2QQLA

Neuropilin-2 a1a2b1b2 domains in complex with a semaphorin-blocking fab
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
576
structure length
554
Chain Sequence
PPCGGRLNSKDAGYITSPGYPQDYPSHQNCEWIVYAPEPNQKIVLNFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKHCGNIAPPTIISSGSMLYIKFTSDYARQGAGFSLRYEIFKTGSEDCSKNFTSPNGTIESPGFPEKYPHNLDCTFTILAKPKMEIILQFLIFDLCKYDWLDIWDGIPHVGPLIGKYCGTKTPSELRSSTGILSLTFHTDMAVAKDGFSARYYLVHQEPLENFQCNVPLGMESGRIANEQISASSTYSDGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLTAIATQGAISRETQNGYYVKSYKLEVSTNGEDWMVYRHGKNHKVFQANNDATEVVLNKLHAPLLTRFVRIRPQTWHSGIALRLELFGCRVTDAPCSNMLGMLSGLIADSQISASSTQEYLWSPSAARLVSSRSGWFPRIPQAQPGEEWLQVDLGTPKTVKGVIIQGARGARAFVRKFKVSYSLNGKDWEYIQDPRTQQPKLFEGNMHYDTPDIRRFDPIPAQYVRVYPERWSPAGIGMRLEVLGCDWTHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Neuropilin-2
publication title Structural studies of neuropilin/antibody complexes provide insights into semaphorin and VEGF binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 126
structure length 554
sequence length 576
ec nomenclature
pdb deposition date 2007-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00431 CUB CUB domain
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2qqlA03
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2qqlA04
2.60.120.290 Mainly Beta Sandwich Jelly Rolls Spermadhesin, CUB domain 2qqlA02
2.60.120.290 Mainly Beta Sandwich Jelly Rolls Spermadhesin, CUB domain 2qqlA01
2ZEZA 3LPGA 2VZOA 2ZXQA 2WZ8A 5FUIA 3DEMA 4LOTA 1JU3A 3NQHA 3MV11 5LCWL 1UZ0A 4PT6A 2E33A 3A7QA 2KD7A 1O8PA 5EJ1B 2VO5A 1SPPB 2Y6JA 3K75B 2VZUA 3OG2A 3C8XA 3IAPA 1JHJA 3W5NA 4P08A 3FHQA 4LKSA 5CKMA 3T2QA 1D7PM 3CZJA 4A45A 3VD4A 2QQIA 3MBWA 3CIHA 2WZEA 3UNPA 2VZSA 1GOFA 3I3DA 4KMQA 1SFPA 2WUHA 2BGPA 2XQXA 2WN3A 2C26A 1TG7A 4CU6A 5DMYA 2WDBA 1RYYA 3VD5A 4TXWA 2J1UA 3UETA 1OF3A 4XZUG 5HPOA 2Y64A 3I2JA 4A41A 2QQJA 3POIA 4BJ0A 4MOAA 5HXMA 4E8CA 4W50A 1UWWA 2J1VA 3EB7A 4PF1A 2LW8A 4A6OA 5JXIA 1DP0A 2ZEYA 3PUHA 2J1SA 4MADA 4OUEA 5C70A 1PMHX 2VM9A 2W1UA 3I2IA 3VD9A 1NZIA 2Z4FA 4ZZ8A 1GQPA 1LNSA 1SZBA 4XUNA 3WNMA 3POEA 2W9XA 3MUZ1 4W4ZA 3DECA 1O8SA 3I2FA 4BXSV 3WF2A 4TTGA 3WNLA 1UMHA 1UYZA 1NX9A 3T09A 5CKQA 4RYDA 2RV9A 3AC0A 5G04L 1F4AA 3HEIA 2VQUA 4DUXA 3IB3A 1DLCA 4PQQA 2ORZA 3T0BA 1JZ2A 3OGVA 2W1QA 3I3EA 5IFPA 5A1AA 5LA0A 1NKGA 3VDCA 3VD3A 2OKXA 3THCA 3T2PA 5I0DA 1EUTA 2J1TA 2HYXA 4DUVA 2J1AA 3SEPA 5JXHA 3POFA 1PX4A 2Y6KA 1TVGA 1GNYA 3LQCA 1W0NA 2RVAA 2VZVA 3I97A 4D0QA 1W8OA 4P02B 4KWUA 3HJRA 4BK4A 2VTFA 2VMEA 2X05A 1W8NA 2L9LA 3P1IA 3FL7A 4ET7A 2CDPA 3BN6A 4QX0A 4QPWA 3NJVA 3CKHA 1L7RA 1NUKA 2E26A 3T08A 2VR4A 3WSOA 2V5DA 1XC6A 5LA2A 3SKJE 3F2ZA 3D3AA 3OB8A 1UYYA 2QBXA 3HPNA 3HNYM 4DXRA 1W9TA 1WKYA 3DYPA 3C7GA 2W5FA 2BBAA 2X09A 3SKVA 1ULPA 4OYUA 3CMGA 2WAOA 5F7UA 5CZKA 3WNKA 3ACGA 5EIYB 5C71A 2YC4A 2VZ3A 3LEKA 4QAWA 1J83A 3C7HA 1SDDB 2ZEWA 3WNPA 3WNNA 3MV01 3FHAA 2HLEA 1JYXA 2XONA 1K3IA 1R64A 3K4DA 2J22A 5DPNA 4ZZ5A 1F4HA 3ACHA 4JKLA 1GUIA 3T0AA 1KGYA 1CZSA 1BHGA 1JI6A 3C7FA 4L0PA 1US2A 4P5YA 5DN2A 3W5MA 1OF4A 3SEEA 1UY1A 3K46A 2ZEXA 4CUCA 2W1WA 5JXGA 4DXTA 2VMFA 1W99A 2YFUA 2VMCA 4GWJA 3K4AA 4AG4A 2DCJA 1JYVA 2WBKA 3HOBA 1SHWB 1GU3A 4AAXA 3OEBA 1I5PA 3VDBA 2QQLA 2J1RA 4IUGA 2JD9A 3ACFA 4CU7A 2Y8KA 5B4NA 5IYYA 4QX2A 2PQSA 3OBAA 2VOTA 3K77A 3WF1A 1JU4A 3A23A 2Y6HA 2C9KA 1NAEA 2W3JA 3FN9A 2JDAA 4JHZA 2Y6GA 2VZ1A 2JKXA 3POGA 4GWIA 1JZ5A 5DQ0A 3CZUA 3WF4A 5JR2A 3JXSA 4DUWA 3ACIA 4Z2AA 2VCCA 4FI9A 3NNGA 4XUTA 3GXUA 1EUUA 2V4VA 1OH4A 1JZ7A 1JZ6A 3K4ZA 3LPFA 1JZ3A 1JYWA 2Y6LA 1CX1A 1H6YA 4CU8A 1CIYA 1GOHA 3HNMA 1ULOA 2W1SA 1CZTA 2J7MA 2DCKA 3I2KA 2VQTA 1UXXX 1JYNA 4QB6A 2W95A 1US3A 4RN5A 4LORA 1YQ2A 1H6XA 5EJZB 2VZQA 3THDA 2WO2A 3ZM8A 2BZDA 3U37A 2CDOA 1P8JA 1UYXA 3T0DA 4UOJA 3HNBM 4XUQA 3GM8A 1T2XA 1KEXA 1MPXA 4OZOA 2C4XA 2V72A 2WYSA 2WO3A 3DYMA 5IJRA 4M4RA 3POJA 3POBA 1XPWA 3BGAA 3IIIA 4ZY9A 4LMFA 4YPJA 3CDZB 2WN2A 3LEGA 2WO1A 3J7HA 2WNOA 3MO4A 4CU9A 1UY2A 4CUBA 5IHRA 3I2HA 4MGQA 1OD3A 4CVUA 3OGRA 2ORXA 3LEIA 2XOMA 3VD7A 4QDSA 5LA1A 3C7OA 2VZPA 4ARXA 2YC2A 3NJXA 1J84A 5JUVA 3IDAA 3I2GA 4MGSA 3UESA 4ARYA 3PUIA 2BERA 2W92A 4DEVA 2VC9A 3OGSA 3A21A 2LS6A 4GZ9A 4QX3A 4E8DA 2VMDA 1XNAA 2B4KA 1W9SA 3ECQA 4A42A 4DXSA 4CUAA 3KQ4B 2W94A 1UY3A 2W91A 1DYOA 3CQOA 2X10A 2VZRA 3IAQA 4W8JA 4UAPA 4P00B 4XUOA 3T2OA 1NT0A 1UY0A 3MUY1 5J1XA 1GMMA 2XHNA 5C7GA 2J1EA 2EIBA 2QQOA 5JXJA 3OEAA 5CISA 3NRUA 4ZXEA 4LPLA 1CZVA 5CKNA 4QB2A 1PX3A 2WQ8A 3P6BA 1XNTA 3LE0A 1L7QA 3ABZA 4HG6B 3VDAA 4UI9L 5B4XA 3ETPA 1IQDC 1O59A 4LHSA 1GOGA 1W9WA 4JX0A 5IFTA 4XUPA 2VL4A 1UX7A 3C7EA 4A44A 1WCQA 1OT5A 4MO3M 2VCBA 4OMDA 4QDQA 2W47A 4LQRA 4D8MA 2BGOA 3GDBA 1SPPA 1K12A 2E31A 4A3ZA 3WQBA 4OMCA 3WEZA 2VZTA 1JZ4A 2VCAA 4DEQA 1SG3A 2YG0A 2JE8A 4A4AA 2QQKA 4LOSA 4M4PA 3HN3A 3GGLA 2VJXA 1HN1A 1UY4A 3DYOA 3WF3A 4QDRA 2WAAA 4JKMA 1K45A 5G05L 1UMIA 4KI5M 3A22A 2R7EB 3EYPA 2W87A 5JMOA 4XURA 2B9VA 2EIEA 2ID4A 2QQMA 1UXZA 2WABA 2EICA 2EIDA 4BDVB 5CYYA 4BK5A 2RJ2A 1JZ8A 1PMJX 3I3BA 3WF0A 4XVHA 2QQNA 2E32A 2DDUA 2YB7A 4QB1A 3WNOA 4QX1A 2YFZA 4JKKA 1K42A 2W46A 3E1F1
chains in the Genus database with same CATH superfamily
2KXLA 1W9YA 2VZOA 4LOTA 1ZREA 1MEC3 4L92A 5BNPB 4QQOA 2TBVA 1MEC2 2JE7A 3R4SA 2XR4A 1IGOA 2DVDA 5FZ4A 3KHBA 3UGGA 5FP7A 2ADEA 3DV8A 3LFMA 4HBNA 5J09A 4O61A 1APNA 1O8PA 4FVVA 4LITA 4AI0A 1OLQA 2VO5A 1ZRCA 4PDWB 2Y6JA 3AMMA 5DDJ3 3B69A 3MF9A 5DDJ2 1IS4A 5FK8A 1G9DA 1JHJA 5FZMA 3W5NA 4QKBA 3ZLIA 1OLME 2JG9B 2QTWB 3NAPC 3C3VA 4IEOA 4HKOA 4RS5C 4AFCA 3IT8A 1VMFA 2GP5A 3O0WA 3CZJA 1VRH1 3K48A 2XL7A 1GZCA 1OQEA 3CU7A 2WQZC 2GC0A 3VKMA 2P6HA 4YGDA 3ZDSA 4HPKA 1FATA 1S1AA 1PK6B 1QDOA 3OJBA 3PVEA 2BGPA 5FCCA 5GZEA 2Z5WA 3WX5A 4QXKA 5AFEA 4RD7A 4OHWA 5CNAA 4UBGA 3POYA 1QOOA 3KCXA 3CHXA 3WG1A 1AR73 4OULA 4GA9A 4XBLA 4QPYA 4A41A 1AR72 5C3QA 1ND2A 4AVAA 1ZZ8A 3AKQA 1SMVA 3VBOC 3ZXGA 5HV4A 2E7AA 3TNQA 1ZNPA 2JD4A 4UFHA 4GULA 5FXVA 1DP0A 3H3LA 1DIWA 2VTXA 4OI1A 2ZEYA 5C5TA 2ZGSA 3LEMA 3TN93 3EQEA 3TYJA 1W39A 3TN92 1GP5A 1EY2A 1LHOA 3M3CA 3V0BB 4YW5A 5F39A 3WDWA 5LZ6A 4P9XA 3VD9A 4ZZ8A 3MI8A 2GN3A 5C3OA 5CU1A 3IDBB 3Q9OA 1V00A 3CJXA 3D8CA 1Y9MA 2ZCWA 2W9XA 4JQTA 3MUZ1 3RZHA 1N47A 4RGKA 4BQXA 3Q8BA 1O8SA 3J26N 4LO7A 1W8HA 2VMHA 4YGEA 1UU5A 2E51A 4TTGA 4IV3C 4NAMA 2WINB 5CKQA 3H7JA 4SLIA 4RYDA 2RV9A 3AKPA 2F6BA 2YPJA 4FAGA 5IK4A 1TNRA 5G04L 1ZA4A 5TSWA 3VZLA 5DZFA 2ZMLA 3WP6A 1DLCA 1NCRC 4IEZA 4W6XA 3UT0A 4X6QB 5BPXA 3E5QA 1DQ4A 2UY9A 3T0BA 2WT1A 3ZPYA 5FZEA 1CAWB 1JZ2A 3B00A 4S2FA 4CCJA 5EPAA 1W6NA 3U14A 3WP3A 1C4RA 5LA0A 3VBUA 3GZAA 1NKGA 2D6PA 1VBC3 3VDCA 4Z1VA 3VD3A 3THCA 1VBC2 1B09A 3T2PA 2VOKA 2C5DA 4EWDA 2BBVA 2BP6A 2DTWA 4IE4A 1YFUA 4EN7B 2D6KA 4YZ5A 4ZU7A 5FXZA 4HANA 4B8EA 4IV1A 4JGZA 2YU1A 4CCCA 3WDXA 3IMMA 2VECA 2TEPA 1HRV1 1WW4A 5IVCA 3RZGA 3AJYA 1W8OA 4RGAA 5FZOB 3JD73 3JD72 2ZJCA 3ROUA 4CCLA 2VTFA 2WS91 5LBFA 1I9RA 2X05A 1RUI3 3P1IA 3TB0A 2JDHA 1H2MA 3OSDA 3OUHA 3BTAA 2CDPA 1HXS1 3PU3A 4Q1RA 4GMP0 1U5ZA 1SLBA 3AKTA 4XPVA 2ENRA 2Y6FA 5F3EA 2BYVE 5IVVA 4QPWA 1JH5A 1QXPA 2R30A 5F5CA 4CCNA 1RXFA 2CGOA 5JLVA 3HQXA 5JDBA 2ATFA 3I54A 4J6GA 1Q8QA 3WSOA 1N1TA 3H50A 2GN7A 1LKNA 3SKJE 2QCSB 3HQUA 3IPVA 2R063 1UYYA 1XU2A 2R062 2ZZJA 3GALA 3HNYM 4DXRA 1W2NA 4HKLA 4AI9A 1N3QA 5FZLA 5FYIA 1SLTA 1A3KA 2YU2A 1O5LA 3DUIA 4NWVA 3VB9A 1RUC1 1ULDA 2VULA 1OH3A 1D2SA 1ULPA 1UQXA 3ZYRA 5J3UA 3WNKA 5I0RA 2OPKA 3MW3A 4FFHA 4FXKB 3OPWA 2OYZA 3RFRA 3WDVA 2MPFA 4M0HA 4OHVA 3LEKA 2XVLA 4QAWA 5FY1A 4YVWC 1PVXA 1SDDB 1AYN3 4LBQB 1MZEA 1AYN2 3H1WA 3WNNA 1CJDA 1NLQA 1QH7A 4R52A 4BMBA 5A3MA 5M0TA 1J1TA 2HWD3 5BNOB 4I3PA 4Q26A 4AI3A 2HWD2 2FCVA 5BV6A 3WUDA 2IVIB 1WZXA 1LHVA 3IKWA 2BNOA 5DABA 4Z92B 5LB6A 1R64A 1C1FA 1Z0HA 4O65A 1K5MC 4K8RB 2P2KA 3GBWA 2D97A 1KDMA 4JKLA 3RRDA 3RSJA 3ETQA 1V6NA 3VBSC 2FDFA 1GUIA 1VBE3 2PLV3 1KGYA 4S2HA 5F5QA 4LHLA 1VBE2 1WBFA 2PLV2 1V70A 3RVHA 4L0PA 1LOEA 2R16A 4N43B 5FKBA 3VKLA 5FUPA 1OF4A 1KS5A 3SEEA 1AL0G 1UY1A 3K46A 1IG0A 2NZ9A 1XNKA 1BEV3 4CP9B 2GAUA 2VMGA 3K51A 4OUMA 2YC0A 2QKDA 1BEV2 3EJKA 5LK5A 3LZZA 4QU2A 2VUCA 2VMFA 5LW9A 1YIFA 4B7KA 1COV1 4GWJA 2HWF3 2DCJA 1LOFA 3AJZA 4QM8A 1ENQA 2HWF2 2PYTA 4GB33 1H0BA 3HOBA 4YW4A 3ZN4A 4GB32 5A70A 3OPZA 1CIWA 1SHWB 2UWCA 4AGRA 1JOBA 4AAXA 2ZACA 4FTEA 2Q8DA 4QHZA 1BK1A 4BQ2A 2N7GA 4NUBA 3ZXLA 2GH8A 3HIFA 3QOPA 4DOUA 1TMF1 4QPGA 2VOTA 5FYMA 4EYUA 4ZHNA 4AVVA 3K77A 3V64A 4AR2A 1GNZA 5F9TA 5A6QA 1GICA 5C3SA 1W6PA 2Y6HA 1NAEA 4I3GA 4BLIA 1NA1C 4OHXA 5FYCA 4JHZA 4E4DX 5FZCA 1NY71 1V6MA 3QH6A 3BTYA 1KFXL 2VNVA 4GWIA 4K7JA 1LRHA 3Q8AA 1QJEA 3N36A 5I91A 2PMWB 5C9AC 3GZEA 2XJRA 3KV6A 1ULCA 1HW5A 3DPRB 4XJWA 5A80A 1RMU3 4OHZA 1V6KA 4C0BA 1RMU2 4OHYA 3SLIA 3AMQA 1G9BA 2RMU1 1WW5A 1JYWA 3TAYA 2Y6LA 1VBD3 4XFAA 3B93A 1RB8G 1VBD2 1XOYA 3BUCA 2J7MA 4WZCA 4XYXA 3PU8A 4PQ9A 2Q1ZB 4EWAA 4QX7A 1UXXX 2UU8A 1JYNA 2BWAA 5LRSA 4RN5A 5GLZA 4CDUB 1GYKA 4FOVA 1QKQA 3CJIC 1A8MA 1WMEA 3PJQA 5KR7A 1FV3A 4NHKA 4B1LA 5FREA 3RZJA 4N90A 1EV11 4M00A 1WMDA 4N53A 3ZSKA 1LOCA 2RS11 1GWMA 1NLRA 1W2AX 4Q27A 3SISA 5A7QA 5C3RA 1ZBA3 1DHKB 3RYKA 2D5FA 1ZBA2 2O14A 2EA7A 5JMCA 1P8JA 2NM1A 1RUF1 2R043 4AHYA 1U12A 3ZYGA 2R042 1BCXA 3AZZA 2WNUB 3N9OA 1MPXA 1FOD3 5I0SA 2JE9A 2CWSA 4RQPB 4XFHA 1FOD2 5FYVA 5A7SA 2A6XA 3HN1A 1MS9A 1OOPB 2JG8B 1WLCA 3FHIB 3VKFC 3ZVXA 5C8CB 4AEDC 1OLRA 1RUJ1 3SH5A 2OZJA 3MW2A 2WN2A 3RS6A 1ZZ9A 3LEGA 2YYOA 5ABJC 5FOBB 5DZEA 1SFNA 2JICA 3ILFA 4HFSA 1SEFA 4I0AA 3MO4A 4M3CF 2BUKA 1UY2A 4CUBA 1Q8SA 1QF3A 4A7ZA 5FZBA 3BTZA 2XJTA 2VD7A 3IBMA 2AUYA 4XOGA 3MIBA 5FZ9A 4DFSA 2ZPXA 5ANNA 2VTXJ 5E1RA 5D8AA 2UYAA 3T4HB 3VDDA 5JPMB 3LEIA 4NMIA 4TLGA 1S0DA 1Q43A 4FOQA 2X5IC 4QDSA 2B46X 1BKZA 3FLRA 1H8TB 2R0FA 2D3PA 2VZPA 2Q8EA 1JN2P 5KWRA 2FZ1A 2WL1A 2YC2A 3NJXA 1F5FA 3PL0A 3ZSLA 1SBDA 4UW6A 3ZSMA 4NE9A 4XXPA 4Y24A 2XVGA 3UESA 4EROA 2IXKA 1RUD3 3SH4A 2PAEA 5ERLA 1RUD2 2AH2A 3BTXA 1D0GA 5HCBA 1O3SA 1OUSA 1VB4A 2BERA 2LALA 5FYZA 1VE0A 2LUWA 3ZPOA 2F17A 3QCWA 4QX3A 5DAPA 5DAWA 3RZMA 1GZTA 1DLLA 1S2KA 2IFRA 1UNBA 3RQ0A 5AC91 4MGTA 4A42A 4AYUA 4DXSA 3OBTA 3CEWA 3WT3A 3KQ4B 1DGRN 4EZHA 1UY3A 2W91A 1DYOA 5GJ6A 3S7EA 1YC61 1PGL1 3G6JB 5AVAA 3CQOA 2VOVA 2VU9A 1BLZA 3VZNA 1CESA 3CL1A 4XUOA 5FJKA 2BGCA 5F6LB 5FZ6A 3O1UA 4KU7A 5A7WB 2PHWA 1CX4A 1E5IA 1M06G 5FO7B 5ACA1 2EIBA 2BFUS 2XXZA 2HWB3 2ERFA 1DDLA 1H1AA 2HWB2 3OEAA 3NRUA 5CISA 4NIGA 5GZGA 4XBNA 3WUCA 4WVZA 1AR63 5CKNA 1D2QA 2WLQA 1KJRA 1PO23 5FFOC 3MFCA 5BNNA 1AR62 1QWRA 1PO22 1KFUL 3ABZA 1ENXA 2Q4SA 4HG6B 4JZRA 4R4XA 1XB9A 3UGFA 4MXWB 4YM3A 4FPHA 3DXTA 2DUPA 4QPIB 3ZFGB 1O4YA 1W9WA 2FCUA 4CEWA 4CEYC 1RGSA 4M3CB 5C6CA 3N7LA 2OT7A 5IFTA 3PUQA 2ZAHA 4XUPA 5BNPA 2OQ7A 4AW7A 5BY5A 1UMZA 3JU9A 1C28A 1JYCA 2HH9A 4K8FA 1POV0 5A32B 3ZIWA 5A3NA 1OT5A 2VCBA 4OMDA 1AX1A 4NWWA 4XIKA 3LSEA 3O12A 1ND3B 5IVJA 3WW2A 4MVTA 1C1LA 3GDBA 4XJAA 4QWNA 4PDWA 2E31A 1AR93 3JCIA 3U07A 1AR92 4LA3A 3PIJA 4M0NA 1ZZ6A 4EN8B 1UZVA 1YXWA 2JG9A 2VZTA 4FPKA 1POQA 3WQ0A 1GNHA 1WBLA 5CFDB 4QGLA 3H3UA 1SG3A 3DCQA 3EHKA 1G9AA 3VHPA 1UAIA 2JE8A 2ZGLA 4BQ1A 5F2SA 5C8WA 4LBJA 2YHJA 2OPWA 4CDQB 3O1VA 3A0KA 5H9PA 2P34A 5T5PA 4EJRA 2R6QA 3GGLA 1HN1A 1UY4A 1CONA 1DQ6A 2IWGB 3D4KA 5CG8A 2JDMA 4D7YA 3POSA 3WF3A 2I2SA 5I8SA 3WW1A 1LOGA 1Y9QA 2BNNA 4JKMA 4I01A 2FMDA 1B35C 2BJSA 5A3OA 2I45A 5IAXA 2R7EB 5FZ0A 1QJFA 3A4UA 2WWSA 2ZGUA 2VW1A 3E6BA 4MH0E 2B9VA 1EP0A 3BODA 3ST7A 1IS5A 2QQMA 4J1XA 3ZDVA 4LT5A 2XBO3 4YZ3A 2ZHMA 2XBO2 2CNAA 2OIIA 5APAA 4CDXA 3MF6A 4R9CA 4JVAA 2WJSA 3ELNA 4V2VA 5GLUA 1RXGA 4L9BA 4BK5A 1DGLA 3M3QA 4AQ6A 3C2UA 3V0BA 1JUIA 3IMNA 1JHNA 2GDFA 4HZFA 5FY0A 4NIHA 5GZFA 3I3BA 2AZ5A 5K8SA 3ZN6B 4L2NA 4QB1A 4QX1A 3ENRA 3KT7A 1N3PA 4RS5B 2YFZA 5KHKA 3ON7A 3PURA 4JKKA 1VRBA 3EBRA 3U75A 2GNDA 4UF0B 1S0GA 4FQ4A 4W6WA 4OQ8A 3M3EA 3PMEA 3ZXKA 4D3WA 1SLCA 1SLLA 4Q8KA 2Z2SB 2ZEZA 3MW4A 1NYWA 2ZXQA 4NRPA 2WZ8A 3N7MA 4NIDA 1JU3A 2DWRA 1UZZA 4Z2AA 2JDZA 2OQ6A 3JQWA 4LNVA 3Q8EA 1KQRA 2E33A 2FDKA 1V6LA 1ND2C 1CAWA 2XGXA 3BB6A 3VHOA 1CGPA 2PAKA 1U0AA 5EJ1B 1SPPB 3K75B 5DAVA 3PHMA 1RUG1 1VAVA 3C8XA 1XNCA 3B94A 3IAPA 4JGYB 5DAXA 4AQSA 3ALQA 1R083 4IEQA 1R082 1X33A 2K46A 2OUJA 4YZ1A 3FE5A 1AJKA 3T2QA 1D7PM 1MS5A 1AR81 3O7OA 2GNBA 3MBWA 3KWVA 5KHHA 4DO0A 5GZDA 2WZEA 4JDOA 1QQP1 2XKPA 5FOJB 1GOFA 1MS3A 3M3OA 1SFPA 5FZOA 2WUHA 1LOAA 5FP4A 2VVEA 1X7NA 2BEOA 2RR13 2XQXA 3LIGA 3WNXA 4Y1XA 2WN3A 2RR12 5DMYA 4Q4W3 2PHDA 5FY5A 2JX9A 1OUXA 2XKOA 4Q4Y1 4Q4W2 4IE6A 5FJHA 5C3PA 1UZYA 3UETA 4XZUG 2VAUA 3AZWA 2JJ6A 3I49A 2C0ZA 1DZTA 3I2JA 4NHXA 2QQJA 4I0BA 3I8TA 4CP1A 2CAVA 1WD4A 4H2AA 4MOAA 5EQUA 1UWWA 4XTMA 3EB7A 4PF1A 4UBHA 3NV2A 4Q4X1 2SLIA 4H3WA 1MS4A 3U10A 5BXXA 4A6OA 1NCRB 5JXIA 4MZUA 3JB4C 2GNTA 2W08A 5JOZA 1W6QB 3PUHA 4Q8LA 3IN9A 4YW2A 3VBUC 3RGBA 4MADA 1W8FA 3R0RA 4XW3A 3FBMA 4YARA 1HDKA 2ZX0A 4META 1NZIA 1D4VB 5FPZA 1LNSA 4XUNA 4NN0A 3JQXA 3WNMA 5JSPA 4IV1C 1DGRA 2VBBA 5E88A 4HETA 4BA6A 2YXSA 4BZ4A 3AZYA 3I2FA 3G7DA 1UU6A 1LU1A 3I4IA 1ZZBA 1BVVA 2XJUA 1UYZA 4H7MA 4LBQA 4Q0VA 3RI8A 4B4RA 5FPUA 1GR3A 5I93A 1UO9A 2G9FA 4GJZA 1F4AA 3BOPA 3HEIA 2VQUA 4D7SA 4DUXA 3B7MA 4XEZA 4PI2A 1HX6A 1GP6A 4IETA 2MEV1 1S0BA 2HKXA 2I07B 4PQQA 1RHI3 4B4QA 1W8ZA 3OBRA 1RHI2 4KL1A 1UIJA 1WLTA 4YGCA 2W1QA 1VB2A 3DKQA 5FPBA 1W6OB 3WQ1A 2UYBA 2JIJA 4FFFA 4XAAA 4QQPA 3VBRB 1Y43B 2OKXA 1X36A 4C90A 4GJYA 1S0EA 4N43A 5FPVA 5FZIA 2RS53 2HYXA 4TSVA 3H7YA 3SEPA 4ISRA 1D0HA 2RS52 3E5UA 5C4WA 3ZXFA 4CRQA 2Y6KA 4CP9A 4ONUA 2QQPA 2XHKA 1BYHA 3I97A 1U5IA 1S2BA 1WCKA 4NHLA 2D6OX 2CGNA 1W8TA 4BK4A 3BYWA 4AHWA 3W21A 5GKAC 3ME2A 3BN6A 4C0HA 4NPMA 3E97A 5JSOA 1CQ9A 3APBA 1W2UA 5JOXA 1VAMA 1YHFA 1L7LA 2XWJB 3CKHA 3QBQA 4INDA 4PLMA 2DV9A 1NUKA 2E26A 4S2DA 4AGGA 1E5SA 3PIGA 1XC6A 2B7YA 2UWBA 1AX2A 2GC2A 3F2ZA 4BYYA 2A1XA 3AYAA 3D3AA 1FPN1 2B45X 2FHRA 1Z7S1 3OB8A 3RWNA 3H8OA 3HPNA 3H8UA 1Y4WA 2D44A 1W03A 1ALYA 4MYEA 1OA3A 4OUSA 4JQRA 1JXNA 1YJLA 3KM5A 1MQTB 1RTVA 3JB8A 4OYUA 1KJLA 3CMGA 2K9ZA 2VUDA 4HT1T 5FBZA 3H8XA 1TZOA 1BMV2 3J8F1 2RS33 2G1MA 2RS32 3M2MA 1J83A 3NV3A 3PLQA 3PVOA 4LBOA 2AC1A 2WRAA 5KBFA 3WNPA 5H9SA 4JRLA 4NVPA 3DPRA 5T3NA 3D82A 4QGNA 1LOFC 1W0OA 2AACA 2IXJA 5ANQA 2AEZA 2BV4A 2HLEA 1JYXA 1F9KA 4AF9A 2DF7A 1QJX3 1XYPA 2CWMA 3CF6E 1QJX2 5DPNA 3RJRA 4GMP1 2ET7A 2VNRA 3GZTB 1AR71 4IGQA 3ACHA 4EN6B 4IW3A 2BRTA 1QHDA 3PTRB 2PN5A 2WT0A 3T0AA 3S6PA 4ZKTB 2VUAA 1SFYA 4QPGC 1QJU1 3BALA 2VW0A 3C7FA 4IEYA 1US2A 1DQ5A 4N8MA 1UL9A 4Y22B 5DN2A 2CGPA 4CDUA 1ZRRA 5A3UA 5DXDA 4A7KA 1XU1A 1G6NA 2WYFA 1GZWB 3B9IA 4XFFA 5FY9A 3N7JA 2ZEXA 5IK8A 1LB2A 1MS8A 4XACA 1W9FA 5HCHA 3ASIA 4N9IA 3DN7A 4ZS2A 5F3IA 1UW8A 3RPQA 4H14A 1URXA 4TLFA 2YFUA 1LOBA 2D98A 4AG4A 1QMJA 1JYVA 5K0UA 1E57A 3FC0A 3ZOIA 1JYTA 4E4HA 2YUEA 2WNUA 4YVSB 2ZGNA 2CYFA 3WQ7A 4ASMB 1YFYA 2JKBA 4AQTA 4OI2A 4RQPA 5FY7A 1KDKA 2QQLA 3AK0A 4JAAA 5SV5A 4IUGA 3OPTA 4Q0PA 1VRH3 1YQCA 2JD9A 2R1DA 2JG8A 3ACFA 3OBZA 1TQ5A 1VRH2 1O3RA 2DVGA 5FZFA 1V9U1 4PBPA 2AGSA 3GBGA 3IDCB 5GALA 5A7PA 4XFCA 3KZ4C 4K3UA 3P3NA 3WF1A 1JU4A 3O5SA 2ZAAA 3A23A 1H30A 3VBHB 3DKWA 4RHV1 1C8M1 5FIXA 2WKKA 4WM8C 3MPBA 3V0AB 4KWJA 2C9KA 2VUJA 4XQDA 5FPAA 4LBKA 2W3JA 2Y0IA 2JDAA 4CDWB 4RR3A 4XTPA 4XC9A 1QU0A 4MHRA 1CPNA 4YW6A 1E5RA 2PHRA 2ZX3A 4WM7B 1G9CA 1GV9A 4OZXA 4IEXA 3NO8A 4N53C 2VCCA 4FI9A 1H8TA 1ODNA 5C5UA 3IIAA 1OURA 2B42B 2EXHA 1EUUA 2V4VA 4Y3OA 3UKVA 3QLQA 4AEKA 4AWDA 4AZZA 2XLAA 2WZR1 3N9PA 2XPJA 4QU1A 1OH4A 4QKNA 2ZHLA 1JZ7A 1NE4A 5A3PA 1JZ6A 1J1LA 1JZ3A 2GSYA 3K3NA 1N3OA 1NQDA 1CX1A 3FLTA 4CU8A 1CIYA 1GOHA 1X50A 2J42A 1LGCA 3OUIA 3UK9A 2W1SA 2EXJA 4Q0QA 3GNEA 4OI4A 2VG9A 5IATA 1CZTA 3IM0A 2HWC1 4K20A 3O0XA 3WCRA 3UGHA 2VQTA 4LBLA 4BB3A 4QHBA 4ATFA 1US3A 2A7AA 2ZS6B 1HIXA 3U4XA 4NIAA 1YQ2A 4BE3A 1RUI2 1UX6A 4AEDB 1H6XA 3KV9A 5LWBA 1QEXA 1NQJA 3T1MA 3SC7X 2WA4A 3THDA 4UW3A 3WZ1A 1OFNA 2G4IA 3MIFA 3JUUA 4G4FA 4RSUA 5A7WA 3VDDC 5D8AC 4O9GA 3WP4A 3T0DA 2JDUA 3RZKA 2A3XA 4LK7A 4DINB 1OQ1A 3MEPA 1SLAA 2F4PA 1KEXA 1WCUA 3BU7A 1AL21 3NNMA 2X5IB 1AYN1 1D4M1 2V72A 2JXAA 5DUVA 5LATA 4QXHA 3DYMA 2MNGA 4YM1A 1OFSA 2OW4A 4KQ7A 3UYJA 2WFF1 2Q8OA 1CAUB 4PIZA 1HRV3 1YQ5A 3RYPA 1AXKA 4PLNA 1HRV2 2WR9A 5IWFA 3H9AA 2K0GA 3CDZB 3TNPB 4PIYA 4MXWA 2WS93 2XMLA 3J7HA 3ZYBA 4QPIA 3ZFGA 4D69A 4EV0A 1S4CA 2WS92 3AVSA 5IK5A 3OUJA 1HXS3 1LODA 3KV4A 4WBBA 5IHRA 1HXS2 3OD0A 4PCRA 3ZFFB 1OD3A 1JMUB 1ZRIA 2KR2A 5I8TA 3O1OA 5JZGB 4Y5SA 4QT6A 1UPIA 4XF9A 4Y5TA 1I5ZA 1ND3A 1R091 1DGWX 5L9BA 1YI9A 2NP0A 2DU0A 4I02A 3M1HA 2XOMA 4FPLA 3WDTA 4XZPA 3VGIA 1AXYA 1YYNA 3QD6A 3C7OA 1W8UA 5EJ3A 4MLOA 2EXKA 3ZMOA 4BQYA 1GQHA 1QNYA 3AMHA 1FV2A 4MGSA 5CFDA 5L7OB 1ULEA 1FNZA 1RUC3 3Q8FA 4OFGA 3PUIA 1GFF2 1RUC2 3INAA 5EYXA 1OI6A 4CDQA 3LCPA 2VC9A 1XJAA 3OGSA 4PLOA 5KHGA 3VL9A 3BKZA 1RVF1 4KH9A 1HQLA 2JDNA 4GZ9A 5BNNC 4IE7A 4E8DA 4Y4RA 2VMDA 4QX8A 4HN1A 5F5IA 4I30A 3N7KA 5FKCA 1H2LA 2E7TA 2JWPA 2X8KA 3WG3A 4UFLA 3I59B 3R4DB 4CEWC 4DXZA 2D3RA 2QNKA 4W8JA 4UAPA 5BNPC 3JBG1 4YSFA 2Z79A 4ZS3A 2WT2A 5FMDA 2ARAA 2WQ4A 1QJZA 4RFRB 4UFJA 5F2WA 3VN4A 4DQAA 1A34A 4BQ3A 2GZWA 1UY0A 3MUY1 1GMMA 2D93A 2WC2A 2ZBJA 4PDWC 3ZN5A 5C7GA 1ZX5A 2J1EA 4GH4B 4Q0SA 2QQOA 2IZWA 3MFAA 1NCQB 4CP2A 1W8WA 5LEJA 5EYYA 1TEIA 2DVAA 1REDA 5GM0A 3O1SA 1YJKA 2JG9C 3MICA 1ST8A 1AVBA 3SXWA 1UU4A 5IT6A 3J7MA 2VE1A 4QB2A 5T5JA 3I3MA 3ZN6A 1PX3A 3DL3A 4ZU4A 1C5HA 5GLTA 4UF0A 1OSGA 4HLTA 1LECA 3GCWA 3NMBA 1RITA 4UI9L 5B4XA 3VDAA 3WD5A 3I2OA 1COV3 2XDVA 4LHSA 4AFMA 4XF0A 1COV2 3D0SA 4XDPA 3M7AA 4A44A 3AZXA 5FZ8A 3AB0A 2P5BA 5T52A 4OQ9A 3ZSJA 1NLSA 4FP2A 4QDQA 1HRI1 4COYA 3O14A 2D6MA 3KS7A 5GLVA 1SPPA 1RINA 1K12A 3VBFA 4A3ZA 5EP9A 5AVPA 2P17A 3USUB 5CADA 5L9VA 1OKQA 4JGYA 3WQBA 1TMF3 2BW8A 4FT8A 3A0NA 1TMF2 4CDXC 5L19A 3WEZA 4AAPA 5CEHA 3AP6A 1AX0A 2HWE1 2Y33A 3V65A 1S2EA 4EQVA 5I0UA 1BBT1 1IS6A 2DVFA 3OCPA 4BIFA 4E9KA 4DEQA 4LLFA 4R9DA 2OXBA 3HD8B 4LIUA 2FDHA 3HN3A 2VJXA 1NY72 1PGW2 5KXDA 3KGZA 5FTTC 3WHTA 1PVC3 2VOWA 3DYOA 4TWTA 1VMHA 1PVC2 3GHMA 1ZZ7A 2IXIA 4JCKA 1K45A 4XJUA 3TEXA 1LEDA 1UOBA 2RDNA 5F3CA 2NQYA 3GZUC 2H0BA 2RMU3 3LOIA 1F5JA 2EIEA 2ID4A 2RMU2 4RGGA 1H8VA 3ZFEB 2EIDA 5FZHA 3RG0A 2BVVA 5CB7A 1HJGA 1W6QA 1PZ9A 3TBDA 1XYNA 4Q4V1 1ND2B 1SLIA 1POV1 1AXZA 1JZ8A 3NJYA 4Z07A 4HL0A 5EV7A 2BVBA 4LBMA 5FLHA 2FDGA 4COVA 4ES8A 1OMIA 2VCMA 1VMJA 2XLGA 1STMA 4MGZE 3WF0A 5CFCA 2QQNA 2E32A 3NKGA 2DDUA 3ZX7A 1EV13 1FNYA 1GP4A 1Q5OA 1W2OA 2AREA 3AYCA 4LEJA 1EV12 2RS13 1PM7A 1RUD1 2FCTA 2RS12 1OHFA 1VJ2A 1VR3A 1RIRA 3E1F1 3E5XA 1HQNA 2A75A 4C1XA 4CU6A 2BNMA 1RUF3 1YUDA 3L9JT 4NPLA 5FUIA 2C9AA 1RUF2 3NQHA 4K21A 4O7XA 3MV11 2VMIA 4RFT0 5LA9A 5J37A 2AYHA 3PVNA 5K4LA 1UZ0A 3USSA 1ASJ1 1MVEA 3A7QA 1WA6X 2KD7A 4XMIA 2YPDA 2CTVA 4N7UA 1W6OA 3HBZA 4BLJA 3H1YA 3MLKA 3OG2A 5KC6A 3HVDA 1W2TA 2A71A 1UOFA 3VBRA 4EN9B 4CXYA 1VAKA 1M4WA 3ZXEA 3ZYIB 2WWUA 3ZO0B 4P14A 4IEWA 2BFUL 3K3OA 2E53A 3PJYA 2EIGA 1QGLA 4ZONA 3KSCA 2QQIA 2ET1A 4LJHA 3CIHA 2GC1A 5E6HA 5FY4A 3SCGA 4QKDA 3NKTA 3UNPA 2VZSA 4MGYE 2D5HA 3CBNA 4NO4A 1SQ4A 2PHFA 4XJ8A 1ZZCA 5A1LA 3I7DA 1WMFA 2HJIA 3HT1A 4IV1B 3FJSA 1VBA1 1SCRA 2WDBA 3EMRA 2F4LA 4GXLA 4LR4A 5LY2A 3VD5A 1FX5A 5JOYA 2J1UA 5JR7B 1CAXB 1OF3A 5A1FA 1XE7A 2Y64A 4JTOA 1PHMA 4BH9A 5BYNA 2EAAA 2XJVA 1LCLA 4COZA 1RUOA 4V1PA 4W50A 4E8CA 3MIDA 1LGBA 4NR1A 4LE4A 4QKFA 4AFAA 3WW3A 3FFQA 3LDBA 3TWIA 4MX3A 3B02A 3GF6A 3NVCA 3BPSA 4P9LA 2J1SA 4BQ5A 2JB8A 1QJY1 1PIV1 1TME1 2DURA 3VZJA 4OUEA 2HBUA 2WNVB 5C70A 4D7TA 5AC93 2D43A 1DZQA 4Y26A 5AC92 4HVQA 4AOCA 1GQPA 1MQTA 1SZBA 1RUNA 5FV3A 3N9MA 3POEA 3KQRA 2NYYA 3CNAA 5C4WC 4XHBA 3S5AA 2DU1A 5FP3A 1PGL2 1JS9A 1KXGA 3DECA 1A78A 4Y1ZA 3R05A 4IE5A 4BXSV 3SCHA 3WF2A 3T09A 4AXOA 1IG3A 5LEKA 4XF4A 2HEVF 3AC0A 4LKFA 5FLIA 5IVEA 2I74A 2V73A 4XDQA 2DYCA 4LO4B 5LASA 3IB3A 4LA2A 1FXZA 2W52A 1HJFA 4Y5Z0 3H1MA 1GWLA 2ORZA 3U11A 1K5JA 3J7NA 3WHUA 1X82A 3I3EA 5IFPA 1U5XA 5A1AA 1YIPA 5FXXA 1YQ8A 2ARBA 5HI0A 4JTNA 2BDRA 1J3RA 5F8PA 1PK6A 1R1ZA 4AK3A 2DBNA 3MIHA 3QH7A 4HK8A 1JTZX 2ARXA 2J1TA 3BIWE 2W68A 4MXVA 1MR5A 4BU2A 5JXHA 1GZWA 3POFA 1PX4A 4LUMA 4WZFA 5CIRA 1GNYA 3LQCA 1O7FA 1W0NA 2RVAA 5FYBA 4E2GA 3AL5A 4D0QA 3LA2A 2ZGQA 4KWUA 4URAA 3CLPA 2VMEA 2L9LA 3FL7A 1OD5A 2AENA 2EVXA 5I8YA 2Q8CA 4XE9A 5KHJA 3KD4A 4NRMA 4YVSA 5FLJA 4AFDA 2RDSA 1EAH3 4OLLA 1W3XA 3DPRC 1EAH2 3NJVA 4LHNA 1DQ0A 3ATGA 2YROA 4KBBA 1PO11 5FZGA 3NNFA 3U1XA 4F3JA 2IFWA 2V5DA 3VZOA 5JIUA 2G9GA 3ES1A 2FQPA 1EYBA 2YGMA 3NAPB 1MS0A 2OZ6A 1W9TA 1O6UA 1WKYA 3B5LB 5F6KA 3VBHA 3C7GA 2Q30A 5F1RA 2YV8A 3VLBB 3FZ3A 3V0AA 5A33B 1W04A 2BBAA 1IKPA 4ZXKA 1AYM1 4FOYA 1LR5A 4EE2A 4CDUC 2WAOA 4XFBA 5CZKA 3ZYPA 2R071 3ACGA 2D6LX 4CDWA 5F7UA 4QPGB 5C71A 1L3JA 2ZTNA 3AP5A 4WM7A 4YM0A 2YC4A 2GU9A 2IXLA 2VZ3A 4JHTA 3N9QA 3ZYFA 1AJOA 1OVSA 3C7HA 2KA3A 2PHUA 1LJ7A 4Y1UA 5JPNB 2ZX1A 2GP3A 1Y9GA 5T55A 5CA6A 5K0UC 1S0JA 3VBOB 3SQOA 3OOXA 5FO8B 3AMNA 4UFIA 3NL1A 3M3IA 5FPXA 1K3IA 3K4DA 2J22A 3FUOA 1RUH1 4R4ZA 4RQPC 2GALA 2P3IA 1WLDA 1DF0A 4IXLA 3WOGA 1R1A1 1I1EA 3CO2A 1OA2A 2JG8C 2R1BA 2XUMA 2RM23 4QMAA 1QH6A 1RL3A 2RM22 1ZBE1 3LAGA 3AP4A 3PMSA 1JI6A 1JOPA 4W6YA 3H8RA 2V09A 1DG6A 1GBGA 1NZCA 2DUOA 3THPA 1OA4A 5E16A 5FQ0B 1XQNA 3O1RA 2A5ZA 4CUCA 2W1WA 5JXGA 4ES9A 4RR3C 4IV3B 4BPZA 2D7FA 4UW5A 4WM8B 3PVBB 2VOXA 1W99A 3SCFA 4YFZA 4FCAA 1CAVB 5FWJA 1ZRFA 3K4AA 2Q1FA 3RJ2X 2G19A 1H4GA 2NPIA 1RUG3 2RDQA 3O0VA 4PF5A 4B3NA 1H8TC 1RUG2 2BWCA 4N53B 3ZKUA 4WVMB 1GU3A 3GJBA 2X5IA 4FBFA 3VDBA 1BK0A 1AR83 4ASLA 1SACA 2Y8KA 4IEVA 5B4NA 5IYYA 2GNMA 4QXCA 1QQP3 1CAUA 4JGZC 4HSJA 1QQP2 4A2UA 5FZ7A 1RHI1 1PM4A 4QQ2A 1PMIA 1RUE1 1OVPA 2Q0AA 4QM9A 1C5IA 4AI2A 4HMZA 1AUYA 1WWYA 2H0VA 3OGGA 2CU5A 2EALA 4OVEA 4YNIA 2R32A 2VQ0A 4CPBD 2XH6A 3ZFFA 2CL2A 2VZ1A 2Y6GA 4K1ZA 4CCOA 4AL9A 4R9BA 4JDNA 5BNOA 5JZGA 2BPA2 1WMXA 1JZ5A 4Y20B 1XSQA 3CZUA 2YZ4A 5LBCA 2BTVC 1QIQA 3E6DA 1XNBA 2LRPA 3ACIA 4Q4X3 4N7IA 4FPEA 3NNGA 4XUTA 4XQ4A 3OYWB 3MLJA 4Q4X2 4XMAA 2FMYA 3GXUA 3TOJA 1FMD1 3AKRA 1UN1A 2X53S 2OVUA 4P5HA 1LTEA 1YNAA 2YY1A 1MVQA 4UFMA 5JSRA 3VDDB 3FLPA 1GZ9A 5EWSA 4BWOA 5KXCA 3K4ZA 1H4HA 5L7OA 1J3PA 3BCWA 3FMGA 4HONA 2ZOEB 3LKJA 2TUNA 3N35A 1BQPA 2ZMKA 3HNMA 1ULOA 3J4UH 5FZKA 1VBB1 3WINE 4D6QA 3GHNA 5ISLA 4L11A 4QB6A 5D1IA 3O1MA 4K6BA 4LORA 5GZCA 3P5BA 1MACA 4QPIC 1DYKA 3ZFGC 3I59A 4IL7A 4FAHA 5DAQA 3ZYHA 2VZQA 2FZ2A 4BOWA 4YVWB 1SBFA 2WSUA 2WO2A 3KT1A 3T3YA 3M70A 5FBJA 4O9EA 3ZM8A 2BZDA 5JWPA 4KGQA 1ND3C 2CDOA 2ZGTA 1UD1A 4I09A 3HNBM 1MEC1 4GH4A 2QDNA 3W59A 1NCQA 2SBAA 4CA9A 4DRVA 4IGOA 4OZOA 4PIXA 5LK7B 4HSLA 1K5MB 1ODMA 2WYSA 3KT4A 3NV4A 5JI7A 5IJRA 3ZKYA 4M4RA 5DDJ1 1ZA7A 3UKNA 3LD8A 3VBSB 2VXJA 4QQLA 4FO9A 4HOOA 3VKOA 1REEA 1GQGA 4ZY9A 4LMFA 4KG0A 4CDQC 3NWKA 4EZ4A 3MHZA 1QXRA 1WUVA 1YEWA 2XB6C 4YPJA 2IXCA 1QJX1 3WW4A 4NJ4A 1J3QA 1LEMA 2CY6A 3WXPA 4BHPA 5LY1A 4BCUA 5AFBA 1OPMA 5FDBA 3MPPG 2XQRA 3OD4A 3QACA 4CE8A 2YDEA 4QD2A 4CVUA 4IQPA 4FP3A 3OGRA 5FMOS 1Y3TA 4QXBA 2C6SA 3KV5A 4XAEA 4CXWA 1S55A 4XCBA 2P3KA 2QZ2A 4GD4A 4AFBA 4DY3A 3IDEA 3USUA 2ZX2A 3VD7A 5LA1A 1XE8A 3POWA 2ZZQA 2ZHKA 4NROA 1FPN3 1J84A 1HV1A 1Z7S3 2AEYA 3IDAA 1FPN2 4HKWA 1Z7S2 4FFGA 3S30A 1JOJA 4J25A 3T30A 4AQ2A 4Q1PA 2OX0A 4X8NA 3LWCA 5CG9A 2XJSA 2DVBA 2PTMA 4ARYA 2RDRA 4P9GA 4COWA 1FYUA 1TNFA 3LSDA 1GKBA 3TN91 1ULGA 2LS6A 3W58A 3J8F3 4YZ2A 3S57A 1G9FA 3UL2A 3J8F2 5E8AA 3HQRA 1XNAA 3AP7A 1W9SA 3HWJA 4QGMA 1NA1B 3ECQA 2OUHA 1QDCA 4Z8BA 2W94A 3BVCA 1PGSA 5FAXA 1CD3G 1XBFA 3AL6A 4WVWA 5T54A 2VBPA 2X10A 3WR0A 3IAQA 3ES4A 5C9AB 2WWJA 4GIQA 4HK9A 3ZXJA 3ZFEA 5LBBA 2GMMA 4XF1A 1NT0A 2P3YA 1OOPA 4GMP3 5J1XA 5A6ZA 5C8CA 4FTBA 2XHNA 2VVFA 3VBFC 2A6ZA 4XBQA 5JXJA 3AZVA 1XNDA 4JGYC 3KVBA 1OBNA 1QJU3 3KCYA 1LHWA 2EXIA 4IE0A 1QJU2 3MYXA 2GH2A 2PFWA 3EXUA 4LO6B 4XF3A 3LDRA 4J1WA 4Y1VA 1H1IA 1QNWA 3B01A 3MLLA 1VBC1 2WQ8A 3P6BA 1XNTA 2DCTA 4CDXB 1PZ8A 3LE0A 1L7QA 1S0CA 5LRRA 4YLZA 2EF6A 3I2DA 3LA7A 4ZU5A 1CN1A 2YBKA 3PUAA 4YW3A 3ETPA 3CJIB 5FY8A 3SH3A 1VP6A 5BNQA 1FT9A 3VHNA 1GOGA 2OA2A 2E7QA 4LKEA 3GJAA 4JX0A 3R4UA 4R8HA 5KC5A 1W90A 2PELA 2VL4A 2ZX4A 4E2QA 1RC6A 4K40A 1WCQA 1T6GC 1N1VA 3JD71 4HXCA 2P4EA 3F95A 2VH9A 5DUWA 2W47A 3ZMNA 4YZ4A 4D8MA 1RUI1 4TN7A 4MHUA 3VUOA 1O3TA 4A7YA 1V9U3 1LHNA 1OPOA 1WW7A 3S7IA 1V9U2 4KNCA 3FX3A 5J7MA 4L99A 2VCAA 1LULA 1C8M3 2XG3A 3KF3A 3PUSA 2YG0A 4LKDA 4RHV3 3AYDA 1C8M2 4RHV2 1NG0A 4IEUA 2WFPA 2AR6A 4UW4A 4A4AA 2DTYA 2VBDA 2BOJA 2YBPA 3PNAA 4M4PA 5CFCC 2R061 1JUHA 2A6YA 5ABJB 1KD7A 2P1BA 2NN8A 1LESA 2QJVA 4LO5B 3AXEA 2CHHA 3KHCA 3UJOA 1DQ2A 4FPFA 2IXHA 4QDRA 4Y1YA 2WAAA 2H6CA 4MGKE 2YGLA 1GLHA 1YQ6A 5FR3A 1CAXA 1T6BX 2BOIA 1UMIA 4XQWA 4AVCA 2ZABA 4KI5M 4LULA 1QY4A 5EXOA 2VGDA 2HYKA 2WZR3 3EYPA 1SBEA 1QOTA 2R49A 2WZR2 4YG3A 5DG2A 5FZ3A 2JECA 1UXZA 2XJPA 4DPNA 2DCZA 2W2IA 4U2AA 4EWEA 4BDVB 4YG0A 2HWD1 5IK7A 4IEPA 2WIIB 4FPOB 2HWC3 2QFEA 2RJ2A 2W0XA 2JENA 3VBRC 2WNVA 1PMJX 2HWC2 3HBKA 2Y60A 4AEMA 5FUNA 2DCYA 3BIEA 3IWZA 3FWEA 2VNGA 4LUKA 4M3CA 2FD8A 2VPVA 1XRUA 2MHFA 1W06A 2YB7A 2PHLA 3WNOA 3U78A 1VBE1 2PLV1 3VKNA 5A32A 3VV1A 4I0WB 4KGGA 1XXNA 2B39A 4XJZA 2ZGOA 4UFKA 2W46A 4ZPIA 2R0HA 1GANA 3UV9A 5A3LA 4Q2FA 3OTFA 3RDIA 1QXJA 1BEV1 1MZFA 3LPGA 4NIIA 3DEMA 3GYDA 2YBSA 3LFIA 2IVJA 5IVBA 4YFWA 4PT6A 5LCWL 4BIOA 4X8PA 1AL23 1Z78A 3NJZA 1D4M3 1AL22 1FI2A 5DUXA 2XL9A 1DFQA 1D4M2 2HWF1 5A6YA 5FYTA 1HV0A 1Q8OA 2VZUA 3LDKA 4GB31 4LLOA 2WSVA 1KRIA 2WFF3 5DG1A 2WFF2 4PI0A 4P08A 2FDIA 3FHQA 4LKSA 4WV8A 4YG6A 1CR7A 1W05A 1O4ZA 2P37A 3FBYA 5L36A 2QUOA 4UYBA 4XJ9A 5CKMA 3LB9A 5I0TA 5FZ1A 2FBEA 3B9CA 5K9YA 3VZMA 4CCEA 4A45A 3VD4A 2JEMA 1N1SA 4CTEA 5C33A 1W6MB 3B3QE 4K1YA 5JCTA 5HBAA 1MQTC 4MV2A 3RI9A 1VPHA 2NMOA 4Z82A 3I3DA 4KMQA 4YWAA 2VNOA 3HAGA 2GMEA 2Z69A 4CEYB 1R093 2Y0OA 2C26A 1TG7A 1R092 3AVRA 3MGUA 4C8DA 3DXUA 1DU3D 4XILA 1RYYA 4HN0A 4Y4YA 5C4WB 4TXWA 4LK6A 1VALA 1NXD1 3AYEA 2B5HA 5HPOA 4FSJA 4DMIA 1JBCA 1EPZA 3POIA 4BJ0A 4KWLA 4DNYA 5CAZA 4DIQA 3KLSA 1IOAA 4DS0A 4LIVA 5HXMA 2J1VA 3SHRA 1O91A 5A7OA 3SMHA 2LW8A 5FYSA 4R9AA 3GCXA 5HCFA 4UWDA 5E89A 5FPLA 4B7EA 4CZSA 1IZ3A 1RVF3 1RMU1 3NAPA 1ACCA 3AFGA 2XUEA 4RS5A 4M3CE 1RVF2 4XHXA 3L2HA 2E63A 1ENRA 3LA3A 3ZR5A 3VZKA 2RJKA 1PMHX 2VM9A 1PK6C 2W1UA 3I2IA 3OY8B 4GKYA 2Z4FA 5A33A 4CP0A 1VBD1 4D6SA 3T1LA 2ZKNA 2D3SA 1U5YA 4W4ZA 2CAUA 3JBG3 2QDRA 3JBG2 1UMHA 3WNLA 1G8WA 1NX9A 3O1TA 1ZRDA 4IDZA 1B35B 1WCDJ 1TE1B 2PQQA 3LF7A 4JC1A 4QHOA 3NV1A 3LIHA 3VBOA 1PGW1 3AFKA 4YVSC 4DY5A 1PVC1 3HR9A 4CCKA 4S2GA 1ZBA1 1MZ6A 3OGVA 5CVRA 5EZWA 2R041 4B29A 4EN0A 4C1WA 1C57A 2B9UA 4AVBA 5D21A 1J59A 4XDOA 1IKQA 1FOD1 2QQUA 3KCCA 5I0DA 2ETEA 1UCXA 1EUTA 3ORJA 2A3YA 4DUVA 2J1AA 3TEYA 2ZKLA 3VBHC 5T50A 2X29A 3TEWA 5FQ0A 3IZOA 4HVRA 4MG2A 1TVGA 3PDQA 2VZVA 3N9LA 4HPKB 3T4VA 2K2SA 4IV3A 4CDWC 4KWKA 1CVNA 4WM8A 2Q1MA 4P02B 4OI0A 1HRI3 4WM7C 5JVVA 3HJRA 1HRI2 1CAVA 3ACLA 3D5OA 1W8NA 3R6SA 3WDYA 2Y38A 2ES3A 1MS1A 3BI3A 1NCRA 3ZYJB 4ATEA 1W28A 4QX0A 4XXAA 1Y7BA 2NLRA 4WVMA 1W3VA 3WCSA 2WNEA 2HWE3 1L7RA 1BBT3 2HWE2 4KBZA 3S5QA 3URFA 1HB3A 3T08A 1BBT2 1HB1A 4YW1A 2VR4A 4Q0UA 5K0UB 1XYOA 1F2NA 2VW2A 2QE3A 2D6NA 2B8MA 1V6IA 5LA2A 5KXEA 1JW6A 5HCAA 2LTNA 2PA7A 2QBXA 3BU0A 1H2NA 4G9SB 2W39A 3DYPA 4XFIA 1X8MA 4D6RA 1HKDA 1UZWA 2W5FA 2X09A 2DFCA 2ZGRA 4AI8A 1DCSA 1OC1A 2QVSB 3RZLA 5FWEA 2A3WA 4FFIA 4BM8A 3M4FA 5EIYB 1H2KA 5IW0A 1O3QA 1HN0A 4Y20A 3NW4A 4P9IA 3X29B 2GMPA 4NPRA 1DGWA 1Q8VA 2ZEWA 1UOGA 1SDWA 1Q3EA 2KM2A 3OYWA 3MV01 2VXRA 4TYSA 4RR3B 4KG8A 2A73B 3W9AA 1NXMA 3FHAA 1XSRA 1CJPA 4Q4V3 2Z42A 1POV3 1IPSA 2RG4A 1RUJ3 2ZGKA 4Q4V2 2CV6A 2P6CA 2VVDA 4AE2A 4AVTA 1RUJ2 2XONA 4YRDA 4ZZ5A 1AZDA 1OKOA 4GAZA 1W6NB 3TRSB 1ONAA 3VBUB 1F4HA 5DZGA 5FYUA 1H1MA 4BQWA 4B4PA 1IPKA 1IPJA 2HWB1 5A6XA 1CZSA 3E6CC 1BHGA 1GSLA 5FXWA 3THTA 4G3YC 4P5YA 3PTYA 3WVJA 4CUGA 4CYDA 3W5MA 4JGZB 4NAOA 5F32A 1JYIA 1AR61 3FUQA 1WA4A 1PO21 2G9ZA 4ET7A 2ARCA 3DGTA 4MUVA 4YVWA 2JDKA 3ZFFC 2VY0A 4UT5A 4DXTA 1ASJ3 1W0PA 5J36A 2WZPP 5BNOC 1NOVA 5JZGC 4P9YA 1ASJ2 4H55A 1C8NA 2A6WA 2VMCA 3ZIXA 2BU9A 2WBKA 2HEYF 4LBNA 5JAXA 4I2OA 4F83A 4RL7A 4URTA 4L8QA 1PNGA 1BXHA 1QOSA 4MGIE 5IAVA 3OEBA 1I5PA 1K5MA 4JRAA 5T5LA 5L9RA 2J1RA 1ENSA 2RE9A 1REFA 2P3JA 5L7OC 1AR91 5J96B 4N43C 1YCIA 3VBSA 4CU7A 4XFGA 4QX2A 2PQSA 3IPVB 3OBAA 2O0OA 2PAMA 4KU8A 2A6VA 2PHXA 4E2SA 4IGPA 1ZYBA 3WP5A 1CWPA 5F3GA 5FZAA 1WW6A 3SKVA 1VBA3 5EHDA 4FTSA 1DQ1A 2JDYA 1VBA2 3FN9A 5ACA3 2O8OA 2JKXA 4ISQA 3POGA 1IHMA 5H9RA 4E4ZA 5ACA2 2LM3A 5B2GB 3Q8CA 4XABA 5DQ0A 4COUA 1HQWA 4QX5A 4B1MA 2ZHNA 3WF4A 1YLLA 4BQ4A 5JR2A 3JXSA 3ITQA 4DUWA 2RJLA 1A8DA 2ILMA 1BZWA 2ZMNA 4IESA 4A6SA 3NNJA 1BVP1 4RA0A 1ULFA 1SCSA 1PZ7A 1X8EA 3OF1A 4DRRA 4LE3A 4GH4C 1QJY3 1PIV3 1TME3 2UURA 3AM2A 1I6XA 1QJY2 1PIV2 1TME2 3LPFA 4Y22A 1NCQC 3NNLA 4FXGB 1YO8A 3WG2A 2QQVA 1H6YA 2XBO1 5EFUA 2WO7A 2LROA 5A3TA 1EAH1 1JODA 1LENA 2DCKA 3I2KA 4PBOA 1NA1A 2W95A 4AI1A 2RHPA 4GQ7A 3RZZA 4AVSA 3N4MA 1UYPA 5FK7A 2VQAA 1A6CA 4BISA 2V4AA 3FFZA 3H42B 5F37A 3HMYA 5EJZB 1V6JA 5FMBA 4Z2WA 1UKRA 1LGNA 1RJ7A 4AEJA 2H6BA 5C9AA 1XE0A 4DB5A 4MSVA 3U37A 1CPMA 1NE6A 4JDMA 1UYXA 3DF0A 4M01A 4SBVA 4UOJA 2Y34A 4XUQA 5FYYA 3GM8A 1T2XA 5FYHA 4TZDA 3ZXAC 2V5YA 3H0OA 1IQAA 2O8QA 3NSTA 2C4XA 2QZ3A 4IERA 4W65A 2WO3A 2ZGMA 3POJA 3POBA 4PHZA 3ILNA 5J98B 1XPWA 1N1YA 4YGBA 1WGPA 3BGAA 3IIIA 4NHYA 1LAJA 3KMHA 3GBFA 5IVFA 1R081 1ZM1A 1PNFA 1HLCA 2UWAA 4WVVA 1KS4A 3CJIA 2WO1A 4K9SA 4LHKA 3RYRA 2WNOA 3MIGA 4A3XA 1W6PB 5IVYA 4CU9A 4YW7A 2HBTA 3H3ZA 2C1FA 3T2TA 3I2HA 2RM21 4MGQA 3SNMA 2TNFA 1VIWB 4CCMA 1AF9A 1O5UA 1S0IA 2JIGA 2ORXA 1YI7A 2RR11 2WNUC 2ZA9A 3BOWA 1PO13 4GWNA 1YFXA 3OGJA 1PO12 3D6EA 4Q4W1 4HVOA 3ZFEC 4ARXA 5FRAA 1OOPC 5K7PA 5JUVA 5C8CC 1G86A 3I2GA 4CXXA 2E9QA 4CSWA 3TEZA 4AHXA 4OCTA 1O4TA 1GWKA 1V6OA 3RWKX 1H9WA 3UJQA 3MDPA 3VBFB 1AYM3 3WY6A 2DBIA 2W92A 4P9WA 4YYOA 1AYM2 4AEDA 2R073 4DEVA 4P9JA 3A21A 2R072 2DUQA 3WV6A 5ABJA 5J48A 2YMZA 3N3HA 4XIOA 4DZGA 3LOBA 2Q5TA 2B4KA 2GC3A 1UOJA 2IC1A 2UY8A 1LU2A 5FP9A 5FP8A 3EO6A 4CUAA 4E27A 4F7ZA 5SV8A 1C3HA 5KXBA 3RNSA 4C91A 1DZRA 1HB4A 4NOTA 4BXFA 5LBEA 2VZRA 4UXAA 4D94A 5FZDA 5CBLA 1F15A 4P00B 5L73A 4AGVA 1F8VA 4CPBA 1IS3A 1RUH3 2ADDA 1MZ5A 2IUWA 2FDJA 3T2OA 3V56A 1RUH2 1R1A3 1WD3A 1AR82 4LXLA 2WA3A 5DUUA 1R1A2 4ORFA 4QQHA 3KGLA 2EAKA 2PHTA 1WLWA 1ZBE3 4BMEA 2QQWA 1ZBE2 1YRZA 4GWMA 3MIEA 4ZXEA 1X9PA 4LPLA 1CZVA 3ZR6A 4Q4Y3 2A70A 3RMXA 2XVKA 4Q4Y2 4U36A 2DFBA 1DBNA 4ASKA 2JB4A 3VL8A 2RS51 1IQDC 1O59A 5A7NA 5FO9B 3RMYA 3KVAA 3ILRA 5CFCB 1UKGA 1UIKA 3UKTA 1KITA 2D40A 1UX7A 3C7EA 4XCAA 1YFWA 3KF5A 4NRQA 3MZHA 4MO3M 5D8AB 4LQRA 1G7YA 2BGOA 4FPGA 1Q56A 5IUQA 2C24A 3HT2A 3U0ZA 1UPSA 4OMCA 4GALA 2BQPA 3ZSEA 1F31A 4V2WA 1JZ4A 1RUE3 1OQDA 3D0JA 1RUE2 5JIAA 2WNVC 1UF2C 4GKXA 4F8AA 3WDUA 5HV0A 1RJ8A 1OLMA 1V0AA 1W6MA 4LBQD 4YM2A 3WLUA 3BPZA 1HB2A 3AX4A 2QQKA 4LOSA 1YWKA 5D2AA 5H9QA 3JZVA 4FQZA 1H9PA 2MEV3 1I3HA 4CEYA 4LTAA 1BJQA 2MEV2 2Y26A 4FPJA 5HXVA 4H7LA 1S0FA 3N9NA 3S0MA 2CSGA 2XLFA 3KB5A 3M8LA 1AHSA 1WCSA 4ITCA 5G05L 5KHIA 5A3WA 2WLPA 1BMV1 1FMD3 3A22A 4Q5OA 1FMD2 1DYPA 3L2YA 5FMCA 2RS31 2W87A 3LGRA 1FAYA 5JMOA 4XURA 4NHMA 5FMOL 5JI9A 3J7LA 1OXCA 3AP9A 4E4SA 1X9TA 2WABA 5T5OA 2EICA 3K2OA 5CFDC 3ZXDA 3AXDA 4Q29A 2O1QA 2XJQA 4FPCA 5CYYA 1VBB3 3U4SA 5GLWA 3WG4A 2JDPA 1VBB2 4CCDA 5BUVA 3AMPA 4FPYA 3SITA 3VHRA 2NMNA 4L97A 4N9HA 2ZGPA 1VLNA 1E5HA 4JV4A 3OY8A 4XVHA 4FOWA 3I3QA 2OS2A 5JOWA 2HEWF 5BNNB 2XWBB 2E6VA 1J58A 1LHUA 2PXJA 3P3PA 4X6RB 1EPWA 4XETA 5F5AA 4Y33A 4PJYA 1F35A 4AHZA 1K42A 1ZVFA 3AKSA 1Q8PA 4LO8A 3J9SA 3W20A 1B35A 3O1PA 4CEWB
chains in the Genus database with same CATH topology
2ZEZA 3LPGA 2VZOA 2ZXQA 2WZ8A 5FUIA 3DEMA 4LOTA 1JU3A 3NQHA 3MV11 5LCWL 1UZ0A 4PT6A 2E33A 3A7QA 2KD7A 1O8PA 5EJ1B 2VO5A 1SPPB 2Y6JA 3K75B 2VZUA 3OG2A 3C8XA 3IAPA 1JHJA 3W5NA 4P08A 3FHQA 4LKSA 5CKMA 3T2QA 1D7PM 3CZJA 4A45A 3VD4A 2QQIA 3MBWA 3CIHA 2WZEA 3UNPA 2VZSA 1GOFA 3I3DA 4KMQA 1SFPA 2WUHA 2BGPA 2XQXA 2WN3A 2C26A 1TG7A 4CU6A 5DMYA 2WDBA 1RYYA 3VD5A 4TXWA 2J1UA 3UETA 1OF3A 4XZUG 5HPOA 2Y64A 3I2JA 4A41A 2QQJA 3POIA 4BJ0A 4MOAA 5HXMA 4E8CA 4W50A 1UWWA 2J1VA 3EB7A 4PF1A 2LW8A 4A6OA 5JXIA 1DP0A 2ZEYA 3PUHA 2J1SA 4MADA 4OUEA 5C70A 1PMHX 2VM9A 2W1UA 3I2IA 3VD9A 1NZIA 2Z4FA 4ZZ8A 1GQPA 1LNSA 1SZBA 4XUNA 3WNMA 3POEA 2W9XA 3MUZ1 4W4ZA 3DECA 1O8SA 3I2FA 4BXSV 3WF2A 4TTGA 3WNLA 1UMHA 1UYZA 1NX9A 3T09A 5CKQA 4RYDA 2RV9A 3AC0A 5G04L 1F4AA 3HEIA 2VQUA 4DUXA 3IB3A 1DLCA 4PQQA 2ORZA 3T0BA 1JZ2A 3OGVA 2W1QA 3I3EA 5IFPA 5A1AA 5LA0A 1NKGA 3VDCA 3VD3A 2OKXA 3THCA 3T2PA 5I0DA 1EUTA 2J1TA 2HYXA 4DUVA 2J1AA 3SEPA 5JXHA 3POFA 1PX4A 2Y6KA 1TVGA 1GNYA 3LQCA 1W0NA 2RVAA 2VZVA 3I97A 4D0QA 1W8OA 4P02B 4KWUA 3HJRA 4BK4A 2VTFA 2VMEA 2X05A 1W8NA 2L9LA 3P1IA 3FL7A 4ET7A 2CDPA 3BN6A 4QX0A 4QPWA 3NJVA 3CKHA 1L7RA 1NUKA 2E26A 3T08A 2VR4A 3WSOA 2V5DA 1XC6A 5LA2A 3SKJE 3F2ZA 3D3AA 3OB8A 1UYYA 2QBXA 3HPNA 3HNYM 4DXRA 1W9TA 1WKYA 3DYPA 3C7GA 2W5FA 2BBAA 2X09A 3SKVA 1ULPA 4OYUA 3CMGA 2WAOA 5F7UA 5CZKA 3WNKA 3ACGA 5EIYB 5C71A 2YC4A 2VZ3A 3LEKA 4QAWA 1J83A 3C7HA 1SDDB 2ZEWA 3WNPA 3WNNA 3MV01 3FHAA 2HLEA 1JYXA 2XONA 1K3IA 1R64A 3K4DA 2J22A 5DPNA 4ZZ5A 1F4HA 3ACHA 4JKLA 1GUIA 3T0AA 1KGYA 1CZSA 1BHGA 1JI6A 3C7FA 4L0PA 1US2A 4P5YA 5DN2A 3W5MA 1OF4A 3SEEA 1UY1A 3K46A 2ZEXA 4CUCA 2W1WA 5JXGA 4DXTA 2VMFA 1W99A 2YFUA 2VMCA 4GWJA 3K4AA 4AG4A 2DCJA 1JYVA 2WBKA 3HOBA 1SHWB 1GU3A 4AAXA 3OEBA 1I5PA 3VDBA 2QQLA 2J1RA 4IUGA 2JD9A 3ACFA 4CU7A 2Y8KA 5B4NA 5IYYA 4QX2A 2PQSA 3OBAA 2VOTA 3K77A 3WF1A 1JU4A 3A23A 2Y6HA 2C9KA 1NAEA 2W3JA 3FN9A 2JDAA 4JHZA 2Y6GA 2VZ1A 2JKXA 3POGA 4GWIA 1JZ5A 5DQ0A 3CZUA 3WF4A 5JR2A 3JXSA 4DUWA 3ACIA 4Z2AA 2VCCA 4FI9A 3NNGA 4XUTA 3GXUA 1EUUA 2V4VA 1OH4A 1JZ7A 1JZ6A 3K4ZA 3LPFA 1JZ3A 1JYWA 2Y6LA 1CX1A 1H6YA 4CU8A 1CIYA 1GOHA 3HNMA 1ULOA 2W1SA 1CZTA 2J7MA 2DCKA 3I2KA 2VQTA 1UXXX 1JYNA 4QB6A 2W95A 1US3A 4RN5A 4LORA 1YQ2A 1H6XA 5EJZB 2VZQA 3THDA 2WO2A 3ZM8A 2BZDA 3U37A 2CDOA 1P8JA 1UYXA 3T0DA 4UOJA 3HNBM 4XUQA 3GM8A 1T2XA 1KEXA 1MPXA 4OZOA 2C4XA 2V72A 2WYSA 2WO3A 3DYMA 5IJRA 4M4RA 3POJA 3POBA 1XPWA 3BGAA 3IIIA 4ZY9A 4LMFA 4YPJA 3CDZB 2WN2A 3LEGA 2WO1A 3J7HA 2WNOA 3MO4A 4CU9A 1UY2A 4CUBA 5IHRA 3I2HA 4MGQA 1OD3A 4CVUA 3OGRA 2ORXA 3LEIA 2XOMA 3VD7A 4QDSA 5LA1A 3C7OA 2VZPA 4ARXA 2YC2A 3NJXA 1J84A 5JUVA 3IDAA 3I2GA 4MGSA 3UESA 4ARYA 3PUIA 2BERA 2W92A 4DEVA 2VC9A 3OGSA 3A21A 2LS6A 4GZ9A 4QX3A 4E8DA 2VMDA 1XNAA 2B4KA 1W9SA 3ECQA 4A42A 4DXSA 4CUAA 3KQ4B 2W94A 1UY3A 2W91A 1DYOA 3CQOA 2X10A 2VZRA 3IAQA 4W8JA 4UAPA 4P00B 4XUOA 3T2OA 1NT0A 1UY0A 3MUY1 5J1XA 1GMMA 2XHNA 5C7GA 2J1EA 2EIBA 2QQOA 5JXJA 3OEAA 5CISA 3NRUA 4ZXEA 4LPLA 1CZVA 5CKNA 4QB2A 1PX3A 2WQ8A 3P6BA 1XNTA 3LE0A 1L7QA 3ABZA 4HG6B 3VDAA 4UI9L 5B4XA 3ETPA 1IQDC 1O59A 4LHSA 1GOGA 1W9WA 4JX0A 5IFTA 4XUPA 2VL4A 1UX7A 3C7EA 4A44A 1WCQA 1OT5A 4MO3M 2VCBA 4OMDA 4QDQA 2W47A 4LQRA 4D8MA 2BGOA 3GDBA 1SPPA 1K12A 2E31A 4A3ZA 3WQBA 4OMCA 3WEZA 2VZTA 1JZ4A 2VCAA 4DEQA 1SG3A 2YG0A 2JE8A 4A4AA 2QQKA 4LOSA 4M4PA 3HN3A 3GGLA 2VJXA 1HN1A 1UY4A 3DYOA 3WF3A 4QDRA 2WAAA 4JKMA 1K45A 5G05L 1UMIA 4KI5M 3A22A 2R7EB 3EYPA 2W87A 5JMOA 4XURA 2B9VA 2EIEA 2ID4A 2QQMA 1UXZA 2WABA 2EICA 2EIDA 4BDVB 5CYYA 4BK5A 2RJ2A 1JZ8A 1PMJX 3I3BA 3WF0A 4XVHA 2QQNA 2E32A 2DDUA 2YB7A 4QB1A 3WNOA 4QX1A 2YFZA 4JKKA 1K42A 2W46A 3E1F1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZEZ A;  3LPG A;  2VZO A;  2ZXQ A;  2WZ8 A;  5FUI A;  3DEM A;  4LOT A;  1JU3 A;  3NQH A;  3MV1 1;  5LCW L;  1UZ0 A;  4PT6 A;  2E33 A;  3A7Q A;  2KD7 A;  1O8P A;  5EJ1 B;  2VO5 A;  1SPP B;  2Y6J A;  3K75 B;  2VZU A;  3OG2 A;  3C8X A;  3IAP A;  1JHJ A;  3W5N A;  4P08 A;  3FHQ A;  4LKS A;  5CKM A;  3T2Q A;  1D7P M;  3CZJ A;  4A45 A;  3VD4 A;  2QQI A;  3MBW A;  3CIH A;  2WZE A;  3UNP A;  2VZS A;  1GOF A;  3I3D A;  4KMQ A;  1SFP A;  2WUH A;  2BGP A;  2XQX A;  2WN3 A;  2C26 A;  1TG7 A;  4CU6 A;  5DMY A;  2WDB A;  1RYY A;  3VD5 A;  4TXW A;  2J1U A;  3UET A;  1OF3 A;  4XZU G;  5HPO A;  2Y64 A;  3I2J A;  4A41 A;  2QQJ A;  3POI A;  4BJ0 A;  4MOA A;  5HXM A;  4E8C A;  4W50 A;  1UWW A;  2J1V A;  3EB7 A;  4PF1 A;  2LW8 A;  4A6O A;  5JXI A;  1DP0 A;  2ZEY A;  3PUH A;  2J1S A;  4MAD A;  4OUE A;  5C70 A;  1PMH X;  2VM9 A;  2W1U A;  3I2I A;  3VD9 A;  1NZI A;  2Z4F A;  4ZZ8 A;  1GQP A;  1LNS A;  1SZB A;  4XUN A;  3WNM A;  3POE A;  2W9X A;  3MUZ 1;  4W4Z A;  3DEC A;  1O8S A;  3I2F A;  4BXS V;  3WF2 A;  4TTG A;  3WNL A;  1UMH A;  1UYZ A;  1NX9 A;  3T09 A;  5CKQ A;  4RYD A;  2RV9 A;  3AC0 A;  5G04 L;  1F4A A;  3HEI A;  2VQU A;  4DUX A;  3IB3 A;  1DLC A;  4PQQ A;  2ORZ A;  3T0B A;  1JZ2 A;  3OGV A;  2W1Q A;  3I3E A;  5IFP A;  5A1A A;  5LA0 A;  1NKG A;  3VDC A;  3VD3 A;  2OKX A;  3THC A;  3T2P A;  5I0D A;  1EUT A;  2J1T A;  2HYX A;  4DUV A;  2J1A A;  3SEP A;  5JXH A;  3POF A;  1PX4 A;  2Y6K A;  1TVG A;  1GNY A;  3LQC A;  1W0N A;  2RVA A;  2VZV A;  3I97 A;  4D0Q A;  1W8O A;  4P02 B;  4KWU A;  3HJR A;  4BK4 A;  2VTF A;  2VME A;  2X05 A;  1W8N A;  2L9L A;  3P1I A;  3FL7 A;  4ET7 A;  2CDP A;  3BN6 A;  4QX0 A;  4QPW A;  3NJV A;  3CKH A;  1L7R A;  1NUK A;  2E26 A;  3T08 A;  2VR4 A;  3WSO A;  2V5D A;  1XC6 A;  5LA2 A;  3SKJ E;  3F2Z A;  3D3A A;  3OB8 A;  1UYY A;  2QBX A;  3HPN A;  3HNY M;  4DXR A;  1W9T A;  1WKY A;  3DYP A;  3C7G A;  2W5F A;  2BBA A;  2X09 A;  3SKV A;  1ULP A;  4OYU A;  3CMG A;  2WAO A;  5F7U A;  5CZK A;  3WNK A;  3ACG A;  5EIY B;  5C71 A;  2YC4 A;  2VZ3 A;  3LEK A;  4QAW A;  1J83 A;  3C7H A;  1SDD B;  2ZEW A;  3WNP A;  3WNN A;  3MV0 1;  3FHA A;  2HLE A;  1JYX A;  2XON A;  1K3I A;  1R64 A;  3K4D A;  2J22 A;  5DPN A;  4ZZ5 A;  1F4H A;  3ACH A;  4JKL A;  1GUI A;  3T0A A;  1KGY A;  1CZS A;  1BHG A;  1JI6 A;  3C7F A;  4L0P A;  1US2 A;  4P5Y A;  5DN2 A;  3W5M A;  1OF4 A;  3SEE A;  1UY1 A;  3K46 A;  2ZEX A;  4CUC A;  2W1W A;  5JXG A;  4DXT A;  2VMF A;  1W99 A;  2YFU A;  2VMC A;  4GWJ A;  3K4A A;  4AG4 A;  2DCJ A;  1JYV A;  2WBK A;  3HOB A;  1SHW B;  1GU3 A;  4AAX A;  3OEB A;  1I5P A;  3VDB A;  2QQL A;  2J1R A;  4IUG A;  2JD9 A;  3ACF A;  4CU7 A;  2Y8K A;  5B4N A;  5IYY A;  4QX2 A;  2PQS A;  3OBA A;  2VOT A;  3K77 A;  3WF1 A;  1JU4 A;  3A23 A;  2Y6H A;  2C9K A;  1NAE A;  2W3J A;  3FN9 A;  2JDA A;  4JHZ A;  2Y6G A;  2VZ1 A;  2JKX A;  3POG A;  4GWI A;  1JZ5 A;  5DQ0 A;  3CZU A;  3WF4 A;  5JR2 A;  3JXS A;  4DUW A;  3ACI A;  4Z2A A;  2VCC A;  4FI9 A;  3NNG A;  4XUT A;  3GXU A;  1EUU A;  2V4V A;  1OH4 A;  1JZ7 A;  1JZ6 A;  3K4Z A;  3LPF A;  1JZ3 A;  1JYW A;  2Y6L A;  1CX1 A;  1H6Y A;  4CU8 A;  1CIY A;  1GOH A;  3HNM A;  1ULO A;  2W1S A;  1CZT A;  2J7M A;  2DCK A;  3I2K A;  2VQT A;  1UXX X;  1JYN A;  4QB6 A;  2W95 A;  1US3 A;  4RN5 A;  4LOR A;  1YQ2 A;  1H6X A;  5EJZ B;  2VZQ A;  3THD A;  2WO2 A;  3ZM8 A;  2BZD A;  3U37 A;  2CDO A;  1P8J A;  1UYX A;  3T0D A;  4UOJ A;  3HNB M;  4XUQ A;  3GM8 A;  1T2X A;  1KEX A;  1MPX A;  4OZO A;  2C4X A;  2V72 A;  2WYS A;  2WO3 A;  3DYM A;  5IJR A;  4M4R A;  3POJ A;  3POB A;  1XPW A;  3BGA A;  3III A;  4ZY9 A;  4LMF A;  4YPJ A;  3CDZ B;  2WN2 A;  3LEG A;  2WO1 A;  3J7H A;  2WNO A;  3MO4 A;  4CU9 A;  1UY2 A;  4CUB A;  5IHR A;  3I2H A;  4MGQ A;  1OD3 A;  4CVU A;  3OGR A;  2ORX A;  3LEI A;  2XOM A;  3VD7 A;  4QDS A;  5LA1 A;  3C7O A;  2VZP A;  4ARX A;  2YC2 A;  3NJX A;  1J84 A;  5JUV A;  3IDA A;  3I2G A;  4MGS A;  3UES A;  4ARY A;  3PUI A;  2BER A;  2W92 A;  4DEV A;  2VC9 A;  3OGS A;  3A21 A;  2LS6 A;  4GZ9 A;  4QX3 A;  4E8D A;  2VMD A;  1XNA A;  2B4K A;  1W9S A;  3ECQ A;  4A42 A;  4DXS A;  4CUA A;  3KQ4 B;  2W94 A;  1UY3 A;  2W91 A;  1DYO A;  3CQO A;  2X10 A;  2VZR A;  3IAQ A;  4W8J A;  4UAP A;  4P00 B;  4XUO A;  3T2O A;  1NT0 A;  1UY0 A;  3MUY 1;  5J1X A;  1GMM A;  2XHN A;  5C7G A;  2J1E A;  2EIB A;  2QQO A;  5JXJ A;  3OEA A;  5CIS A;  3NRU A;  4ZXE A;  4LPL A;  1CZV A;  5CKN A;  4QB2 A;  1PX3 A;  2WQ8 A;  3P6B A;  1XNT A;  3LE0 A;  1L7Q A;  3ABZ A;  4HG6 B;  3VDA A;  4UI9 L;  5B4X A;  3ETP A;  1IQD C;  1O59 A;  4LHS A;  1GOG A;  1W9W A;  4JX0 A;  5IFT A;  4XUP A;  2VL4 A;  1UX7 A;  3C7E A;  4A44 A;  1WCQ A;  1OT5 A;  4MO3 M;  2VCB A;  4OMD A;  4QDQ A;  2W47 A;  4LQR A;  4D8M A;  2BGO A;  3GDB A;  1SPP A;  1K12 A;  2E31 A;  4A3Z A;  3WQB A;  4OMC A;  3WEZ A;  2VZT A;  1JZ4 A;  2VCA A;  4DEQ A;  1SG3 A;  2YG0 A;  2JE8 A;  4A4A A;  2QQK A;  4LOS A;  4M4P A;  3HN3 A;  3GGL A;  2VJX A;  1HN1 A;  1UY4 A;  3DYO A;  3WF3 A;  4QDR A;  2WAA A;  4JKM A;  1K45 A;  5G05 L;  1UMI A;  4KI5 M;  3A22 A;  2R7E B;  3EYP A;  2W87 A;  5JMO A;  4XUR A;  2B9V A;  2EIE A;  2ID4 A;  2QQM A;  1UXZ A;  2WAB A;  2EIC A;  2EID A;  4BDV B;  5CYY A;  4BK5 A;  2RJ2 A;  1JZ8 A;  1PMJ X;  3I3B A;  3WF0 A;  4XVH A;  2QQN A;  2E32 A;  2DDU A;  2YB7 A;  4QB1 A;  3WNO A;  4QX1 A;  2YFZ A;  4JKK A;  1K42 A;  2W46 A;  3E1F 1; 
#chains in the Genus database with same CATH topology
 2KXL A;  1W9Y A;  2VZO A;  4LOT A;  1ZRE A;  1MEC 3;  4L92 A;  5BNP B;  4QQO A;  2TBV A;  1MEC 2;  2JE7 A;  3R4S A;  2XR4 A;  1IGO A;  2DVD A;  5FZ4 A;  3KHB A;  3UGG A;  5FP7 A;  2ADE A;  3DV8 A;  3LFM A;  4HBN A;  5J09 A;  4O61 A;  1APN A;  1O8P A;  4FVV A;  4LIT A;  4AI0 A;  1OLQ A;  2VO5 A;  1ZRC A;  4PDW B;  2Y6J A;  3AMM A;  5DDJ 3;  3B69 A;  3MF9 A;  5DDJ 2;  1IS4 A;  5FK8 A;  1G9D A;  1JHJ A;  5FZM A;  3W5N A;  4QKB A;  3ZLI A;  1OLM E;  2JG9 B;  2QTW B;  3NAP C;  3C3V A;  4IEO A;  4HKO A;  4RS5 C;  4AFC A;  3IT8 A;  1VMF A;  2GP5 A;  3O0W A;  3CZJ A;  1VRH 1;  3K48 A;  2XL7 A;  1GZC A;  1OQE A;  3CU7 A;  2WQZ C;  2GC0 A;  3VKM A;  2P6H A;  4YGD A;  3ZDS A;  4HPK A;  1FAT A;  1S1A A;  1PK6 B;  1QDO A;  3OJB A;  3PVE A;  2BGP A;  5FCC A;  5GZE A;  2Z5W A;  3WX5 A;  4QXK A;  5AFE A;  4RD7 A;  4OHW A;  5CNA A;  4UBG A;  3POY A;  1QOO A;  3KCX A;  3CHX A;  3WG1 A;  1AR7 3;  4OUL A;  4GA9 A;  4XBL A;  4QPY A;  4A41 A;  1AR7 2;  5C3Q A;  1ND2 A;  4AVA A;  1ZZ8 A;  3AKQ A;  1SMV A;  3VBO C;  3ZXG A;  5HV4 A;  2E7A A;  3TNQ A;  1ZNP A;  2JD4 A;  4UFH A;  4GUL A;  5FXV A;  1DP0 A;  3H3L A;  1DIW A;  2VTX A;  4OI1 A;  2ZEY A;  5C5T A;  2ZGS A;  3LEM A;  3TN9 3;  3EQE A;  3TYJ A;  1W39 A;  3TN9 2;  1GP5 A;  1EY2 A;  1LHO A;  3M3C A;  3V0B B;  4YW5 A;  5F39 A;  3WDW A;  5LZ6 A;  4P9X A;  3VD9 A;  4ZZ8 A;  3MI8 A;  2GN3 A;  5C3O A;  5CU1 A;  3IDB B;  3Q9O A;  1V00 A;  3CJX A;  3D8C A;  1Y9M A;  2ZCW A;  2W9X A;  4JQT A;  3MUZ 1;  3RZH A;  1N47 A;  4RGK A;  4BQX A;  3Q8B A;  1O8S A;  3J26 N;  4LO7 A;  1W8H A;  2VMH A;  4YGE A;  1UU5 A;  2E51 A;  4TTG A;  4IV3 C;  4NAM A;  2WIN B;  5CKQ A;  3H7J A;  4SLI A;  4RYD A;  2RV9 A;  3AKP A;  2F6B A;  2YPJ A;  4FAG A;  5IK4 A;  1TNR A;  5G04 L;  1ZA4 A;  5TSW A;  3VZL A;  5DZF A;  2ZML A;  3WP6 A;  1DLC A;  1NCR C;  4IEZ A;  4W6X A;  3UT0 A;  4X6Q B;  5BPX A;  3E5Q A;  1DQ4 A;  2UY9 A;  3T0B A;  2WT1 A;  3ZPY A;  5FZE A;  1CAW B;  1JZ2 A;  3B00 A;  4S2F A;  4CCJ A;  5EPA A;  1W6N A;  3U14 A;  3WP3 A;  1C4R A;  5LA0 A;  3VBU A;  3GZA A;  1NKG A;  2D6P A;  1VBC 3;  3VDC A;  4Z1V A;  3VD3 A;  3THC A;  1VBC 2;  1B09 A;  3T2P A;  2VOK A;  2C5D A;  4EWD A;  2BBV A;  2BP6 A;  2DTW A;  4IE4 A;  1YFU A;  4EN7 B;  2D6K A;  4YZ5 A;  4ZU7 A;  5FXZ A;  4HAN A;  4B8E A;  4IV1 A;  4JGZ A;  2YU1 A;  4CCC A;  3WDX A;  3IMM A;  2VEC A;  2TEP A;  1HRV 1;  1WW4 A;  5IVC A;  3RZG A;  3AJY A;  1W8O A;  4RGA A;  5FZO B;  3JD7 3;  3JD7 2;  2ZJC A;  3ROU A;  4CCL A;  2VTF A;  2WS9 1;  5LBF A;  1I9R A;  2X05 A;  1RUI 3;  3P1I A;  3TB0 A;  2JDH A;  1H2M A;  3OSD A;  3OUH A;  3BTA A;  2CDP A;  1HXS 1;  3PU3 A;  4Q1R A;  4GMP 0;  1U5Z A;  1SLB A;  3AKT A;  4XPV A;  2ENR A;  2Y6F A;  5F3E A;  2BYV E;  5IVV A;  4QPW A;  1JH5 A;  1QXP A;  2R30 A;  5F5C A;  4CCN A;  1RXF A;  2CGO A;  5JLV A;  3HQX A;  5JDB A;  2ATF A;  3I54 A;  4J6G A;  1Q8Q A;  3WSO A;  1N1T A;  3H50 A;  2GN7 A;  1LKN A;  3SKJ E;  2QCS B;  3HQU A;  3IPV A;  2R06 3;  1UYY A;  1XU2 A;  2R06 2;  2ZZJ A;  3GAL A;  3HNY M;  4DXR A;  1W2N A;  4HKL A;  4AI9 A;  1N3Q A;  5FZL A;  5FYI A;  1SLT A;  1A3K A;  2YU2 A;  1O5L A;  3DUI A;  4NWV A;  3VB9 A;  1RUC 1;  1ULD A;  2VUL A;  1OH3 A;  1D2S A;  1ULP A;  1UQX A;  3ZYR A;  5J3U A;  3WNK A;  5I0R A;  2OPK A;  3MW3 A;  4FFH A;  4FXK B;  3OPW A;  2OYZ A;  3RFR A;  3WDV A;  2MPF A;  4M0H A;  4OHV A;  3LEK A;  2XVL A;  4QAW A;  5FY1 A;  4YVW C;  1PVX A;  1SDD B;  1AYN 3;  4LBQ B;  1MZE A;  1AYN 2;  3H1W A;  3WNN A;  1CJD A;  1NLQ A;  1QH7 A;  4R52 A;  4BMB A;  5A3M A;  5M0T A;  1J1T A;  2HWD 3;  5BNO B;  4I3P A;  4Q26 A;  4AI3 A;  2HWD 2;  2FCV A;  5BV6 A;  3WUD A;  2IVI B;  1WZX A;  1LHV A;  3IKW A;  2BNO A;  5DAB A;  4Z92 B;  5LB6 A;  1R64 A;  1C1F A;  1Z0H A;  4O65 A;  1K5M C;  4K8R B;  2P2K A;  3GBW A;  2D97 A;  1KDM A;  4JKL A;  3RRD A;  3RSJ A;  3ETQ A;  1V6N A;  3VBS C;  2FDF A;  1GUI A;  1VBE 3;  2PLV 3;  1KGY A;  4S2H A;  5F5Q A;  4LHL A;  1VBE 2;  1WBF A;  2PLV 2;  1V70 A;  3RVH A;  4L0P A;  1LOE A;  2R16 A;  4N43 B;  5FKB A;  3VKL A;  5FUP A;  1OF4 A;  1KS5 A;  3SEE A;  1AL0 G;  1UY1 A;  3K46 A;  1IG0 A;  2NZ9 A;  1XNK A;  1BEV 3;  4CP9 B;  2GAU A;  2VMG A;  3K51 A;  4OUM A;  2YC0 A;  2QKD A;  1BEV 2;  3EJK A;  5LK5 A;  3LZZ A;  4QU2 A;  2VUC A;  2VMF A;  5LW9 A;  1YIF A;  4B7K A;  1COV 1;  4GWJ A;  2HWF 3;  2DCJ A;  1LOF A;  3AJZ A;  4QM8 A;  1ENQ A;  2HWF 2;  2PYT A;  4GB3 3;  1H0B A;  3HOB A;  4YW4 A;  3ZN4 A;  4GB3 2;  5A70 A;  3OPZ A;  1CIW A;  1SHW B;  2UWC A;  4AGR A;  1JOB A;  4AAX A;  2ZAC A;  4FTE A;  2Q8D A;  4QHZ A;  1BK1 A;  4BQ2 A;  2N7G A;  4NUB A;  3ZXL A;  2GH8 A;  3HIF A;  3QOP A;  4DOU A;  1TMF 1;  4QPG A;  2VOT A;  5FYM A;  4EYU A;  4ZHN A;  4AVV A;  3K77 A;  3V64 A;  4AR2 A;  1GNZ A;  5F9T A;  5A6Q A;  1GIC A;  5C3S A;  1W6P A;  2Y6H A;  1NAE A;  4I3G A;  4BLI A;  1NA1 C;  4OHX A;  5FYC A;  4JHZ A;  4E4D X;  5FZC A;  1NY7 1;  1V6M A;  3QH6 A;  3BTY A;  1KFX L;  2VNV A;  4GWI A;  4K7J A;  1LRH A;  3Q8A A;  1QJE A;  3N36 A;  5I91 A;  2PMW B;  5C9A C;  3GZE A;  2XJR A;  3KV6 A;  1ULC A;  1HW5 A;  3DPR B;  4XJW A;  5A80 A;  1RMU 3;  4OHZ A;  1V6K A;  4C0B A;  1RMU 2;  4OHY A;  3SLI A;  3AMQ A;  1G9B A;  2RMU 1;  1WW5 A;  1JYW A;  3TAY A;  2Y6L A;  1VBD 3;  4XFA A;  3B93 A;  1RB8 G;  1VBD 2;  1XOY A;  3BUC A;  2J7M A;  4WZC A;  4XYX A;  3PU8 A;  4PQ9 A;  2Q1Z B;  4EWA A;  4QX7 A;  1UXX X;  2UU8 A;  1JYN A;  2BWA A;  5LRS A;  4RN5 A;  5GLZ A;  4CDU B;  1GYK A;  4FOV A;  1QKQ A;  3CJI C;  1A8M A;  1WME A;  3PJQ A;  5KR7 A;  1FV3 A;  4NHK A;  4B1L A;  5FRE A;  3RZJ A;  4N90 A;  1EV1 1;  4M00 A;  1WMD A;  4N53 A;  3ZSK A;  1LOC A;  2RS1 1;  1GWM A;  1NLR A;  1W2A X;  4Q27 A;  3SIS A;  5A7Q A;  5C3R A;  1ZBA 3;  1DHK B;  3RYK A;  2D5F A;  1ZBA 2;  2O14 A;  2EA7 A;  5JMC A;  1P8J A;  2NM1 A;  1RUF 1;  2R04 3;  4AHY A;  1U12 A;  3ZYG A;  2R04 2;  1BCX A;  3AZZ A;  2WNU B;  3N9O A;  1MPX A;  1FOD 3;  5I0S A;  2JE9 A;  2CWS A;  4RQP B;  4XFH A;  1FOD 2;  5FYV A;  5A7S A;  2A6X A;  3HN1 A;  1MS9 A;  1OOP B;  2JG8 B;  1WLC A;  3FHI B;  3VKF C;  3ZVX A;  5C8C B;  4AED C;  1OLR A;  1RUJ 1;  3SH5 A;  2OZJ A;  3MW2 A;  2WN2 A;  3RS6 A;  1ZZ9 A;  3LEG A;  2YYO A;  5ABJ C;  5FOB B;  5DZE A;  1SFN A;  2JIC A;  3ILF A;  4HFS A;  1SEF A;  4I0A A;  3MO4 A;  4M3C F;  2BUK A;  1UY2 A;  4CUB A;  1Q8S A;  1QF3 A;  4A7Z A;  5FZB A;  3BTZ A;  2XJT A;  2VD7 A;  3IBM A;  2AUY A;  4XOG A;  3MIB A;  5FZ9 A;  4DFS A;  2ZPX A;  5ANN A;  2VTX J;  5E1R A;  5D8A A;  2UYA A;  3T4H B;  3VDD A;  5JPM B;  3LEI A;  4NMI A;  4TLG A;  1S0D A;  1Q43 A;  4FOQ A;  2X5I C;  4QDS A;  2B46 X;  1BKZ A;  3FLR A;  1H8T B;  2R0F A;  2D3P A;  2VZP A;  2Q8E A;  1JN2 P;  5KWR A;  2FZ1 A;  2WL1 A;  2YC2 A;  3NJX A;  1F5F A;  3PL0 A;  3ZSL A;  1SBD A;  4UW6 A;  3ZSM A;  4NE9 A;  4XXP A;  4Y24 A;  2XVG A;  3UES A;  4ERO A;  2IXK A;  1RUD 3;  3SH4 A;  2PAE A;  5ERL A;  1RUD 2;  2AH2 A;  3BTX A;  1D0G A;  5HCB A;  1O3S A;  1OUS A;  1VB4 A;  2BER A;  2LAL A;  5FYZ A;  1VE0 A;  2LUW A;  3ZPO A;  2F17 A;  3QCW A;  4QX3 A;  5DAP A;  5DAW A;  3RZM A;  1GZT A;  1DLL A;  1S2K A;  2IFR A;  1UNB A;  3RQ0 A;  5AC9 1;  4MGT A;  4A42 A;  4AYU A;  4DXS A;  3OBT A;  3CEW A;  3WT3 A;  3KQ4 B;  1DGR N;  4EZH A;  1UY3 A;  2W91 A;  1DYO A;  5GJ6 A;  3S7E A;  1YC6 1;  1PGL 1;  3G6J B;  5AVA A;  3CQO A;  2VOV A;  2VU9 A;  1BLZ A;  3VZN A;  1CES A;  3CL1 A;  4XUO A;  5FJK A;  2BGC A;  5F6L B;  5FZ6 A;  3O1U A;  4KU7 A;  5A7W B;  2PHW A;  1CX4 A;  1E5I A;  1M06 G;  5FO7 B;  5ACA 1;  2EIB A;  2BFU S;  2XXZ A;  2HWB 3;  2ERF A;  1DDL A;  1H1A A;  2HWB 2;  3OEA A;  3NRU A;  5CIS A;  4NIG A;  5GZG A;  4XBN A;  3WUC A;  4WVZ A;  1AR6 3;  5CKN A;  1D2Q A;  2WLQ A;  1KJR A;  1PO2 3;  5FFO C;  3MFC A;  5BNN A;  1AR6 2;  1QWR A;  1PO2 2;  1KFU L;  3ABZ A;  1ENX A;  2Q4S A;  4HG6 B;  4JZR A;  4R4X A;  1XB9 A;  3UGF A;  4MXW B;  4YM3 A;  4FPH A;  3DXT A;  2DUP A;  4QPI B;  3ZFG B;  1O4Y A;  1W9W A;  2FCU A;  4CEW A;  4CEY C;  1RGS A;  4M3C B;  5C6C A;  3N7L A;  2OT7 A;  5IFT A;  3PUQ A;  2ZAH A;  4XUP A;  5BNP A;  2OQ7 A;  4AW7 A;  5BY5 A;  1UMZ A;  3JU9 A;  1C28 A;  1JYC A;  2HH9 A;  4K8F A;  1POV 0;  5A32 B;  3ZIW A;  5A3N A;  1OT5 A;  2VCB A;  4OMD A;  1AX1 A;  4NWW A;  4XIK A;  3LSE A;  3O12 A;  1ND3 B;  5IVJ A;  3WW2 A;  4MVT A;  1C1L A;  3GDB A;  4XJA A;  4QWN A;  4PDW A;  2E31 A;  1AR9 3;  3JCI A;  3U07 A;  1AR9 2;  4LA3 A;  3PIJ A;  4M0N A;  1ZZ6 A;  4EN8 B;  1UZV A;  1YXW A;  2JG9 A;  2VZT A;  4FPK A;  1POQ A;  3WQ0 A;  1GNH A;  1WBL A;  5CFD B;  4QGL A;  3H3U A;  1SG3 A;  3DCQ A;  3EHK A;  1G9A A;  3VHP A;  1UAI A;  2JE8 A;  2ZGL A;  4BQ1 A;  5F2S A;  5C8W A;  4LBJ A;  2YHJ A;  2OPW A;  4CDQ B;  3O1V A;  3A0K A;  5H9P A;  2P34 A;  5T5P A;  4EJR A;  2R6Q A;  3GGL A;  1HN1 A;  1UY4 A;  1CON A;  1DQ6 A;  2IWG B;  3D4K A;  5CG8 A;  2JDM A;  4D7Y A;  3POS A;  3WF3 A;  2I2S A;  5I8S A;  3WW1 A;  1LOG A;  1Y9Q A;  2BNN A;  4JKM A;  4I01 A;  2FMD A;  1B35 C;  2BJS A;  5A3O A;  2I45 A;  5IAX A;  2R7E B;  5FZ0 A;  1QJF A;  3A4U A;  2WWS A;  2ZGU A;  2VW1 A;  3E6B A;  4MH0 E;  2B9V A;  1EP0 A;  3BOD A;  3ST7 A;  1IS5 A;  2QQM A;  4J1X A;  3ZDV A;  4LT5 A;  2XBO 3;  4YZ3 A;  2ZHM A;  2XBO 2;  2CNA A;  2OII A;  5APA A;  4CDX A;  3MF6 A;  4R9C A;  4JVA A;  2WJS A;  3ELN A;  4V2V A;  5GLU A;  1RXG A;  4L9B A;  4BK5 A;  1DGL A;  3M3Q A;  4AQ6 A;  3C2U A;  3V0B A;  1JUI A;  3IMN A;  1JHN A;  2GDF A;  4HZF A;  5FY0 A;  4NIH A;  5GZF A;  3I3B A;  2AZ5 A;  5K8S A;  3ZN6 B;  4L2N A;  4QB1 A;  4QX1 A;  3ENR A;  3KT7 A;  1N3P A;  4RS5 B;  2YFZ A;  5KHK A;  3ON7 A;  3PUR A;  4JKK A;  1VRB A;  3EBR A;  3U75 A;  2GND A;  4UF0 B;  1S0G A;  4FQ4 A;  4W6W A;  4OQ8 A;  3M3E A;  3PME A;  3ZXK A;  4D3W A;  1SLC A;  1SLL A;  4Q8K A;  2Z2S B;  2ZEZ A;  3MW4 A;  1NYW A;  2ZXQ A;  4NRP A;  2WZ8 A;  3N7M A;  4NID A;  1JU3 A;  2DWR A;  1UZZ A;  4Z2A A;  2JDZ A;  2OQ6 A;  3JQW A;  4LNV A;  3Q8E A;  1KQR A;  2E33 A;  2FDK A;  1V6L A;  1ND2 C;  1CAW A;  2XGX A;  3BB6 A;  3VHO A;  1CGP A;  2PAK A;  1U0A A;  5EJ1 B;  1SPP B;  3K75 B;  5DAV A;  3PHM A;  1RUG 1;  1VAV A;  3C8X A;  1XNC A;  3B94 A;  3IAP A;  4JGY B;  5DAX A;  4AQS A;  3ALQ A;  1R08 3;  4IEQ A;  1R08 2;  1X33 A;  2K46 A;  2OUJ A;  4YZ1 A;  3FE5 A;  1AJK A;  3T2Q A;  1D7P M;  1MS5 A;  1AR8 1;  3O7O A;  2GNB A;  3MBW A;  3KWV A;  5KHH A;  4DO0 A;  5GZD A;  2WZE A;  4JDO A;  1QQP 1;  2XKP A;  5FOJ B;  1GOF A;  1MS3 A;  3M3O A;  1SFP A;  5FZO A;  2WUH A;  1LOA A;  5FP4 A;  2VVE A;  1X7N A;  2BEO A;  2RR1 3;  2XQX A;  3LIG A;  3WNX A;  4Y1X A;  2WN3 A;  2RR1 2;  5DMY A;  4Q4W 3;  2PHD A;  5FY5 A;  2JX9 A;  1OUX A;  2XKO A;  4Q4Y 1;  4Q4W 2;  4IE6 A;  5FJH A;  5C3P A;  1UZY A;  3UET A;  4XZU G;  2VAU A;  3AZW A;  2JJ6 A;  3I49 A;  2C0Z A;  1DZT A;  3I2J A;  4NHX A;  2QQJ A;  4I0B A;  3I8T A;  4CP1 A;  2CAV A;  1WD4 A;  4H2A A;  4MOA A;  5EQU A;  1UWW A;  4XTM A;  3EB7 A;  4PF1 A;  4UBH A;  3NV2 A;  4Q4X 1;  2SLI A;  4H3W A;  1MS4 A;  3U10 A;  5BXX A;  4A6O A;  1NCR B;  5JXI A;  4MZU A;  3JB4 C;  2GNT A;  2W08 A;  5JOZ A;  1W6Q B;  3PUH A;  4Q8L A;  3IN9 A;  4YW2 A;  3VBU C;  3RGB A;  4MAD A;  1W8F A;  3R0R A;  4XW3 A;  3FBM A;  4YAR A;  1HDK A;  2ZX0 A;  4MET A;  1NZI A;  1D4V B;  5FPZ A;  1LNS A;  4XUN A;  4NN0 A;  3JQX A;  3WNM A;  5JSP A;  4IV1 C;  1DGR A;  2VBB A;  5E88 A;  4HET A;  4BA6 A;  2YXS A;  4BZ4 A;  3AZY A;  3I2F A;  3G7D A;  1UU6 A;  1LU1 A;  3I4I A;  1ZZB A;  1BVV A;  2XJU A;  1UYZ A;  4H7M A;  4LBQ A;  4Q0V A;  3RI8 A;  4B4R A;  5FPU A;  1GR3 A;  5I93 A;  1UO9 A;  2G9F A;  4GJZ A;  1F4A A;  3BOP A;  3HEI A;  2VQU A;  4D7S A;  4DUX A;  3B7M A;  4XEZ A;  4PI2 A;  1HX6 A;  1GP6 A;  4IET A;  2MEV 1;  1S0B A;  2HKX A;  2I07 B;  4PQQ A;  1RHI 3;  4B4Q A;  1W8Z A;  3OBR A;  1RHI 2;  4KL1 A;  1UIJ A;  1WLT A;  4YGC A;  2W1Q A;  1VB2 A;  3DKQ A;  5FPB A;  1W6O B;  3WQ1 A;  2UYB A;  2JIJ A;  4FFF A;  4XAA A;  4QQP A;  3VBR B;  1Y43 B;  2OKX A;  1X36 A;  4C90 A;  4GJY A;  1S0E A;  4N43 A;  5FPV A;  5FZI A;  2RS5 3;  2HYX A;  4TSV A;  3H7Y A;  3SEP A;  4ISR A;  1D0H A;  2RS5 2;  3E5U A;  5C4W A;  3ZXF A;  4CRQ A;  2Y6K A;  4CP9 A;  4ONU A;  2QQP A;  2XHK A;  1BYH A;  3I97 A;  1U5I A;  1S2B A;  1WCK A;  4NHL A;  2D6O X;  2CGN A;  1W8T A;  4BK4 A;  3BYW A;  4AHW A;  3W21 A;  5GKA C;  3ME2 A;  3BN6 A;  4C0H A;  4NPM A;  3E97 A;  5JSO A;  1CQ9 A;  3APB A;  1W2U A;  5JOX A;  1VAM A;  1YHF A;  1L7L A;  2XWJ B;  3CKH A;  3QBQ A;  4IND A;  4PLM A;  2DV9 A;  1NUK A;  2E26 A;  4S2D A;  4AGG A;  1E5S A;  3PIG A;  1XC6 A;  2B7Y A;  2UWB A;  1AX2 A;  2GC2 A;  3F2Z A;  4BYY A;  2A1X A;  3AYA A;  3D3A A;  1FPN 1;  2B45 X;  2FHR A;  1Z7S 1;  3OB8 A;  3RWN A;  3H8O A;  3HPN A;  3H8U A;  1Y4W A;  2D44 A;  1W03 A;  1ALY A;  4MYE A;  1OA3 A;  4OUS A;  4JQR A;  1JXN A;  1YJL A;  3KM5 A;  1MQT B;  1RTV A;  3JB8 A;  4OYU A;  1KJL A;  3CMG A;  2K9Z A;  2VUD A;  4HT1 T;  5FBZ A;  3H8X A;  1TZO A;  1BMV 2;  3J8F 1;  2RS3 3;  2G1M A;  2RS3 2;  3M2M A;  1J83 A;  3NV3 A;  3PLQ A;  3PVO A;  4LBO A;  2AC1 A;  2WRA A;  5KBF A;  3WNP A;  5H9S A;  4JRL A;  4NVP A;  3DPR A;  5T3N A;  3D82 A;  4QGN A;  1LOF C;  1W0O A;  2AAC A;  2IXJ A;  5ANQ A;  2AEZ A;  2BV4 A;  2HLE A;  1JYX A;  1F9K A;  4AF9 A;  2DF7 A;  1QJX 3;  1XYP A;  2CWM A;  3CF6 E;  1QJX 2;  5DPN A;  3RJR A;  4GMP 1;  2ET7 A;  2VNR A;  3GZT B;  1AR7 1;  4IGQ A;  3ACH A;  4EN6 B;  4IW3 A;  2BRT A;  1QHD A;  3PTR B;  2PN5 A;  2WT0 A;  3T0A A;  3S6P A;  4ZKT B;  2VUA A;  1SFY A;  4QPG C;  1QJU 1;  3BAL A;  2VW0 A;  3C7F A;  4IEY A;  1US2 A;  1DQ5 A;  4N8M A;  1UL9 A;  4Y22 B;  5DN2 A;  2CGP A;  4CDU A;  1ZRR A;  5A3U A;  5DXD A;  4A7K A;  1XU1 A;  1G6N A;  2WYF A;  1GZW B;  3B9I A;  4XFF A;  5FY9 A;  3N7J A;  2ZEX A;  5IK8 A;  1LB2 A;  1MS8 A;  4XAC A;  1W9F A;  5HCH A;  3ASI A;  4N9I A;  3DN7 A;  4ZS2 A;  5F3I A;  1UW8 A;  3RPQ A;  4H14 A;  1URX A;  4TLF A;  2YFU A;  1LOB A;  2D98 A;  4AG4 A;  1QMJ A;  1JYV A;  5K0U A;  1E57 A;  3FC0 A;  3ZOI A;  1JYT A;  4E4H A;  2YUE A;  2WNU A;  4YVS B;  2ZGN A;  2CYF A;  3WQ7 A;  4ASM B;  1YFY A;  2JKB A;  4AQT A;  4OI2 A;  4RQP A;  5FY7 A;  1KDK A;  2QQL A;  3AK0 A;  4JAA A;  5SV5 A;  4IUG A;  3OPT A;  4Q0P A;  1VRH 3;  1YQC A;  2JD9 A;  2R1D A;  2JG8 A;  3ACF A;  3OBZ A;  1TQ5 A;  1VRH 2;  1O3R A;  2DVG A;  5FZF A;  1V9U 1;  4PBP A;  2AGS A;  3GBG A;  3IDC B;  5GAL A;  5A7P A;  4XFC A;  3KZ4 C;  4K3U A;  3P3N A;  3WF1 A;  1JU4 A;  3O5S A;  2ZAA A;  3A23 A;  1H30 A;  3VBH B;  3DKW A;  4RHV 1;  1C8M 1;  5FIX A;  2WKK A;  4WM8 C;  3MPB A;  3V0A B;  4KWJ A;  2C9K A;  2VUJ A;  4XQD A;  5FPA A;  4LBK A;  2W3J A;  2Y0I A;  2JDA A;  4CDW B;  4RR3 A;  4XTP A;  4XC9 A;  1QU0 A;  4MHR A;  1CPN A;  4YW6 A;  1E5R A;  2PHR A;  2ZX3 A;  4WM7 B;  1G9C A;  1GV9 A;  4OZX A;  4IEX A;  3NO8 A;  4N53 C;  2VCC A;  4FI9 A;  1H8T A;  1ODN A;  5C5U A;  3IIA A;  1OUR A;  2B42 B;  2EXH A;  1EUU A;  2V4V A;  4Y3O A;  3UKV A;  3QLQ A;  4AEK A;  4AWD A;  4AZZ A;  2XLA A;  2WZR 1;  3N9P A;  2XPJ A;  4QU1 A;  1OH4 A;  4QKN A;  2ZHL A;  1JZ7 A;  1NE4 A;  5A3P A;  1JZ6 A;  1J1L A;  1JZ3 A;  2GSY A;  3K3N A;  1N3O A;  1NQD A;  1CX1 A;  3FLT A;  4CU8 A;  1CIY A;  1GOH A;  1X50 A;  2J42 A;  1LGC A;  3OUI A;  3UK9 A;  2W1S A;  2EXJ A;  4Q0Q A;  3GNE A;  4OI4 A;  2VG9 A;  5IAT A;  1CZT A;  3IM0 A;  2HWC 1;  4K20 A;  3O0X A;  3WCR A;  3UGH A;  2VQT A;  4LBL A;  4BB3 A;  4QHB A;  4ATF A;  1US3 A;  2A7A A;  2ZS6 B;  1HIX A;  3U4X A;  4NIA A;  1YQ2 A;  4BE3 A;  1RUI 2;  1UX6 A;  4AED B;  1H6X A;  3KV9 A;  5LWB A;  1QEX A;  1NQJ A;  3T1M A;  3SC7 X;  2WA4 A;  3THD A;  4UW3 A;  3WZ1 A;  1OFN A;  2G4I A;  3MIF A;  3JUU A;  4G4F A;  4RSU A;  5A7W A;  3VDD C;  5D8A C;  4O9G A;  3WP4 A;  3T0D A;  2JDU A;  3RZK A;  2A3X A;  4LK7 A;  4DIN B;  1OQ1 A;  3MEP A;  1SLA A;  2F4P A;  1KEX A;  1WCU A;  3BU7 A;  1AL2 1;  3NNM A;  2X5I B;  1AYN 1;  1D4M 1;  2V72 A;  2JXA A;  5DUV A;  5LAT A;  4QXH A;  3DYM A;  2MNG A;  4YM1 A;  1OFS A;  2OW4 A;  4KQ7 A;  3UYJ A;  2WFF 1;  2Q8O A;  1CAU B;  4PIZ A;  1HRV 3;  1YQ5 A;  3RYP A;  1AXK A;  4PLN A;  1HRV 2;  2WR9 A;  5IWF A;  3H9A A;  2K0G A;  3CDZ B;  3TNP B;  4PIY A;  4MXW A;  2WS9 3;  2XML A;  3J7H A;  3ZYB A;  4QPI A;  3ZFG A;  4D69 A;  4EV0 A;  1S4C A;  2WS9 2;  3AVS A;  5IK5 A;  3OUJ A;  1HXS 3;  1LOD A;  3KV4 A;  4WBB A;  5IHR A;  1HXS 2;  3OD0 A;  4PCR A;  3ZFF B;  1OD3 A;  1JMU B;  1ZRI A;  2KR2 A;  5I8T A;  3O1O A;  5JZG B;  4Y5S A;  4QT6 A;  1UPI A;  4XF9 A;  4Y5T A;  1I5Z A;  1ND3 A;  1R09 1;  1DGW X;  5L9B A;  1YI9 A;  2NP0 A;  2DU0 A;  4I02 A;  3M1H A;  2XOM A;  4FPL A;  3WDT A;  4XZP A;  3VGI A;  1AXY A;  1YYN A;  3QD6 A;  3C7O A;  1W8U A;  5EJ3 A;  4MLO A;  2EXK A;  3ZMO A;  4BQY A;  1GQH A;  1QNY A;  3AMH A;  1FV2 A;  4MGS A;  5CFD A;  5L7O B;  1ULE A;  1FNZ A;  1RUC 3;  3Q8F A;  4OFG A;  3PUI A;  1GFF 2;  1RUC 2;  3INA A;  5EYX A;  1OI6 A;  4CDQ A;  3LCP A;  2VC9 A;  1XJA A;  3OGS A;  4PLO A;  5KHG A;  3VL9 A;  3BKZ A;  1RVF 1;  4KH9 A;  1HQL A;  2JDN A;  4GZ9 A;  5BNN C;  4IE7 A;  4E8D A;  4Y4R A;  2VMD A;  4QX8 A;  4HN1 A;  5F5I A;  4I30 A;  3N7K A;  5FKC A;  1H2L A;  2E7T A;  2JWP A;  2X8K A;  3WG3 A;  4UFL A;  3I59 B;  3R4D B;  4CEW C;  4DXZ A;  2D3R A;  2QNK A;  4W8J A;  4UAP A;  5BNP C;  3JBG 1;  4YSF A;  2Z79 A;  4ZS3 A;  2WT2 A;  5FMD A;  2ARA A;  2WQ4 A;  1QJZ A;  4RFR B;  4UFJ A;  5F2W A;  3VN4 A;  4DQA A;  1A34 A;  4BQ3 A;  2GZW A;  1UY0 A;  3MUY 1;  1GMM A;  2D93 A;  2WC2 A;  2ZBJ A;  4PDW C;  3ZN5 A;  5C7G A;  1ZX5 A;  2J1E A;  4GH4 B;  4Q0S A;  2QQO A;  2IZW A;  3MFA A;  1NCQ B;  4CP2 A;  1W8W A;  5LEJ A;  5EYY A;  1TEI A;  2DVA A;  1RED A;  5GM0 A;  3O1S A;  1YJK A;  2JG9 C;  3MIC A;  1ST8 A;  1AVB A;  3SXW A;  1UU4 A;  5IT6 A;  3J7M A;  2VE1 A;  4QB2 A;  5T5J A;  3I3M A;  3ZN6 A;  1PX3 A;  3DL3 A;  4ZU4 A;  1C5H A;  5GLT A;  4UF0 A;  1OSG A;  4HLT A;  1LEC A;  3GCW A;  3NMB A;  1RIT A;  4UI9 L;  5B4X A;  3VDA A;  3WD5 A;  3I2O A;  1COV 3;  2XDV A;  4LHS A;  4AFM A;  4XF0 A;  1COV 2;  3D0S A;  4XDP A;  3M7A A;  4A44 A;  3AZX A;  5FZ8 A;  3AB0 A;  2P5B A;  5T52 A;  4OQ9 A;  3ZSJ A;  1NLS A;  4FP2 A;  4QDQ A;  1HRI 1;  4COY A;  3O14 A;  2D6M A;  3KS7 A;  5GLV A;  1SPP A;  1RIN A;  1K12 A;  3VBF A;  4A3Z A;  5EP9 A;  5AVP A;  2P17 A;  3USU B;  5CAD A;  5L9V A;  1OKQ A;  4JGY A;  3WQB A;  1TMF 3;  2BW8 A;  4FT8 A;  3A0N A;  1TMF 2;  4CDX C;  5L19 A;  3WEZ A;  4AAP A;  5CEH A;  3AP6 A;  1AX0 A;  2HWE 1;  2Y33 A;  3V65 A;  1S2E A;  4EQV A;  5I0U A;  1BBT 1;  1IS6 A;  2DVF A;  3OCP A;  4BIF A;  4E9K A;  4DEQ A;  4LLF A;  4R9D A;  2OXB A;  3HD8 B;  4LIU A;  2FDH A;  3HN3 A;  2VJX A;  1NY7 2;  1PGW 2;  5KXD A;  3KGZ A;  5FTT C;  3WHT A;  1PVC 3;  2VOW A;  3DYO A;  4TWT A;  1VMH A;  1PVC 2;  3GHM A;  1ZZ7 A;  2IXI A;  4JCK A;  1K45 A;  4XJU A;  3TEX A;  1LED A;  1UOB A;  2RDN A;  5F3C A;  2NQY A;  3GZU C;  2H0B A;  2RMU 3;  3LOI A;  1F5J A;  2EIE A;  2ID4 A;  2RMU 2;  4RGG A;  1H8V A;  3ZFE B;  2EID A;  5FZH A;  3RG0 A;  2BVV A;  5CB7 A;  1HJG A;  1W6Q A;  1PZ9 A;  3TBD A;  1XYN A;  4Q4V 1;  1ND2 B;  1SLI A;  1POV 1;  1AXZ A;  1JZ8 A;  3NJY A;  4Z07 A;  4HL0 A;  5EV7 A;  2BVB A;  4LBM A;  5FLH A;  2FDG A;  4COV A;  4ES8 A;  1OMI A;  2VCM A;  1VMJ A;  2XLG A;  1STM A;  4MGZ E;  3WF0 A;  5CFC A;  2QQN A;  2E32 A;  3NKG A;  2DDU A;  3ZX7 A;  1EV1 3;  1FNY A;  1GP4 A;  1Q5O A;  1W2O A;  2ARE A;  3AYC A;  4LEJ A;  1EV1 2;  2RS1 3;  1PM7 A;  1RUD 1;  2FCT A;  2RS1 2;  1OHF A;  1VJ2 A;  1VR3 A;  1RIR A;  3E1F 1;  3E5X A;  1HQN A;  2A75 A;  4C1X A;  4CU6 A;  2BNM A;  1RUF 3;  1YUD A;  3L9J T;  4NPL A;  5FUI A;  2C9A A;  1RUF 2;  3NQH A;  4K21 A;  4O7X A;  3MV1 1;  2VMI A;  4RFT 0;  5LA9 A;  5J37 A;  2AYH A;  3PVN A;  5K4L A;  1UZ0 A;  3USS A;  1ASJ 1;  1MVE A;  3A7Q A;  1WA6 X;  2KD7 A;  4XMI A;  2YPD A;  2CTV A;  4N7U A;  1W6O A;  3HBZ A;  4BLJ A;  3H1Y A;  3MLK A;  3OG2 A;  5KC6 A;  3HVD A;  1W2T A;  2A71 A;  1UOF A;  3VBR A;  4EN9 B;  4CXY A;  1VAK A;  1M4W A;  3ZXE A;  3ZYI B;  2WWU A;  3ZO0 B;  4P14 A;  4IEW A;  2BFU L;  3K3O A;  2E53 A;  3PJY A;  2EIG A;  1QGL A;  4ZON A;  3KSC A;  2QQI A;  2ET1 A;  4LJH A;  3CIH A;  2GC1 A;  5E6H A;  5FY4 A;  3SCG A;  4QKD A;  3NKT A;  3UNP A;  2VZS A;  4MGY E;  2D5H A;  3CBN A;  4NO4 A;  1SQ4 A;  2PHF A;  4XJ8 A;  1ZZC A;  5A1L A;  3I7D A;  1WMF A;  2HJI A;  3HT1 A;  4IV1 B;  3FJS A;  1VBA 1;  1SCR A;  2WDB A;  3EMR A;  2F4L A;  4GXL A;  4LR4 A;  5LY2 A;  3VD5 A;  1FX5 A;  5JOY A;  2J1U A;  5JR7 B;  1CAX B;  1OF3 A;  5A1F A;  1XE7 A;  2Y64 A;  4JTO A;  1PHM A;  4BH9 A;  5BYN A;  2EAA A;  2XJV A;  1LCL A;  4COZ A;  1RUO A;  4V1P A;  4W50 A;  4E8C A;  3MID A;  1LGB A;  4NR1 A;  4LE4 A;  4QKF A;  4AFA A;  3WW3 A;  3FFQ A;  3LDB A;  3TWI A;  4MX3 A;  3B02 A;  3GF6 A;  3NVC A;  3BPS A;  4P9L A;  2J1S A;  4BQ5 A;  2JB8 A;  1QJY 1;  1PIV 1;  1TME 1;  2DUR A;  3VZJ A;  4OUE A;  2HBU A;  2WNV B;  5C70 A;  4D7T A;  5AC9 3;  2D43 A;  1DZQ A;  4Y26 A;  5AC9 2;  4HVQ A;  4AOC A;  1GQP A;  1MQT A;  1SZB A;  1RUN A;  5FV3 A;  3N9M A;  3POE A;  3KQR A;  2NYY A;  3CNA A;  5C4W C;  4XHB A;  3S5A A;  2DU1 A;  5FP3 A;  1PGL 2;  1JS9 A;  1KXG A;  3DEC A;  1A78 A;  4Y1Z A;  3R05 A;  4IE5 A;  4BXS V;  3SCH A;  3WF2 A;  3T09 A;  4AXO A;  1IG3 A;  5LEK A;  4XF4 A;  2HEV F;  3AC0 A;  4LKF A;  5FLI A;  5IVE A;  2I74 A;  2V73 A;  4XDQ A;  2DYC A;  4LO4 B;  5LAS A;  3IB3 A;  4LA2 A;  1FXZ A;  2W52 A;  1HJF A;  4Y5Z 0;  3H1M A;  1GWL A;  2ORZ A;  3U11 A;  1K5J A;  3J7N A;  3WHU A;  1X82 A;  3I3E A;  5IFP A;  1U5X A;  5A1A A;  1YIP A;  5FXX A;  1YQ8 A;  2ARB A;  5HI0 A;  4JTN A;  2BDR A;  1J3R A;  5F8P A;  1PK6 A;  1R1Z A;  4AK3 A;  2DBN A;  3MIH A;  3QH7 A;  4HK8 A;  1JTZ X;  2ARX A;  2J1T A;  3BIW E;  2W68 A;  4MXV A;  1MR5 A;  4BU2 A;  5JXH A;  1GZW A;  3POF A;  1PX4 A;  4LUM A;  4WZF A;  5CIR A;  1GNY A;  3LQC A;  1O7F A;  1W0N A;  2RVA A;  5FYB A;  4E2G A;  3AL5 A;  4D0Q A;  3LA2 A;  2ZGQ A;  4KWU A;  4URA A;  3CLP A;  2VME A;  2L9L A;  3FL7 A;  1OD5 A;  2AEN A;  2EVX A;  5I8Y A;  2Q8C A;  4XE9 A;  5KHJ A;  3KD4 A;  4NRM A;  4YVS A;  5FLJ A;  4AFD A;  2RDS A;  1EAH 3;  4OLL A;  1W3X A;  3DPR C;  1EAH 2;  3NJV A;  4LHN A;  1DQ0 A;  3ATG A;  2YRO A;  4KBB A;  1PO1 1;  5FZG A;  3NNF A;  3U1X A;  4F3J A;  2IFW A;  2V5D A;  3VZO A;  5JIU A;  2G9G A;  3ES1 A;  2FQP A;  1EYB A;  2YGM A;  3NAP B;  1MS0 A;  2OZ6 A;  1W9T A;  1O6U A;  1WKY A;  3B5L B;  5F6K A;  3VBH A;  3C7G A;  2Q30 A;  5F1R A;  2YV8 A;  3VLB B;  3FZ3 A;  3V0A A;  5A33 B;  1W04 A;  2BBA A;  1IKP A;  4ZXK A;  1AYM 1;  4FOY A;  1LR5 A;  4EE2 A;  4CDU C;  2WAO A;  4XFB A;  5CZK A;  3ZYP A;  2R07 1;  3ACG A;  2D6L X;  4CDW A;  5F7U A;  4QPG B;  5C71 A;  1L3J A;  2ZTN A;  3AP5 A;  4WM7 A;  4YM0 A;  2YC4 A;  2GU9 A;  2IXL A;  2VZ3 A;  4JHT A;  3N9Q A;  3ZYF A;  1AJO A;  1OVS A;  3C7H A;  2KA3 A;  2PHU A;  1LJ7 A;  4Y1U A;  5JPN B;  2ZX1 A;  2GP3 A;  1Y9G A;  5T55 A;  5CA6 A;  5K0U C;  1S0J A;  3VBO B;  3SQO A;  3OOX A;  5FO8 B;  3AMN A;  4UFI A;  3NL1 A;  3M3I A;  5FPX A;  1K3I A;  3K4D A;  2J22 A;  3FUO A;  1RUH 1;  4R4Z A;  4RQP C;  2GAL A;  2P3I A;  1WLD A;  1DF0 A;  4IXL A;  3WOG A;  1R1A 1;  1I1E A;  3CO2 A;  1OA2 A;  2JG8 C;  2R1B A;  2XUM A;  2RM2 3;  4QMA A;  1QH6 A;  1RL3 A;  2RM2 2;  1ZBE 1;  3LAG A;  3AP4 A;  3PMS A;  1JI6 A;  1JOP A;  4W6Y A;  3H8R A;  2V09 A;  1DG6 A;  1GBG A;  1NZC A;  2DUO A;  3THP A;  1OA4 A;  5E16 A;  5FQ0 B;  1XQN A;  3O1R A;  2A5Z A;  4CUC A;  2W1W A;  5JXG A;  4ES9 A;  4RR3 C;  4IV3 B;  4BPZ A;  2D7F A;  4UW5 A;  4WM8 B;  3PVB B;  2VOX A;  1W99 A;  3SCF A;  4YFZ A;  4FCA A;  1CAV B;  5FWJ A;  1ZRF A;  3K4A A;  2Q1F A;  3RJ2 X;  2G19 A;  1H4G A;  2NPI A;  1RUG 3;  2RDQ A;  3O0V A;  4PF5 A;  4B3N A;  1H8T C;  1RUG 2;  2BWC A;  4N53 B;  3ZKU A;  4WVM B;  1GU3 A;  3GJB A;  2X5I A;  4FBF A;  3VDB A;  1BK0 A;  1AR8 3;  4ASL A;  1SAC A;  2Y8K A;  4IEV A;  5B4N A;  5IYY A;  2GNM A;  4QXC A;  1QQP 3;  1CAU A;  4JGZ C;  4HSJ A;  1QQP 2;  4A2U A;  5FZ7 A;  1RHI 1;  1PM4 A;  4QQ2 A;  1PMI A;  1RUE 1;  1OVP A;  2Q0A A;  4QM9 A;  1C5I A;  4AI2 A;  4HMZ A;  1AUY A;  1WWY A;  2H0V A;  3OGG A;  2CU5 A;  2EAL A;  4OVE A;  4YNI A;  2R32 A;  2VQ0 A;  4CPB D;  2XH6 A;  3ZFF A;  2CL2 A;  2VZ1 A;  2Y6G A;  4K1Z A;  4CCO A;  4AL9 A;  4R9B A;  4JDN A;  5BNO A;  5JZG A;  2BPA 2;  1WMX A;  1JZ5 A;  4Y20 B;  1XSQ A;  3CZU A;  2YZ4 A;  5LBC A;  2BTV C;  1QIQ A;  3E6D A;  1XNB A;  2LRP A;  3ACI A;  4Q4X 3;  4N7I A;  4FPE A;  3NNG A;  4XUT A;  4XQ4 A;  3OYW B;  3MLJ A;  4Q4X 2;  4XMA A;  2FMY A;  3GXU A;  3TOJ A;  1FMD 1;  3AKR A;  1UN1 A;  2X53 S;  2OVU A;  4P5H A;  1LTE A;  1YNA A;  2YY1 A;  1MVQ A;  4UFM A;  5JSR A;  3VDD B;  3FLP A;  1GZ9 A;  5EWS A;  4BWO A;  5KXC A;  3K4Z A;  1H4H A;  5L7O A;  1J3P A;  3BCW A;  3FMG A;  4HON A;  2ZOE B;  3LKJ A;  2TUN A;  3N35 A;  1BQP A;  2ZMK A;  3HNM A;  1ULO A;  3J4U H;  5FZK A;  1VBB 1;  3WIN E;  4D6Q A;  3GHN A;  5ISL A;  4L11 A;  4QB6 A;  5D1I A;  3O1M A;  4K6B A;  4LOR A;  5GZC A;  3P5B A;  1MAC A;  4QPI C;  1DYK A;  3ZFG C;  3I59 A;  4IL7 A;  4FAH A;  5DAQ A;  3ZYH A;  2VZQ A;  2FZ2 A;  4BOW A;  4YVW B;  1SBF A;  2WSU A;  2WO2 A;  3KT1 A;  3T3Y A;  3M70 A;  5FBJ A;  4O9E A;  3ZM8 A;  2BZD A;  5JWP A;  4KGQ A;  1ND3 C;  2CDO A;  2ZGT A;  1UD1 A;  4I09 A;  3HNB M;  1MEC 1;  4GH4 A;  2QDN A;  3W59 A;  1NCQ A;  2SBA A;  4CA9 A;  4DRV A;  4IGO A;  4OZO A;  4PIX A;  5LK7 B;  4HSL A;  1K5M B;  1ODM A;  2WYS A;  3KT4 A;  3NV4 A;  5JI7 A;  5IJR A;  3ZKY A;  4M4R A;  5DDJ 1;  1ZA7 A;  3UKN A;  3LD8 A;  3VBS B;  2VXJ A;  4QQL A;  4FO9 A;  4HOO A;  3VKO A;  1REE A;  1GQG A;  4ZY9 A;  4LMF A;  4KG0 A;  4CDQ C;  3NWK A;  4EZ4 A;  3MHZ A;  1QXR A;  1WUV A;  1YEW A;  2XB6 C;  4YPJ A;  2IXC A;  1QJX 1;  3WW4 A;  4NJ4 A;  1J3Q A;  1LEM A;  2CY6 A;  3WXP A;  4BHP A;  5LY1 A;  4BCU A;  5AFB A;  1OPM A;  5FDB A;  3MPP G;  2XQR A;  3OD4 A;  3QAC A;  4CE8 A;  2YDE A;  4QD2 A;  4CVU A;  4IQP A;  4FP3 A;  3OGR A;  5FMO S;  1Y3T A;  4QXB A;  2C6S A;  3KV5 A;  4XAE A;  4CXW A;  1S55 A;  4XCB A;  2P3K A;  2QZ2 A;  4GD4 A;  4AFB A;  4DY3 A;  3IDE A;  3USU A;  2ZX2 A;  3VD7 A;  5LA1 A;  1XE8 A;  3POW A;  2ZZQ A;  2ZHK A;  4NRO A;  1FPN 3;  1J84 A;  1HV1 A;  1Z7S 3;  2AEY A;  3IDA A;  1FPN 2;  4HKW A;  1Z7S 2;  4FFG A;  3S30 A;  1JOJ A;  4J25 A;  3T30 A;  4AQ2 A;  4Q1P A;  2OX0 A;  4X8N A;  3LWC A;  5CG9 A;  2XJS A;  2DVB A;  2PTM A;  4ARY A;  2RDR A;  4P9G A;  4COW A;  1FYU A;  1TNF A;  3LSD A;  1GKB A;  3TN9 1;  1ULG A;  2LS6 A;  3W58 A;  3J8F 3;  4YZ2 A;  3S57 A;  1G9F A;  3UL2 A;  3J8F 2;  5E8A A;  3HQR A;  1XNA A;  3AP7 A;  1W9S A;  3HWJ A;  4QGM A;  1NA1 B;  3ECQ A;  2OUH A;  1QDC A;  4Z8B A;  2W94 A;  3BVC A;  1PGS A;  5FAX A;  1CD3 G;  1XBF A;  3AL6 A;  4WVW A;  5T54 A;  2VBP A;  2X10 A;  3WR0 A;  3IAQ A;  3ES4 A;  5C9A B;  2WWJ A;  4GIQ A;  4HK9 A;  3ZXJ A;  3ZFE A;  5LBB A;  2GMM A;  4XF1 A;  1NT0 A;  2P3Y A;  1OOP A;  4GMP 3;  5J1X A;  5A6Z A;  5C8C A;  4FTB A;  2XHN A;  2VVF A;  3VBF C;  2A6Z A;  4XBQ A;  5JXJ A;  3AZV A;  1XND A;  4JGY C;  3KVB A;  1OBN A;  1QJU 3;  3KCY A;  1LHW A;  2EXI A;  4IE0 A;  1QJU 2;  3MYX A;  2GH2 A;  2PFW A;  3EXU A;  4LO6 B;  4XF3 A;  3LDR A;  4J1W A;  4Y1V A;  1H1I A;  1QNW A;  3B01 A;  3MLL A;  1VBC 1;  2WQ8 A;  3P6B A;  1XNT A;  2DCT A;  4CDX B;  1PZ8 A;  3LE0 A;  1L7Q A;  1S0C A;  5LRR A;  4YLZ A;  2EF6 A;  3I2D A;  3LA7 A;  4ZU5 A;  1CN1 A;  2YBK A;  3PUA A;  4YW3 A;  3ETP A;  3CJI B;  5FY8 A;  3SH3 A;  1VP6 A;  5BNQ A;  1FT9 A;  3VHN A;  1GOG A;  2OA2 A;  2E7Q A;  4LKE A;  3GJA A;  4JX0 A;  3R4U A;  4R8H A;  5KC5 A;  1W90 A;  2PEL A;  2VL4 A;  2ZX4 A;  4E2Q A;  1RC6 A;  4K40 A;  1WCQ A;  1T6G C;  1N1V A;  3JD7 1;  4HXC A;  2P4E A;  3F95 A;  2VH9 A;  5DUW A;  2W47 A;  3ZMN A;  4YZ4 A;  4D8M A;  1RUI 1;  4TN7 A;  4MHU A;  3VUO A;  1O3T A;  4A7Y A;  1V9U 3;  1LHN A;  1OPO A;  1WW7 A;  3S7I A;  1V9U 2;  4KNC A;  3FX3 A;  5J7M A;  4L99 A;  2VCA A;  1LUL A;  1C8M 3;  2XG3 A;  3KF3 A;  3PUS A;  2YG0 A;  4LKD A;  4RHV 3;  3AYD A;  1C8M 2;  4RHV 2;  1NG0 A;  4IEU A;  2WFP A;  2AR6 A;  4UW4 A;  4A4A A;  2DTY A;  2VBD A;  2BOJ A;  2YBP A;  3PNA A;  4M4P A;  5CFC C;  2R06 1;  1JUH A;  2A6Y A;  5ABJ B;  1KD7 A;  2P1B A;  2NN8 A;  1LES A;  2QJV A;  4LO5 B;  3AXE A;  2CHH A;  3KHC A;  3UJO A;  1DQ2 A;  4FPF A;  2IXH A;  4QDR A;  4Y1Y A;  2WAA A;  2H6C A;  4MGK E;  2YGL A;  1GLH A;  1YQ6 A;  5FR3 A;  1CAX A;  1T6B X;  2BOI A;  1UMI A;  4XQW A;  4AVC A;  2ZAB A;  4KI5 M;  4LUL A;  1QY4 A;  5EXO A;  2VGD A;  2HYK A;  2WZR 3;  3EYP A;  1SBE A;  1QOT A;  2R49 A;  2WZR 2;  4YG3 A;  5DG2 A;  5FZ3 A;  2JEC A;  1UXZ A;  2XJP A;  4DPN A;  2DCZ A;  2W2I A;  4U2A A;  4EWE A;  4BDV B;  4YG0 A;  2HWD 1;  5IK7 A;  4IEP A;  2WII B;  4FPO B;  2HWC 3;  2QFE A;  2RJ2 A;  2W0X A;  2JEN A;  3VBR C;  2WNV A;  1PMJ X;  2HWC 2;  3HBK A;  2Y60 A;  4AEM A;  5FUN A;  2DCY A;  3BIE A;  3IWZ A;  3FWE A;  2VNG A;  4LUK A;  4M3C A;  2FD8 A;  2VPV A;  1XRU A;  2MHF A;  1W06 A;  2YB7 A;  2PHL A;  3WNO A;  3U78 A;  1VBE 1;  2PLV 1;  3VKN A;  5A32 A;  3VV1 A;  4I0W B;  4KGG A;  1XXN A;  2B39 A;  4XJZ A;  2ZGO A;  4UFK A;  2W46 A;  4ZPI A;  2R0H A;  1GAN A;  3UV9 A;  5A3L A;  4Q2F A;  3OTF A;  3RDI A;  1QXJ A;  1BEV 1;  1MZF A;  3LPG A;  4NII A;  3DEM A;  3GYD A;  2YBS A;  3LFI A;  2IVJ A;  5IVB A;  4YFW A;  4PT6 A;  5LCW L;  4BIO A;  4X8P A;  1AL2 3;  1Z78 A;  3NJZ A;  1D4M 3;  1AL2 2;  1FI2 A;  5DUX A;  2XL9 A;  1DFQ A;  1D4M 2;  2HWF 1;  5A6Y A;  5FYT A;  1HV0 A;  1Q8O A;  2VZU A;  3LDK A;  4GB3 1;  4LLO A;  2WSV A;  1KRI A;  2WFF 3;  5DG1 A;  2WFF 2;  4PI0 A;  4P08 A;  2FDI A;  3FHQ A;  4LKS A;  4WV8 A;  4YG6 A;  1CR7 A;  1W05 A;  1O4Z A;  2P37 A;  3FBY A;  5L36 A;  2QUO A;  4UYB A;  4XJ9 A;  5CKM A;  3LB9 A;  5I0T A;  5FZ1 A;  2FBE A;  3B9C A;  5K9Y A;  3VZM A;  4CCE A;  4A45 A;  3VD4 A;  2JEM A;  1N1S A;  4CTE A;  5C33 A;  1W6M B;  3B3Q E;  4K1Y A;  5JCT A;  5HBA A;  1MQT C;  4MV2 A;  3RI9 A;  1VPH A;  2NMO A;  4Z82 A;  3I3D A;  4KMQ A;  4YWA A;  2VNO A;  3HAG A;  2GME A;  2Z69 A;  4CEY B;  1R09 3;  2Y0O A;  2C26 A;  1TG7 A;  1R09 2;  3AVR A;  3MGU A;  4C8D A;  3DXU A;  1DU3 D;  4XIL A;  1RYY A;  4HN0 A;  4Y4Y A;  5C4W B;  4TXW A;  4LK6 A;  1VAL A;  1NXD 1;  3AYE A;  2B5H A;  5HPO A;  4FSJ A;  4DMI A;  1JBC A;  1EPZ A;  3POI A;  4BJ0 A;  4KWL A;  4DNY A;  5CAZ A;  4DIQ A;  3KLS A;  1IOA A;  4DS0 A;  4LIV A;  5HXM A;  2J1V A;  3SHR A;  1O91 A;  5A7O A;  3SMH A;  2LW8 A;  5FYS A;  4R9A A;  3GCX A;  5HCF A;  4UWD A;  5E89 A;  5FPL A;  4B7E A;  4CZS A;  1IZ3 A;  1RVF 3;  1RMU 1;  3NAP A;  1ACC A;  3AFG A;  2XUE A;  4RS5 A;  4M3C E;  1RVF 2;  4XHX A;  3L2H A;  2E63 A;  1ENR A;  3LA3 A;  3ZR5 A;  3VZK A;  2RJK A;  1PMH X;  2VM9 A;  1PK6 C;  2W1U A;  3I2I A;  3OY8 B;  4GKY A;  2Z4F A;  5A33 A;  4CP0 A;  1VBD 1;  4D6S A;  3T1L A;  2ZKN A;  2D3S A;  1U5Y A;  4W4Z A;  2CAU A;  3JBG 3;  2QDR A;  3JBG 2;  1UMH A;  3WNL A;  1G8W A;  1NX9 A;  3O1T A;  1ZRD A;  4IDZ A;  1B35 B;  1WCD J;  1TE1 B;  2PQQ A;  3LF7 A;  4JC1 A;  4QHO A;  3NV1 A;  3LIH A;  3VBO A;  1PGW 1;  3AFK A;  4YVS C;  4DY5 A;  1PVC 1;  3HR9 A;  4CCK A;  4S2G A;  1ZBA 1;  1MZ6 A;  3OGV A;  5CVR A;  5EZW A;  2R04 1;  4B29 A;  4EN0 A;  4C1W A;  1C57 A;  2B9U A;  4AVB A;  5D21 A;  1J59 A;  4XDO A;  1IKQ A;  1FOD 1;  2QQU A;  3KCC A;  5I0D A;  2ETE A;  1UCX A;  1EUT A;  3ORJ A;  2A3Y A;  4DUV A;  2J1A A;  3TEY A;  2ZKL A;  3VBH C;  5T50 A;  2X29 A;  3TEW A;  5FQ0 A;  3IZO A;  4HVR A;  4MG2 A;  1TVG A;  3PDQ A;  2VZV A;  3N9L A;  4HPK B;  3T4V A;  2K2S A;  4IV3 A;  4CDW C;  4KWK A;  1CVN A;  4WM8 A;  2Q1M A;  4P02 B;  4OI0 A;  1HRI 3;  4WM7 C;  5JVV A;  3HJR A;  1HRI 2;  1CAV A;  3ACL A;  3D5O A;  1W8N A;  3R6S A;  3WDY A;  2Y38 A;  2ES3 A;  1MS1 A;  3BI3 A;  1NCR A;  3ZYJ B;  4ATE A;  1W28 A;  4QX0 A;  4XXA A;  1Y7B A;  2NLR A;  4WVM A;  1W3V A;  3WCS A;  2WNE A;  2HWE 3;  1L7R A;  1BBT 3;  2HWE 2;  4KBZ A;  3S5Q A;  3URF A;  1HB3 A;  3T08 A;  1BBT 2;  1HB1 A;  4YW1 A;  2VR4 A;  4Q0U A;  5K0U B;  1XYO A;  1F2N A;  2VW2 A;  2QE3 A;  2D6N A;  2B8M A;  1V6I A;  5LA2 A;  5KXE A;  1JW6 A;  5HCA A;  2LTN A;  2PA7 A;  2QBX A;  3BU0 A;  1H2N A;  4G9S B;  2W39 A;  3DYP A;  4XFI A;  1X8M A;  4D6R A;  1HKD A;  1UZW A;  2W5F A;  2X09 A;  2DFC A;  2ZGR A;  4AI8 A;  1DCS A;  1OC1 A;  2QVS B;  3RZL A;  5FWE A;  2A3W A;  4FFI A;  4BM8 A;  3M4F A;  5EIY B;  1H2K A;  5IW0 A;  1O3Q A;  1HN0 A;  4Y20 A;  3NW4 A;  4P9I A;  3X29 B;  2GMP A;  4NPR A;  1DGW A;  1Q8V A;  2ZEW A;  1UOG A;  1SDW A;  1Q3E A;  2KM2 A;  3OYW A;  3MV0 1;  2VXR A;  4TYS A;  4RR3 B;  4KG8 A;  2A73 B;  3W9A A;  1NXM A;  3FHA A;  1XSR A;  1CJP A;  4Q4V 3;  2Z42 A;  1POV 3;  1IPS A;  2RG4 A;  1RUJ 3;  2ZGK A;  4Q4V 2;  2CV6 A;  2P6C A;  2VVD A;  4AE2 A;  4AVT A;  1RUJ 2;  2XON A;  4YRD A;  4ZZ5 A;  1AZD A;  1OKO A;  4GAZ A;  1W6N B;  3TRS B;  1ONA A;  3VBU B;  1F4H A;  5DZG A;  5FYU A;  1H1M A;  4BQW A;  4B4P A;  1IPK A;  1IPJ A;  2HWB 1;  5A6X A;  1CZS A;  3E6C C;  1BHG A;  1GSL A;  5FXW A;  3THT A;  4G3Y C;  4P5Y A;  3PTY A;  3WVJ A;  4CUG A;  4CYD A;  3W5M A;  4JGZ B;  4NAO A;  5F32 A;  1JYI A;  1AR6 1;  3FUQ A;  1WA4 A;  1PO2 1;  2G9Z A;  4ET7 A;  2ARC A;  3DGT A;  4MUV A;  4YVW A;  2JDK A;  3ZFF C;  2VY0 A;  4UT5 A;  4DXT A;  1ASJ 3;  1W0P A;  5J36 A;  2WZP P;  5BNO C;  1NOV A;  5JZG C;  4P9Y A;  1ASJ 2;  4H55 A;  1C8N A;  2A6W A;  2VMC A;  3ZIX A;  2BU9 A;  2WBK A;  2HEY F;  4LBN A;  5JAX A;  4I2O A;  4F83 A;  4RL7 A;  4URT A;  4L8Q A;  1PNG A;  1BXH A;  1QOS A;  4MGI E;  5IAV A;  3OEB A;  1I5P A;  1K5M A;  4JRA A;  5T5L A;  5L9R A;  2J1R A;  1ENS A;  2RE9 A;  1REF A;  2P3J A;  5L7O C;  1AR9 1;  5J96 B;  4N43 C;  1YCI A;  3VBS A;  4CU7 A;  4XFG A;  4QX2 A;  2PQS A;  3IPV B;  3OBA A;  2O0O A;  2PAM A;  4KU8 A;  2A6V A;  2PHX A;  4E2S A;  4IGP A;  1ZYB A;  3WP5 A;  1CWP A;  5F3G A;  5FZA A;  1WW6 A;  3SKV A;  1VBA 3;  5EHD A;  4FTS A;  1DQ1 A;  2JDY A;  1VBA 2;  3FN9 A;  5ACA 3;  2O8O A;  2JKX A;  4ISQ A;  3POG A;  1IHM A;  5H9R A;  4E4Z A;  5ACA 2;  2LM3 A;  5B2G B;  3Q8C A;  4XAB A;  5DQ0 A;  4COU A;  1HQW A;  4QX5 A;  4B1M A;  2ZHN A;  3WF4 A;  1YLL A;  4BQ4 A;  5JR2 A;  3JXS A;  3ITQ A;  4DUW A;  2RJL A;  1A8D A;  2ILM A;  1BZW A;  2ZMN A;  4IES A;  4A6S A;  3NNJ A;  1BVP 1;  4RA0 A;  1ULF A;  1SCS A;  1PZ7 A;  1X8E A;  3OF1 A;  4DRR A;  4LE3 A;  4GH4 C;  1QJY 3;  1PIV 3;  1TME 3;  2UUR A;  3AM2 A;  1I6X A;  1QJY 2;  1PIV 2;  1TME 2;  3LPF A;  4Y22 A;  1NCQ C;  3NNL A;  4FXG B;  1YO8 A;  3WG2 A;  2QQV A;  1H6Y A;  2XBO 1;  5EFU A;  2WO7 A;  2LRO A;  5A3T A;  1EAH 1;  1JOD A;  1LEN A;  2DCK A;  3I2K A;  4PBO A;  1NA1 A;  2W95 A;  4AI1 A;  2RHP A;  4GQ7 A;  3RZZ A;  4AVS A;  3N4M A;  1UYP A;  5FK7 A;  2VQA A;  1A6C A;  4BIS A;  2V4A A;  3FFZ A;  3H42 B;  5F37 A;  3HMY A;  5EJZ B;  1V6J A;  5FMB A;  4Z2W A;  1UKR A;  1LGN A;  1RJ7 A;  4AEJ A;  2H6B A;  5C9A A;  1XE0 A;  4DB5 A;  4MSV A;  3U37 A;  1CPM A;  1NE6 A;  4JDM A;  1UYX A;  3DF0 A;  4M01 A;  4SBV A;  4UOJ A;  2Y34 A;  4XUQ A;  5FYY A;  3GM8 A;  1T2X A;  5FYH A;  4TZD A;  3ZXA C;  2V5Y A;  3H0O A;  1IQA A;  2O8Q A;  3NST A;  2C4X A;  2QZ3 A;  4IER A;  4W65 A;  2WO3 A;  2ZGM A;  3POJ A;  3POB A;  4PHZ A;  3ILN A;  5J98 B;  1XPW A;  1N1Y A;  4YGB A;  1WGP A;  3BGA A;  3III A;  4NHY A;  1LAJ A;  3KMH A;  3GBF A;  5IVF A;  1R08 1;  1ZM1 A;  1PNF A;  1HLC A;  2UWA A;  4WVV A;  1KS4 A;  3CJI A;  2WO1 A;  4K9S A;  4LHK A;  3RYR A;  2WNO A;  3MIG A;  4A3X A;  1W6P B;  5IVY A;  4CU9 A;  4YW7 A;  2HBT A;  3H3Z A;  2C1F A;  3T2T A;  3I2H A;  2RM2 1;  4MGQ A;  3SNM A;  2TNF A;  1VIW B;  4CCM A;  1AF9 A;  1O5U A;  1S0I A;  2JIG A;  2ORX A;  1YI7 A;  2RR1 1;  2WNU C;  2ZA9 A;  3BOW A;  1PO1 3;  4GWN A;  1YFX A;  3OGJ A;  1PO1 2;  3D6E A;  4Q4W 1;  4HVO A;  3ZFE C;  4ARX A;  5FRA A;  1OOP C;  5K7P A;  5JUV A;  5C8C C;  1G86 A;  3I2G A;  4CXX A;  2E9Q A;  4CSW A;  3TEZ A;  4AHX A;  4OCT A;  1O4T A;  1GWK A;  1V6O A;  3RWK X;  1H9W A;  3UJQ A;  3MDP A;  3VBF B;  1AYM 3;  3WY6 A;  2DBI A;  2W92 A;  4P9W A;  4YYO A;  1AYM 2;  4AED A;  2R07 3;  4DEV A;  4P9J A;  3A21 A;  2R07 2;  2DUQ A;  3WV6 A;  5ABJ A;  5J48 A;  2YMZ A;  3N3H A;  4XIO A;  4DZG A;  3LOB A;  2Q5T A;  2B4K A;  2GC3 A;  1UOJ A;  2IC1 A;  2UY8 A;  1LU2 A;  5FP9 A;  5FP8 A;  3EO6 A;  4CUA A;  4E27 A;  4F7Z A;  5SV8 A;  1C3H A;  5KXB A;  3RNS A;  4C91 A;  1DZR A;  1HB4 A;  4NOT A;  4BXF A;  5LBE A;  2VZR A;  4UXA A;  4D94 A;  5FZD A;  5CBL A;  1F15 A;  4P00 B;  5L73 A;  4AGV A;  1F8V A;  4CPB A;  1IS3 A;  1RUH 3;  2ADD A;  1MZ5 A;  2IUW A;  2FDJ A;  3T2O A;  3V56 A;  1RUH 2;  1R1A 3;  1WD3 A;  1AR8 2;  4LXL A;  2WA3 A;  5DUU A;  1R1A 2;  4ORF A;  4QQH A;  3KGL A;  2EAK A;  2PHT A;  1WLW A;  1ZBE 3;  4BME A;  2QQW A;  1ZBE 2;  1YRZ A;  4GWM A;  3MIE A;  4ZXE A;  1X9P A;  4LPL A;  1CZV A;  3ZR6 A;  4Q4Y 3;  2A70 A;  3RMX A;  2XVK A;  4Q4Y 2;  4U36 A;  2DFB A;  1DBN A;  4ASK A;  2JB4 A;  3VL8 A;  2RS5 1;  1IQD C;  1O59 A;  5A7N A;  5FO9 B;  3RMY A;  3KVA A;  3ILR A;  5CFC B;  1UKG A;  1UIK A;  3UKT A;  1KIT A;  2D40 A;  1UX7 A;  3C7E A;  4XCA A;  1YFW A;  3KF5 A;  4NRQ A;  3MZH A;  4MO3 M;  5D8A B;  4LQR A;  1G7Y A;  2BGO A;  4FPG A;  1Q56 A;  5IUQ A;  2C24 A;  3HT2 A;  3U0Z A;  1UPS A;  4OMC A;  4GAL A;  2BQP A;  3ZSE A;  1F31 A;  4V2W A;  1JZ4 A;  1RUE 3;  1OQD A;  3D0J A;  1RUE 2;  5JIA A;  2WNV C;  1UF2 C;  4GKX A;  4F8A A;  3WDU A;  5HV0 A;  1RJ8 A;  1OLM A;  1V0A A;  1W6M A;  4LBQ D;  4YM2 A;  3WLU A;  3BPZ A;  1HB2 A;  3AX4 A;  2QQK A;  4LOS A;  1YWK A;  5D2A A;  5H9Q A;  3JZV A;  4FQZ A;  1H9P A;  2MEV 3;  1I3H A;  4CEY A;  4LTA A;  1BJQ A;  2MEV 2;  2Y26 A;  4FPJ A;  5HXV A;  4H7L A;  1S0F A;  3N9N A;  3S0M A;  2CSG A;  2XLF A;  3KB5 A;  3M8L A;  1AHS A;  1WCS A;  4ITC A;  5G05 L;  5KHI A;  5A3W A;  2WLP A;  1BMV 1;  1FMD 3;  3A22 A;  4Q5O A;  1FMD 2;  1DYP A;  3L2Y A;  5FMC A;  2RS3 1;  2W87 A;  3LGR A;  1FAY A;  5JMO A;  4XUR A;  4NHM A;  5FMO L;  5JI9 A;  3J7L A;  1OXC A;  3AP9 A;  4E4S A;  1X9T A;  2WAB A;  5T5O A;  2EIC A;  3K2O A;  5CFD C;  3ZXD A;  3AXD A;  4Q29 A;  2O1Q A;  2XJQ A;  4FPC A;  5CYY A;  1VBB 3;  3U4S A;  5GLW A;  3WG4 A;  2JDP A;  1VBB 2;  4CCD A;  5BUV A;  3AMP A;  4FPY A;  3SIT A;  3VHR A;  2NMN A;  4L97 A;  4N9H A;  2ZGP A;  1VLN A;  1E5H A;  4JV4 A;  3OY8 A;  4XVH A;  4FOW A;  3I3Q A;  2OS2 A;  5JOW A;  2HEW F;  5BNN B;  2XWB B;  2E6V A;  1J58 A;  1LHU A;  2PXJ A;  3P3P A;  4X6R B;  1EPW A;  4XET A;  5F5A A;  4Y33 A;  4PJY A;  1F35 A;  4AHZ A;  1K42 A;  1ZVF A;  3AKS A;  1Q8P A;  4LO8 A;  3J9S A;  3W20 A;  1B35 A;  3O1P A;  4CEW B; 
#chains in the Genus database with same CATH homology
 2ZEZ A;  3LPG A;  2VZO A;  2ZXQ A;  2WZ8 A;  5FUI A;  3DEM A;  4LOT A;  1JU3 A;  3NQH A;  3MV1 1;  5LCW L;  1UZ0 A;  4PT6 A;  2E33 A;  3A7Q A;  2KD7 A;  1O8P A;  5EJ1 B;  2VO5 A;  1SPP B;  2Y6J A;  3K75 B;  2VZU A;  3OG2 A;  3C8X A;  3IAP A;  1JHJ A;  3W5N A;  4P08 A;  3FHQ A;  4LKS A;  5CKM A;  3T2Q A;  1D7P M;  3CZJ A;  4A45 A;  3VD4 A;  2QQI A;  3MBW A;  3CIH A;  2WZE A;  3UNP A;  2VZS A;  1GOF A;  3I3D A;  4KMQ A;  1SFP A;  2WUH A;  2BGP A;  2XQX A;  2WN3 A;  2C26 A;  1TG7 A;  4CU6 A;  5DMY A;  2WDB A;  1RYY A;  3VD5 A;  4TXW A;  2J1U A;  3UET A;  1OF3 A;  4XZU G;  5HPO A;  2Y64 A;  3I2J A;  4A41 A;  2QQJ A;  3POI A;  4BJ0 A;  4MOA A;  5HXM A;  4E8C A;  4W50 A;  1UWW A;  2J1V A;  3EB7 A;  4PF1 A;  2LW8 A;  4A6O A;  5JXI A;  1DP0 A;  2ZEY A;  3PUH A;  2J1S A;  4MAD A;  4OUE A;  5C70 A;  1PMH X;  2VM9 A;  2W1U A;  3I2I A;  3VD9 A;  1NZI A;  2Z4F A;  4ZZ8 A;  1GQP A;  1LNS A;  1SZB A;  4XUN A;  3WNM A;  3POE A;  2W9X A;  3MUZ 1;  4W4Z A;  3DEC A;  1O8S A;  3I2F A;  4BXS V;  3WF2 A;  4TTG A;  3WNL A;  1UMH A;  1UYZ A;  1NX9 A;  3T09 A;  5CKQ A;  4RYD A;  2RV9 A;  3AC0 A;  5G04 L;  1F4A A;  3HEI A;  2VQU A;  4DUX A;  3IB3 A;  1DLC A;  4PQQ A;  2ORZ A;  3T0B A;  1JZ2 A;  3OGV A;  2W1Q A;  3I3E A;  5IFP A;  5A1A A;  5LA0 A;  1NKG A;  3VDC A;  3VD3 A;  2OKX A;  3THC A;  3T2P A;  5I0D A;  1EUT A;  2J1T A;  2HYX A;  4DUV A;  2J1A A;  3SEP A;  5JXH A;  3POF A;  1PX4 A;  2Y6K A;  1TVG A;  1GNY A;  3LQC A;  1W0N A;  2RVA A;  2VZV A;  3I97 A;  4D0Q A;  1W8O A;  4P02 B;  4KWU A;  3HJR A;  4BK4 A;  2VTF A;  2VME A;  2X05 A;  1W8N A;  2L9L A;  3P1I A;  3FL7 A;  4ET7 A;  2CDP A;  3BN6 A;  4QX0 A;  4QPW A;  3NJV A;  3CKH A;  1L7R A;  1NUK A;  2E26 A;  3T08 A;  2VR4 A;  3WSO A;  2V5D A;  1XC6 A;  5LA2 A;  3SKJ E;  3F2Z A;  3D3A A;  3OB8 A;  1UYY A;  2QBX A;  3HPN A;  3HNY M;  4DXR A;  1W9T A;  1WKY A;  3DYP A;  3C7G A;  2W5F A;  2BBA A;  2X09 A;  3SKV A;  1ULP A;  4OYU A;  3CMG A;  2WAO A;  5F7U A;  5CZK A;  3WNK A;  3ACG A;  5EIY B;  5C71 A;  2YC4 A;  2VZ3 A;  3LEK A;  4QAW A;  1J83 A;  3C7H A;  1SDD B;  2ZEW A;  3WNP A;  3WNN A;  3MV0 1;  3FHA A;  2HLE A;  1JYX A;  2XON A;  1K3I A;  1R64 A;  3K4D A;  2J22 A;  5DPN A;  4ZZ5 A;  1F4H A;  3ACH A;  4JKL A;  1GUI A;  3T0A A;  1KGY A;  1CZS A;  1BHG A;  1JI6 A;  3C7F A;  4L0P A;  1US2 A;  4P5Y A;  5DN2 A;  3W5M A;  1OF4 A;  3SEE A;  1UY1 A;  3K46 A;  2ZEX A;  4CUC A;  2W1W A;  5JXG A;  4DXT A;  2VMF A;  1W99 A;  2YFU A;  2VMC A;  4GWJ A;  3K4A A;  4AG4 A;  2DCJ A;  1JYV A;  2WBK A;  3HOB A;  1SHW B;  1GU3 A;  4AAX A;  3OEB A;  1I5P A;  3VDB A;  2QQL A;  2J1R A;  4IUG A;  2JD9 A;  3ACF A;  4CU7 A;  2Y8K A;  5B4N A;  5IYY A;  4QX2 A;  2PQS A;  3OBA A;  2VOT A;  3K77 A;  3WF1 A;  1JU4 A;  3A23 A;  2Y6H A;  2C9K A;  1NAE A;  2W3J A;  3FN9 A;  2JDA A;  4JHZ A;  2Y6G A;  2VZ1 A;  2JKX A;  3POG A;  4GWI A;  1JZ5 A;  5DQ0 A;  3CZU A;  3WF4 A;  5JR2 A;  3JXS A;  4DUW A;  3ACI A;  4Z2A A;  2VCC A;  4FI9 A;  3NNG A;  4XUT A;  3GXU A;  1EUU A;  2V4V A;  1OH4 A;  1JZ7 A;  1JZ6 A;  3K4Z A;  3LPF A;  1JZ3 A;  1JYW A;  2Y6L A;  1CX1 A;  1H6Y A;  4CU8 A;  1CIY A;  1GOH A;  3HNM A;  1ULO A;  2W1S A;  1CZT A;  2J7M A;  2DCK A;  3I2K A;  2VQT A;  1UXX X;  1JYN A;  4QB6 A;  2W95 A;  1US3 A;  4RN5 A;  4LOR A;  1YQ2 A;  1H6X A;  5EJZ B;  2VZQ A;  3THD A;  2WO2 A;  3ZM8 A;  2BZD A;  3U37 A;  2CDO A;  1P8J A;  1UYX A;  3T0D A;  4UOJ A;  3HNB M;  4XUQ A;  3GM8 A;  1T2X A;  1KEX A;  1MPX A;  4OZO A;  2C4X A;  2V72 A;  2WYS A;  2WO3 A;  3DYM A;  5IJR A;  4M4R A;  3POJ A;  3POB A;  1XPW A;  3BGA A;  3III A;  4ZY9 A;  4LMF A;  4YPJ A;  3CDZ B;  2WN2 A;  3LEG A;  2WO1 A;  3J7H A;  2WNO A;  3MO4 A;  4CU9 A;  1UY2 A;  4CUB A;  5IHR A;  3I2H A;  4MGQ A;  1OD3 A;  4CVU A;  3OGR A;  2ORX A;  3LEI A;  2XOM A;  3VD7 A;  4QDS A;  5LA1 A;  3C7O A;  2VZP A;  4ARX A;  2YC2 A;  3NJX A;  1J84 A;  5JUV A;  3IDA A;  3I2G A;  4MGS A;  3UES A;  4ARY A;  3PUI A;  2BER A;  2W92 A;  4DEV A;  2VC9 A;  3OGS A;  3A21 A;  2LS6 A;  4GZ9 A;  4QX3 A;  4E8D A;  2VMD A;  1XNA A;  2B4K A;  1W9S A;  3ECQ A;  4A42 A;  4DXS A;  4CUA A;  3KQ4 B;  2W94 A;  1UY3 A;  2W91 A;  1DYO A;  3CQO A;  2X10 A;  2VZR A;  3IAQ A;  4W8J A;  4UAP A;  4P00 B;  4XUO A;  3T2O A;  1NT0 A;  1UY0 A;  3MUY 1;  5J1X A;  1GMM A;  2XHN A;  5C7G A;  2J1E A;  2EIB A;  2QQO A;  5JXJ A;  3OEA A;  5CIS A;  3NRU A;  4ZXE A;  4LPL A;  1CZV A;  5CKN A;  4QB2 A;  1PX3 A;  2WQ8 A;  3P6B A;  1XNT A;  3LE0 A;  1L7Q A;  3ABZ A;  4HG6 B;  3VDA A;  4UI9 L;  5B4X A;  3ETP A;  1IQD C;  1O59 A;  4LHS A;  1GOG A;  1W9W A;  4JX0 A;  5IFT A;  4XUP A;  2VL4 A;  1UX7 A;  3C7E A;  4A44 A;  1WCQ A;  1OT5 A;  4MO3 M;  2VCB A;  4OMD A;  4QDQ A;  2W47 A;  4LQR A;  4D8M A;  2BGO A;  3GDB A;  1SPP A;  1K12 A;  2E31 A;  4A3Z A;  3WQB A;  4OMC A;  3WEZ A;  2VZT A;  1JZ4 A;  2VCA A;  4DEQ A;  1SG3 A;  2YG0 A;  2JE8 A;  4A4A A;  2QQK A;  4LOS A;  4M4P A;  3HN3 A;  3GGL A;  2VJX A;  1HN1 A;  1UY4 A;  3DYO A;  3WF3 A;  4QDR A;  2WAA A;  4JKM A;  1K45 A;  5G05 L;  1UMI A;  4KI5 M;  3A22 A;  2R7E B;  3EYP A;  2W87 A;  5JMO A;  4XUR A;  2B9V A;  2EIE A;  2ID4 A;  2QQM A;  1UXZ A;  2WAB A;  2EIC A;  2EID A;  4BDV B;  5CYY A;  4BK5 A;  2RJ2 A;  1JZ8 A;  1PMJ X;  3I3B A;  3WF0 A;  4XVH A;  2QQN A;  2E32 A;  2DDU A;  2YB7 A;  4QB1 A;  3WNO A;  4QX1 A;  2YFZ A;  4JKK A;  1K42 A;  2W46 A;  3E1F 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...