4YGEA

Crystal structure of ergic-53/mcfd2, trigonal calcium-bound form 2
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
227
structure length
227
Chain Sequence
b'PHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSSDQIRVAPSLKSQRGSVWTKTKAAFENWEVEVTFRVTGRGRIGADGLAIWYAENQGLEGPVFGSADLWNGVGIFFDSFDNDGKKNNPAIVIIGNNGQIHYDHQNDGASQALASCQRDFRNKPYPVRAKITYYQNTLTVMINNGFTPDKNDYEFCAKVENMIIPAQGHFGISAATGGLADDHDVLSFLTFQLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein ERGIC-53
publication title Interaction mode of coagulation factors V and VIII with the cargo receptor MCFD2/ERGIC-53 complex
rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 51
structure length 227
sequence length 227
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2015-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03388 Lectin_leg-like Legume-like lectin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ygeA00
4XBLA 1IKQA 2A75A 2W08A 3OJBA 4U36A 2A6YA 1D0HA 2D3RA 4M3CB 2P3JA 1V6JA 2R49A 1LODA 3VKFC 1ENQA 4XDQA 3B9CA 3OYWB 3WDYA 1Z0HA 1G9DA 5CNAA 2D6OX 2UU8A 4OZXA 2YV8A 3AFKA 3APBA 1V6IA 1SLBA 2WKKA 3HR9A 1AX1A 2JE9A 4R9CA 3SLIA 1WBFA 1N1TA 1MS5A 5KXEA 4ATFA 1SLTA 4XXAA 2OVUA 1G8WA 3SH4A 1Q56A 4YW2A 1C4RA 2ZGKA 1V00A 4XTMA 4XOGA 2D6NA 1ULDA 3M1HA 4FOWA 4FOYA 1FATA 5T55A 1FV3A 3FBYA 2A6WA 1O4YA 2A5ZA 2A6VA 2OUHA 2ZABA 3ZYPA 3POWA 1N47A 1GZWB 5GLZA 1OFSA 2GNTA 3HMYA 5T50A 3A0KA 3JUUA 4TYSA 3WDTA 3NV4A 4XE9A 3UJQA 1WD4A 4YZ1A 4Y1UA 3KM5A 4BMBA 3NV1A 3O5SA 5E88A 3WUCA 4FPLA 4BMEA 4YG0A 1MZ5A 2CWSA 5DUVA 3ZSLA 2EIGA 3AP4A 1I3HA 3U4XA 1YRZA 1GYKA 2ZAAA 2ZGNA 3IMNA 3VUOA 1LOAA 3WG2A 3WVJA 2V73A 3NV2A 1SLAA 4AGGA 1APNA 3V65A 1AXKA 2SBAA 4GALA 1VLNA 2ZGQA 1SCSA 1RINA 5GLUA 1UAIA 1QNWA 2CNAA 3PJQA 2YZ4A 2ZBJA 5CBLA 2P2KA 4D69A 3MPPG 2CYFA 2VH9A 5DZFA 4BLIA 2DVFA 2JD4A 3ZXLA 1DIWA 5DXDA 1N1VA 3WG1A 1SLCA 4XBNA 4Y1VA 3FLRA 1QOOA 4FPEA 4YG6A 3T1MA 5IT6A 3WG4A 1RIRA 3MW3A 3V64A 2A3WA 1XQNA 1VAMA 3MEPA 2OUJA 4FOQA 1WUVA 3M3CA 3LSDA 2WT1A 1AX2A 5DUUA 2LTNA 2JKBA 2E6VA 1VAVA 3AP6A 3R4SA 3VKLA 3WOGA 1GBGA 1PZ7A 5E89A 1CJPA 4DQAA 3AZXA 3AX4A 2EXKA 5AVAA 1GV9A 2VW1A 2A3XA 1MS0A 4XBQA 3RG0A 3ZXEA 3B69A 3UK9A 3RSJA 3WNXA 1YXWA 2E7QA 1ENRA 5BYNA 4XMAA 4HANA 2NN8A 4F83A 1A8DA 3POSA 4GXLA 5GALA 1BZWA 4XTPA 3OY8B 3PVOA 3VV1A 1IOAA 5JOZA 2ZGTA 2D44A 3DGTA 4YM0A 5GZFA 4Q27A 3ZXFA 2PHXA 3A0NA 4AVTA 4BPZA 1JBCA 1MS9A 5T5PA 3IKWA 1MS3A 4YZ3A 4LBKA 2WSUA 4LBNA 1IS3A 3AXEA 3R4UA 1MS1A 3FFZA 1LECA 2GNMA 3AZZA 1V6LA 2GMEA 2A3YA 3INAA 4DRRA 1W6MB 1W6QA 1DQ5A 3VKOA 2D6KA 5KXBA 4UW3A 1LCLA 1Y7BA 1CPMA 3POYA 4XMIA 2AH2A 3R05A 2H0BA 1VALA 1CESA 2NM1A 3ATGA 4Y1YA 4XJ9A 5DUWA 3B00A 1S1AA 1WLDA 4YW3A 1DQ2A 1W6PA 2DV9A 3ENRA 1LHUA 1DLLA 1WCSA 3D4KA 4Q1PA 1J1TA 4UW6A 5F9TA 2ZHKA 1CVNA 2R0FA 4I30A 1S0BA 4FPFA 2BQPA 2C9AA 3L2YA 1ULCA 1WW4A 2B7YA 3RMYA 1C57A 5T5LA 3PVEA 1DYKA 1LJ7A 1MS4A 4PCRA 4AVSA 1MVQA 2DVAA 1NXD1 1IS5A 4ZXKA 4YFZA 3USUA 2D6PA 2DUOA 1QMJA 1DZQA 1JUIA 1JHNA 1N3PA 2DVBA 1QDCA 4BLJA 1ZA4A 1BQPA 2AUYA 4JCKA 1CONA 3GNEA 4YG3A 4ATEA 4PBOA 2DTYA 3FLPA 1N1YA 4XJUA 3TAYA 1I1EA 1GANA 2EF6A 4GKXA 2DUQA 1AZDA 2DU1A 2DWRA 1QDOA 3O12A 2AREA 5EYXA 5GLVA 5HCFA 1IS4A 1FYUA 4GWMA 4IQPA 2ZMLA 5L73A 2XG3A 1WD3A 1GICA 3N7MA 1LOFA 3V0BB 3WDUA 1UL9A 3GALA 4L8QA 3V0AB 3MW4A 2P37A 3N7JA 1GZ9A 4LBQA 2W39A 3QLQA 4YZ4A 1S0GA 3N7KA 1DYPA 4YW4A 2VW2A 2UWCA 4XIKA 1AJOA 1S0IA 3AYCA 3DUIA 1MS8A 4K21A 1BKZA 4FPCA 1AVBA 2CWMA 4WVWA 1CQ9A 4WZFA 5EXOA 4DRVA 3AP9A 4YFWA 3IPVB 4K1ZA 4ITCA 4YZ5A 2ZGMA 5FRAA 1LEMA 1W0OA 3M3QA 3N3HA 3D6EA 1W0PA 3WUDA 1GLHA 3AZYA 4AYUA 2A71A 3N7LA 3OYWA 2R1BA 2ZHMA 3WG3A 2CTVA 2W52A 2ERFA 4FOVA 2NMNA 3VKNA 1G86A 4SLIA 3I4IA 3AJZA 1SLIA 3AJYA 2DUPA 2RHPA 2D6LX 5EWSA 1UPSA 1C1LA 2GALA 2PHWA 2W68A 3WDVA 2Q5TA 4Q26A 4Y24A 1B09A 4Y20A 5CA6A 4XHBA 2A70A 3B01A 4FPHA 4Y1XA 5IK5A 2D3SA 2ZA9A 3OBRA 3Q9OA 4FPKA 1A78A 2ZMKA 4C1XA 1ZM1A 2FHRA 1GZWA 2I2SA 1Q8QA 5HCBA 1LENA 3ZPYA 2ARBA 1SACA 1OKQA 1HDKA 4YM2A 1QOTA 4XJAA 1S0FA 5JVVA 5JOWA 1W6OB 2SLIA 1S0CA 5IK8A 2YROA 1IKPA 2DU0A 3ZXKA 4Q8LA 2WNEA 1Q8OA 1KDKA 1QOSA 1W6QB 3H0OA 3WV6A 2WJSA 4FQ4A 2ZACA 2LALA 2DURA 3CNAA 1WW6A 1JOJA 2PHFA 3AP7A 3BODA 1S0DA 4XJWA 4DFSA 4ISQA 4C1WA 5H9PA 1W6NA 3IM0A 3BTAA 1JN2P 3SNMA 3W58A 2WLQA 4Y22A 2D6MA 5LK5A 4CTEA 1LESA 2D43A 4M01A 5GZCA 2XB6C 4UW5A 2DTWA 1LOEA 3ILRA 3M2MA 1A3KA 4BOWA 5IK4A 3SH3A 3WLUA 1KJRA 5DUXA 3OGGA 1F31A 4FPOB 5SV8A 3I8TA 3WHTA 4M3CF 1BYHA 1SBDA 1O4ZA 4P9YA 5DG1A 3ILFA 3B3QE 2GN3A 3OPZA 3RMXA 1YO8A 4XHXA 1JXNA 1LOGA 1KDMA 4H55A 4YZ2A 1KRIA 2DYCA 3NV3A 4YM3A 2AR6A 4GKYA 2ZKNA 3C2UA 3ZVXA 5JLVA 3NWKA 4YM1A 1S0EA 1DQ1A 3UL2A 4RL7A 2TEPA 3AXDA 2VXRA 2ES3A 3O0WA 2ZZJA 2JE7A 5GJ6A 1UX6A 2KM2A 2P3IA 2WT0A 2ZGSA 4WV8A 1JW6A 4GA9A 1DFQA 2UWAA 3TB0A 1QGLA 1SCRA 1GNHA 1GNZA 1F9KA 1ULEA 2GNBA 4YGEA 1H9PA 2D3PA 1AX0A 1GKBA 1N3OA 3PMEA 1IS6A 2A6XA 4LBQB 2AYHA 1CIWA 4YGCA 2VU9A 4AWDA 1YI7A 2EXJA 1DQ4A 2JJ6A 4LBMA 1QU0A 4Q1RA 2P3KA 3D5OA 4ISRA 1SBFA 1BXHA 3OY8A 3OBTA 2P34A 4JRAA 5IUQA 1FNZA 1N3QA 1Q8VA 3WCRA 1DQ6A 4W65A 3ZSJA 1GSLA 5IK7A 1U0AA 1CN1A 2NYYA 3ILNA 4NO4A 2VW0A 2ZHNA 2EXIA 1FNYA 1G9FA 1V6KA 4FPJA 4MYEA 4AGRA 4XXPA 1W6MA 4AVVA 4ASMB 1LOFC 3AZVA 3PVNA 3ZSKA 1G9BA 4XZPA 2EALA 3SISA 1G7YA 5EYYA 1V6NA 1LOCA 1AXYA 1X50A 3T2TA 2WSVA 3FUOA 3WZ1A 4XILA 1JYIA 3RQ0A 4LBLA 1F5FA 4RA0A 3UJOA 4FQZA 2ZGUA 4R9DA 2ZGOA 1PZ8A 3BIWE 4K20A 1LGNA 3AK0A 2A6ZA 1WLCA 4M00A 2JECA 1URXA 1Q8SA 1SFYA 1YYNA 4Y20B 1LOBA 5CB7A 4Q8KA 1LULA 1G9AA 4YLZA 1MR5A 3AYAA 1N1SA 4M3CA 1HLCA 2ZMNA 4JC1A 4NOTA 4XIOA 4TZDA 4DS0A 2PHUA 1V6OA 1MACA 2GDFA 3FLTA 2WT2A 2PHTA 1D2SA 4XJ8A 4ZKTB 4Y26A 1LTEA 5DZEA 5KXDA 5H9RA 1FX5A 3ZYRA 1ENSA 2ZGPA 3AP5A 3M3OA 2UURA 1AJKA 1HKDA 4LBJA 2EAKA 1HQLA 3SH5A 1UKGA 1QKQA 1LHNA 1SBEA 1W6NB 4UW4A 1BJQA 5JDBA 4FPYA 4Y22B 1Q8PA 5DG2A 1S0JA 2GMMA 3ASIA 2GNDA 4Q2FA 1ULFA 1LHWA 1QF3A 1TEIA 1VIWB 2CL2A 5GLWA 1DBNA 1DHKB 4XJZA 3FUQA 2E7TA 4LBOA 1LU1A 2YY1A 1WW5A 5GZDA 3V0AA 5E8AA 4FVVA 1G9CA 4GWNA 5CAZA 4Y1ZA 4P14A 3N35A 3QCWA 4U2AA 2FMDA 1KQRA 4HL0A 3AYDA 5JOXA 2YMZA 2ZGLA 5GM0A 2VY0A 2C5DA 4R9BA 1KITA 1JYCA 1H30A 2ENRA 4YW1A 3A4UA 1FV2A 2CY6A 3BOPA 4LBQD 1AF9A 2R1DA 2AGSA 3IPVA 1GZCA 3RRDA 1W6PB 3KQRA 3SITA 1ULGA 5F5QA 4PQ9A 3VKMA 2EXHA 1C1FA 2ZHLA 4CRQA 5HCAA 2DVGA 2GN7A 2NZ9A 4YW5A 3WDXA 1WW7A 1UZZA 4WVVA 1LGBA 5GLTA 4CZSA 3T1LA 3MW2A 1AXZA 5GZEA 1R1ZA 1OQ1A 3RS6A 4AGVA 3WDWA 3USUB 1LGCA 4FP3A 4YGBA 5DZGA 1LHOA 2VUAA 2D7FA 1CR7A 1LHVA 3AZWA 3LSEA 4PF5A 1KJLA 1UN1A 1MVEA 1UMZA 3WHUA 2V5YA 5JMCA 2DVDA 1WLWA 3O0XA 1Z78A 1EPWA 1UZYA 1PZ9A 4YGDA 2A7AA 2Z42A 2NMOA 2JDZA 4R9AA 1LU2A 2G4IA 4Z8BA 2PHRA 4BM8A 4DPNA 1ONAA 2OW4A 3O0VA 5T5OA 1V6MA 4P9WA 3W59A 3JU9A 2ZGRA 1YIFA 2PELA 2YXSA 3AYEA 2UWBA 5KXCA 1HQWA 3HN1A 2NP0A 3LCPA 3ZSMA 1H9WA 3ZXJA 1W6OA 4XYXA 1DQ0A 4FP2A 1FAYA 2GMPA 2HYKA 2R0HA 2E51A 5FREA 5T52A 4PBPA 2R16A 2WQZC 2AENA 3WCSA 2E53A 4K1YA 4KBBA 1CPNA 1LEDA 5T54A 4M3CE 4P9XA 1NLSA 2ARXA 3N36A 4BQ1A 5GZGA 3V0BA 3IN9A 1RITA 1QNYA 1SLLA 1DGLA 1WBLA 3M3EA 4FPGA 5H9QA 5H9SA 1MZ6A 5JOYA 5T5JA
chains in the Genus database with same CATH superfamily
1GFF2 4V2VA 2OZJA 3KGZA 2C24A 2ZTNA 1CAXB 2W08A 4HXCA 3RJ2X 1U5IA 4CPBD 2VBDA 2WAOA 2D3RA 5C3RA 4QPGC 1RVF2 2VZOA 1RMU1 5ISLA 4DUXA 1BBT1 1U5XA 1CAUA 3NW4A 4MVTA 1LODA 1ENQA 2BFUL 4LPLA 1ZZBA 1J58A 1DDLA 3WDYA 5CFCB 4LHNA 1FOD3 3ITQA 3MBWA 1V6IA 4W6XA 1SLBA 2VOWA 2XOMA 4HK8A 4Q0QA 2O1QA 1QJFA 2RVAA 3VHNA 2BPA2 5KXEA 3OPWA 2WWUA 5JOZA 2BYVE 3SH4A 2W91A 3VDDA 2RDRA 1NY72 3E5UA 5A7NA 5FYYA 2D6NA 1YJKA 2TBVA 3H1WA 1F4AA 1VB4A 1COV3 3M1HA 2A6WA 1O4YA 3B02A 4XUQA 3ZYPA 3POWA 1N47A 2RR12 3WF2A 1GZWB 2XJQA 5GLZA 4D6QA 5J09A 1QHDA 3A0KA 5KR7A 5BNOC 4AHXA 4IEVA 1YI9A 3AKSA 4TWTA 2VECA 4XE9A 3UJQA 2Y33A 4D6SA 2HBUA 3O5SA 3WUCA 3E6CC 3SKVA 4FPLA 2JDHA 1ZBE3 2XL7A 4YG0A 4XQ4A 5FWEA 5DUVA 3ZSLA 5FMOL 1KFUL 1I3HA 3AP4A 3ZMNA 4CU7A 1K5MC 3VUOA 3LD8A 5CFDC 5LWBA 3O1PA 1W03A 2PAKA 2V73A 3N9LA 1ZBE2 4JKMA 4AGGA 2JDAA 1S2KA 1UY1A 1SCSA 3M8LA 2JG9A 5GLUA 2V4AA 3A7QA 1LR5A 3WF3A 4F3JA 5L9RA 1NG0A 2CNAA 4IEYA 5A3PA 2ZBJA 1VB2A 4AAPA 5CBLA 2P2KA 4PLOA 4ES9A 5FYUA 1HRV1 5DZFA 2WZPP 4L92A 2WYFA 1H4GA 1DF0A 5DXDA 3WG1A 4XBNA 3DYPA 2YU2A 4TSVA 4YG6A 5A32B 3KV6A 3WG4A 3ZFGB 4EN7B 3HAGA 1AYN3 4RS5B 1NLRA 1V9U3 1XNBA 2PAEA 3V64A 4E2SA 1OA2A 3KT4A 5BNNB 1VAMA 4G9SB 2VUCA 3LPGA 4FOQA 4GB31 4OUMA 4KU8A 1AX2A 2B5HA 4PT6A 3WOGA 1PMJX 3M7AA 3R4SA 2VZUA 4AW7A 4DUWA 5BUVA 1AYN2 1PZ7A 1V9U2 4I3PA 4O9GA 3HBZA 1GV9A 1US3A 1JZ3A 1HXS3 4MGSA 3PDQA 3ZMOA 1CIYA 1PM4A 1I6XA 4PHZA 5HPOA 2ZOEB 4IV1A 4KI5M 5A1LA 2VL4A 3KVBA 4P5HA 3ORJA 5I91A 1XYPA 5BYNA 2LUWA 2VMEA 1K45A 4N43B 4A2UA 1HXS2 3IB3A 3OY8B 2VR4A 3DGTA 2VZSA 1Q43A 1UW8A 1WKYA 3WQ1A 3CBNA 4DMIA 3A0NA 4AVTA 4BPZA 2QZ3A 5T5PA 4EZHA 4QKNA 3KB5A 3P1IA 2OPWA 1ZZCA 3AXEA 3R4UA 4UBHA 4M0NA 1T6BX 1WCKA 4QU2A 4W4ZA 5I0RA 1AR73 3USSA 2A3YA 3TEYA 2BP6A 4WM7C 5EJ1B 1W6QA 1DQ5A 3A22A 2JE8A 1BK0A 2WNVA 3K51A 4QHOA 4GAZA 5JCTA 5JSOA 1UO9A 1LCLA 1Y7BA 2R071 1CPMA 3VBFB 5K8SA 1PVC3 4UFLA 2YFZA 1AR72 4Y1YA 2H0BA 1VALA 2QNKA 2NM1A 1UOGA 5FZBA 4Z1VA 3B00A 1UYZA 1WLDA 2UY9A 5E6HA 2X53S 1JZ6A 4OMCA 2Q1ZB 4Q1PA 4UW6A 4EV0A 5FKCA 3HPNA 4BYYA 5F9TA 5IFTA 3JBG1 3MO4A 2XLAA 4B1MA 3UESA 4EWEA 4FPFA 2QFEA 2C0ZA 3OD0A 2HWF1 4BHPA 4LUMA 4NIHA 2VPVA 5GKAC 4BE3A 1W28A 2MPFA 1DZRA 3I59A 2DVAA 3EQEA 4ZXKA 5FYMA 3MIHA 2VNVA 1CAVB 4FTEA 5CG8A 3J7LA 3OCPA 2KXLA 3UKTA 2I74A 1IG0A 2JDMA 1DZQA 2PQQA 1RVF1 1N3PA 2ZZQA 4Y33A 4I2OA 4HBNA 3IDEA 3OG2A 4JCKA 1BQPA 1ZRRA 2VG9A 3GNEA 4ATEA 1YFUA 4A3ZA 3IWZA 2RDSA 1N1YA 2G19A 3FLPA 2Y64A 3MF6A 5FBJA 2P1BA 3K2OA 3N9MA 2DUQA 2DWRA 3P6BA 3C7GA 4QB6A 2QQUA 4XFFA 2ARCA 3VDDC 3VBRB 4AAXA 2FDFA 5HCFA 1IS4A 1FYUA 1RUJ1 4QQPA 5L73A 1WD3A 4O61A 1GICA 1IG3A 5FLHA 1HN1A 1UU4A 3AMHA 1NX9A 4ORFA 2HWB2 4YVSA 3GALA 5APAA 3WDUA 4AHYA 3H3ZA 5TSWA 3HNYM 2DDUA 4QXHA 5FO8B 3JD73 1P8JA 2UYBA 1HX6A 4D0QA 1RUNA 4F7ZA 5ACA2 3QD6A 3CZUA 3KHBA 2VQTA 2UWCA 4NR1A 2HBTA 3K46A 4XIKA 3W5NA 1NXMA 3N9PA 3ZR6A 1PO21 2PN5A 4I0WB 2Q8EA 1BKZA 4MX3A 3VZJA 1XXNA 4DNYA 5A70A 1J1LA 2VMCA 4AQ2A 4AI3A 1AVBA 4H14A 3H1YA 2PLV1 1UPIA 4A41A 5J1XA 1NQDA 3LEMA 4CVUA 3SCHA 4YZ5A 2UY8A 2ADEA 3IPVB 3D82A 4CDWB 2X05A 1X33A 5KC5A 4W50A 3ACGA 5IWFA 4AYUA 1W04A 1STMA 5FZ9A 2ZHMA 2CHHA 5CFCA 1H6XA 2WAAA 3HIFA 3B5LB 4FOVA 3AVRA 3SHRA 1G86A 4DXRA 2R32A 3AJZA 2VZRA 5ANNA 2XPJA 3AJYA 2RHPA 4AFDA 2HWD1 4P9IA 1YEWA 4QPIA 2NLRA 1I5ZA 2P6HA 1REDA 1RHI3 4DIQA 5LBBA 3P3NA 2Q5TA 2BBAA 1I9RA 4YPJA 5FOJB 3ZFFC 1Y9QA 4GWIA 5IVCA 1CZTA 1VBD1 2A70A 4BQ4A 2HEWF 2ZA9A 4M4PA 1RUE1 2ZMKA 2IFWA 2FHRA 1GZWA 1RHI2 2LS6A 5IW0A 1LENA 4HSLA 2ARBA 1OH4A 5F3EA 1OKQA 5IAVA 4YM2A 2Q0AA 3QH7A 3ZXGA 4XJAA 5JVVA 5IK8A 1ST8A 2BVBA 2JEMA 2DU0A 2XKOA 4NUBA 2WNEA 1KDKA 1QOSA 4UI9L 3WV6A 4A7YA 4MXWA 4DINB 2PAMA 2LALA 1GWMA 1W9SA 1WW6A 2DURA 1VBB3 5LA2A 2VO5A 3AP7A 4JDMA 1QJZA 3BODA 4IV1C 2RJLA 4CDUB 1W6NA 4I3GA 3FFQA 4NWVA 1O5LA 2EVXA 1HN0A 4LKDA 1LESA 1XYOA 4UOJA 2KA3A 1VBB2 2VQAA 3NRUA 3ZN4A 4UW5A 4NIGA 1YLLA 1DG6A 1DGWA 3M2MA 5BNPA 4LNVA 3MHZA 3ZYIB 4BOWA 5IFPA 2H6BA 3LEIA 4MG2A 1Q5OA 4A44A 3I8TA 1BEV3 5FZ8A 5F3IA 2P17A 1SBDA 4B7KA 1O4ZA 4P9YA 5HXVA 2R043 3POIA 2YFUA 3FHQA 1DLCA 4XHXA 1JXNA 3WF4A 1KDMA 4A45A 3LFIA 2WNVC 4HK9A 4W6WA 1OQDA 1KRIA 3NV3A 4GKYA 3IMMA 3KSCA 4DZGA 2FBEA 1BEV2 1W2UA 1YQ5A 4ZZ5A 5JLVA 3UL2A 1DQ1A 5DAQA 4YVWC 4RQPC 4RL7A 3K3NA 2R042 4NRPA 3RWNA 3AXDA 3ZFEB 5IYYA 2GZWA 1X82A 2WYSA 5GJ6A 2KM2A 1UU5A 4BXFA 2WQ8A 2Y6JA 4UYBA 2W94A 3O1SA 1RUG1 4HPKB 4JHZA 3SEPA 1GQGA 1H8TA 1H9PA 4IETA 1GR3A 2D3PA 4IEPA 1O5UA 4IV3B 1PGSA 2D93A 2VU9A 2YHJA 4AWDA 3LWCA 1DYOA 1QU0A 2VZPA 2XDVA 3J8F1 1EPZA 2P3KA 3TNPB 2PQSA 4ISRA 3WT3A 5EV7A 4CEYB 1BXHA 3OY8A 1JYNA 3PLQA 5JXHA 5FLJA 1NA1B 4COZA 1YQ2A 1KFXL 4KG8A 1H2KA 1ZREA 3ZSJA 5B4XA 1HV1A 1PK6B 1FI2A 1TE1B 5FBZA 3TBDA 1CN1A 1UZWA 4NRMA 2VW0A 2RJKA 2EXIA 1FNYA 4IEQA 4AFAA 2RS33 4FT8A 2DCTA 3VBUB 4Q4X1 4AVVA 3ZSKA 3VBHB 3PVNA 3GBFA 4IEOA 4E9KA 1NOVA 4YVSC 1GWLA 5EYYA 3S30A 1V6NA 3KHCA 1GNYA 2NQYA 3FHIB 2VUDA 3PUAA 2OYZA 1YUDA 3RQ0A 4AFBA 3UJOA 1MPXA 1SEFA 2Y6FA 3B9IA 1F15A 3BU0A 2RS32 1PX3A 4BQWA 5FWJA 3AVSA 1GOGA 3AK0A 4AI9A 3ACFA 3HQUA 1W8NA 1US2A 3I54A 4UF0B 4M00A 4MGIE 5FXWA 1G9AA 1SFYA 3BALA 5ACA1 3P3PA 1HB1A 1WMDA 1MQTB 2WR9A 2QBXA 4I0AA 4YLZA 3WINE 1EV11 1MR5A 3NJZA 1N1SA 4NOTA 1WA4A 3MI8A 5AC92 5KHGA 3T4HB 5FXXA 4DS0A 2VTFA 1MACA 2GDFA 4N9IA 5FZEA 5LRRA 2WT2A 4LIVA 2K2SA 4PQQA 2XJTA 2ZX4A 4DB5A 1R081 5M0TA 1UOJA 1JOPA 1XE8A 2MEV1 1LTEA 2P4EA 4Y26A 1QQP2 4OHZA 4DXTA 5CFCC 5KXDA 5FZLA 2ZPXA 1UCXA 1UY0A 5H9RA 1ENSA 2ZGPA 4EQVA 2L9LA 1HKDA 3LPFA 1O7FA 1H6YA 2ZX3A 3KV5A 5C4WA 2EAKA 1HQLA 4QPIC 4TN7A 3SCFA 3VD5A 3H3UA 2BWAA 3VBRA 1Q8PA 2GMMA 1UOBA 2WNOA 4XAEA 3ASIA 3HQRA 4AL9A 1ND3B 5D2AA 2Y0IA 2OX0A 4MGTA 1ULFA 5I8YA 1QF3A 1VIWB 5JZGB 1W99A 3ES1A 1DHKB 3HNMA 3D3AA 4LBOA 1LU1A 1UZ0A 5A33B 2G9GA 3VGIA 3BTXA 2BNMA 1ODMA 2IXJA 3FE5A 4GWNA 3D8CA 3UGGA 4COWA 3DYMA 4COYA 4EE2A 3S5AA 3QCWA 4LE3A 3ZN6B 3ES4A 1XU1A 2VCCA 1O3QA 4UFKA 1KQRA 4HL0A 3AYDA 4JGZB 4UFMA 5JAXA 2IXHA 3AC0A 4P02B 2ZGLA 5GM0A 2YC4A 2C5DA 3PMSA 4R9BA 4XFHA 5C9AB 4P9LA 3BUCA 3NNFA 4QB1A 1OVSA 4YW1A 3A4UA 1O3SA 3TEWA 1FV2A 1D4M1 3BOPA 4LBQD 1POV1 4MO3M 4ZONA 4CCLA 1AF9A 3WF0A 4AI2A 2GSYA 3IPVA 3RRDA 2HEYF 3SITA 5F5QA 1C1FA 2FDIA 4CRQA 5HCAA 2GN7A 4QQHA 1OI6A 5DDJ2 1SDWA 3A21A 3VL8A 4F8AA 2V72A 3UKVA 3MIBA 3VZLA 3I2FA 3MW2A 5FZ3A 4ARYA 1OQ1A 2VVFA 5JI7A 4XFIA 1F35A 1G6NA 3DV8A 4FP3A 5G05L 3ZOIA 2VUAA 2D7FA 3KQ4B 3T0BA 3LSEA 2X8KA 2YB7A 3NSTA 4CDQB 1FMD1 1UN1A 2BGPA 4QX0A 4CCEA 2DVDA 3ZFGC 3JCIA 1W2TA 3I2JA 2ZEYA 2ZCWA 5BNNC 4LT5A 2RE9A 1L7LA 4P9WA 2ZGRA 3AYEA 5KXCA 4GJYA 2DBNA 5FZ0A 3RI9A 3RPQA 3VBSB 2QQLA 4XYXA 3ZXDA 5FY9A 2PA7A 2QZ2A 5C3SA 4B7EA 2E51A 4NROA 3FBMA 4LORA 3M4FA 5FREA 4PBPA 4HOOA 1EAH1 2YG0A 3B7MA 1LEDA 5LATA 1RUC3 1AR93 1HV0A 2VCBA 4M3CE 2QDNA 2TNFA 4AI0A 4BQ1A 4N7UA 4YARA 2CGPA 3TN92 1RITA 1SLLA 4Q0VA 1WBLA 3CDZB 1SFNA 3M3EA 4CP9B 1JU4A 1HJGA 3WQ0A 1MZ6A 4JX0A 4N43C 1Y4WA 4Q4V1 3VD3A 1JYXA 5LEJA 5A3UA 3PHMA 1IKQA 1SG3A 3GXUA 2A75A 3I2GA 4RGAA 4U36A 4JDNA 4JTNA 4QPGA 3PL0A 3CJIB 4QD2A 1UNBA 3GDBA 1V6JA 2RMU2 1E57A 1RMU3 4ZU7A 3NJVA 4MGKE 2R49A 4QX7A 3O1OA 3SXWA 2GH8A 3OYWB 4COUA 1O3TA 3CZJA 2Q4SA 5FP3A 3CHXA 2VCAA 4JGYB 4Q0SA 3AFKA 2W46A 4JRLA 3W20A 1UYPA 2QKDA 2QQIA 5FZDA 5L36A 4OQ8A 1W9WA 1N1TA 1W05A 1PVXA 1XSQA 3VD7A 4ATFA 3UKNA 5LEKA 5FPLA 1QIQA 1F4HA 1V00A 2YPDA 3AM2A 2QQWA 4XTMA 1RB8G 1ULDA 1B35B 1VBC1 2BOJA 4FOWA 1J59A 1RUI1 4LKFA 2HJIA 1FV3A 3POEA 2OUHA 2ZABA 3ST7A 3OD4A 5BY5A 3ME2A 5FO9B 1OFSA 4EN0A 5LZ6A 3MUZ1 4JDOA 5T50A 2BGOA 4IV3A 4ZS3A 5FYZA 1H2LA 4TYSA 1W9YA 4FFFA 3KS7A 1XJAA 3KCYA 4BMBA 1RJ7A 3LAGA 2XBO3 5FZAA 1VBA1 3HD8B 4JV4A 4GIQA 3IZOA 5C4WC 4CYDA 4FXKB 1XNKA 1LOAA 1GOHA 4DXSA 1PNGA 3WVJA 2XBO2 3T0AA 4EWAA 3VBRC 2Y34A 1APNA 3C7EA 3DYOA 1AXKA 4WM8B 1U12A 1VLNA 4J25A 4PI2A 2X5IB 2ZGQA 1RINA 3JXSA 4QPYA 4NE9A 3PJQA 1H2NA 1HB3A 2YZ4A 4QAWA 2QQMA 1QJY3 2XONA 4X8NA 5FTTC 3F2ZA 5FP8A 3MPPG 2WA4A 2C4XA 1UYXA 5FYCA 1HRV3 2JD4A 4J1WA 2J1TA 2WFF1 4Y1VA 3RGBA 2E7AA 3SEEA 3OPTA 3FLRA 1QOOA 1QJY2 3K3OA 1RIRA 3E6DA 4KU7A 1BMV2 3MFCA 5F32A 4K40A 4CEWB 1XE0A 1W39A 2ATFA 2OS2A 3MEPA 5HBAA 1WUVA 4GB33 4MXVA 3W5MA 1H2MA 3LSDA 5DUUA 4LA2A 2JKBA 4FFHA 4CU8A 3ABZA 3WNMA 4NHLA 4IEUA 3VKLA 3WR0A 5K0UB 5E89A 4OHVA 1KS5A 3AX4A 1XSRA 2WZ8A 2BNOA 1Z7S1 4HN1A 3LQCA 2A3XA 4LQRA 3CEWA 3EO6A 2RM23 2HWC3 1HIXA 4PDWA 4EROA 1YWKA 3RSJA 1R093 1MEC1 5DDJ1 5FZOB 2E7QA 5I8SA 3D0SA 1XRUA 4HANA 3MYXA 2ZKLA 4A3XA 4F83A 4GXLA 2B39A 1IOAA 2VOXA 1ND3A 2RM22 2WZR1 2D44A 2HWC2 4YM0A 5GZFA 4MHUA 3WXPA 3LA7A 3ZXFA 4EYUA 3I49A 5FY8A 1MS9A 1JYVA 5LA1A 1MS3A 5A33A 3U37A 5A7SA 4BZ4A 1VRH3 4LBKA 5HI0A 5FZHA 4DRRA 1LECA 3INAA 3PTRB 4WM7A 3UT0A 3ZN6A 3FHAA 4JVAA 3VKOA 1GP4A 2B42B 2MHFA 1CX4A 2D6KA 3P5BA 2E26A 1EUTA 1FPN1 1R1A3 1VRH2 4OI4A 4CCCA 1NCQA 2RV9A 1RUH2 4X8PA 5C9AA 2FD8A 4DUVA 1W8ZA 3Q8EA 2AH2A 1OUSA 4MGYE 3RI8A 1AL21 3R05A 1IQAA 1PIV3 4Q4W1 4KQ7A 1S1AA 2R061 1W2OA 2DV9A 3ENRA 1DLLA 1C3HA 4BCUA 1R1A2 1ULOA 2D5HA 1VE0A 2R0FA 2AZ5A 3M3IA 3FC0A 3POBA 5FPZA 2XJVA 2BQPA 2GC0A 2W1SA 4IGQA 1WW4A 2VMFA 3TN91 1PIV2 5T5LA 1PM7A 2YBKA 4AVSA 4HVOA 1ASJ3 5C71A 1IS5A 4GMP3 1AR83 2WO2A 4HLTA 2QQKA 1CZSA 2Y38A 3GZUC 4KBZA 4QGLA 4N53B 3VDAA 2WO7A 4CDQA 4D7SA 4BLJA 1OLMA 4BISA 2AUYA 3K48A 2QE3A 2WWJA 1NAEA 1K12A 1ASJ2 4YG3A 4Z92B 4N8MA 4FFIA 4ZHNA 1AR82 1ZBA1 1I1EA 1Y3TA 2Y60A 3DKWA 3I2KA 4LA3A 4GKXA 2QQNA 1FOD2 1QDOA 1YHFA 3E5XA 5GLVA 1O91A 1Y9MA 1ZA7A 3VBSA 4GH4A 1VJ2A 1AR61 3U75A 1NCRB 3N7MA 1LOFA 2BW8A 1SQ4A 1J3PA 3VD4A 4L8QA 2IXIA 1JZ7A 3N7JA 4RGGA 2Q30A 2RS51 4N9HA 4QDSA 4YZ4A 3QLQA 1BVP1 4IV3C 5D21A 2CAVA 5KHJA 1COV2 3J7NA 2JB8A 1UWWA 4AQ6A 2ETEA 4IW3A 2RDQA 2LRPA 5FLIA 4X6QB 5LBEA 1JZ8A 3AYCA 4Q29A 3HT1A 4K21A 3RZHA 2ZX2A 1PO23 4BQ2A 2V4VA 1UD1A 4FPCA 5AVPA 3IBMA 1CQ9A 4QMAA 1W06A 1RUOA 4IEZA 1CAWA 1QJU1 1SPPA 2B45X 4K1ZA 3KV9A 4YFWA 5FY1A 5FZ1A 4OUEA 1W0OA 3LEKA 3M3QA 1H4HA 4CUGA 3D6EA 1QH7A 2WDBA 2XKPA 2R1BA 3OYWA 3VBUC 5F5IA 4GD4A 3VBHC 2ERFA 4LKEA 4JGYA 5C8CB 5CKQA 1TME1 2TUNA 2XGXA 4DEVA 1RTVA 3WP3A 1OOPB 5EWSA 4RHV1 5FYSA 3BTZA 2Y6LA 3K4AA 3ZR5A 1UPSA 2HWD3 3C7FA 1POV0 2FCTA 2W68A 5JWPA 1XU2A 4Q26A 3ZFFA 1B09A 4Y20A 4BQXA 3U07A 3UETA 3MICA 4GZ9A 5DAWA 4OHWA 5IVYA 3RZLA 2D3SA 4FPKA 3ACIA 3Q9OA 4CA9A 1A78A 4JZRA 4C1XA 5A7OA 1RUE3 3LIHA 1ZM1A 2BEOA 3Q8CA 2I2SA 2BJSA 3WW3A 4V1PA 1SACA 2Y8KA 3MIFA 3C8XA 3URFA 1JUHA 3N9NA 5JOWA 5FPXA 1FT9A 2ADDA 2SLIA 2ZS6B 4FXGB 3WSOA 1IKPA 5FZIA 3PU8A 4QM8A 3VN4A 3ZXKA 1A6CA 1AYM1 2W1QA 1QXPA 1VPHA 2WJSA 4FQ4A 5F6LB 4IERA 3ZDVA 2PHFA 1HQNA 4PDWC 1POQA 5L9BA 5FUNA 3VHPA 4DFSA 2QQJA 5H9PA 4LULA 3IM0A 2FDKA 2W9XA 2WLQA 3CMGA 2D6MA 5LK5A 2D40A 4LEJA 2F17A 4M01A 5GZCA 1HRI3 2DCZA 2XB6C 4NRQA 1CD3G 1ND3C 2BNNA 3MLJA 4Y5SA 5FMCA 1A3KA 1QJX3 5FPAA 4HFSA 3GGLA 3TWIA 5C5UA 1JZ5A 5SV8A 4G4FA 3BU7A 1Q3EA 4M3CF 3WHTA 1BYHA 2VMHA 5I0DA 1HRI2 1RUD1 1C8M1 2OXBA 2R6QA 4NHKA 1YO8A 2Q1MA 1W0NA 1QJX2 3FN9A 3WD5A 1XNCA 3NAPB 5C9AC 1NCQC 1PGL2 3ZVXA 3MLLA 1QEXA 4YVWA 4RQPA 1S0EA 3EYPA 5FFOC 4CEWA 3HT2A 5JR2A 5A6XA 2JKXA 4FSJA 5FOBB 2JE7A 1W2AX 3MV11 3RFRA 3BGAA 2QCSB 1RUH1 4MZUA 2CSGA 4P5YA 1Y43B 1PVC2 4PF1A 1UIJA 3GJBA 2YC0A 1NE6A 4XUTA 3O1UA 1ULEA 4YGEA 3T30A 5JIAA 4D7TA 1AX0A 3TOJA 4I01A 4FO9A 1GKBA 3PMEA 4LBQB 1YIPA 2XWBB 2AYHA 1HB4A 3ELNA 4S2FA 2EXJA 4COVA 4LBMA 4IE4A 2YGLA 2VBBA 3IDAA 2YPJA 3J8F3 3ZDSA 4AVAA 3KF3A 4LTAA 2VQUA 4GULA 4CDQC 3RZJA 5FUPA 3FX3A 2BVVA 4RSUA 5I93A 1N3QA 1Q8VA 3FL7A 3WCRA 4HZFA 1GSLA 5FXZA 4EZ4A 3NNLA 3EXUA 2NYYA 4Y4RA 2EICA 2ZHNA 4W6YA 4FPJA 4GH4C 4MYEA 3VBSC 4AGRA 1CJDA 4LKSA 1LOFC 4DEQA 4HETA 4OUSA 3KV4A 1NY71 2N7GA 5EZWA 1AXYA 2VCMA 3SC7X 2WSVA 3FUOA 3U14A 4XF9A 2X09A 5A1AA 1F5FA 4RA0A 4Y5Z0 4UFHA 4YW6A 2RR11 3WNKA 1QH6A 4K20A 3HN3A 5D8AA 4MSVA 1UXZA 3CKHA 3RYPA 3JD72 4B4RA 2JECA 1URXA 5CIRA 1Q8SA 1YYNA 1LOBA 4HSJA 1COV1 1LULA 1CAXA 4XFBA 5FK7A 3WW2A 3RZGA 5A7WB 4JC1A 2ZJCA 4XDPA 3VHRA 5FZGA 3VHOA 2IXLA 4O9EA 3FLTA 5IVJA 2PHTA 2RS13 2JENA 3TRSB 4ET7A 2W87A 1ULPA 2MEV3 3GBWA 1QXRA 2ZEWA 2EIDA 4IE5A 4JGYC 1ZBE1 3UNPA 2FCVA 3M3OA 2UURA 1X9TA 4XCBA 3PIGA 5L7OB 3O1RA 5LA0A 1GP6A 4R4ZA 1QKQA 1LHNA 1SBEA 5BNQA 4NIIA 4FI9A 1UY2A 4Y22B 4Z2AA 2VMIA 3W9AA 4O65A 4QHZA 3I3MA 2CDPA 2ZXQA 4OI1A 4Q2FA 2CGOA 1TMF3 1NCRA 1ZRIA 5DPNA 4H3WA 2G1MA 2CL2A 1DBNA 2VZTA 2XVLA 4NJ4A 4Z07A 5GZDA 2YY1A 3TEXA 5E8AA 1ZRDA 3E97A 3U78A 1L7RA 5CAZA 2ZX0A 4MUVA 4P14A 3G7DA 3JQXA 1TMF2 2GP5A 3IDCB 4CCDA 5IATA 1ZZ9A 4ZY9A 5JUVA 1PMIA 5JOXA 3T08A 3ALQA 3Q8BA 1M4WA 1A34A 4AZZA 4IEWA 4TTGA 1VMJA 1H30A 1UXXX 4FFGA 1AYN1 5FZ4A 1V9U1 2XUEA 3DEMA 1NUKA 1D4M3 5IVVA 1J83A 1E5SA 1YCIA 1W6PB 1L3JA 3GZEA 2VNRA 3K75B 4PQ9A 1T6GC 5SV5A 2GAUA 2ZHLA 4YW7A 4L11A 4YW5A 4WM8C 5BV6A 5CEHA 3UGFA 1PGW2 2OPKA 5BPXA 4D8MA 1LGBA 1ZNPA 3ZIXA 5LK7B 1HXS1 1X8MA 4A6OA 4MOAA 3MPBA 3T1LA 1R1ZA 1OOPA 1WMXA 3USUB 5JXJA 1LGCA 5DZGA 4YGBA 3HOBA 1LHOA 5J36A 3AZWA 3SQOA 4LK6A 1ACCA 2J42A 2J7MA 5LW9A 5A3WA 2JIJA 5I0TA 5JMCA 5LCWL 3ZFGA 3ZO0B 5CISA 4PIXA 1EPWA 4RS5A 3BVCA 3WEZA 1JODA 2A7AA 5J3UA 2JIGA 2Z42A 1C5IA 2JDZA 2QJVA 4R9AA 2G4IA 5BNNA 1JH5A 4CEWC 2G9ZA 2CV6A 2VZVA 4RR3B 3FWEA 4OMDA 1ONAA 3W59A 4NMIA 1V6MA 1HW5A 5I0SA 3JU9A 4CUCA 2GP3A 2PELA 2UWBA 1HQWA 2NP0A 3LCPA 1AR71 4LLFA 3AMPA 1FAYA 2R0HA 2WNUB 4L99A 5K0UC 5FJKA 4AR2A 1D4VB 4LO4B 2J1VA 2WS93 2HWE3 4YNIA 5T52A 3TNQA 3WW1A 2WQZC 2VC9A 3HQXA 3K4DA 4DO0A 1EAH3 4XCAA 3LIGA 5T54A 1H8VA 3N36A 1NT0A 5FY0A 1UYYA 1QNYA 3THDA 1DGLA 4WBBA 5H9QA 4N43A 2WS92 5F3CA 2HWE2 1DU3D 5T5JA 2F4LA 5JOYA 1VBE3 1M06G 4Q4V3 4AQSA 4IGPA 4AOCA 1OMIA 5JIUA 3OJBA 4UT5A 3O14A 4Q5OA 4QGNA 1F8VA 4XF4A 1D0HA 3MLKA 1O4TA 4M3CB 2BFUS 2P3JA 3HEIA 3KCXA 4HMZA 1JZ2A 1VBE2 3MV01 3OUIA 1PO13 4XDQA 3B9CA 3RZKA 5CNAA 4HKOA 4OZXA 2UU8A 4OQ9A 3APBA 3VBFA 2FQPA 3NAPA 2VAUA 1AX1A 4P00B 4R9CA 1OT5A 3VDCA 5F7UA 1WBFA 2HWB1 1PO12 4JKLA 1MS5A 2XHNA 2QQVA 4HVQA 1Q56A 2BOIA 4PI0A 3OEAA 5D8AC 4YW2A 2ZGKA 4S2DA 2E33A 1PMHX 3CJXA 4XOGA 5LB6A 4NIAA 2ZEZA 1VBC3 5EQUA 5T55A 3FBYA 3WQ7A 1RUI3 2A6VA 1GZTA 4E4SA 1OD5A 3H8XA 3E1F1 4C90A 3F95A 3JD71 3HMYA 1WWYA 2WN3A 3OUHA 4OCTA 1CAVA 2OQ6A 3JUUA 2BZDA 3WDTA 4C8DA 1TNFA 3ZSEA 1WD4A 4IE0A 4Y1UA 5E88A 4N53C 4XVHA 1SZBA 1E5HA 3OUJA 4N7IA 1W9FA 3NNMA 4JTOA 3RZMA 2GH2A 2EIGA 3U4XA 2ZAAA 2ZGNA 3IMNA 1FXZA 3J7MA 4HT1T 3AL5A 4KGQA 3NV2A 5FKBA 3H50A 3V65A 4XETA 5FCCA 1OF3A 2FDJA 2P6CA 4Z2WA 1NCRC 1GQHA 1LRHA 4AEJA 4UFIA 1XNTA 3O1MA 3ZKUA 1ND2B 3WNPA 4H2AA 1REEA 1UMIA 2CYFA 2VH9A 3ZXLA 1DIWA 1RHI1 4EN6B 4OHYA 5IHRA 2J22A 2WFF3 5IT6A 4FPEA 5DAVA 2VTXJ 1OC1A 3NNGA 1YQ8A 4LMFA 2A3WA 2Q1FA 4QX5A 5L19A 1XQNA 2MNGA 5A1FA 5FAXA 4CDWA 4L97A 4ZU5A 2LTNA 1YJLA 2E6VA 1VAVA 2HEVF 3AP6A 2QDRA 4EN8B 3AZXA 4Q4Y3 5AVAA 2HH9A 1Z7S3 3ROUA 1VBB1 1S2BA 2JDKA 2WL1A 2RJ2A 3KD4A 3W21A 1XNDA 3LDBA 1E5RA 1OOPC 3ZXEA 5L7OA 1YXWA 2D5FA 1ENRA 4XMAA 4Q4Y2 2NN8A 4LJHA 3H8OA 1W8FA 2QUOA 1EUUA 3TEZA 1BZWA 4XTPA 3VV1A 1D0GA 4RS5C 1W3VA 4XABA 4WZCA 4R52A 3RVHA 1RUF3 2WLPA 3IKWA 3JQWA 3CQOA 3DKQA 2WSUA 1IS3A 1CAUB 1BEV1 2GNMA 4AFCA 2R041 1W6MB 1E5IA 5C3PA 2VZ3A 1RUF2 3WNNA 5KXBA 1IZ3A 5JXIA 4LO5B 4UW3A 3WX5A 3AKQA 3DPRB 4CDUA 3IIIA 2YYOA 3RG0A 1CESA 4YW3A 5DUWA 4BA6A 1OPOA 4BU2A 5ABJB 1JOBA 1DQ2A 1W6PA 3S0MA 2R063 1LHUA 3POFA 1JZ4A 1J1TA 3PUIA 3ZYBA 4I30A 2WBKA 2WUHA 4S2HA 4XPVA 1RUC2 1AR92 4P9GA 1S0BA 2NPIA 2X10A 3AMNA 4KG0A 3L2YA 1ULCA 2B7YA 3U0ZA 1C57A 2VOVA 1DYKA 5F2SA 1LJ7A 3PUSA 5BXXA 1BBT3 4IE7A 1GUIA 1MVQA 1NXD1 4INDA 3O1TA 1RJ8A 3USUA 2VMGA 3MIGA 2DUOA 1QMJA 1NYWA 2E63A 4JAAA 2W1UA 1O3RA 3LF7A 5C33A 1JUIA 3AMMA 2W0XA 1GOFA 3PUQA 2DVBA 1QDCA 1UY4A 1RMU2 3MF9A 4H7MA 3VBFC 4BQYA 3NAPC 2O14A 1BBT2 1CWPA 1SMVA 3MIDA 5B2GB 1TVGA 4PBOA 5FP7A 2Z2SB 5FY4A 5FZ6A 3H7JA 5IJRA 3ZFEA 4E2QA 3TAYA 1CZVA 4RR3A 2EF6A 5LASA 1AZDA 2OKXA 3O12A 4AG4A 5I0UA 4CCKA 1VP6A 4GWMA 2XMLA 2XQXA 2ZMLA 4IQPA 2XG3A 4P9JA 2RS31 4HPKA 1I5PA 1IPKA 1IGOA 4BH9A 3V0BB 2JG9B 4QQOA 1JHJA 2FCUA 3LEGA 4CU9A 1ZZ7A 4META 4SBVA 4CCOA 2JDNA 2W39A 1YFXA 5IVFA 2E9QA 3N9QA 3BB6A 2KR2A 3SMHA 4M4RA 4UAPA 2VW2A 1OFNA 3RNSA 4EN9B 1EP0A 1AJOA 4HONA 2AEYA 2I07B 4BB3A 5AC91 5C6CA 1MS8A 4CEYA 2YC2A 2XJUA 5JSRA 2IUWA 1ZRCA 2YDEA 4FBFA 1NA1A 4WVWA 4WVMB 2VQ0A 1QQP1 2BDRA 5EXOA 1PK6A 4DRVA 2IC1A 5KHHA 2C26A 2ZGMA 2XHKA 5FRAA 2FDHA 1LEMA 3N3HA 1W0PA 2BRTA 1GLHA 3AZYA 3H9AA 1VR3A 3VBUA 3WUDA 4D3WA 5LRSA 3VBHA 5EJ3A 1KS4A 4O7XA 5KWRA 2W52A 4Y3OA 3NJXA 3OF1A 2NMNA 3I4IA 3T3YA 5EJZB 5DAXA 1OPMA 1SLIA 3NVCA 2DUPA 1JMUB 3T09A 3EBRA 4QX2A 4RHV3 4IV1B 4J1XA 3RYRA 2GALA 2PHWA 2Y6GA 4RYDA 3WDVA 2F4PA 3EMRA 3JB8A 4JHTA 1OVPA 4UF0A 4Y24A 4I02A 3S7EA 4AF9A 5CA6A 1MQTA 5FZFA 3I3DA 4XZUG 1PNFA 3B01A 3WW4A 4FPHA 4UBGA 2ZX1A 4Y1XA 5IK5A 2YGMA 1HRV2 5DQ0A 3OBAA 2VBPA 4LK7A 2BTVC 2LM3A 4BK4A 4CDWC 2FZ1A 2CU5A 4RGKA 2Y26A 4LE4A 5A3LA 1HDKA 1QOTA 3KT1A 3J4UH 1W6OB 3HWJA 2XJSA 2XQRA 3POJA 3C3VA 5FK8A 1Q8OA 1W6QB 2YUEA 5FMBA 4QB2A 3ETPA 4DY3A 4MADA 2VVEA 4GB32 4CPBA 3CNAA 3PNAA 2OZ6A 2VGDA 5L7OC 1S0DA 2Y6KA 3QOPA 4XAAA 1K5JA 4ISQA 4Q0PA 1H1MA 4C1WA 3PIJA 3BTAA 1TNRA 3LA3A 3SNMA 5E1RA 2K46A 4RD7A 4CTEA 2D43A 3ZYFA 2DBIA 3BN6A 5JZGA 3ILRA 1R092 3VD9A 2VNOA 5JMOA 1OLME 1ND2A 4PIZA 4MH0E 3SH3A 3WLUA 5DUXA 3VZNA 3OGGA 1F31A 4FPOB 5B4NA 5HV4A 1U5ZA 3GYDA 2J1EA 3I2IA 2R30A 1RUD3 3ILFA 3OTFA 3OPZA 3RMXA 3NQHA 4JGZA 3VZKA 1KEXA 2UYAA 4CXXA 2DYCA 4ZZ8A 4OULA 2R073 2Z69A 4IESA 4ZXEA 2O8OA 3BPZA 3NWKA 4YM1A 3VL9A 4B8EA 2YBSA 1JS9A 4CDUC 4DXZA 4K8FA 4E4DX 1XPWA 1JTZX 4H7LA 2VXRA 3ZM8A 2ES3A 2WRAA 4NHXA 1VMHA 2ZZJA 2Q8OA 1UX6A 2ZGSA 3DXTA 4KWJA 3T2PA 4GA9A 1DFQA 3JBG3 4QPWA 2UWAA 4HKWA 2HWF3 2GNBA 3WP6A 4YVSB 1W8UA 3ZX7A 2AC1A 2JXAA 1N3OA 5FYVA 4YGCA 1AR91 2V09A 3JBG2 4QKFA 2FZ2A 2JJ6A 1WCUA 3NKGA 1KD7A 1OH3A 5FYHA 3WY6A 1RVF3 2HWF2 2RMU1 3D5OA 4I09A 4MLOA 4UWDA 1ZRFA 2XWJB 3I7DA 1W2NA 1SBFA 4AI1A 3U1XA 4JRAA 2XUMA 1TQ5A 5DN2A 1OQEA 2BV4A 5IUQA 1BLZA 3GZTB 1YC61 4OI2A 1OA3A 3ZFEC 4RR3C 5CKNA 1U0AA 4L9BA 2XJRA 4NO4A 5CADA 2VM9A 3O1VA 2WFPA 3WP4A 2P5BA 2PHLA 1RUJ3 4ZS2A 1V6KA 2EAAA 4XXPA 1W6MA 2J1RA 2WNUC 5A6ZA 3AZVA 1G9BA 2HKXA 2HLEA 1S4CA 3PURA 5C7GA 1GQPA 2W47A 4LIUA 3SISA 4XF0A 1LOCA 1U5YA 1H1AA 3WZ1A 2DF7A 4XILA 5FO7B 1JYIA 4LBLA 2XVKA 3DPRA 2EA7A 1RUJ2 4CCJA 4URAA 4CP9A 1PZ8A 4QPIB 3BIWE 5ABJA 2V5DA 5F5CA 2RR13 2JWPA 1LGNA 1RXGA 3O7OA 2A6ZA 2VVDA 1WLCA 1HB2A 4CEYC 4Q8KA 5CB7A 5A32A 1NA1C 4XEZA 3I3EA 4XUNA 1RYYA 3CJIA 2PLV3 3MDPA 4NWWA 3AYAA 5CZKA 4YRDA 1HLCA 2ZMNA 1V0AA 1PK6C 3GM8A 4AEDB 3GZAA 4FTBA 3THCA 1V6OA 1PO22 3ZYJB 3H42B 4IEXA 4A4AA 5JXGA 5KBFA 2B4KA 3IT8A 1UMHA 3MUY1 2PLV2 5DZEA 1F2NA 2XBO1 4QDQA 3ZYRA 5I8TA 3AP5A 3S57A 4MXWB 2X29A 5F8PA 3KWVA 1AJKA 4C0HA 4AHWA 3L9JT 2JDPA 1H1IA 4LBJA 4E8CA 1WGPA 4Z82A 3WP5A 3SH5A 4CCNA 1W6NB 1O8PA 3ZPOA 4FPYA 2ILMA 3N4MA 2ORZA 3PUHA 3V56A 1S0JA 1B35A 1JYWA 3OBZA 3GCWA 1MQTC 1VBD3 2GNDA 1OHFA 5A7PA 2BGCA 3PU3A 3ZYHA 1LHWA 1TEIA 2BUKA 3WNXA 5GLWA 4B3NA 2HWD2 5EPAA 5BNPB 3FUQA 4B1LA 3V0BA 1WW5A 3IAPA 4IL7A 2G9FA 3LFMA 4FVVA 4AE2A 2Y0OA 1QJY1 4QQ2A 3OB8A 1BMV1 4QX3A 3UV9A 4P08A 1VBD2 2W95A 2C1FA 4U2AA 2FMDA 5JPNB 1YFWA 1RUE2 5FR3A 1S2EA 2ZEXA 4A42A 4BIFA 5FZCA 1OD3A 1Y9GA 2ENRA 4XW3A 3A23A 3OOXA 1UIKA 3QACA 4WVMA 1VAKA 2KD7A 4K7JA 1SHWB 5C8WA 2R1DA 4LUKA 4R8HA 2IZWA 5ANQA 3H7YA 2W92A 2AEZA 3G6JB 2EXHA 4WM8A 4CXWA 1XE7A 2DVGA 2NZ9A 2X5IA 3U10A 3WDXA 3ZLIA 5JZGC 4N90A 1UZZA 4WVVA 5GLTA 1H8TB 1ND2C 1ZVFA 1WMFA 1AXZA 1OBNA 1W8OA 2OQ7A 2RM21 3RS6A 2HWC1 1WCQA 2DFBA 4NAMA 1L7QA 1R091 3S7IA 4BWOA 1CR7A 1LHVA 5KC6A 3H8RA 4HG6B 4E2GA 4JGZC 4PF5A 2JDUA 4WVZA 4FTSA 4KNCA 3ZIWA 1MVEA 1UMZA 5KHIA 2V5YA 4BDVB 3O0XA 4FAHA 1Z78A 3IIAA 1UZYA 4YGDA 2DCYA 2NMOA 5CU1A 3OGJA 4NHMA 5C3OA 2VOTA 4Z8BA 2IVIB 1D2QA 2PHRA 2OW4A 2WC2A 1VRH1 5T5OA 4CDXB 1CX1A 5K4LA 3VZOA 2YXSA 3HN1A 2J1SA 1NQJA 3ZSMA 3ZXJA 1W6OA 4FP2A 3I3BA 5K0UA 1UY3A 1RUG3 2HYKA 3I2OA 1OXCA 1F5JA 5C5TA 4Y4YA 3POGA 3B94A 4AFMA 5LA9A 1R1A1 2AENA 1WLTA 2OT7A 2E53A 4HKLA 4K1YA 5T3NA 1UQXA 3MGUA 5FZOA 2ARXA 3C7HA 4RN5A 1RUG2 1PIV1 3CIHA 4CUBA 3FMGA 4LXLA 2H6CA 1JU3A 2W5FA 3H3LA 5K9YA 5FDBA 3LDRA 1C5HA 4URTA 3RJRA 4XBLA 1C28A 3LB9A 3ZXAC 4XF3A 3HNBM 2A6YA 4LR4A 4CCMA 3J8F2 4AQTA 5J48A 2C6SA 5FZMA 2DCKA 1WMEA 2Z4FA 1ASJ1 1W9TA 4W8JA 1NZCA 4B4QA 2F6BA 4GMP1 1AR81 4NPMA 5G04L 3VKFC 1WZXA 1XBFA 2VOKA 4Q4X3 5FV3A 1Z0HA 1G9DA 5J37A 1FOD1 2D6OX 3DF0A 2YV8A 2WQ4A 1UKRA 2XLFA 4LLOA 2XL9A 4NIDA 2WKKA 1UU6A 3HR9A 2JE9A 3BTYA 1SDDB 3SLIA 3DPRC 1UX7A 2PXJA 2HWB3 5C4WB 1SLTA 4Q4X2 2OVUA 1EY2A 1G8WA 4XFGA 4XXAA 5ABJC 5JPMB 1C4RA 1OKOA 4XDOA 5ACA3 4FOYA 1FATA 5A7QA 2JD9A 1EV13 3PJYA 3VBOB 2A5ZA 3CJIC 2XJPA 3J7HA 4LOTA 2RG4A 4Q0UA 3IDBB 2WN2A 2GNTA 4KL1A 4KMQA 2YU1A 4CP1A 4E27A 3NV4A 5FPUA 1R083 5J7MA 2K0GA 4E4HA 5CYYA 4N53A 3AKRA 1EV12 1S55A 3KM5A 4BMEA 3NV1A 4YZ1A 3DCQA 2XH6A 4BQ5A 4JQRA 1MZ5A 3ACHA 2CWSA 5K7PA 2IVJA 4NPLA 2RS12 4BXSV 2W3JA 1IQDC 1R082 2PFWA 5F2WA 1YRZA 3SKJE 1GYKA 3CLPA 2MEV2 3LOIA 4XQWA 3WG2A 4Y5TA 2JICA 5F1RA 2LROA 4IDZA 3K4ZA 3R6SA 1SLAA 1B35C 3EB7A 3MFAA 4XUPA 5F3GA 2SBAA 4GALA 1REFA 5CG9A 2JB4A 5L9VA 2AACA 1IHMA 3HBKA 1UAIA 2JG9C 5CVRA 2E31A 3C7OA 1QNWA 1VRBA 1W8HA 2K9ZA 1KXGA 3PTYA 1T2XA 2J1AA 3KVAA 4D69A 4YSFA 3AKTA 5DABA 3CO2A 5A80A 3BYWA 1XNAA 4BLIA 2DVFA 3THPA 3ACLA 3M70A 4ZU4A 1N1VA 1SLCA 1IPJA 3T1MA 4QDRA 3EJKA 4NAOA 3MW3A 2EIEA 2HYXA 3T0DA 1RGSA 2C9KA 2IXKA 3MIEA 3QBQA 1POV3 1NE4A 4AEDA 1DP0A 2JG8B 2OUJA 3S5QA 3M3CA 4OYUA 4QXCA 1X9PA 2WT1A 1AUYA 3T2QA 2Z5WA 2X5IC 3UYJA 1GBGA 4DQAA 1CJPA 4QWNA 1D4M2 2EXKA 5C8CA 1GWKA 1EYBA 4KWUA 2VW1A 5F39A 3BI3A 1MS0A 1YQ6A 4XBQA 3B69A 3UK9A 3THTA 1DGRN 1X36A 3VZMA 3WF1A 1BCXA 4CP0A 5HV0A 5HXMA 1LNSA 3DXUA 4ASLA 1FMD3 1MZEA 1A8DA 3POSA 4A7KA 5GALA 2W2IA 3AL6A 3PVOA 1HRI1 1OUXA 2ID4A 2ZGTA 1LKNA 2CAUA 2R7EB 1J3QA 1K3IA 4Q27A 2WWSA 2PHXA 4RFRB 2BBVA 1JBCA 1QJX1 4QPGB 2GC3A 2B9UA 2OA2A 4YZ3A 3NKTA 5F5AA 2BERA 4LBNA 1PGL1 1FMD2 4K3UA 2BU9A 1XOYA 1MS1A 3FFZA 3AZZA 4G3YC 1V6LA 2GMEA 4E4ZA 5FYIA 4K9SA 3L2HA 4QHBA 2O0OA 2IFRA 3NO8A 3RWKX 4CSWA 4YWAA 1QXJA 1PVC1 3POYA 4XMIA 2D97A 1O59A 1OURA 4OFGA 2Q8CA 3ATGA 3TB0A 4AVCA 2LW8A 4EWDA 4QKDA 4XJ9A 5A3MA 2WO3A 1QY4A 4XQDA 4EJRA 1WCSA 3D4KA 4QT6A 4ONUA 2WA3A 2ZHKA 5LBCA 1CVNA 1EAH2 3NNJA 4JQTA 2C9AA 4RFT0 4QXKA 3RMYA 3BPSA 3PVEA 3R0RA 1DZTA 1MS4A 1OSGA 5LBFA 4PCRA 5DAPA 5BNOB 2IWGB 4Q4V2 4YFZA 2D6PA 1SFPA 4QKBA 2JX9A 2H0VA 2E32A 5IAXA 1QWRA 1JHNA 4NVPA 4JKKA 1KGYA 1ZZ6A 4OLLA 4C0BA 1ZA4A 5JSPA 3LOBA 3I2HA 4NHYA 1CONA 2VJXA 2ET1A 3RYKA 2DTYA 1K5MB 1RXFA 4XJUA 4CU6A 5CFDB 1GANA 1NKGA 1X8EA 2DU1A 3FJSA 4CDXA 2AREA 3ETQA 5EYXA 3IAQA 5FUIA 4XACA 1VMFA 1TG7A 1UL9A 3V0AB 3MW4A 2P37A 2A73B 3N9OA 1GZ9A 4LBQA 5FQ0B 1JYTA 1S0GA 3N7KA 1DYPA 4IXLA 1VBC2 4YW4A 1J84A 1RUI2 5E16A 5A3TA 3KZ4C 1S0IA 4OHXA 5FMOS 5AC93 3DUIA 1GP5A 4PIYA 4UFJA 1VBA3 5C70A 4LO8A 2CWMA 4WZFA 1WCDJ 1QQP3 4BK5A 2CGNA 3AP9A 3CF6E 4ITCA 4E8DA 1W90A 3WNOA 1VBA2 1ZZ8A 2VTXA 2GU9A 2RS11 2A71A 3N7LA 4OI0A 1OA4A 4LOSA 2PTMA 4ZPIA 3U11A 2A1XA 2CTVA 3WG3A 5AFEA 5JI9A 5FXVA 3VKNA 4SLIA 4TXWA 2FDGA 2D6LX 4D94A 4PDWB 2CDOA 4GWJA 5F6KA 1GMMA 3BCWA 4KWLA 5FY7A 3LZZA 1C1LA 3FZ3A 5D1IA 4X6RB 4XHBA 4I0BA 4YYOA 1ALYA 2QQOA 5LY2A 5A3NA 5IVEA 3DN7A 1AHSA 3GF6A 1TMF1 4PLNA 3GJAA 4BIOA 3OBRA 3EHKA 5A7WA 3VBOA 3RDIA 4AEDC 2P3YA 3T2OA 5HCBA 3GHNA 1Q8QA 4LHLA 3KMHA 3ZPYA 2B46X 2WFF2 4B4PA 3ZN5A 1S0FA 3DECA 1S0CA 4WM7B 1LAJA 2YROA 4Q8LA 3U4SA 3H0OA 3J26N 5C8CC 5J98B 4D7YA 5LY1A 2ZACA 1C8NA 1JOJA 1LB2A 1NCQB 2B8MA 1PGW1 5DDJ3 1MEC3 4XJWA 3E6BA 4HVRA 4NPRA 3W58A 1JN2P 4Y22A 1BK1A 1ENXA 1Z7S2 3DL3A 1UF2C 2WZR3 2DTWA 1LOEA 3KLSA 5EFUA 3GCXA 4IGOA 1MEC2 5BNPC 5IK4A 3I3QA 2WINB 1KJRA 3HVDA 3I2DA 3JZVA 1W8WA 3H1MA 1JI6A 1XYNA 2WZR2 1RC6A 1YNAA 3LDKA 3B3QE 2GN3A 3OGRA 4PJYA 5DG1A 4BQ3A 1LOGA 4H55A 3K77A 4QXBA 2W1WA 4YZ2A 1FPN3 4YM3A 2AR6A 3MZHA 3QH6A 2ZKNA 3C2UA 2J1UA 2FMYA 4DY5A 1AL23 2Y6HA 3NMBA 3BIEA 2TEPA 2JG8A 4MHRA 4Q4W3 4AI8A 4CXYA 1UZVA 3LE0A 5EHDA 3O0WA 3VDDB 2P3IA 5KHKA 2WT0A 4WV8A 1FPN2 1XB9A 1JW6A 2YBPA 3J9SA 4KGGA 4AEKA 4AHZA 5F37A 4CE8A 5FPVA 1O6UA 1QGLA 1SCRA 1GNHA 1GNZA 1F9KA 4GH4B 4GMP0 3TN93 3ZYGA 2VZ1A 3AMQA 1AL22 4S2GA 5FY5A 2WS91 2HWE1 2Z79A 4Q4W2 1H8TC 2R062 1IS6A 2A6XA 1CIWA 2D98A 3OSDA 3JB4C 1NZIA 1PHMA 4KH9A 4LHSA 1YI7A 2WIIB 1DQ4A 4K8RB 4Q1RA 4IE6A 1K42A 1YFYA 2RMU3 3VB9A 2ZAHA 1MZFA 1V70A 1VBE1 2VUJA 3S6PA 1X7NA 3OBTA 2P34A 3H8UA 5FZ7A 5AFBA 4XURA 1FNZA 1ZBA3 1DQ6A 4QX1A 4W65A 3T4VA 2B9VA 5IK7A 1CAWB 1SPPB 3ILNA 4LHKA 4CDXC 3ON7A 4QU1A 2RDNA 2XVGA 3KF5A 4TLGA 5CKMA 4D6RA 2QTWB 3LKJA 5C3QA 4A7ZA 1G9FA 1ZX5A 2WNUA 1PO11 1AR63 3LGRA 4ASMB 1IPSA 3LA2A 1OLQA 1ZBA2 4XZPA 2EALA 2PHDA 1G7YA 4KWKA 1X50A 3T2TA 2RS53 2PYTA 4C91A 4AXOA 4NN0A 2WO1A 4IUGA 5IVBA 4FQZA 2ZGUA 4R9DA 5FP4A 2ZGOA 5DMYA 1AR62 1YQCA 4OZOA 4ES8A 2I45A 5ERLA 1D7PM 3ZFFB 2RS52 4Y20B 5HCHA 4B29A 2BWCA 4GQ7A 5FP9A 4M3CA 4XIOA 2OIIA 1CGPA 1NLQA 4TZDA 1QJU3 2XXZA 2QQPA 4XC9A 4L2NA 2PHUA 5EP9A 5BNOA 3SCGA 5FMDA 3UGHA 1D2SA 3I97A 4XJ8A 4ZKTB 1RL3A 4M0HA 4MGQA 2QVSB 3RZZA 4XUOA 1FX5A 2VD7A 1QJU2 1TME3 2DCJA 2VNGA 4V2WA 3VLBB 2GC1A 4AEMA 1BVVA 1DCSA 1K5MA 1TZOA 5CFDA 2DFCA 5FPBA 1UKGA 5FYTA 4UW4A 5JDBA 1W8TA 1BJQA 5JR7B 5DG2A 3Q8AA 1TME2 4QGMA 3R4DB 2EIBA 4RHV2 3VBOC 4XJZA 2E7TA 3Q8FA 3TYJA 3V0AA 1GU3A 3CL1A 1G9CA 3GHMA 5FQ0A 4Y1ZA 1DGRA 4AVBA 3N35A 5FYBA 1AL0G 1J3RA 3WQBA 5J96B 4ARXA 1AYM3 1A8MA 2WNVB 4CUAA 2YMZA 4XFCA 2VY0A 4ASKA 4QX8A 1KITA 2XR4A 1JYCA 3OEBA 5FZKA 1QJEA 2CY6A 4YVWB 2WZEA 3OGVA 4RQPB 3X29B 3AFGA 3WNLA 1H0BA 4L0PA 2AGSA 3VDBA 1AYM2 1GZCA 4LO6B 5A6YA 3KQRA 1ULGA 4QM9A 1ZYBA 4UXAA 3VKMA 4QQLA 4TLFA 3GBGA 2VE1A 1ODNA 3KT7A 5EIYB 4Q4Y1 2ORXA 1WW7A 1DGWX 4XF1A 4CZSA 5FIXA 4GJZA 1BHGA 5GZEA 2O8QA 3I59B 4AGVA 3ZKYA 2JDYA 2WABA 3WDWA 4FCAA 1OF4A 3NJYA 1C8M3 5A3OA 1HJFA 1KJLA 3B93A 4DOUA 4K6BA 3AB0A 3WHUA 2PMWB 4MGZE 1WLWA 1XC6A 2Q8DA 3PVBB 1PZ9A 2IXCA 1RUD2 3NL1A 4HN0A 4LO7A 1C8M2 1LU2A 4A6SA 1RUF1 2VMDA 4MV2A 4XFAA 2JG8C 4BM8A 4DPNA 4PLMA 3O0VA 4CP2A 4AK3A 1UOFA 2VXJA 1YIFA 2VZQA 3HJRA 5FJHA 3KCCA 1RUH3 2R072 5A6QA 2ARAA 4J6GA 1H9WA 3KGLA 1DQ0A 2GC2A 2GMPA 1O8SA 3ECQA 4LITA 3AKPA 1R64A 1PX4A 3BOWA 1W3XA 1OLRA 2XLGA 2R16A 3D0JA 3OGSA 2ET7A 4FAGA 3WCSA 2VULA 4KBBA 1RUC1 3E5QA 4R4XA 1CPNA 4BJ0A 3CU7A 4P9XA 1NLSA 1WA6X 5GZGA 3IN9A 3BKZA 4FPGA 5D8AB 5H9SA 4OVEA
chains in the Genus database with same CATH topology
1GFF2 2OZJA 3KGZA 2ZTNA 1CAXB 2W08A 3RJ2X 1U5IA 2D3RA 4QPGC 1RVF2 1RMU1 1BBT1 1U5XA 1CAUA 3NW4A 4MVTA 1LODA 1ENQA 2BFUL 1ZZBA 1J58A 1DDLA 3WDYA 5CFCB 4LHNA 1FOD3 4W6XA 1V6IA 1SLBA 2VOWA 4HK8A 4Q0QA 2O1QA 3VHNA 2BPA2 5KXEA 2BYVE 3SH4A 3VDDA 1NY72 3E5UA 2D6NA 1YJKA 2TBVA 3H1WA 3M1HA 1VB4A 1COV3 2A6WA 1O4YA 3B02A 3ZYPA 3POWA 1N47A 2RR12 1GZWB 2XJQA 5GLZA 5J09A 1QHDA 3A0KA 5BNOC 4AHXA 4IEVA 1YI9A 3AKSA 4TWTA 2VECA 4XE9A 3UJQA 3O5SA 3WUCA 3E6CC 4FPLA 1ZBE3 2XL7A 4YG0A 4XQ4A 5DUVA 3ZSLA 5FMOL 1KFUL 1I3HA 3AP4A 3ZMNA 1K5MC 3VUOA 5CFDC 2PAKA 2V73A 1ZBE2 4AGGA 1S2KA 3M8LA 1SCSA 4F3JA 2JG9A 5GLUA 1LR5A 1NG0A 2CNAA 4IEYA 2ZBJA 1VB2A 5CBLA 2P2KA 4PLOA 4ES9A 1HRV1 5DZFA 2WZPP 4L92A 1H4GA 1DF0A 5DXDA 3WG1A 4XBNA 4TSVA 4YG6A 3WG4A 4EN7B 3ZFGB 3HAGA 1AYN3 4RS5B 1NLRA 1V9U3 1XNBA 2PAEA 3V64A 4E2SA 1OA2A 3KT4A 5BNNB 1VAMA 4G9SB 4GB31 4FOQA 4OUMA 4KU8A 1AX2A 2B5HA 3WOGA 3R4SA 3M7AA 4AW7A 5BUVA 1AYN2 1PZ7A 1V9U2 4I3PA 4O9GA 3HBZA 1GV9A 1HXS3 3ZMOA 1I6XA 2ZOEB 4IV1A 4P5HA 5I91A 1XYPA 5BYNA 2LUWA 4N43B 4A2UA 1HXS2 3OY8B 3DGTA 1Q43A 1UW8A 3WQ1A 4DMIA 3A0NA 4AVTA 4BPZA 2QZ3A 5T5PA 3KB5A 1ZZCA 3AXEA 3R4UA 4UBHA 4M0NA 1WCKA 5I0RA 4QU2A 1AR73 3USSA 2A3YA 4WM7C 1W6QA 1DQ5A 2WNVA 3K51A 5JCTA 5JSOA 1LCLA 1Y7BA 2R071 1CPMA 3VBFB 5K8SA 1PVC3 1AR72 4Y1YA 2H0BA 1VALA 2QNKA 2NM1A 4Z1VA 3B00A 1WLDA 2UY9A 2X53S 2Q1ZB 4Q1PA 4UW6A 4EV0A 4BYYA 5F9TA 3JBG1 2XLAA 4EWEA 4FPFA 2QFEA 2C0ZA 3OD0A 2HWF1 4BHPA 4LUMA 2VPVA 5GKAC 4BE3A 2MPFA 1DZRA 3I59A 2DVAA 3EQEA 4ZXKA 3MIHA 5CG8A 1CAVB 4FTEA 3OCPA 2KXLA 3UKTA 2I74A 1DZQA 2PQQA 1RVF1 1N3PA 2ZZQA 4I2OA 4HBNA 3IDEA 4JCKA 1BQPA 1ZRRA 2VG9A 3GNEA 4ATEA 1YFUA 3IWZA 3FLPA 1N1YA 3MF6A 4AHYA 2DUQA 2DWRA 4XFFA 3VDDC 3VBRB 5HCFA 1IS4A 1FYUA 1RUJ1 4QQPA 5L73A 1WD3A 1GICA 5FLHA 1UU4A 3AMHA 4ORFA 3WDUA 2HWB2 4YVSA 3GALA 3H3ZA 5TSWA 5FO8B 3JD73 2UYBA 1HX6A 1RUNA 4F7ZA 5ACA2 3QD6A 4NR1A 2UWCA 4XIKA 1NXMA 1PO21 2PN5A 4I0WB 1BKZA 4MX3A 3VZJA 1XXNA 4DNYA 1J1LA 4AQ2A 4AI3A 1AVBA 4H14A 3H1YA 2PLV1 1UPIA 1NQDA 3SCHA 4YZ5A 2UY8A 3IPVB 3D82A 4CDWB 1X33A 5KC5A 4AYUA 2ZHMA 5CFCA 3HIFA 3B5LB 4FOVA 3SHRA 1G86A 2R32A 3AJZA 2XPJA 3AJYA 2RHPA 4AFDA 2HWD1 4P9IA 4QPIA 2NLRA 1I5ZA 1REDA 1RHI3 3P3NA 2Q5TA 1I9RA 5FOJB 3ZFFC 1Y9QA 1VBD1 2A70A 2HEWF 2ZA9A 1RUE1 2ZMKA 2IFWA 2FHRA 1GZWA 1RHI2 1LENA 4HSLA 2ARBA 3ZXGA 1OKQA 4YM2A 2Q0AA 3QH7A 4XJAA 5JVVA 5IK8A 2BVBA 2JEMA 2DU0A 2XKOA 2WNEA 1KDKA 1QOSA 3WV6A 4A7YA 4MXWA 4DINB 2PAMA 2LALA 2DURA 1WW6A 1VBB3 3AP7A 4JDMA 1QJZA 3BODA 4IV1C 2RJLA 4CDUB 1W6NA 4I3GA 3FFQA 4NWVA 1O5LA 2EVXA 1LESA 1XYOA 2KA3A 2VQAA 1VBB2 3ZN4A 4UW5A 1YLLA 1DG6A 1DGWA 3M2MA 5BNPA 4LNVA 3ZYIB 4BOWA 2H6BA 1Q5OA 3I8TA 1BEV3 2P17A 1SBDA 4B7KA 1O4ZA 4P9YA 5HXVA 2R043 4XHXA 1JXNA 1KDMA 2WNVC 4HK9A 4W6WA 1OQDA 1KRIA 3NV3A 4GKYA 3KSCA 4DZGA 2FBEA 1BEV2 1W2UA 5JLVA 3UL2A 1DQ1A 4YVWC 4RQPC 4RL7A 2R042 3RWNA 3ZFEB 3AXDA 2GZWA 1X82A 5GJ6A 2KM2A 1UU5A 1RUG1 4HPKB 1GQGA 1H8TA 1H9PA 4IETA 1GR3A 2D3PA 4IEPA 1O5UA 4IV3B 1PGSA 2D93A 2VU9A 2YHJA 4AWDA 3LWCA 1QU0A 3J8F1 1EPZA 2P3KA 3TNPB 4ISRA 3WT3A 5EV7A 4CEYB 1BXHA 3OY8A 3PLQA 5FLJA 1NA1B 4COZA 1KFXL 4KG8A 1H2KA 1ZREA 3ZSJA 1HV1A 1PK6B 1FI2A 1TE1B 5FBZA 3TBDA 1CN1A 2VW0A 2RJKA 2EXIA 1FNYA 4IEQA 4AFAA 2RS33 4FT8A 2DCTA 3VBUB 4Q4X1 4AVVA 3ZSKA 3VBHB 3PVNA 3GBFA 4IEOA 4E9KA 1NOVA 4YVSC 5EYYA 3S30A 1V6NA 2NQYA 3FHIB 2OYZA 3RQ0A 1YUDA 4AFBA 3UJOA 1SEFA 3B9IA 2RS32 3AK0A 3I54A 4M00A 4MGIE 1G9AA 1SFYA 3BALA 5ACA1 3P3PA 1WMDA 1MQTB 4I0AA 4YLZA 3WINE 1EV11 1MR5A 3NJZA 1N1SA 4NOTA 1WA4A 3MI8A 5AC92 5KHGA 4DS0A 1MACA 2GDFA 4N9IA 5LRRA 2WT2A 2K2SA 2XJTA 2ZX4A 4DB5A 1R081 1XE8A 2MEV1 1LTEA 4Y26A 4OHZA 1QQP2 5CFCC 5KXDA 2ZPXA 1UCXA 5H9RA 1ENSA 2ZGPA 1HKDA 1O7FA 2ZX3A 5C4WA 2EAKA 1HQLA 4QPIC 3SCFA 3H3UA 2BWAA 3VBRA 1Q8PA 2GMMA 3ASIA 1ND3B 2Y0IA 1ULFA 5I8YA 1QF3A 1VIWB 5JZGB 3ES1A 1DHKB 4LBOA 1LU1A 5A33B 2G9GA 3VGIA 2BNMA 2IXJA 3FE5A 4GWNA 3D8CA 4COYA 4COWA 3QCWA 4LE3A 3ZN6B 3ES4A 1XU1A 1O3QA 1KQRA 4HL0A 3AYDA 4JGZB 5JAXA 2IXHA 2ZGLA 5GM0A 2C5DA 3PMSA 4R9BA 4XFHA 5C9AB 4P9LA 4YW1A 3A4UA 1O3SA 1FV2A 1D4M1 3BOPA 4LBQD 1POV1 1AF9A 4AI2A 2GSYA 3IPVA 3RRDA 2HEYF 3SITA 5F5QA 1C1FA 4CRQA 5HCAA 2GN7A 4QQHA 1OI6A 5DDJ2 1SDWA 3VL8A 4F8AA 3UKVA 3MIBA 3VZLA 3MW2A 1OQ1A 2VVFA 5JI7A 4XFIA 1G6NA 3DV8A 4FP3A 2VUAA 2D7FA 3LSEA 2X8KA 3NSTA 4CDQB 1FMD1 1UN1A 2DVDA 3ZFGC 3JCIA 2ZCWA 5BNNC 4LT5A 2RE9A 4P9WA 2ZGRA 3AYEA 5KXCA 3RI9A 3RPQA 3VBSB 3ZXDA 4XYXA 2PA7A 2QZ2A 4B7EA 2E51A 3FBMA 3M4FA 5FREA 4PBPA 1EAH1 3B7MA 1LEDA 1RUC3 1AR93 1HV0A 2CGPA 4M3CE 2QDNA 2TNFA 4AI0A 4BQ1A 4N7UA 4YARA 3TN92 1RITA 1SLLA 4Q0VA 1WBLA 3M3EA 1SFNA 3WQ0A 1MZ6A 4N43C 4Q4V1 5LEJA 3PHMA 1IKQA 2A75A 4RGAA 4U36A 4JDNA 4JTNA 4QPGA 3CJIB 4QD2A 1V6JA 2RMU2 1E57A 1RMU3 4ZU7A 4MGKE 2R49A 3SXWA 2GH8A 3OYWB 4COUA 1O3TA 2Q4SA 4JGYB 4Q0SA 3AFKA 4JRLA 2QKDA 5L36A 1N1TA 1PVXA 4ATFA 3UKNA 5LEKA 4XTMA 1V00A 3AM2A 1RB8G 1ULDA 1B35B 1VBC1 1J59A 4FOWA 1RUI1 2HJIA 1FV3A 2OUHA 2ZABA 3ST7A 3OD4A 5BY5A 3ME2A 5FO9B 1OFSA 4EN0A 4JDOA 5T50A 4IV3A 1H2LA 4TYSA 3KS7A 3KCYA 4BMBA 1RJ7A 3LAGA 2XBO3 1VBA1 3HD8B 4JV4A 4GIQA 5C4WC 4CYDA 4FXKB 1XNKA 1LOAA 1PNGA 3WVJA 2XBO2 4EWAA 3VBRC 1APNA 1AXKA 4WM8B 1U12A 1VLNA 2X5IB 2ZGQA 1RINA 4QPYA 3PJQA 1H2NA 2YZ4A 5FTTC 4X8NA 1QJY3 3MPPG 2WA4A 1HRV3 2JD4A 4J1WA 2WFF1 4Y1VA 2E7AA 3FLRA 1QOOA 1QJY2 4KU7A 1RIRA 3E6DA 1BMV2 3MFCA 4K40A 4CEWB 3MEPA 1W39A 2ATFA 5HBAA 1WUVA 4GB33 4MXVA 1H2MA 3LSDA 5DUUA 4LA2A 2JKBA 4NHLA 4IEUA 3VKLA 3WR0A 5K0UB 5E89A 4OHVA 1KS5A 3AX4A 2BNOA 1Z7S1 4HN1A 2A3XA 3CEWA 3EO6A 2RM23 2HWC3 1HIXA 4PDWA 4EROA 1YWKA 3RSJA 1R093 1MEC1 5DDJ1 2E7QA 5I8SA 3D0SA 1XRUA 4HANA 3MYXA 2ZKLA 4A3XA 4F83A 4GXLA 2B39A 1IOAA 2VOXA 1ND3A 2RM22 2WZR1 2D44A 2HWC2 4YM0A 5GZFA 3WXPA 5JOZA 3LA7A 3ZXFA 1MS9A 1MS3A 5A33A 4BZ4A 1VRH3 4LBKA 5HI0A 4DRRA 1LECA 3INAA 4WM7A 3ZN6A 4JVAA 3VKOA 2B42B 2MHFA 1CX4A 2D6KA 1FPN1 1R1A3 1VRH2 4OI4A 5C9AA 1NCQA 4X8PA 1RUH2 2AH2A 4MGYE 3RI8A 1AL21 3R05A 1IQAA 1PIV3 4Q4W1 4KQ7A 1S1AA 2R061 2DV9A 3ENRA 1DLLA 1C3HA 4BCUA 1R1A2 2D5HA 2R0FA 2AZ5A 3M3IA 3FC0A 5FPZA 2XJVA 2BQPA 2GC0A 3TN91 1WW4A 1PIV2 5T5LA 1PM7A 4AVSA 4HVOA 1ASJ3 1IS5A 4GMP3 1AR83 4HLTA 2Y38A 3GZUC 4QGLA 4N53B 4CDQA 4D7SA 4BLJA 2AUYA 3K48A 2QE3A 1ASJ2 4YG3A 4Z92B 1AR82 1ZBA1 1I1EA 1Y3TA 3DKWA 4LA3A 4GKXA 1FOD2 1QDOA 1YHFA 3E5XA 5GLVA 1O91A 3VBSA 4GH4A 1VJ2A 1AR61 1NCRB 3N7MA 1LOFA 2BW8A 1SQ4A 1J3PA 4L8QA 2IXIA 3N7JA 4RGGA 2Q30A 2RS51 4N9HA 4YZ4A 3QLQA 1BVP1 4IV3C 2CAVA 5KHJA 1COV2 4AQ6A 2ETEA 5FLIA 4X6QB 3AYCA 4Q29A 3HT1A 4K21A 2ZX2A 1PO23 1UD1A 4FPCA 5AVPA 3IBMA 1CQ9A 4QMAA 1RUOA 4IEZA 1CAWA 1QJU1 2B45X 4K1ZA 4YFWA 1W0OA 3M3QA 1H4HA 3D6EA 1QH7A 3OYWA 2XKPA 2R1BA 3VBUC 3VBHC 2ERFA 5C8CB 4JGYA 1TME1 2TUNA 2XGXA 1RTVA 3WP3A 1OOPB 5EWSA 4RHV1 1UPSA 2HWD3 1POV0 2W68A 5JWPA 1XU2A 4Q26A 3ZFFA 1B09A 4Y20A 3U07A 3MICA 4OHWA 2D3SA 4FPKA 3Q9OA 1A78A 4C1XA 1RUE3 1ZM1A 2BEOA 2I2SA 3WW3A 4V1PA 1SACA 3MIFA 3URFA 1JUHA 5JOWA 5FPXA 1FT9A 2ZS6B 2SLIA 4FXGB 1IKPA 3VN4A 4QM8A 3ZXKA 1A6CA 1AYM1 1QXPA 2WJSA 4FQ4A 5F6LB 4IERA 2PHFA 1HQNA 4PDWC 3VHPA 4DFSA 5H9PA 4LULA 3IM0A 2WLQA 5LK5A 2D6MA 2D40A 4LEJA 4M01A 5GZCA 1HRI3 2DCZA 2XB6C 1CD3G 1ND3C 2BNNA 3MLJA 1A3KA 1QJX3 4HFSA 3TWIA 5SV8A 4G4FA 3BU7A 1Q3EA 4M3CF 3WHTA 1BYHA 2VMHA 1HRI2 1RUD1 1C8M1 2R6QA 4NHKA 1YO8A 2Q1MA 1QJX2 3WD5A 1XNCA 3NAPB 5C9AC 1NCQC 1PGL2 3ZVXA 3MLLA 4YVWA 4RQPA 1S0EA 5FFOC 4CEWA 3HT2A 4FSJA 5FOBB 2JE7A 2QCSB 1RUH1 4MZUA 1Y43B 1PVC2 1UIJA 2YC0A 1NE6A 1ULEA 4YGEA 5JIAA 4D7TA 1AX0A 3TOJA 4I01A 4FO9A 1GKBA 3PMEA 4LBQB 1YIPA 2XWBB 2AYHA 3ELNA 4S2FA 2EXJA 4COVA 4LBMA 2YGLA 2YPJA 3J8F3 3ZDSA 4AVAA 4LTAA 4CDQC 4GULA 3FX3A 2BVVA 4RSUA 5I93A 1N3QA 1Q8VA 3WCRA 4HZFA 1GSLA 3EXUA 2NYYA 2ZHNA 4W6