3AP5A

Crystal structure of the galectin-8 n-terminal carbohydrate recognition domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
152
structure length
152
Chain Sequence
b'LSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSVKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galectin-8
molecule tags Sugar binding protein
source organism Homo sapiens
publication title Galectin-8-N-domain recognition mechanism for sialylated and sulfated glycans
pubmed doi rcsb
total genus 30
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2010-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ap5A00
1JYCA 3M2MA 2VW1A 2D6PA 3NWKA 2SBAA 2E6VA 3V65A 4XE9A 3N36A 4XIOA 2GALA 4LBQA 1U0AA 3SH3A 2NN8A 5GLZA 1SLCA 4BQ1A 3NV4A 5DUVA 1WCSA 2EXKA 3WCRA 1LOGA 1Q8VA 3O0WA 2YZ4A 2JE9A 4FVVA 3RMXA 1CJPA 3PMEA 3WV6A 1S0DA 1LGBA 2OVUA 4LBOA 2DVDA 4RL7A 4JCKA 4Y1ZA 5L73A 3WG1A 2WNEA 3NV1A 3C2UA 4FPFA 1BQPA 4LBQB 3SITA 4FPEA 4XJUA 4XBQA 1DFQA 4FPKA 5IK4A 1LOBA 4LBNA 1YIFA 2WSVA 1LGCA 1G9BA 1DQ1A 1MS1A 3POWA 3POSA 3NV3A 3HN1A 3UJOA 1Z0HA 2DURA 2CY6A 3N7MA 2ERFA 1ZA4A 1LOCA 1CPMA 3W58A 1IS4A 4I30A 1GNHA 1LHNA 5KXEA 2JECA 1UZZA 2HYKA 2LALA 1C4RA 4DFSA 2GNMA 2NMOA 2ZMKA 3ZSMA 1YRZA 2DWRA 1WBLA 4BMEA 1WLWA 3I4IA 2DTYA 1N1TA 1ULFA 3AZYA 2G4IA 1MS5A 3AZZA 2ZGNA 4OZXA 5JOZA 1ULGA 3N7KA 2WKKA 3AK0A 5JOYA 5IUQA 2NP0A 2PELA 1MZ6A 1QF3A 3WLUA 1G9AA 5IT6A 5GZCA 1LOFA 3AZWA 1W0OA 1URXA 3IPVB 1ENSA 4GWMA 1CVNA 1V6OA 3OBRA 1GLHA 1JUIA 1LESA 5FREA 2VW2A 3WG4A 5GZDA 3AYEA 1RINA 1YXWA 3AP4A 3AFKA 4LBLA 1UAIA 2TEPA 1BJQA 1BZWA 1JHNA 5H9RA 3PVEA 4DS0A 1N1YA 4DQAA 1MS0A 1LULA 2E53A 2CWMA 2ZGOA 1F31A 2JJ6A 3ZXLA 4YGBA 1OFSA 1N1SA 1N1VA 2A3YA 5T5OA 4R9BA 3V0BA 1V6KA 3WDUA 1WUVA 4HANA 2ENRA 2D43A 3UL2A 4YFWA 2WT0A 1HLCA 2JDZA 5IK7A 1DLLA 1SLLA 2DVAA 1G7YA 1S0FA 3ILNA 1ULCA 5GLWA 5T5JA 5EWSA 3NV2A 3PJQA 3UJQA 2A7AA 2H0BA 1S0CA 1RIRA 1WLDA 1UX6A 1A8DA 4AGGA 4AGVA 3WVJA 4M00A 1DYKA 3T1LA 4XTPA 4XBNA 3WG2A 4YG0A 1QNYA 3OYWA 4SLIA 4JC1A 2DU1A 5T5PA 4LBMA 1N3PA 1V6LA 1MS4A 1W6PB 2PHRA 1DZQA 1F9KA 3A0NA 4FPCA 1R1ZA 4Q1RA 4XIKA 2FMDA 4C1WA 2W52A 2WT2A 4H55A 3SH4A 2DVFA 1QMJA 2RHPA 3O0XA 5T5LA 3KQRA 3MW3A 5GM0A 2ARXA 3BTAA 5DG2A 3L2YA 4GKYA 1LEMA 2DTWA 2ZHLA 3FBYA 3N7LA 2WQZC 3ILFA 1MS9A 4YM3A 2EXHA 1FATA 3AP6A 4NOTA 3N35A 3AP7A 2EXJA 3QLQA 4ISQA 2GNBA 4XJ8A 4GWNA 3AX4A 4XJ9A 3LCPA 1WD4A 1QOTA 2UWCA 4U36A 4Y1UA 4YZ3A 3USUB 3FFZA 3CNAA 3IMNA 1V6MA 4FOQA 5E8AA 3WOGA 1A3KA 3SNMA 3WCSA 4FPOB 4FOYA 1QDOA 3ASIA 1GYKA 3R05A 1PZ7A 4K20A 3AXDA 4Y24A 5CB7A 1FV3A 5EYXA 5HCFA 5T54A 3T1MA 3T2TA 1WW5A 1W6OB 3AYAA 3VKOA 1AXYA 1VLNA 3ZXEA 3OY8A 1FYUA 3M3CA 3SH5A 1MZ5A 4FOVA 1V6JA 2ZHKA 3MEPA 1JYIA 5LK5A 4U2AA 1WW7A 2CTVA 5DZFA 1W6QA 3N3HA 4YZ2A 2D6MA 2DUQA 2A70A 4YFZA 1YI7A 3AJZA 1YO8A 5DZEA 4Y1YA 1WLCA 4UW6A 4C1XA 2ZHMA 4FP3A 4W65A 5GLUA 2WSUA 4Y1VA 4Q27A 2P34A 1LODA 4FQ4A 1GV9A 2DV9A 3RSJA 1AF9A 1DYPA 3O5SA 3B69A 1SBEA 3HMYA 1F5FA 3WHTA 4YGCA 3OJBA 3WDTA 1G9FA 1ONAA 2SLIA 4GALA 1DGLA 2D6OX 1QGLA 4RA0A 1LCLA 2ZMNA 3N7JA 1RITA 1XQNA 1ZM1A 5JOWA 4YM1A 4CZSA 5JMCA 2BQPA 5JLVA 1IS6A 1IOAA 1PZ9A 1SFYA 2XG3A 1YYNA 2ZGPA 3ZXFA 1KJRA 1W6PA 1DQ0A 1O4ZA 2NYYA 1N3QA 4FPYA 2A75A 1LU2A 1W6NA 4XHXA 5HCBA 2ZAAA 3BIWE 4WZFA 3SISA 2D6LX 1HDKA 4XXPA 1FAYA 1QOOA 1SBDA 1VIWB 3GNEA 4XJWA 4YM0A 2E7TA 2D3PA 1D0HA 5H9PA 4ZKTB 3APBA 4LBJA 1WD3A 2YV8A 2V73A 1G8WA 2PHWA 3A0KA 2E51A 5FRAA 1I3HA 1JOJA 3AYDA 4PQ9A 4M3CE 1UN1A 1GKBA 3AZXA 3RQ0A 2A6VA 3D5OA 1LHUA 1NLSA 4K21A 5GLVA 2ZBJA 2CYFA 1CN1A 4DRRA 1KJLA 1OKQA 1SCRA 2XB6C 1LJ7A 2UURA 3FLTA 2PHXA 5E89A 1S1AA 2C5DA 2GN3A 4BLJA 2UWAA 1AZDA 1AJOA 1D2SA 4ZXKA 3ZXJA 2D44A 2OUHA 2ZGTA 2YROA 4Q8KA 4YG6A 4FQZA 4NO4A 3PVOA 5DUWA 4XOGA 4Y20B 1SCSA 4FPHA 1H9PA 4FPJA 3USUA 1AVBA 2GNDA 4DRVA 1LECA 3VKNA 4GXLA 1CR7A 3WNXA 3BODA 1MACA 3I8TA 1LOFC 2A5ZA 2ZA9A 1LHWA 2PHTA 3AZVA 3JU9A 2V5YA 4GKXA 4LBQD 3WG3A 3HR9A 2Z42A 1BXHA 2R1DA 4Y20A 1QOSA 2AUYA 2ZGLA 1Q8OA 1G9CA 2AYHA 5KXCA 4JRAA 3TB0A 2GNTA 1AXZA 5T55A 4XHBA 4XJZA 1W6OA 3WZ1A 1C57A 4FP2A 3VKLA 3DGTA 3B01A 4CTEA 3M3QA 2VH9A 3ZSJA 2KM2A 1APNA 1UZYA 1WW6A 5GZFA 3OBTA 4R9AA 1DQ4A 1A78A 4YZ4A 2AREA 4XDQA 2VY0A 1ENRA 4M3CB 1KITA 4XZPA 4WVWA 2ZGSA 2A6WA 3IN9A 4XJAA 4YW5A 4GA9A 4L8QA 2PHUA 2GMMA 1Q56A 5EYYA 2AR6A 1CONA 4D69A 2AGSA 4AWDA 1ULEA 3AP9A 1DBNA 1LENA 4YW2A 1WBFA 2ZGRA 2DU0A 1G86A 2ARBA 3DUIA 4YW3A 3RRDA 3TAYA 4YGEA 1GSLA 1QU0A 2LTNA 3POYA 3ILRA 1HQWA 4PF5A 5AVAA 4Y1XA 4UW3A 2AH2A 3MPPG 3KM5A 4AYUA 1S0IA 3U4XA 3O12A 5H9SA 2Q5TA 3O0VA 2ZACA 4Q8LA 1FV2A 1V00A 2P3JA 4ISRA 1UL9A 1Q8PA 4PCRA 1JW6A 4WV8A 5DXDA 1UKGA 1LHVA 1N47A 2GDFA 3ZYPA 1C1FA 1KRIA 2VW0A 2A3WA 3M3EA 1W6MA 3VV1A 3ZYRA 1CIWA 2JD4A 4YZ1A 1VALA 2EF6A 2ZGMA 2ZKNA 4R9DA 2DUPA 4K1ZA 1KQRA 2EXIA 1QDCA 4BPZA 2DUOA 5DUUA 3V64A 3MW2A 5HCAA 2JKBA 1V6IA 2CWSA 1O4YA 2NZ9A 4M3CA 1W6NB 3V0AA 2R49A 2B7YA 1MVQA 2AENA 3H0OA 1G9DA 1W0PA 3OGGA 1H30A 1JBCA 2D7FA 1GZWB 3M3OA 1AX2A 2WT1A 4Y22B 1AXKA 4AVSA 4TZDA 2GMEA 1VAVA 1SBFA 4CRQA 4KBBA 1QKQA 1CQ9A 3PVNA 4Q2FA 2GMPA 2I2SA 5F5QA 2D3RA 1S0BA 2A3XA 4F83A 3FLPA 4FPLA 1GZWA 2EALA 1JN2P 4XMAA 1Y7BA 1X50A 3RG0A 4YW4A 2W39A 2OUJA 1LEDA 3LSDA 3WUDA 5GZEA 3D4KA 4K1YA 2R16A 1S0JA 4BLIA 3W59A 1GANA 4WVVA 3FUQA 2P2KA 4XXAA 3VKMA 4ASMB 4Q26A 3WDXA 4XBLA 5CA6A 3BOPA 3WDVA 3B3QE 3D6EA 3AP5A 2DVGA 3OPZA 4AVVA 3B00A 1IKPA 3IKWA 1ULDA 4P9XA 4ITCA 4TYSA 5JOXA 2NMNA 2YY1A 3IM0A 3AYCA 1Q8QA 5JVVA 2P3IA 1W6QB 2DYCA 3QCWA 4M01A 3VUOA 5DZGA 1ENQA 1S0EA 1QNWA 4UW4A 5GJ6A 1MS3A 3WHUA 1GZCA 1KDMA 1UPSA 4M3CF 4Y22A 1AX0A 4YGDA 4XILA 3ZXKA 1KDKA 4Z8BA 3FLRA 5CAZA 4LBKA 5DG1A 1GZ9A 2ZGQA 3ZSLA 4YZ5A 5F9TA 1J1TA 1PZ8A 1WW4A 4ATEA 2ZABA 2WJSA 3ZPYA 4ATFA 1IS3A 2EAKA 1NXD1 3INAA 1LTEA 3OYWB 4HL0A 2A71A 4Y26A 3WDWA 3R4SA 1FNYA 3M1HA 5GALA 1GBGA 1OQ1A 1LHOA 4PBOA 2R0HA 3SLIA 2JE7A 1LOEA 1DQ2A 1LGNA 3ATGA 4DPNA 4YLZA 4UW5A 2VU9A 5T52A 3IPVA 1FX5A 3VKFC 2UWBA 4R9CA 4XYXA 3OY8B 2D6NA 1DIWA 1AX1A 3R4UA 1Z78A 2R1BA 5EXOA 3RS6A 1DQ5A 1N3OA 4XTMA 4BMBA 2E7QA 4BM8A 4P14A 2CL2A 1Q8SA 2ZMLA 1MS8A 1VAMA 5E88A 4FPGA 3Q9OA 1CPNA 1LU1A 2UU8A 5CBLA 4PBPA 1BKZA 3A4UA 3MW4A 3ZVXA 4IQPA 4AGRA 1LOAA 1SLAA 2D3SA 4FOWA 1BYHA 3FUOA 5T50A 4YM2A 5JDBA 1C1LA 1SLBA 5IK8A 2W08A 2YXSA 1JXNA 2ZZJA 2FHRA 5BYNA 4XMIA 4Q1PA 1SLIA 2GN7A 1SACA 1W6MB 1TEIA 3V0AB 2W68A 1DHKB 3AJYA 2A6YA 2A6XA 2ZGKA 5GZGA 2DVBA 1IS5A 2P3KA 2NM1A 1UMZA 3GALA 5DUXA 3RMYA 1MR5A 2PHFA 2A6ZA 1HKDA 1GICA 1IKQA 5IK5A 3UK9A 2VUAA 4YG3A 5H9QA 3WDYA 4BOWA 1H9WA 2OW4A 4MYEA 2EIGA 1CESA 3AXEA 1AJKA 5GLTA 2C9AA 3V0BB 3B9CA 1S0GA 4P9WA 2CNAA 1MVEA 3ZSKA 5SV8A 2WLQA 2VXRA 5KXBA 5CNAA 5KXDA 3ENRA 4YW1A 4AVTA 1GNZA 1DQ6A 1SLTA 1B09A 3JUUA 2ZGUA 1I1EA 2YMZA 2ZHNA 3LSEA 4P9YA 3WUCA 2D6KA 2ES3A 2R0FA 1V6NA 2P37A 1HQLA 1EPWA 1FNZA
chains in the Genus database with same CATH superfamily
3RYPA 4P9LA 2BJSA 5A80A 3ZFGB 3FZ3A 4CUAA 3NWKA 2SBAA 2WFF3 4UFIA 3T3YA 3W20A 4XACA 2GALA 4LBQA 3EMRA 4CXWA 1EPZA 3LA2A 1YLLA 3IDCB 5CFDB 1EY2A 2EXKA 1AL21 2WAOA 3C7GA 4JZRA 3WCRA 2XLGA 3HWJA 3O0WA 2YZ4A 3QD6A 3RMXA 2BPA2 1QEXA 2RS11 1CJPA 1T6BX 3PMEA 4LA2A 2OVUA 3VD3A 2R043 4CCJA 4JKKA 4DXRA 2WNEA 4FPFA 3C2UA 4DUXA 2B5HA 5A3WA 1YEWA 3WX5A 3BIEA 1UYYA 4BK4A 1C5HA 5C6CA 1HB2A 5EP9A 5F5AA 1RUF1 1G9BA 1ZBE1 1VBA2 3POSA 4KG8A 4HMZA 3ELNA 5CADA 3NV3A 1A8MA 2K9ZA 2DURA 2WN2A 1NG0A 2JG9A 3IAPA 1F5JA 3WSOA 3O14A 1LOCA 1XNCA 2WA4A 1RUD1 1XOYA 5FZ0A 1LHNA 5KXEA 1RUE2 4QPGB 2HYKA 3H8XA 1GP5A 1VBC3 2PA7A 3LF7A 1YRZA 4AHZA 1CAUB 4XETA 4FO9A 1BEV3 1N1TA 1ULFA 3POBA 1PM4A 2Y6GA 3AZZA 1ULGA 2HWF2 3KWVA 1QQP3 2WKKA 5EJ1B 1JZ3A 2YDEA 4YNIA 2OIIA 2NP0A 1YJKA 2QQLA 3KT1A 1NZCA 1NAEA 2Y33A 1SPPB 1UZVA 4I09A 1LOFA 3AZWA 3KV9A 1URXA 3BGAA 2F6BA 4IE0A 1ENSA 4GWMA 4BHPA 4CEWC 3OBRA 4XFGA 4S2HA 4KGGA 1C5IA 5FY8A 2VW2A 1OQEA 1RUJ1 1LAJA 3SEEA 1RINA 1OHFA 3NMBA 2AC1A 4KH9A 4OMDA 1J83A 5ANNA 3O1VA 2R061 3EYPA 1BJQA 1JHNA 3PVEA 1LULA 3OB8A 1PMIA 4RGKA 3VBUB 3CQOA 3ZXLA 1B35C 3K46A 3VBHC 3T08A 5BNPA 5CKNA 5T5OA 3O1TA 1RUE3 1HRV3 2X5IA 3V0BA 2HWC1 2PHDA 2ENRA 3ZFGA 4HPKB 3ZR5A 2D43A 1ASJ3 4YFWA 1PX4A 3DECA 4Y3OA 4CEYC 4PI2A 4LOTA 3WF3A 1G7YA 1S0FA 4HN0A 3RI9A 5EWSA 2VZVA 2A7AA 1WLDA 1EUTA 1WCDJ 3ABZA 3E1F1 1TG7A 1ST8A 4M00A 5G05L 3U11A 3Q8CA 4XTPA 1AYN1 3WG2A 1QNYA 3OYWA 4GULA 3NW4A 5FZHA 3BKZA 2DU1A 5FZ1A 1QJEA 4LBMA 1V6LA 3A7QA 5JR7B 1MS4A 2PHRA 4IESA 3LIGA 4UFKA 5FTTC 3S7IA 4C8DA 2DCTA 2WT2A 4L99A 2E9QA 3ECQA 1QMJA 4Q0VA 1D2QA 2W47A 1OVPA 2VBDA 2ZX4A 3O0XA 5GM0A 3AB0A 4KQ7A 2ARXA 4I2OA 5KHHA 1AYM1 1DF0A 1RYYA 2CDPA 2DTWA 2ZOEB 3ZYFA 1X33A 5JXIA 3GJAA 1FT9A 3J7NA 4OHWA 3QLQA 2GNBA 5GKAC 4CUGA 4XJ8A 3N9PA 4XJ9A 3DYOA 4YZ3A 1NCRB 2WYSA 3WF2A 4FOQA 3CNAA 4FTBA 1A3KA 3WCSA 4GB33 1U5IA 4P02B 5AC92 1JYNA 1BBT2 1NT0A 3NJZA 1UF2C 1GYKA 5FP7A 2B39A 1YQ6A 1G9DA 3UJQA 3T2TA 5FLIA 4A3XA 4A42A 5FQ0B 1XSRA 1AXYA 1ULPA 3JB8A 3OY8A 1JYVA 1XBFA 3CL1A 4FTSA 2R073 3JB4C 4HETA 4U2AA 4YYOA 1W2TA 4YZ2A 2WINB 2UYBA 1W90A 2D6MA 3B9IA 1YI7A 3AJZA 3OBAA 4YRDA 1YO8A 4WM8B 1R092 4TN7A 1RXGA 4W65A 3POJA 5B4NA 2IUWA 5A7PA 1IHMA 4BQWA 4Q27A 1VE0A 4F3JA 2JB4A 1GV9A 1SPPA 2RS12 2PHLA 3O5SA 3B69A 4DY5A 5FMBA 3FC0A 2JKXA 3MLKA 1OUXA 2Z2SB 1AR93 3N9MA 5L7OC 4QPIC 1G9FA 2BNMA 2SLIA 2QJVA 3LFIA 5BNOA 3D0JA 1UD1A 2G9GA 4CDQB 5KHKA 3HNMA 5D8AA 1K5MC 4AEDA 4X6RB 4CZSA 3OTFA 3M4FA 1TVGA 5CKQA 5JLVA 3HQUA 3I7DA 5CYYA 4UXAA 1JMUB 3B93A 1PVC2 2GC1A 1DQ0A 3O1OA 4JX0A 1NLRA 3BCWA 3WP3A 2GH2A 4LO6B 3ZMNA 1TE1B 1N3QA 4JKMA 2A75A 1LU2A 1W6NA 2JG8B 4RFT0 5C3OA 1UZWA 2ZAAA 3SISA 4LK6A 4CDUC 3KB5A 1HDKA 2D6LX 4JVAA 4H14A 3GNEA 3LAGA 1C8NA 4HVOA 5A70A 4UF0A 3BN6A 3OPWA 4NJ4A 5LASA 2P1BA 3WXPA 4ZKTB 3I3QA 1AR72 3NO8A 5LBFA 1CX1A 1E57A 5FY1A 3BYWA 3KQ4B 5HXMA 2QKDA 1H8TA 1I3HA 1QH6A 3OGRA 2FDHA 4M3CE 3ZR6A 3B5LB 2EIDA 2W87A 1ND3B 2QQOA 1VBE3 1VRH1 4JGYC 5JZGA 3H1MA 1LHUA 5L7OA 4Z1VA 2BU9A 2Y26A 3FLTA 2W1UA 1LJ7A 4LHSA 4ASKA 1S1AA 4BLJA 2JIJA 1GU3A 1W0NA 2BOJA 2UWAA 1AJOA 3N9NA 2DFCA 3Q8BA 5D8AB 5FZFA 2VMIA 5B2GB 5KC6A 2YROA 2VUCA 1V9U1 4QHOA 1XNBA 4MH0E 4QAWA 1S2KA 4KBZA 4FPHA 1RUG2 2LM3A 4B1MA 4QKBA 2VJXA 5FV3A 4CU9A 4IV1B 1YQ2A 4A6OA 3I8TA 4KGQA 4YVSA 3VN4A 4BWOA 5BNQA 1LHWA 3JU9A 3P3PA 4LT5A 3HR9A 2Z42A 2HWC3 2R1DA 2F4PA 3ACLA 1QOSA 2ZGLA 1Q8OA 4QWNA 5KXCA 2Q1MA 4WM7B 1E5RA 4JRAA 3TB0A 1NQDA 2RMU2 3ZYJB 1XRUA 2FCVA 1QJZA 4H2AA 5T55A 4IDZA 4XJZA 1W6OA 1C57A 3VKLA 3B01A 3M3QA 2VH9A 2XWBB 3K4ZA 1XYNA 1QXJA 1PK6A 2VTXJ 3I2IA 2IFWA 1QH7A 5FYYA 4RR3C 4OVEA 1NE6A 5A1AA 2J22A 4YZ4A 1K5JA 2AREA 3TBDA 3MV01 4M3CB 3VD9A 1KITA 1NCQB 1H6XA 4YW7A 4WVWA 3IN9A 4XJAA 4YW5A 4OHYA 5C9AA 2GMMA 1UKRA 3JBG1 4JDMA 1S2BA 2OPWA 2AGSA 3OBZA 4AWDA 1H8TC 2WO2A 1WBFA 2ZGRA 4MXWB 4LO5B 4QX7A 4E4ZA 3RRDA 3TAYA 4PDWB 1GSLA 1C28A 2JWPA 5K0UA 1HRV2 2Q4SA 3LD8A 3VDDB 5KHIA 3J8F2 5LW9A 2WZR2 3VBSA 1PO22 4AYUA 5F3CA 3O12A 5H9SA 2Q5TA 1DYOA 3O0VA 5FZDA 4QXHA 1AR71 4ISRA 3FE5A 1RGSA 3A22A 1OVSA 3CHXA 4EE2A 4DO0A 4NVPA 1JW6A 5BNOB 3T09A 1UKGA 1LHVA 3B02A 4QPGA 3H42B 3TNQA 5JZGB 3N9OA 2A3WA 3VV1A 1O8PA 3AC0A 4YZ1A 4IEYA 2EF6A 5BNPC 3VBHA 1U12A 1DGRN 5C8CB 3M3IA 4K1ZA 2FCUA 1RJ8A 2J1VA 4X8PA 3MW2A 1H8VA 1WCUA 3ZFGC 4BZ4A 1TNFA 1V6IA 1AR73 4M3CA 5IHRA 2JG8A 2YPDA 1W6NB 4BB3A 4AFBA 5LEKA 1X7NA 4CP0A 5I0SA 3DEMA 3AKSA 4QPWA 2D7FA 3AFGA 4J1XA 4Y22B 1OLME 5ANQA 1VAVA 1SBFA 3HEIA 4H7MA 4CE8A 3PVNA 5FK7A 5A32A 4Q4W1 3HNYM 3RZGA 3KV6A 4CEWB 4F83A 1BCXA 1TME3 1GZWA 2C4XA 1RHI1 2JEMA 1X50A 1J1LA 1HB3A 1YQCA 4O65A 2W39A 3RG0A 1LEDA 5FO8B 2RDNA 5GZEA 2R16A 4BLIA 4RS5B 4WVVA 3FUQA 3VKMA 2JDPA 2WFPA 2BFUS 1X36A 1UW8A 4YARA 2YC0A 5FIXA 3AP5A 2R071 5C3QA 2GZWA 1IKPA 3NJXA 3H8OA 2R30A 5C8CC 2YY1A 3VZLA 4LKSA 1J84A 1Q8QA 3KZ4C 3U1XA 5J1XA 4QX0A 5F1RA 2J7MA 5DZGA 1ENQA 1S0EA 2BYVE 5LEJA 3OF1A 2XHKA 3VD5A 1MS3A 2AEYA 3VBSC 4Y22A 1UPSA 2VOXA 4YGDA 1HN0A 4XILA 3WW4A 1YI9A 3VBRA 3ZXKA 2Q1ZB 4OQ9A 1DGWX 1H1IA 4Z8BA 2IVIB 5IVFA 3FLRA 4MXVA 5DG1A 1NA1A 4TLFA 5F9TA 3LKJA 1H4GA 2QQPA 5I91A 3ZPYA 2PLV3 1NXD1 2W9XA 5DPNA 2A71A 4I02A 3WDWA 3M1HA 3DXTA 4V1PA 4UFJA 1LHOA 2UY8A 2R0HA 5FMCA 3WF4A 4FAHA 1MZEA 3BUCA 1ZBA2 5LK7B 2ARCA 1R1A3 5J48A 5LRRA 2VU9A 1I5ZA 1XU1A 1FX5A 3IPVA 1ND2B 3VKFC 1CAWA 4AR2A 1H1MA 1GNYA 2IXHA 1V9U2 1WA4A 1VRH3 3R4UA 1O4TA 2W1WA 4BMBA 2YC2A 4I0AA 2E7QA 2VNOA 4BM8A 1UY1A 4UWDA 4PT6A 1NUKA 4MGIE 5E88A 4FPGA 1LU1A 4NUBA 4FCAA 4EN6B 4CXYA 4PBPA 1BKZA 3HT2A 1ZZBA 4LPLA 1AR83 4Q4X3 1SLAA 3I2JA 3FUOA 2O14A 1ZVFA 4JTNA 3CEWA 5F3GA 1JXNA 2FHRA 4UOJA 3ZXDA 4FFFA 1NY71 4Q1PA 3CZUA 5BXXA 1QJY3 2WQ8A 4K3UA 4X6QB 4MV2A 1TEIA 3HNBM 3V0AB 2W68A 4LORA 4IE7A 5IVYA 1OF4A 2RR12 2WNUB 4PIXA 5GZGA 1F35A 4LOSA 1UMZA 3GALA 3SHRA 1REFA 5EJZB 2A6ZA 5BV6A 5EHDA 1HKDA 4AQTA 2YYOA 1CAUA 1IKQA 2Y6HA 4P9JA 4A3ZA 5IK5A 1PIV2 2VUAA 2D93A 5H9QA 3VZMA 4BOWA 1RMU3 5BNPB 1H9WA 1IG0A 4MYEA 1O3QA 2E33A 1AJKA 4BQ5A 3VD4A 5T3NA 3V0BB 4P9WA 3VBOC 2CNAA 4IGOA 3GHMA 3ZSKA 5BY5A 3EBRA 1ND3C 4AI3A 5KXBA 2VOTA 5CNAA 1QJFA 2C6SA 2YFZA 3NNFA 5EJ3A 4BXFA 5JZGC 3U0ZA 3HVDA 4NN0A 4XUNA 4XCBA 4AQ6A 2ZGUA 2W0XA 1QIQA 4RGGA 3M70A 5LB6A 2D6KA 3BTZA 1W2NA 2ES3A 2R0FA 3A23A 4AEKA 3RWNA 1V6NA 4C0HA 5FY7A 1UYZA 4CVUA 4L9BA 4F8AA 4HVRA 4I01A 2P6HA 1QY4A 2E6VA 4QKNA 1W8TA 3N36A 2YFUA 4P9GA 1TZOA 3FX3A 4E9KA 5GLZA 4XURA 4BQ1A 2E32A 3NAPA 3SEPA 1WCSA 4RQPC 1ZYBA 2DBIA 1ACCA 4NPMA 4FVVA 4CDUB 2RVAA 4CP9A 2RDQA 4HPKA 1WGPA 1ND2A 4AVCA 2JG8C 4Y1ZA 5L73A 4JCKA 4Z07A 5FY0A 3S7EA 3L9JT 2QZ2A 1BBT3 5FZ3A 3SITA 5FYSA 3WNOA 4FPEA 4LEJA 4XJUA 2B8MA 2WZR3 4XUQA 3MI8A 1S4CA 2B4KA 4LXLA 2MHFA 1LOBA 5FP4A 1RMU1 3CIHA 4GIQA 1VBA3 5C3RA 3MICA 1OH4A 1DQ1A 1MS1A 2VQAA 3FHAA 3POWA 4E2GA 2TNFA 3N4MA 2YC4A 1OMIA 2V5DA 2FCTA 3WNKA 4NR1A 3HN1A 4RS5C 5F32A 2K46A 2RS31 2CY6A 4Q4X2 4HKOA 2XHNA 1AL23 2BZDA 2ERFA 2XVLA 1CPMA 5LA2A 3W58A 3DKQA 4LNVA 3MO4A 4FAGA 2B9VA 4P00B 4PI0A 2JECA 4A6SA 1UZZA 1W2UA 5AFBA 3PIGA 4N43B 1O3SA 3TEWA 4QXCA 2YBKA 1OOPB 1WLWA 4OQ8A 4OZXA 1MS5A 3H3ZA 2R072 3SQOA 5FUPA 4LHKA 3AK0A 1E5HA 2XKOA 1ZZ8A 3MF6A 4IEWA 1QF3A 4MXWA 1W39A 2GC2A 3CJXA 3MBWA 3QBQA 1O7FA 1VBD2 2XLFA 5GZCA 3PUHA 2YG0A 2VG9A 4AFCA 1W0OA 1UO9A 2QQVA 4J6GA 5FPLA 1SHWB 4I3GA 1D4M1 4JTOA 3S5QA 1GLHA 2Y6FA 4MOAA 4RR3A 1MQTA 2PTMA 1UMHA 4CXXA 2ZEYA 5GZDA 1W8NA 3AYEA 3RZJA 4AHYA 3AFKA 2JDNA 4XUPA 3S0MA 2PMWB 1IQAA 2TEPA 4Z92B 2RM21 5H9RA 4DS0A 5AFEA 4JQRA 5DN2A 2E53A 5L9BA 4HZFA 4YGBA 3T0DA 2VTXA 5FYVA 3NNMA 3LE0A 1RUC1 3O1MA 1HB1A 5TSWA 3P3NA 5J98B 3I59A 3BU7A 5FLJA 1VBC2 2LW8A 4JDNA 5A3OA 1S2EA 5EFUA 3HD8B 4AEDB 1UOFA 2VCCA 2WZR1 1HLCA 3J4UH 2GC3A 4QXBA 1PM7A 1FOD1 1DLLA 1W8FA 4PQQA 4QXKA 3VBSB 2OZ6A 3ILNA 1ULCA 2R6QA 3HAGA 5T5JA 3PJQA 4NE9A 3O1UA 1HV1A 2W2IA 3P5BA 4A41A 1S0CA 2ILMA 4AK3A 3O7OA 1CZVA 4AGGA 1A8DA 4AGVA 3IIAA 3WVJA 4CDQC 1DYKA 3K3OA 3T1LA 1QQP1 1W2AX 4I0WB 2VZOA 3J8F1 1KS4A 1JYTA 4PLMA 4DRRA 4NAOA 3S57A 1N3PA 3ZKUA 5FPVA 1KFXL 2E26A 2QDRA 3KV5A 5FP8A 3ZN4A 4MLOA 4FPCA 4S2DA 2LROA 2MEV2 1COV3 4QU1A 3I2GA 2W52A 4AFMA 4C1WA 1EAH1 2WRAA 4H55A 4HSLA 3SH4A 2XQXA 3ITQA 5JXJA 3AM2A 2RHPA 5FY9A 5T5LA 4J25A 4AAXA 5C4WB 4LO4B 3CLPA 4XQWA 3BTAA 3ZN5A 5DG2A 3L2YA 4GKYA 2ZHLA 5E1RA 5DMYA 3DXUA 2WQZC 3CJIC 3ILFA 4N43C 4YM3A 2EXHA 3ZMOA 3N35A 1YC61 5CVRA 2EXJA 5E16A 2WLPA 5KBFA 4GWNA 4O61A 3JZVA 2WNUC 3GHNA 5JAXA 5FBZA 1V6MA 4AQ2A 1R083 4RQPB 3WOGA 4LO8A 5F5IA 5JI9A 2W92A 4E4HA 4FOYA 2QNKA 3K48A 3R05A 5D8AC 4Y24A 3LEIA 5T54A 3VDDC 1FV3A 5EYXA 4ZU7A 5FO7B 4QQPA 1W28A 2VZQA 2H6BA 4COWA 4IE6A 4GB31 4QKFA 3UESA 3ZYBA 5FZLA 2VZTA 2Y38A 3KD4A 3ACFA 5FXZA 5FLHA 1JYIA 1YFUA 4MGSA 4P5HA 3I3DA 5LK5A 4N8MA 1Y4WA 1WW7A 4TLGA 4QD2A 4HOOA 2C1FA 2VXJA 4XW3A 2P6CA 3PUQA 1D4VB 5IYYA 1CIYA 2XMLA 1C3HA 3C7EA 4OUSA 5DZEA 1WLCA 3IDBB 5FUIA 4UW6A 4DB5A 4C91A 1SMVA 2ZHMA 4NIHA 3PHMA 2I74A 2WSUA 1RUC2 2WFF2 4L0PA 2D98A 2P34A 1LODA 2ZJCA 3H9AA 4FQ4A 3RSJA 3VD7A 1AHSA 1AF9A 1KGYA 3CJIA 1NQJA 2JENA 3D0SA 4GH4B 3ZIXA 4D6QA 1MPXA 1SBEA 3Q8EA 5A6YA 3HMYA 1F5FA 4JGYB 5FZ7A 3WHTA 3ZXGA 2QFEA 2GP5A 4L2NA 3WW2A 2DCKA 5I0TA 2WNOA 3SKVA 1FOD2 3NKGA 1RVF1 2QQKA 2D6OX 5HI0A 2MNGA 1EV13 1Y3TA 4AFAA 1XQNA 4HG6B 3V56A 4Q0QA 3MIHA 4GAZA 4JHTA 4AI9A 2RS32 2QQIA 4B4PA 3CDZB 2ZGPA 2IFRA 1ALYA 4UBHA 5FKCA 1O4ZA 5DDJ1 5FZ6A 2NYYA 4FFIA 4LLFA 2WO1A 2B46X 3FHIB 3T2QA 1JYXA 2LUWA 2VTFA 3ZN6A 4GMP0 4NHYA 4BCUA 4PJYA 1FXZA 1QOOA 4DUVA 3PTYA 5HCHA 1KD7A 3VBHB 5H9PA 3NL1A 3LGRA 2HWB3 1OA4A 2H6CA 4ZONA 1JU4A 2E51A 3AYDA 3BALA 3ZIWA 1COV1 4LHNA 1KEXA 3OEAA 3VZOA 4OMCA 1VBD1 5A7WA 2CGPA 4B7EA 4KG0A 1X8MA 1MEC3 3IWZA 3UT0A 1NX9A 1D4M2 2ZBJA 2MEV3 3K3NA 4OUMA 1CN1A 1DZRA 1SQ4A 1OKQA 1QHDA 1RUJ2 2XB6C 4Q4V2 2UURA 4LQRA 3WP5A 2PHXA 5E89A 3IBMA 4CU7A 2ETEA 4AHWA 1D2SA 3GM8A 4ZXKA 3TEYA 2OUHA 1AR62 4YW6A 2HWE1 4FQZA 1CAWB 1PVXA 2IVJA 3JQXA 2JDYA 3QOPA 4NO4A 1K45A 1SCSA 4XF1A 3USUA 1AVBA 2GNDA 1H2MA 4DRVA 4B7KA 1LECA 2ZXQA 4HONA 4LK7A 1AL22 4G9SB 1CR7A 4XUTA 3BODA 4D7TA 2A5ZA 2JD9A 4XC9A 1Q5OA 1VBC1 2PHTA 3OG2A 4GKXA 2V5YA 3WG3A 5IVEA 1WCQA 1PK6B 4D7SA 1E5SA 2EIEA 5FP3A 1H1AA 1Y9QA 3H7JA 4DXZA 1W2OA 4IXLA 2GNTA 1AXZA 3D82A 2FD8A 1VBA1 4XHBA 1SDWA 2X09A 3MGUA 3DGTA 4CTEA 4CDWA 2V4VA 1UIKA 2XJSA 3SMHA 5IW0A 2WUHA 2CU5A 2VNVA 1SZBA 3U4SA 5FZ4A 1WW6A 1RVF2 3OBTA 5GZFA 5JSOA 3MIDA 4R9AA 1A78A 3J7LA 4XDQA 3AVRA 5A3TA 5FR3A 4MGQA 4XZPA 3OOXA 4BISA 1GP6A 1ZRIA 2A6WA 5FPUA 3FFQA 1CD3G 4GA9A 1XYOA 2RS52 2PHUA 4K7JA 1Q56A 3AKQA 2V09A 4D94A 4EJRA 4D8MA 1ULEA 1DBNA 1ZRFA 2DU0A 1MZFA 2ARBA 4M0HA 3WNPA 1RUD3 4YGEA 4I3PA 3ILRA 1CZSA 4PF5A 4FT8A 4UW3A 5J36A 3MPPG 3U4XA 3WR0A 2ZACA 4QX1A 5FP9A 3N9LA 4AAPA 1RUH2 1UL9A 2RS33 5A7WB 2WWSA 1Q8PA 4Q0SA 4PCRA 4WV8A 4X8NA 5DXDA 3TNPB 5FPXA 1NE4A 3LFMA 1I5PA 3OGSA 4ZZ8A 5FMDA 1SFNA 5FZBA 4ZU4A 1MEC2 2VW0A 5EQUA 4HK9A 5A6ZA 1W6MA 2G9FA 3ZYRA 1CIWA 3VGIA 2ZGMA 3POIA 1B35B 1KQRA 4JGZA 4LIUA 4BPZA 1IQDC 4FSJA 4MADA 2FDGA 4UYBA 5DUUA 4ES9A 5KR7A 3TYJA 2CAVA 4IERA 2IXKA 3MLLA 2W5FA 3V0AA 2B7YA 3RGBA 2BNNA 3H0OA 1W0PA 2VPVA 3OGGA 4MGZE 2JDAA 4YVWC 5IAVA 5K4LA 1GZWB 3UGGA 5FOJB 3H1WA 1AXKA 5FZKA 3JBG2 2YPJA 2VMDA 1CQ9A 2ET7A 4KBBA 4W50A 2WZPP 4Q2FA 4GMP3 1ND3A 5JIUA 2TUNA 1O5UA 2D3RA 2A3XA 5FWEA 1H2LA 2PYTA 4CDWC 1DGWA 4FPLA 4LJHA 2C24A 4OHZA 1QXPA 4XMAA 5A7NA 1O59A 1J58A 3L2HA 3KMHA 3LSDA 1JI6A 5CFDA 1YFWA 2CGOA 3RDIA 3FHQA 5FYIA 1XSQA 2F4LA 4PLNA 2RM22 4GZ9A 4W6YA 3TRSB 3WDXA 4ASMB 3WDVA 3CBNA 3AVSA 3B3QE 2GU9A 5DAWA 3OPZA 4AVVA 2DVGA 1L7LA 3K2OA 1XC6A 4AI8A 2GC0A 4NHKA 4W6WA 1W9YA 4NHXA 3AYCA 3P6BA 1AYM2 1TMF2 2GAUA 2ORZA 2WR9A 3CKHA 4XDOA 2P3IA 1W6QB 1UZ0A 2XKPA 4M01A 5DDJ2 3VUOA 3RVHA 4UW4A 1PNGA 1UX7A 1NYWA 4MO3M 5FDBA 1GZCA 1WWYA 3MIBA 3B94A 1AX0A 2E7AA 1V70A 2YB7A 4CEYB 2OKXA 5L7OB 4XAEA 2W1SA 5A33A 4E8CA 1ZBE2 1F2NA 3U78A 5FZ8A 5J96B 1ZZ9A 2ZGQA 4CDQA 1XXNA 3R0RA 5CG9A 3TWIA 1POV1 3KCYA 2WJSA 1W99A 4FFGA 1LTEA 3J9SA 3POEA 1NCRA 1FNYA 5LA0A 1OQ1A 3LOBA 1VMJA 2BWCA 2JE7A 2QTWB 3NRUA 3SLIA 3VB9A 1UU4A 2JICA 3POGA 2Z69A 1US3A 1GOGA 4GJZA 2BVVA 2BGCA 2ZZQA 2MEV1 5C9AB 2X53S 1AR61 2ARAA 2JXAA 3LB9A 1MEC1 4R9CA 4Y4YA 4XYXA 2HWE2 5A7QA 3ZYHA 5C4WC 3ALQA 3OY8B 3LA7A 4K8FA 4WM8C 2QQNA 1UU5A 2G19A 2E63A 4N53B 2D6NA 4NIAA 4WVMA 1AX1A 3W5MA 4TTGA 3THTA 4QGLA 3FN9A 4P14A 1Q8SA 2HWB1 1MS8A 1VAMA 3Q9OA 2IC1A 2HBTA 5F2WA 4IQPA 4NAMA 2D3SA 1BYHA 2Y0OA 1SLBA 4PLOA 1NOVA 5IK8A 2ZZJA 3LEKA 4Q4W3 5FYHA 5IWFA 2R062 2JE8A 4XMIA 2HEWF 4UFHA 1REDA 1W8OA 2GN7A 5DAPA 3WP4A 1DHKB 3TEXA 2Q0AA 3AJYA 1YUDA 4LMFA 1WKYA 1X9PA 5FYUA 5FYZA 5C8CA 3PTRB 4CP1A 1DP0A 1XU2A 4B4QA 5ISLA 1CWPA 2NM1A 2FDKA 4RFRB 1Z7S3 5FPAA 1IGOA 3GJBA 2G1MA 5DUXA 3E6CC 1MR5A 2BGOA 2RDSA 4GWIA 1EV11 3ETQA 3BPSA 1GICA 4P08A 3FWEA 1OOPA 3SCGA 1ZBE3 1BMV2 3UK9A 5CIRA 3PUSA 4XQ4A 2OPKA 3WDYA 2OW4A 5JXGA 4R52A 5A3UA 5GLTA 5A3LA 2HYXA 3A21A 2WA3A 3WQ0A 4NIIA 3CO2A 4EWDA 4BH9A 4QHZA 2YU1A 4Q0PA 4LTAA 5KXDA 5CEHA 4QB6A 4RR3B 2HWD3 4IEPA 1RHI3 3LSEA 1PO11 4P9YA 5JSPA 3BI3A 4CUCA 3H8RA 5F6KA 4COYA 1NZIA 2ET1A 1EPWA 2VZ3A 3NQHA 4M0NA 1JYCA 1NY72 3KGLA 4DIQA 4EN8B 5IAXA 2CHHA 1O8SA 4ARXA 1K5MA 1EUUA 2RV9A 4XE9A 3JD73 3I3EA 2R32A 1U0AA 2RR11 1SLCA 2BOIA 5DUVA 3KCCA 1PGL2 1COV2 1HV0A 1LOGA 1Q8VA 1XE0A 2JE9A 5FZAA 1GR3A 1HRI2 3WV6A 1S0DA 1VMFA 4LBOA 4RL7A 2Q8CA 5KHGA 5C71A 1BQPA 1JU3A 2XJRA 4S2GA 4XBQA 5A7SA 4FPKA 1ASJ1 3AKPA 5IK4A 4LBNA 5JMOA 3PUIA 1W9WA 1BBT1 1LGCA 1UOJA 2W3JA 4LKEA 4YVSB 5EIYB 1VRBA 2VBPA 1GWLA 3UJOA 2HKXA 4YVWB 5ERLA 1UYXA 4DMIA 1Z0HA 2HWD2 3N7MA 3ZPOA 1ZA4A 4MHUA 3K51A 1UMIA 3K4AA 5A7OA 1IS4A 3GZAA 3X29B 1GNHA 4BK5A 3WNMA 2LALA 4XZUG 1C4RA 4INDA 1YQ5A 4DFSA 2GNMA 3ZSMA 2N7GA 3AKTA 3ZFFC 1H4HA 1WBLA 3KV4A 4AFDA 4RHV2 4BMEA 1OFNA 1S55A 1T6GC 2BV4A 2DTYA 2VNGA 3AZYA 3I4IA 2G4IA 5ABJC 2ZGNA 4LITA 1UOBA 3N7KA 1ZZ6A 2XOMA 2WS93 1AR92 3WLUA 3MUZ1 1PMJX 1G9AA 1REEA 5CISA 1CAXA 1PGSA 1W8UA 5SV5A 3ZDVA 3C8XA 3IDAA 2BGPA 2GP3A 3T2PA 4N7IA 3OUHA 2A1XA 5JXHA 3EB7A 1JUIA 1LESA 4IEZA 4IW3A 5F6LB 5FREA 3WG4A 1FMD1 4PF1A 1J3PA 4XF9A 1YXWA 2VOWA 5FPZA 2FDFA 4IV3B 4AF9A 1UAIA 1I6XA 1BZWA 2CV6A 1XYPA 3ES4A 2XJUA 3M8LA 1N1YA 1WLTA 1MS0A 2WABA 3MHZA 1F31A 2JJ6A 4KI5M 5IFTA 1OFSA 2QBXA 1F8VA 4BA6A 2A3YA 1JUHA 1ZX5A 4Q29A 5I0RA 1FPN1 1STMA 1V6KA 3POFA 1PO12 2XUMA 5BNNB 1RUF3 2VQUA 4QM9A 1WUVA 4HANA 4O9EA 4UFLA 1HB4A 3UL2A 2WT0A 5IK7A 1VJ2A 2JDZA 4OZOA 1ZRDA 2UY9A 3ZOIA 2NQYA 4ORFA 4QPIB 3ORJA 1ZZ7A 2DCYA 1UQXA 2QQMA 5FZCA 5GLWA 4EWAA 3NV2A 4IGQA 2OX0A 2H0BA 4HT1T 1OA3A 1RIRA 1NA1C 3ZX7A 1OLQA 1VB4A 2BBAA 3BTYA 4XBNA 3ST7A 2HWB2 5A6QA 4XUOA 1H6YA 3T4HB 2ZTNA 4JGZC 4SLIA 2X5IC 1OF3A 2VC9A 4LUKA 1ASJ2 2AEZA 3UV9A 2CSGA 2VVDA 2JDKA 3PNAA 4OI2A 1UPIA 1DZQA 3A0NA 4GWJA 3EJKA 1A6CA 4XIKA 1R1A1 2FMDA 3OPTA 4FFHA 4BE3A 4AW7A 5JR2A 2HJIA 1UY2A 3HOBA 4Q4V3 5L9RA 3KQRA 3MW3A 4CP2A 1JS9A 4O9GA 3OUIA 3PLQA 4RQPA 4EROA 4N53C 2Q30A 1MS9A 1XE7A 5DDJ3 5FZIA 1FATA 4ZHNA 1YQ8A 4ISQA 1OOPC 3DF0A 4W4ZA 5HXVA 5IFPA 3AX4A 1RUG3 3LCPA 4QPIA 4RHV1 1OKOA 1QOTA 1WD4A 2UWCA 2X8KA 3OGVA 4Y1UA 3USUB 1QJX3 1OBNA 2XGXA 3FFZA 3IMNA 4OHVA 4R4XA 5E8AA 5HPOA 3SNMA 2HLEA 3ZYIB 5CG8A 4FPOB 4A45A 2XPJA 1GP4A 1QDOA 3ASIA 1PZ7A 1Z7S1 2J1UA 3OEBA 4K20A 5HCFA 5CB7A 3LOIA 1QJX1 3T1MA 3VKOA 4HKLA 2VZUA 3LDKA 1VLNA 1OLMA 1OQDA 3MIEA 2FMYA 3GXUA 4XCAA 3GDBA 4DEQA 2XLAA 3M3CA 1MZ5A 2O8QA 2XBO3 1RXFA 4ZS3A 4A44A 1FMD2 1Q3EA 2ZHKA 1GFF2 3KF5A 1E5IA 1YNAA 1J3QA 3KSCA 3MEPA 4N43A 5EPAA 4L97A 4QB1A 2CTVA 1W6QA 3N3HA 2DUQA 1RB8G 2XJQA 2A70A 4YFZA 3WW1A 4QX3A 1R082 1T2XA 3AL6A 1K12A 4Y1YA 3ZLIA 4C1XA 2ZPXA 5JPMB 2XWJB 1UWWA 4QX2A 3RFRA 2VQTA 4CCDA 2ZKLA 4CU8A 3SC7X 3THPA 4KU8A 3E5XA 4Z2WA 3EQEA 4UF0B 4XQDA 1BVVA 1KS5A 2RS53 2V72A 2XONA 4YGCA 3THCA 3WW3A 3WDTA 1ONAA 4K9SA 1MQTC 3KLSA 4GALA 1DGLA 4RA0A 2VO5A 1LCLA 1DU3D 2ZMNA 5LY1A 2JDMA 3N7JA 1RITA 1ZM1A 2KD7A 3UGHA 5JOWA 5F39A 2VOKA 3ON7A 5C70A 2WO7A 1W8ZA 4OYUA 2BQPA 1POQA 3ZFEC 1IOAA 1PZ9A 2XG3A 1WCKA 3VZJA 3ZXFA 4D7YA 1KJRA 5A1LA 1VBE2 4FPYA 3KVAA 3BOWA 3U75A 3S30A 4A7ZA 4WZFA 4HN1A 3RJ2X 5F7UA 2X29A 4XXPA 2XUEA 4XFHA 1FAYA 3VBUC 4B4RA 1VIWB 2WNVB 4GD4A 4XJWA 4YM0A 3DPRB 1O5LA 3RZMA 2D3PA 3HT1A 4AVAA 2XL9A 3APBA 1WD3A 4Q5OA 1OPMA 2YV8A 1GQGA 2V73A 2PHWA 3ROUA 1DLCA 2PN5A 3HQXA 4PQ9A 1UN1A 4RS5A 1GKBA 3AZXA 1DDLA 2WWUA 1FMD3 2RM23 3RQ0A 5IATA 3D5OA 5A3PA 2K2SA 1W8WA 3CMGA 3J7MA 3JQWA 4K21A 4EN9B 2EA7A 1OI6A 3JBG3 2CYFA 4IE5A 1KJLA 1SCRA 3JXSA 1J59A 2YBPA 4CCCA 1J3RA 4MHRA 5F3EA 1AYN3 3K4DA 5F8PA 3VDBA 1GMMA 1PNFA 2WS91 1GWMA 3TN91 2D44A 1NCQC 5BUVA 4Q8KA 4L92A 4YG6A 4AEDC 5DUWA 1BEV1 4XOGA 5FY5A 2Y6LA 4QQ2A 4Y4RA 1B35A 1CAVA 1H9PA 3JD72 4CA9A 4Q4Y3 2RE9A 3DKWA 2BFUL 3HN3A 4GXLA 4ZS2A 4BU2A 1UU6A 1LOFC 2C9KA 2ZA9A 5I0DA 1VBD3 4LBQD 4AI1A 4QMAA 1BXHA 4BQ4A 2PAMA 4Y20A 3C7OA 2AUYA 1FPN3 4META 1G9CA 2AYHA 1ENXA 4DOUA 3AKRA 3WF0A 4LKFA 1TNRA 2LRPA 2OQ6A 3UKVA 1U5ZA 3H3UA 2EAAA 3LPGA 3WEZA 3WZ1A 4E4SA 4FP2A 2CDOA 3VDDA 1KFUL 5CFCC 4AQSA 5JWPA 1QJU2 3ZSJA 2QZ3A 1D4M3 2B9UA 2Y8KA 3H3LA 1L3JA 5DAXA 5LZ6A 1JOBA 4IL7A 2Y64A 1JODA 5IVVA 1UZYA 3THDA 3KHCA 1Y9MA 3PUAA 5F5CA 3PVBB 1V9U3 2WBKA 3NKTA 1TMF3 3ZFFB 2OA2A 2VY0A 1BK1A 1UCXA 2UYAA 5I93A 3ACIA 1V0AA 3RZZA 2RR13 2J1RA 3T4VA 1JH5A 1NCQA 4QB2A 5FXWA 1PX3A 3C3VA 4L8QA 5LBBA 1CAVB 1R091 1CONA 3HBKA 2Y6KA 5FKBA 1R64A 1QWRA 4XAAA 1Q43A 4YW2A 2WDBA 4J1WA 1G86A 4YW3A 1OC1A 3DUIA 4N9IA 2JB8A 1VBE1 4IGPA 4NWVA 5LRSA 4WZCA 1QU0A 2VNRA 5D21A 3POYA 4QX8A 2HWD1 4AE2A 4Y1XA 5IVCA 2HBUA 1S0IA 2IXIA 4Y33A 3KGZA 5FZEA 5I8SA 4OLLA 1FV2A 3OD4A 4HK8A 4OI1A 2P3JA 3MDPA 2X5IB 2XVGA 3UKTA 5DAQA 1OLRA 3KHBA 1N47A 1RC6A 1SFPA 4XVHA 5E6HA 5LA9A 3ZYPA 3I3BA 5C9AC 2BNOA 2JG9B 2ZEWA 4GB32 2JD4A 2L9LA 1NCRC 2P3YA 5BNNC 3H50A 1JZ6A 4OULA 2DUOA 3GF6A 4XPVA 3V64A 5C5TA 1HQNA 2ID4A 4NROA 5JSRA 5KHJA 2CWSA 2NZ9A 3GBWA 4IETA 4LA3A 4MGYE 4UFMA 1WZXA 3RNSA 3VZKA 2RS13 2AENA 4LO7A 5D2AA 4XFIA 1H30A 2HWF3 1R081 2WO3A 2WNVA 1AX2A 2WT1A 3M3OA 4TWTA 4AVSA 3T2OA 4XFFA 1JZ8A 2GMEA 5EZWA 1QJU3 3VL9A 1QKQA 1YFYA 3PIJA 5LCWL 3HJRA 3RZLA 4PDWC 2B42B 2GMPA 5F5QA 1QJY1 2C0ZA 2HEVF 1S0BA 2QQJA 3S6PA 1EYBA 2VOVA 4KNCA 4MX3A 4UAPA 3E97A 4ZY9A 4QHBA 4DEVA 5FJHA 1Y7BA 4YW4A 4IV3C 4PIZA 4A4AA 5IVBA 1AR81 3ZXAC 3D4KA 1RUH1 3W59A 1OD5A 1ZNPA 4XXAA 2DF7A 4AOCA 3UYJA 2OS2A 3Q8AA 1XPWA 4Q26A 4AEMA 3BOPA 5CA6A 4JHZA 1H2KA 1U5XA 1PHMA 1YCIA 5J7MA 5LBEA 5D1IA 1ULDA 4P9XA 4BQ2A 4E4DX 2PQSA 5JOXA 3MFAA 1UXXX 4SBVA 2VR4A 3LWCA 5A33B 1WMEA 4PIYA 3VBOB 5JVVA 2DYCA 4HLTA 1EP0A 4CCKA 2XBO2 2FZ2A 4A2UA 4P5YA 3AMHA 4UI9L 1PVC3 4CEWA 3JCIA 5FXXA 2PAEA 4YPJA 4B8EA 3WHUA 2HEYF 1WA6X 1IG3A 2WQ4A 3FMGA 4PHZA 3TEZA 1HXS3 1FOD3 5C3PA 2VMEA 1H0BA 1KDKA 5CAZA 2RMU1 4LBKA 3KVBA 4JQTA 4JRLA 1J1TA 1PZ8A 4ATEA 2ZABA 4BJ0A 2EAKA 4Q4X1 3INAA 4HL0A 2VMFA 3OYWB 1AYM3 3GBGA 5FYTA 1RUC3 4HFSA 3R4SA 5FFOC 5I8YA 2BEOA 5GALA 3TN93 4Q4V1 4K8RB 4QGNA 3EO6A 4WM7C 2WZ8A 5IJRA 4COUA 1TQ5A 5F37A 1LOEA 1DQ2A 3MFCA 5C5UA 5BNOC 3ATGA 5L19A 4UW5A 5M0TA 4EN0A 3E5UA 4ZZ5A 3PL0A 3WD5A 1RUI1 3KT7A 2G9ZA 3UETA 2C26A 2OQ7A 1X9TA 2PLV2 4R8HA 1Z78A 5EXOA 4XTMA 1N3OA 3WINE 3B7MA 3WQ1A 3U07A 2BVBA 1UY3A 2ZMLA 3ACHA 1CPNA 1SDDB 3H8UA 2UU8A 5CBLA 4Z82A 5J37A 3IIIA 3A4UA 1LOAA 4FOWA 4OI0A 1VBB3 4ASLA 5T50A 4YM2A 3T30A 1C1LA 2W08A 2YXSA 1DG6A 1TME1 1XJAA 2V4AA 5BYNA 1D0GA 3AMMA 3EXUA 2VGDA 3NJVA 2IWGB 1NLQA 4C90A 4NIGA 1HXS1 3MPBA 1W6MB 4AZZA 4D3WA 1QJY2 1JYWA 4QDQA 2ADEA 3R4DB 4XFCA 5FYBA 1QJU1 1PVC1 5I8TA 4AXOA 3GZEA 4FBFA 1AR82 2PHFA 1IZ3A 1W06A 1W04A 2VUDA 4BQXA 3SCHA 4BQYA 4MVTA 4OFGA 2FQPA 1BK0A 2Q8DA 4NRPA 1F15A 5DABA 5FWJA 1HJFA 2RS51 1W9TA 2EIGA 3AXEA 2C9AA 4BDVB 1IPKA 2ZEZA 1A34A 2YGLA 2WLQA 3I49A 1VB2A 3RWKX 4BIFA 1UXZA 1PMHX 1VPHA 3G7DA 3KCXA 3ENRA 4Y5SA 2WYFA 4AVTA 1GNZA 1US2A 1DQ6A 1SLTA 3VHPA 1B09A 3JUUA 1I1EA 1RHI2 5JPNB 2ZHNA 1Y43B 1OH3A 4XEZA 4XF3A 2P17A 1G6NA 2QQWA 4WBBA 2DFBA 4W6XA 1W3VA 2BDRA 4S2FA 1HQLA 4QM8A 1FNZA 1X8EA 1HJGA 2BP6A 2VMGA 3M2MA 4LR4A 2VW1A 2D6PA 1ZRCA 2VZRA 5AVPA 4XDPA 3I97A 3V65A 4XIOA 2HWF1 4DXSA 2X05A 2D97A 2XDVA 2VUJA 1ZRRA 2NN8A 3GBFA 3SH3A 3NV4A 4UT5A 5A3NA 5BNNA 4KMQA 2VULA 3NAPB 5FY4A 5FK8A 1CZTA 4IEUA 3ZO0B 3KS7A 4XABA 4IEVA 1LGBA 2VM9A 4N9HA 2KA3A 2DVDA 1EV12 1GZTA 1ODMA 3BVCA 4OUEA 4XFBA 4CCMA 3WG1A 1HN1A 3NV1A 4GJYA 1IPJA 2W1QA 1RUI2 2J1EA 4LBQB 4CEYA 3TOJA 5FYMA 3UNPA 2VMCA 2O0OA 1DFQA 2WC2A 3NNLA 3RYKA 4B1LA 4FXKB 3M7AA 4V2VA 3GZTB 3VBRC 5JCTA 4MUVA 1YIFA 2WSVA 2BRTA 3ZM8A 3SCFA 5FZOB 5F3IA 1GQHA 2Y0IA 5FPBA 2Y6JA 3OSDA 3WQBA 4CPBA 2J1TA 1MQTB 5FUNA 2XH6A 2WL1A 4FXGB 4BQ3A 3CZJA 4I30A 3VBFB 2Z5WA 3OD0A 1RJ7A 1TME2 2H0VA 1CAXB 3KT4A 4CDUA 4QU2A 2NMOA 2E31A 2VAUA 2ZMKA 4AL9A 2DWRA 4CP9B 5LBCA 4CDWB 4ET7A 2JX9A 4Q4Y1 1BEV2 2XXZA 3IDEA 3PDQA 3RPQA 3VDAA 5JOZA 5JOYA 1VBB1 4ONUA 5IUQA 3I59B 2PELA 4E8DA 1MZ6A 5LATA 1OA2A 1TMF1 5J09A 5IT6A 2WAAA 2VD7A 2PXJA 2WZEA 5K8SA 3E6BA 5CU1A 2ZX1A 3IPVB 3LIHA 4NHLA 4DXTA 1VRH2 4DZGA 2CAUA 5FBJA 5LA1A 3DYPA 2OYZA 1CVNA 1V6OA 3ME2A 4CDXA 1UY0A 1FI2A 2TBVA 3AP4A 4LBLA 4E27A 4KWUA 5FZOA 3HIFA 3RYRA 4DQAA 2IXJA 5IVJA 2CWMA 2ZGOA 1YWKA 1N1SA 1C8M2 1N1VA 3LZZA 5HBAA 4CYDA 4N7UA 4RN5A 4R9BA 5CZKA 1XE8A 4N53A 3WDUA 1PO23 5ACA3 3NVCA 3WY6A 1RUOA 3DL3A 2VZSA 2RMU3 2K0GA 2J42A 2WNUA 1SLLA 2DVAA 4JAAA 1P8JA 4DPNA 4IV1C 4IV1A 3NAPC 4IEQA 4CSWA 4KL1A 2YU2A 4K6BA 4Q4W2 4M4PA 5FZGA 3FBMA 3VZNA 1UX6A 3WQ7A 4QX5A 1RVF3 2VVFA 5A6XA 1ND2C 2VZ1A 1LNSA 4YG0A 4EV0A 4KWJA 4JC1A 5T5PA 4QKDA 2BUKA 1AL0G 3GCXA 1W6PB 3MIFA 1F9KA 1PGW1 4COVA 1H2NA 1R1ZA 4Q1RA 1O3TA 3I2OA 2Y60A 4DY3A 4L11A 2D5HA 2VCBA 1HXS2 4B29A 5A3MA 2DVFA 3MF9A 5EV7A 3C7FA 3VBOA 2F17A 3W21A 1LEMA 3N7LA 2ZAHA 3FBYA 5K0UC 3AP6A 4NOTA 4Y5Z0 3AP7A 2W91A 3MIGA 4EZ4A 4RSUA 5FXVA 5CFCB 1BMV1 4QGMA 3CU7A 4U36A 5I0UA 4NWWA 4Q4Y2 1JZ2A 3WT3A 4EN7B 4MGTA 3K77A 1NKGA 1XB9A 4DINB 3DCQA 2XJTA 3AXDA 4GQ7A 1WW5A 1W6OB 3AYAA 2Q8EA 5ACA2 2DDUA 2DCJA 3BB6A 3ZXEA 2IXLA 3H7YA 3LPFA 4JDOA 1FYUA 4CCNA 3SH5A 2AACA 4FOVA 3LDBA 1V6JA 1ZZCA 1DCSA 1ZBA1 1OXCA 5CFDC 1UYPA 2RDRA 3VBFA 3WF1A 3S5AA 5DZFA 3HBZA 3DYMA 1HRI3 5FQ0A 3BTXA 2BBVA 3MLJA 4DNYA 4MSVA 4NIDA 5GLUA 4HSJA 4Y1VA 3CJIB 1YJLA 3Q8FA 3ZN6B 2DV9A 1HRI1 1DYPA 1OSGA 2XBO1 4QT6A 4JGYA 5DQ0A 4YVSC 1M06G 3F2ZA 1ZBA3 4GH4A 1JZ5A 3OJBA 4YVWA 3RZHA 4EYUA 2ZEXA 4LIVA 1QGLA 3T0BA 4AI0A 4MZUA 1NA1B 2IXCA 2VVEA 1XNKA 4D6RA 1GOFA 1VAKA 3ES1A 4YM1A 1CX4A 3IT8A 4NMIA 5JMCA 2B45X 3U14A 1RUG1 4RHV3 1IS6A 1M4WA 2PLV1 1SFYA 2XJVA 5JI7A 1YYNA 2JIGA 2WIIB 1W6PA 2Z4FA 3T0AA 1CJDA 3ZSEA 4XHXA 3I2HA 5HCBA 1YFXA 2NLRA 4XF4A 4W8JA 1Y9GA 3BIWE 2PQQA 4MGKE 1KXGA 2AZ5A 5J3UA 1SBDA 3PURA 3C7HA 3RJRA 4COZA 4NHMA 3HPNA 3AMNA 2E7TA 3J26N 3VDCA 1D0HA 2RJKA 4LBJA 3OCPA 4EWEA 4AEJA 3I2FA 2XJPA 3A0KA 1G8WA 4QPYA 3I54A 5FMOL 2CGNA 5FRAA 1EAH3 1JOJA 3E5QA 5C8WA 2Q1FA 5CFCA 2QDNA 1K3IA 1OD3A 2A6VA 4JKLA 4CCEA 3SXWA 5K9YA 1NLSA 2DBNA 3KF3A 5GLVA 2R042 3UKNA 1RUJ3 3BU0A 2VQ0A 5FZMA 1PIV3 4AVBA 4UBGA 5HV0A 2C5DA 2GN3A 1RUNA 1F4HA 5CKMA 2J1AA 1RUF2 1AZDA 4AG4A 4B3NA 3ZXJA 2ZGTA 4EZHA 1QXRA 2VBBA 3VHRA 4Y5TA 3LEGA 3PVOA 2D40A 2Q8OA 1VP6A 4Y20B 2JDHA 3NSTA 4FPJA 5ABJB 1JHJA 2QVSB 4QQLA 3O1PA 4MG2A 2ZS6B 3IB3A 3VKNA 1AUYA 3AL5A 3WNXA 1CGPA 1MACA 1HRV1 1RUE1 5L36A 3AZVA 2VE1A 1POV0 4HKWA 1ZREA 1PO21 5FYCA 3ZDSA 4V2WA 3MZHA 2ORXA 2VCMA 3QACA 3VHOA 3U10A 4FTEA 3I3MA 2VECA 4CU6A 3VBRB 1UIJA 3I2DA 3NNGA 2I45A 2YHJA 2JG9C 5A1FA 1O3RA 2D5FA 2KM2A 1ODNA 2Z79A 4KWKA 1APNA 5LWBA 4QQHA 3IZOA 3OGJA 4WM7A 5AC93 1ZA7A 1JZ4A 2HWE3 1DQ4A 1LR5A 4H3WA 1LKNA 2QQUA 3MYXA 1ENRA 3CF6E 3H1YA 3VBUA 1OURA 3ZFEA 2ZGSA 3TN92 2XVKA 3RI8A 4JGZB 3PU3A 4IUGA 1W9SA 5EYYA 2AR6A 4D69A 2X10A 3P1IA 3JD71 4YWAA 3AP9A 1LENA 4RYDA 1AR91 3FJSA 2ZCWA 2WFF1 4XFAA 3LA3A 4K40A 2XL7A 2LTNA 3HQRA 1HQWA 5APAA 1R093 4AI2A 1AYN2 5AVAA 3PU8A 2AH2A 4NPLA 2W46A 3KM5A 2XQRA 1PO13 4KU7A 2VL4A 4BYYA 4URAA 4XF0A 4Q8LA 4URTA 1V00A 1BVP1 1IPSA 1OPOA 3USSA 4IEXA 5K0UB 1LRHA 2NPIA 2GDFA 1Z7S2 1C1FA 1KRIA 1QJX2 3EHKA 3M3EA 1JZ7A 1WMFA 1VALA 2ZKNA 3BPZA 2R7EB 2DUPA 4QDRA 2EXIA 2R041 1QDCA 4R9DA 3VL8A 4IV3A 1FPN2 1OUSA 1WMDA 5HCAA 4WVZA 2JKBA 4QQOA 3PMSA 4ZPIA 4ZU5A 2RG4A 1O4YA 4LKDA 5BPXA 3VBFC 2FDIA 2R49A 3G6JB 4E2QA 1MVQA 1XNDA 3J7HA 2BWAA 3LDRA 3ETPA 1JBCA 1W9FA 3UGFA 4DUWA 5ABJA 1VR3A 3D8CA 4TZDA 4I0BA 1VBB2 5L9VA 4Z2AA 1SEFA 4CRQA 4EQVA 2RJ2A 3RZKA 4AHXA 1L7RA 2I2SA 4CPBD 2VCAA 3FLPA 3LEMA 1K5MB 2GSYA 4D0QA 4NRMA 4RD7A 2LS6A 2EALA 1JN2P 1UNBA 2GH8A 2OUJA 3WUDA 4K1YA 2A73B 2OT7A 2W95A 5KWRA 1S0JA 4G4FA 1GANA 2P2KA 3R6SA 5AC91 5FAXA 3SKJE 3MV11 4LLOA 4XBLA 3W9AA 4BIOA 1R1A2 4CCLA 3D6EA 4NPRA 3B00A 2EVXA 2IZWA 2VZPA 1C8M1 1NXMA 3IKWA 1RUI3 4ITCA 3DPRA 1XNAA 4O7XA 2NMNA 3DPRC 3IM0A 4TYSA 1W8HA 5LY2A 4LHLA 3VLBB 5C33A 1PGL1 3F95A 3MUY1 1AR63 5HV4A 4TXWA 5FOBB 2ZX3A 1LB2A 3QCWA 1VMHA 1O6UA 2VMHA 4LE3A 1QNWA 1W3XA 5GJ6A 4C0BA 2XR4A 5C7GA 1KDMA 4M3CF 3ZFEB 2PAKA 3O1SA 3IAQA 5FJKA 1BHGA 2Y34A 4ZXEA 1K42A 3GYDA 3WNLA 1PGW2 3DV8A 3IMMA 3PJYA 2BERA 4QPGC 1POV3 1GZ9A 2BTVC 3URFA 3ZSLA 5FMOS 4YZ5A 1GWKA 2ZX2A 1WMXA 1WW4A 4ATFA 5FCCA 2QUOA 1IS3A 1ULOA 2OXBA 2OZJA 3NNJA 4RGAA 4Y26A 5FZ9A 3ZYGA 2MPFA 4OHXA 5JIAA 1GQPA 1GBGA 3K75B 4PBOA 2BW8A 3GZUC 1LGNA 4LULA 4NRQA 4A7KA 2YUEA 4HXCA 4YLZA 1RTVA 2YGMA 2KR2A 4FI9A 4A7YA 1HIXA 1I9RA 1PIV1 1GOHA 1RL3A 2WS92 2WWJA 5T52A 2R063 3OUJA 3WP6A 2UWBA 2ATFA 2KXLA 4G3YC 4JV4A 5FO9B 4OI4A 5C3SA 2W94A 4WM8A 3QH7A 2FBEA 1DIWA 1JOPA 2EIBA 2WN3A 3J8F3 3ACGA 3RS6A 1DQ5A 4CCOA 1RUH3 4R4ZA 4WVMB 3O1RA 1YHFA 3NJYA 5A32B 4BXSV 2CL2A 1SG3A 4YSFA 1QQP2 5DAVA 1O91A 1UY4A 4GH4C 3AMPA 1DGRA 3MW4A 3E6DA 3ZVXA 4AGRA 4CDXC 1OT5A 1RUD2 4M4RA 5JDBA 1H8TB 3GCWA 4LE4A 4HVQA 5KC5A 1W03A 3LQCA 1XNTA 4P9IA 2P5BA 1GUIA 1SLIA 2JDUA 4HBNA 2QCSB 1SACA 3FL7A 1EAH2 4GMP1 1HW5A 2O1QA 5ACA1 2A6YA 2A6XA 2FZ1A 1PK6C 2ADDA 3QH6A 2ZGKA 2O8OA 2YBSA 2DVBA 1IS5A 2P3KA 1HX6A 5K7PA 5G04L 1JTZX 3RMYA 4LUMA 2EICA 2FDJA 4ARYA 2J1SA 1DZTA 2QE3A 4N90A 3I2KA 4F7ZA 3D3AA 1C8M3 4YG3A 5C4WA 5JUVA 1U5YA 4IE4A 4TSVA 2WNVC 5F2SA 1CESA 1RMU2 3U37A 3N9QA 3WNNA 1BLZA 1D7PM 4ES8A 3B9CA 1S0GA 3AMQA 3DN7A 1MVEA 1L7QA 5SV8A 4OCTA 2VXRA 4KWLA 4PDWA 2P4EA 2ZX0A 2HH9A 1UOGA 4H7LA 4E2SA 5B4XA 1W05A 4IEOA 4YW1A 1YIPA 4Q0UA 3ZKYA 4CDXB 3GGLA 4QDSA 4D6SA 2PFWA 3W5NA 2YMZA 2RJLA 2I07B 4CUBA 2HWC2 3WUCA 3VHNA 1X82A 1F4AA 2P37A 2DCZA 4FP3A 2R1BA 3ZFFA
chains in the Genus database with same CATH topology
3RYPA 4P9LA 3ZFGB 3FZ3A 3NWKA 2SBAA 2WFF3 2GALA 4LBQA 1EPZA 3LA2A 1YLLA 3IDCB 5CFDB 1EY2A 2EXKA 1AL21 3WCRA 2XLGA 3HWJA 3O0WA 2YZ4A 3QD6A 3RMXA 2BPA2 2RS11 1CJPA 3PMEA 4LA2A 2OVUA 2R043 2WNEA 4FPFA 3C2UA 2B5HA 3WX5A 5C6CA 1C5HA 1RUF1 1G9BA 1ZBE1 1VBA2 3POSA 4KG8A 4HMZA 3ELNA 5CADA 3NV3A 1A8MA 2K9ZA 2DURA 1NG0A 2JG9A 1F5JA 3O14A 1LOCA 1XNCA 2WA4A 1RUD1 1LHNA 5KXEA 1RUE2 4QPGB 2HYKA 1VBC3 2PA7A 1YRZA 4AHZA 1CAUB 4XETA 4FO9A 1BEV3 1N1TA 1ULFA 3AZZA 1ULGA 2HWF2 1QQP3 2WKKA 2YDEA 4YNIA 2OIIA 2NP0A 1YJKA 3KT1A 1NZCA 4I09A 1LOFA 3AZWA 1URXA 2F6BA 1ENSA 4GWMA 4BHPA 4CEWC 3OBRA 4XFGA 4S2HA 4KGGA 1C5IA 2VW2A 1OQEA 1RUJ1 1RINA 1OHFA 4KH9A 2R061 1BJQA 1JHNA 3PVEA 1LULA 1PMIA 3VBUB 3ZXLA 1B35C 3VBHC 5BNPA 5T5OA 1RUE3 1HRV3 2X5IA 3V0BA 2HWC1 2PHDA 2ENRA 3ZFGA 4HPKB 2D43A 1ASJ3 4YFWA 4CEYC 1G7YA 1S0FA 4HN0A 3RI9A 5EWSA 2A7AA 1WLDA 1WCDJ 4M00A 3U11A 4XTPA 1AYN1 3WG2A 1QNYA 3OYWA 4GULA 3NW4A 2DU1A 4LBMA 1V6LA 5JR7B 1MS4A 2PHRA 4IESA 5FTTC 3S7IA 2DCTA 2WT2A 4L99A 2E9QA 3ECQA 1QMJA 4Q0VA 1D2QA 2ZX4A 3O0XA 5GM0A 3AB0A 4KQ7A 2ARXA 4I2OA 5KHHA 1AYM1 1DF0A 2DTWA 2ZOEB 1X33A 1FT9A 4OHWA 3QLQA 2GNBA 5GKAC 4XJ8A 4XJ9A 4YZ3A 1NCRB 4FOQA 3CNAA 4FTBA 1A3KA 3WCSA 4GB33 1U5IA 5AC92 1BBT2 3NJZA 1UF2C 1GYKA 1G9DA 2B39A 3UJQA 3T2TA 5FLIA 4A3XA 5FQ0B 1AXYA 3JB8A 3OY8A 3CL1A 4FTSA 2R073 3JB4C 4HETA 4U2AA 4YYOA 4YZ2A 2WINB 2UYBA 2D6MA 3B9IA 1YI7A 3AJZA 4YRDA 1YO8A 4WM8B 1R092 4W65A 1IHMA 4Q27A 4F3JA 1GV9A 2RS12 2PHLA 3O5SA 3B69A 4DY5A 3FC0A 3MLKA 2Z2SB 1AR93 5L7OC 4QPIC 1G9FA 2BNMA 2SLIA 2QJVA 5BNOA 3D0JA 1UD1A 2G9GA 4CDQB 5KHKA 5D8AA 1K5MC 4AEDA 4X6RB 4CZSA 3OTFA 3M4FA 5JLVA 3I7DA 4UXAA 3B93A 1PVC2 2GC1A 1DQ0A 1NLRA 3BCWA 3ZMNA 2GH2A 4LO6B 1TE1B 1N3QA 4RFT0 2A75A 1LU2A 1W6NA 2JG8B 2ZAAA 3SISA 4CDUC 3KB5A 1HDKA 2D6LX 4JVAA 4H14A 3GNEA 3LAGA 1C8NA 4HVOA 3WXPA 4ZKTB 1AR72 3NO8A 1E57A 2QKDA 1H8TA 1I3HA 1QH6A 4M3CE 3B5LB 1ND3B 1VBE3 1VRH1 4JGYC 5JZGA 3H1MA 1LHUA 5L7OA 4Z1VA 2Y26A 3FLTA 1LJ7A 1S1AA 4BLJA 2UWAA 5D8AB 1AJOA 2DFCA 2VMIA 5B2GB 5KC6A 2YROA 1V9U1 1XNBA 4MH0E 1S2KA 4FPHA 1RUG2 2LM3A 4IV1B 3I8TA 4KGQA 4YVSA 3VN4A 4BWOA 5BNQA 1LHWA 3JU9A 3P3PA 4LT5A 3HR9A 2Z42A 2HWC3 2R1DA 2F4PA 3ACLA 1QOSA 2ZGLA 1Q8OA 5KXCA 2Q1MA 4WM7B 3ZYJB 4JRAA 3TB0A 1NQDA 2RMU2 1XRUA 5T55A 1QJZA 4XJZA 1W6OA 1C57A 3VKLA 3B01A 3M3QA 2VH9A 2XWBB 1XYNA 1QXJA 1PK6A 2IFWA 1QH7A 4RR3C 4OVEA 1NE6A 4YZ4A 2AREA 3TBDA 4M3CB 1KITA 1NCQB 4WVWA 3IN9A 4XJAA 4YW5A 4OHYA 5C9AA 2GMMA 1UKRA 3JBG1 4JDMA 1S2BA 2AGSA 4AWDA 1H8TC 1WBFA 2ZGRA 4MXWB 4LO5B 4E4ZA 3RRDA 3TAYA 4PDWB 1GSLA 1C28A 5K0UA 1HRV2 2Q4SA 3VDDB 5KHIA 3J8F2 2WZR2 3VBSA 1PO22 4AYUA 3O12A 5H9SA 2Q5TA 3O0VA 1AR71 4ISRA 3FE5A 1RGSA 4NVPA 1JW6A 5BNOB 1UKGA 3B02A 1LHVA 4QPGA 3TNQA 5JZGB 2A3WA 3VV1A 4YZ1A 4IEYA 2EF6A 5BNPC 3VBHA 1U12A 1DGRN 5C8CB 3M3IA 4K1ZA 1RJ8A 4X8PA 3MW2A 1H8VA 3ZFGC 4BZ4A 1TNFA 1V6IA 1AR73 4M3CA 5LEKA 2JG8A 1W6NB 4AFBA 1X7NA 4CP0A 5I0SA 3AKSA 2D7FA 3AFGA 4J1XA 4Y22B 1VAVA 1SBFA 4H7MA 3PVNA 5A32A 4Q4W1 4CEWB 4F83A 1BCXA 1TME3 1GZWA 1RHI1 2JEMA 1X50A 1J1LA 3RG0A 2W39A 1LEDA 5FO8B 5GZEA 2R16A 4BLIA 4RS5B 4WVVA 3FUQA 3VKMA 2WFPA 2BFUS 1X36A 1UW8A 4YARA 2YC0A 3AP5A 2R071 2GZWA 1IKPA 2R30A 5C8CC 2YY1A 3VZLA 1Q8QA 3KZ4C 5F1RA 5DZGA 1ENQA 1S0EA 2BYVE 5LEJA 3OF1A 2XHKA 1MS3A 3VBSC 4Y22A 1UPSA 2VOXA 4YGDA 4XILA 3WW4A 1YI9A 3VBRA 3ZXKA 2Q1ZB 1DGWX 1H1IA 3FLRA 4MXVA 5DG1A 1NA1A 4TLFA 5F9TA 3LKJA 1H4GA 2QQPA 5I91A 3ZPYA 2PLV3 1NXD1 2A71A 4I02A 3WDWA 3M1HA 4V1PA 1LHOA 2UY8A 2R0HA 4FAHA 1MZEA 1ZBA2 5LK7B 1R1A3 5J48A 5LRRA 2VU9A 1I5ZA 1XU1A 1FX5A 3IPVA 1ND2B 3VKFC 1CAWA 1H1MA 2IXHA 1V9U2 1WA4A 1VRH3 3R4UA 1O4TA 4BMBA 4I0AA 2E7QA 2VNOA 4BM8A 4MGIE 5E88A 4FPGA 1LU1A 4EN6B 4FCAA 4PBPA 1BKZA 3HT2A 1ZZBA 1AR83 4Q4X3 1SLAA 3FUOA 1ZVFA 4JTNA 3CEWA 1JXNA 2FHRA 3ZXDA 1NY71 4Q1PA 5BXXA 1QJY3 4K3UA 4X6QB 4MV2A 1TEIA 3V0AB 2W68A 2RR12 2WNUB 4PIXA 5GZGA 1UMZA 3GALA 3SHRA 1REFA 2A6ZA 5BV6A 1HKDA 4AQTA 2YYOA 1CAUA 1IKQA 5IK5A 4P9JA 1PIV2 2VUAA 2D93A 5H9QA 3VZMA 4BOWA 1RMU3 5BNPB 1H9WA 4MYEA 1O3QA 1AJKA 5T3NA 3V0BB 4P9WA 3VBOC 2CNAA 3ZSKA 3GHMA 5BY5A 3EBRA 1ND3C 4AI3A 5KXBA 5CNAA 5EJ3A 5JZGC 3U0ZA 4NN0A 4AQ6A 2ZGUA 2W0XA 4RGGA 3M70A 2D6KA 2ES3A 4AEKA 2R0FA 4C0HA 3RWNA 1V6NA 4L9BA 4F8AA 4HVRA 4I01A 1QY4A 2E6VA 3N36A 4P9GA 3FX3A 4E9KA 5GLZA 4BQ1A 3NAPA 1WCSA 4RQPC 1ZYBA 4FVVA 4CDUB 4HPKA 1WGPA 1ND2A 4AVCA 2JG8C 4Y1ZA 5L73A 4JCKA 4Z07A 3S7EA 3L9JT 2QZ2A 1BBT3 3SITA 4FPEA 4LEJA 4XJUA 2B8MA 2WZR3 3MI8A 2MHFA 1LOBA 1RMU1 4GIQA 1VBA3 3MICA 1DQ1A 1MS1A 2VQAA 3POWA 4E2GA 2TNFA 3N4MA 1OMIA 4NR1A 3HN1A 4RS5C 2RS31 2CY6A 4Q4X2 4HKOA 1AL23 2ERFA 2XVLA 1CPMA 3W58A 4LNVA 4FAGA 2JECA 5AFBA 1UZZA 1W2UA 4N43B 1O3SA 1OOPB 1WLWA 4OZXA 1MS5A 3H3ZA 2R072 4LHKA 3AK0A 2XKOA 3MF6A 1ZZ8A 4IEWA 3ZFEA 1QF3A 4MXWA 1W39A 2GC2A 3CJXA 3QBQA 1O7FA 1VBD2 2XLFA 5GZCA 4AFCA 2VG9A 1W0OA 4J6GA 4I3GA 1D4M1 4JTOA 1GLHA 4RR3A 1MQTA 2PTMA 5GZDA 3AYEA 4AHYA 3AFKA 3S0MA 1IQAA 2TEPA 4Z92B 2RM21 5H9RA 4DS0A 5AFEA 4JQRA 2E53A 4HZFA 4YGBA 1RUC1 5TSWA 3P3NA 5J98B 3I59A 3BU7A 5FLJA 1VBC2 4JDNA 5EFUA 3HD8B 4AEDB 2WZR1 1HLCA 3J4UH 2GC3A 1PM7A 1FOD1 1DLLA 4QXKA 3VBSB 2OZ6A 3ILNA 1ULCA 2R6QA 3HAGA 5T5JA 3PJQA 1HV1A 1S0CA 2ILMA 4AK3A 3O7OA 4CDQC 4AGGA 1A8DA 4AGVA 3IIAA 3WVJA 1DYKA 3T1LA 1QQP1 4I0WB 3J8F1 1KS4A 4PLMA 1N3PA 1KFXL 2QDRA 3ZN4A 4MLOA 4FPCA 4S2DA 2MEV2 1COV3 4AFMA 4C1WA 2W52A 1EAH1 4H55A 4HSLA 3SH4A 3AM2A 2RHPA 5T5LA 5C4WB 4LO4B 3CLPA 4XQWA 3BTAA 3ZN5A 5DG2A 3L2YA 4GKYA 2ZHLA 5E1RA 2WQZC 3CJIC 3ILFA 4N43C 4YM3A 2EXHA 3ZMOA 3N35A 5CVRA 5KBFA 2EXJA 5E16A 2WLPA 4GWNA 3JZVA 2WNUC 3GHNA 5JAXA 5FBZA 1V6MA 4AQ2A 1R083 4RQPB 3WOGA 4LO8A 5JI9A 4FOYA 2QNKA 3K48A 3R05A 5D8AC 4Y24A 5T54A 3VDDC 1FV3A 5EYXA 4ZU7A 5FO7B 4QQPA 2H6BA 4COWA 4GB31 2Y38A 3KD4A 5FLHA 1JYIA 1YFUA 4P5HA 5LK5A 1WW7A 4QD2A 2C1FA 4XW3A 1D4VB 5DZEA 4OUSA 1C3HA 1WLCA 3IDBB 4UW6A 4DB5A 4C91A 1SMVA 2ZHMA 3PHMA 2I74A 2WSUA 1RUC2 2WFF2 2D98A 2P34A 1LODA 2ZJCA 3H9AA 4FQ4A 3RSJA 1AHSA 1AF9A 3CJIA 3D0SA 1NQJA 2JENA 4GH4B 3ZIXA 1SBEA 3HMYA 1F5FA 4JGYB 3WHTA 3ZXGA 4AHXA 2QFEA 4L2NA 3WW2A 2DCKA 5I0TA 1FOD2 3NKGA 1RVF1 5HI0A 2D6OX 2MNGA 1EV13 1Y3TA 4AFAA 1XQNA 3V56A 4Q0QA 3MIHA 2RS32 4B4PA 2ZGPA 2IFRA 1ALYA 4UBHA 1O4ZA 5DDJ1 2NYYA 4LLFA 2B46X 3FHIB 2LUWA 3ZN6A 4GMP0 4BCUA 4PJYA 1FXZA 1QOOA 3PTYA 1KD7A 3VBHB 5H9PA 3NL1A 3LGRA 2HWB3 1OA4A 2H6CA 2E51A 3AYDA 3BALA 3ZIWA 1COV1 4LHNA 3VZOA 2CGPA 1VBD1 4B7EA 4KG0A 1X8MA 1MEC3 3IWZA 2ZBJA 1D4M2 2MEV3 4OUMA 1CN1A 1DZRA 1SQ4A 1OKQA 1QHDA 1RUJ2 2XB6C 4Q4V2 2UURA 3WP5A 4DRRA 2PHXA 5E89A 3IBMA 2ETEA 4AHWA 1D2SA 4ZXKA 2OUHA 1AR62 2HWE1 4FQZA 1CAWB 1PVXA 3JQXA 3QOPA 4NO4A 4XF1A 1SCSA 3USUA 1AVBA 2GNDA 1H2MA 4DRVA 4B7KA 1LECA 1AL22 4G9SB 1CR7A 3BODA 4D7TA 2A5ZA 1Q5OA 1VBC1 2PHTA 4GKXA 2V5YA 3WG3A 1PK6B 4D7SA 1H1AA 1Y9QA 3H7JA 4DXZA 4IXLA 2GNTA 1AXZA 3D82A 1VBA1 4XHBA 1SDWA 3MGUA 3DGTA 4CTEA 4CDWA 2XJSA 1UIKA 3SMHA 5JSOA 1WW6A 1RVF2 3OBTA 5GZFA 3MIDA 4R9AA 1A78A 4XDQA 4XZPA 2A6WA 3FFQA 1CD3G 4GA9A 1XYOA 2RS52 2PHUA 4K7JA 1Q56A 3AKQA 2V09A 4D94A 4EJRA 1ULEA 1DBNA 1ZRFA 2DU0A 1MZFA 2ARBA 4M0HA 1RUD3 4YGEA 4I3PA 3ILRA 4PF5A 4FT8A 4UW3A 5J36A 3MPPG 3U4XA 3WR0A 2ZACA 1RUH2 1UL9A 2RS33 2WWSA 1Q8PA 4Q0SA 4PCRA 4WV8A 4X8NA 5DXDA 3TNPB 5FPXA 1NE4A 1SFNA 4ZU4A 1MEC2 2VW0A 4HK9A 1W6MA 2G9FA 3ZYRA 1CIWA 3VGIA 2ZGMA 1B35B 1KQRA 4JGZA 4BPZA 4FSJA 5DUUA 4ES9A 3TYJA 2CAVA 4IERA 2IXKA 3MLLA 3V0AA 2B7YA 2BNNA 3H0OA 1W0PA 2VPVA 3OGGA 4MGZE 4YVWC 1GZWB 5FOJB 3H1WA 1AXKA 3JBG2 2YPJA 4KBBA 1CQ9A 2ET7A 2WZPP 4Q2FA 4GMP3 1ND3A 5JIUA 2TUNA 1O5UA 2D3RA 2A3XA 1H2LA 2PYTA 4CDWC 1DGWA 4FPLA 4OHZA 1QXPA 4XMAA 1J58A 3L2HA 3KMHA 3LSDA 5CFDA 1YFWA 2CGOA 3RDIA 4W6YA 4PLNA 2RM22 3TRSB 3WDXA 4ASMB 3WDVA 3B3QE 2GU9A