2QQLA

Neuropilin-2 a1a2b1b2 domains in complex with a semaphorin-blocking fab
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
576
structure length
554
Chain Sequence
PPCGGRLNSKDAGYITSPGYPQDYPSHQNCEWIVYAPEPNQKIVLNFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKHCGNIAPPTIISSGSMLYIKFTSDYARQGAGFSLRYEIFKTGSEDCSKNFTSPNGTIESPGFPEKYPHNLDCTFTILAKPKMEIILQFLIFDLCKYDWLDIWDGIPHVGPLIGKYCGTKTPSELRSSTGILSLTFHTDMAVAKDGFSARYYLVHQEPLENFQCNVPLGMESGRIANEQISASSTYSDGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLTAIATQGAISRETQNGYYVKSYKLEVSTNGEDWMVYRHGKNHKVFQANNDATEVVLNKLHAPLLTRFVRIRPQTWHSGIALRLELFGCRVTDAPCSNMLGMLSGLIADSQISASSTQEYLWSPSAARLVSSRSGWFPRIPQAQPGEEWLQVDLGTPKTVKGVIIQGARGARAFVRKFKVSYSLNGKDWEYIQDPRTQQPKLFEGNMHYDTPDIRRFDPIPAQYVRVYPERWSPAGIGMRLEVLGCDWTHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural studies of neuropilin/antibody complexes provide insights into semaphorin and VEGF binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Neuropilin-2
total genus 126
structure length 554
sequence length 576
ec nomenclature
pdb deposition date 2007-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00431 CUB CUB domain
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2qqlA03
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2qqlA04
2.60.120.290 Mainly Beta Sandwich Jelly Rolls Spermadhesin, CUB domain 2qqlA02
2.60.120.290 Mainly Beta Sandwich Jelly Rolls Spermadhesin, CUB domain 2qqlA01
2QQNA 3LEGA 4CU9A 3CMGA 3D3AA 3SEEA 3T2OA 1H6XA 1I5PA 2XOMA 4QDSA 4QAWA 4ARXA 2VMDA 4ET7A 1CIYA 3OGVA 1GOHA 1JZ7A 2ZEZA 3A22A 3F2ZA 3W5NA 2J7MA 4JX0A 3ETPA 5G05L 1NX9A 4BK5A 3PUHA 2VZPA 2BBAA 4W50A 5HPOA 4HG6B 4CUBA 3OEBA 2QQJA 2VC9A 1GOFA 4QX0A 2W91A 4LHSA 3T2PA 4JHZA 2V5DA 1J83A 5B4XA 3LEKA 1SPPA 3HNYM 3A7QA 2VCCA 5JUVA 2J1RA 2KD7A 1TG7A 3NRUA 3WNNA 1HN1A 4JKMA 5JR2A 1JHJA 2OKXA 4DUWA 1RYYA 4KWUA 3T2QA 1JYNA 4A41A 3IAPA 3BGAA 1UWWA 2VR4A 1ULPA 2RJ2A 2ZEWA 1W99A 4ZXEA 1DYOA 3POBA 4PT6A 1WKYA 3NJXA 4DXRA 4QDRA 1K12A 2QQIA 3K77A 4CUCA 4A3ZA 3OG2A 4PF1A 3I2GA 4JKKA 5LA1A 4BXSV 1PMJX 3ACHA 3T0DA 3C8XA 1DLCA 1W9SA 4MGSA 1ULOA 5J1XA 2X10A 3LPFA 2QQMA 2EIEA 3ZM8A 2LW8A 5JMOA 1UX7A 5A1AA 2VZSA 3OB8A 1UY4A 1W0NA 2RVAA 1K42A 3KQ4B 1NUKA 1YQ2A 3OGRA 1CZVA 1EUTA 4XUPA 1OT5A 1CZTA 1R64A 2WBKA 1O8PA 1DP0A 2YFZA 3C7EA 1K45A 2BZDA 4P00B 4D8MA 3GM8A 4A44A 1EUUA 1NKGA 1OF4A 5I0DA 4W8JA 3THCA 2W47A 2Y6KA 3WF2A 2CDPA 2C9KA 1GU3A 4XZUG 2WAOA 5C71A 1F4HA 4QPWA 1UYYA 3I3EA 5JXHA 1UXXX 4LOTA 1US3A 5CKQA 3VDCA 4BJ0A 2WO2A 5C7GA 2ORXA 5G04L 3NJVA 4L0PA 3DECA 3IDAA 3MUZ1 3I3DA 4MADA 4TXWA 5CZKA 3I2IA 3ECQA 1BHGA 4DUXA 1JI6A 2B4KA 3T09A 3WSOA 1L7QA 2W94A 5EJ1B 3W5MA 1SZBA 4FI9A 2V4VA 1UYXA 3ACIA 4ARYA 4A4AA 2L9LA 3C7HA 3CZUA 2WZ8A 1JYXA 5C70A 3ACGA 4XUTA 1NZIA 1W8NA 3I2KA 3DYPA 4CUAA 4DXTA 3FHAA 4E8DA 2E32A 1US2A 4XURA 3VDAA 2W1QA 3HJRA 4E8CA 2ID4A 4MO3M 2W1WA 2VTFA 1KEXA 3ACFA 3WF4A 1SG3A 2DCJA 3WF1A 2YG0A 1O8SA 2QQLA 3WNPA 2J22A 3HOBA 3IAQA 4QX1A 1GOGA 2W5FA 5CKMA 3K75B 2XHNA 3GGLA 2DCKA 2W92A 2JDAA 4A42A 3WNOA 5CYYA 3T0AA 2WUHA 4GWJA 4IUGA 3POEA 2VM9A 2EIDA 3POFA 3UNPA 1JZ6A 3PUIA 3K46A 2X09A 5DPNA 5JXGA 2VMCA 2WN2A 1LNSA 3DEMA 4P5YA 4MGQA 1GNYA 2Y6JA 4P08A 5IHRA 1UYZA 1NAEA 3HEIA 4QX3A 5CKNA 4PQQA 2W3JA 4XUOA 3GDBA 1JU3A 1UXZA 2VZRA 3T0BA 2E33A 2VJXA 3C7GA 3CKHA 2ZXQA 2JKXA 3THDA 2WZEA 1JU4A 5LA2A 3LEIA 2VQUA 1JZ8A 3A23A 2Y8KA 2X05A 1OH4A 2J1VA 1XNAA 1IQDC 2PQSA 3WF3A 4UAPA 5DQ0A 3C7OA 3CIHA 2C4XA 3I2HA 1W9TA 2DDUA 3SKVA 5JXIA 4OYUA 1JYWA 1T2XA 2W46A 2VMFA 3WEZA 3WNMA 4LKSA 1CZSA 2J1EA 3U37A 2J1UA 4XUNA 1UY1A 1GUIA 3E1F1 1OD3A 4QDQA 4OMCA 4LMFA 4LORA 2WN3A 4A45A 4XVHA 1JYVA 2Y6LA 3VD3A 3VD7A 1P8JA 3I97A 5IFTA 1XNTA 2BGOA 4BDVB 3P6BA 5IFPA 5LCWL 3JXSA 3MV11 1WCQA 3OEAA 4DXSA 4CVUA 1GMMA 4KMQA 3NNGA 3NQHA 4OMDA 3OGSA 5JXJA 5IJRA 4QB6A 1MPXA 1PMHX 4UOJA 4A6OA 2VCAA 3POGA 1PX4A 4QX2A 1SPPB 3A21A 4YPJA 2VZOA 4RYDA 2WABA 3VDBA 2WQ8A 3IIIA 1JZ3A 2C26A 2VCBA 3C7FA 2QBXA 1XC6A 3K4DA 4GZ9A 3DYMA 3I3BA 2J1SA 3MBWA 2VO5A 5FUIA 3WF0A 2B9VA 3VD9A 1XPWA 4CU8A 3BN6A 3WNLA 2QQOA 2WYSA 2Y6HA 3WQBA 1W8OA 2WO1A 2Z4FA 4DEQA 2VQTA 2YB7A 1H6YA 3J7HA 3CQOA 5EIYB 1GQPA 2VOTA 4QB1A 2VMEA 4M4PA 1L7RA 2BERA 2W1SA 4ZY9A 4CU6A 2J1TA 4OUEA 4OZOA 1UY3A 1F4AA 2WNOA 1SDDB 1O59A 3T08A 2XONA 4KI5M 2HYXA 1UMIA 3I2FA 3POJA 4QB2A 3VD5A 4Z2AA 2J1AA 2YC2A 3WNKA 1UY2A 4LOSA 2JE8A 3VD4A 2VZVA 2VZQA 4LPLA 4JKLA 3P1IA 4AAXA 3HNMA 4DEVA 2W87A 2R7EB 3FL7A 3K4AA 2VZTA 4D0QA 3ABZA 2VZ1A 2YC4A 3HN3A 2RV9A 4DUVA 4GWIA 3SKJE 3CZJA 2Y6GA 1J84A 1K3IA 2EIBA 3DYOA 3IB3A 3MV01 3POIA 4UI9L 2E26A 2JD9A 3MUY1 3LQCA 3UESA 3AC0A 2V72A 2W1UA 4W4ZA 2QQKA 5IYYA 5B4NA 1W9WA 1OF3A 1D7PM 3K4ZA 2WO3A 1PX3A 3EYPA 4BK4A 1UY0A 2VZ3A 4ZZ8A 1JZ5A 1CX1A 2CDOA 5LA0A 3FHQA 5HXMA 3LPGA 5DN2A 2BGPA 2HLEA 2ORZA 1UZ0A 3HNBM 3I2JA 3UETA 1SHWB 2WDBA 3SEPA 4P02B 4ZZ5A 4AG4A 1JZ2A 5EJZB 2XQXA 4RN5A 4M4RA 3MO4A 2VZUA 2WAAA 3EB7A 5DMYA 4MOAA 1UMHA 3OBAA 1JZ4A 2LS6A 2YFUA 2ZEYA 5F7UA 3GXUA 2W95A 2W9XA 1NT0A 1TVGA 3FN9A 3HPNA 3LE0A 2ZEXA 2VL4A 4LQRA 4XUQA 4CU7A 1SFPA 2E31A 4TTGA 1KGYA 2EICA 3CDZB 2Y64A 5CISA
chains in the Genus database with same CATH superfamily
2QQNA 4QPYA 2WS92 5E88A 2HWE3 2TNFA 3NV4A 4CZSA 3FLPA 1EY2A 2XOMA 4QDSA 4FFGA 5HBAA 3OF1A 3M1HA 5IVEA 4AI2A 3WD5A 1JZ7A 1ZA4A 2QZ2A 1VRH3 2WNUC 2JENA 4EWAA 5FZFA 3USUA 3BIEA 1HXS3 1RHI3 1W9FA 1H8TA 2VUCA 2VZPA 3KGZA 3PUHA 4YGDA 3VLBB 5JZGA 3GALA 2HWB3 1YJKA 4QPGC 2X29A 1W3XA 1COV1 3A0NA 4FPHA 3NSTA 5FYVA 1VBE2 2WINB 2UYAA 3SISA 1PVC1 2WIIB 4EROA 4L2NA 3VDDC 1H1AA 1UOFA 2JE9A 5HI0A 1J83A 3PTRB 3LEKA 4FFIA 3WCRA 1K5MA 2DVBA 3HNYM 4XJ8A 4Y1YA 3RZMA 4LO6B 5FPVA 3U78A 2DF7A 3OYWB 1IS6A 5LRRA 4AVAA 2Y6FA 2J1RA 2VOWA 5L7OB 3VBUC 3WQ1A 1ASJ2 4CDUC 2R043 4I30A 4NWWA 4XTMA 1NE6A 2VAUA 4SBVA 1SLLA 1TME3 1TMF1 1OA2A 3KT4A 5FLIA 3RZKA 1Y9QA 2UWCA 1QMJA 1AX2A 3WW1A 4OHXA 5DDJ3 2JDYA 1XOYA 1UYPA 4FBFA 4LBKA 1W3VA 5A6XA 1REFA 2CHHA 1W6MB 3ZX7A 2NN8A 1AL0G 3TN93 4H7LA 4CXXA 4TZDA 2YBKA 1W99A 3PVEA 3RJRA 2JIJA 1ND3B 2O0OA 1CIWA 2O1QA 5A7NA 4PT6A 1LRHA 3B94A 3NJXA 5DG2A 1XYOA 3RMXA 4DXRA 3HBZA 4IEUA 3CJIC 1D0GA 5D8AA 4N8MA 4AHYA 1V9U3 4GAZA 4BM8A 1K12A 5AVPA 4CUCA 4A3ZA 4B1LA 4YVWA 3HIFA 4A7KA 3BUCA 3UJQA 3AMHA 5DDJ1 2UWAA 4NROA 4N53C 3TEWA 3KT1A 3H1YA 2FMDA 3ACHA 2RS13 4NAMA 3RS6A 2XJQA 3WDTA 4C90A 3T0DA 2GH8A 1DLCA 3BTAA 2QJVA 1NA1B 2RDNA 4FOYA 3SH5A 3TN91 4Q4V1 5F3CA 1SBFA 2ZOEB 5J98B 2CWSA 2XXZA 2DUQA 1JN2P 3AKPA 2UWBA 1HRV2 3RZZA 4CP2A 3LPFA 1ST8A 1ZZ8A 1DZRA 2Z42A 4AXOA 3RZLA 3FLTA 2XDVA 4JGYA 2BYVE 5DAVA 1CVNA 1SCSA 1LOAA 2Y0OA 4JQRA 3VBRB 5ABJC 3VL9A 3KQ4B 2D97A 2VXJA 4N90A 1VBD2 3VHNA 4RS5C 2A6XA 2XWJB 4XTPA 3FMGA 4XUPA 1CZTA 3C7EA 5L9BA 5JOYA 1HKDA 2YFZA 5JLVA 4P00B 1FNZA 3GM8A 5FZLA 1QQP2 5LEKA 5I0DA 1NKGA 4W8JA 1ZZ9A 4J6GA 3E6CC 2Y6KA 3WF2A 5ANNA 4IE5A 3RI9A 5FYZA 4AHZA 2W39A 1B35B 4IEWA 4PIXA 1F4HA 4QPWA 5FO8B 5IT6A 2WNVB 2YDEA 2CTVA 3VB9A 2RJKA 5BNOC 3WY6A 1RMU1 1ALYA 3ZFFB 4IE4A 4XYXA 4CDQA 2WO2A 2ZX0A 4CCMA 2OZJA 4LKDA 5G04L 1NA1C 4Q4Y1 4A7ZA 1KS5A 5FYTA 3VBOC 5A6ZA 3AMQA 3DECA 3AVSA 1G9BA 2WSUA 2ERFA 2VUJA 3I3DA 3OUJA 3M3IA 1G9FA 4X8NA 2JG9B 4AQ6A 4LBQD 5M0TA 1W6OA 5DUWA 3LIHA 3ECQA 2QKDA 3I59A 3MPBA 4PBPA 2ZACA 1ZBE1 5FJKA 1JI6A 1VBA1 2B4KA 4L8QA 3T09A 2QDNA 4IEQA 5C9AC 4S2GA 2DVDA 4XIOA 2D6OX 4Q1RA 5F5QA 2HWE2 4FI9A 4LO8A 1ULCA 1WCDJ 2V4VA 4P9WA 1HB2A 4HKOA 1W2TA 1CJPA 2A7AA 1G9CA 4OFGA 4Q0VA 2AUYA 1W8UA 4ASLA 4MUVA 2WZ8A 4XXPA 1GR3A 3ACGA 1WW5A 1PNGA 1QDOA 2OPKA 4GIQA 1ZBE3 4Z07A 4Y5Z0 5J36A 1CD3G 2VOXA 4AEJA 3KCCA 2E32A 3K48A 5A7OA 5HCFA 1QH6A 5EYYA 2A1XA 2WZPP 2NMNA 4Z82A 1RUE1 1BK0A 3VGIA 4FAHA 4YZ2A 4M3CA 2P3IA 2ES3A 2XKOA 4FO9A 4GA9A 4UXAA 2JDZA 4X6QB 2VBBA 1QU0A 2JG9C 2G9ZA 2FCTA 3BVCA 3JD73 1XSQA 2GC0A 4Q4W1 5IWFA 3SH4A 2RS32 1N47A 5ANQA 2BFUS 2BQPA 2XLGA 4XE9A 5FY4A 3U11A 3ZXEA 3ZXAC 5CAZA 5CFDB 1NXMA 4UWDA 1SG3A 1CAUA 2XJPA 4WM8C 1A34A 1ENRA 4X6RB 2OYZA 2YG0A 5FP3A 2JDNA 2WZR1 1IS5A 3E6DA 2J22A 1XU2A 2ZAAA 4QX1A 3MPPG 3MDPA 1C3HA 5A6QA 3ITQA 3AP7A 3WCSA 2XHNA 3PNAA 2BJSA 2DBIA 3GGLA 5LB6A 4P9YA 4IV3A 5FYBA 4A42A 4N7IA 3N9OA 1RUC3 4YW1A 2WLQA 4ATEA 2DVFA 1UMZA 1YI7A 1NCRC 2DU1A 1IS4A 3B01A 5FO7B 4DQAA 4F7ZA 3POEA 4OVEA 5T5OA 4RGGA 4CPBA 2D6PA 2X5IC 1PVC3 1JZ6A 5DPNA 3ZYHA 2VMCA 4P5YA 1GNYA 1WCUA 3PLQA 3VBHA 1UYZA 1VP6A 1D4M1 1CN1A 1ODNA 1DGWA 4B1MA 3ZXGA 3N7LA 4XUOA 4LK6A 2HWF2 5CG9A 1N1SA 1JU3A 2HWD1 1COV3 3HMYA 3PHMA 4CEWC 2WFF3 3T0BA 1Q8VA 4CDUA 5IW0A 1AJOA 2PN5A 1OH3A 5DZEA 2VJXA 1DQ0A 5FY5A 2ZXQA 3M7AA 3VBFA 1J59A 3WW3A 2GAUA 3AMMA 5J37A 3TRSB 2FDFA 2RDSA 3EMRA 1EPZA 2RJLA 2C5DA 1FMD2 1XNAA 4YZ4A 4RD7A 1IQDC 3LOIA 4TLGA 1C1LA 3JB8A 4XC9A 5IVFA 1HX6A 2HWC3 5ACA1 1REDA 5C5TA 1W0OA 5FR3A 2YROA 4LKFA 1LR5A 4QPGA 1GQHA 3VBOB 2AC1A 3ASIA 2PQQA 3DXTA 2WT2A 3ZR5A 5J7MA 4XFBA 4JGYC 3U37A 2J1UA 2R062 3ZXFA 4B4PA 4BIOA 3E1F1 4LO7A 5FZ6A 2VCMA 4NRMA 1PO12 1JW6A 1QXJA 1NCQB 5KHKA 2VNOA 3J8F1 4FPLA 3JCIA 3OUHA 4H2AA 4Q4X2 4XVHA 5DG1A 2PHRA 1O4TA 5F5AA 2Y6LA 1RUH3 2GSYA 1QOTA 2A6WA 1VRH1 4GWNA 4AVBA 5IFTA 3O14A 5GLTA 5IFPA 5LCWL 1DQ2A 3JXSA 1E5SA 3OEAA 4CVUA 2ET1A 4KWKA 5LBBA 4RQPB 5L19A 2CNAA 4XIKA 1J3RA 3NNGA 2Q8EA 3NQHA 4OMDA 1PIV2 3OGSA 4XJZA 4FPJA 5JXJA 3DUIA 1MPXA 2VOKA 4JDNA 4QWNA 4Y4RA 1LAJA 3NV3A 2RMU1 5FK7A 4A6OA 2R042 3GNEA 3POGA 1PX4A 2CAUA 4P9JA 4R9BA 3TNPB 2DVGA 1MZ6A 1N1TA 2WS91 4XETA 5A80A 3VDBA 4HANA 4M0NA 2PHDA 2C26A 1MS0A 4N9IA 3GBGA 1TQ5A 2W0XA 4BQ1A 1UCXA 3E6BA 3MLLA 4NIIA 5KHIA 1HQLA 3SCFA 2YGLA 1Q3EA 1XC6A 4XF9A 2BDRA 5C8CC 3WNXA 3CBNA 2YUEA 1X36A 3ES1A 4YYOA 1J1LA 4LBQA 3QCWA 2DWRA 1W8FA 4YW3A 3UGHA 1GP6A 2V09A 4L97A 4IEPA 4AR2A 4QQHA 5JI9A 2P5BA 2VO5A 1XRUA 2JXAA 5FUIA 3WP4A 1F15A 3PURA 4GH4C 1DHKB 1Q56A 4IEYA 4R8HA 2IC1A 3ZVXA 2VOVA 3BN6A 5F5CA 4AI1A 4YARA 3MZHA 3U10A 5FUPA 2E51A 1W8OA 2WO1A 2XUMA 3SHRA 1FNYA 3AX4A 4AQSA 2BBVA 5EFUA 1BEV1 3LWCA 3T3YA 3H3UA 3UL2A 4ISQA 2VQTA 2DCTA 3G7DA 1H6YA 1H8TC 3J7HA 1GP5A 4Q1PA 2WNUA 3D8CA 1OUSA 3A4UA 3VDDB 3ZYFA 4DS0A 1GQPA 1VBB2 1YUDA 5FYCA 4QKBA 2ZX4A 1XQNA 3ORJA 1O4ZA 2NM1A 2ZABA 3KVAA 5EJ3A 3VBUB 5I0SA 2B45X 4RA0A 4XQ4A 3IDBB 1QJU3 3NKGA 3Q9OA 4CU6A 1GFF2 5CFCB 3H9AA 5BNPB 1O3QA 1R093 1UY3A 5FY0A 2ZGPA 4YGEA 2BVBA 2VBDA 1MVEA 1F4AA 2O8QA 3E5UA 2D6MA 1ONAA 3B9IA 3H8RA 5C5UA 1DGLA 5FZ9A 5EWSA 5EQUA 5L73A 3VZLA 4CEWB 1WW4A 4KI5M 1UMIA 3FBMA 4HSJA 5I0RA 2TUNA 3VHRA 2ILMA 2G1MA 1ZRRA 4NUBA 2A6YA 5DDJ2 3RWKX 4HFSA 4LHKA 1S0CA 5FCCA 1WD4A 1LJ7A 4YW5A 5KBFA 2XJTA 2VZQA 2YYOA 4XF3A 2BTVC 2UY9A 4A2UA 3QH7A 4JKLA 2ARAA 3J4UH 2EXIA 4AAXA 1UD1A 4BH9A 1GLHA 3T1MA 4ES8A 4AE2A 2WNEA 4HOOA 4UFLA 1Q8OA 4O7XA 4IW3A 3AYCA 4FTSA 2VZTA 2FCVA 3RPQA 3CHXA 4RR3C 2XG3A 4XEZA 4XFAA 3V0AB 4JVAA 2GNBA 1XJAA 3VBSC 3BI3A 3PTYA 4WVVA 2BWCA 2Q30A 4JV4A 4HN1A 4AVSA 1DYPA 3H42B 3IDCB 3GZAA 3CZJA 1LULA 2Y6GA 1OHFA 3OPWA 2LUWA 3LAGA 3LZZA 4HVOA 4JDMA 3RI8A 3ZXKA 4EN0A 3M4FA 1LHUA 4ASMB 2EIBA 1KRIA 4R52A 3AZYA 3KMHA 2B39A 1BYHA 5AFEA 4IE6A 3EQEA 3B93A 5JPNB 5HCHA 5CFCA 1XE0A 1RUI2 1ACCA 1X9PA 3MUY1 3LQCA 3GHMA 1FI2A 1FOD2 3UK9A 3AFKA 3ZYBA 1ZBE2 5EHDA 2QQKA 5IYYA 1PHMA 1RUH2 4DZGA 4XMIA 3S5AA 2X53S 5A33B 4DY3A 1PX3A 4BK4A 3S6PA 2QDRA 3LKJA 2FHRA 5C3SA 3O1MA 2XJRA 4Q0UA 3OD0A 3S57A 5F1RA 1CX1A 5LA0A 4QX8A 3O1RA 4KH9A 4S2HA 5FRAA 4MSVA 5A7PA 3T30A 1HJGA 3ZOIA 1OURA 1AL23 3ACLA 1DQ4A 3ZO0B 1UZ0A 3HNBM 4HK9A 3UETA 4FFHA 1OLRA 3SEPA 3OD4A 1VMFA 4JTOA 4P02B 4ZZ5A 4BQ3A 5GZGA 1JZ2A 2XQXA 2JB4A 2ZGMA 4Y26A 3CO2A 1OA4A 1RUF1 5GLVA 3ZXDA 4M4RA 1ZZ7A 2VZUA 2WAAA 2BW8A 2HWE1 4CDWA 2JD4A 4CXYA 2BGCA 1KDMA 2A70A 3IN9A 1COV2 5F7UA 1LODA 2PAKA 1S4CA 4SLIA 4U36A 4ZHNA 4AHWA 2BOIA 1W2AX 3LIGA 3M3CA 2VECA 1H4GA 2HYKA 4LJHA 3WQ7A 4FPYA 3FLRA 5D2AA 1V6NA 2GMMA 3WG4A 3OTFA 1CONA 4GMP1 5BNNA 2OPWA 2EICA 2CGNA 4XPVA 1QJX1 3H50A 5CISA 1JUIA 2BEOA 2DU0A 3RNSA 1NLSA 3CMGA 1Y9MA 3MFAA 3MIGA 4LNVA 3ILFA 3ZN5A 1TMF2 3SEEA 1VALA 2WWSA 2EF6A 3H7JA 4FPCA 3T2OA 4D6SA 5FIXA 2F4LA 1W9YA 1WWYA 1Y9GA 4O9GA 1FPN2 3INAA 5A3TA 1X9TA 2DFBA 2VMDA 4NPRA 4QM8A 4QU1A 1CIYA 2RM22 1LHWA 1GOHA 1ZA7A 3OGVA 1VBB3 5BNPC 5L36A 1UAIA 2QNKA 1W04A 4XHBA 3W5NA 2J7MA 3TB0A 5FV3A 1VMHA 3RGBA 1NX9A 2F4PA 3U4SA 1POV3 1AR72 1UN1A 3KQRA 2BBAA 4JZRA 1JMUB 1ULFA 2G9FA 1AR93 2WZR2 4MGIE 2MEV3 4AQ2A 4E4HA 5HPOA 2ET7A 3FFQA 5I91A 1WMDA 2V5YA 4FQZA 4CEYA 3ZKYA 1V6IA 3VZOA 1FXZA 4K8FA 5C9AA 3BTXA 2W91A 5JSPA 2WT0A 1W6PA 4LHSA 5T52A 4F8AA 5B4XA 1SPPA 4HL0A 4AFMA 5C8WA 4FSJA 1D4M2 2XQRA 4AFCA 2RS33 3AYEA 1BJQA 1EP0A 2HWC2 4XFIA 4QPGB 4YNIA 5JUVA 2Y34A 1MS1A 2KD7A 4C1XA 2PHLA 1HN1A 3I2DA 4GALA 4KQ7A 2OKXA 4X8PA 4YM1A 1RYYA 4R9DA 4CP1A 4AEDB 4KWUA 1APNA 4UW5A 4RHV1 1W2NA 4HN0A 2WL1A 4A41A 2DYCA 4FT8A 1HRI1 2K2SA 4NRQA 3O0WA 3MIBA 4Y20A 5A3LA 3WDYA 4KGQA 4CCOA 4CDWB 5IVBA 1VBD1 3U4XA 1H4HA 5IAXA 4DO0A 3AKRA 4EE2A 2BP6A 1E5RA 4I2OA 4YGBA 1QQP1 1BVP1 2FQPA 4ONUA 1SACA 3RZHA 5J09A 1JODA 2R061 1XYNA 1WLTA 3ZMNA 1AX1A 1CAVA 1NCQA 3BYWA 3HT2A 3OG2A 3IKWA 2ZTNA 1YQ8A 4Q8LA 4BXSV 2D7FA 1D2SA 3NMBA 2XJSA 1PGL1 5LW9A 4XJ9A 1ULOA 3AXDA 2RMU3 2GMPA 5DXDA 2QQMA 4DB5A 4OI0A 5FDBA 4CRQA 2EIEA 5JMOA 2RHPA 5A1AA 3PIGA 3OB8A 1R091 1UY4A 4YVSC 1V70A 2QTWB 4UW4A 1K42A 4EJRA 1O5UA 1OPMA 4L9BA 1MACA 4Y33A 2ARXA 1HQNA 4YVWC 5KC5A 1CZVA 1AYM3 4UFIA 1EUTA 3V0BB 3AYDA 2F6BA 1OT5A 1NQJA 1R64A 1ZZ6A 4XJAA 1K45A 2BZDA 3ELNA 5CFDA 1OF4A 2VH9A 1HDKA 2PHUA 2VD7A 4HKLA 3VBRC 4ASKA 1YXWA 1G9AA 4AFBA 2CDPA 2C9KA 5FPUA 1GU3A 5IVJA 5C71A 4O65A 1S0JA 5JXHA 2R063 2JEMA 1OVPA 1BEV3 4GQ7A 3NJZA 3W9AA 4KWJA 4A3XA 1HQWA 5A3UA 4BMBA 5LRSA 2P34A 5DZGA 3HQUA 5CADA 4K8RB 1W6NB 4FCAA 2JECA 3J9SA 3I2IA 3N9NA 4G3YC 3USSA 3FHIB 1ULEA 4E2SA 1BHGA 2MHFA 4Q4W2 1OQ1A 1WCSA 4FOQA 4DUXA 2DURA 3KWVA 3ZN6B 4AEMA 3N36A 5B2GB 4MG2A 3WSOA 1Q8PA 2WNUB 3VDDA 4R4ZA 2AREA 3HWJA 2JICA 1MS9A 2Z2SB 4LHNA 1SZBA 3BPSA 4PQ9A 4BQ5A 1UYXA 4YGCA 3W5MA 4KGGA 4I02A 3IMNA 4L11A 4Y22B 4M01A 5LK7B 2D5FA 1BBT2 5A3PA 5J3UA 4D94A 4P9XA 1S2BA 3O5SA 3UJOA 4FP2A 1VAVA 3DN7A 1TEIA 4COWA 4RR3B 3VKNA 2CL2A 5FXXA 3ROUA 1RUJ3 1XU1A 4HBNA 1YFYA 2FDIA 4Y20B 3FHAA 1A6CA 2PHWA 2XHKA 2AH2A 3Q8EA 3UV9A 4XURA 3VDAA 3WOGA 5KWRA 2W1QA 4R9CA 1RVF1 1TE1B 3PVBB 2ID4A 4MO3M 4LBNA 4ZS3A 4AEDA 4BQ2A 2OX0A 1C5IA 2QQVA 1W8ZA 2GH2A 3IPVB 1KEXA 3ZIWA 2BWAA 4IETA 5DABA 4LR4A 3FE5A 1G86A 3E5QA 1BQPA 2OA2A 4AHXA 1JS9A 2VVEA 3MIHA 1OLME 2BOJA 1X33A 4MXWA 2QQLA 2R071 3MLJA 1MS8A 3TOJA 1C8M3 3WF0A 3WNPA 1SLTA 3HOBA 4PBOA 3IAQA 1ZYBA 1WCKA 4Y5TA 1R1A2 3PVOA 1OVSA 1YFXA 1GZWB 2VNGA 4DINB 1SBDA 3N3HA 4M00A 4XJUA 1GZWA 1UPSA 4LBQB 2DCKA 5FAXA 2XBO3 5FZ8A 4C1WA 1SLAA 2W92A 2YC0A 1EAH1 2PHXA 1FMD1 1POQA 1W90A 3WNOA 1SFNA 2R30A 1YQCA 2V73A 2WUHA 1HV1A 5ACA2 1MEC2 1N3OA 2QQWA 4GWJA 5C4WC 2VM9A 3UNPA 5F3IA 2QZ3A 2BPA2 2W68A 5FLHA 3AZXA 3R6SA 3OSDA 5I8SA 2RS12 2Y6JA 5A70A 1HB3A 4L92A 1YCIA 2VVFA 2QE3A 1NAEA 3HEIA 1AR61 1E5IA 2RR13 4PQQA 3AMNA 2VE1A 3ILNA 3O1UA 2ZPXA 3BTZA 1OFSA 3QD6A 1K5JA 1VRH2 5ISLA 2P1BA 5A1FA 5FPZA 2NP0A 5A3NA 4BCUA 1F31A 1AR92 2JKXA 2WZR3 2WZEA 1JU4A 1H1IA 1RUI1 3THDA 4CCCA 3ZR6A 1FOD1 4WVZA 2Y33A 2Y8KA 3VBRA 2IXHA 3ZFFC 1MZ5A 1ZZCA 2E7TA 1RUH1 1XNKA 4JC1A 4URAA 1WGPA 4YZ3A 1OLMA 1GSLA 2PQSA 3RDIA 2Y38A 4PI0A 2JDMA 2ADDA 2R041 2R1BA 3I2HA 1W9TA 2DDUA 4CPBD 3KB5A 1JXNA 1V6LA 1RC6A 3ALQA 5J96B 2ZX1A 2VMFA 2W46A 3AL5A 4DPNA 3WEZA 5C3QA 4PLMA 5C8CB 4MGKE 3EJKA 4ITCA 1TME2 1UU5A 4GKYA 4OMCA 2HH9A 2GMEA 4UT5A 5CEHA 1KD7A 2B9UA 3CF6E 1RUF2 3KV6A 4Q4V3 5AVAA 4A45A 3O1OA 5FBJA 3FWEA 4JCKA 5A33A 5A7WB 2ZS6B 5AC93 2LM3A 3VD7A 5A32A 5DAQA 4TWTA 1H9PA 3MI8A 1BCXA 1EV13 4EWDA 4LHLA 4V1PA 5F39A 1POV1 1C28A 1NG0A 4XABA 3VKOA 4DXSA 3BOPA 4FVVA 4MZUA 1GMMA 2OS2A 3ZSMA 1V00A 1H8VA 3RZJA 2EIGA 2NMOA 2BNNA 1WUVA 3U1XA 3DKQA 4XMAA 4UOJA 5FPAA 4AFAA 3V0BA 4D6QA 1AR71 2E53A 1QJX2 4CDWC 4XDOA 3N9LA 4YPJA 3FBYA 4Z2WA 4AI3A 4LA3A 3OYWA 1ZRDA 1JZ3A 3N7MA 3FFZA 2I2SA 4AGGA 2Q5TA 2VCBA 5FP9A 1W06A 1XSRA 4QXKA 3IWZA 1FPN1 5FMOL 4NR1A 1BMV1 3LFIA 4BQXA 3D0JA 3J8F3 3DYMA 1C4RA 2IFRA 2JJ6A 3BU0A 2IVJA 2RG4A 3WINE 1LKNA 1AYN3 2B9VA 5LBEA 3USUB 2BVVA 3DV8A 1UQXA 4P9IA 1QQP3 2YMZA 5IVYA 4CCKA 5IK5A 3B02A 3WQBA 2G19A 2G4IA 2DTWA 3RVHA 4CEYC 1JOJA 4Y24A 3N35A 2D5HA 4DFSA 2WFPA 2QVSB 4BQWA 3PJQA 4RHV3 1W8WA 4DEQA 1WLDA 2YB7A 5HV0A 5KXEA 5JR7B 4HXCA 4LE3A 2Q1MA 3CQOA 5LK5A 3S7IA 1R082 4QKDA 3HVDA 3KSCA 5JDBA 4QX7A 3ZFEA 3G6JB 3KVBA 4XZPA 2VOTA 2X5IB 3CL1A 3J7MA 1UOJA 4IEOA 4OULA 2YXSA 3THPA 2GZWA 4M4PA 3ZN4A 3AZVA 1RB8G 3U14A 3AFGA 2XBO2 3QH6A 5A3WA 1A8MA 2W1SA 4XFGA 3GCWA 4BHPA 5A7WA 5I8YA 3ZIXA 1HRI2 1OOPB 2KXLA 4I3PA 5T5JA 3S5QA 5HV4A 4OUEA 1Q8SA 4XDQA 3D5OA 2VMGA 5BNNC 1FYUA 3AKTA 4CCNA 2NZ9A 2NYYA 1UKGA 2D6LX 3HN1A 5F3GA 3IMMA 5L9VA 1SDDB 1ND3C 2ZGQA 1F35A 1O59A 1X50A 2WNVA 1RXGA 3GJAA 4HSLA 2WRAA 3B5LB 5FY8A 5ABJA 1LENA 2JDUA 2WA3A 3JD71 3MW2A 3FJSA 3AL6A 4BZ4A 1S0FA 4YM2A 4EQVA 4I0BA 5FZMA 3I2FA 4ATFA 3FZ3A 4XQWA 1WBFA 4UW3A 2ZGLA 5EV7A 2J1AA 4CEYB 5BUVA 2YC2A 4GB32 4LK7A 4LO5B 1M06G 1X8EA 5ERLA 2VZVA 5FZAA 3OY8A 1PGL2 1IZ3A 3NNJA 2J42A 1VBC2 5JSOA 1YQ5A 2W87A 4FQ4A 3D0SA 3BALA 2XGXA 5F5IA 1DU3D 4LA2A 1OA3A 1Z7S3 2AEYA 3TNQA 1ZX5A 2VZ1A 3S0MA 4UYBA 1RUC1 2YC4A 3O1PA 1T6BX 1OOPC 4FPFA 3LDKA 1IPKA 4DUVA 4OCTA 3OGGA 4GWIA 3SKJE 4ZKTB 3RSJA 1H2KA 1M4WA 2C1FA 2PLV1 2VQAA 1YNAA 3DYOA 4IERA 4QT6A 3T4VA 5FZ7A 1W6QB 2GC2A 5J48A 1J58A 3POIA 4UI9L 2VQ0A 2JD9A 5F8PA 1JTZX 1Q43A 5FK8A 1IPJA 3KM5A 3UESA 3VZMA 4W6WA 2W1UA 1N1VA 4W4ZA 5HXVA 3DF0A 4AGRA 2XL7A 3ST7A 5B4NA 4XAAA 3AKSA 4AI0A 1D7PM 3TEZA 1OI6A 2HJIA 5CIRA 3HD8B 1HJFA 5C6CA 4FTEA 1UY0A 2WKKA 1JZ5A 4K1ZA 2P37A 3Q8BA 4K40A 3SMHA 1ULDA 1W28A 3R05A 1GICA 4HPKB 1PO22 3FHQA 4BE3A 2PHTA 2PLV3 5CBLA 5JI7A 5C4WA 5HXMA 5DN2A 2BGPA 1L7LA 3I2JA 5C3RA 4OHYA 4XJWA 2WDBA 4JDOA 1AZDA 4PDWC 3B3QE 1RXFA 4TLFA 1BKZA 2CGPA 5EJZB 1RIRA 5FJHA 2WC2A 2RR11 1SMVA 5JWPA 3GBWA 1UX6A 1JYCA 2CWMA 3JQXA 3MO4A 4Y5SA 5A1LA 1QJX3 3DCQA 3DPRA 4N7UA 4V2WA 3W20A 5DMYA 2P4EA 1ASJ1 1RUJ1 2XWBB 3M70A 3OBAA 3JZVA 1IGOA 2YFUA 2ZEYA 2QQUA 1FT9A 4E4DX 1UF2C 2YGMA 4H55A 5HCBA 1ZRFA 4C0HA 2MPFA 2ZKNA 5LY2A 2W9XA 3TBDA 1WW7A 1RUE3 4W65A 4BWOA 3V65A 4NRPA 5A3MA 1J3QA 1TVGA 1H30A 1H8TB 2XKPA 2ZGSA 3D6EA 3FN9A 2NQYA 1U12A 1PNFA 4LQRA 3MGUA 3WDUA 3UT0A 3APBA 4QD2A 1LGBA 2O8OA 5FY7A 5FXZA 4AEDC 4YG3A 5L7OA 2OVUA 4Y22A 1UZWA 2Y64A 4HG6B 4LLOA 5FYMA 4CU9A 1S2EA 2WA4A 1R1A1 3D3AA 3VZKA 2VXRA 1NY72 1C8M1 4UFJA 1H6XA 1I5PA 4RHV2 5LBFA 3GZEA 4IEXA 1DQ1A 4NHYA 3PU3A 3RYPA 5I0UA 4HONA 1PM4A 3X29B 4ARXA 2CSGA 3O7OA 5H9PA 4COUA 1PO13 5F9TA 4GWMA 3F2ZA 3VN4A 3ETPA 4Q4V2 4Q0QA 1VB2A 4BK5A 2ZGNA 1V9U1 1BXHA 4QKFA 5E16A 5BPXA 3WDWA 4CUBA 1Y4WA 2EALA 2QQJA 2AGSA 3ZMOA 2VC9A 1GOFA 4YW2A 1CGPA 1TNRA 4K20A 4JHZA 2V5DA 1SCRA 2CY6A 1SFYA 2Q1FA 4BQYA 2VCCA 1EAH2 2HKXA 4LBLA 4OQ8A 1CAXB 1AYN1 1WW6A 1TG7A 1WMEA 2V4AA 3NRUA 3WNNA 1ZBA1 2ZZQA 3LA2A 2DVAA 5C8CA 4OHVA 1PZ7A 4DUWA 1AR91 4OUSA 1ZRCA 4LLFA 4EYUA 5JSRA 1RINA 2R0HA 1JYIA 4IXLA 3LA7A 1LOFC 5FUNA 2GNDA 2JE7A 4FOWA 3BGAA 3VBSB 2ZBJA 3ETQA 3ZSKA 2RS11 3VBHC 1VMJA 5A32B 3NAPA 2RJ2A 2ZEWA 4ZXEA 1GV9A 5E6HA 1YEWA 2GP3A 2Z79A 4OI4A 4Q4Y2 2QCSB 5IVCA 2XB6C 3FUOA 4NOTA 5AC91 3VUOA 1JOBA 1SEFA 2CAVA 4Q0PA 3WVJA 1MEC3 2WT1A 3KV4A 1NOVA 5FKCA 1NCRA 2ADEA 4EZHA 2OXBA 1LTEA 2HWB1 1GZTA 2D98A 3GYDA 2A6VA 3R4UA 1B35A 5FO9B 3W21A 4PF1A 3I2GA 4JKKA 3ZSEA 1VBA2 5CVRA 1DDLA 1YI9A 3V56A 4WVWA 3PVNA 4IE7A 4KWLA 3C8XA 1XNCA 2EXHA 1U0AA 3AKQA 3I4IA 5FZ1A 5GZDA 1Y7BA 1QJFA 1W9SA 4MGSA 1RUG2 4OQ9A 3WP5A 1QEXA 4AL9A 1OSGA 1U5XA 3M2MA 5GKAC 5KR7A 2PELA 2X10A 4AEKA 2CYFA 4CA9A 4WM8A 1MZEA 3NL1A 1UX7A 5IK7A 1XE7A 1RUD1 3J7NA 4D6RA 1QIQA 1W0NA 1H9WA 2RVAA 2YBPA 1BVVA 5GZFA 4CXWA 3LCPA 4XBQA 1YYNA 1DYKA 1QJU2 2SBAA 1HRI3 1NCQC 5K0UC 1QOSA 4N9HA 2JG9A 4AVVA 3I7DA 1R1ZA 4LITA 4QHBA 5FWEA 4DRVA 1DGRN 1O8PA 1DP0A 4QQOA 3TEYA 4D8MA 2LALA 4RSUA 5IAVA 2YU2A 5L9RA 3U75A 4A44A 1EUUA 3W58A 5FZCA 4GULA 1SLCA 3T4HB 3THCA 5KXDA 5FZHA 1LOGA 5FKBA 4AVTA 2B8MA 2FCUA 1MS5A 2WAOA 3WT3A 1BBT1 1UYYA 4K3UA 3I3EA 2EAKA 4TSVA 3SITA 4FPKA 4F83A 5D1IA 5H9RA 3K3NA 1UXXX 2Q4SA 1R083 4BISA 4LOTA 1PK6C 4WVMB 1BMV2 3VDCA 4NIGA 3ES4A 4IEVA 2R0FA 3ZKUA 2B42B 4XF0A 4BOWA 2ORXA 2OZ6A 1JHNA 2YPDA 4L0PA 5FZDA 4B7KA 2XLAA 1GANA 3RMYA 3MUZ1 5BNNB 3WHUA 1RVF2 4TYSA 1KDKA 3GJBA 2PA7A 3NO8A 4TXWA 5CU1A 1KXGA 4COVA 2EXJA 3BCWA 4I3GA 4Y1ZA 1V6JA 2X5IA 4LKEA 3KCXA 5AFBA 3IIAA 3OCPA 4M0HA 2AEZA 4MHRA 2YV8A 5JAXA 1QF3A 2W94A 5EJ1B 1CAXA 3ACIA 4ARYA 1O5LA 4U2AA 3VBOA 2DCZA 2MNGA 1GKBA 1GZCA 3RZGA 5D8AB 2L9LA 2XBO1 4XCAA 3C7HA 3CZUA 4CDQC 5JOZA 1U5YA 1GWMA 1V6MA 1ZZBA 4QHOA 5GM0A 1JYXA 1DQ5A 5C70A 3KS7A 3TAYA 3ZFGC 4XBNA 1NZIA 1XNBA 2WJSA 2D44A 2XUEA 4MHUA 2HEVF 1XBFA 4QQ2A 4CUAA 2AENA 2BUKA 2RDQA 4E8DA 2HWF1 2XR4A 1US2A 1LECA 1MR5A 1Q8QA 3HJRA 2QUOA 5IVVA 1FV2A 5EP9A 1O7FA 3J26N 1G8WA 2PYTA 4RS5A 3ZFEB 3IDEA 3MHZA 1Z7S1 1D4M3 2VTFA 5BV6A 1W03A 4EN6B 3BODA 1RMU2 1AVBA 3JBG3 3VBHB 3HT1A 4GKXA 1PZ8A 1J1TA 2D43A 2KR2A 2DCJA 1C8NA 2VY0A 5LATA 1OQDA 1RTVA 5FZBA 3SNMA 2ZGRA 5T55A 5FZEA 4YG0A 1FOD3 4NVPA 4DMIA 1LESA 3K75B 3BU7A 4IQPA 5A7SA 3TEXA 4CDXC 2VTXJ 5IATA 5JZGB 5T3NA 2GNMA 1LOCA 5T5PA 2GU9A 2IUWA 5A7QA 4FP3A 2ZKLA 3NNFA 1IQAA 3ME2A 5GJ6A 3OPZA 1QDCA 4IV1A 3KV9A 4DNYA 1JYTA 1DZTA 2DUOA 4BMEA 2PLV2 3POSA 4IUGA 4GMP0 3ATGA 2BNMA 3O1SA 3QACA 1HW5A 2EIDA 1SQ4A 4GJZA 3PUIA 1RJ8A 4RFRB 4OHZA 4K6BA 5JXGA 4Y4YA 3B9CA 4C91A 3E5XA 2XL9A 3DEMA 1VPHA 3HQRA 2HBUA 5DAPA 4ZU4A 3SCGA 4P08A 2VMHA 1WMXA 2A5ZA 3LEMA 3WHTA 5C4WB 3L2HA 1AR83 1L3JA 1A78A 1LOFA 2OIIA 3DGTA 3HBKA 4LUKA 5GLUA 4QX3A 5CKNA 5JCTA 4JTNA 2W3JA 1HRV3 1VLNA 5JIAA 3WW4A 1C5HA 5LZ6A 1PK6A 3O12A 2VZRA 1CQ9A 1IKPA 1RUE2 4IL7A 3PJYA 2E33A 4Y3OA 1QNYA 1XB9A 3VBUA 5D21A 4J1WA 3RQ0A 3WDVA 1HB1A 1VRBA 4IV3B 4N53B 2F17A 2K9ZA 3A23A 3R4SA 2W2IA 4N43B 2J1VA 1AYM2 5IK4A 5GLWA 2VG9A 3WF3A 1HB4A 1ZBA3 5FOJB 1EAH3 3C7OA 1UU6A 1IOAA 3SKVA 1MS3A 4CE8A 5JXIA 2WS93 4HZFA 4OYUA 3VZNA 4K9SA 1QY4A 1KJLA 1T2XA 5DUVA 5BXXA 3OBRA 1ASJ3 1O3SA 5KC6A 4LKSA 2XVLA 2ZHLA 2ARCA 2PXJA 1E57A 1UY1A 1GUIA 4LMFA 1OD3A 1ENSA 3LDBA 2JWPA 2RM23 2VVDA 4LORA 3U0ZA 1CAWB 2I74A 3EXUA 1E5HA 1JYVA 4MGZE 2R49A 2YHJA 1AR73 2KA3A 3WG3A 2WSVA 1VBB1 3V64A 4E4SA 4NE9A 1B09A 2IZWA 2H0VA 4B29A 2RS51 1JYNA 4WV8A 1XNTA 5SV8A 2BGOA 1I3HA 1SBEA 4BDVB 4MGTA 1F9KA 3Q8FA 4HMZA 4E27A 1B35C 3MV11 2XJUA 1WA4A 1WCQA 1C1FA 5D8AC 1QJY2 3OOXA 5KHGA 1DIWA 1HN0A 4NHLA 4LBOA 1I1EA 5FZ4A 5T5LA 3S30A 2AZ5A 3ZDSA 4QB6A 1PMHX 4BXFA 1AHSA 4B4QA 2VCAA 3VZJA 4QX2A 4LT5A 1FX5A 3NAPC 3QLQA 4KL1A 1SPPB 2HWD2 1H2NA 1W6PB 2VNRA 1NZCA 1OXCA 3THTA 4YZ5A 4RQPA 1G6NA 2WABA 2WQ4A 3UKVA 3AM2A 3MFCA 5F6KA 1QJEA 1D4VB 1OC1A 1Q5OA 2I07B 4JHTA 2UYBA 3W59A 4H14A 4P9GA 2QBXA 3WG1A 3K4DA 5FZOB 1YHFA 2ZAHA 1W6OB 3HQXA 3M3EA 3MYXA 1CPMA 4WM7C 3RWNA 2DCYA 2D3SA 2E63A 4XFFA 4XFHA 4KU8A 1MQTB 5FZKA 3I3BA 1VIWB 1F8VA 3TYJA 4AFDA 4C8DA 4URTA 3C3VA 4Y1VA 4YW4A 2FD8A 1RITA 5TSWA 1XPWA 3EHKA 4QX5A 4XW3A 1V9U2 5BY5A 2TBVA 3OY8B 1OLQA 2IXJA 3H7YA 3SH3A 2GN3A 3O0VA 2ZX2A 1H2MA 4QGMA 3N9QA 2B46X 3ON7A 4CDXB 4HLTA 1WZXA 1QH7A 4KG8A 1CESA 4D7SA 4MVTA 5DZFA 5C3OA 2ZHKA 3A0KA 3VKLA 4RGAA 2H6CA 1UIKA 1LHNA 3PDQA 4H3WA 2FDHA 2K0GA 4QB1A 1V6KA 3M3QA 5K7PA 1SLIA 3AJYA 1KQRA 3GCXA 2FMYA 4CYDA 2HWB2 4QXBA 4MLOA 1AUYA 1L7RA 3K51A 5F37A 2GALA 1DG6A 1FV3A 4QGNA 3VHOA 1PMIA 1OUXA 1RUC2 1UPIA 5FPXA 2K46A 4QPIA 1NLQA 3GF6A 1V0AA 2TEPA 4B3NA 4WM8B 4PHZA 2EAAA 2EXKA 2W52A 1RUG1 2VGDA 4Q5OA 5JMCA 5F2SA 4BIFA 1PGW2 1PK6B 2QFEA 3I8TA 4AOCA 1W0PA 1Y3TA 1YFUA 1BLZA 3NNLA 2XVGA 1RUD2 3I54A 1O3RA 5FXVA 3POJA 5IUQA 4QB2A 3OBTA 2Q1ZB 3WG2A 1DBNA 4Z2AA 1AR82 1S0GA 4ORFA 4ZPIA 1F5JA 1QJU1 4Z8BA 1UY2A 4XAEA 1VR3A 4LOSA 3ZXLA 3DPRC 3EBRA 1NCRB 2JE8A 4YM3A 5IK8A 1GBGA 4G9SB 1LGNA 1YLLA 3WP3A 4LUMA 3P1IA 1AL21 4KBBA 1MVQA 4MH0E 2WLPA 2VW2A 1PO21 2OUJA 4PDWB 5K4LA 3AB0A 3AZWA 1VAKA 2D3PA 2G9GA 1LB2A 4PDWA 4Q26A 1XNDA 1O3TA 4LIVA 4D0QA 4BLIA 3ABZA 1LHOA 1QJZA 5FWJA 1EYBA 2BNOA 1MS4A 3NNMA 5LBCA 4D7TA 3RFRA 3N7JA 3TWIA 4DIQA 2QQPA 2HEWF 1VBA3 1I5ZA 1J84A 4OI2A 2A75A 2BV4A 1K3IA 1S55A 1H2LA 2R073 3ZYIB 5A6YA 4DY5A 4NIHA 1LOEA 1S1AA 4ES9A 3WUCA 2VU9A 4TN7A 4CEWA 3P3PA 3MV01 4P9LA 2JDHA 4A6SA 1OFNA 2ZMLA 1CX4A 2E26A 4M3CB 3T2TA 4O9EA 3UYJA 3AZZA 4Q4X3 4CCJA 5I93A 3MIDA 1QKQA 1W9WA 3KHCA 1OF3A 2RE9A 3K4ZA 5EPAA 1WLWA 1YFWA 2WO3A 1Z0HA 4B7EA 4E9KA 1EPWA 2LTNA 4MX3A 1EV12 4ZZ8A 1QHDA 4XDPA 1NLRA 4QHZA 2ZHNA 3C2UA 1ZREA 2JX9A 1SDWA 1AF9A 1DCSA 1IG0A 4FFFA 1OBNA 5FY9A 3JUUA 3LPGA 1G9DA 1AXKA 1Z78A 2BFUL 4UF0A 2HLEA 1D0HA 4NN0A 1NY71 3ZYPA 4IV1C 3D82A 1SHWB 3ZXJA 4QQPA 4V2VA 4AG4A 3MICA 2JG8A 2ZX3A 1C57A 1S0EA 4COYA 4B8EA 2HWC1 4RGKA 2BU9A 4IDZA 4FAGA 5LWBA 1HXS1 1RHI1 4CDXA 2HWD3 3JBG1 2VUDA 4RS5B 2E7AA 3AVRA 3RRDA 4NHMA 4MOAA 1MQTC 2ZMNA 1R1A3 1UMHA 1S0BA 4MXVA 3ZSJA 3DXUA 3E97A 2RDRA 4M3CE 3GXUA 2WFF2 2W95A 4K1YA 5APAA 3H3ZA 2GC3A 4K21A 2H0BA 1KS4A 1SLBA 3H1MA 4Q27A 5FZ0A 3N9MA 2ZEXA 1IKQA 2HEYF 4CDQB 4DXZA 2E31A 1AYN2 5CB7A 3BB6A 4TTGA 3WLUA 1KGYA 4LBJA 5FZ3A 3ZFGB 1GWKA 2A3YA 1ZBA2 3CDZB 2IWGB 1ZM1A 4JQTA 4A4AA 4Q29A 3UGFA 3P5BA 1JUHA 3LEGA 5LA9A 1RUNA 5H9SA 4YRDA 5FMBA 4EN9B 1UOBA 1HV0A 2JDKA 4LXLA 1LU1A 3POWA 1XYPA 3SC7X 4QAWA 3ZFGA 2ATFA 5BYNA 4ET7A 5T50A 4Q2FA 2ZEZA 4ZXKA 3BKZA 3A22A 3B7MA 1TZOA 1PGSA 1RUF3 4JX0A 5FYIA 2B5HA 5FZOA 2GNTA 5G05L 5FZIA 4BU2A 2A73B 4W50A 5AC92 5DAXA 3IBMA 3PUQA 1WA6X 1QOOA 3OEBA 1POV0 3I2OA 2X8KA 4HETA 1LU2A 5EZWA 3ZSLA 3BTYA 1R092 1WMFA 4QX0A 4E2QA 4YFZA 5LY1A 3T2PA 4NIAA 4YW7A 3I3MA 4WVMA 3A7QA 5F3EA 1G7YA 3PMEA 1UKRA 2Z69A 3WZ1A 2WWUA 2FZ1A 4S2FA 3LD8A 3QOPA 5C3PA 4JKMA 2IXCA 5JR2A 3BOWA 1JHJA 1X8MA 1RUD3 3LSEA 1UO9A 3QBQA 3VV1A 1NA1A 4HK8A 3T2QA 4XCBA 4JAAA 1GP4A 4UW6A 2CV6A 5CFCC 5K0UB 3IAPA 4AGVA 3IZOA 4H7MA 1OPOA 1AYM1 4UFKA 3MIEA 1BZWA 1UWWA 2D40A 1H1MA 2VR4A 1ULPA 4QQLA 1DLLA 2CGOA 4QGLA 1YC61 1LGCA 2ENRA 4WBBA 4QU2A 1DYOA 5FMOS 4W6YA 3POBA 5FP7A 3CU7A 4NJ4A 4AVCA 3ZPOA 5I0TA 1MZFA 5KHJA 1WKYA 1PM7A 3VBSA 5ACA3 1JBCA 4QDRA 4PJYA 3NAPB 2Y60A 1A8DA 1PVC2 1CPNA 2QQIA 3K77A 5FFOC 2IXLA 2A6ZA 4YSFA 1HIXA 4EN8B 5LA1A 4UFMA 3WXPA 1PMJX 2RM21 3MF6A 1AXYA 4AI9A 5FLJA 1I6XA 3NVCA 5J1XA 2RS52 4A7YA 1RJ7A 1GWLA 4WZFA 4RFT0 4EWEA 5LASA 1S0DA 2LROA 2UURA 3VBFB 3ZM8A 2LW8A 1YJLA 1J3PA 2VZSA 4YW6A 5FTTC 3AP6A 2FDKA 2EVXA 2P6HA 4IV1B 3GZUC 4N53A 3ZYGA 2XLFA 1NUKA 1F2NA 2KM2A 1YQ2A 3OGRA 3T1LA 1W6NA 2VTXA 5FP8A 1HLCA 3EO6A 1PO23 3RYKA 2WBKA 5FOBB 4Z1VA 3PL0A 4IGOA 4EZ4A 4UFHA 1QWRA 1GQGA 4I0WB 1NE4A 4AAPA 2W47A 3RG0A 2DUPA 1DF0A 3KLSA 3LDRA 4QKNA 1CAVB 4XZUG 3NV2A 4HT1T 1N3PA 3F95A 2PTMA 4YG6A 4YWAA 2OQ7A 4S2DA 1GNZA 2C6SA 3VL8A 3JB4C 1GYKA 2AACA 2P3KA 1US3A 2ZJCA 3KF3A 4JGZA 5CKQA 3I49A 1IG3A 4CUGA 5KXCA 4BJ0A 3V0AA 5C7GA 3M8LA 3H1WA 5FMDA 3N4MA 3NJVA 2NLRA 1U5IA 5GZEA 1NXD1 3IDAA 4YZ1A 4DRRA 4MV2A 4COZA 4MADA 4NPLA 5CZKA 2DV9A 4AF9A 4XOGA 5JPMB 2NPIA 3KT7A 1Z7S2 3KHBA 1K5MC 4NO4A 5FMCA 3LFMA 3MW3A 3MEPA 1PIV3 5GALA 2A3XA 2FBEA 2R32A 3IT8A 5DUUA 1L7QA 4WM7A 5HCAA 4CP0A 4L99A 2VMIA 4ZONA 1JH5A 1ZNPA 3ENRA 4IESA 4QPIB 2VW1A 3DPRB 5JZGC 3KV5A 1LEMA 4XILA 2AYHA 2WWJA 1YIFA 1ULGA 2ZCWA 5JOWA 1VB4A 1O6UA 5FQ0B 4GB33 4MGYE 4HPKA 2D93A 4RQPC 4LTAA 3I3QA 4LBMA 2GP5A 4XUTA 5FYSA 2XPJA 1W8NA 3I2KA 1KJRA 3DYPA 4Y1UA 4Q0SA 1AR62 1N1YA 1VBC3 4DXTA 3LB9A 4IE0A 3I59B 3NJYA 4Y1XA 2MEV2 3RYRA 1W2UA 1PGW1 1XXNA 1ND2C 3IM0A 5CFDC 4NWVA 4E8CA 2ARBA 4BB3A 4JRLA 2YZ4A 3PU8A 2W1WA 3DKWA 1PZ9A 1IS3A 1A3KA 1UZZA 3KCYA 1AR81 3WUDA 1ND2A 3ACFA 1CR7A 4NHXA 4YVSA 1NQDA 1STMA 3WF4A 2GN7A 1ENXA 3WF1A 2OUHA 2YPJA 2P2KA 2P17A 2WQZC 1O8SA 3KGLA 3PUAA 5FREA 3UGGA 5GZCA 5C9AB 1XE8A 4N43C 1GOGA 2H6BA 4LULA 2W5FA 1V6OA 3Q8CA 5CKMA 4Z92B 1F5FA 4PF5A 2PAMA 4AZZA 1CJDA 3BPZA 1URXA 3AXEA 3FUQA 2JDAA 5CG8A 2GDFA 2E7QA 5CYYA 3T0AA 1S0IA 1AL22 1YIPA 2ZGUA 4E2GA 4OI1A 3POFA 3AP9A 5E8AA 3K46A 1UNBA 1VBE1 2X09A 4CTEA 3CJXA 3IPVA 4ZS2A 4XBLA 3VBFC 2WN2A 1LNSA 2AR6A 2RS31 4MGQA 4M3CF 2Q8DA 3RJ2X 2D3RA 3FC0A 1BK1A 2WR9A 4RL7A 5IHRA 2E6VA 2D6KA 2VULA 4B4RA 3JU9A 3UKNA 3ZLIA 1ZRIA 5FYHA 2RS53 1EV11 4FPGA 5FBZA 1WD3A 3GDBA 4JGZC 1UXZA 2P3YA 3N9PA 2DBNA 1CAWA 3VKMA 2LRPA 4BPZA 3C7GA 3CKHA 3MW4A 2PFWA 5LA2A 3LEIA 2VQUA 4BQ4A 1JZ8A 1VBE3 1CWPA 1QJY1 2X05A 1OOPA 4CCDA 1OH4A 4R4XA 4PIYA 4JGYB 1LOBA 4GJYA 4HVQA 2Q8CA 3AP5A 4PCRA 4UAPA 5DQ0A 3CLPA 3CIHA 2C4XA 4INDA 5FY1A 4XACA 1WLCA 1UIJA 2R072 4AK3A 1HRV1 4IV3C 1JYWA 5ABJB 4LE4A 3B00A 2WFF1 3WNMA 1CZSA 2J1EA 3OJBA 1FATA 4YVSB 5FPBA 3WV6A 4JRAA 4XUNA 3KZ4C 1QGLA 4KU7A 4QDQA 5FP4A 2R1DA 1ENQA 1RUI3 3H8UA 2VBPA 3WR0A 4YVWB 4AWDA 5EXOA 4CDUB 2WN3A 1K5MB 2JKBA 4PLOA 1ODMA 1VE0A 1HXS2 1RHI2 4YLZA 5CA6A 3VD3A 1AX0A 4KG0A 1W6MA 1H0BA 3TN92 4AW7A 4C0BA 1P8JA 2FDJA 3I97A 3GBFA 1MEC1 1W2OA 3O0XA 1VAMA 1DQ6A 4XF1A 3ZYJB 2WNVC 4GMP3 1O4YA 4JGZB 1ND3A 1GNHA 3P6BA 4GD4A 1YWKA 3GZTB 5BNOB 4YM0A 3DL3A 4EV0A 3URFA 1PVXA 5JIUA 1S2KA 1W8TA 5EYXA 2ETEA 3WQ0A 3LOBA 1AJKA 4KMQA 1OMIA 4QMAA 3MLKA 2ZHMA 4KBZA 4CCEA 3D4KA 5IJRA 1CAUB 4R9AA 3LF7A 3K2OA 4FPEA 5H9QA 2VUAA 3BIWE 4GXLA 3S7EA 3ZYRA 3A21A 3NWKA 4UBGA 3SCHA 3KF5A 1DGWX 2VZOA 2CU5A 4RYDA 1YQ6A 2WQ8A 3ZFEC 3IIIA 1N3QA 4KNCA 3ZN6A 1UZVA 4OLLA 1QXRA 2DFCA 1OKOA 2Y0IA 3C7FA 4LEJA 3O1VA 2JG8C 2YBSA 4FPOB 1YRZA 4HKWA 2XVKA 2OT7A 2XJVA 5JVVA 5KHHA 4GZ9A 4Q4Y3 3ZPYA 2UY8A 5F2WA 3WP6A 5T54A 2OQ6A 1VBD3 1FAYA 2J1SA 1DZQA 3MBWA 3H3LA 4ZU7A 3VD9A 4CU8A 4META 5F6LB 4CP9A 2JIGA 5E1RA 3WNLA 1YO8A 3AMPA 1REEA 2QQOA 2PHFA 2WYSA 3Q8AA 2Y6HA 4I01A 2JB8A 1TME1 1TMF3 1RUOA 3LGRA 4PIZA 5K9YA 2Z4FA 4P5HA 1PIV1 2W08A 1LHVA 3NW4A 2O14A 1FPN3 1LCLA 1RUG3 2R6QA 2RMU2 3H0OA 4XF4A 4XFCA 5EIYB 3L9JT 3OBZA 5LEJA 3MF9A 5BNPA 1I9RA 5BNOA 2ZGTA 2PAEA 3SLIA 2FZ2A 1DFQA 3WDXA 2VMEA 3VHPA 4K7JA 3L2YA 2ZZJA 4FXKB 4LO4B 2DTYA 2R16A 1UU4A 2BERA 4ZY9A 2J1TA 2C9AA 3JQWA 1KITA 4IEZA 4OZOA 5KXBA 3MIFA 3AK0A 5C33A 2P3JA 4DOUA 3M3OA 5FYYA 5K0UA 4XQDA 2WNOA 4PI2A 4IGQA 3T08A 1JOPA 4OZXA 2ZGKA 2XONA 3H8OA 5GLZA 3H8XA 4QXCA 2JDPA 1O91A 2HYXA 3P3NA 4IGPA 3FX3A 3SQOA 4D3WA 2FDGA 4GH4B 2IXKA 2SLIA 4I0AA 2B7YA 1BEV2 4NHKA 3VD5A 2IXIA 3NV1A 2C24A 1BBT3 2RR12 3WNKA 1MQTA 3PUSA 3VD4A 3AYAA 2WO7A 4LPLA 4AI8A 3ILRA 1RUJ2 3U07A 3HNMA 1T6GC 4DEVA 2R7EB 3FL7A 3K3OA 5BNQA 3AP4A 2PMWB 3K4AA 1W05A 3HAGA 3LA3A 4HVRA 4Q4W3 2YY1A 1VJ2A 1UOGA 3PIJA 2Z5WA 4Q8KA 1W6QA 4BYYA 1KFXL 1W8HA 3CJIA 4QPIC 4ISRA 3HN3A 3VKFC 3ZFFA 2EA7A 1KFUL 2ZA9A 3CEWA 2RV9A 4E4ZA 2A71A 2HBTA 1R081 1WBLA 1RMU3 2ZMKA 3JBG2 2YU1A 3POYA 4NMIA 4LIUA 4FXGB 2ZGOA 3N7KA 4P14A 3CJIB 5DUXA 2P6CA 4F3JA 4NAOA 2D6NA 4J1XA 3IB3A 4FOVA 4QM9A 1OD5A 1C8M2 4AQTA 1UW8A 2GC1A 4ZU5A 1ND2B 3AC0A 2BRTA 2V72A 4AYUA 5JOXA 2IVIB 4J25A 1AR63 2VNVA 4O61A 4YFWA 1IPSA 4PLNA 5DAWA 2UU8A 5CNAA 5F32A 3SXWA 3O1TA 2N7GA 5SV5A 1OKQA 2WYFA 3WX5A 1IHMA 3EYPA 1ZVFA 4EN7B 2VZ3A 2CDOA 2Y26A 4BA6A 4FTBA 1QXPA 2VPVA 1RGSA 3R4DB 4GH4A 5FXWA 1W39A 4D7YA 1Y43B 4CSWA 2XH6A 3JD72 4MXWB 4UBHA 1X82A 5I8TA 2ORZA 1QJY3 4RR3A 4G4FA 1DGRA 1OQEA 2A3WA 1UZYA 4NPMA 4I09A 3PMSA 1PO11 1QNWA 1X7NA 3GHNA 3LSDA 4GB31 4RN5A 3KD4A 4WM7B 5FYUA 4QXHA 2OW4A 2JG8B 4BLJA 2E9QA 3B69A 4OUMA 1NYWA 4W6XA 4XHXA 1GZ9A 2MEV1 3EB7A 5FPLA 4N43A 2Q8OA 1VBC1 4UF0B 3UKTA 1JZ4A 2LS6A 2XMLA 2HWF3 1AXZA 4CP9B 3R0RA 3AJZA 1NT0A 2Q0AA 1RVF3 1UL9A 3WW2A 5A3OA 1RL3A 3J7LA 2I45A 4WZCA 5FZGA 2C0ZA 3OUIA 4OHWA 1D2QA 2IFWA 3OPTA 4CCLA 4D69A 4NIDA 3J8F2 3HPNA 3LE0A 4Q4X1 3NKTA 2VW0A 1U5ZA 3OGJA 1SFPA 2VL4A 4XUQA 5E89A 4CU7A 5L7OC 1FMD3 4MYEA 3ZDVA 5FQ0A 3CNAA 5K8SA 3HR9A 4XXAA 1TNFA 1LEDA
chains in the Genus database with same CATH topology
2QQNA 3LEGA 4CU9A 3CMGA 3D3AA 3SEEA 3T2OA 1H6XA 1I5PA 2XOMA 4QDSA 4QAWA 4ARXA 2VMDA 4ET7A 1CIYA 3OGVA 1GOHA 1JZ7A 2ZEZA 3A22A 3F2ZA 3W5NA 2J7MA 4JX0A 3ETPA 5G05L 1NX9A 4BK5A 3PUHA 2VZPA 2BBAA 4W50A 5HPOA 4HG6B 4CUBA 3OEBA 2QQJA 2VC9A 1GOFA 4QX0A 2W91A 4LHSA 3T2PA 4JHZA 2V5DA 1J83A 5B4XA 3LEKA 1SPPA 3HNYM 3A7QA 2VCCA 5JUVA 2J1RA 2KD7A 1TG7A 3NRUA 3WNNA 1HN1A 4JKMA 5JR2A 1JHJA 2OKXA 4DUWA 1RYYA 4KWUA 3T2QA 1JYNA 4A41A 3IAPA 3BGAA 1UWWA 2VR4A 1ULPA 2RJ2A 2ZEWA 1W99A 4ZXEA 1DYOA 3POBA 4PT6A 1WKYA 3NJXA 4DXRA 4QDRA 1K12A 2QQIA 3K77A 4CUCA 4A3ZA 3OG2A 4PF1A 3I2GA 4JKKA 5LA1A 4BXSV 1PMJX 3ACHA 3T0DA 3C8XA 1DLCA 1W9SA 4MGSA 1ULOA 5J1XA 2X10A 3LPFA 2QQMA 2EIEA 3ZM8A 2LW8A 5JMOA 1UX7A 5A1AA 2VZSA 3OB8A 1UY4A 1W0NA 2RVAA 1K42A 3KQ4B 1NUKA 1YQ2A 3OGRA 1CZVA 1EUTA 4XUPA 1OT5A 1CZTA 1R64A 2WBKA 1O8PA 1DP0A 2YFZA 3C7EA 1K45A 2BZDA 4P00B 4D8MA 3GM8A 4A44A 1EUUA 1NKGA 1OF4A 5I0DA 4W8JA 3THCA 2W47A 2Y6KA 3WF2A 2CDPA 2C9KA 1GU3A 4XZUG 2WAOA 5C71A 1F4HA 4QPWA 1UYYA 3I3EA 5JXHA 1UXXX 4LOTA 1US3A 5CKQA 3VDCA 4BJ0A 2WO2A 5C7GA 2ORXA 5G04L 3NJVA 4L0PA 3DECA 3IDAA 3MUZ1 3I3DA 4MADA 4TXWA 5CZKA 3I2IA 3ECQA 1BHGA 4DUXA 1JI6A 2B4KA 3T09A 3WSOA 1L7QA 2W94A 5EJ1B 3W5MA 1SZBA 4FI9A 2V4VA 1UYXA 3ACIA 4ARYA 4A4AA 2L9LA 3C7HA 3CZUA 2WZ8A 1JYXA 5C70A 3ACGA 4XUTA 1NZIA 1W8NA 3I2KA 3DYPA 4CUAA 4DXTA 3FHAA 4E8DA 2E32A 1US2A 4XURA 3VDAA 2W1QA 3HJRA 4E8CA 2ID4A 4MO3M 2W1WA 2VTFA 1KEXA 3ACFA 3WF4A 1SG3A 2DCJA 3WF1A 2YG0A 1O8SA 2QQLA 3WNPA 2J22A 3HOBA 3IAQA 4QX1A 1GOGA 2W5FA 5CKMA 3K75B 2XHNA 3GGLA 2DCKA 2W92A 2JDAA 4A42A 3WNOA 5CYYA 3T0AA 2WUHA 4GWJA 4IUGA 3POEA 2VM9A 2EIDA 3POFA 3UNPA 1JZ6A 3PUIA 3K46A 2X09A 5DPNA 5JXGA 2VMCA 2WN2A 1LNSA 3DEMA 4P5YA 4MGQA 1GNYA 2Y6JA 4P08A 5IHRA 1UYZA 1NAEA 3HEIA 4QX3A 5CKNA 4PQQA 2W3JA 4XUOA 3GDBA 1JU3A 1UXZA 2VZRA 3T0BA 2E33A 2VJXA 3C7GA 3CKHA 2ZXQA 2JKXA 3THDA 2WZEA 1JU4A 5LA2A 3LEIA 2VQUA 1JZ8A 3A23A 2Y8KA 2X05A 1OH4A 2J1VA 1XNAA 1IQDC 2PQSA 3WF3A 4UAPA 5DQ0A 3C7OA 3CIHA 2C4XA 3I2HA 1W9TA 2DDUA 3SKVA 5JXIA 4OYUA 1JYWA 1T2XA 2W46A 2VMFA 3WEZA 3WNMA 4LKSA 1CZSA 2J1EA 3U37A 2J1UA 4XUNA 1UY1A 1GUIA 3E1F1 1OD3A 4QDQA 4OMCA 4LMFA 4LORA 2WN3A 4A45A 4XVHA 1JYVA 2Y6LA 3VD3A 3VD7A 1P8JA 3I97A 5IFTA 1XNTA 2BGOA 4BDVB 3P6BA 5IFPA 5LCWL 3JXSA 3MV11 1WCQA 3OEAA 4DXSA 4CVUA 1GMMA 4KMQA 3NNGA 3NQHA 4OMDA 3OGSA 5JXJA 5IJRA 4QB6A 1MPXA 1PMHX 4UOJA 4A6OA 2VCAA 3POGA 1PX4A 4QX2A 1SPPB 3A21A 4YPJA 2VZOA 4RYDA 2WABA 3VDBA 2WQ8A 3IIIA 1JZ3A 2C26A 2VCBA 3C7FA 2QBXA 1XC6A 3K4DA 4GZ9A 3DYMA 3I3BA 2J1SA 3MBWA 2VO5A 5FUIA 3WF0A 2B9VA 3VD9A 1XPWA 4CU8A 3BN6A 3WNLA 2QQOA 2WYSA 2Y6HA 3WQBA 1W8OA 2WO1A 2Z4FA 4DEQA 2VQTA 2YB7A 1H6YA 3J7HA 3CQOA 5EIYB 1GQPA 2VOTA 4QB1A 2VMEA 4M4PA 1L7RA 2BERA 2W1SA 4ZY9A 4CU6A 2J1TA 4OUEA 4OZOA 1UY3A 1F4AA 2WNOA 1SDDB 1O59A 3T08A 2XONA 4KI5M 2HYXA 1UMIA 3I2FA 3POJA 4QB2A 3VD5A 4Z2AA 2J1AA 2YC2A 3WNKA 1UY2A 4LOSA 2JE8A 3VD4A 2VZVA 2VZQA 4LPLA 4JKLA 3P1IA 4AAXA 3HNMA 4DEVA 2W87A 2R7EB 3FL7A 3K4AA 2VZTA 4D0QA 3ABZA 2VZ1A 2YC4A 3HN3A 2RV9A 4DUVA 4GWIA 3SKJE 3CZJA 2Y6GA 1J84A 1K3IA 2EIBA 3DYOA 3IB3A 3MV01 3POIA 4UI9L 2E26A 2JD9A 3MUY1 3LQCA 3UESA 3AC0A 2V72A 2W1UA 4W4ZA 2QQKA 5IYYA 5B4NA 1W9WA 1OF3A 1D7PM 3K4ZA 2WO3A 1PX3A 3EYPA 4BK4A 1UY0A 2VZ3A 4ZZ8A 1JZ5A 1CX1A 2CDOA 5LA0A 3FHQA 5HXMA 3LPGA 5DN2A 2BGPA 2HLEA 2ORZA 1UZ0A 3HNBM 3I2JA 3UETA 1SHWB 2WDBA 3SEPA 4P02B 4ZZ5A 4AG4A 1JZ2A 5EJZB 2XQXA 4RN5A 4M4RA 3MO4A 2VZUA 2WAAA 3EB7A 5DMYA 4MOAA 1UMHA 3OBAA 1JZ4A 2LS6A 2YFUA 2ZEYA 5F7UA 3GXUA 2W95A 2W9XA 1NT0A 1TVGA 3FN9A 3HPNA 3LE0A 2ZEXA 2VL4A 4LQRA 4XUQA 4CU7A 1SFPA 2E31A 4TTGA 1KGYA 2EICA 3CDZB 2Y64A 5CISA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QQN A;  3LEG A;  4CU9 A;  3CMG A;  3D3A A;  3SEE A;  3T2O A;  1H6X A;  1I5P A;  2XOM A;  4QDS A;  4QAW A;  4ARX A;  2VMD A;  4ET7 A;  1CIY A;  3OGV A;  1GOH A;  1JZ7 A;  2ZEZ A;  3A22 A;  3F2Z A;  3W5N A;  2J7M A;  4JX0 A;  3ETP A;  5G05 L;  1NX9 A;  4BK5 A;  3PUH A;  2VZP A;  2BBA A;  4W50 A;  5HPO A;  4HG6 B;  4CUB A;  3OEB A;  2QQJ A;  2VC9 A;  1GOF A;  4QX0 A;  2W91 A;  4LHS A;  3T2P A;  4JHZ A;  2V5D A;  1J83 A;  5B4X A;  3LEK A;  1SPP A;  3HNY M;  3A7Q A;  2VCC A;  5JUV A;  2J1R A;  2KD7 A;  1TG7 A;  3NRU A;  3WNN A;  1HN1 A;  4JKM A;  5JR2 A;  1JHJ A;  2OKX A;  4DUW A;  1RYY A;  4KWU A;  3T2Q A;  1JYN A;  4A41 A;  3IAP A;  3BGA A;  1UWW A;  2VR4 A;  1ULP A;  2RJ2 A;  2ZEW A;  1W99 A;  4ZXE A;  1DYO A;  3POB A;  4PT6 A;  1WKY A;  3NJX A;  4DXR A;  4QDR A;  1K12 A;  2QQI A;  3K77 A;  4CUC A;  4A3Z A;  3OG2 A;  4PF1 A;  3I2G A;  4JKK A;  5LA1 A;  4BXS V;  1PMJ X;  3ACH A;  3T0D A;  3C8X A;  1DLC A;  1W9S A;  4MGS A;  1ULO A;  5J1X A;  2X10 A;  3LPF A;  2QQM A;  2EIE A;  3ZM8 A;  2LW8 A;  5JMO A;  1UX7 A;  5A1A A;  2VZS A;  3OB8 A;  1UY4 A;  1W0N A;  2RVA A;  1K42 A;  3KQ4 B;  1NUK A;  1YQ2 A;  3OGR A;  1CZV A;  1EUT A;  4XUP A;  1OT5 A;  1CZT A;  1R64 A;  2WBK A;  1O8P A;  1DP0 A;  2YFZ A;  3C7E A;  1K45 A;  2BZD A;  4P00 B;  4D8M A;  3GM8 A;  4A44 A;  1EUU A;  1NKG A;  1OF4 A;  5I0D A;  4W8J A;  3THC A;  2W47 A;  2Y6K A;  3WF2 A;  2CDP A;  2C9K A;  1GU3 A;  4XZU G;  2WAO A;  5C71 A;  1F4H A;  4QPW A;  1UYY A;  3I3E A;  5JXH A;  1UXX X;  4LOT A;  1US3 A;  5CKQ A;  3VDC A;  4BJ0 A;  2WO2 A;  5C7G A;  2ORX A;  5G04 L;  3NJV A;  4L0P A;  3DEC A;  3IDA A;  3MUZ 1;  3I3D A;  4MAD A;  4TXW A;  5CZK A;  3I2I A;  3ECQ A;  1BHG A;  4DUX A;  1JI6 A;  2B4K A;  3T09 A;  3WSO A;  1L7Q A;  2W94 A;  5EJ1 B;  3W5M A;  1SZB A;  4FI9 A;  2V4V A;  1UYX A;  3ACI A;  4ARY A;  4A4A A;  2L9L A;  3C7H A;  3CZU A;  2WZ8 A;  1JYX A;  5C70 A;  3ACG A;  4XUT A;  1NZI A;  1W8N A;  3I2K A;  3DYP A;  4CUA A;  4DXT A;  3FHA A;  4E8D A;  2E32 A;  1US2 A;  4XUR A;  3VDA A;  2W1Q A;  3HJR A;  4E8C A;  2ID4 A;  4MO3 M;  2W1W A;  2VTF A;  1KEX A;  3ACF A;  3WF4 A;  1SG3 A;  2DCJ A;  3WF1 A;  2YG0 A;  1O8S A;  2QQL A;  3WNP A;  2J22 A;  3HOB A;  3IAQ A;  4QX1 A;  1GOG A;  2W5F A;  5CKM A;  3K75 B;  2XHN A;  3GGL A;  2DCK A;  2W92 A;  2JDA A;  4A42 A;  3WNO A;  5CYY A;  3T0A A;  2WUH A;  4GWJ A;  4IUG A;  3POE A;  2VM9 A;  2EID A;  3POF A;  3UNP A;  1JZ6 A;  3PUI A;  3K46 A;  2X09 A;  5DPN A;  5JXG A;  2VMC A;  2WN2 A;  1LNS A;  3DEM A;  4P5Y A;  4MGQ A;  1GNY A;  2Y6J A;  4P08 A;  5IHR A;  1UYZ A;  1NAE A;  3HEI A;  4QX3 A;  5CKN A;  4PQQ A;  2W3J A;  4XUO A;  3GDB A;  1JU3 A;  1UXZ A;  2VZR A;  3T0B A;  2E33 A;  2VJX A;  3C7G A;  3CKH A;  2ZXQ A;  2JKX A;  3THD A;  2WZE A;  1JU4 A;  5LA2 A;  3LEI A;  2VQU A;  1JZ8 A;  3A23 A;  2Y8K A;  2X05 A;  1OH4 A;  2J1V A;  1XNA A;  1IQD C;  2PQS A;  3WF3 A;  4UAP A;  5DQ0 A;  3C7O A;  3CIH A;  2C4X A;  3I2H A;  1W9T A;  2DDU A;  3SKV A;  5JXI A;  4OYU A;  1JYW A;  1T2X A;  2W46 A;  2VMF A;  3WEZ A;  3WNM A;  4LKS A;  1CZS A;  2J1E A;  3U37 A;  2J1U A;  4XUN A;  1UY1 A;  1GUI A;  3E1F 1;  1OD3 A;  4QDQ A;  4OMC A;  4LMF A;  4LOR A;  2WN3 A;  4A45 A;  4XVH A;  1JYV A;  2Y6L A;  3VD3 A;  3VD7 A;  1P8J A;  3I97 A;  5IFT A;  1XNT A;  2BGO A;  4BDV B;  3P6B A;  5IFP A;  5LCW L;  3JXS A;  3MV1 1;  1WCQ A;  3OEA A;  4DXS A;  4CVU A;  1GMM A;  4KMQ A;  3NNG A;  3NQH A;  4OMD A;  3OGS A;  5JXJ A;  5IJR A;  4QB6 A;  1MPX A;  1PMH X;  4UOJ A;  4A6O A;  2VCA A;  3POG A;  1PX4 A;  4QX2 A;  1SPP B;  3A21 A;  4YPJ A;  2VZO A;  4RYD A;  2WAB A;  3VDB A;  2WQ8 A;  3III A;  1JZ3 A;  2C26 A;  2VCB A;  3C7F A;  2QBX A;  1XC6 A;  3K4D A;  4GZ9 A;  3DYM A;  3I3B A;  2J1S A;  3MBW A;  2VO5 A;  5FUI A;  3WF0 A;  2B9V A;  3VD9 A;  1XPW A;  4CU8 A;  3BN6 A;  3WNL A;  2QQO A;  2WYS A;  2Y6H A;  3WQB A;  1W8O A;  2WO1 A;  2Z4F A;  4DEQ A;  2VQT A;  2YB7 A;  1H6Y A;  3J7H A;  3CQO A;  5EIY B;  1GQP A;  2VOT A;  4QB1 A;  2VME A;  4M4P A;  1L7R A;  2BER A;  2W1S A;  4ZY9 A;  4CU6 A;  2J1T A;  4OUE A;  4OZO A;  1UY3 A;  1F4A A;  2WNO A;  1SDD B;  1O59 A;  3T08 A;  2XON A;  4KI5 M;  2HYX A;  1UMI A;  3I2F A;  3POJ A;  4QB2 A;  3VD5 A;  4Z2A A;  2J1A A;  2YC2 A;  3WNK A;  1UY2 A;  4LOS A;  2JE8 A;  3VD4 A;  2VZV A;  2VZQ A;  4LPL A;  4JKL A;  3P1I A;  4AAX A;  3HNM A;  4DEV A;  2W87 A;  2R7E B;  3FL7 A;  3K4A A;  2VZT A;  4D0Q A;  3ABZ A;  2VZ1 A;  2YC4 A;  3HN3 A;  2RV9 A;  4DUV A;  4GWI A;  3SKJ E;  3CZJ A;  2Y6G A;  1J84 A;  1K3I A;  2EIB A;  3DYO A;  3IB3 A;  3MV0 1;  3POI A;  4UI9 L;  2E26 A;  2JD9 A;  3MUY 1;  3LQC A;  3UES A;  3AC0 A;  2V72 A;  2W1U A;  4W4Z A;  2QQK A;  5IYY A;  5B4N A;  1W9W A;  1OF3 A;  1D7P M;  3K4Z A;  2WO3 A;  1PX3 A;  3EYP A;  4BK4 A;  1UY0 A;  2VZ3 A;  4ZZ8 A;  1JZ5 A;  1CX1 A;  2CDO A;  5LA0 A;  3FHQ A;  5HXM A;  3LPG A;  5DN2 A;  2BGP A;  2HLE A;  2ORZ A;  1UZ0 A;  3HNB M;  3I2J A;  3UET A;  1SHW B;  2WDB A;  3SEP A;  4P02 B;  4ZZ5 A;  4AG4 A;  1JZ2 A;  5EJZ B;  2XQX A;  4RN5 A;  4M4R A;  3MO4 A;  2VZU A;  2WAA A;  3EB7 A;  5DMY A;  4MOA A;  1UMH A;  3OBA A;  1JZ4 A;  2LS6 A;  2YFU A;  2ZEY A;  5F7U A;  3GXU A;  2W95 A;  2W9X A;  1NT0 A;  1TVG A;  3FN9 A;  3HPN A;  3LE0 A;  2ZEX A;  2VL4 A;  4LQR A;  4XUQ A;  4CU7 A;  1SFP A;  2E31 A;  4TTG A;  1KGY A;  2EIC A;  3CDZ B;  2Y64 A;  5CIS A; 
#chains in the Genus database with same CATH topology
 2QQN A;  4QPY A;  2WS9 2;  5E88 A;  2HWE 3;  2TNF A;  3NV4 A;  4CZS A;  3FLP A;  1EY2 A;  2XOM A;  4QDS A;  4FFG A;  5HBA A;  3OF1 A;  3M1H A;  5IVE A;  4AI2 A;  3WD5 A;  1JZ7 A;  1ZA4 A;  2QZ2 A;  1VRH 3;  2WNU C;  2JEN A;  4EWA A;  5FZF A;  3USU A;  3BIE A;  1HXS 3;  1RHI 3;  1W9F A;  1H8T A;  2VUC A;  2VZP A;  3KGZ A;  3PUH A;  4YGD A;  3VLB B;  5JZG A;  3GAL A;  2HWB 3;  1YJK A;  4QPG C;  2X29 A;  1W3X A;  1COV 1;  3A0N A;  4FPH A;  3NST A;  5FYV A;  1VBE 2;  2WIN B;  2UYA A;  3SIS A;  1PVC 1;  2WII B;  4ERO A;  4L2N A;  3VDD C;  1H1A A;  1UOF A;  2JE9 A;  5HI0 A;  1J83 A;  3PTR B;  3LEK A;  4FFI A;  3WCR A;  1K5M A;  2DVB A;  3HNY M;  4XJ8 A;  4Y1Y A;  3RZM A;  4LO6 B;  5FPV A;  3U78 A;  2DF7 A;  3OYW B;  1IS6 A;  5LRR A;  4AVA A;  2Y6F A;  2J1R A;  2VOW A;  5L7O B;  3VBU C;  3WQ1 A;  1ASJ 2;  4CDU C;  2R04 3;  4I30 A;  4NWW A;  4XTM A;  1NE6 A;  2VAU A;  4SBV A;  1SLL A;  1TME 3;  1TMF 1;  1OA2 A;  3KT4 A;  5FLI A;  3RZK A;  1Y9Q A;  2UWC A;  1QMJ A;  1AX2 A;  3WW1 A;  4OHX A;  5DDJ 3;  2JDY A;  1XOY A;  1UYP A;  4FBF A;  4LBK A;  1W3V A;  5A6X A;  1REF A;  2CHH A;  1W6M B;  3ZX7 A;  2NN8 A;  1AL0 G;  3TN9 3;  4H7L A;  4CXX A;  4TZD A;  2YBK A;  1W99 A;  3PVE A;  3RJR A;  2JIJ A;  1ND3 B;  2O0O A;  1CIW A;  2O1Q A;  5A7N A;  4PT6 A;  1LRH A;  3B94 A;  3NJX A;  5DG2 A;  1XYO A;  3RMX A;  4DXR A;  3HBZ A;  4IEU A;  3CJI C;  1D0G A;  5D8A A;  4N8M A;  4AHY A;  1V9U 3;  4GAZ A;  4BM8 A;  1K12 A;  5AVP A;  4CUC A;  4A3Z A;  4B1L A;  4YVW A;  3HIF A;  4A7K A;  3BUC A;  3UJQ A;  3AMH A;  5DDJ 1;  2UWA A;  4NRO A;  4N53 C;  3TEW A;  3KT1 A;  3H1Y A;  2FMD A;  3ACH A;  2RS1 3;  4NAM A;  3RS6 A;  2XJQ A;  3WDT A;  4C90 A;  3T0D A;  2GH8 A;  1DLC A;  3BTA A;  2QJV A;  1NA1 B;  2RDN A;  4FOY A;  3SH5 A;  3TN9 1;  4Q4V 1;  5F3C A;  1SBF A;  2ZOE B;  5J98 B;  2CWS A;  2XXZ A;  2DUQ A;  1JN2 P;  3AKP A;  2UWB A;  1HRV 2;  3RZZ A;  4CP2 A;  3LPF A;  1ST8 A;  1ZZ8 A;  1DZR A;  2Z42 A;  4AXO A;  3RZL A;  3FLT A;  2XDV A;  4JGY A;  2BYV E;  5DAV A;  1CVN A;  1SCS A;  1LOA A;  2Y0O A;  4JQR A;  3VBR B;  5ABJ C;  3VL9 A;  3KQ4 B;  2D97 A;  2VXJ A;  4N90 A;  1VBD 2;  3VHN A;  4RS5 C;  2A6X A;  2XWJ B;  4XTP A;  3FMG A;  4XUP A;  1CZT A;  3C7E A;  5L9B A;  5JOY A;  1HKD A;  2YFZ A;  5JLV A;  4P00 B;  1FNZ A;  3GM8 A;  5FZL A;  1QQP 2;  5LEK A;  5I0D A;  1NKG A;  4W8J A;  1ZZ9 A;  4J6G A;  3E6C C;  2Y6K A;  3WF2 A;  5ANN A;  4IE5 A;  3RI9 A;  5FYZ A;  4AHZ A;  2W39 A;  1B35 B;  4IEW A;  4PIX A;  1F4H A;  4QPW A;  5FO8 B;  5IT6 A;  2WNV B;  2YDE A;  2CTV A;  3VB9 A;  2RJK A;  5BNO C;  3WY6 A;  1RMU 1;  1ALY A;  3ZFF B;  4IE4 A;  4XYX A;  4CDQ A;  2WO2 A;  2ZX0 A;  4CCM A;  2OZJ A;  4LKD A;  5G04 L;  1NA1 C;  4Q4Y 1;  4A7Z A;  1KS5 A;  5FYT A;  3VBO C;  5A6Z A;  3AMQ A;  3DEC A;  3AVS A;  1G9B A;  2WSU A;  2ERF A;  2VUJ A;  3I3D A;  3OUJ A;  3M3I A;  1G9F A;  4X8N A;  2JG9 B;  4AQ6 A;  4LBQ D;  5M0T A;  1W6O A;  5DUW A;  3LIH A;  3ECQ A;  2QKD A;  3I59 A;  3MPB A;  4PBP A;  2ZAC A;  1ZBE 1;  5FJK A;  1JI6 A;  1VBA 1;  2B4K A;  4L8Q A;  3T09 A;  2QDN A;  4IEQ A;  5C9A C;  4S2G A;  2DVD A;  4XIO A;  2D6O X;  4Q1R A;  5F5Q A;  2HWE 2;  4FI9 A;  4LO8 A;  1ULC A;  1WCD J;  2V4V A;  4P9W A;  1HB2 A;  4HKO A;  1W2T A;  1CJP A;  2A7A A;  1G9C A;  4OFG A;  4Q0V A;  2AUY A;  1W8U A;  4ASL A;  4MUV A;  2WZ8 A;  4XXP A;  1GR3 A;  3ACG A;  1WW5 A;  1PNG A;  1QDO A;  2OPK A;  4GIQ A;  1ZBE 3;  4Z07 A;  4Y5Z 0;  5J36 A;  1CD3 G;  2VOX A;  4AEJ A;  3KCC A;  2E32 A;  3K48 A;  5A7O A;  5HCF A;  1QH6 A;  5EYY A;  2A1X A;  2WZP P;  2NMN A;  4Z82 A;  1RUE 1;  1BK0 A;  3VGI A;  4FAH A;  4YZ2 A;  4M3C A;  2P3I A;  2ES3 A;  2XKO A;  4FO9 A;  4GA9 A;  4UXA A;  2JDZ A;  4X6Q B;  2VBB A;  1QU0 A;  2JG9 C;  2G9Z A;  2FCT A;  3BVC A;  3JD7 3;  1XSQ A;  2GC0 A;  4Q4W 1;  5IWF A;  3SH4 A;  2RS3 2;  1N47 A;  5ANQ A;  2BFU S;  2BQP A;  2XLG A;  4XE9 A;  5FY4 A;  3U11 A;  3ZXE A;  3ZXA C;  5CAZ A;  5CFD B;  1NXM A;  4UWD A;  1SG3 A;  1CAU A;  2XJP A;  4WM8 C;  1A34 A;  1ENR A;  4X6R B;  2OYZ A;  2YG0 A;  5FP3 A;  2JDN A;  2WZR 1;  1IS5 A;  3E6D A;  2J22 A;  1XU2 A;  2ZAA A;  4QX1 A;  3MPP G;  3MDP A;  1C3H A;  5A6Q A;  3ITQ A;  3AP7 A;  3WCS A;  2XHN A;  3PNA A;  2BJS A;  2DBI A;  3GGL A;  5LB6 A;  4P9Y A;  4IV3 A;  5FYB A;  4A42 A;  4N7I A;  3N9O A;  1RUC 3;  4YW1 A;  2WLQ A;  4ATE A;  2DVF A;  1UMZ A;  1YI7 A;  1NCR C;  2DU1 A;  1IS4 A;  3B01 A;  5FO7 B;  4DQA A;  4F7Z A;  3POE A;  4OVE A;  5T5O A;  4RGG A;  4CPB A;  2D6P A;  2X5I C;  1PVC 3;  1JZ6 A;  5DPN A;  3ZYH A;  2VMC A;  4P5Y A;  1GNY A;  1WCU A;  3PLQ A;  3VBH A;  1UYZ A;  1VP6 A;  1D4M 1;  1CN1 A;  1ODN A;  1DGW A;  4B1M A;  3ZXG A;  3N7L A;  4XUO A;  4LK6 A;  2HWF 2;  5CG9 A;  1N1S A;  1JU3 A;  2HWD 1;  1COV 3;  3HMY A;  3PHM A;  4CEW C;  2WFF 3;  3T0B A;  1Q8V A;  4CDU A;  5IW0 A;  1AJO A;  2PN5 A;  1OH3 A;  5DZE A;  2VJX A;  1DQ0 A;  5FY5 A;  2ZXQ A;  3M7A A;  3VBF A;  1J59 A;  3WW3 A;  2GAU A;  3AMM A;  5J37 A;  3TRS B;  2FDF A;  2RDS A;  3EMR A;  1EPZ A;  2RJL A;  2C5D A;  1FMD 2;  1XNA A;  4YZ4 A;  4RD7 A;  1IQD C;  3LOI A;  4TLG A;  1C1L A;  3JB8 A;  4XC9 A;  5IVF A;  1HX6 A;  2HWC 3;  5ACA 1;  1RED A;  5C5T A;  1W0O A;  5FR3 A;  2YRO A;  4LKF A;  1LR5 A;  4QPG A;  1GQH A;  3VBO B;  2AC1 A;  3ASI A;  2PQQ A;  3DXT A;  2WT2 A;  3ZR5 A;  5J7M A;  4XFB A;  4JGY C;  3U37 A;  2J1U A;  2R06 2;  3ZXF A;  4B4P A;  4BIO A;  3E1F 1;  4LO7 A;  5FZ6 A;  2VCM A;  4NRM A;  1PO1 2;  1JW6 A;  1QXJ A;  1NCQ B;  5KHK A;  2VNO A;  3J8F 1;  4FPL A;  3JCI A;  3OUH A;  4H2A A;  4Q4X 2;  4XVH A;  5DG1 A;  2PHR A;  1O4T A;  5F5A A;  2Y6L A;  1RUH 3;  2GSY A;  1QOT A;  2A6W A;  1VRH 1;  4GWN A;  4AVB A;  5IFT A;  3O14 A;  5GLT A;  5IFP A;  5LCW L;  1DQ2 A;  3JXS A;  1E5S A;  3OEA A;  4CVU A;  2ET1 A;  4KWK A;  5LBB A;  4RQP B;  5L19 A;  2CNA A;  4XIK A;  1J3R A;  3NNG A;  2Q8E A;  3NQH A;  4OMD A;  1PIV 2;  3OGS A;  4XJZ A;  4FPJ A;  5JXJ A;  3DUI A;  1MPX A;  2VOK A;  4JDN A;  4QWN A;  4Y4R A;  1LAJ A;  3NV3 A;  2RMU 1;  5FK7 A;  4A6O A;  2R04 2;  3GNE A;  3POG A;  1PX4 A;  2CAU A;  4P9J A;  4R9B A;  3TNP B;  2DVG A;  1MZ6 A;  1N1T A;  2WS9 1;  4XET A;  5A80 A;  3VDB A;  4HAN A;  4M0N A;  2PHD A;  2C26 A;  1MS0 A;  4N9I A;  3GBG A;  1TQ5 A;  2W0X A;  4BQ1 A;  1UCX A;  3E6B A;  3MLL A;  4NII A;  5KHI A;  1HQL A;  3SCF A;  2YGL A;  1Q3E A;  1XC6 A;  4XF9 A;  2BDR A;  5C8C C;  3WNX A;  3CBN A;  2YUE A;  1X36 A;  3ES1 A;  4YYO A;  1J1L A;  4LBQ A;  3QCW A;  2DWR A;  1W8F A;  4YW3 A;  3UGH A;  1GP6 A;  2V09 A;  4L97 A;  4IEP A;  4AR2 A;  4QQH A;  5JI9 A;  2P5B A;  2VO5 A;  1XRU A;  2JXA A;  5FUI A;  3WP4 A;  1F15 A;  3PUR A;  4GH4 C;  1DHK B;  1Q56 A;  4IEY A;  4R8H A;  2IC1 A;  3ZVX A;  2VOV A;  3BN6 A;  5F5C A;  4AI1 A;  4YAR A;  3MZH A;  3U10 A;  5FUP A;  2E51 A;  1W8O A;  2WO1 A;  2XUM A;  3SHR A;  1FNY A;  3AX4 A;  4AQS A;  2BBV A;  5EFU A;  1BEV 1;  3LWC A;  3T3Y A;  3H3U A;  3UL2 A;  4ISQ A;  2VQT A;  2DCT A;  3G7D A;  1H6Y A;  1H8T C;  3J7H A;  1GP5 A;  4Q1P A;  2WNU A;  3D8C A;  1OUS A;  3A4U A;  3VDD B;  3ZYF A;  4DS0 A;  1GQP A;  1VBB 2;  1YUD A;  5FYC A;  4QKB A;  2ZX4 A;  1XQN A;  3ORJ A;  1O4Z A;  2NM1 A;  2ZAB A;  3KVA A;  5EJ3 A;  3VBU B;  5I0S A;  2B45 X;  4RA0 A;  4XQ4 A;  3IDB B;  1QJU 3;  3NKG A;  3Q9O A;  4CU6 A;  1GFF 2;  5CFC B;  3H9A A;  5BNP B;  1O3Q A;  1R09 3;  1UY3 A;  5FY0 A;  2ZGP A;  4YGE A;  2BVB A;  2VBD A;  1MVE A;  1F4A A;  2O8Q A;  3E5U A;  2D6M A;  1ONA A;  3B9I A;  3H8R A;  5C5U A;  1DGL A;  5FZ9 A;  5EWS A;  5EQU A;  5L73 A;  3VZL A;  4CEW B;  1WW4 A;  4KI5 M;  1UMI A;  3FBM A;  4HSJ A;  5I0R A;  2TUN A;  3VHR A;  2ILM A;  2G1M A;  1ZRR A;  4NUB A;  2A6Y A;  5DDJ 2;  3RWK X;  4HFS A;  4LHK A;  1S0C A;  5FCC A;  1WD4 A;  1LJ7 A;  4YW5 A;  5KBF A;  2XJT A;  2VZQ A;  2YYO A;  4XF3 A;  2BTV C;  2UY9 A;  4A2U A;  3QH7 A;  4JKL A;  2ARA A;  3J4U H;  2EXI A;  4AAX A;  1UD1 A;  4BH9 A;  1GLH A;  3T1M A;  4ES8 A;  4AE2 A;  2WNE A;  4HOO A;  4UFL A;  1Q8O A;  4O7X A;  4IW3 A;  3AYC A;  4FTS A;  2VZT A;  2FCV A;  3RPQ A;  3CHX A;  4RR3 C;  2XG3 A;  4XEZ A;  4XFA A;  3V0A B;  4JVA A;  2GNB A;  1XJA A;  3VBS C;  3BI3 A;  3PTY A;  4WVV A;  2BWC A;  2Q30 A;  4JV4 A;  4HN1 A;  4AVS A;  1DYP A;  3H42 B;  3IDC B;  3GZA A;  3CZJ A;  1LUL A;  2Y6G A;  1OHF A;  3OPW A;  2LUW A;  3LAG A;  3LZZ A;  4HVO A;  4JDM A;  3RI8 A;  3ZXK A;  4EN0 A;  3M4F A;  1LHU A;  4ASM B;  2EIB A;  1KRI A;  4R52 A;  3AZY A;  3KMH A;  2B39 A;  1BYH A;  5AFE A;  4IE6 A;  3EQE A;  3B93 A;  5JPN B;  5HCH A;  5CFC A;  1XE0 A;  1RUI 2;  1ACC A;  1X9P A;  3MUY 1;  3LQC A;  3GHM A;  1FI2 A;  1FOD 2;  3UK9 A;  3AFK A;  3ZYB A;  1ZBE 2;  5EHD A;  2QQK A;  5IYY A;  1PHM A;  1RUH 2;  4DZG A;  4XMI A;  3S5A A;  2X53 S;  5A33 B;  4DY3 A;  1PX3 A;  4BK4 A;  3S6P A;  2QDR A;  3LKJ A;  2FHR A;  5C3S A;  3O1M A;  2XJR A;  4Q0U A;  3OD0 A;  3S57 A;  5F1R A;  1CX1 A;  5LA0 A;  4QX8 A;  3O1R A;  4KH9 A;  4S2H A;  5FRA A;  4MSV A;  5A7P A;  3T30 A;  1HJG A;  3ZOI A;  1OUR A;  1AL2 3;  3ACL A;  1DQ4 A;  3ZO0 B;  1UZ0 A;  3HNB M;  4HK9 A;  3UET A;  4FFH A;  1OLR A;  3SEP A;  3OD4 A;  1VMF A;  4JTO A;  4P02 B;  4ZZ5 A;  4BQ3 A;  5GZG A;  1JZ2 A;  2XQX A;  2JB4 A;  2ZGM A;  4Y26 A;  3CO2 A;  1OA4 A;  1RUF 1;  5GLV A;  3ZXD A;  4M4R A;  1ZZ7 A;  2VZU A;  2WAA A;  2BW8 A;  2HWE 1;  4CDW A;  2JD4 A;  4CXY A;  2BGC A;  1KDM A;  2A70 A;  3IN9 A;  1COV 2;  5F7U A;  1LOD A;  2PAK A;  1S4C A;  4SLI A;  4U36 A;  4ZHN A;  4AHW A;  2BOI A;  1W2A X;  3LIG A;  3M3C A;  2VEC A;  1H4G A;  2HYK A;  4LJH A;  3WQ7 A;  4FPY A;  3FLR A;  5D2A A;  1V6N A;  2GMM A;  3WG4 A;  3OTF A;  1CON A;  4GMP 1;  5BNN A;  2OPW A;  2EIC A;  2CGN A;  4XPV A;  1QJX 1;  3H50 A;  5CIS A;  1JUI A;  2BEO A;  2DU0 A;  3RNS A;  1NLS A;  3CMG A;  1Y9M A;  3MFA A;  3MIG A;  4LNV A;  3ILF A;  3ZN5 A;  1TMF 2;  3SEE A;  1VAL A;  2WWS A;  2EF6 A;  3H7J A;  4FPC A;  3T2O A;  4D6S A;  5FIX A;  2F4L A;  1W9Y A;  1WWY A;  1Y9G A;  4O9G A;  1FPN 2;  3INA A;  5A3T A;  1X9T A;  2DFB A;  2VMD A;  4NPR A;  4QM8 A;  4QU1 A;  1CIY A;  2RM2 2;  1LHW A;  1GOH A;  1ZA7 A;  3OGV A;  1VBB 3;  5BNP C;  5L36 A;  1UAI A;  2QNK A;  1W04 A;  4XHB A;  3W5N A;  2J7M A;  3TB0 A;  5FV3 A;  1VMH A;  3RGB A;  1NX9 A;  2F4P A;  3U4S A;  1POV 3;  1AR7 2;  1UN1 A;  3KQR A;  2BBA A;  4JZR A;  1JMU B;  1ULF A;  2G9F A;  1AR9 3;  2WZR 2;  4MGI E;  2MEV 3;  4AQ2 A;  4E4H A;  5HPO A;  2ET7 A;  3FFQ A;  5I91 A;  1WMD A;  2V5Y A;  4FQZ A;  4CEY A;  3ZKY A;  1V6I A;  3VZO A;  1FXZ A;  4K8F A;  5C9A A;  3BTX A;  2W91 A;  5JSP A;  2WT0 A;  1W6P A;  4LHS A;  5T52 A;  4F8A A;  5B4X A;  1SPP A;  4HL0 A;  4AFM A;  5C8W A;  4FSJ A;  1D4M 2;  2XQR A;  4AFC A;  2RS3 3;  3AYE A;  1BJQ A;  1EP0 A;  2HWC 2;  4XFI A;  4QPG B;  4YNI A;  5JUV A;  2Y34 A;  1MS1 A;  2KD7 A;  4C1X A;  2PHL A;  1HN1 A;  3I2D A;  4GAL A;  4KQ7 A;  2OKX A;  4X8P A;  4YM1 A;  1RYY A;  4R9D A;  4CP1 A;  4AED B;  4KWU A;  1APN A;  4UW5 A;  4RHV 1;  1W2N A;  4HN0 A;  2WL1 A;  4A41 A;  2DYC A;  4FT8 A;  1HRI 1;  2K2S A;  4NRQ A;  3O0W A;  3MIB A;  4Y20 A;  5A3L A;  3WDY A;  4KGQ A;  4CCO A;  4CDW B;  5IVB A;  1VBD 1;  3U4X A;  1H4H A;  5IAX A;  4DO0 A;  3AKR A;  4EE2 A;  2BP6 A;  1E5R A;  4I2O A;  4YGB A;  1QQP 1;  1BVP 1;  2FQP A;  4ONU A;  1SAC A;  3RZH A;  5J09 A;  1JOD A;  2R06 1;  1XYN A;  1WLT A;  3ZMN A;  1AX1 A;  1CAV A;  1NCQ A;  3BYW A;  3HT2 A;  3OG2 A;  3IKW A;  2ZTN A;  1YQ8 A;  4Q8L A;  4BXS V;  2D7F A;  1D2S A;  3NMB A;  2XJS A;  1PGL 1;  5LW9 A;  4XJ9 A;  1ULO A;  3AXD A;  2RMU 3;  2GMP A;  5DXD A;  2QQM A;  4DB5 A;  4OI0 A;  5FDB A;  4CRQ A;  2EIE A;  5JMO A;  2RHP A;  5A1A A;  3PIG A;  3OB8 A;  1R09 1;  1UY4 A;  4YVS C;  1V70 A;  2QTW B;  4UW4 A;  1K42 A;  4EJR A;  1O5U A;  1OPM A;  4L9B A;  1MAC A;  4Y33 A;  2ARX A;  1HQN A;  4YVW C;  5KC5 A;  1CZV A;  1AYM 3;  4UFI A;  1EUT A;  3V0B B;  3AYD A;  2F6B A;  1OT5 A;  1NQJ A;  1R64 A;  1ZZ6 A;  4XJA A;  1K45 A;  2BZD A;  3ELN A;  5CFD A;  1OF4 A;  2VH9 A;  1HDK A;  2PHU A;  2VD7 A;  4HKL A;  3VBR C;  4ASK A;  1YXW A;  1G9A A;  4AFB A;  2CDP A;  2C9K A;  5FPU A;  1GU3 A;  5IVJ A;  5C71 A;  4O65 A;  1S0J A;  5JXH A;  2R06 3;  2JEM A;  1OVP A;  1BEV 3;  4GQ7 A;  3NJZ A;  3W9A A;  4KWJ A;  4A3X A;  1HQW A;  5A3U A;  4BMB A;  5LRS A;  2P34 A;  5DZG A;  3HQU A;  5CAD A;  4K8R B;  1W6N B;  4FCA A;  2JEC A;  3J9S A;  3I2I A;  3N9N A;  4G3Y C;  3USS A;  3FHI B;  1ULE A;  4E2S A;  1BHG A;  2MHF A;  4Q4W 2;  1OQ1 A;  1WCS A;  4FOQ A;  4DUX A;  2DUR A;  3KWV A;  3ZN6 B;  4AEM A;  3N36 A;  5B2G B;  4MG2 A;  3WSO A;  1Q8P A;  2WNU B;  3VDD A;  4R4Z A;  2ARE A;  3HWJ A;  2JIC A;  1MS9 A;  2Z2S B;  4LHN A;  1SZB A;  3BPS A;  4PQ9 A;  4BQ5 A;  1UYX A;  4YGC A;  3W5M A;  4KGG A;  4I02 A;  3IMN A;  4L11 A;  4Y22 B;  4M01 A;  5LK7 B;  2D5F A;  1BBT 2;  5A3P A;  5J3U A;  4D94 A;  4P9X A;  1S2B A;  3O5S A;  3UJO A;  4FP2 A;  1VAV A;  3DN7 A;  1TEI A;  4COW A;  4RR3 B;  3VKN A;  2CL2 A;  5FXX A;  3ROU A;  1RUJ 3;  1XU1 A;  4HBN A;  1YFY A;  2FDI A;  4Y20 B;  3FHA A;  1A6C A;  2PHW A;  2XHK A;  2AH2 A;  3Q8E A;  3UV9 A;  4XUR A;  3VDA A;  3WOG A;  5KWR A;  2W1Q A;  4R9C A;  1RVF 1;  1TE1 B;  3PVB B;  2ID4 A;  4MO3 M;  4LBN A;  4ZS3 A;  4AED A;  4BQ2 A;  2OX0 A;  1C5I A;  2QQV A;  1W8Z A;  2GH2 A;  3IPV B;  1KEX A;  3ZIW A;  2BWA A;  4IET A;  5DAB A;  4LR4 A;  3FE5 A;  1G86 A;  3E5Q A;  1BQP A;  2OA2 A;  4AHX A;  1JS9 A;  2VVE A;  3MIH A;  1OLM E;  2BOJ A;  1X33 A;  4MXW A;  2QQL A;  2R07 1;  3MLJ A;  1MS8 A;  3TOJ A;  1C8M 3;  3WF0 A;  3WNP A;  1SLT A;  3HOB A;  4PBO A;  3IAQ A;  1ZYB A;  1WCK A;  4Y5T A;  1R1A 2;  3PVO A;  1OVS A;  1YFX A;  1GZW B;  2VNG A;  4DIN B;  1SBD A;  3N3H A;  4M00 A;  4XJU A;  1GZW A;  1UPS A;  4LBQ B;  2DCK A;  5FAX A;  2XBO 3;  5FZ8 A;  4C1W A;  1SLA A;  2W92 A;  2YC0 A;  1EAH 1;  2PHX A;  1FMD 1;  1POQ A;  1W90 A;  3WNO A;  1SFN A;  2R30 A;  1YQC A;  2V73 A;  2WUH A;  1HV1 A;  5ACA 2;  1MEC 2;  1N3O A;  2QQW A;  4GWJ A;  5C4W C;  2VM9 A;  3UNP A;  5F3I A;  2QZ3 A;  2BPA 2;  2W68 A;  5FLH A;  3AZX A;  3R6S A;  3OSD A;  5I8S A;  2RS1 2;  2Y6J A;  5A70 A;  1HB3 A;  4L92 A;  1YCI A;  2VVF A;  2QE3 A;  1NAE A;  3HEI A;  1AR6 1;  1E5I A;  2RR1 3;  4PQQ A;  3AMN A;  2VE1 A;  3ILN A;  3O1U A;  2ZPX A;  3BTZ A;  1OFS A;  3QD6 A;  1K5J A;  1VRH 2;  5ISL A;  2P1B A;  5A1F A;  5FPZ A;  2NP0 A;  5A3N A;  4BCU A;  1F31 A;  1AR9 2;  2JKX A;  2WZR 3;  2WZE A;  1JU4 A;  1H1I A;  1RUI 1;  3THD A;  4CCC A;  3ZR6 A;  1FOD 1;  4WVZ A;  2Y33 A;  2Y8K A;  3VBR A;  2IXH A;  3ZFF C;  1MZ5 A;  1ZZC A;  2E7T A;  1RUH 1;  1XNK A;  4JC1 A;  4URA A;  1WGP A;  4YZ3 A;  1OLM A;  1GSL A;  2PQS A;  3RDI A;  2Y38 A;  4PI0 A;  2JDM A;  2ADD A;  2R04 1;  2R1B A;  3I2H A;  1W9T A;  2DDU A;  4CPB D;  3KB5 A;  1JXN A;  1V6L A;  1RC6 A;  3ALQ A;  5J96 B;  2ZX1 A;  2VMF A;  2W46 A;  3AL5 A;  4DPN A;  3WEZ A;  5C3Q A;  4PLM A;  5C8C B;  4MGK E;  3EJK A;  4ITC A;  1TME 2;  1UU5 A;  4GKY A;  4OMC A;  2HH9 A;  2GME A;  4UT5 A;  5CEH A;  1KD7 A;  2B9U A;  3CF6 E;  1RUF 2;  3KV6 A;  4Q4V 3;  5AVA A;  4A45 A;  3O1O A;  5FBJ A;  3FWE A;  4JCK A;  5A33 A;  5A7W B;  2ZS6 B;  5AC9 3;  2LM3 A;  3VD7 A;  5A32 A;  5DAQ A;  4TWT A;  1H9P A;  3MI8 A;  1BCX A;  1EV1 3;  4EWD A;  4LHL A;  4V1P A;  5F39 A;  1POV 1;  1C28 A;  1NG0 A;  4XAB A;  3VKO A;  4DXS A;  3BOP A;  4FVV A;  4MZU A;  1GMM A;  2OS2 A;  3ZSM A;  1V00 A;  1H8V A;  3RZJ A;  2EIG A;  2NMO A;  2BNN A;  1WUV A;  3U1X A;  3DKQ A;  4XMA A;  4UOJ A;  5FPA A;  4AFA A;  3V0B A;  4D6Q A;  1AR7 1;  2E53 A;  1QJX 2;  4CDW C;  4XDO A;  3N9L A;  4YPJ A;  3FBY A;  4Z2W A;  4AI3 A;  4LA3 A;  3OYW A;  1ZRD A;  1JZ3 A;  3N7M A;  3FFZ A;  2I2S A;  4AGG A;  2Q5T A;  2VCB A;  5FP9 A;  1W06 A;  1XSR A;  4QXK A;  3IWZ A;  1FPN 1;  5FMO L;  4NR1 A;  1BMV 1;  3LFI A;  4BQX A;  3D0J A;  3J8F 3;  3DYM A;  1C4R A;  2IFR A;  2JJ6 A;  3BU0 A;  2IVJ A;  2RG4 A;  3WIN E;  1LKN A;  1AYN 3;  2B9V A;  5LBE A;  3USU B;  2BVV A;  3DV8 A;  1UQX A;  4P9I A;  1QQP 3;  2YMZ A;  5IVY A;  4CCK A;  5IK5 A;  3B02 A;  3WQB A;  2G19 A;  2G4I A;  2DTW A;  3RVH A;  4CEY C;  1JOJ A;  4Y24 A;  3N35 A;  2D5H A;  4DFS A;  2WFP A;  2QVS B;  4BQW A;  3PJQ A;  4RHV 3;  1W8W A;  4DEQ A;  1WLD A;  2YB7 A;  5HV0 A;  5KXE A;  5JR7 B;  4HXC A;  4LE3 A;  2Q1M A;  3CQO A;  5LK5 A;  3S7I A;  1R08 2;  4QKD A;  3HVD A;  3KSC A;  5JDB A;  4QX7 A;  3ZFE A;  3G6J B;  3KVB A;  4XZP A;  2VOT A;  2X5I B;  3CL1 A;  3J7M A;  1UOJ A;  4IEO A;  4OUL A;  2YXS A;  3THP A;  2GZW A;  4M4P A;  3ZN4 A;  3AZV A;  1RB8 G;  3U14 A;  3AFG A;  2XBO 2;  3QH6 A;  5A3W A;  1A8M A;  2W1S A;  4XFG A;  3GCW A;  4BHP A;  5A7W A;  5I8Y A;  3ZIX A;  1HRI 2;  1OOP B;  2KXL A;  4I3P A;  5T5J A;  3S5Q A;  5HV4 A;  4OUE A;  1Q8S A;  4XDQ A;  3D5O A;  2VMG A;  5BNN C;  1FYU A;  3AKT A;  4CCN A;  2NZ9 A;  2NYY A;  1UKG A;  2D6L X;  3HN1 A;  5F3G A;  3IMM A;  5L9V A;  1SDD B;  1ND3 C;  2ZGQ A;  1F35 A;  1O59 A;  1X50 A;  2WNV A;  1RXG A;  3GJA A;  4HSL A;  2WRA A;  3B5L B;  5FY8 A;  5ABJ A;  1LEN A;  2JDU A;  2WA3 A;  3JD7 1;  3MW2 A;  3FJS A;  3AL6 A;  4BZ4 A;  1S0F A;  4YM2 A;  4EQV A;  4I0B A;  5FZM A;  3I2F A;  4ATF A;  3FZ3 A;  4XQW A;  1WBF A;  4UW3 A;  2ZGL A;  5EV7 A;  2J1A A;  4CEY B;  5BUV A;  2YC2 A;  4GB3 2;  4LK7 A;  4LO5 B;  1M06 G;  1X8E A;  5ERL A;  2VZV A;  5FZA A;  3OY8 A;  1PGL 2;  1IZ3 A;  3NNJ A;  2J42 A;  1VBC 2;  5JSO A;  1YQ5 A;  2W87 A;  4FQ4 A;  3D0S A;  3BAL A;  2XGX A;  5F5I A;  1DU3 D;  4LA2 A;  1OA3 A;  1Z7S 3;  2AEY A;  3TNQ A;  1ZX5 A;  2VZ1 A;  3S0M A;  4UYB A;  1RUC 1;  2YC4 A;  3O1P A;  1T6B X;  1OOP C;  4FPF A;  3LDK A;  1IPK A;  4DUV A;  4OCT A;  3OGG A;  4GWI A;  3SKJ E;  4ZKT B;  3RSJ A;  1H2K A;  1M4W A;  2C1F A;  2PLV 1;  2VQA A;  1YNA A;  3DYO A;  4IER A;  4QT6 A;  3T4V A;  5FZ7 A;  1W6Q B;  2GC2 A;  5J48 A;  1J58 A;  3POI A;  4UI9 L;  2VQ0 A;  2JD9 A;  5F8P A;  1JTZ X;  1Q43 A;  5FK8 A;  1IPJ A;  3KM5 A;  3UES A;  3VZM A;  4W6W A;  2W1U A;  1N1V A;  4W4Z A;  5HXV A;  3DF0 A;  4AGR A;  2XL7 A;  3ST7 A;  5B4N A;  4XAA A;  3AKS A;  4AI0 A;  1D7P M;  3TEZ A;  1OI6 A;  2HJI A;  5CIR A;  3HD8 B;  1HJF A;  5C6C A;  4FTE A;  1UY0 A;  2WKK A;  1JZ5 A;  4K1Z A;  2P37 A;  3Q8B A;  4K40 A;  3SMH A;  1ULD A;  1W28 A;  3R05 A;  1GIC A;  4HPK B;  1PO2 2;  3FHQ A;  4BE3 A;  2PHT A;  2PLV 3;  5CBL A;  5JI7 A;  5C4W A;  5HXM A;  5DN2 A;  2BGP A;  1L7L A;  3I2J A;  5C3R A;  4OHY A;  4XJW A;  2WDB A;  4JDO A;  1AZD A;  4PDW C;  3B3Q E;  1RXF A;  4TLF A;  1BKZ A;  2CGP A;  5EJZ B;  1RIR A;  5FJH A;  2WC2 A;  2RR1 1;  1SMV A;  5JWP A;  3GBW A;  1UX6 A;  1JYC A;  2CWM A;  3JQX A;  3MO4 A;  4Y5S A;  5A1L A;  1QJX 3;  3DCQ A;  3DPR A;  4N7U A;  4V2W A;  3W20 A;  5DMY A;  2P4E A;  1ASJ 1;  1RUJ 1;  2XWB B;  3M70 A;  3OBA A;  3JZV A;  1IGO A;  2YFU A;  2ZEY A;  2QQU A;  1FT9 A;  4E4D X;  1UF2 C;  2YGM A;  4H55 A;  5HCB A;  1ZRF A;  4C0H A;  2MPF A;  2ZKN A;  5LY2 A;  2W9X A;  3TBD A;  1WW7 A;  1RUE 3;  4W65 A;  4BWO A;  3V65 A;  4NRP A;  5A3M A;  1J3Q A;  1TVG A;  1H30 A;  1H8T B;  2XKP A;  2ZGS A;  3D6E A;  3FN9 A;  2NQY A;  1U12 A;  1PNF A;  4LQR A;  3MGU A;  3WDU A;  3UT0 A;  3APB A;  4QD2 A;  1LGB A;  2O8O A;  5FY7 A;  5FXZ A;  4AED C;  4YG3 A;  5L7O A;  2OVU A;  4Y22 A;  1UZW A;  2Y64 A;  4HG6 B;  4LLO A;  5FYM A;  4CU9 A;  1S2E A;  2WA4 A;  1R1A 1;  3D3A A;  3VZK A;  2VXR A;  1NY7 2;  1C8M 1;  4UFJ A;  1H6X A;  1I5P A;  4RHV 2;  5LBF A;  3GZE A;  4IEX A;  1DQ1 A;  4NHY A;  3PU3 A;  3RYP A;  5I0U A;  4HON A;  1PM4 A;  3X29 B;  4ARX A;  2CSG A;  3O7O A;  5H9P A;  4COU A;  1PO1 3;  5F9T A;  4GWM A;  3F2Z A;  3VN4 A;  3ETP A;  4Q4V 2;  4Q0Q A;  1VB2 A;  4BK5 A;  2ZGN A;  1V9U 1;  1BXH A;  4QKF A;  5E16 A;  5BPX A;  3WDW A;  4CUB A;  1Y4W A;  2EAL A;  2QQJ A;  2AGS A;  3ZMO A;  2VC9 A;  1GOF A;  4YW2 A;  1CGP A;  1TNR A;  4K20 A;  4JHZ A;  2V5D A;  1SCR A;  2CY6 A;  1SFY A;  2Q1F A;  4BQY A;  2VCC A;  1EAH 2;  2HKX A;  4LBL A;  4OQ8 A;  1CAX B;  1AYN 1;  1WW6 A;  1TG7 A;  1WME A;  2V4A A;  3NRU A;  3WNN A;  1ZBA 1;  2ZZQ A;  3LA2 A;  2DVA A;  5C8C A;  4OHV A;  1PZ7 A;  4DUW A;  1AR9 1;  4OUS A;  1ZRC A;  4LLF A;  4EYU A;  5JSR A;  1RIN A;  2R0H A;  1JYI A;  4IXL A;  3LA7 A;  1LOF C;  5FUN A;  2GND A;  2JE7 A;  4FOW A;  3BGA A;  3VBS B;  2ZBJ A;  3ETQ A;  3ZSK A;  2RS1 1;  3VBH C;  1VMJ A;  5A32 B;  3NAP A;  2RJ2 A;  2ZEW A;  4ZXE A;  1GV9 A;  5E6H A;  1YEW A;  2GP3 A;  2Z79 A;  4OI4 A;  4Q4Y 2;  2QCS B;  5IVC A;  2XB6 C;  3FUO A;  4NOT A;  5AC9 1;  3VUO A;  1JOB A;  1SEF A;  2CAV A;  4Q0P A;  3WVJ A;  1MEC 3;  2WT1 A;  3KV4 A;  1NOV A;  5FKC A;  1NCR A;  2ADE A;  4EZH A;  2OXB A;  1LTE A;  2HWB 1;  1GZT A;  2D98 A;  3GYD A;  2A6V A;  3R4U A;  1B35 A;  5FO9 B;  3W21 A;  4PF1 A;  3I2G A;  4JKK A;  3ZSE A;  1VBA 2;  5CVR A;  1DDL A;  1YI9 A;  3V56 A;  4WVW A;  3PVN A;  4IE7 A;  4KWL A;  3C8X A;  1XNC A;  2EXH A;  1U0A A;  3AKQ A;  3I4I A;  5FZ1 A;  5GZD A;  1Y7B A;  1QJF A;  1W9S A;  4MGS A;  1RUG 2;  4OQ9 A;  3WP5 A;  1QEX A;  4AL9 A;  1OSG A;  1U5X A;  3M2M A;  5GKA C;  5KR7 A;  2PEL A;  2X10 A;  4AEK A;  2CYF A;  4CA9 A;  4WM8 A;  1MZE A;  3NL1 A;  1UX7 A;  5IK7 A;  1XE7 A;  1RUD 1;  3J7N A;  4D6R A;  1QIQ A;  1W0N A;  1H9W A;  2RVA A;  2YBP A;  1BVV A;  5GZF A;  4CXW A;  3LCP A;  4XBQ A;  1YYN A;  1DYK A;  1QJU 2;  2SBA A;  1HRI 3;  1NCQ C;  5K0U C;  1QOS A;  4N9H A;  2JG9 A;  4AVV A;  3I7D A;  1R1Z A;  4LIT A;  4QHB A;  5FWE A;  4DRV A;  1DGR N;  1O8P A;  1DP0 A;  4QQO A;  3TEY A;  4D8M A;  2LAL A;  4RSU A;  5IAV A;  2YU2 A;  5L9R A;  3U75 A;  4A44 A;  1EUU A;  3W58 A;  5FZC A;  4GUL A;  1SLC A;  3T4H B;  3THC A;  5KXD A;  5FZH A;  1LOG A;  5FKB A;  4AVT A;  2B8M A;  2FCU A;  1MS5 A;  2WAO A;  3WT3 A;  1BBT 1;  1UYY A;  4K3U A;  3I3E A;  2EAK A;  4TSV A;  3SIT A;  4FPK A;  4F83 A;  5D1I A;  5H9R A;  3K3N A;  1UXX X;  2Q4S A;  1R08 3;  4BIS A;  4LOT A;  1PK6 C;  4WVM B;  1BMV 2;  3VDC A;  4NIG A;  3ES4 A;  4IEV A;  2R0F A;  3ZKU A;  2B42 B;  4XF0 A;  4BOW A;  2ORX A;  2OZ6 A;  1JHN A;  2YPD A;  4L0P A;  5FZD A;  4B7K A;  2XLA A;  1GAN A;  3RMY A;  3MUZ 1;  5BNN B;  3WHU A;  1RVF 2;  4TYS A;  1KDK A;  3GJB A;  2PA7 A;  3NO8 A;  4TXW A;  5CU1 A;  1KXG A;  4COV A;  2EXJ A;  3BCW A;  4I3G A;  4Y1Z A;  1V6J A;  2X5I A;  4LKE A;  3KCX A;  5AFB A;  3IIA A;  3OCP A;  4M0H A;  2AEZ A;  4MHR A;  2YV8 A;  5JAX A;  1QF3 A;  2W94 A;  5EJ1 B;  1CAX A;  3ACI A;  4ARY A;  1O5L A;  4U2A A;  3VBO A;  2DCZ A;  2MNG A;  1GKB A;  1GZC A;  3RZG A;  5D8A B;  2L9L A;  2XBO 1;  4XCA A;  3C7H A;  3CZU A;  4CDQ C;  5JOZ A;  1U5Y A;  1GWM A;  1V6M A;  1ZZB A;  4QHO A;  5GM0 A;  1JYX A;  1DQ5 A;  5C70 A;  3KS7 A;  3TAY A;  3ZFG C;  4XBN A;  1NZI A;  1XNB A;  2WJS A;  2D44 A;  2XUE A;  4MHU A;  2HEV F;  1XBF A;  4QQ2 A;  4CUA A;  2AEN A;  2BUK A;  2RDQ A;  4E8D A;  2HWF 1;  2XR4 A;  1US2 A;  1LEC A;  1MR5 A;  1Q8Q A;  3HJR A;  2QUO A;  5IVV A;  1FV2 A;  5EP9 A;  1O7F A;  3J26 N;  1G8W A;  2PYT A;  4RS5 A;  3ZFE B;  3IDE A;  3MHZ A;  1Z7S 1;  1D4M 3;  2VTF A;  5BV6 A;  1W03 A;  4EN6 B;  3BOD A;  1RMU 2;  1AVB A;  3JBG 3;  3VBH B;  3HT1 A;  4GKX A;  1PZ8 A;  1J1T A;  2D43 A;  2KR2 A;  2DCJ A;  1C8N A;  2VY0 A;  5LAT A;  1OQD A;  1RTV A;  5FZB A;  3SNM A;  2ZGR A;  5T55 A;  5FZE A;  4YG0 A;  1FOD 3;  4NVP A;  4DMI A;  1LES A;  3K75 B;  3BU7 A;  4IQP A;  5A7S A;  3TEX A;  4CDX C;  2VTX J;  5IAT A;  5JZG B;  5T3N A;  2GNM A;  1LOC A;  5T5P A;  2GU9 A;  2IUW A;  5A7Q A;  4FP3 A;  2ZKL A;  3NNF A;  1IQA A;  3ME2 A;  5GJ6 A;  3OPZ A;  1QDC A;  4IV1 A;  3KV9 A;  4DNY A;  1JYT A;  1DZT A;  2DUO A;  4BME A;  2PLV 2;  3POS A;  4IUG A;  4GMP 0;  3ATG A;  2BNM A;  3O1S A;  3QAC A;  1HW5 A;  2EID A;  1SQ4 A;  4GJZ A;  3PUI A;  1RJ8 A;  4RFR B;  4OHZ A;  4K6B A;  5JXG A;  4Y4Y A;  3B9C A;  4C91 A;  3E5X A;  2XL9 A;  3DEM A;  1VPH A;  3HQR A;  2HBU A;  5DAP A;  4ZU4 A;  3SCG A;  4P08 A;  2VMH A;  1WMX A;  2A5Z A;  3LEM A;  3WHT A;  5C4W B;  3L2H A;  1AR8 3;  1L3J A;  1A78 A;  1LOF A;  2OII A;  3DGT A;  3HBK A;  4LUK A;  5GLU A;  4QX3 A;  5CKN A;  5JCT A;  4JTN A;  2W3J A;  1HRV 3;  1VLN A;  5JIA A;  3WW4 A;  1C5H A;  5LZ6 A;  1PK6 A;  3O12 A;  2VZR A;  1CQ9 A;  1IKP A;  1RUE 2;  4IL7 A;  3PJY A;  2E33 A;  4Y3O A;  1QNY A;  1XB9 A;  3VBU A;  5D21 A;  4J1W A;  3RQ0 A;  3WDV A;  1HB1 A;  1VRB A;  4IV3 B;  4N53 B;  2F17 A;  2K9Z A;  3A23 A;  3R4S A;  2W2I A;  4N43 B;  2J1V A;  1AYM 2;  5IK4 A;  5GLW A;  2VG9 A;  3WF3 A;  1HB4 A;  1ZBA 3;  5FOJ B;  1EAH 3;  3C7O A;  1UU6 A;  1IOA A;  3SKV A;  1MS3 A;  4CE8 A;  5JXI A;  2WS9 3;  4HZF A;  4OYU A;  3VZN A;  4K9S A;  1QY4 A;  1KJL A;  1T2X A;  5DUV A;  5BXX A;  3OBR A;  1ASJ 3;  1O3S A;  5KC6 A;  4LKS A;  2XVL A;  2ZHL A;  2ARC A;  2PXJ A;  1E57 A;  1UY1 A;  1GUI A;  4LMF A;  1OD3 A;  1ENS A;  3LDB A;  2JWP A;  2RM2 3;  2VVD A;  4LOR A;  3U0Z A;  1CAW B;  2I74 A;  3EXU A;  1E5H A;  1JYV A;  4MGZ E;  2R49 A;  2YHJ A;  1AR7 3;  2KA3 A;  3WG3 A;  2WSV A;  1VBB 1;  3V64 A;  4E4S A;  4NE9 A;  1B09 A;  2IZW A;  2H0V A;  4B29 A;  2RS5 1;  1JYN A;  4WV8 A;  1XNT A;  5SV8 A;  2BGO A;  1I3H A;  1SBE A;  4BDV B;  4MGT A;  1F9K A;  3Q8F A;  4HMZ A;  4E27 A;  1B35 C;  3MV1 1;  2XJU A;  1WA4 A;  1WCQ A;  1C1F A;  5D8A C;  1QJY 2;  3OOX A;  5KHG A;  1DIW A;  1HN0 A;  4NHL A;  4LBO A;  1I1E A;  5FZ4 A;  5T5L A;  3S30 A;  2AZ5 A;  3ZDS A;  4QB6 A;  1PMH X;  4BXF A;  1AHS A;  4B4Q A;  2VCA A;  3VZJ A;  4QX2 A;  4LT5 A;  1FX5 A;  3NAP C;  3QLQ A;  4KL1 A;  1SPP B;  2HWD 2;  1H2N A;  1W6P B;  2VNR A;  1NZC A;  1OXC A;  3THT A;  4YZ5 A;  4RQP A;  1G6N A;  2WAB A;  2WQ4 A;  3UKV A;  3AM2 A;  3MFC A;  5F6K A;  1QJE A;  1D4V B;  1OC1 A;  1Q5O A;  2I07 B;  4JHT A;  2UYB A;  3W59 A;  4H14 A;  4P9G A;  2QBX A;  3WG1 A;  3K4D A;  5FZO B;  1YHF A;  2ZAH A;  1W6O B;  3HQX A;  3M3E A;  3MYX A;  1CPM A;  4WM7 C;  3RWN A;  2DCY A;  2D3S A;  2E63 A;  4XFF A;  4XFH A;  4KU8 A;  1MQT B;  5FZK A;  3I3B A;  1VIW B;  1F8V A;  3TYJ A;  4AFD A;  4C8D A;  4URT A;  3C3V A;  4Y1V A;  4YW4 A;  2FD8 A;  1RIT A;  5TSW A;  1XPW A;  3EHK A;  4QX5 A;  4XW3 A;  1V9U 2;  5BY5 A;  2TBV A;  3OY8 B;  1OLQ A;  2IXJ A;  3H7Y A;  3SH3 A;  2GN3 A;  3O0V A;  2ZX2 A;  1H2M A;  4QGM A;  3N9Q A;  2B46 X;  3ON7 A;  4CDX B;  4HLT A;  1WZX A;  1QH7 A;  4KG8 A;  1CES A;  4D7S A;  4MVT A;  5DZF A;  5C3O A;  2ZHK A;  3A0K A;  3VKL A;  4RGA A;  2H6C A;  1UIK A;  1LHN A;  3PDQ A;  4H3W A;  2FDH A;  2K0G A;  4QB1 A;  1V6K A;  3M3Q A;  5K7P A;  1SLI A;  3AJY A;  1KQR A;  3GCX A;  2FMY A;  4CYD A;  2HWB 2;  4QXB A;  4MLO A;  1AUY A;  1L7R A;  3K51 A;  5F37 A;  2GAL A;  1DG6 A;  1FV3 A;  4QGN A;  3VHO A;  1PMI A;  1OUX A;  1RUC 2;  1UPI A;  5FPX A;  2K46 A;  4QPI A;  1NLQ A;  3GF6 A;  1V0A A;  2TEP A;  4B3N A;  4WM8 B;  4PHZ A;  2EAA A;  2EXK A;  2W52 A;  1RUG 1;  2VGD A;  4Q5O A;  5JMC A;  5F2S A;  4BIF A;  1PGW 2;  1PK6 B;  2QFE A;  3I8T A;  4AOC A;  1W0P A;  1Y3T A;  1YFU A;  1BLZ A;  3NNL A;  2XVG A;  1RUD 2;  3I54 A;  1O3R A;  5FXV A;  3POJ A;  5IUQ A;  4QB2 A;  3OBT A;  2Q1Z B;  3WG2 A;  1DBN A;  4Z2A A;  1AR8 2;  1S0G A;  4ORF A;  4ZPI A;  1F5J A;  1QJU 1;  4Z8B A;  1UY2 A;  4XAE A;  1VR3 A;  4LOS A;  3ZXL A;  3DPR C;  3EBR A;  1NCR B;  2JE8 A;  4YM3 A;  5IK8 A;  1GBG A;  4G9S B;  1LGN A;  1YLL A;  3WP3 A;  4LUM A;  3P1I A;  1AL2 1;  4KBB A;  1MVQ A;  4MH0 E;  2WLP A;  2VW2 A;  1PO2 1;  2OUJ A;  4PDW B;  5K4L A;  3AB0 A;  3AZW A;  1VAK A;  2D3P A;  2G9G A;  1LB2 A;  4PDW A;  4Q26 A;  1XND A;  1O3T A;  4LIV A;  4D0Q A;  4BLI A;  3ABZ A;  1LHO A;  1QJZ A;  5FWJ A;  1EYB A;  2BNO A;  1MS4 A;  3NNM A;  5LBC A;  4D7T A;  3RFR A;  3N7J A;  3TWI A;  4DIQ A;  2QQP A;  2HEW F;  1VBA 3;  1I5Z A;  1J84 A;  4OI2 A;  2A75 A;  2BV4 A;  1K3I A;  1S55 A;  1H2L A;  2R07 3;  3ZYI B;  5A6Y A;  4DY5 A;  4NIH A;  1LOE A;  1S1A A;  4ES9 A;  3WUC A;  2VU9 A;  4TN7 A;  4CEW A;  3P3P A;  3MV0 1;  4P9L A;  2JDH A;  4A6S A;  1OFN A;  2ZML A;  1CX4 A;  2E26 A;  4M3C B;  3T2T A;  4O9E A;  3UYJ A;  3AZZ A;  4Q4X 3;  4CCJ A;  5I93 A;  3MID A;  1QKQ A;  1W9W A;  3KHC A;  1OF3 A;  2RE9 A;  3K4Z A;  5EPA A;  1WLW A;  1YFW A;  2WO3 A;  1Z0H A;  4B7E A;  4E9K A;  1EPW A;  2LTN A;  4MX3 A;  1EV1 2;  4ZZ8 A;  1QHD A;  4XDP A;  1NLR A;  4QHZ A;  2ZHN A;  3C2U A;  1ZRE A;  2JX9 A;  1SDW A;  1AF9 A;  1DCS A;  1IG0 A;  4FFF A;  1OBN A;  5FY9 A;  3JUU A;  3LPG A;  1G9D A;  1AXK A;  1Z78 A;  2BFU L;  4UF0 A;  2HLE A;  1D0H A;  4NN0 A;  1NY7 1;  3ZYP A;  4IV1 C;  3D82 A;  1SHW B;  3ZXJ A;  4QQP A;  4V2V A;  4AG4 A;  3MIC A;  2JG8 A;  2ZX3 A;  1C57 A;  1S0E A;  4COY A;  4B8E A;  2HWC 1;  4RGK A;  2BU9 A;  4IDZ A;  4FAG A;  5LWB A;  1HXS 1;  1RHI 1;  4CDX A;  2HWD 3;  3JBG 1;  2VUD A;  4RS5 B;  2E7A A;  3AVR A;  3RRD A;  4NHM A;  4MOA A;  1MQT C;  2ZMN A;  1R1A 3;  1UMH A;  1S0B A;  4MXV A;  3ZSJ A;  3DXU A;  3E97 A;  2RDR A;  4M3C E;  3GXU A;  2WFF 2;  2W95 A;  4K1Y A;  5APA A;  3H3Z A;  2GC3 A;  4K21 A;  2H0B A;  1KS4 A;  1SLB A;  3H1M A;  4Q27 A;  5FZ0 A;  3N9M A;  2ZEX A;  1IKQ A;  2HEY F;  4CDQ B;  4DXZ A;  2E31 A;  1AYN 2;  5CB7 A;  3BB6 A;  4TTG A;  3WLU A;  1KGY A;  4LBJ A;  5FZ3 A;  3ZFG B;  1GWK A;  2A3Y A;  1ZBA 2;  3CDZ B;  2IWG B;  1ZM1 A;  4JQT A;  4A4A A;  4Q29 A;  3UGF A;  3P5B A;  1JUH A;  3LEG A;  5LA9 A;  1RUN A;  5H9S A;  4YRD A;  5FMB A;  4EN9 B;  1UOB A;  1HV0 A;  2JDK A;  4LXL A;  1LU1 A;  3POW A;  1XYP A;  3SC7 X;  4QAW A;  3ZFG A;  2ATF A;  5BYN A;  4ET7 A;  5T50 A;  4Q2F A;  2ZEZ A;  4ZXK A;  3BKZ A;  3A22 A;  3B7M A;  1TZO A;  1PGS A;  1RUF 3;  4JX0 A;  5FYI A;  2B5H A;  5FZO A;  2GNT A;  5G05 L;  5FZI A;  4BU2 A;  2A73 B;  4W50 A;  5AC9 2;  5DAX A;  3IBM A;  3PUQ A;  1WA6 X;  1QOO A;  3OEB A;  1POV 0;  3I2O A;  2X8K A;  4HET A;  1LU2 A;  5EZW A;  3ZSL A;  3BTY A;  1R09 2;  1WMF A;  4QX0 A;  4E2Q A;  4YFZ A;  5LY1 A;  3T2P A;  4NIA A;  4YW7 A;  3I3M A;  4WVM A;  3A7Q A;  5F3E A;  1G7Y A;  3PME A;  1UKR A;  2Z69 A;  3WZ1 A;  2WWU A;  2FZ1 A;  4S2F A;  3LD8 A;  3QOP A;  5C3P A;  4JKM A;  2IXC A;  5JR2 A;  3BOW A;  1JHJ A;  1X8M A;  1RUD 3;  3LSE A;  1UO9 A;  3QBQ A;  3VV1 A;  1NA1 A;  4HK8 A;  3T2Q A;  4XCB A;  4JAA A;  1GP4 A;  4UW6 A;  2CV6 A;  5CFC C;  5K0U B;  3IAP A;  4AGV A;  3IZO A;  4H7M A;  1OPO A;  1AYM 1;  4UFK A;  3MIE A;  1BZW A;  1UWW A;  2D40 A;  1H1M A;  2VR4 A;  1ULP A;  4QQL A;  1DLL A;  2CGO A;  4QGL A;  1YC6 1;  1LGC A;  2ENR A;  4WBB A;  4QU2 A;  1DYO A;  5FMO S;  4W6Y A;  3POB A;  5FP7 A;  3CU7 A;  4NJ4 A;  4AVC A;  3ZPO A;  5I0T A;  1MZF A;  5KHJ A;  1WKY A;  1PM7 A;  3VBS A;  5ACA 3;  1JBC A;  4QDR A;  4PJY A;  3NAP B;  2Y60 A;  1A8D A;  1PVC 2;  1CPN A;  2QQI A;  3K77 A;  5FFO C;  2IXL A;  2A6Z A;  4YSF A;  1HIX A;  4EN8 B;  5LA1 A;  4UFM A;  3WXP A;  1PMJ X;  2RM2 1;  3MF6 A;  1AXY A;  4AI9 A;  5FLJ A;  1I6X A;  3NVC A;  5J1X A;  2RS5 2;  4A7Y A;  1RJ7 A;  1GWL A;  4WZF A;  4RFT 0;  4EWE A;  5LAS A;  1S0D A;  2LRO A;  2UUR A;  3VBF B;  3ZM8 A;  2LW8 A;  1YJL A;  1J3P A;  2VZS A;  4YW6 A;  5FTT C;  3AP6 A;  2FDK A;  2EVX A;  2P6H A;  4IV1 B;  3GZU C;  4N53 A;  3ZYG A;  2XLF A;  1NUK A;  1F2N A;  2KM2 A;  1YQ2 A;  3OGR A;  3T1L A;  1W6N A;  2VTX A;  5FP8 A;  1HLC A;  3EO6 A;  1PO2 3;  3RYK A;  2WBK A;  5FOB B;  4Z1V A;  3PL0 A;  4IGO A;  4EZ4 A;  4UFH A;  1QWR A;  1GQG A;  4I0W B;  1NE4 A;  4AAP A;  2W47 A;  3RG0 A;  2DUP A;  1DF0 A;  3KLS A;  3LDR A;  4QKN A;  1CAV B;  4XZU G;  3NV2 A;  4HT1 T;  1N3P A;  3F95 A;  2PTM A;  4YG6 A;  4YWA A;  2OQ7 A;  4S2D A;  1GNZ A;  2C6S A;  3VL8 A;  3JB4 C;  1GYK A;  2AAC A;  2P3K A;  1US3 A;  2ZJC A;  3KF3 A;  4JGZ A;  5CKQ A;  3I49 A;  1IG3 A;  4CUG A;  5KXC A;  4BJ0 A;  3V0A A;  5C7G A;  3M8L A;  3H1W A;  5FMD A;  3N4M A;  3NJV A;  2NLR A;  1U5I A;  5GZE A;  1NXD 1;  3IDA A;  4YZ1 A;  4DRR A;  4MV2 A;  4COZ A;  4MAD A;  4NPL A;  5CZK A;  2DV9 A;  4AF9 A;  4XOG A;  5JPM B;  2NPI A;  3KT7 A;  1Z7S 2;  3KHB A;  1K5M C;  4NO4 A;  5FMC A;  3LFM A;  3MW3 A;  3MEP A;  1PIV 3;  5GAL A;  2A3X A;  2FBE A;  2R32 A;  3IT8 A;  5DUU A;  1L7Q A;  4WM7 A;  5HCA A;  4CP0 A;  4L99 A;  2VMI A;  4ZON A;  1JH5 A;  1ZNP A;  3ENR A;  4IES A;  4QPI B;  2VW1 A;  3DPR B;  5JZG C;  3KV5 A;  1LEM A;  4XIL A;  2AYH A;  2WWJ A;  1YIF A;  1ULG A;  2ZCW A;  5JOW A;  1VB4 A;  1O6U A;  5FQ0 B;  4GB3 3;  4MGY E;  4HPK A;  2D93 A;  4RQP C;  4LTA A;  3I3Q A;  4LBM A;  2GP5 A;  4XUT A;  5FYS A;  2XPJ A;  1W8N A;  3I2K A;  1KJR A;  3DYP A;  4Y1U A;  4Q0S A;  1AR6 2;  1N1Y A;  1VBC 3;  4DXT A;  3LB9 A;  4IE0 A;  3I59 B;  3NJY A;  4Y1X A;  2MEV 2;  3RYR A;  1W2U A;  1PGW 1;  1XXN A;  1ND2 C;  3IM0 A;  5CFD C;  4NWV A;  4E8C A;  2ARB A;  4BB3 A;  4JRL A;  2YZ4 A;  3PU8 A;  2W1W A;  3DKW A;  1PZ9 A;  1IS3 A;  1A3K A;  1UZZ A;  3KCY A;  1AR8 1;  3WUD A;  1ND2 A;  3ACF A;  1CR7 A;  4NHX A;  4YVS A;  1NQD A;  1STM A;  3WF4 A;  2GN7 A;  1ENX A;  3WF1 A;  2OUH A;  2YPJ A;  2P2K A;  2P17 A;  2WQZ C;  1O8S A;  3KGL A;  3PUA A;  5FRE A;  3UGG A;  5GZC A;  5C9A B;  1XE8 A;  4N43 C;  1GOG A;  2H6B A;  4LUL A;  2W5F A;  1V6O A;  3Q8C A;  5CKM A;  4Z92 B;  1F5F A;  4PF5 A;  2PAM A;  4AZZ A;  1CJD A;  3BPZ A;  1URX A;  3AXE A;  3FUQ A;  2JDA A;  5CG8 A;  2GDF A;  2E7Q A;  5CYY A;  3T0A A;  1S0I A;  1AL2 2;  1YIP A;  2ZGU A;  4E2G A;  4OI1 A;  3POF A;  3AP9 A;  5E8A A;  3K46 A;  1UNB A;  1VBE 1;  2X09 A;  4CTE A;  3CJX A;  3IPV A;  4ZS2 A;  4XBL A;  3VBF C;  2WN2 A;  1LNS A;  2AR6 A;  2RS3 1;  4MGQ A;  4M3C F;  2Q8D A;  3RJ2 X;  2D3R A;  3FC0 A;  1BK1 A;  2WR9 A;  4RL7 A;  5IHR A;  2E6V A;  2D6K A;  2VUL A;  4B4R A;  3JU9 A;  3UKN A;  3ZLI A;  1ZRI A;  5FYH A;  2RS5 3;  1EV1 1;  4FPG A;  5FBZ A;  1WD3 A;  3GDB A;  4JGZ C;  1UXZ A;  2P3Y A;  3N9P A;  2DBN A;  1CAW A;  3VKM A;  2LRP A;  4BPZ A;  3C7G A;  3CKH A;  3MW4 A;  2PFW A;  5LA2 A;  3LEI A;  2VQU A;  4BQ4 A;  1JZ8 A;  1VBE 3;  1CWP A;  1QJY 1;  2X05 A;  1OOP A;  4CCD A;  1OH4 A;  4R4X A;  4PIY A;  4JGY B;  1LOB A;  4GJY A;  4HVQ A;  2Q8C A;  3AP5 A;  4PCR A;  4UAP A;  5DQ0 A;  3CLP A;  3CIH A;  2C4X A;  4IND A;  5FY1 A;  4XAC A;  1WLC A;  1UIJ A;  2R07 2;  4AK3 A;  1HRV 1;  4IV3 C;  1JYW A;  5ABJ B;  4LE4 A;  3B00 A;  2WFF 1;  3WNM A;  1CZS A;  2J1E A;  3OJB A;  1FAT A;  4YVS B;  5FPB A;  3WV6 A;  4JRA A;  4XUN A;  3KZ4 C;  1QGL A;  4KU7 A;  4QDQ A;  5FP4 A;  2R1D A;  1ENQ A;  1RUI 3;  3H8U A;  2VBP A;  3WR0 A;  4YVW B;  4AWD A;  5EXO A;  4CDU B;  2WN3 A;  1K5M B;  2JKB A;  4PLO A;  1ODM A;  1VE0 A;  1HXS 2;  1RHI 2;  4YLZ A;  5CA6 A;  3VD3 A;  1AX0 A;  4KG0 A;  1W6M A;  1H0B A;  3TN9 2;  4AW7 A;  4C0B A;  1P8J A;  2FDJ A;  3I97 A;  3GBF A;  1MEC 1;  1W2O A;  3O0X A;  1VAM A;  1DQ6 A;  4XF1 A;  3ZYJ B;  2WNV C;  4GMP 3;  1O4Y A;  4JGZ B;  1ND3 A;  1GNH A;  3P6B A;  4GD4 A;  1YWK A;  3GZT B;  5BNO B;  4YM0 A;  3DL3 A;  4EV0 A;  3URF A;  1PVX A;  5JIU A;  1S2K A;  1W8T A;  5EYX A;  2ETE A;  3WQ0 A;  3LOB A;  1AJK A;  4KMQ A;  1OMI A;  4QMA A;  3MLK A;  2ZHM A;  4KBZ A;  4CCE A;  3D4K A;  5IJR A;  1CAU B;  4R9A A;  3LF7 A;  3K2O A;  4FPE A;  5H9Q A;  2VUA A;  3BIW E;  4GXL A;  3S7E A;  3ZYR A;  3A21 A;  3NWK A;  4UBG A;  3SCH A;  3KF5 A;  1DGW X;  2VZO A;  2CU5 A;  4RYD A;  1YQ6 A;  2WQ8 A;  3ZFE C;  3III A;  1N3Q A;  4KNC A;  3ZN6 A;  1UZV A;  4OLL A;  1QXR A;  2DFC A;  1OKO A;  2Y0I A;  3C7F A;  4LEJ A;  3O1V A;  2JG8 C;  2YBS A;  4FPO B;  1YRZ A;  4HKW A;  2XVK A;  2OT7 A;  2XJV A;  5JVV A;  5KHH A;  4GZ9 A;  4Q4Y 3;  3ZPY A;  2UY8 A;  5F2W A;  3WP6 A;  5T54 A;  2OQ6 A;  1VBD 3;  1FAY A;  2J1S A;  1DZQ A;  3MBW A;  3H3L A;  4ZU7 A;  3VD9 A;  4CU8 A;  4MET A;  5F6L B;  4CP9 A;  2JIG A;  5E1R A;  3WNL A;  1YO8 A;  3AMP A;  1REE A;  2QQO A;  2PHF A;  2WYS A;  3Q8A A;  2Y6H A;  4I01 A;  2JB8 A;  1TME 1;  1TMF 3;  1RUO A;  3LGR A;  4PIZ A;  5K9Y A;  2Z4F A;  4P5H A;  1PIV 1;  2W08 A;  1LHV A;  3NW4 A;  2O14 A;  1FPN 3;  1LCL A;  1RUG 3;  2R6Q A;  2RMU 2;  3H0O A;  4XF4 A;  4XFC A;  5EIY B;  3L9J T;  3OBZ A;  5LEJ A;  3MF9 A;  5BNP A;  1I9R A;  5BNO A;  2ZGT A;  2PAE A;  3SLI A;  2FZ2 A;  1DFQ A;  3WDX A;  2VME A;  3VHP A;  4K7J A;  3L2Y A;  2ZZJ A;  4FXK B;  4LO4 B;  2DTY A;  2R16 A;  1UU4 A;  2BER A;  4ZY9 A;  2J1T A;  2C9A A;  3JQW A;  1KIT A;  4IEZ A;  4OZO A;  5KXB A;  3MIF A;  3AK0 A;  5C33 A;  2P3J A;  4DOU A;  3M3O A;  5FYY A;  5K0U A;  4XQD A;  2WNO A;  4PI2 A;  4IGQ A;  3T08 A;  1JOP A;  4OZX A;  2ZGK A;  2XON A;  3H8O A;  5GLZ A;  3H8X A;  4QXC A;  2JDP A;  1O91 A;  2HYX A;  3P3N A;  4IGP A;  3FX3 A;  3SQO A;  4D3W A;  2FDG A;  4GH4 B;  2IXK A;  2SLI A;  4I0A A;  2B7Y A;  1BEV 2;  4NHK A;  3VD5 A;  2IXI A;  3NV1 A;  2C24 A;  1BBT 3;  2RR1 2;  3WNK A;  1MQT A;  3PUS A;  3VD4 A;  3AYA A;  2WO7 A;  4LPL A;  4AI8 A;  3ILR A;  1RUJ 2;  3U07 A;  3HNM A;  1T6G C;  4DEV A;  2R7E B;  3FL7 A;  3K3O A;  5BNQ A;  3AP4 A;  2PMW B;  3K4A A;  1W05 A;  3HAG A;  3LA3 A;  4HVR A;  4Q4W 3;  2YY1 A;  1VJ2 A;  1UOG A;  3PIJ A;  2Z5W A;  4Q8K A;  1W6Q A;  4BYY A;  1KFX L;  1W8H A;  3CJI A;  4QPI C;  4ISR A;  3HN3 A;  3VKF C;  3ZFF A;  2EA7 A;  1KFU L;  2ZA9 A;  3CEW A;  2RV9 A;  4E4Z A;  2A71 A;  2HBT A;  1R08 1;  1WBL A;  1RMU 3;  2ZMK A;  3JBG 2;  2YU1 A;  3POY A;  4NMI A;  4LIU A;  4FXG B;  2ZGO A;  3N7K A;  4P14 A;  3CJI B;  5DUX A;  2P6C A;  4F3J A;  4NAO A;  2D6N A;  4J1X A;  3IB3 A;  4FOV A;  4QM9 A;  1OD5 A;  1C8M 2;  4AQT A;  1UW8 A;  2GC1 A;  4ZU5 A;  1ND2 B;  3AC0 A;  2BRT A;  2V72 A;  4AYU A;  5JOX A;  2IVI B;  4J25 A;  1AR6 3;  2VNV A;  4O61 A;  4YFW A;  1IPS A;  4PLN A;  5DAW A;  2UU8 A;  5CNA A;  5F32 A;  3SXW A;  3O1T A;  2N7G A;  5SV5 A;  1OKQ A;  2WYF A;  3WX5 A;  1IHM A;  3EYP A;  1ZVF A;  4EN7 B;  2VZ3 A;  2CDO A;  2Y26 A;  4BA6 A;  4FTB A;  1QXP A;  2VPV A;  1RGS A;  3R4D B;  4GH4 A;  5FXW A;  1W39 A;  4D7Y A;  1Y43 B;  4CSW A;  2XH6 A;  3JD7 2;  4MXW B;  4UBH A;  1X82 A;  5I8T A;  2ORZ A;  1QJY 3;  4RR3 A;  4G4F A;  1DGR A;  1OQE A;  2A3W A;  1UZY A;  4NPM A;  4I09 A;  3PMS A;  1PO1 1;  1QNW A;  1X7N A;  3GHN A;  3LSD A;  4GB3 1;  4RN5 A;  3KD4 A;  4WM7 B;  5FYU A;  4QXH A;  2OW4 A;  2JG8 B;  4BLJ A;  2E9Q A;  3B69 A;  4OUM A;  1NYW A;  4W6X A;  4XHX A;  1GZ9 A;  2MEV 1;  3EB7 A;  5FPL A;  4N43 A;  2Q8O A;  1VBC 1;  4UF0 B;  3UKT A;  1JZ4 A;  2LS6 A;  2XML A;  2HWF 3;  1AXZ A;  4CP9 B;  3R0R A;  3AJZ A;  1NT0 A;  2Q0A A;  1RVF 3;  1UL9 A;  3WW2 A;  5A3O A;  1RL3 A;  3J7L A;  2I45 A;  4WZC A;  5FZG A;  2C0Z A;  3OUI A;  4OHW A;  1D2Q A;  2IFW A;  3OPT A;  4CCL A;  4D69 A;  4NID A;  3J8F 2;  3HPN A;  3LE0 A;  4Q4X 1;  3NKT A;  2VW0 A;  1U5Z A;  3OGJ A;  1SFP A;  2VL4 A;  4XUQ A;  5E89 A;  4CU7 A;  5L7O C;  1FMD 3;  4MYE A;  3ZDV A;  5FQ0 A;  3CNA A;  5K8S A;  3HR9 A;  4XXA A;  1TNF A;  1LED A; 
#chains in the Genus database with same CATH homology
 2QQN A;  3LEG A;  4CU9 A;  3CMG A;  3D3A A;  3SEE A;  3T2O A;  1H6X A;  1I5P A;  2XOM A;  4QDS A;  4QAW A;  4ARX A;  2VMD A;  4ET7 A;  1CIY A;  3OGV A;  1GOH A;  1JZ7 A;  2ZEZ A;  3A22 A;  3F2Z A;  3W5N A;  2J7M A;  4JX0 A;  3ETP A;  5G05 L;  1NX9 A;  4BK5 A;  3PUH A;  2VZP A;  2BBA A;  4W50 A;  5HPO A;  4HG6 B;  4CUB A;  3OEB A;  2QQJ A;  2VC9 A;  1GOF A;  4QX0 A;  2W91 A;  4LHS A;  3T2P A;  4JHZ A;  2V5D A;  1J83 A;  5B4X A;  3LEK A;  1SPP A;  3HNY M;  3A7Q A;  2VCC A;  5JUV A;  2J1R A;  2KD7 A;  1TG7 A;  3NRU A;  3WNN A;  1HN1 A;  4JKM A;  5JR2 A;  1JHJ A;  2OKX A;  4DUW A;  1RYY A;  4KWU A;  3T2Q A;  1JYN A;  4A41 A;  3IAP A;  3BGA A;  1UWW A;  2VR4 A;  1ULP A;  2RJ2 A;  2ZEW A;  1W99 A;  4ZXE A;  1DYO A;  3POB A;  4PT6 A;  1WKY A;  3NJX A;  4DXR A;  4QDR A;  1K12 A;  2QQI A;  3K77 A;  4CUC A;  4A3Z A;  3OG2 A;  4PF1 A;  3I2G A;  4JKK A;  5LA1 A;  4BXS V;  1PMJ X;  3ACH A;  3T0D A;  3C8X A;  1DLC A;  1W9S A;  4MGS A;  1ULO A;  5J1X A;  2X10 A;  3LPF A;  2QQM A;  2EIE A;  3ZM8 A;  2LW8 A;  5JMO A;  1UX7 A;  5A1A A;  2VZS A;  3OB8 A;  1UY4 A;  1W0N A;  2RVA A;  1K42 A;  3KQ4 B;  1NUK A;  1YQ2 A;  3OGR A;  1CZV A;  1EUT A;  4XUP A;  1OT5 A;  1CZT A;  1R64 A;  2WBK A;  1O8P A;  1DP0 A;  2YFZ A;  3C7E A;  1K45 A;  2BZD A;  4P00 B;  4D8M A;  3GM8 A;  4A44 A;  1EUU A;  1NKG A;  1OF4 A;  5I0D A;  4W8J A;  3THC A;  2W47 A;  2Y6K A;  3WF2 A;  2CDP A;  2C9K A;  1GU3 A;  4XZU G;  2WAO A;  5C71 A;  1F4H A;  4QPW A;  1UYY A;  3I3E A;  5JXH A;  1UXX X;  4LOT A;  1US3 A;  5CKQ A;  3VDC A;  4BJ0 A;  2WO2 A;  5C7G A;  2ORX A;  5G04 L;  3NJV A;  4L0P A;  3DEC A;  3IDA A;  3MUZ 1;  3I3D A;  4MAD A;  4TXW A;  5CZK A;  3I2I A;  3ECQ A;  1BHG A;  4DUX A;  1JI6 A;  2B4K A;  3T09 A;  3WSO A;  1L7Q A;  2W94 A;  5EJ1 B;  3W5M A;  1SZB A;  4FI9 A;  2V4V A;  1UYX A;  3ACI A;  4ARY A;  4A4A A;  2L9L A;  3C7H A;  3CZU A;  2WZ8 A;  1JYX A;  5C70 A;  3ACG A;  4XUT A;  1NZI A;  1W8N A;  3I2K A;  3DYP A;  4CUA A;  4DXT A;  3FHA A;  4E8D A;  2E32 A;  1US2 A;  4XUR A;  3VDA A;  2W1Q A;  3HJR A;  4E8C A;  2ID4 A;  4MO3 M;  2W1W A;  2VTF A;  1KEX A;  3ACF A;  3WF4 A;  1SG3 A;  2DCJ A;  3WF1 A;  2YG0 A;  1O8S A;  2QQL A;  3WNP A;  2J22 A;  3HOB A;  3IAQ A;  4QX1 A;  1GOG A;  2W5F A;  5CKM A;  3K75 B;  2XHN A;  3GGL A;  2DCK A;  2W92 A;  2JDA A;  4A42 A;  3WNO A;  5CYY A;  3T0A A;  2WUH A;  4GWJ A;  4IUG A;  3POE A;  2VM9 A;  2EID A;  3POF A;  3UNP A;  1JZ6 A;  3PUI A;  3K46 A;  2X09 A;  5DPN A;  5JXG A;  2VMC A;  2WN2 A;  1LNS A;  3DEM A;  4P5Y A;  4MGQ A;  1GNY A;  2Y6J A;  4P08 A;  5IHR A;  1UYZ A;  1NAE A;  3HEI A;  4QX3 A;  5CKN A;  4PQQ A;  2W3J A;  4XUO A;  3GDB A;  1JU3 A;  1UXZ A;  2VZR A;  3T0B A;  2E33 A;  2VJX A;  3C7G A;  3CKH A;  2ZXQ A;  2JKX A;  3THD A;  2WZE A;  1JU4 A;  5LA2 A;  3LEI A;  2VQU A;  1JZ8 A;  3A23 A;  2Y8K A;  2X05 A;  1OH4 A;  2J1V A;  1XNA A;  1IQD C;  2PQS A;  3WF3 A;  4UAP A;  5DQ0 A;  3C7O A;  3CIH A;  2C4X A;  3I2H A;  1W9T A;  2DDU A;  3SKV A;  5JXI A;  4OYU A;  1JYW A;  1T2X A;  2W46 A;  2VMF A;  3WEZ A;  3WNM A;  4LKS A;  1CZS A;  2J1E A;  3U37 A;  2J1U A;  4XUN A;  1UY1 A;  1GUI A;  3E1F 1;  1OD3 A;  4QDQ A;  4OMC A;  4LMF A;  4LOR A;  2WN3 A;  4A45 A;  4XVH A;  1JYV A;  2Y6L A;  3VD3 A;  3VD7 A;  1P8J A;  3I97 A;  5IFT A;  1XNT A;  2BGO A;  4BDV B;  3P6B A;  5IFP A;  5LCW L;  3JXS A;  3MV1 1;  1WCQ A;  3OEA A;  4DXS A;  4CVU A;  1GMM A;  4KMQ A;  3NNG A;  3NQH A;  4OMD A;  3OGS A;  5JXJ A;  5IJR A;  4QB6 A;  1MPX A;  1PMH X;  4UOJ A;  4A6O A;  2VCA A;  3POG A;  1PX4 A;  4QX2 A;  1SPP B;  3A21 A;  4YPJ A;  2VZO A;  4RYD A;  2WAB A;  3VDB A;  2WQ8 A;  3III A;  1JZ3 A;  2C26 A;  2VCB A;  3C7F A;  2QBX A;  1XC6 A;  3K4D A;  4GZ9 A;  3DYM A;  3I3B A;  2J1S A;  3MBW A;  2VO5 A;  5FUI A;  3WF0 A;  2B9V A;  3VD9 A;  1XPW A;  4CU8 A;  3BN6 A;  3WNL A;  2QQO A;  2WYS A;  2Y6H A;  3WQB A;  1W8O A;  2WO1 A;  2Z4F A;  4DEQ A;  2VQT A;  2YB7 A;  1H6Y A;  3J7H A;  3CQO A;  5EIY B;  1GQP A;  2VOT A;  4QB1 A;  2VME A;  4M4P A;  1L7R A;  2BER A;  2W1S A;  4ZY9 A;  4CU6 A;  2J1T A;  4OUE A;  4OZO A;  1UY3 A;  1F4A A;  2WNO A;  1SDD B;  1O59 A;  3T08 A;  2XON A;  4KI5 M;  2HYX A;  1UMI A;  3I2F A;  3POJ A;  4QB2 A;  3VD5 A;  4Z2A A;  2J1A A;  2YC2 A;  3WNK A;  1UY2 A;  4LOS A;  2JE8 A;  3VD4 A;  2VZV A;  2VZQ A;  4LPL A;  4JKL A;  3P1I A;  4AAX A;  3HNM A;  4DEV A;  2W87 A;  2R7E B;  3FL7 A;  3K4A A;  2VZT A;  4D0Q A;  3ABZ A;  2VZ1 A;  2YC4 A;  3HN3 A;  2RV9 A;  4DUV A;  4GWI A;  3SKJ E;  3CZJ A;  2Y6G A;  1J84 A;  1K3I A;  2EIB A;  3DYO A;  3IB3 A;  3MV0 1;  3POI A;  4UI9 L;  2E26 A;  2JD9 A;  3MUY 1;  3LQC A;  3UES A;  3AC0 A;  2V72 A;  2W1U A;  4W4Z A;  2QQK A;  5IYY A;  5B4N A;  1W9W A;  1OF3 A;  1D7P M;  3K4Z A;  2WO3 A;  1PX3 A;  3EYP A;  4BK4 A;  1UY0 A;  2VZ3 A;  4ZZ8 A;  1JZ5 A;  1CX1 A;  2CDO A;  5LA0 A;  3FHQ A;  5HXM A;  3LPG A;  5DN2 A;  2BGP A;  2HLE A;  2ORZ A;  1UZ0 A;  3HNB M;  3I2J A;  3UET A;  1SHW B;  2WDB A;  3SEP A;  4P02 B;  4ZZ5 A;  4AG4 A;  1JZ2 A;  5EJZ B;  2XQX A;  4RN5 A;  4M4R A;  3MO4 A;  2VZU A;  2WAA A;  3EB7 A;  5DMY A;  4MOA A;  1UMH A;  3OBA A;  1JZ4 A;  2LS6 A;  2YFU A;  2ZEY A;  5F7U A;  3GXU A;  2W95 A;  2W9X A;  1NT0 A;  1TVG A;  3FN9 A;  3HPN A;  3LE0 A;  2ZEX A;  2VL4 A;  4LQR A;  4XUQ A;  4CU7 A;  1SFP A;  2E31 A;  4TTG A;  1KGY A;  2EIC A;  3CDZ B;  2Y64 A;  5CIS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...