2QQLA

Neuropilin-2 a1a2b1b2 domains in complex with a semaphorin-blocking fab
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
576
structure length
554
Chain Sequence
PPCGGRLNSKDAGYITSPGYPQDYPSHQNCEWIVYAPEPNQKIVLNFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKHCGNIAPPTIISSGSMLYIKFTSDYARQGAGFSLRYEIFKTGSEDCSKNFTSPNGTIESPGFPEKYPHNLDCTFTILAKPKMEIILQFLIFDLCKYDWLDIWDGIPHVGPLIGKYCGTKTPSELRSSTGILSLTFHTDMAVAKDGFSARYYLVHQEPLENFQCNVPLGMESGRIANEQISASSTYSDGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLTAIATQGAISRETQNGYYVKSYKLEVSTNGEDWMVYRHGKNHKVFQANNDATEVVLNKLHAPLLTRFVRIRPQTWHSGIALRLELFGCRVTDAPCSNMLGMLSGLIADSQISASSTQEYLWSPSAARLVSSRSGWFPRIPQAQPGEEWLQVDLGTPKTVKGVIIQGARGARAFVRKFKVSYSLNGKDWEYIQDPRTQQPKLFEGNMHYDTPDIRRFDPIPAQYVRVYPERWSPAGIGMRLEVLGCDWTHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Neuropilin-2
publication title Structural studies of neuropilin/antibody complexes provide insights into semaphorin and VEGF binding
pubmed doi rcsb
source organism Homo sapiens
total genus 126
structure length 554
sequence length 576
ec nomenclature
pdb deposition date 2007-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00431 CUB CUB domain
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2qqlA03
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2qqlA04
2.60.120.290 Mainly Beta Sandwich Jelly Rolls Spermadhesin, CUB domain 2qqlA02
2.60.120.290 Mainly Beta Sandwich Jelly Rolls Spermadhesin, CUB domain 2qqlA01
1XNAA 3LQCA 4OMDA 1GNYA 5FUIA 2Y6KA 2WAAA 4QB1A 2LW8A 3I2KA 5B4NA 3WSOA 4A41A 1K3IA 3DYOA 4MO3M 4QDRA 3C7EA 3T0BA 4Z2AA 4XUNA 3CDZB 2Y8KA 1IQDC 2W91A 3WNPA 2W47A 4E8DA 1SHWB 1W0NA 3ACHA 2VM9A 5J1XA 5LCWL 3LEIA 3CZUA 3UNPA 1I5PA 3IAPA 2XOMA 1K12A 2WO2A 3FN9A 2J1TA 3K4ZA 4DEVA 4TTGA 2WBKA 2W1UA 3THDA 2BBAA 3VD9A 3VD7A 5JXJA 1O59A 1JZ2A 2BGPA 3NQHA 2VZRA 2C4XA 1DYOA 1KEXA 2VMDA 5CZKA 3POEA 1J84A 3T0AA 4AAXA 2XONA 3HN3A 3LPGA 3U37A 2PQSA 3POBA 1PMHX 5C70A 5JXGA 2VR4A 4GWJA 3HPNA 3DEMA 1ULPA 3D3AA 1W99A 2VZQA 4MGQA 1SPPB 4XUTA 3IAQA 2VZVA 4MADA 4UOJA 2QQKA 2Y6JA 2X09A 4XURA 3WNOA 2VCBA 3MBWA 1UYYA 4LPLA 2RVAA 3CIHA 1WCQA 3LE0A 4QX2A 4DUXA 2WAOA 2VC9A 2W94A 3GDBA 4DXRA 3FL7A 4D0QA 5DPNA 3PUIA 3I3EA 4GWIA 5JXIA 4CU8A 1W8OA 2ID4A 1UY1A 5G04L 1OD3A 3F2ZA 3UESA 1YQ2A 1XPWA 3WEZA 3C7GA 1UY2A 3HOBA 3VD5A 4LOSA 2ZEZA 3C7HA 2VJXA 5CKNA 3VDCA 4DXSA 4BK5A 2V4VA 5C71A 1UWWA 1JZ5A 1CZSA 4A42A 2HLEA 3WNLA 2LS6A 4JKLA 1CIYA 1NKGA 3I2JA 2ORZA 2QQMA 4M4RA 4CU7A 4P02B 5IYYA 1OF4A 2VZ3A 1CZTA 4ZY9A 1JZ6A 1UY3A 2XHNA 3T2OA 4XUQA 2EIEA 4AG4A 3WF1A 2YC4A 3OGSA 1NZIA 2E32A 4LOTA 4GZ9A 1MPXA 1NAEA 5JUVA 1UY4A 4IUGA 1US3A 5DN2A 2WO3A 3ACFA 4JKKA 2VCCA 2CDPA 3DYMA 1JU4A 3HNYM 2VZTA 4W4ZA 4CU9A 2W87A 4FI9A 1CX1A 2WUHA 2J1AA 3HEIA 1GQPA 3J7HA 1UMHA 2VO5A 4ARYA 1EUTA 1TG7A 1JZ8A 3BN6A 5C7GA 3PUHA 3BGAA 3WF3A 1DLCA 3ABZA 4KMQA 4W8JA 2E26A 3T0DA 3T2QA 4A6OA 2BGOA 4UI9L 4LORA 3GGLA 3POJA 3WF4A 4TXWA 4JKMA 4QAWA 2YC2A 3W5NA 4ARXA 1JYXA 4LMFA 4CUAA 4XUPA 5LA2A 3SEEA 1R64A 4PT6A 1J83A 3CQOA 2W46A 4DEQA 1JYVA 2EICA 1UMIA 2V5DA 3IDAA 4QPWA 5JXHA 1GOGA 2VZUA 2YG0A 2Y64A 1PX3A 3MO4A 2WN2A 2J1SA 2VZPA 2YB7A 3K75B 4BJ0A 5EJ1B 4ZZ8A 2VCAA 1K42A 5JMOA 3C7FA 4A4AA 4ET7A 4CVUA 2JD9A 1NT0A 1LNSA 3POGA 1O8SA 3SEPA 4M4PA 4KI5M 2J1VA 5IFTA 2QQIA 3UETA 2WZ8A 3JXSA 4PQQA 5A1AA 3I2IA 2JKXA 1D7PM 3OB8A 2HYXA 3ZM8A 4ZZ5A 5CKMA 3FHQA 4L0PA 3POFA 5CISA 1JHJA 1K45A 2RJ2A 2JE8A 5HPOA 1GU3A 2X05A 4JX0A 3I97A 2KD7A 2W1WA 3T08A 1GOFA 5EIYB 2YFZA 1GUIA 5B4XA 2VZOA 4QDQA 3WQBA 4BDVB 5HXMA 5LA0A 1XC6A 2C9KA 1F4AA 3EB7A 3P1IA 1UZ0A 4LHSA 4OZOA 2W92A 1L7RA 3ETPA 5F7UA 2ZEXA 2X10A 3OBAA 2W95A 2ZEYA 3I3BA 1T2XA 2J1RA 2WDBA 1BHGA 4RYDA 3WF2A 2VZSA 1JU3A 4W50A 5DMYA 5G05L 1JZ4A 1W9WA 2YFUA 4MGSA 3K77A 2JDAA 3LPFA 3OGRA 2J1EA 3NRUA 1PMJX 3A7QA 3VDBA 4XUOA 4LKSA 2DCJA 2W1SA 2Y6LA 3T09A 3W5MA 1SDDB 1UY0A 3WNKA 5CYYA 2W9XA 3VD3A 2QQLA 2ZEWA 2VQUA 5LA1A 3K4AA 4HG6B 3SKVA 4PF1A 1NUKA 3I2GA 1H6XA 3A21A 3LEGA 4A45A 4DUWA 3POIA 4CU6A 1UXZA 1F4HA 3HJRA 1L7QA 1W9TA 1SPPA 3IB3A 4YPJA 1JYNA 2W1QA 1UYXA 2B9VA 3KQ4B 1SZBA 1SFPA 1O8PA 4QX3A 3OEBA 1RYYA 2C26A 3FHAA 2WNOA 3DECA 4MOAA 3IIIA 5DQ0A 1JYWA 2Y6HA 3CZJA 3I2HA 3I2FA 3MUY1 3MV11 5IHRA 4QB2A 4XVHA 5JR2A 2XQXA 3P6BA 4DUVA 1OH4A 1ULOA 1KGYA 1H6YA 2VMFA 2WYSA 2CDOA 2WQ8A 2EIDA 2VQTA 2OKXA 4QX1A 2Z4FA 1JI6A 2BERA 3NNGA 1OF3A 2J7MA 2VMCA 2WZEA 4P5YA 1WKYA 4JHZA 5EJZB 2WN3A 2WABA 4D8MA 2WO1A 4QX0A 4BXSV 2BZDA 2R7EB 1XNTA 4P00B 3K4DA 1UX7A 1SG3A 2EIBA 3MV01 1W8NA 3NJVA 2E31A 1CZVA 3E1F1 3WF0A 3C7OA 3ECQA 3OGVA 2W3JA 2V72A 3OEAA 4BK4A 4CUBA 3GXUA 4DXTA 2L9LA 1EUUA 4ZXEA 1W9SA 2QBXA 5CKQA 3CKHA 4P08A 1US2A 3SKJE 3DYPA 2VMEA 3GM8A 4A44A 1DP0A 3ACIA 3I3DA 3HNBM 4LQRA 3EYPA 2QQJA 1HN1A 1TVGA 3CMGA 5IJRA 4UAPA 2W5FA 3ACGA 4QDSA 4XZUG 4OMCA 3THCA 4A3ZA 5IFPA 2DDUA 2VL4A 4E8CA 3WNNA 3A22A 2QQNA 3K46A 1JZ7A 1JZ3A 3VDAA 2VOTA 1UYZA 1PX4A 4OUEA 2J1UA 2VZ1A 3AC0A 1GMMA 2RV9A 3VD4A 3MUZ1 3WNMA 2ZXQA 2DCKA 1GOHA 1NX9A 1P8JA 2QQOA 3NJXA 4RN5A 3A23A 1UXXX 2ORXA 4OYUA 2B4KA 3LEKA 4CUCA 3C8XA 3OG2A 5I0DA 2E33A 2J22A 3HNMA 3T2PA 4QB6A 2VTFA 2Y6GA 4KWUA 1OT5A
chains in the Genus database with same CATH superfamily
4AI8A 2XL7A 3EJKA 2RG4A 1VIWB 2AR6A 1H8TA 2XJSA 2ILMA 4BWOA 3DL3A 3VKOA 1X8MA 2W08A 2YU2A 1RUD1 5BPXA 4I3PA 1E5HA 1W9FA 4A41A 1WW5A 4OCTA 5HV4A 4CZSA 2ZHLA 5F5AA 4NIIA 3AKSA 3WLUA 4QDRA 3RS6A 3WOGA 1LOBA 1UOBA 4Z2AA 1KFUL 1QY4A 4AEKA 2K0GA 4FXGB 4NRMA 4B8EA 3E97A 2G9GA 3WNPA 4XW3A 4N8MA 1SLTA 1ND3C 4I02A 3ACHA 4E8DA 1GQHA 3AYAA 5BV6A 1UF2C 2HWE2 4BA6A 5ISLA 4CCLA 1U0AA 2ARXA 4KU8A 4RL7A 3LEIA 3LCPA 3TN91 3ZPYA 2VPVA 2IVIB 3FN9A 5JI7A 1IS4A 1SBDA 3P3NA 4KG8A 4N43B 4CDXB 1NCRC 3VDDA 1VBC2 1VBB1 5FY1A 2BBAA 5I0UA 4YZ2A 3VKMA 3SNMA 2WNUB 3VD7A 1RJ8A 2FZ1A 2QFEA 5JXJA 3I59A 1LHWA 5LRRA 5J37A 1JZ2A 2BGPA 2ZX3A 3TOJA 4LKDA 2XONA 4IGQA 1GZCA 3HN3A 2XUEA 5DAVA 3N9LA 1JODA 5C70A 2ZX2A 3KV9A 1TQ5A 2RS51 4HSJA 4QM9A 3UGHA 4P9IA 3JB4C 5FY0A 4NJ4A 4Q27A 1W99A 4Z07A 2VZQA 2JWPA 2XWBB 4XUTA 3SH3A 3IAQA 1LGBA 1DG6A 3RYKA 3R05A 5C4WB 5JCTA 4YVSC 1AR91 2VZVA 2K9ZA 4NAOA 1RUG3 2HWB3 3KVBA 1W8TA 3SCFA 2Y6JA 2FCUA 2AH2A 3MW2A 3KT4A 5EHDA 2ZZQA 4E2QA 2VCBA 1CPNA 1MVQA 4YLZA 5CBLA 2RVAA 4QX2A 1WCQA 5CNAA 4AK3A 4QGLA 2ETEA 2D7FA 1M4WA 1PGSA 4P9GA 4D0QA 1W6PB 4XOGA 3PUIA 2HYKA 4A3XA 1XJAA 2RS33 1RUE1 1A34A 1W8OA 1AX2A 2CTVA 2PTMA 3OJBA 5DAWA 4ZU7A 3JZVA 5JSRA 1TNRA 5BNOB 1OD3A 2WYFA 4D7SA 1SLBA 2ZOEB 3O1VA 1OQEA 1N1SA 1UCXA 1UNBA 2ARBA 2R32A 5FZCA 1AL21 2I45A 3VDCA 2Z5WA 2HBTA 1NXD1 3WINE 5A3MA 2E7QA 1VP6A 1NOVA 1W9YA 3R4UA 3VGIA 1QXRA 3ZSEA 2VNVA 4XF9A 2WSVA 3KM5A 5FMOS 4AW7A 2TUNA 4JGZC 3PTYA 1CIYA 4P14A 2ORZA 4XFAA 5C8WA 2VG9A 4M4RA 2NZ9A 5DUWA 5FZ6A 4XDQA 5L9BA 1PZ9A 1YLLA 1R081 4GKYA 1ZRCA 3QD6A 1XYNA 4I3GA 1CZTA 2PN5A 3ELNA 1W0PA 5GZEA 3ZIXA 5KHJA 4Q0VA 3T2OA 1F8VA 1RUG2 4COYA 5D1IA 4CEYB 2QNKA 2HWB2 2BUKA 2WR9A 4AG4A 4DFSA 1ZZBA 3WQ7A 2YC4A 5BNPB 1DIWA 2P34A 3OGSA 1NZIA 1EAH1 4N9IA 3OD0A 1BMV1 5EYXA 1C4RA 2H6CA 1B35B 1MPXA 4J1XA 4YGEA 3G6JB 1ZZCA 4Y5TA 5DN2A 2WO3A 2F17A 4RQPA 1W6NA 1HQLA 3QH7A 5DUVA 5L73A 3ZFEA 3MLKA 1ENSA 2LRPA 3ME2A 4LBLA 1S0EA 2RS32 3VBOA 1FI2A 2D6LX 4XJAA 4UBHA 1W2UA 1GQPA 5A33B 2HEVF 4PLMA 1W8HA 2VO5A 4BZ4A 4ARYA 2K46A 1RUJ1 2UY8A 4M3CA 3OGJA 4OFGA 4XHXA 3THTA 1MS0A 1EPWA 2GU9A 3MPPG 1N3OA 3BTAA 3PUHA 1KFXL 3VBRA 5JZGC 3BGAA 4PDWB 1OXCA 1DLCA 5F8PA 1NZCA 3AP6A 4X6QB 4KMQA 4LBOA 1S0FA 4PBPA 2DBNA 3Q8AA 4XMAA 2E26A 5C9AA 3T0DA 4QKBA 3S7IA 4FSJA 2ES3A 1WBLA 4NROA 3NV2A 1RMU1 2BGOA 2BYVE 3CF6E 3BVCA 4CEWB 3J7NA 1Q8VA 4Q0QA 3PL0A 5EPAA 5T5OA 2GSYA 2ZKNA 4AXOA 2CHHA 1VE0A 4AR2A 1I9RA 2WWUA 1D2SA 3RJRA 4JKMA 3D82A 2P17A 2AACA 3T1MA 4BQ3A 5FY7A 1JYXA 5CG9A 1O3QA 2VW0A 5GZGA 2O14A 2GP5A 4QD2A 1WZXA 4LLFA 4UW6A 4AVCA 2CL2A 4HT1T 3CJIA 1C5HA 4F8AA 4HN1A 3VBSC 2Y26A 2P3YA 4GB31 5JPMB 3UKNA 1OQDA 1FV3A 1PZ7A 3BALA 5D8AC 1WLWA 3HBZA 4IEXA 1Z0HA 5AVAA 2YG0A 4MV2A 1MS3A 2IXHA 3MIHA 5I8SA 5GZDA 2PHRA 4AFMA 5A3LA 4ASKA 3MO4A 5FZIA 2J1SA 4C1WA 3OGGA 5C5UA 4LT5A 4GD4A 4HXCA 1FNYA 2C9AA 2GC0A 3ZYHA 2O8OA 4ASMB 4ZZ8A 3VL9A 5JMOA 4GMP3 2FD8A 4ET7A 2D93A 2QQVA 1CAXA 1ND2B 1NT0A 4RS5A 1UZYA 4NMIA 3POGA 2Q8EA 5CEHA 5J09A 4CDUB 4N7UA 1GV9A 3KLSA 1K5MB 1LOFA 1VBE3 3UETA 4COUA 4HPKA 2G9FA 5L19A 2ZABA 4P9YA 4LO7A 1IPKA 2JKXA 1QKQA 3M3EA 4XBLA 1REDA 2WL1A 4GULA 4XEZA 2O0OA 1YYNA 3ZKYA 1R1A3 5FTTC 5CKMA 4AI9A 5FK8A 1S4CA 4WM7B 1J3PA 5CISA 3H3ZA 3ZFFA 1K45A 5FK7A 3WG4A 3WP3A 4JGYB 1PZ8A 4L97A 3MIGA 5F9TA 4L99A 5HPOA 2ZHKA 4NN0A 2W1WA 3I54A 1GP6A 5F3IA 1HRI3 3GHNA 1HB3A 5A7WA 4FPFA 4Y1UA 3AMNA 3H8UA 4FAHA 5EIYB 4OLLA 2R1DA 1VBA3 1DBNA 2VZOA 1GFF2 1PNGA 1WLCA 1YUDA 3QOPA 5FPZA 4FOYA 3P1IA 5ABJA 3RPQA 2ATFA 1G8WA 4LHSA 1EV11 1APNA 3RI9A 2D43A 1AX0A 1JS9A 1MS1A 1WW4A 5FYBA 1ALYA 3V65A 3VHRA 2RDSA 1DLLA 1GZ9A 2ZEXA 3A4UA 1AZDA 4PIYA 4QQHA 4WV8A 5HCBA 1ULDA 2XL9A 2PHWA 2W95A 2ZEYA 4Q4X1 2Q4SA 1V6NA 3B93A 4NPLA 3PIJA 2XVGA 1VBE2 1W3VA 3AKRA 1BHGA 1U5ZA 3KQRA 1FATA 3IMNA 2ZGOA 3O1PA 1HDKA 3RWKX 3WP6A 1BQPA 1Z7S1 1R1A2 2W52A 2YZ4A 3NSTA 5K0UC 2XR4A 4CE8A 5EQUA 1NLQA 3LPFA 4YZ4A 4Q4W3 1N3QA 5D21A 3I3MA 5FY9A 5A7OA 3A7QA 1KJRA 5GJ6A 4XFIA 3ZYGA 4Q26A 3FX3A 5L9VA 4N43A 1GSLA 4CDXA 4XAEA 4DS0A 2KXLA 1RVF1 2I2SA 2VXJA 3DV8A 1HRI2 4LKSA 4TYSA 2P6CA 2J42A 2VUAA 2ZGSA 3S7EA 2XH6A 4R4ZA 3W5MA 1RB8G 1VBA2 3OD4A 2EXKA 2E63A 5CYYA 2WNUA 4O9GA 3PMEA 1GWLA 2QQLA 1W6QA 2A6VA 3A0NA 2JIJA 2P3KA 5J48A 5LA1A 3E5UA 3KF5A 4HG6B 2JG8C 3ZN5A 2PLV3 4B29A 1S2KA 2NYYA 1RUF1 4MHRA 2SBAA 4COVA 1QNYA 1H6XA 4Z2WA 3BIEA 3A21A 2IXLA 4FO9A 4DUWA 1QU0A 2DBIA 2D6MA 4DINB 1VBD1 2DV9A 5HCFA 5J98B 3NNJA 4LIVA 4K7JA 1KDMA 4LK7A 1L7QA 2GMPA 4LTAA 1PMIA 2Y0IA 1LU1A 2XJTA 3AZXA 3B5LB 2IUWA 4FFGA 1OKOA 4NO4A 5FPBA 5C4WA 4BCUA 4DMIA 4BYYA 4FPKA 1RUC3 1WMFA 1QJU3 2A3XA 3KQ4B 4IV1B 3TNPB 3POSA 5FZMA 2YC0A 3K3NA 2QJVA 2QVSB 4GH4A 3WP5A 1O8PA 3PLQA 2HEYF 3OYWB 4XXPA 4HN0A 3PJYA 3RWNA 4CTEA 1HV0A 3FHAA 2WNOA 4P5HA 1MQTB 1HXS3 1W6PA 4M0NA 1HQNA 3RZKA 3ILNA 4AGVA 1ACCA 4MOAA 5AC91 1UZZA 1H30A 3GBGA 4P9XA 3LZZA 1S2EA 2UYAA 4N53B 4GMP0 1YFYA 5GLUA 3ZYRA 5BNOA 4XTPA 5ACA1 2BU9A 3VZLA 1X8EA 1X36A 4QB2A 3V56A 1W03A 5JR2A 1C57A 4Z8BA 2AZ5A 2PLV2 1SFYA 2TEPA 1ULOA 2PHDA 4UXAA 5TSWA 4OZXA 3VKLA 1OFNA 3RJ2X 1NCQC 4N7IA 4GJZA 2WQ8A 2D97A 3HAGA 4KQ7A 4XJUA 4K1ZA 2OKXA 2PMWB 2IWGB 4AFDA 1AR81 1MS5A 1S0GA 5LEKA 1OF3A 2IXIA 2VMCA 3AP9A 4P5YA 4EJRA 1RUC2 2R1BA 1E57A 1D4VB 1QJU2 1Q8OA 4Q4V3 5EJZB 1OFSA 2YY1A 4CEYA 4Y4YA 2BFUS 3IPVB 1OLMA 2B9UA 3NKTA 3VBHB 1W8WA 5BNPA 5FQ0B 4PF5A 3JD71 1G9FA 1HX6A 1HB2A 1FYUA 1V6MA 3H7JA 1B35A 1XNTA 5DDJ1 3MIFA 4DO0A 2EIBA 3T2TA 3WG3A 4S2GA 3NJVA 1HXS2 3MFCA 2DUQA 3C7OA 3VZJA 4YWAA 3M3QA 1IPSA 3U4SA 3OSDA 3TNQA 3U10A 2B45X 2Q30A 4BK4A 3AP4A 1W04A 3KHCA 1RHI3 5A33A 2GH8A 5DABA 2L9LA 5E1RA 4E4DX 1LECA 5CKQA 4KGGA 4P08A 4PDWA 4XACA 3KT7A 5FV3A 2X29A 3RNSA 3DCQA 4A44A 2VXRA 5C8CB 4E9KA 2P3IA 3ZYBA 5IVVA 3ACIA 3EXUA 1UPSA 4YSFA 2DVFA 3OCPA 5I0TA 3NKGA 3LB9A 5CFCB 1AXKA 2HWF3 1HN1A 1TVGA 1WMEA 4IXLA 1J59A 4CEWA 3IBMA 5IVCA 2D3SA 3RVHA 3K2OA 3ZXKA 4AEDB 4WVMB 2W68A 3AZZA 1WW6A 1OA4A 3KCYA 4QMAA 2VW1A 4YW4A 2WZPP 4A3ZA 5IFPA 4Y33A 4AQSA 3MEPA 4OHYA 1KD7A 2VL4A 4E8CA 2VY0A 4AVBA 3HIFA 3WNNA 4LLOA 3W58A 3A22A 1YNAA 4ZU4A 3V0BB 3EHKA 1JZ7A 3WHUA 1KDKA 1JZ3A 2Z42A 1B09A 3OPTA 1PGW1 4OUEA 2ZJCA 2OPWA 1G6NA 3OPZA 4JQRA 5A32B 3KSCA 4B4RA 2VZ1A 5FFOC 3ENRA 3IDBB 1IPJA 2XJQA 2WA3A 4AGGA 3SXWA 3VD4A 3WNMA 1X50A 2PHFA 3CO2A 1P8JA 2QQOA 4RN5A 1LOGA 5FPAA 1PO11 3UKTA 3S6PA 5IK7A 4PIZA 3WP4A 1RHI2 1Y7BA 2JJ6A 4E27A 4ZPIA 2I74A 1VMFA 1H1MA 2IC1A 2XLFA 1BBT3 4DPNA 3RZLA 2FDIA 2VBPA 3LEKA 4XFHA 3AYCA 1TEIA 2BEOA 4I30A 2YPDA 3BIWE 1KITA 1IS5A 2PQQA 1VMJA 3H50A 3T2PA 1ND2A 4MX3A 4S2FA 5H9SA 4Q29A 4CDUA 2QUOA 3LFMA 2NLRA 4Y24A 1VLNA 1K5MA 3MF6A 1ND3B 2EXIA 1T6BX 2HWF2 4BLJA 4ES8A 3MLLA 1JYCA 2P4EA 4PIXA 1DQ5A 2P6HA 5C3PA 1XBFA 5FZDA 3WDXA 4L11A 3AYEA 3VUOA 3I2KA 3UL2A 2WS91 3PURA 4LKFA 4W65A 5B4NA 3ON7A 3DYOA 4MO3M 4WM7A 5FRAA 3ZSMA 5JSPA 3E6CC 1ZREA 1NCRB 2ZGPA 1ZNPA 2P37A 4JGYA 2ZMLA 4NRPA 4WM8C 5FO9B 5LY2A 1SCSA 5KWRA 3BCWA 4DRRA 4OI4A 2OW4A 3HMYA 5F3GA 2RMU3 2Y8KA 1IQDC 3VBFC 3GJBA 2A6WA 2W91A 3S5AA 5EJ3A 1IS6A 1SHWB 1W0NA 4QXKA 1WUVA 4NOTA 1I1EA 4CSWA 4H2AA 1ZBA3 1QJEA 3APBA 3FLPA 5AFBA 3OOXA 5A70A 1G9DA 1I6XA 3U14A 3IAPA 4JV4A 5FYYA 2RDRA 3N3HA 2J1TA 3K4ZA 1BBT2 3NNMA 1S0JA 4RSUA 2DURA 2VOXA 2QZ2A 2W1UA 4MSVA 2Y60A 4META 3JQXA 3MDPA 1W06A 1UW8A 1AXYA 1O59A 1ULFA 2VH9A 5FP4A 4DY3A 3NQHA 2VZRA 1O7FA 2C4XA 1KEXA 4XBQA 2OUJA 2VTXA 1RJ7A 5CZKA 1ENXA 2BRTA 4TZDA 4AAXA 4QKDA 4AQ2A 1WA6X 1S55A 2JB8A 4JC1A 1ULGA 2AREA 2DCTA 2UYBA 3HT1A 4TLFA 1UQXA 1OVSA 2RR13 3N7KA 1S0IA 5ANQA 1U12A 4AL9A 4XDPA 1SLIA 1ZBE3 3ACLA 3POBA 3WNXA 4PJYA 5T5PA 3HPNA 3DEMA 3D3AA 4YFZA 4QPGA 1Q56A 2C6SA 2X5IB 4FFIA 1SPPB 4LO5B 5BNNC 2R061 3WD5A 2RMU2 4XFBA 3NAPC 1U5YA 4AI3A 4HKWA 1G9BA 4MADA 4UOJA 2QQKA 2VECA 1RUH3 4AFBA 3KMHA 1XQNA 1AR63 1DQ4A 4XF3A 3KV5A 1NY71 3MBWA 1ZBA2 3KB5A 2PHXA 4B1MA 3CIHA 5DAPA 1DZTA 2WIIB 5JOWA 1IGOA 4WVWA 2W94A 2Q0AA 4QX8A 3B9IA 1AR73 2GC1A 2ZACA 4PI0A 5AFEA 2B5HA 2ZGNA 1UOJA 3I3EA 5FPLA 3B00A 2OQ7A 4LA2A 2JDZA 2VOKA 1QH6A 3ES4A 2JB4A 2WRAA 4RD7A 4QGMA 3EO6A 4MVTA 3WV6A 2RJKA 1XPWA 2GMEA 3FUQA 1GYKA 3VD5A 1H8TC 5IAXA 1ULEA 1BEV3 4YFWA 3C7HA 3IKWA 5KC5A 4DXSA 3TEYA 4BK5A 5FCCA 5FREA 3MLJA 1O3RA 1QWRA 3SCHA 1W2TA 4Q8LA 2RR12 2JDYA 2WLPA 3NJYA 1QGLA 1GANA 4CDQB 3OYWA 1ZBE2 2CSGA 2XBO3 1WLTA 4ES9A 4LBJA 3J8F1 1TMF3 1MQTA 4R9CA 3OBZA 4A7KA 4P02B 3M3IA 1HJFA 4CXXA 5K8SA 2QE3A 1SCRA 3ZDSA 2WZR3 4N53A 2RDNA 1HRV3 3VBUA 1TME1 4HFSA 1RUH2 2JDUA 1V6OA 2OA2A 1AR62 2E32A 3CNAA 1PK6A 4GZ9A 4Y3OA 1NAEA 2D98A 2A5ZA 4IUGA 2IZWA 1US3A 5FP3A 3EBRA 5FZ4A 2WSUA 4A6SA 4AAPA 4LBQD 1LULA 2WFPA 2GZWA 3K48A 3VDDC 2FZ2A 2VCCA 2XHKA 1POQA 2WWJA 3L9JT 1JU4A 2A6ZA 5CA6A 2IFWA 3E5XA 2XJPA 4RFT0 4W4ZA 2MNGA 1ASJ3 1H9WA 3IDCB 4Y1YA 5FZ3A 3SH4A 2WUHA 4AWDA 1VAKA 2AC1A 4LNVA 1G86A 1UMZA 1VAVA 2J1AA 4Y26A 4CRQA 3WX5A 2WC2A 1XE0A 3WXPA 5JOZA 1TG7A 3E5QA 2DVAA 1BEV2 4U2AA 4COWA 3IPVA 1YJLA 1CGPA 2Y33A 2YUEA 1K5JA 3I4IA 5LY1A 4LXLA 3VBHA 5FQ0A 4CUGA 1I3HA 3MI8A 4PLOA 3UGGA 2MPFA 5FYSA 4KU7A 1UU6A 3AM2A 2XBO2 1J1TA 3TBDA 5FWJA 5BXXA 3RG0A 2FDHA 3LOIA 5FPVA 5A3NA 1TMF2 2BNMA 1AYN3 1HN0A 3O5SA 3VV1A 3POJA 4EQVA 4AHYA 2HJIA 4CCJA 2RE9A 3OTFA 2EXJA 3RZMA 3W9AA 3PVBB 2WZR2 2YC2A 1HRV2 5T52A 1ZZ9A 3H7YA 2WFF3 4NHLA 3W5NA 3O1RA 4XUPA 3UGFA 2QDRA 1BK1A 3M7AA 4IEVA 4YARA 1R64A 4YZ5A 1LRHA 4PT6A 5JR7B 1KRIA 1NG0A 5FWEA 2JDPA 3LAGA 5FKCA 4DEQA 1JYVA 2CU5A 1VALA 5FYHA 1GOGA 4W6WA 1ASJ2 3L2HA 4I0BA 1PX3A 1UL9A 2UURA 1R093 3T4HB 4YW6A 3BB6A 1S2BA 4LHNA 1YI9A 3KD4A 3RMYA 4LBNA 1Y9QA 4OHWA 4X6RB 4AZZA 4BQXA 3O1SA 4DB5A 2G1MA 1QH7A 2CNAA 2GH2A 4BJ0A 3H9AA 2QCSB 3C7FA 3JBG1 4A4AA 5JLVA 3V0BA 1BLZA 1GZWB 1JBCA 1PGL2 1FPN1 1O8SA 3POWA 3SEPA 1C8M3 1QXJA 5IFTA 3AL5A 2WT0A 1NLSA 4PQQA 4QU2A 4QXBA 1AYN2 5FOJB 5A32A 4EN8B 1D0HA 1D7PM 4AHZA 5T5JA 5LEJA 1RUI3 5JOYA 2HYXA 3QH6A 4MXWB 1YQ8A 2QKDA 3FHQA 4L0PA 3RMXA 1W2NA 3B01A 4BB3A 3WW2A 3U07A 1FMD1 5CU1A 4EZHA 1F5JA 4XPVA 2WFF2 1G7YA 5FKBA 4XQDA 1LOAA 4GKXA 1LHUA 1PVC3 2LUWA 2X05A 4JX0A 4N90A 4RQPC 1GOFA 1ZZ7A 3ZFEC 1ZRDA 1OD5A 1PO23 2JKBA 2D3PA 4YW3A 2A6YA 2YFZA 4QDQA 3VBOC 5HXMA 2VBBA 2RS11 4A7ZA 3DKWA 4EWEA 5LA0A 4IV3B 3HQUA 3GCWA 4NPMA 4DY5A 2XDVA 1I5ZA 2G19A 1ND3A 4ATEA 1XNDA 1NXMA 1R092 1RINA 1UZ0A 2OPKA 3KWVA 4L92A 4OZOA 4XTMA 1WMDA 4C8DA 5K0UB 4IEWA 3HVDA 3M1HA 2ZGQA 4S2DA 3HQRA 4XQWA 1TNFA 5GKAC 4YZ3A 5FXXA 1LEDA 3RQ0A 1UKRA 1OHFA 2VUJA 3MPBA 5F39A 1FT9A 3WDWA 1RTVA 1NCRA 5IAVA 5C9AC 3DN7A 1POV1 1KS5A 3AZVA 3C2UA 2JX9A 1C8M2 2DTYA 5K4LA 4Q1RA 2JE9A 1NQDA 2AEYA 4BPZA 2WDBA 4GIQA 4NHMA 2SLIA 3SISA 3WF2A 1W0OA 3HWJA 4Q4Y3 1D4M3 5G05L 4BIFA 1RUI2 1URXA 1H4HA 1W9WA 4XJ8A 3SITA 1DGWX 1LCLA 2Y6FA 3Q9OA 3K77A 4Y1VA 2EF6A 3ZPOA 1HIXA 3CJIC 3HD8B 3OGRA 3UJQA 5FR3A 1IG3A 2DYCA 3I49A 1AJOA 1PVC2 3U0ZA 2G4IA 2ZBJA 4QHBA 4EROA 4HBNA 1PO22 3T09A 4QXCA 5F5QA 5DZFA 5FBJA 5LATA 2HWC3 3R6SA 1O4TA 5C5TA 4HKLA 1UAIA 2W9XA 4LE4A 3KT1A 5FYTA 1CVNA 3D0JA 5C3OA 1AYM1 3WT3A 3SKVA 3M3OA 5DZEA 4D3WA 5FZ9A 3WUCA 1NUKA 4JZRA 4EV0A 3I2GA 3U78A 1CIWA 1LEMA 4QPYA 1YIFA 3LEGA 2LTNA 3RI8A 4AE2A 1ZRIA 4RS5C 1F35A 1HXS1 1OBNA 2ET7A 5FZOB 5HCAA 1LOFC 3PJQA 4XIKA 2X5IA 4C0HA 1SPPA 4YGCA 2DCYA 4OQ9A 2RM23 3LOBA 1UYXA 2B9VA 4HANA 4O7XA 1O4YA 1FNZA 1OURA 1OOPC 1HJGA 2CWSA 3M2MA 4Q4Y2 4CP0A 1GNZA 1D4M2 1OSGA 3OY8B 3ZFFC 4QX3A 5GLWA 4B7KA 1GP5A 3SMHA 1XB9A 4QM8A 3J4UH 3OEBA 1NCQB 3FHIB 1FX5A 3NW4A 3PUSA 3DECA 1UIKA 1V70A 2ZGTA 4JAAA 4QGNA 2WNEA 4C1XA 3TEZA 2EIGA 3IIIA 3U4XA 4MGYE 4BLIA 3KV4A 5APAA 2Y6HA 1LGNA 1DGRN 3CZJA 4KG0A 5ABJC 2JD4A 1ODNA 2HWC2 2JG9B 3N35A 3MUY1 2PFWA 5IHRA 1RUD3 1BVVA 2O8QA 4XJWA 4FPOB 1ONAA 2F4PA 4DUVA 1Q8QA 4LO4B 3TEXA 4U36A 2NMNA 4OHZA 4NHKA 2VMFA 1C3HA 4CDQA 1HQWA 1PNFA 1ENQA 5KBFA 3JB8A 4C91A 2FDGA 2XKOA 1V0AA 4XF1A 4MG2A 2YV8A 5A3OA 3B94A 4LHKA 4HLTA 5F2WA 1IS3A 2WZEA 1WKYA 2RM22 4JHZA 4NWVA 4UF0B 1XOYA 4OI1A 3TN93 4QX0A 1HB4A 3RSJA 2A3WA 2OX0A 4AHXA 1A78A 2BZDA 1MVEA 3GBFA 4BXSV 4EWDA 1NA1A 3VKNA 2Q1ZB 4P00B 4AI2A 3RZZA 3K4DA 3J26N 1SG3A 3MV01 1VBB3 4N43C 1W8NA 4KBBA 3TYJA 4CDXC 3ZYPA 1IHMA 1W90A 2JE7A 4QQPA 4BH9A 3BUCA 1QJY3 2BTVC 2WNUC 3AKTA 3FJSA 3MHZA 2JENA 3M70A 4FPHA 2CAUA 3ZXGA 5KXDA 3ZXDA 1OPOA 3PNAA 4LIUA 3ZSLA 4UFKA 2QBXA 2C5DA 3CKHA 5JDBA 4NIDA 4QPIC 4CYDA 2VMEA 3N7LA 3SC7X 1W6OB 2RS53 4O61A 1DGLA 5E8AA 1CONA 5A1LA 2VE1A 2VULA 3I3DA 3HNBM 4JDNA 4LQRA 4Q0SA 5C4WC 3CU7A 2QQJA 3CMGA 1W39A 5IJRA 3UKVA 1MS9A 2MEV1 4UYBA 5IUQA 1RL3A 3H1MA 4D6SA 1COV3 4OMCA 1VRBA 4A2UA 2TBVA 1JOPA 1BKZA 1Q8SA 4GH4C 5FIXA 1ZX5A 5FO8B 1MEC1 2A75A 3TN92 3AMPA 4QWNA 3JUUA 4CPBD 3OF1A 5IK8A 3ZN4A 1W8ZA 1LODA 3E6DA 2VOTA 2XB6C 3ZN6B 1PX4A 1VBB2 3UJOA 1SFNA 3AC0A 1GMMA 4EN9B 4UW3A 5BNOC 4XIOA 5A1FA 5GM0A 1QJY2 2HEWF 1GOHA 3RDIA 5CVRA 2ZGRA 1AL23 1MZ6A 4CCNA 1UXXX 1GICA 5FPXA 4LBQB 1O6UA 1LAJA 1GP4A 3M4FA 5FBZA 1HLCA 1H4GA 4WM8B 3LD8A 2EA7A 1LKNA 1JW6A 1WD4A 3OG2A 5H9RA 2E33A 2RS52 2J22A 4C90A 5KHKA 5KXCA 4GA9A 3O1OA 3VBFB 4YM0A 1GZWA 3AL6A 4Z1VA 1EYBA 3H8OA 2RMU1 3AXDA 2VTFA 1R083 1VRH3 2WJSA 1YIPA 3B9CA 4XF4A 1F5FA 4OMDA 4W6XA 4BQWA 1GNYA 1WD3A 1X9TA 1XSRA 2WAAA 4QB1A 3R4DB 1EAH3 2LW8A 2AENA 1COV2 2Y0OA 4FCAA 4MXWA 5FO7B 1EP0A 2B46X 2DVBA 1ZA7A 1QJX1 1B35C 4OHXA 2XVKA 3SCGA 1KXGA 5IVFA 4Q4W2 5EWSA 1W3XA 1UKGA 4M0HA 2VAUA 4H3WA 4P9LA 4H7LA 3LSEA 4HL0A 2YBKA 4OVEA 3IM0A 3TRSB 4K9SA 4M01A 5F37A 3HN1A 1YO8A 2AEZA 2ARAA 2BFUL 2R041 4QQLA 5A3TA 4NE9A 4IV3A 1RITA 1RUJ3 5L7OB 4B4QA 4LITA 3AJZA 3DPRC 2VBDA 1AL22 1MS8A 1QJZA 1SLLA 3O0WA 2P1BA 5LCWL 2XQRA 3ILRA 5LK7B 1I5PA 1K12A 2WO2A 4PDWC 1W2OA 1XNCA 1ZBE1 2VVDA 3LSDA 1LENA 4K21A 2FMDA 5FYZA 1HB1A 5GALA 3JU9A 4RHV1 2TNFA 5DUUA 2CY6A 1CAWB 3THDA 1OA3A 5BNNB 3VD9A 1RMU3 1SMVA 2GAUA 4I01A 4EWAA 2BVVA 1V6JA 5HCHA 1KS4A 4RR3B 4XFGA 1JYTA 2PAKA 1R082 1VRH2 3V0AB 1DYOA 3MZHA 2VMDA 4Q5OA 1RUH1 3NV4A 4P9WA 3T0AA 2FBEA 1AR61 4Y20B 4XFFA 4Y1ZA 3CLPA 2BW8A 1EAH2 4D7YA 1SEFA 1AL0G 4E2GA 3U37A 3BTZA 3OBRA 1GWMA 4BHPA 5JXGA 2VR4A 4GWJA 2R071 1ULPA 5HXVA 4MGQA 1D2QA 1LJ7A 2BOIA 3SLIA 3DGTA 2LM3A 3ZR5A 1RXFA 3MIEA 2VGDA 4HK9A 2O1QA 2ET1A 2GC3A 5HI0A 2X09A 3ZFGC 5JSOA 4M3CF 4BQ4A 1RUJ2 3WNOA 3AJYA 2RHPA 4O9EA 4UFMA 1OH3A 4LPLA 3FFZA 3LE0A 3ZX7A 4DUXA 4CDWB 2VC9A 1CAVB 2JXAA 3FL7A 3KGLA 4DXRA 3GZTB 2JDMA 3ZXAC 1OC1A 1OUXA 4GWIA 4E4SA 5M0TA 1Q43A 1ND2C 4GWMA 1TMF1 5ERLA 4UFLA 3TWIA 3VB9A 1RC6A 1UY1A 3A0KA 5FZOA 1SLAA 3WG2A 1K5MC 2P5BA 1YQ2A 2C1FA 2XXZA 4AQ6A 3G7DA 2GC2A 1UY2A 2HWE1 3C7GA 3HOBA 4MLOA 1RUOA 3VZNA 4FPCA 2ZEZA 1QIQA 4GALA 5CKNA 4HZFA 4Q4V2 1DFQA 5F6KA 5CFDB 2ERFA 2G9ZA 2V4VA 3TB0A 4WM7C 5I93A 2JICA 5KXBA 2WQ4A 4LO8A 4MGIE 4G9SB 3Q8BA 4JGYC 1GQGA 3GJAA 4A42A 2UWCA 5LW9A 1VBC1 4YVWB 3BI3A 1NCQA 4NUBA 3ZXEA 4CCMA 4BQYA 4NIGA 4G3YC 4X8PA 2CGOA 3I2JA 1JMUB 2QQMA 3MFAA 2DTWA 4FQ4A 5FYMA 2B8MA 3TAYA 4QX7A 5C3RA 5IYYA 3VL8A 1A8MA 4CP9B 4ZY9A 3H42B 4HSLA 4WZCA 2XHNA 1OQ1A 1LTEA 4XUQA 3ORJA 1EV13 2NQYA 2JG9A 2QQWA 3WF1A 1YC61 1W6MB 4ZKTB 1ZVFA 3WDVA 2A1XA 1VAMA 3IWZA 4DQAA 1Y9GA 1S0DA 4ITCA 5JUVA 5IWFA 1UO9A 1JXNA 2VMIA 3VHOA 5K9YA 5KC6A 3FUOA 1PGL1 2XUMA 3ACFA 4V2VA 4Q4X3 1DDLA 4UFJA 2DFCA 2YHJA 4JKKA 3AMMA 3NJZA 1YXWA 3S0MA 3K51A 4CU9A 2W87A 4FI9A 2LALA 3BPZA 4BM8A 1CX1A 4ZXKA 4FP3A 2VNRA 3ZXFA 1Q3EA 4DNYA 3B7MA 1HV1A 3J7HA 1UMHA 1JYIA 5T55A 1U5IA 1EUTA 4FOVA 3O0VA 4YW7A 3U75A 1Z7S3 3UYJA 1YHFA 4WVZA 5C7GA 1IOAA 4UF0A 3WF3A 3ITQA 2H6BA 1CESA 4Y1XA 2Z69A 4MGTA 2XMLA 1DF0A 2GALA 3ABZA 4W8JA 3QCWA 4COZA 4LKEA 3WR0A 4QPGC 5FMCA 3GBWA 4A6OA 3SHRA 1RVF3 2BDRA 5JPNB 4D6QA 1XU2A 3Q8CA 3GGLA 3CHXA 1XNBA 3WF4A 4RA0A 5GLTA 5F3EA 2UY9A 1SACA 2VOWA 3NWKA 1A3KA 2ZGUA 1EV12 5FYVA 4K3UA 4IGOA 2V4AA 1RUF3 4ARXA 4K40A 1XYOA 2BV4A 2F4LA 1ODMA 1ZRRA 5A7NA 4CUAA 5EYYA 5LA2A 5BUVA 3SEEA 2GNTA 4FAGA 2BVBA 2GNDA 1Z78A 4IEPA 1JN2P 1W6OA 4FFHA 1QOSA 3D0SA 4D7TA 1VBD3 2OZJA 1J83A 1YWKA 3CQOA 2D6PA 2W46A 4Q4X2 5CB7A 2WNVC 1E5SA 3PVEA 4YVSB 4MXVA 4ZS2A 3OBTA 3AVRA 4KWJA 5L36A 5JXHA 2N7GA 3ILFA 4AFCA 3LDRA 3W20A 4F83A 1QDCA 5FZGA 1RUG1 1V6LA 4ORFA 2HWB1 4YW2A 1DQ1A 3RZGA 4PBOA 2PAMA 4D69A 2WWSA 2EVXA 4A7YA 4PI2A 1OLRA 2VZPA 2YB7A 1TE1B 1Z7S2 3K75B 1WCDJ 2VUCA 4UBGA 5DAQA 2JD9A 3D5OA 4XDOA 2FMYA 2RS31 1MQTC 1V00A 3PU8A 2ZS6B 2A70A 5J36A 2OT7A 4SBVA 1RVF2 2QQIA 5AC93 3JXSA 4AQTA 3ETQA 4EYUA 1BXHA 1XRUA 4QHZA 4CA9A 5A1AA 4KNCA 5JWPA 1DQ6A 3I2IA 3D8CA 2D3RA 2ZGLA 4AFAA 5FMBA 3VBUC 3OB8A 3THPA 2UU8A 4M00A 1W05A 1E5IA 2ZAHA 3LKJA 4ISRA 2PHTA 5FOBB 1PK6C 1N1TA 4JRLA 1REFA 1WCSA 3D6EA 4XCAA 1OVPA 4ATFA 1M06G 1RUF2 4LBQA 2JE8A 3H3UA 4TWTA 1OLQA 1GU3A 5C9AB 1KJLA 4JGZB 4XILA 4DOUA 3I97A 2KD7A 1VBD2 4AI0A 2DU0A 3CBNA 5B4XA 1QQP3 5FJHA 3WQBA 4BDVB 1X33A 1JH5A 2JECA 3WDTA 2D6NA 4HVRA 3CJXA 3GALA 1T6GC 3ST7A 1AR83 4XYXA 1AUYA 1F4AA 5T3NA 5FPUA 5E16A 4LK6A 2YMZA 2A6XA 3IMMA 4IE4A 2W92A 5CADA 1L7RA 4IV1A 3RRDA 4IEQA 3UT0A 4BE3A 1AX1A 5F7UA 4INDA 4E4ZA 3JD73 3USSA 1ZZ8A 3CJIB 4LO6B 2X10A 4NHYA 1XXNA 3VBHC 4IE7A 5DDJ3 4Q2FA 3VN4A 1ULCA 2ADEA 1XE7A 3FLRA 5F5IA 1O3TA 3I3BA 4DXZA 2R30A 3USUB 1UIJA 2P2KA 4XF0A 5FLHA 1T2XA 3U11A 1Y3TA 5AC92 2VNOA 4ISQA 4RYDA 5FZ1A 4CCCA 3JQWA 1JU3A 2WQZC 5DMYA 1OMIA 5K7PA 4JRAA 3M8LA 5JZGB 5L7OA 3W59A 1JZ4A 3WZ1A 1PIV3 1WGPA 2YFUA 2NN8A 3Q8EA 5FZEA 3WVJA 4MGSA 3VZOA 4BISA 3NRUA 1AR72 1PMJX 1V9U3 4O65A 4DZGA 3B02A 1CAWA 2W1SA 2Y6LA 1O5UA 5DUXA 5JIUA 4XBNA 1SDDB 1QQP2 3WNKA 5KHGA 2HH9A 3O1MA 5SV5A 4RR3A 1OOPB 4KBZA 3VD3A 1AR82 2BP6A 2VQUA 3H3LA 2X8KA 1YFUA 5F6LB 5FYUA 3K4AA 1UOFA 3V0AA 3WQ1A 3O0XA 2R0HA 4D94A 4Y20A 4PF1A 5EV7A 3K3OA 1QDOA 3MIDA 5F1RA 3PVOA 1IKQA 4CXYA 3JD72 3VBSB 4OHVA 3POIA 1CN1A 2R16A 2PA7A 5DDJ2 4AVAA 4FPJA 2VQ0A 2ZGMA 1UXZA 4R52A 2IXKA 2H0VA 5D8AB 1F4HA 3N9MA 5E6HA 3HJRA 4W6YA 1W9TA 2I07B 3GZEA 2AYHA 3AVSA 5A6ZA 1C5IA 2W1QA 5ABJB 4NIHA 1O4ZA 1L3JA 3AP5A 2YGLA 2DFBA 5A6YA 5IVEA 2VNGA 3W21A 1PO13 2OZ6A 2VVEA 1D0GA 4LUMA 3NMBA 4CXWA 3KVAA 1FOD3 4CP2A 4FQZA 4Z82A 4BU2A 1V6KA 1GBGA 1PIV2 1CD3G 1UX6A 3MW3A 3SH5A 4GMP1 1RYYA 2WKKA 3GF6A 4LEJA 4CDWA 1CAVA 1MZEA 2R49A 5SV8A 4LR4A 3ZDVA 2E7AA 5F32A 5C8CA 4NPRA 1V9U2 5IK5A 4LULA 1VBE1 5DAXA 2HWD3 3ZSJA 5DQ0A 5CFCA 1YRZA 1FV2A 4HKOA 5I0RA 4AGRA 1YI7A 2GP3A 2MHFA 2D6KA 3I2HA 3I2FA 2VOVA 1XU1A 3N36A 4FXKB 1R1A1 1AHSA 2OXBA 4AEDA 2JDNA 4WVMA 4XVHA 2WS93 1J1LA 5H9PA 2FDJA 2JIGA 2XQXA 2BWCA 3WCSA 3P6BA 1OH4A 5CFDA 4IEYA 1H6YA 2Q5TA 1G9AA 1VPHA 5F3CA 3WDYA 1XE8A 5IVYA 5LBEA 2CDOA 3AKQA 2VQTA 1HRI1 2PXJA 4HONA 4IDZA 4YVWA 3UV9A 4Q0UA 1PGW2 1Y43B 1VBA1 2OQ6A 4UT5A 1WA4A 1QJY1 1W6QB 5AVPA 2P3JA 5C6CA 2J7MA 4QXHA 4XFCA 4CP9A 2JDKA 4M3CE 3ALQA 1PO12 2CYFA 2WABA 1H1AA 3ASIA 3ZR6A 4QPIB 1FOD2 5FMOL 1C1LA 2WO1A 1W6MA 3QACA 5T5LA 3J9SA 4B3NA 2WA4A 2DWRA 3F95A 2KA3A 4MHUA 2F6BA 2XJRA 2XLGA 1RGSA 2E31A 5A80A 5FUPA 4Q0PA 3OGVA 3WQ0A 3AXEA 4I0AA 2W3JA 4YG6A 3KS7A 2Q8OA 2V72A 3OEAA 2HWD2 1XYPA 3AMHA 4CUBA 5FY4A 3T4VA 5KHIA 4GH4B 1PVXA 1COV1 4ZXEA 4L8QA 2QDNA 3VBRC 4NRQA 4URAA 5FXWA 2WS92 1S0BA 4FTEA 3DYPA 5FZ8A 1JTZX 4Q4W1 3VZMA 4CCOA 3FWEA 4IEUA 4K8RB 1QOTA 4R9AA 1RIRA 1WMXA 4XJZA 4AI1A 3H1YA 2R063 2X5IC 5IT6A 4Q1PA 3EYPA 3LA2A 4LHLA 3O12A 2ZX4A 2IXJA 4UAPA 5FXZA 3ACGA 4YM2A 1O5LA 4KL1A 1V6IA 2JG8B 1LR5A 1RUNA 3THCA 1WW7A 4AF9A 1GZTA 2PLV1 3WW1A 4YZ1A 2DDUA 3PUAA 3VHPA 3MIBA 3T30A 3KZ4C 2QQNA 1MZ5A 3K46A 4B1LA 2NPIA 4OUMA 2YPJA 4V2WA 2EALA 4ZS3A 1UYZA 1YEWA 5I8TA 5LA9A 2Y38A 2A7AA 4PHZA 4YVSA 3ZMNA 1VRH1 2AGSA 2BPA2 3MUZ1 2ZXQA 2DCKA 2XJUA 1RUC1 3VDBA 1QJU1 2BNNA 5EZWA 3IT8A 3J7MA 2FHRA 2A71A 4GQ7A 4OYUA 3EQEA 2YROA 4Y22B 4ZU5A 5FDBA 4CUCA 2YDEA 3AYDA 3MW4A 4IE6A 2W2IA 2ZHNA 4CDQC 3P5BA 5I0DA 1CQ9A 3J8F3 4J25A 1WLDA 1J58A 1YQ6A 2XG3A 4IEZA 5FAXA 1N3PA 1NYWA 1SBEA 1YQCA 2R062 2Y6GA 3LIGA 4N9HA 4HETA 2Q8CA 4IEOA 1OT5A 1A8DA 1XNAA 3HQXA 4ONUA 3AK0A 3LQCA 3DPRB 5A6QA 4XE9A 1BVP1 1TME3 2Y6KA 4XJ9A 5FUIA 1ZA4A 3ATGA 3WUDA 4QT6A 3ZYIB 3H8XA 1NY72 3JCIA 3WSOA 1K3IA 4K20A 3WG1A 1NA1C 1DZRA 4XHBA 2ZMNA 2Q8DA 3C7EA 1CAUB 3B3QE 3LGRA 4GWNA 1ZM1A 4Y4RA 3T0BA 1W2AX 4JGZA 3E6BA 4XUNA 4ZONA 3CDZB 5FZ0A 4BMBA 5IVBA 4CP1A 1FAYA 2E7TA 4V1PA 3FBYA 2W47A 4MGZE 1AXZA 2GDFA 3LWCA 2VM9A 3O7OA 3QBQA 3VLBB 2E6VA 3DXTA 2BQPA 3IIAA 4Q4V1 5J1XA 4D6RA 2ZHMA 4MH0E 2XVLA 3WY6A 2D6OX 5JOXA 2ENRA 3ZVXA 2XPJA 3CZUA 3UNPA 2XOMA 2QQUA 3AMQA 5FZHA 3WW3A 5LB6A 2UWAA 1LOCA 4DEVA 5LZ6A 1UPIA 2VD7A 4LJHA 4XMIA 4TTGA 4IE5A 3GNEA 1N47A 4IE0A 4YGBA 2WBKA 2ZKLA 1JUHA 2BBVA 3RYRA 4AVTA 1JHNA 3J8F2 1H0BA 5JMCA 5FZKA 1LHNA 3USUA 3VKFC 1BCXA 4OI0A 1C8NA 1JUIA 3ZFGB 2E53A 2CV6A 4I0WB 4QQ2A 3N9OA 5IK4A 3POEA 4IGPA 1J84A 1RHI1 4FPEA 5BNQA 3AP7A 1TME2 2YYOA 1OI6A 3LPGA 3BU0A 4CPBA 5JZGA 2GN7A 2NMOA 3MYXA 2PQSA 4NWWA 2CWMA 1PMHX 4FOWA 1LB2A 1YFWA 5FUNA 5KHHA 2B42B 1H2NA 3R0RA 4RGGA 3GZAA 4LA3A 5FXVA 1VR3A 2RJLA 2HWF1 3LFIA 1DQ2A 3AFGA 4HMZA 5A7QA 5DZGA 5EFUA 4JDMA 3NL1A 2IVJA 4XURA 1DCSA 3AFKA 1OOPA 4L2NA 1HKDA 3PDQA 5LBBA 1UYYA 1W8UA 5FY8A 1RUD2 5IVJA 2QZ3A 2FCVA 2WAOA 4JQTA 5I0SA 1SLCA 3GDBA 3JBG3 1LGCA 3S5QA 5FYCA 3FZ3A 5JVVA 5DPNA 3ZXLA 1IKPA 3RGBA 5C3SA 3VBSA 5JXIA 1FPN3 2ID4A 5EXOA 1IQAA 5G04L 2A73B 3F2ZA 1AF9A 5D8AA 2E51A 1AR93 4YG3A 3UESA 3LF7A 4FPGA 5CIRA 3WEZA 4ZHNA 3PU3A 5FZLA 4FP2A 4FT8A 4J6GA 1H2MA 3I2DA 1GNHA 4LOSA 2GMMA 4XXAA 1BZWA 2VJXA 1W28A 1AVBA 1DYPA 1FMD3 3C3VA 3EMRA 3KF3A 4FFFA 5FP8A 5I91A 4FTBA 1BBT1 3OUIA 5C71A 1UWWA 3POYA 1JZ5A 3N7JA 3UK9A 1CZSA 4DIQA 3ZYFA 2HLEA 1ZRFA 3WNLA 4PQ9A 4XAAA 1YQ5A 2LS6A 4JKLA 1NKGA 1RUE3 4BXFA 1IZ3A 1W8FA 2ZMKA 3T3YA 1H9PA 5FLIA 4CU7A 5HBAA 2EAAA 4YRDA 1PM4A 2RS13 4Z92B 4JDOA 1OF4A 2VZ3A 5CAZA 5J7MA 1JZ6A 5A7PA 1UY3A 4IV3C 1DYKA 4ASLA 1VJ2A 2EIEA 4XCBA 1DHKB 5L9RA 3I7DA 3DF0A 3PTRB 1OLME 4LOTA 5F2SA 3GZUC 1UY4A 3LA7A 4F3JA 2FDFA 2R0FA 3R4SA 4KWLA 4LUKA 2ZGKA 4QPGB 5FMDA 3JBG2 1E5RA 3SQOA 2ZTNA 2RDQA 1JOJA 4CCKA 4R8HA 1POV3 2CDPA 3DYMA 3HNYM 1FPN2 2VZTA 3MF9A 3P3PA 4XZPA 3MGUA 1QXPA 2D5FA 3FLTA 5A6XA 5FZBA 1BJQA 5KR7A 1AR92 3HEIA 3NV1A 3FFQA 4UFHA 2YBSA 1ZBA1 5FZFA 1JZ8A 3BN6A 1O91A 4MZUA 1MZFA 5BNPC 2VU9A 5JI9A 5LWBA 1FMD2 3ZO0B 1WCKA 3AB0A 3QLQA 1Y4WA 2OIIA 4QPIA 4UW4A 5IATA 1FXZA 1YFXA 2XJVA 3PUQA 2Z79A 2WNVB 3T2QA 4PLNA 2Z2SB 3AX4A 1RUE2 4UI9L 1A6CA 2VTXJ 4LORA 2OS2A 1GR3A 1NE4A 4H7MA 3RZHA 2RS12 4HK8A 1QMJA 1IG0A 1X7NA 1OPMA 2DU1A 2JEMA 3DUIA 2DUPA 4TXWA 3H1WA 3X29B 5A3UA 1AYM3 4QAWA 4OQ8A 2IFRA 3CL1A 4IERA 1F31A 5E88A 2CGNA 3GCXA 3Q8FA 5D2AA 4YW1A 2RR11 5K0UA 1UN1A 4LMFA 1MR5A 3BOPA 1LHOA 4MUVA 5JIAA 1C28A 4AHWA 1H8VA 1UU5A 4BQ5A 1JOBA 2CAVA 2WT1A 2VVFA 2VMHA 1VB4A 5GZCA 4I09A 1XSQA 2EICA 1UMIA 2V5DA 3IDAA 3RZJA 4QPWA 3NAPB 1PHMA 3KCCA 2VZUA 4CU8A 3NVCA 5LBFA 3URFA 4EZ4A 3H0OA 4CEWC 4KH9A 5T50A 4R9BA 1X9PA 2Y64A 3VBUB 4B7EA 1RXGA 3LA3A 3B69A 4KGQA 3RYPA 2WN2A 2FDKA 3ZSKA 5F5CA 1PK6B 4BQ2A 5HV0A 1ST8A 2JG8A 3O1TA 3NO8A 4BOWA 1BMV2 3V64A 5EJ1B 3RFRA 4CCEA 2VCAA 5A3PA 1K42A 1AR71 3OUJA 3T1LA 4CVUA 1F9KA 4GB33 1LNSA 1Q5OA 4M4PA 4KI5M 2J1VA 1QQP1 1OKQA 2WZ8A 5H9QA 2PHUA 1H8TB 1CJPA 2VMGA 5BY5A 3NV3A 3GYDA 3ZM8A 2JG9C 3ZKUA 3INAA 4JVAA 2XLAA 3HBKA 1BEV1 4IW3A 4P9JA 4AEMA 4ZZ5A 1DU3D 1AYM2 2BGCA 3POFA 2QQPA 1JHJA 5J3UA 1Y9MA 2RJ2A 5GZFA 2CGPA 1LESA 1SQ4A 4Y22A 1CR7A 2XBO1 3T08A 4K8FA 4CCDA 4RGAA 1SBFA 3BU7A 3ZXJA 1GUIA 3HR9A 4OULA 4CDUC 3WHTA 1RMU2 1NLRA 1LU2A 1XC6A 5EP9A 2W0XA 2C9KA 2H0BA 3KHBA 3NNFA 3EB7A 2WZR1 4AYUA 4UWDA 1HRV1 2YGMA 1OUSA 3DPRA 4AOCA 2GNMA 2A3YA 4NVPA 3ETPA 1PIV1 2ZA9A 1DQ0A 3OY8A 1CPMA 2JDHA 3VDDB 3OBAA 1TZOA 4PCRA 1GKBA 5BYNA 3O1UA 2KR2A 4FTSA 1V9U1 3DKQA 1CAUA 3NNLA 1DZQA 2DCZA 4GB32 3FBMA 4JCKA 1UU4A 2J1RA 3I59B 4YM3A 1ASJ1 1C1FA 1UZWA 3D4KA 2WLQA 4MYEA 2VUDA 1QOOA 2VZSA 4LE3A 2ADDA 4W50A 4FPLA 4NAMA 1POV0 4BIOA 1G9CA 2BJSA 4GXLA 3N9QA 3KV6A 3CEWA 4AEJA 4L9BA 4YGDA 2JDAA 5IW0A 2PYTA 1LOEA 3WDUA 3N9PA 2J1EA 2YU1A 4JTNA 3DXUA 5FYIA 4JHTA 4EN7B 1REEA 3KCXA 2NP0A 1S1AA 1S0CA 4XUOA 1CX4A 2DCJA 4GAZA 2OVUA 3LDBA 1AYN1 4Y5SA 1UY0A 1N1VA 1H2KA 2MEV3 2Q1FA 4WZFA 4NHXA 3ZLIA 2C0ZA 4FVVA 4WBBA 2ZEWA 3ZFGA 4BQ1A 1FOD1 4TN7A 2X53S 1L7LA 1GWKA 1MEC3 2IXCA 2WFF1 4HOOA 1QF3A 1ZZ6A 4KWKA 1CWPA 4QHOA 2V5YA 4A45A 2XKPA 5KXEA 4CU6A 2BWAA 4FPYA 1UD1A 3BTYA 2OUHA 5A7SA 4YYOA 5DG1A 4YM1A 2PHLA 1ZYBA 4B4PA 1BYHA 3BOWA 4YW5A 4IL7A 3IB3A 2HWD1 4YPJA 1JYNA 2NM1A 1XNKA 2ZCWA 1R091 1WCUA 2C24A 5FLJA 3ZIWA 1VMHA 3OUHA 4URTA 4RGKA 3ZYJB 2ZX1A 1SZBA 1SFPA 1VB2A 1EY2A 5GLVA 2DUOA 1GLHA 1MS4A 3S30A 4E4HA 2KM2A 2C26A 1DGRA 1R1ZA 3I2OA 4QX5A 3BPSA 3ROUA 5J96B 4R9DA 3BTXA 2V09A 1C8M1 4S2HA 4JTOA 4F7ZA 5C3QA 1OA2A 5FP9A 4XABA 1J3RA 2ZZJA 2ZPXA 4XC9A 1JYWA 2FQPA 3BYWA 2MEV2 4XETA 4EN6B 5DXDA 1RUI1 1KQRA 3MV11 5FZAA 2FCTA 4IV1C 5FJKA 4GJYA 3L2YA 5LBCA 1MEC2 4QU1A 1QJX3 3WW4A 1KGYA 3IN9A 3IDEA 1F15A 2D5HA 1W6NB 4RQPB 4FOQA 1PVC1 1QJFA 2ARCA 2WYSA 5LASA 3ZFEB 4QKNA 1O3SA 2EIDA 2YXSA 1PO21 2K2SA 4R4XA 2B7YA 3VBOB 3AZWA 4IQPA 4K1YA 3FMGA 4XQ4A 1NE6A 2Z4FA 4QX1A 3ZN6A 1JI6A 2BERA 2DF7A 2R6QA 3NNGA 4OI2A 5LRSA 2R043 4M3CB 4IESA 4N53C 4SLIA 5ACA3 2GNBA 4UW5A 2WN3A 3VBRB 5L7OC 1UYPA 2B39A 4Q8KA 4D8MA 3H8RA 4QQOA 2YBPA 4HVQA 1YJKA 4RFRB 5FP7A 2R7EB 1YCIA 2PAEA 2E9QA 3FE5A 4RHV3 4LBMA 4WM8A 1UX7A 1X82A 1HW5A 1J3QA 2BNOA 2UWBA 3E1F1 1CZVA 4H55A 4NIAA 1U5XA 1ENRA 1QHDA 3ECQA 3WF0A 3TEWA 1LHVA 2D44A 3OPWA 3VBFA 1CJDA 1DGWA 2GN3A 1PM7A 2VCMA 1NQJA 4WVVA 4RR3C 4X8NA 2V73A 5CG8A 3GXUA 1UZVA 4DXTA 3LDKA 3PVNA 4Q4Y1 4TSVA 1D4M1 3I3QA 4H14A 1EUUA 3WCRA 2QTWB 1W9SA 4DRVA 1QEXA 3ZMOA 5JAXA 4EE2A 1US2A 2ZX0A 4HVOA 3SKJE 3GHMA 3PHMA 4OUSA 4Y5Z0 4CEYC 1QJX2 1MACA 2R073 3ES1A 3GM8A 2VW2A 3IZOA 2LROA 3BKZA 3S57A 2WINB 3KGZA 1DP0A 1QNWA 2PELA 3PIGA 2WNVA 1H2LA 3MICA 3ZOIA 4AVVA 4BMEA 2W39A 2AUYA 2HWC1 5B2GB 3VZKA 1SDWA 2W5FA 4QDSA 2R042 2Q1MA 4XZUG 5GLZA 3M3CA 4EN0A 5ACA2 2OYZA 1AJKA 3N7MA 5C33A 3LIHA 2XGXA 1CAXB 3PMSA 4J1WA 2Y34A 4CDWC 4RS5B 2WO7A 3LEMA 4TLGA 2EAKA 5FZ7A 3BODA 3VDAA 5I8YA 4MGKE 4QKFA 4RHV2 4E2SA 4YNIA 5C8CC 2ZAAA 3N4MA 4I2OA 4HPKB 3O14A 4LBKA 2WT2A 3HT2A 2EXHA 2J1UA 5BNNA 3FC0A 2BOJA 5CFCC 2RV9A 3J7LA 4C0BA 3NAPA 1STMA 1UOGA 2DVDA 5E89A 2HWE3 2RM21 2DVGA 5T54A 5ANNA 1NX9A 2VQAA 4IETA 3NJXA 1EPZA 3A23A 3AZYA 1WWYA 4K6BA 2D40A 4AEDC 3VHNA 2ORXA 3N9NA 4YG0A 3ZFFB 4G4FA 4NR1A 3I8TA 1H1IA 2B4KA 5CFDC 4AVSA 1NA1B 1F2NA 2XWJB 5A3WA 2HBUA 5LK5A 5FY5A 1VBC3 3C8XA 5A7WB 4FBFA 4UFIA 2R072 4YVWC 3HNMA 5DG2A 1WBFA 4QB6A 1BK0A 2HKXA 1N1YA 3U1XA 4KWUA 3AKPA 1Q8PA
chains in the Genus database with same CATH topology
1XNAA 3LQCA 4OMDA 1GNYA 5FUIA 2Y6KA 2WAAA 4QB1A 2LW8A 3I2KA 5B4NA 3WSOA 4A41A 1K3IA 3DYOA 4MO3M 4QDRA 3C7EA 3T0BA 4Z2AA 4XUNA 3CDZB 2Y8KA 1IQDC 2W91A 3WNPA 2W47A 4E8DA 1SHWB 1W0NA 3ACHA 2VM9A 5J1XA 5LCWL 3LEIA 3CZUA 3UNPA 1I5PA 3IAPA 2XOMA 1K12A 2WO2A 3FN9A 2J1TA 3K4ZA 4DEVA 4TTGA 2WBKA 2W1UA 3THDA 2BBAA 3VD9A 3VD7A 5JXJA 1O59A 1JZ2A 2BGPA 3NQHA 2VZRA 2C4XA 1DYOA 1KEXA 2VMDA 5CZKA 3POEA 1J84A 3T0AA 4AAXA 2XONA 3HN3A 3LPGA 3U37A 2PQSA 3POBA 1PMHX 5C70A 5JXGA 2VR4A 4GWJA 3HPNA 3DEMA 1ULPA 3D3AA 1W99A 2VZQA 4MGQA 1SPPB 4XUTA 3IAQA 2VZVA 4MADA 4UOJA 2QQKA 2Y6JA 2X09A 4XURA 3WNOA 2VCBA 3MBWA 1UYYA 4LPLA 2RVAA 3CIHA 1WCQA 3LE0A 4QX2A 4DUXA 2WAOA 2VC9A 2W94A 3GDBA 4DXRA 3FL7A 4D0QA 5DPNA 3PUIA 3I3EA 4GWIA 5JXIA 4CU8A 1W8OA 2ID4A 1UY1A 5G04L 1OD3A 3F2ZA 3UESA 1YQ2A 1XPWA 3WEZA 3C7GA 1UY2A 3HOBA 3VD5A 4LOSA 2ZEZA 3C7HA 2VJXA 5CKNA 3VDCA 4DXSA 4BK5A 2V4VA 5C71A 1UWWA 1JZ5A 1CZSA 4A42A 2HLEA 3WNLA 2LS6A 4JKLA 1CIYA 1NKGA 3I2JA 2ORZA 2QQMA 4M4RA 4CU7A 4P02B 5IYYA 1OF4A 2VZ3A 1CZTA 4ZY9A 1JZ6A 1UY3A 2XHNA 3T2OA 4XUQA 2EIEA 4AG4A 3WF1A 2YC4A 3OGSA 1NZIA 2E32A 4LOTA 4GZ9A 1MPXA 1NAEA 5JUVA 1UY4A 4IUGA 1US3A 5DN2A 2WO3A 3ACFA 4JKKA 2VCCA 2CDPA 3DYMA 1JU4A 3HNYM 2VZTA 4W4ZA 4CU9A 2W87A 4FI9A 1CX1A 2WUHA 2J1AA 3HEIA 1GQPA 3J7HA 1UMHA 2VO5A 4ARYA 1EUTA 1TG7A 1JZ8A 3BN6A 5C7GA 3PUHA 3BGAA 3WF3A 1DLCA 3ABZA 4KMQA 4W8JA 2E26A 3T0DA 3T2QA 4A6OA 2BGOA 4UI9L 4LORA 3GGLA 3POJA 3WF4A 4TXWA 4JKMA 4QAWA 2YC2A 3W5NA 4ARXA 1JYXA 4LMFA 4CUAA 4XUPA 5LA2A 3SEEA 1R64A 4PT6A 1J83A 3CQOA 2W46A 4DEQA 1JYVA 2EICA 1UMIA 2V5DA 3IDAA 4QPWA 5JXHA 1GOGA 2VZUA 2YG0A 2Y64A 1PX3A 3MO4A 2WN2A 2J1SA 2VZPA 2YB7A 3K75B 4BJ0A 5EJ1B 4ZZ8A 2VCAA 1K42A 5JMOA 3C7FA 4A4AA 4ET7A 4CVUA 2JD9A 1NT0A 1LNSA 3POGA 1O8SA 3SEPA 4M4PA 4KI5M 2J1VA 5IFTA 2QQIA 3UETA 2WZ8A 3JXSA 4PQQA 5A1AA 3I2IA 2JKXA 1D7PM 3OB8A 2HYXA 3ZM8A 4ZZ5A 5CKMA 3FHQA 4L0PA 3POFA 5CISA 1JHJA 1K45A 2RJ2A 2JE8A 5HPOA 1GU3A 2X05A 4JX0A 3I97A 2KD7A 2W1WA 3T08A 1GOFA 5EIYB 2YFZA 1GUIA 5B4XA 2VZOA 4QDQA 3WQBA 4BDVB 5HXMA 5LA0A 1XC6A 2C9KA 1F4AA 3EB7A 3P1IA 1UZ0A 4LHSA 4OZOA 2W92A 1L7RA 3ETPA 5F7UA 2ZEXA 2X10A 3OBAA 2W95A 2ZEYA 3I3BA 1T2XA 2J1RA 2WDBA 1BHGA 4RYDA 3WF2A 2VZSA 1JU3A 4W50A 5DMYA 5G05L 1JZ4A 1W9WA 2YFUA 4MGSA 3K77A 2JDAA 3LPFA 3OGRA 2J1EA 3NRUA 1PMJX 3A7QA 3VDBA 4XUOA 4LKSA 2DCJA 2W1SA 2Y6LA 3T09A 3W5MA 1SDDB 1UY0A 3WNKA 5CYYA 2W9XA 3VD3A 2QQLA 2ZEWA 2VQUA 5LA1A 3K4AA 4HG6B 3SKVA 4PF1A 1NUKA 3I2GA 1H6XA 3A21A 3LEGA 4A45A 4DUWA 3POIA 4CU6A 1UXZA 1F4HA 3HJRA 1L7QA 1W9TA 1SPPA 3IB3A 4YPJA 1JYNA 2W1QA 1UYXA 2B9VA 3KQ4B 1SZBA 1SFPA 1O8PA 4QX3A 3OEBA 1RYYA 2C26A 3FHAA 2WNOA 3DECA 4MOAA 3IIIA 5DQ0A 1JYWA 2Y6HA 3CZJA 3I2HA 3I2FA 3MUY1 3MV11 5IHRA 4QB2A 4XVHA 5JR2A 2XQXA 3P6BA 4DUVA 1OH4A 1ULOA 1KGYA 1H6YA 2VMFA 2WYSA 2CDOA 2WQ8A 2EIDA 2VQTA 2OKXA 4QX1A 2Z4FA 1JI6A 2BERA 3NNGA 1OF3A 2J7MA 2VMCA 2WZEA 4P5YA 1WKYA 4JHZA 5EJZB 2WN3A 2WABA 4D8MA 2WO1A 4QX0A 4BXSV 2BZDA 2R7EB 1XNTA 4P00B 3K4DA 1UX7A 1SG3A 2EIBA 3MV01 1W8NA 3NJVA 2E31A 1CZVA 3E1F1 3WF0A 3C7OA 3ECQA 3OGVA 2W3JA 2V72A 3OEAA 4BK4A 4CUBA 3GXUA 4DXTA 2L9LA 1EUUA 4ZXEA 1W9SA 2QBXA 5CKQA 3CKHA 4P08A 1US2A 3SKJE 3DYPA 2VMEA 3GM8A 4A44A 1DP0A 3ACIA 3I3DA 3HNBM 4LQRA 3EYPA 2QQJA 1HN1A 1TVGA 3CMGA 5IJRA 4UAPA 2W5FA 3ACGA 4QDSA 4XZUG 4OMCA 3THCA 4A3ZA 5IFPA 2DDUA 2VL4A 4E8CA 3WNNA 3A22A 2QQNA 3K46A 1JZ7A 1JZ3A 3VDAA 2VOTA 1UYZA 1PX4A 4OUEA 2J1UA 2VZ1A 3AC0A 1GMMA 2RV9A 3VD4A 3MUZ1 3WNMA 2ZXQA 2DCKA 1GOHA 1NX9A 1P8JA 2QQOA 3NJXA 4RN5A 3A23A 1UXXX 2ORXA 4OYUA 2B4KA 3LEKA 4CUCA 3C8XA 3OG2A 5I0DA 2E33A 2J22A 3HNMA 3T2PA 4QB6A 2VTFA 2Y6GA 4KWUA 1OT5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNA A;  3LQC A;  4OMD A;  1GNY A;  5FUI A;  2Y6K A;  2WAA A;  4QB1 A;  2LW8 A;  3I2K A;  5B4N A;  3WSO A;  4A41 A;  1K3I A;  3DYO A;  4MO3 M;  4QDR A;  3C7E A;  3T0B A;  4Z2A A;  4XUN A;  3CDZ B;  2Y8K A;  1IQD C;  2W91 A;  3WNP A;  2W47 A;  4E8D A;  1SHW B;  1W0N A;  3ACH A;  2VM9 A;  5J1X A;  5LCW L;  3LEI A;  3CZU A;  3UNP A;  1I5P A;  3IAP A;  2XOM A;  1K12 A;  2WO2 A;  3FN9 A;  2J1T A;  3K4Z A;  4DEV A;  4TTG A;  2WBK A;  2W1U A;  3THD A;  2BBA A;  3VD9 A;  3VD7 A;  5JXJ A;  1O59 A;  1JZ2 A;  2BGP A;  3NQH A;  2VZR A;  2C4X A;  1DYO A;  1KEX A;  2VMD A;  5CZK A;  3POE A;  1J84 A;  3T0A A;  4AAX A;  2XON A;  3HN3 A;  3LPG A;  3U37 A;  2PQS A;  3POB A;  1PMH X;  5C70 A;  5JXG A;  2VR4 A;  4GWJ A;  3HPN A;  3DEM A;  1ULP A;  3D3A A;  1W99 A;  2VZQ A;  4MGQ A;  1SPP B;  4XUT A;  3IAQ A;  2VZV A;  4MAD A;  4UOJ A;  2QQK A;  2Y6J A;  2X09 A;  4XUR A;  3WNO A;  2VCB A;  3MBW A;  1UYY A;  4LPL A;  2RVA A;  3CIH A;  1WCQ A;  3LE0 A;  4QX2 A;  4DUX A;  2WAO A;  2VC9 A;  2W94 A;  3GDB A;  4DXR A;  3FL7 A;  4D0Q A;  5DPN A;  3PUI A;  3I3E A;  4GWI A;  5JXI A;  4CU8 A;  1W8O A;  2ID4 A;  1UY1 A;  5G04 L;  1OD3 A;  3F2Z A;  3UES A;  1YQ2 A;  1XPW A;  3WEZ A;  3C7G A;  1UY2 A;  3HOB A;  3VD5 A;  4LOS A;  2ZEZ A;  3C7H A;  2VJX A;  5CKN A;  3VDC A;  4DXS A;  4BK5 A;  2V4V A;  5C71 A;  1UWW A;  1JZ5 A;  1CZS A;  4A42 A;  2HLE A;  3WNL A;  2LS6 A;  4JKL A;  1CIY A;  1NKG A;  3I2J A;  2ORZ A;  2QQM A;  4M4R A;  4CU7 A;  4P02 B;  5IYY A;  1OF4 A;  2VZ3 A;  1CZT A;  4ZY9 A;  1JZ6 A;  1UY3 A;  2XHN A;  3T2O A;  4XUQ A;  2EIE A;  4AG4 A;  3WF1 A;  2YC4 A;  3OGS A;  1NZI A;  2E32 A;  4LOT A;  4GZ9 A;  1MPX A;  1NAE A;  5JUV A;  1UY4 A;  4IUG A;  1US3 A;  5DN2 A;  2WO3 A;  3ACF A;  4JKK A;  2VCC A;  2CDP A;  3DYM A;  1JU4 A;  3HNY M;  2VZT A;  4W4Z A;  4CU9 A;  2W87 A;  4FI9 A;  1CX1 A;  2WUH A;  2J1A A;  3HEI A;  1GQP A;  3J7H A;  1UMH A;  2VO5 A;  4ARY A;  1EUT A;  1TG7 A;  1JZ8 A;  3BN6 A;  5C7G A;  3PUH A;  3BGA A;  3WF3 A;  1DLC A;  3ABZ A;  4KMQ A;  4W8J A;  2E26 A;  3T0D A;  3T2Q A;  4A6O A;  2BGO A;  4UI9 L;  4LOR A;  3GGL A;  3POJ A;  3WF4 A;  4TXW A;  4JKM A;  4QAW A;  2YC2 A;  3W5N A;  4ARX A;  1JYX A;  4LMF A;  4CUA A;  4XUP A;  5LA2 A;  3SEE A;  1R64 A;  4PT6 A;  1J83 A;  3CQO A;  2W46 A;  4DEQ A;  1JYV A;  2EIC A;  1UMI A;  2V5D A;  3IDA A;  4QPW A;  5JXH A;  1GOG A;  2VZU A;  2YG0 A;  2Y64 A;  1PX3 A;  3MO4 A;  2WN2 A;  2J1S A;  2VZP A;  2YB7 A;  3K75 B;  4BJ0 A;  5EJ1 B;  4ZZ8 A;  2VCA A;  1K42 A;  5JMO A;  3C7F A;  4A4A A;  4ET7 A;  4CVU A;  2JD9 A;  1NT0 A;  1LNS A;  3POG A;  1O8S A;  3SEP A;  4M4P A;  4KI5 M;  2J1V A;  5IFT A;  2QQI A;  3UET A;  2WZ8 A;  3JXS A;  4PQQ A;  5A1A A;  3I2I A;  2JKX A;  1D7P M;  3OB8 A;  2HYX A;  3ZM8 A;  4ZZ5 A;  5CKM A;  3FHQ A;  4L0P A;  3POF A;  5CIS A;  1JHJ A;  1K45 A;  2RJ2 A;  2JE8 A;  5HPO A;  1GU3 A;  2X05 A;  4JX0 A;  3I97 A;  2KD7 A;  2W1W A;  3T08 A;  1GOF A;  5EIY B;  2YFZ A;  1GUI A;  5B4X A;  2VZO A;  4QDQ A;  3WQB A;  4BDV B;  5HXM A;  5LA0 A;  1XC6 A;  2C9K A;  1F4A A;  3EB7 A;  3P1I A;  1UZ0 A;  4LHS A;  4OZO A;  2W92 A;  1L7R A;  3ETP A;  5F7U A;  2ZEX A;  2X10 A;  3OBA A;  2W95 A;  2ZEY A;  3I3B A;  1T2X A;  2J1R A;  2WDB A;  1BHG A;  4RYD A;  3WF2 A;  2VZS A;  1JU3 A;  4W50 A;  5DMY A;  5G05 L;  1JZ4 A;  1W9W A;  2YFU A;  4MGS A;  3K77 A;  2JDA A;  3LPF A;  3OGR A;  2J1E A;  3NRU A;  1PMJ X;  3A7Q A;  3VDB A;  4XUO A;  4LKS A;  2DCJ A;  2W1S A;  2Y6L A;  3T09 A;  3W5M A;  1SDD B;  1UY0 A;  3WNK A;  5CYY A;  2W9X A;  3VD3 A;  2QQL A;  2ZEW A;  2VQU A;  5LA1 A;  3K4A A;  4HG6 B;  3SKV A;  4PF1 A;  1NUK A;  3I2G A;  1H6X A;  3A21 A;  3LEG A;  4A45 A;  4DUW A;  3POI A;  4CU6 A;  1UXZ A;  1F4H A;  3HJR A;  1L7Q A;  1W9T A;  1SPP A;  3IB3 A;  4YPJ A;  1JYN A;  2W1Q A;  1UYX A;  2B9V A;  3KQ4 B;  1SZB A;  1SFP A;  1O8P A;  4QX3 A;  3OEB A;  1RYY A;  2C26 A;  3FHA A;  2WNO A;  3DEC A;  4MOA A;  3III A;  5DQ0 A;  1JYW A;  2Y6H A;  3CZJ A;  3I2H A;  3I2F A;  3MUY 1;  3MV1 1;  5IHR A;  4QB2 A;  4XVH A;  5JR2 A;  2XQX A;  3P6B A;  4DUV A;  1OH4 A;  1ULO A;  1KGY A;  1H6Y A;  2VMF A;  2WYS A;  2CDO A;  2WQ8 A;  2EID A;  2VQT A;  2OKX A;  4QX1 A;  2Z4F A;  1JI6 A;  2BER A;  3NNG A;  1OF3 A;  2J7M A;  2VMC A;  2WZE A;  4P5Y A;  1WKY A;  4JHZ A;  5EJZ B;  2WN3 A;  2WAB A;  4D8M A;  2WO1 A;  4QX0 A;  4BXS V;  2BZD A;  2R7E B;  1XNT A;  4P00 B;  3K4D A;  1UX7 A;  1SG3 A;  2EIB A;  3MV0 1;  1W8N A;  3NJV A;  2E31 A;  1CZV A;  3E1F 1;  3WF0 A;  3C7O A;  3ECQ A;  3OGV A;  2W3J A;  2V72 A;  3OEA A;  4BK4 A;  4CUB A;  3GXU A;  4DXT A;  2L9L A;  1EUU A;  4ZXE A;  1W9S A;  2QBX A;  5CKQ A;  3CKH A;  4P08 A;  1US2 A;  3SKJ E;  3DYP A;  2VME A;  3GM8 A;  4A44 A;  1DP0 A;  3ACI A;  3I3D A;  3HNB M;  4LQR A;  3EYP A;  2QQJ A;  1HN1 A;  1TVG A;  3CMG A;  5IJR A;  4UAP A;  2W5F A;  3ACG A;  4QDS A;  4XZU G;  4OMC A;  3THC A;  4A3Z A;  5IFP A;  2DDU A;  2VL4 A;  4E8C A;  3WNN A;  3A22 A;  2QQN A;  3K46 A;  1JZ7 A;  1JZ3 A;  3VDA A;  2VOT A;  1UYZ A;  1PX4 A;  4OUE A;  2J1U A;  2VZ1 A;  3AC0 A;  1GMM A;  2RV9 A;  3VD4 A;  3MUZ 1;  3WNM A;  2ZXQ A;  2DCK A;  1GOH A;  1NX9 A;  1P8J A;  2QQO A;  3NJX A;  4RN5 A;  3A23 A;  1UXX X;  2ORX A;  4OYU A;  2B4K A;  3LEK A;  4CUC A;  3C8X A;  3OG2 A;  5I0D A;  2E33 A;  2J22 A;  3HNM A;  3T2P A;  4QB6 A;  2VTF A;  2Y6G A;  4KWU A;  1OT5 A; 
#chains in the Genus database with same CATH topology
 4AI8 A;  2XL7 A;  3EJK A;  2RG4 A;  1VIW B;  2AR6 A;  1H8T A;  2XJS A;  2ILM A;  4BWO A;  3DL3 A;  3VKO A;  1X8M A;  2W08 A;  2YU2 A;  1RUD 1;  5BPX A;  4I3P A;  1E5H A;  1W9F A;  4A41 A;  1WW5 A;  4OCT A;  5HV4 A;  4CZS A;  2ZHL A;  5F5A A;  4NII A;  3AKS A;  3WLU A;  4QDR A;  3RS6 A;  3WOG A;  1LOB A;  1UOB A;  4Z2A A;  1KFU L;  1QY4 A;  4AEK A;  2K0G A;  4FXG B;  4NRM A;  4B8E A;  3E97 A;  2G9G A;  3WNP A;  4XW3 A;  4N8M A;  1SLT A;  1ND3 C;  4I02 A;  3ACH A;  4E8D A;  1GQH A;  3AYA A;  5BV6 A;  1UF2 C;  2HWE 2;  4BA6 A;  5ISL A;  4CCL A;  1U0A A;  2ARX A;  4KU8 A;  4RL7 A;  3LEI A;  3LCP A;  3TN9 1;  3ZPY A;  2VPV A;  2IVI B;  3FN9 A;  5JI7 A;  1IS4 A;  1SBD A;  3P3N A;  4KG8 A;  4N43 B;  4CDX B;  1NCR C;  3VDD A;  1VBC 2;  1VBB 1;  5FY1 A;  2BBA A;  5I0U A;  4YZ2 A;  3VKM A;  3SNM A;  2WNU B;  3VD7 A;  1RJ8 A;  2FZ1 A;  2QFE A;  5JXJ A;  3I59 A;  1LHW A;  5LRR A;  5J37 A;  1JZ2 A;  2BGP A;  2ZX3 A;  3TOJ A;  4LKD A;  2XON A;  4IGQ A;  1GZC A;  3HN3 A;  2XUE A;  5DAV A;  3N9L A;  1JOD A;  5C70 A;  2ZX2 A;  3KV9 A;  1TQ5 A;  2RS5 1;  4HSJ A;  4QM9 A;  3UGH A;  4P9I A;  3JB4 C;  5FY0 A;  4NJ4 A;  4Q27 A;  1W99 A;  4Z07 A;  2VZQ A;  2JWP A;  2XWB B;  4XUT A;  3SH3 A;  3IAQ A;  1LGB A;  1DG6 A;  3RYK A;  3R05 A;  5C4W B;  5JCT A;  4YVS C;  1AR9 1;  2VZV A;  2K9Z A;  4NAO A;  1RUG 3;  2HWB 3;  3KVB A;  1W8T A;  3SCF A;  2Y6J A;  2FCU A;  2AH2 A;  3MW2 A;  3KT4 A;  5EHD A;  2ZZQ A;  4E2Q A;  2VCB A;  1CPN A;  1MVQ A;  4YLZ A;  5CBL A;  2RVA A;  4QX2 A;  1WCQ A;  5CNA A;  4AK3 A;  4QGL A;  2ETE A;  2D7F A;  1M4W A;  1PGS A;  4P9G A;  4D0Q A;  1W6P B;  4XOG A;  3PUI A;  2HYK A;  4A3X A;  1XJA A;  2RS3 3;  1RUE 1;  1A34 A;  1W8O A;  1AX2 A;  2CTV A;  2PTM A;  3OJB A;  5DAW A;  4ZU7 A;  3JZV A;  5JSR A;  1TNR A;  5BNO B;  1OD3 A;  2WYF A;  4D7S A;  1SLB A;  2ZOE B;  3O1V A;  1OQE A;  1N1S A;  1UCX A;  1UNB A;  2ARB A;  2R32 A;  5FZC A;  1AL2 1;  2I45 A;  3VDC A;  2Z5W A;  2HBT A;  1NXD 1;  3WIN E;  5A3M A;  2E7Q A;  1VP6 A;  1NOV A;  1W9Y A;  3R4U A;  3VGI A;  1QXR A;  3ZSE A;  2VNV A;  4XF9 A;  2WSV A;  3KM5 A;  5FMO S;  4AW7 A;  2TUN A;  4JGZ C;  3PTY A;  1CIY A;  4P14 A;  2ORZ A;  4XFA A;  5C8W A;  2VG9 A;  4M4R A;  2NZ9 A;  5DUW A;  5FZ6 A;  4XDQ A;  5L9B A;  1PZ9 A;  1YLL A;  1R08 1;  4GKY A;  1ZRC A;  3QD6 A;  1XYN A;  4I3G A;  1CZT A;  2PN5 A;  3ELN A;  1W0P A;  5GZE A;  3ZIX A;  5KHJ A;  4Q0V A;  3T2O A;  1F8V A;  1RUG 2;  4COY A;  5D1I A;  4CEY B;  2QNK A;  2HWB 2;  2BUK A;  2WR9 A;  4AG4 A;  4DFS A;  1ZZB A;  3WQ7 A;  2YC4 A;  5BNP B;  1DIW A;  2P34 A;  3OGS A;  1NZI A;  1EAH 1;  4N9I A;  3OD0 A;  1BMV 1;  5EYX A;  1C4R A;  2H6C A;  1B35 B;  1MPX A;  4J1X A;  4YGE A;  3G6J B;  1ZZC A;  4Y5T A;  5DN2 A;  2WO3 A;  2F17 A;  4RQP A;  1W6N A;  1HQL A;  3QH7 A;  5DUV A;  5L73 A;  3ZFE A;  3MLK A;  1ENS A;  2LRP A;  3ME2 A;  4LBL A;  1S0E A;  2RS3 2;  3VBO A;  1FI2 A;  2D6L X;  4XJA A;  4UBH A;  1W2U A;  1GQP A;  5A33 B;  2HEV F;  4PLM A;  1W8H A;  2VO5 A;  4BZ4 A;  4ARY A;  2K46 A;  1RUJ 1;  2UY8 A;  4M3C A;  3OGJ A;  4OFG A;  4XHX A;  3THT A;  1MS0 A;  1EPW A;  2GU9 A;  3MPP G;  1N3O A;  3BTA A;  3PUH A;  1KFX L;  3VBR A;  5JZG C;  3BGA A;  4PDW B;  1OXC A;  1DLC A;  5F8P A;  1NZC A;  3AP6 A;  4X6Q B;  4KMQ A;  4LBO A;  1S0F A;  4PBP A;  2DBN A;  3Q8A A;  4XMA A;  2E26 A;  5C9A A;  3T0D A;  4QKB A;  3S7I A;  4FSJ A;  2ES3 A;  1WBL A;  4NRO A;  3NV2 A;  1RMU 1;  2BGO A;  2BYV E;  3CF6 E;  3BVC A;  4CEW B;  3J7N A;  1Q8V A;  4Q0Q A;  3PL0 A;  5EPA A;  5T5O A;  2GSY A;  2ZKN A;  4AXO A;  2CHH A;  1VE0 A;  4AR2 A;  1I9R A;  2WWU A;  1D2S A;  3RJR A;  4JKM A;  3D82 A;  2P17 A;  2AAC A;  3T1M A;  4BQ3 A;  5FY7 A;  1JYX A;  5CG9 A;  1O3Q A;  2VW0 A;  5GZG A;  2O14 A;  2GP5 A;  4QD2 A;  1WZX A;  4LLF A;  4UW6 A;  4AVC A;  2CL2 A;  4HT1 T;  3CJI A;  1C5H A;  4F8A A;  4HN1 A;  3VBS C;  2Y26 A;  2P3Y A;  4GB3 1;  5JPM B;  3UKN A;  1OQD A;  1FV3 A;  1PZ7 A;  3BAL A;  5D8A C;  1WLW A;  3HBZ A;  4IEX A;  1Z0H A;  5AVA A;  2YG0 A;  4MV2 A;  1MS3 A;  2IXH A;  3MIH A;  5I8S A;  5GZD A;  2PHR A;  4AFM A;  5A3L A;  4ASK A;  3MO4 A;  5FZI A;  2J1S A;  4C1W A;  3OGG A;  5C5U A;  4LT5 A;  4GD4 A;  4HXC A;  1FNY A;  2C9A A;  2GC0 A;  3ZYH A;  2O8O A;  4ASM B;  4ZZ8 A;  3VL9 A;  5JMO A;  4GMP 3;  2FD8 A;  4ET7 A;  2D93 A;  2QQV A;  1CAX A;  1ND2 B;  1NT0 A;  4RS5 A;  1UZY A;  4NMI A;  3POG A;  2Q8E A;  5CEH A;  5J09 A;  4CDU B;  4N7U A;  1GV9 A;  3KLS A;  1K5M B;  1LOF A;  1VBE 3;  3UET A;  4COU A;  4HPK A;  2G9F A;  5L19 A;  2ZAB A;  4P9Y A;  4LO7 A;  1IPK A;  2JKX A;  1QKQ A;  3M3E A;  4XBL A;  1RED A;  2WL1 A;  4GUL A;  4XEZ A;  2O0O A;  1YYN A;  3ZKY A;  1R1A 3;  5FTT C;  5CKM A;  4AI9 A;  5FK8 A;  1S4C A;  4WM7 B;  1J3P A;  5CIS A;  3H3Z A;  3ZFF A;  1K45 A;  5FK7 A;  3WG4 A;  3WP3 A;  4JGY B;  1PZ8 A;  4L97 A;  3MIG A;  5F9T A;  4L99 A;  5HPO A;  2ZHK A;  4NN0 A;  2W1W A;  3I54 A;  1GP6 A;  5F3I A;  1HRI 3;  3GHN A;  1HB3 A;  5A7W A;  4FPF A;  4Y1U A;  3AMN A;  3H8U A;  4FAH A;  5EIY B;  4OLL A;  2R1D A;  1VBA 3;  1DBN A;  2VZO A;  1GFF 2;  1PNG A;  1WLC A;  1YUD A;  3QOP A;  5FPZ A;  4FOY A;  3P1I A;  5ABJ A;  3RPQ A;  2ATF A;  1G8W A;  4LHS A;  1EV1 1;  1APN A;  3RI9 A;  2D43 A;  1AX0 A;  1JS9 A;  1MS1 A;  1WW4 A;  5FYB A;  1ALY A;  3V65 A;  3VHR A;  2RDS A;  1DLL A;  1GZ9 A;  2ZEX A;  3A4U A;  1AZD A;  4PIY A;  4QQH A;  4WV8 A;  5HCB A;  1ULD A;  2XL9 A;  2PHW A;  2W95 A;  2ZEY A;  4Q4X 1;  2Q4S A;  1V6N A;  3B93 A;  4NPL A;  3PIJ A;  2XVG A;  1VBE 2;  1W3V A;  3AKR A;  1BHG A;  1U5Z A;  3KQR A;  1FAT A;  3IMN A;  2ZGO A;  3O1P A;  1HDK A;  3RWK X;  3WP6 A;  1BQP A;  1Z7S 1;  1R1A 2;  2W52 A;  2YZ4 A;  3NST A;  5K0U C;  2XR4 A;  4CE8 A;  5EQU A;  1NLQ A;  3LPF A;  4YZ4 A;  4Q4W 3;  1N3Q A;  5D21 A;  3I3M A;  5FY9 A;  5A7O A;  3A7Q A;  1KJR A;  5GJ6 A;  4XFI A;  3ZYG A;  4Q26 A;  3FX3 A;  5L9V A;  4N43 A;  1GSL A;  4CDX A;  4XAE A;  4DS0 A;  2KXL A;  1RVF 1;  2I2S A;  2VXJ A;  3DV8 A;  1HRI 2;  4LKS A;  4TYS A;  2P6C A;  2J42 A;  2VUA A;  2ZGS A;  3S7E A;  2XH6 A;  4R4Z A;  3W5M A;  1RB8 G;  1VBA 2;  3OD4 A;  2EXK A;  2E63 A;  5CYY A;  2WNU A;  4O9G A;  3PME A;  1GWL A;  2QQL A;  1W6Q A;  2A6V A;  3A0N A;  2JIJ A;  2P3K A;  5J48 A;  5LA1 A;  3E5U A;  3KF5 A;  4HG6 B;  2JG8 C;  3ZN5 A;  2PLV 3;  4B29 A;  1S2K A;  2NYY A;  1RUF 1;  4MHR A;  2SBA A;  4COV A;  1QNY A;  1H6X A;  4Z2W A;  3BIE A;  3A21 A;  2IXL A;  4FO9 A;  4DUW A;  1QU0 A;  2DBI A;  2D6M A;  4DIN B;  1VBD 1;  2DV9 A;  5HCF A;  5J98 B;  3NNJ A;  4LIV A;  4K7J A;  1KDM A;  4LK7 A;  1L7Q A;  2GMP A;  4LTA A;  1PMI A;  2Y0I A;  1LU1 A;  2XJT A;  3AZX A;  3B5L B;  2IUW A;  4FFG A;  1OKO A;  4NO4 A;  5FPB A;  5C4W A;  4BCU A;  4DMI A;  4BYY A;  4FPK A;  1RUC 3;  1WMF A;  1QJU 3;  2A3X A;  3KQ4 B;  4IV1 B;  3TNP B;  3POS A;  5FZM A;  2YC0 A;  3K3N A;  2QJV A;  2QVS B;  4GH4 A;  3WP5 A;  1O8P A;  3PLQ A;  2HEY F;  3OYW B;  4XXP A;  4HN0 A;  3PJY A;  3RWN A;  4CTE A;  1HV0 A;  3FHA A;  2WNO A;  4P5H A;  1MQT B;  1HXS 3;  1W6P A;  4M0N A;  1HQN A;  3RZK A;  3ILN A;  4AGV A;  1ACC A;  4MOA A;  5AC9 1;  1UZZ A;  1H30 A;  3GBG A;  4P9X A;  3LZZ A;  1S2E A;  2UYA A;  4N53 B;  4GMP 0;  1YFY A;  5GLU A;  3ZYR A;  5BNO A;  4XTP A;  5ACA 1;  2BU9 A;  3VZL A;  1X8E A;  1X36 A;  4QB2 A;  3V56 A;  1W03 A;  5JR2 A;  1C57 A;  4Z8B A;  2AZ5 A;  2PLV 2;  1SFY A;  2TEP A;  1ULO A;  2PHD A;  4UXA A;  5TSW A;  4OZX A;  3VKL A;  1OFN A;  3RJ2 X;  1NCQ C;  4N7I A;  4GJZ A;  2WQ8 A;  2D97 A;  3HAG A;  4KQ7 A;  4XJU A;  4K1Z A;  2OKX A;  2PMW B;  2IWG B;  4AFD A;  1AR8 1;  1MS5 A;  1S0G A;  5LEK A;  1OF3 A;  2IXI A;  2VMC A;  3AP9 A;  4P5Y A;  4EJR A;  1RUC 2;  2R1B A;  1E57 A;  1D4V B;  1QJU 2;  1Q8O A;  4Q4V 3;  5EJZ B;  1OFS A;  2YY1 A;  4CEY A;  4Y4Y A;  2BFU S;  3IPV B;  1OLM A;  2B9U A;  3NKT A;  3VBH B;  1W8W A;  5BNP A;  5FQ0 B;  4PF5 A;  3JD7 1;  1G9F A;  1HX6 A;  1HB2 A;  1FYU A;  1V6M A;  3H7J A;  1B35 A;  1XNT A;  5DDJ 1;  3MIF A;  4DO0 A;  2EIB A;  3T2T A;  3WG3 A;  4S2G A;  3NJV A;  1HXS 2;  3MFC A;  2DUQ A;  3C7O A;  3VZJ A;  4YWA A;  3M3Q A;  1IPS A;  3U4S A;  3OSD A;  3TNQ A;  3U10 A;  2B45 X;  2Q30 A;  4BK4 A;  3AP4 A;  1W04 A;  3KHC A;  1RHI 3;  5A33 A;  2GH8 A;  5DAB A;  2L9L A;  5E1R A;  4E4D X;  1LEC A;  5CKQ A;  4KGG A;  4P08 A;  4PDW A;  4XAC A;  3KT7 A;  5FV3 A;  2X29 A;  3RNS A;  3DCQ A;  4A44 A;  2VXR A;  5C8C B;  4E9K A;  2P3I A;  3ZYB A;  5IVV A;  3ACI A;  3EXU A;  1UPS A;  4YSF A;  2DVF A;  3OCP A;  5I0T A;  3NKG A;  3LB9 A;  5CFC B;  1AXK A;  2HWF 3;  1HN1 A;  1TVG A;  1WME A;  4IXL A;  1J59 A;  4CEW A;  3IBM A;  5IVC A;  2D3S A;  3RVH A;  3K2O A;  3ZXK A;  4AED B;  4WVM B;  2W68 A;  3AZZ A;  1WW6 A;  1OA4 A;  3KCY A;  4QMA A;  2VW1 A;  4YW4 A;  2WZP P;  4A3Z A;  5IFP A;  4Y33 A;  4AQS A;  3MEP A;  4OHY A;  1KD7 A;  2VL4 A;  4E8C A;  2VY0 A;  4AVB A;  3HIF A;  3WNN A;  4LLO A;  3W58 A;  3A22 A;  1YNA A;  4ZU4 A;  3V0B B;  3EHK A;  1JZ7 A;  3WHU A;  1KDK A;  1JZ3 A;  2Z42 A;  1B09 A;  3OPT A;  1PGW 1;  4OUE A;  2ZJC A;  2OPW A;  1G6N A;  3OPZ A;  4JQR A;  5A32 B;  3KSC A;  4B4R A;  2VZ1 A;  5FFO C;  3ENR A;  3IDB B;  1IPJ A;  2XJQ A;  2WA3 A;  4AGG A;  3SXW A;  3VD4 A;  3WNM A;  1X50 A;  2PHF A;  3CO2 A;  1P8J A;  2QQO A;  4RN5 A;  1LOG A;  5FPA A;  1PO1 1;  3UKT A;  3S6P A;  5IK7 A;  4PIZ A;  3WP4 A;  1RHI 2;  1Y7B A;  2JJ6 A;  4E27 A;  4ZPI A;  2I74 A;  1VMF A;  1H1M A;  2IC1 A;  2XLF A;  1BBT 3;  4DPN A;  3RZL A;  2FDI A;  2VBP A;  3LEK A;  4XFH A;  3AYC A;  1TEI A;  2BEO A;  4I30 A;  2YPD A;  3BIW E;  1KIT A;  1IS5 A;  2PQQ A;  1VMJ A;  3H50 A;  3T2P A;  1ND2 A;  4MX3 A;  4S2F A;  5H9S A;  4Q29 A;  4CDU A;  2QUO A;  3LFM A;  2NLR A;  4Y24 A;  1VLN A;  1K5M A;  3MF6 A;  1ND3 B;  2EXI A;  1T6B X;  2HWF 2;  4BLJ A;  4ES8 A;  3MLL A;  1JYC A;  2P4E A;  4PIX A;  1DQ5 A;  2P6H A;  5C3P A;  1XBF A;  5FZD A;  3WDX A;  4L11 A;  3AYE A;  3VUO A;  3I2K A;  3UL2 A;  2WS9 1;  3PUR A;  4LKF A;  4W65 A;  5B4N A;  3ON7 A;  3DYO A;  4MO3 M;  4WM7 A;  5FRA A;  3ZSM A;  5JSP A;  3E6C C;  1ZRE A;  1NCR B;  2ZGP A;  1ZNP A;  2P37 A;  4JGY A;  2ZML A;  4NRP A;  4WM8 C;  5FO9 B;  5LY2 A;  1SCS A;  5KWR A;  3BCW A;  4DRR A;  4OI4 A;  2OW4 A;  3HMY A;  5F3G A;  2RMU 3;  2Y8K A;  1IQD C;  3VBF C;  3GJB A;  2A6W A;  2W91 A;  3S5A A;  5EJ3 A;  1IS6 A;  1SHW B;  1W0N A;  4QXK A;  1WUV A;  4NOT A;  1I1E A;  4CSW A;  4H2A A;  1ZBA 3;  1QJE A;  3APB A;  3FLP A;  5AFB A;  3OOX A;  5A70 A;  1G9D A;  1I6X A;  3U14 A;  3IAP A;  4JV4 A;  5FYY A;  2RDR A;  3N3H A;  2J1T A;  3K4Z A;  1BBT 2;  3NNM A;  1S0J A;  4RSU A;  2DUR A;  2VOX A;  2QZ2 A;  2W1U A;  4MSV A;  2Y60 A;  4MET A;  3JQX A;  3MDP A;  1W06 A;  1UW8 A;  1AXY A;  1O59 A;  1ULF A;  2VH9 A;  5FP4 A;  4DY3 A;  3NQH A;  2VZR A;  1O7F A;  2C4X A;  1KEX A;  4XBQ A;  2OUJ A;  2VTX A;  1RJ7 A;  5CZK A;  1ENX A;  2BRT A;  4TZD A;  4AAX A;  4QKD A;  4AQ2 A;  1WA6 X;  1S55 A;  2JB8 A;  4JC1 A;  1ULG A;  2ARE A;  2DCT A;  2UYB A;  3HT1 A;  4TLF A;  1UQX A;  1OVS A;  2RR1 3;  3N7K A;  1S0I A;  5ANQ A;  1U12 A;  4AL9 A;  4XDP A;  1SLI A;  1ZBE 3;  3ACL A;  3POB A;  3WNX A;  4PJY A;  5T5P A;  3HPN A;  3DEM A;  3D3A A;  4YFZ A;  4QPG A;  1Q56 A;  2C6S A;  2X5I B;  4FFI A;  1SPP B;  4LO5 B;  5BNN C;  2R06 1;  3WD5 A;  2RMU 2;  4XFB A;  3NAP C;  1U5Y A;  4AI3 A;  4HKW A;  1G9B A;  4MAD A;  4UOJ A;  2QQK A;  2VEC A;  1RUH 3;  4AFB A;  3KMH A;  1XQN A;  1AR6 3;  1DQ4 A;  4XF3 A;  3KV5 A;  1NY7 1;  3MBW A;  1ZBA 2;  3KB5 A;  2PHX A;  4B1M A;  3CIH A;  5DAP A;  1DZT A;  2WII B;  5JOW A;  1IGO A;  4WVW A;  2W94 A;  2Q0A A;  4QX8 A;  3B9I A;  1AR7 3;  2GC1 A;  2ZAC A;  4PI0 A;  5AFE A;  2B5H A;  2ZGN A;  1UOJ A;  3I3E A;  5FPL A;  3B00 A;  2OQ7 A;  4LA2 A;  2JDZ A;  2VOK A;  1QH6 A;  3ES4 A;  2JB4 A;  2WRA A;  4RD7 A;  4QGM A;  3EO6 A;  4MVT A;  3WV6 A;  2RJK A;  1XPW A;  2GME A;  3FUQ A;  1GYK A;  3VD5 A;  1H8T C;  5IAX A;  1ULE A;  1BEV 3;  4YFW A;  3C7H A;  3IKW A;  5KC5 A;  4DXS A;  3TEY A;  4BK5 A;  5FCC A;  5FRE A;  3MLJ A;  1O3R A;  1QWR A;  3SCH A;  1W2T A;  4Q8L A;  2RR1 2;  2JDY A;  2WLP A;  3NJY A;  1QGL A;  1GAN A;  4CDQ B;  3OYW A;  1ZBE 2;  2CSG A;  2XBO 3;  1WLT A;  4ES9 A;  4LBJ A;  3J8F 1;  1TMF 3;  1MQT A;  4R9C A;  3OBZ A;  4A7K A;  4P02 B;  3M3I A;  1HJF A;  4CXX A;  5K8S A;  2QE3 A;  1SCR A;  3ZDS A;  2WZR 3;  4N53 A;  2RDN A;  1HRV 3;  3VBU A;  1TME 1;  4HFS A;  1RUH 2;  2JDU A;  1V6O A;  2OA2 A;  1AR6 2;  2E32 A;  3CNA A;  1PK6 A;  4GZ9 A;  4Y3O A;  1NAE A;  2D98 A;  2A5Z A;  4IUG A;  2IZW A;  1US3 A;  5FP3 A;  3EBR A;  5FZ4 A;  2WSU A;  4A6S A;  4AAP A;  4LBQ D;  1LUL A;  2WFP A;  2GZW A;  3K48 A;  3VDD C;  2FZ2 A;  2VCC A;  2XHK A;  1POQ A;  2WWJ A;  3L9J T;  1JU4 A;  2A6Z A;  5CA6 A;  2IFW A;  3E5X A;  2XJP A;  4RFT 0;  4W4Z A;  2MNG A;  1ASJ 3;  1H9W A;  3IDC B;  4Y1Y A;  5FZ3 A;  3SH4 A;  2WUH A;  4AWD A;  1VAK A;  2AC1 A;  4LNV A;  1G86 A;  1UMZ A;  1VAV A;  2J1A A;  4Y26 A;  4CRQ A;  3WX5 A;  2WC2 A;  1XE0 A;  3WXP A;  5JOZ A;  1TG7 A;  3E5Q A;  2DVA A;  1BEV 2;  4U2A A;  4COW A;  3IPV A;  1YJL A;  1CGP A;  2Y33 A;  2YUE A;  1K5J A;  3I4I A;  5LY1 A;  4LXL A;  3VBH A;  5FQ0 A;  4CUG A;  1I3H A;  3MI8 A;  4PLO A;  3UGG A;  2MPF A;  5FYS A;  4KU7 A;  1UU6 A;  3AM2 A;  2XBO 2;  1J1T A;  3TBD A;  5FWJ A;  5BXX A;  3RG0 A;  2FDH A;  3LOI A;  5FPV A;  5A3N A;  1TMF 2;  2BNM A;  1AYN 3;  1HN0 A;  3O5S A;  3VV1 A;  3POJ A;  4EQV A;  4AHY A;  2HJI A;  4CCJ A;  2RE9 A;  3OTF A;  2EXJ A;  3RZM A;  3W9A A;  3PVB B;  2WZR 2;  2YC2 A;  1HRV 2;  5T52 A;  1ZZ9 A;  3H7Y A;  2WFF 3;  4NHL A;  3W5N A;  3O1R A;  4XUP A;  3UGF A;  2QDR A;  1BK1 A;  3M7A A;  4IEV A;  4YAR A;  1R64 A;  4YZ5 A;  1LRH A;  4PT6 A;  5JR7 B;  1KRI A;  1NG0 A;  5FWE A;  2JDP A;  3LAG A;  5FKC A;  4DEQ A;  1JYV A;  2CU5 A;  1VAL A;  5FYH A;  1GOG A;  4W6W A;  1ASJ 2;  3L2H A;  4I0B A;  1PX3 A;  1UL9 A;  2UUR A;  1R09 3;  3T4H B;  4YW6 A;  3BB6 A;  1S2B A;  4LHN A;  1YI9 A;  3KD4 A;  3RMY A;  4LBN A;  1Y9Q A;  4OHW A;  4X6R B;  4AZZ A;  4BQX A;  3O1S A;  4DB5 A;  2G1M A;  1QH7 A;  2CNA A;  2GH2 A;  4BJ0 A;  3H9A A;  2QCS B;  3C7F A;  3JBG 1;  4A4A A;  5JLV A;  3V0B A;  1BLZ A;  1GZW B;  1JBC A;  1PGL 2;  1FPN 1;  1O8S A;  3POW A;  3SEP A;  1C8M 3;  1QXJ A;  5IFT A;  3AL5 A;  2WT0 A;  1NLS A;  4PQQ A;  4QU2 A;  4QXB A;  1AYN 2;  5FOJ B;  5A32 A;  4EN8 B;  1D0H A;  1D7P M;  4AHZ A;  5T5J A;  5LEJ A;  1RUI 3;  5JOY A;  2HYX A;  3QH6 A;  4MXW B;  1YQ8 A;  2QKD A;  3FHQ A;  4L0P A;  3RMX A;  1W2N A;  3B01 A;  4BB3 A;  3WW2 A;  3U07 A;  1FMD 1;  5CU1 A;  4EZH A;  1F5J A;  4XPV A;  2WFF 2;  1G7Y A;  5FKB A;  4XQD A;  1LOA A;  4GKX A;  1LHU A;  1PVC 3;  2LUW A;  2X05 A;  4JX0 A;  4N90 A;  4RQP C;  1GOF A;  1ZZ7 A;  3ZFE C;  1ZRD A;  1OD5 A;  1PO2 3;  2JKB A;  2D3P A;  4YW3 A;  2A6Y A;  2YFZ A;  4QDQ A;  3VBO C;  5HXM A;  2VBB A;  2RS1 1;  4A7Z A;  3DKW A;  4EWE A;  5LA0 A;  4IV3 B;  3HQU A;  3GCW A;  4NPM A;  4DY5 A;  2XDV A;  1I5Z A;  2G19 A;  1ND3 A;  4ATE A;  1XND A;  1NXM A;  1R09 2;  1RIN A;  1UZ0 A;  2OPK A;  3KWV A;  4L92 A;  4OZO A;  4XTM A;  1WMD A;  4C8D A;  5K0U B;  4IEW A;  3HVD A;  3M1H A;  2ZGQ A;  4S2D A;  3HQR A;  4XQW A;  1TNF A;  5GKA C;  4YZ3 A;  5FXX A;  1LED A;  3RQ0 A;  1UKR A;  1OHF A;  2VUJ A;  3MPB A;  5F39 A;  1FT9 A;  3WDW A;  1RTV A;  1NCR A;  5IAV A;  5C9A C;  3DN7 A;  1POV 1;  1KS5 A;  3AZV A;  3C2U A;  2JX9 A;  1C8M 2;  2DTY A;  5K4L A;  4Q1R A;  2JE9 A;  1NQD A;  2AEY A;  4BPZ A;  2WDB A;  4GIQ A;  4NHM A;  2SLI A;  3SIS A;  3WF2 A;  1W0O A;  3HWJ A;  4Q4Y 3;  1D4M 3;  5G05 L;  4BIF A;  1RUI 2;  1URX A;  1H4H A;  1W9W A;  4XJ8 A;  3SIT A;  1DGW X;  1LCL A;  2Y6F A;  3Q9O A;  3K77 A;  4Y1V A;  2EF6 A;  3ZPO A;  1HIX A;  3CJI C;  3HD8 B;  3OGR A;  3UJQ A;  5FR3 A;  1IG3 A;  2DYC A;  3I49 A;  1AJO A;  1PVC 2;  3U0Z A;  2G4I A;  2ZBJ A;  4QHB A;  4ERO A;  4HBN A;  1PO2 2;  3T09 A;  4QXC A;  5F5Q A;  5DZF A;  5FBJ A;  5LAT A;  2HWC 3;  3R6S A;  1O4T A;  5C5T A;  4HKL A;  1UAI A;  2W9X A;  4LE4 A;  3KT1 A;  5FYT A;  1CVN A;  3D0J A;  5C3O A;  1AYM 1;  3WT3 A;  3SKV A;  3M3O A;  5DZE A;  4D3W A;  5FZ9 A;  3WUC A;  1NUK A;  4JZR A;  4EV0 A;  3I2G A;  3U78 A;  1CIW A;  1LEM A;  4QPY A;  1YIF A;  3LEG A;  2LTN A;  3RI8 A;  4AE2 A;  1ZRI A;  4RS5 C;  1F35 A;  1HXS 1;  1OBN A;  2ET7 A;  5FZO B;  5HCA A;  1LOF C;  3PJQ A;  4XIK A;  2X5I A;  4C0H A;  1SPP A;  4YGC A;  2DCY A;  4OQ9 A;  2RM2 3;  3LOB A;  1UYX A;  2B9V A;  4HAN A;  4O7X A;  1O4Y A;  1FNZ A;  1OUR A;  1OOP C;  1HJG A;  2CWS A;  3M2M A;  4Q4Y 2;  4CP0 A;  1GNZ A;  1D4M 2;  1OSG A;  3OY8 B;  3ZFF C;  4QX3 A;  5GLW A;  4B7K A;  1GP5 A;  3SMH A;  1XB9 A;  4QM8 A;  3J4U H;  3OEB A;  1NCQ B;  3FHI B;  1FX5 A;  3NW4 A;  3PUS A;  3DEC A;  1UIK A;  1V70 A;  2ZGT A;  4JAA A;  4QGN A;  2WNE A;  4C1X A;  3TEZ A;  2EIG A;  3III A;  3U4X A;  4MGY E;  4BLI A;  3KV4 A;  5APA A;  2Y6H A;  1LGN A;  1DGR N;  3CZJ A;  4KG0 A;  5ABJ C;  2JD4 A;  1ODN A;  2HWC 2;  2JG9 B;  3N35 A;  3MUY 1;  2PFW A;  5IHR A;  1RUD 3;  1BVV A;  2O8Q A;  4XJW A;  4FPO B;  1ONA A;  2F4P A;  4DUV A;  1Q8Q A;  4LO4 B;  3TEX A;  4U36 A;  2NMN A;  4OHZ A;  4NHK A;  2VMF A;  1C3H A;  4CDQ A;  1HQW A;  1PNF A;  1ENQ A;  5KBF A;  3JB8 A;  4C91 A;  2FDG A;  2XKO A;  1V0A A;  4XF1 A;  4MG2 A;  2YV8 A;  5A3O A;  3B94 A;  4LHK A;  4HLT A;  5F2W A;  1IS3 A;  2WZE A;  1WKY A;  2RM2 2;  4JHZ A;  4NWV A;  4UF0 B;  1XOY A;  4OI1 A;  3TN9 3;  4QX0 A;  1HB4 A;  3RSJ A;  2A3W A;  2OX0 A;  4AHX A;  1A78 A;  2BZD A;  1MVE A;  3GBF A;  4BXS V;  4EWD A;  1NA1 A;  3VKN A;  2Q1Z B;  4P00 B;  4AI2 A;  3RZZ A;  3K4D A;  3J26 N;  1SG3 A;  3MV0 1;  1VBB 3;  4N43 C;  1W8N A;  4KBB A;  3TYJ A;  4CDX C;  3ZYP A;  1IHM A;  1W90 A;  2JE7 A;  4QQP A;  4BH9 A;  3BUC A;  1QJY 3;  2BTV C;  2WNU C;  3AKT A;  3FJS A;  3MHZ A;  2JEN A;  3M70 A;  4FPH A;  2CAU A;  3ZXG A;  5KXD A;  3ZXD A;  1OPO A;  3PNA A;  4LIU A;  3ZSL A;  4UFK A;  2QBX A;  2C5D A;  3CKH A;  5JDB A;  4NID A;  4QPI C;  4CYD A;  2VME A;  3N7L A;  3SC7 X;  1W6O B;  2RS5 3;  4O61 A;  1DGL A;  5E8A A;  1CON A;  5A1L A;  2VE1 A;  2VUL A;  3I3D A;  3HNB M;  4JDN A;  4LQR A;  4Q0S A;  5C4W C;  3CU7 A;  2QQJ A;  3CMG A;  1W39 A;  5IJR A;  3UKV A;  1MS9 A;  2MEV 1;  4UYB A;  5IUQ A;  1RL3 A;  3H1M A;  4D6S A;  1COV 3;  4OMC A;  1VRB A;  4A2U A;  2TBV A;  1JOP A;  1BKZ A;  1Q8S A;  4GH4 C;  5FIX A;  1ZX5 A;  5FO8 B;  1MEC 1;  2A75 A;  3TN9 2;  3AMP A;  4QWN A;  3JUU A;  4CPB D;  3OF1 A;  5IK8 A;  3ZN4 A;  1W8Z A;  1LOD A;  3E6D A;  2VOT A;  2XB6 C;  3ZN6 B;  1PX4 A;  1VBB 2;  3UJO A;  1SFN A;  3AC0 A;  1GMM A;  4EN9 B;  4UW3 A;  5BNO C;  4XIO A;  5A1F A;  5GM0 A;  1QJY 2;  2HEW F;  1GOH A;  3RDI A;  5CVR A;  2ZGR A;  1AL2 3;  1MZ6 A;  4CCN A;  1UXX X;  1GIC A;  5FPX A;  4LBQ B;  1O6U A;  1LAJ A;  1GP4 A;  3M4F A;  5FBZ A;  1HLC A;  1H4G A;  4WM8 B;  3LD8 A;  2EA7 A;  1LKN A;  1JW6 A;  1WD4 A;  3OG2 A;  5H9R A;  2E33 A;  2RS5 2;  2J22 A;  4C90 A;  5KHK A;  5KXC A;  4GA9 A;  3O1O A;  3VBF B;  4YM0 A;  1GZW A;  3AL6 A;  4Z1V A;  1EYB A;  3H8O A;  2RMU 1;  3AXD A;  2VTF A;  1R08 3;  1VRH 3;  2WJS A;  1YIP A;  3B9C A;  4XF4 A;  1F5F A;  4OMD A;  4W6X A;  4BQW A;  1GNY A;  1WD3 A;  1X9T A;  1XSR A;  2WAA A;  4QB1 A;  3R4D B;  1EAH 3;  2LW8 A;  2AEN A;  1COV 2;  2Y0O A;  4FCA A;  4MXW A;  5FO7 B;  1EP0 A;  2B46 X;  2DVB A;  1ZA7 A;  1QJX 1;  1B35 C;  4OHX A;  2XVK A;  3SCG A;  1KXG A;  5IVF A;  4Q4W 2;  5EWS A;  1W3X A;  1UKG A;  4M0H A;  2VAU A;  4H3W A;  4P9L A;  4H7L A;  3LSE A;  4HL0 A;  2YBK A;  4OVE A;  3IM0 A;  3TRS B;  4K9S A;  4M01 A;  5F37 A;  3HN1 A;  1YO8 A;  2AEZ A;  2ARA A;  2BFU L;  2R04 1;  4QQL A;  5A3T A;  4NE9 A;  4IV3 A;  1RIT A;  1RUJ 3;  5L7O B;  4B4Q A;  4LIT A;  3AJZ A;  3DPR C;  2VBD A;  1AL2 2;  1MS8 A;  1QJZ A;  1SLL A;  3O0W A;  2P1B A;  5LCW L;  2XQR A;  3ILR A;  5LK7 B;  1I5P A;  1K12 A;  2WO2 A;  4PDW C;  1W2O A;  1XNC A;  1ZBE 1;  2VVD A;  3LSD A;  1LEN A;  4K21 A;  2FMD A;  5FYZ A;  1HB1 A;  5GAL A;  3JU9 A;  4RHV 1;  2TNF A;  5DUU A;  2CY6 A;  1CAW B;  3THD A;  1OA3 A;  5BNN B;  3VD9 A;  1RMU 3;  1SMV A;  2GAU A;  4I01 A;  4EWA A;  2BVV A;  1V6J A;  5HCH A;  1KS4 A;  4RR3 B;  4XFG A;  1JYT A;  2PAK A;  1R08 2;  1VRH 2;  3V0A B;  1DYO A;  3MZH A;  2VMD A;  4Q5O A;  1RUH 1;  3NV4 A;  4P9W A;  3T0A A;  2FBE A;  1AR6 1;  4Y20 B;  4XFF A;  4Y1Z A;  3CLP A;  2BW8 A;  1EAH 2;  4D7Y A;  1SEF A;  1AL0 G;  4E2G A;  3U37 A;  3BTZ A;  3OBR A;  1GWM A;  4BHP A;  5JXG A;  2VR4 A;  4GWJ A;  2R07 1;  1ULP A;  5HXV A;  4MGQ A;  1D2Q A;  1LJ7 A;  2BOI A;  3SLI A;  3DGT A;  2LM3 A;  3ZR5 A;  1RXF A;  3MIE A;  2VGD A;  4HK9 A;  2O1Q A;  2ET1 A;  2GC3 A;  5HI0 A;  2X09 A;  3ZFG C;  5JSO A;  4M3C F;  4BQ4 A;  1RUJ 2;  3WNO A;  3AJY A;  2RHP A;  4O9E A;  4UFM A;  1OH3 A;  4LPL A;  3FFZ A;  3LE0 A;  3ZX7 A;  4DUX A;  4CDW B;  2VC9 A;  1CAV B;  2JXA A;  3FL7 A;  3KGL A;  4DXR A;  3GZT B;  2JDM A;  3ZXA C;  1OC1 A;  1OUX A;  4GWI A;  4E4S A;  5M0T A;  1Q43 A;  1ND2 C;  4GWM A;  1TMF 1;  5ERL A;  4UFL A;  3TWI A;  3VB9 A;  1RC6 A;  1UY1 A;  3A0K A;  5FZO A;  1SLA A;  3WG2 A;  1K5M C;  2P5B A;  1YQ2 A;  2C1F A;  2XXZ A;  4AQ6 A;  3G7D A;  2GC2 A;  1UY2 A;  2HWE 1;  3C7G A;  3HOB A;  4MLO A;  1RUO A;  3VZN A;  4FPC A;  2ZEZ A;  1QIQ A;  4GAL A;  5CKN A;  4HZF A;  4Q4V 2;  1DFQ A;  5F6K A;  5CFD B;  2ERF A;  2G9Z A;  2V4V A;  3TB0 A;  4WM7 C;  5I93 A;  2JIC A;  5KXB A;  2WQ4 A;  4LO8 A;  4MGI E;  4G9S B;  3Q8B A;  4JGY C;  1GQG A;  3GJA A;  4A42 A;  2UWC A;  5LW9 A;  1VBC 1;  4YVW B;  3BI3 A;  1NCQ A;  4NUB A;  3ZXE A;  4CCM A;  4BQY A;  4NIG A;  4G3Y C;  4X8P A;  2CGO A;  3I2J A;  1JMU B;  2QQM A;  3MFA A;  2DTW A;  4FQ4 A;  5FYM A;  2B8M A;  3TAY A;  4QX7 A;  5C3R A;  5IYY A;  3VL8 A;  1A8M A;  4CP9 B;  4ZY9 A;  3H42 B;  4HSL A;  4WZC A;  2XHN A;  1OQ1 A;  1LTE A;  4XUQ A;  3ORJ A;  1EV1 3;  2NQY A;  2JG9 A;  2QQW A;  3WF1 A;  1YC6 1;  1W6M B;  4ZKT B;  1ZVF A;  3WDV A;  2A1X A;  1VAM A;  3IWZ A;  4DQA A;  1Y9G A;  1S0D A;  4ITC A;  5JUV A;  5IWF A;  1UO9 A;  1JXN A;  2VMI A;  3VHO A;  5K9Y A;  5KC6 A;  3FUO A;  1PGL 1;  2XUM A;  3ACF A;  4V2V A;  4Q4X 3;  1DDL A;  4UFJ A;  2DFC A;  2YHJ A;  4JKK A;  3AMM A;  3NJZ A;  1YXW A;  3S0M A;  3K51 A;  4CU9 A;  2W87 A;  4FI9 A;  2LAL A;  3BPZ A;  4BM8 A;  1CX1 A;  4ZXK A;  4FP3 A;  2VNR A;  3ZXF A;  1Q3E A;  4DNY A;  3B7M A;  1HV1 A;  3J7H A;  1UMH A;  1JYI A;  5T55 A;  1U5I A;  1EUT A;  4FOV A;  3O0V A;  4YW7 A;  3U75 A;  1Z7S 3;  3UYJ A;  1YHF A;  4WVZ A;  5C7G A;  1IOA A;  4UF0 A;  3WF3 A;  3ITQ A;  2H6B A;  1CES A;  4Y1X A;  2Z69 A;  4MGT A;  2XML A;  1DF0 A;  2GAL A;  3ABZ A;  4W8J A;  3QCW A;  4COZ A;  4LKE A;  3WR0 A;  4QPG C;  5FMC A;  3GBW A;  4A6O A;  3SHR A;  1RVF 3;  2BDR A;  5JPN B;  4D6Q A;  1XU2 A;  3Q8C A;  3GGL A;  3CHX A;  1XNB A;  3WF4 A;  4RA0 A;  5GLT A;  5F3E A;  2UY9 A;  1SAC A;  2VOW A;  3NWK A;  1A3K A;  2ZGU A;  1EV1 2;  5FYV A;  4K3U A;  4IGO A;  2V4A A;  1RUF 3;  4ARX A;  4K40 A;  1XYO A;  2BV4 A;  2F4L A;  1ODM A;  1ZRR A;  5A7N A;  4CUA A;  5EYY A;  5LA2 A;  5BUV A;  3SEE A;  2GNT A;  4FAG A;  2BVB A;  2GND A;  1Z78 A;  4IEP A;  1JN2 P;  1W6O A;  4FFH A;  1QOS A;  3D0S A;  4D7T A;  1VBD 3;  2OZJ A;  1J83 A;  1YWK A;  3CQO A;  2D6P A;  2W46 A;  4Q4X 2;  5CB7 A;  2WNV C;  1E5S A;  3PVE A;  4YVS B;  4MXV A;  4ZS2 A;  3OBT A;  3AVR A;  4KWJ A;  5L36 A;  5JXH A;  2N7G A;  3ILF A;  4AFC A;  3LDR A;  3W20 A;  4F83 A;  1QDC A;  5FZG A;  1RUG 1;  1V6L A;  4ORF A;  2HWB 1;  4YW2 A;  1DQ1 A;  3RZG A;  4PBO A;  2PAM A;  4D69 A;  2WWS A;  2EVX A;  4A7Y A;  4PI2 A;  1OLR A;  2VZP A;  2YB7 A;  1TE1 B;  1Z7S 2;  3K75 B;  1WCD J;  2VUC A;  4UBG A;  5DAQ A;  2JD9 A;  3D5O A;  4XDO A;  2FMY A;  2RS3 1;  1MQT C;  1V00 A;  3PU8 A;  2ZS6 B;  2A70 A;  5J36 A;  2OT7 A;  4SBV A;  1RVF 2;  2QQI A;  5AC9 3;  3JXS A;  4AQT A;  3ETQ A;  4EYU A;  1BXH A;  1XRU A;  4QHZ A;  4CA9 A;  5A1A A;  4KNC A;  5JWP A;  1DQ6 A;  3I2I A;  3D8C A;  2D3R A;  2ZGL A;  4AFA A;  5FMB A;  3VBU C;  3OB8 A;  3THP A;  2UU8 A;  4M00 A;  1W05 A;  1E5I A;  2ZAH A;  3LKJ A;  4ISR A;  2PHT A;  5FOB B;  1PK6 C;  1N1T A;  4JRL A;  1REF A;  1WCS A;  3D6E A;  4XCA A;  1OVP A;  4ATF A;  1M06 G;  1RUF 2;  4LBQ A;  2JE8 A;  3H3U A;  4TWT A;  1OLQ A;  1GU3 A;  5C9A B;  1KJL A;  4JGZ B;  4XIL A;  4DOU A;  3I97 A;  2KD7 A;  1VBD 2;  4AI0 A;  2DU0 A;  3CBN A;  5B4X A;  1QQP 3;  5FJH A;  3WQB A;  4BDV B;  1X33 A;  1JH5 A;  2JEC A;  3WDT A;  2D6N A;  4HVR A;  3CJX A;  3GAL A;  1T6G C;  3ST7 A;  1AR8 3;  4XYX A;  1AUY A;  1F4A A;  5T3N A;  5FPU A;  5E16 A;  4LK6 A;  2YMZ A;  2A6X A;  3IMM A;  4IE4 A;  2W92 A;  5CAD A;  1L7R A;  4IV1 A;  3RRD A;  4IEQ A;  3UT0 A;  4BE3 A;  1AX1 A;  5F7U A;  4IND A;  4E4Z A;  3JD7 3;  3USS A;  1ZZ8 A;  3CJI B;  4LO6 B;  2X10 A;  4NHY A;  1XXN A;  3VBH C;  4IE7 A;  5DDJ 3;  4Q2F A;  3VN4 A;  1ULC A;  2ADE A;  1XE7 A;  3FLR A;  5F5I A;  1O3T A;  3I3B A;  4DXZ A;  2R30 A;  3USU B;  1UIJ A;  2P2K A;  4XF0 A;  5FLH A;  1T2X A;  3U11 A;  1Y3T A;  5AC9 2;  2VNO A;  4ISQ A;  4RYD A;  5FZ1 A;  4CCC A;  3JQW A;  1JU3 A;  2WQZ C;  5DMY A;  1OMI A;  5K7P A;  4JRA A;  3M8L A;  5JZG B;  5L7O A;  3W59 A;  1JZ4 A;  3WZ1 A;  1PIV 3;  1WGP A;  2YFU A;  2NN8 A;  3Q8E A;  5FZE A;  3WVJ A;  4MGS A;  3VZO A;  4BIS A;  3NRU A;  1AR7 2;  1PMJ X;  1V9U 3;  4O65 A;  4DZG A;  3B02 A;  1CAW A;  2W1S A;  2Y6L A;  1O5U A;  5DUX A;  5JIU A;  4XBN A;  1SDD B;  1QQP 2;  3WNK A;  5KHG A;  2HH9 A;  3O1M A;  5SV5 A;  4RR3 A;  1OOP B;  4KBZ A;  3VD3 A;  1AR8 2;  2BP6 A;  2VQU A;  3H3L A;  2X8K A;  1YFU A;  5F6L B;  5FYU A;  3K4A A;  1UOF A;  3V0A A;  3WQ1 A;  3O0X A;  2R0H A;  4D94 A;  4Y20 A;  4PF1 A;  5EV7 A;  3K3O A;  1QDO A;  3MID A;  5F1R A;  3PVO A;  1IKQ A;  4CXY A;  3JD7 2;  3VBS B;  4OHV A;  3POI A;  1CN1 A;  2R16 A;  2PA7 A;  5DDJ 2;  4AVA A;  4FPJ A;  2VQ0 A;  2ZGM A;  1UXZ A;  4R52 A;  2IXK A;  2H0V A;  5D8A B;  1F4H A;  3N9M A;  5E6H A;  3HJR A;  4W6Y A;  1W9T A;  2I07 B;  3GZE A;  2AYH A;  3AVS A;  5A6Z A;  1C5I A;  2W1Q A;  5ABJ B;  4NIH A;  1O4Z A;  1L3J A;  3AP5 A;  2YGL A;  2DFB A;  5A6Y A;  5IVE A;  2VNG A;  3W21 A;  1PO1 3;  2OZ6 A;  2VVE A;  1D0G A;  4LUM A;  3NMB A;  4CXW A;  3KVA A;  1FOD 3;  4CP2 A;  4FQZ A;  4Z82 A;  4BU2 A;  1V6K A;  1GBG A;  1PIV 2;  1CD3 G;  1UX6 A;  3MW3 A;  3SH5 A;  4GMP 1;  1RYY A;  2WKK A;  3GF6 A;  4LEJ A;  4CDW A;  1CAV A;  1MZE A;  2R49 A;  5SV8 A;  4LR4 A;  3ZDV A;  2E7A A;  5F32 A;  5C8C A;  4NPR A;  1V9U 2;  5IK5 A;  4LUL A;  1VBE 1;  5DAX A;  2HWD 3;  3ZSJ A;  5DQ0 A;  5CFC A;  1YRZ A;  1FV2 A;  4HKO A;  5I0R A;  4AGR A;  1YI7 A;  2GP3 A;  2MHF A;  2D6K A;  3I2H A;  3I2F A;  2VOV A;  1XU1 A;  3N36 A;  4FXK B;  1R1A 1;  1AHS A;  2OXB A;  4AED A;  2JDN A;  4WVM A;  4XVH A;  2WS9 3;  1J1L A;  5H9P A;  2FDJ A;  2JIG A;  2XQX A;  2BWC A;  3WCS A;  3P6B A;  1OH4 A;  5CFD A;  4IEY A;  1H6Y A;  2Q5T A;  1G9A A;  1VPH A;  5F3C A;  3WDY A;  1XE8 A;  5IVY A;  5LBE A;  2CDO A;  3AKQ A;  2VQT A;  1HRI 1;  2PXJ A;  4HON A;  4IDZ A;  4YVW A;  3UV9 A;  4Q0U A;  1PGW 2;  1Y43 B;  1VBA 1;  2OQ6 A;  4UT5 A;  1WA4 A;  1QJY 1;  1W6Q B;  5AVP A;  2P3J A;  5C6C A;  2J7M A;  4QXH A;  4XFC A;  4CP9 A;  2JDK A;  4M3C E;  3ALQ A;  1PO1 2;  2CYF A;  2WAB A;  1H1A A;  3ASI A;  3ZR6 A;  4QPI B;  1FOD 2;  5FMO L;  1C1L A;  2WO1 A;  1W6M A;  3QAC A;  5T5L A;  3J9S A;  4B3N A;  2WA4 A;  2DWR A;  3F95 A;  2KA3 A;  4MHU A;  2F6B A;  2XJR A;  2XLG A;  1RGS A;  2E31 A;  5A80 A;  5FUP A;  4Q0P A;  3OGV A;  3WQ0 A;  3AXE A;  4I0A A;  2W3J A;  4YG6 A;  3KS7 A;  2Q8O A;  2V72 A;  3OEA A;  2HWD 2;  1XYP A;  3AMH A;  4CUB A;  5FY4 A;  3T4V A;  5KHI A;  4GH4 B;  1PVX A;  1COV 1;  4ZXE A;  4L8Q A;  2QDN A;  3VBR C;  4NRQ A;  4URA A;  5FXW A;  2WS9 2;  1S0B A;  4FTE A;  3DYP A;  5FZ8 A;  1JTZ X;  4Q4W 1;  3VZM A;  4CCO A;  3FWE A;  4IEU A;  4K8R B;  1QOT A;  4R9A A;  1RIR A;  1WMX A;  4XJZ A;  4AI1 A;  3H1Y A;  2R06 3;  2X5I C;  5IT6 A;  4Q1P A;  3EYP A;  3LA2 A;  4LHL A;  3O12 A;  2ZX4 A;  2IXJ A;  4UAP A;  5FXZ A;  3ACG A;  4YM2 A;  1O5L A;  4KL1 A;  1V6I A;  2JG8 B;  1LR5 A;  1RUN A;  3THC A;  1WW7 A;  4AF9 A;  1GZT A;  2PLV 1;  3WW1 A;  4YZ1 A;  2DDU A;  3PUA A;  3VHP A;  3MIB A;  3T30 A;  3KZ4 C;  2QQN A;  1MZ5 A;  3K46 A;  4B1L A;  2NPI A;  4OUM A;  2YPJ A;  4V2W A;  2EAL A;  4ZS3 A;  1UYZ A;  1YEW A;  5I8T A;  5LA9 A;  2Y38 A;  2A7A A;  4PHZ A;  4YVS A;  3ZMN A;  1VRH 1;  2AGS A;  2BPA 2;  3MUZ 1;  2ZXQ A;  2DCK A;  2XJU A;  1RUC 1;  3VDB A;  1QJU 1;  2BNN A;  5EZW A;  3IT8 A;  3J7M A;  2FHR A;  2A71 A;  4GQ7 A;  4OYU A;  3EQE A;  2YRO A;  4Y22 B;  4ZU5 A;  5FDB A;  4CUC A;  2YDE A;  3AYD A;  3MW4 A;  4IE6 A;  2W2I A;  2ZHN A;  4CDQ C;  3P5B A;  5I0D A;  1CQ9 A;  3J8F 3;  4J25 A;  1WLD A;  1J58 A;  1YQ6 A;  2XG3 A;  4IEZ A;  5FAX A;  1N3P A;  1NYW A;  1SBE A;  1YQC A;  2R06 2;  2Y6G A;  3LIG A;  4N9H A;  4HET A;  2Q8C A;  4IEO A;  1OT5 A;  1A8D A;  1XNA A;  3HQX A;  4ONU A;  3AK0 A;  3LQC A;  3DPR B;  5A6Q A;  4XE9 A;  1BVP 1;  1TME 3;  2Y6K A;  4XJ9 A;  5FUI A;  1ZA4 A;  3ATG A;  3WUD A;  4QT6 A;  3ZYI B;  3H8X A;  1NY7 2;  3JCI A;  3WSO A;  1K3I A;  4K20 A;  3WG1 A;  1NA1 C;  1DZR A;  4XHB A;  2ZMN A;  2Q8D A;  3C7E A;  1CAU B;  3B3Q E;  3LGR A;  4GWN A;  1ZM1 A;  4Y4R A;  3T0B A;  1W2A X;  4JGZ A;  3E6B A;  4XUN A;  4ZON A;  3CDZ B;  5FZ0 A;  4BMB A;  5IVB A;  4CP1 A;  1FAY A;  2E7T A;  4V1P A;  3FBY A;  2W47 A;  4MGZ E;  1AXZ A;  2GDF A;  3LWC A;  2VM9 A;  3O7O A;  3QBQ A;  3VLB B;  2E6V A;  3DXT A;  2BQP A;  3IIA A;  4Q4V 1;  5J1X A;  4D6R A;  2ZHM A;  4MH0 E;  2XVL A;  3WY6 A;  2D6O X;  5JOX A;  2ENR A;  3ZVX A;  2XPJ A;  3CZU A;  3UNP A;  2XOM A;  2QQU A;  3AMQ A;  5FZH A;  3WW3 A;  5LB6 A;  2UWA A;  1LOC A;  4DEV A;  5LZ6 A;  1UPI A;  2VD7 A;  4LJH A;  4XMI A;  4TTG A;  4IE5 A;  3GNE A;  1N47 A;  4IE0 A;  4YGB A;  2WBK A;  2ZKL A;  1JUH A;  2BBV A;  3RYR A;  4AVT A;  1JHN A;  3J8F 2;  1H0B A;  5JMC A;  5FZK A;  1LHN A;  3USU A;  3VKF C;  1BCX A;  4OI0 A;  1C8N A;  1JUI A;  3ZFG B;  2E53 A;  2CV6 A;  4I0W B;  4QQ2 A;  3N9O A;  5IK4 A;  3POE A;  4IGP A;  1J84 A;  1RHI 1;  4FPE A;  5BNQ A;  3AP7 A;  1TME 2;  2YYO A;  1OI6 A;  3LPG A;  3BU0 A;  4CPB A;  5JZG A;  2GN7 A;  2NMO A;  3MYX A;  2PQS A;  4NWW A;  2CWM A;  1PMH X;  4FOW A;  1LB2 A;  1YFW A;  5FUN A;  5KHH A;  2B42 B;  1H2N A;  3R0R A;  4RGG A;  3GZA A;  4LA3 A;  5FXV A;  1VR3 A;  2RJL A;  2HWF 1;  3LFI A;  1DQ2 A;  3AFG A;  4HMZ A;  5A7Q A;  5DZG A;  5EFU A;  4JDM A;  3NL1 A;  2IVJ A;  4XUR A;  1DCS A;  3AFK A;  1OOP A;  4L2N A;  1HKD A;  3PDQ A;  5LBB A;  1UYY A;  1W8U A;  5FY8 A;  1RUD 2;  5IVJ A;  2QZ3 A;  2FCV A;  2WAO A;  4JQT A;  5I0S A;  1SLC A;  3GDB A;  3JBG 3;  1LGC A;  3S5Q A;  5FYC A;  3FZ3 A;  5JVV A;  5DPN A;  3ZXL A;  1IKP A;  3RGB A;  5C3S A;  3VBS A;  5JXI A;  1FPN 3;  2ID4 A;  5EXO A;  1IQA A;  5G04 L;  2A73 B;  3F2Z A;  1AF9 A;  5D8A A;  2E51 A;  1AR9 3;  4YG3 A;  3UES A;  3LF7 A;  4FPG A;  5CIR A;  3WEZ A;  4ZHN A;  3PU3 A;  5FZL A;  4FP2 A;  4FT8 A;  4J6G A;  1H2M A;  3I2D A;  1GNH A;  4LOS A;  2GMM A;  4XXA A;  1BZW A;  2VJX A;  1W28 A;  1AVB A;  1DYP A;  1FMD 3;  3C3V A;  3EMR A;  3KF3 A;  4FFF A;  5FP8 A;  5I91 A;  4FTB A;  1BBT 1;  3OUI A;  5C71 A;  1UWW A;  3POY A;  1JZ5 A;  3N7J A;  3UK9 A;  1CZS A;  4DIQ A;  3ZYF A;  2HLE A;  1ZRF A;  3WNL A;  4PQ9 A;  4XAA A;  1YQ5 A;  2LS6 A;  4JKL A;  1NKG A;  1RUE 3;  4BXF A;  1IZ3 A;  1W8F A;  2ZMK A;  3T3Y A;  1H9P A;  5FLI A;  4CU7 A;  5HBA A;  2EAA A;  4YRD A;  1PM4 A;  2RS1 3;  4Z92 B;  4JDO A;  1OF4 A;  2VZ3 A;  5CAZ A;  5J7M A;  1JZ6 A;  5A7P A;  1UY3 A;  4IV3 C;  1DYK A;  4ASL A;  1VJ2 A;  2EIE A;  4XCB A;  1DHK B;  5L9R A;  3I7D A;  3DF0 A;  3PTR B;  1OLM E;  4LOT A;  5F2S A;  3GZU C;  1UY4 A;  3LA7 A;  4F3J A;  2FDF A;  2R0F A;  3R4S A;  4KWL A;  4LUK A;  2ZGK A;  4QPG B;  5FMD A;  3JBG 2;  1E5R A;  3SQO A;  2ZTN A;  2RDQ A;  1JOJ A;  4CCK A;  4R8H A;  1POV 3;  2CDP A;  3DYM A;  3HNY M;  1FPN 2;  2VZT A;  3MF9 A;  3P3P A;  4XZP A;  3MGU A;  1QXP A;  2D5F A;  3FLT A;  5A6X A;  5FZB A;  1BJQ A;  5KR7 A;  1AR9 2;  3HEI A;  3NV1 A;  3FFQ A;  4UFH A;  2YBS A;  1ZBA 1;  5FZF A;  1JZ8 A;  3BN6 A;  1O91 A;  4MZU A;  1MZF A;  5BNP C;  2VU9 A;  5JI9 A;  5LWB A;  1FMD 2;  3ZO0 B;  1WCK A;  3AB0 A;  3QLQ A;  1Y4W A;  2OII A;  4QPI A;  4UW4 A;  5IAT A;  1FXZ A;  1YFX A;  2XJV A;  3PUQ A;  2Z79 A;  2WNV B;  3T2Q A;  4PLN A;  2Z2S B;  3AX4 A;  1RUE 2;  4UI9 L;  1A6C A;  2VTX J;  4LOR A;  2OS2 A;  1GR3 A;  1NE4 A;  4H7M A;  3RZH A;  2RS1 2;  4HK8 A;  1QMJ A;  1IG0 A;  1X7N A;  1OPM A;  2DU1 A;  2JEM A;  3DUI A;  2DUP A;  4TXW A;  3H1W A;  3X29 B;  5A3U A;  1AYM 3;  4QAW A;  4OQ8 A;  2IFR A;  3CL1 A;  4IER A;  1F31 A;  5E88 A;  2CGN A;  3GCX A;  3Q8F A;  5D2A A;  4YW1 A;  2RR1 1;  5K0U A;  1UN1 A;  4LMF A;  1MR5 A;  3BOP A;  1LHO A;  4MUV A;  5JIA A;  1C28 A;  4AHW A;  1H8V A;  1UU5 A;  4BQ5 A;  1JOB A;  2CAV A;  2WT1 A;  2VVF A;  2VMH A;  1VB4 A;  5GZC A;  4I09 A;  1XSQ A;  2EIC A;  1UMI A;  2V5D A;  3IDA A;  3RZJ A;  4QPW A;  3NAP B;  1PHM A;  3KCC A;  2VZU A;  4CU8 A;  3NVC A;  5LBF A;  3URF A;  4EZ4 A;  3H0O A;  4CEW C;  4KH9 A;  5T50 A;  4R9B A;  1X9P A;  2Y64 A;  3VBU B;  4B7E A;  1RXG A;  3LA3 A;  3B69 A;  4KGQ A;  3RYP A;  2WN2 A;  2FDK A;  3ZSK A;  5F5C A;  1PK6 B;  4BQ2 A;  5HV0 A;  1ST8 A;  2JG8 A;  3O1T A;  3NO8 A;  4BOW A;  1BMV 2;  3V64 A;  5EJ1 B;  3RFR A;  4CCE A;  2VCA A;  5A3P A;  1K42 A;  1AR7 1;  3OUJ A;  3T1L A;  4CVU A;  1F9K A;  4GB3 3;  1LNS A;  1Q5O A;  4M4P A;  4KI5 M;  2J1V A;  1QQP 1;  1OKQ A;  2WZ8 A;  5H9Q A;  2PHU A;  1H8T B;  1CJP A;  2VMG A;  5BY5 A;  3NV3 A;  3GYD A;  3ZM8 A;  2JG9 C;  3ZKU A;  3INA A;  4JVA A;  2XLA A;  3HBK A;  1BEV 1;  4IW3 A;  4P9J A;  4AEM A;  4ZZ5 A;  1DU3 D;  1AYM 2;  2BGC A;  3POF A;  2QQP A;  1JHJ A;  5J3U A;  1Y9M A;  2RJ2 A;  5GZF A;  2CGP A;  1LES A;  1SQ4 A;  4Y22 A;  1CR7 A;  2XBO 1;  3T08 A;  4K8F A;  4CCD A;  4RGA A;  1SBF A;  3BU7 A;  3ZXJ A;  1GUI A;  3HR9 A;  4OUL A;  4CDU C;  3WHT A;  1RMU 2;  1NLR A;  1LU2 A;  1XC6 A;  5EP9 A;  2W0X A;  2C9K A;  2H0B A;  3KHB A;  3NNF A;  3EB7 A;  2WZR 1;  4AYU A;  4UWD A;  1HRV 1;  2YGM A;  1OUS A;  3DPR A;  4AOC A;  2GNM A;  2A3Y A;  4NVP A;  3ETP A;  1PIV 1;  2ZA9 A;  1DQ0 A;  3OY8 A;  1CPM A;  2JDH A;  3VDD B;  3OBA A;  1TZO A;  4PCR A;  1GKB A;  5BYN A;  3O1U A;  2KR2 A;  4FTS A;  1V9U 1;  3DKQ A;  1CAU A;  3NNL A;  1DZQ A;  2DCZ A;  4GB3 2;  3FBM A;  4JCK A;  1UU4 A;  2J1R A;  3I59 B;  4YM3 A;  1ASJ 1;  1C1F A;  1UZW A;  3D4K A;  2WLQ A;  4MYE A;  2VUD A;  1QOO A;  2VZS A;  4LE3 A;  2ADD A;  4W50 A;  4FPL A;  4NAM A;  1POV 0;  4BIO A;  1G9C A;  2BJS A;  4GXL A;  3N9Q A;  3KV6 A;  3CEW A;  4AEJ A;  4L9B A;  4YGD A;  2JDA A;  5IW0 A;  2PYT A;  1LOE A;  3WDU A;  3N9P A;  2J1E A;  2YU1 A;  4JTN A;  3DXU A;  5FYI A;  4JHT A;  4EN7 B;  1REE A;  3KCX A;  2NP0 A;  1S1A A;  1S0C A;  4XUO A;  1CX4 A;  2DCJ A;  4GAZ A;  2OVU A;  3LDB A;  1AYN 1;  4Y5S A;  1UY0 A;  1N1V A;  1H2K A;  2MEV 3;  2Q1F A;  4WZF A;  4NHX A;  3ZLI A;  2C0Z A;  4FVV A;  4WBB A;  2ZEW A;  3ZFG A;  4BQ1 A;  1FOD 1;  4TN7 A;  2X53 S;  1L7L A;  1GWK A;  1MEC 3;  2IXC A;  2WFF 1;  4HOO A;  1QF3 A;  1ZZ6 A;  4KWK A;  1CWP A;  4QHO A;  2V5Y A;  4A45 A;  2XKP A;  5KXE A;  4CU6 A;  2BWA A;  4FPY A;  1UD1 A;  3BTY A;  2OUH A;  5A7S A;  4YYO A;  5DG1 A;  4YM1 A;  2PHL A;  1ZYB A;  4B4P A;  1BYH A;  3BOW A;  4YW5 A;  4IL7 A;  3IB3 A;  2HWD 1;  4YPJ A;  1JYN A;  2NM1 A;  1XNK A;  2ZCW A;  1R09 1;  1WCU A;  2C24 A;  5FLJ A;  3ZIW A;  1VMH A;  3OUH A;  4URT A;  4RGK A;  3ZYJ B;  2ZX1 A;  1SZB A;  1SFP A;  1VB2 A;  1EY2 A;  5GLV A;  2DUO A;  1GLH A;  1MS4 A;  3S30 A;  4E4H A;  2KM2 A;  2C26 A;  1DGR A;  1R1Z A;  3I2O A;  4QX5 A;  3BPS A;  3ROU A;  5J96 B;  4R9D A;  3BTX A;  2V09 A;  1C8M 1;  4S2H A;  4JTO A;  4F7Z A;  5C3Q A;  1OA2 A;  5FP9 A;  4XAB A;  1J3R A;  2ZZJ A;  2ZPX A;  4XC9 A;  1JYW A;  2FQP A;  3BYW A;  2MEV 2;  4XET A;  4EN6 B;  5DXD A;  1RUI 1;  1KQR A;  3MV1 1;  5FZA A;  2FCT A;  4IV1 C;  5FJK A;  4GJY A;  3L2Y A;  5LBC A;  1MEC 2;  4QU1 A;  1QJX 3;  3WW4 A;  1KGY A;  3IN9 A;  3IDE A;  1F15 A;  2D5H A;  1W6N B;  4RQP B;  4FOQ A;  1PVC 1;  1QJF A;  2ARC A;  2WYS A;  5LAS A;  3ZFE B;  4QKN A;  1O3S A;  2EID A;  2YXS A;  1PO2 1;  2K2S A;  4R4X A;  2B7Y A;  3VBO B;  3AZW A;  4IQP A;  4K1Y A;  3FMG A;  4XQ4 A;  1NE6 A;  2Z4F A;  4QX1 A;  3ZN6 A;  1JI6 A;  2BER A;  2DF7 A;  2R6Q A;  3NNG A;  4OI2 A;  5LRS A;  2R04 3;  4M3C B;  4IES A;  4N53 C;  4SLI A;  5ACA 3;  2GNB A;  4UW5 A;  2WN3 A;  3VBR B;  5L7O C;  1UYP A;  2B39 A;  4Q8K A;  4D8M A;  3H8R A;  4QQO A;  2YBP A;  4HVQ A;  1YJK A;  4RFR B;  5FP7 A;  2R7E B;  1YCI A;  2PAE A;  2E9Q A;  3FE5 A;  4RHV 3;  4LBM A;  4WM8 A;  1UX7 A;  1X82 A;  1HW5 A;  1J3Q A;  2BNO A;  2UWB A;  3E1F 1;  1CZV A;  4H55 A;  4NIA A;  1U5X A;  1ENR A;  1QHD A;  3ECQ A;  3WF0 A;  3TEW A;  1LHV A;  2D44 A;  3OPW A;  3VBF A;  1CJD A;  1DGW A;  2GN3 A;  1PM7 A;  2VCM A;  1NQJ A;  4WVV A;  4RR3 C;  4X8N A;  2V73 A;  5CG8 A;  3GXU A;  1UZV A;  4DXT A;  3LDK A;  3PVN A;  4Q4Y 1;  4TSV A;  1D4M 1;  3I3Q A;  4H14 A;  1EUU A;  3WCR A;  2QTW B;  1W9S A;  4DRV A;  1QEX A;  3ZMO A;  5JAX A;  4EE2 A;  1US2 A;  2ZX0 A;  4HVO A;  3SKJ E;  3GHM A;  3PHM A;  4OUS A;  4Y5Z 0;  4CEY C;  1QJX 2;  1MAC A;  2R07 3;  3ES1 A;  3GM8 A;  2VW2 A;  3IZO A;  2LRO A;  3BKZ A;  3S57 A;  2WIN B;  3KGZ A;  1DP0 A;  1QNW A;  2PEL A;  3PIG A;  2WNV A;  1H2L A;  3MIC A;  3ZOI A;  4AVV A;  4BME A;  2W39 A;  2AUY A;  2HWC 1;  5B2G B;  3VZK A;  1SDW A;  2W5F A;  4QDS A;  2R04 2;  2Q1M A;  4XZU G;  5GLZ A;  3M3C A;  4EN0 A;  5ACA 2;  2OYZ A;  1AJK A;  3N7M A;  5C33 A;  3LIH A;  2XGX A;  1CAX B;  3PMS A;  4J1W A;  2Y34 A;  4CDW C;  4RS5 B;  2WO7 A;  3LEM A;  4TLG A;  2EAK A;  5FZ7 A;  3BOD A;  3VDA A;  5I8Y A;  4MGK E;  4QKF A;  4RHV 2;  4E2S A;  4YNI A;  5C8C C;  2ZAA A;  3N4M A;  4I2O A;  4HPK B;  3O14 A;  4LBK A;  2WT2 A;  3HT2 A;  2EXH A;  2J1U A;  5BNN A;  3FC0 A;  2BOJ A;  5CFC C;  2RV9 A;  3J7L A;  4C0B A;  3NAP A;  1STM A;  1UOG A;  2DVD A;  5E89 A;  2HWE 3;  2RM2 1;  2DVG A;  5T54 A;  5ANN A;  1NX9 A;  2VQA A;  4IET A;  3NJX A;  1EPZ A;  3A23 A;  3AZY A;  1WWY A;  4K6B A;  2D40 A;  4AED C;  3VHN A;  2ORX A;  3N9N A;  4YG0 A;  3ZFF B;  4G4F A;  4NR1 A;  3I8T A;  1H1I A;  2B4K A;  5CFD C;  4AVS A;  1NA1 B;  1F2N A;  2XWJ B;  5A3W A;  2HBU A;  5LK5 A;  5FY5 A;  1VBC 3;  3C8X A;  5A7W B;  4FBF A;  4UFI A;  2R07 2;  4YVW C;  3HNM A;  5DG2 A;  1WBF A;  4QB6 A;  1BK0 A;  2HKX A;  1N1Y A;  3U1X A;  4KWU A;  3AKP A;  1Q8P A; 
#chains in the Genus database with same CATH homology
 1XNA A;  3LQC A;  4OMD A;  1GNY A;  5FUI A;  2Y6K A;  2WAA A;  4QB1 A;  2LW8 A;  3I2K A;  5B4N A;  3WSO A;  4A41 A;  1K3I A;  3DYO A;  4MO3 M;  4QDR A;  3C7E A;  3T0B A;  4Z2A A;  4XUN A;  3CDZ B;  2Y8K A;  1IQD C;  2W91 A;  3WNP A;  2W47 A;  4E8D A;  1SHW B;  1W0N A;  3ACH A;  2VM9 A;  5J1X A;  5LCW L;  3LEI A;  3CZU A;  3UNP A;  1I5P A;  3IAP A;  2XOM A;  1K12 A;  2WO2 A;  3FN9 A;  2J1T A;  3K4Z A;  4DEV A;  4TTG A;  2WBK A;  2W1U A;  3THD A;  2BBA A;  3VD9 A;  3VD7 A;  5JXJ A;  1O59 A;  1JZ2 A;  2BGP A;  3NQH A;  2VZR A;  2C4X A;  1DYO A;  1KEX A;  2VMD A;  5CZK A;  3POE A;  1J84 A;  3T0A A;  4AAX A;  2XON A;  3HN3 A;  3LPG A;  3U37 A;  2PQS A;  3POB A;  1PMH X;  5C70 A;  5JXG A;  2VR4 A;  4GWJ A;  3HPN A;  3DEM A;  1ULP A;  3D3A A;  1W99 A;  2VZQ A;  4MGQ A;  1SPP B;  4XUT A;  3IAQ A;  2VZV A;  4MAD A;  4UOJ A;  2QQK A;  2Y6J A;  2X09 A;  4XUR A;  3WNO A;  2VCB A;  3MBW A;  1UYY A;  4LPL A;  2RVA A;  3CIH A;  1WCQ A;  3LE0 A;  4QX2 A;  4DUX A;  2WAO A;  2VC9 A;  2W94 A;  3GDB A;  4DXR A;  3FL7 A;  4D0Q A;  5DPN A;  3PUI A;  3I3E A;  4GWI A;  5JXI A;  4CU8 A;  1W8O A;  2ID4 A;  1UY1 A;  5G04 L;  1OD3 A;  3F2Z A;  3UES A;  1YQ2 A;  1XPW A;  3WEZ A;  3C7G A;  1UY2 A;  3HOB A;  3VD5 A;  4LOS A;  2ZEZ A;  3C7H A;  2VJX A;  5CKN A;  3VDC A;  4DXS A;  4BK5 A;  2V4V A;  5C71 A;  1UWW A;  1JZ5 A;  1CZS A;  4A42 A;  2HLE A;  3WNL A;  2LS6 A;  4JKL A;  1CIY A;  1NKG A;  3I2J A;  2ORZ A;  2QQM A;  4M4R A;  4CU7 A;  4P02 B;  5IYY A;  1OF4 A;  2VZ3 A;  1CZT A;  4ZY9 A;  1JZ6 A;  1UY3 A;  2XHN A;  3T2O A;  4XUQ A;  2EIE A;  4AG4 A;  3WF1 A;  2YC4 A;  3OGS A;  1NZI A;  2E32 A;  4LOT A;  4GZ9 A;  1MPX A;  1NAE A;  5JUV A;  1UY4 A;  4IUG A;  1US3 A;  5DN2 A;  2WO3 A;  3ACF A;  4JKK A;  2VCC A;  2CDP A;  3DYM A;  1JU4 A;  3HNY M;  2VZT A;  4W4Z A;  4CU9 A;  2W87 A;  4FI9 A;  1CX1 A;  2WUH A;  2J1A A;  3HEI A;  1GQP A;  3J7H A;  1UMH A;  2VO5 A;  4ARY A;  1EUT A;  1TG7 A;  1JZ8 A;  3BN6 A;  5C7G A;  3PUH A;  3BGA A;  3WF3 A;  1DLC A;  3ABZ A;  4KMQ A;  4W8J A;  2E26 A;  3T0D A;  3T2Q A;  4A6O A;  2BGO A;  4UI9 L;  4LOR A;  3GGL A;  3POJ A;  3WF4 A;  4TXW A;  4JKM A;  4QAW A;  2YC2 A;  3W5N A;  4ARX A;  1JYX A;  4LMF A;  4CUA A;  4XUP A;  5LA2 A;  3SEE A;  1R64 A;  4PT6 A;  1J83 A;  3CQO A;  2W46 A;  4DEQ A;  1JYV A;  2EIC A;  1UMI A;  2V5D A;  3IDA A;  4QPW A;  5JXH A;  1GOG A;  2VZU A;  2YG0 A;  2Y64 A;  1PX3 A;  3MO4 A;  2WN2 A;  2J1S A;  2VZP A;  2YB7 A;  3K75 B;  4BJ0 A;  5EJ1 B;  4ZZ8 A;  2VCA A;  1K42 A;  5JMO A;  3C7F A;  4A4A A;  4ET7 A;  4CVU A;  2JD9 A;  1NT0 A;  1LNS A;  3POG A;  1O8S A;  3SEP A;  4M4P A;  4KI5 M;  2J1V A;  5IFT A;  2QQI A;  3UET A;  2WZ8 A;  3JXS A;  4PQQ A;  5A1A A;  3I2I A;  2JKX A;  1D7P M;  3OB8 A;  2HYX A;  3ZM8 A;  4ZZ5 A;  5CKM A;  3FHQ A;  4L0P A;  3POF A;  5CIS A;  1JHJ A;  1K45 A;  2RJ2 A;  2JE8 A;  5HPO A;  1GU3 A;  2X05 A;  4JX0 A;  3I97 A;  2KD7 A;  2W1W A;  3T08 A;  1GOF A;  5EIY B;  2YFZ A;  1GUI A;  5B4X A;  2VZO A;  4QDQ A;  3WQB A;  4BDV B;  5HXM A;  5LA0 A;  1XC6 A;  2C9K A;  1F4A A;  3EB7 A;  3P1I A;  1UZ0 A;  4LHS A;  4OZO A;  2W92 A;  1L7R A;  3ETP A;  5F7U A;  2ZEX A;  2X10 A;  3OBA A;  2W95 A;  2ZEY A;  3I3B A;  1T2X A;  2J1R A;  2WDB A;  1BHG A;  4RYD A;  3WF2 A;  2VZS A;  1JU3 A;  4W50 A;  5DMY A;  5G05 L;  1JZ4 A;  1W9W A;  2YFU A;  4MGS A;  3K77 A;  2JDA A;  3LPF A;  3OGR A;  2J1E A;  3NRU A;  1PMJ X;  3A7Q A;  3VDB A;  4XUO A;  4LKS A;  2DCJ A;  2W1S A;  2Y6L A;  3T09 A;  3W5M A;  1SDD B;  1UY0 A;  3WNK A;  5CYY A;  2W9X A;  3VD3 A;  2QQL A;  2ZEW A;  2VQU A;  5LA1 A;  3K4A A;  4HG6 B;  3SKV A;  4PF1 A;  1NUK A;  3I2G A;  1H6X A;  3A21 A;  3LEG A;  4A45 A;  4DUW A;  3POI A;  4CU6 A;  1UXZ A;  1F4H A;  3HJR A;  1L7Q A;  1W9T A;  1SPP A;  3IB3 A;  4YPJ A;  1JYN A;  2W1Q A;  1UYX A;  2B9V A;  3KQ4 B;  1SZB A;  1SFP A;  1O8P A;  4QX3 A;  3OEB A;  1RYY A;  2C26 A;  3FHA A;  2WNO A;  3DEC A;  4MOA A;  3III A;  5DQ0 A;  1JYW A;  2Y6H A;  3CZJ A;  3I2H A;  3I2F A;  3MUY 1;  3MV1 1;  5IHR A;  4QB2 A;  4XVH A;  5JR2 A;  2XQX A;  3P6B A;  4DUV A;  1OH4 A;  1ULO A;  1KGY A;  1H6Y A;  2VMF A;  2WYS A;  2CDO A;  2WQ8 A;  2EID A;  2VQT A;  2OKX A;  4QX1 A;  2Z4F A;  1JI6 A;  2BER A;  3NNG A;  1OF3 A;  2J7M A;  2VMC A;  2WZE A;  4P5Y A;  1WKY A;  4JHZ A;  5EJZ B;  2WN3 A;  2WAB A;  4D8M A;  2WO1 A;  4QX0 A;  4BXS V;  2BZD A;  2R7E B;  1XNT A;  4P00 B;  3K4D A;  1UX7 A;  1SG3 A;  2EIB A;  3MV0 1;  1W8N A;  3NJV A;  2E31 A;  1CZV A;  3E1F 1;  3WF0 A;  3C7O A;  3ECQ A;  3OGV A;  2W3J A;  2V72 A;  3OEA A;  4BK4 A;  4CUB A;  3GXU A;  4DXT A;  2L9L A;  1EUU A;  4ZXE A;  1W9S A;  2QBX A;  5CKQ A;  3CKH A;  4P08 A;  1US2 A;  3SKJ E;  3DYP A;  2VME A;  3GM8 A;  4A44 A;  1DP0 A;  3ACI A;  3I3D A;  3HNB M;  4LQR A;  3EYP A;  2QQJ A;  1HN1 A;  1TVG A;  3CMG A;  5IJR A;  4UAP A;  2W5F A;  3ACG A;  4QDS A;  4XZU G;  4OMC A;  3THC A;  4A3Z A;  5IFP A;  2DDU A;  2VL4 A;  4E8C A;  3WNN A;  3A22 A;  2QQN A;  3K46 A;  1JZ7 A;  1JZ3 A;  3VDA A;  2VOT A;  1UYZ A;  1PX4 A;  4OUE A;  2J1U A;  2VZ1 A;  3AC0 A;  1GMM A;  2RV9 A;  3VD4 A;  3MUZ 1;  3WNM A;  2ZXQ A;  2DCK A;  1GOH A;  1NX9 A;  1P8J A;  2QQO A;  3NJX A;  4RN5 A;  3A23 A;  1UXX X;  2ORX A;  4OYU A;  2B4K A;  3LEK A;  4CUC A;  3C8X A;  3OG2 A;  5I0D A;  2E33 A;  2J22 A;  3HNM A;  3T2P A;  4QB6 A;  2VTF A;  2Y6G A;  4KWU A;  1OT5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...