOZA 2Y38A 2WV0A 3PUQA 2CQNA 1KA8A 1N77A 5IYYA 4L9TA 4TWTA 1R4NB 4A69C 3AL0C 1FMD3 2W94A 1VP6A 4AIKA 2EZLA 5CFDC 5JMOA 4RLFA 3IIIA 4NWVA 5JOXA 4NN0A 2V9VA 4N43A 5C4WA 1EH6A 2WZEA 3O8GA 4GALA 3MKWB 1W9WA 2PHLA 1CN1A 2PHFA 1DG6A 1PZ8A 5D4SA 2XRLA 5FYSA 2OD5A 3HGGA 4LFUA 3D0SA 5CU1A 5BQTA 1EPZA 2VJ5A 3POSA 1JXNA 4ESJA 3QRFF 2VVEA 3ZOIA 2RS53 1GZCA 1C3HA 1FNNA 4BM8A 1PM4A 4L9NA 4G9YA 1UAAA 2H0VA 2B63J 2VXJA 2WT2A 1VQMI 3MBWA 4QPGC 3HPNA 3PUIA 1IXRC 3E5UA 4IJAA 4SLIA 5FLHA 5D8KB 2JXAA 4FQ4A 3KX2A 3I54A 2XGXA 3VV1A 4KIBA 3HQRA 2X1CA 2QQUA 3L2RA 1O3TA 4BNCA 4UW6A 2CW8A 1R5HA 2ENRA 2XUBA 1YNAA 4CDQB 2WAQA 4C2MJ 2CYFA 4OZOA 3L2WA 4KT5C 2ET7A 2VT3A 4D6QA 1JKRC 4LNVA 5GAGJ 4ZZLA 1ORKA 3T4HB 4EEFG 3KT4A 4AQ6A 2ZEWA 1ZARA 3GZ5A 2JUCA 3BPZA 5GLWA 3F8NA 3S2HJ 3GYDA 1W9FA 4E8DA 3ACLA 2G7UA 3WODF 2QENA 4IESA 4M6VA 4UWDA 5FBJA 1JUMA 1I5ZA 4NAMA 4AQ2A 1UCRA 2Z69A 5LASA 5A80A 3JCUC 2D6NA 3LWCA 5FZIA 2L7KA 3TEXA 2MEV1 3S15J 1W04A 2O61A 2IGNA 3DPRA 3I2OA 4IVNA 3SDGA 5FRAA 3ZQIA 2E7XA 4I0AA 2XLFA 5LGTA 1MD0A 3BCBA 4UV9A 1DGRN 3GHMA 2G7HA 3KV5A 2IXHA 4RLQA 3OYWB 5E1XA 3BPVA 1ASJ1 1R22A 2DA7A 4D7TA 4Z2YA 1HRI1 4CP1A 4E7SA 2EPFA 5T50A 4R8HA 1LOBA 2LC2A 4GWIA 4BQ1A 1NXD1 2ZCWA 5F6KA 1SLAA 2VNRA 3CCUI 1L7QA 3SCFA 1XDSA 1WZ2A 1F8VA 1J75A 2WBKA 3JREA 5DDGA 2JVGA 1UG0A 2WT1A 2HWC1 2DLLA 2H09A 5A3PA 4QDRA 1MS0A 5E3LA 2NVUB 1QU0A 1FMD1 2ZPXA 2JWPA 2ZXIA 3BQZA 1BEV1 4PJMA 3MHZA 1AL0G 4GRIA 4MTDA 3I2HA 3JD72 1J83A 4Q4W3 1OFNA 5C70A 2W87A 2IGOA 3WTSC 5DUUA 4B29A 3PHMA 3V0AB 1BBYA 4XJWA 3I2GA 2Y0IA 3QPTA 5LHHA 1NCQB 1BC8C 2WS91 4EJVA 3H5AA 3LFMA 4AVSA 2E1MB 4I76A 2WWYA 2BOIA 1MMNA 3HQUA 2B8MA 1VQ9I 2KJBA 1F2NA 5A32B 1XB9A 1NOVA 4EATA 4XORA 2GIVA 1O4TA 5SV8A 2HPMA 3QPSA 3MIFA 2VMDA 4ES8A 5IJRA 2Q30A 3HUGB 1UXZA 2WSVA 4H0EA 5HDGA 1QF3A 2MA3A 4CA0A 2FMLA 3EXUA 1R58A 2ESNA 5IYBJ 2P1BA 4AIDA 3SMHA 5HI0A 4QQLA 4Y1VA 2DCEA 3KQRA 2WJSA 1LFBA 4HAMA 3AYCA 4PF5A 3KQ4B 3HOWJ 4BXSV 1CAXA 5F8PA 3ZPOA 3KHCA 1WBLA 4QDQA 5CBLA 1HN0A 3TW7A 2VBPA 4DYCA 4XBNA 1PUFA 5IAVA 4W8JA 2EIBA 2VZSA 4XUPA 4XJZA 3TN91 2ZOEB 1IKQA 3OS2A 3CMEI 1DYOA 3O5SA 3W20A 4MNUA 5F3EA 4N53B 1OCRH 4HDVA 1CD3G 1W0NA 5FP7A 1QJY2 1FP2A 2EZHA 4BXXJ 2D40A 2EFQA 2L9LA 4HYEA 5EZWA 4D7MA 1VQ6I 1AR92 4JV4A 1XSQA 2UYAA 1VRBA 5FP4A 4MGKE 3BU0A 2VXZA 2W52A 4DB5A 4WF2A 3Q5FA 2ZS6B 2ARCA 2M0MA 2B9VA 4D69A 3I3MA 1IC8A 2Z2SB 2IXLA 1XYPA 4NHYA 2XAJA 4BQQA 5IPAA 1CF7B 4K7JA 5FZ4A 5GALA 3CUOA 4NBQA 5C7GA 1S0IA 2YC4A 1NCQC 3S5QA 2JA6J 4U87A 2R49A 1DZRA 1BJZA 1FYUA 2QQPA 5C8CB 1FOKA 2QUFA 2HQAA 4RA2A 3ELNA 4RQPA 5C4XJ 5A3LA 4S2HA 2DT6A 3WNMA 2I10A 1YW9A 1BXHA 5LCWL 2Q8EA 4COYA 3UGGA 3MUY1 1MDMA 2JG9B 5D5VB 4H14A 1IUYA 4JK1X 4FSJA 4ENJA 2K9MA 1EV7A 4RMNA 1OCTC 5ABJA 4S2FA 4YM1A 5L3CA 3BROA 1QH6A 3O7OA 1TLHB 4L97A 4Q4V2 4F3QA 4PGGA 2P5KA 3WDTA 1A04A 2LMDA 1VI0A 1RUF1 4YEJA 2Q1FA 4YFWA 1W6OA 2EH3A 2IA2A 4Z6YA 3MPBA 1LFUP 2ZJ2A 5J48A 1DCSA 1R5GA 3KVBA 5LW9A 4M73A 3ASIA 1XMXA 3CLOA 1PGL1 1IPSA 4AM3A 1FOYA 2L9NA 3EUKL 1GUUA 4AEDB 4HPKA 1VF9A 4JCKA 1LEAA 4AW7A 3HOUJ 3RZGA 4ZU5A 3WF1A 2G9GA 1NE6A 3EHKA 4HSLA 3GFJA 2W1QA 1VQ5I 1ZA7A 1WI3A 2IVIB 2VCBA 5FYBA 1J58A 1HXS1 5DABA 5L9BA 3UL2A 3REOA 1WFXA 2VOKA 4COVA 1WJFA 2DFFA 4FISA 5K7ZA 2NNNA 4AFCA 3OR2C 3E1F1 2DTZA 1D5VA 1JOJA 5EGOB 4JDOA 1DBNA 3GTOJ 5FZ1A 5BNOA 1QOOA 3IDEA 4HBNA 1WWXA 4C0HA 1KRIA 5HBAA 3PM1A 2NQYA 5IATA 2L9SA 2EVXA 5JSRA 2YHJA 2RJLA 3TWIA 5FQ0B 1ZR2A 1U5TC 1WD4A 2NYXA 4QXCA 5KVRA 3NJYA 4BQOA 5FY9A 5L7OB 3ZM8A 3EUHA 1IS3A 1FYMA 4UF0A 3ATGA 1NCRB 3VBHA 4WK8F 3DXJF 4A3EJ 4KIFA 2YB7A 1UYYA 3IBMA 4URAA 3K7AJ 1S0EA 1QZEA 1ENRA 4M3FA 2BVLA 2K02A 1LDKB 4Q4Y1 1XCBA 3KP2A 5GADJ 4OOIA 4BXFA 3FBNB 2IXJA 2F4IA 2ZBKA 4L5EA 1ZELA 3D5OA 5TJJA 2MC3A 2VZTA 3K3NA 4G94A 1OF3A 1BR4A 3S7EA 4B48A 2F4PA 5BNOC 5CVVA 3OSFA 1G9DA 2Y6FA 1TW2A 4QQOA 2FDKA 1Y6IA 4PDKA 5GJ6A 1ZGWA 2EA7A 3LL7A 4WM7B 2KRFA 3KT1A 3QP6A 1ZA4A 5CYVA 3ZRGA 3NAUA 5IUQA 4E27A 2BVVA 4KU8A 2XB6C 1FAYA 3D5RC 3EUHC 3PIOF 4BH9A 2KL4A 3K46A 3LSEA 1VNDA 4QM9A 1E5IA 2DPUA 4EJRA 5JXGA 3Q0WA 4HQMA 3WG9A 4Q0SA 2K4JA 2XAFA 1BN5A 2WFF1 4OMYA 3JRDA 5KC5A 4NIGA 3MZHA 4HF2A 1GHCA 3OYDA 4Q0PA 4G8XA 2JDHA 4YZ3A 1TNSA 4II3A 1QNWA 1OH4A 2CWSA 4FPJA 5F5IA 4XUOA 1JYWA 4WXHA 1R081 4KN7X 4NRQA 3PMEA 4IKFA 4G6TB 3LA3A 2VU9A 3ST7A 3A7QA 4IXAA 4YFZA 3C7GA 3HPGA 3SC7X 1ZBE1 3WG3A 2NYYA 3USUA 1AXZA 3LF7A 1CJPA 2J1TA 4I3PA 3KYLA 2LF8A 1FV2A 4GMP1 2YC0A 3GNEA 1Z1DA 3WLUA 3PSFA 3OL3A 2E35A 1AJKA 3G1OA 1VBB1 1VMHA 3WNOA 1AKHA 2RR13 4V2GA 4IQ4A 3ZCOA 3BTLA 5T5LA 3DBRB 1QKQA 2G4IA 2CQQA 3HIFA 4UXNA 1COV1 4A6DA 1NG7A 5JPNB 1B6AA 2LP0A 2EA2A 4N7UA 4RDUA 4L0YB 4BQYA 5M3FJ 2DU1A 4N4OB 1W2OA 3GBWA 2DFHA 3HT2A 4MXWA 5J09A 2K85A 5CJ9A 5HNHA 3OOPA 5L19A 1J0RA 3S6PA 2B46X 1QXPA 1XRUA 2C9AA 2G9ZA 1VRH1 3I4NJ 1PMJX 1MGTA 5LBBA 4NR1A 4S05A 4YW3A 3M3EA 3AVSA 4FFIA 3A21A 3LA2A 1NX9A 3HNYM 3WW2A 3NARA 1EF4A 3A03A 4HLYA 4GXLA 1E5RA 3AL6A 1US2A 4QPIA 4DYRA 1AYM3 2OU2A 5IFTA 4BQ2A 1C0WA 3NJZA 1XNKA 2C6YA 4G4FA 4XFGA 3G7DA 3G6JB 3UJQA 1YQCA 1V6KA 4L5IA 4QX1A 3THDA 1KU2A 2AC1A 5D2AA 1C8M3 4MADA 3FDYA 3N7MA 3QYFA 5FFZA 3P1IA 3QH7A 1JUHA 3B3QE 5JSPA 4PUSA 2STTA 3FHAA 1C8M2 3GW2A 4A3GJ 2OC6A 4NQWB 5FYMA 2L2OA 5FRMA 1F5TA 2JE9A 1LB2A 4E4ZA 2CW7A 4DEVA 1X8MA 4LULA 3IPVA 1OCOH 2WNUB 2HBTA 1POV3 2YX4A 3ZQCA 2HOEA 4U2AA 1ZGAA 1Q1HA 1NK3P 1MQTB 5IYCJ 4FXKB 2IGKA 2VKHA 1MEC3 3MKZA 4LBQA 1Y8QB 4V2FA 2HEOA 2F17A 1MEC2 4QXHA 4UBGA 3LOBA 4FPYA 3DBHB 1O3QA 1QH7A 2A6YA 3O14A 3E3VA 2ZGLA 2JD9A 1A8MA 1UZ0A 4JDMA 1ZK8A 4UFIA 4O65A 4HG2A 3SEEA 3KMHA 3VODA 5G04L 3WEZA 4C1XA 4DYQA 1SLCA 1X58A 2VJXA 1UB9A 1YFHA 5JOZA 5FPBA 2RM22 1RVF1 4ITVA 3AKRA 4XOGA 5FZKA 4YGBA 2BE5F 4E7KA 2RR11 2C4XA 2W2IA 4N0BA 1Q5OA 3ZX7A 1O4YA 3UK9A 4MX3A 2OPTA 4IO9F 4O61A 5GZCA 2UWBA 2JDUA 3AMMA 3N9PA 2OYZA 5FROA 3OIOA 3OYCA 3NQOA 4Y7NJ 3ROUA 1JU3A 2JZYA 4EYUA 1MZ5A 5BNNB 2V72A 4UUSA 3TQNA 4ISQA 2BQPA 1FIPA 3WDUA 2M87A 5JXHA 3CF5F 1P8JA 2W39A 1ZRCA 3WQ0A 2WWSA 3HDDA 3H3ZA 1AX1A 4XEZA 4QPQA 4YARA 3U78A 4XLEA 3N9QA 3VOEA 1ZRDA 2QQLA 1W99A 1D8KA 2ZGUA 2JKXA 3IM0A 2CV6A 2GP3A 3HOBA 2WQ8A 1VMJA 1LE8B 4OHVA 1P92A 2YMZA 1AYM1 3D6EA 3T0YA 3HJRA 1TQPA 3ZN1A 1V9U3 2P17A 3SFIA 2R5ZA 1OA2A 3GVAA 4FX0A 1N3QA 4J00A 1BHGA 5L3EA 3HR9A 1V9U2 2V5YA 1J9IA 2KIQA 3V8LA 4QQPA 1MQTC 1OLMA 1OHFA 2W1UA 3WNXA 1NZIA 3CJIB 3ZN6A 2XVKA 3RWKX 3PNYA 2E1OA 4A3KJ 1XGSA 3COAC 5F08A 3GTQJ 4XBFA 2NM1A 4GXOA 3CP2A 1B4AA 2LK2A 2JD4A 3WUCA 2YU3A 4OCTA 1KYZA 3KEOA 1BMV1 1E5HA 1ZH5A 2QYOA 3C2GA 4D6SA 2ORXA 4G7HF 2XQXA 3POEA 1LGBA 2GIZA 1H9WA 2DFBA 4JGYB 4XACA 3T0DA 1POV1 4W65A 2CGPA 5A2QZ 1QXRA 2M4KA 5FPVA 4UBHA 2JPCA 1WA6X 1JMUB 4DEQA 4AVVA 3TEDA 1HQNA 5LA0A 4QX7A 5CFCB 2ZO4A 3BG5A 4S2DA 4HPQA 5IVYA 2VBYA 4XDQA 1LDDA 1F15A 4IRGA 1DQ5A 1VTNC 3FHNA 4XNFA 3BR5A 1XYOA 3LDKA 2HEWF 3J9SA 3WG7H 1DGRA 3ZFEB 2XAHA 5D5XB 4N43B 4L9BA 5T5JA 2DXIA 2CHHA 1CZTA 4LLLA 4NC7A 5LA1A 2CO5A 4XLPF 4JTNA 4C90A 3SEQA 1KJRA 4AFMA 1SLIA 2R1DA 3HKZN 2ZEYA 4Q0QA 2LRPA 4Q1PA 1R23A 3U11A 1IQAA 1I3AA 4Y3OA 2K27A 3ECHA 2DA1A 3B01A 3LSDA 1QHGA 4CCOA 2X29A 1ETVA 1KDKA 2R16A 1IXSB 4LORA 4P00B 1RHI3 4QKDA 2Y6HA 1YFWA 1C1FA 2OPKA 3E5XA 4DQ2A 1W2UA 3VB9A 5A3UA 3WG1A 4MTEA 2ZGQA 1VQ7I 2YU1A 2RC4A 3I59B 1LCLA 2V4JC 4XPVA 1OISA 1YHQI 4YW1A 3HRUA 4WXDA 4PCRA 3QLQA 1U78A 4LO4B 2XROA 2GH2A 4LKFA 3H7JA 3WV6A 3WF2A 1HN1A 3QP5A 3T3YA 4Q47A 2R5YB 5IP6A 3CJIC 3S3NA 1HJGA 4I3GA 1CAUA 3S0MA 3S17J 2Y26A 4A45A 2F5FA 1TWAJ 4OIOF 1S0BA 4ABZA 3VL8A 4YGEA 3M8EA 2W4SA 1ETYA 2BY1A 4R9AA 2IFRA 3KT7A 3FXUA 3U1DA 3O0XA 4AEJA 2RS13 3FXKA 1T2XA 1VAMA 2R7OA 3FXJA 5L3DA 1S0CA 1HXDA 4FE4A 4J19A 2RS12 3C7FA 2KISA 3K4NA 3KLSA 4DMIA 5I0RA 4A3ZA 2P81A 4DOUA 2EV6A 1CAVA 1S0JA 4NE9A 1SDWA 3ZFGA 4W4ZA 1S29A 2NNYA 2IC1A 2E31A 1I1EA 5J1UA 5JLVA 1QJFA 1W5SA 1T6BX 3FXRA 4CUAA 4B3XA 1YS6A 4AHWA 2LSOA 2DMPA 3LIGA 1O57A 4W6XA 2KIFA 1RMU2 3CZ6A 1V6MA 4BGDA 1NA1A 4DRRA 1XNTA 1RUI3 2FDIA 1MS9A 4OAYA 1HB4A 2Y30A 4IV1A 2JE7A 1PVC1 1GNYA 2DMQA 2O0OA 3BB6A 5FZFA 1FMWA 2MSYA 1G8XA 3IH4A 3WU2C 4HVOA 1ZZ7A 4BMEA 1RJ7A 1SVOA 3POGA 3JRFA 3ZFGC 2W68A 3B9CA 5HV4A 2CS3A 3A01B 3HOSA 4AQTA 2RDSA 3FK6A 3JCIA 3PURA 1UU5A 1S0GA 3Q0UA 2E1CA 1OLTA 5CZKA 3L2YA 1W6QA 2W95A 1CESA 4FFFA 4LTAA 1ZR4A 4CP2A 2H0BA 2HZDA 1MS8A 2A70A 4ZXKA 1JZ7A 5T54A 5D4RA 2IA1A 1OCPA 4CXXA 4RS8A 3HN1A 4HEA2 3G1MA 5E8IA 2MLGA 1REFA 4N9IA 3Q9VA 3SXWA 4HT1T 3DP7A 2E34A 4WBBA 1IG7A 1N47A 2RDRA 2PJPA 1RHI1 2OA2A 3O1TA 3DLAA 4W97A 1V0AA 1ON2A 4M3EA 1AR73 1ZN2A 3R61A 5FY8A 1SD4A 3P9IA 2IJLA 5L9RA 4UT5A 4OMDA 1AR72 1T08B 4IEWA 3INAA 1SD5A 3ZGKA 1YS7A 4PHZA 1AHDP 2FCTA 3OYNA 1W2TA 2AO9A 3OSDA 2IXCA 1H2MA 3DKQA 3EYPA 1VALA 2CL2A 1Z0XA 1DZQA 1LGNA 1PIV2 2DUQA 5HLHA 4RGXA 5IT9K 1AX0A 4NIHA 2X9DA 2JIGA 3C7EA 3MICA 3AYEA 3U4SA 2BERA 3CEWA 1IN4A 3FXLA 5K0UA 3FBYA 1FIAA 1W0OA 4LO5B 3SH5A 4UUTA 2VZ1A 4OI0A 3PUSA 1Y4WA 1GOHA 4XQDA 4QWNA 5EZHA 4R79A 1IS6A 4QPWA 1YIFA 2ELHA 2P6CA 1UOBA 1V6OA 2ES3A 4M0HA 1FX5A 2ZEXA 3J7AO 1NZCA 3GYHX 3T8TA 3VYUB 3JQWA 4FPOB 2BY2A 5C9AA 4P55A 2HYXA 4AZZA 2E5NA 3IP4B 1OSGA 1N3PA 4Y22B 3T5XA 1C4RA 3HNBM 2P34A 4O7XA 4BS9A 2BUKA 2Z4FA 3S30A 5HS8A 2GU9A 1QPMA 1BI0A 2YUSA 1UU4A 1YJWI 1EAH3 4ZU7A 3ETQA 2FJ1A 2ARXA 3P3PA 1EAH2 5C3PA 5K0UC 1JI8A 4M9ZA 1LHUA 4CXFA 4OHZA 2VQGA 2EIJH 4I09A 3I2KA 3S2WA 4BOWA 2KLOA 1MNEA 5DM6F 1HQWA 4AE2A 1YJNI 1X50A 1GQHA 3VBUA 2JSPA 2J42A 2DVGA 3OYFA 2R063 1SACA 1W0TA 4CEYA 1ETQA 2R062 3WCSA 2P4EA 3TEYA 4EJOA 1LTEA 2XLGA 4RQPB 1H4GA 5C9AC 5K7FA 1FXZA 4XOPA 3HSFA 3Q8CA 3LSMA 3RI9A 1OPCA 2D43A 2ADDA 2YBKA 1S4CA 1D0ZA 1XXNA 4OHWA 4EZHA 1OLRA 2FDJA 2DMUA 3MV01 1PVXA 1PZ9A 3AL5A 3WU1B 4C2UA 4HANA 1SFEA 4HX8A 4FAHA 4ZDPA 4U7DA 3FF5A 3JSOA 5APAA 4EQVA 4P1WA 3ERED 3H36A 3ZXDA 3ZIXA 2KDOA 4LLNA 2ZGNA 3VBRA 2R073 2JJ7A 4NHKA 3WTTC 1SEFA 5HVQC 1F5JA 1XPWA 2R072 4Q0UA 2XMLA 4F55A 1X9PA 1CQTA 1TTYA 3VBOA 2A68F 1HW2A 2X5IB 1JYTA 5FJ8J 5A6XA 4P9WA 4Y17A 5HLIA 4KFCA 2IUWA 1TVGA 1MZ6A 3W21A 4QTRA 1TWFJ 4A3MJ 4IV3A 1X4PA 2DDAA 1UAIA 2Y6JA 4HLTA 5FUPA 1HW1A 1ULYA 4HV6A 5FYCA 3AYDA 4XMAA 4R9CA 3BIWE 4LBJA 4E2GA 2WY8Q 2YXSA 2XC7A 3OUIA 5K5QA 3THCA 5FPAA 3MFCA 4NIDA 2Y31A 1GR3A 2MW8A 2ID6A 3POWA 4XRSG 2V1XA 1YJ9I 3CMMA 1RC6A 3OY8B 2DT5A 1ETXA 3WF0A 1GZWB 3H1MA 3DL3A 1H0MA 5FBZA 4CE8A 3C18A 1HQCA 2QZ2A 4UB8C 4KI5M 3CD6I 1U0JA 2ADEA 3ZXEA 1RC9A 1QWRA 4MH0E 3GXOA 2A5WA 3TW6A 4PDWA 4BJ5C 3D1NI 3PTRB 5HXVA 5CA6A 5CEHA 2LLKA 4EN7B 2JRMA 1ON1A 1JE8A 4QHOA 4ZS2A 1TQIA 4BE2A 3FMSA 4E4SA 3GTPJ 3WGGA 3E5QA 5EXOA 2DPDA 1YW7A 1FJLA 1VBC3 2JN6A 4IV3C 1QRYA 4EWEA 1DU6A 2XBO1 3A2KA 3ILNA 2QWWA 2X1EA 5EV7A 4IHXA 4PZJA 4OU0A 2Q2EB 1VQOI 3CJQB 3AP4A 2O14A 3RDIA 4LBOA 4H4KC 1IS5A 4JKMA 1FBSA 5K7HA 4L9VA 5T52A 4XIOA 4CU7A 9ANTA 3BZCA 4AVAA 3GJAA 4CU8A 1SD7A 5BNPA 2OTJI 3D8CA 1QGPA 4PDWC 4IEXA 4EROA 3SQOA 2D5FA 5F3IA 4LLFA 1AR61 3KGZA 1U5YA 3D3AA 1BC7C 2D3SA 2XVLA 4CCCA 4HG6B 1AR91 1WCUA 4Q2FA 4NIIA 2X5IC 4HQEA 4RAFA 2JMWA 3VWBA 2OQ6A 1MR5A 3ZYPA 5J4VA 4M4RA 1T38A 2IWGB 3HOTA 4JX4A 3WHBA 3GZAA 2AREA 2GOMA 5J37A 1BBT1 3PSIA 4O3MA 5T5OA 4CRQA 4ZYDA 2X6XA 3LFUA 2R7DA 5GKAC 2P2KA 2ZAAA 3L1PA 4I01A 3CUQA 2EXHA 5KR7A 4EJUA 2CQKA 2GOXB 5DAQA 4AI2A 1AX2A 3DKYA 4J1WA 2PHWA 1Y0NA 1PK6A 2RJ2A 5FP9A 2JK3A 4Q5OA 1KU9A 3HTUA 2X8KA 4XF0A 2IFWA 1JYVA 2HOAA 1YI2I 4BY1J 4IEZA 4M3CA 4OQ8A 3Q0VA 3KZ4C 2ME6A 2CU5A 3V0BA 2R93J 2HYJA 1US3A 3VHOA 1FI2A 4AAPA 1XD7A 6PAXA 4Z8BA 5AVAA 1O4XA 4FOVA 3WNLA 5A3MA 1ODDA 5J3LA 3EDPA 4KITB 2LM3A 1RUD3 2MH9A 5ANQA 2BJSA 5K7PA 4Q4V1 3R4SA 3T2PA 2VBZA 1Y8RB 1FWZA 2E63A 1LDJA 4RM3A 4MLOA 1EKEA 1OT5A 4KN4X 5HS7A 1VE0A 2DBBA 4LKEA 1ZHFA 1FSEA 5FY7A 1VBD2 2IEKA 3I3DA 1LOFA 2JDPA 4K8FA 1W8FA 3FWEA 2BV4A 1IZ3A 1RI7A 2Q8KA 5FP8A 3ECQA 2KMUA 4G9SB 1TQMA 2VBWA 4AGVA 1GBGA 1FOD1 1A35A 1J5YA 4CPBA 3DEWA 3EBRA 1ZBA3 1G3TA 3J7ZI 2X10A 3K51A 4PLMA 1HDDC 5FGMA 1VBC1 1E5SA 1ZRFA 1ZBA2 5FYVA 1W8OA 4PFPA 5JLWA 5FZEA 4MUVA 1RETA 3ZYHA 3VPRA 2JA7J 4IPAA 2NXNB 2PLYA 1XNCA 2W48A 3GEZA 4CU9A 3KF3A 1IRXA 1K6OA 4DFSA 2UURA 4MGIE 1BLZA 4AI1A 2EBIA 3W2AA 1A36A 3J7HA 2JQ7A 2ZXQA 3ERMA 4KDPA 1TBXA 1EY2A 1M4WA 2VOWA 5BYNA 5A33B 1UO9A 2FQ3A 1KQ8A 2CUEA 3DUIA 5C8WA 1AU7A 1LOFC 4DZGA 2AENA 3PTYA 4B4RA 1QJU3 3ZSMA 2GA2A 5DM7F 4XTPA 4AF9A 3PUAA 4RB2C 1WKYA 1XBFA 4C3HJ 1ZG1A 1Q8QA 4LG0A 3JSPA 4JHTA 3IKWA 1UN1A 2WQZC 3S57A 3FC0A 1UYXA 1P4WA 4OINF 1FBUA 1RUG2 4LR4A 3ULQB 1CAWA 1H0BA 3ALQA 4JKKA 2VOPA 4WVMA 2QGUA 1IF1A 5E8AA 1ULPA 4M9XA 4GWNA 1T33A 2BBAA 3GGLA 1WW5A 3UGFA 4XILA 4BEHA 1B35A 4HZFA 3M8LA 5FZ3A 4OIRF 4YM0A 3PVEA 2VVDA 2VH9A 1S1AA 2EALA 1NH3A 2HDCA 5JPMB 4DS0A 1PM7A 3MIHA 5E1RA 1O7LA 2O3FA 1SLTA 4Z2AA 2JKBA 1ITYA 1V6IA 4CDXA 5E8GA 3CP8A 2R043 1ENSA 4IOCF 4GWJA 2A61A 4QB6A 2R042 2DOEA 3U07A 4MGRA 2L7FP 3HC7A 3V42A 3H3UA 3BG3A 2GQQA 2XSJC 4XONA 2E7WA 4X6AJ 1AXKA 4QX3A 5IK8A 2PMWB 3WP6A 2QQAA 4NPLA 1T39A 4E7IA 4QGNA 2IGMA 4ATFA 1ZG5A 1RUC1 2DBIA 3K4JA 1J2XA 2PMZN 2ZXJA 1H4HA 2B0LA 1L3JA 1PGW2 4AYUA 4B3NA 5FRNA 5A7WB 3B94A 3MLJA 4CHUA 1UIKA 1IDYA 3BOWA 3A1YA 3LIHA 5FXWA 1LOCA 5FO7B 1LR5A 1JXSA 1ZZ9A 3K6GA 4CDXC 3K70C 4DRVA 1BOAA 2XONA 1Y43B 2ZBJA 3WHCA 2JG8C 4QAWA 4MGYE 1EYBA 4NHJA 3R05A 4A6SA 2ZX1A 3FHQA 1GU3A 2JE8A 3JAMZ 4MGZE 4LIVA 1IV8A 1OA3A 5IT3A 5F04A 5FKBA 5FUNA 3ZDSA 1JTZX 4AIHA 4MZUA 2YROA 1XQNA 1VBA3 1JBCA 1W1WE 4XUTA 2VCMA 3SZTA 2K9SA 3TO9A 2LBFB 1VBA2 1QDOA 2G1MA 2Q8CA 4HSRA 1AL21 2EIEA 2GZWA 3A0NA 2WRAA 3CJTB 3VHPA 1X1DA 1QJU1 4ZDLA 4X0GA 4YG3A 2VXRA 2ETEA 4Q8LA 4CDUA 2OIIA 3H7YA 2V79A 5D1IA 2V9KA 2WWUA 4Y15A 1JZ8A 3P5JA 1SFYA 4MQVA 5GAHJ 3UKGA 1DLLA 4RN5A 4XKVA 5IOYA 4LK1F 2XJSA 4AVTA 1FPN2 4IERA 3DPLC 4WM8B 2WAQN 2VONA 1MKMA 1V54H 4KGGA 4IHWA 3ZFFA 4K1YA 3ZKUA 4A3BJ 1C1LA 1UZVA 4BE3A 2NLRA 1HRV3 1LU1A 2DYCA 4P9IA 3V4GA 4K40A 5JIUA 1V5GA 4QXBA 4D7YA 1JZ5A 2EQRA 4DXZA 5EJCA 4F83A 1E3HA 1ZNPA 4DNYA 3PNVA 2VOTA 2VLAA 3N05A 3Q9SA 3WZ1A 2P3JA 4WX9A 4GYIA 1XPXA 1DU3D 2WNOA 2QM3A 2EFWA 1JW6A 2R7EB 5C3QA 3OYGA 4ET7A 3PFIA 1NLRA 3MFAA 1ZYRF 5KHDA 2B9SA 4KU7A 3H1YA 2H6BA 4HMZA 3T8RA 2L7ZA 3I4IA 1LVAA 3HSRA 4AYBA 1APNA 2E36A 1IPKA 1WCMJ 2R32A 5C33A 2H94A 2DK8A 1WKMA 1BVP1 2XWJB 3TNPB 3H9AA 1AR82 2ETHA 4HETA 4JHZA 2HS5A 1H8TA 4KMFA 4Q0VA 4JC1A 1SFXA 4RR3B 2JPBA 1CQ9A 1D3YA 3LOIA 1IUFA 2LKSA 1W03A 3J8F1 3WF3A 4UFJA 2YPRA 2HXIA 5JI9A 4K20A 5E20A 4A3IJ 3CTAA 3BPXA 2LNBA 2ZTNA 5JR2A 1IN5A 3OGJA 4JX0A 4MXVA 5HS9A 3MIEA 1RNLA 1YX5A 5ICCA 1QIQA 2YR2A 2BVBA 1LNSA 3O1PA 4WVWA 2QQOA 5HXMA 1CAUB 2Y69H 1ULDA 3PIJA 3JBG3 1HSTA 3V65A 3UETA 2E53A 4WM8C 4IE6A 1B1BA 2NZ9A 4IQJA 2WA0A 4IEJA 3DWLE 4KG8A 1UHMA 4YNIA 4IEOA 2WZ8A 1PZ7A 2UWMA 4ZTFA 1XG1A 3IAM2 5FZ6A 4MOAA 2V4VA 1D2QA 1IS4A 3PMSA 2D6PA 4XIKA 4PBPA 4QM8A 4H7MA 3U14A 4F91B 2PG4A 4XKBA 4JP0A 4G7OF 2P5LC 2CAUA 2Y0MA 2UYBA 3IWFA 1Z7S1 4Q26A 3L2UA 1ZVFA 4YVWA 3TEWA 3KPHA 4LO8A 1K12A 2ILMA 2VL4A 4RFRB 1RXFA 1E0EA 5FLVA 3K4BA 1CZSA 4L0PA 5G05L 1A6QA 1W6NA 1SQ4A 1HW5A 2PFBA 2VPLA 4M01A 1JUIA 5T5PA 1ZRIA 1W8HA 1ENQA 4O5VA 2X6WA 1FNZA 4QB1A 4OQ9A 3W6KB 5DEQA 4R4XA 1HKQA 3QU3A 2EXJA 4BISA 4NROA 4IV1B 3C2HA 2X1DA 3IIAA 3MZ8A 2CFXA 4CPBD 2HWD3 3ELKA 1V5EA 1OQEA 4M6YA 4V19K 4ZJZA 1RR8C 2YY1A 2HWD2 2VQAA 4RR3C 1YRNB 1EH8A 3GBGA 3CDHA 1GQGA 3F22A 1M1EB 3WW3A 1PO23 1S2EA 4FT8A 3UKVA 2FBKA 2JRTA 4D5CA 1IRGA 1W6QB 1LNWA 1PO22 5L36A 5DDJ2 2M0CA 4UFMA 4CZZA 1VQNI 5EDNA 3CQOA 3WTUC 3QCWA