2QQLA

Neuropilin-2 a1a2b1b2 domains in complex with a semaphorin-blocking fab
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
576
structure length
554
Chain Sequence
PPCGGRLNSKDAGYITSPGYPQDYPSHQNCEWIVYAPEPNQKIVLNFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKHCGNIAPPTIISSGSMLYIKFTSDYARQGAGFSLRYEIFKTGSEDCSKNFTSPNGTIESPGFPEKYPHNLDCTFTILAKPKMEIILQFLIFDLCKYDWLDIWDGIPHVGPLIGKYCGTKTPSELRSSTGILSLTFHTDMAVAKDGFSARYYLVHQEPLENFQCNVPLGMESGRIANEQISASSTYSDGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLTAIATQGAISRETQNGYYVKSYKLEVSTNGEDWMVYRHGKNHKVFQANNDATEVVLNKLHAPLLTRFVRIRPQTWHSGIALRLELFGCRVTDAPCSNMLGMLSGLIADSQISASSTQEYLWSPSAARLVSSRSGWFPRIPQAQPGEEWLQVDLGTPKTVKGVIIQGARGARAFVRKFKVSYSLNGKDWEYIQDPRTQQPKLFEGNMHYDTPDIRRFDPIPAQYVRVYPERWSPAGIGMRLEVLGCDWTHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural studies of neuropilin/antibody complexes provide insights into semaphorin and VEGF binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Neuropilin-2
total genus 126
structure length 554
sequence length 576
ec nomenclature
pdb deposition date 2007-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00431 CUB CUB domain
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2qqlA03
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2qqlA04
2.60.120.290 Mainly Beta Sandwich Jelly Rolls Spermadhesin, CUB domain 2qqlA02
2.60.120.290 Mainly Beta Sandwich Jelly Rolls Spermadhesin, CUB domain 2qqlA01
1LNSA 3AC0A 2YFUA 2VMDA 1OF3A 3OG2A 3ACHA 4MGSA 4XUPA 3VD9A 3BGAA 4LKSA 4CUAA 4ZZ5A 2VZOA 2Y6HA 3MV11 2V4VA 2JD9A 4A6OA 2VMFA 1IQDC 4KWUA 2V72A 3C8XA 3W5NA 2QQNA 3T0AA 2ZEWA 1L7RA 1UZ0A 1SG3A 4XZUG 3VD3A 3NQHA 5G04L 2L9LA 2VQUA 1JHJA 1UY4A 4RN5A 4QB1A 1NZIA 4AAXA 5CYYA 1OF4A 3IB3A 1JZ2A 1JZ3A 4XUQA 2QQLA 1DLCA 1UY2A 4DUXA 4UAPA 2E32A 1YQ2A 2W1WA 3NJVA 5IHRA 1GOHA 3I2IA 5C70A 3SKVA 1ULOA 3POIA 2WN2A 1NKGA 2Y6KA 1UMIA 4CUBA 2HLEA 3MO4A 3HJRA 3WNKA 2VCCA 3A21A 3VD4A 3WSOA 2DDUA 3EYPA 4OUEA 3T08A 5EIYB 1TVGA 2B9VA 5JXGA 1JI6A 1XNAA 3K4AA 4JX0A 2QQKA 4P08A 3WNNA 5FUIA 2Z4FA 5EJ1B 3K75B 3C7EA 3WNLA 3HOBA 1OH4A 3I2HA 2VC9A 3UETA 2WNOA 3KQ4B 4BK4A 5B4NA 3LE0A 4CVUA 2RV9A 1I5PA 2EIDA 3I3BA 4GZ9A 5LCWL 4UI9L 1XC6A 5DPNA 3DEMA 2Y64A 3I2FA 1K42A 1CZVA 2ID4A 2VZ1A 4PT6A 4OMCA 3WEZA 3POFA 3UESA 4A4AA 2J1TA 1PX3A 1ULPA 1GU3A 2WN3A 3LEGA 2E31A 2VZRA 1D7PM 2JE8A 2J1AA 1SPPA 2CDPA 3LPFA 3WF4A 2W94A 4TTGA 3IIIA 1UWWA 3FHQA 5IJRA 2J1VA 1H6XA 3SEEA 4D0QA 2Y8KA 4CU9A 5DMYA 4PF1A 3CMGA 3CKHA 1UYZA 4MOAA 1JZ4A 3VDBA 5IFTA 3FN9A 2W92A 2XOMA 4ARXA 4XUNA 5EJZB 1SDDB 4QX0A 1W9SA 2VL4A 1JYNA 3CDZB 3HEIA 3CIHA 5I0DA 3F2ZA 2VZUA 3DYMA 4CU6A 2WABA 2HYXA 4CUCA 3WNMA 3WF0A 1JYWA 1UY0A 2QQJA 1RYYA 2QQIA 4YPJA 1UYYA 2EIEA 1CZSA 3WF2A 1J84A 4KMQA 5HPOA 1W99A 2VQTA 3CZUA 1JU3A 1UY3A 4LOSA 2J1SA 2LW8A 2YFZA 3K77A 5DN2A 1CIYA 1GUIA 1H6YA 3GXUA 3NNGA 5CISA 1K3IA 3I3EA 2Y6JA 3U37A 4L0PA 1GQPA 1NT0A 4M4RA 4QX3A 4M4PA 4JKKA 5HXMA 3LPGA 3T2OA 1UYXA 2LS6A 4Z2AA 3T0DA 1JZ8A 1P8JA 3A7QA 1T2XA 2YG0A 2RJ2A 3OGVA 5J1XA 4P5YA 2PQSA 3ABZA 1EUUA 4CU8A 3WF3A 4OZOA 3LEKA 1R64A 2ORZA 4E8CA 4A45A 2W9XA 2J7MA 3C7FA 3EB7A 4TXWA 3T09A 4HG6B 1O59A 1JYXA 2WO3A 3OBAA 3HNBM 3GDBA 3SKJE 2XQXA 5CKMA 2X05A 2W46A 5C7GA 3WNPA 3MUZ1 2CDOA 1MPXA 4QDQA 2VMEA 2C4XA 1O8SA 2VZSA 3POBA 4LMFA 1UXZA 4AG4A 2W95A 4ARYA 1NUKA 4ZY9A 2W3JA 3C7HA 2BBAA 1K12A 4XVHA 1JYVA 3P6BA 1J83A 4OMDA 2BZDA 2VM9A 2W1SA 2WAAA 2J22A 2VCAA 1F4HA 3OGRA 3IAPA 4FI9A 2ZXQA 3CZJA 2VZVA 4ET7A 2VJXA 4A44A 2DCJA 4ZZ8A 2BGPA 4A42A 2E33A 2XHNA 3E1F1 3WF1A 4DXSA 2V5DA 4XUTA 5A1AA 5G05L 1SPPB 2VTFA 4LHSA 3HN3A 1DP0A 2Y6GA 1O8PA 2Y6LA 4JKLA 4GWIA 3I2KA 2WYSA 3W5MA 2J1UA 5LA0A 3C7GA 3VDAA 2W91A 2ZEZA 1F4AA 1GNYA 3MV01 2WAOA 4ZXEA 2ZEYA 1PMHX 1WKYA 1JZ5A 4RYDA 5JMOA 2EIBA 1SZBA 5JUVA 2VZTA 4BK5A 1UMHA 2DCKA 3K46A 2E26A 3WNOA 4QDRA 2VR4A 3J7HA 4MGQA 3I3DA 5IFPA 4DUWA 3I2JA 3OEAA 4IUGA 3VDCA 3ETPA 4QPWA 2J1RA 4MADA 3D3AA 5DQ0A 4QAWA 3DYPA 4QX2A 4BXSV 2X09A 1TG7A 3SEPA 4LOTA 1UY1A 1W8OA 3ACGA 1PMJX 1KGYA 1BHGA 4W4ZA 2QQOA 2ZEXA 3DECA 2BERA 4W50A 3CQOA 3POJA 1JZ6A 4D8MA 3BN6A 1W0NA 2ORXA 5JR2A 4A41A 2VCBA 1US3A 2JKXA 4DEQA 3T0BA 1OT5A 4OYUA 2R7EB 2RVAA 2XONA 3FHAA 2WZEA 3ECQA 3ACIA 3WQBA 1GOGA 4XUOA 5CKQA 1NAEA 4CU7A 3THCA 3LEIA 1US2A 3LQCA 3PUHA 5LA2A 3MUY1 3GGLA 3K4ZA 2YC4A 1HN1A 4DXRA 2QBXA 2VZQA 1KEXA 4GWJA 4QB6A 2C26A 4DUVA 4JHZA 4KI5M 2YC2A 2J1EA 1SHWB 4JKMA 4QX1A 1GOFA 3OGSA 2C9KA 2WBKA 3T2PA 5JXJA 4LPLA 2VOTA 2X10A 2VMCA 3ACFA 2KD7A 4MO3M 2WUHA 4W8JA 1GMMA 2BGOA 1W8NA 3A23A 3I2GA 3JXSA 5JXHA 4QB2A 2EICA 2W47A 3POEA 1W9WA 1PX4A 2WO1A 5CKNA 1W9TA 2QQMA 1OD3A 2B4KA 2VO5A 1CX1A 4BDVB 3HNMA 3IAQA 2OKXA 1CZTA 2JDAA 4P02B 3ZM8A 3FL7A 1WCQA 3UNPA 3K4DA 5IYYA 4QDSA 3HPNA 1UXXX 1SFPA 4P00B 3POGA 3T2QA 2WDBA 3GM8A 3HNYM 5CZKA 3DYOA 4LORA 3VD7A 5JXIA 2W1UA 3OEBA 4XURA 2YB7A 1XPWA 3PUIA 3IDAA 5C71A 4A3ZA 4LQRA 3I97A 3NJXA 3OB8A 4UOJA 2W1QA 1UX7A 2WZ8A 3A22A 1JU4A 4DXTA 1DYOA 5LA1A 3P1IA 1K45A 4E8DA 1NX9A 1XNTA 2VZ3A 2W5FA 3MBWA 3VD5A 3NRUA 2WQ8A 2W87A 1L7QA 1EUTA 4DEVA 3C7OA 4PQQA 4BJ0A 2VZPA 5F7UA 3THDA 1JZ7A 5B4XA 2WO2A
chains in the Genus database with same CATH superfamily
5FZ7A 1SDWA 4Q4X1 1CESA 1A6CA 1X8MA 1W3VA 2WFF1 3FLPA 3AC0A 2WNUC 2Y60A 3JB4C 2JJ6A 4CEYC 4BLJA 2P5BA 1X9PA 3OG2A 4YM1A 2Y0OA 5A32A 3SCHA 4W6YA 3VD9A 3EQEA 3VKNA 4LKSA 4ZZ5A 5CNAA 1WLCA 1PO12 4RFRB 4MSVA 4QKBA 1GQGA 4NHKA 2FCTA 3LDKA 5F3CA 2K9ZA 4YZ1A 1WD3A 2QQNA 1TE1B 1I5ZA 2ZEWA 1ULCA 4I0AA 4Q0PA 1U5YA 5FK8A 1UZ0A 1W6QB 4AFBA 1SG3A 4NVPA 1C8NA 1L7LA 3NQHA 5T50A 3JBG1 4PBPA 4LA2A 5G04L 3WG4A 2L9LA 4RN5A 5JOZA 2E53A 3ZXKA 4XCAA 4MXVA 1NZIA 4O7XA 2R1BA 1HV1A 3M3EA 2EXIA 4XQWA 5FP4A 3IB3A 1JZ2A 5F5IA 3OBZA 1WCSA 3TEYA 3ZYPA 1ULFA 4NAOA 1N1VA 3EBRA 4Q0SA 3RMXA 4XPVA 1XE8A 1DLCA 4R4ZA 1RUI2 3I59B 3OYWB 3WDVA 1V6JA 5JIAA 2HWE3 2MEV2 5FRAA 3NJVA 5IHRA 2ARCA 3MPPG 4MYEA 3I2IA 3URFA 4AVBA 3ZFEB 4Y5SA 1QJFA 4FO9A 1POV3 3U4XA 3MIEA 2IVJA 4GULA 5D1IA 3U11A 1OHFA 3D0SA 4Q4V2 4AW7A 3HJRA 4OLLA 1U12A 3WNKA 4N90A 5ACA2 1QJU2 4WZCA 3A21A 3S7EA 4HONA 5C3QA 2ZZJA 5JSRA 3JQWA 4MV2A 3ZSLA 4TWTA 3U1XA 1KQRA 2WS91 2R063 2D3PA 5IVCA 4OFGA 5A33B 2WFPA 5JXGA 1JI6A 1RUD1 5BNOC 1UU6A 1S0IA 2Z5WA 1PNFA 3WDTA 4CE8A 2AACA 4JX0A 2DFCA 3H0OA 5A3PA 1UO9A 4S2FA 4ATFA 3VDDA 1UOFA 1YQ6A 1YRZA 4Q4X2 4C90A 3K75B 2P1BA 4LR4A 2WS93 1GWLA 3UETA 2P6CA 1VE0A 5K7PA 5FPVA 5LEJA 1DZTA 2B39A 5B4NA 2E7AA 3TOJA 1HLCA 1UD1A 3KCYA 5C9AC 2VVEA 5LK7B 1RGSA 1W8TA 4GZ9A 2AGSA 2QVSB 2H6BA 2X8KA 4ATEA 2D5FA 3SNMA 2JDHA 2QNKA 2RDRA 2Y64A 2HEVF 1YEWA 3NNLA 2JE7A 1W04A 2ID4A 4IV1A 3OF1A 5A3MA 1XYPA 2JG9A 1VBD1 2ZMLA 3POFA 3VBOB 1PGL1 1C8M2 4I0BA 3ZFGA 3SC7X 1RUJ1 2XWBB 4XDQA 1REFA 1GU3A 2HEYF 2PLV2 2E31A 2VZRA 2WN3A 3E6BA 1J58A 1SPPA 2ES3A 3AVSA 2CDPA 3MIHA 4CTEA 5FDBA 5D8AC 3WQ7A 3AJZA 4CDXC 4TTGA 3IIIA 3AL6A 5JOXA 3WP5A 1JYIA 4N53A 3ZR6A 4F83A 1C28A 5DMYA 1VB2A 4Y4YA 3OGJA 3CKHA 4AFDA 4COZA 4EWEA 3ZXGA 3C3VA 3OCPA 1IG3A 1XE0A 2DCYA 2RDSA 3SH5A 3R4UA 3DKQA 4I3GA 4XFAA 3WUCA 1S0FA 1PZ9A 4AFMA 2OZ6A 1OKOA 4LIVA 4CP1A 1WMEA 4GH4B 5KXBA 3FFZA 1WBLA 3N35A 3H50A 4XUNA 3ZXJA 1UIJA 2BOIA 2UU8A 3PVBB 4XFFA 3MLLA 2PAEA 1JOPA 2QCSB 4FFGA 4XJUA 2FCVA 4QX0A 4MGIE 5IATA 2QJVA 2VL4A 5HCAA 5J3UA 1JYNA 3Q9OA 3CIHA 4LXLA 4NPLA 5I0DA 4AE2A 5FMDA 3THTA 4CP0A 2XR4A 2VOWA 1FT9A 2BVBA 1RIRA 4YG0A 5FP3A 4CUCA 2XUEA 3WNMA 4X8PA 3NJYA 1H4HA 2G1MA 1VBA2 1ST8A 2QQIA 4Q1RA 5H9PA 4YPJA 1V70A 2PHXA 1VBD3 2FCUA 1UYYA 3E6CC 2EIEA 1OA4A 4WVMA 4BISA 4O65A 3LA3A 2BWCA 4AI8A 3ES1A 3CZUA 4XXPA 1N1YA 2VW2A 4BXFA 4QU2A 1Y4WA 3K77A 3U4SA 1CIYA 3WXPA 5J96B 2XUMA 3N36A 3GXUA 3W9AA 5I8TA 1LCLA 3TWIA 1HXS3 2A73B 1VBC2 4J1XA 1YI7A 2JDPA 4RFT0 4CCNA 2RR13 3RZZA 2ZA9A 1JOJA 1J1LA 2C5DA 1GQPA 1ZZBA 1NT0A 2OQ6A 4OHWA 4D7SA 1QJY3 1S2BA 4JKKA 1G86A 5JPNB 3WG1A 4URAA 3ZN4A 1XU1A 5M0TA 4LK6A 3ZLIA 1UYXA 2XVGA 3A7QA 3CEWA 3PHMA 4UFIA 3FFQA 4XYXA 1YIFA 5F32A 5ERLA 1ZBE2 5A1FA 4QPGB 3OGVA 3M8LA 2VULA 1HRV2 2A6YA 5EP9A 2JDYA 1RITA 4I0WB 1TNRA 1VRH2 1QJY1 3V65A 3U10A 3ABZA 5L19A 5FO9B 1SCSA 4AOCA 4Y1VA 2KA3A 4QXKA 4AFAA 1QJX2 3B69A 3F95A 4JC1A 1PMIA 3C7FA 3ZR5A 1XRUA 4CP9B 3SH4A 5C3RA 1NYWA 1O59A 2ERFA 2PYTA 2WT1A 4P14A 3KZ4C 3HNBM 5GLUA 3N9PA 1NA1A 2ARXA 3FMGA 4HSLA 5A80A 2R32A 4B29A 3WNPA 3M3OA 3PU8A 1IQAA 5DG2A 4DY3A 2GMPA 1XSQA 1RVF2 1B35A 5CU1A 1D2SA 2OT7A 1V6KA 4QGMA 3ZSJA 2VBPA 1UXZA 4GD4A 1HX6A 4Y5Z0 1ENRA 3IM0A 4Q0UA 4Q4Y1 2W95A 1IOAA 4LITA 2HWB3 2VUCA 1AR63 3H1WA 1PZ8A 1JYVA 3BTAA 3P6BA 1PO23 4NR1A 2QDNA 1CN1A 3FBYA 4C1XA 3HAGA 5JZGB 4X6QB 4PCRA 2AREA 1LGCA 2WNVC 4ZU5A 5FZOA 3GJAA 3J8F1 3TAYA 2SLIA 3NNMA 3DF0A 3DL3A 4EJRA 3NAPA 4R4XA 4E9KA 2Q8DA 4BHPA 4A42A 2EALA 3AKSA 3ROUA 4IV1C 3KF3A 1PGW2 5A3OA 2B42B 4LKDA 4EE2A 3JBG2 2RM23 3OPTA 4PF5A 4AF9A 1W28A 1CIWA 3CO2A 2XJVA 4OHYA 5A1LA 5A1AA 3V56A 2ZAAA 5FYVA 3ME2A 3V0BA 1RUJ3 4B1LA 1I9RA 2WRAA 4RHV1 4JDNA 3CNAA 1Z7S1 2GAUA 3B3QE 4PI2A 4PIXA 2ZGUA 1QMJA 2YPJA 4IDZA 1W8UA 3RSJA 4AEKA 1Q56A 2PLV1 2VTFA 1YHFA 1VMHA 3MHZA 3O1MA 2XMLA 5FZEA 1O8PA 4QQ2A 2HWD1 5D2AA 5CFCA 5IT6A 4PDWB 4I01A 2RM22 3HQXA 2HWE1 1YYNA 4MUVA 3NKGA 5FZGA 3RZGA 5LY2A 3WW1A 2O14A 5LA0A 3O1RA 3T2TA 2VW1A 4Q8KA 2CGPA 1BJQA 4QPIC 2ZEZA 4YGCA 5J36A 4IEOA 3WR0A 2AYHA 5SV8A 4Y5TA 3W59A 4AEDA 5JMOA 3S0MA 3RYPA 3WDYA 4ASKA 4Y1XA 5JUVA 1VB4A 2CY6A 4QQPA 3AP6A 1HJGA 2VZTA 4JHTA 4Y22A 3BKZA 1QJU3 4L99A 3K2OA 1AR81 1AXZA 1GYKA 1OFNA 1WW7A 5DAXA 3H8RA 3DPRA 4JQTA 2E6VA 2VQAA 5FFOC 2NMOA 4OQ8A 4NPMA 3H8OA 3I49A 4IV3B 1K42A 5L36A 4Q2FA 2DF7A 4DMIA 1MS9A 3I3DA 1X8EA 3R05A 3I2JA 3B94A 5LW9A 3N7LA 1DGLA 1AUYA 2RG4A 3NV3A 3WINE 1QJU1 3ZMOA 2QQWA 1WZXA 3B9IA 5I0UA 3VDCA 1H9PA 1KFUL 1IS3A 4QPWA 1OUSA 2HKXA 2IXKA 5DXDA 3VHRA 5BNPC 4LKFA 2ZGLA 4IE5A 4QAWA 3ZYFA 5F37A 2XJPA 4UW6A 1TME2 3PTYA 2A6WA 4CDWC 1B35B 1H0BA 4LOTA 1UY1A 3WDXA 4XF9A 1N3PA 4Y1YA 1PGL2 2TEPA 2ZGPA 3H3LA 4FXKB 1BHGA 4W4ZA 1UL9A 4B8EA 2HBUA 4CEWB 2BERA 2EXHA 2YU2A 2YROA 3CQOA 4Y33A 5FQ0A 3LAGA 4CA9A 4A6SA 2A3YA 2QQVA 2PHFA 1W0NA 2O1QA 4ES8A 5JR2A 1MZ6A 3U78A 4M3CB 1CJDA 4FTEA 2VCBA 2JX9A 3KV5A 5BPXA 5BNOA 1Y43B 1H2KA 1NXD1 4RHV2 4K3UA 4AYUA 2BU9A 2D44A 1KD7A 1GWKA 5EYXA 1F15A 1N1SA 5E6HA 1O4TA 3CJIA 4IXLA 4AQ2A 2WZEA 4XQDA 3GBFA 3ECQA 2AZ5A 3ACIA 1VRBA 4Z82A 1VBE3 5AC91 2BPA2 5FYHA 1GOGA 3H8UA 5DAWA 3MIFA 4HN1A 4XJAA 4HLTA 4CU7A 1EV13 4JDOA 1ZRIA 1QOSA 1KITA 3PUHA 4FFIA 5LA2A 5FBJA 4E27A 3AK0A 1O91A 2O8OA 2QQUA 3WCRA 1HIXA 3SITA 3VBHC 4ORFA 4QKDA 4HETA 4XCBA 4DXRA 4B4QA 2NP0A 1VBC1 4LIUA 2HWB1 1GKBA 4FPYA 1QQP1 3IDCB 4FAGA 3VZLA 3RFRA 3J7NA 2D6NA 2RS11 4JAAA 4GWJA 3WHTA 2RMU2 5KXDA 3IPVA 1V0AA 2GN3A 3VBFB 4NOTA 4KI5M 4N43A 3RNSA 2Y0IA 2J1EA 4YVWA 1BBT2 5EYYA 3AZWA 3W21A 4MGTA 2DVGA 4AVAA 3AMHA 1NCRB 2GNDA 1VBA3 5F6LB 2UYBA 5F2WA 1IKQA 5FY4A 2R1DA 5JXJA 3DV8A 3KVBA 1YFUA 2BFUL 2ET1A 2VGDA 2PAMA 2VOTA 3B00A 3ACFA 2DU0A 1BBT3 4LBMA 2YMZA 4MO3M 2WUHA 4RQPC 1Y3TA 1LODA 4W8JA 1O3TA 3AP4A 1GMMA 1W2AX 1W8NA 2NPIA 4OI0A 5LBCA 1EAH1 1R083 4NWVA 4CCDA 3AXEA 3OD4A 2N7GA 1TME3 2UWCA 3POEA 1PX4A 2W52A 2WO1A 1W9TA 2YV8A 3FE5A 4GKXA 5ABJB 3KCCA 1LOAA 2CYFA 4AVSA 3CLPA 5AC93 1OURA 3WUDA 4YW1A 4ZHNA 4XMAA 2WS92 3FL7A 2XJSA 5GZEA 3ZM8A 4QPGA 2P34A 1CD3G 1CAXB 4XDPA 4O9EA 5I8SA 3T4VA 3ES4A 3AYEA 1MEC1 4QDSA 2YPDA 1Y7BA 3AMNA 3UYJA 2NMNA 1JH5A 5JSOA 2RHPA 4CDUC 3ZPOA 1ND3A 1W8HA 5FUPA 2VBBA 3ILFA 3RZJA 2FDHA 3A4UA 4LBJA 5DDJ3 3D0JA 2P17A 4IE4A 4QM9A 2J42A 1VPHA 3O0VA 1KRIA 4ASLA 1W39A 1JW6A 3T1LA 2PLV3 1XPWA 3WHUA 1JMUB 1HRI2 3M70A 3N9QA 1VAVA 4DINB 3IDAA 4XF0A 4HT1T 1DQ5A 1RMU2 3I97A 3KT4A 3OB8A 1WA4A 4UOJA 1C1FA 2A5ZA 1YQ5A 2D98A 2PXJA 5T52A 1SFNA 1ULEA 5EV7A 4IGPA 2RM21 4AGVA 2V73A 5HCFA 3LSEA 1XNTA 3VD5A 4A7YA 5JOWA 5A7PA 3GBWA 2W87A 2WC2A 3UV9A 2WZR2 2WSVA 2VUAA 3OPZA 4IV1B 1EUTA 2VD7A 5FYZA 3WNXA 1OOPA 1QDOA 4DEVA 4D3WA 4FBFA 4PQQA 4Q4V1 1LKNA 4K8RB 2VUDA 5GZGA 3N7KA 4DZGA 3GYDA 4XACA 1JZ7A 1V6NA 2ZHNA 3WLUA 2B7YA 4S2HA 4PIYA 2BNOA 4FOQA 3VBHB 4DPNA 3L9JT 4J6GA 1RB8G 2VMDA 2HWD2 3AVRA 1OF3A 4YG6A 1NLQA 1BK0A 4P9YA 4FAHA 4WM7B 1W6NA 2AR6A 3HD8B 3BGAA 4H2AA 4JCKA 4OHXA 1YUDA 1ENXA 1WMDA 2X29A 2V4VA 2JD9A 1ZRRA 2Y6HA 2YBPA 4QHOA 2VMFA 1D4M2 3WW4A 4HPKA 4CPBA 5KXCA 2ZMNA 3AKTA 3C8XA 3B7MA 1HW5A 4R9BA 3IDEA 1UPIA 1RHI1 2BYVE 2GN7A 1Z7S3 2MPFA 5K0UC 4PJYA 4OUSA 5L73A 2VQUA 1JHJA 1UY4A 2A6XA 1OOPB 3HQRA 3LGRA 5CYYA 2ENRA 1KFXL 4NROA 2RS31 4QKFA 3VKFC 1W8WA 1RUJ2 1UCXA 5FZ3A 1S4CA 1JZ3A 4CDUB 1W6QA 1GZWA 3QH6A 1UY2A 1UMZA 1ONAA 4QX5A 1AVBA 4UAPA 4X6RB 1ZX5A 5FPXA 4BZ4A 2OPKA 5H9RA 2WINB 5FZBA 4C8DA 1DZQA 1L3JA 3GZUC 1XSRA 4A7KA 4BYYA 3ILNA 3BVCA 3PUSA 3POIA 1WWYA 2W0XA 4X8NA 2WN2A 1WUVA 2Y6KA 1ZRFA 5E88A 5IVYA 5A32B 2CWSA 3PVNA 3JB8A 4XFBA 1CJPA 3FUQA 4LLFA 4CDWA 2I74A 1Q8QA 3VD4A 3WQ0A 3CF6E 3WSOA 2DDUA 5CAZA 3T08A 2JD4A 5EIYB 3DCQA 1OVSA 2B9VA 1RUF3 3PDQA 1DQ4A 3KHCA 1VAKA 2JG9C 4XHXA 1R081 4COYA 4KWKA 2G9GA 3PU3A 4MXWA 1MZ5A 4AEMA 2XL9A 1EYBA 1R092 2VECA 4XMIA 1GP6A 4P08A 5FUNA 2RE9A 2X5IB 1G8WA 3D82A 5FUIA 5H9QA 1DU3D 5EJ1B 3WP3A 3GF6A 3C7EA 4UF0B 3HR9A 4EZHA 3HOBA 2D6LX 2WSUA 3QACA 4LO4B 2IXIA 4RR3B 5FQ0B 3TN93 3ZYHA 5A3WA 1I5PA 4N9IA 1RINA 1EP0A 3IMNA 4AI0A 5FYTA 3MIBA 2CSGA 1ODNA 1YXWA 1JS9A 4UI9L 1ZM1A 1BLZA 3I4IA 4ES9A 2JB4A 4CCCA 1CZVA 4P9WA 4PDWA 2MNGA 1WLTA 1W9FA 1DG6A 2DTYA 3EHKA 5F3IA 2XJTA 4XIKA 3UESA 2Q1ZB 4QPIA 4R52A 4WBBA 1YNAA 2JENA 2ZHKA 1PX3A 1ULPA 5FO8B 3FWEA 5JZGC 4Q4Y2 5LATA 2Q4SA 5FZ8A 5LASA 1CAXA 2H0BA 5IVEA 1UWWA 1CAVB 2XLFA 1XU2A 1APNA 1XBFA 1WMXA 3VL8A 2VOKA 4QM8A 4BLIA 5LEKA 4D0QA 4CU9A 1SLBA 1VBE1 2FMDA 4PF1A 4RA0A 4UBGA 1OPMA 4HKOA 2ZGTA 4WM7A 1S55A 5KHKA 5DUWA 4N9HA 4DOUA 3WQ1A 4BH9A 3PJQA 5A6ZA 2NN8A 2CAVA 2XOMA 3LOIA 4ARXA 4L9BA 2GALA 4XF4A 2VH9A 4HKWA 3GZEA 2B8MA 1W6OB 5IUQA 1W2TA 2FMYA 1V6MA 5FZOB 2WR9A 4B4RA 1K5MB 2CU5A 1W9SA 5GLWA 2D3RA 4XQ4A 3CDZB 4JGZB 3F2ZA 2VZUA 3KT1A 3HWJA 3H9AA 3VHNA 1LENA 1SEFA 1H8VA 2HYXA 3ZYRA 5FAXA 2FBEA 1WA6X 2BWAA 4M3CA 4YLZA 5JPMB 1IPJA 4AVCA 1WCKA 4HOOA 1RYYA 5KC6A 5FY8A 1MR5A 2DUQA 2WZR1 4TLGA 5EHDA 3RWKX 2JXAA 1E5SA 3VBUC 4EN9B 4IV3C 1UF2C 5CBLA 1LECA 1DQ2A 4LBNA 3VGIA 1F2NA 3AZVA 3OGGA 3QBQA 4IEYA 3H7YA 4LTAA 1GLHA 2D5HA 4FP2A 4GALA 4YZ2A 4JRLA 1UY3A 1XNKA 2J1SA 3RYKA 4Y4RA 2R041 1OH3A 4XABA 4Y1ZA 2BP6A 5HV4A 4XTPA 1FI2A 2NYYA 3ZYIB 1K3IA 3KSCA 1OXCA 3C2UA 4LJHA 2Y6JA 1RUC3 4XJZA 5A33A 4E8DA 3MICA 4QU1A 2OUHA 3IT8A 4N7UA 2PHDA 4M4RA 4QX3A 4K40A 2CGNA 5KC5A 1HB3A 2C24A 2PMWB 2RR11 4RR3C 1JYTA 4L8QA 2LS6A 4Z2AA 1JZ8A 1P8JA 1RUC1 5DZEA 1HKDA 1EV12 1T2XA 1UN1A 2ZGQA 3I8TA 4IE6A 5LA9A 1RHI2 1VBE2 4K20A 2GC1A 1GWMA 3UJOA 4BQ3A 1GSLA 3APBA 3GJBA 5FYUA 2BUKA 1NLSA 2ZJCA 1YIPA 5I91A 1NA1B 1PO11 2KXLA 3LEKA 2ILMA 4PHZA 3ALQA 4Q27A 5J48A 2ORZA 4E8CA 1SLLA 2VG9A 3VZKA 4Y3OA 5DABA 2W9XA 4RHV3 4CCEA 5FZFA 3EB7A 1D0GA 5T55A 1H8TA 2GMMA 4TXWA 4QMAA 1HV0A 1JYXA 1R1A3 1W6PA 1B35C 3PUAA 4Q0QA 5I0SA 2Q0AA 1QOTA 4KBBA 4LBLA 1HQWA 3RRDA 3PMEA 3H3ZA 5BNOB 3MUZ1 2GH2A 1WLWA 3ST7A 4QDQA 2BQPA 2VMEA 5FXZA 1O8SA 5LY1A 1W6MA 4LMFA 4AG4A 1YQ8A 3S7IA 1NUKA 3BTXA 2IFWA 2W3JA 3C7HA 4E4DX 4FPFA 4BQWA 1EAH3 3U0ZA 1ZA7A 4LO7A 3TNQA 4TYSA 2VM9A 1J3PA 4IETA 4PDWC 1F4HA 3VBUB 3VZMA 1S2EA 3OBTA 1Q8SA 4FPJA 4JDMA 4HFSA 4QHZA 5ACA3 4K21A 1BK1A 1TNFA 3Q8EA 5BNNC 2ZKLA 5C8CC 2Q5TA 2Z69A 4ET7A 1ASJ1 3GZAA 3R6SA 2DCJA 4CCJA 4FCAA 4H14A 1OQDA 5ANNA 2DUOA 1S1AA 2OXBA 4EROA 4IV3A 3WF1A 5JZGA 5EFUA 2V5DA 4DXSA 4ZXKA 3INAA 5DAPA 2VMHA 5IK8A 2YU1A 3OTFA 3O12A 1OPOA 5KBFA 4Q1PA 4UT5A 2P3YA 5C6CA 5L7OC 4P9GA 3MLJA 5IK5A 1SPPB 2X5IC 2P3IA 1QNWA 4QPGC 2JICA 4C0HA 4JTNA 3ZYJB 2QTWB 3LWCA 1VLNA 2D6MA 1DP0A 1NQDA 5LRSA 3J8F2 4IE7A 4JKLA 1Y9QA 3ELNA 3WW2A 1YQCA 4G3YC 2WYSA 4SLIA 4V1PA 4CP9A 4Q29A 3AX4A 4KG0A 1UOGA 5IVBA 1XNBA 3VDAA 5BY5A 5FYYA 2W91A 1NCQA 2CTVA 1HDKA 2WAOA 2LRPA 3ZYGA 1QIQA 3L2HA 2YGLA 1JZ5A 4RYDA 5B2GB 2PELA 2EIBA 1SZBA 5IVFA 1RUH1 3E5XA 3VHPA 1O3SA 1ENQA 1RUF1 2X5IA 5IK7A 4BK5A 4B4PA 1CPMA 5H9SA 2DCKA 1RUNA 4GKYA 5J98B 4CPBD 5AVPA 4O61A 4AVVA 1ND2C 3MEPA 4B7EA 3J7HA 1OFSA 3AYAA 4C1WA 4OCTA 1AL21 1FPN3 1PK6B 2RJLA 2IXLA 4Z2WA 2HEWF 4YWAA 2PFWA 2Q30A 4L2NA 1CR7A 5FYCA 2C0ZA 3OEAA 4CDWB 2HWE2 3MGUA 2G19A 2WZR3 3VBFC 3H3UA 5KWRA 3D3AA 3FZ3A 5K0UB 4LE3A 5LRRA 4MGZE 5BYNA 3DYPA 4FPGA 1R082 2KM2A 4IE0A 4M3CE 4JTOA 1W8OA 5J7MA 3H7JA 4BB3A 1PMJX 1AR92 1QY4A 1RUG2 1NCRA 4UW5A 2ZZQA 3D5OA 2XVKA 5HI0A 1BQPA 4YNIA 4W50A 2P4EA 4YW2A 3POJA 2JG8C 2XXZA 2CGOA 5F5QA 4BCUA 5FLHA 3JBG3 1PGSA 1A8DA 3ZFGC 4ZKTB 2ORXA 1I1EA 5EPAA 5FP9A 1J1TA 1QJEA 2A75A 4WVVA 1CPNA 1OT5A 4OYUA 2HJIA 1OQ1A 3ZN5A 2R7EB 5A6QA 4LK7A 5FMCA 4NN0A 4DIQA 1ZYBA 3O1SA 1HJFA 2A3XA 3VKMA 2EAKA 1AHSA 4M0NA 4QT6A 3WQBA 4NHLA 5CKQA 1NAEA 1COV2 3KGLA 2QUOA 3GBGA 3LFMA 3LEIA 3THCA 4BWOA 1TME1 3KGZA 4EN8B 1UW8A 1QOOA 3KMHA 1JTZX 1KJLA 4FQZA 3GGLA 5FTTC 3ZKUA 5A7WB 4K1ZA 5JAXA 1O3RA 2YC4A 3M3IA 2XH6A 1UZYA 2JDKA 4F7ZA 1UKGA 5BXXA 3JD72 5FPAA 3BUCA 4AQSA 4QB6A 2XLAA 5LK5A 5I0RA 1MEC3 4JHZA 4DUVA 2RS51 3O1UA 3RZLA 4IGQA 1PVXA 4OZXA 4CRQA 2WFF3 4AHZA 1LOBA 1DHKB 3NV4A 4CEWA 1GOFA 2TBVA 1RUD3 2ARBA 1V00A 3JCIA 1YC61 1ASJ3 3NWKA 2IUWA 5FYBA 2X10A 5F8PA 1V9U2 4KU8A 1N47A 2D6KA 5FMOS 2KD7A 4F8AA 4WM8C 1AZDA 1LEMA 1YO8A 1HRI3 4FXGB 3RPQA 1ZRCA 2BGOA 1ODMA 1BMV1 1B09A 4GA9A 1XYOA 1SMVA 4QQOA 5EWSA 3T30A 1WW4A 1GP5A 1W9WA 4ITCA 3ON7A 3J9SA 5BNNA 2VMGA 1DGRN 3K51A 4YW7A 5C8CA 1MACA 1ZREA 3ZPYA 2QQMA 3TB0A 2B4KA 2VO5A 2XBO1 2RS12 4M00A 1W3XA 2VQ0A 1QXJA 2JDAA 3DPRB 2O8QA 4P02B 4XJ8A 3VL9A 5KHJA 3VDDB 1DGRA 4S2GA 2XL7A 3OOXA 2GSYA 3A0NA 4MXWB 3WDUA 4D6QA 2XKOA 3ZVXA 1RUC2 3HPNA 5KHGA 1UXXX 3VLBB 4EYUA 4XAAA 4P9IA 3HNYM 5CZKA 3DYOA 1D0HA 5LBFA 2D3SA 1G9AA 2BRTA 4K7JA 5T5PA 4AXOA 1Y9MA 5C9AB 1I3HA 2RDQA 4UW3A 1GNHA 2ZHLA 4FFFA 1J59A 5IWFA 4K9SA 1FMD2 2DVDA 4INDA 4Q4W2 5FV3A 4WM7C 4BE3A 1LHWA 4LQRA 5A70A 3NJXA 5CFCB 1PK6C 2W1QA 1HQNA 3VB9A 1GICA 1UZVA 1ASJ2 3WDWA 1W6MB 1XXNA 3PTRB 4D6SA 2YDEA 4PLMA 2AENA 5SV5A 3VHOA 3RG0A 2DYCA 4A7ZA 1K45A 1SACA 4N53B 2GU9A 3VN4A 1NX9A 1XJAA 2W5FA 3ZOIA 4COVA 2ADEA 1AR82 2WQ8A 1MEC2 4EWAA 4AI1A 3MW4A 1S0DA 3ENRA 4XW3A 2JIGA 2GP5A 4BMEA 2DVBA 2P6HA 2DFBA 1WCDJ 2VNGA 3DGTA 2XBO3 2QDRA 4TLFA 1OC1A 3VKOA 3AJYA 3POSA 4BJ0A 4NHMA 2ZGRA 1PNGA 4ZS3A 1U5ZA 1F9KA 4HVRA 1UZWA 2WO2A 5B4XA 2VNOA 1DZRA 2WL1A 3PUQA 4E4SA 2YHJA 1DGWX 3M7AA 3MLKA 5C3PA 2ZHMA 3O1PA 1F5FA 1XYNA 4U2AA 4LBQA 1UX6A 2DCTA 3NNJA 3ACHA 2ET7A 1FOD2 4NIAA 2VBDA 4MGSA 4QD2A 1AYM1 1TMF2 4XUPA 5DUUA 5FP8A 4M01A 5JIUA 5BNPA 2Q1FA 3PIJA 4CUAA 2VZOA 4NE9A 5K4LA 1W90A 1FOD3 1MQTA 1ZRDA 4KWUA 1G9BA 1A34A 3T0AA 1L7RA 2LTNA 3CJIB 1W2UA 4YVWC 1C4RA 1LESA 1RL3A 2W39A 4XZUG 5FPUA 2DVFA 3O1TA 1UOBA 3VD3A 5FYMA 2E9QA 5FYIA 1W6PB 2PHLA 1TQ5A 4QB1A 3THPA 3AM2A 2WNEA 1RVF3 1WMFA 4M3CF 1MQTC 1W03A 3SHRA 4AAXA 1OF4A 1Q3EA 3TEXA 3ORJA 1Q8OA 1E5HA 2Z42A 3B93A 5C8WA 3BPSA 1NG0A 1IHMA 1HB4A 2WJSA 3HN1A 2JDMA 5DZFA 5ABJA 3QLQA 4DUXA 2Y26A 4IEPA 4MGKE 1OOPC 4RR3A 1N3OA 1YQ2A 1F5JA 2W1WA 1QWRA 1RTVA 2WKKA 1GOHA 2VVFA 4XAEA 5IW0A 1ULOA 1JN2P 1VBB3 4LUMA 4DB5A 4NHXA 1NKGA 1RMU3 1UMIA 1X9TA 1QH6A 4NJ4A 1T6GC 3I3MA 4MG2A 2WIIB 1FMD3 4XTMA 1OLQA 1TMF3 2F4LA 2F6BA 3AKRA 3N9NA 4WV8A 4GMP1 3MIGA 4ISQA 2VCCA 3POWA 1KXGA 5EXOA 4XHBA 3RJ2X 3O0XA 1W8ZA 1IS4A 1ND3B 1W8FA 3VBRB 1TVGA 4CZSA 1GV9A 3T1MA 1PO22 3IKWA 1AR71 1YJKA 2VNRA 3VBFA 2OS2A 3V0AB 1ZZ6A 3UKTA 2AUYA 1VBB2 1W0OA 5A7QA 4ZONA 3KF5A 1DF0A 2XGXA 4QXCA 3WNNA 2RS52 2AEYA 4LBQB 4XBLA 2A6VA 1H1MA 1SBFA 2WQZC 3KS7A 4FQ4A 4XC9A 3NVCA 5A7WA 3I2HA 1BEV2 3J8F3 1QU0A 1W6NB 4RQPA 3VKLA 4NPRA 4AWDA 1VBC3 2A70A 3OYWA 4XFCA 4NRQA 1MS3A 1OA2A 2PTMA 1U5XA 2EIDA 1H1AA 3I3BA 4OUMA 1HRV1 4GWMA 1AYM2 2QQPA 4W6XA 4Q26A 5LCWL 4FVVA 3DEMA 1D2QA 1IZ3A 1EV11 4OI4A 1AL22 4QHBA 5FZ1A 4FTBA 3HT1A 4V2WA 4XOGA 3O1VA 4I09A 1DYPA 4NHYA 4A4AA 1OLME 3KV6A 5FZAA 4EN0A 3LA2A 2V5YA 1KS5A 2AH2A 3M2MA 3LEGA 4N53C 4JGZA 4L97A 1D7PM 2JE8A 3LPFA 5FJKA 5DDJ2 3K48A 1D4M3 5FY7A 2WA3A 2WT0A 5FWJA 1R1A1 4HPKB 5IJRA 1Z0HA 4D69A 2R071 1H6XA 1LU2A 3KWVA 2ZX3A 1EY2A 3CMGA 1MS5A 1STMA 1MS0A 1COV1 3S5QA 2PHRA 2VXJA 4UBHA 1RHI3 4FOYA 2HWD3 1CAWA 5IFTA 3FN9A 2RR12 2W92A 5KHIA 5K0UA 3ZXAC 1LJ7A 3VBHA 3RWNA 5C33A 3LOBA 5EJZB 5C4WC 1BCXA 5IK4A 1SDDB 5BNNB 5C8CB 5K8SA 2XBO2 1COV3 2F17A 4XJ9A 1Q43A 2D43A 2LM3A 1X7NA 4EZ4A 2WWUA 3MI8A 1V6OA 2PHWA 3GZTB 5GM0A 4CU6A 2A1XA 1SLAA 1ULDA 4P9LA 1NE6A 1WBFA 4URTA 5FO7B 3I3QA 1FYUA 4I02A 1OLRA 3MPBA 2BEOA 2IZWA 1DCSA 2XKPA 3B5LB 1PO21 3IZOA 5F39A 4YW4A 3WF0A 1JYWA 1UY0A 2QQJA 1RUI1 2BFUS 2K46A 3R4SA 3E6DA 5LB6A 1S0CA 1WD4A 1CZSA 2FDFA 3WF2A 4A2UA 2D93A 1J84A 2RDNA 4XF3A 5HPOA 1QNYA 3NKTA 1W99A 3ITQA 4CDXA 3IIAA 3BU7A 5L7OB 4LOSA 5JWPA 1UNBA 2LW8A 2YFZA 1GUIA 3CJXA 1W05A 3O14A 3NNGA 4QGNA 3D6EA 4KL1A 1IG0A 2VUJA 1J3RA 4WZFA 5CISA 1JXNA 1W2NA 3I3EA 3LCPA 1QJZA 2BOJA 1NY71 2GC3A 4Y20A 2E51A 5FCCA 3U37A 1V9U1 5D8AA 1DQ6A 3JD73 4EN7B 5FYSA 1TMF1 4FPLA 5I8YA 2JIJA 3VZNA 3QOPA 4IEWA 4AHWA 5CG8A 1CQ9A 4M4PA 3BTZA 4MX3A 2PHUA 1YCIA 5AC92 4AGRA 3KHBA 4YZ5A 1DBNA 1NCRC 3IPVB 3T2OA 1NLRA 4JRAA 4KWJA 4UWDA 2YG0A 3ZN6B 1ALYA 2RJ2A 2Z2SB 1HXS1 1OKQA 5J1XA 2Y34A 4O9GA 1ND3C 5APAA 1W0PA 2A71A 1FMD1 2NLRA 1QJX1 4CCMA 4HL0A 4CU8A 1EUUA 2CHHA 3WF3A 1E5RA 2VOXA 4OZOA 3JQXA 1GP4A 5JOYA 1GZWB 2BNMA 2ZGSA 1M4WA 1F31A 2VE1A 3SXWA 2J7MA 2ZAHA 1C8M1 1OQEA 3T09A 3BIWE 2I2SA 1RUD2 4YW6A 2WO3A 4JGYA 4XIOA 3VUOA 2DTWA 2XQXA 5CKMA 2FDKA 3HT2A 2X05A 1YFXA 3GCXA 4YVSA 2W46A 5C7GA 4B1MA 2RMU3 3NJZA 2CDOA 3LA7A 5FZMA 4FT8A 3ZSMA 4L11A 4QGLA 4RD7A 3FUOA 5KXEA 2C4XA 2VZSA 3RZKA 1LAJA 2D97A 1YWKA 2WQ4A 1K12A 2P37A 4RGAA 3TN92 1J83A 2DWRA 1OA3A 1KDMA 1RC6A 1YJLA 2XVLA 1ZZ8A 2W1SA 2BW8A 2J22A 3ZFFA 2HWF1 2VCAA 3OGRA 4D7YA 4OULA 3IAPA 4XXAA 1RUE2 3NNFA 4QXBA 3CZJA 5FZ6A 1SLTA 2VZVA 5DUXA 2W08A 4F3JA 1NCQB 2RS32 4ZZ8A 1FV2A 1ZZCA 4UFJA 2BGPA 1T6BX 1RUE3 4FPOB 5I0TA 5CEHA 2E33A 2R073 5CB7A 2XHNA 1GQHA 3PVOA 2BJSA 3E1F1 3H1MA 4XUTA 3WG3A 3PMSA 3ZIXA 1EAH2 3M3QA 4J1WA 2DCZA 1LHNA 1QDCA 1CONA 3AXDA 3U75A 5G05L 2HWB2 3ZXFA 1NQJA 1AR72 5FZCA 2BTVC 3OPWA 5IVVA 4IERA 4GWNA 4ZU7A 1PIV3 2D6PA 2UYAA 4AL9A 1QF3A 3HN3A 1Z7S2 4MH0E 4AI2A 2GNMA 3GCWA 4AR2A 2Y6LA 4R9DA 1OLMA 2ZKNA 5HV0A 1YFYA 2ZTNA 4GWIA 4JVAA 4UXAA 3SMHA 1UAIA 3W5MA 1XOYA 4CDQB 1N1TA 2J1UA 3ZXDA 1A3KA 4AHYA 4FSJA 4UW4A 5BUVA 1R091 4MGYE 1LB2A 4G9SB 1PIV1 4E4ZA 1PK6A 1F4AA 1YLLA 2ZGMA 3MV01 4BQ2A 3PNAA 4ZXEA 3CBNA 5A6YA 2B45X 4QX8A 1BVVA 3AP9A 4PLOA 1HRI1 3HMYA 3UJQA 4AI9A 2ARAA 2YGMA 1VRH3 1MZFA 1YFWA 3ZFEC 1OI6A 5JLVA 5CADA 3T2QA 1WW6A 3UGGA 1O5UA 3K46A 2I07B 1QXRA 1AL0G 2GZWA 2B9UA 3O7OA 3Q8AA 1NZCA 1UU4A 2E26A 3WNOA 2IWGB 2VR4A 2GNBA 4QDRA 2XLGA 4ASMB 2VY0A 5C4WB 2UURA 2Q1MA 4BM8A 5GLZA 1S0BA 1EPZA 3SQOA 5F1RA 5D21A 3GALA 1H4GA 1XNDA 3IMMA 4WVWA 3M1HA 5CVRA 3ETPA 3NV1A 3TNPB 3KD4A 4NMIA 2FZ2A 4XILA 3ZYBA 4MADA 4QXHA 4GB31 5JVVA 1MZEA 4N43C 4QX2A 1LHUA 5EQUA 2GMEA 3ZFEA 4DFSA 2UWBA 3EXUA 4BXSV 4G4FA 3MYXA 2X09A 4YZ4A 1LHOA 4NUBA 4DS0A 3RMYA 5CFDC 1RJ7A 2R30A 2MEV1 3ILRA 4P5HA 5FMBA 3SCGA 4GMP0 4M0HA 4RS5B 1BMV2 4PI0A 2R061 3DECA 5LZ6A 1AJKA 4WM8B 2GH8A 3RZHA 3ZXEA 3V0BB 4N43B 1FV3A 2OYZA 4Q4W1 3BN6A 4Z8BA 2XJQA 4UFKA 4NIIA 3JU9A 2R072 4CEYB 1US3A 1D4M1 1O7FA 3T0BA 3I54A 3V0AA 3Q8BA 4W65A 3NAPB 1H2LA 3SCFA 3LFIA 3FHAA 3LIGA 2TUNA 4KGGA 5FBZA 2E7TA 5A7OA 2OUJA 2CAUA 3ZDVA 4P9JA 5FY5A 2ZX1A 2OIIA 5FY0A 2UWAA 5KHHA 1Z78A 1LGBA 3BOWA 4IEQA 3B9CA 2OA2A 3IWZA 1POQA 1HN1A 2XB6C 2QBXA 5JSPA 2VZQA 4LHLA 1KEXA 5FMOL 2WWSA 4IEVA 1BBT1 1KS4A 5A7NA 4YM3A 3ZSEA 3OD0A 4XETA 2C26A 3FHIB 1U0AA 3KLSA 3WV6A 3HIFA 4LT5A 1H2MA 1OBNA 2Y38A 1QQP2 3AYDA 4QKNA 2WT2A 4QX1A 3T2PA 2WBKA 1BVP1 4LA3A 5T3NA 2JG9B 2Y6FA 1DIWA 5LBBA 2HWC1 5GKAC 1Q5OA 4Q4Y3 1H2NA 1O3QA 2QZ3A 2V4AA 5FP7A 1PM4A 1OUXA 2JKBA 4Y26A 3H8XA 1QQP3 2WNUB 2C9AA 2FD8A 1H30A 3A23A 2H0VA 3I2GA 4KWLA 4HVOA 1LGNA 3RGBA 1PVC3 2W47A 3AMMA 4E2SA 1KDKA 5FKBA 2ZOEB 1NA1C 1WGPA 1LOFA 1LOGA 1CX1A 4BDVB 5JDBA 3IAQA 4BA6A 2OKXA 1MS8A 2DBIA 1GZTA 4YZ3A 3ZX7A 2IFRA 1TZOA 3NW4A 4KNCA 4YSFA 3CJIC 4LO8A 3IN9A 3J7MA 4YW3A 1LHVA 3G6JB 1ULGA 1VR3A 2K2SA 3K4DA 5IYYA 1ZNPA 1VBB1 5E1RA 1SFPA 3POGA 2R49A 3Q8FA 1GANA 2QE3A 2QZ2A 2W68A 3U07A 4DRVA 4LORA 3VD7A 4K8FA 2YBSA 3PIGA 4OHVA 3AMQA 3ASIA 1VAMA 5T5JA 5FZHA 1GNZA 5HBAA 2VAUA 4YGBA 4LBOA 5JCTA 1X36A 3CHXA 2A7AA 3U14A 4NIHA 4GH4A 2BGCA 2HBTA 4EN6B 2K0GA 3AYCA 5FXWA 3RI9A 4A3ZA 5C71A 3TEWA 3O5SA 3WZ1A 3OY8B 2VU9A 4BPZA 1EPWA 1JU4A 3VBOC 1LRHA 1GBGA 4Z1VA 2EF6A 3P1IA 1RUI3 4PQ9A 1NOVA 1JHNA 2VZ3A 2ZPXA 3OJBA 3MBWA 4GIQA 3NRUA 1R1ZA 2ZX4A 2R0HA 1L7QA 2BVVA 4XFIA 2CV6A 2LUWA 5FPLA 4COWA 3S57A 2VTXJ 1XB9A 4LUKA 3AB0A 1POV0 2CNAA 1N3QA 4R9CA 1A8MA 5EJ3A 5FK7A 3ZFFC 3UL2A 3B01A 3S6PA 5D8AB 2VZPA 4H3WA 1BZWA 3QH7A 5FPZA 4ZU4A 3WT3A 4B3NA 2R042 4BQ4A 2CWMA 1LNSA 1SBDA 4Q5OA 4P9XA 4GMP3 1LTEA 4TN7A 2YFUA 4YG3A 2EVXA 2RS53 3USUB 3V64A 4RL7A 1ZZ9A 1OMIA 2GP3A 5C3OA 1R093 4I30A 5FZIA 2D7FA 3MF6A 3QD6A 1IPSA 5CFDB 1RUF2 3MV11 1CAWB 5FXXA 4A6OA 4HK8A 1IQDC 4QPYA 2SBAA 2V72A 4IW3A 4JGYC 4JQRA 3W5NA 1DQ1A 2JDZA 2Y33A 4FPCA 1JOBA 4XFHA 3VDDC 2JG8B 4BIFA 4YVSC 1SQ4A 2Q8OA 4GJZA 1FX5A 3UK9A 4CDUA 1WW5A 3KV4A 4NRMA 4UYBA 5FOJB 1S2KA 5FWEA 1VMJA 4Q8LA 3PLQA 1RUH3 5JMCA 1FNZA 1C1LA 4YM2A 5FIXA 2P2KA 3AP5A 5FOBB 4OI2A 3N9OA 3VZOA 4FOWA 1LOFC 1OD5A 3LDBA 3W20A 4CCLA 1Q8VA 2FHRA 5AFEA 1RUH2 4R9AA 1BKZA 1C3HA 1HN0A 5GZCA 3KB5A 1XE7A 4XUQA 2QQLA 1CGPA 1FOD1 1BEV3 2GDFA 2AC1A 3BPZA 4C0BA 3BI3A 2E32A 5CFCC 1IS5A 1ENSA 1CWPA 3BB6A 2R6QA 3AFKA 5AFBA 5C70A 5F9TA 3SKVA 1QH7A 3RVHA 1FPN2 5F5CA 2RS33 4CUBA 3MO4A 4N8MA 4XDOA 1VP6A 2BNNA 1VIWB 4AZZA 1G9CA 2E63A 5E89A 1ZBA2 2RJKA 5HCHA 4MHRA 3I7DA 2P3KA 2ZMKA 1K5MA 5F6KA 5A3TA 3SLIA 3EO6A 3EYPA 4OUEA 3E5QA 3AKQA 1RXFA 3LSDA 4BU2A 1G7YA 1XNAA 4E2GA 3K4AA 5E8AA 2NZ9A 3N4MA 5HCBA 4Z92B 3DPRC 1PHMA 3MIDA 1XQNA 1LOEA 2QQKA 2VCMA 4AQTA 3ATGA 4CCKA 2YBKA 2VOVA 3BOPA 1RMU1 2W2IA 3HQUA 2OPWA 2Z4FA 3Q8CA 3HBZA 4IL7A 3RQ0A 3K3OA 4FFHA 3WNLA 3FX3A 1OH4A 3KQ4B 2VC9A 2WNOA 1ZVFA 4EWDA 1PM7A 4WM8A 4BK4A 3LE0A 4CVUA 2HWF3 2RV9A 4XJWA 5FZLA 4WVMB 3P3PA 1AF9A 3BYWA 2WNVB 2YYOA 3WY6A 5DPNA 1XC6A 5DUVA 4LE4A 2XJRA 3B02A 3I2FA 2OW4A 2ZS6B 1AYN3 2VZ1A 1AR73 2V09A 3HVDA 3FLRA 4PT6A 3RZMA 4OMCA 4AGGA 4RSUA 1AR83 1IKPA 3WEZA 3I2OA 3AKPA 1E5IA 2J1TA 5GLVA 4LNVA 4FOVA 4YGDA 3N7MA 3AP7A 2J1AA 4D94A 4S2DA 3D4KA 4CCOA 1DDLA 1SLCA 2E7QA 3DXUA 4GB32 3THDA 1UU5A 2W94A 3WF4A 4IGOA 3RDIA 1NY72 4KH9A 4BQ5A 1IPKA 2VPVA 2YC0A 3FHQA 4UFHA 1H9WA 2J1VA 5C4WA 3SEEA 2Y8KA 3KT7A 5J37A 1LU1A 4ZPIA 4DNYA 2ZGNA 1HB1A 4N7IA 4LO6B 3WX5A 1UYZA 2R16A 4MOAA 1JZ4A 5FKCA 1DQ0A 4UF0A 3GNEA 4LO5B 3VDBA 4DO0A 3NMBA 1RJ8A 5CFDA 1O5LA 2NQYA 2PQQA 2UY8A 2A3WA 2YY1A 5DAVA 2JECA 4ZS2A 1ND2B 1JBCA 1MS1A 4HN0A 4FPEA 2JB8A 3EJKA 3FC0A 3USUA 3BTYA 5FXVA 4E2QA 3ZIWA 5FPBA 2IXJA 1X33A 4GXLA 3CL1A 3NL1A 2VVDA 3HEIA 3M4FA 4I3PA 5FZ0A 3S5AA 3DYMA 5T5OA 2WABA 3AZYA 2XWJB 5EZWA 3ZFGB 1O4YA 4I2OA 2NM1A 3ZMNA 2WYFA 4GQ7A 1R1A2 4CEYA 2KR2A 2GNTA 3FJSA 3O0WA 4GB33 4NIGA 2ZBJA 1AX0A 2ZGOA 4BIOA 4FPKA 1SFYA 1MQTB 5FJHA 2ZGKA 5FLIA 2EAAA 5ACA1 3R0RA 4YARA 5JI7A 4KMQA 2DV9A 4CUGA 1VBD2 2JWPA 3MDPA 2VQTA 1AR91 1RUG1 1JU3A 3R4DB 4MLOA 1DFQA 1ZZ7A 4LBKA 5DN2A 3ZO0B 5C3SA 1H6YA 1ZBE3 3IDBB 3KCXA 1UKRA 1UYPA 3TN91 4XBNA 3LIHA 2D40A 2H6CA 4YM0A 1OVPA 4L0PA 1DYKA 3LF7A 3VBRC 2WA4A 3LZZA 1LEDA 1LR5A 1KJRA 2XJUA 5A3UA 1CVNA 3I2DA 1URXA 1K5JA 2XDVA 3DUIA 5HXMA 1REEA 2RS13 2ETEA 1OSGA 3LPGA 3OSDA 4HBNA 4LKEA 1MVQA 4ONUA 1UOJA 3T0DA 5CA6A 1V6LA 1HQLA 1YI9A 5IAXA 2GC0A 4RS5A 5L9BA 3NAPC 3P3NA 2EIGA 4PBOA 4QWNA 5DG1A 2X53S 3T4HB 4P5YA 3TBDA 2C1FA 1AX2A 2JE9A 2ZX0A 2PQSA 5IAVA 4BMBA 4YVSB 5LWBA 1BXHA 4L92A 5ABJC 4KBZA 2G9FA 3J4UH 1R64A 1C5HA 2DBNA 5GZDA 1V9U3 3G7DA 4LLOA 4C91A 4A45A 4KU7A 1F8VA 1AYN2 3TRSB 3AZZA 4UFMA 3UT0A 4CDQA 5CG9A 4RS5C 4HG6B 2EXJA 4AI3A 5L7OA 3N7JA 3KM5A 1E57A 4HVQA 3OBAA 4R8HA 2WFF2 3DXTA 3GDBA 3SKJE 5A7SA 3WG2A 4DY5A 1NCQC 4YVWB 2WO7A 1JYCA 4JGZC 4IEUA 1CAUA 2WLPA 4JZRA 5A3NA 3VZJA 3ZKYA 2JG8A 1K5MC 4NWWA 1MPXA 4LULA 2EA7A 1F35A 3POBA 4BQ1A 2Q8CA 1QHDA 4FPHA 4LHNA 4ARYA 4ZY9A 2VXRA 4XVHA 1I6XA 2BBAA 4W6WA 1ACCA 5FZKA 5KR7A 4OMDA 1PVC1 2I45A 2LALA 5F5AA 2DU1A 2R062 4HANA 2BZDA 2P3JA 2WAAA 1M06G 1VALA 1CX4A 3JZVA 4Q4X3 2HH9A 2ADDA 4QQHA 4NIDA 4AEDB 2PA7A 4FI9A 2ZXQA 4H7MA 5A3LA 4IQPA 3AMPA 2VJXA 4CSWA 3WP6A 4A44A 5HXVA 4GH4C 1VBA1 4RGKA 4HSJA 3SH3A 4DRRA 4HZFA 4YFWA 4HK9A 3WOGA 2O0OA 1MS4A 2IXCA 4Q4V3 2XHKA 4CXYA 1CAUB 4QQLA 2JEMA 4AK3A 2VTXA 3VBSC 3KVAA 1WCUA 3DN7A 3PJYA 1W2OA 3CU7A 5DZGA 4HXCA 2MEV3 3H42B 5F3GA 4D7TA 3LEMA 5C9AA 2QKDA 3TYJA 4XEZA 1G6NA 2DVAA 2UY9A 4LHSA 3PL0A 3MFAA 2MHFA 2JDUA 2Y6GA 2DURA 1WLDA 5ANQA 3UKVA 1RUE1 2GC2A 4OI1A 1TEIA 3I2KA 1XNCA 2XQRA 1REDA 1NXMA 4V2VA 5FY1A 1MVEA 5FZ9A 1H8TB 2VW0A 3C7GA 5FLJA 5I93A 1S0JA 4H7LA 4PIZA 1AYN1 1D4VB 1PO13 4CXWA 3HBKA 1GNYA 2CL2A 2IVIB 3E5UA 3E97A 4LHKA 2OZJA 1PMHX 1WKYA 2ZEYA 1C5IA 3VBSA 2WLQA 1ZA4A 3ZXLA 3H1YA 4D6RA 2D6OX 3NV2A 5DDJ1 4NAMA 2BBVA 1SCRA 4LBQD 2BV4A 2HYKA 1O4ZA 3ZN6A 4AAPA 2A6ZA 4K6BA 1UMHA 1ZBA3 1FXZA 1JODA 3OUJA 4XFGA 4YGEA 4AEDC 2FZ1A 2ZACA 5FZ4A 2OQ7A 3RI8A 3AFGA 3USSA 5JI9A 5GJ6A 1AR62 3VBSB 3TEZA 3T3YA 4GAZA 1CAVA 3JUUA 4HKLA 4MGQA 5IFPA 2YZ4A 3OUIA 3PURA 4DUWA 1G9FA 1VJ2A 4IESA 4NO4A 3GHNA 4ISRA 3WW3A 5K9YA 3FBMA 2LROA 2PAKA 4Y20B 1ZBA1 1ND2A 4MZUA 4IUGA 4QPIB 4YFZA 1LOCA 2J1RA 4CEWC 2WNUA 3UGFA 3WVJA 1G9DA 1J3QA 1VRH1 5DQ0A 3WD5A 3OUHA 3PVEA 1PIV2 4NRPA 4YYOA 4RGGA 3SISA 4MHUA 2ATFA 3D8CA 3ZSKA 1GR3A 3BALA 3RYRA 1TG7A 4META 3SEPA 4BOWA 3N9MA 5BV6A 1QEXA 1AJOA 3MZHA 3ACGA 4UFLA 1JUHA 4Y1UA 1QJX3 1KGYA 1QXPA 1UIKA 2QQOA 2ZEXA 4DQAA 1FNYA 4RQPB 1V6IA 4A3XA 1JZ6A 4D8MA 2RMU1 1IS6A 2F4PA 4A41A 1A78A 3O1OA 2JKXA 1AX1A 4DEQA 1S0EA 1Q8PA 3AZXA 2VMIA 1RVF1 4CYDA 1Y9GA 1H1IA 1UPSA 3M3CA 1QKQA 2RVAA 4Q4W3 2XONA 3N3HA 3WCSA 4XBQA 2Q8EA 1SLIA 3QCWA 5FR3A 4B7KA 2YUEA 3RJRA 1IGOA 5T54A 3K3NA 5F2SA 5FZDA 4XUOA 1GZCA 2XG3A 5CIRA 5FY9A 1US2A 3DKWA 3ETQA 3LQCA 4CDQC 5E16A 3MUY1 2OVUA 2R043 5LBEA 3LDRA 1FATA 3K4ZA 3ZDSA 2AEZA 4BQXA 4AEJA 3MF9A 3BODA 3UKNA 3WP4A 4IEZA 1S0GA 4Y22B 4TZDA 2ZCWA 1FAYA 5FREA 1PGW1 2YC2A 4YW5A 1O6UA 1SHWB 1HXS2 4EV0A 4JKMA 3JD71 1DGWA 4FP3A 3OGSA 2C9KA 5GLTA 3NSTA 1AR61 4CXXA 4AHXA 1GFF2 1X82A 2IC1A 4E4HA 4OHZA 4Q0VA 2BDRA 1AXKA 2EXKA 4LPLA 2VMCA 2TNFA 2B5HA 3RS6A 2FDGA 5GZFA 1C8M3 2Z79A 4EQVA 5TSWA 3A0KA 3W58A 3JXSA 1AR93 1RUG3 5C5TA 5JXHA 1AL23 1FPN1 1UQXA 1HRV3 2VNVA 1HB2A 4U36A 1POV1 4QB2A 2EICA 3FLTA 4HMZA 3VBUA 3OY8A 3I59A 4SBVA 3ZFFB 5C5UA 5CKNA 1W6OA 4KGQA 1QGLA 5JR7B 1OD3A 5BNPB 3HNMA 2HWC3 3L2YA 4AVTA 2B46X 1BEV1 1CZTA 3KQRA 3BU0A 1RUOA 1RXGA 4OQ9A 1QJY2 1WCQA 1X50A 3ACLA 4GJYA 4WVZA 2IXHA 3UNPA 1W06A 4FTSA 1GZ9A 3AL5A 2JDNA 3X29B 2PHTA 2QFEA 5L9VA 5AVAA 4AFCA 3OBRA 4JV4A 5IVJA 4XE9A 2HWC2 4J25A 1NE4A 4P00B 1UZZA 2WDBA 3GM8A 4MVTA 3GHMA 4YRDA 5F3EA 2OX0A 1C57A 2WZPP 4BQYA 3BIEA 1AXYA 1VMFA 2YXSA 2W1UA 5JXIA 2FDIA 3OEBA 3BCWA 4JGYB 4Z07A 2G9ZA 2G4IA 2ZX2A 1PVC2 4QX7A 4TSVA 4XURA 5T5LA 1DLLA 4CP2A 3N9LA 2YB7A 4K1YA 3J26N 5BNQA 2WNVA 3UGHA 3NO8A 5A6XA 3S30A 3MFCA 4KG8A 3PUIA 1BYHA 3VBOA 5J09A 5GALA 1H8TC 1JUIA 3EMRA 2XPJA 2R0FA 4AQ6A 3LKJA 2DUPA 1UX7A 1W9YA 1SBEA 2WZ8A 4IEXA 4XF1A 4XZPA 4CDXB 4COUA 4DXZA 1U5IA 3A22A 1LULA 3POYA 4H55A 2ZABA 1DYOA 4DXTA 5LA1A 4Y24A 5L9RA 2FQPA 3LB9A 2HWF2 4OVEA 3VV1A 2WWJA 3KV9A 3IBMA 3J7LA 5ISLA 3P5BA 3MW2A 3VBRA 1PZ7A 4KQ7A 3C7OA 1AYM3 3LD8A 2FDJA 4LEJA 3MW3A 5DAQA 2PN5A 5F7UA 4PLNA 1ZBE1 2C6SA 2HLEA
chains in the Genus database with same CATH topology
1LNSA 3AC0A 2YFUA 2VMDA 1OF3A 3OG2A 3ACHA 4MGSA 4XUPA 3VD9A 3BGAA 4LKSA 4CUAA 4ZZ5A 2VZOA 2Y6HA 3MV11 2V4VA 2JD9A 4A6OA 2VMFA 1IQDC 4KWUA 2V72A 3C8XA 3W5NA 2QQNA 3T0AA 2ZEWA 1L7RA 1UZ0A 1SG3A 4XZUG 3VD3A 3NQHA 5G04L 2L9LA 2VQUA 1JHJA 1UY4A 4RN5A 4QB1A 1NZIA 4AAXA 5CYYA 1OF4A 3IB3A 1JZ2A 1JZ3A 4XUQA 2QQLA 1DLCA 1UY2A 4DUXA 4UAPA 2E32A 1YQ2A 2W1WA 3NJVA 5IHRA 1GOHA 3I2IA 5C70A 3SKVA 1ULOA 3POIA 2WN2A 1NKGA 2Y6KA 1UMIA 4CUBA 2HLEA 3MO4A 3HJRA 3WNKA 2VCCA 3A21A 3VD4A 3WSOA 2DDUA 3EYPA 4OUEA 3T08A 5EIYB 1TVGA 2B9VA 5JXGA 1JI6A 1XNAA 3K4AA 4JX0A 2QQKA 4P08A 3WNNA 5FUIA 2Z4FA 5EJ1B 3K75B 3C7EA 3WNLA 3HOBA 1OH4A 3I2HA 2VC9A 3UETA 2WNOA 3KQ4B 4BK4A 5B4NA 3LE0A 4CVUA 2RV9A 1I5PA 2EIDA 3I3BA 4GZ9A 5LCWL 4UI9L 1XC6A 5DPNA 3DEMA 2Y64A 3I2FA 1K42A 1CZVA 2ID4A 2VZ1A 4PT6A 4OMCA 3WEZA 3POFA 3UESA 4A4AA 2J1TA 1PX3A 1ULPA 1GU3A 2WN3A 3LEGA 2E31A 2VZRA 1D7PM 2JE8A 2J1AA 1SPPA 2CDPA 3LPFA 3WF4A 2W94A 4TTGA 3IIIA 1UWWA 3FHQA 5IJRA 2J1VA 1H6XA 3SEEA 4D0QA 2Y8KA 4CU9A 5DMYA 4PF1A 3CMGA 3CKHA 1UYZA 4MOAA 1JZ4A 3VDBA 5IFTA 3FN9A 2W92A 2XOMA 4ARXA 4XUNA 5EJZB 1SDDB 4QX0A 1W9SA 2VL4A 1JYNA 3CDZB 3HEIA 3CIHA 5I0DA 3F2ZA 2VZUA 3DYMA 4CU6A 2WABA 2HYXA 4CUCA 3WNMA 3WF0A 1JYWA 1UY0A 2QQJA 1RYYA 2QQIA 4YPJA 1UYYA 2EIEA 1CZSA 3WF2A 1J84A 4KMQA 5HPOA 1W99A 2VQTA 3CZUA 1JU3A 1UY3A 4LOSA 2J1SA 2LW8A 2YFZA 3K77A 5DN2A 1CIYA 1GUIA 1H6YA 3GXUA 3NNGA 5CISA 1K3IA 3I3EA 2Y6JA 3U37A 4L0PA 1GQPA 1NT0A 4M4RA 4QX3A 4M4PA 4JKKA 5HXMA 3LPGA 3T2OA 1UYXA 2LS6A 4Z2AA 3T0DA 1JZ8A 1P8JA 3A7QA 1T2XA 2YG0A 2RJ2A 3OGVA 5J1XA 4P5YA 2PQSA 3ABZA 1EUUA 4CU8A 3WF3A 4OZOA 3LEKA 1R64A 2ORZA 4E8CA 4A45A 2W9XA 2J7MA 3C7FA 3EB7A 4TXWA 3T09A 4HG6B 1O59A 1JYXA 2WO3A 3OBAA 3HNBM 3GDBA 3SKJE 2XQXA 5CKMA 2X05A 2W46A 5C7GA 3WNPA 3MUZ1 2CDOA 1MPXA 4QDQA 2VMEA 2C4XA 1O8SA 2VZSA 3POBA 4LMFA 1UXZA 4AG4A 2W95A 4ARYA 1NUKA 4ZY9A 2W3JA 3C7HA 2BBAA 1K12A 4XVHA 1JYVA 3P6BA 1J83A 4OMDA 2BZDA 2VM9A 2W1SA 2WAAA 2J22A 2VCAA 1F4HA 3OGRA 3IAPA 4FI9A 2ZXQA 3CZJA 2VZVA 4ET7A 2VJXA 4A44A 2DCJA 4ZZ8A 2BGPA 4A42A 2E33A 2XHNA 3E1F1 3WF1A 4DXSA 2V5DA 4XUTA 5A1AA 5G05L 1SPPB 2VTFA 4LHSA 3HN3A 1DP0A 2Y6GA 1O8PA 2Y6LA 4JKLA 4GWIA 3I2KA 2WYSA 3W5MA 2J1UA 5LA0A 3C7GA 3VDAA 2W91A 2ZEZA 1F4AA 1GNYA 3MV01 2WAOA 4ZXEA 2ZEYA 1PMHX 1WKYA 1JZ5A 4RYDA 5JMOA 2EIBA 1SZBA 5JUVA 2VZTA 4BK5A 1UMHA 2DCKA 3K46A 2E26A 3WNOA 4QDRA 2VR4A 3J7HA 4MGQA 3I3DA 5IFPA 4DUWA 3I2JA 3OEAA 4IUGA 3VDCA 3ETPA 4QPWA 2J1RA 4MADA 3D3AA 5DQ0A 4QAWA 3DYPA 4QX2A 4BXSV 2X09A 1TG7A 3SEPA 4LOTA 1UY1A 1W8OA 3ACGA 1PMJX 1KGYA 1BHGA 4W4ZA 2QQOA 2ZEXA 3DECA 2BERA 4W50A 3CQOA 3POJA 1JZ6A 4D8MA 3BN6A 1W0NA 2ORXA 5JR2A 4A41A 2VCBA 1US3A 2JKXA 4DEQA 3T0BA 1OT5A 4OYUA 2R7EB 2RVAA 2XONA 3FHAA 2WZEA 3ECQA 3ACIA 3WQBA 1GOGA 4XUOA 5CKQA 1NAEA 4CU7A 3THCA 3LEIA 1US2A 3LQCA 3PUHA 5LA2A 3MUY1 3GGLA 3K4ZA 2YC4A 1HN1A 4DXRA 2QBXA 2VZQA 1KEXA 4GWJA 4QB6A 2C26A 4DUVA 4JHZA 4KI5M 2YC2A 2J1EA 1SHWB 4JKMA 4QX1A 1GOFA 3OGSA 2C9KA 2WBKA 3T2PA 5JXJA 4LPLA 2VOTA 2X10A 2VMCA 3ACFA 2KD7A 4MO3M 2WUHA 4W8JA 1GMMA 2BGOA 1W8NA 3A23A 3I2GA 3JXSA 5JXHA 4QB2A 2EICA 2W47A 3POEA 1W9WA 1PX4A 2WO1A 5CKNA 1W9TA 2QQMA 1OD3A 2B4KA 2VO5A 1CX1A 4BDVB 3HNMA 3IAQA 2OKXA 1CZTA 2JDAA 4P02B 3ZM8A 3FL7A 1WCQA 3UNPA 3K4DA 5IYYA 4QDSA 3HPNA 1UXXX 1SFPA 4P00B 3POGA 3T2QA 2WDBA 3GM8A 3HNYM 5CZKA 3DYOA 4LORA 3VD7A 5JXIA 2W1UA 3OEBA 4XURA 2YB7A 1XPWA 3PUIA 3IDAA 5C71A 4A3ZA 4LQRA 3I97A 3NJXA 3OB8A 4UOJA 2W1QA 1UX7A 2WZ8A 3A22A 1JU4A 4DXTA 1DYOA 5LA1A 3P1IA 1K45A 4E8DA 1NX9A 1XNTA 2VZ3A 2W5FA 3MBWA 3VD5A 3NRUA 2WQ8A 2W87A 1L7QA 1EUTA 4DEVA 3C7OA 4PQQA 4BJ0A 2VZPA 5F7UA 3THDA 1JZ7A 5B4XA 2WO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LNS A;  3AC0 A;  2YFU A;  2VMD A;  1OF3 A;  3OG2 A;  3ACH A;  4MGS A;  4XUP A;  3VD9 A;  3BGA A;  4LKS A;  4CUA A;  4ZZ5 A;  2VZO A;  2Y6H A;  3MV1 1;  2V4V A;  2JD9 A;  4A6O A;  2VMF A;  1IQD C;  4KWU A;  2V72 A;  3C8X A;  3W5N A;  2QQN A;  3T0A A;  2ZEW A;  1L7R A;  1UZ0 A;  1SG3 A;  4XZU G;  3VD3 A;  3NQH A;  5G04 L;  2L9L A;  2VQU A;  1JHJ A;  1UY4 A;  4RN5 A;  4QB1 A;  1NZI A;  4AAX A;  5CYY A;  1OF4 A;  3IB3 A;  1JZ2 A;  1JZ3 A;  4XUQ A;  2QQL A;  1DLC A;  1UY2 A;  4DUX A;  4UAP A;  2E32 A;  1YQ2 A;  2W1W A;  3NJV A;  5IHR A;  1GOH A;  3I2I A;  5C70 A;  3SKV A;  1ULO A;  3POI A;  2WN2 A;  1NKG A;  2Y6K A;  1UMI A;  4CUB A;  2HLE A;  3MO4 A;  3HJR A;  3WNK A;  2VCC A;  3A21 A;  3VD4 A;  3WSO A;  2DDU A;  3EYP A;  4OUE A;  3T08 A;  5EIY B;  1TVG A;  2B9V A;  5JXG A;  1JI6 A;  1XNA A;  3K4A A;  4JX0 A;  2QQK A;  4P08 A;  3WNN A;  5FUI A;  2Z4F A;  5EJ1 B;  3K75 B;  3C7E A;  3WNL A;  3HOB A;  1OH4 A;  3I2H A;  2VC9 A;  3UET A;  2WNO A;  3KQ4 B;  4BK4 A;  5B4N A;  3LE0 A;  4CVU A;  2RV9 A;  1I5P A;  2EID A;  3I3B A;  4GZ9 A;  5LCW L;  4UI9 L;  1XC6 A;  5DPN A;  3DEM A;  2Y64 A;  3I2F A;  1K42 A;  1CZV A;  2ID4 A;  2VZ1 A;  4PT6 A;  4OMC A;  3WEZ A;  3POF A;  3UES A;  4A4A A;  2J1T A;  1PX3 A;  1ULP A;  1GU3 A;  2WN3 A;  3LEG A;  2E31 A;  2VZR A;  1D7P M;  2JE8 A;  2J1A A;  1SPP A;  2CDP A;  3LPF A;  3WF4 A;  2W94 A;  4TTG A;  3III A;  1UWW A;  3FHQ A;  5IJR A;  2J1V A;  1H6X A;  3SEE A;  4D0Q A;  2Y8K A;  4CU9 A;  5DMY A;  4PF1 A;  3CMG A;  3CKH A;  1UYZ A;  4MOA A;  1JZ4 A;  3VDB A;  5IFT A;  3FN9 A;  2W92 A;  2XOM A;  4ARX A;  4XUN A;  5EJZ B;  1SDD B;  4QX0 A;  1W9S A;  2VL4 A;  1JYN A;  3CDZ B;  3HEI A;  3CIH A;  5I0D A;  3F2Z A;  2VZU A;  3DYM A;  4CU6 A;  2WAB A;  2HYX A;  4CUC A;  3WNM A;  3WF0 A;  1JYW A;  1UY0 A;  2QQJ A;  1RYY A;  2QQI A;  4YPJ A;  1UYY A;  2EIE A;  1CZS A;  3WF2 A;  1J84 A;  4KMQ A;  5HPO A;  1W99 A;  2VQT A;  3CZU A;  1JU3 A;  1UY3 A;  4LOS A;  2J1S A;  2LW8 A;  2YFZ A;  3K77 A;  5DN2 A;  1CIY A;  1GUI A;  1H6Y A;  3GXU A;  3NNG A;  5CIS A;  1K3I A;  3I3E A;  2Y6J A;  3U37 A;  4L0P A;  1GQP A;  1NT0 A;  4M4R A;  4QX3 A;  4M4P A;  4JKK A;  5HXM A;  3LPG A;  3T2O A;  1UYX A;  2LS6 A;  4Z2A A;  3T0D A;  1JZ8 A;  1P8J A;  3A7Q A;  1T2X A;  2YG0 A;  2RJ2 A;  3OGV A;  5J1X A;  4P5Y A;  2PQS A;  3ABZ A;  1EUU A;  4CU8 A;  3WF3 A;  4OZO A;  3LEK A;  1R64 A;  2ORZ A;  4E8C A;  4A45 A;  2W9X A;  2J7M A;  3C7F A;  3EB7 A;  4TXW A;  3T09 A;  4HG6 B;  1O59 A;  1JYX A;  2WO3 A;  3OBA A;  3HNB M;  3GDB A;  3SKJ E;  2XQX A;  5CKM A;  2X05 A;  2W46 A;  5C7G A;  3WNP A;  3MUZ 1;  2CDO A;  1MPX A;  4QDQ A;  2VME A;  2C4X A;  1O8S A;  2VZS A;  3POB A;  4LMF A;  1UXZ A;  4AG4 A;  2W95 A;  4ARY A;  1NUK A;  4ZY9 A;  2W3J A;  3C7H A;  2BBA A;  1K12 A;  4XVH A;  1JYV A;  3P6B A;  1J83 A;  4OMD A;  2BZD A;  2VM9 A;  2W1S A;  2WAA A;  2J22 A;  2VCA A;  1F4H A;  3OGR A;  3IAP A;  4FI9 A;  2ZXQ A;  3CZJ A;  2VZV A;  4ET7 A;  2VJX A;  4A44 A;  2DCJ A;  4ZZ8 A;  2BGP A;  4A42 A;  2E33 A;  2XHN A;  3E1F 1;  3WF1 A;  4DXS A;  2V5D A;  4XUT A;  5A1A A;  5G05 L;  1SPP B;  2VTF A;  4LHS A;  3HN3 A;  1DP0 A;  2Y6G A;  1O8P A;  2Y6L A;  4JKL A;  4GWI A;  3I2K A;  2WYS A;  3W5M A;  2J1U A;  5LA0 A;  3C7G A;  3VDA A;  2W91 A;  2ZEZ A;  1F4A A;  1GNY A;  3MV0 1;  2WAO A;  4ZXE A;  2ZEY A;  1PMH X;  1WKY A;  1JZ5 A;  4RYD A;  5JMO A;  2EIB A;  1SZB A;  5JUV A;  2VZT A;  4BK5 A;  1UMH A;  2DCK A;  3K46 A;  2E26 A;  3WNO A;  4QDR A;  2VR4 A;  3J7H A;  4MGQ A;  3I3D A;  5IFP A;  4DUW A;  3I2J A;  3OEA A;  4IUG A;  3VDC A;  3ETP A;  4QPW A;  2J1R A;  4MAD A;  3D3A A;  5DQ0 A;  4QAW A;  3DYP A;  4QX2 A;  4BXS V;  2X09 A;  1TG7 A;  3SEP A;  4LOT A;  1UY1 A;  1W8O A;  3ACG A;  1PMJ X;  1KGY A;  1BHG A;  4W4Z A;  2QQO A;  2ZEX A;  3DEC A;  2BER A;  4W50 A;  3CQO A;  3POJ A;  1JZ6 A;  4D8M A;  3BN6 A;  1W0N A;  2ORX A;  5JR2 A;  4A41 A;  2VCB A;  1US3 A;  2JKX A;  4DEQ A;  3T0B A;  1OT5 A;  4OYU A;  2R7E B;  2RVA A;  2XON A;  3FHA A;  2WZE A;  3ECQ A;  3ACI A;  3WQB A;  1GOG A;  4XUO A;  5CKQ A;  1NAE A;  4CU7 A;  3THC A;  3LEI A;  1US2 A;  3LQC A;  3PUH A;  5LA2 A;  3MUY 1;  3GGL A;  3K4Z A;  2YC4 A;  1HN1 A;  4DXR A;  2QBX A;  2VZQ A;  1KEX A;  4GWJ A;  4QB6 A;  2C26 A;  4DUV A;  4JHZ A;  4KI5 M;  2YC2 A;  2J1E A;  1SHW B;  4JKM A;  4QX1 A;  1GOF A;  3OGS A;  2C9K A;  2WBK A;  3T2P A;  5JXJ A;  4LPL A;  2VOT A;  2X10 A;  2VMC A;  3ACF A;  2KD7 A;  4MO3 M;  2WUH A;  4W8J A;  1GMM A;  2BGO A;  1W8N A;  3A23 A;  3I2G A;  3JXS A;  5JXH A;  4QB2 A;  2EIC A;  2W47 A;  3POE A;  1W9W A;  1PX4 A;  2WO1 A;  5CKN A;  1W9T A;  2QQM A;  1OD3 A;  2B4K A;  2VO5 A;  1CX1 A;  4BDV B;  3HNM A;  3IAQ A;  2OKX A;  1CZT A;  2JDA A;  4P02 B;  3ZM8 A;  3FL7 A;  1WCQ A;  3UNP A;  3K4D A;  5IYY A;  4QDS A;  3HPN A;  1UXX X;  1SFP A;  4P00 B;  3POG A;  3T2Q A;  2WDB A;  3GM8 A;  3HNY M;  5CZK A;  3DYO A;  4LOR A;  3VD7 A;  5JXI A;  2W1U A;  3OEB A;  4XUR A;  2YB7 A;  1XPW A;  3PUI A;  3IDA A;  5C71 A;  4A3Z A;  4LQR A;  3I97 A;  3NJX A;  3OB8 A;  4UOJ A;  2W1Q A;  1UX7 A;  2WZ8 A;  3A22 A;  1JU4 A;  4DXT A;  1DYO A;  5LA1 A;  3P1I A;  1K45 A;  4E8D A;  1NX9 A;  1XNT A;  2VZ3 A;  2W5F A;  3MBW A;  3VD5 A;  3NRU A;  2WQ8 A;  2W87 A;  1L7Q A;  1EUT A;  4DEV A;  3C7O A;  4PQQ A;  4BJ0 A;  2VZP A;  5F7U A;  3THD A;  1JZ7 A;  5B4X A;  2WO2 A; 
#chains in the Genus database with same CATH topology
 5FZ7 A;  1SDW A;  4Q4X 1;  1CES A;  1A6C A;  1X8M A;  1W3V A;  2WFF 1;  3FLP A;  3AC0 A;  2WNU C;  2Y60 A;  3JB4 C;  2JJ6 A;  4CEY C;  4BLJ A;  2P5B A;  1X9P A;  3OG2 A;  4YM1 A;  2Y0O A;  5A32 A;  3SCH A;  4W6Y A;  3VD9 A;  3EQE A;  3VKN A;  4LKS A;  4ZZ5 A;  5CNA A;  1WLC A;  1PO1 2;  4RFR B;  4MSV A;  4QKB A;  1GQG A;  4NHK A;  2FCT A;  3LDK A;  5F3C A;  2K9Z A;  4YZ1 A;  1WD3 A;  2QQN A;  1TE1 B;  1I5Z A;  2ZEW A;  1ULC A;  4I0A A;  4Q0P A;  1U5Y A;  5FK8 A;  1UZ0 A;  1W6Q B;  4AFB A;  1SG3 A;  4NVP A;  1C8N A;  1L7L A;  3NQH A;  5T50 A;  3JBG 1;  4PBP A;  4LA2 A;  5G04 L;  3WG4 A;  2L9L A;  4RN5 A;  5JOZ A;  2E53 A;  3ZXK A;  4XCA A;  4MXV A;  1NZI A;  4O7X A;  2R1B A;  1HV1 A;  3M3E A;  2EXI A;  4XQW A;  5FP4 A;  3IB3 A;  1JZ2 A;  5F5I A;  3OBZ A;  1WCS A;  3TEY A;  3ZYP A;  1ULF A;  4NAO A;  1N1V A;  3EBR A;  4Q0S A;  3RMX A;  4XPV A;  1XE8 A;  1DLC A;  4R4Z A;  1RUI 2;  3I59 B;  3OYW B;  3WDV A;  1V6J A;  5JIA A;  2HWE 3;  2MEV 2;  5FRA A;  3NJV A;  5IHR A;  2ARC A;  3MPP G;  4MYE A;  3I2I A;  3URF A;  4AVB A;  3ZFE B;  4Y5S A;  1QJF A;  4FO9 A;  1POV 3;  3U4X A;  3MIE A;  2IVJ A;  4GUL A;  5D1I A;  3U11 A;  1OHF A;  3D0S A;  4Q4V 2;  4AW7 A;  3HJR A;  4OLL A;  1U12 A;  3WNK A;  4N90 A;  5ACA 2;  1QJU 2;  4WZC A;  3A21 A;  3S7E A;  4HON A;  5C3Q A;  2ZZJ A;  5JSR A;  3JQW A;  4MV2 A;  3ZSL A;  4TWT A;  3U1X A;  1KQR A;  2WS9 1;  2R06 3;  2D3P A;  5IVC A;  4OFG A;  5A33 B;  2WFP A;  5JXG A;  1JI6 A;  1RUD 1;  5BNO C;  1UU6 A;  1S0I A;  2Z5W A;  1PNF A;  3WDT A;  4CE8 A;  2AAC A;  4JX0 A;  2DFC A;  3H0O A;  5A3P A;  1UO9 A;  4S2F A;  4ATF A;  3VDD A;  1UOF A;  1YQ6 A;  1YRZ A;  4Q4X 2;  4C90 A;  3K75 B;  2P1B A;  4LR4 A;  2WS9 3;  1GWL A;  3UET A;  2P6C A;  1VE0 A;  5K7P A;  5FPV A;  5LEJ A;  1DZT A;  2B39 A;  5B4N A;  2E7A A;  3TOJ A;  1HLC A;  1UD1 A;  3KCY A;  5C9A C;  2VVE A;  5LK7 B;  1RGS A;  1W8T A;  4GZ9 A;  2AGS A;  2QVS B;  2H6B A;  2X8K A;  4ATE A;  2D5F A;  3SNM A;  2JDH A;  2QNK A;  2RDR A;  2Y64 A;  2HEV F;  1YEW A;  3NNL A;  2JE7 A;  1W04 A;  2ID4 A;  4IV1 A;  3OF1 A;  5A3M A;  1XYP A;  2JG9 A;  1VBD 1;  2ZML A;  3POF A;  3VBO B;  1PGL 1;  1C8M 2;  4I0B A;  3ZFG A;  3SC7 X;  1RUJ 1;  2XWB B;  4XDQ A;  1REF A;  1GU3 A;  2HEY F;  2PLV 2;  2E31 A;  2VZR A;  2WN3 A;  3E6B A;  1J58 A;  1SPP A;  2ES3 A;  3AVS A;  2CDP A;  3MIH A;  4CTE A;  5FDB A;  5D8A C;  3WQ7 A;  3AJZ A;  4CDX C;  4TTG A;  3III A;  3AL6 A;  5JOX A;  3WP5 A;  1JYI A;  4N53 A;  3ZR6 A;  4F83 A;  1C28 A;  5DMY A;  1VB2 A;  4Y4Y A;  3OGJ A;  3CKH A;  4AFD A;  4COZ A;  4EWE A;  3ZXG A;  3C3V A;  3OCP A;  1IG3 A;  1XE0 A;  2DCY A;  2RDS A;  3SH5 A;  3R4U A;  3DKQ A;  4I3G A;  4XFA A;  3WUC A;  1S0F A;  1PZ9 A;  4AFM A;  2OZ6 A;  1OKO A;  4LIV A;  4CP1 A;  1WME A;  4GH4 B;  5KXB A;  3FFZ A;  1WBL A;  3N35 A;  3H50 A;  4XUN A;  3ZXJ A;  1UIJ A;  2BOI A;  2UU8 A;  3PVB B;  4XFF A;  3MLL A;  2PAE A;  1JOP A;  2QCS B;  4FFG A;  4XJU A;  2FCV A;  4QX0 A;  4MGI E;  5IAT A;  2QJV A;  2VL4 A;  5HCA A;  5J3U A;  1JYN A;  3Q9O A;  3CIH A;  4LXL A;  4NPL A;  5I0D A;  4AE2 A;  5FMD A;  3THT A;  4CP0 A;  2XR4 A;  2VOW A;  1FT9 A;  2BVB A;  1RIR A;  4YG0 A;  5FP3 A;  4CUC A;  2XUE A;  3WNM A;  4X8P A;  3NJY A;  1H4H A;  2G1M A;  1VBA 2;  1ST8 A;  2QQI A;  4Q1R A;  5H9P A;  4YPJ A;  1V70 A;  2PHX A;  1VBD 3;  2FCU A;  1UYY A;  3E6C C;  2EIE A;  1OA4 A;  4WVM A;  4BIS A;  4O65 A;  3LA3 A;  2BWC A;  4AI8 A;  3ES1 A;  3CZU A;  4XXP A;  1N1Y A;  2VW2 A;  4BXF A;  4QU2 A;  1Y4W A;  3K77 A;  3U4S A;  1CIY A;  3WXP A;  5J96 B;  2XUM A;  3N36 A;  3GXU A;  3W9A A;  5I8T A;  1LCL A;  3TWI A;  1HXS 3;  2A73 B;  1VBC 2;  4J1X A;  1YI7 A;  2JDP A;  4RFT 0;  4CCN A;  2RR1 3;  3RZZ A;  2ZA9 A;  1JOJ A;  1J1L A;  2C5D A;  1GQP A;  1ZZB A;  1NT0 A;  2OQ6 A;  4OHW A;  4D7S A;  1QJY 3;  1S2B A;  4JKK A;  1G86 A;  5JPN B;  3WG1 A;  4URA A;  3ZN4 A;  1XU1 A;  5M0T A;  4LK6 A;  3ZLI A;  1UYX A;  2XVG A;  3A7Q A;  3CEW A;  3PHM A;  4UFI A;  3FFQ A;  4XYX A;  1YIF A;  5F32 A;  5ERL A;  1ZBE 2;  5A1F A;  4QPG B;  3OGV A;  3M8L A;  2VUL A;  1HRV 2;  2A6Y A;  5EP9 A;  2JDY A;  1RIT A;  4I0W B;  1TNR A;  1VRH 2;  1QJY 1;  3V65 A;  3U10 A;  3ABZ A;  5L19 A;  5FO9 B;  1SCS A;  4AOC A;  4Y1V A;  2KA3 A;  4QXK A;  4AFA A;  1QJX 2;  3B69 A;  3F95 A;  4JC1 A;  1PMI A;  3C7F A;  3ZR5 A;  1XRU A;  4CP9 B;  3SH4 A;  5C3R A;  1NYW A;  1O59 A;  2ERF A;  2PYT A;  2WT1 A;  4P14 A;  3KZ4 C;  3HNB M;  5GLU A;  3N9P A;  1NA1 A;  2ARX A;  3FMG A;  4HSL A;  5A80 A;  2R32 A;  4B29 A;  3WNP A;  3M3O A;  3PU8 A;  1IQA A;  5DG2 A;  4DY3 A;  2GMP A;  1XSQ A;  1RVF 2;  1B35 A;  5CU1 A;  1D2S A;  2OT7 A;  1V6K A;  4QGM A;  3ZSJ A;  2VBP A;  1UXZ A;  4GD4 A;  1HX6 A;  4Y5Z 0;  1ENR A;  3IM0 A;  4Q0U A;  4Q4Y 1;  2W95 A;  1IOA A;  4LIT A;  2HWB 3;  2VUC A;  1AR6 3;  3H1W A;  1PZ8 A;  1JYV A;  3BTA A;  3P6B A;  1PO2 3;  4NR1 A;  2QDN A;  1CN1 A;  3FBY A;  4C1X A;  3HAG A;  5JZG B;  4X6Q B;  4PCR A;  2ARE A;  1LGC A;  2WNV C;  4ZU5 A;  5FZO A;  3GJA A;  3J8F 1;  3TAY A;  2SLI A;  3NNM A;  3DF0 A;  3DL3 A;  4EJR A;  3NAP A;  4R4X A;  4E9K A;  2Q8D A;  4BHP A;  4A42 A;  2EAL A;  3AKS A;  3ROU A;  4IV1 C;  3KF3 A;  1PGW 2;  5A3O A;  2B42 B;  4LKD A;  4EE2 A;  3JBG 2;  2RM2 3;  3OPT A;  4PF5 A;  4AF9 A;  1W28 A;  1CIW A;  3CO2 A;  2XJV A;  4OHY A;  5A1L A;  5A1A A;  3V56 A;  2ZAA A;  5FYV A;  3ME2 A;  3V0B A;  1RUJ 3;  4B1L A;  1I9R A;  2WRA A;  4RHV 1;  4JDN A;  3CNA A;  1Z7S 1;  2GAU A;  3B3Q E;  4PI2 A;  4PIX A;  2ZGU A;  1QMJ A;  2YPJ A;  4IDZ A;  1W8U A;  3RSJ A;  4AEK A;  1Q56 A;  2PLV 1;  2VTF A;  1YHF A;  1VMH A;  3MHZ A;  3O1M A;  2XML A;  5FZE A;  1O8P A;  4QQ2 A;  2HWD 1;  5D2A A;  5CFC A;  5IT6 A;  4PDW B;  4I01 A;  2RM2 2;  3HQX A;  2HWE 1;  1YYN A;  4MUV A;  3NKG A;  5FZG A;  3RZG A;  5LY2 A;  3WW1 A;  2O14 A;  5LA0 A;  3O1R A;  3T2T A;  2VW1 A;  4Q8K A;  2CGP A;  1BJQ A;  4QPI C;  2ZEZ A;  4YGC A;  5J36 A;  4IEO A;  3WR0 A;  2AYH A;  5SV8 A;  4Y5T A;  3W59 A;  4AED A;  5JMO A;  3S0M A;  3RYP A;  3WDY A;  4ASK A;  4Y1X A;  5JUV A;  1VB4 A;  2CY6 A;  4QQP A;  3AP6 A;  1HJG A;  2VZT A;  4JHT A;  4Y22 A;  3BKZ A;  1QJU 3;  4L99 A;  3K2O A;  1AR8 1;  1AXZ A;  1GYK A;  1OFN A;  1WW7 A;  5DAX A;  3H8R A;  3DPR A;  4JQT A;  2E6V A;  2VQA A;  5FFO C;  2NMO A;  4OQ8 A;  4NPM A;  3H8O A;  3I49 A;  4IV3 B;  1K42 A;  5L36 A;  4Q2F A;  2DF7 A;  4DMI A;  1MS9 A;  3I3D A;  1X8E A;  3R05 A;  3I2J A;  3B94 A;  5LW9 A;  3N7L A;  1DGL A;  1AUY A;  2RG4 A;  3NV3 A;  3WIN E;  1QJU 1;  3ZMO A;  2QQW A;  1WZX A;  3B9I A;  5I0U A;  3VDC A;  1H9P A;  1KFU L;  1IS3 A;  4QPW A;  1OUS A;  2HKX A;  2IXK A;  5DXD A;  3VHR A;  5BNP C;  4LKF A;  2ZGL A;  4IE5 A;  4QAW A;  3ZYF A;  5F37 A;  2XJP A;  4UW6 A;  1TME 2;  3PTY A;  2A6W A;  4CDW C;  1B35 B;  1H0B A;  4LOT A;  1UY1 A;  3WDX A;  4XF9 A;  1N3P A;  4Y1Y A;  1PGL 2;  2TEP A;  2ZGP A;  3H3L A;  4FXK B;  1BHG A;  4W4Z A;  1UL9 A;  4B8E A;  2HBU A;  4CEW B;  2BER A;  2EXH A;  2YU2 A;  2YRO A;  3CQO A;  4Y33 A;  5FQ0 A;  3LAG A;  4CA9 A;  4A6S A;  2A3Y A;  2QQV A;  2PHF A;  1W0N A;  2O1Q A;  4ES8 A;  5JR2 A;  1MZ6 A;  3U78 A;  4M3C B;  1CJD A;  4FTE A;  2VCB A;  2JX9 A;  3KV5 A;  5BPX A;  5BNO A;  1Y43 B;  1H2K A;  1NXD 1;  4RHV 2;  4K3U A;  4AYU A;  2BU9 A;  2D44 A;  1KD7 A;  1GWK A;  5EYX A;  1F15 A;  1N1S A;  5E6H A;  1O4T A;  3CJI A;  4IXL A;  4AQ2 A;  2WZE A;  4XQD A;  3GBF A;  3ECQ A;  2AZ5 A;  3ACI A;  1VRB A;  4Z82 A;  1VBE 3;  5AC9 1;  2BPA 2;  5FYH A;  1GOG A;  3H8U A;  5DAW A;  3MIF A;  4HN1 A;  4XJA A;  4HLT A;  4CU7 A;  1EV1 3;  4JDO A;  1ZRI A;  1QOS A;  1KIT A;  3PUH A;  4FFI A;  5LA2 A;  5FBJ A;  4E27 A;  3AK0 A;  1O91 A;  2O8O A;  2QQU A;  3WCR A;  1HIX A;  3SIT A;  3VBH C;  4ORF A;  4QKD A;  4HET A;  4XCB A;  4DXR A;  4B4Q A;  2NP0 A;  1VBC 1;  4LIU A;  2HWB 1;  1GKB A;  4FPY A;  1QQP 1;  3IDC B;  4FAG A;  3VZL A;  3RFR A;  3J7N A;  2D6N A;  2RS1 1;  4JAA A;  4GWJ A;  3WHT A;  2RMU 2;  5KXD A;  3IPV A;  1V0A A;  2GN3 A;  3VBF B;  4NOT A;  4KI5 M;  4N43 A;  3RNS A;  2Y0I A;  2J1E A;  4YVW A;  1BBT 2;  5EYY A;  3AZW A;  3W21 A;  4MGT A;  2DVG A;  4AVA A;  3AMH A;  1NCR B;  2GND A;  1VBA 3;  5F6L B;  2UYB A;  5F2W A;  1IKQ A;  5FY4 A;  2R1D A;  5JXJ A;  3DV8 A;  3KVB A;  1YFU A;  2BFU L;  2ET1 A;  2VGD A;  2PAM A;  2VOT A;  3B00 A;  3ACF A;  2DU0 A;  1BBT 3;  4LBM A;  2YMZ A;  4MO3 M;  2WUH A;  4RQP C;  1Y3T A;  1LOD A;  4W8J A;  1O3T A;  3AP4 A;  1GMM A;  1W2A X;  1W8N A;  2NPI A;  4OI0 A;  5LBC A;  1EAH 1;  1R08 3;  4NWV A;  4CCD A;  3AXE A;  3OD4 A;  2N7G A;  1TME 3;  2UWC A;  3POE A;  1PX4 A;  2W52 A;  2WO1 A;  1W9T A;  2YV8 A;  3FE5 A;  4GKX A;  5ABJ B;  3KCC A;  1LOA A;  2CYF A;  4AVS A;  3CLP A;  5AC9 3;  1OUR A;  3WUD A;  4YW1 A;  4ZHN A;  4XMA A;  2WS9 2;  3FL7 A;  2XJS A;  5GZE A;  3ZM8 A;  4QPG A;  2P34 A;  1CD3 G;  1CAX B;  4XDP A;  4O9E A;  5I8S A;  3T4V A;  3ES4 A;  3AYE A;  1MEC 1;  4QDS A;  2YPD A;  1Y7B A;  3AMN A;  3UYJ A;  2NMN A;  1JH5 A;  5JSO A;  2RHP A;  4CDU C;  3ZPO A;  1ND3 A;  1W8H A;  5FUP A;  2VBB A;  3ILF A;  3RZJ A;  2FDH A;  3A4U A;  4LBJ A;  5DDJ 3;  3D0J A;  2P17 A;  4IE4 A;  4QM9 A;  2J42 A;  1VPH A;  3O0V A;  1KRI A;  4ASL A;  1W39 A;  1JW6 A;  3T1L A;  2PLV 3;  1XPW A;  3WHU A;  1JMU B;  1HRI 2;  3M70 A;  3N9Q A;  1VAV A;  4DIN B;  3IDA A;  4XF0 A;  4HT1 T;  1DQ5 A;  1RMU 2;  3I97 A;  3KT4 A;  3OB8 A;  1WA4 A;  4UOJ A;  1C1F A;  2A5Z A;  1YQ5 A;  2D98 A;  2PXJ A;  5T52 A;  1SFN A;  1ULE A;  5EV7 A;  4IGP A;  2RM2 1;  4AGV A;  2V73 A;  5HCF A;  3LSE A;  1XNT A;  3VD5 A;  4A7Y A;  5JOW A;  5A7P A;  3GBW A;  2W87 A;  2WC2 A;  3UV9 A;  2WZR 2;  2WSV A;  2VUA A;  3OPZ A;  4IV1 B;  1EUT A;  2VD7 A;  5FYZ A;  3WNX A;  1OOP A;  1QDO A;  4DEV A;  4D3W A;  4FBF A;  4PQQ A;  4Q4V 1;  1LKN A;  4K8R B;  2VUD A;  5GZG A;  3N7K A;  4DZG A;  3GYD A;  4XAC A;  1JZ7 A;  1V6N A;  2ZHN A;  3WLU A;  2B7Y A;  4S2H A;  4PIY A;  2BNO A;  4FOQ A;  3VBH B;  4DPN A;  3L9J T;  4J6G A;  1RB8 G;  2VMD A;  2HWD 2;  3AVR A;  1OF3 A;  4YG6 A;  1NLQ A;  1BK0 A;  4P9Y A;  4FAH A;  4WM7 B;  1W6N A;  2AR6 A;  3HD8 B;  3BGA A;  4H2A A;  4JCK A;  4OHX A;  1YUD A;  1ENX A;  1WMD A;  2X29 A;  2V4V A;  2JD9 A;  1ZRR A;  2Y6H A;  2YBP A;  4QHO A;  2VMF A;  1D4M 2;  3WW4 A;  4HPK A;  4CPB A;  5KXC A;  2ZMN A;  3AKT A;  3C8X A;  3B7M A;  1HW5 A;  4R9B A;  3IDE A;  1UPI A;  1RHI 1;  2BYV E;  2GN7 A;  1Z7S 3;  2MPF A;  5K0U C;  4PJY A;  4OUS A;  5L73 A;  2VQU A;  1JHJ A;  1UY4 A;  2A6X A;  1OOP B;  3HQR A;  3LGR A;  5CYY A;  2ENR A;  1KFX L;  4NRO A;  2RS3 1;  4QKF A;  3VKF C;  1W8W A;  1RUJ 2;  1UCX A;  5FZ3 A;  1S4C A;  1JZ3 A;  4CDU B;  1W6Q A;  1GZW A;  3QH6 A;  1UY2 A;  1UMZ A;  1ONA A;  4QX5 A;  1AVB A;  4UAP A;  4X6R B;  1ZX5 A;  5FPX A;  4BZ4 A;  2OPK A;  5H9R A;  2WIN B;  5FZB A;  4C8D A;  1DZQ A;  1L3J A;  3GZU C;  1XSR A;  4A7K A;  4BYY A;  3ILN A;  3BVC A;  3PUS A;  3POI A;  1WWY A;  2W0X A;  4X8N A;  2WN2 A;  1WUV A;  2Y6K A;  1ZRF A;  5E88 A;  5IVY A;  5A32 B;  2CWS A;  3PVN A;  3JB8 A;  4XFB A;  1CJP A;  3FUQ A;  4LLF A;  4CDW A;  2I74 A;  1Q8Q A;  3VD4 A;  3WQ0 A;  3CF6 E;  3WSO A;  2DDU A;  5CAZ A;  3T08 A;  2JD4 A;  5EIY B;  3DCQ A;  1OVS A;  2B9V A;  1RUF 3;  3PDQ A;  1DQ4 A;  3KHC A;  1VAK A;  2JG9 C;  4XHX A;  1R08 1;  4COY A;  4KWK A;  2G9G A;  3PU3 A;  4MXW A;  1MZ5 A;  4AEM A;  2XL9 A;  1EYB A;  1R09 2;  2VEC A;  4XMI A;  1GP6 A;  4P08 A;  5FUN A;  2RE9 A;  2X5I B;  1G8W A;  3D82 A;  5FUI A;  5H9Q A;  1DU3 D;  5EJ1 B;  3WP3 A;  3GF6 A;  3C7E A;  4UF0 B;  3HR9 A;  4EZH A;  3HOB A;  2D6L X;  2WSU A;  3QAC A;  4LO4 B;  2IXI A;  4RR3 B;  5FQ0 B;  3TN9 3;  3ZYH A;  5A3W A;  1I5P A;  4N9I A;  1RIN A;  1EP0 A;  3IMN A;  4AI0 A;  5FYT A;  3MIB A;  2CSG A;  1ODN A;  1YXW A;  1JS9 A;  4UI9 L;  1ZM1 A;  1BLZ A;  3I4I A;  4ES9 A;  2JB4 A;  4CCC A;  1CZV A;  4P9W A;  4PDW A;  2MNG A;  1WLT A;  1W9F A;  1DG6 A;  2DTY A;  3EHK A;  5F3I A;  2XJT A;  4XIK A;  3UES A;  2Q1Z B;  4QPI A;  4R52 A;  4WBB A;  1YNA A;  2JEN A;  2ZHK A;  1PX3 A;  1ULP A;  5FO8 B;  3FWE A;  5JZG C;  4Q4Y 2;  5LAT A;  2Q4S A;  5FZ8 A;  5LAS A;  1CAX A;  2H0B A;  5IVE A;  1UWW A;  1CAV B;  2XLF A;  1XU2 A;  1APN A;  1XBF A;  1WMX A;  3VL8 A;  2VOK A;  4QM8 A;  4BLI A;  5LEK A;  4D0Q A;  4CU9 A;  1SLB A;  1VBE 1;  2FMD A;  4PF1 A;  4RA0 A;  4UBG A;  1OPM A;  4HKO A;  2ZGT A;  4WM7 A;  1S55 A;  5KHK A;  5DUW A;  4N9H A;  4DOU A;  3WQ1 A;  4BH9 A;  3PJQ A;  5A6Z A;  2NN8 A;  2CAV A;  2XOM A;  3LOI A;  4ARX A;  4L9B A;  2GAL A;  4XF4 A;  2VH9 A;  4HKW A;  3GZE A;  2B8M A;  1W6O B;  5IUQ A;  1W2T A;  2FMY A;  1V6M A;  5FZO B;  2WR9 A;  4B4R A;  1K5M B;  2CU5 A;  1W9S A;  5GLW A;  2D3R A;  4XQ4 A;  3CDZ B;  4JGZ B;  3F2Z A;  2VZU A;  3KT1 A;  3HWJ A;  3H9A A;  3VHN A;  1LEN A;  1SEF A;  1H8V A;  2HYX A;  3ZYR A;  5FAX A;  2FBE A;  1WA6 X;  2BWA A;  4M3C A;  4YLZ A;  5JPM B;  1IPJ A;  4AVC A;  1WCK A;  4HOO A;  1RYY A;  5KC6 A;  5FY8 A;  1MR5 A;  2DUQ A;  2WZR 1;  4TLG A;  5EHD A;  3RWK X;  2JXA A;  1E5S A;  3VBU C;  4EN9 B;  4IV3 C;  1UF2 C;  5CBL A;  1LEC A;  1DQ2 A;  4LBN A;  3VGI A;  1F2N A;  3AZV A;  3OGG A;  3QBQ A;  4IEY A;  3H7Y A;  4LTA A;  1GLH A;  2D5H A;  4FP2 A;  4GAL A;  4YZ2 A;  4JRL A;  1UY3 A;  1XNK A;  2J1S A;  3RYK A;  4Y4R A;  2R04 1;  1OH3 A;  4XAB A;  4Y1Z A;  2BP6 A;  5HV4 A;  4XTP A;  1FI2 A;  2NYY A;  3ZYI B;  1K3I A;  3KSC A;  1OXC A;  3C2U A;  4LJH A;  2Y6J A;  1RUC 3;  4XJZ A;  5A33 A;  4E8D A;  3MIC A;  4QU1 A;  2OUH A;  3IT8 A;  4N7U A;  2PHD A;  4M4R A;  4QX3 A;  4K40 A;  2CGN A;  5KC5 A;  1HB3 A;  2C24 A;  2PMW B;  2RR1 1;  4RR3 C;  1JYT A;  4L8Q A;  2LS6 A;  4Z2A A;  1JZ8 A;  1P8J A;  1RUC 1;  5DZE A;  1HKD A;  1EV1 2;  1T2X A;  1UN1 A;  2ZGQ A;  3I8T A;  4IE6 A;  5LA9 A;  1RHI 2;  1VBE 2;  4K20 A;  2GC1 A;  1GWM A;  3UJO A;  4BQ3 A;  1GSL A;  3APB A;  3GJB A;  5FYU A;  2BUK A;  1NLS A;  2ZJC A;  1YIP A;  5I91 A;  1NA1 B;  1PO1 1;  2KXL A;  3LEK A;  2ILM A;  4PHZ A;  3ALQ A;  4Q27 A;  5J48 A;  2ORZ A;  4E8C A;  1SLL A;  2VG9 A;  3VZK A;  4Y3O A;  5DAB A;  2W9X A;  4RHV 3;  4CCE A;  5FZF A;  3EB7 A;  1D0G A;  5T55 A;  1H8T A;  2GMM A;  4TXW A;  4QMA A;  1HV0 A;  1JYX A;  1R1A 3;  1W6P A;  1B35 C;  3PUA A;  4Q0Q A;  5I0S A;  2Q0A A;  1QOT A;  4KBB A;  4LBL A;  1HQW A;  3RRD A;  3PME A;  3H3Z A;  5BNO B;  3MUZ 1;  2GH2 A;  1WLW A;  3ST7 A;  4QDQ A;  2BQP A;  2VME A;  5FXZ A;  1O8S A;  5LY1 A;  1W6M A;  4LMF A;  4AG4 A;  1YQ8 A;  3S7I A;  1NUK A;  3BTX A;  2IFW A;  2W3J A;  3C7H A;  4E4D X;  4FPF A;  4BQW A;  1EAH 3;  3U0Z A;  1ZA7 A;  4LO7 A;  3TNQ A;  4TYS A;  2VM9 A;  1J3P A;  4IET A;  4PDW C;  1F4H A;  3VBU B;  3VZM A;  1S2E A;  3OBT A;  1Q8S A;  4FPJ A;  4JDM A;  4HFS A;  4QHZ A;  5ACA 3;  4K21 A;  1BK1 A;  1TNF A;  3Q8E A;  5BNN C;  2ZKL A;  5C8C C;  2Q5T A;  2Z69 A;  4ET7 A;  1ASJ 1;  3GZA A;  3R6S A;  2DCJ A;  4CCJ A;  4FCA A;  4H14 A;  1OQD A;  5ANN A;  2DUO A;  1S1A A;  2OXB A;  4ERO A;  4IV3 A;  3WF1 A;  5JZG A;  5EFU A;  2V5D A;  4DXS A;  4ZXK A;  3INA A;  5DAP A;  2VMH A;  5IK8 A;  2YU1 A;  3OTF A;  3O12 A;  1OPO A;  5KBF A;  4Q1P A;  4UT5 A;  2P3Y A;  5C6C A;  5L7O C;  4P9G A;  3MLJ A;  5IK5 A;  1SPP B;  2X5I C;  2P3I A;  1QNW A;  4QPG C;  2JIC A;  4C0H A;  4JTN A;  3ZYJ B;  2QTW B;  3LWC A;  1VLN A;  2D6M A;  1DP0 A;  1NQD A;  5LRS A;  3J8F 2;  4IE7 A;  4JKL A;  1Y9Q A;  3ELN A;  3WW2 A;  1YQC A;  4G3Y C;  2WYS A;  4SLI A;  4V1P A;  4CP9 A;  4Q29 A;  3AX4 A;  4KG0 A;  1UOG A;  5IVB A;  1XNB A;  3VDA A;  5BY5 A;  5FYY A;  2W91 A;  1NCQ A;  2CTV A;  1HDK A;  2WAO A;  2LRP A;  3ZYG A;  1QIQ A;  3L2H A;  2YGL A;  1JZ5 A;  4RYD A;  5B2G B;  2PEL A;  2EIB A;  1SZB A;  5IVF A;  1RUH 1;  3E5X A;  3VHP A;  1O3S A;  1ENQ A;  1RUF 1;  2X5I A;  5IK7 A;  4BK5 A;  4B4P A;  1CPM A;  5H9S A;  2DCK A;  1RUN A;  4GKY A;  5J98 B;  4CPB D;  5AVP A;  4O61 A;  4AVV A;  1ND2 C;  3MEP A;  4B7E A;  3J7H A;  1OFS A;  3AYA A;  4C1W A;  4OCT A;  1AL2 1;  1FPN 3;  1PK6 B;  2RJL A;  2IXL A;  4Z2W A;  2HEW F;  4YWA A;  2PFW A;  2Q30 A;  4L2N A;  1CR7 A;  5FYC A;  2C0Z A;  3OEA A;  4CDW B;  2HWE 2;  3MGU A;  2G19 A;  2WZR 3;  3VBF C;  3H3U A;  5KWR A;  3D3A A;  3FZ3 A;  5K0U B;  4LE3 A;  5LRR A;  4MGZ E;  5BYN A;  3DYP A;  4FPG A;  1R08 2;  2KM2 A;  4IE0 A;  4M3C E;  4JTO A;  1W8O A;  5J7M A;  3H7J A;  4BB3 A;  1PMJ X;  1AR9 2;  1QY4 A;  1RUG 2;  1NCR A;  4UW5 A;  2ZZQ A;  3D5O A;  2XVK A;  5HI0 A;  1BQP A;  4YNI A;  4W50 A;  2P4E A;  4YW2 A;  3POJ A;  2JG8 C;  2XXZ A;  2CGO A;  5F5Q A;  4BCU A;  5FLH A;  3JBG 3;  1PGS A;  1A8D A;  3ZFG C;  4ZKT B;  2ORX A;  1I1E A;  5EPA A;  5FP9 A;  1J1T A;  1QJE A;  2A75 A;  4WVV A;  1CPN A;  1OT5 A;  4OYU A;  2HJI A;  1OQ1 A;  3ZN5 A;  2R7E B;  5A6Q A;  4LK7 A;  5FMC A;  4NN0 A;  4DIQ A;  1ZYB A;  3O1S A;  1HJF A;  2A3X A;  3VKM A;  2EAK A;  1AHS A;  4M0N A;  4QT6 A;  3WQB A;  4NHL A;  5CKQ A;  1NAE A;  1COV 2;  3KGL A;  2QUO A;  3GBG A;  3LFM A;  3LEI A;  3THC A;  4BWO A;  1TME 1;  3KGZ A;  4EN8 B;  1UW8 A;  1QOO A;  3KMH A;  1JTZ X;  1KJL A;  4FQZ A;  3GGL A;  5FTT C;  3ZKU A;  5A7W B;  4K1Z A;  5JAX A;  1O3R A;  2YC4 A;  3M3I A;  2XH6 A;  1UZY A;  2JDK A;  4F7Z A;  1UKG A;  5BXX A;  3JD7 2;  5FPA A;  3BUC A;  4AQS A;  4QB6 A;  2XLA A;  5LK5 A;  5I0R A;  1MEC 3;  4JHZ A;  4DUV A;  2RS5 1;  3O1U A;  3RZL A;  4IGQ A;  1PVX A;  4OZX A;  4CRQ A;  2WFF 3;  4AHZ A;  1LOB A;  1DHK B;  3NV4 A;  4CEW A;  1GOF A;  2TBV A;  1RUD 3;  2ARB A;  1V00 A;  3JCI A;  1YC6 1;  1ASJ 3;  3NWK A;  2IUW A;  5FYB A;  2X10 A;  5F8P A;  1V9U 2;  4KU8 A;  1N47 A;  2D6K A;  5FMO S;  2KD7 A;  4F8A A;  4WM8 C;  1AZD A;  1LEM A;  1YO8 A;  1HRI 3;  4FXG B;  3RPQ A;  1ZRC A;  2BGO A;  1ODM A;  1BMV 1;  1B09 A;  4GA9 A;  1XYO A;  1SMV A;  4QQO A;  5EWS A;  3T30 A;  1WW4 A;  1GP5 A;  1W9W A;  4ITC A;  3ON7 A;  3J9S A;  5BNN A;  2VMG A;  1DGR N;  3K51 A;  4YW7 A;  5C8C A;  1MAC A;  1ZRE A;  3ZPY A;  2QQM A;  3TB0 A;  2B4K A;  2VO5 A;  2XBO 1;  2RS1 2;  4M00 A;  1W3X A;  2VQ0 A;  1QXJ A;  2JDA A;  3DPR B;  2O8Q A;  4P02 B;  4XJ8 A;  3VL9 A;  5KHJ A;  3VDD B;  1DGR A;  4S2G A;  2XL7 A;  3OOX A;  2GSY A;  3A0N A;  4MXW B;  3WDU A;  4D6Q A;  2XKO A;  3ZVX A;  1RUC 2;  3HPN A;  5KHG A;  1UXX X;  3VLB B;  4EYU A;  4XAA A;  4P9I A;  3HNY M;  5CZK A;  3DYO A;  1D0H A;  5LBF A;  2D3S A;  1G9A A;  2BRT A;  4K7J A;  5T5P A;  4AXO A;  1Y9M A;  5C9A B;  1I3H A;  2RDQ A;  4UW3 A;  1GNH A;  2ZHL A;  4FFF A;  1J59 A;  5IWF A;  4K9S A;  1FMD 2;  2DVD A;  4IND A;  4Q4W 2;  5FV3 A;  4WM7 C;  4BE3 A;  1LHW A;  4LQR A;  5A70 A;  3NJX A;  5CFC B;  1PK6 C;  2W1Q A;  1HQN A;  3VB9 A;  1GIC A;  1UZV A;  1ASJ 2;  3WDW A;  1W6M B;  1XXN A;  3PTR B;  4D6S A;  2YDE A;  4PLM A;  2AEN A;  5SV5 A;  3VHO A;  3RG0 A;  2DYC A;  4A7Z A;  1K45 A;  1SAC A;  4N53 B;  2GU9 A;  3VN4 A;  1NX9 A;  1XJA A;  2W5F A;  3ZOI A;  4COV A;  2ADE A;  1AR8 2;  2WQ8 A;  1MEC 2;  4EWA A;  4AI1 A;  3MW4 A;  1S0D A;  3ENR A;  4XW3 A;  2JIG A;  2GP5 A;  4BME A;  2DVB A;  2P6H A;  2DFB A;  1WCD J;  2VNG A;  3DGT A;  2XBO 3;  2QDR A;  4TLF A;  1OC1 A;  3VKO A;  3AJY A;  3POS A;  4BJ0 A;  4NHM A;  2ZGR A;  1PNG A;  4ZS3 A;  1U5Z A;  1F9K A;  4HVR A;  1UZW A;  2WO2 A;  5B4X A;  2VNO A;  1DZR A;  2WL1 A;  3PUQ A;  4E4S A;  2YHJ A;  1DGW X;  3M7A A;  3MLK A;  5C3P A;  2ZHM A;  3O1P A;  1F5F A;  1XYN A;  4U2A A;  4LBQ A;  1UX6 A;  2DCT A;  3NNJ A;  3ACH A;  2ET7 A;  1FOD 2;  4NIA A;  2VBD A;  4MGS A;  4QD2 A;  1AYM 1;  1TMF 2;  4XUP A;  5DUU A;  5FP8 A;  4M01 A;  5JIU A;  5BNP A;  2Q1F A;  3PIJ A;  4CUA A;  2VZO A;  4NE9 A;  5K4L A;  1W90 A;  1FOD 3;  1MQT A;  1ZRD A;  4KWU A;  1G9B A;  1A34 A;  3T0A A;  1L7R A;  2LTN A;  3CJI B;  1W2U A;  4YVW C;  1C4R A;  1LES A;  1RL3 A;  2W39 A;  4XZU G;  5FPU A;  2DVF A;  3O1T A;  1UOB A;  3VD3 A;  5FYM A;  2E9Q A;  5FYI A;  1W6P B;  2PHL A;  1TQ5 A;  4QB1 A;  3THP A;  3AM2 A;  2WNE A;  1RVF 3;  1WMF A;  4M3C F;  1MQT C;  1W03 A;  3SHR A;  4AAX A;  1OF4 A;  1Q3E A;  3TEX A;  3ORJ A;  1Q8O A;  1E5H A;  2Z42 A;  3B93 A;  5C8W A;  3BPS A;  1NG0 A;  1IHM A;  1HB4 A;  2WJS A;  3HN1 A;  2JDM A;  5DZF A;  5ABJ A;  3QLQ A;  4DUX A;  2Y26 A;  4IEP A;  4MGK E;  1OOP C;  4RR3 A;  1N3O A;  1YQ2 A;  1F5J A;  2W1W A;  1QWR A;  1RTV A;  2WKK A;  1GOH A;  2VVF A;  4XAE A;  5IW0 A;  1ULO A;  1JN2 P;  1VBB 3;  4LUM A;  4DB5 A;  4NHX A;  1NKG A;  1RMU 3;  1UMI A;  1X9T A;  1QH6 A;  4NJ4 A;  1T6G C;  3I3M A;  4MG2 A;  2WII B;  1FMD 3;  4XTM A;  1OLQ A;  1TMF 3;  2F4L A;  2F6B A;  3AKR A;  3N9N A;  4WV8 A;  4GMP 1;  3MIG A;  4ISQ A;  2VCC A;  3POW A;  1KXG A;  5EXO A;  4XHB A;  3RJ2 X;  3O0X A;  1W8Z A;  1IS4 A;  1ND3 B;  1W8F A;  3VBR B;  1TVG A;  4CZS A;  1GV9 A;  3T1M A;  1PO2 2;  3IKW A;  1AR7 1;  1YJK A;  2VNR A;  3VBF A;  2OS2 A;  3V0A B;  1ZZ6 A;  3UKT A;  2AUY A;  1VBB 2;  1W0O A;  5A7Q A;  4ZON A;  3KF5 A;  1DF0 A;  2XGX A;  4QXC A;  3WNN A;  2RS5 2;  2AEY A;  4LBQ B;  4XBL A;  2A6V A;  1H1M A;  1SBF A;  2WQZ C;  3KS7 A;  4FQ4 A;  4XC9 A;  3NVC A;  5A7W A;  3I2H A;  1BEV 2;  3J8F 3;  1QU0 A;  1W6N B;  4RQP A;  3VKL A;  4NPR A;  4AWD A;  1VBC 3;  2A70 A;  3OYW A;  4XFC A;  4NRQ A;  1MS3 A;  1OA2 A;  2PTM A;  1U5X A;  2EID A;  1H1A A;  3I3B A;  4OUM A;  1HRV 1;  4GWM A;  1AYM 2;  2QQP A;  4W6X A;  4Q26 A;  5LCW L;  4FVV A;  3DEM A;  1D2Q A;  1IZ3 A;  1EV1 1;  4OI4 A;  1AL2 2;  4QHB A;  5FZ1 A;  4FTB A;  3HT1 A;  4V2W A;  4XOG A;  3O1V A;  4I09 A;  1DYP A;  4NHY A;  4A4A A;  1OLM E;  3KV6 A;  5FZA A;  4EN0 A;  3LA2 A;  2V5Y A;  1KS5 A;  2AH2 A;  3M2M A;  3LEG A;  4N53 C;  4JGZ A;  4L97 A;  1D7P M;  2JE8 A;  3LPF A;  5FJK A;  5DDJ 2;  3K48 A;  1D4M 3;  5FY7 A;  2WA3 A;  2WT0 A;  5FWJ A;  1R1A 1;  4HPK B;  5IJR A;  1Z0H A;  4D69 A;  2R07 1;  1H6X A;  1LU2 A;  3KWV A;  2ZX3 A;  1EY2 A;  3CMG A;  1MS5 A;  1STM A;  1MS0 A;  1COV 1;  3S5Q A;  2PHR A;  2VXJ A;  4UBH A;  1RHI 3;  4FOY A;  2HWD 3;  1CAW A;  5IFT A;  3FN9 A;  2RR1 2;  2W92 A;  5KHI A;  5K0U A;  3ZXA C;  1LJ7 A;  3VBH A;  3RWN A;  5C33 A;  3LOB A;  5EJZ B;  5C4W C;  1BCX A;  5IK4 A;  1SDD B;  5BNN B;  5C8C B;  5K8S A;  2XBO 2;  1COV 3;  2F17 A;  4XJ9 A;  1Q43 A;  2D43 A;  2LM3 A;  1X7N A;  4EZ4 A;  2WWU A;  3MI8 A;  1V6O A;  2PHW A;  3GZT B;  5GM0 A;  4CU6 A;  2A1X A;  1SLA A;  1ULD A;  4P9L A;  1NE6 A;  1WBF A;  4URT A;  5FO7 B;  3I3Q A;  1FYU A;  4I02 A;  1OLR A;  3MPB A;  2BEO A;  2IZW A;  1DCS A;  2XKP A;  3B5L B;  1PO2 1;  3IZO A;  5F39 A;  4YW4 A;  3WF0 A;  1JYW A;  1UY0 A;  2QQJ A;  1RUI 1;  2BFU S;  2K46 A;  3R4S A;  3E6D A;  5LB6 A;  1S0C A;  1WD4 A;  1CZS A;  2FDF A;  3WF2 A;  4A2U A;  2D93 A;  1J84 A;  2RDN A;  4XF3 A;  5HPO A;  1QNY A;  3NKT A;  1W99 A;  3ITQ A;  4CDX A;  3IIA A;  3BU7 A;  5L7O B;  4LOS A;  5JWP A;  1UNB A;  2LW8 A;  2YFZ A;  1GUI A;  3CJX A;  1W05 A;  3O14 A;  3NNG A;  4QGN A;  3D6E A;  4KL1 A;  1IG0 A;  2VUJ A;  1J3R A;  4WZF A;  5CIS A;  1JXN A;  1W2N A;  3I3E A;  3LCP A;  1QJZ A;  2BOJ A;  1NY7 1;  2GC3 A;  4Y20 A;  2E51 A;  5FCC A;  3U37 A;  1V9U 1;  5D8A A;  1DQ6 A;  3JD7 3;  4EN7 B;  5FYS A;  1TMF 1;  4FPL A;  5I8Y A;  2JIJ A;  3VZN A;  3QOP A;  4IEW A;  4AHW A;  5CG8 A;  1CQ9 A;  4M4P A;  3BTZ A;  4MX3 A;  2PHU A;  1YCI A;  5AC9 2;  4AGR A;  3KHB A;  4YZ5 A;  1DBN A;  1NCR C;  3IPV B;  3T2O A;  1NLR A;  4JRA A;  4KWJ A;  4UWD A;  2YG0 A;  3ZN6 B;  1ALY A;  2RJ2 A;  2Z2S B;  1HXS 1;  1OKQ A;  5J1X A;  2Y34 A;  4O9G A;  1ND3 C;  5APA A;  1W0P A;  2A71 A;  1FMD 1;  2NLR A;  1QJX 1;  4CCM A;  4HL0 A;  4CU8 A;  1EUU A;  2CHH A;  3WF3 A;  1E5R A;  2VOX A;  4OZO A;  3JQX A;  1GP4 A;  5JOY A;  1GZW B;  2BNM A;  2ZGS A;  1M4W A;  1F31 A;  2VE1 A;  3SXW A;  2J7M A;  2ZAH A;  1C8M 1;  1OQE A;  3T09 A;  3BIW E;  2I2S A;  1RUD 2;  4YW6 A;  2WO3 A;  4JGY A;  4XIO A;  3VUO A;  2DTW A;  2XQX A;  5CKM A;  2FDK A;  3HT2 A;  2X05 A;  1YFX A;  3GCX A;  4YVS A;  2W46 A;  5C7G A;  4B1M A;  2RMU 3;  3NJZ A;  2CDO A;  3LA7 A;  5FZM A;  4FT8 A;  3ZSM A;  4L11 A;  4QGL A;  4RD7 A;  3FUO A;  5KXE A;  2C4X A;  2VZS A;  3RZK A;  1LAJ A;  2D97 A;  1YWK A;  2WQ4 A;  1K12 A;  2P37 A;  4RGA A;  3TN9 2;  1J83 A;  2DWR A;  1OA3 A;  1KDM A;  1RC6 A;  1YJL A;  2XVL A;  1ZZ8 A;  2W1S A;  2BW8 A;  2J22 A;  3ZFF A;  2HWF 1;  2VCA A;  3OGR A;  4D7Y A;  4OUL A;  3IAP A;  4XXA A;  1RUE 2;  3NNF A;  4QXB A;  3CZJ A;  5FZ6 A;  1SLT A;  2VZV A;  5DUX A;  2W08 A;  4F3J A;  1NCQ B;  2RS3 2;  4ZZ8 A;  1FV2 A;  1ZZC A;  4UFJ A;  2BGP A;  1T6B X;  1RUE 3;  4FPO B;  5I0T A;  5CEH A;  2E33 A;  2R07 3;  5CB7 A;  2XHN A;  1GQH A;  3PVO A;  2BJS A;  3E1F 1;  3H1M A;  4XUT A;  3WG3 A;  3PMS A;  3ZIX A;  1EAH 2;  3M3Q A;  4J1W A;  2DCZ A;  1LHN A;  1QDC A;  1CON A;  3AXD A;  3U75 A;  5G05 L;  2HWB 2;  3ZXF A;  1NQJ A;  1AR7 2;  5FZC A;  2BTV C;  3OPW A;  5IVV A;  4IER A;  4GWN A;  4ZU7 A;  1PIV 3;  2D6P A;  2UYA A;  4AL9 A;  1QF3 A;  3HN3 A;  1Z7S 2;  4MH0 E;  4AI2 A;  2GNM A;  3GCW A;  4AR2 A;  2Y6L A;  4R9D A;  1OLM A;  2ZKN A;  5HV0 A;  1YFY A;  2ZTN A;  4GWI A;  4JVA A;  4UXA A;  3SMH A;  1UAI A;  3W5M A;  1XOY A;  4CDQ B;  1N1T A;  2J1U A;  3ZXD A;  1A3K A;  4AHY A;  4FSJ A;  4UW4 A;  5BUV A;  1R09 1;  4MGY E;  1LB2 A;  4G9S B;  1PIV 1;  4E4Z A;  1PK6 A;  1F4A A;  1YLL A;  2ZGM A;  3MV0 1;  4BQ2 A;  3PNA A;  4ZXE A;  3CBN A;  5A6Y A;  2B45 X;  4QX8 A;  1BVV A;  3AP9 A;  4PLO A;  1HRI 1;  3HMY A;  3UJQ A;  4AI9 A;  2ARA A;  2YGM A;  1VRH 3;  1MZF A;  1YFW A;  3ZFE C;  1OI6 A;  5JLV A;  5CAD A;  3T2Q A;  1WW6 A;  3UGG A;  1O5U A;  3K46 A;  2I07 B;  1QXR A;  1AL0 G;  2GZW A;  2B9U A;  3O7O A;  3Q8A A;  1NZC A;  1UU4 A;  2E26 A;  3WNO A;  2IWG B;  2VR4 A;  2GNB A;  4QDR A;  2XLG A;  4ASM B;  2VY0 A;  5C4W B;  2UUR A;  2Q1M A;  4BM8 A;  5GLZ A;  1S0B A;  1EPZ A;  3SQO A;  5F1R A;  5D21 A;  3GAL A;  1H4G A;  1XND A;  3IMM A;  4WVW A;  3M1H A;  5CVR A;  3ETP A;  3NV1 A;  3TNP B;  3KD4 A;  4NMI A;  2FZ2 A;  4XIL A;  3ZYB A;  4MAD A;  4QXH A;  4GB3 1;  5JVV A;  1MZE A;  4N43 C;  4QX2 A;  1LHU A;  5EQU A;  2GME A;  3ZFE A;  4DFS A;  2UWB A;  3EXU A;  4BXS V;  4G4F A;  3MYX A;  2X09 A;  4YZ4 A;  1LHO A;  4NUB A;  4DS0 A;  3RMY A;  5CFD C;  1RJ7 A;  2R30 A;  2MEV 1;  3ILR A;  4P5H A;  5FMB A;  3SCG A;  4GMP 0;  4M0H A;  4RS5 B;  1BMV 2;  4PI0 A;  2R06 1;  3DEC A;  5LZ6 A;  1AJK A;  4WM8 B;  2GH8 A;  3RZH A;  3ZXE A;  3V0B B;  4N43 B;  1FV3 A;  2OYZ A;  4Q4W 1;  3BN6 A;  4Z8B A;  2XJQ A;  4UFK A;  4NII A;  3JU9 A;  2R07 2;  4CEY B;  1US3 A;  1D4M 1;  1O7F A;  3T0B A;  3I54 A;  3V0A A;  3Q8B A;  4W65 A;  3NAP B;  1H2L A;  3SCF A;  3LFI A;  3FHA A;  3LIG A;  2TUN A;  4KGG A;  5FBZ A;  2E7T A;  5A7O A;  2OUJ A;  2CAU A;  3ZDV A;  4P9J A;  5FY5 A;  2ZX1 A;  2OII A;  5FY0 A;  2UWA A;  5KHH A;  1Z78 A;  1LGB A;  3BOW A;  4IEQ A;  3B9C A;  2OA2 A;  3IWZ A;  1POQ A;  1HN1 A;  2XB6 C;  2QBX A;  5JSP A;  2VZQ A;  4LHL A;  1KEX A;  5FMO L;  2WWS A;  4IEV A;  1BBT 1;  1KS4 A;  5A7N A;  4YM3 A;  3ZSE A;  3OD0 A;  4XET A;  2C26 A;  3FHI B;  1U0A A;  3KLS A;  3WV6 A;  3HIF A;  4LT5 A;  1H2M A;  1OBN A;  2Y38 A;  1QQP 2;  3AYD A;  4QKN A;  2WT2 A;  4QX1 A;  3T2P A;  2WBK A;  1BVP 1;  4LA3 A;  5T3N A;  2JG9 B;  2Y6F A;  1DIW A;  5LBB A;  2HWC 1;  5GKA C;  1Q5O A;  4Q4Y 3;  1H2N A;  1O3Q A;  2QZ3 A;  2V4A A;  5FP7 A;  1PM4 A;  1OUX A;  2JKB A;  4Y26 A;  3H8X A;  1QQP 3;  2WNU B;  2C9A A;  2FD8 A;  1H30 A;  3A23 A;  2H0V A;  3I2G A;  4KWL A;  4HVO A;  1LGN A;  3RGB A;  1PVC 3;  2W47 A;  3AMM A;  4E2S A;  1KDK A;  5FKB A;  2ZOE B;  1NA1 C;  1WGP A;  1LOF A;  1LOG A;  1CX1 A;  4BDV B;  5JDB A;  3IAQ A;  4BA6 A;  2OKX A;  1MS8 A;  2DBI A;  1GZT A;  4YZ3 A;  3ZX7 A;  2IFR A;  1TZO A;  3NW4 A;  4KNC A;  4YSF A;  3CJI C;  4LO8 A;  3IN9 A;  3J7M A;  4YW3 A;  1LHV A;  3G6J B;  1ULG A;  1VR3 A;  2K2S A;  3K4D A;  5IYY A;  1ZNP A;  1VBB 1;  5E1R A;  1SFP A;  3POG A;  2R49 A;  3Q8F A;  1GAN A;  2QE3 A;  2QZ2 A;  2W68 A;  3U07 A;  4DRV A;  4LOR A;  3VD7 A;  4K8F A;  2YBS A;  3PIG A;  4OHV A;  3AMQ A;  3ASI A;  1VAM A;  5T5J A;  5FZH A;  1GNZ A;  5HBA A;  2VAU A;  4YGB A;  4LBO A;  5JCT A;  1X36 A;  3CHX A;  2A7A A;  3U14 A;  4NIH A;  4GH4 A;  2BGC A;  2HBT A;  4EN6 B;  2K0G A;  3AYC A;  5FXW A;  3RI9 A;  4A3Z A;  5C71 A;  3TEW A;  3O5S A;  3WZ1 A;  3OY8 B;  2VU9 A;  4BPZ A;  1EPW A;  1JU4 A;  3VBO C;  1LRH A;  1GBG A;  4Z1V A;  2EF6 A;  3P1I A;  1RUI 3;  4PQ9 A;  1NOV A;  1JHN A;  2VZ3 A;  2ZPX A;  3OJB A;  3MBW A;  4GIQ A;  3NRU A;  1R1Z A;  2ZX4 A;  2R0H A;  1L7Q A;  2BVV A;  4XFI A;  2CV6 A;  2LUW A;  5FPL A;  4COW A;  3S57 A;  2VTX J;  1XB9 A;  4LUK A;  3AB0 A;  1POV 0;  2CNA A;  1N3Q A;  4R9C A;  1A8M A;  5EJ3 A;  5FK7 A;  3ZFF C;  3UL2 A;  3B01 A;  3S6P A;  5D8A B;  2VZP A;  4H3W A;  1BZW A;  3QH7 A;  5FPZ A;  4ZU4 A;  3WT3 A;  4B3N A;  2R04 2;  4BQ4 A;  2CWM A;  1LNS A;  1SBD A;  4Q5O A;  4P9X A;  4GMP 3;  1LTE A;  4TN7 A;  2YFU A;  4YG3 A;  2EVX A;  2RS5 3;  3USU B;  3V64 A;  4RL7 A;  1ZZ9 A;  1OMI A;  2GP3 A;  5C3O A;  1R09 3;  4I30 A;  5FZI A;  2D7F A;  3MF6 A;  3QD6 A;  1IPS A;  5CFD B;  1RUF 2;  3MV1 1;  1CAW B;  5FXX A;  4A6O A;  4HK8 A;  1IQD C;  4QPY A;  2SBA A;  2V72 A;  4IW3 A;  4JGY C;  4JQR A;  3W5N A;  1DQ1 A;  2JDZ A;  2Y33 A;  4FPC A;  1JOB A;  4XFH A;  3VDD C;  2JG8 B;  4BIF A;  4YVS C;  1SQ4 A;  2Q8O A;  4GJZ A;  1FX5 A;  3UK9 A;  4CDU A;  1WW5 A;  3KV4 A;  4NRM A;  4UYB A;  5FOJ B;  1S2K A;  5FWE A;  1VMJ A;  4Q8L A;  3PLQ A;  1RUH 3;  5JMC A;  1FNZ A;  1C1L A;  4YM2 A;  5FIX A;  2P2K A;  3AP5 A;  5FOB B;  4OI2 A;  3N9O A;  3VZO A;  4FOW A;  1LOF C;  1OD5 A;  3LDB A;  3W20 A;  4CCL A;  1Q8V A;  2FHR A;  5AFE A;  1RUH 2;  4R9A A;  1BKZ A;  1C3H A;  1HN0 A;  5GZC A;  3KB5 A;  1XE7 A;  4XUQ A;  2QQL A;  1CGP A;  1FOD 1;  1BEV 3;  2GDF A;  2AC1 A;  3BPZ A;  4C0B A;  3BI3 A;  2E32 A;  5CFC C;  1IS5 A;  1ENS A;  1CWP A;  3BB6 A;  2R6Q A;  3AFK A;  5AFB A;  5C70 A;  5F9T A;  3SKV A;  1QH7 A;  3RVH A;  1FPN 2;  5F5C A;  2RS3 3;  4CUB A;  3MO4 A;  4N8M A;  4XDO A;  1VP6 A;  2BNN A;  1VIW B;  4AZZ A;  1G9C A;  2E63 A;  5E89 A;  1ZBA 2;  2RJK A;  5HCH A;  4MHR A;  3I7D A;  2P3K A;  2ZMK A;  1K5M A;  5F6K A;  5A3T A;  3SLI A;  3EO6 A;  3EYP A;  4OUE A;  3E5Q A;  3AKQ A;  1RXF A;  3LSD A;  4BU2 A;  1G7Y A;  1XNA A;  4E2G A;  3K4A A;  5E8A A;  2NZ9 A;  3N4M A;  5HCB A;  4Z92 B;  3DPR C;  1PHM A;  3MID A;  1XQN A;  1LOE A;  2QQK A;  2VCM A;  4AQT A;  3ATG A;  4CCK A;  2YBK A;  2VOV A;  3BOP A;  1RMU 1;  2W2I A;  3HQU A;  2OPW A;  2Z4F A;  3Q8C A;  3HBZ A;  4IL7 A;  3RQ0 A;  3K3O A;  4FFH A;  3WNL A;  3FX3 A;  1OH4 A;  3KQ4 B;  2VC9 A;  2WNO A;  1ZVF A;  4EWD A;  1PM7 A;  4WM8 A;  4BK4 A;  3LE0 A;  4CVU A;  2HWF 3;  2RV9 A;  4XJW A;  5FZL A;  4WVM B;  3P3P A;  1AF9 A;  3BYW A;  2WNV B;  2YYO A;  3WY6 A;  5DPN A;  1XC6 A;  5DUV A;  4LE4 A;  2XJR A;  3B02 A;  3I2F A;  2OW4 A;  2ZS6 B;  1AYN 3;  2VZ1 A;  1AR7 3;  2V09 A;  3HVD A;  3FLR A;  4PT6 A;  3RZM A;  4OMC A;  4AGG A;  4RSU A;  1AR8 3;  1IKP A;  3WEZ A;  3I2O A;  3AKP A;  1E5I A;  2J1T A;  5GLV A;  4LNV A;  4FOV A;  4YGD A;  3N7M A;  3AP7 A;  2J1A A;  4D94 A;  4S2D A;  3D4K A;  4CCO A;  1DDL A;  1SLC A;  2E7Q A;  3DXU A;  4GB3 2;  3THD A;  1UU5 A;  2W94 A;  3WF4 A;  4IGO A;  3RDI A;  1NY7 2;  4KH9 A;  4BQ5 A;  1IPK A;  2VPV A;  2YC0 A;  3FHQ A;  4UFH A;  1H9W A;  2J1V A;  5C4W A;  3SEE A;  2Y8K A;  3KT7 A;  5J37 A;  1LU1 A;  4ZPI A;  4DNY A;  2ZGN A;  1HB1 A;  4N7I A;  4LO6 B;  3WX5 A;  1UYZ A;  2R16 A;  4MOA A;  1JZ4 A;  5FKC A;  1DQ0 A;  4UF0 A;  3GNE A;  4LO5 B;  3VDB A;  4DO0 A;  3NMB A;  1RJ8 A;  5CFD A;  1O5L A;  2NQY A;  2PQQ A;  2UY8 A;  2A3W A;  2YY1 A;  5DAV A;  2JEC A;  4ZS2 A;  1ND2 B;  1JBC A;  1MS1 A;  4HN0 A;  4FPE A;  2JB8 A;  3EJK A;  3FC0 A;  3USU A;  3BTY A;  5FXV A;  4E2Q A;  3ZIW A;  5FPB A;  2IXJ A;  1X33 A;  4GXL A;  3CL1 A;  3NL1 A;  2VVD A;  3HEI A;  3M4F A;  4I3P A;  5FZ0 A;  3S5A A;  3DYM A;  5T5O A;  2WAB A;  3AZY A;  2XWJ B;  5EZW A;  3ZFG B;  1O4Y A;  4I2O A;  2NM1 A;  3ZMN A;  2WYF A;  4GQ7 A;  1R1A 2;  4CEY A;  2KR2 A;  2GNT A;  3FJS A;  3O0W A;  4GB3 3;  4NIG A;  2ZBJ A;  1AX0 A;  2ZGO A;  4BIO A;  4FPK A;  1SFY A;  1MQT B;  5FJH A;  2ZGK A;  5FLI A;  2EAA A;  5ACA 1;  3R0R A;  4YAR A;  5JI7 A;  4KMQ A;  2DV9 A;  4CUG A;  1VBD 2;  2JWP A;  3MDP A;  2VQT A;  1AR9 1;  1RUG 1;  1JU3 A;  3R4D B;  4MLO A;  1DFQ A;  1ZZ7 A;  4LBK A;  5DN2 A;  3ZO0 B;  5C3S A;  1H6Y A;  1ZBE 3;  3IDB B;  3KCX A;  1UKR A;  1UYP A;  3TN9 1;  4XBN A;  3LIH A;  2D40 A;  2H6C A;  4YM0 A;  1OVP A;  4L0P A;  1DYK A;  3LF7 A;  3VBR C;  2WA4 A;  3LZZ A;  1LED A;  1LR5 A;  1KJR A;  2XJU A;  5A3U A;  1CVN A;  3I2D A;  1URX A;  1K5J A;  2XDV A;  3DUI A;  5HXM A;  1REE A;  2RS1 3;  2ETE A;  1OSG A;  3LPG A;  3OSD A;  4HBN A;  4LKE A;  1MVQ A;  4ONU A;  1UOJ A;  3T0D A;  5CA6 A;  1V6L A;  1HQL A;  1YI9 A;  5IAX A;  2GC0 A;  4RS5 A;  5L9B A;  3NAP C;  3P3N A;  2EIG A;  4PBO A;  4QWN A;  5DG1 A;  2X53 S;  3T4H B;  4P5Y A;  3TBD A;  2C1F A;  1AX2 A;  2JE9 A;  2ZX0 A;  2PQS A;  5IAV A;  4BMB A;  4YVS B;  5LWB A;  1BXH A;  4L92 A;  5ABJ C;  4KBZ A;  2G9F A;  3J4U H;  1R64 A;  1C5H A;  2DBN A;  5GZD A;  1V9U 3;  3G7D A;  4LLO A;  4C91 A;  4A45 A;  4KU7 A;  1F8V A;  1AYN 2;  3TRS B;  3AZZ A;  4UFM A;  3UT0 A;  4CDQ A;  5CG9 A;  4RS5 C;  4HG6 B;  2EXJ A;  4AI3 A;  5L7O A;  3N7J A;  3KM5 A;  1E57 A;  4HVQ A;  3OBA A;  4R8H A;  2WFF 2;  3DXT A;  3GDB A;  3SKJ E;  5A7S A;  3WG2 A;  4DY5 A;  1NCQ C;  4YVW B;  2WO7 A;  1JYC A;  4JGZ C;  4IEU A;  1CAU A;  2WLP A;  4JZR A;  5A3N A;  3VZJ A;  3ZKY A;  2JG8 A;  1K5M C;  4NWW A;  1MPX A;  4LUL A;  2EA7 A;  1F35 A;  3POB A;  4BQ1 A;  2Q8C A;  1QHD A;  4FPH A;  4LHN A;  4ARY A;  4ZY9 A;  2VXR A;  4XVH A;  1I6X A;  2BBA A;  4W6W A;  1ACC A;  5FZK A;  5KR7 A;  4OMD A;  1PVC 1;  2I45 A;  2LAL A;  5F5A A;  2DU1 A;  2R06 2;  4HAN A;  2BZD A;  2P3J A;  2WAA A;  1M06 G;  1VAL A;  1CX4 A;  3JZV A;  4Q4X 3;  2HH9 A;  2ADD A;  4QQH A;  4NID A;  4AED B;  2PA7 A;  4FI9 A;  2ZXQ A;  4H7M A;  5A3L A;  4IQP A;  3AMP A;  2VJX A;  4CSW A;  3WP6 A;  4A44 A;  5HXV A;  4GH4 C;  1VBA 1;  4RGK A;  4HSJ A;  3SH3 A;  4DRR A;  4HZF A;  4YFW A;  4HK9 A;  3WOG A;  2O0O A;  1MS4 A;  2IXC A;  4Q4V 3;  2XHK A;  4CXY A;  1CAU B;  4QQL A;  2JEM A;  4AK3 A;  2VTX A;  3VBS C;  3KVA A;  1WCU A;  3DN7 A;  3PJY A;  1W2O A;  3CU7 A;  5DZG A;  4HXC A;  2MEV 3;  3H42 B;  5F3G A;  4D7T A;  3LEM A;  5C9A A;  2QKD A;  3TYJ A;  4XEZ A;  1G6N A;  2DVA A;  2UY9 A;  4LHS A;  3PL0 A;  3MFA A;  2MHF A;  2JDU A;  2Y6G A;  2DUR A;  1WLD A;  5ANQ A;  3UKV A;  1RUE 1;  2GC2 A;  4OI1 A;  1TEI A;  3I2K A;  1XNC A;  2XQR A;  1RED A;  1NXM A;  4V2V A;  5FY1 A;  1MVE A;  5FZ9 A;  1H8T B;  2VW0 A;  3C7G A;  5FLJ A;  5I93 A;  1S0J A;  4H7L A;  4PIZ A;  1AYN 1;  1D4V B;  1PO1 3;  4CXW A;  3HBK A;  1GNY A;  2CL2 A;  2IVI B;  3E5U A;  3E97 A;  4LHK A;  2OZJ A;  1PMH X;  1WKY A;  2ZEY A;  1C5I A;  3VBS A;  2WLQ A;  1ZA4 A;  3ZXL A;  3H1Y A;  4D6R A;  2D6O X;  3NV2 A;  5DDJ 1;  4NAM A;  2BBV A;  1SCR A;  4LBQ D;  2BV4 A;  2HYK A;  1O4Z A;  3ZN6 A;  4AAP A;  2A6Z A;  4K6B A;  1UMH A;  1ZBA 3;  1FXZ A;  1JOD A;  3OUJ A;  4XFG A;  4YGE A;  4AED C;  2FZ1 A;  2ZAC A;  5FZ4 A;  2OQ7 A;  3RI8 A;  3AFG A;  3USS A;  5JI9 A;  5GJ6 A;  1AR6 2;  3VBS B;  3TEZ A;  3T3Y A;  4GAZ A;  1CAV A;  3JUU A;  4HKL A;  4MGQ A;  5IFP A;  2YZ4 A;  3OUI A;  3PUR A;  4DUW A;  1G9F A;  1VJ2 A;  4IES A;  4NO4 A;  3GHN A;  4ISR A;  3WW3 A;  5K9Y A;  3FBM A;  2LRO A;  2PAK A;  4Y20 B;  1ZBA 1;  1ND2 A;  4MZU A;  4IUG A;  4QPI B;  4YFZ A;  1LOC A;  2J1R A;  4CEW C;  2WNU A;  3UGF A;  3WVJ A;  1G9D A;  1J3Q A;  1VRH 1;  5DQ0 A;  3WD5 A;  3OUH A;  3PVE A;  1PIV 2;  4NRP A;  4YYO A;  4RGG A;  3SIS A;  4MHU A;  2ATF A;  3D8C A;  3ZSK A;  1GR3 A;  3BAL A;  3RYR A;  1TG7 A;  4MET A;  3SEP A;  4BOW A;  3N9M A;  5BV6 A;  1QEX A;  1AJO A;  3MZH A;  3ACG A;  4UFL A;  1JUH A;  4Y1U A;  1QJX 3;  1KGY A;  1QXP A;  1UIK A;  2QQO A;  2ZEX A;  4DQA A;  1FNY A;  4RQP B;  1V6I A;  4A3X A;  1JZ6 A;  4D8M A;  2RMU 1;  1IS6 A;  2F4P A;  4A41 A;  1A78 A;  3O1O A;  2JKX A;  1AX1 A;  4DEQ A;  1S0E A;  1Q8P A;  3AZX A;  2VMI A;  1RVF 1;  4CYD A;  1Y9G A;  1H1I A;  1UPS A;  3M3C A;  1QKQ A;  2RVA A;  4Q4W 3;  2XON A;  3N3H A;  3WCS A;  4XBQ A;  2Q8E A;  1SLI A;  3QCW A;  5FR3 A;  4B7K A;  2YUE A;  3RJR A;  1IGO A;  5T54 A;  3K3N A;  5F2S A;  5FZD A;  4XUO A;  1GZC A;  2XG3 A;  5CIR A;  5FY9 A;  1US2 A;  3DKW A;  3ETQ A;  3LQC A;  4CDQ C;  5E16 A;  3MUY 1;  2OVU A;  2R04 3;  5LBE A;  3LDR A;  1FAT A;  3K4Z A;  3ZDS A;  2AEZ A;  4BQX A;  4AEJ A;  3MF9 A;  3BOD A;  3UKN A;  3WP4 A;  4IEZ A;  1S0G A;  4Y22 B;  4TZD A;  2ZCW A;  1FAY A;  5FRE A;  1PGW 1;  2YC2 A;  4YW5 A;  1O6U A;  1SHW B;  1HXS 2;  4EV0 A;  4JKM A;  3JD7 1;  1DGW A;  4FP3 A;  3OGS A;  2C9K A;  5GLT A;  3NST A;  1AR6 1;  4CXX A;  4AHX A;  1GFF 2;  1X82 A;  2IC1 A;  4E4H A;  4OHZ A;  4Q0V A;  2BDR A;  1AXK A;  2EXK A;  4LPL A;  2VMC A;  2TNF A;  2B5H A;  3RS6 A;  2FDG A;  5GZF A;  1C8M 3;  2Z79 A;  4EQV A;  5TSW A;  3A0K A;  3W58 A;  3JXS A;  1AR9 3;  1RUG 3;  5C5T A;  5JXH A;  1AL2 3;  1FPN 1;  1UQX A;  1HRV 3;  2VNV A;  1HB2 A;  4U36 A;  1POV 1;  4QB2 A;  2EIC A;  3FLT A;  4HMZ A;  3VBU A;  3OY8 A;  3I59 A;  4SBV A;  3ZFF B;  5C5U A;  5CKN A;  1W6O A;  4KGQ A;  1QGL A;  5JR7 B;  1OD3 A;  5BNP B;  3HNM A;  2HWC 3;  3L2Y A;  4AVT A;  2B46 X;  1BEV 1;  1CZT A;  3KQR A;  3BU0 A;  1RUO A;  1RXG A;  4OQ9 A;  1QJY 2;  1WCQ A;  1X50 A;  3ACL A;  4GJY A;  4WVZ A;  2IXH A;  3UNP A;  1W06 A;  4FTS A;  1GZ9 A;  3AL5 A;  2JDN A;  3X29 B;  2PHT A;  2QFE A;  5L9V A;  5AVA A;  4AFC A;  3OBR A;  4JV4 A;  5IVJ A;  4XE9 A;  2HWC 2;  4J25 A;  1NE4 A;  4P00 B;  1UZZ A;  2WDB A;  3GM8 A;  4MVT A;  3GHM A;  4YRD A;  5F3E A;  2OX0 A;  1C57 A;  2WZP P;  4BQY A;  3BIE A;  1AXY A;  1VMF A;  2YXS A;  2W1U A;  5JXI A;  2FDI A;  3OEB A;  3BCW A;  4JGY B;  4Z07 A;  2G9Z A;  2G4I A;  2ZX2 A;  1PVC 2;  4QX7 A;  4TSV A;  4XUR A;  5T5L A;  1DLL A;  4CP2 A;  3N9L A;  2YB7 A;  4K1Y A;  3J26 N;  5BNQ A;  2WNV A;  3UGH A;  3NO8 A;  5A6X A;  3S30 A;  3MFC A;  4KG8 A;  3PUI A;  1BYH A;  3VBO A;  5J09 A;  5GAL A;  1H8T C;  1JUI A;  3EMR A;  2XPJ A;  2R0F A;  4AQ6 A;  3LKJ A;  2DUP A;  1UX7 A;  1W9Y A;  1SBE A;  2WZ8 A;  4IEX A;  4XF1 A;  4XZP A;  4CDX B;  4COU A;  4DXZ A;  1U5I A;  3A22 A;  1LUL A;  3POY A;  4H55 A;  2ZAB A;  1DYO A;  4DXT A;  5LA1 A;  4Y24 A;  5L9R A;  2FQP A;  3LB9 A;  2HWF 2;  4OVE A;  3VV1 A;  2WWJ A;  3KV9 A;  3IBM A;  3J7L A;  5ISL A;  3P5B A;  3MW2 A;  3VBR A;  1PZ7 A;  4KQ7 A;  3C7O A;  1AYM 3;  3LD8 A;  2FDJ A;  4LEJ A;  3MW3 A;  5DAQ A;  2PN5 A;  5F7U A;  4PLN A;  1ZBE 1;  2C6S A;  2HLE A; 
#chains in the Genus database with same CATH homology
 1LNS A;  3AC0 A;  2YFU A;  2VMD A;  1OF3 A;  3OG2 A;  3ACH A;  4MGS A;  4XUP A;  3VD9 A;  3BGA A;  4LKS A;  4CUA A;  4ZZ5 A;  2VZO A;  2Y6H A;  3MV1 1;  2V4V A;  2JD9 A;  4A6O A;  2VMF A;  1IQD C;  4KWU A;  2V72 A;  3C8X A;  3W5N A;  2QQN A;  3T0A A;  2ZEW A;  1L7R A;  1UZ0 A;  1SG3 A;  4XZU G;  3VD3 A;  3NQH A;  5G04 L;  2L9L A;  2VQU A;  1JHJ A;  1UY4 A;  4RN5 A;  4QB1 A;  1NZI A;  4AAX A;  5CYY A;  1OF4 A;  3IB3 A;  1JZ2 A;  1JZ3 A;  4XUQ A;  2QQL A;  1DLC A;  1UY2 A;  4DUX A;  4UAP A;  2E32 A;  1YQ2 A;  2W1W A;  3NJV A;  5IHR A;  1GOH A;  3I2I A;  5C70 A;  3SKV A;  1ULO A;  3POI A;  2WN2 A;  1NKG A;  2Y6K A;  1UMI A;  4CUB A;  2HLE A;  3MO4 A;  3HJR A;  3WNK A;  2VCC A;  3A21 A;  3VD4 A;  3WSO A;  2DDU A;  3EYP A;  4OUE A;  3T08 A;  5EIY B;  1TVG A;  2B9V A;  5JXG A;  1JI6 A;  1XNA A;  3K4A A;  4JX0 A;  2QQK A;  4P08 A;  3WNN A;  5FUI A;  2Z4F A;  5EJ1 B;  3K75 B;  3C7E A;  3WNL A;  3HOB A;  1OH4 A;  3I2H A;  2VC9 A;  3UET A;  2WNO A;  3KQ4 B;  4BK4 A;  5B4N A;  3LE0 A;  4CVU A;  2RV9 A;  1I5P A;  2EID A;  3I3B A;  4GZ9 A;  5LCW L;  4UI9 L;  1XC6 A;  5DPN A;  3DEM A;  2Y64 A;  3I2F A;  1K42 A;  1CZV A;  2ID4 A;  2VZ1 A;  4PT6 A;  4OMC A;  3WEZ A;  3POF A;  3UES A;  4A4A A;  2J1T A;  1PX3 A;  1ULP A;  1GU3 A;  2WN3 A;  3LEG A;  2E31 A;  2VZR A;  1D7P M;  2JE8 A;  2J1A A;  1SPP A;  2CDP A;  3LPF A;  3WF4 A;  2W94 A;  4TTG A;  3III A;  1UWW A;  3FHQ A;  5IJR A;  2J1V A;  1H6X A;  3SEE A;  4D0Q A;  2Y8K A;  4CU9 A;  5DMY A;  4PF1 A;  3CMG A;  3CKH A;  1UYZ A;  4MOA A;  1JZ4 A;  3VDB A;  5IFT A;  3FN9 A;  2W92 A;  2XOM A;  4ARX A;  4XUN A;  5EJZ B;  1SDD B;  4QX0 A;  1W9S A;  2VL4 A;  1JYN A;  3CDZ B;  3HEI A;  3CIH A;  5I0D A;  3F2Z A;  2VZU A;  3DYM A;  4CU6 A;  2WAB A;  2HYX A;  4CUC A;  3WNM A;  3WF0 A;  1JYW A;  1UY0 A;  2QQJ A;  1RYY A;  2QQI A;  4YPJ A;  1UYY A;  2EIE A;  1CZS A;  3WF2 A;  1J84 A;  4KMQ A;  5HPO A;  1W99 A;  2VQT A;  3CZU A;  1JU3 A;  1UY3 A;  4LOS A;  2J1S A;  2LW8 A;  2YFZ A;  3K77 A;  5DN2 A;  1CIY A;  1GUI A;  1H6Y A;  3GXU A;  3NNG A;  5CIS A;  1K3I A;  3I3E A;  2Y6J A;  3U37 A;  4L0P A;  1GQP A;  1NT0 A;  4M4R A;  4QX3 A;  4M4P A;  4JKK A;  5HXM A;  3LPG A;  3T2O A;  1UYX A;  2LS6 A;  4Z2A A;  3T0D A;  1JZ8 A;  1P8J A;  3A7Q A;  1T2X A;  2YG0 A;  2RJ2 A;  3OGV A;  5J1X A;  4P5Y A;  2PQS A;  3ABZ A;  1EUU A;  4CU8 A;  3WF3 A;  4OZO A;  3LEK A;  1R64 A;  2ORZ A;  4E8C A;  4A45 A;  2W9X A;  2J7M A;  3C7F A;  3EB7 A;  4TXW A;  3T09 A;  4HG6 B;  1O59 A;  1JYX A;  2WO3 A;  3OBA A;  3HNB M;  3GDB A;  3SKJ E;  2XQX A;  5CKM A;  2X05 A;  2W46 A;  5C7G A;  3WNP A;  3MUZ 1;  2CDO A;  1MPX A;  4QDQ A;  2VME A;  2C4X A;  1O8S A;  2VZS A;  3POB A;  4LMF A;  1UXZ A;  4AG4 A;  2W95 A;  4ARY A;  1NUK A;  4ZY9 A;  2W3J A;  3C7H A;  2BBA A;  1K12 A;  4XVH A;  1JYV A;  3P6B A;  1J83 A;  4OMD A;  2BZD A;  2VM9 A;  2W1S A;  2WAA A;  2J22 A;  2VCA A;  1F4H A;  3OGR A;  3IAP A;  4FI9 A;  2ZXQ A;  3CZJ A;  2VZV A;  4ET7 A;  2VJX A;  4A44 A;  2DCJ A;  4ZZ8 A;  2BGP A;  4A42 A;  2E33 A;  2XHN A;  3E1F 1;  3WF1 A;  4DXS A;  2V5D A;  4XUT A;  5A1A A;  5G05 L;  1SPP B;  2VTF A;  4LHS A;  3HN3 A;  1DP0 A;  2Y6G A;  1O8P A;  2Y6L A;  4JKL A;  4GWI A;  3I2K A;  2WYS A;  3W5M A;  2J1U A;  5LA0 A;  3C7G A;  3VDA A;  2W91 A;  2ZEZ A;  1F4A A;  1GNY A;  3MV0 1;  2WAO A;  4ZXE A;  2ZEY A;  1PMH X;  1WKY A;  1JZ5 A;  4RYD A;  5JMO A;  2EIB A;  1SZB A;  5JUV A;  2VZT A;  4BK5 A;  1UMH A;  2DCK A;  3K46 A;  2E26 A;  3WNO A;  4QDR A;  2VR4 A;  3J7H A;  4MGQ A;  3I3D A;  5IFP A;  4DUW A;  3I2J A;  3OEA A;  4IUG A;  3VDC A;  3ETP A;  4QPW A;  2J1R A;  4MAD A;  3D3A A;  5DQ0 A;  4QAW A;  3DYP A;  4QX2 A;  4BXS V;  2X09 A;  1TG7 A;  3SEP A;  4LOT A;  1UY1 A;  1W8O A;  3ACG A;  1PMJ X;  1KGY A;  1BHG A;  4W4Z A;  2QQO A;  2ZEX A;  3DEC A;  2BER A;  4W50 A;  3CQO A;  3POJ A;  1JZ6 A;  4D8M A;  3BN6 A;  1W0N A;  2ORX A;  5JR2 A;  4A41 A;  2VCB A;  1US3 A;  2JKX A;  4DEQ A;  3T0B A;  1OT5 A;  4OYU A;  2R7E B;  2RVA A;  2XON A;  3FHA A;  2WZE A;  3ECQ A;  3ACI A;  3WQB A;  1GOG A;  4XUO A;  5CKQ A;  1NAE A;  4CU7 A;  3THC A;  3LEI A;  1US2 A;  3LQC A;  3PUH A;  5LA2 A;  3MUY 1;  3GGL A;  3K4Z A;  2YC4 A;  1HN1 A;  4DXR A;  2QBX A;  2VZQ A;  1KEX A;  4GWJ A;  4QB6 A;  2C26 A;  4DUV A;  4JHZ A;  4KI5 M;  2YC2 A;  2J1E A;  1SHW B;  4JKM A;  4QX1 A;  1GOF A;  3OGS A;  2C9K A;  2WBK A;  3T2P A;  5JXJ A;  4LPL A;  2VOT A;  2X10 A;  2VMC A;  3ACF A;  2KD7 A;  4MO3 M;  2WUH A;  4W8J A;  1GMM A;  2BGO A;  1W8N A;  3A23 A;  3I2G A;  3JXS A;  5JXH A;  4QB2 A;  2EIC A;  2W47 A;  3POE A;  1W9W A;  1PX4 A;  2WO1 A;  5CKN A;  1W9T A;  2QQM A;  1OD3 A;  2B4K A;  2VO5 A;  1CX1 A;  4BDV B;  3HNM A;  3IAQ A;  2OKX A;  1CZT A;  2JDA A;  4P02 B;  3ZM8 A;  3FL7 A;  1WCQ A;  3UNP A;  3K4D A;  5IYY A;  4QDS A;  3HPN A;  1UXX X;  1SFP A;  4P00 B;  3POG A;  3T2Q A;  2WDB A;  3GM8 A;  3HNY M;  5CZK A;  3DYO A;  4LOR A;  3VD7 A;  5JXI A;  2W1U A;  3OEB A;  4XUR A;  2YB7 A;  1XPW A;  3PUI A;  3IDA A;  5C71 A;  4A3Z A;  4LQR A;  3I97 A;  3NJX A;  3OB8 A;  4UOJ A;  2W1Q A;  1UX7 A;  2WZ8 A;  3A22 A;  1JU4 A;  4DXT A;  1DYO A;  5LA1 A;  3P1I A;  1K45 A;  4E8D A;  1NX9 A;  1XNT A;  2VZ3 A;  2W5F A;  3MBW A;  3VD5 A;  3NRU A;  2WQ8 A;  2W87 A;  1L7Q A;  1EUT A;  4DEV A;  3C7O A;  4PQQ A;  4BJ0 A;  2VZP A;  5F7U A;  3THD A;  1JZ7 A;  5B4X A;  2WO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...