4DNYA

Crystal structure of enterohemorrhagic e. coli stce(132-251)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
109
structure length
109
Chain Sequence
GIDFTPHNGTKKIINTVAEVNKLSDASGSSIHSHLTNNALVEIHTANGRWVRDIYLPQGPDLEGKMVRFVSSAGYSSTVFYGDRKVTLSVGNTLLFKYVNGQWFRSGEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insight into the Bacterial Mucinase StcE Essential to Adhesion and Immune Evasion during Enterohemorrhagic E. coli Infection.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Metalloprotease stcE
total genus 31
structure length 109
sequence length 109
ec nomenclature ec 3.4.24.-:
pdb deposition date 2012-02-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1230 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4dnyA00
4DNYA
chains in the Genus database with same CATH superfamily
1REEA 5IVEA 3T2TA 3KCXA 5AC93 4XJZA 2ORZA 2IXKA 1OKOA 3LZZA 4CCCA 4E27A 4EE2A 3USUA 3GM8A 2WO3A 5EHDA 1UYXA 1H4HA 1ZBA1 1VBA3 1YNAA 1TMF3 4PDWA 2QQUA 2ZGLA 5FYIA 3K3NA 5EYYA 5IK8A 5FZGA 1FXZA 4MG2A 3IAQA 3J4UH 1H30A 5EWSA 1YRZA 4Q0PA 4JGYA 1RC6A 4ORFA 3NSTA 4YGCA 5FZFA 4NIDA 2JKBA 1UO9A 3ACFA 4HN0A 3ILFA 1XXNA 5IW0A 3JUUA 3CLPA 4XF9A 3KSCA 3ALQA 3FN9A 4Y24A 5FP3A 4GWMA 1UN1A 1MZEA 2Z79A 5FZLA 2GALA 4CZSA 4QQPA 3H3UA 5FP9A 1KITA 5GZCA 2IVJA 2WZPP 1W8TA 1ENQA 3P6BA 2ILMA 4LBNA 2VOVA 2VO5A 2DF7A 2GNBA 4EWEA 4UF0A 1GLHA 3F95A 2GN3A 3OF1A 5FYBA 3WQBA 2WNUB 2D93A 3B94A 1RIRA 2XG3A 2IXIA 2QUOA 1SLAA 3POSA 4QMAA 5FXXA 4XJAA 3Q8AA 2AC1A 2XXZA 3GZAA 5DZGA 5A32B 2A71A 2WABA 5FY1A 5FXZA 3VBUB 2DTYA 1RXGA 1RUI2 3OUHA 1H1AA 2JE8A 2AENA 4PDWB 5LBCA 3RZZA 3ZXFA 3D82A 2W2IA 5GJ6A 3T4HB 4BIFA 3BTAA 4WM8A 2ZGMA 3A0KA 4Y1VA 5CZKA 4CDXB 4Y20A 2XMLA 4AW7A 1MVQA 2PHXA 3JQWA 1DGWA 2YC2A 5LATA 1ND3A 2B46X 3BYWA 3VBOA 1WZXA 4CDUB 4CXYA 3QLQA 3MV11 5H9PA 5JLVA 1NKGA 4UFIA 1IPSA 3SH3A 2W1WA 3D6EA 5ABJA 5EV7A 4BHPA 2VCBA 3AVSA 2JDZA 5EJ3A 1BK1A 1UZ0A 3H1WA 1OBNA 1W8NA 2XL7A 3A21A 5FMDA 1YQ2A 2E31A 4HLTA 4N43B 2BBVA 3ZFEA 3I3DA 4OI0A 4JCKA 3E97A 1QNYA 3A0NA 1HN0A 3MIHA 4ZS2A 3DPRA 3LEMA 2X53S 1FAYA 4HPKA 3T2PA 1K5JA 3B9IA 1HIXA 3B3QE 3ES1A 1KEXA 5GALA 3W20A 3PUQA 2R062 3LIGA 4AHWA 2VTFA 3UJQA 4C0HA 5F9TA 1V70A 1L7RA 2QKDA 4GMP1 5CNAA 4Y4RA 2VW1A 4P9XA 3WW4A 3INAA 5J37A 1Q5OA 4PBPA 2PLV2 3KGZA 4AI8A 4YVWA 4B4PA 5I0SA 2VECA 3DXUA 4HONA 3U37A 4YGDA 1PGW1 3I2IA 4LO7A 4QQLA 1F35A 1N3PA 3AKPA 2GP3A 3BODA 2G4IA 2G9GA 2NMOA 4ES8A 2EAKA 2D43A 4P9IA 2FCUA 3I2JA 4HL0A 1XU2A 3GALA 3WV6A 4FPEA 1OSGA 2D6PA 1DG6A 4IEUA 4TWTA 2PLV3 3JB4C 3PVOA 4HVRA 3UETA 4XFFA 3HNBM 2VVDA 3WP6A 3VKOA 3ZFEB 1DLLA 4Y1ZA 1Z0HA 2C5DA 4BU2A 4HKOA 5ERLA 1HV1A 2CDPA 4LKDA 1CX1A 2VE1A 5HXVA 2CV6A 5LRRA 4LIVA 4UW6A 3I2FA 4JHZA 4MGTA 4MGQA 3AKRA 4BDVB 1APNA 1C4RA 1J1TA 4LK7A 4YG0A 1OA2A 3IBMA 4C0BA 1G7YA 2YU1A 5FYVA 1GZWA 3KVAA 2CWMA 2P4EA 1IS5A 4XURA 2OW4A 4LE4A 4XMAA 1TMF1 3WDTA 2WLQA 1JI6A 1WMDA 2QQIA 3H8OA 5G04L 4XHXA 3R05A 4QGNA 4AFAA 5J48A 3BUCA 2CAVA 5DZEA 2J1EA 2I07B 2RS52 2WT2A 3IDBB 3NV3A 3RYKA 1LOCA 2L9LA 1NLSA 1YUDA 3VBHB 1PIV1 2CAUA 4HFSA 1TNRA 4CU6A 1FNYA 2KM2A 2R49A 3VKLA 1D2QA 4BQ5A 1JXNA 1X36A 4K6BA 1QJU2 4NR1A 4NVPA 3VBOC 2EIDA 3CDZB 4L0PA 4W65A 1RUF3 1R091 3UT0A 2HWE2 4NROA 5A7NA 1SBEA 2DVBA 4D8MA 2R0FA 4UYBA 1IHMA 3I97A 4XUPA 3NQHA 5FYUA 3WP3A 5IHRA 1PO11 4FFIA 5FK8A 5H9QA 4OI1A 3WG1A 2CL2A 1NXMA 4QDSA 4TSVA 3VZNA 2HWE3 4ISQA 5JXIA 3C7FA 2KR2A 2C26A 4ES9A 2XJUA 2WFF1 3AFKA 2C1FA 2R041 1I6XA 2DUOA 1VAMA 5CYYA 4JQRA 3ZOIA 5CADA 1WWYA 5AVPA 1N47A 5EQUA 4W6YA 5BNOC 3RZLA 1CJPA 5FP7A 1POQA 4Q2FA 2AGSA 4XCBA 4QPIC 2ET7A 2VNVA 3VDDB 3NWKA 1LTEA 1GFF2 3KF5A 2XHNA 4Q4V1 2VQ0A 2VTXJ 3RG0A 1WCSA 4KBBA 3PMEA 1W8UA 4Y3OA 1H4GA 3ZYIB 1RUNA 2PLV1 4EN9B 1NZIA 2VGDA 1XSRA 4DXTA 1PO23 4YZ1A 1S4CA 1YJKA 2JG9A 3J7MA 3M3CA 3OY8B 4JGYC 3DYOA 3UL2A 2WT0A 1KDKA 1LESA 2IXLA 2HWD3 5I0UA 3WXPA 5F32A 4KG0A 1FOD3 1AYM1 3GBFA 4K40A 1ND2A 2NQYA 3TB0A 2Z69A 1NLRA 5FZ3A 5F6LB 2R072 2XPJA 2YGMA 5IYYA 4S2DA 1SHWB 3WDXA 2A1XA 2VBPA 1V9U2 3E5QA 1OOPA 2R6QA 2D6OX 2YHJA 3DGTA 1O8PA 4QX5A 1VBD1 5IT6A 3LSEA 1DHKB 2HWD2 5FFOC 3ZKYA 1W3VA 3CJIC 1YFWA 4IE5A 3U14A 2WO1A 4EROA 5FR3A 1PO21 1GNYA 4FOVA 4PIXA 1RUG2 4CUCA 1LCLA 3ST7A 2YBPA 1R1A2 3WT3A 2ZGPA 4IERA 2JDHA 4AQTA 2ZMKA 3BPSA 4P02B 4CCLA 1YFUA 4DUWA 4AQ2A 4Q4V3 4XC9A 4YVSB 1BMV1 3MW2A 4I01A 3S6PA 4M0HA 2LALA 3G6JB 1UYPA 2A70A 1Z7S3 2QQVA 1QJY1 2VULA 1RUG3 2VZOA 3WF0A 1W2OA 3CL1A 4M0NA 1R1A3 2B9VA 4DNYA 5FZIA 2J22A 3VZJA 1OFNA 2BFUS 4HMZA 3OUJA 4QU2A 1JYXA 2Y6HA 4Q4V2 1RJ7A 4Y5Z0 4KU8A 1EV11 3VDBA 2J1UA 3NL1A 4QWNA 1HJFA 2CGNA 4B29A 1Z7S2 3SISA 4CTEA 1MQTB 3MHZA 2WBKA 4WM8C 3IT8A 5FPZA 5FLHA 4JTOA 4AFBA 4YZ2A 2WA4A 3ZN6A 2PHRA 3OTFA 1YC61 4N53B 5LY1A 2JD4A 2RMU2 3KM5A 3PVEA 2GMEA 1GWKA 3N7KA 2YZ4A 1VBC1 4O9GA 5FPXA 1T6GC 1WD3A 2WNUC 3T08A 1MQTC 1R093 2RDNA 4WM8B 4XFGA 2PHDA 4LHNA 1VMHA 2E7TA 5FBZA 2OKXA 3ZLIA 2UU8A 1LR5A 2ZACA 1EAH3 3N9MA 4D7YA 1POV0 4LITA 4QGMA 3VBUC 2EALA 3C7HA 2RS31 2W47A 4D6SA 3DV8A 4JRLA 4RQPC 1A3KA 2V5YA 2RMU3 4D3WA 3H0OA 4XEZA 3LIHA 1W6OA 4XUQA 1JS9A 2LRPA 3MF6A 3WLUA 4RD7A 5C4WC 1R092 4LULA 1U0AA 1R1ZA 3VUOA 4LA3A 4DINB 2XH6A 5FYYA 1JYWA 4IE6A 4CYDA 2R043 1AR82 2VVFA 3OUIA 4CCDA 1YYNA 1ULOA 4QXKA 4OUEA 2JJ6A 1LOEA 2BFUL 1MS1A 4ZONA 4RL7A 3KZ4C 1N1VA 1TME3 3M1HA 2BPA2 2QZ3A 3ZN6B 4QQ2A 3MBWA 1RMU1 5GZDA 1J83A 4JTNA 1AR83 2ZAHA 4LBQD 3OG2A 3WNXA 3GJBA 2ZX3A 1OXCA 1G9DA 3VBFB 3FWEA 1LGCA 2E32A 4UBHA 2VM9A 1WMEA 1YEWA 5FY4A 2TEPA 4PT6A 2P3JA 3NVCA 4UW3A 3VD7A 4OUMA 4M3CE 5GLUA 3CJIA 4E4DX 5FUPA 5FBJA 5FDBA 3TOJA 1GBGA 3LOIA 5F37A 1CN1A 5E16A 5A7QA 2H6BA 5FZCA 2UWAA 3SQOA 1UMIA 2LTNA 1AR81 5FYCA 2DTWA 2WAAA 1XB9A 1HB3A 2XKPA 1OHFA 1JODA 1W90A 5EP9A 2MNGA 5BNNB 4ATEA 3VHNA 1FI2A 5FMCA 4QKDA 3DCQA 4B1LA 1I1EA 3WG2A 3R0RA 1CZSA 1QJX3 2OX0A 4WVVA 4Y33A 3VBUA 4AK3A 4UOJA 5IUQA 5C70A 5FP8A 4AVSA 1VP6A 5FPVA 2RS32 2XJVA 1HXS2 5FY8A 4CUAA 4QKBA 4BZ4A 3MUZ1 5A7SA 3GJAA 3AL6A 4Y20B 1QJY3 1TQ5A 5K7PA 5F1RA 2VCCA 1W06A 4RHV2 1S0IA 2ETEA 4CDWC 4FBFA 2X29A 1DQ4A 2Q0AA 2FZ1A 5T5JA 3POGA 4JGZB 1JTZX 3FLRA 2W87A 1YQ5A 3THPA 1C5IA 4JVAA 1KQRA 1GZWB 5GKAC 1O3QA 4XQWA 4GH4B 5GLTA 5LBEA 4MADA 3BVCA 4IEVA 1MZ6A 1QEXA 1YWKA 3WW2A 1AJKA 4Y26A 4C90A 3U4SA 4XDPA 5C9AA 1OD3A 1PGSA 1ZBE2 2ZGRA 2CWSA 1LNSA 2JENA 2R061 2XKOA 1S0JA 3IDEA 3NV2A 4CCJA 4E4HA 1ZA4A 5J98B 1LOGA 1FNZA 1KS5A 1NUKA 1W2UA 4LTAA 3RQ0A 2A6YA 4LBQB 4EWDA 3CBNA 1AYM3 4P9WA 4XQDA 4FPFA 4Y1UA 5BXXA 1KD7A 4BM8A 2O0OA 2F4PA 4CP1A 1LECA 3T1MA 5L7OB 1NT0A 2RM23 3QD6A 1ZBE3 5ANNA 2VNGA 4K7JA 4NUBA 2AR6A 5IJRA 4CVUA 5IK5A 1DGRA 4YNIA 3CIHA 2ZGTA 4LO4B 5KBFA 2QQPA 3SHRA 1ZVFA 4DXSA 2ZEWA 1AYM2 3LB9A 1V6KA 4HETA 1ZYBA 3KLSA 1YFYA 1DLCA 5HCBA 4BQ1A 1VJ2A 3NAPB 4V2WA 4Y1YA 3NNMA 1GICA 3ZYHA 5J3UA 1AZDA 5E89A 1DYKA 4BMEA 5A7WB 4CDWA 4GKYA 4LE3A 4AI9A 4X8PA 3ETPA 1PZ8A 3MYXA 3CEWA 3Q8BA 1QH6A 2JDMA 4NPLA 1P8JA 2ATFA 3OYWA 2B7YA 1UX7A 4DO0A 5M0TA 1JOPA 1Y7BA 3MV01 2YGLA 5DG1A 1LGBA 3ETQA 4YM2A 5L36A 3ZFGB 1XNKA 2ADDA 3MFAA 2WAOA 1CZVA 3H3ZA 4OYUA 1RHI2 1F2NA 4AAXA 2WNVC 4DPNA 5HCAA 1CR7A 3JU9A 3OSDA 2Q1FA 1G8WA 3BU7A 3ZXGA 2MEV1 2GNMA 1IS4A 2JD9A 3SITA 3LSDA 3UKTA 5I0RA 3VDCA 5EZWA 3VBSC 4H2AA 5E8AA 1TNFA 2PHWA 3GBGA 1G6NA 5JWPA 2Y0OA 2QZ2A 4PLNA 5KHIA 1KJLA 4WZFA 4RQPA 3A22A 1NCRA 3VHPA 3U07A 5LK7B 1Q8SA 3RMXA 5HCFA 1OF3A 1CIWA 1QOOA 1KFUL 2C6SA 2GMPA 2J1RA 4MUVA 4Y4YA 2V5DA 5D8AC 2VR4A 5FZOB 3WP5A 3RFRA 5C5UA 3CO2A 4F8AA 3OGRA 3MPBA 4WM7A 4NOTA 3VZLA 3EYPA 2OUHA 2W1SA 4H55A 2DDUA 3ZX7A 3NW4A 5T3NA 1TEIA 3ATGA 3KV5A 1HDKA 2FHRA 5F5QA 2P1BA 3I7DA 1DIWA 1DYPA 1PMIA 2CTVA 1VBA1 3ZFGA 1DQ5A 1CJDA 2ZHKA 4J1WA 4KG8A 5FOBB 2NPIA 4JV4A 2ZAAA 2JG8A 5FQ0B 1W8FA 2RS51 1BZWA 4TTGA 5C3OA 2YROA 4QB2A 4MGIE 5LY2A 2RJLA 1V6NA 3RZGA 1N3OA 3H8RA 2IXJA 3RI9A 1MQTA 3QACA 3ZXEA 3KB5A 4R4ZA 4XZUG 1S0BA 2JB8A 1SLIA 3VKNA 2VMEA 4JAAA 4ZXKA 3O1SA 1NY71 1H9PA 2G1MA 4H3WA 4YVWB 2XLAA 2RR12 5C4WB 1BEV3 1UXZA 3MLLA 5DDJ2 3O0WA 5IAVA 5FXWA 4BWOA 3S57A 4AEJA 2WYFA 4AI2A 1YJLA 2VJXA 4NWVA 5IWFA 1ZZCA 5SV8A 3AZWA 5DABA 1J3RA 1UZZA 2JDNA 1SEFA 2WA3A 4FPOB 1AR91 2XJPA 4XETA 4AOCA 3GHNA 4LKEA 2D5FA 2AYHA 4BQYA 3JXSA 3POYA 2RR13 1EPZA 4XJWA 1BEV2 1UF2C 2W94A 5FZEA 1HRI2 2TNFA 2MHFA 4M3CA 1KXGA 2Q1MA 2ZXQA 4XDOA 3ELNA 1PGW2 2CDOA 3N7MA 4LORA 4LMFA 4XTPA 5FY9A 3RMYA 1QXRA 5FZ9A 1NA1A 4GD4A 3OJBA 3TWIA 1OLQA 4HKWA 4X6QB 1ULEA 3IN9A 3J26N 3SH4A 5AFBA 3AXEA 4QM8A 2Y26A 5AC92 4XBLA 3APBA 4NHMA 1FV3A 3DYMA 5KHJA 1U12A 2BNNA 1LKNA 1REFA 1ND2B 1HRI3 1UL9A 2F17A 2D6NA 1XU1A 5CFDC 5EIYB 1L7QA 2ZX1A 1ZRFA 3IKWA 1VRH1 4XXPA 2JB4A 1MS0A 3ACHA 2VNOA 1RUC1 4CCOA 2GC2A 3K4AA 4ZZ5A 3LDBA 3JBG2 3C8XA 4BH9A 1NQDA 2BU9A 3C3VA 4YWAA 4QXCA 5JZGB 1C8M1 5A3MA 1A78A 3O0XA 1UOFA 2JDYA 2X09A 3WCSA 1I9RA 2QTWB 1PZ9A 2OIIA 3O1TA 1B35B 2BWCA 2A3WA 4I09A 1COV2 3RDIA 5KXBA 4MXWA 1H2MA 4RR3B 1OVPA 3FHQA 4CCEA 5FZKA 4M3CB 1POV3 3IMMA 5JCTA 4N8MA 2XOMA 3FC0A 3U1XA 3NMBA 4Z82A 2YPJA 1DYOA 4UFLA 3HN1A 4W6XA 2JXAA 2D3SA 3B00A 3J9SA 4XF3A 2WZ8A 2PHTA 4CXWA 5GZEA 4LR4A 4QQOA 1NG0A 1URXA 3TBDA 1ZZ9A 4FVVA 1RUI3 4FPCA 3WDUA 4IV3C 3SNMA 2AEYA 3OPTA 5HPOA 2HYXA 4HT1T 3C2UA 1NA1B 2ZOEB 2J1TA 2BGPA 4LHKA 4QDQA 3WSOA 4EN6B 3D8CA 3ECQA 2GAUA 4QXBA 4CU7A 1S2EA 1CQ9A 1W3XA 3E5XA 3I59B 1BBT1 1XNTA 2ZHNA 3FMGA 3JD73 4FPGA 2VG9A 5IK4A 1CAUB 3H8XA 4CDQB 5IVBA 5CG8A 1OD5A 1WCDJ 5FZ6A 2Q8DA 5A6XA 2ZTNA 2VZTA 3HAGA 1UPIA 3VL8A 5DQ0A 3LFIA 3RRDA 4DUVA 2XBO3 2DBIA 4FI9A 1YIFA 2DCZA 2LUWA 2VY0A 4TYSA 5IFPA 3I49A 2BWAA 1LHNA 3A7QA 3I8TA 4BPZA 2QVSB 2V4AA 3HWJA 4FQZA 5J09A 5AC91 4QT6A 3JD72 3MF9A 1OUXA 3H42B 2JG8B 4GA9A 3K46A 4K1YA 1RUJ1 4CE8A 3MIGA 2WQZC 2FMDA 5F3GA 3RZHA 5A7PA 4AG4A 4F3JA 1JYCA 4RS5A 1WBFA 2XBO2 3A23A 2J1VA 3ZYBA 1WW4A 4QGLA 2QDRA 1W9TA 3JQXA 1WW5A 2YFZA 3B7MA 4A44A 4NO4A 2WC2A 5FAXA 3S5QA 4DS0A 3BOWA 2O8OA 3SCGA 4SLIA 2WT1A 1N1YA 2XHKA 4OHVA 1Q3EA 3THDA 2ZGNA 3ZIWA 5JMOA 5L7OA 3O1RA 4B4QA 1UY1A 2GN7A 5A33B 1LOFA 5FQ0A 4FOYA 4AHYA 1LU2A 4OZOA 3M3EA 4BK4A 5B2GB 4Q27A 2PMWB 4PI2A 1HRV3 3VKFC 1Y9MA 4FP2A 5FYSA 2EXIA 1WLDA 2DVGA 3ZXLA 1XE7A 4LT5A 4ZU5A 2GNTA 5CU1A 2GC3A 1UKRA 1XYPA 4PI0A 3PU3A 2YMZA 4HBNA 3ZYGA 2W39A 3NAPC 3ZFFA 1GP5A 3N9OA 4ATFA 4XJ8A 1PIV2 2QDNA 1JYTA 1HRV2 2HLEA 1OF4A 4JDNA 3LAGA 4QPIB 3CZJA 1TE1B 3B9CA 2ORXA 1MZFA 4CUGA 1IOAA 1GP6A 2DCTA 4AQSA 3WG4A 3H9AA 4XMIA 4DMIA 4KI5M 5CISA 2DUQA 3ZN4A 3OGVA 3KWVA 3V56A 2OQ7A 1PIV3 5C33A 3UKNA 2J7MA 2EIEA 2QQLA 3VBSA 2ZGOA 4NJ4A 3H7YA 4WV8A 4LO5B 1N1SA 5CIRA 1I5ZA 3MUY1 1QQP3 3R4SA 1FPN2 3MI8A 4N7UA 1OVSA 3K77A 4XOGA 1BK0A 2DCYA 3IAPA 5D8AB 5BNQA 1J84A 4CEYA 4LPLA 5C3SA 2E7AA 2NLRA 4Q29A 4BISA 4LBMA 4AQ6A 4BQXA 1QGLA 2UWBA 2JDUA 1TME1 1RTVA 4N9HA 3RS6A 1BLZA 1OQDA 1VAKA 2XVLA 4QX2A 2WIIB 4DUXA 3W58A 1ASJ3 2BW8A 3ZYJB 4HK8A 2VQUA 2RDQA 4HANA 2B39A 2PQSA 3HIFA 1WMFA 2GC0A 2CGOA 4BQ4A 4S2HA 4Z92B 1UMHA 4YRDA 4NWWA 2B9UA 1QJU3 4YZ4A 4ZU4A 3WF2A 4GB33 5FLIA 4JC1A 1W28A 3TN91 1LOFC 4FXKB 3ME2A 1PZ7A 1UPSA 5I8TA 4XBQA 2X10A 1VPHA 2QBXA 1W6QB 3WX5A 4FO9A 4H7LA 1ASJ2 1I3HA 1IKQA 1N3QA 3AMMA 4AEDA 5FK7A 2C0ZA 1FATA 4C8DA 4GB32 4YW4A 1UIJA 3D0SA 1EV12 3C7EA 4IUGA 4YVWC 4M4RA 1O8SA 4FOQA 4WVWA 3IMNA 4ZZ8A 4K8FA 5CEHA 5F39A 3POWA 4A42A 2DVFA 1W2NA 3AKQA 3J8F2 4ZHNA 4AR2A 1JU4A 3UGFA 4BLJA 3OGGA 3RWKX 1WLCA 1YFXA 5C7GA 4IL7A 4MHUA 2DCJA 2ZEZA 3W59A 1HB1A 4QX7A 3CNAA 3CZUA 1C1LA 4AVBA 5A32A 1EV13 2LROA 5E6HA 3VBRB 2GSYA 4XE9A 5F5IA 5FPAA 2FDKA 2D44A 1XE0A 2ZMLA 4LHSA 4HZFA 1SDDB 4RFRB 5LK5A 3J8F3 1OC1A 4IEZA 5JDBA 2HWB3 1PO22 1JOJA 1WLWA 4NAMA 2ZGQA 3D5OA 4I0AA 2IVIB 4F83A 4OLLA 1UY0A 3HQRA 5CKNA 2UYBA 4NRQA 2FDHA 4MOAA 2VQTA 3T4VA 3W9AA 3AMHA 1V9U1 4QD2A 3BALA 2ZX0A 2PN5A 2GP5A 1GV9A 3KF3A 4RGKA 1B09A 4TZDA 2R073 4DRVA 4N53A 2QQJA 2RG4A 2ERFA 1IG0A 1NYWA 1W0PA 2X5IA 3DN7A 4FPYA 4O7XA 3GBWA 2Q5TA 3Q8CA 4XXAA 3VD5A 2EXHA 1F9KA 5F8PA 1WA6X 4MZUA 3SCFA 4JDMA 4DRRA 2QNKA 3U4XA 3WEZA 4RS5B 4AXOA 4ZKTB 4JX0A 1GANA 3VZKA 1BVVA 2P2KA 1W6PA 4OZXA 3KQ4B 4U36A 3H50A 5FREA 4V1PA 4XFBA 1CAVB 4QU1A 4XAAA 4RSUA 3BKZA 1DCSA 3T30A 5E88A 4NPRA 4YW2A 4QKFA 4LEJA 4XUOA 1JZ3A 3KV6A 1DGRN 2Q1ZB 4J25A 3ACLA 4FFGA 3DECA 2R7EB 1BHGA 1YCIA 4IEYA 4YG3A 4NMIA 1GOFA 1QDCA 3ZN5A 2Y60A 5JIUA 4LBOA 5CA6A 4UFHA 1HXS1 1XOYA 1GKBA 1BYHA 2DCKA 3AP6A 1RUH2 3GCWA 4IE4A 4TLGA 4XJUA 3FX3A 3WNMA 4GQ7A 1HQLA 1VAVA 1V6IA 2B4KA 5KC6A 1QDOA 1VMJA 5HI0A 2J1SA 2VZPA 4COZA 3E6BA 1W8HA 4NAOA 2ZEYA 4DOUA 1DDLA 3K3OA 1C5HA 4QHOA 4LNVA 4E8DA 2CSGA 3K4DA 3P3NA 5L9BA 4KWUA 4QQHA 3W21A 3WNKA 2E63A 4FPHA 1EY2A 1RUH3 2W91A 1OUSA 3PJQA 4A7ZA 1VR3A 1PGL2 1RVF1 5LA0A 2HWE1 1GNHA 4NIIA 1GU3A 4MSVA 2Z2SB 3I54A 3ON7A 3V0BB 2ZGKA 3WW3A 4GH4C 4PQQA 3T0BA 4PLOA 1RUD3 2I45A 3CHXA 3GCXA 4CDQC 1K12A 3OBAA 2WINB 4Q4X2 4E9KA 2VL4A 5I8YA 3O1MA 2XQRA 4ZPIA 3HT1A 1O4ZA 2P6CA 3AP7A 3PL0A 4OVEA 1ND3C 5K0UA 4IV3B 5FPUA 2OZ6A 4AGGA 1HX6A 2HBUA 2JEMA 4CU8A 3KT7A 1ZNPA 2GH2A 5FMOS 1CAWB 2ES3A 3T3YA 1QOTA 4K9SA 1RUD2 2ARBA 3FJSA 3V65A 1GZTA 4E2QA 4Q4X3 4G4FA 5FYHA 1RL3A 2RE9A 3WR0A 3AMQA 4URAA 3ITQA 5A3TA 4Q4Y1 1JHNA 2E6VA 3PHMA 2YPDA 4NRPA 3DYPA 3NV4A 3LPGA 1J3PA 2FQPA 3UK9A 3QBQA 5J1XA 1A8MA 4D94A 4Z2WA 2JG8C 3QH6A 3LA7A 3T09A 1COV1 2HJIA 5JXGA 4OHZA 3ZYRA 1PVC1 1RUOA 3ZSMA 1FMD1 2YU2A 4G3YC 3AVRA 3N7JA 4XFIA 3RYPA 4XTMA 5HXMA 4MGZE 3KCCA 2NN8A 1E5RA 2HWC1 3VDDC 3AP9A 1R083 5FUNA 5TSWA 3USUB 3DXTA 1X33A 2VUCA 2WWUA 3JBG1 5EFUA 2V09A 4XPVA 3CMGA 5IK7A 5FPLA 1VRH2 5C6CA 1GYKA 5JVVA 2BNOA 5HBAA 3CQOA 3AYDA 4TLFA 1NCQA 1Q43A 5L9RA 1KRIA 1M06G 4XUNA 1HKDA 2E33A 2C4XA 1N1TA 2BVBA 2RMU1 4AL9A 4AAPA 3EQEA 2VPVA 1FMD3 1R082 1MZ5A 1EAH1 1REDA 1SLTA 4MHRA 1G9CA 5C9AC 1H8TC 4AVTA 2GNDA 4M4PA 5FO9B 2VW0A 1W8OA 3VHRA 1QJX2 4G9SB 2KXLA 2D6KA 1JN2P 4MH0E 2AH2A 2PTMA 1JZ2A 2YXSA 5FZAA 4PBOA 2W95A 2DU1A 2W1UA 3RJ2X 1QJFA 1PK6C 2V73A 4LUMA 5JR2A 3HOBA 2WNUA 4FFFA 2XL9A 2HEWF 2BUKA 1QJY2 1RUE2 4YFZA 2OS2A 2PFWA 2VW2A 4ARXA 1VMFA 2E9QA 3HVDA 5A6ZA 1UU4A 2B42B 1SPPA 5LASA 5EXOA 2VUAA 2YDEA 3AKTA 3HR9A 5DDJ1 4AYUA 1R1A1 1PVC2 1WBLA 2AEZA 2W1QA 3PUAA 3QCWA 4L11A 4ITCA 4M01A 4XF0A 5D2AA 5FYTA 4C1XA 3PVNA 3ACGA 2D5HA 4UI9L 4GZ9A 1D4VB 4Q1RA 5HCHA 3Q8FA 2QJVA 1KS4A 3H8UA 1V6OA 4DY3A 1UMZA 2ZGSA 1RUD1 1LEMA 2RDRA 3CKHA 3IPVA 1YQ6A 4LKFA 4EZ4A 3W5NA 4M00A 3ZSLA 2K9ZA 3WG3A 1OMIA 1PVC3 4NIHA 4GJZA 1GQHA 2HWF1 4UW5A 2XONA 4ISRA 4YVSC 3JB8A 4IEWA 4O61A 4L2NA 3V64A 3GGLA 3ZR5A 2UWCA 3WOGA 1STMA 2N7GA 3HNMA 1E57A 1H9WA 2RM22 1W04A 2E53A 4JHTA 2DFCA 3PJYA 1D2SA 1AJOA 3AMPA 3KCYA 4Q0VA 3F2ZA 4ET7A 5AFEA 4BYYA 3MDPA 2FCVA 1VBE3 1L3JA 1WCQA 1YI7A 1O91A 3BIEA 1ZX5A 2VD7A 3L2HA 2UY9A 3AJYA 3FUOA 4XJ9A 2Z5WA 2FDJA 4LA2A 3S5AA 3PMSA 4CUBA 2A6XA 3KV4A 5GM0A 2PXJA 5BY5A 1DGWX 4N53C 5T50A 4OQ8A 2R0HA 1UQXA 2VNRA 5D1IA 3I3MA 2ENRA 3TRSB 2RS12 3RNSA 3BTZA 1Y9QA 3ZPYA 3AZYA 1VBE2 3FLTA 1NZCA 1OPOA 1VB4A 1VE0A 4QPGB 2ZZJA 1BJQA 1FX5A 2D7FA 4QPWA 2R16A 1B35A 1T2XA 3CU7A 4XFHA 2X05A 4HVQA 5JOWA 2FDGA 5JI9A 2PHFA 1SFNA 2NM1A 1O7FA 1PO12 1AL21 3LDKA 1W2TA 5C3QA 3KMHA 4LBJA 4QPGC 5FO8B 3POBA 1NCRB 1RJ8A 2VOTA 2WO2A 3GYDA 3J7LA 2JG9B 1MPXA 4HXCA 2P3KA 3AYAA 3M2MA 1D0HA 1ND2C 1Z78A 2GDFA 2OUJA 1OOPB 1US2A 3KGLA 2VAUA 4KQ7A 3MGUA 1JUHA 4OULA 4W8JA 3VGIA 5C8WA 5CFDB 1AVBA 4OMCA 4B7EA 1IG3A 4P08A 1PO13 3GZEA 1I5PA 2JG9C 5DMYA 4LK6A 1HV0A 3WVJA 4A3ZA 4LUKA 3FUQA 2ZGUA 3PLQA 3I2DA 2HWF2 3B01A 3ZFFC 4YW1A 4XW3A 1SFPA 2BP6A 2FZ2A 3OGJA 2BQPA 1E5HA 3AFGA 4XFAA 3I3EA 3MFCA 2CNAA 2P34A 3N35A 4FT8A 3SC7X 1E5SA 4MGYE 5JSOA 2O1QA 4JKLA 2ARAA 5K4LA 2QQOA 3NJXA 1YI9A 2ZS6B 2PYTA 1QJZA 3ABZA 2Y6LA 5ACA1 2IZWA 4RGAA 2NMNA 2ZHMA 4YG6A 3EO6A 3FLPA 1F5FA 2W9XA 4YW3A 2Y34A 1NLQA 2OT7A 2X8KA 5EYXA 1JZ5A 3DPRB 5LB6A 1B35C 2VZRA 4XUTA 5T5PA 4YZ3A 1AF9A 3TNQA 3KHBA 1RUE1 1RITA 5AVAA 1GP4A 4IV1B 1S0EA 2R071 4YGEA 5GLZA 5EPAA 5FOJB 1RYYA 1AX2A 2RDSA 1CAXB 2D97A 1LJ7A 2VMFA 5BNNC 5BYNA 1JZ4A 2TUNA 4XCAA 5F3CA 3CJXA 4FP3A 4QHBA 3ZDVA 4JKKA 4YLZA 1PX4A 4N90A 1AHSA 3POJA 4CCMA 4BLIA 3ILRA 4EN7B 4RA0A 1DZRA 1T6BX 3L2YA 2FDFA 2A6ZA 4BXFA 2F4LA 4IE7A 4AFCA 3J8F1 1R081 5DDJ3 2P5BA 4WVMA 2QQMA 1ASJ1 5T52A 2AZ5A 3U78A 5DUUA 3WY6A 1QJX1 4L99A 2VMGA 4D0QA 1HQWA 1AR93 4IEPA 4KL1A 4QDRA 1PMHX 4OI2A 5I0TA 2BDRA 4LBKA 4WM7B 5LZ6A 1G86A 2BRTA 4PF1A 1GQPA 4BE3A 1QQP1 2WFF2 3CF6E 2WFPA 3N9NA 4GWIA 5A1FA 4IV3A 2R30A 1SDWA 1F4HA 3I2KA 4MX3A 1ULPA 4LBQA 1VBB1 1DFQA 4Q4Y3 4EWAA 4FOWA 4Q26A 1OQ1A 2H0VA 2KD7A 4TXWA 4WM7C 3NKGA 4CP0A 5KWRA 3VBHC 4B8EA 4YYOA 3UJOA 4QPIA 5LA2A 3WF3A 2Y6FA 5FUIA 3KVBA 4Z1VA 1OLRA 1IPJA 4KGQA 1BQPA 1DGLA 4GMP3 4R9DA 3FHIB 3AMNA 1J58A 3ZKUA 2W08A 5G05L 5FZ7A 3SLIA 5CKMA 5ACA2 3Q9OA 4CEWC 2I2SA 1LEDA 3EBRA 4FPJA 1GWMA 3OBRA 4ASMB 3MZHA 5L73A 3JBG3 2BVVA 3MIEA 4R4XA 4BXSV 1DQ0A 2F6BA 2Y64A 3S0MA 4SBVA 4AGVA 2ADEA 3ILNA 2HEYF 2A7AA 2E26A 4CEWB 1SMVA 5KXDA 4Y22B 2EIBA 2WZR1 3LPFA 1XE8A 3MW4A 5FKCA 3LGRA 3ZXDA 2VZVA 4QX0A 4DEVA 1RVF3 1LODA 1AR72 2VZSA 3GF6A 5JPNB 5BNPB 5FWJA 5KHKA 1COV3 3JCIA 4XFCA 5CB7A 1G9BA 2PHUA 1KJRA 4IXLA 1V6MA 1AL23 1RMU2 5ABJC 1DZQA 3THCA 1GSLA 1DU3D 1CZTA 3MO4A 2VQAA 4COWA 1A6CA 3BN6A 3TNPB 1MEC2 1XRUA 2VMCA 5BNNA 2IXHA 3BIWE 1LHOA 1XBFA 1CPMA 3PUIA 3DEMA 4DEQA 1RINA 1C3HA 2BOJA 2A75A 2IFRA 1UAIA 2EXKA 1ULDA 2VZ3A 3NJZA 2MEV3 4I02A 2UYAA 1DF0A 5CVRA 4NN0A 1K3IA 1AL22 4ARYA 4R52A 3ZFGC 3NJVA 2CHHA 2ZX4A 4Q8LA 1UY2A 3ZMOA 2WKKA 3VDAA 2VOKA 2JDKA 2ZEXA 1PGL1 1DP0A 4M3CF 1H8VA 2Q8CA 3PIJA 3BB6A 2WQ4A 4GMP0 1QNWA 4COYA 5JXJA 1W9WA 4H7MA 2WLPA 2MEV2 2RHPA 2OZJA 2WNOA 4KWLA 4COUA 4ZS3A 1US3A 2XDVA 3LQCA 4AI0A 4CA9A 4KU7A 1AXYA 3VD3A 4HSJA 4K21A 1NX9A 2K2SA 3U0ZA 2PAKA 1X7NA 1BVP1 4QX1A 2J42A 4FAHA 5HV4A 2VTXA 4Z8BA 4P9LA 3Q8EA 5CAZA 2BJSA 1NE4A 1W6OB 2AACA 4IGOA 3BCWA 3O1OA 1GZCA 1O3SA 1MEC1 1JU3A 1L7LA 1PNFA 3P3PA 1QY4A 4BJ0A 3WINE 4HSLA 2OA2A 3HQUA 3M70A 3WP4A 2PQQA 2Q4SA 1NAEA 2XB6C 5IVCA 3BU0A 1HB2A 3WDVA 2JE7A 5T5OA 4AFDA 1JYNA 1YQ8A 1OQEA 2WZEA 3NJYA 2O8QA 5E1RA 1JZ6A 2DWRA 2OXBA 1LHVA 4FTEA 2IFWA 2LS6A 2XJTA 1U5YA 4L9BA 1J3QA 4KMQA 2P6HA 4CU9A 1VBD3 4J6GA 3ZSJA 1V0AA 1O4TA 4CDXC 1A8DA 2VMIA 2EXJA 2BZDA 3DUIA 4GALA 5C4WA 5C5TA 2D3PA 1Q56A 1EPWA 2VCAA 3WF1A 1EP0A 1ODNA 4UBGA 1F15A 3P5BA 2CGPA 1C8M3 1LHUA 2R1BA 5A3NA 1OFSA 1ZRRA 4A45A 2YYOA 4N43C 3SH5A 4PDWC 2DVDA 3AK0A 5K8SA 1FT9A 2EICA 3UGGA 4DY5A 3S7EA 1X82A 1UNBA 4H14A 4QPGA 4QXHA 5F3IA 4E4SA 3OBZA 1IZ3A 4P9GA 4TN7A 5FJHA 1RUI1 5GZFA 1XC6A 2WR9A 1YO8A 4WVZA 2A3YA 1QXJA 2IXCA 2JIJA 1BCXA 4P00B 4PQ9A 3SMHA 4CDUC 5A3LA 2BYVE 1LB2A 3OYWB 1UWWA 3K2OA 3IIAA 2E51A 3ZXKA 3O1VA 4OUSA 1GWLA 3QOPA 1UXXX 4FQ4A 3B5LB 1OI6A 1QXPA 2PAMA 4GWJA 4IQPA 5APAA 4FFHA 3ZM8A 3KQRA 5A3OA 4A6OA 1NCRC 2R32A 4P5YA 4NHKA 3TEZA 3AX4A 3QH7A 2VOWA 1QQP2 4FTBA 1FPN3 1H8TA 1ENRA 1S1AA 1CAWA 5A3UA 3N36A 2D40A 5J96B 1LULA 4XILA 3UGHA 2VVEA 1UKGA 1WD4A 3LOBA 4NIAA 4QHZA 4PF5A 4ASKA 1H2KA 1W6MA 3WNLA 3H7JA 3WF4A 5FWEA 4AVAA 1JBCA 4ZXEA 3IDCB 5FZ4A 1UU6A 1ALYA 2HWC2 2W46A 1W0OA 2JIGA 2EA7A 1BEV1 1Y43B 2QQWA 3GHMA 5A3WA 3RPQA 2IUWA 5BNPA 1ZZBA 3ZFEC 3GDBA 2AREA 3GZTB 4MLOA 3WUDA 1OPMA 4AI1A 5LEKA 3DL3A 4QAWA 5FZOA 1D4M1 1IS6A 5JMCA 2A6WA 4QM9A 1W9SA 2WRAA 5F2SA 1H6XA 1FPN1 1OH3A 1QIQA 3I3BA 4OHXA 4DB5A 5KHGA 2QFEA 2WSUA 2JWPA 3KS7A 3R4DB 5KHHA 3ZSKA 2P3YA 1UD1A 2C9KA 1KGYA 5FY5A 2WUHA 3DF0A 1NA1C 5FZ0A 5IVFA 4XIKA 1LENA 4IEQA 3MLJA 1K45A 4QX8A 5LBBA 5LBFA 3HPNA 1CIYA 4BOWA 4Q5OA 2RR11 4XBNA 3AL5A 1MACA 2C9AA 1PMJX 1W2AX 3NV1A 4LHLA 4NHXA 3LEGA 4HKLA 5H9SA 3WW1A 5DAXA 1CAVA 1K5MB 4ZU7A 1OH4A 1KFXL 1HRV1 3EB7A 5SV5A 1TG7A 4O65A 1W6MB 4EV0A 1OURA 1CESA 4XACA 2ET1A 1TMF2 4YM1A 2BV4A 4ASLA 4EZHA 2DFBA 3PTRB 3HN3A 3IM0A 1K5MC 1C28A 3U75A 1ST8A 1LHWA 1MS5A 4RFT0 4UFMA 3C7GA 4CPBA 1QJEA 2HWB2 3GXUA 1A34A 2HKXA 1H6YA 3NKTA 3AXDA 3O12A 3ORJA 4GJYA 3ZO0B 5FMOL 5LA9A 1NCQB 3VN4A 2XUMA 5F5AA 5A7WA 5JOZA 3W5MA 3PTYA 4LLOA 1OA4A 5FTTC 1SLCA 1GZ9A 3GZUC 4AHZA 3AYEA 4X6RB 1UZYA 1VRBA 5J36A 2ZA9A 2DYCA 3IZOA 2Y6JA 4XAEA 3FZ3A 5ANQA 1W99A 1YQCA 4UAPA 2VH9A 1OLME 2Z4FA 1JW6A 2CU5A 1VBE1 4OI4A 2JX9A 1UYZA 1Q8QA 2XBO1 1QH7A 3DKQA 1OKQA 4EN8B 5T55A 3S7IA 3SXWA 1Y3TA 1GNZA 2XJQA 1CPNA 1UU5A 5I91A 5FZBA 3M3OA 1F4AA 5JUVA 4EYUA 3WNPA 2A5ZA 1CD3G 3AJZA 3VLBB 1H2NA 2G9FA 4Y22A 3JZVA 2YBKA 3LA3A 2Z42A 1RUH1 1U5XA 5BNPC 3UNPA 3KT1A 3MICA 1WW6A 2ZJCA 1S55A 5F6KA 3U11A 1LGNA 4B4RA 4BK5A 3VD9A 2Q8OA 4KGGA 4AEDC 1RUJ2 2GMMA 2DURA 3OPZA 5D21A 3ZYPA 4AVVA 2JICA 3WQ0A 1SCRA 5CBLA 4AE2A 3H1MA 4GWNA 2G19A 1XNDA 2OPWA 3ENRA 1PVXA 2XWBB 3ZDSA 1JHJA 1XNBA 3O14A 1AR71 1JUIA 1BKZA 1SLBA 3M7AA 1D0GA 1UX6A 2ARXA 3HNYM 1RUJ3 4LLFA 2WNVB 4C1WA 2YC4A 4B1MA 1J1LA 3H1YA 3SEPA 1GUIA 2W92A 4Z07A 2YY1A 2XVKA 3LEKA 5A6YA 4LOSA 2RV9A 1PK6A 1ENSA 1H8TB 1QU0A 5DUVA 3K48A 4META 1O5UA 4Q8KA 1CWPA 1LU1A 2ZPXA 3FFQA 3WQ7A 5JAXA 4BMBA 2R063 2G9ZA 4BA6A 5FKBA 4FCAA 3KD4A 3N9QA 1YXWA 4W4ZA 1UOJA 1F31A 5JOYA 2YFUA 4AF9A 2VC9A 3KT4A 3OEAA 5T54A 2VZ1A 1MVEA 3VB9A 2A3XA 1X8EA 2BGOA 2QQNA 2LM3A 1DQ2A 4DFSA 4Z2AA 3OOXA 4AZZA 1JZ7A 1MS9A 2QE3A 5FMBA 3T0DA 3I2GA 4YARA 2Y38A 3C7OA 4P5HA 4CXXA 2FCTA 5T5LA 3VL9A 1HN1A 2R1DA 4Y1XA 5F5CA 2O14A 3CJIB 2Q30A 1FYUA 5FY0A 3X29B 2VCMA 4S2GA 4XDQA 1D4M2 3U10A 3AZVA 4JQTA 5DN2A 4Y5SA 3HJRA 4CDUA 5B4NA 3AP5A 1Y9GA 1KDMA 3NAPA 4IETA 4GAZA 1XNCA 1SBFA 5IATA 1H2LA 1WCUA 4LJHA 5DXDA 2OVUA 1S2BA 4PIYA 3WNOA 3TAYA 3LA2A 4AFMA 4GULA 5BUVA 1XJAA 4LXLA 3OPWA 4N43A 3LCPA 4IESA 4AI3A 5BNOA 1D4M3 4L97A 1YHFA 1S0GA 4XVHA 3VD4A 5A70A 1CVNA 3SKJE 3FBMA 4EN0A 1ACCA 4FTSA 3O1PA 2GC1A 2CYFA 4PIZA 3VKMA 3VBRC 4LIUA 3D0JA 1UOBA 3LD8A 1YIPA 2ARCA 4N7IA 4RQPB 4WBBA 3EXUA 4XQ4A 1G9FA 5K9YA 4MXWB 4RR3A 4XHBA 1VRH3 2ZHLA 4JZRA 2ZABA 3V0BA 4N9IA 5A1AA 4J1XA 1QKQA 5LEJA 3HMYA 2QCSB 1DQ6A 3PDQA 3J7HA 2BERA 2P37A 4I0WB 1FMD2 5JOXA 1XNAA 5A7OA 2RS53 3HEIA 1S0FA 2A6VA 2B45X 2BTVC 3T2QA 4LKSA 3MPPG 1DZTA 1OOPC 1SZBA 1Q8PA 4GH4A 1WKYA 5DUWA 3N7LA 4Q0QA 3VV1A 2XLFA 5FPBA 5FYZA 1R64A 1DQ1A 2JKXA 1AYN1 5FY7A 3O1UA 4CRQA 5C8CA 1WUVA 1RUF2 3AYCA 1RUE3 3WHUA 1W0NA 4A6SA 3O7OA 2VU9A 1GMMA 5FXVA 1CAXA 4I3PA 5JR7B 4K3UA 2B8MA 4CEYC 4ONUA 5CG9A 3RZJA 5A3PA 1JYVA 2NP0A 2YV8A 3ZPOA 1LAJA 3T0AA 1W05A 5A80A 1ULFA 5BPXA 3ZMNA 1XYNA 4BQWA 5J7MA 2TBVA 2Y6KA 4CEYB 1W6PB 2FMYA 1AXZA 2HYKA 4RR3C 5DAQA 4S2FA 5F7UA 2E7QA 2GH8A 4XYXA 3VBFC 4RGGA 1CAUA 5FYMA 1ZRCA 2VBBA 3RZMA 3AZZA 5FO7B 1VBC3 5JZGC 3LE0A 4L8QA 4Q4W2 2OQ6A 4INDA 4MVTA 4UWDA 1CGPA 4W6WA 1IKPA 5FZ1A 3BGAA 3L9JT 3PU8A 4D69A 4DIQA 5CFCC 2H0BA 4OQ9A 3ZVXA 3E6CC 2RS11 1VIWB 2WNVA 1PM7A 3BOPA 2ZZQA 1GOGA 3HD8B 3E1F1 3KV9A 3NNFA 2PAEA 2W5FA 3RJRA 3PUSA 3ZSEA 3ZIXA 4QKNA 4L92A 4LO6B 1AR61 1BBT3 1C8NA 2SLIA 4GKXA 4O9EA 3UV9A 4D6QA 3BTYA 2BBAA 4IEOA 1MS8A 3M4FA 5I8SA 1VBC2 4UFJA 5LW9A 4Q4W3 4BB3A 1FOD2 4Q4W1 5FZMA 2UY8A 2V4VA 3AB0A 4IV1C 3POIA 3VBRA 3LF7A 1Z7S1 1NQJA 1RHI1 1V9U3 3K75B 3T2OA 5I93A 1BBT2 2B5HA 1O4YA 4EJRA 3I2HA 2IC1A 3R4UA 2RS13 3WDYA 3OD4A 2XJSA 3N9LA 1OA3A 4A7YA 4HG6B 4B3NA 4FAGA 1SPPB 1QF3A 2WDBA 3VHOA 4OHWA 4CP2A 1F8VA 3VDDA 4CSWA 1BXHA 1IPKA 1O6UA 2VZUA 2RM21 2YBSA 4JRAA 4OCTA 3N4MA 3TEYA 1LOBA 1JMUB 1H0BA 1AX1A 3DKWA 3AP4A 2SBAA 2WSVA 1HB4A 2WWJA 3OEBA 1EUUA 1HLCA 1V6LA 1UOGA 1W03A 1ULGA 1S0DA 4DXZA 1Q8VA 3I2OA 3OGSA 1AYN2 1SQ4A 5D8AA 4CCNA 1X9TA 2HBTA 2WQ8A 3OD0A 4KBZA 1HQNA 2HWD1 4Q0SA 5FZDA 1BMV2 3RGBA 2XQXA 3ZR6A 2WYSA 3HQXA 2Y0IA 3WD5A 5A1LA 5L19A 1X9PA 2HWF3 5I0DA 1RUG1 1D7PM 4RYDA 3ACIA 2OPKA 2W0XA 5BNOB 2YB7A 2W3JA 3VZOA 3B02A 2XWJB 5L7OC 1AYN3 1SG3A 3R6SA 3RVHA 2JECA 3I59A 5CKQA 4BCUA 4IV1A 2D3RA 2WL1A 4CPBD 3VBFA 1QHDA 2JDPA 4R9CA 4KWJA 3RI8A 3OBTA 5FLJA 1V00A 3MIDA 5KXEA 1EAH2 1WMXA 1YLLA 2VXJA 4YSFA 4YVSA 1ZBE1 3BTXA 3VBHA 3FL7A 1UYYA 1HJGA 4QB1A 4W50A 5JPMB 1AX0A 3BPZA 4PJYA 4YW6A 4BQ2A 4MXVA 5CFCA 1JOBA 4XF4A 1PK6B 3TEXA 5JSRA 1FV2A 4JKMA 1W9FA 3SCHA 1SLLA 2A73B 3HT2A 3OB8A 1SBDA 1AUYA 2EIGA 2P17A 1ZBA3 4PLMA 2R042 4QX3A 2HH9A 1XYOA 4IGQA 5ABJB 1ZREA 1FOD1 1GOHA 3FBYA 5LWBA 3K4ZA 2JDAA 4PHZA 4RHV1 5A6QA 1UY3A 3ZXJA 3O5SA 3O0VA 3WQ1A 3KHCA 1TME2 4I0BA 1X8MA 3E6DA 2D98A 3V0AB 4LO8A 4P9JA 4K8RB 5K0UB 3N3HA 1E5IA 1NE6A 2ZCWA 1ZBA2 2VUJA 1ZRDA 1PHMA 1HRI1 3P1IA 5CFDA 4CEWA 1IQAA 1LRHA 2Q8EA 1IQDC 3WCRA 1WLTA 5C3PA 3IWZA 4FPKA 1AR92 5K0UC 3D3AA 5JXHA 4NE9A 3IB3A 2ZX2A 1NXD1 2DVAA 3J7NA 3WZ1A 3PVBB 4E2GA 2QQKA 3IPVB 4D7SA 4Q0UA 1X50A 5DG2A 2WFF3 4I30A 5IVYA 4UFKA 2WNEA 1H1IA 1O5LA 1O59A 4Q4Y2 2V72A 3UESA 5IVVA 1G9AA 1C57A 2W52A 4NRMA 3OY8A 4Y5TA 3LKJA 4UT5A 1JYIA 2PELA 1S0CA 4CP9B 2WWSA 3LWCA 4YGBA 4AWDA 5IFTA 5LRSA 2C24A 3S30A 1RXFA 1PX3A 1WW7A 4HOOA 1H1MA 1CONA 1JH5A 5C8CC 5ACA3 3E5UA 3V0AA 3RSJA 1GR3A 1ZZ6A 4F7ZA 1VALA 4I3GA 4UW4A 2LW8A 1Y4WA 1LOAA 2IWGB 2RS33 3GNEA 1HXS3 4Q4X1 3UYJA 1RB8G 4HK9A 5EJ1B 1ONAA 4A7KA 2DV9A 4P14A 1U5ZA 1M4WA 5FIXA 4Q1PA 4A2UA 1W39A 1RVF2 1ULCA 1S2KA 4RHV3 1AR73 5FZHA 1XQNA 4COVA 5IAXA 1GQGA 1WGPA 3NO8A 5BV6A 3PUHA 2DBNA 3EMRA 4AHXA 4LQRA 4IDZA 4XABA 2VXRA 2ZKLA 1RMU3 4IE0A 4XZPA 1HW5A 3SKVA 5C71A 1TVGA 2WS93 5C8CB 4CDXA 1MEC3 2Y6GA 3VZMA 2AUYA 3PNAA 3A4UA 3JD71 2VUDA 4IGPA 4YW5A 4XIOA 3ES4A 2BOIA 4FXGB 4PCRA 4P9YA 3SEEA 1UW8A 4E4ZA 1K5MA 4A4AA 2BNMA 3IDAA 2EAAA 2JE9A 3H3LA 5DPNA 3ZYFA 3I4IA 4RS5C 1JZ8A 2WN3A 2D6LX 2BEOA 2WS92 4K1ZA 1ZM1A 1AL0G 1XSQA 3AZXA 3POEA 5DAVA 1K42A 4AGRA 3FE5A 2VZQA 1MS4A 3AC0A 3HBKA 4AEKA 4IW3A 1O3RA 4BQ3A 3TYJA 1QWRA 2HWB1 4CP9A 1W6QA 2GZWA 3FHAA 5JZGA 4MO3M 1J59A 2PHLA 4YFWA 4AVCA 1UZVA 4LOTA 3N9PA 4YM0A 2ZKNA 1VLNA 3M3QA 4FPLA 3ZFFB 5FP4A 4BIOA 1C1FA 3TEWA 3NNJA 3D4KA 4DZGA 2WZR2 4YW7A 1IS3A 3AM2A 5GLWA 4A41A 1CX4A 1DBNA 1WCKA 5DZFA 2YC0A 4KH9A 4UF0B 3MIFA 5H9RA 4D6RA 2XR4A 4MGKE 5JIAA 4HN1A 2CY6A 4OMDA 1XPWA 3NRUA 1RUC3 1NOVA 4D7TA 4DQAA 3RZKA 4OHYA 3NNLA 1VB2A 1SFYA 3ZXAC 4I2OA 2WZR3 2YG0A 5CFCB 3MW3A 4NHYA 3LFMA 2UURA 1VBD2 1ENXA 3DPRC 2W68A 2I74A 2RJ2A 5KC5A 4R9AA 5KXCA 3B69A 4R8HA 3WNNA 1RHI3 1UY4A 3TN93 4AEMA 4B7KA 4NIGA 3PIGA 1RUC2 4GB31 4WVMB 3IIIA 4IEXA 4RN5A 3WDWA 3POFA 2BGCA 3EJKA 4MGSA 2H6CA 2WN2A 1VBB2 4A3XA 4YZ5A 1C8M2 1POV1 2FBEA 4ZY9A 2D6MA 2ZBJA 5LA1A 2K46A 1EUTA 5F3EA 5FRAA 1AR63 5ISLA 1W8ZA 2MPFA 2WS91 4GIQA 2HEVF 4GXLA 1OLMA 1PM4A 3TN92 4CDWB 1ZA7A 4E2SA 3VBOB 1QOSA 5FJKA 4XF1A 1MS3A 3G7DA 1W6NB 4KNCA 5F2WA 4JGZC 4CDQA 3LDRA 2XJRA 2P3IA 1VBB3 5FV3A 1ND3B 1V6JA 2YUEA 3USSA 3URFA 4HPKB 5EJZB 1F5JA 2FDIA 2OYZA 1AR62 3AKSA 1IGOA 1WA4A 5HV0A 1UCXA 4HVOA 4URTA 1NCQC 2KA3A 3PURA 5IVJA 5JSPA 4CCKA 3WUCA 1Q8OA 2XLGA 5A33A 5GZGA 4NHLA 1ODMA 3LEIA 1W9YA 3UKVA 4EQVA 3MEPA 2DU0A 5FZ8A 5KR7A 3NNGA 2GU9A 3RYRA 5LCWL 2NYYA 4V2VA 1NY72 4AEDB 2PA7A 1TZOA 1U5IA 3RWNA 1OT5A 1QJU1 5B4XA 2WO7A 1UZWA 2WJSA 3I3QA 2VMHA 1SCSA 2HWC3 2RJKA 1PNGA 3EHKA 2DUPA 4NPMA 2VOXA 4QPYA 4C91A 3B93A 5L9VA 3K51A 5FCCA 1EYBA 3M3IA 4MYEA 2RVAA 4YPJA 2ZMNA 1W6NA 3ASIA 3M8LA 4X8NA 2VMDA 5DAWA 5C9AB 3MLKA 3BI3A 1QMJA 2EF6A 4U2AA 4UXAA 3MIBA 1ZZ7A 4WZCA 1MR5A 2Y8KA 4JGYB 2J1AA 5C3RA 1UIKA 2XUEA 3ROUA 4YM3A 4QB6A 4FSJA 3THTA 4DXRA 2ID4A 2Y33A 4MV2A 4JGZA 2K0GA 1ZZ8A 1RUF1 4K20A 5GLVA 3OCPA 2X5IC 4JDOA 2EVXA 4OFGA 4R9BA 2VBDA 1W8WA 2XVGA 3HBZA 3T1LA 5JI7A 1VBA2 1O3TA 2XGXA 5DUXA 4LBLA 1ZRIA 2NZ9A 3FFZA 3VBSB 5DAPA 4KWKA 1AXKA 1RGSA 4E8CA 2X5IB 3WHTA 2FD8A 1SACA
chains in the Genus database with same CATH topology
1REEA 3T2TA 3KCXA 5AC93 4XJZA 2IXKA 3LZZA 4E27A 3USUA 1H4HA 1ZBA1 1VBA3 1YNAA 1TMF3 4PDWA 2ZGLA 5EYYA 5IK8A 1FXZA 3J4UH 1H30A 5EWSA 1YRZA 4Q0PA 4JGYA 1RC6A 4ORFA 3NSTA 4YGCA 2JKBA 4HN0A 3ILFA 1XXNA 3JUUA 3CLPA 4XF9A 3KSCA 3ALQA 4Y24A 4GWMA 1UN1A 1MZEA 2Z79A 4CZSA 2GALA 4QQPA 3H3UA 1KITA 5GZCA 2WZPP 1ENQA 2ILMA 4LBNA 2VOVA 2DF7A 2GNBA 4EWEA 1GLHA 2GN3A 3OF1A 2WNUB 2D93A 3B94A 1RIRA 2XG3A 2IXIA 2QUOA 1SLAA 3POSA 4QMAA 4XJAA 3GZAA 5DZGA 5A32B 2A71A 3VBUB 2DTYA 1RUI2 1H1AA 2AENA 4PDWB 3RZZA 3ZXFA 3D82A 5GJ6A 4BIFA 3BTAA 4WM8A 2ZGMA 3A0KA 4Y1VA 4CDXB 4Y20A 4AW7A 1MVQA 2PHXA 3JQWA 1DGWA 1ND3A 2B46X 3VBOA 4CDUB 3QLQA 5H9PA 5JLVA 5ABJA 3SH3A 3D6EA 5EV7A 4BHPA 2JDZA 5EJ3A 1BK1A 3H1WA 2XL7A 4HLTA 4N43B 2BBVA 3ZFEA 4OI0A 4JCKA 3E97A 1QNYA 3A0NA 3MIHA 3DPRA 2X53S 1FAYA 4HPKA 3B9IA 1HIXA 3B3QE 3ES1A 5GALA 2R062 4AHWA 3UJQA 4C0HA 5F9TA 1V70A 2QKDA 4GMP1 5CNAA 2VW1A 4P9XA 3WW4A 3INAA 5J37A 1Q5OA 4PBPA 2PLV2 3KGZA 4AI8A 4YVWA 4B4PA 5I0SA 2VECA 4YGDA 1PGW1 4LO7A 4QQLA 1N3PA 3AKPA 3BODA 2G4IA 2G9GA 2NMOA 4ES8A 2EAKA 2D43A 4P9IA 4HL0A 1XU2A 3GALA 3WV6A 4FPEA 1OSGA 2D6PA 1DG6A 4IEUA 4TWTA 2PLV3 3JB4C 3PVOA 4HVRA 4XFFA 2VVDA 3WP6A 3VKOA 3ZFEB 1DLLA 4Y1ZA 1Z0HA 2C5DA 4HKOA 1HV1A 5HXVA 2CV6A 5LRRA 4UW6A 3AKRA 1APNA 1C4RA 1J1TA 4YG0A 1OA2A 3IBMA 4C0BA 1G7YA 1GZWA 2CWMA 1IS5A 2OW4A 4LE4A 4XMAA 1TMF1 3WDTA 2WLQA 1WMDA 4XHXA 3R05A 4QGNA 4AFAA 5J48A 2CAVA 5DZEA 2RS52 2I07B 2WT2A 3IDBB 3NV3A 3RYKA 1LOCA 1NLSA 1YUDA 3VBHB 1PIV1 2CAUA 4HFSA 1TNRA 1FNYA 2KM2A 2R49A 3VKLA 1D2QA 1JXNA 1X36A 4K6BA 1QJU2 4NR1A 4NVPA 3VBOC 4W65A 1RUF3 1R091 2HWE2 1SBEA 2DVBA 2R0FA 1IHMA 3WP3A 1PO11 5H9QA 4OI1A 3WG1A 2CL2A 1NXMA 4TSVA 3VZNA 2HWE3 4ISQA 4ES9A 2XJUA 2WFF1 3AFKA 2C1FA 2R041 1I6XA 2DUOA 1VAMA 4JQRA 5CADA 5AVPA 5BNOC 1N47A 4W6YA 1CJPA 4Q2FA 2AGSA 4QPIC 2ET7A 3VDDB 3NWKA 1LTEA 1GFF2 4Q4V1 2VQ0A 3RG0A 1WCSA 4KBBA 3PMEA 1H4GA 3ZYIB 1RUNA 2PLV1 4EN9B 2VGDA 1PO23 4YZ1A 1YJKA 2JG9A 3M3CA 3OY8B 4JGYC 2WT0A 1KDKA 1LESA 2IXLA 2HWD3 5I0UA 3WXPA 4KG0A 1FOD3 1AYM1 3GBFA 4K40A 1ND2A 2NQYA 3TB0A 2Z69A 1NLRA 5F6LB 2R072 2XPJA 2YGMA 4S2DA 3WDXA 1V9U2 3E5QA 1OOPA 2R6QA 2YHJA 2D6OX 3DGTA 4QX5A 1VBD1 5IT6A 3LSEA 1DHKB 2HWD2 5FFOC 3CJIC 1YFWA 4EROA 1PO21 4FOVA 4PIXA 1RUG2 1LCLA 3ST7A 1R1A2 3WT3A 2ZGPA 4IERA 4AQTA 2ZMKA 1YFUA 4AQ2A 4Q4V3 4YVSB 1BMV1 3MW2A 4I01A 3S6PA 4M0HA 2LALA 3G6JB 2A70A 1Z7S3 1QJY1 2VULA 1RUG3 3CL1A 4M0NA 1R1A3 4DNYA 3VZJA 1OFNA 2BFUS 4HMZA 4QU2A 4Q4V2 1RJ7A 4Y5Z0 4KU8A 1EV11 3NL1A 2CGNA 4B29A 1Z7S2 3SISA 4CTEA 1MQTB 4WM8C 5FPZA 3IT8A 5FLHA 4JTOA 4AFBA 4YZ2A 2WA4A 3ZN6A 2PHRA 3OTFA 4N53B 2JD4A 2RMU2 3KM5A 3PVEA 2GMEA 3N7KA 2YZ4A 1VBC1 4O9GA 5FPXA 1T6GC 1WD3A 2WNUC 1MQTC 1R093 4WM8B 4XFGA 2PHDA 4LHNA 2E7TA 5FBZA 2UU8A 1LR5A 2ZACA 1EAH3 4D7YA 1POV0 4QGMA 3VBUC 2EALA 2RS31 3DV8A 4JRLA 4RQPC 1A3KA 2V5YA 2RMU3 4D3WA 3H0OA 4XEZA 1W6OA 3MF6A 3WLUA 4RD7A 5C4WC 1R092 4LULA 1U0AA 1R1ZA 3VUOA 4LA3A 4DINB 2XH6A 4CYDA 2R043 1AR82 2VVFA 1YYNA 4QXKA 2JJ6A 1LOEA 2BFUL 1MS1A 4RL7A 3KZ4C 1N1VA 1TME3 3M1HA 2BPA2 2QZ3A 3ZN6B 4QQ2A 1RMU1 5GZDA 4JTNA 1AR83 2ZAHA 4LBQD 3WNXA 2ZX3A 1G9DA 3VBFB 3FWEA 1LGCA 4UBHA 1WMEA 2TEPA 2P3JA 3NVCA 4UW3A 4OUMA 4M3CE 5GLUA 3CJIA 4E4DX 5FDBA 3TOJA 1GBGA 3LOIA 1CN1A 5E16A 2H6BA 2UWAA 2LTNA 1AR81 2DTWA 2XKPA 1OHFA 5BNNB 2MNGA 4ATEA 3VHNA 1FI2A 1I1EA 3WG2A 3R0RA 4WVVA 1QJX3 4AK3A 3VBUA 5IUQA 4AVSA 1VP6A 2RS32 2XJVA 1HXS2 4BZ4A 4Y20B 1QJY3 1TQ5A 5K7PA 5F1RA 4RHV2 4CDWC 1S0IA 2ETEA 4FBFA 2X29A 1DQ4A 2Q0AA 2FZ1A 5T5JA 4JGZB 1JTZX 3FLRA 3THPA 1C5IA 4JVAA 1KQRA 1GZWB 5GKAC 1O3QA 4XQWA 4GH4B 5GLTA 4IEVA 1MZ6A 1YWKA 3WW2A 1AJKA 4Y26A 4C90A 5C9AA 1PGSA 1ZBE2 2ZGRA 2CWSA 2JENA 2R061 2XKOA 1S0JA 3IDEA 3NV2A 1ZA4A 5J98B 1LOGA 1FNZA 1KS5A 1W2UA 4LTAA 3RQ0A 2A6YA 4LBQB 4EWDA 1AYM3 4P9WA 4XQDA 4FPFA 4Y1UA 5BXXA 1KD7A 4BM8A 2O0OA 2F4PA 4CP1A 1LECA 3T1MA 5L7OB 2RM23 3QD6A 1ZBE3 2VNGA 4K7JA 2AR6A 5IK5A 1DGRA 4YNIA 2ZGTA 4LO4B 5KBFA 2QQPA 3SHRA 1ZVFA 1AYM2 3LB9A 1V6KA 4HETA 1ZYBA 3KLSA 1YFYA 5HCBA 4BQ1A 1VJ2A 3NAPB 4Y1YA 1GICA 5J3UA 1AZDA 5E89A 1DYKA 4BMEA 4CDWA 4GKYA 4LE3A 4X8PA 1PZ8A 3MYXA 3CEWA 1QH6A 2ATFA 3OYWA 2B7YA 1Y7BA 2YGLA 5DG1A 1LGBA 3ETQA 4YM2A 5L36A 3ZFGB 1XNKA 3MFAA 3H3ZA 1RHI2 1F2NA 5HCAA 2WNVC 1CR7A 3JU9A 1G8WA 3BU7A 3ZXGA 2MEV1 2GNMA 1IS4A 3UKTA 3SITA 3LSDA 5I0RA 5EZWA 3VBSC 5E8AA 1TNFA 2PHWA 3GBGA 1G6NA 5JWPA 2Y0OA 2QZ2A 4PLNA 5KHIA 1KJLA 4WZFA 4RQPA 1NCRA 3VHPA 3U07A 5LK7B 1Q8SA 3RMXA 5HCFA 3UL2A 1CIWA 1QOOA 1KFUL 2GMPA 4MUVA 5D8AC 4Y4YA 3WP5A 3CO2A 4WM7A 3MPBA 3VZLA 4NOTA 2OUHA 4H55A 3ZX7A 3NW4A 5T3NA 1TEIA 3ATGA 1HDKA 2FHRA 5F5QA 3I7DA 1DIWA 1DYPA 1PMIA 2CTVA 1VBA1 3ZFGA 1DQ5A 1CJDA 2ZHKA 4J1WA 4KG8A 5FOBB 2NPIA 4JV4A 2ZAAA 2JG8A 5FQ0B 2RS51 1BZWA 2YROA 4MGIE 2RJLA 1V6NA 1N3OA 2IXJA 3RI9A 1MQTA 3QACA 3ZXEA 3KB5A 4R4ZA 1S0BA 1SLIA 3VKNA 4JAAA 4ZXKA 1NY71 1H9PA 4YVWB 4H3WA 2XLAA 2RR12 5C4WB 1BEV3 3MLLA 5DDJ2 3O0WA 4BWOA 4AEJA 4AI2A 1YJLA 4NWVA 1ZZCA 5SV8A 3AZWA 1J3RA 1UZZA 4FPOB 1SEFA 2WA3A 4XETA 1AR91 2XJPA 3GHNA 2D5FA 2AYHA 3POYA 2RR13 1EPZA 4XJWA 1BEV2 1UF2C 1HRI2 2TNFA 2MHFA 4M3CA 1KXGA 2Q1MA 3ELNA 1PGW2 3N7MA 4XTPA 3RMYA 1QXRA 1NA1A 3OJBA 3TWIA 1OLQA 4HKWA 4X6QB 1ULEA 3IN9A 3J26N 3SH4A 5AFBA 3AXEA 4QM8A 2Y26A 5AC92 4XBLA 3APBA 4NHMA 1FV3A 5KHJA 1U12A 2BNNA 1LKNA 1REFA 1ND2B 1HRI3 1UL9A 2D6NA 1XU1A 5CFDC 2ZX1A 1ZRFA 3IKWA 1VRH1 4XXPA 1MS0A 2VNOA 1RUC1 2GC2A 3JBG2 4BH9A 1NQDA 3C3VA 5JZGB 1C8M1 5A3MA 1A78A 3O0XA 3WCSA 1I9RA 1PZ9A 2OIIA 1B35B 2BWCA 2A3WA 4I09A 1COV2 3RDIA 5KXBA 4MXWA 1H2MA 4RR3B 4M3CB 1POV3 5JCTA 3FC0A 4Z82A 2YPJA 4W6XA 3HN1A 2JXAA 2D3SA 3B00A 3J9SA 4XF3A 2PHTA 5GZEA 4LR4A 4QQOA 1NG0A 1URXA 3TBDA 1ZZ9A 4FVVA 1RUI3 4FPCA 3WDUA 4IV3C 3SNMA 4HT1T 3C2UA 1NA1B 2ZOEB 4LHKA 4EN6B 3D8CA 3ECQA 2GAUA 3I59B 1CQ9A 3E5XA 3JD73 1BBT1 2ZHNA 3FMGA 4FPGA 5IK4A 2VG9A 1CAUB 5CG8A 4CDQB 1OD5A 1WCDJ 2ZTNA 3HAGA 1UPIA 3VL8A 3RRDA 2XBO3 1YIFA 2DCZA 2LUWA 2VY0A 4TYSA 2BWAA 1LHNA 3I8TA 4BPZA 2QVSB 3HWJA 4FQZA 5J09A 5AC91 4QT6A 3JD72 3MF9A 2JG8B 4GA9A 4K1YA 1RUJ1 3MIGA 2WQZC 2FMDA 4AG4A 4F3JA 1JYCA 4RS5A 1WBFA 2XBO2 1WW4A 4QGLA 2QDRA 3JQXA 1WW5A 3B7MA 4NO4A 2WC2A 5FAXA 4DS0A 3BOWA 2O8OA 3SCGA 4SLIA 2WT1A 1N1YA 2XHKA 4OHVA 1Q3EA 5L7OA 2ZGNA 3ZIWA 4B4QA 2GN7A 5A33B 1LOFA 5FQ0A 4FOYA 4AHYA 1LU2A 3M3EA 5B2GB 4Q27A 1HRV3 3VKFC 4FP2A 2EXIA 1WLDA 2DVGA 3ZXLA 1XE7A 4LT5A 4ZU5A 2GNTA 5CU1A 2GC3A 1UKRA 1XYPA 2YMZA 4HBNA 3ZYGA 2W39A 3NAPC 3ZFFA 4ATFA 4XJ8A 1PIV2 2QDNA 1HRV2 4JDNA 3LAGA 4QPIB 1TE1B 3B9CA 1MZFA 1IOAA 2DCTA 4AQSA 3WG4A 3H9AA 4XMIA 4DMIA 2DUQA 3ZN4A 3V56A 1PIV3 5C33A 3UKNA 3VBSA 2ZGOA 3H7YA 4WV8A 4LO5B 1N1SA 5CIRA 1I5ZA 3R4SA 1QQP3 4N7UA 1FPN2 3MI8A 4XOGA 4FTEA 2DCYA 5BNQA 5D8AB 4CEYA 2E7AA 2NLRA 4Q29A 4LBMA 4AQ6A 1QGLA 2UWBA 1TME1 1RTVA 4N9HA 3RS6A 1OQDA 1VAKA 2XVLA 2WIIB 3W58A 1ASJ3 2BW8A 3ZYJB 4HK8A 4HANA 2B39A 3HIFA 1WMFA 2GC0A 2CGOA 4Z92B 4S2HA 4YRDA 4NWWA 2B9UA 1QJU3 4YZ4A 4ZU4A 4GB33 5FLIA 4JC1A 3TN91 1LOFC 4FXKB 3ME2A 1PZ7A 1UPSA 5I8TA 4XBQA 1W6QB 3WX5A 4FO9A 4H7LA 1ASJ2 1I3HA 1IKQA 1N3QA 3AMMA 4AEDA 2C0ZA 1FATA 4GB32 4YW4A 1UIJA 3D0SA 1EV12 4YVWC 4WVWA 4FOQA 3IMNA 4K8FA 3POWA 2DVFA 3AKQA 3J8F2 4BLJA 3OGGA 1WLCA 1YFXA 4IL7A 2DCJA 3W59A 3CNAA 1C1LA 4AVBA 5A32A 1EV13 3VBRB 2GSYA 4XE9A 2D44A 2ZMLA 4HZFA 5LK5A 3J8F3 4IEZA 5JDBA 2HWB3 1PO22 1JOJA 1WLWA 2ZGQA 3D5OA 4I0AA 4F83A 4OLLA 2UYBA 3W9AA 3AMHA 1V9U1 4QD2A 3BALA 2ZX0A 2PN5A 1GV9A 1B09A 4TZDA 2R073 4DRVA 4N53A 2ERFA 1NYWA 1W0PA 2X5IA 3DN7A 4FPYA 3GBWA 2Q5TA 4XXAA 4DRRA 2EXHA 1F9KA 3U4XA 3SCFA 4MZUA 4JDMA 2QNKA 4RS5B 4AXOA 4ZKTB 1GANA 3VZKA 1BVVA 2P2KA 1W6PA 4OZXA 4U36A 5FREA 3H50A 4V1PA 4XFBA 1CAVB 4RSUA 5E88A 4NPRA 4YW2A 4LEJA 1DGRN 2Q1ZB 3ACLA 1YCIA 4IEYA 4YG3A 1QDCA 3ZN5A 5JIUA 4LBOA 5CA6A 1HXS1 1GKBA 1BYHA 2DCKA 3AP6A 1RUH2 4XJUA 3FX3A 4GQ7A 1HQLA 1VAVA 1V6IA 5KC6A 1QDOA 5HI0A 4COZA 3E6BA 1DDLA 4DOUA 1C5HA 4LNVA 3P3NA 4QQHA 2E63A 4FPHA 1EY2A 1RUH3 3PJQA 1PGL2 4A7ZA 1VR3A 1RVF1 2HWE1 1GNHA 4MSVA 2Z2SB 3I54A 3V0BB 2ZGKA 3WW3A 4GH4C 4PLOA 1RUD3 2I45A 4CDQC 2WINB 4Q4X2 4E9KA 5I8YA 3HT1A 1O4ZA 3AP7A 4OVEA 5K0UA 1ND3C 4IV3B 2OZ6A 4AGGA 1HX6A 2JEMA 3KT7A 1ZNPA 2GH2A 5FMOS 1CAWB 2ES3A 1QOTA 4K9SA 1RUD2 2ARBA 3FJSA 3V65A 4E2QA 4Q4X3 4G4FA 1RL3A 2RE9A 3WR0A 3AMQA 4Q4Y1 1JHNA 2E6VA 3PHMA 3NV4A 1J3PA 2FQPA 3UK9A 3QBQA 1A8MA 4D94A 4Z2WA 2JG8C 3QH6A 3LA7A 1COV1 2HJIA 4OHZA 3ZYRA 1PVC1 1RUOA 3ZSMA 1FMD1 4G3YC 3N7JA 4XFIA 3RYPA 4XTMA 4MGZE 3KCCA 2NN8A 2HWC1 3VDDC 3AP9A 1R083 5TSWA 3USUB 1X33A 5EFUA 3JBG1 2V09A 4XPVA 5IK7A 1VRH2 5C6CA 1GYKA 5JVVA 2BNOA 5HBAA 3AYDA 4TLFA 1NCQA 1Q43A 1KRIA 1M06G 1HKDA 1N1TA 2BVBA 2RMU1 3EQEA 2VPVA 1FMD3 1R082 1MZ5A 1EAH1 1REDA 1SLTA 1G9CA 5C9AC 1H8TC 4AVTA 2GNDA 5FO9B 2VW0A 3VHRA 1QJX2 4G9SB 2KXLA 2D6KA 1JN2P 4MH0E 2AH2A 2PTMA 2YXSA 4PBOA 2DU1A 3RJ2X 1PK6C 2V73A 4LUMA 2WNUA 2XL9A 2HEWF 2BUKA 1QJY2 1RUE2 4YFZA 2PFWA 2VW2A 2E9QA 1UU4A 2B42B 5EXOA 2VUAA 2YDEA 3AKTA 3HR9A 5DDJ1 4AYUA 1R1A1 1PVC2 1WBLA 4L11A 3QCWA 4M01A 4XF0A 4ITCA 4C1XA 3PVNA 2D5HA 1D4VB 4Q1RA 2QJVA 1KS4A 3H8UA 1V6OA 4DY3A 1UMZA 2ZGSA 1RUD1 1LEMA 3IPVA 4M00A 3ZSLA 2K9ZA 3WG3A 1OMIA 1PVC3 1GQHA 2HWF1 4UW5A 4ISRA 4YVSC 3JB8A 4IEWA 4L2NA 3V64A 2UWCA 3WOGA 2N7GA 1E57A 1H9WA 2RM22 2E53A 2DFCA 3PJYA 1D2SA 1AJOA 3AMPA 3KCYA 4Q0VA 5AFEA 4BYYA 3MDPA 1VBE3 1L3JA 1YI7A 1O91A 1ZX5A 3L2HA 2UY9A 3AJYA 3FUOA 4XJ9A 2Z5WA 4LA2A 3PMSA 2A6XA 5GM0A 5BY5A 1DGWX 4N53C 5T50A 2R0HA 2VNRA 5D1IA 2ENRA 3TRSB 2RS12 3RNSA 1Y9QA 3ZPYA 3AZYA 1VBE2 3FLTA 1NZCA 1OPOA 1VB4A 4QPGB 2ZZJA 1BJQA 1FX5A 2D7FA 4F8AA 2R16A 1B35A 4XFHA 3CU7A 4HVQA 5JOWA 5JI9A 2PHFA 1SFNA 2NM1A 1O7FA 1PO12 1AL21 3KMHA 4LBJA 4QPGC 5FO8B 1NCRB 1RJ8A 3GYDA 2JG9B 2P3KA 3AYAA 3M2MA 1D0HA 1ND2C 1Z78A 2GDFA 2OUJA 1OOPB 3KGLA 4KQ7A 5C8CC 3MGUA 1JUHA 4OULA 3VGIA 5C8WA 5CFDB 1AVBA 4B7EA 1PO13 2JG9C 1HV0A 3WVJA 4LUKA 3FUQA 2ZGUA 3PLQA 3I2DA 2HWF2 3B01A 3ZFFC 4YW1A 4XW3A 2FZ2A 3OGJA 2BQPA 4XFAA 3AFGA 3MFCA 2CNAA 2P34A 3N35A 4FT8A 5JSOA 4MGYE 2O1QA 1YI9A 2ZS6B 2PYTA 1QJZA 5ACA1 2IZWA 4RGAA 2NMNA 2ZHMA 4YG6A 3EO6A 3FLPA 1F5FA 4YW3A 5EYXA 2X8KA 3DPRB 1B35C 5T5PA 4YZ3A 1AF9A 3TNQA 1RUE1 1RITA 5AVAA 4IV1B 1S0EA 2R071 4YGEA 5GLZA 5FOJB 1AX2A 1CAXB 2D97A 1LJ7A 5BYNA 5BNNC 2TUNA 3CJXA 4FP3A 4QHBA 4YLZA 4N90A 1AHSA 4BLIA 3ILRA 4EN7B 4RA0A 1DZRA 3L2YA 2A6ZA 4AFCA 3J8F1 1R081 5DDJ3 4WVMA 1ASJ1 5T52A 2AZ5A 5DUUA 3WY6A 1QJX1 4L99A 2VMGA 1HQWA 1AR93 4IEPA 4KL1A 4OI2A 5I0TA 4LBKA 4WM7B 1G86A 4BE3A 1QQP1 2WFF2 3CF6E 2WFPA 4IV3A 2R30A 1SDWA 4MX3A 4LBQA 1VBB1 1DFQA 4Q4Y3 4EWAA 4FOWA 4Q26A 1OQ1A 2H0VA 4WM7C 3NKGA 4CP0A 5KWRA 3VBHC 4B8EA 4YYOA 3UJOA 4QPIA 4Z1VA 1OLRA 1IPJA 4KGQA 1BQPA 1DGLA 4GMP3 4R9DA 3FHIB 3AMNA 1J58A 2W08A 3SLIA 5ACA2 3Q9OA 4CEWC 2I2SA 1LEDA 3EBRA 4FPJA 3MZHA 3OBRA 4ASMB 5L73A 3JBG3 2BVVA 3MIEA 4R4XA 1DQ0A 2F6BA 3S0MA 4SBVA 4AGVA 3ILNA 2HEYF 2A7AA 4CEWB 1SMVA 5KXDA 4Y22B 2WZR1 1XE8A 3MW4A 3ZXDA 3LGRA 1RVF3 1LODA 1AR72 3GF6A 5JPNB 5BNPB 5KHKA 1COV3 3JCIA 4XFCA 5CB7A 1G9BA 2PHUA 1KJRA 4IXLA 1V6MA 1AL23 1RMU2 5ABJC 1DZQA 1GSLA 1DU3D 4COWA 2VQAA 1A6CA 3TNPB 1MEC2 1XRUA 5BNNA 2IXHA 3BIWE 1LHOA 1CPMA 1RINA 1C3HA 2A75A 2IFRA 1UAIA 2EXKA 1ULDA 5CVRA 3NJZA 2MEV3 4I02A 2UYAA 1DF0A 4NN0A 1AL22 4R52A 3ZFGC 3ZMOA 2ZX4A 4Q8LA 2WKKA 2VOKA 1PGL1 4M3CF 1H8VA 3BB6A 2WQ4A 4GMP0 1QNWA 4COYA 4H7MA 2WLPA 2MEV2 2RHPA 2OZJA 4KWLA 4COUA 4AI0A 4KU7A 1AXYA 4HSJA 4K21A 3U0ZA 2K2SA 2PAKA 1X7NA 1BVP1 4FAHA 4Z8BA 4P9LA 5CAZA 1NE4A 1W6OB 3BCWA 1GZCA 1O3SA 1MEC1 1PNFA 3P3PA 1QY4A 3WINE 4HSLA 2OA2A 3M70A 3WP4A 2PQQA 2Q4SA 2XB6C 3WDVA 2JE7A 5T5OA 4AFDA 1OQEA 5E1RA 2O8QA 2DWRA 1LHVA 2IFWA 2XJTA 4L9BA 1U5YA 1J3QA 1VBD3 4J6GA 3ZSJA 4CDXC 1O4TA 1A8DA 2VMIA 2EXJA 5C4WA 3DUIA 4GALA 2D3PA 1Q56A 1EPWA 1EP0A 4UBGA 2CGPA 1C8M3 1LHUA 2R1BA 1OFSA 1ZRRA 2YYOA 4N43C 3SH5A 4PDWC 2DVDA 3AK0A 5K8SA 1FT9A 4DY5A 3S7EA 1X82A 4H14A 4QPGA 4E4SA 4P9GA 1IZ3A 1RUI1 5GZFA 1YO8A 4WVZA 2A3YA 1QXJA 2IXCA 4PQ9A 1BCXA 4CDUC 3SMHA 5A3LA 1LB2A 2BYVE 3OYWB 3IIAA 2E51A 3ZXKA 4OUSA 3QOPA 4FQ4A 3B5LB 1OI6A 1QXPA 2PAMA 4IQPA 3KQRA 1NCRC 2R32A 4NHKA 3AX4A 3QH7A 2VOWA 1QQP2 4FTBA 1FPN3 1H8TA 1ENRA 1S1AA 1CAWA 3N36A 2D40A 5J96B 1LULA 4XILA 2VVEA 1UKGA 1WD4A 3LOBA 4PF5A 1H2KA 1W6MA 4AVAA 3H7JA 1JBCA 3IDCB 1UU6A 1ALYA 2HWC2 1W0OA 2EA7A 1BEV1 1Y43B 3GHMA 3RPQA 5BNPA 1ZZBA 3ZFEC 4MLOA 2AREA 3GZTB 5LEKA 3WUDA 1OPMA 4AI1A 3DL3A 1D4M1 1IS6A 5JMCA 2A6WA 4QM9A 1FPN1 4OHXA 4DB5A 5KHGA 2QFEA 2WSUA 3KS7A 3R4DB 5KHHA 3ZSKA 1UD1A 3DF0A 1NA1C 4XIKA 1LENA 4IEQA 3MLJA 4BOWA 2RR11 4XBNA 4DPNA 1MACA 2C9AA 4LHLA 5JSPA 3NV1A 3WW1A 4HKLA 5H9SA 1CAVA 1K5MB 4ZU7A 1KFXL 1HRV1 5SV5A 1W6MB 4EV0A 1CESA 4YM1A 2ET1A 1TMF2 4ASLA 2DFBA 3IM0A 1K5MC 1C28A 1LHWA 1MS5A 4RFT0 2HWB2 2HKXA 3O12A 3NKTA 3AXDA 3ZO0B 5FMOL 1NCQB 3VN4A 2XUMA 5JOZA 3PTYA 4LLOA 1OA4A 5FTTC 1SLCA 1GZ9A 3GZUC 4AHZA 3AYEA 4X6RB 1UZYA 5J36A 2ZA9A 2DYCA 3FZ3A 2VH9A 1JW6A 1VBE1 4OI4A 2JX9A 1Q8QA 2XBO1 1QH7A 1OKQA 4EN8B 5T55A 3S7IA 3SXWA 1Y3TA 1GNZA 2XJQA 1CPNA 1UU5A 5I91A 3M3OA 2A5ZA 1CD3G 3AJZA 3VLBB 1H2NA 2G9FA 4Y22A 3JZVA 3LA3A 2Z42A 1RUH1 1U5XA 5BNPC 3KT1A 3MICA 1WW6A 2ZJCA 1S55A 5F6KA 3U11A 1LGNA 4B4RA 2Q8OA 4KGGA 4AEDC 1RUJ2 2GMMA 2DURA 3OPZA 3ZYPA 4AVVA 2JICA 3WQ0A 1SCRA 5CBLA 4AE2A 3H1MA 4GWNA 1XNDA 3ENRA 1PVXA 2XWBB 3ZDSA 1XNBA 3O14A 1AR71 1JUIA 1BKZA 1SLBA 3M7AA 1D0GA 1UX6A 2ARXA 1RUJ3 4LLFA 2WNVB 4C1WA 1J1LA 3H1YA 4Z07A 2YY1A 2XVKA 1PK6A 1ENSA 1H8TB 1QU0A 5DUVA 3K48A 4META 1O5UA 4Q8KA 2ZPXA 1LU1A 3FFQA 3WQ7A 5JAXA 4BMBA 2R063 4BA6A 4FCAA 3KD4A 1YXWA 5JOYA 1F31A 4AF9A 3KT4A 5T54A 1MVEA 2A3XA 1X8EA 2LM3A 1DQ2A 4DFSA 1MS9A 2QE3A 4YARA 2Y38A 4P5HA 5T5LA 3VL9A 2R1DA 4Y1XA 3CJIB 2Q30A 1FYUA 3X29B 4S2GA 4XDQA 1D4M2 3U10A 3AZVA 4CDUA 3AP5A 1KDMA 3NAPA 4IETA 1XNCA 1SBFA 1H2LA 5DXDA 2OVUA 1S2BA 4PIYA 3TAYA 3LA2A 4AFMA 4GULA 5BUVA 4N43A 5BNOA 3LCPA 4IESA 4AI3A 1D4M3 4L97A 1YHFA 1S0GA 1CVNA 3FBMA 4EN0A 4FTSA 2GC1A 2CYFA 4PIZA 3VKMA 3VBRC 3D0JA 1YIPA 4N7IA 4RQPB 4WBBA 3EXUA 4XQ4A 1G9FA 5K9YA 4MXWB 4RR3A