4I01A

Structure of the mutant catabolite gen activator protein v140l
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
202
structure length
202
Chain Sequence
PQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDLTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modulation of global low-frequency motions underlies allosteric regulation: demonstration in CRP/FNR family transcription factors.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords Catabolite gene activator
total genus 63
structure length 202
sequence length 202
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4i01A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4i01A01
1B4AA 5K8SA 3VHRA 2JSCA 2EV6A 2O6GE 2IXCA 3TKYA 1YG2A 4M73A 2XIGA 4IETA 1H9TA 4QMAA 5FGMA 3D5LA 4QX5A 2DT5A 2Z2SB 2A3SA 4META 4LK1F 2FF4A 3R0AA 5JSRA 2M30A 4L0ZB 3IRQA 3NL1A 5BPXA 1F5TA 4OINF 3EQEA 2G7HA 5HDNA 2QQ9A 3SCHA 1IN8A 4E2SA 4IEUA 4F8AA 4WVZA 3P9CA 3HT2A 1KQ9A 3IBMA 5D8KB 2D1HA 5HLIA 4BH9A 2EFWA 2PTMA 2IXJA 4HV5A 1O3QA 1TQPA 4IEWA 1QY4A 1RTVA 1LDJA 3IKVA 5JVTA 1WRJA 2CYYA 2H27A 1I5ZA 2ZMEA 3M8FA 1U3EM 2STTA 4LD5A 1QZZA 3HSFA 4KN7X 1CAUA 5ILVA 4LLNA 3H7YA 1X82A 1DZRA 2CW0F 2CSOA 2V1DA 4PZJA 4KIBA 4KL1A 4FAGA 4NVPA 5TRDA 1U6GA 4QWQA 1MDMA 4GYGA 4XFBA 1ZARA 5L3FA 1YFWA 3I71A 3T8RA 4ZYDA 3U11A 2IXLA 2GZWA 3JZVA 5CYVA 3H92A 1YUDA 2Z5UA 2A69F 4OU0A 1EYBA 1DUXC 5D5WB 1H0MA 2EFQA 1IN4A 5HLHA 3DKWA 1IPJA 3NQOA 2ISZA 4WX9A 4G6QA 1EY2A 1ZRDA 3KGZA 4LGWA 1S3JA 5FDBA 2VOPA 3DEUA 3MFKA 1R00A 2R7DA 3GX4X 5E1WA 4BYYA 4XEZA 1O3SA 3GFJA 1RZ4A 1YWKA 3FM5A 2DPDA 4Q0VA 4YARA 1IUYA 1FBSA 3BJ6A 2K02A 4EM1A 1TNSA 3BPZA 4HDVA 4FAHA 4CGZA 3DFGA 4KMUX 4LTAA 5E16A 5JSOA 3JTHA 1YFYA 1HKTA 5KHGA 3LSTA 3L9FA 4KMFA 3LAGA 2PQQA 1J5YA 3V8LA 2NYXA 5FPXA 1EP0A 3D0SA 1GHCA 4ZU5A 3NSTA 3PQKA 4HN1A 5F6FA 2GXGA 4YYOA 5JCTA 1RUNA 1Q5OA 1TQIA 3F8FA 2LF8A 4QXKA 1P4AA 4MQVA 1Q1HA 5HS9A 2PG4A 3FF5A 1R23A 1S29A 2HWVA 4TV7A 4YFXF 5CLSA 4XLPF 4Q0PA 1MD0A 2PAEA 5LHIA 4GO1A 4G6DA 1T38A 2W84A 1TW3A 2HOEA 2P6TA 1IW7F 1BC8C 3SXYA 4MQ9F 3D82A 3ELKA 5LEJA 4E70A 3GXOA 1JXSA 4EWAA 4L5JA 3UKVA 3L2CA 5LHHA 4AIKA 5DCMA 2PA7A 4FX0A 4DINB 3KMHA 4Q0UA 3L09A 3F8CA 1G3WA 2K27A 3K0LA 3U9GA 2EJRA 4OIOF 1ZNPA 1WQ2A 5CU1A 4MGYE 3H1WA 1MJBA 2GA2A 4KYWA 1J9IA 4YFNF 4CICA 3QPTA 3KE2A 2ZFWA 4MNUA 3TNPB 2Y48A 4RGSA 5LGNA 1MKMA 3J7AO 1IRGA 1HXDA 1V3FA 1YLLA 3QOPA 2OYZA 2BNNA 5D4RA 2IRFG 2FSWA 3JW4A 4LB5A 1BJAA 4QGNA 5HDGA 2OAZA 3DV8A 2PN6A 2H94A 3MAJA 1MDMB 4HX8A 2IC1A 2L02A 5ILSA 4RB1A 1YHFA 2L3DA 3HHHA 4AXOA 4BIFA 3LOIA 1J59A 2ZO4A 4GCVA 3D0JA 4HBLA 2XROA 3R6SA 2QVSB 3V7RA 3O14A 1W7PD 3TDZC 3GBFA 2VPVA 1IN5A 4IVNA 1GXQA 1WLTA 2QNKA 4JK1X 1Y9QA 5LGUA 2FBKA 2QVOA 3WW4A 4G94A 3ES4A 4Z07A 3WTSC 4UXNA 2J5OA 3WODF 3FM3A 2Q8KA 3ZMSA 3IIAA 3DPTA 2V79A 1U12A 2E7XA 1ZREA 3M70A 5CVIA 4HF1A 2QWWA 3ZMVA 2G7UA 4Q47A 3U10A 3DF8A 4R79A 2FMLA 1K6OA 4L9NA 1GXPA 1NE4A 3ML6A 1TTYA 5JR7B 4P9FA 4UBGA 1PUEE 1O7FA 4RAZA 3OD0A 3GFMA 1R58A 5H20A 2HKOA 3GZ6A 2Q0AA 2EA4A 2HYGD 3FZ3A 4AQ2A 2OPKA 2D40A 3NW4A 1FPQA 2OA2A 4H0EA 2O8QA 3KSCA 4M74A 2XAQA 5FLXZ 5FQ0B 4LMYA 1YO5C 3KFWX 4MUVA 2HKXA 2IA1A 2Z69A 2Q2EA 4HF0A 1ZZ7A 5BOXA 2DTRA 4G7HF 1HKSA 1ON2A 4YNIA 1ZZ8A 3IWFA 1J1LA 4S04A 1O3TA 2EV0A 2GIVA 4R8HA 1S7AA 4A5NA 1Z9CA 2ZJ2A 1QNTA 5D5VB 2X0LA 2QDRA 1LR5A 1S7OA 3EBRA 1YIOA 1ULYA 4Q0QA 4A0ZA 4EM2A 3WTWC 3V8JA 4MTDA 5FQ0A 1DP7P 1R1VA 3CDHA 3HOSA 4LLLA 4LB6B 3FXUA 5CVJA 2QQAA 2K86A 2HTSA 3ZMDA 2H0VA 3WTVC 4ZYGA 2NNNA 4HYEA 1T0FA 1MJ9A 3BZ6A 2BNOA 1J3PA 3GYHX 2WC2A 1RL3A 5I8SA 3FE5A 5BPIA 1HW5A 1OFNA 5EZWA 1L3JA 2HZTA 1RUOA 1LEBA 4AVAA 1UPIA 1MGTA 1FBQA 2XGXA 2O61A 5I0RA 3ZPLA 4E2QA 2Q0OA 4KNYA 5DCFA 2M1BA 5BQTA 5I91A 2XAJA 4AD9A 1SMYF 3B02A 4K2EA 4ZZLA 1ONVA 3RIRA 3T5XA 4I3PA 2BV6A 5JI6A 4XFGA 4ENNA 2IXHA 3G3ZA 4MH0E 1T98A 1XD7A 1ZZCA 4KWLA 2ESNA 3HOTA 3I54A 4D0PA 2FXAA 2YSRA 2LKPA 3WU1B 3B73A 3KLNA 4XFAA 3GFLA 2ZMEB 1OYIA 3NEUA 3LA7A 4X6QB 1EH8A 2XLFA 4FBFA 1R5HA 1YYVA 1G3SA 1KQ0A 3QP5A 5JFRA 3EO6A 3GWZA 1SFEA 3DP7A 2JRTA 1RIOH 3KZZA 4E2GA 2E1NA 2L01A 2K9ZA 1Y0UA 4QGLA 2KXLA 4CO8A 4RB3C 1QXRA 1B1BA 2QLZA 4A6EA 3F21A 1ZX5A 2G9WA 2QBYB 3L7WA 1YFUA 5FLJA 4A2UA 1K78A 3HTUA 4L9JA 3V7SA 3HTSB 4J1XA 1XGMA 2JT1A 2Z99A 1NE6A 1KYZA 4O3MA 3KEOA 3F72A 4HOBA 2FNAA 4I0BA 4WWCA 2P17A 1MZBA 5A2QK 2RKHA 3J81K 3MPBA 3ELNA 4ESBA 3NVCA 5L3GA 2EB7A 5I93A 2PJPA 4LEJA 3QU3A 3BU7A 2E1CA 3M8EA 3FMQA 1HSTA 1ZG5A 1SD4A 4CXFA 4Q0SA 1R1UA 2PHDA 1BI0A 2XRNA 3QRFF 1YFHA 1YW8A 3IL2A 2IW5A 4A6DA 2FNPA 1NZCA 4KFCA 1HSJA 3U0ZA 4ETSA 5ICGA 5K5RA 4ZZDA 1ZLJA 4RS8A 2LSOA 2UWMA 3IDBB 1FBUA 1JE8A 2A6EF 4BAYA 1H9GA 2K7LA 2ISYA 4HQEA 3ABUA 1BM9A 1FZPB 4IXAA 5CADA 3IWZA 2UXXA 2RGVA 3VB2A 1WSUA 4UHTA 5I0TA 3HT1A 4Y13A 3F23A 4LJZF 3CJXA 1LEAA 5LRRA 2UYBA 1JHFA 2GWRA 4KWJA 4OFGA 5DYMA 1Z6RA 3ZN1A 4HN0A 1R7JA 3CJNA 2O8XA 2F5CA 3OTFA 2CQKA 3WG9A 2DW4A 3BJAA 2ET1A 4YG2F 4A5MA 4A0XA 3IHUA 5K5OA 3ES1A 2EVXA 4KUMA 3HRTA 2Z33A 2LNBA 3R61A 4WK8F 4HF2A 1YLFA 5L3BA 4XF4A 1LDKB 2A61A 1FI2A 2RV8A 1ZZBA 4AVCA 2VONA 3ZP5A 4JTNA 3G7DA 1P4WA 5E1XA 3CEWA 4AQ6A 4MV2A 3OOPA 2TDXA 3J80Z 4Y15A 2YU3A 3PNAA 4P96A 1HW1A 2PYTA 3TNQA 1REPC 4EJVA 3OCPA 3ZMZA 1LJ9A 1FSEA 5HI0A 4WCGA 3FMRA 2KRFA 4ENJA 2PMHA 3EETA 3VEPA 3K1MA 5ERIA 2JPCA 3HUGA 3KP7A 3LA2A 4OIPF 4EJOA 3SMHA 3W6KB 4EV0A 1K79A 4LLGF 1ZVFA 3KP5A 4KIFA 2CGPA 2VECA 4L18B 1V70A 3RPQA 4RAYA 1FP1D 5FLXK 2K4BA 3ZN0A 4Q4ZF 3N4MA 3R0JA 1AWCA 1OI6A 4Z2YA 2BYVE 4B09A 3RNSA 4G7OF 5FLIA 5EFUA 1STZA 4KU7A 3T8TA 1O4TA 1HKQA 3HRUA 5EEHA 1K78B 2MA3A 2Y0OA 1G4DA 2Q1ZB 5JSPA 3KLOA 1O7LA 2HQNA 2FOKA 3VODA 1J75A 2DQLA 5D5UB 2DQRA 1NYWA 5BY5A 4YFKF 1EV7A 3HHGA 5D6EA 4KU8A 1SQ4A 5BV6A 2VE8A 5ICCA 4OIQF 5FD6A 3LZZA 3OV8A 3K9TA 4M6XA 2WV0A 2QCSB 1ZLKA 2C6YA 4BHPA 3Q9SA 1B6AA 1KU2A 4MGKE 1G3TA 1W4MA 5LLQA 3WGIA 4IEVA 1QPMA 4RGUA 2QM3A 4OIRF 3T0YA 2LDUA 3E3VA 3ABTA 1Z6TA 1IN6A 3BDDA 2Y0MA 4A0YA 3AAFA 4MX3A 1F1ZA 3ULQB 2FMYA 5K5QA 3WU0A 2H09A 2VE9A 5BPDA 3H50A 1XE7A 1U2WA 3BY6A 4ESJA 4HBNA 4EROA 5J7MA 3F8NA 4YIFA 2PAKA 2K0GA 1FYLA 1X3UA 5KHJA 4L2NA 2VN2A 3RTRA 4UV9A 1VTNC 3WTTC 1UW8A 2QENA 4AIJA 3RI4A 4P9GA 4OMYA 1OKRA 4TLFA 3GUDA 3UKTA 2FEZA 3E6BA 5J8FA 2RN7A 1ZGAA 2GH2A 4LFUA 1O5UA 1HW2A 1YFXA 4U0VA 4WXDA 3MWMA 3KP3A 1FP2A 2B5HA 4L5IA 4IEXA 5F1RA 3N97A 1LQ1A 2XAHA 1LDDA 2KJBA 4FT8A 1QGPA 4I02A 4BHBA 2L4MA 5D5XB 3Q5FA 3GFIA 4BHCA 2OD5A 1USSA 2CWEA 5DEQA 1ZYRF 3CO6C 2UZKA 1YQAA 1DZTA 1WI9A 4CDGA 4EMSA 3COAC 2DK5A 4XSZF 1XCVA 4GULA 5DUKA 4D7TA 2GA1A 3GO5A 4AVPA 3SQNA 1IPKA 2HGCA 5ICEA 2A07F 2V1UA 3O3KA 4J1WA 3ROUA 1LKNA 1SFNA 2OZJA 3KEQA 3BCWA 2H6BA 4EGYA 3W6JB 5FCCA 2EAAA 2D2WA 5JAXA 2PMUA 4MGZE 2XASA 1WA4A 1XGNA 4R1HA 3WTXC 2QZ8A 2CG4A 2C0ZA 1FYMA 3JSPA 3K1PA 1W5SA 1J3RA 4UUVA 4KA4A 4QM8A 2VC0A 4HSLA 3TOAA 2P5KA 2XAFA 3V7CA 4LUMA 1G3YA 2VBXA 2NAZA 1I27A 1EH6A 1CAVA 4MTEA 1W7PA 3I58A 2CAUA 3CUQA 4LK0F 2IT0A 3H7JA 4RGXA 3G73A 4G8XA 2GC0A 1J2XA 2ZNYA 5HLGA 3KZYA 2HYFA 5EEGA 3FZVA 1P2FA 2STWA 1ON1A 3MEXA 1YTYA 3V4GA 3ZMUA 2NNYA 1IRFA 4IEOA 1PP7U 3GZ5A 3PFIA 3TOBA 2AXLA 2ATFA 3RPUA 3L00A 2ESHA 2M8EA 5C8WA 2ZXJA 3BPXA 2IA2A 1QBJA 1BIBA 4HAMA 1D8KA 1T2KA 2JZYA 1CF7A 2FBHA 4MGRA 4WBBA 1X8EA 3GVAA 5FB2A 2FQPA 4I2OA 2VBWA 5FLHA 1P4XA 2V6CA 4RB0A 5ILUA 3C7JA 2DU9A 1BOAA 2XVCA 3WE3A 3BOQA 2RVCA 4BXUA 3K69A 2V9VA 2XLAA 2YX4A 1BN5A 3BP8A 1V4RA 2ZKLA 3VOEA 2KJCA 3R60A 4IHSA 5KBFA 1I1GA 3HIFA 1DGWA 2PEXA 5HOOA 1YS6A 3LAJA 3FHIB 4U88A 3EQLF 2M45A 4RB2C 1JHHA 2GC2A 2MLKA 1IAWA 4XFHA 2BBYA 1O3RA 3MCZA 4HVRA 2ZKZA 5J3UA 1SFUA 4XFFA 1SMTA 4ZU4A 4EVIA 1R1TA 2XKOA 3KCCA 5DD8A 3MZYA 3SZTA 3IDCB 5E1RA 5CVRA 5D6FA 2W24A 4MHGA 4S05A 5J48A 4MGIE 3EYIA 4I98B 2HEOA 2UY9A 4XF3A 3BALA 2JPBA 5DV5A 1FXZA 4ENKA 2GC3A 2NS0A 1YW9A 4XFIA 3WGGA 4HVOA 4IRHA 2DPUA 4O9EA 4I0AA 5LRSA 1ZN2A 3E97A 3EUHA 2XL7A 2RQPA 1UIKA 1R22A 4XF0A 5I0SA 3PVBB 4AWXB 4WZCA 5CVVA 3C3WA 5L3CA 4F7ZA 1ZZ6A 2COMA 4LA3A 4XF1A 2DBBA 1Z91A 3F8MA 2ADUA 4HZFA 3LQQA 5E17F 1ODDA 1RNLA 3EYYA 1SAXA 2HQRA 4JBAA 3SCGA 2Z9OA 1CAVB 4U7BA 3J80K 4HDUA 4UNOA 1XSVA 3R4KA 4EJWA 3CLPA 4K8FA 1XSDA 3ECHA 3CF6E 2VC1A 2FU4A 3EDPA 2UYAA 1KYWA 2DO7A 2YPRA 3LQRA 4MEXF 1OMIA 5J6XA 3USSA 4FHTA 4N9IA 1QZYA 2L54A 1SD7A 3I4PA 1KU7A 3T1BA 4OMZA 3RKWA 4CHUA 2PBIA 1IXCA 3FX3A 2IXIA 5D4SA 5HVQC 3RJPA 3NKTA 1HBXG 1CAXA 3DN7A 4QM9A 1XB4A 1ZG3A 1MJAA 2GQQA 4N0BA 3RYKA 4M71A 1UCXA 3SHRA 4IPAA 2PFWA 5BMZA 5IT9Z 4M6YA 4LULA 2IVMA 1FWZA 3F6VA 1QWRA 5ED4A 1XDSA 3ACLA 3EHKA 5CJ9A 2QJVA 2JTVA 1PP8F 2XHKA 3LWCA 2V09A 1FX7A 1UCRA 3KP4A 3WTZA 1VJ2A 3S7EA 1PMIA 1DGRA 4HMZA 3E6CC 2VT3A 1OR7A 1T6SA 2ZBKA 1GVJA 3HSEA 2PAMA 2OBPA 2QQBA 1USTA 2GU9A 4P55A 1O57A 2P4WA 1UFMA 5AIQA 5KHHA 4PGGA 1E2XA 1P6RA 4IESA 4ASNA 1JUHA 1X7NA 3CLOA 2FE3A 1IXRC 3RKYA 1CAWA 3V8KA 4B8XA 1ZG1A 4L9TA 1SEFA 4D7SA 5H6RA 1ZRRA 3IRRA 2OU2A 4O6JA 4M9SA 2CV6A 1H1MA 1J0RA 4JQFA 1BI2A 2P5VA 3HSRA 2CO5A 2BE5F 2V1XA 2VT2A 4DQ2A 4Y17A 3DPLC 2A6HF 4L9VA 3C3VA 4AIHA 4X6RB 3C1DA 4B29A 1D8JA 3TDUC 4U0YA 3HRMA 1KA8A 3LFKA 1EH7A 3MZHA 3I7DA 3I0TA 3O6BB 4LG0B 4M9ZA 1ZH5A 1EPZA 3QAHA 1HQCA 2FRHA 3WGHA 2EA2A 1W5TA 3M1EA 5LHGA 4KICA 4AVBA 1XN7A 4Q48A 1QXJA 2Z3YA 3LWFA 2UY8A 1UD1A 2D5FA 2XUBA 2DK8A 3K2ZA 3H3UA 2P6SA 1TQ5A 2ETHA 4XBFA 1XCBA 2XKPA 2PQ8A 5K1YA 3IKTA 4ESFA 5JR3A 5LGTA 2O3FA 2MHFA 4I01A 1C0WA 4HV6A 2PI0A 2WFPA 1AOYA 3FWEA 2HFHA 3I59A 2EK5A 1X8MA 4NB5A 3CTAA 1XSXA 2HR3A 4UVCA 2ELHA 4O9GA 1IZ1A 1Y3TA 2KIFA 1U5TC 4N9HA 5FO5A 1YW7A 2B8MA 1XDUA 4LA2A 3P7NA 2D93A 1R36A 1YS7A 4G9YA 3KP6A 4ZU7A 2BNMA 2K4JA 2QUFA 1BBYA 1CAUB 3WW2A 1TW2A 3TO6A 3DQVC 5J8CA 1R5GA 2MNGA 3UKNA 3CO7C 3WW3A 3SCFA 4P9UA 1BC7C 1B9MA 4GGGA 4PGHA 1Z7UA 3FXQA 3CL1A 2OZ6A 3DXJF 1SD6A 2XV4S 2M5WA 4IEPA 3QU6A 3CUOA 3EJKA 2EV5A 2QBYA 3F8BA 4R52A 2B9UA 4GXOA 4WF2A 5JHUA 5HS7A 2I45A 1BIAA 4KDPA 1WKMA 2LF7A 3F6OA 2MLGA 3HRSA 4XRFA 4OOIA 5TJJA 3MDPA 2BEOA 1WGPA 5C6CA 5I0UA 1BI1A 1CF7B 4ORFA 4L0YB 4KIGA 2VODA 3F3XA 1Q43A 2DCTA 1FNNA 3WW1A 1S6LA 3Q9VA 1DPUA 4MZUA 4Q5SF 2D1VA 4A12A 5BUVA 2KIUA 4ENMA 3NJZA 1ZZ9A 1A04A 1UB9A 1Q3EA 3L2HA 2W85A 3BB6A 2CAVA 4YRDA 2FBIA 1OYYA 5D1IA 1PDNC 4WXHA 4IEYA 4PDKA 4XLNF 1GQGA 2VOOA 1WWXA 1KU3A 4Z82A 4ONUA 4HA8A 2GC1A 1XMAA 1K7AA 3REOA 5E1ZB 3IC7A 3JSOA 1U8RA 4BNCA 3I64A 2EWNA 3RYRA 3KGLA 1RGSA 4KT5C 2MBFA 4CYDA 2O1QA 5DDGA 5KHIA 5L3DA 2OQRA 3BWGA 2KKOA 2VXZA 3HYIA 4HX4A 4OLLA 2PHLA 4IEQA 3P9KA 2PFBA 1VR3A 3ETQA 3PLQA 1BI3A 2R3SA 1TNTA 3BPVA 1XRUA 2E9QA 2KIMA 2MH9A 3H1MA 1TQMA 1LB2A 4EWDA 3P9IA 4NQWA 4JV4A 2MH2A 4UXAA 2GAUA 4L11A 4EGZA 1RC6A 5DD4A 4YSFA 1OYWA 3S0MA 2L4AA 5LEKA 3U1DA 5HS8A 3ZDSA 5A2QZ 5FD5A 3LAPA 1OPCA 2ZCWA 2F2EA 4M9XA 2CFXA 5DCMB 2P7CB 3H1YA 4LG0A 2A5YB 2O0YA 2J5PA 3GW2A 2MC3A 4KWKA 2B0LA 2IP2A 2YX7A 1UIJA 4ON0A 1G6NA 2F5DA 1XGOA 2VBZA 2M87A 5KHKA 2XLGA 5AIPA 2IPQX 1LRHA 4XFCA 2HJIA 4I7HA 1ZRFA 3PQJA 4RGRA 2P7VB 1JGSA 4UBHA 2OQGA 2N7GA 4LUKA 4QGMA 3JAMZ 5DUIA 1CX4A 3TQNA 3JAMK 3J81Z 4XSXF 5E20A 3CO2A 2F4PA 1J7KA 5H6QA 1FSHA 2EA7A 1D5VA 4PIYA 1GQHA 4HX7A 2YR2A 1QO0D 3QP6A 1FLIA 3JTGA 5FFZA 3M9AA 4IRIA 1U78A 4HLTA 4PJYA 1F9NA 1LNWA 3SZPA 2NRAC 2E7WA 3H8UA 2HTJA 3I59B 4UV8A 2Q4SA 2DAOA 1QQIA 2DLLA 1CAXB 3KETA 5AVPA 3DL3A 1FC3A 3S2WA 3WE2A 4EQQA 3CUQC 1ZAOA 2ETEA 2IXKA 1KGSA 2IJLA 4QLCU 1PM7A 5F64A 5L3EA 1L0OC 1Z05A 1KU9A 3RKXA 1ZRCA 3RDIA 1U5TA 5AONA 2WWYA 4EM0B 4GYIA 5T3NA 1O5LA 4IEZA 5KK1A 2F5FA 3SFZA 4EJUA 3BROA 4LLOA 1VP6A 1Z1DA 1FYKA 1D3YA 1H1IA 3H3ZA 1IXSB 4BQAA 2HDCA 4FX4A 4PIZA 2VBYA 1J58A 4HW0A 3E5XA 3TO9A 3I53A 3ERED 3U2RA 4DNCA 3GF2A 1L3LA 1FT9A 3QPHA 3HQXA 1W7PB 2DFIA 2PLYA 1U5TB 3RYPA 1B59A 5E8GA 2OZUA 3K1NA 4U7DA 4IHTA 5E18F 4KN4X 2MD5A 3BJOA 4HVQA 2P8TA 3ST7A 2EFNA 3SXWA 1F4KA 1FOKA 5HDKA 2DI3A 2D45A 4ZYHA 4JVAA 5I8TA 2XL9A 3M3IA 2FQ3A 3WTUC 3F22A 4WXCA 2A68F 6PAXA 2EFOA 4M72A 2GXBA 5ICFA 3H9AA 5LBQA 3ISPA 3SHFA 2XAGA 4PCQA 3CUQB 1E17A 3QACA 3E5UA 4ZYEA 2RDPA 5BS6A 1B9NA 2ZNZA 3M7GA 5IT3A 3C18A 4MEYF 1NHAA 1DDNA 4IJAA 3FFQA 4EJTA 1XGSA 3OF1A 5BXXA 2FA5A 5CVUA 4IERA 3E5QA 1ZGJA 4UVAA 3GLXA 2Y75A 3LA3A 4U0WA 5FPZA 1T39A 2O03A 2AS5F 1UHMA 2ACJA 4P5OA 4CZZA 1OD5A 3WTYC 4NHJA 2RNJA 3O2PE 3GEZA 2P5LC 4XETA 2OA4A 2W25A 3VFZA 1UHWA 1CAWB 1SD5A 4RD7A 3ZQ7A 4I09A 1XMKA 5E8IA 2R7FA 4EWEA 1TLHB 4YIIA 3ECOA 2UXNA 3FXRA 2VQAA 1LVAA 2QYOA 2RC4A 1RI7A 1IN7A 2WTEA 4Q29A 4HLXA 5IT9K 4IF4A 2W57A 4HSJA 3OGJA 3FHZA 2ET7A 2HS5A 3E6DA 5D8LB 4ZH4F 1J3QA 2X4HA 3TO7A 4UVBA 1XE8A 1ZHFA 2Q30A 3I5UA 1TBXA 3TGNA 3RZZA 3ZMTA 4XF9A 1CGPA 5I8YA 5FFXA 3NRVA 1I1SA 2F5EA 5KVRA 2MPFA 4O5VA 1NXMA 1P92A 1KQ8A 2BGCA 3E6MA 2EFPA 4H7LA 1S8NA 3MQ0A 1I6XA 2D5HA 1SFXA 1DPRA 4IRGA 3GYDA 4JTOA 4PIXA 1FY7A 2H6CA 4HQMA 3FJSA 3FMSA 2IA0A 4HLYA 3MYXA 3S7IA 3KP2A 4G7ZF 1IF1A
chains in the Genus database with same CATH superfamily
1B4AA 1XU1A 1QMJA 5CKTA 2ZABA 2HWC3 2JSCA 1LJ7A 2JUCA 2ZGNA 2IXCA 4XPVA 4BCUA 1AR92 3GCWA 4M73A 2XIGA 4FCAA 4IETA 3D1NI 4QDRA 3ESWB 2WNVB 4HSRA 4QX5A 5LATA 2DT5A 2R7ZJ 1ZA7A 2Z2SB 3UK9A 2HXOA 3ZPYA 5FK7A 3IRQA 1F5TA 5IK7A 2G7HA 4V2WA 2VR4A 5J09A 3OR2C 3JU9A 3SCHA 1JZ8A 2XMLA 2YU1A 1NUKA 5D8KB 3RI8A 2HZDA 5EEAA 1QNYA 3ZXAC 2EFWA 2F5VA 2P81A 5M3FJ 1TQPA 4B3AA 4YZ2A 4FTBA 2HNHA 5IATA 1LDJA 3CC2I 4NC6A 1AU7A 2XGEA 1MS4A 3AXEA 3IPVA 1CAUA 3THDA 3H7YA 5AC93 4XM3A 2CW0F 3S3MA 1Q8OA 4XURA 3ZOIA 3ZQIA 3P5BA 4PDWA 1LOFA 4GZ9A 2XJRA 1R093 3TEDA 1ZARA 3MIGA 3U11A 2IXLA 2UV1A 5CYVA 4OU0A 5A3WA 4AEMA 5D5WB 1IN4A 3FUOA 1HLCA 3V64A 3IAM2 1IPJA 2VQTA 1REFA 2E34A 1I39A 1EY2A 2OTLI 2VZVA 4FP3A 3JCIA 3TAYA 2JIGA 1R00A 3MKLA 3IUOA 4XEZA 4PLNA 1UMIA 4Q4X3 1V9U3 2DODA 4P08A 3NMBA 3GMEA 1FBSA 3CU7A 3SKVA 2R0HA 4CGZA 4RFRB 5E16A 1W6PA 4E8DA 3H3VK 4G9SB 2KHMA 2XB0X 2IS4A 2QSFX 1IG0A 4N90A 4KMFA 2ZX4A 2QKLB 2MC4A 2HEYF 3V8LA 2NYXA 5FPXA 4ARYA 3H35A 1GV9A 3SEQA 5F6FA 1QH7A 2CUJA 2ZTNA 3AM2A 2GXGA 4F55A 1ZBA2 4CDUB 5JCTA 1VQ4I 4Q4Y3 5HS9A 1HRI2 5CAZA 5C9AB 1S29A 5C3EJ 1RUG2 1WW6A 1R1A3 1T38A 9ANTA 3EUKL 1SDDB 2W84A 2O14A 1IW7F 3SXYA 1ETWA 2JDKA 4RMNA 4YW4A 3N35A 1NK3P 3AKSA 3VYUB 2GOMA 4EWAA 5F08A 2VW0A 3DBRB 4AWDA 4AIKA 2PA7A 2ZAHA 4UFLA 4E4HA 4J6GA 1G3WA 2K27A 5BNOA 3PUHA 1ZNPA 1WQ2A 1W6QA 4MGYE 1MS8A 1MJBA 1AJKA 2GA2A 2VI6A 1Z0XA 1NG0A 4CICA 4D94A 4E4SA 2CU7A 3BPSA 1MQTB 3S1NJ 4GWMA 2JX9A 4N4OB 2NN8A 5FPUA 1HKDA 5D8AC 3HOVJ 1TT0A 3J7AO 5LGNA 3MW4A 4DY3A 1IRGA 4FOWA 1HXDA 1A34A 3PU3A 2UURA 4CXWA 2HWE3 1NG6A 1MSFC 3TL4X 2JD9A 1UZVA 4QGNA 3RZGA 2OAZA 1IQDC 3BN6A 2BVBA 3MAJA 4QQOA 2UWBA 1PZ9A 1AXYA 3U1XA 3FK7A 3HHHA 3GBGA 4BIFA 1UYZA 5FRNA 4XQFA 4RHV2 3V0BB 2P6CA 2XROA 1DBNA 2QVSB 3TBIA 5L7OB 1PVC1 2NP0A 2R4GA 3O14A 1W7PD 3TDZC 1REDA 3GBFA 2FMDA 2PMWB 5DMYA 4CU6A 4EN7B 1H2LA 3MIBA 1JZ4A 2V4VA 2ZGLA 2QNKA 5LGUA 3VBSC 3WW4A 4Z07A 1LU1A 1V6NA 3INAA 3FUQA 4BQ1A 2GOXB 5T5LA 2Q8KA 1QH6A 1PX4A 3DPTA 2DUQA 1F43A 1FOXA 5C8CB 1XYNA 1RPWA 3FLPA 1TTYA 5JR7B 4UBGA 3K4KA 1O7FA 1N47A 2VU9A 1R58A 5H20A 5FZBA 3OEBA 3FZ3A 2D40A 4H0EA 2O8QA 3TW7A 2AZ5A 2XAQA 5JI7A 2ZX0A 4XTPA 4B3NA 5FLXZ 4L5EA 3MO4A 1R64A 2Z69A 2VW1A 4BQ2A 1F15A 1ZZ7A 3D5SC 3MIDA 4KGQA 5IY5H 2RJ2A 1HXS1 1XB9A 3ME2A 1PGSA 1SFPA 2DJIA 1S7AA 4A93J 1W8ZA 3VBFA 2Z16A 1W2UA 2P2KA 1LR5A 1R9TJ 1RUI2 2R7UA 2LY9A 4A0ZA 3FBYA 3WTWC 3V8JA 1HDDC 2L9LA 3VBFB 5JOXA 3CDHA 1COV1 5H9PA 4LB6B 3THPA 1V0AA 3SH3A 1QIQA 1B72B 2ZX3A 2Z4FA 2BNOA 4RGGA 2B4KA 1PJRA 1WZ2A 5J1XA 4MOAA 4R9DA 5EZWA 3A0HC 1NLQA 4D5FA 3RZOJ 3HOWJ 3HJEA 1FIPA 1MGTA 3LDBA 4RQPA 1FBQA 1A3KA 2O61A 1F4HA 5I0RA 5DM6F 3ZPLA 1TMF1 4OUMA 2R5YB 1MS3A 2L7KA 1HQWA 4Y4RA 5I91A 2CH0A 1S2KA 1PVXA 4HPKA 1HC8A 1OFSA 1UG2A 3T5XA 2CFOA 4XFGA 2XRLA 4AU7A 4ENNA 5FXVA 2IXHA 3FLTA 1YQ6A 2CWSA 4P02B 4KWLA 4BQWA 1F8VA 4S2FA 1AR81 2V5DA 3C7OA 3I54A 4ITCA 2L7ZA 1MZ5A 3DKYA 3I97A 3B73A 3ALQA 1W6OA 2EIGA 3U75A 1OURA 1U5YA 3KVAA 5GLTA 5C44J 1OH4A 3NEUA 5C33A 4FBFA 4AFAA 1Y39A 1ZKGA 3USUB 1OQEA 1FMD1 3EO6A 4PBOA 3BUCA 2VXJA 5F5QA 3W9AA 2JRTA 1DQ1A 2DN0A 4NRPA 3KM5A 3A22A 2ES3A 4QQLA 1VBB2 2LD5A 4UFIA 2BVLA 2QLZA 3G6EI 4Y7NJ 3KZ4C 2D6MA 2JVHA 2D6OX 4CP0A 3L7WA 3JD72 5EP9A 4M3CE 1PO11 3WG4A 4A2UA 1W36C 5IFTA 3HTUA 4CXYA 3VZOA 5GP9A 2ZGPA 1XGMA 3H1CA 5FY7A 2Z99A 1MZ6A 1NE6A 1JODA 2VGDA 4LITA 4O3MA 2XPUA 1EA3A 2A5WA 1E57A 4AAPA 4WWCA 2P17A 2NYYA 4HANA 1MZBA 1R091 1D0HA 3J81K 3DGTA 2BPA2 5E79C 2IBDA 1C8M2 2QQJA 2B63J 3CCYA 3QU3A 3BU7A 5FJ8J 2RJKA 4Y33A 2GMEA 1Y1WJ 5KAIC 4XHBA 3POIA 4P9YA 1PO21 2NS7A 1R1UA 2VKVA 3MW3A 1BI0A 5FYZA 1GOGA 2IW5A 1X50A 5KCMA 1HSJA 5CIRA 4NHLA 5F6LB 5IHRA 4IE4A 4FPYA 4ETSA 1MEC2 1V9U1 5JPNB 3K77A 2VBBA 4B3XA 2UWMA 4D8MA 4LOCA 2YMZA 3A0NA 4HQEA 4OMCA 1POV1 1T8IA 4IGQA 3ZXFA 4YEJA 3Q0WA 1VQ6I 2BBAA 3FBMA 4ASLA 1WSUA 1YX3A 3POGA 4AW7A 1K61A 1JHFA 2D98A 4EJRA 4H14A 3RZJA 1JKPC 4GH4C 3RWKX 1W8FA 2M4KA 4YG6A 2CQKA 3HJRA 4XBNA 3WG9A 3BJAA 2EXHA 4YG2F 4A5MA 3OYNA 5IW0A 4A0XA 5K5OA 2LRDA 2EVXA 4AHYA 4NROA 1ACCA 3B6CA 2Z33A 2LNBA 3ZFFA 2E63A 4HF2A 2W92A 2OV7A 1TME1 4HNVA 2RVAA 5B1BH 2ARAA 2WQ8A 4AVCA 4JTNA 3VBHB 3CEWA 3ZCOA 4ISRA 4AQ6A 4MV2A 2TDXA 2JB8A 4Y22B 4BQ5A 2IS1A 3TNQA 3OIPA 1W8NA 2J42A 5HI0A 3FMRA 1O4YA 3B94A 2KRFA 4DZGA 1KITA 4ENJA 3WP3A 2GMPA 4NC7A 4Q4W2 5F32A 1CESA 3RKQA 2WIIB 3K70C 5A1LA 3H5AA 4JYKA 2DMTA 1WCQA 4A3LJ 3CMAI 1H2MA 4KIFA 4D5CA 2Y69H 4L18B 4OWRB 5K4LA 1RXGA 2K4BA 2P3YA 4Q4ZF 3FKIJ 1AWCA 1UOJA 3HWJA 4DBQA 2OS2A 2DYSH 3ZLIA 3RNSA 3AP9A 3FXMA 1STZA 4KU7A 1TVGA 3HRUA 5EEHA 2E7AA 4CPBD 4EE2A 5L36A 3THTA 2FOKA 1SHWB 1J75A 2XJSA 1NYWA 2DOAA 1EV7A 2ZHLA 1MH3A 4TLGA 1MQTA 5FO9B 5FD6A 3OV8A 2HBTA 5T50A 3C7FA 2OQ7A 2WNUA 4QU1A 4BHPA 3Q9SA 3PL8A 2IVIB 1GDTA 4NIAA 1PGL2 3LSIA 2J7MA 2WFF1 2QM3A 4HEA2 3H8OA 2XF6A 5DZGA 3ZR6A 1IN6A 4DUVA 5C3OA 1BBT2 1FEXA 2WT0A 2KM2A 5FRMA 3JR9A 2RS13 5IWFA 2ELKA 3BTJA 2OVUA 2AXTC 2PAKA 5KHJA 4A41A 4UV9A 3VHPA 2QENA 4AIJA 3RI4A 4P9GA 1YQ8A 3ZYIB 4OMYA 3PMEA 4TLFA 4QX1A 5K7HA 2H8RA 2HQ5A 4DXSA 3UJOA 2FEZA 3E6BA 1AYN1 3ECQA 1WPKA 3TEXA 1O5UA 5IAVA 1HW2A 3VDDB 1QDCA 1YFXA 3VD3A 1YEWA 4QX3A 2XXZA 3DTEA 3CZ6A 3KEYA 4L99A 1OPMA 4IEXA 2J1RA 2AC1A 1SVOA 3L2WA 2WJSA 4AEKA 3OG2A 1UYPA 2VD7A 1LDDA 4DO0A 5JIUA 2BW3A 1ND2B 2KJBA 2C4XA 4CCJA 3VGIA 2WRAA 2FCVA 3KS7A 1QGPA 5FLMJ 5GPAA 4BLIA 2OD5A 3WG3A 2Y0SA 1W8WA 2CWEA 1VI0A 1ZYRF 2D6PA 1IHMA 1HF0A 1DZTA 1WI9A 1MBJA 2DYRH 2EH3A 1XU2A 2DK5A 2DDUA 1H30A 1IDYA 4GH4B 3LEGA 1LFUP 1LGBA 4GULA 5HXMA 4D7TA 5FYSA 2GA1A 3GO5A 3GZAA 1QA6A 5E3OA 4OHXA 2V1UA 3O3KA 2R5YA 3OY8B 5DDJ1 1SFNA 4CEWA 1PIV1 3CHXA 4LO7A 1S9HA 3B7MA 1W2OA 4QB6A 2VNGA 4Z1VA 4R1HA 2CG4A 2Y6GA 3JSPA 1J3RA 3VKLA 3O1RA 4QM8A 4HSLA 2VC0A 5AVAA 4M4RA 2NAZA 2ZGMA 5KXEA 4NPLA 3ZFEB 1W7PA 3JRHA 4Q2FA 3I58A 2LMDA 4YM0A 1Y8QB 2TBVA 2DV9A 2IT0A 5F5IA 3H7JA 4JQRA 1IG7A 2XJQA 3AKPA 5EEGA 3KD4A 3FZVA 1P2FA 1MNDA 3KPHA 1ON1A 2WNUC 3AP4A 3ZMUA 2LYCA 2NXNB 2ZJRF 1WCUA 3OOXA 2ATFA 3RPUA 1FPN3 4XDOA 3HPNA 5LD2C 3OGRA 2ZXJA 2ZGTA 3ASIA 3BPXA 2MYSA 1IV6A 4B4PA 1D1BA 1T2KA 1ASJ1 1XE0A 4D7NA 2EZIA 1XBFA 2BVMA 1MZEA 2LP0A 3WF4A 4WZFA 3OYBA 3TW6A 1VALA 4RB0A 3J26N 4UF0A 3WE3A 5FREA 4XR6A 2RVCA 2JDZA 4AF9A 5GTIC 2XLAA 2XDVA 4ZZ5A 1C8NA 3BP8A 1A6IA 2KJCA 3R60A 2EINH 4AIDA 1MMNA 1R5ID 3L2QA 1YJNI 3P3PA 3HIFA 1DGWA 5HOOA 1YS6A 3DEMA 5BNOC 1MS0A 2NVYJ 1PMJX 4NPMA 5LY2A 1ND3C 2BBYA 4BOWA 5EJ3A 1UU4A 3RJ2X 4OUSA 3W5MA 2DDAA 1UX6A 1H88C 3VYRB 4YW2A 1RUH2 2GP3A 2QKDA 5J48A 1RUJ2 1QRYA 5J4YA 2JPBA 5DV5A 4AVSA 3WGGA 1WUVA 2JG9C 5A7WB 3VV1A 2VMEA 1RUC2 3ASNH 4YW1A 1MIJA 2XL7A 3VZNA 1IPSA 3PVBB 3CJRB 5HV4A 3FN9A 3C3WA 4F7ZA 3RZKA 2W95A 3FDYA 3GTKJ 4LA3A 4XF1A 2DBBA 2HWF3 1AR61 3MIHA 3WNNA 1XX5A 5E17F 3DU6A 2VVFA 3Q8AA 2JG8C 4IXLA 2WAAA 3SCGA 4U7BA 4Q26A 1S0IA 3RJRA 3CLPA 5HCHA 3K7AJ 1WCDJ 3ECHA 2NLRA 1JKQC 1T95A 3EDPA 5FAXA 2ZMKA 1KYWA 3LQRA 1S0BA 5T5OA 3LIHA 3CCUI 4XXPA 3V0AA 1YIPA 1SD7A 3T1BA 4Z8BA 4CHUA 2PBIA 2RMU1 1FTZA 2OCEA 5D4SA 5GADJ 1YIFA 1KS5A 1ND2A 5FWEA 1DIWA 2W1WA 1RMU2 1TMF3 2QQWA 1CAXA 4QM9A 1XB4A 2GQQA 4I76A 1U5XA 5JXIA 2JK3A 4OZOA 1UCXA 2EBIA 2M3AA 5KR7A 3SHRA 2PFWA 5BMZA 1WLWA 3WHBA 1FWZA 1QWRA 3J8F1 1XDSA 3EHKA 4XUTA 4GALA 2R49A 1A78A 4A7YA 4FQ4A 2NPIA 3BT9A 3KP4A 1VJ2A 3S7EA 4Z2WA 4Y26A 1OR7A 2ZBKA 4PI2A 3HSEA 2PAMA 4PQ9A 4L97A 1W9YA 2IXSA 1HRV2 1SPPB 4P55A 2BJSA 3PNTA 3OGVA 5I0DA 5A70A 4KBZA 4LJHA 3VBUC 3CLOA 2WY7Q 1JU3A 3S3NA 2QEXI 5J98B 1QNWA 4AEDC 4M6VA 1AHDP 1SEFA 2L9VA 4LT5A 1HOMA 1ZRRA 1UOGA 4JX0A 2GMMA 3UL2A 5IVCA 1H1MA 1F4AA 5KXCA 4IE7A 4JQFA 1BI2A 2P5VA 4MLOA 1QJX1 1WW4A 3H5NA 3SNMA 1W9FA 2A6HF 4P00B 3VYSB 1GNZA 2JRMA 5A6ZA 1H6YA 2CDOA 3MZHA 5CKMA 2YGLA 4LG0B 4V2FA 1JTZX 4BLJA 2VMHA 4C2UA 2Y60A 4HPQA 3GHNA 1OCRH 1VRH1 2LTPA 1OUSA 2D97A 1PIV3 3MFAA 4C1XA 4XKBA 1Y1VJ 4AVBA 2Y9ZA 1LHNA 2DUOA 2Q1FA 2BY0A 1QXJA 1B09A 1UD1A 1GANA 3AYCA 4CUCA 1XQNA 2VKDA 5KNLA 4BE3A 3AX4A 3H3UA 2P6SA 2Y34A 2ETHA 4XBFA 5K9YA 2WWJA 1OCOH 3MHZA 4ESFA 5FMDA 1NCRB 2O3FA 1BEV1 2MHFA 5HODA 3RS6A 2PN5A 1AOYA 5KXBA 3VLBB 2W3JA 1V6KA 4CCOA 2GN7A 1G9AA 2KRCA 4J19A 3CTAA 4BDZA 5HCBA 2H1KA 4NMIA 5FKMA 2Y6JA 4O9GA 4ZZ8A 3ZFFB 1YW7A 4AGVA 2B8MA 2WB1A 2A1XA 2D93A 3ZFEA 3ATGA 2W87A 2F6CA 4LBQA 3KP6A 4ZU7A 2BNMA 2JENA 2QUFA 5CFDB 2GLOA 3I3LA 2PXJA 3DQVC 5ABJB 2V1NA 3KB5A 3V56A 1LUJB 3CO7C 5BNPA 4PGHA 5KHDA 5FY9A 1Z7UA 2OZ6A 3Q8EA 2M5WA 5TGTA 3RMXA 3QU6A 5EQUA 1BCXA 1Y0NA 1Z78A 4FPGA 4R52A 2WYSA 1GZTA 2B9UA 4GXOA 3W59A 5HS7A 4QPYA 3KIOA 3IKWA 3LKJA 2I45A 2MLGA 4XRFA 4OOIA 5TJJA 2BEOA 1WGPA 1CF7B 4N4NB 3OBAA 3RZHA 1Z3XA 3I3BA 3AMNA 3M1HA 5F9TA 3S16J 2E1MB 1CONA 3F3XA 1Q43A 2DOEA 3TEZA 2UWCA 4E6KG 4XRSA 3PUSA 3B00A 4Y5TA 3ACFA 1QJY2 1DPUA 4MZUA 1UXXX 3WDXA 3OYHA 3ZFGC 2JICA 1OCTC 1ZZ9A 1ULEA 2BWAA 3CCVI 4PI0A 4FETA 3O0WA 3BB6A 2CAVA 1D0ZA 3AVSA 2R0QC 3BQZA 3QODA 2COBA 4PDKA 1WWXA 4NQWB 4CEWC 1BHGA 2GC1A 1G8WA 2ZGSA 3GTQJ 3JSOA 1U8RA 4DMIA 1UXZA 2F4OB 2EWNA 4B4QA 3KGLA 4CYDA 3EMRA 3I3QA 2O1QA 2CNAA 1GVDA 5DDGA 4O61A 4HX4A 3LEKA 2Y38A 2PFBA 5J1UA 1KONA 3QPLA 3ETQA 4AVVA 2VOXA 2HWE2 4AI8A 1POV0 1TMF2 2UU8A 2MH9A 2VUAA 1PYVA 3LB9A 4CH7A 2WS91 4FQZA 4JV4A 1S0JA 3NRUA 1GP4A 3Q8CA 4A45A 2CJJA 3GZNB 3ZXEA 3CZJA 5FD5A 4HKOA 1OPCA 2ZCWA 1AYN2 2OX0A 4LG0A 2AYHA 2O0YA 1VBC1 2Q8DA 3HGGA 3T30A 5EJZB 4XZUG 1DQ4A 2MC3A 5IVJA 2YPJA 2R041 4ON0A 1HRV3 1G6NA 4IEJA 1XGOA 1CR7A 2WA4A 4CCLA 3CCRI 4PBPA 2XLGA 2RNGA 2IPQX 2WADA 2WWUA 1ZRFA 2EICA 1JUIA 2VBDA 4NOTA 2N7GA 1GZ9A 3JAMZ 5C4XJ 2JDNA 4BK5A 4AFDA 3AYEA 1JHNA 1WH7A 2WBKA 3CCSI 4FOYA 5GTHC 4UI9L 1GQHA 4P5HA 4OZXA 4HX7A 5E3MA 2ADDA 4NN0A 3K4CA 3FBIB 4BQOA 3RZLA 4XAAA 3N7KA 1GP5A 2F6BA 4AI3A 5FZEA 2FDIA 2K3FA 1IS4A 1Q1VA 5FRAA 4DEVA 4QPIB 3RVHA 4HLTA 1UELB 3H8UA 1VBC2 4CVUA 2A71A 2DAOA 5EJCA 2DLLA 1CAXB 3WHUA 2A5ZA 3ZX7A 2ZEYA 2XSJC 5AVPA 2A6ZA 3MD2A 2OUJA 1RUH3 2LKSA 1FC3A 3DL3A 3ZYFA 1PNFA 1VBE3 2ETEA 4Y24A 4QPGA 1XG1A 1PM7A 1L0OC 2BY1A 3JRFA 3WG7H 2HI3A 3HBZA 2AQEA 1U5TA 3KYDB 4IOAF 3M8JA 4XKWA 4EM0B 1MS5A 5T3NA 3OY8A 2D6LX 1RUD3 1XYOA 3KVBA 3BG3A 3LD8A 5FZHA 4DOUA 3U37A 3HQRA 1FYKA 2ZMLA 1D3YA 1H1IA 3H3ZA 4BQAA 3PSIA 2HDCA 4FFGA 2YFUA 1BKZA 1OJLA 1QQP2 1O8SA 5CISA 3APBA 1RUC3 3GF6A 1L3LA 3QPHA 1F9KA 3Q8BA 3RYPA 1B59A 1GZWA 2OZUA 4NRQA 5K7ZA 2VL8A 4HVQA 4NWVA 3G2BA 3TP0A 3ST7A 3SXWA 4AUXA 1F4KA 5FUPA 3MICA 1FOKA 2D45A 2ZX2A 4LIUA 3WTUC 2HVRA 3L2UA 4N43A 5LBQA 3SHFA 3JRIA 2F4LA 1XPXA 3CUQB 1OLMA 1VQOI 2XBO3 1OLME 3E5UA 4ZYEA 4JX6A 3ZDVA 2RDPA 5BS6A 1B9NA 4EJTA 1UF2C 4GAZA 2WINB 3LQCA 1WH5A 1XGSA 3WDTA 5JXGA 3OF1A 4DW6A 5BXXA 3HUGB 1ZRIA 3PL0A 3BC8A 4ZS3A 3GJAA 5AC91 4UVAA 2E71A 5JZGA 1QJX2 4U0WA 2OKXA 5FPZA 2E7TA 4P5YA 3ZO0B 2AS5F 4FVVA 1OOPB 1UHMA 1XMXA 4P5OA 4URAA 3QCWA 4WV8A 4NHJA 3O2PE 3GEZA 2ZEXA 4QHZA 4ZXKA 1AR72 1WMXA 1IV8A 3AG1H 5EGOA 2E26A 4RD7A 1V9U2 1AL21 2HU9A 3ZQ7A 4I09A 1UJ8A 5E8IA 3AG4H 4GB33 5FYYA 4YIIA 2QQMA 2UXNA 2VQAA 1CWPA 4PSWA 3ZIXA 3PSFA 4GB31 4Q29A 1PK6C 2KPMA 2W48A 2W57A 2X1CA 4CDWC 1Q56A 3OGJA 3AMMA 5FZOA 3E6DA 2DMUA 4IE0A 2X4HA 4GDFA 1XE8A 3WCRA 1ZHFA 1RHI1 2DFBA 3M1CA 3TGNA 1ETXA 3QPSA 4ZPIA 3MMYB 5GAHJ 1UU6A 1DZQA 2VE1A 3BTZA 2V7FA 5FPVA 1KDMA 3CP2A 4V2VA 4XIOA 2BGCA 4LORA 1ZBA1 3POBA 4WVWA 1W0PA 4AHXA 1DPRA 2DVDA 4INDA 3I49A 4PIXA 1FY7A 2G4IA 4HLYA 1HRV1 3U14A 2LALA 3PO3J 4NWWA 3OS0A 1G9DA 3JRBA 5K8SA 2VJXA 2E5ZA 4DIQA 2WNUB 3R4DB 3J8F3 1PGW2 3TKYA 1OLRA 2HYKA 2JQ7A 1WA6X 3OYJA 2VO5A 3R0AA 2LLKA 2YV8A 1K83J 2QQ9A 5A3OA 2DVAA 1IN8A 2WS93 4IEUA 4F8AA 1OQYA 1KQ9A 3IBMA 1ZQ3P 4U36A 3WNPA 2FZ1A 3LSGA 4BH9A 3G1LA 1VQ8I 3ZIWA 3HC7A 3LCPA 1G86A 3I8TA 2WZR2 1M4WA 3CF5F 3K4MA 4HL0A 2LR8A 3ZFEC 3M8FA 1U3EM 2STTA 4CUGA 1QZZA 2F4IA 4LLNA 4O65A 1X82A 1DZRA 4DJAA 4O7XA 4PZJA 5LA2A 4LPLA 3L2YA 4DS0A 4NVPA 2CUZA 1U6GA 4QWQA 2W94A 4IE5A 4CCNA 2G9GA 4XFBA 4W50A 3T8RA 1JUPA 2O5RA 4FPJA 4ABZA 3PIOF 3H92A 1YUDA 4H4KC 2Z5UA 4LG3A 1K4TA 1H0MA 5L19A 2G0EA 3IB3A 1W6PB 2VCAA 5HLHA 5A1AA 2ISZA 2K85A 1VFCA 3I56I 4LGWA 1S3JA 4CA0A 3VSKA 4S2GA 4XKVA 3MFKA 3GX4X 1G59A 4AEDA 1R081 3ZSEA 3S2HJ 3VDBA 1O3SA 3GFJA 2A6XA 3FBNB 4E7IA 2BXYA 1QJY3 4TN7A 5FYCA 2VMDA 4YARA 3FK6A 1NX9A 1XJAA 1AUYA 3WF3A 1TNSA 3SLIA 3BPZA 2J22A 1W99A 3WP5A 4KMUX 3IAQA 3CJTB 4AI2A 1YFYA 4RR3B 1HKTA 4XNFA 3LSTA 5IVVA 2ZSHB 1VMFA 3D0SA 3OIOA 5LBCA 1PK6B 2A73B 1GOHA 5JR2A 3HPGA 3T2QA 3K51A 1I50J 1P4AA 5FP9A 1DP0A 2PG4A 1SAUA 1R23A 3BZCA 4FFFA 4OHZA 5F3CA 2HWVA 4TV7A 1MBGA 4IHVA 4Q0PA 4C9YA 4JZRA 1AA7A 1R4MB 3H42B 1UZWA 4LBJA 5BNQA 5LHIA 1TW3A 2HOEA 5CKNA 3VB9A 4IHWA 1YOVB 3JRAA 2HWC2 3ACIA 2DA2A 3L2CA 1JHJA 4DB5A 1QVTA 1JJ8C 2JG9B 3OSFA 4Q0UA 3L09A 1RUE2 2RS53 3G6JB 3K0LA 4EZHA 4OIOF 1HXS2 3S93A 2XVGA 3LNQA 4IW3A 2OXBA 1PZ7A 1CJPA 3ZN5A 2WN2A 2A6VA 2IWGB 4E9KA 4XJ9A 1W6MA 1Z7S1 2A3XA 1LKXA 4RA0A 1JYIA 2JDHA 2E53A 3OGGA 5IJRA 5EG0B 4MNUA 3TNPB 2Y48A 5LY1A 5FMCA 2X29A 3QOPA 2OYZA 3GLLA 3H5RA 4ZY9A 1L7RA 2IRFG 3JW4A 4PF5A 4LB5A 5HDGA 1HV0A 3DV8A 1YXWA 2PN6A 1MDMB 4QQHA 4HX8A 5HCAA 2L02A 1YC61 4RB1A 3HOUJ 2ID6A 3OSGA 3ASOH 2BY2A 3LOIA 1FOD3 2XPVA 3R6SA 4XMIA 4CDXB 3C2HA 3M2MA 1C1LA 1IN5A 1WLTA 3AKZA 1FMD2 2JJ7A 2FBKA 2QVOA 3FXOA 4RDUA 3ZMOA 1COV3 1UQXA 3WTSC 3N9MA 2YC0A 3JRCA 2VJIA 4YM1A 2J5OA 3DYMA 1D4M1 2E7XA 2OUHA 1JI6A 5CVIA 4HF1A 2YBPA 4RM3A 3AVRA 2QWWA 4J01A 2QZ2A 3VBRB 2FMLA 1K6OA 4L9NA 1GICA 3ABMH 4UW6A 4P9FA 3S3OA 2D7FA 3EPZA 4GMP0 1AX1A 5L7OC 3OUIA 3OD0A 4B8EA 2JDAA 2PHRA 4I0WB 2HKOA 1JUSA 3GZ6A 1GUIA 2Q0AA 4XLCA 2OA2A 1DQ5A 4A6OA 3KT7A 3BCBA 1B35A 2PHTA 1NY71 1C8M3 1YO5C 5ABJA 2KA3A 5FY8A 4HF0A 2BFUS 1HKSA 1ON2A 5ERLA 5GM0A 4E7ZA 5DN2A 1HV1A 3IWFA 5CFDC 4MO7A 2EV0A 1Z9CA 2R042 2WL1A 2KZVA 4Q4Y2 3K4LA 3T08A 1IGOA 3EBRA 1ULYA 3U07A 1HCRA 3CZUA 1BW6A 1K45A 5FTTC 1R1VA 2JWTA 3IH4A 3HOSA 4CU7A 3BIEA 3DBHB 2HTSA 4B43A 3WTVC 1LGCA 2EF6A 2EIJH 2YPDA 3O0VA 1H4HA 1T0FA 1H8VA 5FZ3A 3PUBA 2Y26A 3MV01 1AX2A 4AFCA 3K70D 1RL3A 4CEYC 3FE5A 2VXRA 5BPIA 1HW5A 1OFNA 3LDRA 4DPNA 1LEBA 1X1AA 4YZ5A 1UPIA 2DFHA 2JEMA 2A6YA 1NG7A 5M5YJ 2XGXA 4A42A 2Q0OA 3J7ZI 5DCFA 2XAJA 4AD9A 1SMYF 3TOJA 3BQYA 3WEZA 2K9NA 2LREA 1OQ1A 2BV6A 3G3ZA 4PJ0C 2XAUA 4F83A 2DTZA 4BACA 5JDBA 2ARXA 2OIIA 3DKXA 1VMJA 4YVWA 2YSRA 2LKPA 2WWSA 3WU1B 4KJZA 3OBTA 2FD8A 4XFAA 1IO2A 4HNTA 2QE3A 2ZMEB 3M3OA 3VDDA 2RMU2 5DM7F 2XLFA 5JWPA 1R5HA 4LHSA 2WAOA 1KQ0A 3QP5A 4CDQC 4EN0A 3BI3A 4EN6B 1Q8QA 3THCA 5FUIA 2PHWA 3MIEA 4CP2A 2QKMB 1UMZA 2DA6A 5K7FA 1A8DA 2KXLA 2WQ4A 3URFA 3AL0C 1QXRA 3WF1A 1KRIA 4LBMA 4A6EA 5EYYA 3FMGA 3K4AA 2QBYB 2VZ3A 5GPCA 1YFUA 1K78A 2W39A 2FDKA 1UU5A 4L9JA 4NC8A 3V7SA 5L9VA 2JSPA 2YBKA 3T4HB 3JBG2 4J1XA 4COWA 3SC7X 1CPNA 3NJYA 1YE9A 1GKBA 2JWPA 4UFKA 4XAEA 4I99C 3OUHA 5C4WA 1OF4A 2D6KA 1A5JA 5F27A 5A2QK 3MPBA 3NVCA 1CD3G 5F5AA 5L3GA 1X19A 4JAAA 2PJPA 4RGKA 3RFRA 4CDXC 3OY9A 2E1CA 3B6AA 4QPIC 2GALA 1RYYA 4B1LA 1X1CA 2CRGA 4GFBA 2VVEA 1D0YA 2YU2A 2O9LA 3OEAA 4NDLA 2F4MB 3VD4A 1ZG5A 1VBB3 4BQ4A 1SD4A 2PHDA 3AK0A 1S2EA 3QRFF 1UMHA 2YZ4A 5DAVA 3IL2A 5FZKA 1GWLA 4Z6YA 4FCYA 4UB6C 1TP4A 3ZXSA 2GH8A 2VZOA 4BQXA 2WR9A 3WOGA 4ZZDA 4ZTFA 2VQ0A 2CDPA 1BJZA 4YGEA 5HPOA 1JT6A 5BNNA 2VMIA 2ISYA 1TWFJ 5T5JA 4IXAA 3S2DJ 2C6SA 4PJMA 4M3CB 4UHTA 5I0TA 3F23A 1ASJ3 3OYLA 2R32A 1OD3A 1AR73 1XNAA 1TME2 1IGNA 4OFGA 5JXJA 3PVEA 4HN0A 1R7JA 4W97A 1CQTA 1Z67A 2O8XA 2F5CA 3U21A 3OTFA 3A4UA 1B8IA 4KUMA 3HRTA 3R61A 5F39A 1X58A 4XF4A 2Z42A 3H0OA 3PURA 1ETKA 2RV8A 1ZZBA 2G1MA 3J4UH 3MLKA 3WU2C 2VONA 3IP4B 2HWF1 4QPWA 3HBLA 5DAPA 3ZOBA 1H0BA 1UL9A 5C7GA 3KYCB 4ZDOA 3J80Z 4Y15A 2YU3A 3U1KA 5FFOC 4P96A 1HW1A 3RZMA 1VB2A 4EJVA 4OCTA 3ZMZA 4X1EA 5CZKA 2DBIA 5J1RA 3JRGA 1H1AA 4A3DJ 2PMHA 4R4XA 3AFHA 3VEPA 3HUGA 3KP7A 4EJOA 4EV0A 1J1TA 3VD9A 1I3QJ 4LLGF 4KMQA 1DU6A 2FDGA 1ZVFA 2RDNA 2Q8CA 4GH4A 1JS9A 2CGPA 3I2HA 2VECA 1VQNI 2KD7A 4QD2A 3FC0A 1BR2A 1H89C 4RAYA 2DYCA 2GBYA 3VBOA 3ZN0A 4QX0A 1NZIA 3KLSA 4B7KA 4XMAA 1N1SA 1R092 5K0UB 3OIQA 2BFUL 4B09A 5EFUA 3T8TA 2IGOA 1O4TA 1HKQA 2SBAA 3QYEA 2QQIA 2MA3A 1SFOJ 1OXCA 2L5QA 3DF0A 2XGCA 1O7LA 1GZCA 2EXKA 2W82A 5BY5A 5DAQA 4CDQB 1SQ4A 5GZFA 3TRSB 4A7ZA 5BV6A 2VE8A 3LZZA 1WW5A 3K9TA 4M6XA 2C6YA 2VM9A 1ONAA 2HLEA 3BR0A 1ZR4A 1NT0A 1QOTA 3WGIA 5D21A 1QPMA 1D4VB 1KGYA 4PFPA 4OIRF 4WVMA 1N1VA 4XACA 4CDWB 1R1A2 3IM0A 1Z6TA 4A0YA 2YC2A 1F1ZA 2YUEA 3MPPG 5A6XA 3WU0A 1OLTA 4GJZA 5IOZA 1LECA 1XPWA 4QKBA 1XE7A 2XVLA 1U2WA 4FP2A 4AGGA 3G1MA 3MN2A 3F8NA 5IP7J 5J36A 4K3UA 2VN2A 1VTNC 5A3TA 1UW8A 1T56A 2ZPXA 3KX2A 4XKCA 3K3NA 1URXA 5F3IA 1ODNA 1WKYA 1RUF1 1OKRA 1BYHA 3NWKA 3GUDA 1OBNA 4FTSA 1RUJ1 1OA3A 1ZGAA 2DU1A 4QX2A 1UZ0A 2HWF2 2DA1A 2B45X 2C24A 1V54H 1JZ6A 1YI7A 3MWMA 1FP2A 1RUE1 3HZJA 2IGMA 3UETA 5F1RA 1I5PA 1DP3A 4A3BJ 3N97A 5DUUA 3NV2A 3WG1A 4EQVA 2XAHA 2QSHX 1LOGA 1PVC2 1WBFA 4XIDA 1H2NA 4AYUA 5J37A 2BWCA 3I55I 2LBFA 4I02A 5IK8A 4BHBA 4BQNA 1H6XA 5D5XB 3Q5FA 3H9JA 1USSA 1CZVA 5DEQA 4FO9A 1FJLA 3CO6C 1YQAA 2MW8A 4CDGA 3WY6A 1WCKA 3JXSA 3COAC 3WF0A 2XVKA 2BHYA 4AYBN 2AGSA 2TNFA 1TNRA 1XCVA 5DUKA 2CUEA 4BMEA 3KQRA 1POGA 4RR3C 1DQ2A 3UGGA 2HGCA 3ZQFA 3K10A 5ICEA 1ZBA3 3OPTA 3NNLA 3ZRGA 1MBKA 4FPHA 4QKFA 4UUSB 3KEQA 2BV4A 1DU3D 5E89A 5JAXA 4PSXA 1WCMJ 1VRH2 2XASA 2XBO2 1WA4A 1TZLA 3WTXC 5J1YA 2HWC1 2C0ZA 3K1PA 3J7AY 2CUFA 2WO3A 4KA4A 4PT6A 1KXGA 1MACA 1C5HA 2XAFA 4LUMA 3B3QE 3RG0A 2QDNA 2VOVA 2CAUA 5FZ1A 1BVVA 4LK0F 2MEV1 1N3QA 5C5UA 5E3LA 3A23A 4D0QA 4CDUC 4I30A 4LHNA 3KZYA 4N8MA 2MFZA 2P0WA 4RS5B 3MEXA 3JBG1 1YTYA 5JMCA 3PFIA 3TOBA 3MF6A 1VMHA 1BQPA 1SLAA 4UF0B 3LSPA 2ESHA 2LVSA 3GGLA 3L2VA 5FP4A 5JLVA 5C8WA 4RHV1 5BYNA 3DLLF 2ENRA 5C4JJ 1P9QC 2YG0A 2JZYA 4ATFA 1ODMA 3VBSB 2FBHA 4YVSB 2HOSA 2E36A 5T55A 4WBBA 5DXDA 3ZQCA 4AHZA 1GV2A 2DWRA 5IAXA 2M9HA 5HNHA 3HG9A 2MD0A 1EAH2 4MFEA 3S17J 1MQTC 5FLHA 3NV3A 3VDDC 5ISLA 2DU9A 2XVCA 1UYXA 4XJZA 4ES8A 3R05A 3NAUA 1I9RA 2V9VA 3IN9A 1I3HA 1KFXL 2XUMA 3VOEA 4IZZA 1VQ7I 5KBFA 2J1SA 4E7SA 1QQP3 3LAJA 3FHIB 1W0UA 4XN0A 2DBNA 2YHJA 2M45A 4FPOB 5FKLA 4UB8C 1UO9A 1IC8A 2E2HJ 1IOAA 4QDQA 1PGW1 2DVFA 1SFUA 2J1UA 4CP9B 3KCCA 5DD8A 3IDCB 1E0EA 1IDZA 5JZGC 2HVQA 1BBT3 1HQNA 4MHGA 1W3XA 5FJHA 2GSYA 3EYIA 4I98B 2HEOA 4MGIE 3BALA 1KDKA 4ENKA 1A8MA 2V9KA 4LBNA 1LOBA 2P5BA 4BY1J 2F17A 1JZ3A 1ENHA 4JHZA 4IRHA 2VTFA 2GM4A 1GNYA 2LOOA 4I0AA 1X4OA 2O8OA 3E97A 2ZB9A 2AEYA 3UNGC 3H8RA 1UIKA 4XF0A 1VBD3 4AWXB 5JI9A 3ZXJA 1NH3A 5FBZA 4FSJA 3MFCA 1DGLA 3D6EA 3V0AB 3HAGA 1Z91A 2VIXA 2I8DA 3IH3A 1QF3A 3WQBA 3LQQA 2HH9A 2HQRA 3UNPA 2WAEA 2Z9OA 1CAVB 2YXSA 3R4KA 4EJWA 4RM2A 1XSDA 1LODA 3BYWA 3QQAA 4DGWB 1V6OA 3CF6E 2VC1A 2UYAA 1W03A 4MEXF 2ILMA 1OMIA 3USSA 3HBKA 4CCKA 4FHTA 3IZOA 4BK4A 5GZEA 4BKXA 4AVZA 1KU7A 4OMZA 3HOXJ 2HWB3 1W06A 1AR62 3G71I 3FX3A 2IXIA 2K9SA 3K4NA 3TMOA 3NKTA 1HBXG 2FHRA 1RHI2 1ZG3A 1LE8B 2ID3A 4N0BA 4YRVA 1LENA 2BOIA 4M71A 4EATA 1UWWA 3DLAA 1RUC1 2HQAA 1DYPA 3N9NA 5CQEA 2BW8A 5ED4A 4CYCB 3CJIA 1X3ZB 3ZR5A 1ETYA 2JDUA 2JTVA 4I6ZA 3A0BC 2YB7A 3LWCA 4BISA 2QFEA 1DGRA 1AL23 1RUI3 1UOBA 3VKMA 1VIWB 2VT3A 3OYWA 1GVJA 3S1MJ 2ECCA 2ZSIB 3MW2A 2VOKA 5AIQA 3FXKA 1E2XA 4ASNA 3N7JA 5FZIA 2QQLA 1UYYA 3RKYA 1DYKA 5EDNA 4RSUA 4B8XA 4FOVA 1ZG1A 4L9TA 4M0HA 2YY1A 1K12A 4QKDA 4XICA 5GLUA 1VQKI 5H6RA 5IYDJ 1W0TA 3S8PA 4FPKA 4M9SA 3POFA 5FOBB 4QX8A 3HSRA 2ECBA 3M07A 4CA9A 2BE5F 2V1XA 4DQ2A 1H9PA 5J3LA 4Y17A 1PUFB 2FDHA 4LIVA 2AR6A 4JGYB 4L9VA 3AL5A 1QJU3 1WMDA 1D8JA 4U0YA 1ZBE3 3CC7I 3LFKA 5IP6A 3OSDA 2JMWA 2QF7A 3O6BB 2OC6A 1X4PA 4M9ZA 3ZKUA 3BTCA 4DYQA 3WR0A 1QOSA 1HQCA 3AZWA 4YPJA 5DAWA 2ZGQA 4P9XA 1TEIA 2DCJA 4DYRA 2R1BA 4Q48A 4WM7A 3OYAA 2D5FA 2DK8A 3HL2A 2YGMA 1E3PA 3K2ZA 5SV5A 4RLFA 4LK7A 3FL7A 1GLNA 3I9V2 2ZC2A 1WD3A 4FFIA 2A6TA 2CQXA 1XCBA 2WV1A 2PQ8A 5K1YA 1FV2A 2DF7A 5HXVA 3IKTA 4QHOA 1LFPA 1C0WA 1YRZA 1YJ9I 4HV6A 1ZA4A 3I2GA 4CUAA 2PLV1 5B66C 3VBHC 4IGPA 4OI4A 2HFHA 2E5NA 2QQUA 3W2AA 2GNTA 1C1FA 4Q4W3 4QXHA 1TNFA 3CP8A 1RR8C 1IZ1A 1D5YA 5FO7B 1U5TC 5EF6A 3SH4A 3UT0A 3IH2A 3ZFGA 3M4OJ 3B69A 4G9YA 1YS7A 1YJWI 3W58A 1SBDA 1JTXA 2DVBA 1LNSA 1I1EA 1R5GA 4H2AA 5M5WJ 2V4JC 2RV9A 2WZR1 3SCFA 2A7AA 2V9PA 3ILNA 3RMYA 3FXQA 4Y4YA 1OCCH 1X2MA 3LSRA 1YX5A 2XV4S 4M3BA 3GTGJ 2L9SA 1JH5A 1SCSA 4UT5A 1UY3A 3CESA 3LMMA 1U0JA 3AP7A 3F8BA 1K42A 2VC9A 1HN1A 5JHUA 4MVTA 1R1A1 1BIAA 2OUMA 4KDPA 4YG0A 3T09A 4CE8A 2LF7A 3KQ4B 3HRSA 4FTEA 1DF0A 1BZWA 1BI1A 3VBSA 1KJRA 3ABZA 3RI9A 4ORFA 4B4RA 1QDOA 3K4ZA 1QU3A 1EF4A 1OH3A 3A7QA 3S6PA 4A12A 2KIUA 4ENMA 3NJZA 4BEHB 4BQQA 1Q3EA 2GN3A 5DG1A 2W85A 2FBIA 1OYYA 2XQRA 4V2GA 4XBQA 1KU3A 2WAFA 3QD6A 4Z82A 4QPOA 4HA8A 3CF2A 1XMAA 5BNPC 2NVXJ 4XMYA 5CQGA 3RYRA 2DA4A 1RGSA 1ULOA 2GNDA 4IV3C 3EB7A 1AYM1 1RUF3 4K9SA 5L3DA 2OQRA 1GWMA 3HYIA 2H8WA 2ZGUA 4OLLA 2PHLA 4IEQA 4NAOA 3P9KA 5CKQA 4W65A 1VR3A 1XYPA 1BI3A 5EG0A 2EIDA 3BIWE 5FZGA 4NQWA 1ZELA 1MBHA 2MH2A 1S0GA 4EGZA 1SANA 4YSFA 1OYWA 1GLHA 3SH5A 4AC0A 2RDRA 5LEKA 3U1DA 3M3QA 4HKWA 4L8QA 4ITVA 4X8PA 2BZDA 1OPOA 4KISA 2AREA 3O8HA 5FZLA 2P7CB 3IMMA 3DCQA 2A5YB 2ZHKA 2PMZA 1Z77A 4K1YA 1HIXA 4CP9A 1N3OA 3LSHA 2F5DA 2M2EA 2XF5A 1AKHA 4FPCA 1G9BA 4Y5SA 4HT1T 1GMMA 4ISQA 5AIPA 3PQJA 5AC92 1JGSA 2AEZA 3C2UA 2H1LA 2OQGA 1ZTRA 5CFDA 3T1MA 4QGMA 2ELJA 2F48A 1N1YA 2BGOA 3H3LA 5FP8A 4FE4A 4XSXF 5E20A 4N53B 2F4PA 1NA1C 1D5VA 2E19A 1HJGA 5GKAC 4ZJZA 3H9GA 1QO0D 2LY1A 1W8TA 3QP6A 3ZFGB 1W90A 3AKTA 1FLIA 1EPWA 4FI9A 2M0CA 4QTRA 1VQMI 3M9AA 1F9NA 3ABKH 4OVEA 2NRAC 2E7WA 3ILRA 3I59B 4UV8A 3JB8A 4QQ2A 2BVVA 4XQ4A 4NBQA 3S2WA 3WE2A 4YZ4A 1SDWA 1RJ8A 2X09A 4YLZA 4QLCU 1G8XA 1D1CA 1Z05A 2WLQA 2Z1DA 3RKXA 4YW3A 3RDIA 1MNMC 1MVQA 1P7JA 2X6WA 3PJRA 1O5LA 2RS52 4IE6A 4LE3A 5KK1A 2F5FA 2WUHA 4AHWA 3SFZA 2BGPA 4LNVA 4EN9B 3BROA 3NJXA 5IYBJ 4LLOA 4MHUA 1IXSB 2ID4A 3PNVA 4HW0A 3E5XA 1SCRA 2W1OA 2EZLA 4YVSA 3U2RA 1S5LC 4DNCA 3EYPA 3HQXA 5A6QA 2XSDC 2PLYA 1U5TB 4ASKA 3K1NA 4U7DA 1FAYA 2BBVA 1GV5A 2MD5A 4BQ3A 3BJOA 2Q2EB 4GWJA 3ITQA 5F7UA 4GJYA 4DNYA 4P9IA 2P34A 3OYKA 1OCZH 5HDKA 1S72I 1U8BA 4JVAA 5I8TA 2ZJQF 2FQ3A 6PAXA 2EFOA 1PO12 5FY5A 2GXBA 3LSDA 3X29B 3BR2A 1QQP1 2Q8EA 3CCMI 4PCQA 5GAEJ 4E4ZA 2LTNA 1E17A 2ZS6B 1V5GA 4QHBA 4ZDPA 4Q27A 1ULPA 1LHWA 5IT3A 3C18A 4MEYF 1RB8G 3FFQA 1RRJA 4JKKA 3LSMA 2VOTA 2FA5A 1C8M1 1ZGJA 3N36A 5B1AH 5JXHA 3LA3A 5M3MJ 3B9CA 1T39A 3QBQA 5F37A 4UY8I 2ACJA 5LBEA 3CJIC 4BZ4A 1ZBE1 2VPRA 3WTYC 5FZOB 2RNJA 3HMYA 2HPIA 2CYFA 3I3DA 4AAXA 2DMNA 3DCFA 4XETA 4C8DA 2W25A 3A01A 5ACA1 3VFZA 1IQAA 3FLRA 2VB6A 1PO22 3VZKA 3L2RA 5M0TA 2VJJA 3NJVA 1AYN3 3ZQLA 3P5JA 2VNVA 3OYCA 5LCWL 3CMEI 4QT6A 4YVWB 4DRVA 3ILFA 3ECOA 1O4XA 1LVAA 2RC4A 1IN7A 5EYRA 1W6OB 3WXPA 3Q0UA 2ET7A 5D8LB 4ZH4F 1X9TA 3JREA 1REEA 3RRDA 1VBC3 4E7LA 2JVGA 3ZMTA 4XF9A 4Y20B 1CGPA 5I8YA 5FFXA 2PQSA 2Y6FA 3TP3A 2F5EA 5KVRA 4M3DA 2V6EA 1WW7A 5A33A 4O5VA 1NXMA 1RJ7A 5DQ0A 4AE2A 5CA6A 1W3VA 3E6MA 2QCOA 5A7QA 2PELA 2EFPA 1S8NA 3JQWA 1WWYA 4JGZC 5JMOA 4IRGA 3GYDA 3NO8A 2Q1MA 3MYXA 2IA0A 2R043 2WT2A 1T08B 1WJ5A 4FPEA 1OUXA 3PJYA 4BDYA 3HN3A 4C0BA 2W47A 2B7EA 1DQUA 2XPJA 5DUVA 2IEKA 3UGHA 4XDPA 4YVSC 4W1UA 1ETOA 2RE9A 3LOCA 5F3GA 2VUMJ 5CB7A 4IV3A 4JRAA 4CU9A 2KL4A 2P4EA 4META 2A3SA 4LK1F 2FF4A 1VE0A 1S0FA 5JSRA 1UKRA 1PK6A 1QEXA 4L0ZB 5FPBA 4HNUA 1AHSA 3QYBA 4ZHNA 4E2SA 4C91A 3LE0A 3P9CA 1MH4A 2EPFA 4CXXA 2D1HA 1HQLA 3CLQA 2JA8J 2JXAA 4IEWA 1QY4A 1RTVA 4MFDA 1QVUA 3IKVA 4OAYA 5JVTA 1VBE1 4D6RA 1WRJA 2CYYA 1I5ZA 4TXWA 1CIWA 2E60A 3AMQA 5ILVA 4KT6A 2DU0A 2V1DA 4KIBA 4MGSA 2EXIA 3WCSA 4E7JA 4KWUA 1MDMA 4Q1RA 1JKOC 3LDKA 1YFWA 3AYAA 5DDJ3 2I74A 3S1RJ 1FV3A 1J84A 3DTKA 2A69F 2EFQA 2DCZA 3PM1A 4NIGA 1QJU2 1YQ2A 4BXSV 4KNCA 3ZFFC 3T0BA 4PUSA 3C2BA 1FYUA 3OOUA 2Y0SN 5FROA 4WX9A 2WA0A 4MO3M 3KGZA 3ZYPA 1NK2P 2RDSA 1FIAA 1T33A 1TZOA 2VASA 2R7DA 5E1WA 2E7QA 1OC1A 2O8KA 1ULCA 1V5EA 4RL7A 1RZ4A 4LO4B 4LKEA 4Q0VA 1OHFA 1YJLA 5TSWA 4LTAA 4A3KJ 4IQJA 4FISA 4HPKB 2IVJA 3WINE 5A3UA 1PHMA 1H8TA 2X5IB 5KHGA 3L9FA 4XOGA 2PQQA 1J5YA 3VL9A 5FR3A 4A69C 2VMGA 1GHCA 4QAWA 4ZDLA 3PQKA 3SITA 3ACGA 3A03A 1CQ9A 1R082 4MXWA 2V4AA 3I4NJ 1SBEA 4XJAA 4YYOA 1C3HA 1BEV2 1CZSA 1Q5OA 1TQIA 3F8FA 2LF8A 4MQVA 1CVNA 1Y8RB 1Q1HA 1CX1A 5CLSA 4XLPF 1XC5A 1MR5A 1MD0A 1UY2A 4JGYC 2PAEA 2GXAA 4G6DA 2W5FA 4AQTA 2P6TA 1BC8C 3D82A 1A6QA 5LEJA 4M3CF 3UR3C 2A75A 5D8AB 3N9OA 3NNJA 4CEWB 4L5JA 3UKVA 5LHHA 1ETQA 1HLVA 5EGOB 5A32B 4DINB 2QZ3A 3KMHA 4UW3A 3F8CA 3U9GA 1E5SA 3O1TA 5GZGA 2M8GX 1JYTA 3H1WA 5C5TA 2W1UA 1J9IA 4FPFA 4YFNF 3MZ8A 3QPTA 1F2NA 4U87A 1MS9A 2A3WA 2RR13 1SFKA 2RDQA 2N8GA 2X85A 2Q8OA 4M0NA 4DUWA 2ZFWA 3Q9OA 5C8CC 1MKMA 2VTXA 1YLLA 2I07B 2BNNA 3FHQA 5D4RA 4RHV3 2FSWA 1XS9A 3K2OA 5ILSA 4E8CA 2QQOA 3P6BA 2L3DA 3OYEA 4JC1A 4PDWC 3V65A 2R5ZB 1J59A 4GCVA 3D0JA 3I3MA 3IDAA 4LBQB 5DS9A 2HEWF 1GXQA 3Q3SA 3CIHA 4JK1X 1FTTA 5B3SH 3POJA 3A1YA 4G94A 3ES4A 2VL4A 2JA6J 3O1MA 2X6OA 1I6HJ 2BU9A 3FM3A 3ZMSA 3PVNA 2QGUA 2V79A 1BJQA 3LSJA 1U12A 4XUPA 2KDZA 4HETA 3POWA 2ME0A 3ZMVA 4Q47A 3U10A 1U5ZA 3DF8A 4R79A 1NE4A 1XXNA 3WUDA 4IHXA 4LO6B 3F2ZA 1PUEE 4NNJA 4HK8A 1ND3A 2E2JJ 2D3RA 5AFEA 2W9XA 2OPKA 3NW4A 2CY6A 3WNMA 3JB4C 4LMYA 2DDBA 1T6GC 4IKFA 5LBBA 2Q2EA 1D7PM 2G9ZA 1C4RA 2DTRA 4XLFA 4G7HF 2KT0A 3S14J 4YNIA 1NCRA 1DG6A 2B9SA 2L9NA 3HPHA 4FTHA 4S04A 2HDDA 1O3TA 1OKOA 2ZJCA 1EAH3 4RBOA 1GR3A 1QNTA 1OQDA 2XOMA 2IUWA 2QDRA 1H2KA 5IVBA 1YIOA 3GALA 4M3GA 3H36A 4EM2A 1FMD3 2D5VA 3ZXLA 4MTDA 5FQ0A 2M7BA 1R49A 5E88A 4BM8A 2FBEA 2NMOA 4UAPA 4LLLA 3FXUA 5CVJA 1SLIA 2LM3A 2K86A 3ZMDA 2H0VA 4MXWB 2ZGOA 3AMHA 3NQHA 3OL3A 2M34A 4ZYGA 2NNNA 1MJ9A 2EILH 3BZ6A 2R062 4JCKA 1A36A 3I3EA 4YWAA 4HK9A 1WLCA 3CQOA 4TWTA 1L3JA 2HZTA 1RUOA 5FKNA 4YFZA 2ZACA 1AL22 2FCTA 4Q4W1 3H8XA 4DXRA 1AR71 4LBLA 5FXXA 2B7YA 3ORJA 2M1BA 2P6HA 3RQIA 1FPN1 3F9KA 4K2EA 1S7EA 4JKMA 2RR12 4ZZLA 2DOFA 3RIRA 2XJVA 1G7YA 5JI6A 3MKZA 1OA2A 1YRNB 3DPRC 1V55H 4MH0E 4D1QA 5IT6A 3UKGA 1XD7A 2O7OA 3AB0A 3GJBA 2ESNA 1HXS3 3HOTA 1MSEC 2I5UA 4NIDA 1MEC1 1UY0A 4CDXA 4BDVB 3KLNA 4DEQA 4KH9A 2Z79A 3GFLA 5LK5A 2I2SA 1O6UA 4PK4A 1VAVA 5CBLA 1DGRN 4XC9A 1Z7S2 1SFEA 3D4KA 3DP7A 4XVHA 2JE8A 4X6AJ 5LFAA 4QQPA 4GD4A 3GHMA 5FYHA 2E1NA 2L01A 2K9ZA 1Y0UA 4QGLA 1C57A 2EZHA 4JX4A 5C3SA 1S1AA 3F21A 1ZX5A 1AXKA 1G9FA 2VW2A 1HB4A 1MPXA 5JLWA 1C28A 3JCUC 5FLJA 1KS4A 3QH6A 4JGZA 3UGFA 5F2WA 3HTSB 4ARXA 1GP6A 2VZPA 5BNPB 2JT1A 2CGNA 2R072 1KYZA 4WM7B 3F72A 2FNAA 4GXLA 3CMYA 4ZS2A 3JD71 1SZBA 5FXWA 2WNVC 1AVBA 1NA1B 3ELNA 4ESBA 4W6XA 5I93A 3I4MJ 4PJLA 4YW5A 3N9PA 4CP1A 4COVA 2VJ4A 5FWJA 1IUFA 2Y2ZA 1KFUL 2BDRA 3W3CA 3TEWA 1QJFA 3M8EA 1JZ5A 3KHCA 3FMQA 1HSTA 1W8OA 2DTWA 2VZUA 2K40A 2JJ6A 5HNFA 1EV13 2C9AA 1YW8A 4A6DA 2FNPA 1NZCA 3GTMJ 4KFCA 4OULA 4XUOA 4LR4A 3K75B 5ICGA 5K5RA 1ZLJA 3UV9A 4LBKA 3WLUA 4AI0A 2OJED 2A6EF 1H9GA 2K7LA 3AXDA 1UY4A 1GNHA 3TN92 1FZPB 2JA5J 5CADA 5F0HA 3IWZA 4F52A 2RGVA 3VB2A 5D8AA 4NHYA 1IRZA 3SDBA 2CHHA 1K5MC 3I2KA 3CJXA 1LEAA 3N3HA 3NAPC 5FYMA 4G3YC 4KWJA 5DYMA 1V6LA 3A01B 3MLJA 3SKJE 2SLIA 2QQ8A 3CJNA 5DAXA 1O59A 1W36D 3MI8A 4XDQA 3IHUA 2HEVF 2XWJB 1BR4A 1YLFA 4A3EJ 2ARBA 5L3BA 4D7YA 2HWD2 3DPUA 4IO9F 3ZVXA 3SEZA 4RAFA 2D3SA 2DCYA 1FI2A 1SLLA 1MBFA 3MV11 4QWNA 1PGL1 4CYCA 1QHGA 2XUEA 4LKDA 5FK8A 1N75A 3ZP5A 5A7NA 2VQLA 1LU2A 5L9RA 3A4CA 5KC6A 1SACA 2BTVC 3VBHA 1DU0A 2DA3A 4ASMB 1AR93 3PNAA 4ZKTB 3G1OA 2DUPA 4CEYA 1LJ9A 2V5YA 5E3NA 3ZN6B 4YELA 1FSEA 2A70A 4M01A 3MIFA 1NXD1 3EETA 4JP0A 4BY7J 3LA2A 2HBUA 3SMHA 3W6KB 1K79A 4QB1A 1ENRA 1U5IA 5C9AC 4MSVA 4COUA 1X2NA 4A7KA 3RPQA 1FP1D 4Q4V1 5FLXK 3PIJA 2IAIA 4XONA 3SEEA 1NCQB 1BL0A 3O7OA 1RVF2 1SLTA 5LA9A 3R0JA 1OI6A 4Z2YA 4JGYA 4G7OF 3WNXA 4D7MA 4XABA 1COV2 5IVYA 3WHCA 1G4DA 2HVSA 4R9BA 5JSPA 3KLOA 2G19A 2CW7A 1LAJA 2E1OA 2BUKA 4BE0A 2E31A 4YFKF 4B7EA 1MMSA 3BGAA 3AJZA 3E7LA 5ICCA 4OIQF 3RZDJ 1ENQA 4DY5A 1ZLKA 5EJ1B 4K40A 1B6AA 1PZ8A 5LLQA 4IEVA 3ZYGA 3BLYA 4LXLA 1QHHD 4RGUA 4QIWN 3VHNA 3T0YA 3E3VA 3PUAA 5C8CA 4HKLA 1BMV2 3WQ1A 3NNFA 3BDDA 3AAFA 4MX3A 4MADA 5K5QA 1NQDA 2KR2A 5SV8A 4X0GA 2VE9A 5BPDA 2UUZA 5CFCA 4ESJA 4PF1A 3ZXGA 2D6NA 4EROA 3DKQA 2PJRB 5FYIA 4YIFA 3RQ0A 1FYLA 3ERMA 4L2NA 3HR9A 3RTRA 2KLOA 3WTTC 1S2BA 1DLCA 3NAPA 1U9OA 2YU9J 2R071 1Y7BA 2DMPA 4V1PA 5DZFA 4X8NA 4CPBA 1Z0HA 3R4SA 3UKTA 3EUHC 5J8FA 2RN7A 2WZPP 2GH2A 4A4AA 2VULA 4LFUA 4LKFA 3T0AA