4YGEA

Crystal structure of ergic-53/mcfd2, trigonal calcium-bound form 2
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
227
structure length
227
Chain Sequence
PHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSSDQIRVAPSLKSQRGSVWTKTKAAFENWEVEVTFRVTGRGRIGADGLAIWYAENQGLEGPVFGSADLWNGVGIFFDSFDNDGKKNNPAIVIIGNNGQIHYDHQNDGASQALASCQRDFRNKPYPVRAKITYYQNTLTVMINNGFTPDKNDYEFCAKVENMIIPAQGHFGISAATGGLADDHDVLSFLTFQLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Protein ERGIC-53
publication title Interaction mode of coagulation factors V and VIII with the cargo receptor MCFD2/ERGIC-53 complex
rcsb
source organism Homo sapiens
total genus 51
structure length 227
sequence length 227
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2015-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03388 Lectin_leg-like Legume-like lectin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ygeA00
1GICA 3A4UA 5T5OA 4AVVA 3KQRA 3WG3A 1WW7A 3D4KA 3SH4A 2ARXA 2Z42A 1G9CA 1W6OB 5CB7A 2YROA 3ZVXA 3W59A 1ENRA 1GNHA 3OJBA 2JJ6A 3AXDA 5KXDA 4WVVA 2D6OX 5HCBA 2WNEA 3JU9A 5IK5A 4FPKA 1LODA 4BOWA 1V6IA 4I30A 1DQ5A 1SLTA 4WVWA 2PELA 2ZGLA 3AZWA 2YZ4A 1ONAA 3WZ1A 1WW5A 3RRDA 1A78A 4FVVA 1LOFC 2WLQA 4FOQA 5EWSA 5HCFA 1KJLA 2DYCA 2WSUA 4YW4A 1IOAA 1W6PB 2V5YA 3ASIA 1LULA 4TYSA 3A0KA 1CR7A 3MW2A 1BJQA 1VIWB 2DU0A 5JOWA 3DUIA 3RMYA 3WHTA 1UZYA 1N1VA 5GJ6A 3VKNA 1LHNA 3M1HA 2ZGTA 2W68A 3MEPA 3WDWA 1CJPA 1AX2A 1LOBA 2GMMA 3AP9A 4YM1A 4M00A 3POSA 3V64A 1W6QB 4ATEA 4M3CF 4HL0A 4F83A 4P9XA 4XJ9A 5JVVA 3N36A 4DFSA 1DBNA 5E89A 3WVJA 1Y7BA 2DUQA 1LOEA 1I1EA 4ZKTB 1Q8VA 2PHFA 2OUJA 1C1LA 1C4RA 2ZABA 2C5DA 1S1AA 3N7MA 5EYXA 5T5PA 3OYWA 2AUYA 3TAYA 2AREA 3NV4A 4LBKA 2OW4A 2FHRA 5F5QA 3T1LA 1HKDA 4XHBA 3GNEA 4FPLA 3N35A 2GN7A 1GZCA 3ILFA 5CA6A 2D3PA 2ARBA 4ITCA 1QNYA 4XJAA 4P9WA 3WDYA 1AZDA 1H9PA 5GZGA 4YZ1A 1VAVA 4XBLA 3OY8B 4FOVA 1DQ2A 1KDKA 1C1FA 2GALA 3OGGA 1APNA 2W39A 2JECA 2P3IA 3SISA 1FX5A 1N47A 4FPHA 3WUCA 4FQ4A 4XDQA 2YY1A 5GZEA 3ZXKA 4RL7A 1Z78A 1SCRA 1ULGA 1A3KA 2PHWA 4DQAA 4Q1PA 1FAYA 1SCSA 1Q8PA 2E7QA 4LBQD 3W58A 2P3JA 3O12A 3M3OA 4PF5A 4YM2A 1YIFA 3WDUA 1DGLA 4LBMA 4FPOB 1D0HA 1G9AA 3FLPA 3H0OA 3ILNA 4LBNA 2ZHKA 3PVNA 1LEDA 1G7YA 2WT0A 4M3CB 4YW1A 2OVUA 3N7LA 2EIGA 3SH3A 4Y1XA 1LOCA 2DVDA 4BMEA 4YM3A 2A6XA 4Z8BA 2NMOA 4K1ZA 2ZGPA 1W0OA 1AXKA 4LBQB 1JW6A 2LTNA 1WBFA 2D43A 4XXAA 5DZFA 1ZA4A 5GZDA 4RA0A 3UK9A 1XQNA 3M3QA 1H30A 4WV8A 4SLIA 5CNAA 1IKQA 5T5LA 5BYNA 1G9BA 2DTWA 1N3PA 2D3RA 2GN3A 1CIWA 2NM1A 5DZGA 5AVAA 2UWBA 2I2SA 2SBAA 1WUVA 2UURA 1GZ9A 1KQRA 5H9PA 3FFZA 3AYEA 2E7TA 3AP5A 2VY0A 1LGNA 1UPSA 1LHUA 2ZHMA 1GV9A 1JOJA 3O0WA 3R4UA 5H9QA 1LTEA 4FOYA 2OUHA 3PVEA 3L2YA 2D7FA 1LOFA 2WSVA 3R05A 4FOWA 3CNAA 3O5SA 3ZSKA 4UW3A 4D69A 3LSDA 1SLIA 4CRQA 1MS1A 3V0AA 3AJYA 2NZ9A 1VAMA 2XG3A 3HN1A 3RG0A 1HQWA 1SBEA 2ZHNA 5DUUA 1Q8OA 1SLLA 4XMAA 2A70A 3I8TA 1AF9A 1W6MB 3M3CA 4Y20A 2DUOA 4ZXKA 1QOOA 5DUXA 4BPZA 5FRAA 1WD4A 4NO4A 2Q5TA 1A8DA 2H0BA 4FPCA 1VALA 4DRRA 1DQ4A 1SACA 1ULFA 2CWSA 5DUVA 3AZVA 3VV1A 2DUPA 2W52A 2EAKA 1N3QA 3B9CA 4XBNA 4P14A 3RSJA 3ZXFA 4NOTA 2YV8A 3AZYA 2A75A 2GNDA 3FBYA 1QMJA 2D6LX 2D3SA 2ZGUA 3APBA 4K20A 3ZSJA 3SNMA 1QOTA 2UU8A 1LOAA 1DLLA 1G86A 2ZGKA 4ATFA 4K1YA 2GDFA 1KITA 1AVBA 1GKBA 2VU9A 2VW1A 2ZA9A 1LOGA 1V6MA 2FMDA 4FPGA 4R9DA 3SH5A 4Q1RA 2ERFA 3WLUA 4BLIA 1CN1A 4Q8LA 5H9SA 4U36A 3WCSA 1ENSA 3V0BA 4UW5A 1WLCA 1NXD1 2GMPA 4XXPA 5DUWA 4FP2A 3ENRA 3A0NA 3IPVA 4AGRA 4Y24A 1FYUA 1OKQA 2KM2A 1PZ9A 2LALA 2TEPA 3GALA 5GLZA 4AGGA 2AENA 3MW3A 1QNWA 2A6YA 3TB0A 2A71A 1X50A 1IS3A 2GNMA 2ES3A 3IMNA 1IS6A 3BIWE 2B7YA 5IT6A 1Q56A 2R0FA 2WT2A 1N1YA 1YYNA 4JRAA 1MZ6A 4YW2A 1SBFA 4M01A 1G9DA 4AVTA 1QDCA 1LGBA 2ZBJA 2VW2A 3FLTA 1JUIA 1JN2P 1Q8SA 3OBTA 2D6MA 1LEMA 2DURA 2EF6A 5E88A 5JLVA 1H9WA 1UL9A 3LSEA 1ULEA 4YG6A 1RITA 2ZMNA 2R0HA 1IKPA 1Z0HA 5GZFA 3POYA 2NYYA 4XE9A 1MS9A 3INAA 1RIRA 1LESA 1S0EA 2WT1A 3IN9A 1UMZA 5GLVA 1OFSA 3R4SA 1WLDA 5DZEA 3ZXEA 1N1SA 3HR9A 1J1TA 3ILRA 1WW6A 2CL2A 2HYKA 1QKQA 3OPZA 4FPJA 5LK5A 1ULDA 5T50A 3O0XA 4L8QA 2D6NA 4XOGA 5H9RA 4AYUA 4XYXA 1LU1A 1S0BA 3AYDA 3IPVB 3O0VA 5JOYA 4Y22A 3OYWB 3AFKA 1JYIA 4Q8KA 1GLHA 1G9FA 1LECA 1WD3A 2PHRA 1GZWA 2ZGRA 5GLTA 4FPEA 3LCPA 2CY6A 3USUA 1S0DA 4KBBA 4CZSA 4XZPA 1MS4A 2DVFA 5HCAA 1QDOA 1JHNA 1CPMA 1V00A 1QU0A 2DVAA 1SLCA 5KXBA 3B00A 3AJZA 4GXLA 3AK0A 5T54A 2ZMKA 1UKGA 3WG1A 3VKMA 3AX4A 3U4XA 2CYFA 2R1BA 2E6VA 3PJQA 2JE7A 5IK7A 3WG2A 4YW5A 2YMZA 1F9KA 2PHUA 2P37A 4UW6A 1CQ9A 2ZGOA 4YG0A 1LCLA 1AX0A 3AXEA 2ZGSA 1KDMA 2RHPA 3JUUA 5T5JA 3WDVA 4ASMB 4YM0A 1D2SA 1W6OA 2BQPA 3B3QE 4BQ1A 4JC1A 4XJZA 2ZGMA 2NN8A 1YRZA 1O4ZA 2DTYA 5EYYA 1S0FA 4XILA 2WJSA 4PBPA 1CONA 3AZXA 3AP4A 1F5FA 1GSLA 2EXIA 2ZHLA 4ISRA 4XTMA 2JKBA 2VH9A 5CBLA 4FPYA 4GA9A 3B01A 2E51A 4XJWA 2ZACA 3MW4A 5DG2A 2NP0A 2DV9A 5E8AA 1FNYA 3RMXA 4R9AA 3USUB 4BM8A 2D6PA 3WG4A 1W6PA 2JE9A 5DXDA 3WOGA 3D5OA 2VW0A 1UAIA 4AGVA 4K21A 1RINA 1MS5A 5EXOA 1BQPA 4XJUA 1DFQA 1UX6A 2UWCA 1WCSA 1MR5A 4XJ8A 4MYEA 5GLWA 3NV2A 3UL2A 1BKZA 2GNTA 1DQ6A 1MS3A 2CTVA 1W6QA 2GNBA 5T52A 4FQZA 4YLZA 3VUOA 1HDKA 5JDBA 1DQ0A 2DWRA 3NV3A 4GKXA 2ZKNA 1HLCA 3UJOA 2W08A 5GZCA 1GNZA 1FV3A 3UJQA 3T2TA 3POWA 2A7AA 4XMIA 1F31A 1MACA 1SLBA 1WW4A 1YI7A 5T55A 1U0AA 4YG3A 3OBRA 3DGTA 3N7JA 1TEIA 1R1ZA 4P9YA 4XTPA 2ENRA 1IS5A 1ULCA 2ZAAA 1S0JA 2D6KA 3QCWA 4YZ3A 3WDXA 3ZSLA 4C1XA 1BZWA 1V6OA 4PCRA 1DHKB 2NMNA 3BTAA 1QF3A 3ZXJA 2A6WA 1HQLA 3AYCA 4CTEA 1ENQA 4IQPA 1S0CA 3N3HA 3V0AB 1B09A 3OY8A 1YO8A 5JOZA 1PZ7A 4LBJA 4YFWA 3PMEA 2PHXA 1ZM1A 1V6LA 4GKYA 4PBOA 2DVBA 4W65A 5GM0A 2P34A 4Y20B 1MZ5A 1DIWA 3M2MA 1VLNA 3Q9OA 2JDZA 2V73A 4R9BA 3WCRA 2WQZC 2EXJA 1LHWA 4YGEA 3SITA 2C9AA 1V6KA 3BODA 4R9CA 1NLSA 1FATA 4YFZA 1V6JA 1SFYA 2A5ZA 4Y1VA 1JBCA 3C2UA 3D6EA 1C57A 4M3CE 3ZYRA 1S0IA 1GBGA 1CPNA 1QOSA 3AYAA 5IUQA 4DS0A 2ZGQA 4LBOA 4AVSA 5JMCA 5KXEA 1LHVA 2JD4A 4M3CA 3QLQA 3FUOA 3T1MA 4XHXA 1OQ1A 4GWNA 3WV6A 3AP6A 1LGCA 3RS6A 1SBDA 4DPNA 3I4IA 3HMYA 2ZGNA 1YXWA 3IM0A 1N3OA 2WKKA 4LBQA 3M3EA 4AWDA 4HANA 1WBLA 1MVQA 3N7KA 4XIKA 2A6ZA 5CAZA 3V0BB 1JXNA 1LHOA 2G4IA 1URXA 1I3HA 4PQ9A 1O4YA 2R1DA 4DRVA 2EXHA 3V65A 4TZDA 2VXRA 1PZ8A 4YGCA 4XBQA 1MVEA 1V6NA 2A3WA 2DVGA 3MPPG 2D44A 1IS4A 1LJ7A 4H55A 2AH2A 2UWAA 1EPWA 3IKWA 4WZFA 3VKLA 1KJRA 1LENA 2AR6A 1GANA 2P2KA 3ZXLA 4GWMA 1CVNA 3NV1A 4FP3A 5JOXA 1FV2A 4Q2FA 2VUAA 1LU2A 1UN1A 2YXSA 4GALA 5SV8A 1FNZA 5DG1A 4ISQA 1DZQA 3AZZA 1BYHA 3AP7A 3WNXA 4Y26A 1W6NA 3BOPA 1CESA 2AYHA 1N1TA 3WDTA 2A6VA 5GLUA 1MS0A 3VKOA 4Q27A 1Q8QA 5FREA 2R16A 1DYPA 1S0GA 2SLIA 3B69A 4YZ4A 3WHUA 5IK8A 1G8WA 3FUQA 2PHTA 2E53A 1W6MA 1JYCA 4C1WA 1SLAA 3RQ0A 3ZYPA 4YW3A 5GALA 1KRIA 1AJOA 2A3YA 2R49A 4OZXA 4Q26A 3ZPYA 1QGLA 4LBLA 5KXCA 4Y22B 3WUDA 2A3XA 2AGSA 3NWKA 4YGDA 4U2AA 1AXYA 1GZWB 2CNAA 4YGBA 2DU1A 4BLJA 2ZMLA 4Y1YA 4Y1UA 4BMBA 2ZZJA 4UW4A 1GYKA 2GMEA 4FPFA 5F9TA 5IK4A 1UZZA 2EALA 4YZ2A 4JCKA 3KM5A 1AJKA 3ZSMA 5L73A 1BXHA 3PVOA 3FLRA 4Y1ZA 2XB6C 4YZ5A 1MS8A 2EXKA 3SLIA 1AX1A 1W0PA 1AXZA 1DYKA 1W6NB 1WLWA 1DQ1A 2CWMA 4XIOA 3VKFC 2P3KA 3ATGA
chains in the Genus database with same CATH superfamily
4A6OA 3KQRA 5CFCA 1WW7A 3D4KA 4KI5M 4Q0VA 5AC93 2JG9A 1FMD2 3VDDA 3NAPA 1XYOA 1PIV1 2RR11 1UKRA 5JZGB 3SKVA 4NIHA 3CJIC 2WNEA 5FZOA 1W9WA 4FPKA 1PO22 4LKDA 3SMHA 4AQ2A 5F1RA 2XBO2 4I30A 1DQ5A 1SLTA 4BB3A 2ZGLA 3AZWA 4CP9A 2VOKA 4LE4A 1VBC2 1WW5A 5FY1A 3RRDA 1DZTA 3BI3A 4WM7C 5C8CC 4FOQA 1KJLA 1UY1A 2DYCA 1JTZX 4NHMA 4RD7A 2XUMA 5FYVA 3A0KA 3WW2A 3ZN5A 5IFPA 3MW2A 1BLZA 2DU0A 1UIKA 4CCDA 3DUIA 2KXLA 4CU7A 4JAAA 3GZEA 4CDXA 1HRV1 1UOGA 3VKNA 3KGLA 5F2SA 2ZGTA 4CP2A 5GZGA 3POIA 1AX2A 3AP9A 2AEZA 3MUY1 3NO8A 4M00A 4XUOA 3V64A 1RUNA 2CV6A 4RHV2 1H0BA 2Y6LA 4M3CF 2JICA 2XMLA 1MZEA 3HT1A 5D21A 5JVVA 4EQVA 5E89A 4AI2A 4DOUA 3ES4A 4UT5A 1Y7BA 4G3YC 2QQPA 1LOEA 3VDAA 5JCTA 1AYM1 3K51A 4RS5C 4GWJA 2OUJA 3ZR6A 5C3RA 5LA1A 3WNNA 4MGKE 2OW4A 4IW3A 4QX0A 5L7OB 1QQP1 4K6BA 2X05A 2BNOA 3HD8B 4UF0A 1GZCA 3ILFA 3U4SA 4AEJA 2D3PA 5CA6A 4P9WA 5FZDA 2QDRA 4E2GA 1H9PA 2CHHA 4YZ1A 1UZWA 1AR72 3RYPA 2B4KA 4DY5A 2VVFA 2ZEWA 3OPWA 4Z07A 5EV7A 5DMYA 1SPPB 4Q5OA 1O3SA 4R8HA 5FFOC 1MZFA 2QE3A 4IESA 3ZX7A 1VPHA 3T4VA 3WUCA 2JB4A 3LEMA 4RL7A 1X8MA 3RYRA 5HI0A 1QJX2 1ULGA 1J83A 1A3KA 3AL5A 4Q1PA 4AG4A 1FAYA 1W8HA 1DG6A 3FJSA 3KWVA 4L9BA 4ZU4A 4E4HA 1K5MC 2XXZA 1WZXA 4XF3A 1TME2 4A7KA 1OA4A 2H6CA 4PF5A 1XJAA 3T08A 4QM8A 2XVGA 5KC5A 4FPOB 3BOWA 4PIXA 3H8RA 4L97A 4MX3A 4QM9A 2B39A 4LBNA 1RUD1 4RGKA 3OUIA 5A3MA 4YW1A 5FYBA 2OVUA 2EIGA 3MUZ1 4ZONA 3O1TA 4Y1XA 1UYZA 1NCQB 4BMEA 4Y3OA 2GC2A 2ZX4A 1GP5A 5J3UA 1JW6A 1AR61 2LTNA 3ECQA 4NWWA 2D43A 2IUWA 5DZFA 5ACA2 5K0UC 3M3QA 1MEC1 3POBA 4SLIA 4Q4Y1 1G9BA 1ZBA1 2DTWA 4H7MA 3JZVA 2B9UA 5A32A 2SBAA 3HBKA 3MLLA 2UURA 3BGAA 4LK7A 4NN0A 1KQRA 1YUDA 2OQ6A 3MLKA 5H9PA 5FOBB 3AYEA 4O9GA 1VMFA 4AEDC 2YBPA 2VY0A 3L9JT 1OPOA 4XZUG 5FMBA 4QGLA 1GV9A 1NA1A 1JOJA 1YWKA 2F17A 3O0WA 2ZKLA 5LK7B 2OUHA 1XNDA 3PVEA 4BA6A 3R05A 2D7FA 2WSVA 4FOWA 2XQRA 3LFIA 1XNKA 1XNCA 2AC1A 2BP6A 3C7FA 2ZJCA 2VBPA 5BNPA 1PO11 3MIGA 4EWEA 3AL6A 2ADEA 3RG0A 4TWTA 5FYUA 5HCHA 4C0HA 1ND2A 1NT0A 1GQGA 2A70A 3MF9A 2Y60A 3M3CA 4Y20A 3ZMOA 4Q4W1 3ST7A 4BPZA 2R072 1W2OA 2NQYA 3B9IA 2H0BA 1GNYA 5CISA 5FZBA 1BVVA 1PK6B 1VALA 2QQWA 3BKZA 2WYSA 3M7AA 2CWSA 5I0SA 3BALA 3WF0A 3I3DA 4IGPA 4CDUC 4XAEA 2W52A 1FXZA 1PGSA 1PVC1 2VC9A 4P14A 3RSJA 4Q4V1 4E8CA 1D7PM 3M3IA 3AZYA 4NIGA 1CAUA 2GH8A 2GNDA 2ZZQA 1VRH2 2D3SA 3ZSJA 1H6YA 2ZTNA 3G6JB 3MIHA 4XFCA 4IV3B 3K77A 4AL9A 2YFUA 1DLLA 4AXOA 4Z2AA 2J1TA 2DBIA 2VTFA 2RR13 1TMF2 3PUHA 1W04A 4K1YA 4XDPA 5DAPA 2XKOA 4ATFA 5A1LA 1KITA 5A7OA 1GKBA 2VU9A 2VW1A 3SH5A 4FPGA 5FYMA 3WLUA 1KFUL 4Q1RA 3TEYA 1CAWB 1OVPA 1ASJ1 2YU1A 1EY2A 4P9GA 3ZIXA 3AFGA 4BH9A 3WCSA 3JBG2 1QJY3 1STMA 4AFBA 3CJXA 4UW5A 2GMPA 4LOSA 4XXPA 1RL3A 2CU5A 2J42A 5CFCB 3NNFA 4JTNA 1HRI2 2JG9B 3ACFA 1RUG3 2LALA 3VDDB 4AGGA 3NAPB 4WVMB 2RS12 3TB0A 1X50A 2XJQA 5A3PA 5FLHA 2RS51 5FZOB 2B7YA 1HRV3 2VZ3A 1EPZA 1Q56A 3ELNA 2WT2A 5JSPA 1YYNA 3OF1A 3KCCA 4JRAA 3ZYGA 1OLQA 3VBHC 4DZGA 4F3JA 3PTRB 1GQPA 4DUWA 4JKKA 2XJSA 3ACGA 2P5BA 2QQVA 4GIQA 1REEA 3AKSA 1IQAA 4CXXA 4DIQA 1EAH2 1X82A 1H9WA 4LMFA 3S5QA 1RITA 2BV4A 3CF6E 2ZMNA 4AQSA 4LT5A 1IKPA 4BU2A 1RUOA 2VUDA 2WS92 2OQ7A 1J3RA 3ZXAC 2I74A 4NIAA 4XE9A 4HK8A 2WC2A 3TRSB 4CDXB 1J3PA 1RYYA 4NPLA 4COUA 1O91A 1QQP3 1XU2A 4XFIA 2Y38A 4MGSA 1FPN2 1OFSA 3I97A 3R4SA 5DZEA 5FO9B 1Y9GA 1BEV1 1AR82 1J1TA 2VCAA 1WW6A 2X5IA 3OPZA 4NAOA 4LE3A 3RI9A 4BQYA 4L8QA 3PVBB 4QPWA 4XYXA 3WNMA 2Y26A 4A6SA 3IPVB 3O0VA 5A80A 4Y22A 2QQIA 2CSGA 3C7OA 1G9FA 1WD3A 4PHZA 1UIJA 2G9ZA 4YYOA 3J4UH 4N8MA 3RZZA 3USUA 4J1XA 4UF0B 2VXJA 5GKAC 4RSUA 2Z79A 3I3EA 4XAAA 1V00A 1LB2A 3ZR5A 3O1SA 4OUMA 2BGPA 1SHWB 4NIDA 4GXLA 1ZNPA 1RC6A 3AK0A 1O6UA 3J7HA 3OPTA 1UKGA 3PL0A 4QXBA 3T3YA 1O3RA 1WGPA 3IWZA 3T4HB 3AX4A 2WLPA 3VKMA 3U4XA 2WIIB 4HKLA 4TN7A 3WNPA 2MPFA 3WG2A 3UV9A 5FZ0A 3GZUC 2YMZA 4CEYC 5C70A 2J1EA 2HWB2 5FZ3A 2QQLA 3LDRA 1AL22 2BNMA 4URTA 1AX0A 3AXEA 2W47A 3AMMA 2RMU3 1XE8A 2VNVA 3S30A 3VHRA 1COV2 1DYOA 3IIIA 1D2SA 2BQPA 3B3QE 4JGYC 4BQ1A 1BCXA 5LY1A 2UY8A 1L7RA 2D40A 2NN8A 3LWCA 3X29B 2DTYA 1AR63 2WAAA 3Q8FA 2R042 4N53C 3FZ3A 4JGZC 4RN5A 4S2FA 1CONA 1F5FA 1GSLA 4QT6A 2VZUA 2JKBA 2VH9A 2VZQA 3D3AA 4LQRA 3EHKA 3LOIA 4GA9A 5A33A 2VMIA 1GWKA 4V1PA 2HWC1 2OPKA 4ZZ5A 2Y6HA 3RMXA 3MHZA 4OHYA 3WG4A 1ZRFA 4K21A 3H42B 2W0XA 3PNAA 4L92A 4XC9A 3EXUA 4XJUA 3NKTA 4EWDA 5JXJA 1HXS2 4MYEA 4A44A 4JRLA 4EROA 3WSOA 3UL2A 3IAPA 1DP0A 2WDBA 3HAGA 1RUE1 2QUOA 3ETPA 1OI6A 2Y6FA 3VBFA 3WQ1A 1QJU3 1W6QA 2WFF1 3ZFEB 5T52A 4FFFA 4LITA 3VUOA 1B35A 5FLIA 2RS31 4IE4A 3E6BA 4R4XA 5E1RA 3USSA 1OXCA 2W08A 4AI0A 1ST8A 3M4FA 4LIVA 1FV3A 3I2JA 5CU1A 3UJQA 3E5XA 4OULA 2V4VA 1F31A 4AI1A 1WCDJ 1JUHA 2P3YA 4QPIA 5T55A 4HXCA 2IVIB 3OBRA 3DGTA 4AEMA 2Z5WA 1NA1B 1XPWA 2WZR2 4FFIA 5M0TA 1R1ZA 3FBMA 3VD7A 1AR91 1IS5A 2D5FA 1C8M1 2O8OA 2YC2A 1W2UA 3CDZB 3ZSLA 1BZWA 1Q3EA 1V6OA 4H2AA 2QQKA 4PCRA 4DUVA 2RJKA 3BVCA 3BTAA 3ZXJA 5BNOC 4CTEA 1V0AA 4IQPA 2ARCA 1UOBA 1MQTA 1JS9A 2EIBA 3PIGA 4PT6A 3GJAA 5I0DA 3U0ZA 1YI9A 1ND2B 1PVC3 4LBJA 4Q4X2 2YU2A 5L9RA 2BW8A 4Q4V3 4K8RB 2VO5A 4FTEA 2J1RA 1VP6A 1PNFA 1WMFA 1CZSA 5GM0A 2P34A 4Y20B 4B1MA 1MZ5A 2W46A 2HH9A 3MIFA 4DUXA 3Q9OA 5KBFA 3PMSA 1SFNA 3FMGA 3E97A 1RUF1 3DPRC 5FY8A 3SCHA 2EXJA 1LHWA 1TVGA 3H7YA 1OA3A 4JZRA 1JZ8A 3T0DA 5DN2A 4KL1A 1V6KA 2PFWA 2F6BA 1ASJ3 4HK9A 2HWF3 4RR3C 3OCPA 5J37A 3ZXDA 2IFRA 1POV1 4CDWC 2IC1A 4Y1VA 1JBCA 3C2UA 3POGA 1CAUB 4HVQA 2Y0OA 4I0WB 1S0IA 5F3EA 1CPNA 3U07A 3VD3A 4DS0A 1HQNA 4LBOA 5I0UA 4AVSA 2LRPA 5CKMA 2ZXQA 4BISA 4XHXA 3ROUA 4CVUA 1SDDB 1QHDA 1KXGA 1LGCA 2RS53 3RS6A 2PLV1 1SBDA 1IG0A 4QQOA 2BWAA 3HMYA 3MDPA 3ZYIB 4DXRA 4EV0A 1US3A 2XLFA 4TSVA 2WKKA 4AWDA 5FYTA 3PUSA 4XIKA 2A6ZA 2RM22 5CAZA 1JU4A 3O1UA 1VBB1 2W1QA 4MV2A 2EXHA 2DFBA 3V65A 4TZDA 2E33A 1QXPA 5C9AC 3EBRA 4QU2A 4D6RA 3GCXA 2X09A 3IDCB 3Q8BA 1R1A2 1WMDA 1JHJA 1VBA1 2A3WA 3MPPG 4FO9A 3KV6A 2GH2A 4LORA 4QGMA 4EN6B 2AH2A 1YEWA 5LA2A 1DCSA 4QPGC 3WW1A 3IKWA 5FTTC 1J58A 4AI3A 5C7GA 2R061 3J8F1 1KJRA 1LENA 4O65A 1GANA 2P2KA 1BEV3 2XQXA 1CVNA 4FP3A 4BQ2A 5JOXA 1RUC3 4Q29A 5EFUA 1NZIA 1LU2A 4GD4A 4QPYA 5DG1A 1DZQA 4QDQA 1JZ7A 5A3TA 2VPVA 4RQPC 1JYNA 3I3BA 2XJRA 1YCIA 4B8EA 1UNBA 1R083 2P17A 2B5HA 5J7MA 2OPWA 3BOPA 4H3WA 2AYHA 4XQDA 3V56A 4UAPA 2E7AA 1N1TA 3WDTA 2A6VA 5GLUA 4ZS2A 5DDJ1 1D4M2 3VKOA 4QHBA 1X36A 2SLIA 3R0RA 2XGXA 2X5IB 2BJSA 3FL7A 1RUJ2 3FUQA 5FJHA 1UY4A 1JYCA 5JZGA 4C1WA 2E26A 1PO21 1GWLA 1NCRA 1SLAA 5FZLA 2J7MA 3RQ0A 3T2PA 4B1LA 2GC0A 2Q8CA 2RDQA 1VMHA 2O0OA 5DAVA 1KS4A 4OQ9A 2HBTA 4FAGA 1AJOA 3KVAA 5JWPA 2A3YA 3I2KA 3FHQA 4K8FA 5KXCA 1E5HA 4Y22B 1RMU1 5LW9A 4CUBA 3NWKA 4U2AA 5FMCA 3H3LA 2HEYF 3RYKA 4JDOA 3URFA 2DU1A 4BLJA 5A3NA 5AC91 3UT0A 4QWNA 1UZZA 2W95A 1EV13 1M4WA 5HXVA 3ZXEA 1O3TA 1JOBA 1JZ3A 3ZSMA 2PMWB 2Q1MA 1Z7S3 4GB32 4LKEA 3ORJA 3IDAA 3N9QA 3ZSEA 3BTZA 5A7WA 4MADA 3KCYA 4HN0A 5C8CA 1U5XA 3ME2A 1W0PA 1AXZA 1DYKA 4IE7A 3VBRA 3ATGA 1GUIA 2HWC3 3A4UA 5A6ZA 4MSVA 4AVVA 3MIBA 5HXMA 3NW4A 1BMV1 5CB7A 4QX2A 3ZVXA 2JDYA 3HNYM 2JJ6A 1HW5A 2PHDA 3AXDA 3OJBA 4Y5SA 5KXDA 2D6OX 4JDNA 1XC6A 4COVA 2Q0AA 1AR71 1V6IA 1NY72 1RUE3 3C7GA 3S5AA 2WFF3 3DN7A 1GP6A 5A33B 2EA7A 2P1BA 1A78A 4FVVA 1IPKA 1LOFC 2HWE3 2WLQA 3H1YA 4LK6A 5HCFA 3WF4A 3I2GA 5FO8B 1C8NA 4BJ0A 3ZFFA 4XPVA 3ASIA 1M06G 1LULA 1YQ8A 1BJQA 2MEV2 1VIWB 5JOWA 3QOPA 3WP6A 5CFDA 1UZYA 3LEKA 1SG3A 1NG0A 3M1HA 4IEOA 4MG2A 3MEPA 2W68A 3WZ1A 1CJPA 1LOBA 1W9TA 4GH4A 4LHLA 3VBFB 3ZO0B 1AR93 1H1AA 1W6QB 2XLGA 2BOIA 3GBWA 4S2HA 4W50A 2WWJA 1YQ2A 1R092 5LATA 4XJ9A 4QHZA 1B35B 1R64A 3MICA 4MGZE 1DBNA 1A34A 3MPBA 2V4AA 2XVLA 2NPIA 2YGLA 1JU3A 4WZCA 2B42B 1ZZ8A 5ANQA 1OH4A 3LF7A 3PHMA 2AACA 3OG2A 1DLCA 1I1EA 5ISLA 2PHFA 3DV8A 5T5PA 1BBT2 1S1AA 5JIAA 4QPIB 4LBKA 4OI2A 4X6RB 1K5MA 2FHRA 2JE8A 3T1LA 2WWSA 2RJ2A 4L2NA 4QB6A 1UMIA 1NCQA 2ARBA 2EAAA 4XJAA 1E5IA 1RUF3 1AZDA 4OCTA 3VZNA 1OMIA 1P8JA 2YC0A 1MQTB 2VZSA 4FOVA 1DQ2A 1KDKA 2GALA 1ODNA 4AI8A 4C90A 1ZZ6A 2W39A 1XNBA 1POV3 2F4PA 2JDKA 4CP0A 4ASLA 1FX5A 2WA3A 4FPHA 3RNSA 3WR0A 3ZXGA 2YY1A 2E63A 5D8AC 1RVF2 4O7XA 1Z78A 1F2NA 1C28A 1NE4A 4N43A 2WNUA 3KGZA 5F32A 1UF2C 2IXKA 5FMOL 4IERA 1Q8PA 3QD6A 3VDBA 2IFWA 2VNGA 2E7QA 3OGRA 4HLTA 5K0UA 5LA9A 1SMVA 2O8QA 3O12A 3F95A 5FPUA 1K12A 5J1XA 1O7FA 1YIPA 1YIFA 3WDUA 5I8SA 4F8AA 4DXZA 1D0HA 2W3JA 5I0TA 4Z1VA 3ILNA 4DXSA 5CADA 5J98B 2ZHKA 1S2EA 5JXHA 2WT0A 1PX3A 4NIIA 3N7LA 1D2QA 3SH3A 1BVP1 4QDSA 2DVDA 4YM3A 2A6XA 1J84A 2AEYA 2NMOA 2ZGPA 4NPRA 4HZFA 2QZ3A 3TNPB 3LAGA 4YVSC 3NMBA 3N9LA 4IXLA 3K3NA 5LRRA 2BERA 4NWVA 3GF6A 5GZDA 2CDOA 3CHXA 2YBKA 1XQNA 2KR2A 2VQUA 5CNAA 1IKQA 2JENA 1CX4A 1RHI2 4AFDA 4AQTA 5BYNA 1N3PA 2GN3A 1CIWA 2NM1A 5DZGA 5TSWA 2UWBA 4COYA 3VDCA 2PHLA 3IZOA 5FPVA 2GZWA 5J48A 1JYTA 1FMD3 1UOFA 3MLJA 2Y33A 2E7TA 1TMF1 1DGRA 3O7OA 1LHUA 4W6XA 3H8UA 3R4UA 1PO23 1LTEA 2VMHA 4PI0A 4CDUA 5F6LB 3DYMA 3L2YA 2XBO3 4PDWC 4ONUA 5KHIA 3CNAA 3I2IA 3JB4C 4QX5A 2Y0IA 4HBNA 1VBC3 2G9GA 2JB8A 3KB5A 4LUMA 1VRBA 2BGOA 4UW3A 3ZSKA 3E6CC 3A22A 2ZS6B 3J7LA 1RMU3 4W8JA 5FCCA 5CEHA 1ZA7A 1TNRA 1UWWA 2XG3A 4XUPA 5DUUA 1SLLA 1ND3C 3UETA 4XMAA 5FV3A 4XQWA 2C4XA 1AF9A 4NUBA 5C3PA 4HVRA 3A7QA 4WVMA 3HNMA 1NCRB 1HIXA 1QIQA 2Y6GA 1QOOA 4ZXKA 1F35A 5DUXA 5FRAA 2Y64A 3KHBA 4RHV3 4NO4A 4D3WA 4XFFA 4FPCA 2WL1A 1ZBE2 3U37A 5DUVA 1SQ4A 1QJY1 2JKXA 3RZKA 2FZ2A 4CEWA 5IYYA 4HSLA 4KMQA 2EAKA 1UY0A 4A4AA 4YVWA 4IEUA 1RUG1 2A75A 3CJIB 2BVBA 1H8TA 2WZEA 1UPIA 4QU1A 5FKBA 4OI4A 1T6BX 1QOTA 2UU8A 1HN1A 4AVCA 3TBDA 5FP3A 3TN92 2XONA 2GDFA 5A7WB 1AVBA 5C8CB 2ATFA 2FMDA 2ERFA 1AR73 1NQJA 1CZVA 1ACCA 3OBAA 5H9SA 3HEIA 4N90A 3VB9A 1YJLA 3VBRB 1OPMA 1ENSA 1VBE2 2BWCA 3DKWA 3TEWA 3IPVA 4AFCA 4Y24A 1W8FA 5FMDA 3PURA 2YDEA 1UU6A 4LLOA 1QJX3 3J9SA 1QNWA 2Q1FA 3LIGA 1O5LA 1LR5A 2D97A 2GNMA 4M0HA 5C6CA 1IS6A 4XQ4A 3NSTA 5IT6A 4Q0QA 3VBSC 1N1YA 4I0BA 4NR1A 3CL1A 3I3MA 5FP8A 3NNJA 3ZKYA 1RUI2 2W1SA 4M01A 5FPAA 1G9DA 1TME3 5K7PA 3VBUC 5LWBA 1LGBA 2EIEA 4QXCA 3WF1A 1LEMA 5JR2A 2EF6A 3ZFFB 1UL9A 2HWB1 3IB3A 1ULEA 4PF1A 4YG6A 4AE2A 1AL0G 1Z0HA 5BXXA 1AYN2 5CFDB 2VBDA 1RIRA 1COV1 3HBZA 4M4RA 5HV0A 2WT1A 2WO7A 1OF4A 4MXVA 4GH4B 5GLVA 1OLMA 4XFBA 5F3CA 2BNNA 1PGL2 4W4ZA 2HYKA 1QKQA 2R041 5E16A 5IW0A 3TWIA 3WNLA 4D8MA 5C71A 2BYVE 1O3QA 2WUHA 4P08A 3LE0A 4AVBA 5H9RA 2D6NA 3JQXA 4CEYA 5ACA3 3Q8CA 1LU1A 2VMEA 3KV9A 2OKXA 3AYDA 3ZM8A 4QKNA 1SDWA 2OIIA 4ZZ8A 5IVJA 5JOYA 4L11A 1K5JA 3AFKA 4E4DX 2VMCA 1GLHA 1WA4A 1LECA 2X29A 4PQQA 1K5MB 2RMU1 2ZGRA 3LA7A 1W8UA 5GLTA 2WNVC 1ZX5A 4KBBA 2OZJA 4XZPA 2HJIA 1ULOA 2DVFA 4UFJA 2QTWB 3LDBA 5CG8A 1CPMA 3BTXA 2DVAA 3TNQA 4JKLA 3CU7A 5BPXA 4BIFA 1W2NA 3K4ZA 3D82A 3B00A 1GMMA 5T54A 2ZMKA 4CUGA 3WG1A 3I3QA 5DPNA 4LO7A 2W9XA 4CCNA 2WR9A 3WNOA 2ARAA 3PJQA 5FZ6A 3ZFEA 5C5TA 3NJYA 1OD5A 3FHAA 3ZFGC 2VJXA 4DEQA 2PHUA 5JR7B 3GCWA 3DCQA 3JD72 4UW6A 1CQ9A 3KMHA 4OVEA 5D2AA 4NHLA 4B7KA 4N43B 2WNUB 1PVXA 2VGDA 1KDMA 1H2NA 4CCEA 2Z4FA 1NX9A 1W6OA 2WZR1 3DKQA 4XJZA 5FXVA 5K0UB 5IWFA 1HN0A 3W20A 4LO4B 4MO3M 4AHWA 1QJU1 2WJSA 2XJTA 4PBPA 5EPAA 5FZIA 5CG9A 4ISRA 4XTMA 2ZHLA 4AFMA 2VAUA 3ZKUA 2DCYA 4FPYA 3LPGA 3B01A 3SQOA 4XJWA 2ZACA 3MW4A 1BK0A 1RXFA 4AEDB 2DV9A 4P5HA 2JD9A 4OHXA 1ZZ9A 4B29A 4R9AA 2QQUA 2J22A 4BM8A 3WOGA 1W6PA 5DXDA 1VRH3 4AGVA 1F4AA 2GSYA 1JH5A 5LA0A 4JHTA 2VOXA 4MLOA 2ET1A 3ZYFA 1TMF3 5EJ3A 1WCSA 4AEKA 3M8LA 5BNOA 5FQ0A 2WRAA 5EZWA 5GLWA 5J36A 3NV2A 5EQUA 1BKZA 5K4LA 3THCA 2VQTA 3PJYA 2GNBA 5AFEA 1W05A 1HDKA 5JDBA 3JBG3 2EIDA 3NV3A 4A3XA 5HV4A 3ACLA 4NHYA 1PK6C 3B7MA 4E2QA 5GZCA 1GNZA 1HRI3 2IXIA 3BIEA 4XMIA 2JDNA 1SLBA 1MACA 5DAWA 5KHHA 1OT5A 3PU8A 4YG3A 4AK3A 3DPRA 4BIOA 3KF5A 4P9JA 3N7JA 2XVKA 4CCCA 4BE3A 2ENRA 2ZAAA 3HT2A 3QCWA 4NPMA 4YW7A 4CDUB 1QWRA 4Y5Z0 4IV3C 1PX4A 3T09A 5F5CA 5I8TA 2NMNA 4Z2WA 1VB4A 2RM21 3BUCA 1ENQA 4H14A 1S0CA 2HWF1 3FWEA 3N3HA 4JDMA 4AZZA 3OY8A 5APAA 1YO8A 3RZGA 1EAH3 2Q1ZB 2GU9A 4YFWA 2GAUA 2XDVA 1UD1A 2I07B 3OUJA 2WS93 5F3GA 4GKYA 4PBOA 1FT9A 1IGOA 2DVBA 3MBWA 2RJLA 2FCVA 4KG8A 4CXYA 3ITQA 5CFCC 5C3OA 2V73A 1FPN3 4FAHA 3VDDC 1AR83 1UU5A 3WCRA 4W6WA 3NAPC 3RZJA 3FX3A 3SITA 2PQSA 2E32A 2C9AA 4E2SA 1C3HA 4CEWB 2FDJA 5FUPA 4G4FA 4M4PA 4YVWB 3ZYRA 3N9PA 1C57A 3R4DB 4M3CE 5LY2A 4AFAA 1NOVA 3WP3A 1H8TB 4CU6A 5DAQA 5C3SA 1QOSA 5C8WA 3VLBB 4QPGA 1I9RA 3U14A 5JMCA 2FBEA 4QMAA 2DCKA 5KXEA 1LHVA 4E27A 3GM8A 4M3CA 5FXXA 1JYXA 3QLQA 1OHFA 1OQ1A 4GWNA 5BY5A 1W3XA 4Q0PA 1PIV2 2XJPA 4K7JA 1W8TA 4DPNA 3I4IA 2ZGNA 3IM0A 3UYJA 1RUC1 4RQPA 1OOPC 4HANA 1YNAA 4KGGA 1WBLA 1H8VA 1MVQA 5IVFA 1KS5A 2G9FA 4E4SA 2VOWA 1LHOA 1I3HA 1XYPA 1R081 1U12A 2R1DA 3EO6A 2B9VA 4DRVA 3LIHA 4W6YA 2VXRA 2HWB3 1H2KA 2ZPXA 1AL23 1MVEA 1QH6A 1V9U1 3G7DA 3SCGA 4N7IA 4XF4A 1HJFA 1COV3 1H4GA 3N9MA 4XABA 1EPWA 3VKLA 2VZ1A 4GB31 5L36A 3ZXLA 3NV1A 2R043 2PAEA 4Q2FA 1L7LA 3GHNA 1UN1A 2YXSA 4GALA 5F3IA 5A3OA 3AZZA 2XL7A 3PDQA 4PLOA 4ARYA 4YARA 2K9ZA 3OD0A 3PUQA 4IEWA 3GHMA 1AYM2 3SCFA 3DECA 2BVVA 3WINE 4EN9B 3CQOA 1REDA 3JXSA 4RYDA 4Z92B 2RDSA 4Q27A 1EV11 3LDKA 2R16A 4FI9A 3IT8A 4XF1A 5IK8A 1G8WA 2PHTA 1Z7S1 1XE0A 1U5YA 1HXS3 4FBFA 2QQMA 1IZ3A 4OI0A 1UXXX 3ZYPA 3VN4A 4CEYB 1NY71 2QNKA 4OUEA 2WO2A 2XJVA 2XOMA 4OFGA 4ZU7A 3W5NA 2R49A 4OZXA 3ZPYA 3HQRA 5A3LA 3H8XA 4MGTA 3WUDA 3ACIA 4YGDA 4BDVB 5DABA 2VMDA 5JIUA 3OGJA 4PJYA 3CMGA 5F2WA 2ZZJA 2JG8C 4IEXA 4JGZB 2R32A 5IK4A 2EALA 3O1OA 4YZ2A 2V5DA 1C5HA 1OH3A 5FMOS 1AJKA 2WZR3 2NLRA 4COZA 1BXHA 4HN1A 1W9FA 2A73B 3VZLA 3GBGA 3GDBA 4Y1ZA 1R091 2YG0A 1AX1A 1S2KA 3D0SA 4Y33A 3S7IA 1I6XA 3O1VA 1W6NB 2HWE1 3U10A 3VKFC 2ZEXA 3GJBA 4Q0UA 3SC7X 3LA3A 4I01A 1LNSA 1BBT1 1RUD2 2VMFA 4OUSA 4Q4X3 5T5OA 5IVBA 3WG3A 4CCLA 3SH4A 3K75B 2Z42A 5LZ6A 1G9CA 1W6OB 3RDIA 4GULA 3DF0A 3RVHA 3T0BA 4CXWA 3S57A 2BOJA 2LS6A 3JU9A 1AR62 4QQPA 4BOWA 2HKXA 1S4CA 4WVWA 2FDGA 3S7EA 2XKPA 4R4ZA 2YZ4A 1ONAA 4AF9A 5JSRA 3DXUA 1MEC2 3LOBA 4JQRA 2WSUA 4Q4Y2 1ZBA2 4C8DA 4JKMA 1W6PB 2WNOA 4A7YA 3N9NA 5BNPC 3QBQA 3AMHA 1D4VB 4AAPA 5FQ0B 3WP5A 1ND2C 5BNOB 4HSJA 1N1VA 5GJ6A 3ON7A 2OX0A 2H6BA 1DZRA 1X7NA 5IAVA 4YM1A 3POSA 2VE1A 3Q8AA 5FR3A 4EN0A 4F83A 1SFPA 1WCQA 3MFCA 3N36A 4I0AA 4P9XA 2RM23 5FKCA 3I2OA 3WVJA 5A6XA 4WM8C 4XURA 1BK1A 1PO12 4ZKTB 4FSJA 1Q8VA 5EYXA 1C1LA 2PTMA 2ZABA 2VZRA 3OYWA 2AUYA 2PYTA 1GOHA 2AREA 1R1A3 2WAOA 3DPRB 3E1F1 2P4EA 3DEMA 3NV4A 4Y4RA 4J1WA 5FZ1A 3UKNA 3U11A 3GNEA 2GN7A 3KT1A 2YFZA 4RR3B 3VBOA 2W1UA 3NJVA 4Q4W2 4XF9A 3W5MA 3ZYBA 4A2UA 1H2LA 1VAVA 4XBLA 3OY8B 3AKPA 3P1IA 3PIJA 4HOOA 1C1FA 2IXJA 1RHI1 1YC61 1APNA 3OGGA 3PTYA 2JECA 2D98A 4LA2A 2J1SA 2VBBA 5C4WA 3SISA 2A1XA 3MO4A 4FQ4A 4XDQA 1CD3G 1SCRA 3IBMA 2Z2SB 4ZS3A 1D4M3 2W92A 2PHWA 2IXHA 4DQAA 1RUJ3 2Q8DA 4BZ4A 3VD9A 3POEA 2P3JA 5CYYA 5FP9A 3VD5A 5IHRA 1WCKA 4D6QA 4NE9A 3W21A 2W5FA 3U1XA 5BNNC 4HKWA 4LBMA 4TTGA 1NXMA 5A6YA 2RV9A 5FZMA 5AFBA 2FDIA 4QPGB 2ZX2A 2VZTA 1LEDA 1G7YA 3PVNA 1E5SA 3H7JA 4M3CB 1A6CA 3ZDSA 1FMD1 1ALYA 4UXAA 1V9U3 5JUVA 3BTYA 1LOCA 4Z8BA 1HV1A 4E9KA 3VZKA 2RS52 4PDWA 1AXKA 2JDHA 3AMPA 4RQPB 4GB33 3I2FA 1WBFA 2XBO1 1PM7A 4D7SA 4I3GA 5LCWL 1ZA4A 3UK9A 1VBC1 5L9BA 4WV8A 2VMGA 1XU1A 2JX9A 1J59A 1W9SA 1YHFA 5F5AA 3BPZA 3O1MA 5AVAA 1HB2A 2VECA 3THTA 1CAXA 2XL9A 1TG7A 4WBBA 2HLEA 3SKJE 4D7YA 3BPSA 4FTBA 2QQJA 3CJIA 1UXZA 2L9LA 4X6QB 4JTOA 1OKOA 5CVRA 3VD4A 5KHKA 3CBNA 1LGNA 1W99A 4DY3A 1UPSA 5FY9A 3HVDA 1BEV2 2WQ8A 4MUVA 4QHOA 4RHV1 2ET7A 2J1UA 2VNOA 5EHDA 4CCKA 5T3NA 4WM7A 1YLLA 4AHZA 2LROA 1VR3A 2RVAA 3KT4A 3W9AA 5C33A 2TBVA 4OMDA 1OQDA 3Q8EA 4D69A 3WQBA 3LKJA 4NVPA 4CRQA 1MS1A 2FDFA 3O1PA 3AJYA 1VMJA 3GBFA 2NZ9A 1VAMA 2BZDA 1HQWA 1SBEA 2G1MA 4JHZA 1PM4A 1RUH2 3UNPA 2MEV3 3T2OA 3PLQA 3N4MA 3RWKX 1UMHA 3GGLA 2VQAA 1DGWX 1XXNA 2XWJB 2VVDA 1WD4A 3K3OA 3MZHA 2Q5TA 1A8DA 3ALQA 1R093 4DRRA 1DQ4A 4RS5A 1ULFA 4QB2A 2LW8A 5CKNA 3RPQA 4OMCA 5FZ9A 3VV1A 2DUPA 4C91A 4QB1A 1N3QA 4XBNA 2WABA 3KV4A 3ZXFA 4AI9A 4D6SA 2YPDA 2HYXA 1JZ5A 4FCAA 1BBT3 1AYN1 3FBYA 2D6LX 1QJX1 4K20A 3ZN4A 3VBSA 3SNMA 5DQ0A 2HEWF 2VZPA 4GJYA 3LGRA 4IE0A 2DBNA 3VBUA 1YQ5A 4BQ5A 2WINB 2XHNA 4R9DA 1TME1 2MHFA 2ID4A 1RB8G 5FYYA 2CAVA 4IETA 3AKRA 4Q8LA 4F7ZA 2H0VA 3MYXA 5CZKA 3C7EA 3MGUA 5FPXA 3V0BA 1WLCA 1FOD2 1NXD1 2J1VA 5DUWA 1E5RA 4FP2A 3NQHA 2HWC2 3ENRA 3LB9A 1PMJX 4AGRA 1H4HA 1UU4A 1B35C 3LFMA 4PI2A 1FYUA 1OKQA 2FD8A 1PZ9A 2TEPA 4IGOA 3GALA 4UFLA 5GLZA 2ILMA 3VGIA 1A8MA 4UBGA 4KWKA 1PGW2 1KGYA 1LRHA 1IS3A 3IMNA 4M0NA 5FZHA 1W28A 4QPIC 4MHUA 4ET7A 2VZOA 5EJZB 3B5LB 3RZMA 1W8NA 5EP9A 4YW2A 3WXPA 1OF3A 2DCZA 5ACA1 5FWEA 1QDCA 3EB7A 2ZBJA 4HETA 5FO7B 1JUIA 1Q8SA 2D6MA 3DL3A 5E88A 3GZAA 2RS32 3JD71 2WNVA 3T30A 2R0HA 3MV01 2WYFA 3RZLA 3POYA 2VL4A 2WQ4A 2NYYA 1OUXA 1MS9A 3H3ZA 3WD5A 5FYIA 3B93A 4FTSA 1LESA 2P6CA 3H50A 4UBHA 4X8NA 3IN9A 1UMZA 2CGOA 3L2HA 1KD7A 3P3NA 1WLDA 4EZHA 4XFAA 3EMRA 3FFQA 4FPJA 1AR92 1C8M2 4YWAA 2YBSA 5LK5A 5FPZA 2KD7A 2HBUA 1ULDA 3O0XA 4XOGA 2BUKA 2TUNA 3ZFGA 5ABJC 1O5UA 2OS2A 1VBD2 4AYUA 2ZCWA 3MIEA 2UYBA 1RHI3 3MIDA 4HKOA 1S0BA 5JI7A 3BU0A 3P6BA 1UYYA 3NKGA 3N9OA 3OYWB 5L19A 4J25A 4FFHA 1JYIA 4Q8KA 4AEDA 4B4RA 1GZWA 2VOTA 4FPEA 2HWD2 3LCPA 4IUGA 2CY6A 3WQ7A 1GWMA 1S0DA 3QH7A 1AUYA 4JV4A 3NJXA 1MS4A 1UY2A 3VBOB 3WP4A 3CEWA 1QU0A 4IV1C 1ZVFA 4OYUA 1RUF2 1OURA 5KXBA 2R071 4QX7A 4MGQA 2G19A 2CYFA 1RGSA 2R1BA 3M70A 3MI8A 5KC6A 3IMMA 2JE7A 1Q43A 3WT3A 1RXGA 2EICA 3HJRA 5C4WB 5LRSA 1F9KA 2P37A 2Y6KA 1DU3D 4YG0A 5IVVA 1VRH1 5FY5A 1JZ4A 2ZGSA 5E6HA 1RJ7A 5T5JA 3WDVA 4YM0A 4CPBA 4CDQC 3TEZA 1CWPA 5JSOA 3SHRA 5B4NA 5A7PA 1G6NA 4JC1A 4LKFA 5B4XA 2PLV2 2XLAA 2ZGMA 1YRZA 1O4ZA 1DF0A 4UFKA 3I2DA 3VZJA 3P5BA 3AP4A 1POV0 2EXIA 1ZBE3 4Q0SA 5CBLA 3JBG1 3PU3A 1VBB2 1I5ZA 2IVJA 2X8KA 4XUNA 4OHWA 4KWJA 1HRI1 1J3QA 4B3NA 4BCUA 2Y6JA 2JE9A 3B02A 3D5OA 2GP5A 2RS11 1VBA2 1RINA 1MS5A 2Q30A 2ZEYA 3HQXA 4IEPA 1HX6A 4PDWB 4QKFA 4UYBA 5EXOA 5FDBA 1DFQA 2O14A 1UX6A 3MF6A 2YUEA 4XW3A 3TN93 2R062 3J8F2 4XJ8A 2BTVC 3UGHA 5FYSA 4IE6A 3LD8A 2CTVA 5JPNB 4LEJA 5JZGC 3U78A 5I93A 4Y5TA 1NCRC 4FQZA 1YJKA 5CKQA 1DQ0A 1EAH1 1ZYBA 2RDNA 3K2OA 1VBE3 3NNGA 1CAXB 2CGPA 2VM9A 2WS91 2OA2A 4OQ8A 3T2TA 3POWA 1YI7A 3OTFA 5FBZA 1U0AA 5DDJ2 2XWBB 2QVSB 3CO2A 3VBHA 1FPN1 1EP0A 1TEIA 2JEMA 4AHXA 2BDRA 5BNQA 1AR81 4NRQA 4P9YA 1XRUA 1ULCA 4WM7B 4CCOA 2D6KA 1EUUA 2C6SA 1RUI3 4C1XA 2X53S 2FCTA 3OGSA 2AZ5A 5FK8A 1HQLA 1CIYA 5AVPA 4EYUA 2O1QA 1B09A 4DNYA 1RMU2 1BHGA 4HFSA 1PZ7A 2PXJA 3JQWA 5A6QA 1X33A 3PMEA 5C5UA 2PHXA 3HN3A 1ZM1A 5HBAA 1V6LA 3UKTA 3VBRC 1AYN3 4ASKA 4CCMA 5AC92 3WNKA 1DIWA 3M2MA 1W2AX 1IPSA 5L9VA 2DDUA 4TXWA 5LB6A 1OOPA 1ZRDA 4TLGA 4XFGA 1DDLA 2B46X 4RFT0 4URAA 2WQZC 1NQDA 1XB9A 4LIUA 3AVSA 5KR7A 4V2WA 3MFAA 1H1MA 1WWYA 4RS5B 3IIAA 2QBXA 1YFWA 5I91A 5LEJA 3BODA 4R9CA 1NLSA 3ZMNA 4CCJA 4QX3A 2JXAA 5FY4A 4YFZA 3O1RA 3D6EA 2K0GA 2Q4SA 2ETEA 5FZ4A 2WZPP 1Y4WA 2BFUL 3AB0A 3LEIA 1AL21 4LKSA 1GBGA 1HV0A 3AYAA 4QKBA 4JVAA 1LKNA 1OLME 3VBSB 2K46A 4NHXA 5JXGA 3LZZA 3THPA 3ZFFC 1BMV2 4B4PA 1REFA 4IE5A 4L0PA 3VBUB 3WQ0A 2ZEZA 3TYJA 4UI9L 1OBNA 4MOAA 5CFDC 4BK4A 1TNFA 3M3EA 4LBQA 1GQHA 4RFRB 3F2ZA 4COWA 4GAZA 4B4QA 2C9KA 4GH4C 3N7KA 2XH6A 3V0BB 2G4IA 1W2TA 4QQLA 1O4YA 1DGRN 3A21A 3C8XA 1PZ8A 1ODMA 3JD73 4OHZA 4YGCA 4XBQA 4JGYA 5HPOA 1V6NA 2R30A 4E4ZA 4N9IA 1QJZA 2D44A 2RDRA 4N53A 1YFUA 4JGZA 1CAVB 1HXS1 1QEXA 2VZVA 5FJKA 1NUKA 5FIXA 5A1FA 5FK7A 1FV2A 5FZ8A 4XUTA 1NCQC 3WDXA 4DFSA 2FDHA 1IG3A 2CAUA 4CUAA 1QH7A 3GXUA 4TLFA 1BYHA 2W2IA 2WNVB 3AP7A 3POJA 1IPJA 4Y26A 2Q8OA 1W6NA 3E5QA 3WNXA 3OBZA 2JG8A 4ZU5A 2ORZA 2R6QA 1MS0A 4BQXA 1Q8QA 1NLQA 1DYPA 1S0GA 3B69A 1VJ2A 4LO5B 3MV11 1OC1A 1W03A 2E53A 1W6MA 2WNUC 4N43C 5IFTA 3RJ2X 3D0JA 2FCUA 1W8ZA 2JDAA 2R073 5GALA 2CGNA 3ZFGB 3CZUA 3GYDA 1JYVA 3KZ4C 4LNVA 4K9SA 3ZYJB 4LBLA 5FZFA 2JDPA 4FXKB 4BHPA 2A3XA 4ZPIA 5LASA 4Q4X1 1GZWB 4UOJA 1O8PA 4S2GA 4Y1YA 4Y1UA 3AM2A 3E6DA 4BMBA 4CPBD 1GYKA 4EZ4A 2GMEA 4FPFA 1WCUA 1AHSA 5F9TA 1EUTA 5FZAA 1XSQA 1UX7A 1OD3A 2IZWA 3KM5A 2DCJA 3DXTA 4IEZA 3PVOA 4KWLA 4MXWA 2OZ6A 4HG6B 2JIGA 2XB6C 3HPNA 1MS8A 4MVTA 2EXKA 2WA4A 3SLIA 5LBFA 1JYWA 3CLPA 1XNAA 3OOXA 4S2DA 1RTVA 1DQ1A 1WLWA 4XIOA 2P3KA 2C0ZA 2C24A 4BXFA 1GICA 5CIRA 1IQDC 3T2QA 2ARXA 4NRPA 2B8MA 2WN3A 2Q8EA 2YROA 2RS13 1U5ZA 3W59A 1ENRA 1GNHA 4OHVA 2IXLA 4KWUA 4WVVA 5JXIA 5HCBA 4ES8A 3ES1A 1GZTA 3WW4A 5IK5A 1LODA 5DAXA 5FPLA 4RR3A 4FFGA 1Y9QA 4LULA 4CDWA 4WM8A 2PELA 5L7OC 2GC3A 4WVZA 2HEVF 1JODA 3O14A 3BU7A 2LM3A 5EWSA 4C0BA 2D5HA 4YW4A 1IOAA 4LO8A 2V5YA 4XACA 4TYSA 2XUEA 4CU8A 2QDNA 1R1A1 3RZHA 1CR7A 3HNBM 2W1WA 5K9YA 1T6GC 4BWOA 2VD7A 5FUNA 1CZTA 3J26N 3K4DA 3RMYA 3WHTA 5K8SA 1LHNA 1PIV3 2JG9C 2VG9A 1U5IA 1ZZBA 3WDWA 4YSFA 4ATEA 2GMMA 4GMP1 3ZYHA 1SZBA 1ULPA 2CDPA 4HL0A 5KHJA 4QQHA 2IXCA 3OSDA 4UWDA 5C9AA 2B45X 3VHOA 4RGAA 4I3PA 2UY9A 2DUQA 4UFIA 4H7LA 4XUQA 1WKYA 2WO3A 3VL9A 3KT7A 4QKDA 3ZIWA 3KV5A 4XCAA 5BV6A 1C4RA 3UESA 4CEWC 2C5DA 3N7MA 4A3ZA 3AMQA 1D4M1 3VBHB 1QXJA 5F5QA 4YVWC 1HKDA 4XHBA 1CGPA 4FPLA 3N35A 4K3UA 1RUJ1 4EN8B 2RR12 1H8TC 4G9SB 1QNYA 3K46A 1NE6A 4ITCA 1OA2A 1JI6A 2VOVA 1Y3TA 3WDYA 5F6KA 4CDXC 4CP9B 5BNNA 4IEVA 4MHRA 1O59A 4NMIA 2RG4A 2FMYA 1YFYA 1QJY2 5FP4A 3BYWA 1YQCA 3FHIB 4MZUA 2P3IA 4YRDA 1AYM3 2QQNA 5C3QA 3ETQA 1N47A 1Q5OA 3POFA 5GZEA 2OYZA 1RUG2 3ZXKA 5FZKA 1WMEA 3WF3A 3DYOA 1OOPB 4CSWA 4IEYA 4N9HA 1SCSA 1HRV2 2GC1A 4LBQD 3W58A 4XVHA 3ZLIA 2QKDA 1FI2A 4KGQA 4AVAA 3M3OA 3LQCA 4YM2A 4LUKA 1DGLA 1G9AA 3NJZA 2ZX1A 3FLPA 1KFXL 2WZ8A 1E57A 1PHMA 3H0OA 4OI1A 1MPXA 2VCBA 1W3VA 4ARXA 3ABZA 1RUH1 4LOTA 1D0GA 4HVOA 4MGYE 2QCSB 1OFNA 1TQ5A 4LXLA 1QQP2 5FLJA 2BGCA 4K1ZA 1W0OA 4LBQB 2DFCA 4CE8A 2ZAHA 4HONA 2VR4A 4XCBA 4UFHA 4XXAA 2VTXJ 4RA0A 3TOJA 4PIZA 1H30A 2C1FA 2JDMA 5T5LA 4NJ4A 1J1LA 2D3RA 2V09A 4IEQA 4JGYB 4Y4YA 3OGVA 1RUD3 2I2SA 5F37A 1Y43B 1WUVA 2MEV1 3UKVA 1K42A 5F8PA 1GZ9A 3PUAA 4N53B 2YPJA 3FFZA 5FZEA 5JPMB 3AP5A 3A23A 2QFEA 2LUWA 1GP4A 2ZHMA 5FP7A 3KCXA 1JMUB 1XOYA 5H9QA 1W06A 4FOYA 1LOFA 1OQEA 1Y9MA 3NNLA 1PMHX 1X9TA 3O5SA 5EJ1B 1MEC3 3LSDA 2JG8B 1FOD1 1SLIA 3V0AA 4I2OA 4Q4Y3 4FXGB 1GOFA 1ZBA3 4L99A 5FOJB 4BQWA 3HN1A 3ZFEC 2ZHNA 3NVCA 1Q8OA 3OUHA 2RMU2 3I8TA 5FBJA 1PGW1 5FXWA 3IDBB 1I5PA 5BUVA 2VUJA 4ZXEA 1W6MB 3KD4A 3WEZA 4P5YA 2MNGA 4BYYA 4OZOA 4YPJA 2DUOA 5FXZA 4DMIA 2E9QA 2JIJA 4LJHA 3HQUA 4AW7A 3IAQA 3VL8A 5FAXA 1NA1C 1SACA 3AKQA 1CX1A 4A41A 3AZVA 1JZ6A 3KLSA 2VULA 1K45A 3AMNA 3B9CA 5A32B 2E31A 1PO13 4A42A 4AOCA 5J96B 2BPA2 1POQA 1S55A 2YV8A 4NOTA 5JI9A 1RVF1 3VZOA 1QMJA 5FZCA 3ZN6A 2ZGUA 3APBA 4YNIA 4XFHA 5ANNA 1GOGA 3WF2A 3OEAA 4O61A 1LOAA 4KG0A 1G86A 1WMXA 2ZGKA 4MXWB 4PLNA 4NHKA 2DCTA 1XE7A 2ZA9A 4Q4W3 1TZOA 1LOGA 1V6MA 4BLIA 3CKHA 1QJU2 1CN1A 1ENXA 1VBD1 4U36A 3K4AA 4GZ9A 3I2HA 5BNPB 1NYWA 5F39A 5D8AA 5A3WA 4DEVA 3CIHA 3A0NA 3AVRA 4EJRA 2KM2A 2HWD1 2AENA 3MW3A 2A6YA 2A71A 2ES3A 3BIWE 2QQOA 3ZOIA 2R0FA 4BQ4A 3NL1A 3J7NA 4P00B 5ABJA 1OUSA 4CDWB 4D94A 1MZ6A 4WM8B 1SBFA 4GMP3 3I59A 4D0QA 1OSGA 3EQEA 4AVTA 3FN9A 4AHYA 4FT8A 2VW2A 3FLTA 3J7MA 1JN2P 3OBTA 4AAXA 4QX1A 1H6XA 2DURA 5JLVA 4V2VA 5FYCA 2PAMA 3LSEA 3H3UA 3KF3A 3VHPA 5KWRA 1PVC2 4Q4V2 5F7UA 3H1WA 5GZFA 3FC0A 5B2GB 1PMIA 3S0MA 2VVEA 4IDZA 5IJRA 3INAA 5A7QA 4IV1A 3C3VA 1UQXA 1VB2A 4YVSA 5LBBA 1UCXA 3NNMA 1S0EA 2YC4A 2BBVA 5G05L 1OLRA 1N1SA 2YYOA 3HR9A 2XHKA 4OLLA 3ILRA 4QGNA 2CL2A 3ZDVA 4QDRA 3ACHA 1W8WA 4EN7B 3GZTB 2I45A 3EYPA 2FQPA 5T50A 3UGFA 5C9AB 1L3JA 3AC0A 1ASJ2 4QQ2A 3HIFA 4EWAA 5LBEA 4O9EA 3EJKA 2HWF2 3I7DA 2PN5A 4DXTA 4JX0A 4QXKA 5IVYA 3U75A 2ORXA 3WW3A 2VNRA 5JMOA 4R52A 2DF7A 1ZRRA 1HB4A 1W8OA 4CDQA 1TE1B 4PIYA 5FZ7A 1UYPA 2PHRA 3JCIA 2J1AA 1S2BA 3WY6A 5IATA 4CZSA 5IAXA 5IVEA 4KU8A 2W91A 4ORFA 5HCAA 3QH6A 1QDOA 1JHNA 3BCWA 1SLCA 5BNNB 2TNFA 3AJZA 5I8YA 4HT1T 2VCCA 1ZBE1 2X5IC 1XNTA 2E6VA 4CU9A 3R6SA 4INDA 5IK7A 4NROA 3LEGA 1W90A 1L7QA 1ND3A 2JWPA 4YW5A 2VCMA 1QJEA 3RGBA 1NKGA 2ZGOA 1LCLA 2BFUS 1RJ8A 1UOJA 3BB6A 1RUH3 2RHPA 3BN6A 3JUUA 2N7GA 4HPKA 3OB8A 1VE0A 4QAWA 4QXHA 5FY7A 4LR4A 4ASMB 1DGWA 4GMP0 3TN91 5A1AA 1ZRIA 3K48A 1F5JA 1RUC2 1PNGA 5EYYA 1GU3A 1S0FA 2WN2A 4LHNA 2WWUA 4XILA 1W39A 3AZXA 3CZJA 3T0AA 4ES9A 5A70A 4B7EA 4NRMA 1T2XA 1VBE1 5IVCA 5J09A 1R082 2E51A 2X10A 4KBZA 5DG2A 2NP0A 5E8AA 1IHMA 4IL7A 1FNYA 2FDKA 2BBAA 2VQ0A 4BXSV 3USUB 4LTAA 2D6PA 1HB3A 5LBCA 3D8CA 2XJUA 2VW0A 1UAIA 1X8EA 1V9U2 3B94A 3H1MA 3KSCA 4J6GA 4PLMA 2WBKA 1W0NA 1W9YA 1BQPA 4LA3A 3RI8A 2QZ2A 2UWCA 1YQ6A 2W87A 2ADDA 1MR5A 4K40A 3SEEA 2BU9A 4LHSA 4I09A 1RUI1 1HJGA 2GNTA 1DQ6A 1MS3A 4CUCA 2YHJA 2RE9A 1QY4A 4P9IA 4YLZA 2DWRA 5FYZA 2IWGB 5A7SA 4GKXA 1FOD3 2ZKNA 4RGGA 1HLCA 3UJOA 2JDUA 2PAKA 2A7AA 1WW4A 4MH0E 3THDA 4AQ6A 3LPFA 4HMZA 1EV12 1WLTA 5L7OA 1LAJA 2EVXA 2BRTA 1Z7S2 1PGL1 4XTPA 4YZ3A 1GFF2 1S0JA 1O8SA 5FWJA 1CJDA 1DHKB 5A7NA 1QF3A 2A6WA 3AYCA 2P6HA 3SEPA 1F8VA 3V0AB 1YFXA 3VBFC 1QXRA 3HWJA 1UY3A 5JOZA 1V70A 2RS33 1SPPA 3OEBA 1QJFA 2YB7A 4W65A 1RVF3 4DO0A 1JZ2A 4ZHNA 2Z69A 4DB5A 1SEFA 4EE2A 2YGMA 3KVBA 1VLNA 1KEXA 1XBFA 4GWIA 5ERLA 3TAYA 3S6PA 2JDZA 3H8OA 1EYBA 1H1IA 4E8DA 4R9BA 3VHNA 1C8M3 1CAVA 2R7EB 4JQTA 3C7HA 4YGEA 4A7ZA 4I02A 1RUE2 3ZPOA 3FE5A 3RFRA 5I0RA 2WFF2 1VBD3 4XF0A 1FATA 1V6JA 1SFYA 2HWE2 1GR3A 4KQ7A 2A5ZA 3KS7A 1WA6X 5F5IA 3ZN6B 1MQTC 2GP3A 5IUQA 3RWNA 3H9AA 2ZGQA 5FUIA 3KQ4B 2HWD3 2VUCA 5EIYB 3NRUA 2JD4A 4QX8A 3FUOA 3T1MA 4ZY9A 3WV6A 2PA7A 2K2SA 2OT7A 3AP6A 4KNCA 4P02B 4LPLA 4XEZA 3IDEA 4CP1A 5LEKA 1YXWA 4DINB 2C26A 4D7TA 5KHGA 1N3OA 5SV5A 4IGQA 3I49A 3PUIA 1JXNA 3LA2A 5D8AB 1K3IA 1URXA 4PQ9A 2F4LA 2V72A 4NAMA 3RJRA 4GJZA 3WX5A 1O4TA 5G04L 2DVGA 2OXBA 3VZMA 1IS4A 1LJ7A 2D93A 2XR4A 4H55A 4XDOA 4A45A 1ZRCA 2QJVA 2UWAA 5ABJB 4WZFA 1XSRA 2AR6A 2PLV3 1X9PA 3I59B 4GWMA 4Z82A 4CYDA 3OD4A 4GQ7A 4MGIE 2VUAA 5SV8A 1FNZA 4ISQA 3VBOC 3HOBA 3JB8A 1VBB3 4UFMA 1UO9A 2PQQA 4BQ3A 1F4HA 4BK5A 2VTXA 4CA9A 1CESA 4META 1ZZCA 4IV1B 4YVSB 3I54A 5FZGA 5C4WC 1VBA3 5FREA 1US2A 2ZOEB 4YZ4A 3WHUA 2ZX0A 3TEXA 2WO1A 1ZZ7A 1F15A 2R063 3J8F3 1JOPA 1UZVA 2BEOA 4KU7A 4YW3A 1NLRA 4P9LA 1KRIA 3E5UA 2WFPA 4N7UA 5FY0A 4XETA 1H2MA 2W94A 4Q26A 1UZ0A 4LLFA 1PK6A 1QGLA 1NZCA 3P3PA 5JAXA 1VAKA 1UW8A 4X8PA 4CDQB 2AGSA 1ZREA 1AXYA 2CNAA 5FYHA 3AKTA 4YGBA 3KHCA 2ZMLA 1XYNA 4UW4A 5A3UA 2FZ1A 1HB1A 5DDJ3 1UYXA 4KH9A 1OVSA 1C5IA 4JCKA 3UGGA 2ZX3A 4IV3A 2Y34A 3QACA 2Y8KA 4LO6B 1NAEA 5D1IA 5L73A 4LHKA 3FLRA 2UYAA 4YW6A 1CAWA 1ND3B 5FPBA 3SXWA 2CWMA 2XPJA 3DYPA 4SBVA 4AR2A 4YZ5A 2KA3A 4QD2A 4HPKB
chains in the Genus database with same CATH topology
3KQRA 5CFCA 1WW7A 3D4KA 4Q0VA 5AC93 2JG9A 1FMD2 3VDDA 3NAPA 1XYOA 1PIV1 2RR11 1UKRA 5JZGB 3CJIC 2WNEA 4FPKA 1PO22 3SMHA 4AQ2A 5F1RA 2XBO2 4I30A 1DQ5A 1SLTA 2ZGLA 3AZWA 2VOKA 4LE4A 1VBC2 1WW5A 3RRDA 1DZTA 4WM7C 5C8CC 4FOQA 1KJLA 2DYCA 1JTZX 4NHMA 4RD7A 2XUMA 3A0KA 3WW2A 3ZN5A 3MW2A 2DU0A 1UIKA 3DUIA 2KXLA 4JAAA 4CDXA 1HRV1 3VKNA 3KGLA 2ZGTA 4CP2A 5GZGA 1RUNA 1AX2A 3AP9A 3V64A 3NO8A 4M00A 2CV6A 4RHV2 1H0BA 4M3CF 2JICA 1MZEA 3HT1A 5JVVA 5E89A 4AI2A 4DOUA 3ES4A 1Y7BA 4G3YC 2QQPA 1LOEA 5JCTA 1AYM1 3K51A 4RS5C 2OUJA 4MGKE 2OW4A 5L7OB 1QQP1 4K6BA 2BNOA 3HD8B 1GZCA 3ILFA 4AEJA 5CA6A 2D3PA 4P9WA 2QDRA 4E2GA 1H9PA 4YZ1A 1AR72 3RYPA 4DY5A 2VVFA 4Z07A 5EV7A 1O3SA 4R8HA 5FFOC 1MZFA 2QE3A 4IESA 3ZX7A 3WUCA 4RL7A 3RYRA 5HI0A 1X8MA 1QJX2 1ULGA 1A3KA 4Q1PA 4AG4A 1FAYA 4ZU4A 1DG6A 3FJSA 4L9BA 1K5MC 4XF3A 1TME2 4A7KA 1OA4A 2H6CA 4PF5A 4QM8A 2XVGA 5KC5A 4FPOB 3BOWA 4PIXA 4L97A 4MX3A 4QM9A 2B39A 4LBNA 1RUD1 5A3MA 4YW1A 2OVUA 2EIGA 4Y1XA 4BMEA 1NCQB 2GC2A 2ZX4A 5J3UA 1JW6A 1AR61 2LTNA 3ECQA 4NWWA 2D43A 5DZFA 5ACA2 5K0UC 3M3QA 1MEC1 4SLIA 4Q4Y1 1G9BA 1ZBA1 2DTWA 4H7MA 3JZVA 2B9UA 5A32A 2SBAA 3MLLA 2UURA 4NN0A 1KQRA 1YUDA 3MLKA 5H9PA 5FOBB 3AYEA 4O9GA 4AEDC 2VY0A 3L9JT 1OPOA 4QGLA 1GV9A 1NA1A 1JOJA 1YWKA 3O0WA 2ZKLA 5LK7B 2OUHA 1XNDA 3PVEA 4BA6A 3R05A 2D7FA 2WSVA 4FOWA 1XNKA 1XNCA 2ZJCA 5BNPA 1PO11 3MIGA 4EWEA 3RG0A 4TWTA 4C0HA 1ND2A 1GQGA 2A70A 3MF9A 3M3CA 4Y20A 3ZMOA 4Q4W1 3ST7A 4BPZA 2R072 2NQYA 3B9IA 2H0BA 1BVVA 1PK6B 1VALA 3M7AA 2CWSA 5I0SA 3BALA 4CDUC 2W52A 1FXZA 1PGSA 1PVC1 4P14A 3RSJA 4Q4V1 3M3IA 3AZYA 1CAUA 2GH8A 2GNDA 2ZZQA 1VRH2 2D3SA 3ZSJA 2ZTNA 3MIHA 3G6JB 4XFCA 4IV3B 1DLLA 2RR13 1TMF2 4ATFA 4K1YA 2XKOA 1KITA 1GKBA 2VU9A 2VW1A 3SH5A 4FPGA 3WLUA 1KFUL 4Q1RA 1CAWB 1ASJ1 1EY2A 4P9GA 3ZIXA 3AFGA 4BH9A 3WCSA 3JBG2 1QJY3 4AFBA 3CJXA 4UW5A 2GMPA 4XXPA 1RL3A 5CFCB 4JTNA 1HRI2 2JG9B 1RUG3 2LALA 3VDDB 4AGGA 3NAPB 4WVMB 2RS12 3TB0A 1X50A 2XJQA 5FLHA 2RS51 2B7YA 1HRV3 1EPZA 1Q56A 3ELNA 2WT2A 5JSPA 1YYNA 3OF1A 3KCCA 4JRAA 3ZYGA 1OLQA 3VBHC 4DZGA 4F3JA 2XJSA 4GIQA 1REEA 3AKSA 1IQAA 1EAH2 1X82A 1H9WA 1RITA 3CF6E 4LT5A 2ZMNA 4AQSA 1IKPA 1RUOA 2WS92 1J3RA 3ZXAC 2I74A 4XE9A 4HK8A 2WC2A 3TRSB 4CDXB 1J3PA 4COUA 1O91A 1QQP3 1XU2A 4XFIA 2Y38A 1FPN2 1OFSA 3R4SA 5DZEA 5FO9B 1BEV1 1AR82 1J1TA 2X5IA 1WW6A 3OPZA 4LE3A 3RI9A 4L8QA 3PVBB 4XYXA 2Y26A 3IPVB 3O0VA 4Y22A 1G9FA 1WD3A 1UIJA 4YYOA 3RZZA 3J4UH 3USUA 4J1XA 5GKAC 4RSUA 2Z79A 1V00A 1LB2A 4OUMA 4GXLA 1ZNPA 1RC6A 3AK0A 1O3RA 1UKGA 1WGPA 3IWZA 3VKMA 3AX4A 2WLPA 3U4XA 2WIIB 4HKLA 2MPFA 3WG2A 3UV9A 3GZUC 2YMZA 4CEYC 2HWB2 1AL22 2BNMA 4URTA 1AX0A 3AXEA 3AMMA 2RMU3 1XE8A 3S30A 3VHRA 1COV2 4JGYC 1D2SA 2BQPA 3B3QE 4BQ1A 1BCXA 2UY8A 2D40A 3LWCA 2NN8A 5C8WA 3X29B 2DTYA 1AR63 2R042 4N53C 3FZ3A 4JGZC 4S2FA 1CONA 1F5FA 1GSLA 4QT6A 2JKBA 2VH9A 3EHKA 3LOIA 4GA9A 5A33A 2VMIA 4V1PA 2HWC1 2OPKA 3RMXA 4OHYA 3WG4A 1ZRFA 4K21A 2W0XA 3PNAA 4L92A 3EXUA 4XJUA 3NKTA 4EWDA 1HXS2 4MYEA 4EROA 4JRLA 3UL2A 3HAGA 1RUE1 2QUOA 3VBFA 1OI6A 3WQ1A 1QJU3 1W6QA 2WFF1 3ZFEB 5T52A 3VUOA 1B35A 5FLIA 2RS31 3E6BA 4R4XA 5E1RA 3USSA 2W08A 4AI0A 3M4FA 1FV3A 5CU1A 3UJQA 3E5XA 4OULA 4AI1A 1F31A 1WCDJ 1JUHA 4QPIA 5T55A 3OBRA 3DGTA 4AEMA 2Z5WA 1NA1B 2WZR2 1R1ZA 3FBMA 1AR91 1IS5A 1C8M1 2D5FA 2O8OA 3ZSLA 1W2UA 1BZWA 1Q3EA 1V6OA 4PCRA 2RJKA 5BNOC 3BTAA 3ZXJA 4CTEA 4IQPA 1MQTA 3U0ZA 1YI9A 1ND2B 1PVC3 4LBJA 4Q4X2 2BW8A 4Q4V3 4FTEA 1VP6A 1PNFA 1WMFA 5GM0A 2P34A 4Y20B 1MZ5A 3MIFA 3Q9OA 5KBFA 3PMSA 1SFNA 3FMGA 3E97A 1RUF1 3DPRC 3SCHA 2EXJA 1LHWA 3H7YA 1OA3A 4KL1A 1V6KA 2PFWA 2F6BA 1ASJ3 4HK9A 2HWF3 4RR3C 3OCPA 5J37A 3ZXDA 2IFRA 1POV1 4CDWC 2IC1A 4Y1VA 1JBCA 3C2UA 1CAUB 4HVQA 2Y0OA 4I0WB 1S0IA 1CPNA 3U07A 4DS0A 1HQNA 4LBOA 5I0UA 4AVSA 4XHXA 3ROUA 3ZYIB 1QHDA 1KXGA 1LGCA 2RS53 3RS6A 2PLV1 1SBDA 4QQOA 2BWAA 3HMYA 3MDPA 4EV0A 2XLFA 4TSVA 2WKKA 4AWDA 4XIKA 2A6ZA 2RM22 5CAZA 1VBB1 4MV2A 2EXHA 2DFBA 3V65A 4TZDA 1QXPA 5C9AC 3EBRA 4QU2A 3IDCB 1R1A2 1WMDA 2A3WA 1VBA1 3MPPG 4FO9A 2GH2A 4QGMA 4EN6B 2AH2A 4QPGC 3WW1A 3IKWA 5FTTC 1J58A 4AI3A 2R061 3J8F1 1KJRA 1LENA 1GANA 2P2KA 1BEV3 1CVNA 4FP3A 5JOXA 1RUC3 4Q29A 5EFUA 1LU2A 4QPYA 5DG1A 1DZQA 2VPVA 4RQPC 2XJRA 1YCIA 4B8EA 1R083 2P17A 2B5HA 5J7MA 3BOPA 4H3WA 2AYHA 4XQDA 3V56A 2E7AA 1N1TA 3WDTA 2A6VA 5GLUA 5DDJ1 1D4M2 3VKOA 4QHBA 1X36A 2SLIA 3R0RA 2XGXA 2X5IB 1RUJ2 3FUQA 1JYCA 5JZGA 4C1WA 1PO21 1NCRA 1SLAA 3RQ0A 2GC0A 4FAGA 2O0OA 1KS4A 1AJOA 5JWPA 2A3YA 4K8FA 5KXCA 4Y22B 1RMU1 3NWKA 4U2AA 3URFA 2HEYF 3RYKA 4JDOA 2DU1A 4BLJA 5AC91 1UZZA 1EV13 1M4WA 5HXVA 1O3TA 3ZSMA 2Q1MA 1Z7S3 4GB32 3ZSEA 5C8CA 3KCYA 4HN0A 1U5XA 3ME2A 1W0PA 1AXZA 1DYKA 3VBRA 3ATGA 2HWC3 3A4UA 4MSVA 4AVVA 3MIBA 3NW4A 1BMV1 5CB7A 3ZVXA 3OJBA 2JJ6A 1HW5A 2PHDA 3AXDA 5KXDA 2D6OX 4JDNA 4COVA 2Q0AA 1AR71 1V6IA 1NY72 1RUE3 2WFF3 3DN7A 5A33B 2EA7A 1A78A 4FVVA 1IPKA 1LOFC 2HWE3 2WLQA 3H1YA 5HCFA 5FO8B 1C8NA 3ZFFA 4XPVA 3ASIA 1M06G 1LULA 2MEV2 1BJQA 1VIWB 5JOWA 3QOPA 3WP6A 5CFDA 1UZYA 1NG0A 3M1HA 4IEOA 3MEPA 2W68A 3WZ1A 1CJPA 1LOBA 4GH4A 4LHLA 3VBFB 3ZO0B 1AR93 1H1AA 1W6QB 2XLGA 3GBWA 4S2HA 1R092 4XJ9A 1B35B 3MICA 4MGZE 1DBNA 3MPBA 2XVLA 2NPIA 2YGLA 4WZCA 2B42B 1ZZ8A 3PHMA 1I1EA 2PHFA 3DV8A 5T5PA 1BBT2 1S1AA 5JIAA 4QPIB 4LBKA 4OI2A 4X6RB 1K5MA 2FHRA 3T1LA 2WWSA 4L2NA 1NCQA 2ARBA 2EAAA 4XJAA 1RUF3 1AZDA 3VZNA 1OMIA 2YC0A 1MQTB 4FOVA 1DQ2A 1KDKA 2GALA 4AI8A 4C90A 1ZZ6A 2W39A 1XNBA 1POV3 2F4PA 4CP0A 4ASLA 1FX5A 2WA3A 4FPHA 3RNSA 3WR0A 3ZXGA 2YY1A 2E63A 5D8AC 1RVF2 1Z78A 1F2NA 1C28A 1NE4A 4N43A 2WNUA 3KGZA 1UF2C 2IXKA 5FMOL 4IERA 1Q8PA 3QD6A 2IFWA 2VNGA 2E7QA 4HLTA 5K0UA 1SMVA 2O8QA 3O12A 1O7FA 1YIPA 1YIFA 3WDUA 5I8SA 4F8AA 4DXZA 1D0HA 5I0TA 4Z1VA 3ILNA 5CADA 5J98B 2ZHKA 2WT0A 3N7LA 1D2QA 3SH3A 1BVP1 2DVDA 4YM3A 2A6XA 2NMOA 2ZGPA 4NPRA 4HZFA 2QZ3A 3TNPB 3LAGA 4YVSC 4IXLA 5LRRA 4NWVA 3GF6A 5GZDA 1XQNA 5CNAA 1IKQA 2JENA 1CX4A 1RHI2 4AFDA 4AQTA 5BYNA 1N3PA 2GN3A 1CIWA 2NM1A 5DZGA 5TSWA 2UWBA 4COYA 2PHLA 2GZWA 5J48A 1FMD3 3MLJA 2E7TA 1TMF1 1DGRA 3O7OA 1LHUA 4W6XA 3H8UA 3R4UA 1PO23 1LTEA 2VMHA 4CDUA 5F6LB 3L2YA 2XBO3 4PDWC 4ONUA 5KHIA 3CNAA 3JB4C 4QX5A 2Y0IA 4HBNA 1VBC3 2G9GA 4LUMA 3KB5A 3ZSKA 4UW3A 3E6CC 2ZS6B 1RMU3 5FCCA 1TNRA 2XG3A 5DUUA 1SLLA 1ND3C 4XMAA 4XQWA 1AF9A 4HVRA 4WVMA 1NCRB 1HIXA 4ZXKA 1QOOA 5DUXA 5FRAA 4RHV3 4NO4A 4D3WA 4XFFA 4FPCA 2WL1A 1ZBE2 5DUVA 1SQ4A 1QJY1 2FZ2A 4CEWA 4HSLA 2EAKA 4YVWA 4IEUA 1RUG1 2A75A 3CJIB 2BVBA 1H8TA 1UPIA 4OI4A 1QOTA 2UU8A 4AVCA 3TBDA 3TN92 2GDFA 1AVBA 5C8CB 2ATFA 2FMDA 2ERFA 1AR73 1NQJA 5H9SA 4N90A 1YJLA 3VBRB 1OPMA 1ENSA 1VBE2 2BWCA 3DKWA 3IPVA 4AFCA 4Y24A 2YDEA 1UU6A 4LLOA 1QJX3 3J9SA 1QNWA 1O5LA 1LR5A 2D97A 2GNMA 4M0HA 5C6CA 1IS6A 4XQ4A 3NSTA 5IT6A 4Q0QA 3VBSC 1N1YA 4I0BA 4NR1A 3CL1A 1RUI2 4M01A 1G9DA 1TME3 5K7PA 3VBUC 1LGBA 1LEMA 2EF6A 3ZFFB 1UL9A 2HWB1 1ULEA 4YG6A 4AE2A 1AL0G 1Z0HA 5BXXA 1AYN2 5CFDB 1RIRA 1COV1 3HBZA 2WT1A 4MXVA 4GH4B 5GLVA 4XFBA 2BNNA 1PGL2 2HYKA 1QKQA 2R041 5E16A 3TWIA 2BYVE 1O3QA 4AVBA 5H9RA 2D6NA 3JQXA 4CEYA 5ACA3 1LU1A 3AYDA 1SDWA 2OIIA 5JOYA 4L11A 3AFKA 4E4DX 1GLHA 1WA4A 1LECA 2X29A 5GLTA 1K5MB 2RMU1 2ZGRA 3LA7A 2WNVC 1ZX5A 4KBBA 2OZJA 4XZPA 2HJIA 2DVFA 5CG8A 1CPMA 2DVAA 3TNQA 5BPXA 3CU7A 4BIFA 3D82A 3B00A 5T54A 2ZMKA 3WG1A 4LO7A 3PJQA 3ZFEA 1OD5A 3ZFGC 2PHUA 5JR7B 3JD72 4B7KA 4UW6A 1CQ9A 3KMHA 4OVEA 4NHLA 4N43B 2WNUB 1PVXA 2VGDA 1KDMA 1H2NA 1W6OA 2WZR1 4XJZA 5K0UB 4LO4B 4AHWA 1QJU1 2WJSA 2XJTA 4PBPA 5CG9A 4ISRA 4XTMA 2ZHLA 4AFMA 2DCYA 4FPYA 3B01A 4XJWA 2ZACA 3MW4A 4AEDB 2DV9A 4P5HA 4OHXA 1ZZ9A 4B29A 4R9AA 4BM8A 3WOGA 1W6PA 5DXDA 1VRH3 4AGVA 2GSYA 1JH5A 2VOXA 4MLOA 2ET1A 1TMF3 5EJ3A 1WCSA 4AEKA 3M8LA 5BNOA 5FQ0A 5EZWA 5GLWA 5J36A 3NV2A 1BKZA 3PJYA 2GNBA 5AFEA 1HDKA </