2QQLA

Neuropilin-2 a1a2b1b2 domains in complex with a semaphorin-blocking fab
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
576
structure length
554
Chain Sequence
PPCGGRLNSKDAGYITSPGYPQDYPSHQNCEWIVYAPEPNQKIVLNFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKHCGNIAPPTIISSGSMLYIKFTSDYARQGAGFSLRYEIFKTGSEDCSKNFTSPNGTIESPGFPEKYPHNLDCTFTILAKPKMEIILQFLIFDLCKYDWLDIWDGIPHVGPLIGKYCGTKTPSELRSSTGILSLTFHTDMAVAKDGFSARYYLVHQEPLENFQCNVPLGMESGRIANEQISASSTYSDGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLTAIATQGAISRETQNGYYVKSYKLEVSTNGEDWMVYRHGKNHKVFQANNDATEVVLNKLHAPLLTRFVRIRPQTWHSGIALRLELFGCRVTDAPCSNMLGMLSGLIADSQISASSTQEYLWSPSAARLVSSRSGWFPRIPQAQPGEEWLQVDLGTPKTVKGVIIQGARGARAFVRKFKVSYSLNGKDWEYIQDPRTQQPKLFEGNMHYDTPDIRRFDPIPAQYVRVYPERWSPAGIGMRLEVLGCDWTHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural studies of neuropilin/antibody complexes provide insights into semaphorin and VEGF binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Neuropilin-2
total genus 126
structure length 554
sequence length 576
ec nomenclature
pdb deposition date 2007-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00431 CUB CUB domain
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2qqlA03
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2qqlA04
2.60.120.290 Mainly Beta Sandwich Jelly Rolls Spermadhesin, CUB domain 2qqlA02
2.60.120.290 Mainly Beta Sandwich Jelly Rolls Spermadhesin, CUB domain 2qqlA01
1W9WA 3HOBA 1TG7A 2DCJA 3MV01 4CU9A 4XURA 1JYNA 3I3DA 4ZZ8A 1W0NA 4XVHA 4W50A 2V4VA 4KI5M 4A44A 1UXXX 4E8DA 1CZVA 1UYXA 5EJZB 2W92A 2EIDA 1JHJA 5DPNA 2QQOA 3T2PA 2WAOA 2J1VA 3WNMA 4A42A 2J1SA 1RYYA 4OUEA 3DECA 4BK4A 4PT6A 2J1AA 2VQUA 5DQ0A 3VD5A 4BXSV 2ZXQA 1W8OA 3W5MA 4ZZ5A 1LNSA 3ETPA 1XNAA 3GXUA 4TXWA 2XQXA 4ARYA 4KWUA 4GWIA 1EUTA 3BN6A 3WSOA 1W9TA 4JKMA 5JXIA 1SFPA 4QPWA 4FI9A 4MO3M 2B4KA 4GWJA 5CYYA 3T2OA 1K3IA 2VOTA 3IIIA 5IYYA 2VC9A 4BDVB 2LS6A 2DCKA 3I2KA 5A1AA 3C7OA 4P00B 3VD9A 4QB1A 3VD3A 2VZTA 5JUVA 3POIA 3K75B 3FHQA 4UOJA 2E26A 2J22A 4XUOA 2VMEA 3WNPA 4XUTA 2BERA 5G04L 2JE8A 2VM9A 3IDAA 2L9LA 5G05L 1UMHA 2ZEWA 4LOSA 3CIHA 5HPOA 5CZKA 3WF4A 3NNGA 3NRUA 1UY1A 2EIEA 4UAPA 4TTGA 3MBWA 1OT5A 3K46A 5C7GA 4M4RA 2ID4A 2VZQA 1J84A 4CUAA 3OB8A 5I0DA 1L7QA 4A41A 1UZ0A 4QDRA 2WZ8A 3I97A 4QAWA 4QX1A 2C9KA 3P1IA 4CU7A 1JYWA 1K45A 3LPFA 4DUVA 1HN1A 1GOHA 3T0BA 2QQJA 1H6XA 3I3BA 4BJ0A 1PMHX 4OMCA 1KEXA 3WNNA 3LE0A 2WO1A 2ZEZA 2VQTA 4DEVA 3SEPA 3OEAA 3OGVA 4LORA 1UY2A 3VD7A 2VJXA 2W5FA 2J1UA 3DYMA 1SZBA 4QB2A 3ECQA 3CZUA 2J1TA 1NUKA 3LPGA 1H6YA 4IUGA 2VMFA 2BBAA 1SG3A 3C7HA 1OD3A 1W9SA 2WN2A 2Y8KA 3WNKA 4CU6A 3VDCA 1K42A 4ET7A 2JKXA 3HEIA 3HN3A 3GM8A 4LKSA 3K4ZA 3ACIA 4RN5A 2ORZA 2X10A 2Z4FA 3PUIA 3T0DA 3POBA 2WYSA 3UETA 3T09A 4KMQA 2QBXA 2WAAA 2V5DA 4DXTA 3I2JA 2V72A 3E1F1 3FN9A 1CZTA 2WDBA 3WF3A 4A6OA 5JMOA 2J7MA 1PX4A 3ZM8A 3CKHA 3HNMA 4MADA 3IAPA 5EIYB 3POGA 2YFUA 4QX2A 3DYOA 5FUIA 2BGOA 4DEQA 5LA2A 1UY4A 4A45A 2LW8A 3ABZA 1WKYA 2W91A 1PX3A 2RV9A 1PMJX 2VO5A 4LQRA 3I2GA 4ARXA 3PUHA 2WQ8A 3LEIA 2E32A 3SKJE 4DXSA 5C70A 2J1EA 2R7EB 3IAQA 4OMDA 4AG4A 1DP0A 1KGYA 1UYYA 5LA0A 2VTFA 1JYXA 4D0QA 2CDPA 4JKLA 2E33A 3CQOA 1WCQA 2ZEXA 5JXGA 2VMDA 5IJRA 4MGSA 3DEMA 3MUY1 1GUIA 4L0PA 3C7GA 2WBKA 3GGLA 3HNBM 1GQPA 3IB3A 3WF0A 3T0AA 5J1XA 2DDUA 1XNTA 4DUXA 2VZOA 4M4PA 4MOAA 2W1SA 2WZEA 3GDBA 1OH4A 3U37A 2VZ3A 3POEA 3P6BA 5EJ1B 3NQHA 2JD9A 1J83A 3HPNA 5B4XA 3I2FA 2VCCA 1D7PM 4CVUA 1JZ4A 3CMGA 2VMCA 4DXRA 1GNYA 4XUQA 1JZ3A 3MO4A 5CKNA 1F4HA 4D8MA 2QQLA 5CKQA 2WNOA 1K12A 4QB6A 1BHGA 1I5PA 3D3AA 1JYVA 3POFA 2X05A 4W4ZA 3I2HA 1O8SA 4ZXEA 3EYPA 4P02B 1JZ8A 5JXJA 1UX7A 1NZIA 3C8XA 3THDA 1F4AA 1GU3A 2WUHA 5DMYA 1JU4A 1YQ2A 3BGAA 3K4AA 3K77A 4HG6B 3LEKA 4GZ9A 3KQ4B 4OZOA 3F2ZA 4CU8A 2C26A 1SPPB 1MPXA 5IFPA 3OEBA 3WNLA 3A21A 2RVAA 1CZSA 4MGQA 2W1UA 1IQDC 1R64A 3MV11 3DYPA 2W87A 2Y6GA 3CZJA 4LMFA 2W3JA 4XZUG 1SHWB 5CISA 5IFTA 1T2XA 2VZRA 4ZY9A 4AAXA 3POJA 3A7QA 2W1WA 4CUCA 3I2IA 3J7HA 1US3A 4YPJA 4JKKA 3ACFA 2WABA 2HYXA 1W8NA 4JX0A 4XUNA 5IHRA 1UMIA 2YB7A 2VZSA 4QDQA 3HJRA 3LEGA 3MUZ1 1CIYA 3I3EA 4LPLA 2W47A 4P5YA 3HNYM 4A3ZA 5LCWL 3VDBA 4QX3A 1GOFA 2KD7A 4OYUA 1CX1A 1ULOA 2Y6JA 2WN3A 1UY3A 3SEEA 1DLCA 2E31A 1UXZA 2XONA 3C7FA 1UWWA 5CKMA 1NAEA 5JXHA 2EICA 3EB7A 2BZDA 3ACHA 3FL7A 5JR2A 2WO2A 1NT0A 1JI6A 1OF3A 3OBAA 1NKGA 1JZ2A 2W46A 1OF4A 3OGSA 3WF1A 2YG0A 2QQIA 4RYDA 5C71A 4LOTA 1JZ5A 2VZPA 3WF2A 4A4AA 1W99A 2YFZA 3SKVA 2QQMA 1ULPA 1JU3A 2RJ2A 3WQBA 4P08A 3FHAA 4DUWA 4E8CA 1TVGA 1GOGA 2X09A 3VDAA 5F7UA 3NJXA 2YC4A 3LQCA 3A23A 2C4XA 5LA1A 4JHZA 2JDAA 4QDSA 2ZEYA 2Y6KA 2CDOA 2QQNA 2W95A 2VZVA 3CDZB 2Y6HA 2W94A 1EUUA 2VL4A 1UYZA 2PQSA 2ORXA 2VCAA 4QX0A 4XUPA 3THCA 4Z2AA 3W5NA 4PF1A 3AC0A 4BK5A 2VZUA 3A22A 1XPWA 4PQQA 2WO3A 3T08A 2VR4A 1US2A 1SPPA 4W8JA 3UNPA 3VD4A 2VZ1A 5DN2A 1JZ6A 1GMMA 3ACGA 3WNOA 3WEZA 2W1QA 2B9VA 3T2QA 1UY0A 2BGPA 2Y6LA 2VCBA 2W9XA 2J1RA 4CUBA 2YC2A 2XHNA 1L7RA 3NJVA 3UESA 1SDDB 1XC6A 4LHSA 2EIBA 1JZ7A 2OKXA 5HXMA 3OGRA 2HLEA 4UI9L 2QQKA 1O8PA 3JXSA 3OG2A 1DYOA 2XOMA 1O59A 5B4NA 2Y64A 1NX9A 3K4DA 1P8JA 3C7EA
chains in the Genus database with same CATH superfamily
3RFRA 1W9WA 4QX5A 1HRV2 1U5IA 1VBE1 4NPLA 3AMNA 5JPNB 2WQ4A 2DCJA 4IEUA 2WR9A 4RS5A 4XDQA 5BNNA 3AM2A 2IVJA 3ZFEA 2WNUC 1CIWA 2CL2A 3AP4A 5FPAA 2DUOA 4LULA 4QPIB 4KI5M 3TN92 3USUB 4E8DA 1C1LA 4FFHA 1SFYA 1UYXA 2H6CA 2WQZC 3O1MA 4QD2A 1E57A 1UOBA 2A3YA 2IXCA 2W92A 2MEV1 1YRZA 1S0JA 2EIDA 5JSOA 1FMD3 5T5OA 1DQ5A 5LBCA 3ZOIA 4CPBD 2JEMA 4RR3C 1GZWA 2VMIA 3VBFB 2PMWB 3JB8A 1RYYA 4Q1PA 4BK4A 1PIV1 5AVPA 2J1AA 1BBT3 1MS9A 2UWCA 5DQ0A 1Z7S3 3LWCA 1RUC1 2KXLA 3K3NA 2OX0A 5FOJB 2WO7A 1YLLA 2GC2A 3N7LA 5FYHA 1QJY3 4AXOA 2LALA 1FYUA 1O6UA 4NOTA 1LNSA 1R1A2 3VKFC 2XQXA 1ZBA1 1WMEA 2Y6FA 4GWIA 3VBRB 5EP9A 3VZOA 1EUTA 3KGLA 1PO22 4JKMA 4QPWA 5DZGA 4IGPA 5F5CA 3MZHA 1AR63 3WG4A 1S1AA 2YDEA 2W08A 2XVGA 3KT1A 1HJGA 4GWJA 1LOGA 1SLIA 4Y24A 4GH4B 4XPVA 4FAHA 2FDIA 4LK7A 3BALA 4J1XA 2AZ5A 3X29B 4CDQC 5A1AA 2BWCA 3AB0A 3GF6A 3Q8CA 4O9GA 4XXAA 4PHZA 2X5IA 1N3PA 2WA3A 3MYXA 2E26A 3GBGA 3WY6A 1GLHA 1HQNA 2BERA 1MS1A 2JE8A 1MS8A 3DKWA 1HDKA 2GC0A 4W65A 1GBGA 2EF6A 5G05L 2RS13 2ZEWA 1RMU1 4I3GA 4LOSA 4E9KA 1O3RA 3CIHA 4CDUC 4QX7A 1F2NA 4PI0A 4COYA 3M8LA 1EV11 1BEV2 3KHCA 1JOPA 2H0VA 2PLV2 3ETQA 3BPSA 4XCBA 2UYBA 5IAXA 2BJSA 4TTGA 2PHUA 3QBQA 3MBWA 4XQWA 2ZGTA 3ZXAC 1SCRA 2VQAA 4M4RA 5BNPC 1R1A3 2GC1A 2WWJA 2ZGRA 2VXRA 4HSLA 4XFFA 5DUVA 5JOWA 3M3IA 1S0DA 4E2GA 2EA7A 4H55A 4RS5C 5FJKA 3OB8A 1O4YA 1R093 1L7QA 5K9YA 1H1IA 4P9WA 2TEPA 4A41A 2YPJA 4ASKA 3GZAA 3DXTA 4AI8A 4AVVA 4QDRA 3MFAA 1ULEA 3E5QA 4CDQA 3BU0A 4Q2FA 1SQ4A 1A78A 4QX1A 1AR61 1D0HA 1BLZA 3N35A 1H2LA 2WKKA 4AVCA 5HV0A 4YVSB 1UU4A 3FHIB 5FZBA 4R8HA 1XYOA 2ARBA 2BEOA 4J25A 3N36A 3VN4A 1MS4A 4D3WA 1CJPA 4CTEA 3RRDA 4IE5A 3UK9A 2A6XA 1ULCA 1W2NA 2VXJA 4Y3OA 1H6XA 3I3BA 3ZXGA 1UZYA 1BVVA 1H0BA 1B09A 1DU3D 5ANQA 3M70A 3WNNA 1G8WA 2A6YA 1DZQA 1DZTA 2WZR2 2XJSA 4HXCA 2QFEA 1DGLA 2WO1A 3B01A 1AF9A 2HWF3 3FE5A 2R042 4CE8A 4IW3A 1APNA 4LORA 4CCOA 3BTAA 1W9YA 4EN0A 3POWA 4ZONA 5JPMB 4URAA 1N47A 5IT6A 2CGPA 3DYMA 2XVKA 3HT1A 2ZS6B 2G4IA 2VGDA 4UYBA 3CZUA 3OY8A 2R071 2Z79A 4IUGA 2VMFA 2RJKA 1ZYBA 4RL7A 2A6VA 4I0BA 4IEVA 1Y9GA 4I09A 5FRAA 3C7HA 2EVXA 3OPZA 3BIWE 1PIV3 1C8M1 5F32A 3VBSA 4OHYA 1VBA1 1RUOA 1LOFC 1J3PA 1RUE3 3HN3A 4BU2A 5GZCA 4FQZA 3AKPA 2DVAA 3HR9A 1VRH1 3VBHB 3T2TA 1AXYA 3FUOA 3UETA 4JQTA 3ZFEC 2C24A 2XGXA 5IWFA 2QBXA 5A7WB 2ZHNA 4DXTA 2ZKNA 2PHRA 5CG9A 4JRLA 5FPUA 2RG4A 3KB5A 5JMOA 4A6OA 4QQOA 2IC1A 2YC0A 1JTZX 3MF9A 4MXWB 4YGCA 4IETA 4U36A 1BKZA 3OPTA 5TSWA 3JZVA 2OZJA 5EIYB 3O1OA 1RL3A 1EAH2 1ENQA 5ERLA 2R0FA 1B35B 3VBUB 3RZKA 1AXZA 4NR1A 3RYPA 3PMEA 1O3QA 5LA2A 4BH9A 4AQSA 4YW1A 1GP5A 4QPGA 2Q1FA 3U4XA 5L9RA 1UNBA 2GAUA 3NNMA 1PMJX 3FLPA 2D3SA 1HRI3 1QY4A 2F4LA 5HXVA 4FFFA 2D6LX 5L36A 4X6QB 4NMIA 4XHBA 5DDJ1 5SV8A 5IVBA 2WQ8A 5DZFA 1AHSA 3KCCA 3LEIA 2JG8A 4P9JA 5JMCA 1W8FA 1W2UA 4GJZA 1W39A 4AG4A 3PIJA 3O1VA 2PHFA 4ZKTB 2XH6A 2GMMA 4TLGA 4XHXA 1AL21 3D0JA 2Q8EA 4LNVA 3O1UA 4UW4A 4JKLA 3CQOA 5E89A 1ENRA 1WCQA 3JB4C 1DZRA 1QJU1 3TBDA 2VMDA 4UFIA 5IJRA 5FWEA 3VBSB 3ZFGC 5A1LA 3DEMA 4K7JA 4KWKA 2BPA2 2ZHKA 1H1MA 4NPMA 4L0PA 1MQTA 3HNBM 3AYAA 3LB9A 1OQEA 1K5MA 2GZWA 2RDNA 3H3LA 2B8MA 3IT8A 3WF0A 1LTEA 1ZRRA 2HWB1 2XQRA 1W05A 4LO5B 4R9AA 3MW4A 1X50A 3AYDA 2WZR1 3CL1A 4FPLA 3KHBA 5FK7A 1XYNA 5DAXA 4MOAA 5BXXA 2W1SA 1PGL2 1H2NA 5BNQA 4AHXA 2WZPP 1NCRB 1OH4A 3HD8B 2VZ3A 3U37A 3POEA 4CCCA 1F8VA 3H1YA 2JD9A 4M0NA 4XW3A 4D6SA 2OXBA 5C9AC 2BQPA 1DBNA 3WINE 3RZHA 4M01A 3PJQA 1F15A 4NO4A 3ZXDA 3TOJA 1JZ4A 2VMCA 1BXHA 4FOVA 4MUVA 1NLSA 4NUBA 1GNYA 1YCIA 4Q4V1 4LUMA 1ZZ7A 4R9DA 4XUQA 3VBFC 4C8DA 4QPYA 1ENSA 3O1SA 3IN9A 4XJUA 2ZGNA 1Q8PA 3N9NA 3I4IA 4EROA 3KT7A 4CP0A 4EV0A 1K12A 5GM0A 1POQA 2VW2A 5J37A 2ZX4A 5CAZA 2BBVA 1UN1A 2JKBA 1RXFA 1UZVA 2EXHA 3TNPB 1BBT1 1R1ZA 3POFA 3UL2A 1KDMA 4CDWA 1HQLA 2P5BA 1QMJA 2BRTA 3WG2A 2MPFA 3IIAA 2WNUA 3I2HA 5FYMA 2Y34A 1O8SA 1UZZA 3EYPA 1QOSA 1GZTA 2D44A 2D5FA 4P02B 1CAUA 1LEDA 5CVRA 4FPEA 1NZIA 2AACA 2X29A 1EYBA 4E4SA 4QXCA 1DGRA 2ZGPA 2RM23 2E6VA 1MZ6A 1W0PA 5T3NA 5KHKA 3ZXKA 3WQ1A 5IVYA 3WP6A 3B9IA 4NIDA 4NRPA 1OOPA 5F3IA 1MPXA 5T5PA 3OEBA 4LTAA 1N1VA 5HI0A 2VNGA 3LIGA 3OYWB 1CZSA 4FPYA 4WZCA 2E51A 1QJY1 3NO8A 2JD4A 1OOPB 4JGYC 4TWTA 3DYPA 4XMAA 3D0SA 4RFRB 4DMIA 2W87A 2Y6GA 3CZJA 4PCRA 4KG8A 4Z2WA 1VMHA 3GZUC 1SHWB 3BODA 1O4TA 4DXZA 1T2XA 2H0BA 4HANA 4XJZA 5L9BA 3VHOA 1QJX2 1DQ6A 1Q8QA 4S2GA 3H8RA 4FTEA 3ZR6A 1K5MC 1POV0 1W0OA 5LRSA 1UMIA 2WSUA 2LM3A 4NWWA 3MIHA 2DCZA 3LEGA 5FZCA 2P4EA 3MUZ1 4I3PA 2W2IA 2XG3A 4BQ4A 4CCEA 1CIYA 3IKWA 4LPLA 2DVBA 1NE6A 1N3QA 3KSCA 4KL1A 5E6HA 1V6NA 4GIQA 4LO7A 2BYVE 4K1ZA 4KWLA 2OQ7A 3ZSMA 2Z2SB 2HWB3 3IDCB 4AFBA 5IK5A 3B93A 2ZGMA 4XQDA 4KGQA 2OVUA 3WD5A 3IWZA 1EAH1 1EPZA 4C90A 4ISQA 1OXCA 2RS52 1JUHA 4Y1ZA 3JQXA 4UFKA 3I59B 2QCSB 2C9AA 2YZ4A 4HPKA 2EIGA 3FWEA 4E27A 1GZCA 4URTA 2YHJA 2VG9A 2ZGOA 3VZMA 4K9SA 3GNEA 3I54A 1NT0A 1XOYA 1LU1A 1URXA 2W46A 1OF4A 1DFQA 1NLQA 3GBFA 1VALA 2FDGA 2F4PA 4O61A 2WJSA 4IQPA 2GNMA 3JD73 4FXKB 1D0GA 4B29A 4MGYE 1Z0HA 4RGGA 5JWPA 3QACA 4LOTA 5IVCA 5LWBA 1LRHA 3MW3A 3VGIA 3WDVA 3KD4A 5I0UA 3ZX7A 2DURA 2VZPA 4JTNA 4MSVA 3V0AA 4XEZA 5A33A 4OULA 1LAJA 3MIFA 1VIWB 1W99A 2YFZA 2ZPXA 1G86A 3NV2A 3PNAA 3WT3A 3CEWA 1W8UA 4P08A 5CIRA 1C28A 4H7MA 4DUWA 3LDKA 1POV1 1VR3A 1LJ7A 4IE0A 1JXNA 4IV1B 4XBQA 1GOGA 3W9AA 4BQ5A 2EALA 4AVAA 2YC4A 1C8NA 2D6KA 2C6SA 3FC0A 3ENRA 3ZYJB 5JVVA 5A6XA 4CZSA 3WNXA 4A7KA 1HXS3 4LBNA 5KXEA 4QDSA 5EYXA 5A3TA 2DBIA 3W21A 2VZVA 3CDZB 2HWC2 2XHKA 2K46A 3FZ3A 1PO11 1OFNA 2W94A 3MLJA 4QT6A 1AR62 2CWSA 3N3HA 1W03A 2YXSA 4DPNA 1LOCA 4F3JA 1UYZA 2PQSA 1VBD2 5BY5A 4B7EA 5KC5A 2JG9A 3THCA 4RGAA 5ABJC 2DU0A 5J48A 1GKBA 2AYHA 3W5NA 4LLFA 3EXUA 4HVRA 2QJVA 4XQ4A 4MGTA 1MS5A 3UV9A 4AOCA 4PQQA 4R4XA 1NOVA 3GCXA 4XJ8A 4E4ZA 4NHYA 3UNPA 4PIYA 3IZOA 4EE2A 5DN2A 3VD4A 1VBE3 2CY6A 3ZYFA 3A4UA 2JX9A 2FD8A 3KMHA 2VVEA 5C5UA 3N9QA 2B9VA 1QIQA 4N43B 5FZ4A 1OD5A 3KM5A 3M2MA 3M3CA 4KGGA 4WVZA 3UESA 4ZU7A 2QTWB 1IKPA 2JECA 3VBRA 3AMPA 3D4KA 5FO9B 1WD4A 2MEV3 2EIBA 1UU6A 4ONUA 4NHMA 1JYTA 4Y5SA 1O8PA 3RYRA 3SCGA 5LZ6A 1LGNA 1SACA 2NYYA 3J26N 3RJRA 4QKDA 1AYN2 2XKOA 2A6ZA 3AKTA 1O59A 3NL1A 2Y64A 4CUGA 4MX3A 3V0AB 2ZGKA 3TNQA 1NX9A 3K4DA 4XBNA 1P8JA 5A1FA 2XLFA 3L9JT 1H9WA 3C7EA 3CLPA 4HSJA 4W6YA 4XUOA 1YHFA 5F8PA 2SBAA 1W6PB 3HOBA 4WBBA 3IMNA 1W2AX 2ZX1A 1RUH3 4YGEA 1DGRN 2R061 4GKXA 1LHWA 1OKOA 4AZZA 1JYNA 3VL9A 1W0NA 1COV2 2R30A 4LBQB 3QOPA 4XVHA 4YW2A 3ZYRA 4A44A 1AYM1 1UXXX 2W68A 3RWNA 3UKNA 1CZVA 1NXMA 3USUA 2VECA 1OLME 5C9AA 1UU5A 2VCMA 1PIV2 4XXPA 4YARA 5A3NA 4CDUB 3IBMA 3Q8BA 4A3XA 1JYIA 4LIVA 1NA1A 1W6OA 1HKDA 3NAPC 5JOXA 2SLIA 2ZMKA 3BU7A 4LA3A 1X8MA 2J1SA 4OUEA 3A0KA 4A42A 1M4WA 3DECA 4RSUA 3BTZA 2PAEA 4SLIA 1ASJ1 1JUIA 1UF2C 2VTXA 3IMMA 1VB4A 2KA3A 5FREA 4BE3A 4YRDA 2ZMLA 4YWAA 5C5TA 5FYBA 1H2KA 4J6GA 4ZZ5A 1L3JA 2XUMA 4V2VA 1WLCA 1RJ8A 3GXUA 2IFRA 2P37A 4KWUA 3FFQA 2WA4A 5FZFA 3BN6A 5FZ1A 3WCSA 3BIEA 2EXKA 1FOD1 4FI9A 2B4KA 4Q0QA 1FNZA 5CYYA 4AGRA 3KVAA 1K3IA 1QEXA 3IIIA 4N7UA 1VLNA 5DAPA 5LK5A 1IGOA 2WT0A 3TYJA 3O0WA 1QU0A 1SLBA 1KITA 4AGGA 4HT1T 2R1BA 2DFBA 1MZFA 1EPWA 1W8WA 4MYEA 4ZS3A 3SLIA 3T4HB 3VZJA 5C3QA 1DYPA 2G9GA 3VD9A 4QB1A 2VZTA 3R05A 5ISLA 5BNPB 3HBKA 4Y20B 3FHQA 4C1XA 2J22A 5BNPA 3U1XA 4DB5A 4IEYA 4IEQA 3LAGA 2B5HA 5FAXA 1BBT2 4AR2A 1CAXB 5GLZA 5HPOA 3AKRA 2J42A 3WDTA 4CCNA 5FO7B 3WF4A 1X9PA 1AXKA 4LA2A 1HV0A 4CXWA 5F2WA 2CHHA 3CO2A 1LODA 4V1PA 4LLOA 1FPN2 2EIEA 3AZXA 4UAPA 5J98B 2VW0A 1FX5A 2MNGA 2VBPA 3LEMA 3OGGA 4NPRA 3WHTA 5C7GA 5K7PA 3V0BA 4M00A 1XE7A 2F6BA 3DPRC 1SCSA 3ASIA 2G1MA 2Y60A 3FLRA 4I0AA 4YM0A 3VBHC 2PLV1 5C3RA 3I3QA 4O9EA 1FI2A 1ZVFA 5HBAA 3QH7A 1UOJA 5KHHA 3TEWA 1Y9MA 1J1TA 4Q8KA 4YZ4A 2VTXJ 2WZ8A 1H4HA 4QAWA 4X8NA 4K6BA 4RR3A 1IHMA 3WP3A 4UF0A 3WUCA 3JU9A 2C9KA 4CCDA 4HKOA 2F17A 4HN0A 3BUCA 4HZFA 4B8EA 5A3OA 2ATFA 2D98A 2RM21 4JZRA 3NAPA 1TME1 4CU7A 1PGW2 4HOOA 2ZHMA 4Y5TA 1JYWA 3LOBA 4DUVA 4L2NA 4P9XA 5HV4A 1DF0A 5B2GB 4AFCA 4HK8A 1GOHA 1FXZA 3H3ZA 2P6HA 3T0BA 4WM8B 5FPXA 1YJKA 4AW7A 1RUF1 4BJ0A 4C1WA 1WLDA 5APAA 4EWDA 1H1AA 5K8SA 1YFYA 3D82A 3LE0A 1MZ5A 4V2WA 2ZEZA 4LO8A 3CBNA 3VKMA 4DEVA 3OGVA 4HPKB 3NJYA 4LITA 5SV5A 2PFWA 2QDNA 3WW3A 1R083 1HLCA 4FPOB 1VBC2 4IEWA 2W5FA 2J1UA 4CEYB 2TNFA 3VUOA 5FZOA 4QB2A 1SBEA 1GR3A 2J1TA 4PBPA 1H6YA 4L99A 2DVDA 1HV1A 4UXAA 4M0HA 1RUI1 2ZX3A 1MQTB 1W3XA 2PYTA 4Q0SA 3DKQA 4IEZA 5A70A 1W9SA 3WNKA 1W6MA 1K42A 3VDCA 3WW1A 3PUAA 2GSYA 2UY8A 1O3SA 3GM8A 3LDRA 4PF5A 3APBA 2A5ZA 3K4ZA 3ACIA 1UOGA 2X10A 4XZPA 3WVJA 1YEWA 1WBFA 3SC7X 3POBA 2WYSA 4QPIC 2GDFA 4YG3A 4OHVA 4A7YA 4LHKA 2HWC3 2WSVA 2WNVA 3TWIA 4FP3A 5L7OC 4LEJA 3I2JA 5IVVA 3PTRB 4AHWA 3E1F1 3GJAA 1MVEA 4MLOA 3OTFA 2PAKA 4AVTA 2JG8B 3RMYA 1Z78A 2J7MA 1PX4A 4NRQA 3ZM8A 4Y1XA 3Q9OA 5FFOC 1AYM2 3AL5A 5IVJA 2JDYA 4NHLA 1HB4A 3IAPA 3MFCA 4YVSC 1TNRA 1V6JA 2WZR3 2XPJA 3NV4A 3TRSB 2AC1A 4LXLA 4CDWC 4DEQA 4Q4Y1 4DS0A 4H14A 4C0BA 5IAVA 4BA6A 3N7KA 3ZDSA 2W91A 3ZLIA 4JRAA 1GP6A 4LQRA 4GWMA 3PUHA 1WMDA 1S0CA 4P14A 2R0HA 3FFZA 1JS9A 1V6IA 2K2SA 2R072 3WDYA 2GN7A 1VBE2 4BZ4A 4EN7B 1V9U1 1VRH2 3PIGA 5ACA1 1OI6A 2BNMA 2P3YA 2CDPA 1UIKA 4D0QA 1N3OA 1FNYA 3HQUA 3OPWA 1KRIA 5FXVA 5K0UA 1AR92 1D2QA 4TN7A 5FZEA 1RHI3 2ZEXA 5JXGA 1TMF3 3DN7A 1SLTA 2AH2A 2D43A 3AK0A 3O7OA 3MUY1 5FZAA 2ZGUA 2CSGA 1NZCA 1GUIA 1RJ7A 1W6QB 2V4AA 2BFUL 5CB7A 4A7ZA 2WBKA 2VOXA 2VOVA 3NNJA 1RUI3 3WW2A 4AEMA 1DGWA 1XYPA 4K3UA 2CGNA 3MIGA 4Q4W1 2UYAA 3SH4A 2P34A 2P6CA 2HWE1 3JUUA 5F9TA 1CAWB 1R081 1XNTA 2Y33A 3JD72 2DWRA 4IDZA 4WVMB 4DUXA 5JAXA 2VZOA 1LGCA 1GNZA 3N7JA 4L97A 4BQ1A 2HWC1 4XF0A 1BYHA 3P6BA 5EJ1B 3NQHA 3VHPA 5CBLA 5B4XA 4IV1C 3OF1A 1AUYA 2IFWA 1STMA 2CAUA 3I2FA 1FMD1 1VAKA 1H2MA 2IXLA 4XACA 3ZKUA 4W6XA 1D7PM 4LBQD 4CVUA 4RS5B 2CYFA 5D8AB 3E6CC 2OUHA 3CMGA 2RR13 1QNYA 3ZYPA 5I8TA 3NAPB 2PHDA 5FYZA 1VBD1 4QQPA 3ZN6A 1OHFA 4GJYA 3GALA 3O12A 1ENXA 4BOWA 2YUEA 5CKQA 2JJ6A 4RR3B 4AK3A 2ADDA 3OJBA 1AJOA 2RJLA 3VHRA 3WCRA 2OS2A 1BHGA 1I5PA 3U11A 3D3AA 3O1RA 2KM2A 1C57A 1RHI2 1ND3C 4JV4A 4KBZA 4RHV3 2X05A 3ZYHA 2OYZA 1NCQA 4U2AA 2PHTA 4ZXEA 2JB8A 5GLUA 1I6XA 4AEDB 1JZ8A 5JXJA 3U0ZA 1UX7A 5DAQA 4ZXKA 3J7MA 3VBRC 1F4AA 3O0VA 1C5IA 5HCBA 3H8UA 3BI3A 4GMP1 2PQQA 1Q3EA 4I01A 3AFKA 5KWRA 1C3HA 1Q8VA 5EXOA 3K4AA 3LEKA 2GNDA 2K9ZA 4GZ9A 2OA2A 1LKNA 4OHXA 2HH9A 1W04A 4LJHA 5FJHA 2C26A 2XWJB 1RHI1 2OT7A 1NA1C 1J59A 5IK4A 4IV3B 1CAVA 3WNLA 5IFPA 3RZLA 4OVEA 4XIOA 4QHBA 3A21A 1D4M2 2OPKA 4S2DA 1RUJ2 2O8QA 2W1UA 1IQDC 5DXDA 1HW5A 5L19A 4X8PA 4WM7B 1R1A1 2GNTA 3HBZA 4Q4Y3 4CXYA 4UWDA 4XFHA 5KXDA 4COWA 3N9PA 4MXWA 1UCXA 5IFTA 3N9OA 2VZRA 4XIKA 4ZY9A 4Y1UA 4AAXA 1G6NA 1OLMA 1SEFA 2HBUA 2IUWA 1L7LA 2FZ1A 3NV3A 1OVPA 2ERFA 4FXGB 4GH4A 1XSRA 5GALA 3WQ7A 1ND2B 2WABA 3ACFA 2FCTA 2HYXA 1W8NA 2WNVB 4JX0A 5KXCA 1J3RA 5IHRA 3DPRB 2YB7A 3KLSA 1Y43B 5FQ0A 1UO9A 3RPQA 4ZU4A 3BTXA 1I3HA 1QWRA 1G7YA 1PM7A 2C0ZA 4A3ZA 2Q0AA 4FPKA 4PLOA 4ZU5A 1AL0G 1RGSA 4Q4X3 3NWKA 1RUH2 5A32B 3J7LA 2VNVA 2VOKA 1C8M2 4IGOA 2BTVC 2FQPA 1FOD3 4FFGA 3V64A 1S0EA 1AYN3 3VBFA 1RUG1 1Y3TA 5EFUA 3SEEA 1DLCA 1OC1A 5IATA 1ULFA 3MW2A 3R4DB 4P9IA 4AI9A 2FZ2A 3GYDA 2DVGA 2XONA 2D3RA 5EQUA 3C7FA 5FYSA 5CKMA 2XLGA 1QJU3 4OHZA 4CP9B 2RDQA 5D8AA 1WW6A 4NVPA 4LBLA 3TN91 2A3XA 1ZREA 4N9HA 3FL7A 1WCDJ 2HWD3 5FP4A 5I8YA 1D4M3 5CADA 4LBQA 1VBB3 1NKGA 1Q56A 2WRAA 3JD71 3LFMA 4NRMA 5FP8A 4UBGA 5C8CA 3OGSA 3WW4A 5EPAA 3WF1A 4JTOA 3H0OA 1DDLA 1H8VA 2ES3A 1FAYA 2Z69A 3T1MA 1X7NA 4YM2A 1A34A 1ZRCA 4HKWA 4RYDA 2IWGB 1AX1A 5FZKA 1VBA2 4E2SA 2RMU3 3ZSJA 4EJRA 1JZ5A 5FPLA 2Y38A 3KGZA 3DCQA 5FTTC 1MS0A 1C4RA 2G9ZA 2VULA 3ALQA 2XL7A 2DTYA 4B3NA 3WF2A 4A4AA 1V6OA 2ZGSA 1TE1B 2QQMA 3WDWA 1QNWA 5A32A 1BJQA 4D7SA 4ASLA 2GMEA 1KS4A 5A3LA 3PVOA 2V09A 1DQ0A 3H7JA 1TME3 1R092 1G9AA 2ZX0A 5A6QA 4Z8BA 1JBCA 1QOOA 2NM1A 3LIHA 2P3JA 1TVGA 1CPMA 3GCWA 1YQ6A 3RQ0A 3VDAA 4BIOA 4DZGA 4XDPA 5FBZA 2BWAA 4K21A 1N1TA 3RMXA 1HIXA 1BCXA 3UKTA 2JG8C 3A23A 4HBNA 4Q1RA 4MH0E 1FPN1 2D6OX 5DDJ2 4YM1A 5FZDA 3AZVA 5GLVA 3RI8A 5FMDA 5CFCA 2JDAA 1RITA 5IVFA 3I49A 4GMP3 1GANA 2Y6KA 3AKSA 3K3OA 4XBLA 3AMMA 4NIIA 4YYOA 4FP2A 2QKDA 1ST8A 3LCPA 2Y6HA 4N43C 3WZ1A 1MEC3 1OQDA 4PDWB 4KNCA 3WR0A 4AI1A 4IEPA 5AC93 5C3OA 4QWNA 1CGPA 3KV5A 1CQ9A 2QDRA 3LA7A 5I0TA 3H8OA 1C1FA 1SFNA 3LSDA 4QX0A 4RGKA 4YG0A 2X5IB 5LB6A 4Z2AA 5FZMA 1FPN3 2VZUA 4OHWA 1D4M1 1KXGA 3TB0A 1RUF3 1KS5A 3ES4A 1XPWA 1N1YA 3PU3A 1VAMA 1G9FA 4MV2A 5F3EA 5FKBA 5LY2A 5JIUA 1H4GA 4YGBA 3KV4A 1KFXL 1DIWA 4I02A 2C1FA 3PTYA 4FPHA 4B4RA 3U14A 1X36A 3JQWA 4JGZB 5A7WA 4QGMA 1LCLA 3OOXA 3T1LA 1SDDB 2EXJA 1XC6A 4LHSA 2HWF2 1TME2 2BOIA 1NCQB 2ZTNA 1BVP1 2CV6A 4J1WA 4QHZA 4CA9A 4EN8B 5HXMA 2HLEA 5I0SA 1ZBA2 5LA9A 1CPNA 2YU2A 5FDBA 2Q8OA 1HB1A 3JXSA 3OG2A 3CHXA 4MGZE 3O0XA 5F3GA 1U5XA 4Z1VA 4GB32 2Z5WA 4GXLA 5B4NA 4K1YA 3ZIXA 2TBVA 4WV8A 2BNOA 3ILRA 3MF6A 3ON7A 5F39A 3SCHA 1O91A 5FY5A 1GQGA 4AI0A 4N9IA 3BCWA 4XFAA 2YBKA 2B46X 4E2QA 2HWD1 1TG7A 2G19A 3FX3A 4XAEA 3MV01 3RZMA 3BB6A 2UWAA 5BUVA 3KWVA 2VUCA 3EMRA 2Z42A 4ZPIA 4WVVA 1S0GA 4Q8LA 4RHV2 3POYA 5F6LB 2JG9C 2WFF1 2ETEA 2DF7A 2LROA 5C8WA 1JHJA 2QZ3A 1QJZA 1IQAA 4QM8A 5FP3A 5D2AA 1PVC2 1DHKB 5FLHA 4BYYA 3IM0A 2J1VA 3U4SA 3V65A 2R6QA 3FBYA 3ZXEA 4PT6A 5FYCA 1IOAA 2VQUA 2BVBA 1I9RA 4K8RB 3VD5A 3RZZA 1UAIA 1ZBE1 2Q4SA 2ZXQA 1RVF2 1IPJA 4A6SA 1ND3B 1W8OA 2BGCA 2XUEA 4OFGA 2GP5A 3WHUA 2GNBA 4XDOA 2C5DA 3ME2A 3W5MA 5IVEA 2VD7A 1RIRA 3H3UA 1XNAA 2KR2A 1OA2A 3HWJA 3PVEA 4JAAA 4ARYA 1QJY2 4P9LA 2YBSA 5GZFA 1ONAA 4K8FA 4D6QA 4AF9A 4CCMA 3WSOA 5LBEA 3DPRA 3MEPA 5JXIA 1SMVA 1DQ4A 1ZRFA 4RA0A 1CD3G 1QJFA 4MO3M 4YVWB 5A3UA 1ND2A 2R041 4LKEA 3UGGA 1J58A 2I07B 1JH5A 3CJIA 3LA2A 5IYYA 3ACLA 4TYSA 3SXWA 2ILMA 2VC9A 5LBFA 1MZEA 1V6MA 5T5JA 2CTVA 2RE9A 4BDVB 1BK0A 2FDKA 4D7TA 1ZA4A 4O7XA 3I2KA 4OUSA 1RB8G 1VBC3 5CEHA 1A3KA 3OBTA 4P00B 3BOWA 3QH6A 4Q4W2 4EQVA 3VZKA 5T5LA 4QPGC 3K2OA 1YQ5A 4UOJA 4XF4A 5JOZA 3WNPA 4E4DX 4IV3A 1PZ7A 3PLQA 4BB3A 3IDAA 2VQ0A 3OUIA 2L9LA 4XC9A 3G6JB 1KJLA 2NN8A 2WLPA 5I93A 3BTYA 4UBHA 2RS12 4WVWA 5JZGC 4NJ4A 5C4WC 2XBO3 4HMZA 4NIAA 3NRUA 1HJFA 3VDDA 5D21A 1LECA 5F2SA 1C5HA 5D1IA 3O14A 4Z07A 3LDBA 2HWD2 3R4SA 1J84A 2WT2A 4BQYA 1GFF2 1FV3A 4WM8C 4LO6B 1KFUL 1SLLA 3KVBA 1VBB2 4CUAA 4OQ9A 1W6MB 1YIPA 2XL9A 2IXJA 5FZGA 1UZ0A 4I2OA 3VB9A 1AR72 3MPBA 1WD3A 3AJZA 3ZN4A 4Y5Z0 2DCTA 1QKQA 5BNOB 1I1EA 4S2FA 4ORFA 5JOYA 3WLUA 1PVXA 2B42B 3E97A 2XB6C 3INAA 3J8F3 3ROUA 3WP5A 4XJ9A 2RR12 5FMOL 5LATA 4P5HA 3UJQA 2VNOA 3POSA 1K45A 4AL9A 1GWKA 3JBG2 1HN1A 4F8AA 1R091 5KHGA 1W6NA 4BM8A 1WMFA 5FY0A 2VBDA 3AVSA 3H9AA 5DABA 1ZZBA 2GH8A 2QQJA 1W06A 1YO8A 3NJZA 2JDNA 4OMCA 1KEXA 4B4PA 3SMHA 3OSDA 4TSVA 2UU8A 2VQTA 1QJEA 3LZZA 4WVMA 1MR5A 3IPVB 4CP9A 5FMBA 4R4ZA 4Y22A 1CAWA 2QQPA 1UY2A 1WLTA 3VDDC 3VD7A 3LFIA 5L7OB 3WOGA 1PGW1 3BPZA 3MLLA 2PHLA 1SLAA 3LGRA 3LOIA 2WS91 4ISRA 4XFIA 3ECQA 2FDHA 1RMU3 1H9PA 1S55A 4OI1A 3W58A 2EAKA 3LA3A 1QH6A 4FOYA 4UW3A 2QQVA 5E88A 5FYTA 1SG3A 2Y8KA 2HEVF 4YSFA 5FUPA 3GHNA 2ZGLA 3M3EA 3ZFFC 4R9BA 4AVSA 4Q29A 2DV9A 2JKXA 1KJRA 5DG2A 1V9U3 2P2KA 4MHRA 4XJAA 5K0UC 3CF6E 2HEWF 1AX2A 3MIDA 3ZXJA 3PUIA 1PNGA 5F3CA 1RUE2 3S6PA 1YI7A 4IE4A 4BLJA 4ITCA 3T09A 4KMQA 2LUWA 5KR7A 3THPA 1KDKA 4Q4V2 2WAAA 1IZ3A 4CEYC 4BCUA 2VUDA 2XKPA 1S2KA 3KF5A 4LHNA 1LENA 1RC6A 1YI9A 3FN9A 3UT0A 2ZABA 2WDBA 3WF3A 3PURA 3CU7A 1WLWA 3B00A 4D7YA 1UPIA 2E9QA 1OPOA 1ND2C 3GJBA 5FCCA 5FMOS 1RUH1 3VBOA 2RS11 4QXHA 1EP0A 4GB33 5DDJ3 1VMJA 3HNMA 4MADA 3KCXA 2OPWA 3POGA 4AWDA 5A3MA 2YFUA 1X82A 4PBOA 5FXZA 5H9SA 1LU2A 3DYOA 5FUIA 5FK8A 1UY4A 5FXXA 1B35A 5D8AC 5FLJA 3OBRA 3PL0A 2LW8A 3ABZA 1IS5A 2RV9A 3UGFA 3DGTA 5LY1A 2VUJA 4Y26A 2ARCA 1E5RA 3HQXA 1XQNA 1A6CA 3VL8A 3VV1A 3ZR5A 1NYWA 4ARXA 1LB2A 2OQ6A 5FP7A 3VBOB 5F37A 2YPDA 1LHVA 4KWJA 1RMU2 3SKJE 4BLIA 2DVFA 4DXSA 5C70A 2J1EA 2R7EB 3IAQA 3NKTA 1QDOA 4FT8A 4K20A 5KHJA 4OMDA 1BEV3 4GD4A 1HQWA 1KGYA 1UYYA 1WCUA 4LHLA 2VTFA 1GZ9A 1JYXA 2PHWA 1MQTC 3JBG1 2A1XA 2NMNA 3BYWA 1DQ1A 2WLQA 3B9CA 2E33A 2R1DA 2RR11 3KV6A 4AEDA 3B69A 5JCTA 4YZ1A 2XJQA 4KBBA 1RVF3 3J9SA 4L8QA 4L11A 5FZHA 3TEXA 4LUKA 2IZWA 2ADEA 3Q8EA 1ND3A 4YW6A 1ZZCA 3C7GA 1AR71 1AYM3 1S2BA 3EQEA 4KU7A 1GQPA 2BDRA 2DUPA 1VE0A 3IB3A 1VMFA 1WW7A 3J8F1 3SNMA 4BQWA 5A3PA 1MACA 4QKFA 5FZ3A 2MHFA 4FPGA 3T0AA 3HIFA 1MEC1 3M1HA 1NA1B 1OBNA 1OSGA 5FPVA 2O8OA 3IPVA 1IKQA 3NNLA 4FOQA 1U12A 4M4PA 2WZEA 1GYKA 3MDPA 1KD7A 2PHXA 4XE9A 3KCYA 2GP3A 3VKNA 1J83A 1O5UA 5EJ3A 1XNBA 4XF3A 4Z82A 4A2UA 1RUNA 3UYJA 1Y9QA 3ITQA 3MGUA 2VCCA 2BNNA 4LR4A 4YLZA 1LEMA 2DU1A 1ASJ2 4G9SB 2RS51 1JW6A 2K0GA 5ANNA 5A7NA 3DV8A 2JIGA 4FQ4A 1QXRA 3MIBA 1JZ3A 1S0IA 3MO4A 1VRH3 4QKBA 5CKNA 4D8MA 4BISA 4PI2A 1GICA 1O5LA 2WNOA 2ET1A 1VBA3 3KQRA 4QGLA 3O1PA 3HVDA 4YW3A 4RD7A 3R0RA 1NXD1 4N53B 4YGDA 1JYVA 1IS3A 3E6BA 3HN1A 3PVBB 5J3UA 5KHIA 3O1TA 2WFPA 4Q27A 2CAVA 4DINB 5T50A 2A7AA 1S0BA 2ZMNA 1O4ZA 1QJU2 5JSPA 2I2SA 3V0BB 2XMLA 2PTMA 1DCSA 1MEC2 3C8XA 3THDA 2WUHA 1GU3A 2FCVA 2VAUA 1H30A 2AUYA 2WFF2 4PQ9A 4WM7C 5DG1A 5T54A 1CWPA 4HVOA 2HKXA 2XJRA 2BOJA 1AR83 3BGAA 4HG6B 4HFSA 1HB3A 3M7AA 4META 3G7DA 4OZOA 2R043 1CAXA 3F2ZA 4AI2A 1RUF2 2PA7A 5K4LA 3SCFA 3PHMA 2JDZA 4FTSA 2TUNA 4WM7A 4QPGB 1NCQC 1ZBE2 5EV7A 2BW8A 1V0AA 3ZYBA 5AC92 5CU1A 1VB2A 3VBUA 4MGQA 2IXHA 3OBZA 2DUQA 5BNNC 3B02A 3VZLA 1JOJA 1ACCA 3F95A 1UW8A 2ET7A 5EYYA 3MV11 4M3CA 4MG2A 1UKGA 5JIAA 3IDBB 1QJX3 1VPHA 1PO12 2A75A 2W3JA 4LMFA 2O1QA 1SBFA 5I8SA 3HQRA 5H9RA 1ZX5A 5BYNA 1BMV2 1E5HA 3NSTA 1XBFA 1YC61 5CFCB 1WGPA 3BOPA 4CUCA 5GZGA 3J7HA 2VOWA 4YPJA 3H42B 4JKKA 1YXWA 4QXKA 1REFA 4YVWA 1D2SA 4S2HA 1J3QA 1S2EA 4Q4Y2 1WUVA 3AP7A 3HJRA 4NN0A 2JDMA 3R6SA 3B94A 2XWBB 3WDUA 4G4FA 3EJKA 3HNYM 3ELNA 4AQ6A 1W2TA 4CDWB 5LCWL 4QX3A 3PDQA 1GOFA 4I0WB 4KG0A 1XRUA 1OA3A 3ZPYA 5FZ9A 4OYUA 1PNFA 4H7LA 4G3YC 1ULOA 3TEYA 5FZ7A 3S7IA 2D6PA 2WN3A 5HCHA 1W2OA 2X53S 1UY3A 1AR73 1CJDA 3ES1A 4FFIA 5FWJA 5FV3A 4UFHA 3TEZA 4TZDA 4FSJA 4GKYA 1WMXA 2ZKLA 4GQ7A 2BVVA 4QU2A 4CDUA 4MHUA 2RDSA 5JXHA 2EICA 3EB7A 1VJ2A 3ORJA 2GALA 4CDXC 4AHZA 5C8CB 2BZDA 4IL7A 5J96B 5FZLA 4XF1A 1V9U2 2WO2A 1M06G 2D6NA 1JI6A 1OF3A 1Z7S1 4KQ7A 1NE4A 4QPIA 3OBAA 1GWLA 4R9CA 2W39A 3S0MA 3L2YA 3SISA 2Y26A 2YG0A 5DZEA 4L9BA 3N9LA 4GH4C 1HX6A 1DGWX 5C71A 4Z92B 4AFAA 5I91A 1CR7A 2RS53 2XXZA 4JGZC 5GLTA 5BNOA 1HXS2 2IXIA 1PVC3 4UF0B 3VKLA 4DRRA 5A3WA 4MGKE 5FBJA 4CDQB 4JDMA 1LHOA 1O7FA 3KT4A 3SKVA 3I2OA 1ULPA 1JU3A 2RJ2A 5BPXA 4AFMA 2QE3A 3ZMOA 4N7IA 4YM3A 2VUAA 4UW6A 4Y4YA 3FHAA 2G9FA 2HWF1 1J1LA 2UWBA 5A7SA 1WBLA 3ZVXA 5E8AA 3I8TA 3WUDA 5FPZA 1VBD3 4E8CA 4IEXA 5A80A 4ES8A 2AEZA 4LBKA 2ARXA 4IESA 1ODNA 2JXAA 3IDEA 2WINB 1U5YA 4Q4W3 3CNAA 3TAYA 2C4XA 3C3VA 4JHZA 1F5JA 3FBMA 3JCIA 3LD8A 5FY9A 4YW7A 5C4WB 2ZEYA 3KF3A 4R52A 1QJX1 1JN2P 2NLRA 4MZUA 3SHRA 1EV12 2QQNA 4IERA 3QD6A 4QHOA 2HWE3 2ZBJA 2QNKA 1VRBA 4CEWB 3WG3A 2JG9B 2VL4A 2RS31 5FY8A 2QVSB 2XLAA 2ORXA 2VCAA 5J7MA 4XUPA 5M0TA 5A6YA 4ATEA 4BK5A 1ZZ9A 4HN1A 3A22A 2ZGQA 3OCPA 4Q26A 3ATGA 1UL9A 2B9UA 5A7OA 2Q5TA 1YYNA 2VR4A 1DYKA 5GKAC 3T08A 2D93A 4W8JA 5E1RA 1REEA 5C3PA 2YMZA 2VZ1A 3UJOA 3NMBA 1JZ6A 4GAZA 1ALYA 4MGIE 1GMMA 2AENA 1GNHA 3ACGA 2ZZQA 4Q5OA 3S30A 3RI9A 3WNOA 4BMBA 5FR3A 3WEZA 5LEKA 3T2QA 1UY0A 2BGPA 3MICA 4WZFA 4DY3A 3I3MA 1D4VB 1DQ2A 2J1RA 4CUBA 1JMUB 1XB9A 2WS93 5ABJA 4CP1A 4IXLA 2A6WA 3VBHA 1PK6C 5FY1A 4UW5A 4IV1A 1W28A 2DTWA 1LOAA 4ES9A 5IUQA 2X5IC 4IV3C 4NHKA 2WNUB 2OKXA 4AI3A 4EN9B 4CCJA 2JDHA 3OGRA 4QX8A 4UI9L 2QQKA 4YVWC 5CA6A 4XFGA 1DYOA 3D8CA 4H3WA 2FMYA 5FZ6A 1RTVA 3OY8B 4LE3A 5DAVA 5CFDC 4KU8A 2RM22 5FZOB 5GJ6A 1FT9A 4Q0UA 5KC6A 2JENA 1WW4A 4Y22B 3CJIC 1ZBA3 5AVAA 1REDA 4GA9A 3U07A 4CU9A 4XURA 1XJAA 3I3DA 2WNVC 5FZ0A 5C9AB 4ZZ8A 2MEV2 1H8TC 1XNDA 2YGMA 4GMP0 1IG0A 3P3PA 4W50A 2V4VA 1GV9A 4NAOA 4XFCA 1G9CA 3GZEA 4IEOA 2IVIB 5L9VA 3AL6A 4RFT0 1AL23 2ZAAA 4WM8A 4XFBA 3ZFEB 3NKGA 1ULGA 5EJZB 4FAGA 1AJKA 4B7KA 1RUG2 1OMIA 1W6PA 2B7YA 3ZMNA 1IPKA 1CESA 2A73B 4YVSA 5DPNA 2WWSA 4BQ3A 2QQOA 3T2PA 3M4FA 2CWMA 2WAOA 1RUC3 4RQPC 3WNMA 5FUNA 2D3PA 1E5IA 3SH5A 4FCAA 4TLFA 5FYYA 2VVFA 4SBVA 2D97A 2RS33 2HWB2 4QU1A 2ZX2A 2Q1MA 2VW1A 4BXSV 1KQRA 5FKCA 4DIQA 4GWNA 4PIZA 2FBEA 3M3QA 5FLIA 1COV3 1GSLA 2Q8DA 1BMV1 3ETPA 1TMF2 2DYCA 4TXWA 2E7QA 3UKVA 4LIUA 1PGL1 1UD1A 3JBG3 4YNIA 5F5AA 5CNAA 1W9TA 4AEDC 1SFPA 2FCUA 4YW5A 3ZKYA 5A6ZA 5I0RA 3M3OA 1OUXA 5IW0A 4K40A 1IG3A 4XTMA 5AFBA 2JE7A 3VKOA 3VHNA 4EWAA 2HEYF 1ZRDA 3T2OA 3N9MA 2O14A 1AVBA 2VOTA 3THTA 3I2DA 3DXUA 3U75A 2N7GA 2LS6A 1YWKA 5CG8A 4XOGA 3NW4A 1AR82 3Q8FA 2DCKA 5JI9A 4LO4B 3E5UA 5A7QA 4NWVA 2YGLA 4Y4RA 2UURA 5KBFA 3EBRA 3C7OA 4CPBA 3VD3A 3AJYA 2VNRA 1LULA 3POIA 5JUVA 2BFUS 1LOFA 3AFGA 3K75B 3D6EA 1AL22 3AMHA 3NV1A 3WG1A 1ZBE3 2VMEA 1CAVB 4XUTA 5JR7B 2ZACA 1DG6A 4QQLA 2UY9A 5G04L 1OUSA 4FBFA 2FDFA 4C91A 2VM9A 5AFEA 3B5LB 3OGJA 1UMHA 1V00A 3AXDA 3ILFA 1RVF1 2A71A 3N7MA 1MS3A 3AXEA 4N90A 2QZ2A 1V70A 5CZKA 2RHPA 4XYXA 4LBMA 3RSJA 2LTNA 5FYIA 4GALA 2RDRA 4Q4V3 5L73A 3RG0A 1I5ZA 3H1MA 3NNGA 1UY1A 1XNCA 1NCRC 2I45A 5F6KA 1OT5A 3K46A 1CAUB 1TMF1 3AZYA 2ID4A 4D94A 2VZQA 4M3CF 4ASMB 2ARAA 3WDXA 4C0HA 3MPPG 3ZFFA 3J7NA 3AP5A 5I0DA 4BQ2A 4HK9A 2JE9A 1PMIA 3EHKA 2E63A 1PK6A 4L92A 4XETA 5JI7A 2R062 3I97A 4XILA 1NQDA 3GZTB 4OZXA 4W6WA 5JZGB 4MVTA 2V73A 4UT5A 5FP9A 1GZWB 4QXBA 1LOBA 4CEYA 1LHUA 1S0FA 2FHRA 5KXBA 1OH3A 1VAVA 4AHYA 4BQXA 4YZ2A 1AR91 1E5SA 1WA4A 3P1IA 2NQYA 1FMD2 4DY5A 3LPFA 4OQ8A 4XCAA 5FXWA 4UFJA 4JVAA 2R32A 3C2UA 4HETA 4QQ2A 3ZIWA 5ACA2 1SBDA 3HMYA 2XR4A 5LASA 2WL1A 4MXVA 2FDJA 1G9DA 4BHPA 3ZFGA 1PMHX 1NLRA 1OQ1A 1W9FA 4O65A 3RJ2X 4COUA 1HRV1 2D5HA 1XE0A 1EAH3 2VY0A 1NG0A 2E53A 3ZSEA 2GC3A 3SEPA 3OEAA 4Y1VA 4DNYA 5C33A 3FLTA 4OI4A 3RDIA 2XBO2 5H9PA 2VJXA 2VH9A 4AFDA 1ZZ8A 1F31A 1SZBA 3DUIA 3USSA 4Q0PA 4BIFA 5JZGA 1HRI2 1NUKA 1NY71 1Q8SA 3LPGA 1WW5A 3BVCA 3ZSKA 2XJPA 2BBAA 2ZHLA 2LRPA 4EN6B 3AYEA 2WFF3 1AR81 3AZWA 1W6QA 1OD3A 4YZ3A 2WN2A 4D6RA 2BUKA 4CU6A 2AREA 4OLLA 4ET7A 3HAGA 2JDKA 3HEIA 1X8EA 1UMZA 4LKSA 3ZSLA 5GLWA 4OUMA 3OD0A 1LESA 1PO23 1GP4A 1G9BA 2WT1A 5LRRA 4RN5A 2ORZA 2A70A 2E7AA 2Z4FA 5H9QA 3SQOA 4AE2A 3T0DA 4COZA 1UYPA 3BKZA 1A8MA 1U5ZA 1UPSA 3VDDB 4DQAA 2V5DA 4HL0A 5CFCC 3T4VA 4PLNA 2V72A 4BWOA 1CZTA 2B39A 2OW4A 4AQ2A 2NMOA 5BNOC 3CKHA 1JHNA 4RHV1 3AVRA 2ZAHA 2VMHA 4M3CB 2XVLA 1PGSA 4QX2A 3DL3A 2NP0A 3D5OA 1XE8A 1OVSA 4PDWC 2BGOA 1OLQA 4A45A 2ZA9A 3VZNA 4CXXA 2ZJCA 1VP6A 3N4MA 1OKQA 1FV2A 4XTPA 1WKYA 1OFSA 1PX3A 1CX4A 1EY2A 3KZ4C 4OI2A 5FZIA 4FTBA 2HJIA 2VO5A 4B1LA 1WA6X 5FYUA 2Y0IA 1Y4WA 2R073 3I2GA 2PLV3 3WX5A 2RMU2 4HVQA 5F1RA 2E32A 1QXPA 5T55A 2CNAA 3MHZA 1PO13 2JDPA 2VBBA 4EZHA 1F9KA 5EHDA 4YZ5A 5JLVA 2YV8A 2YYOA 5C3SA 2CGOA 4FPFA 1DP0A 1HB2A 3K51A 2D6MA 4UFLA 5LA0A 5C8CC 1RUJ1 3MIEA 4DRVA 3U78A 2P1BA 1BEV1 5LW9A 4OCTA 1TZOA 2A3WA 1ZA7A 1RXGA 4GB31 3FJSA 1YIFA 3RGBA 4YG6A 4YFWA 2O0OA 4MGSA 4JDNA 2RMU1 4F7ZA 4Q0VA 2Q1ZB 4LK6A 1QQP2 4EZ4A 1HXS1 2VU9A 4AQTA 3GGLA 2ZZJA 1CVNA 5DUXA 5GZEA 5A33B 5CFDB 4IGQA 2Q8CA 2YY1A 4N8MA 1W6OB 2ENRA 2CU5A 2OIIA 2DDUA 3QCWA 5J1XA 1N1SA 1PO21 4CCKA 5FY4A 1ULDA 2I74A 1RUG3 1V6LA 2EAAA 2VPVA 4FPJA 1HN0A 1LOEA 3GDBA 1W8TA 4JC1A 3WP4A 2XJTA 1OLRA 3E5XA 3WQ0A 4NIGA 1AR93 3HPNA 3H7YA 2VE1A 1BK1A 4INDA 3RYKA 3S5QA 3VBSC 3ZFGB 1B35C 1OOPC 4JGYB 3VBUC 1PZ9A 4BPZA 4CP2A 1NCRA 4XAAA 1PZ8A 5LK7B 1YNAA 1ZNPA 4HKLA 4FPCA 2W0XA 1XNKA 1XSQA 3AX4A 3NNFA 1WCKA 4D69A 4DXRA 1POV3 3PMSA 1GWMA 2XDVA 3LKJA 1UQXA 4NROA 1F4HA 1LHNA 4B4QA 4H2AA 1LGBA 3AKQA 2PN5A 5E16A 1K5MB 2QQLA 5T52A 3ILNA 3VBOC 3ZDVA 3ZN5A 5CFDA 4QQHA 4RQPA 4CYDA 1RUC2 4QB6A 2YU1A 1VBB1 1AYN1 2IXKA 2GN3A 4AAPA 1XXNA 2NPIA 1A8DA 3O5SA 4UFMA 1UKRA 3RZGA 4W4ZA 4XJWA 1TEIA 2WNEA 2EXIA 3Q8AA 4PIXA 3UGHA 4BMEA 4OI0A 5FQ0B 3E6DA 1QGLA 2HWE2 1JOBA 4AEKA 4QGNA 1UIJA 4N43A 2E7TA 4JGZA 3FMGA 4CRQA 1X9TA 1JU4A 1YQ2A 5DMYA 1HRV3 1ZM1A 2VMGA 4AGVA 3K77A 1AZDA 1QF3A 3KQ4B 3ZO0B 3VLBB 3GHMA 2QQWA 1V6KA 2R063 3RNSA 4CU8A 3LSEA 1R082 1SPPB 5FMCA 1QHDA 1FATA 4EWEA 5EWSA 2WWUA 3R4UA 1TNFA 5LEJA 4CSWA 3RS6A 3NVCA 1ASJ3 5DUWA 2XBO1 4P9GA 2RVAA 1OURA 4LBOA 2JICA 4Y20A 5EZWA 4CDXA 5IK8A 1R64A 4CEWA 2AR6A 5F5IA 4PDWA 2DFCA 1ZRIA 1H8TA 2WIIB 5A7PA 5DUUA 3AP9A 1RUD1 3MI8A 4XZUG 3U10A 1Z7S2 2ZCWA 3KV9A 1K5JA 5CISA 5J36A 4E4HA 3POJA 5C4WA 3S5AA 3A7QA 1YQ8A 2W1WA 1T6BX 3CJIB 3I2IA 4XMIA 5IK7A 4YFZA 1US3A 3T30A 1COV1 2X8KA 2QQUA 1Q8OA 4XUNA 2FMDA 1PVC1 2Q30A 2YBPA 5BV6A 1T6GC 3ZXLA 2JB4A 2VZSA 3P3NA 2D7FA 2P3KA 3QLQA 4HONA 4LKDA 4QDQA 5DAWA 1JYCA 1OPMA 2P17A 4N53C 4Q4X2 3WV6A 2XJUA 1RUJ3 1QOTA 5FY7A 3W20A 3I3EA 5JSRA 2W47A 2GMPA 3HT2A 4P5YA 4Y1YA 3WXPA 1WCSA 2HBTA 1AX0A 1MVQA 3MLKA 3VDBA 3S57A 4DOUA 3RWKX 3P5BA 4JQRA 1Q43A 4ZS2A 4IE7A 2KD7A 1TQ5A 3ST7A 2AGSA 3ZPOA 4RQPB 1CX1A 4QKNA 1QQP1 3H8XA 5C6CA 2Y6JA 1X33A 4LBJA 1YFUA 2GH2A 3I7DA 2E31A 2DCYA 5AC91 4HLTA 1UXZA 3CJXA 4B1MA 1JODA 1UWWA 1NAEA 4CEWC 2WC2A 5HCFA 1SDWA 3ACHA 4P9YA 3V56A 2AEYA 4JGYA 5JR2A 1Q5OA 4LT5A 5GZDA 4AEJA 3AZZA 3AP6A 5ACA3 1JZ2A 1UZWA 4M3CE 1W6NB 5BNNB 2BP6A 1RUE1 1ODMA 4QMAA 3ZYIB 1DLLA 4PJYA 3S7EA 3I59A 2GU9A 2QQIA 5JDBA 4FOWA 4F83A 1VBC1 3T3YA 1PHMA 2DBNA 4ZHNA 1YJLA 1YQCA 4LE4A 3SH3A 1RUD3 2JDUA 1WZXA 1YFWA 2OZ6A 3A0NA 3OUJA 1RUI2 1PK6B 2D40A 3ZXFA 2V5YA 1Y7BA 3WQBA 2WYFA 3L2HA 3PUSA 1O3TA 1YFXA 1WWYA 2B45X 3ZFFB 1XU1A 3GBWA 2HYKA 5K0UB 4FO9A 1GQHA 5FOBB 1QXJA 1UX6A 2X09A 2OUJA 5ABJB 1F35A 2RS32 4YW4A 5F7UA 3RZJA 3NJXA 4KH9A 3LQCA 2ZOEB 2VVDA 3PUQA 1W90A 3LF7A 1IS4A 1RINA 5LA1A 2QUOA 1CN1A 3AMQA 3H1WA 4CCLA 2P3IA 4JDOA 4AYUA 2CDOA 3FUQA 3PU8A 5HCAA 4I30A 1F5FA 2W95A 3RVHA 1YUDA 1H8TB 1IS6A 4JCKA 4DO0A 4Q4X1 1W3VA 3K48A 1UOFA 1BQPA 2Y0OA 1CONA 2JIJA 1EUUA 4X6RB 3OYWA 4CDXB 4EYUA 1PM4A 3OUHA 3KS7A 1HRI1 1NY72 1QH7A 1U0AA 3TN93 4PF1A 3AC0A 4ATFA 2R49A 2PXJA 3B3QE 4COVA 4XF9A 1EV13 4IE6A 1ZZ6A 2JWPA 2WO3A 1NQJA 1US2A 1W8HA 1SPPA 3J4UH 3J8F2 4GULA 3SITA 4NIHA 2BU9A 5J09A 5FPBA 5FO8B 2BV4A 1RUD2 4DFSA 2W1QA 4JHTA 2XJVA 2NZ9A 2Y6LA 2YROA 4PLMA 3H50A 2VCBA 2W9XA 4XABA 3PJYA 1QQP3 2YC2A 5FIXA 1W8ZA 3ZYGA 2XHNA 4BXFA 1L7RA 3NJVA 3DF0A 2R16A 4Y33A 1XU2A 3AYCA 3EO6A 2PELA 1OA4A 3B7MA 1BZWA 2PAMA 1JZ7A 3OD4A 2W52A 4N53A 5F5QA 1QDCA 1SLCA 5LBBA 4FVVA 2H6BA 2WS92 5FZ8A 3W59A 4QM9A 2XOMA 1S4CA 3URFA 4NAMA 4LKFA 3PVNA 1LR5A 5FYVA 4AVBA 1C8M3 4NE9A 5L7OA 3ZN6B 1FOD2 1IPSA 4NHXA
chains in the Genus database with same CATH topology
1W9WA 3HOBA 1TG7A 2DCJA 3MV01 4CU9A 4XURA 1JYNA 3I3DA 4ZZ8A 1W0NA 4XVHA 4W50A 2V4VA 4KI5M 4A44A 1UXXX 4E8DA 1CZVA 1UYXA 5EJZB 2W92A 2EIDA 1JHJA 5DPNA 2QQOA 3T2PA 2WAOA 2J1VA 3WNMA 4A42A 2J1SA 1RYYA 4OUEA 3DECA 4BK4A 4PT6A 2J1AA 2VQUA 5DQ0A 3VD5A 4BXSV 2ZXQA 1W8OA 3W5MA 4ZZ5A 1LNSA 3ETPA 1XNAA 3GXUA 4TXWA 2XQXA 4ARYA 4KWUA 4GWIA 1EUTA 3BN6A 3WSOA 1W9TA 4JKMA 5JXIA 1SFPA 4QPWA 4FI9A 4MO3M 2B4KA 4GWJA 5CYYA 3T2OA 1K3IA 2VOTA 3IIIA 5IYYA 2VC9A 4BDVB 2LS6A 2DCKA 3I2KA 5A1AA 3C7OA 4P00B 3VD9A 4QB1A 3VD3A 2VZTA 5JUVA 3POIA 3K75B 3FHQA 4UOJA 2E26A 2J22A 4XUOA 2VMEA 3WNPA 4XUTA 2BERA 5G04L 2JE8A 2VM9A 3IDAA 2L9LA 5G05L 1UMHA 2ZEWA 4LOSA 3CIHA 5HPOA 5CZKA 3WF4A 3NNGA 3NRUA 1UY1A 2EIEA 4UAPA 4TTGA 3MBWA 1OT5A 3K46A 5C7GA 4M4RA 2ID4A 2VZQA 1J84A 4CUAA 3OB8A 5I0DA 1L7QA 4A41A 1UZ0A 4QDRA 2WZ8A 3I97A 4QAWA 4QX1A 2C9KA 3P1IA 4CU7A 1JYWA 1K45A 3LPFA 4DUVA 1HN1A 1GOHA 3T0BA 2QQJA 1H6XA 3I3BA 4BJ0A 1PMHX 4OMCA 1KEXA 3WNNA 3LE0A 2WO1A 2ZEZA 2VQTA 4DEVA 3SEPA 3OEAA 3OGVA 4LORA 1UY2A 3VD7A 2VJXA 2W5FA 2J1UA 3DYMA 1SZBA 4QB2A 3ECQA 3CZUA 2J1TA 1NUKA 3LPGA 1H6YA 4IUGA 2VMFA 2BBAA 1SG3A 3C7HA 1OD3A 1W9SA 2WN2A 2Y8KA 3WNKA 4CU6A 3VDCA 1K42A 4ET7A 2JKXA 3HEIA 3HN3A 3GM8A 4LKSA 3K4ZA 3ACIA 4RN5A 2ORZA 2X10A 2Z4FA 3PUIA 3T0DA 3POBA 2WYSA 3UETA 3T09A 4KMQA 2QBXA 2WAAA 2V5DA 4DXTA 3I2JA 2V72A 3E1F1 3FN9A 1CZTA 2WDBA 3WF3A 4A6OA 5JMOA 2J7MA 1PX4A 3ZM8A 3CKHA 3HNMA 4MADA 3IAPA 5EIYB 3POGA 2YFUA 4QX2A 3DYOA 5FUIA 2BGOA 4DEQA 5LA2A 1UY4A 4A45A 2LW8A 3ABZA 1WKYA 2W91A 1PX3A 2RV9A 1PMJX 2VO5A 4LQRA 3I2GA 4ARXA 3PUHA 2WQ8A 3LEIA 2E32A 3SKJE 4DXSA 5C70A 2J1EA 2R7EB 3IAQA 4OMDA 4AG4A 1DP0A 1KGYA 1UYYA 5LA0A 2VTFA 1JYXA 4D0QA 2CDPA 4JKLA 2E33A 3CQOA 1WCQA 2ZEXA 5JXGA 2VMDA 5IJRA 4MGSA 3DEMA 3MUY1 1GUIA 4L0PA 3C7GA 2WBKA 3GGLA 3HNBM 1GQPA 3IB3A 3WF0A 3T0AA 5J1XA 2DDUA 1XNTA 4DUXA 2VZOA 4M4PA 4MOAA 2W1SA 2WZEA 3GDBA 1OH4A 3U37A 2VZ3A 3POEA 3P6BA 5EJ1B 3NQHA 2JD9A 1J83A 3HPNA 5B4XA 3I2FA 2VCCA 1D7PM 4CVUA 1JZ4A 3CMGA 2VMCA 4DXRA 1GNYA 4XUQA 1JZ3A 3MO4A 5CKNA 1F4HA 4D8MA 2QQLA 5CKQA 2WNOA 1K12A 4QB6A 1BHGA 1I5PA 3D3AA 1JYVA 3POFA 2X05A 4W4ZA 3I2HA 1O8SA 4ZXEA 3EYPA 4P02B 1JZ8A 5JXJA 1UX7A 1NZIA 3C8XA 3THDA 1F4AA 1GU3A 2WUHA 5DMYA 1JU4A 1YQ2A 3BGAA 3K4AA 3K77A 4HG6B 3LEKA 4GZ9A 3KQ4B 4OZOA 3F2ZA 4CU8A 2C26A 1SPPB 1MPXA 5IFPA 3OEBA 3WNLA 3A21A 2RVAA 1CZSA 4MGQA 2W1UA 1IQDC 1R64A 3MV11 3DYPA 2W87A 2Y6GA 3CZJA 4LMFA 2W3JA 4XZUG 1SHWB 5CISA 5IFTA 1T2XA 2VZRA 4ZY9A 4AAXA 3POJA 3A7QA 2W1WA 4CUCA 3I2IA 3J7HA 1US3A 4YPJA 4JKKA 3ACFA 2WABA 2HYXA 1W8NA 4JX0A 4XUNA 5IHRA 1UMIA 2YB7A 2VZSA 4QDQA 3HJRA 3LEGA 3MUZ1 1CIYA 3I3EA 4LPLA 2W47A 4P5YA 3HNYM 4A3ZA 5LCWL 3VDBA 4QX3A 1GOFA 2KD7A 4OYUA 1CX1A 1ULOA 2Y6JA 2WN3A 1UY3A 3SEEA 1DLCA 2E31A 1UXZA 2XONA 3C7FA 1UWWA 5CKMA 1NAEA 5JXHA 2EICA 3EB7A 2BZDA 3ACHA 3FL7A 5JR2A 2WO2A 1NT0A 1JI6A 1OF3A 3OBAA 1NKGA 1JZ2A 2W46A 1OF4A 3OGSA 3WF1A 2YG0A 2QQIA 4RYDA 5C71A 4LOTA 1JZ5A 2VZPA 3WF2A 4A4AA 1W99A 2YFZA 3SKVA 2QQMA 1ULPA 1JU3A 2RJ2A 3WQBA 4P08A 3FHAA 4DUWA 4E8CA 1TVGA 1GOGA 2X09A 3VDAA 5F7UA 3NJXA 2YC4A 3LQCA 3A23A 2C4XA 5LA1A 4JHZA 2JDAA 4QDSA 2ZEYA 2Y6KA 2CDOA 2QQNA 2W95A 2VZVA 3CDZB 2Y6HA 2W94A 1EUUA 2VL4A 1UYZA 2PQSA 2ORXA 2VCAA 4QX0A 4XUPA 3THCA 4Z2AA 3W5NA 4PF1A 3AC0A 4BK5A 2VZUA 3A22A 1XPWA 4PQQA 2WO3A 3T08A 2VR4A 1US2A 1SPPA 4W8JA 3UNPA 3VD4A 2VZ1A 5DN2A 1JZ6A 1GMMA 3ACGA 3WNOA 3WEZA 2W1QA 2B9VA 3T2QA 1UY0A 2BGPA 2Y6LA 2VCBA 2W9XA 2J1RA 4CUBA 2YC2A 2XHNA 1L7RA 3NJVA 3UESA 1SDDB 1XC6A 4LHSA 2EIBA 1JZ7A 2OKXA 5HXMA 3OGRA 2HLEA 4UI9L 2QQKA 1O8PA 3JXSA 3OG2A 1DYOA 2XOMA 1O59A 5B4NA 2Y64A 1NX9A 3K4DA 1P8JA 3C7EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W9W A;  3HOB A;  1TG7 A;  2DCJ A;  3MV0 1;  4CU9 A;  4XUR A;  1JYN A;  3I3D A;  4ZZ8 A;  1W0N A;  4XVH A;  4W50 A;  2V4V A;  4KI5 M;  4A44 A;  1UXX X;  4E8D A;  1CZV A;  1UYX A;  5EJZ B;  2W92 A;  2EID A;  1JHJ A;  5DPN A;  2QQO A;  3T2P A;  2WAO A;  2J1V A;  3WNM A;  4A42 A;  2J1S A;  1RYY A;  4OUE A;  3DEC A;  4BK4 A;  4PT6 A;  2J1A A;  2VQU A;  5DQ0 A;  3VD5 A;  4BXS V;  2ZXQ A;  1W8O A;  3W5M A;  4ZZ5 A;  1LNS A;  3ETP A;  1XNA A;  3GXU A;  4TXW A;  2XQX A;  4ARY A;  4KWU A;  4GWI A;  1EUT A;  3BN6 A;  3WSO A;  1W9T A;  4JKM A;  5JXI A;  1SFP A;  4QPW A;  4FI9 A;  4MO3 M;  2B4K A;  4GWJ A;  5CYY A;  3T2O A;  1K3I A;  2VOT A;  3III A;  5IYY A;  2VC9 A;  4BDV B;  2LS6 A;  2DCK A;  3I2K A;  5A1A A;  3C7O A;  4P00 B;  3VD9 A;  4QB1 A;  3VD3 A;  2VZT A;  5JUV A;  3POI A;  3K75 B;  3FHQ A;  4UOJ A;  2E26 A;  2J22 A;  4XUO A;  2VME A;  3WNP A;  4XUT A;  2BER A;  5G04 L;  2JE8 A;  2VM9 A;  3IDA A;  2L9L A;  5G05 L;  1UMH A;  2ZEW A;  4LOS A;  3CIH A;  5HPO A;  5CZK A;  3WF4 A;  3NNG A;  3NRU A;  1UY1 A;  2EIE A;  4UAP A;  4TTG A;  3MBW A;  1OT5 A;  3K46 A;  5C7G A;  4M4R A;  2ID4 A;  2VZQ A;  1J84 A;  4CUA A;  3OB8 A;  5I0D A;  1L7Q A;  4A41 A;  1UZ0 A;  4QDR A;  2WZ8 A;  3I97 A;  4QAW A;  4QX1 A;  2C9K A;  3P1I A;  4CU7 A;  1JYW A;  1K45 A;  3LPF A;  4DUV A;  1HN1 A;  1GOH A;  3T0B A;  2QQJ A;  1H6X A;  3I3B A;  4BJ0 A;  1PMH X;  4OMC A;  1KEX A;  3WNN A;  3LE0 A;  2WO1 A;  2ZEZ A;  2VQT A;  4DEV A;  3SEP A;  3OEA A;  3OGV A;  4LOR A;  1UY2 A;  3VD7 A;  2VJX A;  2W5F A;  2J1U A;  3DYM A;  1SZB A;  4QB2 A;  3ECQ A;  3CZU A;  2J1T A;  1NUK A;  3LPG A;  1H6Y A;  4IUG A;  2VMF A;  2BBA A;  1SG3 A;  3C7H A;  1OD3 A;  1W9S A;  2WN2 A;  2Y8K A;  3WNK A;  4CU6 A;  3VDC A;  1K42 A;  4ET7 A;  2JKX A;  3HEI A;  3HN3 A;  3GM8 A;  4LKS A;  3K4Z A;  3ACI A;  4RN5 A;  2ORZ A;  2X10 A;  2Z4F A;  3PUI A;  3T0D A;  3POB A;  2WYS A;  3UET A;  3T09 A;  4KMQ A;  2QBX A;  2WAA A;  2V5D A;  4DXT A;  3I2J A;  2V72 A;  3E1F 1;  3FN9 A;  1CZT A;  2WDB A;  3WF3 A;  4A6O A;  5JMO A;  2J7M A;  1PX4 A;  3ZM8 A;  3CKH A;  3HNM A;  4MAD A;  3IAP A;  5EIY B;  3POG A;  2YFU A;  4QX2 A;  3DYO A;  5FUI A;  2BGO A;  4DEQ A;  5LA2 A;  1UY4 A;  4A45 A;  2LW8 A;  3ABZ A;  1WKY A;  2W91 A;  1PX3 A;  2RV9 A;  1PMJ X;  2VO5 A;  4LQR A;  3I2G A;  4ARX A;  3PUH A;  2WQ8 A;  3LEI A;  2E32 A;  3SKJ E;  4DXS A;  5C70 A;  2J1E A;  2R7E B;  3IAQ A;  4OMD A;  4AG4 A;  1DP0 A;  1KGY A;  1UYY A;  5LA0 A;  2VTF A;  1JYX A;  4D0Q A;  2CDP A;  4JKL A;  2E33 A;  3CQO A;  1WCQ A;  2ZEX A;  5JXG A;  2VMD A;  5IJR A;  4MGS A;  3DEM A;  3MUY 1;  1GUI A;  4L0P A;  3C7G A;  2WBK A;  3GGL A;  3HNB M;  1GQP A;  3IB3 A;  3WF0 A;  3T0A A;  5J1X A;  2DDU A;  1XNT A;  4DUX A;  2VZO A;  4M4P A;  4MOA A;  2W1S A;  2WZE A;  3GDB A;  1OH4 A;  3U37 A;  2VZ3 A;  3POE A;  3P6B A;  5EJ1 B;  3NQH A;  2JD9 A;  1J83 A;  3HPN A;  5B4X A;  3I2F A;  2VCC A;  1D7P M;  4CVU A;  1JZ4 A;  3CMG A;  2VMC A;  4DXR A;  1GNY A;  4XUQ A;  1JZ3 A;  3MO4 A;  5CKN A;  1F4H A;  4D8M A;  2QQL A;  5CKQ A;  2WNO A;  1K12 A;  4QB6 A;  1BHG A;  1I5P A;  3D3A A;  1JYV A;  3POF A;  2X05 A;  4W4Z A;  3I2H A;  1O8S A;  4ZXE A;  3EYP A;  4P02 B;  1JZ8 A;  5JXJ A;  1UX7 A;  1NZI A;  3C8X A;  3THD A;  1F4A A;  1GU3 A;  2WUH A;  5DMY A;  1JU4 A;  1YQ2 A;  3BGA A;  3K4A A;  3K77 A;  4HG6 B;  3LEK A;  4GZ9 A;  3KQ4 B;  4OZO A;  3F2Z A;  4CU8 A;  2C26 A;  1SPP B;  1MPX A;  5IFP A;  3OEB A;  3WNL A;  3A21 A;  2RVA A;  1CZS A;  4MGQ A;  2W1U A;  1IQD C;  1R64 A;  3MV1 1;  3DYP A;  2W87 A;  2Y6G A;  3CZJ A;  4LMF A;  2W3J A;  4XZU G;  1SHW B;  5CIS A;  5IFT A;  1T2X A;  2VZR A;  4ZY9 A;  4AAX A;  3POJ A;  3A7Q A;  2W1W A;  4CUC A;  3I2I A;  3J7H A;  1US3 A;  4YPJ A;  4JKK A;  3ACF A;  2WAB A;  2HYX A;  1W8N A;  4JX0 A;  4XUN A;  5IHR A;  1UMI A;  2YB7 A;  2VZS A;  4QDQ A;  3HJR A;  3LEG A;  3MUZ 1;  1CIY A;  3I3E A;  4LPL A;  2W47 A;  4P5Y A;  3HNY M;  4A3Z A;  5LCW L;  3VDB A;  4QX3 A;  1GOF A;  2KD7 A;  4OYU A;  1CX1 A;  1ULO A;  2Y6J A;  2WN3 A;  1UY3 A;  3SEE A;  1DLC A;  2E31 A;  1UXZ A;  2XON A;  3C7F A;  1UWW A;  5CKM A;  1NAE A;  5JXH A;  2EIC A;  3EB7 A;  2BZD A;  3ACH A;  3FL7 A;  5JR2 A;  2WO2 A;  1NT0 A;  1JI6 A;  1OF3 A;  3OBA A;  1NKG A;  1JZ2 A;  2W46 A;  1OF4 A;  3OGS A;  3WF1 A;  2YG0 A;  2QQI A;  4RYD A;  5C71 A;  4LOT A;  1JZ5 A;  2VZP A;  3WF2 A;  4A4A A;  1W99 A;  2YFZ A;  3SKV A;  2QQM A;  1ULP A;  1JU3 A;  2RJ2 A;  3WQB A;  4P08 A;  3FHA A;  4DUW A;  4E8C A;  1TVG A;  1GOG A;  2X09 A;  3VDA A;  5F7U A;  3NJX A;  2YC4 A;  3LQC A;  3A23 A;  2C4X A;  5LA1 A;  4JHZ A;  2JDA A;  4QDS A;  2ZEY A;  2Y6K A;  2CDO A;  2QQN A;  2W95 A;  2VZV A;  3CDZ B;  2Y6H A;  2W94 A;  1EUU A;  2VL4 A;  1UYZ A;  2PQS A;  2ORX A;  2VCA A;  4QX0 A;  4XUP A;  3THC A;  4Z2A A;  3W5N A;  4PF1 A;  3AC0 A;  4BK5 A;  2VZU A;  3A22 A;  1XPW A;  4PQQ A;  2WO3 A;  3T08 A;  2VR4 A;  1US2 A;  1SPP A;  4W8J A;  3UNP A;  3VD4 A;  2VZ1 A;  5DN2 A;  1JZ6 A;  1GMM A;  3ACG A;  3WNO A;  3WEZ A;  2W1Q A;  2B9V A;  3T2Q A;  1UY0 A;  2BGP A;  2Y6L A;  2VCB A;  2W9X A;  2J1R A;  4CUB A;  2YC2 A;  2XHN A;  1L7R A;  3NJV A;  3UES A;  1SDD B;  1XC6 A;  4LHS A;  2EIB A;  1JZ7 A;  2OKX A;  5HXM A;  3OGR A;  2HLE A;  4UI9 L;  2QQK A;  1O8P A;  3JXS A;  3OG2 A;  1DYO A;  2XOM A;  1O59 A;  5B4N A;  2Y64 A;  1NX9 A;  3K4D A;  1P8J A;  3C7E A; 
#chains in the Genus database with same CATH topology
 3RFR A;  1W9W A;  4QX5 A;  1HRV 2;  1U5I A;  1VBE 1;  4NPL A;  3AMN A;  5JPN B;  2WQ4 A;  2DCJ A;  4IEU A;  2WR9 A;  4RS5 A;  4XDQ A;  5BNN A;  3AM2 A;  2IVJ A;  3ZFE A;  2WNU C;  1CIW A;  2CL2 A;  3AP4 A;  5FPA A;  2DUO A;  4LUL A;  4QPI B;  4KI5 M;  3TN9 2;  3USU B;  4E8D A;  1C1L A;  4FFH A;  1SFY A;  1UYX A;  2H6C A;  2WQZ C;  3O1M A;  4QD2 A;  1E57 A;  1UOB A;  2A3Y A;  2IXC A;  2W92 A;  2MEV 1;  1YRZ A;  1S0J A;  2EID A;  5JSO A;  1FMD 3;  5T5O A;  1DQ5 A;  5LBC A;  3ZOI A;  4CPB D;  2JEM A;  4RR3 C;  1GZW A;  2VMI A;  3VBF B;  2PMW B;  3JB8 A;  1RYY A;  4Q1P A;  4BK4 A;  1PIV 1;  5AVP A;  2J1A A;  1BBT 3;  1MS9 A;  2UWC A;  5DQ0 A;  1Z7S 3;  3LWC A;  1RUC 1;  2KXL A;  3K3N A;  2OX0 A;  5FOJ B;  2WO7 A;  1YLL A;  2GC2 A;  3N7L A;  5FYH A;  1QJY 3;  4AXO A;  2LAL A;  1FYU A;  1O6U A;  4NOT A;  1LNS A;  1R1A 2;  3VKF C;  2XQX A;  1ZBA 1;  1WME A;  2Y6F A;  4GWI A;  3VBR B;  5EP9 A;  3VZO A;  1EUT A;  3KGL A;  1PO2 2;  4JKM A;  4QPW A;  5DZG A;  4IGP A;  5F5C A;  3MZH A;  1AR6 3;  3WG4 A;  1S1A A;  2YDE A;  2W08 A;  2XVG A;  3KT1 A;  1HJG A;  4GWJ A;  1LOG A;  1SLI A;  4Y24 A;  4GH4 B;  4XPV A;  4FAH A;  2FDI A;  4LK7 A;  3BAL A;  4J1X A;  2AZ5 A;  3X29 B;  4CDQ C;  5A1A A;  2BWC A;  3AB0 A;  3GF6 A;  3Q8C A;  4O9G A;  4XXA A;  4PHZ A;  2X5I A;  1N3P A;  2WA3 A;  3MYX A;  2E26 A;  3GBG A;  3WY6 A;  1GLH A;  1HQN A;  2BER A;  1MS1 A;  2JE8 A;  1MS8 A;  3DKW A;  1HDK A;  2GC0 A;  4W65 A;  1GBG A;  2EF6 A;  5G05 L;  2RS1 3;  2ZEW A;  1RMU 1;  4I3G A;  4LOS A;  4E9K A;  1O3R A;  3CIH A;  4CDU C;  4QX7 A;  1F2N A;  4PI0 A;  4COY A;  3M8L A;  1EV1 1;  1BEV 2;  3KHC A;  1JOP A;  2H0V A;  2PLV 2;  3ETQ A;  3BPS A;  4XCB A;  2UYB A;  5IAX A;  2BJS A;  4TTG A;  2PHU A;  3QBQ A;  3MBW A;  4XQW A;  2ZGT A;  3ZXA C;  1SCR A;  2VQA A;  4M4R A;  5BNP C;  1R1A 3;  2GC1 A;  2WWJ A;  2ZGR A;  2VXR A;  4HSL A;  4XFF A;  5DUV A;  5JOW A;  3M3I A;  1S0D A;  4E2G A;  2EA7 A;  4H55 A;  4RS5 C;  5FJK A;  3OB8 A;  1O4Y A;  1R09 3;  1L7Q A;  5K9Y A;  1H1I A;  4P9W A;  2TEP A;  4A41 A;  2YPJ A;  4ASK A;  3GZA A;  3DXT A;  4AI8 A;  4AVV A;  4QDR A;  3MFA A;  1ULE A;  3E5Q A;  4CDQ A;  3BU0 A;  4Q2F A;  1SQ4 A;  1A78 A;  4QX1 A;  1AR6 1;  1D0H A;  1BLZ A;  3N35 A;  1H2L A;  2WKK A;  4AVC A;  5HV0 A;  4YVS B;  1UU4 A;  3FHI B;  5FZB A;  4R8H A;  1XYO A;  2ARB A;  2BEO A;  4J25 A;  3N36 A;  3VN4 A;  1MS4 A;  4D3W A;  1CJP A;  4CTE A;  3RRD A;  4IE5 A;  3UK9 A;  2A6X A;  1ULC A;  1W2N A;  2VXJ A;  4Y3O A;  1H6X A;  3I3B A;  3ZXG A;  1UZY A;  1BVV A;  1H0B A;  1B09 A;  1DU3 D;  5ANQ A;  3M70 A;  3WNN A;  1G8W A;  2A6Y A;  1DZQ A;  1DZT A;  2WZR 2;  2XJS A;  4HXC A;  2QFE A;  1DGL A;  2WO1 A;  3B01 A;  1AF9 A;  2HWF 3;  3FE5 A;  2R04 2;  4CE8 A;  4IW3 A;  1APN A;  4LOR A;  4CCO A;  3BTA A;  1W9Y A;  4EN0 A;  3POW A;  4ZON A;  5JPM B;  4URA A;  1N47 A;  5IT6 A;  2CGP A;  3DYM A;  2XVK A;  3HT1 A;  2ZS6 B;  2G4I A;  2VGD A;  4UYB A;  3CZU A;  3OY8 A;  2R07 1;  2Z79 A;  4IUG A;  2VMF A;  2RJK A;  1ZYB A;  4RL7 A;  2A6V A;  4I0B A;  4IEV A;  1Y9G A;  4I09 A;  5FRA A;  3C7H A;  2EVX A;  3OPZ A;  3BIW E;  1PIV 3;  1C8M 1;  5F32 A;  3VBS A;  4OHY A;  1VBA 1;  1RUO A;  1LOF C;  1J3P A;  1RUE 3;  3HN3 A;  4BU2 A;  5GZC A;  4FQZ A;  3AKP A;  2DVA A;  3HR9 A;  1VRH 1;  3VBH B;  3T2T A;  1AXY A;  3FUO A;  3UET A;  4JQT A;  3ZFE C;  2C24 A;  2XGX A;  5IWF A;  2QBX A;  5A7W B;  2ZHN A;  4DXT A;  2ZKN A;  2PHR A;  5CG9 A;  4JRL A;  5FPU A;  2RG4 A;  3KB5 A;  5JMO A;  4A6O A;  4QQO A;  2IC1 A;  2YC0 A;  1JTZ X;  3MF9 A;  4MXW B;  4YGC A;  4IET A;  4U36 A;  1BKZ A;  3OPT A;  5TSW A;  3JZV A;  2OZJ A;  5EIY B;  3O1O A;  1RL3 A;  1EAH 2;  1ENQ A;  5ERL A;  2R0F A;  1B35 B;  3VBU B;  3RZK A;  1AXZ A;  4NR1 A;  3RYP A;  3PME A;  1O3Q A;  5LA2 A;  4BH9 A;  4AQS A;  4YW1 A;  1GP5 A;  4QPG A;  2Q1F A;  3U4X A;  5L9R A;  1UNB A;  2GAU A;  3NNM A;  1PMJ X;  3FLP A;  2D3S A;  1HRI 3;  1QY4 A;  2F4L A;  5HXV A;  4FFF A;  2D6L X;  5L36 A;  4X6Q B;  4NMI A;  4XHB A;  5DDJ 1;  5SV8 A;  5IVB A;  2WQ8 A;  5DZF A;  1AHS A;  3KCC A;  3LEI A;  2JG8 A;  4P9J A;  5JMC A;  1W8F A;  1W2U A;  4GJZ A;  1W39 A;  4AG4 A;  3PIJ A;  3O1V A;  2PHF A;  4ZKT B;  2XH6 A;  2GMM A;  4TLG A;  4XHX A;  1AL2 1;  3D0J A;  2Q8E A;  4LNV A;  3O1U A;  4UW4 A;  4JKL A;  3CQO A;  5E89 A;  1ENR A;  1WCQ A;  3JB4 C;  1DZR A;  1QJU 1;  3TBD A;  2VMD A;  4UFI A;  5IJR A;  5FWE A;  3VBS B;  3ZFG C;  5A1L A;  3DEM A;  4K7J A;  4KWK A;  2BPA 2;  2ZHK A;  1H1M A;  4NPM A;  4L0P A;  1MQT A;  3HNB M;  3AYA A;  3LB9 A;  1OQE A;  1K5M A;  2GZW A;  2RDN A;  3H3L A;  2B8M A;  3IT8 A;  3WF0 A;  1LTE A;  1ZRR A;  2HWB 1;  2XQR A;  1W05 A;  4LO5 B;  4R9A A;  3MW4 A;  1X50 A;  3AYD A;  2WZR 1;  3CL1 A;  4FPL A;  3KHB A;  5FK7 A;  1XYN A;  5DAX A;  4MOA A;  5BXX A;  2W1S A;  1PGL 2;  1H2N A;  5BNQ A;  4AHX A;  2WZP P;  1NCR B;  1OH4 A;  3HD8 B;  2VZ3 A;  3U37 A;  3POE A;  4CCC A;  1F8V A;  3H1Y A;  2JD9 A;  4M0N A;  4XW3 A;  4D6S A;  2OXB A;  5C9A C;  2BQP A;  1DBN A;  3WIN E;  3RZH A;  4M01 A;  3PJQ A;  1F15 A;  4NO4 A;  3ZXD A;  3TOJ A;  1JZ4 A;  2VMC A;  1BXH A;  4FOV A;  4MUV A;  1NLS A;  4NUB A;  1GNY A;  1YCI A;  4Q4V 1;  4LUM A;  1ZZ7 A;  4R9D A;  4XUQ A;  3VBF C;  4C8D A;  4QPY A;  1ENS A;  3O1S A;  3IN9 A;  4XJU A;  2ZGN A;  1Q8P A;  3N9N A;  3I4I A;  4ERO A;  3KT7 A;  4CP0 A;  4EV0 A;  1K12 A;  5GM0 A;  1POQ A;  2VW2 A;  5J37 A;  2ZX4 A;  5CAZ A;  2BBV A;  1UN1 A;  2JKB A;  1RXF A;  1UZV A;  2EXH A;  3TNP B;  1BBT 1;  1R1Z A;  3POF A;  3UL2 A;  1KDM A;  4CDW A;  1HQL A;  2P5B A;  1QMJ A;  2BRT A;  3WG2 A;  2MPF A;  3IIA A;  2WNU A;  3I2H A;  5FYM A;  2Y34 A;  1O8S A;  1UZZ A;  3EYP A;  1QOS A;  1GZT A;  2D44 A;  2D5F A;  4P02 B;  1CAU A;  1LED A;  5CVR A;  4FPE A;  1NZI A;  2AAC A;  2X29 A;  1EYB A;  4E4S A;  4QXC A;  1DGR A;  2ZGP A;  2RM2 3;  2E6V A;  1MZ6 A;  1W0P A;  5T3N A;  5KHK A;  3ZXK A;  3WQ1 A;  5IVY A;  3WP6 A;  3B9I A;  4NID A;  4NRP A;  1OOP A;  5F3I A;  1MPX A;  5T5P A;  3OEB A;  4LTA A;  1N1V A;  5HI0 A;  2VNG A;  3LIG A;  3OYW B;  1CZS A;  4FPY A;  4WZC A;  2E51 A;  1QJY 1;  3NO8 A;  2JD4 A;  1OOP B;  4JGY C;  4TWT A;  3DYP A;  4XMA A;  3D0S A;  4RFR B;  4DMI A;  2W87 A;  2Y6G A;  3CZJ A;  4PCR A;  4KG8 A;  4Z2W A;  1VMH A;  3GZU C;  1SHW B;  3BOD A;  1O4T A;  4DXZ A;  1T2X A;  2H0B A;  4HAN A;  4XJZ A;  5L9B A;  3VHO A;  1QJX 2;  1DQ6 A;  1Q8Q A;  4S2G A;  3H8R A;  4FTE A;  3ZR6 A;  1K5M C;  1POV 0;  1W0O A;  5LRS A;  1UMI A;  2WSU A;  2LM3 A;  4NWW A;  3MIH A;  2DCZ A;  3LEG A;  5FZC A;  2P4E A;  3MUZ 1;  4I3P A;  2W2I A;  2XG3 A;  4BQ4 A;  4CCE A;  1CIY A;  3IKW A;  4LPL A;  2DVB A;  1NE6 A;  1N3Q A;  3KSC A;  4KL1 A;  5E6H A;  1V6N A;  4GIQ A;  4LO7 A;  2BYV E;  4K1Z A;  4KWL A;  2OQ7 A;  3ZSM A;  2Z2S B;  2HWB 3;  3IDC B;  4AFB A;  5IK5 A;  3B93 A;  2ZGM A;  4XQD A;  4KGQ A;  2OVU A;  3WD5 A;  3IWZ A;  1EAH 1;  1EPZ A;  4C90 A;  4ISQ A;  1OXC A;  2RS5 2;  1JUH A;  4Y1Z A;  3JQX A;  4UFK A;  3I59 B;  2QCS B;  2C9A A;  2YZ4 A;  4HPK A;  2EIG A;  3FWE A;  4E27 A;  1GZC A;  4URT A;  2YHJ A;  2VG9 A;  2ZGO A;  3VZM A;  4K9S A;  3GNE A;  3I54 A;  1NT0 A;  1XOY A;  1LU1 A;  1URX A;  2W46 A;  1OF4 A;  1DFQ A;  1NLQ A;  3GBF A;  1VAL A;  2FDG A;  2F4P A;  4O61 A;  2WJS A;  4IQP A;  2GNM A;  3JD7 3;  4FXK B;  1D0G A;  4B29 A;  4MGY E;  1Z0H A;  4RGG A;  5JWP A;  3QAC A;  4LOT A;  5IVC A;  5LWB A;  1LRH A;  3MW3 A;  3VGI A;  3WDV A;  3KD4 A;  5I0U A;  3ZX7 A;  2DUR A;  2VZP A;  4JTN A;  4MSV A;  3V0A A;  4XEZ A;  5A33 A;  4OUL A;  1LAJ A;  3MIF A;  1VIW B;  1W99 A;  2YFZ A;  2ZPX A;  1G86 A;  3NV2 A;  3PNA A;  3WT3 A;  3CEW A;  1W8U A;  4P08 A;  5CIR A;  1C28 A;  4H7M A;  4DUW A;  3LDK A;  1POV 1;  1VR3 A;  1LJ7 A;  4IE0 A;  1JXN A;  4IV1 B;  4XBQ A;  1GOG A;  3W9A A;  4BQ5 A;  2EAL A;  4AVA A;  2YC4 A;  1C8N A;  2D6K A;  2C6S A;  3FC0 A;  3ENR A;  3ZYJ B;  5JVV A;  5A6X A;  4CZS A;  3WNX A;  4A7K A;  1HXS 3;  4LBN A;  5KXE A;  4QDS A;  5EYX A;  5A3T A;  2DBI A;  3W21 A;  2VZV A;  3CDZ B;  2HWC 2;  2XHK A;  2K46 A;  3FZ3 A;  1PO1 1;  1OFN A;  2W94 A;  3MLJ A;  4QT6 A;  1AR6 2;  2CWS A;  3N3H A;  1W03 A;  2YXS A;  4DPN A;  1LOC A;  4F3J A;  1UYZ A;  2PQS A;  1VBD 2;  5BY5 A;  4B7E A;  5KC5 A;  2JG9 A;  3THC A;  4RGA A;  5ABJ C;  2DU0 A;  5J48 A;  1GKB A;  2AYH A;  3W5N A;  4LLF A;  3EXU A;  4HVR A;  2QJV A;  4XQ4 A;  4MGT A;  1MS5 A;  3UV9 A;  4AOC A;  4PQQ A;  4R4X A;  1NOV A;  3GCX A;  4XJ8 A;  4E4Z A;  4NHY A;  3UNP A;  4PIY A;  3IZO A;  4EE2 A;  5DN2 A;  3VD4 A;  1VBE 3;  2CY6 A;  3ZYF A;  3A4U A;  2JX9 A;  2FD8 A;  3KMH A;  2VVE A;  5C5U A;  3N9Q A;  2B9V A;  1QIQ A;  4N43 B;  5FZ4 A;  1OD5 A;  3KM5 A;  3M2M A;  3M3C A;  4KGG A;  4WVZ A;  3UES A;  4ZU7 A;  2QTW B;  1IKP A;  2JEC A;  3VBR A;  3AMP A;  3D4K A;  5FO9 B;  1WD4 A;  2MEV 3;  2EIB A;  1UU6 A;  4ONU A;  4NHM A;  1JYT A;  4Y5S A;  1O8P A;  3RYR A;  3SCG A;  5LZ6 A;  1LGN A;  1SAC A;  2NYY A;  3J26 N;  3RJR A;  4QKD A;  1AYN 2;  2XKO A;  2A6Z A;  3AKT A;  1O59 A;  3NL1 A;  2Y64 A;  4CUG A;  4MX3 A;  3V0A B;  2ZGK A;  3TNQ A;  1NX9 A;  3K4D A;  4XBN A;  1P8J A;  5A1F A;  2XLF A;  3L9J T;  1H9W A;  3C7E A;  3CLP A;  4HSJ A;  4W6Y A;  4XUO A;  1YHF A;  5F8P A;  2SBA A;  1W6P B;  3HOB A;  4WBB A;  3IMN A;  1W2A X;  2ZX1 A;  1RUH 3;  4YGE A;  1DGR N;  2R06 1;  4GKX A;  1LHW A;  1OKO A;  4AZZ A;  1JYN A;  3VL9 A;  1W0N A;  1COV 2;  2R30 A;  4LBQ B;  3QOP A;  4XVH A;  4YW2 A;  3ZYR A;  4A44 A;  1AYM 1;  1UXX X;  2W68 A;  3RWN A;  3UKN A;  1CZV A;  1NXM A;  3USU A;  2VEC A;  1OLM E;  5C9A A;  1UU5 A;  2VCM A;  1PIV 2;  4XXP A;  4YAR A;  5A3N A;  4CDU B;  3IBM A;  3Q8B A;  4A3X A;  1JYI A;  4LIV A;  1NA1 A;  1W6O A;  1HKD A;  3NAP C;  5JOX A;  2SLI A;  2ZMK A;  3BU7 A;  4LA3 A;  1X8M A;  2J1S A;  4OUE A;  3A0K A;  4A42 A;  1M4W A;  3DEC A;  4RSU A;  3BTZ A;  2PAE A;  4SLI A;  1ASJ 1;  1JUI A;  1UF2 C;  2VTX A;  3IMM A;  1VB4 A;  2KA3 A;  5FRE A;  4BE3 A;  4YRD A;  2ZML A;  4YWA A;  5C5T A;  5FYB A;  1H2K A;  4J6G A;  4ZZ5 A;  1L3J A;  2XUM A;  4V2V A;  1WLC A;  1RJ8 A;  3GXU A;  2IFR A;  2P37 A;  4KWU A;  3FFQ A;  2WA4 A;  5FZF A;  3BN6 A;  5FZ1 A;  3WCS A;  3BIE A;  2EXK A;  1FOD 1;  4FI9 A;  2B4K A;  4Q0Q A;  1FNZ A;  5CYY A;  4AGR A;  3KVA A;  1K3I A;  1QEX A;  3III A;  4N7U A;  1VLN A;  5DAP A;  5LK5 A;  1IGO A;  2WT0 A;  3TYJ A;  3O0W A;  1QU0 A;  1SLB A;  1KIT A;  4AGG A;  4HT1 T;  2R1B A;  2DFB A;  1MZF A;  1EPW A;  1W8W A;  4MYE A;  4ZS3 A;  3SLI A;  3T4H B;  3VZJ A;  5C3Q A;  1DYP A;  2G9G A;  3VD9 A;  4QB1 A;  2VZT A;  3R05 A;  5ISL A;  5BNP B;  3HBK A;  4Y20 B;  3FHQ A;  4C1X A;  2J22 A;  5BNP A;  3U1X A;  4DB5 A;  4IEY A;  4IEQ A;  3LAG A;  2B5H A;  5FAX A;  1BBT 2;  4AR2 A;  1CAX B;  5GLZ A;  5HPO A;  3AKR A;  2J42 A;  3WDT A;  4CCN A;  5FO7 B;  3WF4 A;  1X9P A;  1AXK A;  4LA2 A;  1HV0 A;  4CXW A;  5F2W A;  2CHH A;  3CO2 A;  1LOD A;  4V1P A;  4LLO A;  1FPN 2;  2EIE A;  3AZX A;  4UAP A;  5J98 B;  2VW0 A;  1FX5 A;  2MNG A;  2VBP A;  3LEM A;  3OGG A;  4NPR A;  3WHT A;  5C7G A;  5K7P A;  3V0B A;  4M00 A;  1XE7 A;  2F6B A;  3DPR C;  1SCS A;  3ASI A;  2G1M A;  2Y60 A;  3FLR A;  4I0A A;  4YM0 A;  3VBH C;  2PLV 1;  5C3R A;  3I3Q A;  4O9E A;  1FI2 A;  1ZVF A;  5HBA A;  3QH7 A;  1UOJ A;  5KHH A;  3TEW A;  1Y9M A;  1J1T A;  4Q8K A;  4YZ4 A;  2VTX J;  2WZ8 A;  1H4H A;  4QAW A;  4X8N A;  4K6B A;  4RR3 A;  1IHM A;  3WP3 A;  4UF0 A;  3WUC A;  3JU9 A;  2C9K A;  4CCD A;  4HKO A;  2F17 A;  4HN0 A;  3BUC A;  4HZF A;  4B8E A;  5A3O A;  2ATF A;  2D98 A;  2RM2 1;  4JZR A;  3NAP A;  1TME 1;  4CU7 A;  1PGW 2;  4HOO A;  2ZHM A;  4Y5T A;  1JYW A;  3LOB A;  4DUV A;  4L2N A;  4P9X A;  5HV4 A;  1DF0 A;  5B2G B;  4AFC A;  4HK8 A;  1GOH A;  1FXZ A;  3H3Z A;  2P6H A;  3T0B A;  4WM8 B;  5FPX A;  1YJK A;  4AW7 A;  1RUF 1;  4BJ0 A;  4C1W A;  1WLD A;  5APA A;  4EWD A;  1H1A A;  5K8S A;  1YFY A;  3D82 A;  3LE0 A;  1MZ5 A;  4V2W A;  2ZEZ A;  4LO8 A;  3CBN A;  3VKM A;  4DEV A;  3OGV A;  4HPK B;  3NJY A;  4LIT A;  5SV5 A;  2PFW A;  2QDN A;  3WW3 A;  1R08 3;  1HLC A;  4FPO B;  1VBC 2;  4IEW A;  2W5F A;  2J1U A;  4CEY B;  2TNF A;  3VUO A;  5FZO A;  4QB2 A;  1SBE A;  1GR3 A;  2J1T A;  4PBP A;  1H6Y A;  4L99 A;  2DVD A;  1HV1 A;  4UXA A;  4M0H A;  1RUI 1;  2ZX3 A;  1MQT B;  1W3X A;  2PYT A;  4Q0S A;  3DKQ A;  4IEZ A;  5A70 A;  1W9S A;  3WNK A;  1W6M A;  1K42 A;  3VDC A;  3WW1 A;  3PUA A;  2GSY A;  2UY8 A;  1O3S A;  3GM8 A;  3LDR A;  4PF5 A;  3APB A;  2A5Z A;  3K4Z A;  3ACI A;  1UOG A;  2X10 A;  4XZP A;  3WVJ A;  1YEW A;  1WBF A;  3SC7 X;  3POB A;  2WYS A;  4QPI C;  2GDF A;  4YG3 A;  4OHV A;  4A7Y A;  4LHK A;  2HWC 3;  2WSV A;  2WNV A;  3TWI A;  4FP3 A;  5L7O C;  4LEJ A;  3I2J A;  5IVV A;  3PTR B;  4AHW A;  3E1F 1;  3GJA A;  1MVE A;  4MLO A;  3OTF A;  2PAK A;  4AVT A;  2JG8 B;  3RMY A;  1Z78 A;  2J7M A;  1PX4 A;  4NRQ A;  3ZM8 A;  4Y1X A;  3Q9O A;  5FFO C;  1AYM 2;  3AL5 A;  5IVJ A;  2JDY A;  4NHL A;  1HB4 A;  3IAP A;  3MFC A;  4YVS C;  1TNR A;  1V6J A;  2WZR 3;  2XPJ A;  3NV4 A;  3TRS B;  2AC1 A;  4LXL A;  4CDW C;  4DEQ A;  4Q4Y 1;  4DS0 A;  4H14 A;  4C0B A;  5IAV A;  4BA6 A;  3N7K A;  3ZDS A;  2W91 A;  3ZLI A;  4JRA A;  1GP6 A;  4LQR A;  4GWM A;  3PUH A;  1WMD A;  1S0C A;  4P14 A;  2R0H A;  3FFZ A;  1JS9 A;  1V6I A;  2K2S A;  2R07 2;  3WDY A;  2GN7 A;  1VBE 2;  4BZ4 A;  4EN7 B;  1V9U 1;  1VRH 2;  3PIG A;  5ACA 1;  1OI6 A;  2BNM A;  2P3Y A;  2CDP A;  1UIK A;  4D0Q A;  1N3O A;  1FNY A;  3HQU A;  3OPW A;  1KRI A;  5FXV A;  5K0U A;  1AR9 2;  1D2Q A;  4TN7 A;  5FZE A;  1RHI 3;  2ZEX A;  5JXG A;  1TMF 3;  3DN7 A;  1SLT A;  2AH2 A;  2D43 A;  3AK0 A;  3O7O A;  3MUY 1;  5FZA A;  2ZGU A;  2CSG A;  1NZC A;  1GUI A;  1RJ7 A;  1W6Q B;  2V4A A;  2BFU L;  5CB7 A;  4A7Z A;  2WBK A;  2VOX A;  2VOV A;  3NNJ A;  1RUI 3;  3WW2 A;  4AEM A;  1DGW A;  1XYP A;  4K3U A;  2CGN A;  3MIG A;  4Q4W 1;  2UYA A;  3SH4 A;  2P34 A;  2P6C A;  2HWE 1;  3JUU A;  5F9T A;  1CAW B;  1R08 1;  1XNT A;  2Y33 A;  3JD7 2;  2DWR A;  4IDZ A;  4WVM B;  4DUX A;  5JAX A;  2VZO A;  1LGC A;  1GNZ A;  3N7J A;  4L97 A;  4BQ1 A;  2HWC 1;  4XF0 A;  1BYH A;  3P6B A;  5EJ1 B;  3NQH A;  3VHP A;  5CBL A;  5B4X A;  4IV1 C;  3OF1 A;  1AUY A;  2IFW A;  1STM A;  2CAU A;  3I2F A;  1FMD 1;  1VAK A;  1H2M A;  2IXL A;  4XAC A;  3ZKU A;  4W6X A;  1D7P M;  4LBQ D;  4CVU A;  4RS5 B;  2CYF A;  5D8A B;  3E6C C;  2OUH A;  3CMG A;  2RR1 3;  1QNY A;  3ZYP A;  5I8T A;  3NAP B;  2PHD A;  5FYZ A;  1VBD 1;  4QQP A;  3ZN6 A;  1OHF A;  4GJY A;  3GAL A;  3O12 A;  1ENX A;  4BOW A;  2YUE A;  5CKQ A;  2JJ6 A;  4RR3 B;  4AK3 A;  2ADD A;  3OJB A;  1AJO A;  2RJL A;  3VHR A;  3WCR A;  2OS2 A;  1BHG A;  1I5P A;  3U11 A;  3D3A A;  3O1R A;  2KM2 A;  1C57 A;  1RHI 2;  1ND3 C;  4JV4 A;  4KBZ A;  4RHV 3;  2X05 A;  3ZYH A;  2OYZ A;  1NCQ A;  4U2A A;  2PHT A;  4ZXE A;  2JB8 A;  5GLU A;  1I6X A;  4AED B;  1JZ8 A;  5JXJ A;  3U0Z A;  1UX7 A;  5DAQ A;  4ZXK A;  3J7M A;  3VBR C;  1F4A A;  3O0V A;  1C5I A;  5HCB A;  3H8U A;  3BI3 A;  4GMP 1;  2PQQ A;  1Q3E A;  4I01 A;  3AFK A;  5KWR A;  1C3H A;  1Q8V A;  5EXO A;  3K4A A;  3LEK A;  2GND A;  2K9Z A;  4GZ9 A;  2OA2 A;  1LKN A;  4OHX A;  2HH9 A;  1W04 A;  4LJH A;  5FJH A;  2C26 A;  2XWJ B;  1RHI 1;  2OT7 A;  1NA1 C;  1J59 A;  5IK4 A;  4IV3 B;  1CAV A;  3WNL A;  5IFP A;  3RZL A;  4OVE A;  4XIO A;  4QHB A;  3A21 A;  1D4M 2;  2OPK A;  4S2D A;  1RUJ 2;  2O8Q A;  2W1U A;  1IQD C;  5DXD A;  1HW5 A;  5L19 A;  4X8P A;  4WM7 B;  1R1A 1;  2GNT A;  3HBZ A;  4Q4Y 3;  4CXY A;  4UWD A;  4XFH A;  5KXD A;  4COW A;  3N9P A;  4MXW A;  1UCX A;  5IFT A;  3N9O A;  2VZR A;  4XIK A;  4ZY9 A;  4Y1U A;  4AAX A;  1G6N A;  1OLM A;  1SEF A;  2HBU A;  2IUW A;  1L7L A;  2FZ1 A;  3NV3 A;  1OVP A;  2ERF A;  4FXG B;  4GH4 A;  1XSR A;  5GAL A;  3WQ7 A;  1ND2 B;  2WAB A;  3ACF A;  2FCT A;  2HYX A;  1W8N A;  2WNV B;  4JX0 A;  5KXC A;  1J3R A;  5IHR A;  3DPR B;  2YB7 A;  3KLS A;  1Y43 B;  5FQ0 A;  1UO9 A;  3RPQ A;  4ZU4 A;  3BTX A;  1I3H A;  1QWR A;  1G7Y A;  1PM7 A;  2C0Z A;  4A3Z A;  2Q0A A;  4FPK A;  4PLO A;  4ZU5 A;  1AL0 G;  1RGS A;  4Q4X 3;  3NWK A;  1RUH 2;  5A32 B;  3J7L A;  2VNV A;  2VOK A;  1C8M 2;  4IGO A;  2BTV C;  2FQP A;  1FOD 3;  4FFG A;  3V64 A;  1S0E A;  1AYN 3;  3VBF A;  1RUG 1;  1Y3T A;  5EFU A;  3SEE A;  1DLC A;  1OC1 A;  5IAT A;  1ULF A;  3MW2 A;  3R4D B;  4P9I A;  4AI9 A;  2FZ2 A;  3GYD A;  2DVG A;  2XON A;  2D3R A;  5EQU A;  3C7F A;  5FYS A;  5CKM A;  2XLG A;  1QJU 3;  4OHZ A;  4CP9 B;  2RDQ A;  5D8A A;  1WW6 A;  4NVP A;  4LBL A;  3TN9 1;  2A3X A;  1ZRE A;  4N9H A;  3FL7 A;  1WCD J;  2HWD 3;  5FP4 A;  5I8Y A;  1D4M 3;  5CAD A;  4LBQ A;  1VBB 3;  1NKG A;  1Q56 A;  2WRA A;  3JD7 1;  3LFM A;  4NRM A;  5FP8 A;  4UBG A;  5C8C A;  3OGS A;  3WW4 A;  5EPA A;  3WF1 A;  4JTO A;  3H0O A;  1DDL A;  1H8V A;  2ES3 A;  1FAY A;  2Z69 A;  3T1M A;  1X7N A;  4YM2 A;  1A34 A;  1ZRC A;  4HKW A;  4RYD A;  2IWG B;  1AX1 A;  5FZK A;  1VBA 2;  4E2S A;  2RMU 3;  3ZSJ A;  4EJR A;  1JZ5 A;  5FPL A;  2Y38 A;  3KGZ A;  3DCQ A;  5FTT C;  1MS0 A;  1C4R A;  2G9Z A;  2VUL A;  3ALQ A;  2XL7 A;  2DTY A;  4B3N A;  3WF2 A;  4A4A A;  1V6O A;  2ZGS A;  1TE1 B;  2QQM A;  3WDW A;  1QNW A;  5A32 A;  1BJQ A;  4D7S A;  4ASL A;  2GME A;  1KS4 A;  5A3L A;  3PVO A;  2V09 A;  1DQ0 A;  3H7J A;  1TME 3;  1R09 2;  1G9A A;  2ZX0 A;  5A6Q A;  4Z8B A;  1JBC A;  1QOO A;  2NM1 A;  3LIH A;  2P3J A;  1TVG A;  1CPM A;  3GCW A;  1YQ6 A;  3RQ0 A;  3VDA A;  4BIO A;  4DZG A;  4XDP A;  5FBZ A;  2BWA A;  4K21 A;  1N1T A;  3RMX A;  1HIX A;  1BCX A;  3UKT A;  2JG8 C;  3A23 A;  4HBN A;  4Q1R A;  4MH0 E;  1FPN 1;  2D6O X;  5DDJ 2;  4YM1 A;  5FZD A;  3AZV A;  5GLV A;  3RI8 A;  5FMD A;  5CFC A;  2JDA A;  1RIT A;  5IVF A;  3I49 A;  4GMP 3;  1GAN A;  2Y6K A;  3AKS A;  3K3O A;  4XBL A;  3AMM A;  4NII A;  4YYO A;  4FP2 A;  2QKD A;  1ST8 A;  3LCP A;  2Y6H A;  4N43 C;  3WZ1 A;  1MEC 3;  1OQD A;  4PDW B;  4KNC A;  3WR0 A;  4AI1 A;  4IEP A;  5AC9 3;  5C3O A;  4QWN A;  1CGP A;  3KV5 A;  1CQ9 A;  2QDR A;  3LA7 A;  5I0T A;  3H8O A;  1C1F A;  1SFN A;  3LSD A;  4QX0 A;  4RGK A;  4YG0 A;  2X5I B;  5LB6 A;  4Z2A A;  5FZM A;  1FPN 3;  2VZU A;  4OHW A;  1D4M 1;  1KXG A;  3TB0 A;  1RUF 3;  1KS5 A;  3ES4 A;  1XPW A;  1N1Y A;  3PU3 A;  1VAM A;  1G9F A;  4MV2 A;  5F3E A;  5FKB A;  5LY2 A;  5JIU A;  1H4G A;  4YGB A;  3KV4 A;  1KFX L;  1DIW A;  4I02 A;  2C1F A;  3PTY A;  4FPH A;  4B4R A;  3U14 A;  1X36 A;  3JQW A;  4JGZ B;  5A7W A;  4QGM A;  1LCL A;  3OOX A;  3T1L A;  1SDD B;  2EXJ A;  1XC6 A;  4LHS A;  2HWF 2;  1TME 2;  2BOI A;  1NCQ B;  2ZTN A;  1BVP 1;  2CV6 A;  4J1W A;  4QHZ A;  4CA9 A;  4EN8 B;  5HXM A;  2HLE A;  5I0S A;  1ZBA 2;  5LA9 A;  1CPN A;  2YU2 A;  5FDB A;  2Q8O A;  1HB1 A;  3JXS A;  3OG2 A;  3CHX A;  4MGZ E;  3O0X A;  5F3G A;  1U5X A;  4Z1V A;  4GB3 2;  2Z5W A;  4GXL A;  5B4N A;  4K1Y A;  3ZIX A;  2TBV A;  4WV8 A;  2BNO A;  3ILR A;  3MF6 A;  3ON7 A;  5F39 A;  3SCH A;  1O91 A;  5FY5 A;  1GQG A;  4AI0 A;  4N9I A;  3BCW A;  4XFA A;  2YBK A;  2B46 X;  4E2Q A;  2HWD 1;  1TG7 A;  2G19 A;  3FX3 A;  4XAE A;  3MV0 1;  3RZM A;  3BB6 A;  2UWA A;  5BUV A;  3KWV A;  2VUC A;  3EMR A;  2Z42 A;  4ZPI A;  4WVV A;  1S0G A;  4Q8L A;  4RHV 2;  3POY A;  5F6L B;  2JG9 C;  2WFF 1;  2ETE A;  2DF7 A;  2LRO A;  5C8W A;  1JHJ A;  2QZ3 A;  1QJZ A;  1IQA A;  4QM8 A;  5FP3 A;  5D2A A;  1PVC 2;  1DHK B;  5FLH A;  4BYY A;  3IM0 A;  2J1V A;  3U4S A;  3V65 A;  2R6Q A;  3FBY A;  3ZXE A;  4PT6 A;  5FYC A;  1IOA A;  2VQU A;  2BVB A;  1I9R A;  4K8R B;  3VD5 A;  3RZZ A;  1UAI A;  1ZBE 1;  2Q4S A;  2ZXQ A;  1RVF 2;  1IPJ A;  4A6S A;  1ND3 B;  1W8O A;  2BGC A;  2XUE A;  4OFG A;  2GP5 A;  3WHU A;  2GNB A;  4XDO A;  2C5D A;  3ME2 A;  3W5M A;  5IVE A;  2VD7 A;  1RIR A;  3H3U A;  1XNA A;  2KR2 A;  1OA2 A;  3HWJ A;  3PVE A;  4JAA A;  4ARY A;  1QJY 2;  4P9L A;  2YBS A;  5GZF A;  1ONA A;  4K8F A;  4D6Q A;  4AF9 A;  4CCM A;  3WSO A;  5LBE A;  3DPR A;  3MEP A;  5JXI A;  1SMV A;  1DQ4 A;  1ZRF A;  4RA0 A;  1CD3 G;  1QJF A;  4MO3 M;  4YVW B;  5A3U A;  1ND2 A;  2R04 1;  4LKE A;  3UGG A;  1J58 A;  2I07 B;  1JH5 A;  3CJI A;  3LA2 A;  5IYY A;  3ACL A;  4TYS A;  3SXW A;  2ILM A;  2VC9 A;  5LBF A;  1MZE A;  1V6M A;  5T5J A;  2CTV A;  2RE9 A;  4BDV B;  1BK0 A;  2FDK A;  4D7T A;  1ZA4 A;  4O7X A;  3I2K A;  4OUS A;  1RB8 G;  1VBC 3;  5CEH A;  1A3K A;  3OBT A;  4P00 B;  3BOW A;  3QH6 A;  4Q4W 2;  4EQV A;  3VZK A;  5T5L A;  4QPG C;  3K2O A;  1YQ5 A;  4UOJ A;  4XF4 A;  5JOZ A;  3WNP A;  4E4D X;  4IV3 A;  1PZ7 A;  3PLQ A;  4BB3 A;  3IDA A;  2VQ0 A;  3OUI A;  2L9L A;  4XC9 A;  3G6J B;  1KJL A;  2NN8 A;  2WLP A;  5I93 A;  3BTY A;  4UBH A;  2RS1 2;  4WVW A;  5JZG C;  4NJ4 A;  5C4W C;  2XBO 3;  4HMZ A;  4NIA A;  3NRU A;  1HJF A;  3VDD A;  5D21 A;  1LEC A;  5F2S A;  1C5H A;  5D1I A;  3O14 A;  4Z07 A;  3LDB A;  2HWD 2;  3R4S A;  1J84 A;  2WT2 A;  4BQY A;  1GFF 2;  1FV3 A;  4WM8 C;  4LO6 B;  1KFU L;  1SLL A;  3KVB A;  1VBB 2;  4CUA A;  4OQ9 A;  1W6M B;  1YIP A;  2XL9 A;  2IXJ A;  5FZG A;  1UZ0 A;  4I2O A;  3VB9 A;  1AR7 2;  3MPB A;  1WD3 A;  3AJZ A;  3ZN4 A;  4Y5Z 0;  2DCT A;  1QKQ A;  5BNO B;  1I1E A;  4S2F A;  4ORF A;  5JOY A;  3WLU A;  1PVX A;  2B42 B;  3E97 A;  2XB6 C;  3INA A;  3J8F 3;  3ROU A;  3WP5 A;  4XJ9 A;  2RR1 2;  5FMO L;  5LAT A;  4P5H A;  3UJQ A;  2VNO A;  3POS A;  1K45 A;  4AL9 A;  1GWK A;  3JBG 2;  1HN1 A;  4F8A A;  1R09 1;  5KHG A;  1W6N A;  4BM8 A;  1WMF A;  5FY0 A;  2VBD A;  3AVS A;  3H9A A;  5DAB A;  1ZZB A;  2GH8 A;  2QQJ A;  1W06 A;  1YO8 A;  3NJZ A;  2JDN A;  4OMC A;  1KEX A;  4B4P A;  3SMH A;  3OSD A;  4TSV A;  2UU8 A;  2VQT A;  1QJE A;  3LZZ A;  4WVM A;  1MR5 A;  3IPV B;  4CP9 A;  5FMB A;  4R4Z A;  4Y22 A;  1CAW A;  2QQP A;  1UY2 A;  1WLT A;  3VDD C;  3VD7 A;  3LFI A;  5L7O B;  3WOG A;  1PGW 1;  3BPZ A;  3MLL A;  2PHL A;  1SLA A;  3LGR A;  3LOI A;  2WS9 1;  4ISR A;  4XFI A;  3ECQ A;  2FDH A;  1RMU 3;  1H9P A;  1S55 A;  4OI1 A;  3W58 A;  2EAK A;  3LA3 A;  1QH6 A;  4FOY A;  4UW3 A;  2QQV A;  5E88 A;  5FYT A;  1SG3 A;  2Y8K A;  2HEV F;  4YSF A;  5FUP A;  3GHN A;  2ZGL A;  3M3E A;  3ZFF C;  4R9B A;  4AVS A;  4Q29 A;  2DV9 A;  2JKX A;  1KJR A;  5DG2 A;  1V9U 3;  2P2K A;  4MHR A;  4XJA A;  5K0U C;  3CF6 E;  2HEW F;  1AX2 A;  3MID A;  3ZXJ A;  3PUI A;  1PNG A;  5F3C A;  1RUE 2;  3S6P A;  1YI7 A;  4IE4 A;  4BLJ A;  4ITC A;  3T09 A;  4KMQ A;  2LUW A;  5KR7 A;  3THP A;  1KDK A;  4Q4V 2;  2WAA A;  1IZ3 A;  4CEY C;  4BCU A;  2VUD A;  2XKP A;  1S2K A;  3KF5 A;  4LHN A;  1LEN A;  1RC6 A;  1YI9 A;  3FN9 A;  3UT0 A;  2ZAB A;  2WDB A;  3WF3 A;  3PUR A;  3CU7 A;  1WLW A;  3B00 A;  4D7Y A;  1UPI A;  2E9Q A;  1OPO A;  1ND2 C;  3GJB A;  5FCC A;  5FMO S;  1RUH 1;  3VBO A;  2RS1 1;  4QXH A;  1EP0 A;  4GB3 3;  5DDJ 3;  1VMJ A;  3HNM A;  4MAD A;  3KCX A;  2OPW A;  3POG A;  4AWD A;  5A3M A;  2YFU A;  1X82 A;  4PBO A;  5FXZ A;  5H9S A;  1LU2 A;  3DYO A;  5FUI A;  5FK8 A;  1UY4 A;  5FXX A;  1B35 A;  5D8A C;  5FLJ A;  3OBR A;  3PL0 A;  2LW8 A;  3ABZ A;  1IS5 A;  2RV9 A;  3UGF A;  3DGT A;  5LY1 A;  2VUJ A;  4Y26 A;  2ARC A;  1E5R A;  3HQX A;  1XQN A;  1A6C A;  3VL8 A;  3VV1 A;  3ZR5 A;  1NYW A;  4ARX A;  1LB2 A;  2OQ6 A;  5FP7 A;  3VBO B;  5F37 A;  2YPD A;  1LHV A;  4KWJ A;  1RMU 2;  3SKJ E;  4BLI A;  2DVF A;  4DXS A;  5C70 A;  2J1E A;  2R7E B;  3IAQ A;  3NKT A;  1QDO A;  4FT8 A;  4K20 A;  5KHJ A;  4OMD A;  1BEV 3;  4GD4 A;  1HQW A;  1KGY A;  1UYY A;  1WCU A;  4LHL A;  2VTF A;  1GZ9 A;  1JYX A;  2PHW A;  1MQT C;  3JBG 1;  2A1X A;  2NMN A;  3BYW A;  1DQ1 A;  2WLQ A;  3B9C A;  2E33 A;  2R1D A;  2RR1 1;  3KV6 A;  4AED A;  3B69 A;  5JCT A;  4YZ1 A;  2XJQ A;  4KBB A;  1RVF 3;  3J9S A;  4L8Q A;  4L11 A;  5FZH A;  3TEX A;  4LUK A;  2IZW A;  2ADE A;  3Q8E A;  1ND3 A;  4YW6 A;  1ZZC A;  3C7G A;  1AR7 1;  1AYM 3;  1S2B A;  3EQE A;  4KU7 A;  1GQP A;  2BDR A;  2DUP A;  1VE0 A;  3IB3 A;  1VMF A;  1WW7 A;  3J8F 1;  3SNM A;  4BQW A;  5A3P A;  1MAC A;  4QKF A;  5FZ3 A;  2MHF A;  4FPG A;  3T0A A;  3HIF A;  1MEC 1;  3M1H A;  1NA1 B;  1OBN A;  1OSG A;  5FPV A;  2O8O A;  3IPV A;  1IKQ A;  3NNL A;  4FOQ A;  1U12 A;  4M4P A;  2WZE A;  1GYK A;  3MDP A;  1KD7 A;  2PHX A;  4XE9 A;  3KCY A;  2GP3 A;  3VKN A;  1J83 A;  1O5U A;  5EJ3 A;  1XNB A;  4XF3 A;  4Z82 A;  4A2U A;  1RUN A;  3UYJ A;  1Y9Q A;  3ITQ A;  3MGU A;  2VCC A;  2BNN A;  4LR4 A;  4YLZ A;  1LEM A;  2DU1 A;  1ASJ 2;  4G9S B;  2RS5 1;  1JW6 A;  2K0G A;  5ANN A;  5A7N A;  3DV8 A;  2JIG A;  4FQ4 A;  1QXR A;  3MIB A;  1JZ3 A;  1S0I A;  3MO4 A;  1VRH 3;  4QKB A;  5CKN A;  4D8M A;  4BIS A;  4PI2 A;  1GIC A;  1O5L A;  2WNO A;  2ET1 A;  1VBA 3;  3KQR A;  4QGL A;  3O1P A;  3HVD A;  4YW3 A;  4RD7 A;  3R0R A;  1NXD 1;  4N53 B;  4YGD A;  1JYV A;  1IS3 A;  3E6B A;  3HN1 A;  3PVB B;  5J3U A;  5KHI A;  3O1T A;  2WFP A;  4Q27 A;  2CAV A;  4DIN B;  5T50 A;  2A7A A;  1S0B A;  2ZMN A;  1O4Z A;  1QJU 2;  5JSP A;  2I2S A;  3V0B B;  2XML A;  2PTM A;  1DCS A;  1MEC 2;  3C8X A;  3THD A;  2WUH A;  1GU3 A;  2FCV A;  2VAU A;  1H30 A;  2AUY A;  2WFF 2;  4PQ9 A;  4WM7 C;  5DG1 A;  5T54 A;  1CWP A;  4HVO A;  2HKX A;  2XJR A;  2BOJ A;  1AR8 3;  3BGA A;  4HG6 B;  4HFS A;  1HB3 A;  3M7A A;  4MET A;  3G7D A;  4OZO A;  2R04 3;  1CAX A;  3F2Z A;  4AI2 A;  1RUF 2;  2PA7 A;  5K4L A;  3SCF A;  3PHM A;  2JDZ A;  4FTS A;  2TUN A;  4WM7 A;  4QPG B;  1NCQ C;  1ZBE 2;  5EV7 A;  2BW8 A;  1V0A A;  3ZYB A;  5AC9 2;  5CU1 A;  1VB2 A;  3VBU A;  4MGQ A;  2IXH A;  3OBZ A;  2DUQ A;  5BNN C;  3B02 A;  3VZL A;  1JOJ A;  1ACC A;  3F95 A;  1UW8 A;  2ET7 A;  5EYY A;  3MV1 1;  4M3C A;  4MG2 A;  1UKG A;  5JIA A;  3IDB B;  1QJX 3;  1VPH A;  1PO1 2;  2A75 A;  2W3J A;  4LMF A;  2O1Q A;  1SBF A;  5I8S A;  3HQR A;  5H9R A;  1ZX5 A;  5BYN A;  1BMV 2;  1E5H A;  3NST A;  1XBF A;  1YC6 1;  5CFC B;  1WGP A;  3BOP A;  4CUC A;  5GZG A;  3J7H A;  2VOW A;  4YPJ A;  3H42 B;  4JKK A;  1YXW A;  4QXK A;  1REF A;  4YVW A;  1D2S A;  4S2H A;  1J3Q A;  1S2E A;  4Q4Y 2;  1WUV A;  3AP7 A;  3HJR A;  4NN0 A;  2JDM A;  3R6S A;  3B94 A;  2XWB B;  3WDU A;  4G4F A;  3EJK A;  3HNY M;  3ELN A;  4AQ6 A;  1W2T A;  4CDW B;  5LCW L;  4QX3 A;  3PDQ A;  1GOF A;  4I0W B;  4KG0 A;  1XRU A;  1OA3 A;  3ZPY A;  5FZ9 A;  4OYU A;  1PNF A;  4H7L A;  4G3Y C;  1ULO A;  3TEY A;  5FZ7 A;  3S7I A;  2D6P A;  2WN3 A;  5HCH A;  1W2O A;  2X53 S;  1UY3 A;  1AR7 3;  1CJD A;  3ES1 A;  4FFI A;  5FWJ A;  5FV3 A;  4UFH A;  3TEZ A;  4TZD A;  4FSJ A;  4GKY A;  1WMX A;  2ZKL A;  4GQ7 A;  2BVV A;  4QU2 A;  4CDU A;  4MHU A;  2RDS A;  5JXH A;  2EIC A;  3EB7 A;  1VJ2 A;  3ORJ A;  2GAL A;  4CDX C;  4AHZ A;  5C8C B;  2BZD A;  4IL7 A;  5J96 B;  5FZL A;  4XF1 A;  1V9U 2;  2WO2 A;  1M06 G;  2D6N A;  1JI6 A;  1OF3 A;  1Z7S 1;  4KQ7 A;  1NE4 A;  4QPI A;  3OBA A;  1GWL A;  4R9C A;  2W39 A;  3S0M A;  3L2Y A;  3SIS A;  2Y26 A;  2YG0 A;  5DZE A;  4L9B A;  3N9L A;  4GH4 C;  1HX6 A;  1DGW X;  5C71 A;  4Z92 B;  4AFA A;  5I91 A;  1CR7 A;  2RS5 3;  2XXZ A;  4JGZ C;  5GLT A;  5BNO A;  1HXS 2;  2IXI A;  1PVC 3;  4UF0 B;  3VKL A;  4DRR A;  5A3W A;  4MGK E;  5FBJ A;  4CDQ B;  4JDM A;  1LHO A;  1O7F A;  3KT4 A;  3SKV A;  3I2O A;  1ULP A;  1JU3 A;  2RJ2 A;  5BPX A;  4AFM A;  2QE3 A;  3ZMO A;  4N7I A;  4YM3 A;  2VUA A;  4UW6 A;  4Y4Y A;  3FHA A;  2G9F A;  2HWF 1;  1J1L A;  2UWB A;  5A7S A;  1WBL A;  3ZVX A;  5E8A A;  3I8T A;  3WUD A;  5FPZ A;  1VBD 3;  4E8C A;  4IEX A;  5A80 A;  4ES8 A;  2AEZ A;  4LBK A;  2ARX A;  4IES A;  1ODN A;  2JXA A;  3IDE A;  2WIN B;  1U5Y A;  4Q4W 3;  3CNA A;  3TAY A;  2C4X A;  3C3V A;  4JHZ A;  1F5J A;  3FBM A;  3JCI A;  3LD8 A;  5FY9 A;  4YW7 A;  5C4W B;  2ZEY A;  3KF3 A;  4R52 A;  1QJX 1;  1JN2 P;  2NLR A;  4MZU A;  3SHR A;  1EV1 2;  2QQN A;  4IER A;  3QD6 A;  4QHO A;  2HWE 3;  2ZBJ A;  2QNK A;  1VRB A;  4CEW B;  3WG3 A;  2JG9 B;  2VL4 A;  2RS3 1;  5FY8 A;  2QVS B;  2XLA A;  2ORX A;  2VCA A;  5J7M A;  4XUP A;  5M0T A;  5A6Y A;  4ATE A;  4BK5 A;  1ZZ9 A;  4HN1 A;  3A22 A;  2ZGQ A;  3OCP A;  4Q26 A;  3ATG A;  1UL9 A;  2B9U A;  5A7O A;  2Q5T A;  1YYN A;  2VR4 A;  1DYK A;  5GKA C;  3T08 A;  2D93 A;  4W8J A;  5E1R A;  1REE A;  5C3P A;  2YMZ A;  2VZ1 A;  3UJO A;  3NMB A;  1JZ6 A;  4GAZ A;  1ALY A;  4MGI E;  1GMM A;  2AEN A;  1GNH A;  3ACG A;  2ZZQ A;  4Q5O A;  3S30 A;  3RI9 A;  3WNO A;  4BMB A;  5FR3 A;  3WEZ A;  5LEK A;  3T2Q A;  1UY0 A;  2BGP A;  3MIC A;  4WZF A;  4DY3 A;  3I3M A;  1D4V B;  1DQ2 A;  2J1R A;  4CUB A;  1JMU B;  1XB9 A;  2WS9 3;  5ABJ A;  4CP1 A;  4IXL A;  2A6W A;  3VBH A;  1PK6 C;  5FY1 A;  4UW5 A;  4IV1 A;  1W28 A;  2DTW A;  1LOA A;  4ES9 A;  5IUQ A;  2X5I C;  4IV3 C;  4NHK A;  2WNU B;  2OKX A;  4AI3 A;  4EN9 B;  4CCJ A;  2JDH A;  3OGR A;  4QX8 A;  4UI9 L;  2QQK A;  4YVW C;  5CA6 A;  4XFG A;  1DYO A;  3D8C A;  4H3W A;  2FMY A;  5FZ6 A;  1RTV A;  3OY8 B;  4LE3 A;  5DAV A;  5CFD C;  4KU8 A;  2RM2 2;  5FZO B;  5GJ6 A;  1FT9 A;  4Q0U A;  5KC6 A;  2JEN A;  1WW4 A;  4Y22 B;  3CJI C;  1ZBA 3;  5AVA A;  1RED A;  4GA9 A;  3U07 A;  4CU9 A;  4XUR A;  1XJA A;  3I3D A;  2WNV C;  5FZ0 A;  5C9A B;  4ZZ8 A;  2MEV 2;  1H8T C;  1XND A;  2YGM A;  4GMP 0;  1IG0 A;  3P3P A;  4W50 A;  2V4V A;  1GV9 A;  4NAO A;  4XFC A;  1G9C A;  3GZE A;  4IEO A;  2IVI B;  5L9V A;  3AL6 A;  4RFT 0;  1AL2 3;  2ZAA A;  4WM8 A;  4XFB A;  3ZFE B;  3NKG A;  1ULG A;  5EJZ B;  4FAG A;  1AJK A;  4B7K A;  1RUG 2;  1OMI A;  1W6P A;  2B7Y A;  3ZMN A;  1IPK A;  1CES A;  2A73 B;  4YVS A;  5DPN A;  2WWS A;  4BQ3 A;  2QQO A;  3T2P A;  3M4F A;  2CWM A;  2WAO A;  1RUC 3;  4RQP C;  3WNM A;  5FUN A;  2D3P A;  1E5I A;  3SH5 A;  4FCA A;  4TLF A;  5FYY A;  2VVF A;  4SBV A;  2D97 A;  2RS3 3;  2HWB 2;  4QU1 A;  2ZX2 A;  2Q1M A;  2VW1 A;  4BXS V;  1KQR A;  5FKC A;  4DIQ A;  4GWN A;  4PIZ A;  2FBE A;  3M3Q A;  5FLI A;  1COV 3;  1GSL A;  2Q8D A;  1BMV 1;  3ETP A;  1TMF 2;  2DYC A;  4TXW A;  2E7Q A;  3UKV A;  4LIU A;  1PGL 1;  1UD1 A;  3JBG 3;  4YNI A;  5F5A A;  5CNA A;  1W9T A;  4AED C;  1SFP A;  2FCU A;  4YW5 A;  3ZKY A;  5A6Z A;  5I0R A;  3M3O A;  1OUX A;  5IW0 A;  4K40 A;  1IG3 A;  4XTM A;  5AFB A;  2JE7 A;  3VKO A;  3VHN A;  4EWA A;  2HEY F;  1ZRD A;  3T2O A;  3N9M A;  2O14 A;  1AVB A;  2VOT A;  3THT A;  3I2D A;  3DXU A;  3U75 A;  2N7G A;  2LS6 A;  1YWK A;  5CG8 A;  4XOG A;  3NW4 A;  1AR8 2;  3Q8F A;  2DCK A;  5JI9 A;  4LO4 B;  3E5U A;  5A7Q A;  4NWV A;  2YGL A;  4Y4R A;  2UUR A;  5KBF A;  3EBR A;  3C7O A;  4CPB A;  3VD3 A;  3AJY A;  2VNR A;  1LUL A;  3POI A;  5JUV A;  2BFU S;  1LOF A;  3AFG A;  3K75 B;  3D6E A;  1AL2 2;  3AMH A;  3NV1 A;  3WG1 A;  1ZBE 3;  2VME A;  1CAV B;  4XUT A;  5JR7 B;  2ZAC A;  1DG6 A;  4QQL A;  2UY9 A;  5G04 L;  1OUS A;  4FBF A;  2FDF A;  4C91 A;  2VM9 A;  5AFE A;  3B5L B;  3OGJ A;  1UMH A;  1V00 A;  3AXD A;  3ILF A;  1RVF 1;  2A71 A;  3N7M A;  1MS3 A;  3AXE A;  4N90 A;  2QZ2 A;  1V70 A;  5CZK A;  2RHP A;  4XYX A;  4LBM A;  3RSJ A;  2LTN A;  5FYI A;  4GAL A;  2RDR A;  4Q4V 3;  5L73 A;  3RG0 A;  1I5Z A;  3H1M A;  3NNG A;  1UY1 A;  1XNC A;  1NCR C;  2I45 A;  5F6K A;  1OT5 A;  3K46 A;  1CAU B;  1TMF 1;  3AZY A;  2ID4 A;  4D94 A;  2VZQ A;  4M3C F;  4ASM B;  2ARA A;  3WDX A;  4C0H A;  3MPP G;  3ZFF A;  3J7N A;  3AP5 A;  5I0D A;  4BQ2 A;  4HK9 A;  2JE9 A;  1PMI A;  3EHK A;  2E63 A;  1PK6 A;  4L92 A;  4XET A;  5JI7 A;  2R06 2;  3I97 A;  4XIL A;  1NQD A;  3GZT B;  4OZX A;  4W6W A;  5JZG B;  4MVT A;  2V73 A;  4UT5 A;  5FP9 A;  1GZW B;  4QXB A;  1LOB A;  4CEY A;  1LHU A;  1S0F A;  2FHR A;  5KXB A;  1OH3 A;  1VAV A;  4AHY A;  4BQX A;  4YZ2 A;  1AR9 1;  1E5S A;  1WA4 A;  3P1I A;  2NQY A;  1FMD 2;  4DY5 A;  3LPF A;  4OQ8 A;  4XCA A;  5FXW A;  4UFJ A;  4JVA A;  2R32 A;  3C2U A;  4HET A;  4QQ2 A;  3ZIW A;  5ACA 2;  1SBD A;  3HMY A;  2XR4 A;  5LAS A;  2WL1 A;  4MXV A;  2FDJ A;  1G9D A;  4BHP A;  3ZFG A;  1PMH X;  1NLR A;  1OQ1 A;  1W9F A;  4O65 A;  3RJ2 X;  4COU A;  1HRV 1;  2D5H A;  1XE0 A;  1EAH 3;  2VY0 A;  1NG0 A;  2E53 A;  3ZSE A;  2GC3 A;  3SEP A;  3OEA A;  4Y1V A;  4DNY A;  5C33 A;  3FLT A;  4OI4 A;  3RDI A;  2XBO 2;  5H9P A;  2VJX A;  2VH9 A;  4AFD A;  1ZZ8 A;  1F31 A;  1SZB A;  3DUI A;  3USS A;  4Q0P A;  4BIF A;  5JZG A;  1HRI 2;  1NUK A;  1NY7 1;  1Q8S A;  3LPG A;  1WW5 A;  3BVC A;  3ZSK A;  2XJP A;  2BBA A;  2ZHL A;  2LRP A;  4EN6 B;  3AYE A;  2WFF 3;  1AR8 1;  3AZW A;  1W6Q A;  1OD3 A;  4YZ3 A;  2WN2 A;  4D6R A;  2BUK A;  4CU6 A;  2ARE A;  4OLL A;  4ET7 A;  3HAG A;  2JDK A;  3HEI A;  1X8E A;  1UMZ A;  4LKS A;  3ZSL A;  5GLW A;  4OUM A;  3OD0 A;  1LES A;  1PO2 3;  1GP4 A;  1G9B A;  2WT1 A;  5LRR A;  4RN5 A;  2ORZ A;  2A70 A;  2E7A A;  2Z4F A;  5H9Q A;  3SQO A;  4AE2 A;  3T0D A;  4COZ A;  1UYP A;  3BKZ A;  1A8M A;  1U5Z A;  1UPS A;  3VDD B;  4DQA A;  2V5D A;  4HL0 A;  5CFC C;  3T4V A;  4PLN A;  2V72 A;  4BWO A;  1CZT A;  2B39 A;  2OW4 A;  4AQ2 A;  2NMO A;  5BNO C;  3CKH A;  1JHN A;  4RHV 1;  3AVR A;  2ZAH A;  2VMH A;  4M3C B;  2XVL A;  1PGS A;  4QX2 A;  3DL3 A;  2NP0 A;  3D5O A;  1XE8 A;  1OVS A;  4PDW C;  2BGO A;  1OLQ A;  4A45 A;  2ZA9 A;  3VZN A;  4CXX A;  2ZJC A;  1VP6 A;  3N4M A;  1OKQ A;  1FV2 A;  4XTP A;  1WKY A;  1OFS A;  1PX3 A;  1CX4 A;  1EY2 A;  3KZ4 C;  4OI2 A;  5FZI A;  4FTB A;  2HJI A;  2VO5 A;  4B1L A;  1WA6 X;  5FYU A;  2Y0I A;  1Y4W A;  2R07 3;  3I2G A;  2PLV 3;  3WX5 A;  2RMU 2;  4HVQ A;  5F1R A;  2E32 A;  1QXP A;  5T55 A;  2CNA A;  3MHZ A;  1PO1 3;  2JDP A;  2VBB A;  4EZH A;  1F9K A;  5EHD A;  4YZ5 A;  5JLV A;  2YV8 A;  2YYO A;  5C3S A;  2CGO A;  4FPF A;  1DP0 A;  1HB2 A;  3K51 A;  2D6M A;  4UFL A;  5LA0 A;  5C8C C;  1RUJ 1;  3MIE A;  4DRV A;  3U78 A;  2P1B A;  1BEV 1;  5LW9 A;  4OCT A;  1TZO A;  2A3W A;  1ZA7 A;  1RXG A;  4GB3 1;  3FJS A;  1YIF A;  3RGB A;  4YG6 A;  4YFW A;  2O0O A;  4MGS A;  4JDN A;  2RMU 1;  4F7Z A;  4Q0V A;  2Q1Z B;  4LK6 A;  1QQP 2;  4EZ4 A;  1HXS 1;  2VU9 A;  4AQT A;  3GGL A;  2ZZJ A;  1CVN A;  5DUX A;  5GZE A;  5A33 B;  5CFD B;  4IGQ A;  2Q8C A;  2YY1 A;  4N8M A;  1W6O B;  2ENR A;  2CU5 A;  2OII A;  2DDU A;  3QCW A;  5J1X A;  1N1S A;  1PO2 1;  4CCK A;  5FY4 A;  1ULD A;  2I74 A;  1RUG 3;  1V6L A;  2EAA A;  2VPV A;  4FPJ A;  1HN0 A;  1LOE A;  3GDB A;  1W8T A;  4JC1 A;  3WP4 A;  2XJT A;  1OLR A;  3E5X A;  3WQ0 A;  4NIG A;  1AR9 3;  3HPN A;  3H7Y A;  2VE1 A;  1BK1 A;  4IND A;  3RYK A;  3S5Q A;  3VBS C;  3ZFG B;  1B35 C;  1OOP C;  4JGY B;  3VBU C;  1PZ9 A;  4BPZ A;  4CP2 A;  1NCR A;  4XAA A;  1PZ8 A;  5LK7 B;  1YNA A;  1ZNP A;  4HKL A;  4FPC A;  2W0X A;  1XNK A;  1XSQ A;  3AX4 A;  3NNF A;  1WCK A;  4D69 A;  4DXR A;  1POV 3;  3PMS A;  1GWM A;  2XDV A;  3LKJ A;  1UQX A;  4NRO A;  1F4H A;  1LHN A;  4B4Q A;  4H2A A;  1LGB A;  3AKQ A;  2PN5 A;  5E16 A;  1K5M B;  2QQL A;  5T52 A;  3ILN A;  3VBO C;  3ZDV A;  3ZN5 A;  5CFD A;  4QQH A;  4RQP A;  4CYD A;  1RUC 2;  4QB6 A;  2YU1 A;  1VBB 1;  1AYN 1;  2IXK A;  2GN3 A;  4AAP A;  1XXN A;  2NPI A;  1A8D A;  3O5S A;  4UFM A;  1UKR A;  3RZG A;  4W4Z A;  4XJW A;  1TEI A;  2WNE A;  2EXI A;  3Q8A A;  4PIX A;  3UGH A;  4BME A;  4OI0 A;  5FQ0 B;  3E6D A;  1QGL A;  2HWE 2;  1JOB A;  4AEK A;  4QGN A;  1UIJ A;  4N43 A;  2E7T A;  4JGZ A;  3FMG A;  4CRQ A;  1X9T A;  1JU4 A;  1YQ2 A;  5DMY A;  1HRV 3;  1ZM1 A;  2VMG A;  4AGV A;  3K77 A;  1AZD A;  1QF3 A;  3KQ4 B;  3ZO0 B;  3VLB B;  3GHM A;  2QQW A;  1V6K A;  2R06 3;  3RNS A;  4CU8 A;  3LSE A;  1R08 2;  1SPP B;  5FMC A;  1QHD A;  1FAT A;  4EWE A;  5EWS A;  2WWU A;  3R4U A;  1TNF A;  5LEJ A;  4CSW A;  3RS6 A;  3NVC A;  1ASJ 3;  5DUW A;  2XBO 1;  4P9G A;  2RVA A;  1OUR A;  4LBO A;  2JIC A;  4Y20 A;  5EZW A;  4CDX A;  5IK8 A;  1R64 A;  4CEW A;  2AR6 A;  5F5I A;  4PDW A;  2DFC A;  1ZRI A;  1H8T A;  2WII B;  5A7P A;  5DUU A;  3AP9 A;  1RUD 1;  3MI8 A;  4XZU G;  3U10 A;  1Z7S 2;  2ZCW A;  3KV9 A;  1K5J A;  5CIS A;  5J36 A;  4E4H A;  3POJ A;  5C4W A;  3S5A A;  3A7Q A;  1YQ8 A;  2W1W A;  1T6B X;  3CJI B;  3I2I A;  4XMI A;  5IK7 A;  4YFZ A;  1US3 A;  3T30 A;  1COV 1;  2X8K A;  2QQU A;  1Q8O A;  4XUN A;  2FMD A;  1PVC 1;  2Q30 A;  2YBP A;  5BV6 A;  1T6G C;  3ZXL A;  2JB4 A;  2VZS A;  3P3N A;  2D7F A;  2P3K A;  3QLQ A;  4HON A;  4LKD A;  4QDQ A;  5DAW A;  1JYC A;  1OPM A;  2P17 A;  4N53 C;  4Q4X 2;  3WV6 A;  2XJU A;  1RUJ 3;  1QOT A;  5FY7 A;  3W20 A;  3I3E A;  5JSR A;  2W47 A;  2GMP A;  3HT2 A;  4P5Y A;  4Y1Y A;  3WXP A;  1WCS A;  2HBT A;  1AX0 A;  1MVQ A;  3MLK A;  3VDB A;  3S57 A;  4DOU A;  3RWK X;  3P5B A;  4JQR A;  1Q43 A;  4ZS2 A;  4IE7 A;  2KD7 A;  1TQ5 A;  3ST7 A;  2AGS A;  3ZPO A;  4RQP B;  1CX1 A;  4QKN A;  1QQP 1;  3H8X A;  5C6C A;  2Y6J A;  1X33 A;  4LBJ A;  1YFU A;  2GH2 A;  3I7D A;  2E31 A;  2DCY A;  5AC9 1;  4HLT A;  1UXZ A;  3CJX A;  4B1M A;  1JOD A;  1UWW A;  1NAE A;  4CEW C;  2WC2 A;  5HCF A;  1SDW A;  3ACH A;  4P9Y A;  3V56 A;  2AEY A;  4JGY A;  5JR2 A;  1Q5O A;  4LT5 A;  5GZD A;  4AEJ A;  3AZZ A;  3AP6 A;  5ACA 3;  1JZ2 A;  1UZW A;  4M3C E;  1W6N B;  5BNN B;  2BP6 A;  1RUE 1;  1ODM A;  4QMA A;  3ZYI B;  1DLL A;  4PJY A;  3S7E A;  3I59 A;  2GU9 A;  2QQI A;  5JDB A;  4FOW A;  4F83 A;  1VBC 1;  3T3Y A;  1PHM A;  2DBN A;  4ZHN A;  1YJL A;  1YQC A;  4LE4 A;  3SH3 A;  1RUD 3;  2JDU A;  1WZX A;  1YFW A;  2OZ6 A;  3A0N A;  3OUJ A;  1RUI 2;  1PK6 B;  2D40 A;  3ZXF A;  2V5Y A;  1Y7B A;  3WQB A;  2WYF A;  3L2H A;  3PUS A;  1O3T A;  1YFX A;  1WWY A;  2B45 X;  3ZFF B;  1XU1 A;  3GBW A;  2HYK A;  5K0U B;  4FO9 A;  1GQH A;  5FOB B;  1QXJ A;  1UX6 A;  2X09 A;  2OUJ A;  5ABJ B;  1F35 A;  2RS3 2;  4YW4 A;  5F7U A;  3RZJ A;  3NJX A;  4KH9 A;  3LQC A;  2ZOE B;  2VVD A;  3PUQ A;  1W90 A;  3LF7 A;  1IS4 A;  1RIN A;  5LA1 A;  2QUO A;  1CN1 A;  3AMQ A;  3H1W A;  4CCL A;  2P3I A;  4JDO A;  4AYU A;  2CDO A;  3FUQ A;  3PU8 A;  5HCA A;  4I30 A;  1F5F A;  2W95 A;  3RVH A;  1YUD A;  1H8T B;  1IS6 A;  4JCK A;  4DO0 A;  4Q4X 1;  1W3V A;  3K48 A;  1UOF A;  1BQP A;  2Y0O A;  1CON A;  2JIJ A;  1EUU A;  4X6R B;  3OYW A;  4CDX B;  4EYU A;  1PM4 A;  3OUH A;  3KS7 A;  1HRI 1;  1NY7 2;  1QH7 A;  1U0A A;  3TN9 3;  4PF1 A;  3AC0 A;  4ATF A;  2R49 A;  2PXJ A;  3B3Q E;  4COV A;  4XF9 A;  1EV1 3;  4IE6 A;  1ZZ6 A;  2JWP A;  2WO3 A;  1NQJ A;  1US2 A;  1W8H A;  1SPP A;  3J4U H;  3J8F 2;  4GUL A;  3SIT A;  4NIH A;  2BU9 A;  5J09 A;  5FPB A;  5FO8 B;  2BV4 A;  1RUD 2;  4DFS A;  2W1Q A;  4JHT A;  2XJV A;  2NZ9 A;  2Y6L A;  2YRO A;  4PLM A;  3H50 A;  2VCB A;  2W9X A;  4XAB A;  3PJY A;  1QQP 3;  2YC2 A;  5FIX A;  1W8Z A;  3ZYG A;  2XHN A;  4BXF A;  1L7R A;  3NJV A;  3DF0 A;  2R16 A;  4Y33 A;  1XU2 A;  3AYC A;  3EO6 A;  2PEL A;  1OA4 A;  3B7M A;  1BZW A;  2PAM A;  1JZ7 A;  3OD4 A;  2W52 A;  4N53 A;  5F5Q A;  1QDC A;  1SLC A;  5LBB A;  4FVV A;  2H6B A;  2WS9 2;  5FZ8 A;  3W59 A;  4QM9 A;  2XOM A;  1S4C A;  3URF A;  4NAM A;  4LKF A;  3PVN A;  1LR5 A;  5FYV A;  4AVB A;  1C8M 3;  4NE9 A;  5L7O A;  3ZN6 B;  1FOD 2;  1IPS A;  4NHX A; 
#chains in the Genus database with same CATH homology
 1W9W A;  3HOB A;  1TG7 A;  2DCJ A;  3MV0 1;  4CU9 A;  4XUR A;  1JYN A;  3I3D A;  4ZZ8 A;  1W0N A;  4XVH A;  4W50 A;  2V4V A;  4KI5 M;  4A44 A;  1UXX X;  4E8D A;  1CZV A;  1UYX A;  5EJZ B;  2W92 A;  2EID A;  1JHJ A;  5DPN A;  2QQO A;  3T2P A;  2WAO A;  2J1V A;  3WNM A;  4A42 A;  2J1S A;  1RYY A;  4OUE A;  3DEC A;  4BK4 A;  4PT6 A;  2J1A A;  2VQU A;  5DQ0 A;  3VD5 A;  4BXS V;  2ZXQ A;  1W8O A;  3W5M A;  4ZZ5 A;  1LNS A;  3ETP A;  1XNA A;  3GXU A;  4TXW A;  2XQX A;  4ARY A;  4KWU A;  4GWI A;  1EUT A;  3BN6 A;  3WSO A;  1W9T A;  4JKM A;  5JXI A;  1SFP A;  4QPW A;  4FI9 A;  4MO3 M;  2B4K A;  4GWJ A;  5CYY A;  3T2O A;  1K3I A;  2VOT A;  3III A;  5IYY A;  2VC9 A;  4BDV B;  2LS6 A;  2DCK A;  3I2K A;  5A1A A;  3C7O A;  4P00 B;  3VD9 A;  4QB1 A;  3VD3 A;  2VZT A;  5JUV A;  3POI A;  3K75 B;  3FHQ A;  4UOJ A;  2E26 A;  2J22 A;  4XUO A;  2VME A;  3WNP A;  4XUT A;  2BER A;  5G04 L;  2JE8 A;  2VM9 A;  3IDA A;  2L9L A;  5G05 L;  1UMH A;  2ZEW A;  4LOS A;  3CIH A;  5HPO A;  5CZK A;  3WF4 A;  3NNG A;  3NRU A;  1UY1 A;  2EIE A;  4UAP A;  4TTG A;  3MBW A;  1OT5 A;  3K46 A;  5C7G A;  4M4R A;  2ID4 A;  2VZQ A;  1J84 A;  4CUA A;  3OB8 A;  5I0D A;  1L7Q A;  4A41 A;  1UZ0 A;  4QDR A;  2WZ8 A;  3I97 A;  4QAW A;  4QX1 A;  2C9K A;  3P1I A;  4CU7 A;  1JYW A;  1K45 A;  3LPF A;  4DUV A;  1HN1 A;  1GOH A;  3T0B A;  2QQJ A;  1H6X A;  3I3B A;  4BJ0 A;  1PMH X;  4OMC A;  1KEX A;  3WNN A;  3LE0 A;  2WO1 A;  2ZEZ A;  2VQT A;  4DEV A;  3SEP A;  3OEA A;  3OGV A;  4LOR A;  1UY2 A;  3VD7 A;  2VJX A;  2W5F A;  2J1U A;  3DYM A;  1SZB A;  4QB2 A;  3ECQ A;  3CZU A;  2J1T A;  1NUK A;  3LPG A;  1H6Y A;  4IUG A;  2VMF A;  2BBA A;  1SG3 A;  3C7H A;  1OD3 A;  1W9S A;  2WN2 A;  2Y8K A;  3WNK A;  4CU6 A;  3VDC A;  1K42 A;  4ET7 A;  2JKX A;  3HEI A;  3HN3 A;  3GM8 A;  4LKS A;  3K4Z A;  3ACI A;  4RN5 A;  2ORZ A;  2X10 A;  2Z4F A;  3PUI A;  3T0D A;  3POB A;  2WYS A;  3UET A;  3T09 A;  4KMQ A;  2QBX A;  2WAA A;  2V5D A;  4DXT A;  3I2J A;  2V72 A;  3E1F 1;  3FN9 A;  1CZT A;  2WDB A;  3WF3 A;  4A6O A;  5JMO A;  2J7M A;  1PX4 A;  3ZM8 A;  3CKH A;  3HNM A;  4MAD A;  3IAP A;  5EIY B;  3POG A;  2YFU A;  4QX2 A;  3DYO A;  5FUI A;  2BGO A;  4DEQ A;  5LA2 A;  1UY4 A;  4A45 A;  2LW8 A;  3ABZ A;  1WKY A;  2W91 A;  1PX3 A;  2RV9 A;  1PMJ X;  2VO5 A;  4LQR A;  3I2G A;  4ARX A;  3PUH A;  2WQ8 A;  3LEI A;  2E32 A;  3SKJ E;  4DXS A;  5C70 A;  2J1E A;  2R7E B;  3IAQ A;  4OMD A;  4AG4 A;  1DP0 A;  1KGY A;  1UYY A;  5LA0 A;  2VTF A;  1JYX A;  4D0Q A;  2CDP A;  4JKL A;  2E33 A;  3CQO A;  1WCQ A;  2ZEX A;  5JXG A;  2VMD A;  5IJR A;  4MGS A;  3DEM A;  3MUY 1;  1GUI A;  4L0P A;  3C7G A;  2WBK A;  3GGL A;  3HNB M;  1GQP A;  3IB3 A;  3WF0 A;  3T0A A;  5J1X A;  2DDU A;  1XNT A;  4DUX A;  2VZO A;  4M4P A;  4MOA A;  2W1S A;  2WZE A;  3GDB A;  1OH4 A;  3U37 A;  2VZ3 A;  3POE A;  3P6B A;  5EJ1 B;  3NQH A;  2JD9 A;  1J83 A;  3HPN A;  5B4X A;  3I2F A;  2VCC A;  1D7P M;  4CVU A;  1JZ4 A;  3CMG A;  2VMC A;  4DXR A;  1GNY A;  4XUQ A;  1JZ3 A;  3MO4 A;  5CKN A;  1F4H A;  4D8M A;  2QQL A;  5CKQ A;  2WNO A;  1K12 A;  4QB6 A;  1BHG A;  1I5P A;  3D3A A;  1JYV A;  3POF A;  2X05 A;  4W4Z A;  3I2H A;  1O8S A;  4ZXE A;  3EYP A;  4P02 B;  1JZ8 A;  5JXJ A;  1UX7 A;  1NZI A;  3C8X A;  3THD A;  1F4A A;  1GU3 A;  2WUH A;  5DMY A;  1JU4 A;  1YQ2 A;  3BGA A;  3K4A A;  3K77 A;  4HG6 B;  3LEK A;  4GZ9 A;  3KQ4 B;  4OZO A;  3F2Z A;  4CU8 A;  2C26 A;  1SPP B;  1MPX A;  5IFP A;  3OEB A;  3WNL A;  3A21 A;  2RVA A;  1CZS A;  4MGQ A;  2W1U A;  1IQD C;  1R64 A;  3MV1 1;  3DYP A;  2W87 A;  2Y6G A;  3CZJ A;  4LMF A;  2W3J A;  4XZU G;  1SHW B;  5CIS A;  5IFT A;  1T2X A;  2VZR A;  4ZY9 A;  4AAX A;  3POJ A;  3A7Q A;  2W1W A;  4CUC A;  3I2I A;  3J7H A;  1US3 A;  4YPJ A;  4JKK A;  3ACF A;  2WAB A;  2HYX A;  1W8N A;  4JX0 A;  4XUN A;  5IHR A;  1UMI A;  2YB7 A;  2VZS A;  4QDQ A;  3HJR A;  3LEG A;  3MUZ 1;  1CIY A;  3I3E A;  4LPL A;  2W47 A;  4P5Y A;  3HNY M;  4A3Z A;  5LCW L;  3VDB A;  4QX3 A;  1GOF A;  2KD7 A;  4OYU A;  1CX1 A;  1ULO A;  2Y6J A;  2WN3 A;  1UY3 A;  3SEE A;  1DLC A;  2E31 A;  1UXZ A;  2XON A;  3C7F A;  1UWW A;  5CKM A;  1NAE A;  5JXH A;  2EIC A;  3EB7 A;  2BZD A;  3ACH A;  3FL7 A;  5JR2 A;  2WO2 A;  1NT0 A;  1JI6 A;  1OF3 A;  3OBA A;  1NKG A;  1JZ2 A;  2W46 A;  1OF4 A;  3OGS A;  3WF1 A;  2YG0 A;  2QQI A;  4RYD A;  5C71 A;  4LOT A;  1JZ5 A;  2VZP A;  3WF2 A;  4A4A A;  1W99 A;  2YFZ A;  3SKV A;  2QQM A;  1ULP A;  1JU3 A;  2RJ2 A;  3WQB A;  4P08 A;  3FHA A;  4DUW A;  4E8C A;  1TVG A;  1GOG A;  2X09 A;  3VDA A;  5F7U A;  3NJX A;  2YC4 A;  3LQC A;  3A23 A;  2C4X A;  5LA1 A;  4JHZ A;  2JDA A;  4QDS A;  2ZEY A;  2Y6K A;  2CDO A;  2QQN A;  2W95 A;  2VZV A;  3CDZ B;  2Y6H A;  2W94 A;  1EUU A;  2VL4 A;  1UYZ A;  2PQS A;  2ORX A;  2VCA A;  4QX0 A;  4XUP A;  3THC A;  4Z2A A;  3W5N A;  4PF1 A;  3AC0 A;  4BK5 A;  2VZU A;  3A22 A;  1XPW A;  4PQQ A;  2WO3 A;  3T08 A;  2VR4 A;  1US2 A;  1SPP A;  4W8J A;  3UNP A;  3VD4 A;  2VZ1 A;  5DN2 A;  1JZ6 A;  1GMM A;  3ACG A;  3WNO A;  3WEZ A;  2W1Q A;  2B9V A;  3T2Q A;  1UY0 A;  2BGP A;  2Y6L A;  2VCB A;  2W9X A;  2J1R A;  4CUB A;  2YC2 A;  2XHN A;  1L7R A;  3NJV A;  3UES A;  1SDD B;  1XC6 A;  4LHS A;  2EIB A;  1JZ7 A;  2OKX A;  5HXM A;  3OGR A;  2HLE A;  4UI9 L;  2QQK A;  1O8P A;  3JXS A;  3OG2 A;  1DYO A;  2XOM A;  1O59 A;  5B4N A;  2Y64 A;  1NX9 A;  3K4D A;  1P8J A;  3C7E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...