4DNYA

Crystal structure of enterohemorrhagic e. coli stce(132-251)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
109
structure length
109
Chain Sequence
GIDFTPHNGTKKIINTVAEVNKLSDASGSSIHSHLTNNALVEIHTANGRWVRDIYLPQGPDLEGKMVRFVSSAGYSSTVFYGDRKVTLSVGNTLLFKYVNGQWFRSGEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Metalloprotease stcE
publication title Structural Insight into the Bacterial Mucinase StcE Essential to Adhesion and Immune Evasion during Enterohemorrhagic E. coli Infection.
pubmed doi rcsb
source organism Escherichia coli
total genus 31
structure length 109
sequence length 109
ec nomenclature ec 3.4.24.-:
pdb deposition date 2012-02-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1230 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4dnyA00
4DNYA
chains in the Genus database with same CATH superfamily
4Y33A 4B8EA 1V6IA 3RQ0A 3T30A 2WNVC 3OUHA 1CJDA 2HBUA 1AZDA 4QGNA 3WD5A 2BNOA 1QEXA 3GBGA 3VBUA 2BWAA 3WF2A 3BPZA 1RUI2 3AMHA 2NM1A 4AHZA 2D44A 1BVP1 1CN1A 3WLUA 2JXAA 1I6XA 2YU1A 1RUJ2 4LBMA 3U0ZA 1RUF3 3WUCA 1QGLA 5DMYA 2R071 4ZZ5A 5A3NA 5JSRA 3UK9A 1OMIA 4I30A 3NAPA 3QBQA 1KJLA 4AXOA 1NX9A 3C2UA 3MIDA 2J22A 2EAAA 2GALA 3LIHA 4YZ2A 5FY5A 4RHV2 4LBKA 1TZOA 1BQPA 4A4AA 1IPJA 1WLWA 2R6QA 2Z69A 3I7DA 3MW4A 4I0AA 4N53C 4UF0A 3ZPOA 1I1EA 2QNKA 4QPWA 1YIFA 3RZKA 1W99A 1IQAA 5FO7B 3LIGA 5CG8A 4CDQA 5GLVA 2N7GA 2EAKA 3LFMA 1FT9A 4Y22B 1BXHA 4RHV3 1EYBA 2R072 5J37A 2E7QA 1AL23 2PA7A 4LO7A 3BN6A 1LHUA 5F7UA 2XJVA 4LR4A 1UN1A 3CJIA 5FZ0A 3WT3A 2ZGSA 5D1IA 1UY0A 2ZZQA 1IS5A 2DF7A 5A7WA 1UX7A 1XNCA 1ZYBA 2CGPA 4XMIA 2R073 2I07B 3C7FA 1H1IA 1N3PA 1QJX1 3PDQA 5DUVA 1HQWA 2Y6HA 4CA9A 4DIQA 2OT7A 5JI9A 5L9BA 4XBLA 2FDKA 1EUUA 2FQPA 1UZ0A 4P14A 1JN2P 2DFCA 5KXBA 2HWC1 4ZXKA 1Y9GA 5BNQA 3Q8FA 4JRLA 2ORXA 3VBUB 1X7NA 3BTXA 1WKYA 3RGBA 4XFGA 4Y4RA 4FBFA 4OHZA 2G1MA 4CCDA 5IVVA 1GP4A 2D6NA 2VMCA 2Y6FA 4AG4A 1QJX2 3OBAA 1NCQA 4LHLA 3FHQA 3OPZA 4IDZA 4LA2A 5H9QA 5J1XA 1IOAA 4YVSC 4Y1XA 1YFXA 1GQPA 3NAPB 1DDLA 1F15A 3T2QA 1O5LA 5T55A 5HV4A 4OZOA 1W0OA 3N9OA 5K4LA 5A1FA 1HXS1 3GDBA 1W8FA 4ISQA 1JMUB 4MXVA 1FOD1 2C0ZA 2GNMA 3ZR6A 3T09A 1NA1A 2EICA 3ROUA 4UF0B 3JUUA 1HV0A 4L9BA 1QJX3 4AVAA 5IFPA 3WP5A 5FPUA 3KV5A 4CDQB 1DGRA 1AR81 1QWRA 4XXAA 2CWMA 4E2QA 1LJ7A 4LLOA 4Z8BA 2PLV2 5A7PA 4Z92B 2XR4A 4JQTA 4GQ7A 4BYYA 2HWC3 2VZRA 5A6YA 4DY5A 1GZCA 1H2LA 3PUHA 4DOUA 4AI8A 3CJIB 1HXS2 1S55A 2FCUA 3CL1A 2V5DA 3GXUA 4NVPA 3AKQA 5ERLA 5A7WB 4NIHA 4YWAA 3W20A 1Y9QA 4N9IA 5DZFA 2ZGTA 1ZBE1 5FQ0A 1W2TA 3KQ4B 3FE5A 4BH9A 1SBDA 4COYA 3WDWA 5FJKA 1YJLA 1MZ6A 4H7MA 1FOD3 3Q8EA 4G4FA 1YFWA 3VKFC 3K3OA 3WUDA 4BMBA 3BI3A 3B7MA 5C8CA 4RYDA 1F4HA 4Q8LA 1W6NB 1N1YA 3BKZA 1U12A 4XDOA 5A3MA 4Q5OA 3WQ7A 3HBKA 1AR83 2ZCWA 2VZUA 4HBNA 3LA3A 2P37A 1GICA 1O8PA 3LE0A 1ZBE2 4NHMA 2ARBA 2EXKA 4NWWA 3O1UA 4I0WB 1NCQB 3MV01 1GR3A 2WQ4A 1CIWA 5T5PA 2VJXA 4P02B 5B2GB 2A1XA 1SCSA 4GKXA 4XILA 1OBNA 4QQLA 2KM2A 3B5LB 3NJVA 4CCNA 1JHJA 3K4ZA 1BK0A 1WMFA 5KHGA 5IYYA 3FN9A 2Y6GA 4JKKA 4PF1A 4CEYC 1NA1B 4J25A 2DFBA 2VTXJ 4FXGB 3T08A 5GZCA 5KHIA 2NLRA 3KV6A 3MLKA 1NT0A 2RHPA 2WYSA 4MUVA 4XAEA 2BWCA 4UFHA 5T3NA 3UKTA 3W21A 4MO3M 4ISRA 3BTYA 1OD3A 3BOPA 1DQ5A 2W5FA 3WZ1A 2VCAA 3N7LA 1HRV1 1BBT1 4HG6B 3N9LA 4LBQA 5EIYB 5FO8B 4HPKA 2JWPA 3AP9A 4D69A 4AL9A 1KGYA 1ULEA 2YC2A 1OXCA 1QJFA 2VMGA 2WZR2 3OF1A 4A7ZA 3JB8A 1REDA 5F3EA 1AHSA 5EPAA 2GC1A 3ZFGC 1AX1A 2J1SA 3BOWA 5BNOA 3RJ2X 3I3QA 3ABZA 3GCXA 4ET7A 1H8TC 3HAGA 5GLUA 1Y43B 5IAXA 5FQ0B 2NYYA 2W92A 3J7LA 1A78A 1K3IA 5BYNA 5L7OC 2NP0A 1OD5A 1YC61 2HKXA 2KXLA 3G7DA 3UKNA 3PU8A 3BPSA 5I8SA 1FAYA 1HRV2 3DN7A 1BBT2 1JUIA 1SLAA 4O9GA 4YZ4A 4AHYA 1B35C 1LECA 2G4IA 5IAVA 5C8CB 4NRMA 1PM7A 5JSPA 4Y1VA 5FKBA 2D93A 3CNAA 4FPLA 3ILRA 3V56A 1DBNA 4CPBD 3OUIA 4P9GA 2QQPA 2QQJA 5EP9A 1MVQA 3CBNA 4IERA 1HRV3 1BBT3 2X5IA 3MLLA 1FV2A 2XUMA 4NRPA 2AZ5A 3EB7A 4KL1A 2VTFA 1E57A 1L3JA 3ZIWA 5FZAA 4COUA 2VUAA 2CL2A 2HWF3 4PLOA 2DUPA 2Q1MA 1MS0A 2R041 1RUG2 3SMHA 2XL7A 4CCKA 2VO5A 4MGQA 2W95A 5ANNA 4C1WA 5T52A 1AYN1 2JIGA 1APNA 4COVA 4GJYA 1UZYA 3WCRA 1PO21 4AEDC 1IPSA 3IMMA 2HYXA 3AXEA 4BM8A 1XSRA 2RS11 4FPEA 3QH6A 5L9VA 3VHPA 5FPLA 1R1ZA 4MGYE 4LBQB 1VE0A 4XTPA 3ZXFA 3LWCA 4HPKB 5I0UA 3WQ0A 5BNNC 2F4PA 4WV8A 3WOGA 2DCYA 3AKRA 3EO6A 4JDOA 3UNPA 1UCXA 3OPWA 1QJU3 1R64A 1RVF1 5JIAA 4BB3A 3NNFA 4EV0A 5BNOB 4XF4A 1LOAA 3N4MA 1AYN2 4XFBA 1IS6A 2VH9A 4INDA 3NKTA 2XDVA 4AFAA 2NN8A 4D7YA 1PNFA 3ACFA 3KHCA 1JYVA 3GCWA 1GWKA 2RS12 3GJAA 4FFFA 3VBHA 2QQNA 2XB6C 4EROA 4P5YA 4A41A 3U07A 2R043 1O8SA 2VULA 5C4WC 2I74A 1H8VA 2D7FA 3PURA 4FP2A 5A6ZA 5BUVA 3ZR5A 3PUIA 4AHXA 5JZGC 1AYN3 3MIFA 2VZSA 5LA0A 3VGIA 1UPSA 5FLJA 4JV4A 1PO23 2VMEA 2W3JA 4HKOA 4IGQA 4S2DA 1PMIA 4IV1A 2RS13 3IDEA 2OZ6A 2DURA 3POSA 5FP9A 3T1LA 2X5IB 2ZMNA 1DQ4A 1OUXA 4D6SA 3KB5A 4BXSV 4DRRA 2TUNA 1F31A 1V6NA 3BCWA 1K5MA 2WA4A 4MHUA 1RVF3 1JOPA 3FLPA 1UU5A 1AJOA 3ZDSA 4BLJA 1HIXA 1OH3A 3NV3A 1NLSA 4J6GA 3VUOA 3MYXA 5EJ1B 4MZUA 3H3UA 2VBBA 4Z07A 2ZX2A 3HIFA 3R05A 1OPMA 4CUAA 3NWKA 2ZKNA 5JAXA 4XEZA 1WCUA 3QD6A 2EALA 1LGCA 2YMZA 1JOJA 1EPWA 1NAEA 3U14A 4RQPC 2B8MA 4IE5A 1RB8G 1VMHA 4EYUA 4M0NA 4JTOA 3DECA 3RI9A 2Y0IA 3OEAA 1JTZX 3I2HA 3I59B 2RR12 4Q4W2 4B1MA 2MHFA 4XFHA 1FPN2 4OQ8A 3SC7X 1MS3A 2IC1A 3I4IA 2ZPXA 4OCTA 1VMFA 1V70A 1Q8QA 2Y33A 1ZRCA 1PHMA 2JEMA 1UQXA 2X29A 2ZGMA 3ILFA 4FOQA 5DDJ2 2RDNA 3O12A 3VBHB 5T5LA 3AYDA 1LOFC 2Q8EA 2NZ9A 1OLRA 1SCRA 4QU1A 4QWNA 2KA3A 2I45A 5FR3A 4J1XA 1NOVA 3CLPA 4CDUA 3OGJA 3ECQA 2R7EB 1S1AA 2E26A 1Q43A 4B1LA 4K8RB 2LROA 3DL3A 1R1A2 2WLQA 1AVBA 1PM4A 1LEDA 5JWPA 3POYA 3FBMA 4OMCA 4YGDA 5GALA 4K20A 2VECA 2ES3A 3AMPA 4JGZA 1HQLA 1YXWA 3NKGA 1YLLA 4LEJA 1LU2A 4MH0E 3DKQA 4QDRA 2WWUA 1U0AA 2R063 1K5MB 2VE1A 2WZPP 1WCSA 4OHXA 5EYXA 1CAVA 4XJ9A 3LOBA 1A3KA 3AFGA 4UW6A 4QXHA 2LTNA 1OSGA 3ACIA 4W50A 3O0WA 1REEA 1D4VB 1GZ9A 3UGGA 3LA2A 3MIBA 5GLWA 2JDUA 1C5IA 3AP4A 3ZO0B 5LA1A 3RZGA 2BOJA 1OI6A 4WVMA 4BXFA 5GLTA 2ZAAA 2F6BA 2V5YA 4Q2FA 4WM8A 5CZKA 4W65A 1YQ8A 4XUTA 4YARA 1NZCA 3QH7A 4N90A 1X50A 2VW2A 4AGVA 3ZSLA 4EN0A 3TNPB 4HVOA 1F9KA 1POV3 2XKPA 2BGCA 4PJYA 5IVYA 3VZNA 5J48A 3T4HB 4B3NA 4LBQD 3DYMA 1RHI2 5SV5A 2R0FA 1JW6A 3DGTA 3OPTA 3THDA 1D4M1 3ACLA 1OOPA 4BLIA 1MR5A 1F8VA 5AFEA 3WNLA 3I49A 1IQDC 2UWCA 3U11A 4RR3A 1WD4A 5JPMB 2FCTA 5LY1A 1SFPA 2OKXA 3ZMNA 2FCVA 2XWBB 1Q8VA 1YJKA 3TEYA 1W2AX 2HWB2 2JE7A 3AZXA 2WRAA 2DV9A 4CDUB 4Z2AA 4JCKA 2VGDA 4AK3A 4CEWA 1R081 3ZFEC 4AGRA 1IG3A 5IVJA 2A3YA 1LGBA 2VG9A 2WNVA 5J7MA 2CYFA 5FZ7A 2GZWA 2VBPA 5FZ6A 4TN7A 5LY2A 4EJRA 4JGZB 1D4M2 4CCCA 4JVAA 4YG3A 4I01A 3NNGA 1H0BA 4Q4Y3 2HEYF 3UT0A 4FI9A 2Q30A 2VBDA 4MOAA 4W6YA 4XXPA 4LOSA 4QQ2A 1ZZ6A 1PO11 1Y9MA 3KHBA 2XJTA 3O7OA 4M00A 4UXAA 1LOCA 3PMSA 4MGSA 3TEZA 3M3CA 1CAVB 1JYWA 5EJ3A 2HWE3 3ZSMA 1OT5A 3OEBA 1D4M3 2A3WA 4K21A 3GNEA 4LUMA 1W04A 1RUC1 4N53A 2D6OX 3WG4A 1BCXA 1AR71 5AVPA 5F1RA 3I2IA 5EWSA 1GFF2 1WW7A 4N7IA 2EXHA 3WDUA 4OMDA 1VBC1 4WVMB 2OUHA 4KU7A 4M4PA 2YC0A 2HLEA 3AMMA 4WM8B 3GZUC 3M3IA 2CDOA 1BMV1 1PZ7A 1XE7A 4OYUA 1W6QB 2DVGA 4MHRA 3OGSA 2Q8DA 4CVUA 3ZYPA 4KGGA 1R083 5I91A 2HEVF 3LEGA 4Y20A 1PO12 3LDKA 3WDYA 2NMNA 4QXKA 4YFZA 1BHGA 1E5SA 2P6HA 2QQOA 3KCCA 4XZPA 4YRDA 1G86A 4OVEA 3C7HA 4KBBA 3LSDA 5HBAA 1OOPB 3WINE 1RUC2 4HN1A 4N8MA 3B9CA 4S2GA 2ATFA 1AR72 1H2MA 1GP5A 3SCGA 2ZGOA 4RR3B 3WG2A 1ZNPA 3C8XA 1VBC2 5FZ9A 1W0NA 2IXCA 3RYRA 3WHUA 3KSCA 5A3OA 2WSVA 3P6BA 5FJHA 3T4VA 5AC92 5LW9A 1RJ8A 5E16A 1OH4A 2PQQA 3JD73 1N3QA 2Q5TA 1RUC3 5A1LA 4CDWA 3BIEA 1AR73 4OHYA 5BXXA 5DPNA 1W0PA 2E6VA 4FPJA 1QXRA 3GF6A 1IPKA 4IW3A 5DAQA 1AR91 5AFBA 1GNHA 1O3QA 1IZ3A 2WQZC 3K4DA 4QXBA 1RC6A 1X82A 5TSWA 2B7YA 2OPKA 1R092 2Q0AA 2YYOA 3AKTA 1W28A 1W2NA 4FPCA 1W03A 3WP3A 3ST7A 4YVSA 4C91A 3PLQA 1LHVA 4DO0A 1YFYA 2QZ3A 2XONA 1W8NA 3AZZA 5APAA 1CX4A 5H9SA 1JHNA 4N53B 2YUEA 4YG0A 5FBZA 3VD9A 5I0SA 5I8TA 4OI2A 1JZ3A 5F3IA 1U5XA 4AGGA 4F8AA 2XJPA 4BHPA 2FHRA 2WO7A 2CV6A 1AR92 3EJKA 1V9U1 2WABA 4AEMA 4FTBA 1VPHA 2XXZA 2XKOA 3LEKA 4OULA 3ZXDA 4Y20B 2G19A 1WCDJ 4YVWC 4P9XA 3VZKA 3WXPA 4L97A 1J3PA 5A3PA 1W2OA 2WKKA 1VAKA 4WVZA 4NIIA 3RNSA 5J09A 3U78A 4BJ0A 2WUHA 1AR93 1PZ8A 1CAXA 5CVRA 3WP6A 2PHXA 3ZXJA 5JXIA 4EZ4A 1XPWA 4NN0A 2GN3A 4CUGA 3WNXA 1JZ4A 2P17A 3OB8A 3JQXA 3POJA 1OFNA 1V9U2 1SPPA 3HT1A 3C7OA 2FMDA 3KV9A 3AJZA 5A7OA 3RZLA 2QQUA 1VIWB 2Y34A 1W9YA 1W6PA 3SXWA 1ZBA1 4IE0A 4SBVA 3KS7A 4FCAA 5HCFA 4KI5M 3F95A 1L7QA 2BU9A 4GMP1 4E4DX 3NV2A 1V9U3 4IGPA 2ZGUA 1RMU1 1ULOA 2I2SA 4Q4V1 2XQXA 1DLLA 1S0CA 4FFHA 3K3NA 4BZ4A 4CE8A 5CAZA 3AL5A 4Z82A 1TMF1 2JIJA 2WFF1 2WO2A 1HRI1 3FFZA 4MGZE 4W4ZA 3UV9A 1RGSA 1SFYA 1DU3D 4YVSB 3BU0A 2PMWB 4ORFA 5A6QA 2GP5A 3IBMA 4CDXB 3N35A 4IEPA 2VZQA 2BFUL 4CZSA 1ZBA2 2VL4A 4CEYA 2BZDA 4O65A 2YG0A 4XURA 5IVBA 3BTZA 1ZRFA 1ZREA 3H7JA 2H0BA 3BALA 4WM7C 5FYYA 1HB2A 5FO9B 4XF9A 5LASA 3LA7A 3NQHA 1KFXL 1RMU2 4LMFA 3LQCA 3O1TA 3T0DA 3KQRA 4YYOA 1YI7A 3W5MA 5B4XA 3R0RA 3WDVA 2WFF2 1HRI2 1UAIA 2BFUS 3OYWA 3NVCA 4W6WA 4DUXA 3S57A 3O1MA 2OQ7A 4D7SA 3PIGA 4YPJA 4COWA 1M06G 2ZBJA 3PVBB 1MS4A 4CCMA 1WGPA 3ZFGA 4AEJA 1C1LA 1CAXB 1RMU3 4Q4V3 5GLZA 1JZ7A 3RG0A 2B46X 3M1HA 1QNWA 1H8TA 5JR7B 3FC0A 3U4SA 1TMF3 5EZWA 4ZU4A 2WFF3 2ZJCA 1HRI3 5LK5A 4AFMA 1S0JA 4GWIA 5L7OA 2W94A 3BB6A 4A44A 4XMAA 5DG2A 1SMVA 1SPPB 4HK8A 3OCPA 4XIKA 5EV7A 3WHTA 4U36A 3MPBA 4NPLA 1WLCA 2UY9A 4EWAA 1W6PB 1G7YA 1TME1 1B35A 1DQ2A 2QVSB 5FAXA 1SLTA 2ZX3A 3GZTB 5C9AC 2JECA 1W6OA 3A0NA 1PZ9A 1TEIA 4YGCA 3M4FA 1OQDA 3OY8A 4QXCA 2H6BA 5FYTA 3I2JA 4FPGA 5IVCA 3O1SA 4E2GA 5C5UA 4B4QA 2B5HA 5IHRA 5FUPA 3SQOA 3H0OA 3LKJA 2QQMA 4MGKE 5FMCA 3RWKX 4NRQA 1QQP1 3JCIA 3VHNA 1TQ5A 2B4KA 4AVCA 2BUKA 5JI7A 4CPBA 5EJZB 4LT5A 1UX6A 1WA4A 4LKFA 2EIGA 3P3NA 1XB9A 1TME2 2VW1A 5F5QA 4CP9A 3UETA 1CJPA 3AB0A 3RYPA 4CEYB 5C6CA 4XOGA 3PUAA 3WNOA 4JKLA 3LOIA 5FMOL 3JXSA 4D6QA 2AH2A 3LGRA 5I0RA 4O9EA 2VC9A 5IK4A 4FTSA 4AEDA 3QLQA 2IXJA 2DCKA 2ZACA 5FXXA 3ZKYA 2VZ3A 1QIQA 2PHLA 1I3HA 4L99A 4AI0A 3O0VA 1TME3 4LULA 4A6OA 5BNNA 3OYWB 1QQP2 5FZMA 1HB3A 1PGW2 3H9AA 1YQ2A 4YW5A 5FMOS 4M0HA 1DYKA 2P6CA 3ZFGB 4MX3A 2MNGA 4C0BA 2WN2A 2RV9A 5FXWA 1MQTC 4ATEA 2F17A 4OUEA 3RFRA 1H8TB 3LF7A 4HK9A 1AL22 3AFKA 4H14A 1RITA 3QCWA 1IKQA 1QQP3 2BQPA 5L7OB 1UY3A 3HQUA 1HB1A 1Y3TA 1EAH1 2R0HA 1JS9A 3GGLA 4MGIE 5C4WA 2VMHA 4GB31 4BPZA 5I8YA 5LEJA 2ZGKA 3IT8A 1B35B 5JZGA 3NO8A 1VBE3 4AE2A 4R9CA 5C8CC 2ZMLA 2Y6JA 1RUD1 1ST8A 1W6OB 3QACA 3B01A 2BDRA 1JYXA 3GM8A 3OY8B 4Z1VA 4XFFA 4GJZA 4QAWA 4XCAA 5FPAA 4OUMA 5G05L 3S7EA 1PGL1 1J59A 3IIAA 3JU9A 5T5JA 4COZA 4FXKB 1GNYA 1YYNA 2BP6A 1HX6A 2FZ1A 3D0JA 2VVFA 2VUDA 4BK5A 1SHWB 2PN5A 4AOCA 1W8TA 3RRDA 4LO4B 1S4CA 3BGAA 1UPIA 4GB32 4LO8A 2V73A 3PVNA 4AI9A 4CP9B 4R52A 1ZVFA 3E6BA 4IL7A 5IK8A 2WBKA 3GJBA 1BZWA 2BNNA 1Z7S1 2YDEA 3N9PA 1AJKA 3IDCB 4UFMA 2XHNA 4UI9L 1W6NA 1XE0A 4AEDB 2Y8KA 2AEZA 2FD8A 4BIOA 1EAH3 2AEYA 2SLIA 1PGL2 1ND3C 1SLIA 4GB33 3T3YA 1JZ6A 2IXIA 1K5JA 3DPRC 1ULGA 1CQ9A 1OA4A 5BNNB 3RJRA 2PHFA 1VP6A 3FLRA 4K6BA 5FPBA 5FYIA 3AVRA 3B69A 3TEWA 1RUD3 4RQPA 3KVBA 4QMAA 2ETEA 3J7NA 1UL9A 4LIUA 4PLMA 5JXHA 4HANA 5FZBA 4EWDA 4CDXC 5L36A 2UYBA 2RS33 2VR4A 3OJBA 5KXCA 4RFT0 1GOHA 1V6LA 2WDBA 2ZGRA 3MZHA 1Z7S2 3HMYA 2HWC2 3FLTA 3PTRB 4XIOA 4YW6A 4M3CA 4N7UA 1UOBA 3CEWA 3AZWA 3THCA 3CHXA 2D97A 2JDAA 2UU8A 3OBZA 1LOFA 3NSTA 1MEC1 1AL0G 4H7LA 4LUKA 5C4WB 5DAPA 1J3QA 4ARYA 5JZGB 3B93A 3Q8BA 5JUVA 1AXKA 1Z7S3 5J3UA 2UY8A 2BTVC 2JG9C 2UWBA 3EBRA 4TXWA 3HNYM 4DXSA 3WVJA 3BODA 2W47A 1LRHA 1W9SA 2A71A 1T6BX 1SG3A 2IXHA 1FOD2 4Q0UA 3ZPYA 1ULFA 1XOYA 1LOEA 3ITQA 4EZHA 2LRPA 1DZTA 2CGNA 1ULCA 4RL7A 1US3A 2VZTA 1OA2A 5FRAA 1G9CA 1AR82 3T2PA 3DF0A 4RGGA 4UW3A 4Y5SA 3WG3A 5J36A 4XUQA 5CB7A 5IJRA 2RJKA 5FZEA 2XGXA 1NQJA 1SZBA 4FPYA 3RZJA 1YIPA 4YZ1A 1PX3A 5KBFA 3ALQA 3ZYRA 2GMMA 1MEC3 2CAUA 4QX5A 4IEWA 3MI8A 2YBPA 3RPQA 1YCIA 1UOGA 4LO5B 1YWKA 2X05A 1IGOA 2OXBA 4AW7A 2GC3A 3HN3A 4GH4C 3FHIB 3MLJA 4RQPB 3CIHA 4ZZ8A 4MG2A 5FY7A 4CU6A 3RS6A 2RS53 3OBRA 5ABJC 4GWNA 3OG2A 1JUHA 1X9PA 2ZHNA 1HDKA 4ZS3A 4QX7A 1G8WA 3W58A 4IEXA 3K4AA 4XUNA 4M3CB 4MSVA 4PDWC 5A80A 2XVKA 1V00A 3GZEA 1RUH1 4JHTA 2B42B 4GWJA 4LHSA 2WS91 1SACA 2ARAA 4LNVA 2BVBA 2ORZA 1MVEA 5E89A 5CEHA 1JYTA 3VDCA 2VPVA 1LR5A 2DCZA 3CU7A 4IE4A 3RMXA 5CKNA 2WNOA 3SH5A 3ZFEA 5A3LA 2IZWA 1VRH1 2HWF1 5DQ0A 2AR6A 4B4RA 2C6SA 1CAUA 3VN4A 1ZX5A 1LKNA 5HCBA 2RJ2A 4FFIA 5A33A 1KDMA 2E51A 4JC1A 4MXWA 5JCTA 2YPDA 3ZKUA 2XBO1 4LKSA 1RUH2 4LE3A 4J1WA 4DFSA 1CD3G 2ADDA 2C26A 2CGOA 5IFTA 2WS92 4CUCA 5IK5A 2JJ6A 2VVDA 1QNYA 2Y0OA 2GNBA 2BBAA 5FY8A 3I2GA 3HEIA 4Q4X1 5IVEA 2YGLA 3CJXA 3H7YA 5LEKA 1C5HA 2FMYA 1NCRC 2PTMA 2TNFA 4R9BA 5E1RA 4META 5FMBA 1VB4A 2HWF2 1HJGA 3HPNA 3TOJA 1QJU1 1RUH3 3BVCA 4QX1A 2ZEWA 2WS93 5AVAA 4WVWA 2XMLA 5LBEA 5JVVA 4XBQA 5CISA 2ZX0A 3KV4A 2DVFA 5F6KA 1FI2A 1ZM1A 2R30A 2XBO2 3AP7A 4FPKA 4WVVA 5F39A 1UU4A 1GQHA 2GH8A 1OLMA 1VRH3 2R16A 5FFOC 2QBXA 1S0EA 3ZYIB 4CCJA 3C7GA 3LSEA 3ZYGA 2OS2A 3CKHA 4Q4X2 1O4ZA 2QKDA 1LOGA 1OVPA 2J1UA 2RVAA 1H9WA 2R49A 3M70A 4HSLA 3ON7A 3ZXLA 2XBO3 4BQ1A 1QJU2 5DAXA 1NUKA 1XQNA 2GSYA 4LORA 2XJRA 5FOBB 1O4TA 4DY3A 1H1AA 2RE9A 3Q8CA 4LLFA 1DQ1A 2QUOA 4GMP0 2PAKA 1UD1A 4Q4X3 3LDBA 4DINB 4EN8B 2EIBA 3MICA 3SH4A 4DXTA 3GBWA 3ZFEB 4E27A 5F3GA 4ASKA 2R042 4PT6A 5BV6A 1CAUB 1XU1A 2O1QA 2VZVA 2QTWB 3I59A 5F2SA 4HVRA 1VAVA 2WSUA 2YXSA 4UFIA 1UXXX 4L92A 4XCBA 4XACA 2BEOA 4NIAA 4C1XA 4MXWB 5A33B 4NAMA 4XPVA 1HN0A 1PO22 4NAOA 4IV3C 3IDAA 4AVTA 4NHYA 4BCUA 4JKMA 1HV1A 4P08A 3HNMA 2FDJA 2YFUA 1VAMA 4I02A 3VBRB 2VOWA 5DN2A 4HL0A 5KHJA 3FWEA 1QY4A 1UMZA 3KGLA 2R1BA 2D43A 5FYCA 3UL2A 1WA6X 1V6MA 2E63A 2ZAHA 4XF3A 4LBLA 5FYBA 1LHNA 1RVF2 4R8HA 1Q3EA 1US2A 3U10A 4CYDA 2B9UA 2P34A 1DIWA 4TWTA 1QDOA 1GZTA 1PVXA 4XW3A 1MZ5A 1OQEA 5DG1A 1TG7A 1KJRA 2W1UA 3IKWA 3ACHA 3VKNA 3N7MA 1X8MA 1NLQA 1C57A 3AJYA 3EMRA 3QOPA 4YVWA 3ACGA 3WQ1A 1VB2A 1LTEA 3AMQA 2E33A 4ZU7A 3VDAA 2G9GA 4AAXA 1AUYA 4EN9B 1T6GC 4I0BA 3HR9A 3S6PA 3J8F1 4NIDA 1M4WA 1QMJA 5FZOA 2VW0A 2D98A 2QQLA 1NKGA 1BLZA 3ZM8A 4QKNA 4A6SA 4P9YA 5FP4A 3MIHA 2IXKA 1IHMA 4I2OA 1LU1A 1JI6A 1ZZ9A 4YM1A 5GKAC 4CTEA 1OUSA 2Y26A 2R061 3FX3A 3RYKA 2W52A 2R1DA 4IETA 1XRUA 1OURA 5BNPC 1KS5A 4Y1UA 4LPLA 3V65A 4XABA 2YZ4A 1PIV1 2VM9A 3VDDC 3J8F2 3K2OA 4KNCA 4A2UA 3O1PA 5M0TA 5JOWA 2VTXA 2QQIA 2CTVA 2AREA 3PVOA 1AR61 4X8NA 2PHDA 3ZSEA 2Q1FA 1AXYA 4HKLA 2Y6LA 1QXJA 1N47A 2RDRA 4RA0A 1H6XA 1KFUL 2DCJA 2WQ8A 3FJSA 3SH3A 3N9NA 1UYYA 2O14A 3PU3A 3OGVA 3HOBA 4UBHA 3ETPA 5FMDA 5FZDA 2RMU1 4LKEA 2R062 2ZX4A 2J1AA 3J8F3 4LITA 4Q0VA 3VD7A 4KWJA 3KT7A 1DLCA 1POV1 1J58A 1K12A 4WM7A 4Q8KA 1W39A 4TTGA 2DUOA 3IZOA 3ES4A 1TNFA 4PQQA 5A70A 4R4ZA 2JB4A 3NJZA 2W68A 4NE9A 3WEZA 2X8KA 3ZYJB 2YROA 4E4HA 3I97A 3VDBA 2W2IA 2D5HA 5FY9A 4BOWA 4YVWB 1C1FA 3O0XA 5HXMA 1AX0A 1H2NA 2GMEA 1PIV3 2RMU2 3OTFA 1XXNA 1CESA 2GNDA 1C8NA 1COV3 5CADA 2WA3A 4YZ5A 2ET1A 5FZOB 1AR63 3HJRA 1OKQA 5FZFA 3WW2A 4QX2A 1UW8A 4ZS2A 3UGFA 3NMBA 1SBEA 4OHVA 1NYWA 2BGOA 1ENSA 1VRBA 3N7JA 4GAZA 1DYOA 2QQKA 4QDSA 5F32A 5LBBA 2RMU3 1W6QA 2ERFA 2EA7A 3I54A 4FOYA 3CO2A 4Q4Y1 5JOXA 2VUCA 5CA6A 5E88A 5C9AA 2D40A 2OZJA 3B00A 3D82A 5SV8A 3WY6A 3PNAA 2XVGA 4CUBA 4DPNA 1WW4A 4LHKA 4DUVA 4Y5Z0 2TBVA 2HWE1 3H8RA 1UKGA 5FZCA 2NMOA 3GYDA 3M3EA 2Q4SA 4YW2A 3THTA 3RI8A 1REFA 2WO3A 3U37A 4EWEA 3A22A 1ULDA 1MPXA 3APBA 4ZPIA 5HI0A 2ZEYA 4XUPA 2ZKLA 4Q4Y2 4DNYA 2ZTNA 3DYOA 4UFKA 2WINB 4B4PA 3UJQA 2CAVA 4CU7A 1URXA 4WM7B 3BUCA 3D6EA 1K42A 1Q8OA 2JX9A 4IEYA 4IEVA 2JKXA 2HWE2 2XVLA 2QFEA 1S2BA 2ZHMA 5T50A 5JMOA 2ZX1A 4QX8A 4HT1T 3W9AA 1UYZA 2IVIB 5J98B 2A7AA 1HKDA 3ZVXA 4JDMA 2Z5WA 3B02A 2D6PA 4ATFA 2DVDA 2QZ2A 3H50A 1VBB3 2WO1A 3J9SA 3VBRC 4AQTA 3J7HA 2VXRA 3VLBB 1W9TA 3DKWA 2C24A 1MQTA 4XTMA 3TYJA 4M3CF 4DMIA 1R082 1QHDA 2GAUA 2GDFA 1H4HA 3JD71 2ID4A 1F4AA 1QH6A 1SFNA 3I3BA 4FT8A 2ARCA 4UAPA 1ENXA 1G6NA 1W3VA 4CP2A 3VBOC 3H3ZA 2UURA 3KT1A 5FUNA 1OVSA 4IEOA 4QM8A 3ZFFC 2ARXA 5C70A 3FL7A 4IXLA 5C9AB 1NXMA 3VKMA 2Y64A 4KBZA 3O1RA 3ZSKA 4N43C 5CIRA 3ETQA 5LB6A 1W8HA 1WZXA 4LTAA 1KXGA 4Y26A 1NG0A 3JD72 5DZGA 1NLRA 4QQHA 4QM9A 1UXZA 5FXZA 5F3CA 1GWLA 1HB4A 2OIIA 4FQ4A 1DQ0A 1WW6A 2W1QA 3A7QA 2JG8C 4ES8A 3DYPA 5L9RA 2AGSA 4YW1A 1BMV2 1NE4A 4Q0QA 4X6RB 2W9XA 3DCQA 5JLVA 2K0GA 4QPYA 3ES1A 3IN9A 3WCSA 4KU8A 5K7PA 4AI3A 5HV0A 5F37A 2IXLA 4F83A 2IWGB 2VY0A 2XWJB 4XFIA 1GANA 3IDBB 3O1VA 4E8DA 3PTYA 3KCXA 1ND3A 5FZ1A 1PVC1 5GM0A 1CZVA 2VQTA 1QU0A 3DPRA 1Z78A 4O61A 5E6HA 4E2SA 4NPRA 3D0SA 4PBOA 2G9FA 5FY0A 3EYPA 4DEQA 2W46A 1PK6C 1KQRA 2CU5A 3DXUA 3IM0A 3N9MA 5CFCC 1VALA 3IAQA 4CDXA 1C3HA 5KHKA 1JU4A 1MQTB 5BPXA 5KWRA 1JYNA 4JX0A 2QQWA 5KXDA 2R32A 5FWEA 4GALA 2LM3A 3KMHA 5FPVA 4BQXA 1J1LA 1XNTA 2XLFA 2DTYA 1JODA 3O5SA 4H55A 4LA3A 1DGLA 2ZHKA 4IEUA 4Q26A 4MLOA 3VKLA 2YBSA 2H0VA 2VNVA 3POGA 1BKZA 3T2OA 4KWKA 4FAHA 4DXZA 1Y4WA 3AKSA 5F5CA 4CP0A 2JG9A 4LKDA 5GZFA 1BEV1 1UIKA 2J7MA 2A6ZA 4KG0A 5A7NA 5FYMA 3S7IA 3ZN4A 3KD4A 1PVC3 3V0AA 1XJAA 4LBNA 3VBSC 4G3YC 4AVBA 5KC5A 4YGBA 3CF6E 4KGQA 3VBFC 4XFCA 3ZYBA 2UWAA 1F2NA 2Z4FA 4PBPA 3SISA 3WNKA 3UJOA 5FY4A 2WNEA 3F2ZA 4L0PA 5C8WA 4DUWA 1OC1A 5BY5A 2O0OA 3WF3A 2UYAA 4ONUA 4NHKA 3ELNA 3C3VA 1NY71 5CKQA 4ZXEA 4NJ4A 1HQNA 3E97A 2VMIA 3MEPA 2QDRA 3D4KA 3WX5A 3MW2A 4RS5C 5GJ6A 1D2SA 1AX2A 1ND3B 2A6YA 1Q56A 3OUJA 5F2WA 3DPRB 4OI4A 1ZZ7A 3RDIA 1FMD1 1L7LA 5DAWA 1RYYA 2ZHLA 1H1MA 1TE1B 2AYHA 1PMHX 1W9WA 4GH4A 4K8FA 1WD3A 4BK4A 1GOGA 4PIZA 5C71A 3WSOA 1BEV3 5B4NA 4EE2A 4QX3A 4NMIA 5ABJA 2PAEA 1NY72 1P8JA 3BTAA 3RWNA 4NWVA 4BDVB 3ZN6A 3ZOIA 1QJY1 4B7EA 1QF3A 2Z79A 4PDWA 4H2AA 2IFRA 5DUWA 4YSFA 3J7MA 5C3OA 4A7YA 1RUE1 4C8DA 1GV9A 4PI0A 4JHZA 4Q4V2 1UYXA 3ZXAC 3HBZA 4AEKA 1TMF2 4QB1A 1BK1A 2CDPA 1OF4A 3D5OA 3WF1A 5C3RA 2TEPA 2JG9B 5IVFA 3K77A 3WNNA 2CY6A 3I3EA 3KT4A 1W8ZA 2CHHA 3E5XA 3A21A 3WNPA 5HXVA 4CXWA 1MZFA 4ITCA 4K7JA 3V0AB 3WDTA 4A45A 1FMD3 3NJYA 2VMFA 2A73B 3CZJA 1ODMA 4RN5A 2Y60A 1ALYA 4JTNA 2PYTA 5K0UC 1CWPA 5LRSA 2H6CA 4XJWA 1S2KA 3ZIXA 3TN91 2BERA 1QJZA 5A6XA 4GIQA 2YPJA 2JDHA 1RIRA 2WT0A 2YB7A 4QB2A 1G9BA 4AYUA 1MS9A 1QJY3 3EQEA 1NCRA 5FWJA 3MHZA 5FKCA 1FV3A 1UF2C 2MEV1 2OYZA 5FXVA 3T0BA 1RUE3 4CP1A 1F5JA 4CXXA 2C9AA 2PFWA 4RFRB 1U5ZA 1CPMA 3B9IA 3NRUA 2W1SA 3AP5A 4UFJA 1VBA3 4GH4B 3V0BA 4ES9A 2DDUA 5HCHA 4PF5A 2E31A 3ORJA 5F8PA 2BW8A 4P9WA 4BQYA 5ABJB 3KLSA 4XFAA 4HXCA 1TNRA 3VB9A 1UMHA 1OKOA 3ZN6B 1VBE1 2HWD1 1O5UA 1W8OA 5IW0A 4FAGA 3LEIA 1Y7BA 2MEV2 4LXLA 3N9QA 2ZGNA 2JDNA 4PDWB 3K51A 1ENQA 4CSWA 3AXDA 5C3PA 1ZRIA 4ZHNA 2K9ZA 3TN93 2E7AA 3HQXA 2Y6KA 4WZFA 3MDPA 2ZZJA 2OQ6A 1RUI1 5FY1A 4CCEA 2XHKA 3S0MA 3JBG3 2IVJA 4A3ZA 1F5FA 3A23A 1ACCA 3SCFA 1SLLA 1LB2A 5HPOA 2FDIA 4FSJA 3K46A 4NROA 5FZIA 2IFWA 4HSJA 3Q8AA 2MEV3 5IWFA 5FV3A 4Y24A 4XDPA 2WC2A 5FZ4A 1NE6A 4DZGA 1VBE2 3CMGA 4CEWC 5CFDA 4WZCA 3OOXA 3ZLIA 5D21A 2DVAA 5I0DA 2VQ0A 4IV3A 3KWVA 4GD4A 1FNZA 3ZXEA 2DYCA 1POV0 2HH9A 3WW3A 4V2WA 2QE3A 4YZ3A 5DUXA 3VHRA 5L19A 3S30A 2VAUA 1KD7A 3CDZB 3HD8B 1G9DA 5DUUA 4XBNA 4C90A 2HWD3 2PHRA 3VKOA 1NCRB 2E7TA 2WZ8A 4TYSA 5FDBA 3USSA 3VHOA 2WT2A 4ASLA 1YQCA 3PHMA 4TLFA 5D8AB 4QQPA 1HJFA 5JSOA 2D3RA 2A3XA 1WWYA 2RS31 1ONAA 2FDFA 1RUI3 4NUBA 4XJUA 4XZUG 3TRSB 4AQ6A 4D94A 2C1FA 2JD9A 2FZ2A 1ENRA 2WWJA 2BBVA 1RUJ3 1DGWA 3KF5A 4Q27A 5EXOA 1H6YA 4AQ2A 3V0BB 1QDCA 1JH5A 1EAH2 1CZSA 1SLBA 4L8QA 1N1TA 3L9JT 2ZGPA 2BGPA 4HZFA 4K1ZA 4M4RA 4V1PA 4W6XA 1WW5A 3AVSA 4QPGB 1I5ZA 1RUD2 4JGYC 1QXPA 1ZZCA 2O8QA 4Q1RA 5J96B 2DWRA 5A3UA 1HW5A 2YC4A 5FOJB 3E5QA 1UKRA 2RS32 3JZVA 5FCCA 4L2NA 2YU2A 2BOIA 5H9PA 4YM0A 1ULPA 4ZU5A 1ND2C 4D7TA 2DVBA 5IK7A 3BYWA 1WMDA 4YM2A 3N36A 4UW4A 5A3TA 2E32A 3WW1A 4HVQA 4HKWA 3H42B 4HFSA 2XQRA 4HMZA 2DUQA 4XF1A 3U1XA 1XYOA 3FHAA 5BNPA 5FP7A 3UYJA 2VCMA 3TAYA 1FATA 1XNDA 1JOBA 4CRQA 5CFDB 1DGRN 3GZAA 3VDDA 3ZDVA 2ET7A 5A7QA 4CDWC 3O1OA 3IIIA 1RUNA 2ZEXA 5LBCA 2F4LA 4IV3B 4DS0A 3HT2A 2JDPA 1RXGA 3NNLA 3AYEA 3TWIA 1DHKB 1LNSA 1UZWA 3M2MA 3E5UA 4XVHA 3GALA 5C3SA 2E9QA 3ZX7A 1S0IA 2PLV1 1BVVA 2G9ZA 4PLNA 3KZ4C 4TLGA 5I0TA 2ZA9A 5FPZA 2WZEA 5E8AA 4XAAA 1ZZ8A 5T5OA 2D6KA 3EHKA 2RS51 4QPIC 5FP3A 3H1WA 4CXYA 1G9FA 2FDHA 4B29A 3POEA 4IUGA 1WCQA 3ENRA 5C5TA 3MFAA 5HCAA 3VD4A 2KD7A 1UZVA 2VOVA 4AVVA 3HQRA 4URAA 5FZKA 1UOJA 1MEC2 3S5AA 1Z0HA 2PAMA 4ARXA 3J26N 3PIJA 5LK7B 2WWSA 4PIYA 5EYYA 5H9RA 5FBJA 4A7KA 4YLZA 1IS3A 1MS5A 1NQDA 1UZZA 2WNUC 3DV8A 4G9SB 4S2HA 4A3XA 1JZ8A 3THPA 2BVVA 2GC0A 2GH2A 3WR0A 4N9HA 2RS52 2D5FA 3E6DA 3Q9OA 1ZRDA 4QDQA 4MYEA 2PELA 2DCTA 2PLV3 3R4UA 1LHOA 4BMEA 2WN3A 1RXFA 1VLNA 3MW3A 1AF9A 2PXJA 4Y3OA 1S2EA 4NHLA 1LCLA 1HXS3 5BNPB 1JYCA 5IUQA 3AYAA 1D2QA 1HLCA 5LATA 4LK6A 3VDDB 1SLCA 2EIDA 5FPXA 1CGPA 3SKJE 2VNRA 4NO4A 3TB0A 3I8TA 1DG6A 4RGAA 1A8DA 2J42A 3N7KA 4R4XA 4FVVA 2VQUA 5FLIA 3LPGA 3IMNA 4BQ3A 1GKBA 1L7RA 3AKPA 4KWLA 2ADEA 4IESA 3U75A 3NV4A 5DAVA 2WZR1 3AP6A 5CFDC 1H4GA 4W8JA 2ZABA 3IAPA 5JMCA 3FUQA 3VL8A 1CONA 1DP0A 4QKBA 1GZWA 1FYUA 1MACA 2FBEA 1XU2A 2JDKA 3NL1A 5C7GA 4F7ZA 1ZBE3 1KITA 1EP0A 4OHWA 4QHOA 1XE8A 3W5NA 1JYIA 2EIEA 2ILMA 5C33A 3AK0A 5LA9A 5F5AA 2PHUA 1YNAA 4AWDA 1DF0A 2DU0A 3VBRA 4K3UA 3ZYHA 5K8SA 1LESA 1CIYA 1J1TA 3I2FA 1SEFA 2DU1A 2CWSA 4X6QB 2BYVE 2XLGA 3EXUA 5LA2A 1VRH2 4P9JA 2Z2SB 3IB3A 4K40A 1G9AA 2P4EA 5D8AC 1IG0A 1MS1A 4LBJA 5ISLA 2P1BA 4XYXA 3SEPA 4UOJA 3VBOA 3OGGA 1OA3A 2JDZA 2XLAA 3OGRA 4OZXA 5F9TA 3ZFFA 1W3XA 2Q1ZB 2WZR3 1LULA 2WL1A 2OX0A 3H8OA 1IKPA 2LW8A 2W87A 4I3PA 1RUG1 2XL9A 4XC9A 4P9LA 1YHFA 4N43A 3S5QA 3RMYA 4QPGC 1XYPA 4FP3A 3SEEA 1QKQA 4UT5A 2V09A 2XOMA 4ZKTB 3B3QE 1UY2A 2VOKA 1LAJA 2W08A 1X33A 4LK7A 2JG8A 3K75B 2K46A 3MV11 4DQAA 1VBD1 1CVNA 5EQUA 1LHWA 4YW4A 3WF0A 3D3AA 3H1YA 3INAA 3VZJA 2P5BA 3AM2A 4YG6A 2OPWA 1QOTA 2QQVA 5LWBA 4FO9A 1XNBA 1UY4A 2L9LA 5FZ8A 1GZWB 2EF6A 2ZMKA 5FYSA 5JPNB 1OLQA 4XQDA 4I09A 4XDQA 1D7PM 5F6LB 3KGZA 3RSJA 1C8M1 1FXZA 4XJZA 4AVSA 1T2XA 3M3QA 3VBUC 5IATA 1PK6A 1VBD2 5CFCA 5DZEA 1W8UA 1RUG3 2VCCA 5ACA1 4KG8A 1OPOA 5FK7A 5LRRA 4EN7B 5CU1A 5FZHA 1JXNA 3ASIA 4BU2A 4D3WA 3X29B 1XYNA 3HNBM 1J84A 2QJVA 2VQAA 3NAPC 4FTEA 3R6SA 2WYFA 3VZLA 3P5BA 3FZ3A 4BIFA 3WNMA 3ME2A 4CCLA 3POFA 1VBD3 4ZY9A 2JB8A 5DXDA 3VBOB 4BQWA 3KM5A 1C8M2 5FTTC 4X8PA 2J1EA 2OVUA 3ZFFB 4GXLA 1POQA 3ZN5A 4ZONA 5CYYA 3MPPG 4CDQC 5ACA2 3AZYA 2VMDA 4N43B 1GBGA 2X10A 5ANQA 3I3DA 2WAOA 2ZS6B 2A6XA 1Q8SA 3I2KA 3JB4C 4OFGA 2RG4A 1C8M3 3VBSA 3P3PA 1J83A 3VBFA 2J1TA 4HOOA 4QX0A 3CJIC 2JG8B 4FQZA 2GP3A 4AHWA 1K45A 1JBCA 1UU6A 2VOTA 3M8LA 5FK8A 5ACA3 2PQSA 1I9RA 3R4SA 4B7KA 5FP8A 1LODA 1N3OA 2ZGQA 2BNMA 2ZGLA 2XJSA 4LOTA 3T0AA 4QKFA 4AF9A 1PGSA 5KC6A 2Z42A 1EPZA 1UMIA 3ATGA 1W90A 2RR11 3PJQA 4Q4W1 4RS5A 2JDMA 3SKVA 1A34A 1Q8PA 1FPN1 1EUTA 1ZA4A 1WMXA 1YQ6A 5D2AA 2HYKA 1COV1 4KWUA 5DDJ1 3V64A 1UWWA 1DYPA 1PK6B 4QKDA 5CFCB 4XJ8A 2CNAA 4TZDA 1DQ6A 1A6CA 4HETA 3VL9A 3LDRA 5JOZA 3OBTA 2VD7A 1NCQC 1XSQA 4D8MA 2XPJA 4YW7A 1S0DA 4AFBA 4CCOA 1SDWA 4LQRA 1R1A1 1XNKA 4KH9A 1QH7A 1GLHA 4Y4YA 1PIV2 2WAAA 1KRIA 1NA1C 2HJIA 4JQRA 4KMQA 1COV2 3MF6A 1I5PA 1RL3A 4Q0PA 1C4RA 1MZEA 2OUJA 2YFZA 1AR62 2J1RA 4OLLA 2Y38A 1PMJX 4IE7A 4LJHA 3MO4A 3O14A 2JKBA 2EXIA 1OFSA 2RR13 3DXTA 2J1VA 1S0GA 1YUDA 1MS8A 4Q4W3 3WW4A 1W06A 1FPN3 3MF9A 3VBSB 3MGUA 4U2AA 3UESA 3VBFB 1NXD1 5JR2A 1STMA 4YM3A 4IV1B 2C9KA 5DDJ3 5K0UA 1X9TA 1YO8A 1V6JA 4XUOA 1LGNA 1Q5OA 1UOFA 2C4XA 4UYBA 1PNGA 4LIVA 1H30A 1AYM1 3FFQA 3ILNA 5FYVA 5FZLA 2Q8CA 3KF3A 5CNAA 4L11A 3L2HA 4NPMA 2RDSA 1JZ2A 4XQ4A 3AC0A 5G04L 4GWMA 1X8EA 3MUZ1 1R1A3 3POWA 4M3CE 1GSLA 4FOVA 1WLTA 3GBFA 1WMEA 1VBB1 4LBOA 3ZYFA 5KR7A 1XNAA 4RS5B 1O4YA 2ENRA 3DEMA 4MV2A 1LOBA 1OHFA 1RHI1 2XJUA 4YW3A 5FIXA 1PX4A 4AR2A 1V6KA 2BV4A 4IQPA 2DBIA 3N3HA 3M3OA 3LFIA 2K2SA 2HBTA 2W91A 1YQ5A 3BIWE 2MPFA 1NZIA 1DZRA 1FX5A 1AYM2 2VZOA 2VZPA 4QU2A 2HWB1 1DZQA 1JU3A 4XHXA 1O7FA 2VOXA 2YBKA 4PHZA 4K9SA 4MVTA 3GHMA 2WT1A 4FPFA 1JZ5A 4LE4A 3I2DA 3K48A 5GZEA 1VBB2 3PMEA 1WBFA 1O91A 2YY1A 3I2OA 2W39A 1B09A 4DEVA 5L73A 1GNZA 1AYM3 4XE9A 4XHBA 3VZMA 3LAGA 2D6MA 4RSUA 1E5RA 4IE6A 4CU8A 3PVEA 3L2YA 1GMMA 1O6UA 4P5HA 5FZGA 1WLDA 3E1F1 1VJ2A 2WR9A 2JE9A 3H8XA 1DFQA 5FYZA 2A6VA 1RHI3 4EQVA 5FYHA 1GP6A 2GU9A 4RD7A 4GZ9A 5JDBA 2P3YA 4Y1YA 5K0UB 5BNOC 2JD4A 2KR2A 3NJXA 1W9FA 2AC1A 3PJYA 2RDQA 4AZZA 4EN6B 3JQWA 2JE8A 2PHWA 2A70A 4OI1A 4PI2A 1N1SA 2HWB3 4BISA 4UBGA 3FUOA 2NQYA 2X09A 1V6OA 5DABA 3PUQA 1XC6A 4P00B 4AI1A 2HEWF 4URTA 3IPVA 2A75A 2WLPA 2YV8A 1KS4A 2IUWA 2GN7A 2YHJA 3D8CA 5JXGA 5K9YA 1W05A 3AYCA 2FDGA 3ZXGA 4UWDA 1GYKA 1EY2A 2GC2A 3MIEA 1BYHA 4FOWA 1OQ1A 4PQ9A 4V2VA 2D3SA 4WBBA 1SDDB 2JENA 4E4ZA 4PIXA 2X5IC 3KCYA 2YGMA 2V4VA 5LCWL 2WIIB 4F3JA 1GQGA 5AC91 1CR7A 1YFUA 4XETA 3M7AA 2ZEZA 3H8UA 2B9VA 4JAAA 4QT6A 3AZVA 4JGYA 1W2UA 4O7XA 4E8CA 3NNJA 2JICA 4Y5TA 5CKMA 4E9KA 3WP4A 3VD3A 4LHNA 1N1VA 3TNQA 1WBLA 4NR1A 1UIJA 2ZOEB 4QHBA 2B39A 1LENA 1A8MA 1ND2A 1R091 1ODNA 3SNMA 4AFDA 5C3QA 1PO13 3POBA 3G6JB 2AUYA 2ZXQA 2DBNA 4IEZA 3J4UH 4OQ9A 5A7SA 2XUEA 3LZZA 4GULA 5KXEA 4AAPA 3LEMA 4HN0A 4BE3A 3BU7A 1ASJ1 4CEWB 3RZHA 2RM21 4YGEA 4Z2WA 3AMNA 4P9IA 3VD5A 4PCRA 1CAWA 2WNVB 4AQSA 1GUIA 1VBC3 4D0QA 3URFA 4YNIA 1OLME 4Q29A 1PVC2 1YEWA 2VUJA 4QGMA 4SLIA 4DB5A 1GOFA 5AC93 2A6WA 4C0HA 5LBFA 1C28A 1UYPA 5FLHA 4QD2A 4K1YA 3VBHC 5IT6A 2V4AA 1X36A 1E5IA 4S2FA 3IPVB 1H9PA 4QPIA 3USUA 3PUSA 3RVHA 2RJLA 5F5IA 1ASJ2 2E53A 3MFCA 2RM22 2BJSA 5FZ3A 1RTVA 4UFLA 1R093 1QOOA 1QOSA 3MBWA 4IV1C 4BQ2A 3WQBA 1VMJA 2AACA 4E4SA 3SHRA 4IEQA 4DXRA 2GMPA 5FUIA 1UNBA 4ASMB 2VNGA 1AXZA 1DCSA 2P3KA 1ASJ3 2W1WA 2RM23 1K5MC 2WNUA 3LB9A 3PL0A 1SBFA 4JGYB 4I3GA 5JXJA 1BEV2 3OD4A 4QB6A 3WDXA 3E6CC 4MADA 4UW5A 5JIUA 2X53S 2O8OA 1HN1A 2Q8OA 2QCSB 5T54A 1OF3A 3H3LA 2OA2A 5GZGA 3MUY1 1U5IA 3MIGA 1ND2B 4XF0A 2AENA 1WUVA 1D0HA 1H2KA 3OD0A 4BQ4A 3POIA 3CZUA 1YI9A 1TVGA 4JDNA 4D6RA 5A32A 3UGHA 1RUOA 3TBDA 2VCBA 3A0KA 1ZA7A 4FFGA 3U4XA 5LZ6A 4H3WA 3AX4A 3KVAA 2C5DA 2VU9A 3ZSJA 2LUWA 4HONA 4QGLA 4CDWB 1XBFA 4KQ7A 3SLIA 4AFCA 5CBLA 3TEXA 1CAWB 2XG3A 1CPNA 2CSGA 1S0BA 3FMGA 1EV11 5FYUA 3W59A 3T2TA 3H1MA 4GKYA 2EXJA 1U5YA 1FMD2 3P1IA 5GZDA 5CG9A 1E5HA 1VBA1 2XJQA 1ZZBA 1W8WA 1D0GA 3HN1A 2EVXA 3T1MA 3NV1A 4OUSA 4MGTA 4NHXA 4QPIB 3USUB 1CZTA 2VVEA 1UY1A 4GA9A 1SQ4A 2DTWA 4JZRA 4CDUC 1W6MA 3LPFA 3RZMA 3UKVA 1QJY2 2WFPA 3IWZA 1QJEA 3CQOA 4IGOA 4M01A 1EV12 1RUE2 2LS6A 4LO6B 2PHTA 3DUIA 4JGZC 4QQOA 2LALA 3JBG1 1ZBA3 2A5ZA 2JDYA 3SCHA 1VBA2 3C7EA 2BPA2 4DRVA 2WNUB 1YRZA 3LCPA 4GMP3 5I93A 3ZMOA 4A42A 2SBAA 1EV13 4XQWA 5D8AA 3LD8A 1O3TA 3I3MA 4Q0SA 2P2KA 1DGWX 3NW4A 4YFWA 4CU9A 4OI0A 3HVDA 4R9DA 2P3IA 1VR3A 1V0AA 5A32B 3OSDA 4JRAA 1CX1A 2D6LX 5FREA 3TN92 4NIGA 4Q1PA 4WM8C 1BJQA 2GNTA 3VZOA 4BQ5A 1RINA 2P3JA 3FBYA 3JBG2 4FPHA 1O3SA 1WCKA 4Y22A 2XH6A 5A3WA 4QPGA 1RUF1 3AL6A 3NNMA 1F35A 3A4UA 4XJAA 3SITA 3GHNA 3R4DB 2BRTA 1FNYA 2NPIA 2B45X 2V72A 1ZRRA 4TSVA 3WG1A 1J3RA 4BA6A 3WV6A 5JOYA 2QDNA 5EHDA 3VV1A 3B94A 5KHHA 4HLTA 2VXJA 2VZ1A 4FPOB 1OOPC 4Y1ZA 3WF4A 1UO9A 5EFUA 1RUJ1 4RR3C 3RZZA 1IS4A 1LEMA 4BWOA 2W0XA 2VNOA 1PGW1 1O59A 1GWMA 3HWJA 4R9AA 1KEXA 4QHZA 2OW4A 1GU3A 2D3PA 2WJSA 1S0FA 1KDKA 1O3RA 1W6MB 1RUF2 1RJ7A 4NOTA 4AI2A 2HWD2 4RHV1 4RGKA 5A1AA 1AL21 3ZXKA
chains in the Genus database with same CATH topology
4B8EA 1V6IA 3RQ0A 2WNVC 1CJDA 3WD5A 1AZDA 4QGNA 2BNOA 3GBGA 3VBUA 2BWAA 3BPZA 1RUI2 3AMHA 2NM1A 4AHZA 2D44A 1BVP1 1CN1A 3WLUA 2JXAA 1I6XA 1RUJ2 4LBMA 3U0ZA 1RUF3 3WUCA 1QGLA 2R071 5JSRA 3UK9A 1OMIA 4I30A 3NAPA 3QBQA 1KJLA 4AXOA 3C2UA 3MIDA 2EAAA 2GALA 4YZ2A 4RHV2 4LBKA 1BQPA 1IPJA 1WLWA 2R6QA 2Z69A 3I7DA 3MW4A 4I0AA 4N53C 1I1EA 2QNKA 1YIFA 5FO7B 1IQAA 5CG8A 4CDQA 5GLVA 2N7GA 2EAKA 1FT9A 4Y22B 1BXHA 4RHV3 1EYBA 2R072 5J37A 2E7QA 1AL23 2PA7A 4LO7A 1LHUA 2XJVA 4LR4A 1UN1A 3CJIA 3WT3A 2ZGSA 5D1IA 2ZZQA 1IS5A 2DF7A 1XNCA 1ZYBA 2CGPA 4XMIA 2R073 2I07B 5DUVA 1H1IA 1N3PA 1QJX1 1HQWA 5JI9A 4XBLA 2FQPA 4P14A 1JN2P 2DFCA 5KXBA 2HWC1 4ZXKA 5BNQA 4JRLA 3VBUB 1X7NA 4FBFA 4XFGA 4OHZA 2D6NA 4AG4A 1QJX2 1NCQA 4LHLA 3OPZA 5H9QA 4LA2A 1DDLA 1IOAA 4YVSC 4Y1XA 1YFXA 3NAPB 1O5LA 5T55A 1W0OA 1HXS1 4ISQA 4MXVA 1FOD1 2C0ZA 2GNMA 1NA1A 3ROUA 3JUUA 1HV0A 4L9BA 1QJX3 4AVAA 3WP5A 4CDQB 1DGRA 1AR81 1QWRA 4XXAA 2CWMA 4E2QA 1LJ7A 4LLOA 4Z8BA 2PLV2 4Z92B 4BYYA 4GQ7A 2HWC3 4DY5A 1GZCA 1H2LA 4DOUA 4AI8A 3CJIB 1HXS2 1S55A 3CL1A 4NVPA 3AKQA 1Y9QA 4N9IA 5DZFA 2ZGTA 1ZBE1 5FQ0A 3FE5A 4BH9A 1SBDA 4COYA 3WDWA 1YJLA 1MZ6A 4H7MA 1FOD3 4G4FA 1YFWA 3VKFC 3WUDA 4BMBA 3B7MA 5C8CA 4Q8LA 1W6NB 1N1YA 1U12A 5A3MA 3WQ7A 1AR83 2ZCWA 4HBNA 3LA3A 2P37A 1GICA 1ZBE2 4NHMA 2ARBA 2EXKA 4NWWA 4I0WB 1NCQB 1GR3A 2WQ4A 1CIWA 5T5PA 5B2GB 1SCSA 4GKXA 4XILA 4QQLA 2KM2A 3B5LB 5KHGA 1WMFA 4CEYC 1NA1B 2DFBA 4FXGB 5KHIA 5GZCA 2NLRA 3MLKA 4MUVA 2RHPA 2BWCA 5T3NA 3UKTA 4ISRA 3BOPA 1DQ5A 3WZ1A 3N7LA 1HRV1 1BBT1 5FO8B 4LBQA 4HPKA 3AP9A 4D69A 4FTBA 1ULEA 3OF1A 2VMGA 2WZR2 4A7ZA 3JB8A 1REDA 1AHSA 2GC1A 3ZFGC 1AX1A 3BOWA 5BNOA 3RJ2X 1H8TC 3HAGA 5GLUA 1Y43B 5FQ0B 2NYYA 1A78A 5BYNA 5L7OC 2NP0A 1OD5A 2HKXA 2KXLA 3G7DA 3UKNA 5I8SA 1FAYA 1HRV2 3DN7A 1BBT2 1JUIA 1SLAA 4O9GA 4YZ4A 4AHYA 1B35C 1LECA 2G4IA 5C8CB 1PM7A 5JSPA 4Y1VA 2D93A 3CNAA 4FPLA 3ILRA 3V56A 1DBNA 4P9GA 2QQPA 1MVQA 4IERA 1HRV3 1BBT3 2X5IA 3MLLA 1FV2A 2XUMA 2AZ5A 4KL1A 1E57A 1L3JA 3ZIWA 4COUA 2VUAA 2CL2A 2HWF3 4PLOA 2DUPA 2Q1MA 1MS0A 2R041 1RUG2 3SMHA 2XL7A 4C1WA 5T52A 1AYN1 1APNA 4COVA 1UZYA 3WCRA 1PO21 4AEDC 3AXEA 4BM8A 2RS11 4FPEA 3QH6A 3VHPA 1R1ZA 4MGYE 4LBQB 4XTPA 3ZXFA 3LWCA 4HPKB 5I0UA 3WQ0A 5BNNC 2F4PA 4WV8A 3WOGA 2DCYA 3AKRA 3EO6A 4JDOA 1UCXA 1QJU3 1RVF1 5JIAA 4EV0A 5BNOB 4XF4A 1LOAA 3N4MA 1AYN2 4XFBA 1IS6A 2VH9A 4INDA 3NKTA 4AFAA 2NN8A 4D7YA 1PNFA 2RS12 3VBHA 4EROA 2XB6C 3U07A 2R043 2VULA 5C4WC 2I74A 1H8VA 2D7FA 4FP2A 5BUVA 4AHXA 5JZGC 1AYN3 3MIFA 3VGIA 1UPSA 5FLJA 4JV4A 1PO23 4HKOA 4S2DA 1PMIA 4IV1A 2RS13 3IDEA 2OZ6A 2DURA 3POSA 3T1LA 2X5IB 2ZMNA 1DQ4A 3KB5A 4DRRA 2TUNA 1F31A 1V6NA 3BCWA 1K5MA 2WA4A 1RVF3 3FLPA 1UU5A 1AJOA 3ZDSA 4BLJA 1HIXA 3NV3A 1NLSA 4J6GA 3VUOA 3MYXA 4MZUA 3H3UA 4Z07A 2ZX2A 3HIFA 3R05A 1OPMA 3NWKA 2ZKNA 5JAXA 4XEZA 3QD6A 2EALA 1LGCA 2YMZA 1JOJA 1EPWA 4RQPC 2B8MA 1RB8G 4M0NA 4JTOA 3RI9A 2Y0IA 1JTZX 3I59B 2RR12 4Q4W2 2MHFA 4XFHA 1FPN2 1MS3A 2IC1A 3I4IA 2ZPXA 1V70A 1Q8QA 1ZRCA 1PHMA 2JEMA 2X29A 2ZGMA 3ILFA 4FOQA 5DDJ2 3VBHB 3O12A 5T5LA 3AYDA 1LOFC 2NZ9A 1OLRA 1SCRA 2KA3A 2I45A 4J1XA 1NOVA 3CLPA 4CDUA 3OGJA 3ECQA 1S1AA 1Q43A 3DL3A 1R1A2 2WLQA 1AVBA 1LEDA 5JWPA 3POYA 3FBMA 4YGDA 5GALA 4K20A 2VECA 2ES3A 3AMPA 4JGZA 1HQLA 1YXWA 3NKGA 1YLLA 4LEJA 1LU2A 4MH0E 4AQ2A 1U0AA 2R063 1K5MB 2WZPP 1WCSA 4OHXA 5EYXA 1CAVA 4XJ9A 3LOBA 1A3KA 3AFGA 4UW6A 2LTNA 1OSGA 3O0WA 1REEA 1D4VB 1GZ9A 3LA2A 3MIBA 3AP4A 1C5IA 3ZO0B 1OI6A 4WVMA 5JOWA 5GLTA 2ZAAA 2F6BA 2V5YA 4Q2FA 4WM8A 4W65A 4YARA 1NZCA 3QH7A 4N90A 1X50A 2VW2A 4AGVA 3ZSLA 4EN0A 3TNPB 4HVOA 1F9KA 1POV3 2XKPA 2BGCA 4PJYA 3VZNA 5J48A 4B3NA 4LBQD 1RHI2 5SV5A 2R0FA 1JW6A 3DGTA 1D4M1 3ACLA 1OOPA 1F8VA 1MR5A 5AFEA 2UWCA 3U11A 4RR3A 1WD4A 5JPMB 3ZMNA 2XWBB 1Q8VA 1YJKA 3AZXA 2HWB2 2JE7A 2DV9A 4CDUB 4JCKA 2VGDA 4AK3A 4CEWA 1R081 3ZFEC 4AGRA 2A3YA 1LGBA 2VG9A 2WNVA 5J7MA 2CYFA 2GZWA 4EJRA 4JGZB 1D4M2 4JVAA 4YG3A 4I01A 1H0BA 4Q4Y3 2HEYF 2Q30A 4XXPA 4W6YA 4QQ2A 1ZZ6A 1PO11 4UXAA 2XJTA 3O7OA 4M00A 1LOCA 3PMSA 3M3CA 1CAVB 5EJ3A 2HWE3 3ZSMA 1D4M3 2A3WA 4K21A 3GNEA 4LUMA 4N53A 1RUC1 2D6OX 3WG4A 1BCXA 1AR71 5AVPA 5F1RA 5EWSA 1GFF2 1WW7A 4N7IA 2EXHA 3WDUA 4BLIA 1VBC1 4WVMB 2OUHA 4KU7A 1BMV1 2YC0A 3AMMA 4WM8B 3GZUC 3M3IA 1PZ7A 1XE7A 1W6QB 2DVGA 3ZYPA 4KGGA 1R083 5I91A 2HEVF 4Y20A 1PO12 3WDYA 2NMNA 4QXKA 4YFZA 3KCCA 4XZPA 4YRDA 1G86A 4OVEA 4KBBA 3LSDA 5HBAA 1OOPB 3WINE 1RUC2 4HN1A 3B9CA 4S2GA 2ATFA 1AR72 1H2MA 3SCGA 2ZGOA 4RR3B 3WG2A 1ZNPA 3RYRA 1VBC2 2IXCA 3WHUA 3KSCA 2WSVA 5AC92 1RJ8A 5E16A 2PQQA 3JD73 1N3QA 2Q5TA 1RUC3 4CDWA 1AR73 4OHYA 5BXXA 1W0PA 2E6VA 4FPJA 1QXRA 3GF6A 1IPKA 1AR91 5AFBA 1GNHA 1O3QA 1IZ3A 2WQZC 1RC6A 1X82A 5TSWA 2B7YA 2OPKA 1R092 2Q0AA 2YYOA 3AKTA 4FPCA 3WP3A 3ST7A 4YVSA 4C91A 3PLQA 1LHVA 1YFYA 2QZ3A 3AZZA 1CX4A 5H9SA 1JHNA 4N53B 2YUEA 4YG0A 5FBZA 5I0SA 5I8TA 4OI2A 4F8AA 1U5XA 4AGGA 2XJPA 4BHPA 2FHRA 2CV6A 1AR92 3EJKA 1V9U1 4AEMA 2XKOA 4OULA 3ZXDA 4Y20B 1WCDJ 4YVWC 4P9XA 3VZKA 3WXPA 4L97A 1J3PA 2WKKA 1VAKA 4WVZA 3RNSA 5J09A 1AR93 1PZ8A 1CAXA 5CVRA 3WP6A 2PHXA 3ZXJA 4NN0A 2GN3A 3WNXA 2P17A 3JQXA 1OFNA 1V9U2 3HT1A 2FMDA 3AJZA 1VIWB 1W6PA 3SXWA 1ZBA1 4SBVA 3KS7A 4FCAA 5HCFA 4GMP1 4E4DX 3NV2A 1V9U3 2ZGUA 1RMU1 2I2SA 4Q4V1 1DLLA 1S0CA 4BZ4A 5CAZA 4Z82A 1TMF1 4MGZE 2WFF1 3UV9A 1HRI1 3FFZA 5JIUA 1RGSA 1SFYA 1DU3D 4YVSB 4ORFA 3IBMA 4CDXB 3N35A 4IEPA 2BFUL 4CZSA 1ZBA2 4CEYA 1ZREA 1ZRFA 3H7JA 2H0BA 3BALA 4WM7C 5FO9B 4XF9A 3LA7A 1KFXL 1RMU2 3KQRA 4YYOA 1YI7A 3WDVA 3R0RA 2WFF2 1HRI2 1UAIA 2BFUS 3OYWA 3NVCA 4W6WA 4D7SA 4COWA 1M06G 2ZBJA 3PVBB 1MS4A 1WGPA 3ZFGA 4AEJA 1C1LA 1CAXB 1RMU3 4Q4V3 5GLZA 3RG0A 2B46X 3M1HA 1QNWA 1H8TA 5JR7B 3FC0A 1TMF3 5EZWA 4ZU4A 2WFF3 2ZJCA 1HRI3 5LK5A 4AFMA 1S0JA 5L7OA 3BB6A 4XMAA 5DG2A 1SMVA 4HK8A 4XIKA 3OCPA 5EV7A 3WHTA 4U36A 3MPBA 1WLCA 2UY9A 4EWAA 1W6PB 1G7YA 1TME1 1B35A 1DQ2A 2QVSB 5FAXA 1SLTA 2ZX3A 3GZTB 5C9AC 2JECA 1W6OA 3A0NA 1PZ9A 1TEIA 4YGCA 3M4FA 1OQDA 3OY8A 2H6BA 4FPGA 4E2GA 4B4QA 2B5HA 3H0OA 3LKJA 3VHNA 4MGKE 1QQP1 3JCIA 1TQ5A 4AVCA 2BUKA 5JI7A 4LT5A 1UX6A 1WA4A 2EIGA 3P3NA 5F5QA 1TME2 2VW1A 5C6CA 1CJPA 3AB0A 3RYPA 4CEYB 4XOGA 3LOIA 5FMOL 4FTSA 5I0RA 2AH2A 3LGRA 4O9EA 5IK4A 4AEDA 3QLQA 2IXJA 2DCKA 2ZACA 2PHLA 1I3HA 4L99A 4AI0A 3O0VA 1TME3 4LULA 5BNNA 3OYWB 1QQP2 1PGW2 3H9AA 4YW5A 5FMOS 4M0HA 1DYKA 3ZFGB 4MX3A 2MNGA 4C0BA 1MQTC 4ATEA 1H8TB 4HK9A 1AL22 3AFKA 4H14A 1RITA 3QCWA 1IKQA 1QQP3 2BQPA 5L7OB 1Y3TA 1EAH1 2R0HA 4MGIE 5C4WA 2VMHA 4GB31 4BPZA 5I8YA 5LEJA 2ZGKA 3IT8A 1B35B 5JZGA 3NO8A 1VBE3 4AE2A 4R9CA 2ZMLA 1RUD1 1W6OB 3QACA 3B01A 3OY8B 4Z1VA 4XFFA 4OUMA 3S7EA 1PGL1 1J59A 3IIAA 3JU9A 5T5JA 4COZA 4FXKB 1YYNA 1HX6A 2FZ1A 3D0JA 2VVFA 2PN5A 3RRDA 4LO4B 4GB32 1UPIA 4LO8A 2V73A 3PVNA 4R52A 1ZVFA 3E6BA 4IL7A 5IK8A 1BZWA 2BNNA 1Z7S1 2YDEA 1AJKA 3IDCB 1W6NA 4AEDB 4BIOA 1EAH3 2SLIA 1PGL2 1ND3C 1SLIA 4GB33 2IXIA 3DPRC 1ULGA 1CQ9A 1OA4A 5BNNB 3RJRA 2PHFA 1VP6A 3FLRA 4K6BA 3B69A 1RUD3 4RQPA 4QMAA 2ETEA 1UL9A 4PLMA 4HANA 4EWDA 4CDXC 5L36A 2UYBA 2RS33 3OJBA 5KXCA 4RFT0 1V6LA 2ZGRA 3MZHA 1Z7S2 3HMYA 2HWC2 3FLTA 4XIOA 4M3CA 4N7UA 3CEWA 3AZWA 2D97A 2UU8A 1LOFA 3NSTA 1MEC1 1AL0G 4H7LA 4LUKA 5C4WB 1J3QA 5JZGB 3B93A 1AXKA 1Z7S3 5J3UA 2UY8A 2BTVC 2JG9C 2UWBA 3EBRA 3WVJA 3BODA 1LRHA 2A71A 2IXHA 1FOD2 4Q0UA 3ZPYA 1ULFA 1LOEA 1DZTA 2CGNA 1ULCA 4RL7A 5FRAA 1OA2A 1G9CA 1AR82 3DF0A 4RGGA 4UW3A 3WG3A 5J36A 5CB7A 2RJKA 2XGXA 1NQJA 4FPYA 1YIPA 4YZ1A 5KBFA 3ALQA 3ZYRA 2GMMA 1MEC3 2CAUA 4QX5A 4IEWA 3MI8A 3RPQA 1YCIA 4LO5B 1YWKA 1IGOA 4AW7A 2GC3A 4GH4C 3FHIB 3MLJA 4RQPB 3RS6A 2RS53 3OBRA 5ABJC 4GWNA 1JUHA 2ZHNA 1HDKA 1G8WA 3W58A 4IEXA 4M3CB 4MSVA 4PDWC 2XVKA 1V00A 1RUH1 2B42B 2WS91 1SACA 4LNVA 2BVBA 1MVEA 5E89A 2VPVA 1LR5A 2DCZA 3CU7A 3RMXA 3SH5A 3ZFEA 5A3LA 2IZWA 1VRH1 2HWF1 2AR6A 4B4RA 1CAUA 3VN4A 1ZX5A 1LKNA 5HCBA 5A33A 1KDMA 2E51A 4JC1A 4MXWA 5JCTA 4DFSA 2XBO1 1RUH2 4LE3A 4J1WA 1CD3G 2CGOA 2WS92 5IK5A 2VVDA 2JJ6A 1QNYA 2Y0OA 2GNBA 4Q4X1 2YGLA 3CJXA 3H7YA 5LEKA 1C5HA 2FMYA 1NCRC 2PTMA 2TNFA 4R9BA 5E1RA 4META 5CA6A 1VB4A 2HWF2 3TOJA 1QJU1 1RUH3 5AVAA 2WS93 4WVWA 5JVVA 4XBQA 2ZX0A 2DVFA 5F6KA 1FI2A 1ZM1A 2R30A 2XBO2 3AP7A 4FPKA 4WVVA 1UU4A 1GQHA 2GH8A 2R16A 1VRH3 3ZYIB 5FFOC 1S0EA 3LSEA 3ZYGA 4Q4X2 1O4ZA 2QKDA 1LOGA 1H9WA 2R49A 3M70A 4HSLA 3ZXLA 2XBO3 4BQ1A 1QJU2 1XQNA 2GSYA 2XJRA 5FOBB 1O4TA 4DY3A 1H1AA 2RE9A 4LLFA 1DQ1A 2QUOA 4GMP0 2PAKA 1UD1A 4Q4X3 4DINB 4EN8B 3MICA 3SH4A 3GBWA 3ZFEB 4E27A 2R042 5BV6A 1CAUB 1XU1A 2O1QA 3I59A 4HVRA 1VAVA 2WSUA 2YXSA 5CFDC 4L92A 5A33B 2BEOA 4C1XA 4MXWB 4XPVA 1PO22 4IV3C 4AVTA 4BCUA 1HV1A 1VAMA 4I02A 3VBRB 2VOWA 4HL0A 5KHJA 3FWEA 1QY4A 1UMZA 3KGLA 2R1BA 2D43A 3UL2A 4XF3A 1V6MA 2E63A 2ZAHA 4LBLA 1LHNA 1RVF2 4R8HA 1Q3EA 3U10A 4CYDA 2B9UA 2P34A 1DIWA 4TWTA 1QDOA 1PVXA 4XW3A 1MZ5A 1OQEA 5DG1A 1KJRA 3IKWA 3VKNA 3N7MA 1X8MA 1C57A 3AJYA 3QOPA 4YVWA 3WQ1A 1VB2A 1LTEA 3AMQA 4ZU7A 2G9GA 1AUYA 4EN9B 1T6GC 4I0BA 3HR9A 3S6PA 3J8F1 1M4WA 1QMJA 2VW0A 2D98A 4P9YA 3MIHA 2IXKA 1IHMA 4I2OA 1LU1A 1ZZ9A 4YM1A 5GKAC 4CTEA 2Y26A 2R061 3FX3A 3RYKA 2W52A 2R1DA 4IETA 1XRUA 5BNPC 1KS5A 4Y1UA 3V65A 2YZ4A 1PIV1 3VDDC 3J8F2 4KNCA 4A2UA 2CTVA 2AREA 3PVOA 1AR61 4X8NA 2PHDA 3ZSEA 1AXYA 4HKLA 1QXJA 1N47A 3SH3A 4RA0A 1KFUL 2DCJA 3FJSA 4UBHA 2RMU1 2R062 2ZX4A 4Q0VA 3J8F3 4KWJA 3KT7A 1POV1 1J58A 4Q8KA 4WM7A 1W39A 2DUOA 3ES4A 1TNFA 4R4ZA 3NJZA 2W68A 2X8KA 3ZYJB 2YROA 2D5HA 4BOWA 4YVWB 1C1FA 3O0XA 1AX0A 1H2NA 2GMEA 1PIV3 2RMU2 3OTFA 1XXNA 1CESA 2GNDA 1C8NA 1COV3 5CADA 2WA3A 4YZ5A 2ET1A 1AR63 1OKQA 3WW2A 1UW8A 1SBEA 4OHVA 1NYWA 1ENSA 3N7JA 2RMU3 1W6QA 2ERFA 2EA7A 3I54A 4FOYA 3CO2A 4Q4Y1 5JOXA 5E88A 5C9AA 2D40A 2OZJA 3B00A 3D82A 5SV8A 3WY6A 3PNAA 2XVGA 4DPNA 1WW4A 4LHKA 4Y5Z0 2TBVA 2HWE1 1UKGA 2NMOA 3GYDA 3M3EA 2Q4SA 4YW2A 3THTA 3RI8A 1REFA 4EWEA 1ULDA 3APBA 5HI0A 2ZKLA 4Q4Y2 4DNYA 2ZTNA 2WINB 4B4PA 3UJQA 2CAVA 1URXA 4WM7B 3D6EA 1Q8OA 2JX9A 4IEYA 4IEVA 5T50A 2HWE2 2XVLA 2QFEA 1S2BA 2ZHMA 2ZX1A 4HT1T 3W9AA 5J98B 2A7AA 1HKDA 3ZVXA 4JDMA 2Z5WA 3B02A 2D6PA 4ATFA 2DVDA 2QZ2A 3H50A 1VBB3 3J9SA 3VBRC 4AQTA 2VXRA 3VLBB 3DKWA 1MQTA 3TYJA 4M3CF 4DMIA 1R082 1QHDA 2GAUA 2GDFA 1H4HA 3JD71 1QH6A 1SFNA 4FT8A 1ENXA 1G6NA 4CP2A 3VBOC 3H3ZA 2UURA 3KT1A 4IEOA 4QM8A 3ZFFC 2ARXA 4IXLA 5C9AB 1NXMA 3VKMA 3ZSKA 4N43C 5CIRA 3ETQA 4LTAA 4Y26A 1KXGA 1NG0A 3JD72 5DZGA 1NLRA 4QQHA 4QM9A 4FQ4A 2OIIA 1DQ0A 1WW6A 2JG8C 4ES8A 2AGSA 4YW1A 1BMV2 1NE4A 4Q0QA 4X6RB 5JLVA 2K0GA 4QPYA 3ES1A 3IN9A 3WCSA 4KU8A 5K7PA 4AI3A 2IXLA 4F83A 2IWGB 2VY0A 2XWJB 4XFIA 1GANA 3IDBB 3PTYA 3KCXA 1ND3A 5GM0A 1PVC1 1QU0A 3DPRA 1Z78A 4E2SA 4NPRA 3D0SA 4PBOA 2G9FA 1PK6C 1KQRA 3IM0A 5CFCC 1VALA 4CDXA 1C3HA 5KHKA 1MQTB 5BPXA 5KWRA 5KXDA 2R32A 4GALA 2LM3A 3KMHA 1J1LA 2XLFA 3O5SA 2DTYA 4H55A 4LA3A 1DGLA 2ZHKA 4IEUA 4Q26A 4MLOA 3VKLA 2H0VA 4FAHA 1BKZA 4KWKA 4DXZA 3AKSA 4CP0A 2JG9A 5GZFA 1BEV1 1UIKA 4KG0A 2A6ZA 3S7IA 3ZN4A 3KD4A 1PVC3 3V0AA 4LBNA 3VBSC 4AVBA 4G3YC 5KC5A 4YGBA 3CF6E 4KGQA 3VBFC 4XFCA 2UWAA 1F2NA 3SISA 4PBPA 3UJOA 2WNEA 5C8WA 5BY5A 2O0OA 2UYAA 4ONUA 4NHKA 3ELNA 3C3VA 1NY71 1HQNA 3E97A 2VMIA 3MEPA 2QDRA 3D4KA 3WX5A 3MW2A 4RS5C 5GJ6A 1D2SA 1AX2A 1ND3B 2A6YA 1Q56A 3DPRB 4OI4A 1ZZ7A 3RDIA 1FMD1 2ZHLA 1H1MA 1TE1B 2AYHA 4GH4A 4K8FA 1WD3A 4PIZA 1BEV3 5ABJA 2PAEA 1NY72 3BTAA 3RWNA 4NWVA 3ZN6A 1QJY1 4B7EA 1QF3A 2Z79A 4PDWA 2IFRA 5DUWA 4YSFA 4A7YA 1RUE1 1GV9A 4Q4V2 3ZXAC 3HBZA 4AEKA 1TMF2 1BK1A 3D5OA 2TEPA 2JG9B 2CY6A 3KT4A 3E5XA 5HXVA 1MZFA 4ITCA 4K7JA 3V0AB 3WDTA 1FMD3 2A73B 5K0UC 1ALYA 4JTNA 2PYTA 5LRSA 2H6CA 4XJWA 1S2KA 3ZIXA 3TN91 1QJZA 4GIQA 2YPJA 1RIRA 2WT0A 1G9BA 4AYUA 1MS9A 1QJY3 3EQEA 1NCRA 1FV3A 1UF2C 2MEV1 2OYZA 1RUE3 4CP1A 1F5JA 2C9AA 2PFWA 1U5ZA 1CPMA 3B9IA 3AP5A 1VBA3 4GH4B 3V0BA 4ES9A 4PF5A 2BW8A 4P9WA 5ABJB 3KLSA 4XFAA 1TNRA 3ZN6B 1VBE1 2HWD1 1O5UA 4FAGA 1Y7BA 2MEV2 2ZGNA 4PDWB 3K51A 1ENQA 3AXDA 2K9ZA 3TN93 2E7AA 3HQXA 4WZFA 3MDPA 2ZZJA 3S0MA 1RUI1 2XHKA 3JBG3 1F5FA 3SCFA 1SLLA 1LB2A 4FSJA 2IFWA 4HSJA 2MEV3 4Y24A 2WC2A 1NE6A 4DZGA 1VBE2 4CEWC 5CFDA 4WZCA 2DVAA 2VQ0A 4IV3A 1FNZA 3ZXEA 2DYCA 1POV0 3WW3A 5DUXA 2QE3A 4YZ3A 3VHRA 5L19A 3S30A 1KD7A 3HD8B 1G9DA 5DUUA 4XBNA 4C90A 2HWD3 2PHRA 3VKOA 1NCRB 2E7TA 5FDBA 4TYSA 3USSA 3VHOA 2WT2A 4ASLA 3PHMA 4TLFA 5D8AB 4QQPA 5JSOA 2D3RA 2A3XA 2RS31 1ONAA 1RUI3 4XJUA 3TRSB 2FZ2A 4AQ6A 4D94A 2C1FA 1ENRA 2BBVA 1RUJ3 1DGWA 4Q27A 5EXOA 3V0BB 1QDCA 1JH5A 1EAH2 1SLBA 4L8QA 1N1TA 3L9JT 2ZGPA 4HZFA 4K1ZA 4V1PA 4W6XA 1WW5A 4QPGB 1I5ZA 1RUD2 4JGYC 1QXPA 1ZZCA 2O8QA 4Q1RA 5J96B 2DWRA 1HW5A 5FOJB 3E5QA 1UKRA 2RS32 3JZVA 5FCCA 4L2NA 5H9PA 4YM0A 4ZU5A 1ND2C 4D7TA 2DVBA 5IK7A 1WMDA 4YM2A 3N36A 4UW4A 3WW1A 4HVQA 4HKWA 4HFSA 4HMZA 2DUQA 4XF1A 1XYOA 5BNPA 3TAYA 1FATA 1XNDA 4CRQA 5CFDB 1DGRN 3GZAA 3VDDA 4CDWC 2ET7A 1RUNA 4IV3B 4DS0A 3HT2A 3AYEA 3TWIA 1DHKB 3M2MA 3E5UA 3GALA 2E9QA 3ZX7A 1S0IA 2PLV1 1BVVA 4PLNA 3KZ4C 5I0TA 2ZA9A 5FPZA 5E8AA 1ZZ8A 5T5OA 2D6KA 3EHKA 2RS51 4QPIC 3H1WA 1G9FA 4B29A 5HCAA 3ENRA 3MFAA 2VOVA 4AVVA 1MEC2 1Z0HA 2PAMA 3J26N 5LK7B 2WWSA 4PIYA 5EYYA 5H9RA 4A7KA 4YLZA 1IS3A 1MS5A 1NQDA 1UZZA 2WNUC 3DV8A 4G9SB 4S2HA 4A3XA 3THPA 2BVVA 2GC0A 2GH2A 3WR0A 4N9HA 2RS52 2D5FA 3E6DA 3Q9OA 1ZRDA 4MYEA 2PELA 2DCTA 2PLV3 3R4UA 1LHOA 4BMEA 1VLNA 3MW3A 1AF9A 4NHLA 1LCLA 1HXS3 5BNPB 1JYCA 5IUQA 3AYAA 1D2QA 1HLCA 3VDDB 1SLCA 5FPXA 1CGPA 2VNRA 4NO4A 3TB0A 3I8TA 1DG6A 4RGAA 1A8DA 3N7KA 4R4XA 5FLIA 4FVVA 3IMNA 1GKBA 3AKPA 4KWLA 4IESA 3NV4A 2WZR1 3AP6A 1H4GA 2ZABA 5JMCA 3FUQA 3VL8A 1CONA 1GZWA 1FYUA 1MACA 2FBEA 1XU2A 3NL1A 4F7ZA 1ZBE3 1KITA 1EP0A 4OHWA 1XE8A 1JYIA 2ILMA 5C33A 3AK0A 2PHUA 1YNAA 4AWDA 1DF0A 2DU0A 3VBRA 4K3UA 5K8SA 1LESA 1J1TA 1SEFA 2DU1A 2CWSA 4X6QB 2BYVE 2XLGA 3EXUA 1VRH2 4P9JA 2Z2SB 4K40A 1G9AA 5D8AC 1MS1A 4LBJA 4XYXA 3VBOA 3OGGA 1OA3A 2JDZA 2XLAA 4OZXA 5F9TA 3ZFFA 2WZR3 2Q1ZB 1LULA 2WL1A 1IKPA 4I3PA 1RUG1 2XL9A 4P9LA 1YHFA 4N43A 3RMYA 4QPGC 1XYPA 4FP3A 1QKQA 4ZKTB 2V09A 3B3QE 2VOKA 2W08A 1X33A 2JG8A 4DQAA 1VBD1 1CVNA 1LHWA 4YW4A 3H1YA 3INAA 3VZJA 3AM2A 4YG6A 1QOTA