3H3ZA

Crystal structure of a putative cyclic nucleotide binding protein (spoa0323) from ruegeria pomeroyi dss-3 at 2.35 a resolution
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
226
structure length
226
Chain Sequence
MAHEAQKAIARNSLLIRSLPEQHVDALLSQAVWRSYDRGETLFLQEEKAQAIHVVIDGWVKLFRMTPTGSEAVVSVFTRGESFGEAVALRNTPYPVSAEAVTPCEVMHIPSPVFVSLMRRDPEICISILATTFGHLHSLVAQLEQLKAQTGAQRVAEFLLELCDCDTGACEVTLPYDKMLIAGRLGMKPESLSRAFSRLKAAGVTVKRNHAEIEDIALLRDYAESD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of PUTATIVE CAMP-BINDING REGULATORY PROTEIN (YP_165150.1) from SILICIBACTER POMEROYI DSS-3 at 2.35 A resolution
rcsb
source organism Ruegeria pomeroyi dss-3
molecule tags Cnmp-binding protein
molecule keywords Cyclic nucleotide-binding protein
total genus 63
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3h3zA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3h3zA01
5CU1A 2YX4A 2PAKA 4RGUA 5K1YA 2Z2SB 2BGCA 2WV0A 1IN6A 4XF3A 5FPXA 2F5DA 3MWMA 4Q48A 3FMRA 4P9UA 3OCPA 3ZMDA 4D7TA 4D7SA 3BY6A 4IXAA 3T8RA 1IF1A 4KN7X 1VP6A 3ZDSA 4EWEA 3H3ZA 4ZZLA 3QU6A 2NNNA 5JR3A 3BZ6A 2W25A 3HSFA 2HQNA 2K7LA 5TRDA 4WXHA 5BS6A 4RD7A 4MGIE 2XGXA 2IA1A 2MNGA 1B4AA 2CO5A 3RJPA 2FA5A 4AVBA 1J2XA 1IXCA 3ISPA 2VPVA 4NHJA 2FMLA 5LRSA 3WTVC 2V09A 1ULYA 3NKTA 4UNOA 1T6SA 2XL7A 3LA3A 4UUVA 1GQHA 1J3RA 3K1MA 2Z69A 1R1VA 1EH7A 3QP6A 4JVAA 3KLOA 3H1MA 3H1WA 2XAGA 3E5QA 3M70A 4QM8A 1STZA 1DPUA 2QJVA 1BC8C 4FBFA 4XEZA 2OD5A 4HVQA 5DUIA 2F5CA 5D6EA 2V79A 1Z6RA 4XLNF 2EFNA 3EUHA 1ODDA 4AIHA 2M5WA 4AWXB 2XV4S 1CF7A 3OTFA 2XHKA 4KIFA 4Q47A 4RB3C 2HTJA 4M72A 1SEFA 2RQPA 4H0EA 2IP2A 4ZU4A 6PAXA 2W85A 3WTUC 4ZZDA 4ENKA 1OFNA 1JHFA 1B1BA 5A2QZ 4ZU7A 1G4DA 3H9AA 4YARA 1LRHA 1O3SA 1ZN2A 1YO5C 4BNCA 1EH8A 3EQLF 4CO8A 1F9NA 4MGZE 3RNSA 5FQ0B 1IZ1A 1F1ZA 3DPLC 2XLAA 4LA2A 4A0YA 2M1BA 5DYMA 5C6CA 3KGZA 3JTHA 3LWFA 2QLZA 4KIBA 1VJ2A 3GYDA 2O1QA 4RGSA 1CAXA 3WGGA 2Z99A 2DK5A 4G6DA 4M9XA 4LB6B 1X8EA 2EV6A 2OYZA 3FX3A 2Y0OA 4MV2A 2UYBA 1OD5A 1ZLKA 4EJOA 2L01A 2X4HA 1YWKA 3LQQA 1P4XA 3WTYC 1S29A 1IXSB 3T1BA 3CDHA 5C8WA 5EEGA 5D1IA 3GFLA 2QZ8A 4UBGA 2F4PA 3FXQA 3K1NA 3VEPA 3EQEA 5LHGA 3H7YA 1BI3A 2QBYA 1DZTA 5LHHA 4PGHA 1BIBA 2G9WA 2PG4A 3KGLA 1QZYA 4Z07A 1HW5A 1U78A 2FQPA 3WU1B 4IEOA 3HSRA 3NQOA 4HF1A 2D1VA 1MJAA 3MCZA 1RUNA 3BOQA 5EFUA 2PHDA 1JE8A 4EJVA 3RI4A 4IF4A 3IKVA 1MDMB 2CW0F 3RIRA 4R79A 4XF9A 4KIGA 4Z2YA 5D4RA 2D5FA 2GC0A 3ETQA 1V70A 2MPFA 4A0XA 1GXQA 5LRRA 4IEQA 3G3ZA 3PLQA 2ACJA 3P9CA 2MC3A 3J80Z 2MLKA 4EROA 1UHMA 4HOBA 4OINF 2UYAA 3H8UA 3LAGA 2HWVA 2QBYB 4ZYHA 4I3PA 3ULQB 5CVJA 1O3TA 4LLGF 4KN4X 3R0AA 4UV9A 3DN7A 3D82A 2XAFA 2F5FA 4H7LA 3C18A 2IXIA 3T0YA 2EJRA 1R5GA 2IRFG 2EFWA 1BBYA 5E16A 1RGSA 3FXUA 1CAXB 1Q3EA 1P92A 1KQ9A 4R1HA 2PFWA 2GXGA 2UWMA 2FNPA 3ZN0A 5LLQA 2BYVE 1UFMA 4G7ZF 1UCRA 5E8GA 1SD4A 2VT2A 5BQTA 3L2HA 1ZX5A 1YG2A 2JPCA 2D45A 1UIJA 2OQRA 3R60A 1ONVA 3CUQC 1FI2A 2OZUA 4PIZA 1HKTA 4EV0A 1X3UA 2E1NA 1XGMA 2GQQA 3LQRA 2EV5A 1D5VA 1DZRA 5BXXA 1FP1D 1R58A 1RZ4A 5LGNA 4CHUA 1ZGJA 2FNAA 3B02A 4Y13A 1YIOA 5JAXA 1EPZA 1O5LA 4IETA 4EWAA 5HS9A 3S7IA 2PEXA 2CGPA 5BMZA 2HGCA 4ESBA 4HVOA 3EDPA 3J7AO 4KU8A 5D5XB 2BNOA 3ZQ7A 3LAPA 2Y48A 1YFHA 1QY4A 1IPJA 3EHKA 3U10A 4QMAA 3KZYA 3RKWA 3NW4A 1DGRA 4RB2C 3FHZA 2ZKZA 1WSUA 2AS5F 3MPBA 5ILVA 1R5HA 3AAFA 4IEVA 3WW1A 3KZZA 3FMSA 5IT9K 3KETA 1G3WA 4OOIA 1OYIA 4DNCA 1UPIA 2PQQA 2RDPA 3GUDA 2PBIA 2H0VA 1JUHA 5DCFA 4OMYA 4EJUA 4KUMA 3ELNA 4HF0A 4PDKA 5E20A 4NQWA 2VBXA 5DEQA 1P2FA 1B6AA 3F22A 2Q0OA 2PJPA 5BPXA 4QWQA 4GCVA 1PDNC 1IW7F 2VECA 4N9HA 4XFCA 1Q5OA 4GULA 2YX7A 4Q0PA 3LA2A 2ESHA 2ISYA 4WF2A 2DQLA 1L0OC 2FMYA 4EWDA 4HLYA 3SZPA 4G9YA 4ASNA 4NVPA 2XKOA 2P4WA 2Z9OA 4EQQA 3ZMZA 5HLIA 4LB5A 1E17A 2GXBA 2DCTA 2QWWA 2ZBKA 1QNTA 3F23A 4KNYA 4LUMA 2PAEA 1FPQA 2W24A 2NRAC 1XDSA 3GO5A 4S05A 3BCWA 1VTNC 4Q0UA 2XROA 3OOPA 4L18B 2EA2A 3WODF 2JZYA 3I58A 2K4JA 4CDGA 1YQAA 5CVIA 1ZH5A 4MGYE 1IUYA 2CAUA 4PJYA 2PHLA 3TNQA 4YFXF 2KIMA 3F8CA 3IDBB 1TQMA 4A2UA 4M71A 4E2SA 1MJBA 4AXOA 3B73A 2XASA 3GF2A 3HRMA 3F72A 4L0ZB 1U3EM 4MGKE 1YS7A 2CG4A 2LDUA 1GHCA 2UXXA 3KP4A 4RAYA 2Q8KA 1DGWA 1SD5A 2UY8A 5FD5A 4JTOA 3LWCA 1HSJA 2A61A 5DCMA 3JZVA 2RN7A 4JTNA 3GFJA 2P5KA 4B29A 4ENJA 4QXKA 3U2RA 3MZYA 1U2WA 2C6YA 2ETEA 4KWLA 5FLIA 2O0YA 3HT2A 3GLXA 3RKYA 3HHHA 4OIQF 5D4SA 2IXJA 2QCSB 2DT5A 1K78A 1HSTA 4ZH4F 1V3FA 4XBFA 2A6EF 3TOBA 1R23A 2GC3A 4MHGA 5L3CA 5J7MA 1T2KA 1CF7B 3O2PE 1S3JA 1HQCA 4HVRA 1K79A 3W6KB 2VOPA 4BHCA 4O9GA 4JBAA 3CO6C 5F64A 1BI1A 1OMIA 1J5YA 2MHFA 3KSCA 4LK0F 4WZCA 1XRUA 1NZCA 2EB7A 2HOEA 2P17A 5E1WA 3E97A 4KMFA 2OZ6A 2XRNA 1YFXA 2V6CA 3Q9SA 5D5UB 2YR2A 3GFMA 1ZRFA 2XAHA 1IRGA 3ML6A 5FPZA 5DD4A 4HMZA 5KHIA 2K4BA 4R8HA 4WK8F 3GXOA 3J80K 4BYYA 4EJTA 2QQBA 1R7JA 2A5YB 4A5NA 4DQ2A 2OA2A 3HHGA 4IERA 5J6XA 2HYGD 3F6OA 3M8EA 1QGPA 3TOAA 5TJJA 5CYVA 1I5ZA 3KP7A 3HTSB 4KDPA 1SQ4A 3TO6A 3WTSC 4Q0SA 3F3XA 1EV7A 4YFNF 1XSVA 2PN6A 5DDGA 1Y9QA 2BEOA 1G3TA 3V7SA 2XL9A 2VBYA 4P96A 3V7RA 1KYZA 5LGTA 3FXRA 3KP2A 5E17F 1TTYA 4HLXA 3JSPA 1ZRRA 1LEAA 2NYXA 1ZNPA 1J58A 4OMZA 3EYYA 3D5LA 1CAUB 2L02A 1KQ8A 4GGGA 5A2QK 5JR7B 1I1GA 3ES1A 4AQ6A 5BOXA 3GX4X 2OZJA 1CAWA 1FT9A 3ST7A 2PA7A 3FWEA 1UW8A 3UKTA 4I02A 3WTZA 5FQ0A 3E5UA 4ONUA 4LTAA 4WWCA 4A6DA 3HRUA 3J81Z 3FFQA 1XGOA 3V8LA 5LEKA 1KU3A 1ZYRF 4IVNA 2I45A 5EEHA 3RDIA 3JAMK 1WKMA 3WG9A 2HDCA 4QM9A 3SCGA 5L3EA 4HX8A 1J0RA 2CWEA 1YFUA 1ZRDA 5AIQA 2NS0A 2FEZA 4HSJA 2H6BA 1T0FA 2KKOA 2BE5F 3GEZA 1LDKB 4O3MA 2CYYA 5L3GA 4KICA 1CAWB 3S2WA 2OU2A 4QLCU 3MZHA 1PUEE 2PTMA 4ZYGA 5HS8A 3ZN1A 1BM9A 2GU9A 4KU7A 1K6OA 2LF8A 4O9EA 2CQKA 5HS7A 3I71A 5HDGA 1FYLA 3FZVA 4HDUA 1QXRA 1GVJA 2ZNZA 4AD9A 1BC7C 1TQIA 4A12A 4EJWA 3VHRA 1AWCA 1XSDA 4LG0B 1USSA 2QM3A 3DL3A 3RYKA 2VT3A 1GQGA 2XAJA 3QAHA 2Q2EA 1LJ9A 3G73A 2GH2A 5FLJA 4EVIA 1FOKA 3CO2A 5E1RA 1SFEA 1I27A 3IC7A 3KFWX 2ETHA 3F21A 2QQAA 2LSOA 2QQ9A 2Y0MA 2EV0A 1T98A 1R00A 1X8MA 4GYIA 4HA8A 5ICFA 1S8NA 3BALA 4IRGA 4EMSA 3FF5A 1ZAOA 4P9FA 2K86A 2EAAA 3BP8A 2QDRA 1HKSA 1KA8A 5BUVA 2V9VA 3V4GA 3QPHA 5K5RA 1C0WA 4I0BA 2QVOA 3K69A 3SCFA 4TLFA 1FBQA 3EJKA 3I59B 1RI7A 4Z82A 2RKHA 1TNTA 3M1EA 1Z7UA 1ZZ9A 1RNLA 1L3JA 2V1XA 5CLSA 1U12A 2FU4A 3ZMVA 1PP7U 1BJAA 5CVRA 4KWJA 2MH2A 5F1RA 3WGHA 2K9ZA 3LA7A 1NHAA 4ESFA 3WU0A 2CSOA 4ORFA 3IRRA 1K78B 4Q5SF 2DLLA 3I7DA 1Y0UA 2D5HA 3NJZA 5I8YA 1YYVA 3FHIB 1YW9A 4LMYA 3TO9A 1P4AA 3CUQB 4E2GA 1FY7A 1J75A 3RTRA 3C3WA 3HIFA 3M8FA 4BH9A 4IESA 4LUKA 4U88A 3RPUA 4WX9A 3NEUA 1D8KA 3KE2A 3I4PA 2PAMA 4LULA 4HN1A 4HYEA 5KHJA 3CLOA 5BPDA 2MH9A 5HI0A 3MQ0A 5HOOA 1LR5A 3QU3A 4OIOF 2A6HF 2QVSB 4JQFA 2E9QA 2UXNA 4BXUA 3KMHA 4MUVA 1SMTA 5BPIA 1FYMA 2BBYA 2YSRA 3GZ6A 3DPTA 3L7WA 5ICCA 3H50A 4Q4ZF 2GIVA 3NVCA 5JI6A 3KP3A 2HR3A 5FCCA 2HS5A 2Q1ZB 2RC4A 1CGPA 2B9UA 4YYOA 3I53A 1W7PB 2PYTA 3U11A 4LFUA 2XIGA 5FGMA 1H0MA 4WVZA 4WCGA 5DV5A 3CL1A 4ZYEA 5KHHA 3OD0A 1FXZA 2K0GA 3T8TA 1U5TB 2J5PA 4IRHA 3SHRA 3ZPLA 2FE3A 2FRHA 5FDBA 2GA2A 1R1UA 4K2EA 2EFQA 4LJZF 1W5SA 3Q9VA 2OBPA 2XAQA 4XFGA 3BB6A 2Q30A 5E8IA 2LF7A 2XVCA 1DP7P 1H1MA 1P6RA 5EZWA 3WTTC 1RIOH 2M45A 3J81K 1KQ0A 3MAJA 1NYWA 5BY5A 3DEUA 1OKRA 1IPKA 2ZXJA 5DUKA 2B8MA 2CAVA 2FOKA 4TV7A 4BQAA 2ZFWA 3FJSA 5JSPA 5CVUA 1CAUA 4KWKA 2QUFA 4UVAA 4J1XA 2AXLA 5JFRA 2NNYA 3FE5A 2ESNA 3USSA 2JPBA 3KCCA 5CADA 2ZCWA 1ZARA 4G94A 1LNWA 4I01A 3BJOA 3C1DA 3NL1A 1MZBA 4L11A 3LSTA 3QOPA 2ZO4A 1NE6A 2IPQX 1H9TA 1J1LA 4MNUA 5J48A 2BNMA 4HBNA 3O6BB 3U0ZA 4IHTA 3OV8A 2Q4SA 2P8TA 1RTVA 5JSOA 2M30A 3IBMA 3REOA 2IXHA 4Q29A 5H20A 4G8XA 2TDXA 4M9SA 1HW2A 1IRFA 5I91A 2F5EA 2PQ8A 4K8FA 3F6VA 4P5OA 1MJ9A 5HVQC 4EGZA 3ECOA 3HQXA 3IWFA 1YW7A 1R1TA 2H09A 1Z05A 3TGNA 1F4KA 2ATFA 4YNIA 3P7NA 3C7JA 4PCQA 1HXDA 3GVAA 4ZYDA 5E1XA 3IKTA 3KLNA 3IDCB 2XUBA 3JAMZ 4IEZA 4RB0A 2ISZA 4QGMA 1O5UA 2K02A 2HTSA 2HZTA 1FC3A 3GYHX 2G7HA 2JTVA 5D5WB 2XLFA 3ROUA 2GC1A 3O14A 3DF8A 1MKMA 1SFXA 1XMAA 5CJ9A 3WW2A 1CX4A 3DKWA 5L3FA 2ZMEA 3T5XA 1IAWA 1U8RA 4HDVA 1D3YA 2PMHA 1ZZBA 3DP7A 1YHFA 2GA1A 3PNAA 4IRIA 2UY9A 4KYWA 3PFIA 1IXRC 2VC0A 2COMA 3TKYA 1YLLA 3GZ5A 4N9IA 4O6JA 2EK5A 1CAVA 1QZZA 4HBLA 1S7OA 4RB1A 3ELKA 4O5VA 2Z3YA 2R7FA 1WRJA 3R6SA 3TNPB 4IEPA 4HX7A 3WTWC 2HKOA 5FFZA 5FD6A 3HOTA 4M9ZA 1XMKA 4XFFA 3C3VA 2VE8A 3JW4A 2BV6A 4IJAA 1J3QA 2J5OA 3F8MA 4OIRF 2RV8A 1AOYA 3DQVC 2R7DA 1O3RA 4L0YB 2N7GA 1MDMA 2X0LA 5JCTA 2WWYA 3WW4A 4OU0A 2DFIA 4OLLA 5ERIA 2DI3A 3SFZA 3PVBB 5HLHA 1I6XA 3GFIA 3VFZA 1Z91A 4I98B 1G3SA 3CUQA 3D0SA 2HEOA 2V1DA 3E6CC 4YG2F 1IN4A 1UIKA 3I5UA 4MTEA 3K9TA 3K2ZA 1FSEA 4MEYF 2H27A 2DTRA 4HQMA 2RGVA 3U9GA 3VB2A 4R52A 1O3QA 4Q0QA 2KJCA 3HRTA 5J8FA 3M3IA 4CZZA 1RUOA 1USTA 4HW0A 3U1DA 4IPAA 2WFPA 2E1CA 4U7DA 1SMYF 1EP0A 1UHWA 3ZP5A 3TQNA 3SHFA 1FZPB 3F8BA 4XLPF 1LEBA 3EBRA 3M7GA 1V4RA 4CICA 3EETA 3BWGA 5FLHA 2GZWA 2PI0A 4XFAA 1Q43A 3UKVA 1SFNA 2O8QA 5L3DA 3DV8A 2MLGA 1CAVB 4I09A 3O3KA 4UVBA 3R4KA 4RS8A 1YUDA 2IXCA 1U5TA 3H92A 1ZG5A 1XDUA 2IT0A 3BJAA 3GW2A 5BV6A 1DPRA 1UB9A 4UVCA 5F6FA 2A07F 5K8SA 4LG0A 2EWNA 2R3SA 1LDJA 2P6SA 1B9MA 4G6QA 3UKNA 1YTYA 1K7AA 3L2CA 1D8JA 2B0LA 2Z33A 2EA7A 4UBHA 1KU9A 1SD6A 2HYFA 2L3DA 5ICEA 5I93A 2EVXA 1O7LA 5AONA 2W57A 3HOSA 1ZGAA 1YFWA 4WBBA 4AIJA 3S0MA 1QO0D 5LEJA 5LBQA 3WW3A 3FM3A 4OFGA 1DDNA 2RNJA 1RL3A 4M6XA 1FBSA 1OPCA 2QNKA 1U6GA 3RZZA 2DQRA 1ZZ6A 3LOIA 4LLOA 1HW1A 2W84A 4RAZA 2RVCA 2FBHA 1XCBA 2QYOA 3COAC 4AVPA 1TW2A 1IN8A 5K5QA 3E6BA 1LVAA 4GXOA 3TDZC 4QX5A 4UXAA 1Y3TA 2MBFA 2FXAA 4PIXA 3IIAA 3CLPA 5CVVA 2H6CA 4MEXF 4Q0VA 1OR7A 1NXMA 2STWA 2KIUA 1Z6TA 4LK1F 4HAMA 1R22A 4CYDA 2FSWA 3WE3A 2KRFA 3WTXC 4ENNA 1DUXC 1FWZA 1OYWA 4I2OA 3SCHA 3LFKA 4U0VA 4IEXA 5HDNA 1TW3A 3KP6A 5H6RA 1TQPA 3Q5FA 4CXFA 4YRDA 4E70A 2OAZA 5FB2A 1VR3A 4XSXF 5ED4A 1ZZ8A 3ACLA 5IT3A 4HLTA 4ON0A 1MD0A 3EYIA 5H6QA 2VN2A 4MQ9F 1X82A 3MYXA 2YU3A 2D93A 2ZKLA 3BPXA 1FBUA 3QRFF 3I54A 2ZNYA 4BHBA 3EO6A 4LEJA 5I8TA 3TO7A 4Y17A 1XD7A 2L54A 1HBXG 1XE8A 3ECHA 4YSFA 1KU2A 4KMUX 2IW5A 5IT9Z 5JHUA 4A0ZA 2A3SA 4U0YA 4GO1A 5E18F 4E2QA 2Z5UA 5KHKA 4PGGA 1UD1A 2O03A 2NAZA 1R36A 2DPDA 2LNBA 2DBBA 2E7XA 1LB2A 3HUGA 4UHTA 4FX0A 1U5TC 4M73A 2EFOA 2GAUA 4AQ2A 4X6QB 3TDUC 3I64A 4KL1A 2DU9A 4YIFA 2DO7A 2DW4A 1EYBA 3QACA 3IWZA 1YS6A 2Y75A 3E3VA 1ZRCA 1FLIA 4XF4A 2JSCA 2DPUA 3ABTA 3HSEA 3S7EA 1YLFA 2HKXA 1TBXA 4AVAA 1JXSA 3DXJF 1WA4A 2ET1A 1YFYA 1ZZCA 4PZJA 4IEYA 3NRVA 2VE9A 1LQ1A 2Q0AA 3L00A 1Z1DA 3KP5A 2VC1A 4RGXA 3OGJA 3ABUA 1IN5A 5L3BA 1FX7A 1MGTA 2IJLA 4L2NA 4G7HF 3NSTA 4UV8A 3F8NA 4G7OF 1WGPA 4F8AA 5FO5A 5D6FA 1Q1HA 1QBJA 3CUOA 3CF6E 3FM5A 2HQRA 3E6MA 1XSXA 4M74A 4B09A 4DINB 3IHUA 4IHSA 2IA0A 5ICGA 3I0TA 3P9KA 2L4AA 2VBWA 3CJXA 5K5OA 2KIFA 1WLTA 3CJNA 1FP2A 4L9TA 2EFPA 2O8XA 5AVPA 3P9IA 1J9IA 3LZZA 2HFHA 2JRTA 2IC1A 3PQJA 3FZ3A 5KHGA 2VQAA 1JGSA 4P9GA 3IL2A 4U7BA 1XE7A 4MGRA 2VOOA 2IXLA 2VXZA 4YIIA 1GXPA 3K1PA 1JHHA 5FFXA 3ERED 1E2XA 4LGWA 5FLXZ 1BOAA 4LD5A 1ON1A 1LKNA 5FLXK 2P7CB 1WQ2A 3RPQA 2M87A 4WXDA 3D0JA 2D1HA 3VODA 5I0UA 3W6JB 3IRQA 1T39A 1O7FA 5KVRA 5D8KB 3CEWA 2M8EA 4N0BA 3E6DA 3RKXA 1BI2A 4XFIA 2FQ3A 4KA4A 3I59A 1TNSA 2K27A 2VBZA 1PMIA 5I0RA 3L09A 1KYWA 5KBFA 1L3LA 1FSHA 3HT1A 4AVCA 2PLYA 4YFKF 1O4TA 2F2EA 2G7UA 1S6LA 5J8CA 3WE2A 2ZMEB 1X7NA 4HN0A 4HV5A 4LLNA 3BDDA 4U0WA 4A6EA 4D0PA 3JTGA 5J3UA 2XLGA 2IVMA 3KEQA 4FX4A 3BPVA 4WXCA 3BPZA 4L9JA 1OYYA 3N4MA 3JSOA 4META 4J1WA 4FAHA 2DK8A 1B59A 2CV6A 3V7CA 4B8XA 2KXLA 2BNNA 4FAGA 4ZU5A 1YW8A 3L9FA 5ILUA 1I1SA 1G3YA 3RYPA 2GC2A 5KK1A 3V8JA 1NE4A 2JT1A 2O6GE 1WI9A 5DD8A 1XB4A 1PP8F 1ZG1A 4GYGA 1W4MA 4PIYA 4P55A 1XGNA 3MDPA 3HRSA 3VOEA 2P5VA 3KEOA 2A69F 3V8KA 1W5TA 1FYKA 1HKQA 2DAOA 4XRFA 2A68F 2STTA 4QGNA 4I0AA 1QPMA 4L5JA 1H1IA 5D5VB 1J59A 4BHPA 1XCVA 3GBFA 5LHIA 3RYRA 4HSLA 4XFHA 2FBKA 4XETA 4BIFA 5JVTA 4MTDA 1W7PA 3QPTA 3CO7C 1UCXA 2ZJ2A 4HV6A 1WWXA 3LAJA 3ZMSA 3R61A 4JV4A 1W7PD 4L9VA 3BROA 2UZKA 2KJBA 5I0SA 4FT8A 5DCMB 1ZHFA 4BAYA 4AIKA 5I8SA 4L5IA 4HZFA 1ZLJA 5HDKA 2E7WA 4QGLA 2MA3A 3M9AA 1KU7A 2P7VB 4JK1X 1TLHB 4F7ZA 2L4MA 4X6RB 2H94A 2B5HA 2P6TA 3BU7A 5E1ZB 3ZMTA 1XGSA 3K0LA 2MD5A 4KFCA 4IEWA 4RGRA 1QWRA 3OF1A 3SMHA 4M6YA 1J7KA 2ADUA 4NB5A 3BJ6A 1REPC 5D8LB 3H3UA 2O61A 4UXNA 3QP5A 2LKPA 5HLGA 4ESJA 1QQIA 3HTUA 1RC6A 2PFBA 2ELHA 2OQGA 1G6NA 4CGZA 2OA4A 2WTEA 4LA3A 2YPRA 2GWRA 2D2WA 4EM1A 2HJIA 1ON2A 1OI6A 2QENA 4XF1A 1T38A 1F5TA 1ZZ7A 2XKPA 1FNNA 1H9GA 4ETSA 2FBIA 2FF4A 1A04A 1ZREA 4OIPF 4Y15A 3ZMUA 4EM2A 2O3FA 1TQ5A 3MFKA 1LDDA 4HF2A 4A5MA 2PMUA 3WGIA 4XFBA 5AIPA 3ES4A 4HQEA 4IEUA 1P4WA 3PQKA 1IN7A 2CFXA 3SXYA 3R0JA 2EA4A 1BIAA 1ZG3A 4I7HA 4EGYA 4S04A 3FMQA 1J3PA 3MEXA 4XF0A 2WC2A 2IA2A 1S7AA 4EM0B 4FHTA 1B9NA 1SFUA 1ZVFA 1PM7A 1SD7A 3F8FA 4L9NA 1EY2A 4ENMA 3SZTA 5ILSA 2VODA 1SAXA 3HYIA 2P5LC 3H1YA 1Z9CA 1BN5A 1XN7A 3N97A 3SQNA 3DFGA 4XSZF 5T3NA 4HX4A 4MH0E 2V1UA 3G7DA 4LLLA 4MX3A 3GWZA 5JSRA 2D40A 3SXWA 1KGSA 1O57A 1EH6A 2C0ZA 2ET7A 5LGUA 3CTAA 2VONA 4MQVA 3H7JA 1BI0A 2IXKA 4KT5C 4MZUA 3E5XA 5I0TA 1QXJA 2OPKA
chains in the Genus database with same CATH superfamily
3AMMA 2FDGA 1PZ9A 1R093 5K1YA 2WV0A 5FPXA 2OT7A 5FYIA 3OCPA 2VOWA 2DMNA 2VJ5A 3VBRB 2J1TA 2QQOA 3HR9A 3T8RA 1QVUA 1AXKA 3H3ZA 5LATA 3QU6A 4XL9A 1FNYA 2BXZA 3BZ6A 3KD4A 1PVC2 3CCVI 2K7LA 2RM23 5TRDA 4AAXA 2Z5WA 2A3YA 3LPGA 2DYCA 4RD7A 5H9SA 2XGXA 2IA1A 1GT0C 1CZTA 2R043 2FA5A 3O1TA 2OQ6A 3W5MA 5A1LA 1J2XA 5B5EC 1IXCA 3ISPA 2AENA 2OTLI 5C5UA 2VPVA 1PVC1 2DODA 1QH6A 2FMLA 2VZVA 2WRAA 1FTZA 3K6GA 1PIV1 2EILH 1MIJA 3VBRA 4GJYA 1YX5A 2XL7A 2A71A 4PUSA 4UUVA 1Y43B 3ZYPA 2Z69A 4X0GA 4I30A 5F9TA 2XAGA 1IQDC 4HL0A 1BC8C 2Y8KA 4XEZA 1OKOA 2WABA 3D6EA 1WJCA 3QCWA 1Z6RA 2EFNA 4X8PA 4AWXB 3MW2A 3AMHA 2W1OA 2OPWA 1QKQA 3M7AA 4RB3C 5A7PA 4AGGA 4M72A 4KI5M 3CJQB 6PAXA 3WTUC 3HD8B 1HCRA 1TL8A 2WUHA 1JHFA 5FYZA 2M4GA 5A2QZ 3VYSB 1SFKA 1S5LC 4BXSV 4XORA 4MG2A 1AJOA 1TVGA 1LRHA 1ZN2A 3PUSA 1F1ZA 3DPLC 3GNEA 4A0YA 5F8PA 5FFOC 3KGZA 3JTHA 1JODA 1NH3A 3NKGA 2E32A 2DJNA 3ZQIA 3IPVB 2Z99A 5H9RA 1X8EA 2AEZA 4XDPA 4HNTA 1GWLA 4K40A 2OYZA 1JBCA 1PM4A 2CV1A 1NX9A 2XOMA 3E7LA 2H8RA 4M0NA 3TBIA 4HK9A 1AHDP 4N53C 1U5IA 5A7SA 1TWHJ 2XBO1 3H36A 3ABKH 3NQHA 2H0BA 3GFLA 3VKOA 1H88C 3WOGA 4CEWC 4PJLA 4FO9A 3ZKUA 4N7UA 1JZ6A 2Y0SN 3WNMA 2R7EB 4NHYA 1UJ8A 2I07B 5DAQA 3DXTA 2ZGRA 4CZSA 1HLVA 1U78A 1SDDB 3WU1B 4IEOA 3BU0A 1VBB1 5J1UA 3WLUA 1FIAA 3MCZA 1RUNA 5IATA 3BOQA 5EFUA 1DQ6A 2PHDA 1JE8A 2CW0F 5IK4A 3RIRA 5A70A 4XF9A 1V70A 1ZELA 5LRRA 5FZOA 3PLQA 2VAUA 2ACJA 3HNYM 3S14J 1S9HA 4EROA 4W1UA 2Y6HA 4HOBA 4OINF 2UYAA 3AKTA 2HWVA 4DGWB 1V6LA 4DO0A 3NNFA 2N8GA 3S1RJ 4UV9A 3D82A 4IKFA 5JOYA 3BZCA 2HI3A 4JGYA 3PTRB 1OUXA 4YVSA 1JOPA 1R5GA 3BCBA 3IB3A 3VYUB 4LBQB 4ANJA 2YC0A 1BBYA 4BJ0A 1QF3A 3NMBA 1RGSA 1CAXB 3URFA 1P92A 2DT7B 1ZTRA 4OULA 3VZJA 2UWMA 4BQQA 4FFHA 4YRVA 3N9QA 1UFMA 4G7ZF 4LO7A 1RMU1 3DCQA 5E8GA 2VT2A 4Z92B 3L2HA 4CRQA 2D45A 5FMDA 2R071 4CCCA 3R60A 1VBE2 2OZUA 3CQZJ 4DFSA 2CDOA 5HCHA 2XB0X 1K61A 5EQUA 5KXDA 3S3OA 4OMCA 1RUG3 2VKEA 1EKEA 5M0TA 1D5VA 1WJAA 1RUH3 5FUIA 1JKRC 4QQPA 3N3HA 4CHUA 3FBIB 4A6SA 1NLRA 3B02A 1UOFA 2YHJA 1YIOA 1O5LA 1XU1A 2QQVA 5J1XA 3INAA 4JOMA 1S0IA 1CVNA 5BMZA 1XS9A 2HGCA 1HN0A 3NV3A 1IDZA 4BQXA 2W5FA 3HGYA 4XC9A 5F3GA 5FXVA 2E71A 2FBEA 5JPMB 1IPJA 2W7NA 4QMAA 3CP2A 3KZYA 1I39A 4A7KA 4RGKA 5FOBB 3FHZA 3GJBA 3MPBA 4JQRA 5FTTC 3TEWA 3TYJA 5BNQA 1HB4A 1FOYA 5EJ3A 2XJQA 3WW1A 3KZZA 1G3WA 2EZIA 4ZY9A 3M4FA 4RR3A 4CDQC 3H5RA 4E7KA 2PBIA 1Z0HA 2VQLA 2YBPA 4QPIA 1XNKA 1H2NA 5HPOA 4EJUA 4QDSA 1GV2A 1WZXA 3M3OA 3CJIB 2LW8A 4UY8I 1PK6A 1LHVA 3F22A 1NCQC 3HNBM 5JWPA 4BBSJ 1IW7F 1OT5A 2VECA 4N9HA 4Q5OA 1UAAA 1Q5OA 3W58A 1ZYBA 5B3SH 2YX7A 2VKDA 2JDNA 3KHBA 4Q0PA 4E7JA 1OVPA 4WF2A 2B7YA 3H3VK 1JKPC 2Y30A 1US2A 1S2EA 3OR1C 2MSYA 1DLLA 1WPKA 2XKOA 2P4WA 1WLCA 2RV9A 4I0WB 2DCTA 1V6OA 2DA1A 1W6MB 2X9DA 4S05A 2CDPA 3KT1A 2MYSA 5L9BA 3OOPA 1S0FA 2VXDA 1X4PA 2EA2A 1YHQI 1YQAA 5FY5A 5CVIA 4MGYE 3PHMA 4Q4X3 1IUYA 5BNNB 4PJYA 3PSIA 2DDBA 3RJRA 2KIMA 3F8CA 1RKTA 1TQMA 4E2SA 1MJBA 3O0VA 4AXOA 4F3JA 2XASA 3HRMA 3PL0A 3VZKA 5KXEA 1U3EM 1BL0A 1IG3A 4MGKE 2LDUA 3VDXA 1ERDA 2UXXA 5KWRA 2Y31A 4RAYA 1ETWA 1SD5A 5FD5A 2WZR3 5JPNB 2W87A 4AEDA 1R4NB 2VULA 4LBNA 5DG2A 5JXHA 4JTNA 5DAXA 1BBT3 3VZLA 4URTA 1U2WA 3ZRGA 5BNNA 4XJ9A 2VH9A 3HQUA 2JDYA 5EP9A 3M3YJ 1VRH3 3R4UA 1W8FA 2AO9A 1MS8A 3WZ1A 2K3PA 3HT2A 2V4JC 3GLXA 3HHHA 4OIQF 2E51A 1HXS3 4P5HA 2DCYA 1JI8A 3OPZA 3TOBA 1AVBA 4JKMA 1MS9A 3H8XA 1D0ZA 4MHGA 1AX1A 5FPLA 1SPPB 1EV12 1T2KA 2VQGA 4CP9A 1CF7B 3O2PE 4HVRA 1K79A 3OS0A 1JJ8C 5HODA 4J6GA 3V0BA 1JKQC 4LK0F 3EB7A 1XRUA 4ZC3A 2P17A 1QXPA 4KMFA 2DDUA 4KITB 2XRNA 4XOPA 4UAPA 1G2HA 2DURA 1OCOH 5D5UB 3GGLA 2XAHA 5FMCA 5IWFA 5FPZA 2LBFB 3VN4A 3J80K 1AL0G 3R05A 3CMEI 4YFWA 3ILFA 2A5YB 1V6NA 4DQ2A 2XJUA 1OR7C 3HHGA 4C8DA 2K9LA 5J6XA 1NXD1 5A7WA 2XG3A 3ZR6A 3VBOA 1QGPA 4DZGA 3DCFA 3KP7A 3HTSB 2VMDA 3IH4A 4KDPA 4LLFA 5FO8B 3FISA 4LITA 1GNHA 3IAQA 5DDGA 2QQWA 1BMV2 4LK7A 2VLAA 1VBA1 3E1F1 4QDRA 2BEOA 2CMPA 2XL9A 3BTXA 1COV2 3FXRA 4IHXA 4Q8LA 4HLXA 2WQ8A 1GNYA 1GZWB 1ZRRA 1OQEA 1MS5A 2NYXA 1ZBE2 1J58A 3D5LA 5EPAA 4BXXJ 3K4BA 1YI7A 1QJY3 1OH4A 1AYN2 3ES1A 2K46A 4AQ6A 1CAWA 1D7PM 4CP2A 2IVJA 2W48A 2EH3A 1YQ6A 4P9IA 2NP0A 2VTXA 3ZXFA 3JCUC 3E5UA 4RDUA 4LTAA 4WWCA 1VBC1 4ITCA 3QYFA 1XGOA 1ZYRF 3RDIA 1KJLA 1WKMA 2C9AA 4QM9A 4A93J 4YW1A 4HX8A 5JR2A 5AIQA 2NS0A 2H6BA 2KKOA 3B6AA 4UW5A 1LDKB 2CYYA 2B9SA 2ZMLA 1CAWB 3BUCA 2OU2A 2R062 4QLCU 2WR9A 2X6YA 1IUFA 3UJQA 1V54H 2XPJA 2D6NA 3RKQA 2JWTA 3RQ4A 2RAEA 5HS7A 2YU9J 2W52A 2MW8A 1QXRA 1GVJA 1A78A 2BVVA 4W97A 1MNEA 5IVCA 3RYKA 2VT3A 1LOEA 1POV0 4EVIA 1PX4A 4NWWA 3LKJA 5EWSA 3ATGA 1HDKA 1X19A 4Y3OA 1PIV2 2EV0A 4ZZ8A 3I4IA 1T98A 4GYIA 3WR0A 5ICFA 4YZ3A 1BEV1 4P9FA 4IXLA 5A1FA 2P34A 4HFSA 3OSFA 2V9VA 3QPHA 3NAPB 4I0BA 1UL9A 3SCFA 1U5ZA 4TLFA 1FBQA 2F4IA 3EJKA 3K4NA 1RI7A 2KP6A 2RKHA 4Y5SA 2J1UA 1L3JA 1CZSA 2FU4A 3OYKA 3AP6A 2ZGMA 1PP7U 2QQNA 2MH2A 1QHGA 3RQ0A 1LOFC 1BK1A 3PNTA 3AMPA 3IRRA 3FLRA 3OPWA 1YQ5A 1HRI2 1Z7LA 1GUIA 3LSHA 4Q5SF 1F4AA 2VOVA 1W6PB 5I8YA 1YYVA 1YW9A 1P4AA 3CUQB 4MO3M 1PGL1 1J75A 4BH9A 3RPUA 3VBUA 4LR4A 2HWC2 1NCRA 4ZS2A 4HK8A 1ETQA 1U5XA 4XICA 5EGOA 3KYDB 4B48A 3GZNB 1AR61 1CQTA 2W1WA 1KXGA 4GB33 4EATA 3MQ0A 1RUI3 2HLEA 4LNVA 3KV4A 4F52A 4BXUA 2BBYA 3MKYB 4AOCA 1W04A 2WIIB 5B1BH 4S0HB 4HKWA 4UUSB 3QH6A 2GIVA 2VBDA 5FCCA 2HS5A 2CUJA 3ZXLA 2Q1ZB 3FBYA 4HT1T 2WFF2 4YYOA 3X2QH 3I53A 3BPSA 2VOXA 2EALA 2PYTA 1MW7A 4OI2A 5C3EJ 4RAFA 2QKLB 2JD4A 4LJHA 4ZYEA 1QGLA 3ZIXA 3TW7A 2PHUA 1WCDJ 1BR1A 1U5TB 3ZPLA 4QB1A 2FE3A 4FFGA 4PI0A 2PMZA 2GA2A 4YG3A 2BVBA 4C2UA 2EFQA 3MV11 3SISA 2XAQA 5FMOS 2Q30A 4N53A 2XVCA 4NIGA 4UUSA 2E7TA 1XNTA 3G2BA 1UZ0A 3RWNA 1BOBA 3WTTC 1DGLA 1TWGJ 4RHV2 3MGUA 1E3HA 1BJQA 1CPNA 1CAUA 4KWKA 5FYUA 3UETA 4J1XA 5GZCA 1D5YA 4K20A 3JRHA 3JU9A 4A69C 3DPUA 5FBZA 2CTVA 2R5YA 4XJWA 1V0AA 5FPAA 2ZHMA 4G94A 4F55A 1NOVA 4Q4X2 4PF5A 5FMOL 2DWRA 1MBKA 3C8XA 1BK0A 4N53B 5FKMA 3ZQGA 1H9TA 4MNUA 1ASJ3 2WBMA 1OVSA 1W6MA 3U0ZA 2D3RA 3RMXA 4IHTA 3AFGA 4CPBA 3W20A 2P8TA 2G19A 4GIQA 1RTVA 3I9V2 5JI7A 5H20A 2TDXA 2F4OB 2IFRA 1HW2A 5I91A 1H6XA 3OIOA 1RMU2 2F5EA 2D6PA 5FP9A 4XUNA 4FCAA 3WHTA 3LSJA 1D4VB 5HVQC 1B35B 3LEGA 3CJTB 3DUIA 1MS3A 3WP6A 1Z05A 1S0JA 2ZXQA 1JTXA 2Y6KA 4AI1A 4PCQA 3P5BA 3GZAA 3RVHA 3BQYA 3KLNA 2XUBA 4IEZA 2ZHLA 2ISZA 3QWLA 3OGVA 1AR83 2ZGNA 4CU8A 2HZTA 1FC3A 3A23A 2B9VA 1Z67A 5D5WB 2CU5A 1UYZA 3ROUA 2VZRA 3O14A 1H6YA 1D3YA 1U9OA 2LMDA 2GA1A 2I2SA 4KYWA 4QAWA 3JB4C 3GZ5A 1MZEA 2V73A 3ELKA 2TUNA 1WRJA 3UL2A 4IEPA 4LHLA 2DYSH 3AXDA 2RS31 3CZUA 4P08A 2C26A 2LROA 4HXCA 3C3VA 3JW4A 3RCOA 5F5QA 4IV1B 3UNPA 3OOUA 1MDMA 2X0LA 2WWYA 3OR2C 3DKXA 5FYYA 4IHVA 2O8KA 1KQRA 2P6HA 1SVMA 4IL6C 4M01A 1B35C 3PVBB 4YM2A 4D5CA 4GMP3 3ENRA 4CH7A 3GFIA 5CZKA 5I0DA 1IC8A 5JOXA 2P3JA 2HWD2 1J84A 1Z7S2 3E6CC 4YG2F 1ULPA 1IN4A 4AWDA 3QYEA 1W9FA 1AX0A 1RUF2 3K2ZA 4MEYF 2FDIA 1W05A 1U9NA 1UF2C 3ZYRA 2HPIA 2L9LA 3ZXJA 5M3MJ 1RUE3 3GMEA 3AP9A 3M3IA 3JRAA 2IEKA 2WLPA 4XKBA 3M2MA 3ZPYA 4CCEA 2VZTA 2WNUB 2X5IA 1EP0A 1UHWA 1YE9A 3GTQJ 2NVUB 4Z2WA 2SLIA 3V64A 4BUPA 4KBBA 1LEBA 3HOBA 3EETA 1VQLI 4ARYA 4WM7C 3BWGA 2JDUA 4KGGA 4HNUA 3R0RA 3PM1A 2MLGA 3GZTB 4AK3A 3DTIA 4I09A 3O3KA 3JRFA 1B72A 3K75B 3WQ0A 5EV7A 1ZG5A 1HF0A 3A03A 2W95A 2DFCA 3THTA 3GW2A 5BV6A 5F6FA 1UKRA 5GADJ 1Y1WJ 4LG0A 1QA6A 1E5SA 3MW4A 3KLSA 2RVAA 1LDJA 2W1SA 1AXYA 3CESA 2LD5A 1IPSA 5F3CA 3KB5A 5C8CA 3N9NA 5DDJ2 3UKNA 3FDYA 3A01A 5C8CC 2R7QA 2XAUA 5GAEJ 3AJYA 2B0LA 4JZRA 1OPMA 1F4HA 4FPHA 3FC0A 5ICEA 3L9JT 2EVXA 5J4VA 4XAAA 4SLIA 2DU0A 3HOSA 4AIJA 5LEJA 2CS3A 2HWE1 1Y0NA 3H9JA 4U36A 3GCXA 1UKGA 4RN5A 3CMAI 4OFGA 2RNJA 3U1KA 2X10A 4Q4V2 1QDOA 2HPMA 2A5ZA 2KIQA 2QNKA 4KGQA 4YWAA 2BQPA 1ZZ6A 4BZ4A 3ABZA 2FDKA 1RR8C 3LOIA 1HW1A 3I3QA 1LTEA 3JR9A 2AQFA 4AVPA 1TW2A 4AI9A 5M3FJ 1LVAA 4GXOA 3TDZC 1SG3A 1RUJ2 1RYYA 2FXAA 3HBZA 2K9NA 5C7GA 1NXMA 1N78A 4HAMA 1PHMA 5FYMA 3TAYA 1OYWA 2WNOA 3SCHA 5HDNA 1TW3A 3KVAA 2ZEWA 4HLTA 1MBGA 1VR3A 2QE3A 2R32A 3EYIA 5K7PA 2OKXA 4BQYA 2TEPA 4MQ9F 2EZKA 3MYXA 2V6EA 3EXUA 2D93A 2ZKLA 3W3CA 1FBUA 3O7OA 3VHNA 2ZNYA 3ACFA 3EO6A 3PU3A 4Q27A 3K2AA 5ISLA 3GTKJ 3VD7A 5A6YA 1A6CA 4Y17A 1XD7A 3KX2A 2W00A 2QSFX 3MKWB 2GM4A 4M3FA 2IS1A 3A22A 2D97A 4U0YA 3G71I 1WZ2A 1ZRIA 4IDZA 3VYRB 2NAZA 2R7RA 4BB3A 5DAWA 2E7QA 5FZOB 4J00A 4E7HA 3HUGA 2DCJA 4FX0A 2VZSA 4DY3A 4NR1A 4AQ2A 1QJX3 4X6QB 3AKRA 1S4CA 1D1BA 2DU9A 2DW4A 1RHI3 4MIMA 3PO3J 5F5CA 1XNCA 3MF6A 1U5YA 3UYJA 3HOUJ 1W8TA 2R4GA 3IAM2 1HX6A 3TBDA 1ENSA 3S7EA 1WGXA 2DA7A 1TBXA 4DBQA 1JXSA 2AEYA 2AR6A 1VBB2 3AYEA 2CV0A 2JDKA 2R0QC 3R4SA 3LCPA 1ZZCA 2VE9A 4AVVA 3O1SA 2KDZA 3V65A 4AVTA 3C7FA 1IN5A 1ULCA 1H89C 1RUC2 1A8MA 4G7HF 2ADEA 3NSTA 2YYOA 4G7OF 4M3CE 4F8AA 3OY9A 1Q1HA 1QBJA 4LXLA 3AG3H 3CUOA 2GSYA 5JZGA 4BEHB 2J1AA 5ICGA 3I0TA 4C3IJ 3POSA 3OYFA 2L4AA 2DVDA 2WSUA 1ONAA 1QZEA 4L9TA 4QPWA 5AVPA 3U75A 3P9IA 4WVMB 1MMSA 5BNOC 1J9IA 1BXHA 1EPWA 3BYWA 1EAH1 3PQJA 1QQP1 3HAGA 3FZ3A 5BNGA 4P9GA 1WW7A 5L7OA 4U7BA 1FOD1 2BV4A 2VOOA 1MBEA 2VXZA 1VE0A 1VQ6I 1AZDA 5FFXA 3VDBA 3HWJA 4Y1YA 3POEA 2OF7A 1Q8OA 4BS9A 3OGRA 2D44A 4BA6A 2VE1A 4E4DX 3B94A 4WXDA 3D0JA 5EEAA 4Y52J 2KRCA 5FZEA 1ZR2A 2A6VA 3IRQA 1T39A 3PFYA 4EZHA 1VI0A 2NM1A 2VJ4A 5BNNC 2ZGTA 1GR3A 1OF3A 1UOGA 2K27A 5F2WA 1PMIA 3L09A 1OUSA 1WMFA 4PCRA 3VDDB 4IE4A 2O0OA 3HT1A 1QJX2 2DUQA 2PLYA 2XF7A 1O4TA 1D0GA 1S6LA 5J8CA 1DCSA 1Y9GA 4BM8A 1U0AA 1AR93 3BDDA 3WHUA 4D0PA 1N47A 3JTGA 4FX4A 4WXCA 1Z7S1 4L9JA 2XWJB 3N4MA 4J1WA 2VY0A 1SFPA 4QXCA 5ERLA 4AF9A 3V7CA 1N1YA 1H0BA 2PJRA 4ZU5A 4M3EA 3S93A 1I1SA 5G04L 2JB8A 1UZWA 3PURA 1LOAA 2VTXJ 4AFAA 5A33A 4QPGB 2O6GE 4FTBA 2VXJA 2DN0A 1IS3A 4AZZA 2XR4A 3OYMA 3T08A 3HRSA 3VOEA 2A69F 3V8KA 4MADA 1FYKA 5IK5A 1BA5A 1VQPI 3BTZA 4RBOA 5LY2A 1QPMA 4DXZA 4L5JA 4NC6A 1XCVA 3GBFA 4AFBA 4HSLA 2FBKA 3H9GA 3HN1A 3WHBA 5JVTA 4E4HA 1W7PA 2ZB9A 3OYBA 4XHXA 3LEKA 4IGPA 3PVOA 1NQDA 2OUHA 5DZGA 3BTJA 3ZSMA 1W7PD 2UZKA 1W8HA 1ZM1A 5C3SA 2AQEA 5FKOA 4L5IA 1JOJA 2RS11 4QGLA 2VKVA 2RNGA 2MA3A 2DOAA 3KF5A 1FJLA 3CCEI 4C2TA 3NWSA 4D7NA 1RUD1 1H9PA 2H94A 1LAJA 2A6XA 2ZBJA 5E1ZB 3ZMTA 1XGSA 4N8MA 4XIKA 1K5MA 3P3PA 2D6LX 4DQAA 5GTHC 1TZOA 4M6YA 4RSUA 4ITVA 2VCCA 1ND2A 2FD5A 2BY2A 4YW2A 2O61A 4UXNA 3M8LA 2TBVA 2QKDA 1RC6A 4GWIA 1G6NA 1POV1 2JE7A 2JDMA 3NJVA 4ASMB 1HQNA 3UV9A 1MEC2 4XZPA 1N1TA 4UFMA 2EAKA 2YPRA 2GWRA 1F5JA 1Q8VA 2D98A 4EM1A 4P14A 3J7LA 2HJIA 3LIHA 1F5TA 2KQRA 2XKPA 1L7LA 5LK7B 1H9GA 2LBFA 2FBIA 1ZBA1 4OIPF 5JVVA 4YW4A 2CQ7A 3KZ4C 4NWVA 3ZMUA 3MFKA 4A5MA 4DUWA 2GN3A 2YZ4A 4PFOA 4IE0A 1SVLA 3PQKA 3CU7A 3Q0VA 1IN7A 1X3ZB 2EBIA 1MH4A 3SXYA 2RDRA 2VMGA 3R0JA 5GAGJ 1X9PA 1ZG3A 4QQLA 2X1DA 1IS4A 3VDDC 5JXIA 2DFEA 2D6KA 5IUQA 4M6VA 4FPFA 1VQ9I 4FHTA 5EZHA 5TGTA 1SFUA 4QQ2A 5C8CB 4CXYA 2VVEA 1TEIA 5LFAA 2HBUA 2NPIA 5LBFA 3HYIA 1VF9A 4P00B 2RMU1 2C4XA 1WJEA 5T3NA 5LBBA 4RQPC 4S2FA 2CUZA 5FKNA 2HBTA 5IYDJ 1IGNA 4YM1A 1HB2A 1O57A 3B6CA 2E53A 1HRV3 2ET7A 5EJZB 3BVCA 1WJDA 1REDA 1TMF3 4Y5TA 2M4KA 3POIA 4XBLA 2IXKA 1HDDC 2K9SA 2WO1A 5CU1A 3S5QA 4W6YA 3O1PA 4MYEA 4XF3A 3S3NA 2F5DA 3MWMA 1P8JA 4P9UA 3T0BA 3ZMNA 3RFRA 3ILRA 2QQJA 5SV5A 3ZDSA 4EWEA 2CL2A 3LSKA 2NNNA 5CFCB 1NCQB 2ZAHA 2K5CA 3G4SI 1XOYA 2AC1A 2X85A 3CJIC 3USUB 5DPNA 4TLGA 1OQYA 4FTSA 5JIAA 2VZPA 1ULEA 5FK8A 3OYCA 3W6VA 2MC4A 4LHKA 5FZIA 4QQHA 4FVVA 4NHJA 5B66C 1QOTA 4FCYA 2L2OA 5LRSA 2V09A 1W0PA 3ACGA 3DU6A 4WVWA 4MOAA 4CEWA 3LDBA 3MBWA 3WVJA 3TWIA 3SKVA 5KC5A 3QP6A 4ZTFA 2LS6A 4LORA 2R5ZB 1YI9A 1MZ5A 3M70A 3DLLF 1AF9A 1VB4A 4FBFA 4B43A 1W1WE 3K4LA 2ZX2A 2RDSA 2ZMEC 3C2GA 3MD2A 4BK5A 1AYM2 4XLNF 4C91A 2M5WA 3SDGA 3OTFA 2A5WA 4NRQA 4R4ZA 4L99A 2QQUA 2DA5A 4NHLA 1WH5A 1SEFA 4GFBA 4COUA 2HWB3 3NAPC 4LIVA 3CBNA 5SV8A 4F3QA 4ET7A 3BZKA 4GWMA 2WYFA 3CDIA 2W9XA 2AHQA 2DVFA 1G4DA 3L2RA 2XJSA 4IQJA 5JZGB 2ELKA 2IGNA 3VD4A 4CO8A 1F9NA 2X51A 3RNSA 3THCA 2XLAA 4LA2A 1QNWA 5FZ3A 3LWFA 2ZABA 4KIBA 3A4CA 1VJ2A 1BVP1 1TG7A 1CAXA 4P9JA 1T6GC 3RZOJ 1W06A 4V2GA 4M3CF 3WF1A 2E6VA 3OBTA 3ZFGB 3OEBA 3H0GJ 3BOWA 5L7OB 1Y8QB 1POQA 4MV2A 2LYCA 1ZLKA 4O7XA 4IL7A 4GZ9A 2XPUA 4D3WA 4FQ4A 1YWKA 2K9QA 1T2XA 3BR6A 5FXWA 1OLMA 5C8WA 5D1IA 2QZ8A 2F4PA 2WB1N 5K7HA 1F5FA 4D6QA 1V5GA 5A3WA 1JMUB 3VEPA 2ID6A 1OA4A 1D2SA 5LHGA 2XUMA 2WYSA 1BI3A 4E7ZA 1DZTA 2KLOA 1BIBA 1RUC1 2PG4A 2HNHA 3KGLA 3M3EA 3PUIA 1HW5A 2FQPA 3HSRA 2FCTA 4DUVA 1Y7BA 2D1VA 3KF3A 1IG0A 1YRNB 1Z0XA 2DBIA 4GKYA 5B4NA 4EJVA 3LDKA 1VBD1 1STMA 4KIGA 2GC0A 4IEQA 4MGQA 1GXQA 5A1AA 1Y56A 5FK7A 4XCAA 5JMOA 3QODA 2VW1A 4QKBA 4BY1J 5A3LA 2DTWA 3J26N 2E60A 1P7IA 2W1UA 2PJRB 4I3PA 5CBLA 1K4SA 3ULQB 2JVHA 4ZXKA 1DFQA 1JU3A 2CYFA 2F5FA 1GANA 2DYRH 4QPIC 2IXIA 3T0YA 2IRFG 2WNUC 3H0OA 2FCVA 2QQIA 2RG4A 1JYIA 5IVEA 3ZFGC 1Q3EA 2WS91 1O4XA 1PGL2 3IUOA 1FPN3 3JRCA 1A6IA 2G4IA 2WAQN 1COV3 2W2IA 1VBD2 2ZC2A 2GBYA 2XSJC 1LOCA 4IGQA 3FBNB 2WN3A 3K3NA 1ZX5A 2M3AA 1JZ8A 1XX5A 2VM9A 4JP0A 2RR13 2VO5A 1ONVA 3CUQC 4A3EJ 3DYMA 1FI2A 1OLTA 1X3UA 4AYUA 4GJZA 4WM7B 4WM8A 2XF5A 4PSWA 2FOWA 1FV3A 3MI8A 1JYWA 2P81A 1FP1D 4IV1C 3WG4A 1D2QA 4M3CB 1AJKA 3ILNA 1ZGJA 2FNAA 4Y13A 1D1AA 3MICA 5FZDA 4ZPIA 3OYHA 5F1JA 1PGSA 4FE7A 4CUGA 4EWAA 1R092 5HS9A 5A3NA 2X6XA 4NOTA 3LSEA 1NA1C 4KU8A 2W1QA 4XM3A 3LAPA 1YFHA 4A3BJ 3EHKA 4Z8BA 3N9PA 3ZIWA 3O1OA 3RKWA 1VRH1 4P9LA 2AS5F 1JN2P 2XVLA 5C3QA 3O12A 3P1IA 1KD7A 5IT9K 1QOOA 1OYIA 1JT6A 3NARA 1UPIA 2RDPA 4YW6A 3ALQA 2RM21 4JGYC 5C70A 3RG0A 4OMYA 2CV2A 3ELNA 3CMMA 4BY7J 2H1KA 4RFT0 1LHWA 2EIKH 3HJRA 2PJPA 4CU9A 4QWQA 2VMCA 2IBDA 2ESHA 3U37A 2ISYA 1V6IA 2FMYA 4MXWA 4EWDA 4G9YA 3QBQA 4GD4A 2B45X 4AC0A 4LBLA 2Z9OA 4BDZA 5HLIA 3CCQI 1E17A 2GXBA 1C1LA 2QWWA 2ZBKA 4KNYA 3LDRA 2PAEA 1FPQA 1XDSA 2W24A 2NRAC 3RZLA 4AU7A 2NOGA 3WF0A 3BCWA 5FY8A 2QQLA 4Q0UA 2JZYA 3I58A 1OD3A 1QJFA 4CDGA 4GH4A 4Y1UA 2ZPXA 4G9SB 5F39A 3HG9A 2CAUA 3OD4A 3VUOA 2PHLA 2X29A 3KWVA 1BYHA 4XRSG 5CG8A 3B73A 3FBMA 3FL7A 2AGSA 1ODNA 4QDQA 4L0PA 1YS7A 3J8F1 4AEMA 2HOAA 2R93J 1DGWA 4JTOA 1V9U1 3WV6A 3O8HA 4DMIA 2Q8CA 2A61A 5JVGF 1MS4A 2RN7A 1Y8RB 3WG7H 2DCKA 4A41A 4QPQA 4XLHA 2P5KA 4B29A 4ENJA 1I3HA 4QXKA 3FXJA 2Y0SA 4NE9A 3ZXAC 4II3A 5FP4A 2C6YA 3AG1H 3MZ8A 3WHCA 3VBOC 4EN6B 3VBHB 1DP3A 3OOXA 3C2UA 5IVYA 3BGAA 1R091 1IS5A 4NQWB 1WLWA 2IXJA 4QPGC 3WDXA 1K78A 4PQ9A 2BXYA 2GC3A 1ALYA 1JOBA 1OFCX 5GAHJ 1S3JA 5FY0A 1YEWA 3KQ4B 1XYPA 3FMGA 3W6KB 5F64A 2V9PA 1C5HA 4CXXA 3APBA 2MHFA 4B4QA 1NZCA 2YB7A 2HOEA 1X1BA 5LASA 1W2TA 4DXRA 2V6CA 1G9AA 3WCRA 1K3IA 3Q9SA 3ZQHA 4JCKA 2VQUA 5J09A 2QZ2A 4HMZA 3W2VA 4R8HA 2VVFA 1PZ7A 4XDOA 2WWSA 4BYYA 4F93B 4XKVA 3L2UA 4COZA 2VU9A 3IT8A 3BKZA 2HYGD 3F6OA 2XSDC 3JBG1 4MGSA 4NBQA 1I5ZA 2VCMA 1WI3A 4XAEA 4YFNF 3MUY1 2PN6A 2JA8J 5BNPA 2PLV1 3D5RC 3O5SA 3V7SA 2VBYA 5T5PA 3V7RA 5LGTA 1MPXA 1TTYA 1Z77A 1LEAA 1W8ZA 3VL9A 1DF0A 5GLVA 4A3FJ 2R1DA 1V00A 1GMMA 4E9KA 2L02A 2VW0A 1S7EA 4GGGA 1N1VA 4AM3A 2EZHA 3QPLA 3NAPA 1OCTC 2BUKA 1VALA 1FT9A 1ZR4A 2PA7A 4OMDA 3OYAA 4XABA 3MIGA 2EICA 2R92J 3UJOA 4ONUA 3EYPA 2KMUA 1TWFJ 3HRUA 3G6JB 1F9KA 3QPSA 5LEKA 3ON7A 4IVNA 5EEHA 1KDKA 5F32A 3WG9A 2HDCA 2IS2A 1QNYA 2VG9A 1MEC3 1MH3A 1AR63 4RM2A 3BT9A 4XN3A 5L3GA 1LECA 1IHMA 3GCWA 2VMHA 2PTMA 4Q4Y1 4ZYGA 4KU7A 1K6OA 3Q8AA 2P6CA 4XBNA 5CA6A 3I71A 4BQ3A 3FZVA 2XMLA 2OC6A 4AD9A 1BC7C 2EXJA 1PNFA 1W0OA 1OCPA 3AZYA 1GQGA 5BYNA 2XAJA 5AVAA 2Q2EA 1FOKA 1I27A 3VKLA 2EIEA 3IC7A 3LGRA 2D3PA 3KFWX 1DQ1A 3F21A 4M00A 3LMMA 1QJU3 2WA0A 2QQ9A 4XOGA 1JU4A 3KT4A 2Q8DA 1A31A 1R083 3S57A 3M8JA 3GTMJ 1X8MA 2MABA 4XKWA 4HA8A 2HWD3 1PMJX 1QH7A 3CJIA 5GPCA 2UWBA 2GMMA 3CQOA 2CNAA 3BP8A 1HKSA 1AHSA 2F4MB 5BUVA 3V4GA 5K5RA 2E35A 2QVOA 1HRI1 4CDXA 3PU8A 5C9AA 2BRTA 1XC6A 3GTLJ 4DIQA 2KDOA 3SKJE 1TNTA 3M1EA 2BVMA 1RNLA 1SC7A 1AXZA 1PO23 2V1XA 2EXKA 1GOHA 5CLSA 1S0GA 3MLJA 2VUDA 1ETXA 4J01A 1BJAA 5CVRA 3WXPA 2W94A 2VZ1A 3WGHA 2HEWF 3A7QA 2YBSA 4H14A 1YI2I 2W3JA 1O6UA 4ORFA 3K51A 5FZCA 2DLLA 2Q1MA 3I7DA 3E1SA 2FD8A 4LMYA 3UT0A 3TO9A 1O8PA 4PBPA 1K5JA 3AL0B 4XQ4A 3RTRA 3M8FA 4IESA 4LUKA 3AB0A 1LHNA 1YO8A 3WP4A 2WFF1 4XMIA 3KE2A 2PAMA 4HN1A 1YQCA 2LKXA 3SC7X 4HYEA 4WM7A 3CLOA 2A6TA 5DS9A 2MH9A 2RS52 4CUBA 3Q8FA 5K9YA 3PUFA 1LR5A 3N7JA 4BISA 2A6HF 3LIGA 3ZYIB 1W36C 3KMHA 1MVEA 1LOGA 2YSRA 4FXKB 1VRH2 3H50A 2ZGLA 3MW3A 3SFIA 5IK7A 5JI6A 5J96B 4AHYA 1CONA 1CX1A 2B9UA 2WADA 1OPOA 1W7PB 5FGMA 5A7QA 1AKHB 3RZMA 2KZGA 1AA7A 5IPAA 3WDWA 3ABLH 2F5VA 4G3YC 4DYRA 2FRHA 5B1AH 4FP2A 5FDBA 4F92B 1RXFA 4YEJA 4LJZF 3CCMI 1SPPA 4XXAA 1W5SA 3Q9VA 4CP9B 3QQAA 1DHKB 3BB6A 5E8IA 2LF7A 2ZJQF 4DXSA 2WL1A 1N77A 3WQ1A 4S2DA 2ZXHA 5EZWA 4A3DJ 4L9BA 2Y26A 5ANNA 1NYWA 4NC8A 2RS33 3DEUA 3LE0A 1OKRA 1IPKA 3U78A 4JC1A 2ZXJA 5DUKA 2CAVA 2FOKA 3VD5A 4TV7A 2ZFWA 2QUFA 2YGLA 1T6BX 5JFRA 4D6SA 4XE9A 2NNYA 3FE5A 2ESNA 2JPBA 1LNWA 4I01A 4XQWA 1VQ7I 2VQHA 3C1DA 4L11A 5A32A 3K4DA 4Q2FA 5DQ0A 3WEZA 2D7FA 3OYEA 1JXNA 1J1LA 5J48A 4LHNA 4HBNA 4OHZA 3ZR8X 2CRGA 3VBOB 1GICA 4L97A 3OV8A 2DVGA 4D6RA 2VMIA 3IBMA 3ZOIA 2VZUA 5CYYA 2JDAA 3DGTA 4GQ7A 1TE1B 1DIWA 4M9SA 5GZEA 3M4OJ 1PUFB 1RPWA 2YU1A 2PQ8A 2JMWA 2OIIA 3L2WA 1DZQA 2GNMA 3U4XA 1PX3A 4JGZB 3HQXA 4IHYA 1R1TA 2Y0IA 2FDJA 3TGNA 2VKHA 1F4KA 3FN9A 1JTYA 4C1WA 4AE2A 3P7NA 2QF7A 3U4SA 2C1FA 4YW5A 1TMF2 1E3PA 3JAMZ 5EZGA 3DEEA 1O5UA 4EN0A 4CDQB 1NT0A 3GYHX 1Z21A 4QT6A 2CFOA 3KT7A 2W39A 3T0AA 2BP6A 1QU3A 3DF8A 2G9GA 5A7OA 1CX4A 3OMYA 5FZ4A 3DKWA 4QTRA 5L3FA 2ZMEA 1IAWA 1U8RA 5FYSA 3T4VA 1AR71 3KIOA 2KM2A 3PFIA 2ZX4A 2VNOA 4XIOA 4B8EA 3GCMA 3TKYA 4N9IA 4O6JA 3ZN6B 1QZZA 4HBLA 3MO4A 2CUEA 4RB1A 1EA3A 5A6ZA 1S72I 2E2IJ 4HKOA 3GJAA 2Z3YA 5GZGA 4HX7A 2C9KA 2WB1A 4QU1A 4Q8KA 5FD6A 2E5ZA 3TOJA 4IE5A 3K4CA 4M9ZA 2WAQA 4DW6A 4XFFA 1GDTA 2J7MA 1MMAA 1Q8QA 3U14A 2I8DA 2GMEA 2R041 3OIPA 3DQVC 3S1QJ 4CDXC 1O3RA 4XN0A 2N7GA 2XJVA 4BDVB 2FX0A 3BR2A 1UZZA 4OCTA 1GZWA 2VXRA 2DFIA 4OLLA 4LO4B 1G86A 3U1XA 2Y69H 3SFZA 3WU2C 1FX5A 2CSGA 1X36A 3ZN6A 3ZFEB 4LOCA 3S2DJ 1V6KA 5FYBA 3ZDVA 1ND3B 2ILMA 2HEOA 1VMHA 3OY8B 1H2LA 5CFCA 4XUQA 2COBA 4MTEA 4GWNA 4AL9A 1FSEA 2CQXA 4FISA 4HQMA 4Q0QA 3H42B 2HYKA 1GZCA 2D6OX 5J8FA 1BEV3 1RUOA 4BE3A 1USTA 2OCCH 1NY71 2L7ZA 2WFPA 4CSWA 1C8M1 1GSLA 3OUJA 4XTPA 2F6BA 2B63J 1KDMA 3TQNA 4QXBA 3OSGA 4DZJA 3FXLA 2ZJPF 2JKBA 1QJU2 2Z1DA 4MLOA 3OY8A 5GLTA 3HB9A 4DNYA 2HWC1 3TEXA 1SFNA 2O8QA 1S55A 5D8AC 2PHXA 3CCRI 3C7GA 5FUNA 4UVBA 3R4KA 4RS8A 2DFHA 2YGMA 4QIWN 1G9BA 1XDUA 1BLZA 4RGGA 4MGTA 4Y5Z0 4XVHA 5GM0A 1UB9A 4UVCA 1D4M3 2EWNA 3KVBA 5FWJA 1O8SA 2JG9A 4XJUA 1EUTA 3PNYA 2ZJCA 3AM2A 3ZPOA 1YCIA 2XJRA 3G1MA 3L2CA 1HA8A 4Y4YA 3ZSLA 1Y39A 5FY7A 1X1CA 1RHI1 2EA7A 2Z33A 4UBHA 2HYFA 2FCUA 2ZJRF 1VAMA 4K7JA 3WCSA 1PMHX 5I93A 1F2NA 4ZZ5A 3HMYA 3G1LA 1LNSA 5AONA 2XBO3 1RUJ1 4K8RB 3S0MA 3VBRC 2JD9A 3VL8A 3GBGA 5LBQA 1ULOA 2R30A 1DDNA 1RL3A 1R082 1OPCA 3JQWA 5DTDA 2EINH 1OCZH 5DM6F 2RE9A 2I10A 3N7LA 2K85A 1UQXA 3FK6A 2RVCA 3KM5A 2FBHA 1XCBA 2CW7A 5ANQA 2Q8OA 4XLCA 4QX5A 4CU6A 1Y3TA 2MBFA 4PIXA 4DUXA 3CLPA 3ITQA 5D21A 2R7ZJ 2H6CA 2Q2EB 1W9YA 1LE8B 1ZA7A 1NG6A 1I1EA 1R22A 3FLPA 4Z1VA 1TT5B 4ENNA 2PHFA 3S3MA 1VQKI 1Y1VJ 3WF4A 4DEVA 4ZXEA 2JE8A 2OV7A 1VZ0A 1ND2C 3Q5FA 4BEHA 4E70A 2OAZA 3PIPF 5FB2A 5ED4A 4W6WA 2VR4A 5IT3A 4ON0A 1OF4A 1E57A 5H6QA 1X82A 2YU3A 4V19K 5EGOB 3BPXA 3NNMA 3QRFF 5HBAA 3TO7A 3VD9A 1UX7A 2BHYA 2QUOA 1GLHA 1VLNA 1XE8A 2WT0A 1KU2A 1V5EA 3WNPA 5DMYA 4A3JJ 1QMJA 2VB6A 5AC92 2ZGUA 1Q8SA 4E2QA 2Z5UA 4W8JA 4PGGA 4CDUA 1WKYA 3K48A 2LNBA 3T1MA 3JBG2 4HSRA 4UHTA 5DUVA 1U5TC 4M73A 2EFOA 5ACA1 5FPBA 1EYBA 3IWZA 3GTPJ 4XF4A 4GXLA 2KL4A 3HSEA 3AMNA 4IHWA 5JXGA 3DBHB 3ZFFB 3S1MJ 3IV5A 3IAS2 4XBQA 1W5CC 2Y34A 1WA4A 2ET1A 4M3BA 4QXHA 5FZ8A 2BOIA 4IEYA 1LQ1A 2Q0AA 4AGVA 1M06G 3CZ6A 3ABUA 4PJMA 5FYCA 5L3BA 1AR81 2IJLA 3ZKYA 2Q1FA 2VW2A 4UV8A 5FO5A 1IG7A 1N3OA 1UYYA 4B4CA 3FM5A 3CF6E 3PSFA 4Q4Y2 3CLQA 3IHUA 3OS2A 4ISQA 1JW6A 1JZ5A 5K5OA 3AP4A 2KIFA 4LIUA 1FP2A 4TTGA 4UFHA 2EFPA 1DBNA 5F37A 1ULGA 3LZZA 2FJ1A 2JRTA 1I3AA 2NZ9A 4O65A 2P3KA 5KHGA 1OC1A 3S1NJ 2ZEXA 3ASOH 4QPYA 3BG7A 3IL2A 5EXOA 1UELB 2ELJA 4YZ1A 3J7NA 4MGRA 2X6OA 3I8TA 2IXLA 4YIIA 1GXPA 2MEV1 1MBJA 1DU6A 1QEXA 1LKNA 5FLXK 5C44J 2P7CB 1WQ2A 3RPQA 2M87A 2D1HA 3TEDA 4QD2A 1O7FA 5D8KB 1XJAA 3OPTA 3HBLA 1W8OA 2M8EA 4AW7A 2JX9A 4XMYA 3E6DA 3RKXA 1V6MA 4KA4A 3I59A 2VBZA 5E3MA 2FZ1A 5KBFA 1TC3C 4YGCA 1FSHA 5FZ1A 5FZAA 4BLIA 4N43C 2DCZA 4YFKF 3VKNA 2RDQA 1PYVA 1A36A 1X7NA 3VDCA 4HN0A 3FHNA 4LLNA 1WJBA 4U0WA 4Q4X1 2XLGA 2IVMA 3KEQA 1K5MB 2BWCA 5FY1A 1SLIA 3ZXSA 3WNXA 3IKWA 5CQEA 1D0XA 2QKMB 1QHDA 3KCXA 4Y24A 3L2VA 1HQLA 2CV6A 4B8XA 3ZGKA 1BHGA 2KXLA 3OB8A 4JGZA 1T0FC 2JIJA 4BACA 5LA2A 4QX8A 4B3AA 2EXIA 5DM7F 5J37A 5KK1A 3V8JA 5A7WB 3B69A 1IV8A 2VUJA 4LKDA 2NYYA 4H55A 4I99C 5DD8A 3VBHC 1XB4A 1PP8F 2L7FP 1VQNI 1W4MA 4P55A 2ECCA 1XGNA 3MDPA 4QX0A 3KEOA 4NHMA 2DT6A 1W5TA 4HKLA 1HKQA 3GLLA 4KBZA 4I0AA 1ACIA 2GDFA 1H1IA 5LHIA 2A1XA 2TNFA 2A70A 2GMPA 5TISC 4MTDA 4A3ZA 3HEIA 1FAYA 5IOZA 1ETYA 3NO8A 5F04A 3CO7C 4FTHA 2BTVC 1WWXA 3ZMSA 1XNAA 4Q4W3 1ACCA 4L9VA 1OOPC 3BROA 5DABA 3PUAA 1CJDA 3IP4B 2JB4A 5DAVA 4OWRB 4E7IA 4CXWA 2WNUA 4PQQA 3OUHA 4FASD 5HDKA 2E7WA 2V4VA 1SLLA 5EHDA 1W6QB 2LC2A 5E79C 1UNBA 1SHWB 2H8WA 1E3OC 2P7VB 1SMVA 4JK1X 1TLHB 4W50A 2HQ5A 1T95A 3J7AY 2B5HA 3BU7A 3BCAA 1B8IB 3VBHA 3K0LA 1RRJA 2AYHA 2MD5A 1QWRA 2DMQA 4WV8A 3SH3A 1HDPA 3BJ6A 2LVSA 2Z4FA 5FZBA 5FKLA 2HWF3 1RR7A 4V1PA 4JDNA 2WDBA 4R4XA 4D7YA 2DBNA 3ZYGA 1YX3A 2XGCA 1GP4A 3HTUA 1K6YA 3BI3A 2HU9A 2PFBA 2OQGA 5JIUA 3G1OA 4XURA 2Q8EA 1G9FA 2X8KA 5FO9B 2NVTJ 5C4JJ 2D2WA 3HPGA 1EJ9A 2HH9A 1H8TA 4S2HA 2KR2A 3DYOA 4FFIA 1W6NB 3DPRB 1ZZ7A 3K10A 3B00A 1FNNA 3SNMA 4ETSA 3TL4X 3X29B 5GZFA 4Y15A 1BMV1 1OCCH 1LDDA 3KV9A 3WGIA 4XFBA 5AIPA 3ES4A 4HQEA 4IEUA 3HOZJ 4AHZA 3BIEA 1X9TA 1VNDA 4XLFA 1FMD1 3ZYHA 2EA4A 2HOSA 4EGYA 1W2UA 4BQ5A 2JG8C 4XOTA 4A6OA 3WD5A 1LU2A 1B9NA 1WBFA 3WDVA 3VV1A 1ZVFA 2FDHA 1PM7A 3K70D 4XZUG 4L9NA 1S2KA 2NVYJ 1O59A 2E7AA 4ENMA 2DOEA 5KC6A 4CEWB 4FPCA 1IKQA 3SQNA 4XSZF 3B3QE 4B4RA 1MR5A 4CUAA 2V1UA 4AEKA 4ZTJA 3G7DA 1R49A 4PLMA 3AL0C 4MX3A 3GWZA 1HC8A 1SANA 1SACA 5ABJC 2D40A 1KGSA 1RUF1 1EH6A 2C0ZA 2VCBA 1TZLA 1EV11 3CTAA 4CEYB 3IDEA 3POJA 1JS9A 3VDAA 1S0BA 3H7JA 1B09A 4AG4A 5J1YA 2RMU2 4WVMA 2QTWB 4KT5C 3B7MA 2VZOA 3P6BA 2G9FA 2OPKA 3PUBA 1F31A 4FI9A 2VOTA 4D9JA 2XB6C 3ZQFA 3VKMA 4B1MA 2Z2SB 2BGCA 3LOCA 2E1MC 2YC2A 1SBDA 4Q48A 3FMRA 2WNEA 2V1NA 5H9PA 3ZMDA 4D7TA 2ZGSA 3BY6A 4IXAA 2YU2A 4FPLA 2D5VA 1IF1A 4OHVA 2HEYF 3HXLA 2WN2A 4QWNA 5JR3A 1W90A 3MF9A 5GJ6A 5BS6A 4MGIE 1OFSA 2MNGA 1B4AA 1PGW1 4YZ4A 2CO5A 3RJPA 4FOQA 1HXS2 2JN6A 2VUCA 2L9NA 4FPJA 1DQUA 3ZFGA 3M07A 3VDDA 4AEDC 4BOWA 3WTVC 4C30A 2NXNB 2M7BA 5FZ7A 3NKTA 4CDWC 1BJZA 3NNGA 1UY3A 1TME3 3LA3A 2DMUA 2ZKNA 3M3QA 2JUCA 5IP6A 4PSXA 1J3RA 1RJ8A 1R1VA 1EH7A 1VQMI 3KLOA 3H1MA 1G8WA 4RM3A 3F0CA 2WAOA 1DPUA 1WD3A 2QJVA 1OA3A 1E5IA 3I4MJ 5FUPA 2F5CA 1VBD3 3MIHA 3EUHA 3JCIA 1ODDA 1IKPA 4RHV3 3F9KA 2QCOA 1A34A 2BBAA 2BY3A 5DN2A 1RUI1 2HTJA 2VTFA 3DF0A 3HKZA 4OZXA 2YUEA 2RQPA 2IP2A 2NMOA 2W85A 4E4SA 2UU8A 4ENKA 3RZGA 4NPMA 4J19A 3ORJA 3PMSA 4IQPA 1B1BA 4TSVA 4HANA 4EZ4A 2BERA 2OVUA 4BE0A 4E4ZA 1NA1A 3A1YA 4BNCA 1YO5C 2GNDA 3N05A 3IIIA 3EQLF 3GTJJ 1COV1 3OWTA 2XB5A 5FQ0B 1IZ1A 3JRIA 2M1BA 5DYMA 5C6CA 1YQ8A 2QLZA 4RGSA 2ID4A 3CDZB 4JX6A 1LFBA 1W8WA 4LB6B 1JYTA 2HXOA 1QQP3 2EV6A 1YJ9I 2O9LA 3CCLI 1GOFA 2VC9A 3FX3A 2Y0OA 2M9HA 1J83A 1VAKA 2UYBA 1OD5A 5CKMA 3S6PA 5IJRA 4EJOA 2L01A 2X4HA 1UWWA 5IVVA 2M7AA 4HPKB 1S29A 3T1BA 3CDHA 1H8VA 4UBGA 1LGCA 2J22A 3K1NA 3I49A 4LHSA 3W2WA 3EQEA 1X2NA 4WM8B 2QBYA 4XNFA 2G9WA 1EF4A 5LCWL 4Z07A 4BJ6C 3RWKX 2UV1A 3I2DA 1HKDA 3NQOA 2GIZA 4HF1A 2VPRA 3GZUC 1MJAA 5HNHA 4FPGA 1IDYA 4Y1VA 1Z3YA 1VFCA 4UW4A 4IF4A 1IGOA 4ZDPA 1MDMB 4B44A 1AR91 4R79A 1F36A 4IOCF 3T3YA 2D5FA 4HPKA 2VQTA 4YM0A 3G6EI 4C3JJ 3P9CA 2MC3A 3UNGC 3J80Z 1UU6A 3VZMA 2MLKA 5C4XJ 2KRHA 4L8QA 4XILA 1RUG2 3H8UA 3LAGA 4D0QA 2HDDA 2QBYB 2R49A 5FMBA 3AG4H 4ZYHA 2M0CA 5IW0A 4NO4A 5CVJA 4LLGF 4KN4X 3DN7A 3PDQA 1ENHA 4LKFA 2HZDA 2XAFA 3C18A 4LO5B 5D2AA 4LO6B 2EFWA 1IZ3A 2GALA 4CYCA 4NRPA 4H3WA 1KQ9A 4R1HA 4AI2A 2FNPA 3ZN0A 5LLQA 2Y9YA 3JREA 4AEJA 1UCRA 1SD4A 1HJFA 3I3BA 5BQTA 1CQ9A 2JPCA 3ESWB 3NNLA 1SLCA 1OKQA 2JQ7A 4WVVA 3WDTA 2I5UA 4PIZA 4EV0A 1JJ6C 3V0AB 3BTYA 4M3DA 1W6OA 4P1WA 2E1NA 2GQQA 5HXMA 4AHWA 5BXXA 2ZXWH 2A6YA 3AYCA 1FIPA 1RZ4A 4CDQA 5LGNA 2V5YA 4J25A 2HWF2 4QHOA 5JAXA 5EJCA 5FY4A 5FYVA 3S7IA 2PEXA 2CGPA 1IJWC 1BCXA 4ESBA 4HVOA 2O7OA 5D5XB 3HL2A 1GLNA 4JAAA 2XPWA 3SZGA 3NW4A 2EIJH 4RB2C 2ZKZA 1GYKA 2PN5A 3RJ2X 5ILVA 4XQFA 1ETKA 2XHNA 1R5HA 3C2BA 3AAFA 3OUIA 1HV1A 3FMSA 3OYWB 3KETA 2JG8B 4MHRA 4OOIA 1RUE1 5C5TA 2ME6A 2PQQA 1MZ6A 3GUDA 3SDBA 1W99A 1ULDA 2Z42A 2H0VA 4A42A 1JUHA 5DCFA 4A44A 4A4AA 4LKSA 3F95A 4HF0A 5E20A 4NQWA 4FPEA 4A3GJ 5DEQA 3DPRA 1P2FA 1JTZX 1WUVA 2Q0OA 2FUG2 3AXEA 1SCRA 1ZBA3 3O1RA 2BY0A 4UW6A 1PDNC 2Y6LA 4EJRA 5M5YJ 1R6RA 3AYDA 2Y60A 4ASKA 1D0YA 1H8TC 2WAAA 2FZ2A 4LQRA 4MFEA 3OJBA 4HLYA 1UZCA 1R1A3 3BG5A 4MXVA 4C90A 3F23A 3AC0A 4LUMA 2UWAA 4G12A 1YJNI 1M1EB 1JYXA 3FKJA 1VTNC 2A3WA 5CKTA 2XROA 3DBLB 4L18B 5LY1A 4PK4A 3WODF 2K4JA 3AZXA 1SZBA 1ZH5A 2Y38A 2A73B 3DKYA 2XONA 4OQ8A 4NMIA 3TNQA 4YFXF 4BIOA 3IDBB 3T0DA 4M71A 3PMEA 1AR92 3GF2A 3F72A 2RMU3 3VBSB 4L0ZB 4UUTA 3NRUA 4A7ZA 2HWE3 2JJ6A 4PDWB 1UPSA 5HV4A 2Q8KA 2UY8A 2X1EA 3ACHA 3I2IA 2WAEA 3LWCA 3FHAA 5IAVA 1APNA 2BZTA 4XKCA 2XVGA 1HSJA 3TMOA 2ZXIA 5DCMA 3JZVA 3ACIA 1GV9A 1G8XA 1DLCA 4E7LA 3MZYA 4IW3A 4OHWA 4UFIA 2PMWB 2ETEA 4YW7A 4N4NB 1WH7A 1MSFC 5FLIA 2O0YA 1TWAJ 4U2AA 2DT5A 4RQPA 4ZH4F 1V3FA 2A6EF 2R7WA 1NCRC 1R23A 5IY5H 5DUXA 3FLTA 2CGOA 4W65A 2VZQA 3J4UH 2R7VA 1WCKA 1VMJA 1SVOA 2ZA9A 3I97A 4O9GA 4JBAA 3CO6C 3GM8A 1XTAA 3KSCA 1Q56A 1JHJA 4HEA2 2UURA 5E1WA 3E97A 3DWLE 1AL21 2NS7A 3L2YA 1ZBE3 3DLAA 1XQNA 4XLAA 1IRGA 2LTNA 5DD4A 4GAZA 5E6HA 1XPWA 1W03A 3GXOA 1M4WA 4EJTA 1R7JA 3PIOF 3FXOA 4CP1A 4BKXA 1MQTB 3TOAA 2ZS6B 5H9QA 1PGW2 2BPA2 1YOVB 3TO6A 1SFOJ 4Q0SA 3F3XA 3NWKA 2KT0A 3VLBB 1RVF1 1XBFA 4A45A 5FRAA 1G3TA 2DTZA 2RS53 4P96A 3KP2A 5E17F 3EUHC 3JSPA 2HWB1 5JOZA 5J1RA 5F08A 3DU5A 4OMZA 3EYYA 1KRIA 1CAUB 1U8BA 4D7MA 1PO21 1FPN1 2W08A 1SFYA 2VCAA 2R061 4IQ4A 5H2FC 5A2QK 2NLRA 1I1GA 5BOXA 3GX4X 2OZJA 1RHI2 4HPQA 3O0WA 3FWEA 1UW8A 3PTYA 3UKTA 4QHZA 3WTZA 5FREA 5FQ0A 5FKBA 1H8AC 5EYXA 3CF2A 3J81Z 2YBKA 4CCDA 3CF5F 1E5RA 4Y1ZA 2RREA 1OOPA 4M3CA 3ABMH 3DTKA 3JAMK 5FPVA 4NHXA 1WD4A 3SCGA 2VJIA 1I5PA 5IVFA 5IFTA 2OJED 3K70C 2CWEA 1ZRDA 3ZR5A 3N9LA 2FEZA 4HSJA 1IOAA 5F0FA 1PVEA 1T0FA 2LFBA 3LFIA 2WQZC 5T5JA 4KICA 3S2WA 3MZHA 1OLRA 5HS8A 3ZN1A 3DYPA 4MVTA 1X1AA 2GU9A 3CD6I 4D94A 2L9RA 2LF8A 1BVVA 4O9EA 2CQKA 5HDGA 1HRV2 3VSLA 1CESA 3RSNA 1TQIA 2PQSA 2H1LA 4EJWA 5A80A 3VHRA 4CP0A 3VBFB 2QM3A 2E36A 3DL3A 1GV5A 3MMYB 2P37A 4HG2A 3G73A 3CO2A 4QB2A 5E1RA 1DG6A 5CEHA 2ETHA 2LSOA 2A6ZA 2ZZQA 2DUOA 3MIDA 3BALA 1K4TA 4IRGA 5CFCC 2AUYA 4OVEA 3BC8A 2QDRA 2VI6A 3ZXKA 2VOKA 1IRZA 1LGNA 1UY0A 2A75A 5GLUA 2ID3A 3BG3A 1RUD2 3OL3A 3I59B 2WAFA 2FDFA 2MG4A 4H4KC 4Z82A 5FR3A 1Z7UA 3TB0A 2Y9ZA 4DRVA 1UXZA 4YG0A 3AZWA 2WS93 5CFDB 5F6LB 2PHTA 4D1QA 4KWJA 1IO2A 4LK6A 3IAPA 3PVEA 5F1RA 3IH3A 3LA7A 4GH4B 1NHAA 2CSOA 1N3PA 4BBRJ 3HDDA 1UOJA 3NJZA 4DYQA 1K83J 4W6XA 2CGNA 3MKLA 1FY7A 1PVXA 3HIFA 1LEDA 1P7JA 4U88A 1UU4A 3N7KA 3NEUA 4RA0A 4LULA 1NQJA 3K7AJ 1W9WA 3V0BB 1YJLA 5L73A 3RMYA 2EPFA 5K7ZA 5HI0A 3LFUA 2QVSB 4OIOF 2E9QA 2RS13 4CDUB 2JDHA 2QQKA 5K0UA 3CKHA 4MUVA 1SMTA 1FYMA 2R0HA 3DPTA 4C3HJ 3WG2A 5LB6A 1WMXA 4Q4ZF 2ZGQA 3NVCA 3WNOA 1IRXA 1S2BA 2DVBA 3NV1A 4IE7A 2RC4A 5KAIC 2WWJA 3U11A 2XIGA 1H0MA 4WCGA 1WCSA 2DA2A 1TME2 5KHHA 3OD0A 3VPRA 1KS5A 4B47A 1FXZA 2K0GA 3T8TA 5C3RA 3BG6A 2WV1A 4JDOA 5F6KA 1ZBA2 1R1ZA 5FAXA 2DU1A 1R1UA 4K2EA 3KZIC 5L36A 2OBPA 4JX4A 1POV3 4DEQA 3HKZN 2LKSA 1DP7P 2ARCA 1H1MA 1P6RA 3THPA 1VQ4I 1KQ0A 5BY5A 5CKQA 2Y6FA 1O4YA 4OI4A 4B3NA 4BQAA 5DDJ1 2X05A 1YJWI 1JUPA 3UKGA 4UVAA 4QKDA 4GALA 4MO7A 2WZPP 3KCCA 5CADA 1ZARA 3F2ZA 3NL1A 1MZBA 1X50A 1WCQA 3QOPA 4IE6A 2ZO4A 4IUGA 4UWDA 2IPQX 4IV3C 1R9TJ 1QJZA 2BNMA 2JG9C 2WKKA 1VBB3 2X5IC 4QB6A 3W9AA 5JSOA 2M30A 4BCUA 4TXWA 1RJ7A 1FTTA 4RS5B 2IFWA 5AC93 1IRFA 1W6NA 3ZFEA 2OUJA 1JUMA 2KZVA 4K8FA