2QQLA

Neuropilin-2 a1a2b1b2 domains in complex with a semaphorin-blocking fab
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
576
structure length
554
Chain Sequence
PPCGGRLNSKDAGYITSPGYPQDYPSHQNCEWIVYAPEPNQKIVLNFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKHCGNIAPPTIISSGSMLYIKFTSDYARQGAGFSLRYEIFKTGSEDCSKNFTSPNGTIESPGFPEKYPHNLDCTFTILAKPKMEIILQFLIFDLCKYDWLDIWDGIPHVGPLIGKYCGTKTPSELRSSTGILSLTFHTDMAVAKDGFSARYYLVHQEPLENFQCNVPLGMESGRIANEQISASSTYSDGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLTAIATQGAISRETQNGYYVKSYKLEVSTNGEDWMVYRHGKNHKVFQANNDATEVVLNKLHAPLLTRFVRIRPQTWHSGIALRLELFGCRVTDAPCSNMLGMLSGLIADSQISASSTQEYLWSPSAARLVSSRSGWFPRIPQAQPGEEWLQVDLGTPKTVKGVIIQGARGARAFVRKFKVSYSLNGKDWEYIQDPRTQQPKLFEGNMHYDTPDIRRFDPIPAQYVRVYPERWSPAGIGMRLEVLGCDWTHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Neuropilin-2
publication title Structural studies of neuropilin/antibody complexes provide insights into semaphorin and VEGF binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 126
structure length 554
sequence length 576
ec nomenclature
pdb deposition date 2007-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00431 CUB CUB domain
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2qqlA03
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2qqlA04
2.60.120.290 Mainly Beta Sandwich Jelly Rolls Spermadhesin, CUB domain 2qqlA02
2.60.120.290 Mainly Beta Sandwich Jelly Rolls Spermadhesin, CUB domain 2qqlA01
3I3DA 2DCJA 3C7HA 3FN9A 3LEKA 5I0DA 2EIEA 4XUNA 1JZ6A 3T0AA 5IHRA 4QX0A 2VR4A 1NX9A 3THDA 1R64A 3MV11 3WF0A 2W5FA 2VZVA 4UAPA 2W3JA 4XUOA 4ET7A 2WABA 3P6BA 5IJRA 4D0QA 2Y64A 4P00B 4QDQA 5CZKA 3P1IA 3BN6A 1PMJX 3NRUA 3VD7A 1UY3A 2VM9A 4TXWA 2KD7A 4ARYA 3AC0A 1UY0A 4QDSA 1GOFA 1JYVA 3SKJE 4GWJA 4CU7A 2XOMA 3HPNA 2PQSA 4CUAA 2YC2A 3DYMA 5DN2A 4BJ0A 3T09A 1UMIA 5C70A 1KGYA 2VCBA 3HNBM 1XPWA 3K77A 3THCA 5IFPA 2VQUA 2VZPA 5LA0A 2EICA 1SPPA 2ID4A 5JXGA 4GZ9A 5C7GA 1XC6A 4LPLA 1DP0A 2JKXA 3A22A 4QX2A 1TG7A 2W92A 3T2PA 3NQHA 1JZ3A 4OYUA 1O8SA 1UY1A 3CQOA 1PX3A 3MO4A 2J1RA 3EYPA 3DECA 3FHAA 2V5DA 2WZEA 1GNYA 1XNAA 2WZ8A 2BGPA 2YFUA 3WNLA 3K75B 4DUVA 1UXZA 2WBKA 1UY2A 3OEAA 2VZUA 3WF1A 3NJVA 1XNTA 4RN5A 3MUY1 4P02B 1JYWA 3DEMA 4XUPA 3D3AA 4KI5M 5JXIA 2CDOA 3ZM8A 3LEGA 1JZ2A 3NJXA 4OMCA 2QQJA 3CZJA 5HPOA 4CUCA 5IYYA 2QQNA 3T2QA 1TVGA 3OGVA 1GUIA 2E33A 2VMDA 2QQIA 3I2IA 5B4NA 2W94A 2DDUA 3OG2A 2W1SA 2ZEXA 3A7QA 3PUHA 1J83A 4Z2AA 3ETPA 2BERA 1UWWA 3ACIA 4W8JA 1JI6A 2W87A 4MGQA 1H6YA 3FL7A 2YB7A 4LQRA 4E8DA 3GXUA 1WCQA 1ULOA 2OKXA 3POIA 4A45A 2QQMA 1ULPA 3LE0A 5CISA 1SZBA 4MADA 3UESA 2ORXA 2VCCA 5JR2A 4JX0A 4QPWA 3LPFA 1BHGA 2WAAA 3WQBA 4QB6A 4W4ZA 4XURA 2LS6A 1O59A 2ZEYA 2W46A 1SG3A 5HXMA 2WN3A 3KQ4B 3K46A 2J1VA 3OB8A 1F4HA 1L7RA 5CKMA 5CKNA 4A41A 2HLEA 3C7EA 1O8PA 3WEZA 1LNSA 4JKKA 2VQTA 1OT5A 4LOSA 2VZQA 3HNMA 4CU6A 4M4PA 4OMDA 5EJZB 3DYPA 4QB1A 4DUXA 3I3EA 2WO1A 3VD3A 1JU4A 1W8NA 1PMHX 4BK4A 4BK5A 2BBAA 3HNYM 3UETA 3GM8A 1UY4A 3K4ZA 4ARXA 2J22A 3POJA 4P5YA 1YQ2A 2W1QA 2EIDA 1JZ4A 4ZY9A 1F4AA 3VD5A 4BDVB 4CUBA 2VZOA 2WQ8A 3WF4A 1GMMA 3POEA 2X09A 4LKSA 3W5MA 2Y6JA 2YC4A 1SPPB 2VOTA 4RYDA 3IAQA 4W50A 5IFTA 1UYXA 2VZ3A 1NKGA 4HG6B 1JZ7A 1K45A 2Y6GA 1UYZA 1WKYA 5FUIA 2QQOA 2VZTA 2VL4A 4MO3M 2RVAA 2ZXQA 1GOGA 3CIHA 1JYNA 1OH4A 2VZ1A 2WDBA 5LCWL 2VC9A 5JXJA 2E26A 1JHJA 2VMEA 3I2JA 2WO3A 2JE8A 1W0NA 1W9WA 2WNOA 2YFZA 2E31A 2C9KA 4JKMA 3WNNA 4A4AA 4LMFA 5F7UA 4A6OA 4DXRA 3ACGA 1OF3A 2Y6HA 3DYOA 3IDAA 3OEBA 2C26A 2W1WA 1UZ0A 3HEIA 5C71A 2QBXA 3WF3A 4CU9A 4ZZ5A 5DPNA 1DLCA 4CVUA 3I3BA 4A42A 4XUTA 1SHWB 3CDZB 3K4DA 2Z4FA 1CZVA 3I97A 3HN3A 2QQLA 5JUVA 3UNPA 1NT0A 3EB7A 3T0BA 3SEEA 2VCAA 2J1UA 1K42A 3T2OA 4A44A 2CDPA 3HJRA 2VO5A 2W1UA 1OD3A 4PF1A 1GU3A 2Y6KA 4UOJA 3W5NA 2VZSA 5J1XA 1SDDB 4OUEA 4QB2A 2XONA 3VDAA 3WNOA 1MPXA 2RV9A 3CZUA 3HOBA 4GWIA 4XUQA 4ZXEA 1UMHA 3VDBA 2WUHA 3C7FA 4P08A 3WF2A 3POGA 1K12A 1RYYA 2BGOA 2W95A 4L0PA 2WAOA 4PQQA 2E32A 4AAXA 1UXXX 1CX1A 1D7PM 2B9VA 3A23A 3MUZ1 2XHNA 2J1TA 2JD9A 4QAWA 3CKHA 3POFA 3GGLA 2W91A 3IAPA 3IIIA 3NNGA 4KWUA 4D8MA 1W8OA 4QX3A 1JZ5A 3K4AA 1NUKA 3ABZA 3E1F1 3T0DA 2VJXA 3C7OA 4YPJA 4MOAA 4KMQA 3ACFA 2C4XA 2J1AA 3MBWA 3I2FA 5DMYA 4DXTA 1OF4A 3POBA 3F2ZA 2W47A 2WN2A 2J1SA 3I2HA 1NAEA 1GQPA 2EIBA 1US3A 3WSOA 1SFPA 1EUUA 2LW8A 1DYOA 1I5PA 4XVHA 2J7MA 3T08A 3SEPA 3WNMA 3U37A 1J84A 3I2GA 1CZSA 3LQCA 2WO2A 1HN1A 1JYXA 1IQDC 4DUWA 2R7EB 5A1AA 2WYSA 1JZ8A 1PX4A 1P8JA 4JHZA 4CU8A 5EJ1B 3CMGA 1US2A 3GDBA 3ECQA 3WNPA 2VTFA 3LPGA 2V4VA 3I2KA 3VD9A 2HYXA 2L9LA 4LOTA 3VD4A 2ZEZA 1CIYA 4A3ZA 4LORA 4LHSA 4ZZ8A 5G04L 2BZDA 2J1EA 3OGRA 4DXSA 3A21A 3J7HA 5DQ0A 1CZTA 3C7GA 3SKVA 2XQXA 2VMCA 4QDRA 4TTGA 3OGSA 3C8XA 4UI9L 4PT6A 4FI9A 5CKQA 5LA1A 5LA2A 4BXSV 5CYYA 4QX1A 2JDAA 1UYYA 3FHQA 5JMOA 2VZRA 3VDCA 4XZUG 3ACHA 1W9TA 4AG4A 1H6XA 1T2XA 5G05L 4MGSA 4OZOA 3IB3A 5B4XA 1W9SA 2RJ2A 1L7QA 5EIYB 2ZEWA 4DEVA 1W99A 4M4RA 2DCKA 4DEQA 4IUGA 2W9XA 2Y6LA 3PUIA 3MV01 2Y8KA 1UX7A 3JXSA 2QQKA 1K3IA 4JKLA 2X05A 3WNKA 1NZIA 2VMFA 1GOHA 2V72A 2ORZA 2YG0A 4E8CA 1EUTA 3LEIA 1JU3A 3OBAA 2X10A 2B4KA 1KEXA 3BGAA 5JXHA
chains in the Genus database with same CATH superfamily
3TEWA 4MV2A 1N3OA 2ZS6B 4GMP0 4QKNA 3OYWB 3USUA 2VOVA 3LEKA 4UF0B 4XUNA 4BB3A 4Y3OA 1PIV3 2VR4A 4KQ7A 5FXZA 3I4IA 1YFXA 5FK7A 2XJTA 3UKTA 4AEDB 5FYIA 2A6WA 2WABA 1LOFA 1NCRA 1X50A 4RD7A 4F3JA 4XMIA 1X8MA 5CADA 4JQTA 1ZYBA 3J7NA 4QDQA 5CZKA 4AW7A 2MNGA 2WJSA 4HMZA 5ANNA 3LSEA 2G9ZA 1PMJX 3T30A 4BIFA 3CU7A 3NV1A 4WZFA 4QQ2A 4QXKA 1ENXA 2KD7A 2D43A 3WHTA 4ARYA 4IEXA 1COV2 4FO9A 1MVQA 2XBO2 5IVFA 1Q56A 4K8RB 4MXWA 1UO9A 1ULFA 3B93A 3I49A 5IAVA 1POV3 4COZA 4AXOA 1MS0A 1MQTC 1JMUB 3RNSA 2R061 5DN2A 4M3CB 4E2GA 3NV3A 4WVVA 1JBCA 4Z82A 3U14A 4CDQA 1BXHA 1KGYA 2OS2A 4O9GA 3RQ0A 3ZX7A 1WCSA 2BRTA 4LEJA 4A7KA 4BQWA 3K77A 1GZWA 3N7KA 3UT0A 4CDQB 1GICA 1VBD2 1UW8A 1GZWB 2DF7A 2IWGB 3TEXA 2VQUA 3OD4A 3NW4A 2YXSA 4QXCA 2Q30A 5CBLA 1LOFC 1TEIA 1WZXA 2ZGLA 3B5LB 4GZ9A 3AP7A 5FO9B 2Z42A 3H1MA 3NMBA 2B39A 1XC6A 4LPLA 4DY5A 3NVCA 2VTXJ 3VZMA 1UZZA 1C1LA 4IGOA 4UW3A 3T2PA 3BALA 3FUQA 1W6NA 4B3NA 2VMIA 4BQYA 4BQ4A 5KXBA 1J3PA 1W6NB 1KQRA 2J1RA 3DECA 5JZGC 2E6VA 2V5DA 3AKRA 4HSLA 4EN0A 4YZ5A 1HB3A 4P9JA 4DUVA 5L7OA 4GKXA 2DVBA 2VZUA 1LKNA 5L7OB 1OLQA 2EAAA 1TE1B 1UZVA 1XNTA 2VE1A 1YWKA 4XUPA 3UJQA 1SFNA 5JXIA 3ZDVA 5C3OA 2YU2A 4Q8LA 1MS5A 2D93A 2ZAHA 5FWJA 1JS9A 4I3PA 1DQ5A 3OUHA 2XWJB 4OMCA 1Y43B 2ARCA 3CZJA 4YW4A 5FY7A 4K1ZA 1LULA 4ZHNA 3UYJA 1UOBA 4DIQA 1F8VA 4IDZA 2BEOA 4MSVA 4CP0A 3BOPA 4L9BA 2RS52 3IDEA 1JYCA 1TVGA 3NKGA 5F2WA 3T2QA 2QE3A 3AKQA 1GUIA 3GHMA 3OGVA 1AR62 1DZRA 1V9U1 2FDFA 1RMU1 2XJSA 1EY2A 1NA1A 1JXNA 1QXPA 1VLNA 2OA2A 2W94A 4MGZE 4ZONA 5KC5A 5L9RA 5LRSA 2ZGNA 1NA1B 4QM9A 1WGPA 2PHXA 4J6GA 3VBOA 1W3VA 2BJSA 2BERA 3ETPA 2XL7A 4UW4A 4W8JA 1JI6A 3VBOB 4MGQA 2Q8OA 3WY6A 5HCFA 3FL7A 4H7MA 2YB7A 4E8DA 4KWKA 3JUUA 1YC61 1QQP1 5DUXA 2B42B 2E9QA 5EYYA 4LA3A 2YDEA 4GWMA 4CCDA 2QQMA 2QQPA 1AYM2 4NPRA 3ZN4A 3SC7X 1PGW2 1ULPA 4I2OA 5JVVA 5FKBA 3LE0A 4OZXA 4MHRA 2E51A 2JX9A 2ORXA 2XLAA 2FCUA 4XABA 5E8AA 1W6MA 3PJYA 5A6YA 4LBJA 2CNAA 3WQBA 2TUNA 4XURA 1W6MB 3JD73 5FZGA 4Q4Y3 1NE6A 4FCAA 5C4WA 4QQLA 4MXVA 4XFBA 4IV1B 4PIXA 2WN3A 1XJAA 1W9FA 3KQ4B 4Q4X2 4QPGB 4YSFA 1V6NA 1VBB3 3FBYA 1D2SA 3GZAA 1O5UA 1CQ9A 1VP6A 3K46A 1WWYA 2YMZA 1WLDA 2VOXA 5C8CA 5CKNA 4RGKA 4D6RA 4A41A 3ZSJA 5C8CB 3O0VA 4M3CE 2HLEA 2GC3A 4FAGA 5JSRA 3C7EA 5F5CA 4R8HA 4AI9A 1LENA 1QJX2 4HLTA 2QJVA 4WM8B 5T55A 3WP3A 3PMSA 2VQTA 4WM7A 2VW1A 4MUVA 4LOSA 4OUMA 3BTAA 4Y1VA 5E88A 2FMDA 2FDJA 4YG0A 5JI7A 5DDJ1 4CU6A 4M4PA 4BQ3A 2F4LA 1FOD3 1MR5A 2DVFA 4Y33A 4MGTA 3EBRA 2YGMA 4V2WA 2P1BA 2D6MA 3AMMA 3R4SA 4R4ZA 3VB9A 2WO1A 2Y0IA 3CJIA 3WW3A 5ABJB 1FI2A 1W3XA 2RM21 3FWEA 2JDHA 1JU4A 4LXLA 1PMHX 1QHDA 1WCKA 1WUVA 3RMYA 1IPKA 1AYN1 1AR92 1YJKA 4RHV3 3S57A 4ONUA 3K4ZA 1RINA 2N7GA 4RS5A 2HWB2 3AP9A 1AR83 2I74A 3A4UA 4YLZA 5K8SA 5C9AA 1VPHA 1POQA 2W1QA 2WIIB 2ERFA 2WS93 4IE5A 5JIAA 3MF6A 1ZVFA 2Z2SB 4NHXA 3VD5A 3NSTA 5BNNA 1JZ4A 4PJYA 2PELA 2Y33A 4PF5A 4CCLA 1C1FA 2XB6C 5F32A 2GMEA 2PHRA 5EHDA 3THTA 3ES4A 3VBHA 5A3PA 4LE4A 5A3WA 2MPFA 3WF4A 3ME2A 1HRV1 3W5MA 1HV0A 4I02A 3AZXA 4J1XA 1WMFA 5DG2A 3TYJA 1T6BX 3VBHB 5FZ4A 1SPPB 4BLJA 5J37A 2VVEA 1PM7A 3IN9A 3IAQA 4LKDA 4N53C 4D7YA 4AYUA 2J42A 1D4M3 1UMZA 1WW4A 2KA3A 2G4IA 1O5LA 1OPOA 3BYWA 3RZGA 4R4XA 1D4VB 3DN7A 3D0SA 1IOAA 3HT1A 5A3MA 3CJIC 1VE0A 1PGL2 2XKPA 2RVAA 2ZXQA 3NAPB 1GOGA 3K3OA 2ZAAA 3ZPOA 2A5ZA 1JYNA 4H3WA 4CTEA 1OH4A 5J36A 1W8FA 2VZ1A 3GJBA 2CV6A 1CJPA 4O61A 1ND3C 2E26A 3IMMA 2PAMA 4AVCA 5I93A 1FMD2 3I2JA 5HI0A 2JE8A 3DXTA 1CJDA 1W9WA 2NM1A 2VW2A 1X8EA 4COVA 5JCTA 2YFZA 4HXCA 2C9KA 3MIHA 4JKMA 4O9EA 3UL2A 5FPZA 5BNPA 2Q8EA 1QOSA 2DURA 3ITQA 1UZWA 1QIQA 5FZFA 4XJUA 3WQ0A 4LUMA 1CAWA 5BNPB 1TME1 2VNRA 4OI4A 4FPLA 5JOWA 1CAWB 1XQNA 1GR3A 1VB4A 4TYSA 3IDAA 3OEBA 1BMV2 1WBFA 2W1WA 2WO7A 4C90A 2VVFA 1LU1A 1R082 2FHRA 2ZX2A 2R042 1VBE2 4KGGA 3JBG2 5DPNA 4BQ1A 4QHBA 2FDIA 1TNRA 4YZ4A 5I8YA 1S0DA 2RR11 5EZWA 1Z7S2 1ENSA 4XQWA 1FNYA 2OVUA 5GLUA 3K4DA 1PO23 2QQLA 1OSGA 2NPIA 1EAH1 3RSJA 1S4CA 4EE2A 4HVQA 1PO11 3EB7A 4CCEA 5C33A 3C3VA 3WP6A 2DCTA 1WCDJ 3WQ1A 1OQDA 2J1UA 5FZIA 4S2FA 3SMHA 3TN92 2XJQA 4P9XA 5A1LA 5ACA2 4OLLA 3ZXFA 1GU3A 5LK7B 4R52A 3PVBB 1G8WA 4H7LA 4UOJA 5FO7B 4AEJA 1YFWA 4Z92B 1ASJ2 4LHKA 1LJ7A 1SDDB 3NV2A 4OUEA 4QB2A 4E4HA 4JQRA 4FFIA 3OF1A 3VDAA 2NZ9A 3WW1A 2WL1A 4YARA 4CDXA 4LK6A 3HOBA 4GWIA 4JAAA 5I0UA 1N1TA 3V0AB 4P14A 1COV3 4XILA 1KJLA 2ZGKA 2XBO3 3FLRA 3DF0A 1REFA 3PUAA 4KBBA 4P08A 1SLLA 1BEV1 4QXHA 4X6QB 3ZO0B 2YHJA 2E32A 4IEQA 2ARBA 4I30A 1ULCA 5IK7A 1YQ5A 3O0WA 1D0HA 1O3QA 1D7PM 4PLOA 4YNIA 3ZN6B 5IVJA 2GP3A 1JHNA 4S2DA 5ANQA 4QQOA 3MFCA 2ZABA 1AXYA 3UKNA 3WDWA 4HK8A 5AC91 1GNZA 1RIRA 2P3KA 2A3YA 3UK9A 2JD9A 2QTWB 5FMBA 2ES3A 1VBD3 5LA9A 1UU6A 3HQRA 4TWTA 4Z07A 1HJFA 2K46A 5CVRA 3D4KA 4CEWA 3H8XA 2VCMA 1O7FA 2XVGA 1UF2C 4B1MA 3ZR6A 4KWUA 4Y1XA 5FZAA 3ABZA 3ZIXA 1W90A 2DFCA 1VBC2 3PIJA 3LB9A 4CDXC 4YPJA 1XU1A 3O1VA 2ZGQA 1F31A 1QJY2 2AC1A 3DGTA 4KMQA 4GALA 2PQQA 5BY5A 2EXJA 3M2MA 4WZCA 3JQWA 3LKJA 1H9WA 1TMF1 3HN1A 4W6XA 5DMYA 1DGWA 1OF4A 4R9BA 3Q8EA 3DKQA 1FPN1 3IM0A 3POBA 4QKFA 2ET1A 3Q8FA 1WW6A 2WN2A 1NLSA 1OA2A 5F5AA 4LULA 1GQPA 5FYMA 2W08A 1E57A 2W2IA 4KG0A 4PLNA 1EUUA 4C0HA 4LO8A 1VBA1 3KGZA 4M0HA 2J7MA 3AYDA 3WNMA 5FUPA 3U37A 2JENA 1CZSA 3N9QA 1BBT2 3VBRB 1R1A2 2QQWA 4CEWC 4HFSA 1QOTA 4Q5OA 1OPMA 4XCAA 1SLCA 1H2LA 2R7EB 2RS53 2ZGUA 5A1AA 2B45X 4I01A 4Q4W2 4EZHA 3CL1A 1AR63 3ZXLA 1PX4A 1ODMA 1JZ8A 1IGOA 4WVMB 1US2A 3FLTA 3LA7A 4BA6A 5BV6A 5F39A 1LGBA 4I3GA 3I2KA 5I8SA 2L9LA 2Q5TA 3AXDA 1GP6A 4LOTA 3VD4A 4KBZA 2ZEZA 3FE5A 3S7IA 1C5IA 4HN1A 4AVAA 5BUVA 2AYHA 3LWCA 1CIYA 2FDKA 5FZOA 1ND2B 4LHSA 3WHUA 2CWMA 4ZZ8A 4IV3C 1X33A 3TWIA 1AVBA 1AYM3 1C5HA 2IXCA 3MEPA 4GH4C 5G04L 4HONA 2WZPP 1RUD2 2W0XA 3MLKA 1PIV1 3BCWA 2J1EA 1PVC2 2QZ2A 1DLLA 1GNHA 3WT3A 4CYDA 1R092 1UZYA 3J7HA 2Y0OA 4IE7A 4Q1PA 4G9SB 5EFUA 1JN2P 5H9PA 1CGPA 1PM4A 1MZ5A 1YRZA 2AACA 3Q8BA 4QDRA 3C8XA 5IVVA 4UI9L 3MYXA 1UIKA 5FPBA 4PT6A 4OHVA 1J3QA 4LBKA 5FFOC 5CKQA 4FT8A 4A7YA 1NG0A 4RSUA 5LA1A 5LA2A 2XHKA 4Q4X3 1KDKA 3LDRA 1DGLA 3H9AA 4QX1A 4BMEA 3AYAA 4XCBA 1UOFA 5KWRA 1O4TA 1X9TA 2BFUS 2JKBA 4JGYB 1IG3A 3HT2A 3KD4A 2HWE2 3ACHA 3RMXA 3ZXJA 3BTYA 1H6XA 1QJX3 2E7TA 4QU2A 1UPIA 1T2XA 4OQ9A 4MGYE 4NVPA 1POV1 4HPKA 1ZBE2 4LKEA 2D98A 3KCXA 1QOOA 3BIWE 1QJZA 4GJZA 5CFDA 4AHZA 2ARAA 5GZDA 3HBZA 3O12A 3NWKA 2ZZQA 2ZEWA 4YVSC 4AGRA 3N3HA 4IUGA 2Y6LA 5H9SA 1IZ3A 2PTMA 1JYTA 1UX7A 3JXSA 4BM8A 3BB6A 5A7NA 3GBWA 2P37A 4JKLA 5F3CA 5A7SA 1AR93 3JQXA 5T3NA 3ZMOA 4P9WA 2VMFA 1AX2A 2V72A 1KS5A 2DBIA 2FDGA 2ORZA 1N47A 2HWB3 2ADDA 3FZ3A 4NRQA 3M70A 2YG0A 3SCGA 3H1YA 4MH0E 3N7MA 2A7AA 5FYCA 4Y1ZA 4EWDA 2H0BA 5FP9A 3VHRA 1XE7A 1UQXA 2OUJA 4W6YA 5A3UA 1XSQA 2H6BA 4YW1A 3C7HA 2VQ0A 3NNJA 1GZCA 4PI2A 2JXAA 3T0AA 1WBLA 4CEYB 4H2AA 1MS4A 2VUJA 1CAUA 1FATA 2W3JA 1CAUB 3IT8A 4QU1A 4EV0A 5CA6A 3I2DA 3VBSB 3U78A 2Y64A 5GLZA 2HWF2 3X29B 2B46X 1C28A 1I3HA 3ZXDA 4AR2A 4LE3A 1W8HA 1LRHA 5A7WA 3M3QA 4Y20A 5AFEA 3NRUA 1YXWA 1GLHA 1QWRA 3CBNA 5IAXA 4M00A 4FVVA 1RUJ2 2A6YA 1RXGA 1SLTA 3O7OA 5CU1A 1B09A 2PN5A 1JYVA 2X5IA 1VRBA 1C57A 3VBUA 3IPVB 1FMD3 1XYNA 4ZXKA 3SKJE 1UOJA 1HJGA 2X5IB 1AHSA 4IEYA 3HPNA 5K0UA 2Y26A 3B02A 5CB7A 1W0OA 4META 4UWDA 3UJOA 4CDWC 4Z1VA 3M3EA 2WFPA 2VCBA 2FMYA 3DCQA 1H8TA 3HNBM 3M7AA 3T1MA 4OUSA 4AF9A 2ZHNA 4AE2A 2HWC2 2BBVA 5FY9A 4XACA 2F6BA 3OY8A 3THCA 2R1DA 2EICA 5F6KA 3FLPA 3GNEA 1RHI2 2WFF2 4RR3A 4AEMA 4E4SA 4GD4A 1R083 4A7ZA 1MS9A 3ILNA 1CIWA 4BWOA 4KU8A 2R043 2WNUA 4NO4A 1Q8VA 1VBE3 4IERA 3JBG3 1LOGA 4RR3B 5T50A 3VHNA 4CDUA 4DZGA 5GZCA 3A22A 1HLCA 1Z7S3 1BKZA 4ES9A 1YYNA 2EALA 1LHVA 3CQOA 3KT4A 4I0WB 4Q4Y1 3ZXEA 4KL1A 3MO4A 4YGBA 3M8LA 3FHAA 2FZ1A 3ZYRA 2OW4A 2WZEA 3CHXA 1U5IA 1XNAA 4PCRA 4DO0A 2BGPA 1XNCA 2YFUA 4IE0A 1VBB1 1UD1A 2E7QA 4QD2A 3VBUC 3ACLA 3GZTB 4CP9A 1XYOA 1LOCA 1UXZA 2Q1ZB 2BWAA 2P6HA 1UY2A 2XUMA 1QXRA 4DY3A 1H4HA 3GBFA 2ZX0A 1WW5A 4XQDA 3NJVA 2QVSB 5FPXA 3TN93 5K0UC 4OQ8A 1DQ6A 5ACA3 1DHKB 3VKMA 1IHMA 1Q8QA 3E97A 4GJYA 1ASJ3 1H8TC 1JYWA 1DGWX 3D3AA 3FJSA 4GKYA 1WMXA 1W2NA 2JIJA 1BVP1 3U11A 4EWAA 3ZFEA 5HPOA 4NHMA 4CUCA 4NN0A 5HV4A 2VNVA 3PHMA 2QQNA 1C8M1 1W9YA 2SLIA 2WNUC 4E4DX 2R0FA 2E33A 2VMDA 4HN0A 1PMIA 2BQPA 2QQIA 3I2IA 3LA3A 2JEMA 4YZ3A 1MEC2 3B94A 2V73A 2W1SA 1YLLA 2XVLA 2ZEXA 2AZ5A 1VMJA 4Q4V3 1ZZCA 1CESA 2GMMA 1IS4A 4JGZB 4OHWA 2BTVC 4RHV1 5DAVA 1J83A 2A75A 5FKCA 4KU7A 4Z2AA 1QNYA 2RE9A 2BUKA 3VDDA 4XDOA 1AR81 2AREA 1JUHA 2IXLA 2KXLA 2W87A 3LDKA 4IE6A 4ITCA 3AFGA 4LQRA 2V4AA 1OLRA 1ULOA 1PNFA 4XE9A 5AVAA 1NCQA 1CN1A 5IVYA 3TOJA 4A45A 2WWSA 3BU7A 4RQPC 4MG2A 4X8NA 4F83A 3RYRA 3H8RA 2BYVE 1SACA 4MGIE 4QKBA 2WT1A 1A8DA 5FLHA 4ZU5A 5CISA 1SZBA 5FP3A 4B29A 3LDBA 5JR2A 1Q5OA 1QKQA 1KDMA 2YPDA 4F7ZA 2RS32 4NUBA 1VBC3 5JWPA 1BHGA 2WAAA 3EO6A 4DXZA 4QB6A 1QJY3 2LS6A 3ZFEC 5JOXA 2YBPA 2CAUA 4YM1A 3KM5A 4XZPA 1DFQA 1MQTA 4D7SA 2MEV2 1HN0A 3JU9A 3S5AA 2GU9A 1B35C 4XQ4A 2XG3A 3LA2A 3OB8A 4XBQA 5D21A 3OSDA 4BE3A 5I91A 1L7RA 3USUB 2YROA 3JB4C 1ZRRA 3MPBA 4AOCA 1W6QA 1DZQA 3ON7A 2JG8A 2OZ6A 3VDDC 1LESA 1O8PA 1LNSA 2MHFA 5D1IA 1UAIA 1OT5A 3ZFGC 1NCRB 2Y60A 5DXDA 1ZZ9A 3RRDA 1FV3A 4BCUA 1NCQC 1BBT3 3LOIA 1R1A3 2EA7A 3ILRA 2YV8A 3LAGA 1WD4A 2VNOA 3B00A 2XGXA 1LOEA 4Q4W3 3N7LA 3ZSKA 3CF6E 5JZGA 3VD3A 5KC6A 1IS6A 5FMOL 5FRAA 2HEWF 3J9SA 1W8WA 3HAGA 3OBTA 4XF3A 1XBFA 4BK5A 5B2GB 3BKZA 4MXWB 2D6OX 2BBAA 1H1MA 2XLFA 3GM8A 1XE0A 4H14A 1QMJA 2JB4A 1S0JA 2J22A 5AVPA 3T4HB 4ARXA 5KXEA 2XXZA 1OUSA 5J98B 5FPUA 3FHIB 3RG0A 1BCXA 2HWD2 4N43C 3VZNA 5GLVA 1VJ2A 3IIAA 3ZLIA 1AXZA 4JHTA 4XETA 2I2SA 2JG8C 4XJZA 1RUD3 3TEYA 2GAUA 4COYA 1J3RA 2WQ8A 1PVC3 1VMFA 1UIJA 1ZBA2 2X09A 3POEA 5L19A 3HBKA 5IVCA 1R093 3MICA 2X53S 4W50A 2BNOA 1UOGA 1ULDA 1EP0A 2WLQA 4UT5A 5GALA 4FPHA 4BQ2A 2LRPA 2ZPXA 3M3OA 1JZ7A 1IPSA 5FUIA 2E53A 3L2YA 1IKPA 3D8CA 4YW7A 5BXXA 1RUF1 3OJBA 4AEDC 2XJVA 5F2SA 5M0TA 4NAOA 1DU3D 3K3NA 1H30A 2GALA 3WP4A 1Y3TA 3AMPA 3KS7A 4FPGA 1COV1 1EV11 4O65A 3D5OA 1W05A 3AYCA 2XBO1 3B7MA 1N3PA 2HWE3 4BZ4A 3N7JA 1AX1A 2VC9A 5JXJA 1JHJA 3H7YA 4NE9A 4DNYA 2WO3A 5I0RA 3B9IA 4XYXA 3WW4A 1V6KA 1W0NA 2GN3A 5FXXA 1ZBE3 2WNOA 3J8F2 4XF1A 1WA6X 1DGRA 3MIFA 4LMFA 5F7UA 3WX5A 1U5YA 5DAQA 1F35A 4Y22A 4DXRA 4CSWA 4YM3A 4BYYA 1VBD1 4GIQA 2Y6HA 1G9DA 1RUG2 3ZR5A 1FT9A 2G19A 2QBXA 2TNFA 3KVAA 5FZ6A 3WF3A 3T2TA 4ZZ5A 1ULEA 4EJRA 1WCUA 1DLCA 2CY6A 3GJAA 5K7PA 3I3BA 2AR6A 3UGFA 2WA3A 1LHOA 1QJFA 1SHWB 2WNVA 4LBNA 2UYAA 1O3TA 2YZ4A 3WDYA 2OYZA 3N9PA 2WSVA 3I97A 3HN3A 5JUVA 1XB9A 1NT0A 2ZX1A 1BJQA 1HX6A 5J09A 4Q2FA 3SEEA 2VCAA 4Q0SA 1K42A 4FP2A 4EN7B 1A3KA 4B7EA 4DRVA 2XJRA 1NQJA 1MVEA 1YI9A 1EPZA 1OD3A 3PIGA 4HK9A 3U10A 2HWF3 1RUI1 1JYIA 4ASLA 4E27A 5J1XA 2VG9A 5FMDA 4AHWA 3VUOA 3OCPA 2NYYA 5FMCA 1PZ9A 2RDRA 1XXNA 3V0BA 5FZLA 3SLIA 4XUQA 1QEXA 5C4WB 3I7DA 4LO7A 1BQPA 3V0BB 4LO6B 2OIIA 3PLQA 1RUJ3 2YBSA 3VDBA 2RS51 2W95A 1AR61 2BGOA 4L0PA 4UXAA 5CIRA 2RM22 2PXJA 3WG3A 5LBFA 4E2QA 2R072 1NZCA 4OI2A 2GZWA 4ATFA 1V00A 2WNVC 4FPOB 1GWMA 4IEOA 1KFUL 3WG2A 4BHPA 1PK6C 5E6HA 5LRRA 5LASA 4WM7B 4AL9A 4N53A 2J1TA 1WD3A 3RYKA 4N53B 3WDXA 3RZZA 2HWC3 4YW2A 3LD8A 3CKHA 2B9UA 4LBOA 4ASKA 4M0NA 1H2KA 4NPLA 4P9YA 1AYM1 1PGW1 4QQHA 5J96B 1RHI3 2WFF3 1HRV2 1ZA7A 5K9YA 4AI0A 2FD8A 4L8QA 1YFYA 4V2VA 1G6NA 3CJIB 2ZBJA 4XFGA 4QX3A 2CGPA 3E1F1 2VJXA 4DQAA 5BYNA 1ND3A 4WBBA 4MOAA 1Q8SA 2BOJA 1ENRA 4RS5B 5EWSA 4P9IA 3MPPG 1ND3B 4N9IA 5FZEA 5L9BA 3RYPA 5C9AB 2OUHA 3EHKA 3VKOA 1HXS2 3V64A 3POYA 3NNFA 2RMU1 3E5UA 3L9JT 1QGLA 3O1RA 4FP3A 5EQUA 5BNNB 2BV4A 2A3WA 3VHOA 2YBKA 2W47A 4IEZA 1V6LA 2J1SA 1NAEA 1QF3A 2XQRA 2QDRA 1J1LA 4OI1A 4XMAA 5C3PA 2PAKA 4IV1C 2JE9A 1DYOA 1QJX1 2LW8A 5LZ6A 1K5MC 1AL21 1SMVA 1AR72 4Q0QA 2P2KA 4Q27A 4XVHA 3T08A 3ZYFA 4N7IA 1JH5A 4NPMA 1GWKA 3I2GA 2VY0A 3LQCA 4Y26A 1HN1A 3WDVA 4XTMA 4D6QA 1JYXA 1KS4A 1CAVA 4OVEA 5F3GA 4CE8A 5BNQA 5GLTA 5J7MA 3BPSA 4DUWA 1NLRA 2WC2A 5A33A 2E63A 2XUEA 1KFXL 3EXUA 4NHKA 5E16A 1J59A 2JD4A 4CU8A 1MEC3 2D6NA 3ECQA 1PNGA 3QCWA 4GMP3 5T5PA 4QT6A 3AKPA 3LPGA 3WINE 2X29A 4TLFA 1X36A 4PDWA 4K8FA 3VD9A 3RPQA 1X9PA 3P5BA 2HWB1 2HYXA 3KZ4C 3PU8A 4ATEA 4BOWA 4MLOA 1RUH2 3AL5A 2JDMA 3RFRA 5ABJC 3SH4A 5FZ0A 4LK7A 5ERLA 2ZGPA 1UN1A 2LUWA 3PDQA 4IEPA 1KD7A 5FUNA 3BUCA 1RUNA 3A0NA 4G4FA 3WV6A 3DKWA 2RJLA 1Y9MA 4NIDA 4DXSA 1OLMA 1FYUA 5FXVA 5JSPA 3FMGA 4ZPIA 2RS33 3C7GA 4QM8A 3SKVA 5L36A 4MHUA 5JLVA 2C5DA 4AI8A 4I0BA 5E89A 1YFUA 3Q8CA 3O1OA 2D6PA 2MEV3 5T5LA 2JG9A 4XDPA 1W03A 1YI7A 4QHZA 3KF5A 4BXSV 2ILMA 3H8OA 1V70A 1CX4A 1BEV2 4PDWC 3VDCA 2PHLA 2R16A 2ZGSA 4RGAA 2A73B 4NOTA 4BISA 2HH9A 4IXLA 2ZGRA 3OPWA 2QNKA 5GZGA 5C3QA 2ZKNA 2JIGA 3IDCB 1GZ9A 1H2NA 2HEVF 4KWJA 5IVEA 3PL0A 3AZYA 4LLFA 4Y5TA 3IBMA 2BDRA 4MGSA 5B4XA 2A1XA 3PUSA 2DYCA 1JW6A 2RDNA 1W9SA 2WA4A 4Q0UA 3ZKYA 4FQ4A 5CEHA 4AEKA 2AEZA 1C8NA 2NMOA 2VVDA 4DEVA 3AB0A 1N1YA 4EROA 2FBEA 4LO4B 5FCCA 4CDXB 3ELNA 1LHNA 1UU5A 1QJU2 4Q0PA 3N4MA 3PUIA 2DFBA 3MV01 1BMV1 2QQKA 3FC0A 1FXZA 1K3IA 1W8UA 3GCXA 2IXHA 3KHBA 4JC1A 3N9OA 3BODA 1R081 4AHXA 2X05A 3WNKA 1NZIA 1WMDA 1PGSA 4Q4V2 4CA9A 1ZRIA 2JG9C 3TBDA 4E8CA 1Z7S1 4P9GA 2OPKA 3LEIA 5FJKA 5HCHA 2HWD3 1VAMA 5D8AC 3MIDA 2DCJA 4CXWA 3O1MA 5APAA 3FN9A 2EIEA 5EP9A 3ZDSA 1VALA 1ZBA3 1M4WA 3WVJA 1LHUA 2AEYA 1NX9A 4NRPA 1R64A 2C6SA 4CEWB 3MV11 5GZEA 1XNBA 3WF0A 4UAPA 2GC0A 4ET7A 4ZS3A 2P3IA 3WCSA 1GSLA 1DG6A 2RS12 5A3NA 3P6BA 2HEYF 4D0QA 3KV6A 1ASJ1 2LALA 3R4DB 4PHZA 3KHCA 3N9NA 1AX0A 4XFAA 3S7EA 4E4ZA 1VRH1 5C5UA 3I3QA 1S1AA 4LBLA 3BN6A 1GV9A 3VD7A 2VOWA 4L2NA 2VM9A 2W39A 3BI3A 2XLGA 3ZFFA 1QH7A 1UY0A 2B7YA 2CYFA 3J7LA 1DDLA 3MW3A 4GXLA 2GNBA 1NXD1 1OKOA 4IV3A 4NWVA 4GH4A 4RL7A 5FYBA 3MZHA 1D0GA 2QKDA 3B01A 4IV3B 1G9AA 4TZDA 2AUYA 1RB8G 4B4QA 4CU7A 2XOMA 2PQSA 3RI9A 3LZZA 3J8F3 2YC2A 3DYMA 4N90A 1HRI2 4BJ0A 4QGLA 1W04A 2H6CA 2LROA 4Y5Z0 5F8PA 4AFBA 3H0OA 4CCMA 1O4ZA 3EJKA 4A2UA 4Q0VA 2P4EA 2ZGOA 2OPWA 3PURA 3HVDA 4QXBA 2BGCA 3KT7A 3OUIA 5LA0A 1RUG3 1DCSA 2ID4A 1ULGA 5JXGA 1NLQA 1O4YA 3QLQA 1IS5A 4CCCA 1FV2A 1DQ4A 2VD7A 1DP0A 1F5FA 1XSRA 2VW0A 2DVAA 2BPA2 4Q26A 1SBFA 1TG7A 1VBC1 2W92A 1G7YA 3VBFA 3A0KA 4OYUA 1XOYA 1YCIA 3BVCA 3Q9OA 1UY1A 5H9RA 4QPIC 3VZJA 1PX3A 3HQXA 1MZ6A 3ZFFC 2GC1A 4XXAA 1GNYA 2JECA 4XJ8A 1QXJA 3VL8A 5FYHA 4UFHA 2DTYA 4QKDA 4EN9B 2D6KA 1GWLA 5FZOB 3LF7A 5LBBA 3TAYA 2WBKA 3KV9A 3IKWA 3OEAA 4YVSA 5FOBB 3W58A 4PBOA 4CCKA 4FPKA 3R4UA 4EWEA 3QOPA 2DTWA 4W6WA 1W6PA 4YVSB 4D7TA 4AVSA 4RN5A 3ILFA 2EXIA 3MUY1 4YG3A 4COWA 4AFAA 2Z69A 4A3XA 1W6PB 1CVNA 4YM2A 4KI5M 1OA3A 4AQSA 1SLAA 3RZMA 3M1HA 4MVTA 2QQJA 1R1A1 4IE4A 2DUQA 2WYFA 4XFIA 2TEPA 1OH3A 1RUE2 3KVBA 5J48A 1AUYA 2VUAA 4LHNA 5IYYA 5KR7A 2BNNA 3ORJA 4M01A 1NE4A 2TBVA 3POWA 2GNTA 1S0GA 1UKRA 4Q4W1 3UGGA 2WZR2 3C2UA 3LSDA 2RM23 3NNLA 5A3OA 2Y6FA 5CAZA 2R073 2Q0AA 3VBFC 1H4GA 2VMHA 2Y38A 3POSA 4UBHA 4Z2WA 5IVBA 3GZUC 2HYKA 1WA4A 1W2UA 3ZYIB 2AENA 2DV9A 4IETA 4BU2A 3ACIA 4AI1A 5JIUA 4HPKB 4KGQA 4L99A 3WG1A 2JB8A 4Q29A 4HT1T 3O0XA 2CTVA 3E6DA 1YHFA 2XVKA 5FPVA 1H6YA 5FPLA 3W9AA 4DRRA 3DPRC 3GXUA 1WCQA 2A71A 3POIA 2OKXA 5CFDB 2PLV2 1FAYA 1HQWA 2VNGA 5C3SA 3H3ZA 3ENRA 1POV0 1HRV3 1RUD1 3PTRB 5IW0A 4D94A 1YO8A 1U5ZA 3VKLA 1OBNA 1PVC1 3I59A 4DINB 3UESA 1LOAA 2VCCA 1R091 5FQ0A 4JX0A 1OOPA 2FQPA 3SITA 4QPWA 3VHPA 1ND2C 3GHNA 3E6BA 3O5SA 4UFKA 3HR9A 1F5JA 3HMYA 4YW3A 5DZFA 1LB2A 2ZEYA 1SG3A 4MZUA 1NY72 4URTA 3LCPA 4EN8B 5HXMA 2QCSB 4IESA 1HXS3 4V1PA 5FO8B 4XHXA 4CDWA 4DS0A 5IT6A 2UY8A 4Z8BA 4CDWB 4NJ4A 2PMWB 1N3QA 4KNCA 4H55A 1ZREA 3RWNA 2BOIA 5CKMA 5A6ZA 5I8TA 5GJ6A 3CJXA 4FTEA 1MZFA 1OFNA 2FDHA 5LY2A 5T54A 1SBDA 4WVWA 3SH5A 2JDNA 1AR73 3H3UA 4UBGA 4K3UA 3V65A 3RS6A 3BU0A 2X8KA 1LGNA 3O1PA 1ALYA 1QJEA 3HNMA 5F5IA 4YM0A 3AJZA 4YWAA 3NL1A 5A7WB 5FLJA 4Y20B 4OMDA 4XIOA 3DYPA 4QB1A 4NROA 2D5HA 3N36A 5FREA 4FTBA 5FP7A 1OOPC 1FX5A 2A70A 3NJZA 2P3JA 4NRMA 5DUUA 4C1WA 4YVWC 5FTTC 4GB32 1W8NA 1HB4A 1O6UA 3H3LA 4YW6A 1SBEA 2JDPA 2ATFA 3U75A 5FAXA 3VBUB 3TRSB 1QDCA 2WINB 1NQDA 3POJA 1RUH3 1CR7A 4P5YA 1N1VA 5A1FA 4ISQA 5K0UB 1SFYA 1SLIA 3THPA 1MS1A 1F9KA 1H1IA 4QMAA 4NR1A 2O8OA 1H9PA 4HVRA 1H8TB 3MGUA 1XYPA 5SV5A 5KHKA 3PVNA 2W52A 4FFFA 2VZOA 1GP4A 3OY8B 4YRDA 2F4PA 2F17A 4LKSA 3KWVA 3ZSMA 2Y6JA 2YC4A 2VOTA 2ZMKA 4XFCA 4C91A 2GSYA 4XBLA 5IFTA 3KV5A 5LEKA 2VXJA 2VZ3A 2WNUB 5BNOC 2XJPA 4ZU7A 4CDUB 5ISLA 2HWF1 1AZDA 2OQ7A 4FXGB 4HG6B 1GBGA 3JD71 1WKYA 3ETQA 4LHLA 4K1YA 4CEYC 2HKXA 5IK5A 1XNKA 4QX5A 1VAKA 3KCCA 5FZ9A 1H8VA 5JMCA 4JVAA 3WLUA 2GNDA 4IEWA 2LTNA 5FZCA 5FMOS 1C8M2 3AJYA 3CIHA 3OTFA 5SV8A 3OGGA 1BEV3 1RUJ1 4CP9B 1T6GC 1LCLA 1VMHA 2WDBA 3VZOA 5TSWA 5LCWL 2ZX4A 1GFF2 2ZA9A 3FFZA 1I5ZA 2Z79A 3KV4A 4RQPA 4KWLA 2VMEA 3J26N 3I2OA 1G86A 3MW4A 1S2EA 4N7UA 1SQ4A 4QWNA 4RQPB 2Q8DA 4ZS2A 3G7DA 1URXA 2E31A 2PYTA 3WUDA 1IKQA 2PHWA 4K21A 2GP5A 5DUWA 1UKGA 2Q4SA 3RJ2X 3OD0A 3WDUA 4A4AA 4A6OA 2HWC1 4LKFA 1FOD1 3ACGA 4PQ9A 4TLGA 1A34A 1OF3A 1QJU3 3ZFEB 1BVVA 1E5RA 3DYOA 4FPEA 5CFCA 4FPCA 1HV1A 2C26A 5A80A 1UZ0A 5C71A 2D44A 4A6SA 1DQ1A 5FBJA 1B35A 4ZU4A 1W0PA 1L3JA 4CU9A 4S2GA 2ZCWA 4CPBA 1B35B 1LAJA 1RVF2 2VECA 2ZHKA 3VL9A 4CVUA 2ENRA 1LGCA 1RUC2 5IWFA 4UFLA 4FSJA 2QZ3A 4YGEA 5HXVA 3CDZB 3VDDB 5FJHA 1CZVA 3AM2A 3ZFGA 1GKBA 2WS91 5J3UA 4NIHA 4YGDA 4IEVA 2A6ZA 3UNPA 3T0BA 1ONAA 1UL9A 4HOOA 4OFGA 1NCQB 5HBAA 1TNFA 5LK5A 5KXCA 3O1UA 3IZOA 3SISA 1ENQA 4HSJA 3RGBA 4AK3A 1GZTA 4A44A 2WQ4A 3HJRA 3SCHA 2VO5A 2FCTA 2RS13 2QQUA 2VULA 3WZ1A 2Y6KA 4FFHA 3KSCA 4GULA 2VZSA 3R6SA 1D4M1 5DG1A 1LEDA 2VQAA 3KLSA 4Y4RA 5LWBA 4E2SA 3D0JA 3V56A 2XONA 4HANA 4LBQD 4NMIA 3CZUA 2P5BA 2RV9A 5FXWA 5CFCC 1MQTB 1Q43A 1PHMA 1YJLA 2WNEA 5HCAA 4ZXEA 3VZKA 4N43A 1ACCA 2WUHA 3C7FA 1UNBA 4FOYA 4AFCA 1K12A 4N43B 4PQQA 3PJQA 4Y1YA 2WAOA 5F1RA 2CGNA 3PU3A 2GH2A 1AJKA 3FX3A 2YUEA 1BK1A 1UXXX 1W6QB 3AFKA 1ZRCA 2I07B 2B5HA 2JG8B 1UYPA 3A23A 2R062 1HRI3 4MYEA 1W06A 1U0AA 3MUZ1 1PZ7A 1RITA 4DFSA 3O14A 1OURA 4CCOA 4AQTA 4E9KA 4QAWA 2HBUA 3OYWA 2YGLA 3GGLA 4UF0A 1DF0A 4YYOA 1GQHA 2W91A 2CSGA 2VGDA 2WQZC 4JGZC 4FXKB 2GDFA 4AEDA 1OD5A 5F5QA 4D3WA 2ZX3A 5JZGB 4ORFA 3W20A 1V6MA 1LEMA 4I09A 1W8OA 1JZ5A 3K4AA 4OCTA 1NUKA 3T0DA 2RS31 5A7PA 1L7LA 2WT0A 5C8WA 4BH9A 3KQRA 4XAAA 2YU1A 3ACFA 3ZPYA 3ZXKA 1LHWA 1RUOA 3MIEA 2MEV1 1RUF2 3S5QA 5JDBA 3I2FA 3U4SA 4IGPA 1GQGA 1PO21 5FPAA 2DUOA 2EF6A 2LM3A 4DXTA 1EV12 4B4PA 4PLMA 1X82A 2OXBA 4CUGA 1DYPA 3F2ZA 5FZMA 3W21A 1ZRDA 5FYZA 2NQYA 3P3PA 5KHHA 5JOZA 2EIBA 2IXKA 4RGGA 3WSOA 2Z5WA 1YQ8A 3H42B 3ASIA 4W65A 2D3SA 2VXRA 4M3CA 2R0HA 3I54A 1I5PA 2CU5A 3B9CA 3IMNA 5GM0A 4GQ7A 4BPZA 1CAXA 1JTZX 3HWJA 2WO2A 3H50A 3WG4A 4XF4A 3ZYGA 2HJIA 3U0ZA 3BOWA 1CAXB 2A6VA 4DPNA 1RUE3 5LATA 5A7OA 5LB6A 2R32A 5IUQA 1AXKA 3OGJA 5A32A 5KBFA 2WZR3 2WYSA 4JHZA 5A32B 1NCRC 1V9U2 2ZTNA 1RMU2 5EJ1B 3WNPA 1G9BA 1XU2A 2PHTA 2VTFA 1Y7BA 3N9MA 4F8AA 4P5HA 4IGQA 4CRQA 5A6XA 1J58A 5FZ7A 1REEA 4JV4A 1UPSA 2ET7A 1OC1A 3PNAA 4L97A 1KJRA 3WW2A 3RZKA 2HWD1 3KB5A 4IL7A 1CPMA 2PFWA 1QQP2 2PLV3 5AFBA 2EXHA 4Y22B 2DU1A 3DXUA 3AP5A 3PMEA 4TN7A 4AI2A 1ZBA1 3OGRA 3A21A 1IQAA 5E1RA 5FYSA 3AX4A 1CZTA 3D82A 4S2HA 4SBVA 4CDQC 2B8MA 5FP8A 3JZVA 1O3SA 1RUI2 2PA7A 3OGSA 3PUQA 3WD5A 4TTGA 4LO5B 1QU0A 3NV4A 1Q8OA 2OX0A 2IVJA 1WLWA 3M3CA 4HKWA 3O1TA 5IATA 4K9SA 1PK6A 4XOGA 2WNVB 5CYYA 2P6CA 3H8UA 4PI0A 1H2MA 2VBPA 1PK6B 4OHXA 3S0MA 4N8MA 2QQVA 1UYYA 1C4RA 2WKKA 5FOJB 3FHQA 2D3PA 4HKLA 2VZRA 5JMOA 2D7FA 2O8QA 4D6SA 3I8TA 1XE8A 2XDVA 4XZUG 1S2BA 2JWPA 4RA0A 1W9TA 4AG4A 1DIWA 4RFRB 2CGOA 1PZ8A 3WOGA 5G05L 2ZMLA 4UFMA 3J8F1 4BIOA 2Q1FA 2VH9A 4OZOA 3IB3A 4JTNA 5DDJ2 2AGSA 3AKTA 3AMQA 5L7OC 2D40A 5GZFA 5EIYB 3ATGA 1DZTA 1S0CA 2H0VA 4LIUA 1GYKA 2CAVA 1HQLA 2DCKA 4Q1RA 3KF3A 2W9XA 2WT2A 4XJWA 4DEQA 1CWPA 5HV0A 2Y8KA 1RUG1 2QDNA 4GB33 4INDA 1Z0HA 1W39A 2UU8A 3WR0A 1OHFA 2DVDA 1AYN2 2JJ6A 5FZHA 4C0BA 1GOHA 2W68A 4N9HA 5DABA 4HZFA 2K0GA 3CNAA 1EUTA 2EAKA 4X8PA 5FY8A 2IUWA 1SDWA 1I9RA 3GZEA 4HVOA 1JU3A 1NOVA 3CLPA 3OBAA 3M3IA 4IV1A 1K5MA 2B4KA 4QPGA 4YG6A 3BGAA 1H0BA 5A3TA 1K5MB 2DU0A 2CL2A 2PAEA 2RMU2 3I3DA 3ZXGA 1NA1C 3W59A 5I0DA 1RTVA 1A8MA 2P17A 1JZ6A 2YPJA 4PBPA 4J25A 5IHRA 3LFMA 4QX0A 2VBBA 3THDA 2EVXA 3VBOC 4WV8A 2VPVA 3OUJA 2IFWA 1W2AX 2VMGA 2W5FA 2VZVA 3PVOA 4GA9A 4GAZA 4RFT0 4WM8A 3RZJA 5FYTA 3VZLA 5IJRA 2NP0A 2O1QA 1AL22 2OZJA 3PVEA 1Q3EA 1U5XA 2JDYA 4P00B 5FK8A 1WLCA 2WRAA 1JOPA 1F2NA 1S0FA 3TEZA 3KCYA 3P1IA 4AFDA 3QH6A 1VR3A 1OVPA 2IFRA 3AYEA 1UY3A 4Q4X1 2G1MA 3RWKX 2C9AA 1C8M3 1W8ZA 4TXWA 3AC0A 4FPJA 1BLZA 1HQNA 1RC6A 3RDIA 5ABJA 1LODA 2ADEA 2RDSA 3VN4A 3OBZA 4QDSA 4QQPA 1A78A 4BXFA 1GOFA 2CHHA 4AGVA 5KHJA 1X7NA 2EXKA 2PHFA 3F95A 5LY1A 3T1LA 2IXJA 1VAVA 2D5FA 2R071 4GWJA 5EXOA 5C4WC 4CZSA 4QPGC 4CUAA 1O3RA 2XL9A 4LBQA 3T09A 3ROUA 2ZGMA 1YQ6A 1UMIA 2VUDA 5C70A 3U1XA 2BVBA 4IEUA 4LBQB 1XPWA 3IWZA 4LIVA 5C8CC 2FZ2A 1CONA 5FY1A 4YZ1A 1TME2 1CAVB 1O91A 2GNMA 2K9ZA 4UW6A 5IFPA 4WM8C 2VZPA 1U12A 1AJOA 1SPPA 4FOQA 3OBRA 3ZYBA 1JUIA 3S30A 1YEWA 5A33B 4WM7C 2OQ6A 3SH3A 2YY1A 5C7GA 4OULA 1EPWA 1AR91 1E5HA 1RVF3 1STMA 4YZ2A 4JDNA 2JKXA 5FZ8A 4QX2A 2D6LX 2E7AA 2RR12 3NQHA 1RUC3 4PDWB 1JZ3A 1W28A 3OPTA 2G9FA 2RHPA 5F37A 1O8SA 2XR4A 4LA2A 2UURA 3GBGA 1DQ2A 3P3NA 3EYPA 3WUCA 3NAPA 4YGCA 1DBNA 1EAH2 1HXS1 5EYXA 4AWDA 4LITA 2WZ8A 1PO12 3WNLA 3K75B 1QDOA 3PTYA 5A3LA 3TNPB 4EYUA 1DQ0A 1S55A 3UKVA 4RS5C 2GC2A 3WF1A 4B4RA 2ZOEB 5C6CA 2R1BA 3WXPA 4CP1A 5C9AC 1VIWB 2IVIB 5LBCA 5EPAA 4P02B 1UX6A 3K48A 3DEMA 1AR71 5BNNC 2RG4A 3MIGA 2CDOA 3ZM8A 3LEGA 4LT5A 4JCKA 1MS8A 2OT7A 4URAA 1JZ2A 1NXMA 3NJXA 3VBHC 3N9LA 1N1SA 2JG9B 1PGL1 1NYWA 3AP6A 5T52A 3KT1A 3ZYJB 4QX8A 5FDBA 4LBMA 5D8AA 5CNAA 4XW3A 5B4NA 3NJYA 4Y4YA 3VKNA 2Y34A 2WWUA 5D8AB 4AI3A 3SNMA 3OG2A 2DDUA 2DWRA 4HKOA 4FTSA 3A7QA 3PUHA 5CG9A 1XNDA 1FMD1 5LBEA 3K51A 1I6XA 1H1AA 1WW7A 2R063 1HKDA 2DUPA 2XH6A 4FPYA 5FYYA 5JI9A 3NAPC 1UWWA 2XKOA 3G6JB 3H7JA 1RUH1 3U07A 5AC92 5L73A 2V5YA 3MHZA 1Y9GA 3LIHA 5K4LA 5FV3A 4NIGA 2XPJA 4R9CA 3T4VA 1TQ5A 2D97A 2HBTA 3B3QE 3ZN5A 4JTOA 4AVVA 3ZSLA 4HETA 4FAHA 4EN6B 1AF9A 2VTXA 3ZSEA 4B1LA 1WLTA 2XMLA 3JCIA 5F3EA 2JE7A 5BPXA 5EV7A 4MADA 3KMHA 3SQOA 5GKAC 2GN7A 2R041 1VBE1 4XFHA 2K2SA 3JBG1 5BNPC 5L9VA 3LPFA 4JRLA 4W4ZA 4BQXA 1LTEA 1O59A 1VRH2 4LUKA 2W46A 3V0AA 1S0IA 1RUF3 3AMNA 3FUOA 3GCWA 4K40A 3MIBA 4FQZA 2UY9A 4M3CF 4QHOA 3VGIA 1HB1A 1TMF2 1UU4A 3GYDA 4XF9A 1ST8A 1EV13 4QPYA 2J1VA 5A6QA 1FPN2 4YFWA 1F4HA 1KXGA 3ZN6A 2KR2A 4TSVA 3TN91 3WEZA 5ACA1 4JKKA 2UWAA 3MW2A 1VBA2 4U36A 5FLIA 3WP5A 1S0EA 3O1SA 4C1XA 3N35A 4AZZA 2VZQA 2R30A 3MFAA 2NMNA 1ZRFA 3ZYPA 2G9GA 4BQ5A 3AL6A 4J1WA 4G3YC 3AMHA 4LJHA 4QPIA 4JDOA 5EJZB 4DUXA 1QJU1 1OMIA 1RGSA 3I3EA 4QPIB 4EQVA 4JRAA 1V9U3 3ZFFB 1RMU3 3ZYHA 4BK4A 4DB5A 4I0AA 3LFIA 4AQ2A 3HNYM 1XRUA 3UETA 4GH4B 1UY4A 4Q4V1 3QBQA 4CPBD 1V6OA 4UFJA 1RXFA 1CD3G 3QACA 4HL0A 2DVGA 1YQ2A 5LW9A 2VU9A 2EIDA 5FZ3A 3NKTA 4LR4A 4UYBA 1OVSA 1QQP3 1F4AA 4ZY9A 5A7QA 5C5TA 5KHGA 4BDVB 3M4FA 4CUBA 5HCBA 1M06G 4LNVA 5GLWA 1OLME 5DAXA 3ES1A 4HBNA 4ISRA 1PIV2 1GMMA 2A3XA 3AZZA 1IS3A 2WSUA 2VOKA 2VBDA 4XPVA 5C3RA 2JDZA 4UW5A 2DBNA 4RYDA 3WQ7A 5IK4A 3BTZA 1UYXA 3DUIA 3LOBA 1RUI3 2RS11 1YIFA 3DV8A 1NKGA 3K2OA 4QGNA 4XIKA 1ZA4A 4AVTA 2BW8A 5JPNB 5CG8A 3AZVA 1VB2A 3VBRA 1QJY1 1K45A 2Y6GA 1OKQA 1UYZA 3VBFB 1OQEA 1APNA 2UWCA 2QQOA 2GMPA 2ZMNA 2VL4A 2VZTA 4MO3M 5KHIA 1ZZBA 4Y1UA 3ZKUA 2EIGA 3AKSA 5EJ3A 2O0OA 1JODA 4WVMA 3DPRA 5FP4A 3U4XA 3ZVXA 4AVBA 1HB2A 4FBFA 2SBAA 3DPRB 4AHYA 4BMBA 5JSOA 2UYBA 2Q8CA 3ALQA 4B7KA 1LECA 1DYKA 4CXYA 2D3RA 2ZHMA 3NNMA 2WLPA 2WWJA 1HRI1 2BWCA 1GANA 1HW5A 3EMRA 3MLLA 3WNNA 1HDKA 5DDJ3 2JDKA 1ND2A 1BBT1 4WVZA 1A6CA 4K20A 1EYBA 1D2QA 1DGRN 4DMIA 4PIZA 5T5OA 1MACA 1ZNPA 1Y4WA 3HD8B 2KM2A 4XDQA 2FCVA 3VKFC 3HEIA 2IXIA 4PIYA 4YW5A 4CCJA 3WDTA 1AYN3 3VBRC 3HQUA 4XTPA 2ARXA 4XHBA 3URFA 2ZACA 1I1EA 4A42A 4XUTA 3RZHA 1BK0A 1OFSA 3WCRA 1FNZA 2DCYA 4XUOA 2Z4FA 1SLBA 3E5QA 4XJAA 4XXPA 3FFQA 2RMU3 4FFGA 1TZOA 3EQEA 4R9AA 1OQ1A 1SEFA 2DCZA 4JGYA 4FOWA 5F3IA 1GP5A 1V6IA 1Z78A 4Y5SA 2RJKA 3T2OA 2CDPA 2W1UA 3I59B 4PF1A 5FYVA 5JPMB 1AL23 3UV9A 5FQ0B 2ZKLA 2YYOA 3W5NA 4YVWA 1OOPB 3LGRA 1AL0G 5LEJA 1K5JA 3OPZA 4YVWB 1LOBA 4XF0A 1YNAA 1JOBA 2RDQA 3WNOA 1MPXA 3LIGA 3R0RA 3HIFA 1RUE1 3LEMA 3BIEA 3AZWA 1UMHA 2R6QA 3POGA 5IK8A 4LTAA 3WF2A 1RYYA 2JDUA 2WZR1 4GWNA 5FZKA 1V0AA 2ZZJA 3AVSA 4AQ6A 3SCFA 2HWE1 4AAXA 3INAA 1ZZ8A 5FR3A 1CX1A 1G9CA 5T5JA 2P34A 1WMEA 2B9VA 1YQCA 1C3HA 2C24A 1ZBE1 1ZZ6A 1OUXA 2V09A 1RJ7A 2XHNA 3J4UH 4JGYC 3KGLA 4L11A 5BNOA 1TME3 3POFA 5D2AA 4Y24A 4JZRA 5BNOB 4KH9A 4NWWA 2PLV1 5FBZA 4UFIA 4CEYA 4C8DA 1W6OA 3BTXA 3WNXA 3IAPA 3GALA 3IIIA 2IZWA 1YUDA 3NNGA 1W6OB 1IG0A 4OHZA 3VLBB 4D8MA 3MI8A 3VBSA 3MLJA 5FIXA 3C7OA 5CFDC 2RR13 3OOXA 5JAXA 3I3MA 1R1ZA 1ZM1A 1QH6A 2BP6A 1RJ8A 3JD72 2BU9A 5FY4A 4Q4Y2 1LR5A 1NY71 2C4XA 3CO2A 2J1AA 2XWBB 3MBWA 1EAH3 1PO13 2YC0A 4BLIA 4NHLA 1VBB2 4CXXA 3QD6A 5DUVA 3USSA 2BVVA 2JICA 3IDBB 3IPVA 3I2HA 4L92A 1CPNA 5FY5A 3ZXAC 1US3A 5KXDA 3Q8AA 1SFPA 4X6RB 1G9FA 3SXWA 4FPFA 4K6BA 3J7MA 5JOYA 3SEPA 1J1TA 1OI6A 1J84A 3BPZA 2A6XA 4AFMA 5DAWA 3JB8A 4CP2A 4OHYA 2P3YA 3L2HA 1IPJA 5FYUA 3VV1A 3RZLA 1IQDC 1FOD2 1QNWA 2WR9A 1RL3A 2ZGTA 3ZOIA 1BYHA 2PHDA 3QH7A 4NIAA 3VBSC 4KG8A 2C1FA 4NIIA 2QUOA 1P8JA 5FZDA 3CMGA 3GDBA 2PHUA 2UWBA 1JOJA 4GB31 2BFUL 5DZGA 1S2KA 5FY0A 4EZ4A 3R05A 3T3YA 1SCRA 2V4VA 4P9LA 3TNQA 3ZIWA 4RHV2 3NO8A 5JR7B 4D69A 5AC93 1PVXA 1UCXA 1AR82 3D6EA 3E5XA 2AH2A 1W2TA 2VAUA 4A3ZA 2WS92 4LORA 3E6CC 3CEWA 4ASMB 4DOUA 5I0TA 1ZZ7A 4ES8A 1F15A 2X5IC 3RJRA 3MF9A 1BZWA 2BZDA 5FZ1A 1RHI1 2WFF1 4XC9A 4YFZA 3TB0A 5CFCB 3AVRA 3GF6A 1HIXA 5DQ0A 1KRIA 4MGKE 1YIPA 1ODNA 2XQXA 2VMCA 5A70A 3FBMA 3ST7A 1D4M2 2ETEA 1W8TA 3AP4A 1VRH3 2BNMA 1V6JA 4K7JA 2GH8A 4FI9A 1REDA 4IW3A 2VUCA 3AK0A 4XJ9A 1TMF3 3APBA 4RR3C 2JDAA 1E5SA 4XFFA 3ZFGB 1OXCA 1FPN3 3B69A 2CWSA 5H9QA 4ZKTB 4CDUC 3UGHA 4B8EA 3DL3A 2NLRA 3RVHA 2ZJCA 4JGZA 4IQPA 4U2AA 4XBNA 4Q8KA 5F9TA 1VBA3 1SCSA 4O7XA 1OA4A 4FOVA 3SHRA 4LLOA 1QY4A 4MX3A 3AXEA 4QGMA 2XJUA 2I45A 2RJ2A 1ZX5A 1L7QA 4CCNA 4AGGA 2NN8A 5DAPA 3RI8A 3S6PA 1W99A 4NHYA 4M4RA 1LU2A 4SLIA 1MS3A 5FZBA 4COUA 1S0BA 3H1WA 3ZMNA 4JDMA 1Y9QA 5DZEA 4AAPA 2O14A 1MEC1 4OI0A 2QFEA 2ZHLA 1W2OA 4GMP1 4NAMA 4R9DA 1KITA 4QX7A 1RVF1 5I0SA 1MZEA 2Q1MA 5F6LB 4XEZA 2C0ZA 1RUC1 1Q8PA 4XAEA 2X10A 1E5IA 2R49A 3MDPA 2IC1A 1KEXA 5JXHA 5FWEA 1PO22
chains in the Genus database with same CATH topology
3I3DA 2DCJA 3C7HA 3FN9A 3LEKA 5I0DA 2EIEA 4XUNA 1JZ6A 3T0AA 5IHRA 4QX0A 2VR4A 1NX9A 3THDA 1R64A 3MV11 3WF0A 2W5FA 2VZVA 4UAPA 2W3JA 4XUOA 4ET7A 2WABA 3P6BA 5IJRA 4D0QA 2Y64A 4P00B 4QDQA 5CZKA 3P1IA 3BN6A 1PMJX 3NRUA 3VD7A 1UY3A 2VM9A 4TXWA 2KD7A 4ARYA 3AC0A 1UY0A 4QDSA 1GOFA 1JYVA 3SKJE 4GWJA 4CU7A 2XOMA 3HPNA 2PQSA 4CUAA 2YC2A 3DYMA 5DN2A 4BJ0A 3T09A 1UMIA 5C70A 1KGYA 2VCBA 3HNBM 1XPWA 3K77A 3THCA 5IFPA 2VQUA 2VZPA 5LA0A 2EICA 1SPPA 2ID4A 5JXGA 4GZ9A 5C7GA 1XC6A 4LPLA 1DP0A 2JKXA 3A22A 4QX2A 1TG7A 2W92A 3T2PA 3NQHA 1JZ3A 4OYUA 1O8SA 1UY1A 3CQOA 1PX3A 3MO4A 2J1RA 3EYPA 3DECA 3FHAA 2V5DA 2WZEA 1GNYA 1XNAA 2WZ8A 2BGPA 2YFUA 3WNLA 3K75B 4DUVA 1UXZA 2WBKA 1UY2A 3OEAA 2VZUA 3WF1A 3NJVA 1XNTA 4RN5A 3MUY1 4P02B 1JYWA 3DEMA 4XUPA 3D3AA 4KI5M 5JXIA 2CDOA 3ZM8A 3LEGA 1JZ2A 3NJXA 4OMCA 2QQJA 3CZJA 5HPOA 4CUCA 5IYYA 2QQNA 3T2QA 1TVGA 3OGVA 1GUIA 2E33A 2VMDA 2QQIA 3I2IA 5B4NA 2W94A 2DDUA 3OG2A 2W1SA 2ZEXA 3A7QA 3PUHA 1J83A 4Z2AA 3ETPA 2BERA 1UWWA 3ACIA 4W8JA 1JI6A 2W87A 4MGQA 1H6YA 3FL7A 2YB7A 4LQRA 4E8DA 3GXUA 1WCQA 1ULOA 2OKXA 3POIA 4A45A 2QQMA 1ULPA 3LE0A 5CISA 1SZBA 4MADA 3UESA 2ORXA 2VCCA 5JR2A 4JX0A 4QPWA 3LPFA 1BHGA 2WAAA 3WQBA 4QB6A 4W4ZA 4XURA 2LS6A 1O59A 2ZEYA 2W46A 1SG3A 5HXMA 2WN3A 3KQ4B 3K46A 2J1VA 3OB8A 1F4HA 1L7RA 5CKMA 5CKNA 4A41A 2HLEA 3C7EA 1O8PA 3WEZA 1LNSA 4JKKA 2VQTA 1OT5A 4LOSA 2VZQA 3HNMA 4CU6A 4M4PA 4OMDA 5EJZB 3DYPA 4QB1A 4DUXA 3I3EA 2WO1A 3VD3A 1JU4A 1W8NA 1PMHX 4BK4A 4BK5A 2BBAA 3HNYM 3UETA 3GM8A 1UY4A 3K4ZA 4ARXA 2J22A 3POJA 4P5YA 1YQ2A 2W1QA 2EIDA 1JZ4A 4ZY9A 1F4AA 3VD5A 4BDVB 4CUBA 2VZOA 2WQ8A 3WF4A 1GMMA 3POEA 2X09A 4LKSA 3W5MA 2Y6JA 2YC4A 1SPPB 2VOTA 4RYDA 3IAQA 4W50A 5IFTA 1UYXA 2VZ3A 1NKGA 4HG6B 1JZ7A 1K45A 2Y6GA 1UYZA 1WKYA 5FUIA 2QQOA 2VZTA 2VL4A 4MO3M 2RVAA 2ZXQA 1GOGA 3CIHA 1JYNA 1OH4A 2VZ1A 2WDBA 5LCWL 2VC9A 5JXJA 2E26A 1JHJA 2VMEA 3I2JA 2WO3A 2JE8A 1W0NA 1W9WA 2WNOA 2YFZA 2E31A 2C9KA 4JKMA 3WNNA 4A4AA 4LMFA 5F7UA 4A6OA 4DXRA 3ACGA 1OF3A 2Y6HA 3DYOA 3IDAA 3OEBA 2C26A 2W1WA 1UZ0A 3HEIA 5C71A 2QBXA 3WF3A 4CU9A 4ZZ5A 5DPNA 1DLCA 4CVUA 3I3BA 4A42A 4XUTA 1SHWB 3CDZB 3K4DA 2Z4FA 1CZVA 3I97A 3HN3A 2QQLA 5JUVA 3UNPA 1NT0A 3EB7A 3T0BA 3SEEA 2VCAA 2J1UA 1K42A 3T2OA 4A44A 2CDPA 3HJRA 2VO5A 2W1UA 1OD3A 4PF1A 1GU3A 2Y6KA 4UOJA 3W5NA 2VZSA 5J1XA 1SDDB 4OUEA 4QB2A 2XONA 3VDAA 3WNOA 1MPXA 2RV9A 3CZUA 3HOBA 4GWIA 4XUQA 4ZXEA 1UMHA 3VDBA 2WUHA 3C7FA 4P08A 3WF2A 3POGA 1K12A 1RYYA 2BGOA 2W95A 4L0PA 2WAOA 4PQQA 2E32A 4AAXA 1UXXX 1CX1A 1D7PM 2B9VA 3A23A 3MUZ1 2XHNA 2J1TA 2JD9A 4QAWA 3CKHA 3POFA 3GGLA 2W91A 3IAPA 3IIIA 3NNGA 4KWUA 4D8MA 1W8OA 4QX3A 1JZ5A 3K4AA 1NUKA 3ABZA 3E1F1 3T0DA 2VJXA 3C7OA 4YPJA 4MOAA 4KMQA 3ACFA 2C4XA 2J1AA 3MBWA 3I2FA 5DMYA 4DXTA 1OF4A 3POBA 3F2ZA 2W47A 2WN2A 2J1SA 3I2HA 1NAEA 1GQPA 2EIBA 1US3A 3WSOA 1SFPA 1EUUA 2LW8A 1DYOA 1I5PA 4XVHA 2J7MA 3T08A 3SEPA 3WNMA 3U37A 1J84A 3I2GA 1CZSA 3LQCA 2WO2A 1HN1A 1JYXA 1IQDC 4DUWA 2R7EB 5A1AA 2WYSA 1JZ8A 1PX4A 1P8JA 4JHZA 4CU8A 5EJ1B 3CMGA 1US2A 3GDBA 3ECQA 3WNPA 2VTFA 3LPGA 2V4VA 3I2KA 3VD9A 2HYXA 2L9LA 4LOTA 3VD4A 2ZEZA 1CIYA 4A3ZA 4LORA 4LHSA 4ZZ8A 5G04L 2BZDA 2J1EA 3OGRA 4DXSA 3A21A 3J7HA 5DQ0A 1CZTA 3C7GA 3SKVA 2XQXA 2VMCA 4QDRA 4TTGA 3OGSA 3C8XA 4UI9L 4PT6A 4FI9A 5CKQA 5LA1A 5LA2A 4BXSV 5CYYA 4QX1A 2JDAA 1UYYA 3FHQA 5JMOA 2VZRA 3VDCA 4XZUG 3ACHA 1W9TA 4AG4A 1H6XA 1T2XA 5G05L 4MGSA 4OZOA 3IB3A 5B4XA 1W9SA 2RJ2A 1L7QA 5EIYB 2ZEWA 4DEVA 1W99A 4M4RA 2DCKA 4DEQA 4IUGA 2W9XA 2Y6LA 3PUIA 3MV01 2Y8KA 1UX7A 3JXSA 2QQKA 1K3IA 4JKLA 2X05A 3WNKA 1NZIA 2VMFA 1GOHA 2V72A 2ORZA 2YG0A 4E8CA 1EUTA 3LEIA 1JU3A 3OBAA 2X10A 2B4KA 1KEXA 3BGAA 5JXHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I3D A;  2DCJ A;  3C7H A;  3FN9 A;  3LEK A;  5I0D A;  2EIE A;  4XUN A;  1JZ6 A;  3T0A A;  5IHR A;  4QX0 A;  2VR4 A;  1NX9 A;  3THD A;  1R64 A;  3MV1 1;  3WF0 A;  2W5F A;  2VZV A;  4UAP A;  2W3J A;  4XUO A;  4ET7 A;  2WAB A;  3P6B A;  5IJR A;  4D0Q A;  2Y64 A;  4P00 B;  4QDQ A;  5CZK A;  3P1I A;  3BN6 A;  1PMJ X;  3NRU A;  3VD7 A;  1UY3 A;  2VM9 A;  4TXW A;  2KD7 A;  4ARY A;  3AC0 A;  1UY0 A;  4QDS A;  1GOF A;  1JYV A;  3SKJ E;  4GWJ A;  4CU7 A;  2XOM A;  3HPN A;  2PQS A;  4CUA A;  2YC2 A;  3DYM A;  5DN2 A;  4BJ0 A;  3T09 A;  1UMI A;  5C70 A;  1KGY A;  2VCB A;  3HNB M;  1XPW A;  3K77 A;  3THC A;  5IFP A;  2VQU A;  2VZP A;  5LA0 A;  2EIC A;  1SPP A;  2ID4 A;  5JXG A;  4GZ9 A;  5C7G A;  1XC6 A;  4LPL A;  1DP0 A;  2JKX A;  3A22 A;  4QX2 A;  1TG7 A;  2W92 A;  3T2P A;  3NQH A;  1JZ3 A;  4OYU A;  1O8S A;  1UY1 A;  3CQO A;  1PX3 A;  3MO4 A;  2J1R A;  3EYP A;  3DEC A;  3FHA A;  2V5D A;  2WZE A;  1GNY A;  1XNA A;  2WZ8 A;  2BGP A;  2YFU A;  3WNL A;  3K75 B;  4DUV A;  1UXZ A;  2WBK A;  1UY2 A;  3OEA A;  2VZU A;  3WF1 A;  3NJV A;  1XNT A;  4RN5 A;  3MUY 1;  4P02 B;  1JYW A;  3DEM A;  4XUP A;  3D3A A;  4KI5 M;  5JXI A;  2CDO A;  3ZM8 A;  3LEG A;  1JZ2 A;  3NJX A;  4OMC A;  2QQJ A;  3CZJ A;  5HPO A;  4CUC A;  5IYY A;  2QQN A;  3T2Q A;  1TVG A;  3OGV A;  1GUI A;  2E33 A;  2VMD A;  2QQI A;  3I2I A;  5B4N A;  2W94 A;  2DDU A;  3OG2 A;  2W1S A;  2ZEX A;  3A7Q A;  3PUH A;  1J83 A;  4Z2A A;  3ETP A;  2BER A;  1UWW A;  3ACI A;  4W8J A;  1JI6 A;  2W87 A;  4MGQ A;  1H6Y A;  3FL7 A;  2YB7 A;  4LQR A;  4E8D A;  3GXU A;  1WCQ A;  1ULO A;  2OKX A;  3POI A;  4A45 A;  2QQM A;  1ULP A;  3LE0 A;  5CIS A;  1SZB A;  4MAD A;  3UES A;  2ORX A;  2VCC A;  5JR2 A;  4JX0 A;  4QPW A;  3LPF A;  1BHG A;  2WAA A;  3WQB A;  4QB6 A;  4W4Z A;  4XUR A;  2LS6 A;  1O59 A;  2ZEY A;  2W46 A;  1SG3 A;  5HXM A;  2WN3 A;  3KQ4 B;  3K46 A;  2J1V A;  3OB8 A;  1F4H A;  1L7R A;  5CKM A;  5CKN A;  4A41 A;  2HLE A;  3C7E A;  1O8P A;  3WEZ A;  1LNS A;  4JKK A;  2VQT A;  1OT5 A;  4LOS A;  2VZQ A;  3HNM A;  4CU6 A;  4M4P A;  4OMD A;  5EJZ B;  3DYP A;  4QB1 A;  4DUX A;  3I3E A;  2WO1 A;  3VD3 A;  1JU4 A;  1W8N A;  1PMH X;  4BK4 A;  4BK5 A;  2BBA A;  3HNY M;  3UET A;  3GM8 A;  1UY4 A;  3K4Z A;  4ARX A;  2J22 A;  3POJ A;  4P5Y A;  1YQ2 A;  2W1Q A;  2EID A;  1JZ4 A;  4ZY9 A;  1F4A A;  3VD5 A;  4BDV B;  4CUB A;  2VZO A;  2WQ8 A;  3WF4 A;  1GMM A;  3POE A;  2X09 A;  4LKS A;  3W5M A;  2Y6J A;  2YC4 A;  1SPP B;  2VOT A;  4RYD A;  3IAQ A;  4W50 A;  5IFT A;  1UYX A;  2VZ3 A;  1NKG A;  4HG6 B;  1JZ7 A;  1K45 A;  2Y6G A;  1UYZ A;  1WKY A;  5FUI A;  2QQO A;  2VZT A;  2VL4 A;  4MO3 M;  2RVA A;  2ZXQ A;  1GOG A;  3CIH A;  1JYN A;  1OH4 A;  2VZ1 A;  2WDB A;  5LCW L;  2VC9 A;  5JXJ A;  2E26 A;  1JHJ A;  2VME A;  3I2J A;  2WO3 A;  2JE8 A;  1W0N A;  1W9W A;  2WNO A;  2YFZ A;  2E31 A;  2C9K A;  4JKM A;  3WNN A;  4A4A A;  4LMF A;  5F7U A;  4A6O A;  4DXR A;  3ACG A;  1OF3 A;  2Y6H A;  3DYO A;  3IDA A;  3OEB A;  2C26 A;  2W1W A;  1UZ0 A;  3HEI A;  5C71 A;  2QBX A;  3WF3 A;  4CU9 A;  4ZZ5 A;  5DPN A;  1DLC A;  4CVU A;  3I3B A;  4A42 A;  4XUT A;  1SHW B;  3CDZ B;  3K4D A;  2Z4F A;  1CZV A;  3I97 A;  3HN3 A;  2QQL A;  5JUV A;  3UNP A;  1NT0 A;  3EB7 A;  3T0B A;  3SEE A;  2VCA A;  2J1U A;  1K42 A;  3T2O A;  4A44 A;  2CDP A;  3HJR A;  2VO5 A;  2W1U A;  1OD3 A;  4PF1 A;  1GU3 A;  2Y6K A;  4UOJ A;  3W5N A;  2VZS A;  5J1X A;  1SDD B;  4OUE A;  4QB2 A;  2XON A;  3VDA A;  3WNO A;  1MPX A;  2RV9 A;  3CZU A;  3HOB A;  4GWI A;  4XUQ A;  4ZXE A;  1UMH A;  3VDB A;  2WUH A;  3C7F A;  4P08 A;  3WF2 A;  3POG A;  1K12 A;  1RYY A;  2BGO A;  2W95 A;  4L0P A;  2WAO A;  4PQQ A;  2E32 A;  4AAX A;  1UXX X;  1CX1 A;  1D7P M;  2B9V A;  3A23 A;  3MUZ 1;  2XHN A;  2J1T A;  2JD9 A;  4QAW A;  3CKH A;  3POF A;  3GGL A;  2W91 A;  3IAP A;  3III A;  3NNG A;  4KWU A;  4D8M A;  1W8O A;  4QX3 A;  1JZ5 A;  3K4A A;  1NUK A;  3ABZ A;  3E1F 1;  3T0D A;  2VJX A;  3C7O A;  4YPJ A;  4MOA A;  4KMQ A;  3ACF A;  2C4X A;  2J1A A;  3MBW A;  3I2F A;  5DMY A;  4DXT A;  1OF4 A;  3POB A;  3F2Z A;  2W47 A;  2WN2 A;  2J1S A;  3I2H A;  1NAE A;  1GQP A;  2EIB A;  1US3 A;  3WSO A;  1SFP A;  1EUU A;  2LW8 A;  1DYO A;  1I5P A;  4XVH A;  2J7M A;  3T08 A;  3SEP A;  3WNM A;  3U37 A;  1J84 A;  3I2G A;  1CZS A;  3LQC A;  2WO2 A;  1HN1 A;  1JYX A;  1IQD C;  4DUW A;  2R7E B;  5A1A A;  2WYS A;  1JZ8 A;  1PX4 A;  1P8J A;  4JHZ A;  4CU8 A;  5EJ1 B;  3CMG A;  1US2 A;  3GDB A;  3ECQ A;  3WNP A;  2VTF A;  3LPG A;  2V4V A;  3I2K A;  3VD9 A;  2HYX A;  2L9L A;  4LOT A;  3VD4 A;  2ZEZ A;  1CIY A;  4A3Z A;  4LOR A;  4LHS A;  4ZZ8 A;  5G04 L;  2BZD A;  2J1E A;  3OGR A;  4DXS A;  3A21 A;  3J7H A;  5DQ0 A;  1CZT A;  3C7G A;  3SKV A;  2XQX A;  2VMC A;  4QDR A;  4TTG A;  3OGS A;  3C8X A;  4UI9 L;  4PT6 A;  4FI9 A;  5CKQ A;  5LA1 A;  5LA2 A;  4BXS V;  5CYY A;  4QX1 A;  2JDA A;  1UYY A;  3FHQ A;  5JMO A;  2VZR A;  3VDC A;  4XZU G;  3ACH A;  1W9T A;  4AG4 A;  1H6X A;  1T2X A;  5G05 L;  4MGS A;  4OZO A;  3IB3 A;  5B4X A;  1W9S A;  2RJ2 A;  1L7Q A;  5EIY B;  2ZEW A;  4DEV A;  1W99 A;  4M4R A;  2DCK A;  4DEQ A;  4IUG A;  2W9X A;  2Y6L A;  3PUI A;  3MV0 1;  2Y8K A;  1UX7 A;  3JXS A;  2QQK A;  1K3I A;  4JKL A;  2X05 A;  3WNK A;  1NZI A;  2VMF A;  1GOH A;  2V72 A;  2ORZ A;  2YG0 A;  4E8C A;  1EUT A;  3LEI A;  1JU3 A;  3OBA A;  2X10 A;  2B4K A;  1KEX A;  3BGA A;  5JXH A; 
#chains in the Genus database with same CATH topology
 3TEW A;  4MV2 A;  1N3O A;  2ZS6 B;  4GMP 0;  4QKN A;  3OYW B;  3USU A;  2VOV A;  3LEK A;  4UF0 B;  4XUN A;  4BB3 A;  4Y3O A;  1PIV 3;  2VR4 A;  4KQ7 A;  5FXZ A;  3I4I A;  1YFX A;  5FK7 A;  2XJT A;  3UKT A;  4AED B;  5FYI A;  2A6W A;  2WAB A;  1LOF A;  1NCR A;  1X50 A;  4RD7 A;  4F3J A;  4XMI A;  1X8M A;  5CAD A;  4JQT A;  1ZYB A;  3J7N A;  4QDQ A;  5CZK A;  4AW7 A;  2MNG A;  2WJS A;  4HMZ A;  5ANN A;  3LSE A;  2G9Z A;  1PMJ X;  3T30 A;  4BIF A;  3CU7 A;  3NV1 A;  4WZF A;  4QQ2 A;  4QXK A;  1ENX A;  2KD7 A;  2D43 A;  3WHT A;  4ARY A;  4IEX A;  1COV 2;  4FO9 A;  1MVQ A;  2XBO 2;  5IVF A;  1Q56 A;  4K8R B;  4MXW A;  1UO9 A;  1ULF A;  3B93 A;  3I49 A;  5IAV A;  1POV 3;  4COZ A;  4AXO A;  1MS0 A;  1MQT C;  1JMU B;  3RNS A;  2R06 1;  5DN2 A;  4M3C B;  4E2G A;  3NV3 A;  4WVV A;  1JBC A;  4Z82 A;  3U14 A;  4CDQ A;  1BXH A;  1KGY A;  2OS2 A;  4O9G A;  3RQ0 A;  3ZX7 A;  1WCS A;  2BRT A;  4LEJ A;  4A7K A;  4BQW A;  3K77 A;  1GZW A;  3N7K A;  3UT0 A;  4CDQ B;  1GIC A;  1VBD 2;  1UW8 A;  1GZW B;  2DF7 A;  2IWG B;  3TEX A;  2VQU A;  3OD4 A;  3NW4 A;  2YXS A;  4QXC A;  2Q30 A;  5CBL A;  1LOF C;  1TEI A;  1WZX A;  2ZGL A;  3B5L B;  4GZ9 A;  3AP7 A;  5FO9 B;  2Z42 A;  3H1M A;  3NMB A;  2B39 A;  1XC6 A;  4LPL A;  4DY5 A;  3NVC A;  2VTX J;  3VZM A;  1UZZ A;  1C1L A;  4IGO A;  4UW3 A;  3T2P A;  3BAL A;  3FUQ A;  1W6N A;  4B3N A;  2VMI A;  4BQY A;  4BQ4 A;  5KXB A;  1J3P A;  1W6N B;  1KQR A;  2J1R A;  3DEC A;  5JZG C;  2E6V A;  2V5D A;  3AKR A;  4HSL A;  4EN0 A;  4YZ5 A;  1HB3 A;  4P9J A;  4DUV A;  5L7O A;  4GKX A;  2DVB A;  2VZU A;  1LKN A;  5L7O B;  1OLQ A;  2EAA A;  1TE1 B;  1UZV A;  1XNT A;  2VE1 A;  1YWK A;  4XUP A;  3UJQ A;  1SFN A;  5JXI A;  3ZDV A;  5C3O A;  2YU2 A;  4Q8L A;  1MS5 A;  2D93 A;  2ZAH A;  5FWJ A;  1JS9 A;  4I3P A;  1DQ5 A;  3OUH A;  2XWJ B;  4OMC A;  1Y43 B;  2ARC A;  3CZJ A;  4YW4 A;  5FY7 A;  4K1Z A;  1LUL A;  4ZHN A;  3UYJ A;  1UOB A;  4DIQ A;  1F8V A;  4IDZ A;  2BEO A;  4MSV A;  4CP0 A;  3BOP A;  4L9B A;  2RS5 2;  3IDE A;  1JYC A;  1TVG A;  3NKG A;  5F2W A;  3T2Q A;  2QE3 A;  3AKQ A;  1GUI A;  3GHM A;  3OGV A;  1AR6 2;  1DZR A;  1V9U 1;  2FDF A;  1RMU 1;  2XJS A;  1EY2 A;  1NA1 A;  1JXN A;  1QXP A;  1VLN A;  2OA2 A;  2W94 A;  4MGZ E;  4ZON A;  5KC5 A;  5L9R A;  5LRS A;  2ZGN A;  1NA1 B;  4QM9 A;  1WGP A;  2PHX A;  4J6G A;  3VBO A;  1W3V A;  2BJS A;  2BER A;  3ETP A;  2XL7 A;  4UW4 A;  4W8J A;  1JI6 A;  3VBO B;  4MGQ A;  2Q8O A;  3WY6 A;  5HCF A;  3FL7 A;  4H7M A;  2YB7 A;  4E8D A;  4KWK A;  3JUU A;  1YC6 1;  1QQP 1;  5DUX A;  2B42 B;  2E9Q A;  5EYY A;  4LA3 A;  2YDE A;  4GWM A;  4CCD A;  2QQM A;  2QQP A;  1AYM 2;  4NPR A;  3ZN4 A;  3SC7 X;  1PGW 2;  1ULP A;  4I2O A;  5JVV A;  5FKB A;  3LE0 A;  4OZX A;  4MHR A;  2E51 A;  2JX9 A;  2ORX A;  2XLA A;  2FCU A;  4XAB A;  5E8A A;  1W6M A;  3PJY A;  5A6Y A;  4LBJ A;  2CNA A;  3WQB A;  2TUN A;  4XUR A;  1W6M B;  3JD7 3;  5FZG A;  4Q4Y 3;  1NE6 A;  4FCA A;  5C4W A;  4QQL A;  4MXV A;  4XFB A;  4IV1 B;  4PIX A;  2WN3 A;  1XJA A;  1W9F A;  3KQ4 B;  4Q4X 2;  4QPG B;  4YSF A;  1V6N A;  1VBB 3;  3FBY A;  1D2S A;  3GZA A;  1O5U A;  1CQ9 A;  1VP6 A;  3K46 A;  1WWY A;  2YMZ A;  1WLD A;  2VOX A;  5C8C A;  5CKN A;  4RGK A;  4D6R A;  4A41 A;  3ZSJ A;  5C8C B;  3O0V A;  4M3C E;  2HLE A;  2GC3 A;  4FAG A;  5JSR A;  3C7E A;  5F5C A;  4R8H A;  4AI9 A;  1LEN A;  1QJX 2;  4HLT A;  2QJV A;  4WM8 B;  5T55 A;  3WP3 A;  3PMS A;  2VQT A;  4WM7 A;  2VW1 A;  4MUV A;  4LOS A;  4OUM A;  3BTA A;  4Y1V A;  5E88 A;  2FMD A;  2FDJ A;  4YG0 A;  5JI7 A;  5DDJ 1;  4CU6 A;  4M4P A;  4BQ3 A;  2F4L A;  1FOD 3;  1MR5 A;  2DVF A;  4Y33 A;  4MGT A;  3EBR A;  2YGM A;  4V2W A;  2P1B A;  2D6M A;  3AMM A;  3R4S A;  4R4Z A;  3VB9 A;  2WO1 A;  2Y0I A;  3CJI A;  3WW3 A;  5ABJ B;  1FI2 A;  1W3X A;  2RM2 1;  3FWE A;  2JDH A;  1JU4 A;  4LXL A;  1PMH X;  1QHD A;  1WCK A;  1WUV A;  3RMY A;  1IPK A;  1AYN 1;  1AR9 2;  1YJK A;  4RHV 3;  3S57 A;  4ONU A;  3K4Z A;  1RIN A;  2N7G A;  4RS5 A;  2HWB 2;  3AP9 A;  1AR8 3;  2I74 A;  3A4U A;  4YLZ A;  5K8S A;  5C9A A;  1VPH A;  1POQ A;  2W1Q A;  2WII B;  2ERF A;  2WS9 3;  4IE5 A;  5JIA A;  3MF6 A;  1ZVF A;  2Z2S B;  4NHX A;  3VD5 A;  3NST A;  5BNN A;  1JZ4 A;  4PJY A;  2PEL A;  2Y33 A;  4PF5 A;  4CCL A;  1C1F A;  2XB6 C;  5F32 A;  2GME A;  2PHR A;  5EHD A;  3THT A;  3ES4 A;  3VBH A;  5A3P A;  4LE4 A;  5A3W A;  2MPF A;  3WF4 A;  3ME2 A;  1HRV 1;  3W5M A;  1HV0 A;  4I02 A;  3AZX A;  4J1X A;  1WMF A;  5DG2 A;  3TYJ A;  1T6B X;  3VBH B;  5FZ4 A;  1SPP B;  4BLJ A;  5J37 A;  2VVE A;  1PM7 A;  3IN9 A;  3IAQ A;  4LKD A;  4N53 C;  4D7Y A;  4AYU A;  2J42 A;  1D4M 3;  1UMZ A;  1WW4 A;  2KA3 A;  2G4I A;  1O5L A;  1OPO A;  3BYW A;  3RZG A;  4R4X A;  1D4V B;  3DN7 A;  3D0S A;  1IOA A;  3HT1 A;  5A3M A;  3CJI C;  1VE0 A;  1PGL 2;  2XKP A;  2RVA A;  2ZXQ A;  3NAP B;  1GOG A;  3K3O A;  2ZAA A;  3ZPO A;  2A5Z A;  1JYN A;  4H3W A;  4CTE A;  1OH4 A;  5J36 A;  1W8F A;  2VZ1 A;  3GJB A;  2CV6 A;  1CJP A;  4O61 A;  1ND3 C;  2E26 A;  3IMM A;  2PAM A;  4AVC A;  5I93 A;  1FMD 2;  3I2J A;  5HI0 A;  2JE8 A;  3DXT A;  1CJD A;  1W9W A;  2NM1 A;  2VW2 A;  1X8E A;  4COV A;  5JCT A;  2YFZ A;  4HXC A;  2C9K A;  3MIH A;  4JKM A;  4O9E A;  3UL2 A;  5FPZ A;  5BNP A;  2Q8E A;  1QOS A;  2DUR A;  3ITQ A;  1UZW A;  1QIQ A;  5FZF A;  4XJU A;  3WQ0 A;  4LUM A;  1CAW A;  5BNP B;  1TME 1;  2VNR A;  4OI4 A;  4FPL A;  5JOW A;  1CAW B;  1XQN A;  1GR3 A;  1VB4 A;  4TYS A;  3IDA A;  3OEB A;  1BMV 2;  1WBF A;  2W1W A;  2WO7 A;  4C90 A;  2VVF A;  1LU1 A;  1R08 2;  2FHR A;  2ZX2 A;  2R04 2;  1VBE 2;  4KGG A;  3JBG 2;  5DPN A;  4BQ1 A;  4QHB A;  2FDI A;  1TNR A;  4YZ4 A;  5I8Y A;  1S0D A;  2RR1 1;  5EZW A;  1Z7S 2;  1ENS A;  4XQW A;  1FNY A;  2OVU A;  5GLU A;  3K4D A;  1PO2 3;  2QQL A;  1OSG A;  2NPI A;  1EAH 1;  3RSJ A;  1S4C A;  4EE2 A;  4HVQ A;  1PO1 1;  3EB7 A;  4CCE A;  5C33 A;  3C3V A;  3WP6 A;  2DCT A;  1WCD J;  3WQ1 A;  1OQD A;  2J1U A;  5FZI A;  4S2F A;  3SMH A;  3TN9 2;  2XJQ A;  4P9X A;  5A1L A;  5ACA 2;  4OLL A;  3ZXF A;  1GU3 A;  5LK7 B;  4R52 A;  3PVB B;  1G8W A;  4H7L A;  4UOJ A;  5FO7 B;  4AEJ A;  1YFW A;  4Z92 B;  1ASJ 2;  4LHK A;  1LJ7 A;  1SDD B;  3NV2 A;  4OUE A;  4QB2 A;  4E4H A;  4JQR A;  4FFI A;  3OF1 A;  3VDA A;  2NZ9 A;  3WW1 A;  2WL1 A;  4YAR A;  4CDX A;  4LK6 A;  3HOB A;  4GWI A;  4JAA A;  5I0U A;  1N1T A;  3V0A B;  4P14 A;  1COV 3;  4XIL A;  1KJL A;  2ZGK A;  2XBO 3;  3FLR A;  3DF0 A;  1REF A;  3PUA A;  4KBB A;  4P08 A;  1SLL A;  1BEV 1;  4QXH A;  4X6Q B;  3ZO0 B;  2YHJ A;  2E32 A;  4IEQ A;  2ARB A;  4I30 A;  1ULC A;  5IK7 A;  1YQ5 A;  3O0W A;  1D0H A;  1O3Q A;  1D7P M;  4PLO A;  4YNI A;  3ZN6 B;  5IVJ A;  2GP3 A;  1JHN A;  4S2D A;  5ANQ A;  4QQO A;  3MFC A;  2ZAB A;  1AXY A;  3UKN A;  3WDW A;  4HK8 A;  5AC9 1;  1GNZ A;  1RIR A;  2P3K A;  2A3Y A;  3UK9 A;  2JD9 A;  2QTW B;  5FMB A;  2ES3 A;  1VBD 3;  5LA9 A;  1UU6 A;  3HQR A;  4TWT A;  4Z07 A;  1HJF A;  2K46 A;  5CVR A;  3D4K A;  4CEW A;  3H8X A;  2VCM A;  1O7F A;  2XVG A;  1UF2 C;  4B1M A;  3ZR6 A;  4KWU A;  4Y1X A;  5FZA A;  3ABZ A;  3ZIX A;  1W90 A;  2DFC A;  1VBC 2;  3PIJ A;  3LB9 A;  4CDX C;  4YPJ A;  1XU1 A;  3O1V A;  2ZGQ A;  1F31 A;  1QJY 2;  2AC1 A;  3DGT A;  4KMQ A;  4GAL A;  2PQQ A;  5BY5 A;  2EXJ A;  3M2M A;  4WZC A;  3JQW A;  3LKJ A;  1H9W A;  1TMF 1;  3HN1 A;  4W6X A;  5DMY A;  1DGW A;  1OF4 A;  4R9B A;  3Q8E A;  3DKQ A;  1FPN 1;  3IM0 A;  3POB A;  4QKF A;  2ET1 A;  3Q8F A;  1WW6 A;  2WN2 A;  1NLS A;  1OA2 A;  5F5A A;  4LUL A;  1GQP A;  5FYM A;  2W08 A;  1E57 A;  2W2I A;  4KG0 A;  4PLN A;  1EUU A;  4C0H A;  4LO8 A;  1VBA 1;  3KGZ A;  4M0H A;  2J7M A;  3AYD A;  3WNM A;  5FUP A;  3U37 A;  2JEN A;  1CZS A;  3N9Q A;  1BBT 2;  3VBR B;  1R1A 2;  2QQW A;  4CEW C;  4HFS A;  1QOT A;  4Q5O A;  1OPM A;  4XCA A;  1SLC A;  1H2L A;  2R7E B;  2RS5 3;  2ZGU A;  5A1A A;  2B45 X;  4I01 A;  4Q4W 2;  4EZH A;  3CL1 A;  1AR6 3;  3ZXL A;  1PX4 A;  1ODM A;  1JZ8 A;  1IGO A;  4WVM B;  1US2 A;  3FLT A;  3LA7 A;  4BA6 A;  5BV6 A;  5F39 A;  1LGB A;  4I3G A;  3I2K A;  5I8S A;  2L9L A;  2Q5T A;  3AXD A;  1GP6 A;  4LOT A;  3VD4 A;  4KBZ A;  2ZEZ A;  3FE5 A;  3S7I A;  1C5I A;  4HN1 A;  4AVA A;  5BUV A;  2AYH A;  3LWC A;  1CIY A;  2FDK A;  5FZO A;  1ND2 B;  4LHS A;  3WHU A;  2CWM A;  4ZZ8 A;  4IV3 C;  1X33 A;  3TWI A;  1AVB A;  1AYM 3;  1C5H A;  2IXC A;  3MEP A;  4GH4 C;  5G04 L;  4HON A;  2WZP P;  1RUD 2;  2W0X A;  3MLK A;  1PIV 1;  3BCW A;  2J1E A;  1PVC 2;  2QZ2 A;  1DLL A;  1GNH A;  3WT3 A;  4CYD A;  1R09 2;  1UZY A;  3J7H A;  2Y0O A;  4IE7 A;  4Q1P A;  4G9S B;  5EFU A;  1JN2 P;  5H9P A;  1CGP A;  1PM4 A;  1MZ5 A;  1YRZ A;  2AAC A;  3Q8B A;  4QDR A;  3C8X A;  5IVV A;  4UI9 L;  3MYX A;  1UIK A;  5FPB A;  4PT6 A;  4OHV A;  1J3Q A;  4LBK A;  5FFO C;  5CKQ A;  4FT8 A;  4A7Y A;  1NG0 A;  4RSU A;  5LA1 A;  5LA2 A;  2XHK A;  4Q4X 3;  1KDK A;  3LDR A;  1DGL A;  3H9A A;  4QX1 A;  4BME A;  3AYA A;  4XCB A;  1UOF A;  5KWR A;  1O4T A;  1X9T A;  2BFU S;  2JKB A;  4JGY B;  1IG3 A;  3HT2 A;  3KD4 A;  2HWE 2;  3ACH A;  3RMX A;  3ZXJ A;  3BTY A;  1H6X A;  1QJX 3;  2E7T A;  4QU2 A;  1UPI A;  1T2X A;  4OQ9 A;  4MGY E;  4NVP A;  1POV 1;  4HPK A;  1ZBE 2;  4LKE A;  2D98 A;  3KCX A;  1QOO A;  3BIW E;  1QJZ A;  4GJZ A;  5CFD A;  4AHZ A;  2ARA A;  5GZD A;  3HBZ A;  3O12 A;  3NWK A;  2ZZQ A;  2ZEW A;  4YVS C;  4AGR A;  3N3H A;  4IUG A;  2Y6L A;  5H9S A;  1IZ3 A;  2PTM A;  1JYT A;  1UX7 A;  3JXS A;  4BM8 A;  3BB6 A;  5A7N A;  3GBW A;  2P37 A;  4JKL A;  5F3C A;  5A7S A;  1AR9 3;  3JQX A;  5T3N A;  3ZMO A;  4P9W A;  2VMF A;  1AX2 A;  2V72 A;  1KS5 A;  2DBI A;  2FDG A;  2ORZ A;  1N47 A;  2HWB 3;  2ADD A;  3FZ3 A;  4NRQ A;  3M70 A;  2YG0 A;  3SCG A;  3H1Y A;  4MH0 E;  3N7M A;  2A7A A;  5FYC A;  4Y1Z A;  4EWD A;  2H0B A;  5FP9 A;  3VHR A;  1XE7 A;  1UQX A;  2OUJ A;  4W6Y A;  5A3U A;  1XSQ A;  2H6B A;  4YW1 A;  3C7H A;  2VQ0 A;  3NNJ A;  1GZC A;  4PI2 A;  2JXA A;  3T0A A;  1WBL A;  4CEY B;  4H2A A;  1MS4 A;  2VUJ A;  1CAU A;  1FAT A;  2W3J A;  1CAU B;  3IT8 A;  4QU1 A;  4EV0 A;  5CA6 A;  3I2D A;  3VBS B;  3U78 A;  2Y64 A;  5GLZ A;  2HWF 2;  3X29 B;  2B46 X;  1C28 A;  1I3H A;  3ZXD A;  4AR2 A;  4LE3 A;  1W8H A;  1LRH A;  5A7W A;  3M3Q A;  4Y20 A;  5AFE A;  3NRU A;  1YXW A;  1GLH A;  1QWR A;  3CBN A;  5IAX A;  4M00 A;  4FVV A;  1RUJ 2;  2A6Y A;  1RXG A;  1SLT A;  3O7O A;  5CU1 A;  1B09 A;  2PN5 A;  1JYV A;  2X5I A;  1VRB A;  1C57 A;  3VBU A;  3IPV B;  1FMD 3;  1XYN A;  4ZXK A;  3SKJ E;  1UOJ A;  1HJG A;  2X5I B;  1AHS A;  4IEY A;  3HPN A;  5K0U A;  2Y26 A;  3B02 A;  5CB7 A;  1W0O A;  4MET A;  4UWD A;  3UJO A;  4CDW C;  4Z1V A;  3M3E A;  2WFP A;  2VCB A;  2FMY A;  3DCQ A;  1H8T A;  3HNB M;  3M7A A;  3T1M A;  4OUS A;  4AF9 A;  2ZHN A;  4AE2 A;  2HWC 2;  2BBV A;  5FY9 A;  4XAC A;  2F6B A;  3OY8 A;  3THC A;  2R1D A;  2EIC A;  5F6K A;  3FLP A;  3GNE A;  1RHI 2;  2WFF 2;  4RR3 A;  4AEM A;  4E4S A;  4GD4 A;  1R08 3;  4A7Z A;  1MS9 A;  3ILN A;  1CIW A;  4BWO A;  4KU8 A;  2R04 3;  2WNU A;  4NO4 A;  1Q8V A;  1VBE 3;  4IER A;  3JBG 3;  1LOG A;  4RR3 B;  5T50 A;  3VHN A;  4CDU A;  4DZG A;  5GZC A;  3A22 A;  1HLC A;  1Z7S 3;  1BKZ A;  4ES9 A;  1YYN A;  2EAL A;  1LHV A;  3CQO A;  3KT4 A;  4I0W B;  4Q4Y 1;  3ZXE A;  4KL1 A;  3MO4 A;  4YGB A;  3M8L A;  3FHA A;  2FZ1 A;  3ZYR A;  2OW4 A;  2WZE A;  3CHX A;  1U5I A;  1XNA A;  4PCR A;  4DO0 A;  2BGP A;  1XNC A;  2YFU A;  4IE0 A;  1VBB 1;  1UD1 A;  2E7Q A;  4QD2 A;  3VBU C;  3ACL A;  3GZT B;  4CP9 A;  1XYO A;  1LOC A;  1UXZ A;  2Q1Z B;  2BWA A;  2P6H A;  1UY2 A;  2XUM A;  1QXR A;  4DY3 A;  1H4H A;  3GBF A;  2ZX0 A;  1WW5 A;  4XQD A;  3NJV A;  2QVS B;  5FPX A;  3TN9 3;  5K0U C;  4OQ8 A;  1DQ6 A;  5ACA 3;  1DHK B;  3VKM A;  1IHM A;  1Q8Q A;  3E97 A;  4GJY A;  1ASJ 3;  1H8T C;  1JYW A;  1DGW X;  3D3A A;  3FJS A;  4GKY A;  1WMX A;  1W2N A;  2JIJ A;  1BVP 1;  3U11 A;  4EWA A;  3ZFE A;  5HPO A;  4NHM A;  4CUC A;  4NN0 A;  5HV4 A;  2VNV A;  3PHM A;  2QQN A;  1C8M 1;  1W9Y A;  2SLI A;  2WNU C;  4E4D X;  2R0F A;  2E33 A;  2VMD A;  4HN0 A;  1PMI A;  2BQP A;  2QQI A;  3I2I A;  3LA3 A;  2JEM A;  4YZ3 A;  1MEC 2;  3B94 A;  2V73 A;  2W1S A;  1YLL A;  2XVL A;  2ZEX A;  2AZ5 A;  1VMJ A;  4Q4V 3;  1ZZC A;  1CES A;  2GMM A;  1IS4 A;  4JGZ B;  4OHW A;  2BTV C;  4RHV 1;  5DAV A;  1J83 A;  2A75 A;  5FKC A;  4KU7 A;  4Z2A A;  1QNY A;  2RE9 A;  2BUK A;  3VDD A;  4XDO A;  1AR8 1;  2ARE A;  1JUH A;  2IXL A;  2KXL A;  2W87 A;  3LDK A;  4IE6 A;  4ITC A;  3AFG A;  4LQR A;  2V4A A;  1OLR A;  1ULO A;  1PNF A;  4XE9 A;  5AVA A;  1NCQ A;  1CN1 A;  5IVY A;  3TOJ A;  4A45 A;  2WWS A;  3BU7 A;  4RQP C;  4MG2 A;  4X8N A;  4F83 A;  3RYR A;  3H8R A;  2BYV E;  1SAC A;  4MGI E;  4QKB A;  2WT1 A;  1A8D A;  5FLH A;  4ZU5 A;  5CIS A;  1SZB A;  5FP3 A;  4B29 A;  3LDB A;  5JR2 A;  1Q5O A;  1QKQ A;  1KDM A;  2YPD A;  4F7Z A;  2RS3 2;  4NUB A;  1VBC 3;  5JWP A;  1BHG A;  2WAA A;  3EO6 A;  4DXZ A;  4QB6 A;  1QJY 3;  2LS6 A;  3ZFE C;  5JOX A;  2YBP A;  2CAU A;  4YM1 A;  3KM5 A;  4XZP A;  1DFQ A;  1MQT A;  4D7S A;  2MEV 2;  1HN0 A;  3JU9 A;  3S5A A;  2GU9 A;  1B35 C;  4XQ4 A;  2XG3 A;  3LA2 A;  3OB8 A;  4XBQ A;  5D21 A;  3OSD A;  4BE3 A;  5I91 A;  1L7R A;  3USU B;  2YRO A;  3JB4 C;  1ZRR A;  3MPB A;  4AOC A;  1W6Q A;  1DZQ A;  3ON7 A;  2JG8 A;  2OZ6 A;  3VDD C;  1LES A;  1O8P A;  1LNS A;  2MHF A;  5D1I A;  1UAI A;  1OT5 A;  3ZFG C;  1NCR B;  2Y60 A;  5DXD A;  1ZZ9 A;  3RRD A;  1FV3 A;  4BCU A;  1NCQ C;  1BBT 3;  3LOI A;  1R1A 3;  2EA7 A;  3ILR A;  2YV8 A;  3LAG A;  1WD4 A;  2VNO A;  3B00 A;  2XGX A;  1LOE A;  4Q4W 3;  3N7L A;  3ZSK A;  3CF6 E;  5JZG A;  3VD3 A;  5KC6 A;  1IS6 A;  5FMO L;  5FRA A;  2HEW F;  3J9S A;  1W8W A;  3HAG A;  3OBT A;  4XF3 A;  1XBF A;  4BK5 A;  5B2G B;  3BKZ A;  4MXW B;  2D6O X;  2BBA A;  1H1M A;  2XLF A;  3GM8 A;  1XE0 A;  4H14 A;  1QMJ A;  2JB4 A;  1S0J A;  2J22 A;  5AVP A;  3T4H B;  4ARX A;  5KXE A;  2XXZ A;  1OUS A;  5J98 B;  5FPU A;  3FHI B;  3RG0 A;  1BCX A;  2HWD 2;  4N43 C;  3VZN A;  5GLV A;  1VJ2 A;  3IIA A;  3ZLI A;  1AXZ A;  4JHT A;  4XET A;  2I2S A;  2JG8 C;  4XJZ A;  1RUD 3;  3TEY A;  2GAU A;  4COY A;  1J3R A;  2WQ8 A;  1PVC 3;  1VMF A;  1UIJ A;  1ZBA 2;  2X09 A;  3POE A;  5L19 A;  3HBK A;  5IVC A;  1R09 3;  3MIC A;  2X53 S;  4W50 A;  2BNO A;  1UOG A;  1ULD A;  1EP0 A;  2WLQ A;  4UT5 A;  5GAL A;  4FPH A;  4BQ2 A;  2LRP A;  2ZPX A;  3M3O A;  1JZ7 A;  1IPS A;  5FUI A;  2E53 A;  3L2Y A;  1IKP A;  3D8C A;  4YW7 A;  5BXX A;  1RUF 1;  3OJB A;  4AED C;  2XJV A;  5F2S A;  5M0T A;  4NAO A;  1DU3 D;  3K3N A;  1H30 A;  2GAL A;  3WP4 A;  1Y3T A;  3AMP A;  3KS7 A;  4FPG A;  1COV 1;  1EV1 1;  4O65 A;  3D5O A;  1W05 A;  3AYC A;  2XBO 1;  3B7M A;  1N3P A;  2HWE 3;  4BZ4 A;  3N7J A;  1AX1 A;  2VC9 A;  5JXJ A;  1JHJ A;  3H7Y A;  4NE9 A;  4DNY A;  2WO3 A;  5I0R A;  3B9I A;  4XYX A;  3WW4 A;  1V6K A;  1W0N A;  2GN3 A;  5FXX A;  1ZBE 3;  2WNO A;  3J8F 2;  4XF1 A;  1WA6 X;  1DGR A;  3MIF A;  4LMF A;  5F7U A;  3WX5 A;  1U5Y A;  5DAQ A;  1F35 A;  4Y22 A;  4DXR A;  4CSW A;  4YM3 A;  4BYY A;  1VBD 1;  4GIQ A;  2Y6H A;  1G9D A;  1RUG 2;  3ZR5 A;  1FT9 A;  2G19 A;  2QBX A;  2TNF A;  3KVA A;  5FZ6 A;  3WF3 A;  3T2T A;  4ZZ5 A;  1ULE A;  4EJR A;  1WCU A;  1DLC A;  2CY6 A;  3GJA A;  5K7P A;  3I3B A;  2AR6 A;  3UGF A;  2WA3 A;  1LHO A;  1QJF A;  1SHW B;  2WNV A;  4LBN A;  2UYA A;  1O3T A;  2YZ4 A;  3WDY A;  2OYZ A;  3N9P A;  2WSV A;  3I97 A;  3HN3 A;  5JUV A;  1XB9 A;  1NT0 A;  2ZX1 A;  1BJQ A;  1HX6 A;  5J09 A;  4Q2F A;  3SEE A;  2VCA A;  4Q0S A;  1K42 A;  4FP2 A;  4EN7 B;  1A3K A;  4B7E A;  4DRV A;  2XJR A;  1NQJ A;  1MVE A;  1YI9 A;  1EPZ A;  1OD3 A;  3PIG A;  4HK9 A;  3U10 A;  2HWF 3;  1RUI 1;  1JYI A;  4ASL A;  4E27 A;  5J1X A;  2VG9 A;  5FMD A;  4AHW A;  3VUO A;  3OCP A;  2NYY A;  5FMC A;  1PZ9 A;  2RDR A;  1XXN A;  3V0B A;  5FZL A;  3SLI A;  4XUQ A;  1QEX A;  5C4W B;  3I7D A;  4LO7 A;  1BQP A;  3V0B B;  4LO6 B;  2OII A;  3PLQ A;  1RUJ 3;  2YBS A;  3VDB A;  2RS5 1;  2W95 A;  1AR6 1;  2BGO A;  4L0P A;  4UXA A;  5CIR A;  2RM2 2;  2PXJ A;  3WG3 A;  5LBF A;  4E2Q A;  2R07 2;  1NZC A;  4OI2 A;  2GZW A;  4ATF A;  1V00 A;  2WNV C;  4FPO B;  1GWM A;  4IEO A;  1KFU L;  3WG2 A;  4BHP A;  1PK6 C;  5E6H A;  5LRR A;  5LAS A;  4WM7 B;  4AL9 A;  4N53 A;  2J1T A;  1WD3 A;  3RYK A;  4N53 B;  3WDX A;  3RZZ A;  2HWC 3;  4YW2 A;  3LD8 A;  3CKH A;  2B9U A;  4LBO A;  4ASK A;  4M0N A;  1H2K A;  4NPL A;  4P9Y A;  1AYM 1;  1PGW 1;  4QQH A;  5J96 B;  1RHI 3;  2WFF 3;  1HRV 2;  1ZA7 A;  5K9Y A;  4AI0 A;  2FD8 A;  4L8Q A;  1YFY A;  4V2V A;  1G6N A;  3CJI B;  2ZBJ A;  4XFG A;  4QX3 A;  2CGP A;  3E1F 1;  2VJX A;  4DQA A;  5BYN A;  1ND3 A;  4WBB A;  4MOA A;  1Q8S A;  2BOJ A;  1ENR A;  4RS5 B;  5EWS A;  4P9I A;  3MPP G;  1ND3 B;  4N9I A;  5FZE A;  5L9B A;  3RYP A;  5C9A B;  2OUH A;  3EHK A;  3VKO A;  1HXS 2;  3V64 A;  3POY A;  3NNF A;  2RMU 1;  3E5U A;  3L9J T;  1QGL A;  3O1R A;  4FP3 A;  5EQU A;  5BNN B;  2BV4 A;  2A3W A;  3VHO A;  2YBK A;  2W47 A;  4IEZ A;  1V6L A;  2J1S A;  1NAE A;  1QF3 A;  2XQR A;  2QDR A;  1J1L A;  4OI1 A;  4XMA A;  5C3P A;  2PAK A;  4IV1 C;  2JE9 A;  1DYO A;  1QJX 1;  2LW8 A;  5LZ6 A;  1K5M C;  1AL2 1;  1SMV A;  1AR7 2;  4Q0Q A;  2P2K A;  4Q27 A;  4XVH A;  3T08 A;  3ZYF A;  4N7I A;  1JH5 A;  4NPM A;  1GWK A;  3I2G A;  2VY0 A;  3LQC A;  4Y26 A;  1HN1 A;  3WDV A;  4XTM A;  4D6Q A;  1JYX A;  1KS4 A;  1CAV A;  4OVE A;  5F3G A;  4CE8 A;  5BNQ A;  5GLT A;  5J7M A;  3BPS A;  4DUW A;  1NLR A;  2WC2 A;  5A33 A;  2E63 A;  2XUE A;  1KFX L;  3EXU A;  4NHK A;  5E16 A;  1J59 A;  2JD4 A;  4CU8 A;  1MEC 3;  2D6N A;  3ECQ A;  1PNG A;  3QCW A;  4GMP 3;  5T5P A;  4QT6 A;  3AKP A;  3LPG A;  3WIN E;  2X29 A;  4TLF A;  1X36 A;  4PDW A;  4K8F A;  3VD9 A;  3RPQ A;  1X9P A;  3P5B A;  2HWB 1;  2HYX A;  3KZ4 C;  3PU8 A;  4ATE A;  4BOW A;  4MLO A;  1RUH 2;  3AL5 A;  2JDM A;  3RFR A;  5ABJ C;  3SH4 A;  5FZ0 A;  4LK7 A;  5ERL A;  2ZGP A;  1UN1 A;  2LUW A;  3PDQ A;  4IEP A;  1KD7 A;  5FUN A;  3BUC A;  1RUN A;  3A0N A;  4G4F A;  3WV6 A;  3DKW A;  2RJL A;  1Y9M A;  4NID A;  4DXS A;  1OLM A;  1FYU A;  5FXV A;  5JSP A;  3FMG A;  4ZPI A;  2RS3 3;  3C7G A;  4QM8 A;  3SKV A;  5L36 A;  4MHU A;  5JLV A;  2C5D A;  4AI8 A;  4I0B A;  5E89 A;  1YFU A;  3Q8C A;  3O1O A;  2D6P A;  2MEV 3;  5T5L A;  2JG9 A;  4XDP A;  1W03 A;  1YI7 A;  4QHZ A;  3KF5 A;  4BXS V;  2ILM A;  3H8O A;  1V70 A;  1CX4 A;  1BEV 2;  4PDW C;  3VDC A;  2PHL A;  2R16 A;  2ZGS A;  4RGA A;  2A73 B;  4NOT A;  4BIS A;  2HH9 A;  4IXL A;  2ZGR A;  3OPW A;  2QNK A;  5GZG A;  5C3Q A;  2ZKN A;  2JIG A;  3IDC B;  1GZ9 A;  1H2N A;  2HEV F;  4KWJ A;  5IVE A;  3PL0 A;  3AZY A;  4LLF A;  4Y5T A;  3IBM A;  2BDR A;  4MGS A;  5B4X A;  2A1X A;  3PUS A;  2DYC A;  1JW6 A;  2RDN A;  1W9S A;  2WA4 A;  4Q0U A;  3ZKY A;  4FQ4 A;  5CEH A;  4AEK A;  2AEZ A;  1C8N A;  2NMO A;  2VVD A;  4DEV A;  3AB0 A;  1N1Y A;  4ERO A;  2FBE A;  4LO4 B;  5FCC A;  4CDX B;  3ELN A;  1LHN A;  1UU5 A;  1QJU 2;  4Q0P A;  3N4M A;  3PUI A;  2DFB A;  3MV0 1;  1BMV 1;  2QQK A;  3FC0 A;  1FXZ A;  1K3I A;  1W8U A;  3GCX A;  2IXH A;  3KHB A;  4JC1 A;  3N9O A;  3BOD A;  1R08 1;  4AHX A;  2X05 A;  3WNK A;  1NZI A;  1WMD A;  1PGS A;  4Q4V 2;  4CA9 A;  1ZRI A;  2JG9 C;  3TBD A;  4E8C A;  1Z7S 1;  4P9G A;  2OPK A;  3LEI A;  5FJK A;  5HCH A;  2HWD 3;  1VAM A;  5D8A C;  3MID A;  2DCJ A;  4CXW A;  3O1M A;  5APA A;  3FN9 A;  2EIE A;  5EP9 A;  3ZDS A;  1VAL A;  1ZBA 3;  1M4W A;  3WVJ A;  1LHU A;  2AEY A;  1NX9 A;  4NRP A;  1R64 A;  2C6S A;  4CEW B;  3MV1 1;  5GZE A;  1XNB A;  3WF0 A;  4UAP A;  2GC0 A;  4ET7 A;  4ZS3 A;  2P3I A;  3WCS A;  1GSL A;  1DG6 A;  2RS1 2;  5A3N A;  3P6B A;  2HEY F;  4D0Q A;  3KV6 A;  1ASJ 1;  2LAL A;  3R4D B;  4PHZ A;  3KHC A;  3N9N A;  1AX0 A;  4XFA A;  3S7E A;  4E4Z A;  1VRH 1;  5C5U A;  3I3Q A;  1S1A A;  4LBL A;  3BN6 A;  1GV9 A;  3VD7 A;  2VOW A;  4L2N A;  2VM9 A;  2W39 A;  3BI3 A;  2XLG A;  3ZFF A;  1QH7 A;  1UY0 A;  2B7Y A;  2CYF A;  3J7L A;  1DDL A;  3MW3 A;  4GXL A;  2GNB A;  1NXD 1;  1OKO A;  4IV3 A;  4NWV A;  4GH4 A;  4RL7 A;  5FYB A;  3MZH A;  1D0G A;  2QKD A;  3B01 A;  4IV3 B;  1G9A A;  4TZD A;  2AUY A;  1RB8 G;  4B4Q A;  4CU7 A;  2XOM A;  2PQS A;  3RI9 A;  3LZZ A;  3J8F 3;  2YC2 A;  3DYM A;  4N90 A;  1HRI 2;  4BJ0 A;  4QGL A;  1W04 A;  2H6C A;  2LRO A;  4Y5Z 0;  5F8P A;  4AFB A;  3H0O A;  4CCM A;  1O4Z A;  3EJK A;  4A2U A;  4Q0V A;  2P4E A;  2ZGO A;  2OPW A;  3PUR A;  3HVD A;  4QXB A;  2BGC A;  3KT7 A;  3OUI A;  5LA0 A;  1RUG 3;  1DCS A;  2ID4 A;  1ULG A;  5JXG A;  1NLQ A;  1O4Y A;  3QLQ A;  1IS5 A;  4CCC A;  1FV2 A;  1DQ4 A;  2VD7 A;  1DP0 A;  1F5F A;  1XSR A;  2VW0 A;  2DVA A;  2BPA 2;  4Q26 A;  1SBF A;  1TG7 A;  1VBC 1;  2W92 A;  1G7Y A;  3VBF A;  3A0K A;  4OYU A;  1XOY A;  1YCI A;  3BVC A;  3Q9O A;  1UY1 A;  5H9R A;  4QPI C;  3VZJ A;  1PX3 A;  3HQX A;  1MZ6 A;  3ZFF C;  2GC1 A;  4XXA A;  1GNY A;  2JEC A;  4XJ8 A;  1QXJ A;  3VL8 A;  5FYH A;  4UFH A;  2DTY A;  4QKD A;  4EN9 B;  2D6K A;  1GWL A;  5FZO B;  3LF7 A;  5LBB A;  3TAY A;  2WBK A;  3KV9 A;  3IKW A;  3OEA A;  4YVS A;  5FOB B;  3W58 A;  4PBO A;  4CCK A;  4FPK A;  3R4U A;  4EWE A;  3QOP A;  2DTW A;  4W6W A;  1W6P A;  4YVS B;  4D7T A;  4AVS A;  4RN5 A;  3ILF A;  2EXI A;  3MUY 1;  4YG3 A;  4COW A;  4AFA A;  2Z69 A;  4A3X A;  1W6P B;  1CVN A;  4YM2 A;  4KI5 M;  1OA3 A;  4AQS A;  1SLA A;  3RZM A;  3M1H A;  4MVT A;  2QQJ A;  1R1A 1;  4IE4 A;  2DUQ A;  2WYF A;  4XFI A;  2TEP A;  1OH3 A;  1RUE 2;  3KVB A;  5J48 A;  1AUY A;  2VUA A;  4LHN A;  5IYY A;  5KR7 A;  2BNN A;  3ORJ A;  4M01 A;  1NE4 A;  2TBV A;  3POW A;  2GNT A;  1S0G A;  1UKR A;  4Q4W 1;  3UGG A;  2WZR 2;  3C2U A;  3LSD A;  2RM2 3;  3NNL A;  5A3O A;  2Y6F A;  5CAZ A;  2R07 3;  2Q0A A;  3VBF C;  1H4G A;  2VMH A;  2Y38 A;  3POS A;  4UBH A;  4Z2W A;  5IVB A;  3GZU C;  2HYK A;  1WA4 A;  1W2U A;  3ZYI B;  2AEN A;  2DV9 A;  4IET A;  4BU2 A;  3ACI A;  4AI1 A;  5JIU A;  4HPK B;  4KGQ A;  4L99 A;  3WG1 A;  2JB8 A;  4Q29 A;  4HT1 T;  3O0X A;  2CTV A;  3E6D A;  1YHF A;  2XVK A;  5FPV A;  1H6Y A;  5FPL A;  3W9A A;  4DRR A;  3DPR C;  3GXU A;  1WCQ A;  2A71 A;  3POI A;  2OKX A;  5CFD B;  2PLV 2;  1FAY A;  1HQW A;  2VNG A;  5C3S A;  3H3Z A;  3ENR A;  1POV 0;  1HRV 3;  1RUD 1;  3PTR B;  5IW0 A;  4D94 A;  1YO8 A;  1U5Z A;  3VKL A;  1OBN A;  1PVC 1;  3I59 A;  4DIN B;  3UES A;  1LOA A;  2VCC A;  1R09 1;  5FQ0 A;  4JX0 A;  1OOP A;  2FQP A;  3SIT A;  4QPW A;  3VHP A;  1ND2 C;  3GHN A;  3E6B A;  3O5S A;  4UFK A;  3HR9 A;  1F5J A;  3HMY A;  4YW3 A;  5DZF A;  1LB2 A;  2ZEY A;  1SG3 A;  4MZU A;  1NY7 2;  4URT A;  3LCP A;  4EN8 B;  5HXM A;  2QCS B;  4IES A;  1HXS 3;  4V1P A;  5FO8 B;  4XHX A;  4CDW A;  4DS0 A;  5IT6 A;  2UY8 A;  4Z8B A;  4CDW B;  4NJ4 A;  2PMW B;  1N3Q A;  4KNC A;  4H55 A;  1ZRE A;  3RWN A;  2BOI A;  5CKM A;  5A6Z A;  5I8T A;  5GJ6 A;  3CJX A;  4FTE A;  1MZF A;  1OFN A;  2FDH A;  5LY2 A;  5T54 A;  1SBD A;  4WVW A;  3SH5 A;  2JDN A;  1AR7 3;  3H3U A;  4UBG A;  4K3U A;  3V65 A;  3RS6 A;  3BU0 A;  2X8K A;  1LGN A;  3O1P A;  1ALY A;  1QJE A;  3HNM A;  5F5I A;  4YM0 A;  3AJZ A;  4YWA A;  3NL1 A;  5A7W B;  5FLJ A;  4Y20 B;  4OMD A;  4XIO A;  3DYP A;  4QB1 A;  4NRO A;  2D5H A;  3N36 A;  5FRE A;  4FTB A;  5FP7 A;  1OOP C;  1FX5 A;  2A70 A;  3NJZ A;  2P3J A;  4NRM A;  5DUU A;  4C1W A;  4YVW C;  5FTT C;  4GB3 2;  1W8N A;  1HB4 A;  1O6U A;  3H3L A;  4YW6 A;  1SBE A;  2JDP A;  2ATF A;  3U75 A;  5FAX A;  3VBU B;  3TRS B;  1QDC A;  2WIN B;  1NQD A;  3POJ A;  1RUH 3;  1CR7 A;  4P5Y A;  1N1V A;  5A1F A;  4ISQ A;  5K0U B;  1SFY A;  1SLI A;  3THP A;  1MS1 A;  1F9K A;  1H1I A;  4QMA A;  4NR1 A;  2O8O A;  1H9P A;  4HVR A;  1H8T B;  3MGU A;  1XYP A;  5SV5 A;  5KHK A;  3PVN A;  2W52 A;  4FFF A;  2VZO A;  1GP4 A;  3OY8 B;  4YRD A;  2F4P A;  2F17 A;  4LKS A;  3KWV A;  3ZSM A;  2Y6J A;  2YC4 A;  2VOT A;  2ZMK A;  4XFC A;  4C91 A;  2GSY A;  4XBL A;  5IFT A;  3KV5 A;  5LEK A;  2VXJ A;  2VZ3 A;  2WNU B;  5BNO C;  2XJP A;  4ZU7 A;  4CDU B;  5ISL A;  2HWF 1;  1AZD A;  2OQ7 A;  4FXG B;  4HG6 B;  1GBG A;  3JD7 1;  1WKY A;  3ETQ A;  4LHL A;  4K1Y A;  4CEY C;  2HKX A;  5IK5 A;  1XNK A;  4QX5 A;  1VAK A;  3KCC A;  5FZ9 A;  1H8V A;  5JMC A;  4JVA A;  3WLU A;  2GND A;  4IEW A;  2LTN A;  5FZC A;  5FMO S;  1C8M 2;  3AJY A;  3CIH A;  3OTF A;  5SV8 A;  3OGG A;  1BEV 3;  1RUJ 1;  4CP9 B;  1T6G C;  1LCL A;  1VMH A;  2WDB A;  3VZO A;  5TSW A;  5LCW L;  2ZX4 A;  1GFF 2;  2ZA9 A;  3FFZ A;  1I5Z A;  2Z79 A;  3KV4 A;  4RQP A;  4KWL A;  2VME A;  3J26 N;  3I2O A;  1G86 A;  3MW4 A;  1S2E A;  4N7U A;  1SQ4 A;  4QWN A;  4RQP B;  2Q8D A;  4ZS2 A;  3G7D A;  1URX A;  2E31 A;  2PYT A;  3WUD A;  1IKQ A;  2PHW A;  4K21 A;  2GP5 A;  5DUW A;  1UKG A;  2Q4S A;  3RJ2 X;  3OD0 A;  3WDU A;  4A4A A;  4A6O A;  2HWC 1;  4LKF A;  1FOD 1;  3ACG A;  4PQ9 A;  4TLG A;  1A34 A;  1OF3 A;  1QJU 3;  3ZFE B;  1BVV A;  1E5R A;  3DYO A;  4FPE A;  5CFC A;  4FPC A;  1HV1 A;  2C26 A;  5A80 A;  1UZ0 A;  5C71 A;  2D44 A;  4A6S A;  1DQ1 A;  5FBJ A;  1B35 A;  4ZU4 A;  1W0P A;  1L3J A;  4CU9 A;  4S2G A;  2ZCW A;  4CPB A;  1B35 B;  1LAJ A;  1RVF 2;  2VEC A;  2ZHK A;  3VL9 A;  4CVU A;  2ENR A;  1LGC A;  1RUC 2;  5IWF A;  4UFL A;  4FSJ A;  2QZ3 A;  4YGE A;  5HXV A;  3CDZ B;  3VDD B;  5FJH A;  1CZV A;  3AM2 A;  3ZFG A;  1GKB A;  2WS9 1;  5J3U A;  4NIH A;  4YGD A;  4IEV A;  2A6Z A;  3UNP A;  3T0B A;  1ONA A;  1UL9 A;  4HOO A;  4OFG A;  1NCQ B;  5HBA A;  1TNF A;  5LK5 A;  5KXC A;  3O1U A;  3IZO A;  3SIS A;  1ENQ A;  4HSJ A;  3RGB A;  4AK3 A;  1GZT A;  4A44 A;  2WQ4 A;  3HJR A;  3SCH A;  2VO5 A;  2FCT A;  2RS1 3;  2QQU A;  2VUL A;  3WZ1 A;  2Y6K A;  4FFH A;  3KSC A;  4GUL A;  2VZS A;  3R6S A;  1D4M 1;  5DG1 A;  1LED A;  2VQA A;  3KLS A;  4Y4R A;  5LWB A;  4E2S A;  3D0J A;  3V56 A;  2XON A;  4HAN A;  4LBQ D;  4NMI A;  3CZU A;  2P5B A;  2RV9 A;  5FXW A;  5CFC C;  1MQT B;  1Q43 A;  1PHM A;  1YJL A;  2WNE A;  5HCA A;  4ZXE A;  3VZK A;  4N43 A;  1ACC A;  2WUH A;  3C7F A;  1UNB A;  4FOY A;  4AFC A;  1K12 A;  4N43 B;  4PQQ A;  3PJQ A;  4Y1Y A;  2WAO A;  5F1R A;  2CGN A;  3PU3 A;  2GH2 A;  1AJK A;  3FX3 A;  2YUE A;  1BK1 A;  1UXX X;  1W6Q B;  3AFK A;  1ZRC A;  2I07 B;  2B5H A;  2JG8 B;  1UYP A;  3A23 A;  2R06 2;  1HRI 3;  4MYE A;  1W06 A;  1U0A A;  3MUZ 1;  1PZ7 A;  1RIT A;  4DFS A;  3O14 A;  1OUR A;  4CCO A;  4AQT A;  4E9K A;  4QAW A;  2HBU A;  3OYW A;  2YGL A;  3GGL A;  4UF0 A;  1DF0 A;  4YYO A;  1GQH A;  2W91 A;  2CSG A;  2VGD A;  2WQZ C;  4JGZ C;  4FXK B;  2GDF A;  4AED A;  1OD5 A;  5F5Q A;  4D3W A;  2ZX3 A;  5JZG B;  4ORF A;  3W20 A;  1V6M A;  1LEM A;  4I09 A;  1W8O A;  1JZ5 A;  3K4A A;  4OCT A;  1NUK A;  3T0D A;  2RS3 1;  5A7P A;  1L7L A;  2WT0 A;  5C8W A;  4BH9 A;  3KQR A;  4XAA A;  2YU1 A;  3ACF A;  3ZPY A;  3ZXK A;  1LHW A;  1RUO A;  3MIE A;  2MEV 1;  1RUF 2;  3S5Q A;  5JDB A;  3I2F A;  3U4S A;  4IGP A;  1GQG A;  1PO2 1;  5FPA A;  2DUO A;  2EF6 A;  2LM3 A;  4DXT A;  1EV1 2;  4B4P A;  4PLM A;  1X82 A;  2OXB A;  4CUG A;  1DYP A;  3F2Z A;  5FZM A;  3W21 A;  1ZRD A;  5FYZ A;  2NQY A;  3P3P A;  5KHH A;  5JOZ A;  2EIB A;  2IXK A;  4RGG A;  3WSO A;  2Z5W A;  1YQ8 A;  3H42 B;  3ASI A;  4W65 A;  2D3S A;  2VXR A;  4M3C A;  2R0H A;  3I54 A;  1I5P A;  2CU5 A;  3B9C A;  3IMN A;  5GM0 A;  4GQ7 A;  4BPZ A;  1CAX A;  1JTZ X;  3HWJ A;  2WO2 A;  3H50 A;  3WG4 A;  4XF4 A;  3ZYG A;  2HJI A;  3U0Z A;  3BOW A;  1CAX B;  2A6V A;  4DPN A;  1RUE 3;  5LAT A;  5A7O A;  5LB6 A;  2R32 A;  5IUQ A;  1AXK A;  3OGJ A;  5A32 A;  5KBF A;  2WZR 3;  2WYS A;  4JHZ A;  5A32 B;  1NCR C;  1V9U 2;  2ZTN A;  1RMU 2;  5EJ1 B;  3WNP A;  1G9B A;  1XU2 A;  2PHT A;  2VTF A;  1Y7B A;  3N9M A;  4F8A A;  4P5H A;  4IGQ A;  4CRQ A;  5A6X A;  1J58 A;  5FZ7 A;  1REE A;  4JV4 A;  1UPS A;  2ET7 A;  1OC1 A;  3PNA A;  4L97 A;  1KJR A;  3WW2 A;  3RZK A;  2HWD 1;  3KB5 A;  4IL7 A;  1CPM A;  2PFW A;  1QQP 2;  2PLV 3;  5AFB A;  2EXH A;  4Y22 B;  2DU1 A;  3DXU A;  3AP5 A;  3PME A;  4TN7 A;  4AI2 A;  1ZBA 1;  3OGR A;  3A21 A;  1IQA A;  5E1R A;  5FYS A;  3AX4 A;  1CZT A;  3D82 A;  4S2H A;  4SBV A;  4CDQ C;  2B8M A;  5FP8 A;  3JZV A;  1O3S A;  1RUI 2;  2PA7 A;  3OGS A;  3PUQ A;  3WD5 A;  4TTG A;  4LO5 B;  1QU0 A;  3NV4 A;  1Q8O A;  2OX0 A;  2IVJ A;  1WLW A;  3M3C A;  4HKW A;  3O1T A;  5IAT A;  4K9S A;  1PK6 A;  4XOG A;  2WNV B;  5CYY A;  2P6C A;  3H8U A;  4PI0 A;  1H2M A;  2VBP A;  1PK6 B;  4OHX A;  3S0M A;  4N8M A;  2QQV A;  1UYY A;  1C4R A;  2WKK A;  5FOJ B;  3FHQ A;  2D3P A;  4HKL A;  2VZR A;  5JMO A;  2D7F A;  2O8Q A;  4D6S A;  3I8T A;  1XE8 A;  2XDV A;  4XZU G;  1S2B A;  2JWP A;  4RA0 A;  1W9T A;  4AG4 A;  1DIW A;  4RFR B;  2CGO A;  1PZ8 A;  3WOG A;  5G05 L;  2ZML A;  4UFM A;  3J8F 1;  4BIO A;  2Q1F A;  2VH9 A;  4OZO A;  3IB3 A;  4JTN A;  5DDJ 2;  2AGS A;  3AKT A;  3AMQ A;  5L7O C;  2D40 A;  5GZF A;  5EIY B;  3ATG A;  1DZT A;  1S0C A;  2H0V A;  4LIU A;  1GYK A;  2CAV A;  1HQL A;  2DCK A;  4Q1R A;  3KF3 A;  2W9X A;  2WT2 A;  4XJW A;  4DEQ A;  1CWP A;  5HV0 A;  2Y8K A;  1RUG 1;  2QDN A;  4GB3 3;  4IND A;  1Z0H A;  1W39 A;  2UU8 A;  3WR0 A;  1OHF A;  2DVD A;  1AYN 2;  2JJ6 A;  5FZH A;  4C0B A;  1GOH A;  2W68 A;  4N9H A;  5DAB A;  4HZF A;  2K0G A;  3CNA A;  1EUT A;  2EAK A;  4X8P A;  5FY8 A;  2IUW A;  1SDW A;  1I9R A;  3GZE A;  4HVO A;  1JU3 A;  1NOV A;  3CLP A;  3OBA A;  3M3I A;  4IV1 A;  1K5M A;  2B4K A;  4QPG A;  4YG6 A;  3BGA A;  1H0B A;  5A3T A;  1K5M B;  2DU0 A;  2CL2 A;  2PAE A;  2RMU 2;  3I3D A;  3ZXG A;  1NA1 C;  3W59 A;  5I0D A;  1RTV A;  1A8M A;  2P17 A;  1JZ6 A;  2YPJ A;  4PBP A;  4J25 A;  5IHR A;  3LFM A;  4QX0 A;  2VBB A;  3THD A;  2EVX A;  3VBO C;  4WV8 A;  2VPV A;  3OUJ A;  2IFW A;  1W2A X;  2VMG A;  2W5F A;  2VZV A;  3PVO A;  4GA9 A;  4GAZ A;  4RFT 0;  4WM8 A;  3RZJ A;  5FYT A;  3VZL A;  5IJR A;  2NP0 A;  2O1Q A;  1AL2 2;  2OZJ A;  3PVE A;  1Q3E A;  1U5X A;  2JDY A;  4P00 B;  5FK8 A;  1WLC A;  2WRA A;  1JOP A;  1F2N A;  1S0F A;  3TEZ A;  3KCY A;  3P1I A;  4AFD A;  3QH6 A;  1VR3 A;  1OVP A;  2IFR A;  3AYE A;  1UY3 A;  4Q4X 1;  2G1M A;  3RWK X;  2C9A A;  1C8M 3;  1W8Z A;  4TXW A;  3AC0 A;  4FPJ A;  1BLZ A;  1HQN A;  1RC6 A;  3RDI A;  5ABJ A;  1LOD A;  2ADE A;  2RDS A;  3VN4 A;  3OBZ A;  4QDS A;  4QQP A;  1A78 A;  4BXF A;  1GOF A;  2CHH A;  4AGV A;  5KHJ A;  1X7N A;  2EXK A;  2PHF A;  3F95 A;  5LY1 A;  3T1L A;  2IXJ A;  1VAV A;  2D5F A;  2R07 1;  4GWJ A;  5EXO A;  5C4W C;  4CZS A;  4QPG C;  4CUA A;  1O3R A;  2XL9 A;  4LBQ A;  3T09 A;  3ROU A;  2ZGM A;  1YQ6 A;  1UMI A;  2VUD A;  5C70 A;  3U1X A;  2BVB A;  4IEU A;  4LBQ B;  1XPW A;  3IWZ A;  4LIV A;  5C8C C;  2FZ2 A;  1CON A;  5FY1 A;  4YZ1 A;  1TME 2;  1CAV B;  1O91 A;  2GNM A;  2K9Z A;  4UW6 A;  5IFP A;  4WM8 C;  2VZP A;  1U12 A;  1AJO A;  1SPP A;  4FOQ A;  3OBR A;  3ZYB A;  1JUI A;  3S30 A;  1YEW A;  5A33 B;  4WM7 C;  2OQ6 A;  3SH3 A;  2YY1 A;  5C7G A;  4OUL A;  1EPW A;  1AR9 1;  1E5H A;  1RVF 3;  1STM A;  4YZ2 A;  4JDN A;  2JKX A;  5FZ8 A;  4QX2 A;  2D6L X;  2E7A A;  2RR1 2;  3NQH A;  1RUC 3;  4PDW B;  1JZ3 A;  1W28 A;  3OPT A;  2G9F A;  2RHP A;  5F37 A;  1O8S A;  2XR4 A;  4LA2 A;  2UUR A;  3GBG A;  1DQ2 A;  3P3N A;  3EYP A;  3WUC A;  3NAP A;  4YGC A;  1DBN A;  1EAH 2;  1HXS 1;  5EYX A;  4AWD A;  4LIT A;  2WZ8 A;  1PO1 2;  3WNL A;  3K75 B;  1QDO A;  3PTY A;  5A3L A;  3TNP B;  4EYU A;  1DQ0 A;  1S55 A;  3UKV A;  4RS5 C;  2GC2 A;  3WF1 A;  4B4R A;  2ZOE B;  5C6C A;  2R1B A;  3WXP A;  4CP1 A;  5C9A C;  1VIW B;  2IVI B;  5LBC A;  5EPA A;  4P02 B;  1UX6 A;  3K48 A;  3DEM A;  1AR7 1;  5BNN C;  2RG4 A;  3MIG A;  2CDO A;  3ZM8 A;  3LEG A;  4LT5 A;  4JCK A;  1MS8 A;  2OT7 A;  4URA A;  1JZ2 A;  1NXM A;  3NJX A;  3VBH C;  3N9L A;  1N1S A;  2JG9 B;  1PGL 1;  1NYW A;  3AP6 A;  5T52 A;  3KT1 A;  3ZYJ B;  4QX8 A;  5FDB A;  4LBM A;  5D8A A;  5CNA A;  4XW3 A;  5B4N A;  3NJY A;  4Y4Y A;  3VKN A;  2Y34 A;  2WWU A;  5D8A B;  4AI3 A;  3SNM A;  3OG2 A;  2DDU A;  2DWR A;  4HKO A;  4FTS A;  3A7Q A;  3PUH A;  5CG9 A;  1XND A;  1FMD 1;  5LBE A;  3K51 A;  1I6X A;  1H1A A;  1WW7 A;  2R06 3;  1HKD A;  2DUP A;  2XH6 A;  4FPY A;  5FYY A;  5JI9 A;  3NAP C;  1UWW A;  2XKO A;  3G6J B;  3H7J A;  1RUH 1;  3U07 A;  5AC9 2;  5L73 A;  2V5Y A;  3MHZ A;  1Y9G A;  3LIH A;  5K4L A;  5FV3 A;  4NIG A;  2XPJ A;  4R9C A;  3T4V A;  1TQ5 A;  2D97 A;  2HBT A;  3B3Q E;  3ZN5 A;  4JTO A;  4AVV A;  3ZSL A;  4HET A;  4FAH A;  4EN6 B;  1AF9 A;  2VTX A;  3ZSE A;  4B1L A;  1WLT A;  2XML A;  3JCI A;  5F3E A;  2JE7 A;  5BPX A;  5EV7 A;  4MAD A;  3KMH A;  3SQO A;  5GKA C;  2GN7 A;  2R04 1;  1VBE 1;  4XFH A;  2K2S A;  3JBG 1;  5BNP C;  5L9V A;  3LPF A;  4JRL A;  4W4Z A;  4BQX A;  1LTE A;  1O59 A;  1VRH 2;  4LUK A;  2W46 A;  3V0A A;  1S0I A;  1RUF 3;  3AMN A;  3FUO A;  3GCW A;  4K40 A;  3MIB A;  4FQZ A;  2UY9 A;  4M3C F;  4QHO A;  3VGI A;  1HB1 A;  1TMF 2;  1UU4 A;  3GYD A;  4XF9 A;  1ST8 A;  1EV1 3;  4QPY A;  2J1V A;  5A6Q A;  1FPN 2;  4YFW A;  1F4H A;  1KXG A;  3ZN6 A;  2KR2 A;  4TSV A;  3TN9 1;  3WEZ A;  5ACA 1;  4JKK A;  2UWA A;  3MW2 A;  1VBA 2;  4U36 A;  5FLI A;  3WP5 A;  1S0E A;  3O1S A;  4C1X A;  3N35 A;  4AZZ A;  2VZQ A;  2R30 A;  3MFA A;  2NMN A;  1ZRF A;  3ZYP A;  2G9G A;  4BQ5 A;  3AL6 A;  4J1W A;  4G3Y C;  3AMH A;  4LJH A;  4QPI A;  4JDO A;  5EJZ B;  4DUX A;  1QJU 1;  1OMI A;  1RGS A;  3I3E A;  4QPI B;  4EQV A;  4JRA A;  1V9U 3;  3ZFF B;  1RMU 3;  3ZYH A;  4BK4 A;  4DB5 A;  4I0A A;  3LFI A;  4AQ2 A;  3HNY M;  1XRU A;  3UET A;  4GH4 B;  1UY4 A;  4Q4V 1;  3QBQ A;  4CPB D;  1V6O A;  4UFJ A;  1RXF A;  1CD3 G;  3QAC A;  4HL0 A;  2DVG A;  1YQ2 A;  5LW9 A;  2VU9 A;  2EID A;  5FZ3 A;  3NKT A;  4LR4 A;  4UYB A;  1OVS A;  1QQP 3;  1F4A A;  4ZY9 A;  5A7Q A;  5C5T A;  5KHG A;  4BDV B;  3M4F A;  4CUB A;  5HCB A;  1M06 G;  4LNV A;  5GLW A;  1OLM E;  5DAX A;  3ES1 A;  4HBN A;  4ISR A;  1PIV 2;  1GMM A;  2A3X A;  3AZZ A;  1IS3 A;  2WSU A;  2VOK A;  2VBD A;  4XPV A;  5C3R A;  2JDZ A;  4UW5 A;  2DBN A;  4RYD A;  3WQ7 A;  5IK4 A;  3BTZ A;  1UYX A;  3DUI A;  3LOB A;  1RUI 3;  2RS1 1;  1YIF A;  3DV8 A;  1NKG A;  3K2O A;  4QGN A;  4XIK A;  1ZA4 A;  4AVT A;  2BW8 A;  5JPN B;  5CG8 A;  3AZV A;  1VB2 A;  3VBR A;  1QJY 1;  1K45 A;  2Y6G A;  1OKQ A;  1UYZ A;  3VBF B;  1OQE A;  1APN A;  2UWC A;  2QQO A;  2GMP A;  2ZMN A;  2VL4 A;  2VZT A;  4MO3 M;  5KHI A;  1ZZB A;  4Y1U A;  3ZKU A;  2EIG A;  3AKS A;  5EJ3 A;  2O0O A;  1JOD A;  4WVM A;  3DPR A;  5FP4 A;  3U4X A;  3ZVX A;  4AVB A;  1HB2 A;  4FBF A;  2SBA A;  3DPR B;  4AHY A;  4BMB A;  5JSO A;  2UYB A;  2Q8C A;  3ALQ A;  4B7K A;  1LEC A;  1DYK A;  4CXY A;  2D3R A;  2ZHM A;  3NNM A;  2WLP A;  2WWJ A;  1HRI 1;  2BWC A;  1GAN A;  1HW5 A;  3EMR A;  3MLL A;  3WNN A;  1HDK A;  5DDJ 3;  2JDK A;  1ND2 A;  1BBT 1;  4WVZ A;  1A6C A;  4K20 A;  1EYB A;  1D2Q A;  1DGR N;  4DMI A;  4PIZ A;  5T5O A;  1MAC A;  1ZNP A;  1Y4W A;  3HD8 B;  2KM2 A;  4XDQ A;  2FCV A;  3VKF C;  3HEI A;  2IXI A;  4PIY A;  4YW5 A;  4CCJ A;  3WDT A;  1AYN 3;  3VBR C;  3HQU A;  4XTP A;  2ARX A;  4XHB A;  3URF A;  2ZAC A;  1I1E A;  4A42 A;  4XUT A;  3RZH A;  1BK0 A;  1OFS A;  3WCR A;  1FNZ A;  2DCY A;  4XUO A;  2Z4F A;  1SLB A;  3E5Q A;  4XJA A;  4XXP A;  3FFQ A;  2RMU 3;  4FFG A;  1TZO A;  3EQE A;  4R9A A;  1OQ1 A;  1SEF A;  2DCZ A;  4JGY A;  4FOW A;  5F3I A;  1GP5 A;  1V6I A;  1Z78 A;  4Y5S A;  2RJK A;  3T2O A;  2CDP A;  2W1U A;  3I59 B;  4PF1 A;  5FYV A;  5JPM B;  1AL2 3;  3UV9 A;  5FQ0 B;  2ZKL A;  2YYO A;  3W5N A;  4YVW A;  1OOP B;  3LGR A;  1AL0 G;  5LEJ A;  1K5J A;  3OPZ A;  4YVW B;  1LOB A;  4XF0 A;  1YNA A;  1JOB A;  2RDQ A;  3WNO A;  1MPX A;  3LIG A;  3R0R A;  3HIF A;  1RUE 1;  3LEM A;  3BIE A;  3AZW A;  1UMH A;  2R6Q A;  3POG A;  5IK8 A;  4LTA A;  3WF2 A;  1RYY A;  2JDU A;  2WZR 1;  4GWN A;  5FZK A;  1V0A A;  2ZZJ A;  3AVS A;  4AQ6 A;  3SCF A;  2HWE 1;  4AAX A;  3INA A;  1ZZ8 A;  5FR3 A;  1CX1 A;  1G9C A;  5T5J A;  2P34 A;  1WME A;  2B9V A;  1YQC A;  1C3H A;  2C24 A;  1ZBE 1;  1ZZ6 A;  1OUX A;  2V09 A;  1RJ7 A;  2XHN A;  3J4U H;  4JGY C;  3KGL A;  4L11 A;  5BNO A;  1TME 3;  3POF A;  5D2A A;  4Y24 A;  4JZR A;  5BNO B;  4KH9 A;  4NWW A;  2PLV 1;  5FBZ A;  4UFI A;  4CEY A;  4C8D A;  1W6O A;  3BTX A;  3WNX A;  3IAP A;  3GAL A;  3III A;  2IZW A;  1YUD A;  3NNG A;  1W6O B;  1IG0 A;  4OHZ A;  3VLB B;  4D8M A;  3MI8 A;  3VBS A;  3MLJ A;  5FIX A;  3C7O A;  5CFD C;  2RR1 3;  3OOX A;  5JAX A;  3I3M A;  1R1Z A;  1ZM1 A;  1QH6 A;  2BP6 A;  1RJ8 A;  3JD7 2;  2BU9 A;  5FY4 A;  4Q4Y 2;  1LR5 A;  1NY7 1;  2C4X A;  3CO2 A;  2J1A A;  2XWB B;  3MBW A;  1EAH 3;  1PO1 3;  2YC0 A;  4BLI A;  4NHL A;  1VBB 2;  4CXX A;  3QD6 A;  5DUV A;  3USS A;  2BVV A;  2JIC A;  3IDB B;  3IPV A;  3I2H A;  4L92 A;  1CPN A;  5FY5 A;  3ZXA C;  1US3 A;  5KXD A;  3Q8A A;  1SFP A;  4X6R B;  1G9F A;  3SXW A;  4FPF A;  4K6B A;  3J7M A;  5JOY A;  3SEP A;  1J1T A;  1OI6 A;  1J84 A;  3BPZ A;  2A6X A;  4AFM A;  5DAW A;  3JB8 A;  4CP2 A;  4OHY A;  2P3Y A;  3L2H A;  1IPJ A;  5FYU A;  3VV1 A;  3RZL A;  1IQD C;  1FOD 2;  1QNW A;  2WR9 A;  1RL3 A;  2ZGT A;  3ZOI A;  1BYH A;  2PHD A;  3QH7 A;  4NIA A;  3VBS C;  4KG8 A;  2C1F A;  4NII A;  2QUO A;  1P8J A;  5FZD A;  3CMG A;  3GDB A;  2PHU A;  2UWB A;  1JOJ A;  4GB3 1;  2BFU L;  5DZG A;  1S2K A;  5FY0 A;  4EZ4 A;  3R05 A;  3T3Y A;  1SCR A;  2V4V A;  4P9L A;  3TNQ A;  3ZIW A;  4RHV 2;  3NO8 A;  5JR7 B;  4D69 A;  5AC9 3;  1PVX A;  1UCX A;  1AR8 2;  3D6E A;  3E5X A;  2AH2 A;  1W2T A;  2VAU A;  4A3Z A;  2WS9 2;  4LOR A;  3E6C C;  3CEW A;  4ASM B;  4DOU A;  5I0T A;  1ZZ7 A;  4ES8 A;  1F15 A;  2X5I C;  3RJR A;  3MF9 A;  1BZW A;  2BZD A;  5FZ1 A;  1RHI 1;  2WFF 1;  4XC9 A;  4YFZ A;  3TB0 A;  5CFC B;  3AVR A;  3GF6 A;  1HIX A;  5DQ0 A;  1KRI A;  4MGK E;  1YIP A;  1ODN A;  2XQX A;  2VMC A;  5A70 A;  3FBM A;  3ST7 A;  1D4M 2;  2ETE A;  1W8T A;  3AP4 A;  1VRH 3;  2BNM A;  1V6J A;  4K7J A;  2GH8 A;  4FI9 A;  1RED A;  4IW3 A;  2VUC A;  3AK0 A;  4XJ9 A;  1TMF 3;  3APB A;  4RR3 C;  2JDA A;  1E5S A;  4XFF A;  3ZFG B;  1OXC A;  1FPN 3;  3B69 A;  2CWS A;  5H9Q A;  4ZKT B;  4CDU C;  3UGH A;  4B8E A;  3DL3 A;  2NLR A;  3RVH A;  2ZJC A;  4JGZ A;  4IQP A;  4U2A A;  4XBN A;  4Q8K A;  5F9T A;  1VBA 3;  1SCS A;  4O7X A;  1OA4 A;  4FOV A;  3SHR A;  4LLO A;  1QY4 A;  4MX3 A;  3AXE A;  4QGM A;  2XJU A;  2I45 A;  2RJ2 A;  1ZX5 A;  1L7Q A;  4CCN A;  4AGG A;  2NN8 A;  5DAP A;  3RI8 A;  3S6P A;  1W99 A;  4NHY A;  4M4R A;  1LU2 A;  4SLI A;  1MS3 A;  5FZB A;  4COU A;  1S0B A;  3H1W A;  3ZMN A;  4JDM A;  1Y9Q A;  5DZE A;  4AAP A;  2O14 A;  1MEC 1;  4OI0 A;  2QFE A;  2ZHL A;  1W2O A;  4GMP 1;  4NAM A;  4R9D A;  1KIT A;  4QX7 A;  1RVF 1;  5I0S A;  1MZE A;  2Q1M A;  5F6L B;  4XEZ A;  2C0Z A;  1RUC 1;  1Q8P A;  4XAE A;  2X10 A;  1E5I A;  2R49 A;  3MDP A;  2IC1 A;  1KEX A;  5JXH A;  5FWE A;  1PO2 2; 
#chains in the Genus database with same CATH homology
 3I3D A;  2DCJ A;  3C7H A;  3FN9 A;  3LEK A;  5I0D A;  2EIE A;  4XUN A;  1JZ6 A;  3T0A A;  5IHR A;  4QX0 A;  2VR4 A;  1NX9 A;  3THD A;  1R64 A;  3MV1 1;  3WF0 A;  2W5F A;  2VZV A;  4UAP A;  2W3J A;  4XUO A;  4ET7 A;  2WAB A;  3P6B A;  5IJR A;  4D0Q A;  2Y64 A;  4P00 B;  4QDQ A;  5CZK A;  3P1I A;  3BN6 A;  1PMJ X;  3NRU A;  3VD7 A;  1UY3 A;  2VM9 A;  4TXW A;  2KD7 A;  4ARY A;  3AC0 A;  1UY0 A;  4QDS A;  1GOF A;  1JYV A;  3SKJ E;  4GWJ A;  4CU7 A;  2XOM A;  3HPN A;  2PQS A;  4CUA A;  2YC2 A;  3DYM A;  5DN2 A;  4BJ0 A;  3T09 A;  1UMI A;  5C70 A;  1KGY A;  2VCB A;  3HNB M;  1XPW A;  3K77 A;  3THC A;  5IFP A;  2VQU A;  2VZP A;  5LA0 A;  2EIC A;  1SPP A;  2ID4 A;  5JXG A;  4GZ9 A;  5C7G A;  1XC6 A;  4LPL A;  1DP0 A;  2JKX A;  3A22 A;  4QX2 A;  1TG7 A;  2W92 A;  3T2P A;  3NQH A;  1JZ3 A;  4OYU A;  1O8S A;  1UY1 A;  3CQO A;  1PX3 A;  3MO4 A;  2J1R A;  3EYP A;  3DEC A;  3FHA A;  2V5D A;  2WZE A;  1GNY A;  1XNA A;  2WZ8 A;  2BGP A;  2YFU A;  3WNL A;  3K75 B;  4DUV A;  1UXZ A;  2WBK A;  1UY2 A;  3OEA A;  2VZU A;  3WF1 A;  3NJV A;  1XNT A;  4RN5 A;  3MUY 1;  4P02 B;  1JYW A;  3DEM A;  4XUP A;  3D3A A;  4KI5 M;  5JXI A;  2CDO A;  3ZM8 A;  3LEG A;  1JZ2 A;  3NJX A;  4OMC A;  2QQJ A;  3CZJ A;  5HPO A;  4CUC A;  5IYY A;  2QQN A;  3T2Q A;  1TVG A;  3OGV A;  1GUI A;  2E33 A;  2VMD A;  2QQI A;  3I2I A;  5B4N A;  2W94 A;  2DDU A;  3OG2 A;  2W1S A;  2ZEX A;  3A7Q A;  3PUH A;  1J83 A;  4Z2A A;  3ETP A;  2BER A;  1UWW A;  3ACI A;  4W8J A;  1JI6 A;  2W87 A;  4MGQ A;  1H6Y A;  3FL7 A;  2YB7 A;  4LQR A;  4E8D A;  3GXU A;  1WCQ A;  1ULO A;  2OKX A;  3POI A;  4A45 A;  2QQM A;  1ULP A;  3LE0 A;  5CIS A;  1SZB A;  4MAD A;  3UES A;  2ORX A;  2VCC A;  5JR2 A;  4JX0 A;  4QPW A;  3LPF A;  1BHG A;  2WAA A;  3WQB A;  4QB6 A;  4W4Z A;  4XUR A;  2LS6 A;  1O59 A;  2ZEY A;  2W46 A;  1SG3 A;  5HXM A;  2WN3 A;  3KQ4 B;  3K46 A;  2J1V A;  3OB8 A;  1F4H A;  1L7R A;  5CKM A;  5CKN A;  4A41 A;  2HLE A;  3C7E A;  1O8P A;  3WEZ A;  1LNS A;  4JKK A;  2VQT A;  1OT5 A;  4LOS A;  2VZQ A;  3HNM A;  4CU6 A;  4M4P A;  4OMD A;  5EJZ B;  3DYP A;  4QB1 A;  4DUX A;  3I3E A;  2WO1 A;  3VD3 A;  1JU4 A;  1W8N A;  1PMH X;  4BK4 A;  4BK5 A;  2BBA A;  3HNY M;  3UET A;  3GM8 A;  1UY4 A;  3K4Z A;  4ARX A;  2J22 A;  3POJ A;  4P5Y A;  1YQ2 A;  2W1Q A;  2EID A;  1JZ4 A;  4ZY9 A;  1F4A A;  3VD5 A;  4BDV B;  4CUB A;  2VZO A;  2WQ8 A;  3WF4 A;  1GMM A;  3POE A;  2X09 A;  4LKS A;  3W5M A;  2Y6J A;  2YC4 A;  1SPP B;  2VOT A;  4RYD A;  3IAQ A;  4W50 A;  5IFT A;  1UYX A;  2VZ3 A;  1NKG A;  4HG6 B;  1JZ7 A;  1K45 A;  2Y6G A;  1UYZ A;  1WKY A;  5FUI A;  2QQO A;  2VZT A;  2VL4 A;  4MO3 M;  2RVA A;  2ZXQ A;  1GOG A;  3CIH A;  1JYN A;  1OH4 A;  2VZ1 A;  2WDB A;  5LCW L;  2VC9 A;  5JXJ A;  2E26 A;  1JHJ A;  2VME A;  3I2J A;  2WO3 A;  2JE8 A;  1W0N A;  1W9W A;  2WNO A;  2YFZ A;  2E31 A;  2C9K A;  4JKM A;  3WNN A;  4A4A A;  4LMF A;  5F7U A;  4A6O A;  4DXR A;  3ACG A;  1OF3 A;  2Y6H A;  3DYO A;  3IDA A;  3OEB A;  2C26 A;  2W1W A;  1UZ0 A;  3HEI A;  5C71 A;  2QBX A;  3WF3 A;  4CU9 A;  4ZZ5 A;  5DPN A;  1DLC A;  4CVU A;  3I3B A;  4A42 A;  4XUT A;  1SHW B;  3CDZ B;  3K4D A;  2Z4F A;  1CZV A;  3I97 A;  3HN3 A;  2QQL A;  5JUV A;  3UNP A;  1NT0 A;  3EB7 A;  3T0B A;  3SEE A;  2VCA A;  2J1U A;  1K42 A;  3T2O A;  4A44 A;  2CDP A;  3HJR A;  2VO5 A;  2W1U A;  1OD3 A;  4PF1 A;  1GU3 A;  2Y6K A;  4UOJ A;  3W5N A;  2VZS A;  5J1X A;  1SDD B;  4OUE A;  4QB2 A;  2XON A;  3VDA A;  3WNO A;  1MPX A;  2RV9 A;  3CZU A;  3HOB A;  4GWI A;  4XUQ A;  4ZXE A;  1UMH A;  3VDB A;  2WUH A;  3C7F A;  4P08 A;  3WF2 A;  3POG A;  1K12 A;  1RYY A;  2BGO A;  2W95 A;  4L0P A;  2WAO A;  4PQQ A;  2E32 A;  4AAX A;  1UXX X;  1CX1 A;  1D7P M;  2B9V A;  3A23 A;  3MUZ 1;  2XHN A;  2J1T A;  2JD9 A;  4QAW A;  3CKH A;  3POF A;  3GGL A;  2W91 A;  3IAP A;  3III A;  3NNG A;  4KWU A;  4D8M A;  1W8O A;  4QX3 A;  1JZ5 A;  3K4A A;  1NUK A;  3ABZ A;  3E1F 1;  3T0D A;  2VJX A;  3C7O A;  4YPJ A;  4MOA A;  4KMQ A;  3ACF A;  2C4X A;  2J1A A;  3MBW A;  3I2F A;  5DMY A;  4DXT A;  1OF4 A;  3POB A;  3F2Z A;  2W47 A;  2WN2 A;  2J1S A;  3I2H A;  1NAE A;  1GQP A;  2EIB A;  1US3 A;  3WSO A;  1SFP A;  1EUU A;  2LW8 A;  1DYO A;  1I5P A;  4XVH A;  2J7M A;  3T08 A;  3SEP A;  3WNM A;  3U37 A;  1J84 A;  3I2G A;  1CZS A;  3LQC A;  2WO2 A;  1HN1 A;  1JYX A;  1IQD C;  4DUW A;  2R7E B;  5A1A A;  2WYS A;  1JZ8 A;  1PX4 A;  1P8J A;  4JHZ A;  4CU8 A;  5EJ1 B;  3CMG A;  1US2 A;  3GDB A;  3ECQ A;  3WNP A;  2VTF A;  3LPG A;  2V4V A;  3I2K A;  3VD9 A;  2HYX A;  2L9L A;  4LOT A;  3VD4 A;  2ZEZ A;  1CIY A;  4A3Z A;  4LOR A;  4LHS A;  4ZZ8 A;  5G04 L;  2BZD A;  2J1E A;  3OGR A;  4DXS A;  3A21 A;  3J7H A;  5DQ0 A;  1CZT A;  3C7G A;  3SKV A;  2XQX A;  2VMC A;  4QDR A;  4TTG A;  3OGS A;  3C8X A;  4UI9 L;  4PT6 A;  4FI9 A;  5CKQ A;  5LA1 A;  5LA2 A;  4BXS V;  5CYY A;  4QX1 A;  2JDA A;  1UYY A;  3FHQ A;  5JMO A;  2VZR A;  3VDC A;  4XZU G;  3ACH A;  1W9T A;  4AG4 A;  1H6X A;  1T2X A;  5G05 L;  4MGS A;  4OZO A;  3IB3 A;  5B4X A;  1W9S A;  2RJ2 A;  1L7Q A;  5EIY B;  2ZEW A;  4DEV A;  1W99 A;  4M4R A;  2DCK A;  4DEQ A;  4IUG A;  2W9X A;  2Y6L A;  3PUI A;  3MV0 1;  2Y8K A;  1UX7 A;  3JXS A;  2QQK A;  1K3I A;  4JKL A;  2X05 A;  3WNK A;  1NZI A;  2VMF A;  1GOH A;  2V72 A;  2ORZ A;  2YG0 A;  4E8C A;  1EUT A;  3LEI A;  1JU3 A;  3OBA A;  2X10 A;  2B4K A;  1KEX A;  3BGA A;  5JXH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...