4I01A

Structure of the mutant catabolite gen activator protein v140l
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
202
structure length
202
Chain Sequence
PQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDLTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Catabolite gene activator
publication title Modulation of global low-frequency motions underlies allosteric regulation: demonstration in CRP/FNR family transcription factors.
pubmed doi rcsb
source organism Escherichia coli
total genus 63
structure length 202
sequence length 202
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4i01A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4i01A01
3H50A 4JBAA 4M9SA 1Z91A 1X8EA 1R22A 1PP7U 4IRIA 4MGKE 3GO5A 2M5WA 2RC4A 3WTSC 2YR2A 3EYIA 1YO5C 2PHDA 1R36A 3WU1B 1KA8A 2PQQA 3HHGA 2XVCA 3I53A 4AIHA 1FC3A 2MC3A 3BOQA 2TDXA 4BHPA 4E70A 1B4AA 1LRHA 4MX3A 2C6YA 3EDPA 3UKVA 2EFWA 4YSFA 4HN1A 4TLFA 3QP5A 4G6DA 2L3DA 3CLOA 1C0WA 5C6CA 1FZPB 2HDCA 3OF1A 1TNTA 4HN0A 4RD7A 1GQHA 2RVCA 4JK1X 2G7HA 2JPCA 1KU3A 1FXZA 2XASA 3R6SA 4IRHA 4UV9A 2QCSB 3QAHA 4PZJA 1J3PA 3CEWA 3UKTA 5CVIA 1HKTA 3VODA 1XDSA 3HT1A 3RDIA 4IVNA 3KZYA 3O3KA 3F6VA 2K86A 3R61A 3IDBB 3VFZA 3KETA 4ZH4F 4CYDA 3F72A 5HS9A 4R52A 1TNSA 3LWCA 4H0EA 1H1IA 2IRFG 1B6AA 5FCCA 3HUGA 4L2NA 1U5TA 3JW4A 1G3SA 3OOPA 4OINF 1ZG1A 5FDBA 1MDMA 1U78A 5LEJA 1S8NA 2VPVA 2CQKA 3HQXA 2CW0F 5BPXA 1OYYA 3E5XA 1L0OC 3E6MA 2STWA 2F5CA 4ORFA 4ON0A 2E7WA 2DK8A 1UIJA 4UV8A 1R1TA 5BPDA 1YWKA 2HYFA 2Z9OA 3FE5A 3T1BA 4RS8A 2WWYA 4M73A 1WLTA 1MD0A 4A0ZA 2Z3YA 2VOPA 1UHMA 2LNBA 4A2UA 1RGSA 1IF1A 3VEPA 1FP1D 1YIOA 3WGHA 1B1BA 2IA1A 4RGXA 4HQMA 5H6RA 4IEUA 3GBFA 1REPC 3RYKA 4XF3A 2A3SA 3KP5A 2W25A 1O4TA 4XSZF 3R0JA 3S2WA 2ESNA 4AD9A 1X82A 1NHAA 2V1DA 1OI6A 2Q1ZB 1JXSA 5CVUA 3EQEA 2DW4A 1W7PD 4Q0PA 4IXAA 4IEOA 4QXKA 1YFUA 4RGRA 3LA3A 4U0WA 1J58A 3LAGA 4HVOA 3GYDA 1JUHA 4E2QA 3MZHA 3GXOA 1S6LA 5D5VB 3DV8A 5FFXA 1WGPA 1LVAA 1YG2A 1DZTA 2XLAA 3ETQA 3TDZC 1O7LA 1U8RA 2O0YA 2B9UA 2HTSA 3GFMA 1CAXA 3JAMZ 1J75A 2O8XA 1MKMA 1G3WA 1KQ0A 2GA1A 3ISPA 2FMYA 2A61A 5TJJA 4O3MA 3QACA 1V3FA 3K1PA 3ABUA 3LOIA 4G7HF 4MQVA 2F5EA 1O3QA 1I5ZA 3NVCA 1J0RA 3F8NA 4EROA 3HSRA 4LG0B 2V79A 3I5UA 3N97A 4ENKA 1FNNA 5LBQA 4Y13A 4IRGA 4A0XA 5ICCA 5LHGA 1F4KA 4IESA 4L9VA 4M74A 2PTMA 4JV4A 4LUMA 3FXRA 1Z7UA 3MYXA 4U7DA 1YLLA 1CAWB 1L3JA 4IEXA 3HHHA 1RTVA 4QGNA 4M6YA 3M1EA 2XL7A 2V1UA 1ZGAA 3NW4A 3F23A 2OPKA 4D0PA 4MV2A 3K69A 4XETA 1NE4A 1K6OA 3ELNA 4EWAA 4HX8A 4TV7A 4MGIE 3QPHA 2E9QA 5I8SA 3LSTA 2QNKA 2VODA 5JSOA 5FPZA 3TDUC 3WGIA 1H9TA 4YARA 3BPZA 2XLGA 4RAZA 3LAJA 4EWEA 2EFOA 3WW3A 2F5DA 3DKWA 3J80Z 4PIYA 1RUNA 2EA7A 4Q47A 3SHRA 4L5IA 1O57A 3D82A 4MEYF 1IRGA 2QBYB 2BBYA 3G73A 3SMHA 3K1MA 1IUYA 2GXGA 5FFZA 3KP3A 3TGNA 4IETA 3IDCB 2A6EF 2PI0A 1Z9CA 4IEVA 4GCVA 5AVPA 2EK5A 4EV0A 3O6BB 1ZN2A 2EFQA 5LEKA 1X8MA 3ES1A 3EBRA 1YS6A 1FBQA 3E6CC 1UPIA 2DAOA 3MDPA 4EJOA 4NQWA 4YIFA 4HAMA 1TQ5A 2UYAA 1EPZA 1T2KA 4ONUA 3TNQA 1U6GA 2D93A 4WF2A 1FYLA 3ZMDA 3CTAA 5CJ9A 2PAEA 4L0YB 1UIKA 3H8UA 1LR5A 4HLYA 5CVRA 3HIFA 3F8BA 3ACLA 2ZKLA 1JGSA 3GFLA 2Z33A 1UCXA 2K02A 2V9VA 4EGZA 3ZPLA 2PFBA 2ADUA 2D1VA 2ZJ2A 3FHIB 1NXMA 2BEOA 2IA0A 4U88A 2WC2A 3WE2A 2ET1A 1LQ1A 1ZRRA 1XCBA 1SAXA 2GH2A 5FLHA 1DGRA 1HSTA 4FX4A 4MNUA 1S29A 5CU1A 3GYHX 5FLIA 4ZYDA 3L2HA 4R8HA 4G6QA 4N0BA 2EA4A 2K9ZA 4J1XA 4HBLA 4KYWA 1E17A 2XGXA 5LGNA 1XGSA 1YS7A 2CO5A 4WXDA 2P5VA 1T39A 2L01A 1UD1A 3MFKA 4M9ZA 3RJPA 1YW9A 1DUXC 2BE5F 5K5RA 4I01A 4KL1A 3GFIA 4UVAA 2W24A 3FWEA 3REOA 2XHKA 1WRJA 2WV0A 1UW8A 5D4SA 2PN6A 5DDGA 4DQ2A 1P6RA 2M45A 4JQFA 1ZGJA 3WW1A 2Q0AA 1IXRC 5ILSA 2OU2A 2PQ8A 4UUVA 4ENMA 5HI0A 1ZX5A 3LZZA 2HKOA 4OFGA 1XGOA 1T98A 1QNTA 4KNYA 2PLYA 3H1YA 1IZ1A 3DEUA 5HLIA 4AVAA 5E8GA 3I58A 4WXHA 1W4MA 2PJPA 4S05A 4Q0UA 4G7ZF 2UYBA 2ZXJA 1IW7F 2RN7A 3TQNA 3IBMA 1YHFA 3V7RA 5AONA 2VC0A 2DU9A 1B9NA 4HSJA 1TBXA 4KU7A 3D5LA 2G9WA 2HOEA 3JAMK 3U9GA 4AWXB 1SFXA 3QOPA 1JE8A 2D5FA 4META 2FSWA 3VHRA 5LHHA 4L9NA 3HRMA 5DYMA 1IXSB 2ZCWA 2BNMA 3CO6C 4EJWA 3TOBA 2N7GA 1UHWA 4OLLA 4LK1F 5FLJA 4XFIA 2P5KA 1Z1DA 4N9IA 2E1CA 4QM9A 5BV6A 1SFNA 4GO1A 1EH6A 3FXQA 3RTRA 2QVOA 4ESBA 4ZZDA 3B73A 2GZWA 1YFYA 2W57A 4HDUA 3PLQA 2DK5A 2FNAA 2RNJA 5HDNA 4IEYA 3EQLF 1IN8A 3KP2A 3SFZA 2YU3A 4MTDA 2BV6A 3KMHA 2H27A 1U3EM 4XFCA 2D45A 2VBYA 1SMYF 4LLOA 4I2OA 2GC0A 5L3GA 3V7SA 4K2EA 3KSCA 3DPLC 5JFRA 1D8JA 1LKNA 3T8TA 2KIUA 1AWCA 3I0TA 3SHFA 1O7FA 3BZ6A 5KHHA 3U2RA 3O14A 5JI6A 2OBPA 4LLGF 3WTXC 1FBSA 3TO6A 3RIRA 3IC7A 3J80K 5J6XA 4HW0A 5J48A 1Z6RA 2LSOA 2PA7A 4AQ6A 4BIFA 3L7WA 1ODDA 2QENA 1ZZ8A 3IKVA 4LD5A 4XBFA 3ROUA 3WU0A 1F1ZA 5D5XB 2ESHA 4HF0A 1QY4A 4XF1A 2A07F 2IXLA 1PDNC 4Q5SF 3F22A 2XLFA 2HR3A 2ISZA 1V4RA 4M6XA 1T6SA 4DINB 1Y0UA 1PUEE 4YNIA 1EYBA 4P55A 4Q0QA 4FAGA 1XCVA 2NS0A 1TQMA 4MGYE 2H6BA 2F2EA 2DQLA 2A68F 4UVBA 2VBXA 1MJ9A 1LDKB 1G6NA 4JTNA 3E97A 3HSFA 2O8QA 3BY6A 1RNLA 2NAZA 2F4PA 2IXIA 5E1WA 3BDDA 5E1XA 2IC1A 3F8CA 3E5QA 5BMZA 1BIBA 3DQVC 1S7AA 1G3TA 2HZTA 2MBFA 4HQEA 5KVRA 4RB2C 1CF7B 4XF0A 3VOEA 1P4WA 4I0AA 2P7VB 2QWWA 4B29A 4LJZF 3I7DA 2EB7A 2B8MA 4RB3C 5DCMB 2OZ6A 3GX4X 1HW2A 2X4HA 2BNNA 5ICGA 4FAHA 3EYYA 4CHUA 3CL1A 3ZN1A 3GF2A 3ZMVA 1XE7A 2YX7A 1OYWA 4I09A 3T5XA 5DCFA 3SQNA 3FM3A 3E5UA 2MH2A 1R5HA 4GGGA 4YIIA 1J5YA 1BM9A 4G8XA 4WCGA 3GW2A 3F21A 5JVTA 4ENJA 2RGVA 1H0MA 4XF9A 1ZVFA 1Q5OA 3U10A 4R79A 1KU7A 2WFPA 1B59A 3KP6A 2G7UA 4HSLA 4UBHA 3ZN0A 2EV0A 5JHUA 2L54A 3SZTA 2GA2A 2IXJA 4XLNF 3FZVA 2HEOA 3F6OA 1K78A 3GVAA 2K4BA 3BB6A 3CUQB 2DTRA 2JSCA 3BP8A 4ZU7A 4G9YA 5CYVA 2XUBA 4AIJA 3IKTA 2O61A 2PMUA 4UHTA 1K79A 1RUOA 4WZCA 4BHBA 1ZAOA 2C0ZA 4P9GA 2P8TA 1R23A 1RL3A 3FZ3A 3JTGA 4KN4X 2DPUA 5FD6A 2OA4A 4ZYEA 4BHCA 3OGJA 2ZFWA 2Q0OA 3QU3A 4ESJA 3ZMTA 4BXUA 1W7PB 1WSUA 1NZCA 1GXPA 4IEPA 1DP7P 4EJTA 3L00A 1ZZBA 2EFPA 1OPCA 4HX7A 5DD8A 2IJLA 3C3WA 1O5UA 1D8KA 2V6CA 3WTZA 5FLXZ 2L4AA 2XV4S 4HLXA 1Q1HA 2L4MA 3I59B 1CAVB 4KMFA 2Q30A 2R7FA 1J7KA 3RZZA 4P9FA 3K2ZA 1R5GA 4L18B 4XF4A 1FT9A 2KKOA 3CF6E 2ZMEB 1HW1A 3J81Z 4Q0VA 4X6RB 3EHKA 1FPQA 2DT5A 4QWQA 1RC6A 3RYRA 3P9CA 3FMSA 4CGZA 4F8AA 2O3FA 4P9UA 5I8TA 3HRTA 5LRSA 2XAHA 1GXQA 3I4PA 1W5SA 3DPTA 4M71A 5FPXA 2XROA 2QQAA 1SD6A 4UBGA 1SFUA 2COMA 4EM0B 4ETSA 2NNYA 1XE8A 2EJRA 2OZUA 3LA7A 1U2WA 1QWRA 1RIOH 4KUMA 1IAWA 4KWLA 4PGHA 3ZMZA 1QXRA 3M70A 5J8FA 4LEJA 4A5MA 4A6EA 1ZG3A 1EY2A 1SMTA 1U12A 4AXOA 4WK8F 1CF7A 1XGNA 3I71A 1BI0A 3FHZA 3WTTC 3SCHA 1TLHB 3KGZA 1LB2A 1I27A 3ECHA 3HOTA 2M87A 3M8EA 5HOOA 1Q3EA 2OQRA 4WX9A 4OIPF 4ZZLA 4P96A 2STTA 1HXDA 3IRRA 4OMYA 5BY5A 4U7BA 3LWFA 2W84A 1P92A 1A04A 2RDPA 2H6CA 3BJAA 3RI4A 2HFHA 1WWXA 4G94A 1OFNA 2ZKZA 3PQJA 4N9HA 5K1YA 3CLPA 2DFIA 5EEGA 5D8KB 5CADA 3GFJA 4HMZA 2P7CB 3EETA 1XB4A 4BH9A 4O9EA 3SCGA 4EM2A 1GVJA 1UCRA 1YTYA 2JTVA 4PIZA 2XIGA 2YPRA 5JR3A 4KFCA 5ED4A 4A5NA 4ASNA 1I6XA 4CXFA 4XLPF 4GULA 4FHTA 1TTYA 5BOXA 4IHTA 4R1HA 4UNOA 2MLGA 2DQRA 3OCPA 2MLKA 5D6FA 4NVPA 3CO2A 5FD5A 1LEBA 4WVZA 1J1LA 3IIAA 4CO8A 4XRFA 4IEZA 4KMUX 1SQ4A 2A5YB 4LTAA 5FGMA 3HYIA 2H94A 4GXOA 1R1UA 1KU2A 4NB5A 1Y3TA 4OOIA 1LDJA 5J7MA 3RNSA 4LLNA 5LGTA 4RGUA 1ZRFA 3ZDSA 2FBKA 3WGGA 3UKNA 4I02A 3WTUC 2LKPA 3WW4A 2ELHA 4RB1A 2QUFA 1ONVA 2DPDA 2FU4A 4GYIA 1XSDA 3PVBB 1NYWA 3HRUA 3CDHA 1BOAA 4L11A 1S7OA 4BAYA 2Y0OA 4FX0A 3M3IA 4KWKA 5J3UA 1KYWA 1XMAA 2XAQA 3DXJF 5I93A 4OMZA 2PYTA 3KFWX 2VBZA 2EV6A 4LFUA 4ESFA 5EZWA 2Z5UA 4LG0A 2MD5A 2PAKA 3TO7A 1QZZA 3TKYA 2QLZA 3LQQA 5LLQA 3SCFA 3WTVC 2FNPA 2IPQX 3PFIA 3Q9SA 3IL2A 4L0ZB 3CUQC 5HLGA 2UZKA 2K27A 2D2WA 1I1GA 4WXCA 5ICEA 4XFFA 4YFKF 3KE2A 5BXXA 3JSPA 1CAWA 1FX7A 2ZNZA 4LULA 1WI9A 4X6QB 3MZYA 5I0SA 2EFNA 1ZHFA 4KICA 2YSRA 1Z6TA 3BJOA 3JTHA 1I1SA 4EQQA 5JR7B 4M72A 2GXBA 3V8KA 3DFGA 1FP2A 1KQ9A 1CX4A 2DI3A 2IP2A 1UFMA 3H3UA 2NNNA 1EH7A 1EP0A 4I0BA 1BN5A 4O6JA 3E6BA 4YG2F 1FOKA 5DUKA 2UY8A 2QZ8A 1VR3A 4EGYA 1ZZ9A 2GAUA 3V7CA 1U5TB 4XSXF 2A6HF 4Q29A 2VT3A 1MDMB 3N4MA 1FY7A 5L3FA 3U11A 5CVJA 4HDVA 4YFXF 2FOKA 5E20A 2M1BA 1R58A 1FI2A 2IA2A 5C8WA 2ZNYA 3BROA 1ZYRF 2QBYA 3NJZA 2ISYA 4XFHA 1ULYA 1QQIA 3L09A 2QJVA 3CJNA 3RPUA 3M7GA 1SFEA 3ML6A 1J9IA 2O03A 4Z82A 3V8JA 1XN7A 5HS7A 5BQTA 1QPMA 5H6QA 1Z05A 2JRTA 4OIQF 4EWDA 3GZ6A 4RGSA 5FLXK 2P17A 5L3DA 1YUDA 1JHHA 1HKQA 2B0LA 4KDPA 3TO9A 3JZVA 2AXLA 2XKOA 4KT5C 2VE9A 4HOBA 2HYGD 2IT0A 4AVBA 2GWRA 1GHCA 5F1RA 3ZMUA 1CGPA 4I3PA 2J5PA 2GC3A 4MGRA 3J81K 3KEQA 1D5VA 2FBHA 1BIAA 5T3NA 5KHGA 1KU9A 3BPXA 4KA4A 3CJXA 4XFGA 1OYIA 3ABTA 2XL9A 3I54A 1CAUB 4BYYA 2HWVA 2D5HA 2VE8A 5HVQC 4NHJA 3NL1A 2FEZA 2VC1A 4MQ9F 1P4XA 1JHFA 1NE6A 1DDNA 1HQCA 4HF2A 4KWJA 4MTEA 2AS5F 2GC2A 3T8RA 3KP7A 4D7SA 2E7XA 1TQPA 4E2GA 5HDGA 2KXLA 1IN7A 2B5HA 1HKSA 4WBBA 1MJBA 1J59A 1CAXB 2HGCA 2PFWA 2BNOA 5E17F 2FF4A 5BS6A 1ZLJA 1TQIA 5A2QZ 1HSJA 4XEZA 4LB6B 2Z69A 1TW3A 1ZNPA 2QQBA 1MJAA 1H1MA 2OYZA 3QRFF 2FE3A 3ES4A 4CICA 2E1NA 2KIFA 3U1DA 4YRDA 2UY9A 3K9TA 1XGMA 2QM3A 1Q43A 5JSPA 1FYKA 3FFQA 1QZYA 1O5LA 4QM8A 4IEWA 2DBBA 3MCZA 2ACJA 1XRUA 4MH0E 3S7EA 1MGTA 5H20A 1EH8A 2UWMA 2V1XA 3IWFA 4ZU4A 2DLLA 2XAJA 3HTSB 4LA2A 2YX4A 3ULQB 1O3SA 2XAGA 3WTYC 5K5OA 1WKMA 4XFBA 2FQPA 1KYZA 2RKHA 2J5OA 4DNCA 5AIPA 2QDRA 2H0VA 2DO7A 4QGLA 3S0MA 1WQ2A 4KU8A 5CVVA 3GZ5A 4HYEA 3U0ZA 2NRAC 4MGZE 4A6DA 3ZQ7A 3NKTA 4Z2YA 2CAUA 1BBYA 3SXYA 3FMQA 5D5WB 1VJ2A 3H92A 3WODF 3NSTA 3BU7A 3K0LA 1T38A 3F8MA 3BCWA 1D3YA 1RZ4A 1J3QA 2EWNA 1XD7A 1SD7A 2JZYA 3F3XA 3DP7A 3PQKA 3R60A 3SXWA 3LAPA 3R4KA 5IT9Z 1YW8A 1Y9QA 4PJYA 1F9NA 2QVSB 3WE3A 5BUVA 2OD5A 4LA3A 2FBIA 4Q4ZF 3Q9VA 4XFAA 2D1HA 4LGWA 4QMAA 3TNPB 3G7DA 5HLHA 2HS5A 2XRNA 4U0VA 3RKYA 2LF8A 4UVCA 4ENNA 3D0JA 3V8LA 3RPQA 2VT2A 3F8FA 1OKRA 2OA2A 1J3RA 3C7JA 3MWMA 2IXKA 5CLSA 2EAAA 1YFWA 3OV8A 5LRRA 3W6KB 3I64A 1DPUA 1CAUA 3COAC 2MHFA 3RKXA 3WTWC 3GUDA 2MPFA 2IXCA 4FBFA 5ILVA 1X3UA 2A69F 5E16A 4S04A 2XKPA 3H3ZA 1U5TC 2Z99A 3IHUA 1XDUA 4G7OF 4A12A 4Q48A 1SD5A 4ZU5A 1IN4A 3WW2A 1FSEA 1IRFA 2CG4A 3BWGA 2LF7A 5JSRA 4I98B 5I91A 3BALA 4MZUA 1HBXG 1S3JA 1ZREA 5I0UA 4E2SA 5HS8A 2VONA 1XMKA 1BC8C 3QPTA 3QP6A 2VECA 2CSOA 2W85A 5F6FA 4UXAA 2IXHA 2Y0MA 4AQ2A 2P4WA 2GQQA 3IWZA 5E1RA 1LJ9A 4UXNA 5FO5A 1OMIA 3LQRA 5E8IA 3H9AA 2R7DA 4B8XA 5J8CA 1YW7A 2ATFA 4PIXA 1OD5A 3M8FA 3ZP5A 1SEFA 1HW5A 4BQAA 3E3VA 1PMIA 5KHIA 3NRVA 1EV7A 4KIGA 3FJSA 2PEXA 3M9AA 3VB2A 1QO0D 4A0YA 4MUVA 3EUHA 2F5FA 3RYPA 4HV6A 4IJAA 5E1ZB 3GEZA 3OD0A 4EM1A 2FXAA 6PAXA 3ECOA 3FF5A 3ZMSA 5KHJA 2QYOA 1BI2A 1R1VA 1IPKA 2ZBKA 1VTNC 4Q0SA 4O5VA 1ZLKA 2P6SA 4F7ZA 3LA2A 5EFUA 1B9MA 1FSHA 2PG4A 4YYOA 2R3SA 5HDKA 2QQ9A 4J1WA 1ZRDA 1UB9A 3DL3A 3OTFA 3J7AO 5DUIA 1LNWA 1BI3A 3MQ0A 3CUOA 1TW2A 5F64A 4Z07A 2VN2A 4CDGA 5LGUA 5D4RA 5JCTA 5DCMA 2GU9A 3DF8A 2OZJA 1ON1A 4Y17A 4JVAA 4PDKA 1USSA 4O9GA 3FX3A 1YFXA 2XAFA 4IPAA 2P6TA 4HV5A 1P4AA 2EV5A 3BPVA 5E18F 2CGPA 5AIQA 2Q2EA 5A2QK 4BNCA 2D40A 4MEXF 4HZFA 3DN7A 5FQ0B 5L3BA 1PP8F 2V09A 2K7LA 4PCQA 3SZPA 1XSVA 3K1NA 5EEHA 4EJVA 2KJCA 5DEQA 3FXUA 1R00A 5D5UB 4AIKA 2UXXA 2EVXA 2UXNA 3KGLA 3KLOA 3KEOA 1MZBA 1QBJA 1XSXA 1YQAA 3P9IA 3MAJA 4YFNF 1ZZ7A 2CYYA 3Q5FA 3CUQA 2PBIA 1G4DA 2H09A 3L2CA 5D8LB 3EO6A 3USSA 2ZO4A 4LK0F 5ILUA 3C1DA 4LLLA 2M8EA 3KZZA 4L5JA 4IERA 4L9JA 4B09A 4HA8A 5KBFA 5I0TA 3C3VA 5IT3A 4AVCA 1LDDA 2CFXA 2KJBA 3HSEA 3H7YA 4HVRA 1FWZA 1J2XA 1IXCA 1G3YA 4HVQA 4KIBA 3D0SA 4P5OA 1ZG5A 1W5TA 4OU0A 2HJIA 2LDUA 2DCTA 1W7PA 5DV5A 3ERED 1ZARA 2FMLA 4QX5A 2OQGA 3R0AA 4KIFA 1BC7C 5ICFA 3MEXA 3LFKA 3FM5A 4WWCA 5IT9K 2CV6A 3MPBA 4MHGA 3H7JA 2I45A 3P7NA 2M30A 5K8SA 5I8YA 2MH9A 3I59A 1DZRA 1CAVA 2Y75A 2OAZA 4HF1A 3KCCA 1IPJA 2EA2A 2ETEA 3HOSA 5D6EA 2Z2SB 3ST7A 1O3RA 2ZMEA 4M9XA 1IN6A 3H1WA 4HBNA 5I0RA 5ERIA 2FRHA 1V70A 1ON2A 4L9TA 1R7JA 1ZRCA 3G3ZA 3JSOA 2Y48A 3O2PE 3ELKA 2GC1A 4LUKA 1QXJA 3AAFA 2IVMA 4Y15A 2CAVA 2BYVE 1O3TA 3KLNA 2Q8KA 5TRDA 2HKXA 1KQ8A 1PM7A 4IF4A 4PGGA 3P9KA 2VBWA 5DD4A 4K8FA 4KN7X 4LMYA 1OR7A 1RI7A 1ZZCA 4H7LA 1DPRA 4CZZA 2O6GE 2RQPA 3HRSA 1KGSA 4HX4A 1USTA 1BJAA 1YYVA 2JPBA 3C18A 2JT1A 2NYXA 2WTEA 4D7TA 4OIRF 2X0LA 2K0GA 4QGMA 5BPIA 2L02A 2VQAA 1LEAA 5D1IA 2ET7A 4EMSA 3S7IA 5L3EA 4FT8A 4AVPA 1FLIA 5FB2A 3GWZA 3CO7C 5KK1A 2VOOA 1VP6A 3E6DA 1IN5A 1T0FA 1E2XA 1L3LA 4IEQA 3QU6A 4IHSA 2KIMA 3GLXA 3NEUA 1SD4A 1K7AA 2O1QA 2MNGA 1X7NA 3PNAA 1ZH5A 5FQ0A 5L3CA 2KRFA 1GQGA 3IRQA 1AOYA 4QLCU 4EJUA 1DGWA 2FA5A 4ZYHA 5K5QA 2P5LC 2HQRA 3BJ6A 2FQ3A 2PHLA 1ZZ6A 1H9GA 3HTUA 2PAMA 1P2FA 2HTJA 2HQNA 3H1MA 1BI1A 5KHKA 4I7HA 4GYGA 3KP4A 1FBUA 4RB0A 1YFHA 3TOAA 2PMHA 2MA3A 2ETHA 1QGPA 3EJKA 3RKWA 1YLFA 3NQOA 4U0YA 3WG9A 1FYMA 3V4GA 2BGCA 4JTOA 2VXZA 3B02A 3HT2A 2RV8A 1K78B 4LB5A 3FMRA 5JAXA 4ZYGA 5LHIA 1F5TA 4RAYA 1WA4A 2IW5A 4OIOF 2Q4SA 2K4JA 2GIVA 3L9FA 4HLTA 4EVIA 1STZA 2CWEA 3T0YA 3W6JB
chains in the Genus database with same CATH superfamily
1Z91A 3ZMOA 2YXSA 5KHDA 2ZGLA 2M5WA 1LOGA 2RC4A 4BDZA 2YC2A 4QX7A 2PHDA 2L5QA 1R36A 4ZS3A 5FPVA 3HBLA 1KA8A 4COVA 4RQPA 5F27A 2PQQA 2XBO3 2FZ2A 1Z3XA 4DYRA 1QIQA 2ZGQA 2NS8A 1VRH3 1AYN2 1PZ9A 4Q1RA 3ZFFA 1LRHA 2FDKA 3SNMA 3OYMA 3C7GA 5ABJB 2C6YA 3EDPA 1Z78A 5CNAA 5JLWA 5JXGA 3V0AB 4TLFA 2VNVA 3CLOA 4BJTA 1OJLA 2HDCA 1FMD2 3DXTA 4GWMA 2ZHLA 2RVCA 2VVDA 1FXZA 1MBEA 1TL8A 2XASA 3R6SA 4JGZB 3QAHA 5CEHA 1RINA 3HOZJ 4XMAA 1HKTA 1MVQA 2EZLA 5EF6A 1PIV3 1OPMA 4IVNA 3LEIA 4R9AA 2ID4A 3R61A 5EYRA 4YGDA 4FXGB 4TN7A 1RUI1 4LBQD 1U9NA 3A4UA 4R52A 2WZR2 4XLCA 1LAJA 2IRFG 2JA8J 2E26A 3AMHA 4UY8I 1W6MB 5JHFA 3OOPA 1V9U2 4XW3A 2IBDA 5FK7A 4FASD 2VPVA 2CW0F 3E6MA 3OYCA 4ORFA 5IVJA 2E33A 1YE9A 4FP3A 1K42A 4LKSA 1IG3A 4UV8A 4WM7A 1R1TA 4UB8C 5BPDA 2HYFA 1UU4A 2GSYA 4RS8A 4BY1J 2WWYA 5E3NA 2GALA 1MD0A 4A0ZA 1X33A 3WX5A 1VBA1 2VOPA 3B01A 4JQTA 1UHMA 2RNGA 2V4VA 3VEPA 4A3IJ 1FP1D 4XKCA 1YIOA 3VL9A 1DU0A 2LY1A 1DZQA 2W0XA 2ME6A 3TMOA 3VBUA 1RUC2 3O1OA 5DZEA 5AFBA 3KP5A 2FQ4A 4L9BA 4XACA 4MO7A 2R043 4PK4A 5DM7F 1N78A 1NHAA 1JXSA 1SBDA 1W7PD 2X5IB 2VVFA 3CCMI 1MBKA 4Q0PA 2CWMA 3APBA 1BL0A 1JKRC 2HPMA 4BXFA 3AZZA 3LAGA 3GYDA 1B8IB 1S6LA 3VYTB 2CV0A 2W82A 5LFAA 5FFXA 4AGRA 1YG2A 5SV8A 3TDZC 4D1QA 2Z4FA 1U5IA 1BW5A 5FBJA 4IO9F 4S0HB 1CAXA 1W2UA 1YEWA 1MMDA 3JAMZ 2ZEWA 3HGYA 2XONA 2O8XA 4MADA 5C4WB 4KGGA 3NNFA 4NROA 3AK0A 3LEGA 5BNOA 4FTEA 5TJJA 3ALQA 4YLZA 1V3FA 3V64A 2D44A 1ETYA 4IV3B 3K3NA 5FZDA 1I5ZA 3BPSA 1B09A 4UFHA 1JUMA 3THCA 3O12A 3R0RA 3I3MA 5EYXA 2I07B 4ENKA 3FBNB 3LEKA 4IRGA 4A0XA 1EJ9A 2J1TA 3K4KA 2IEKA 1MVEA 3J7YJ 3RI8A 2EZKA 3RRDA 5DUUA 3RZGA 3BCBA 2JA2A 1I1EA 4JV4A 4UUSA 4LUMA 2WLPA 1Z7UA 1DGLA 5CB7A 1YLLA 1L3JA 1FMVA 4M6YA 4CEWA 3M1EA 3T4VA 4II3A 3RS6A 3KD4A 4HANA 3CCYA 3K69A 1NE4A 5FWEA 1TMF1 4HX8A 4TV7A 5FZKA 3LSTA 5JSOA 2ERFA 4OMCA 4OQ9A 1E5IA 3BGAA 4RYDA 4IUGA 2KRCA 4EWEA 2F5DA 3ZQCA 1SEUA 3N7MA 3JCUC 5F5QA 1ZRIA 1O57A 4WM8A 4MEYF 2BOIA 3MF6A 4B3AA 2BBYA 3K1MA 5GLUA 4ITCA 4B3NA 2QSFX 1AL21 4IETA 3IDCB 2ELJA 2AUYA 4KMQA 1ITYA 1DYKA 3RWNA 1YJKA 5AVPA 1MIJA 4XJAA 4EV0A 2AEZA 2AREA 2EFQA 3LFUA 3LIGA 3N9MA 5H9PA 2JG9C 1ERDA 1YI9A 1R49A 1FBQA 3MDPA 3VHOA 4HAMA 1TQ5A 1EPZA 2VOVA 3KB5A 2QGUA 1FYLA 5IVBA 3ILRA 1G7YA 1COV1 3CTAA 2F4IA 1UIKA 1DQ1A 3OYIA 3T30A 3K10A 4A44A 4IQ4A 4HLYA 4FTBA 3O0WA 2IS1A 2OF7A 3ACLA 3B3QE 1V00A 1XPWA 4I3GA 3GFLA 2Z33A 1UCXA 3NJVA 2D6NA 4C1XA 3VDAA 3GTPJ 4RGAA 2BP6A 3RWKX 1R5ID 1VBB2 3OYWB 2BOJA 2ZJ2A 4JC1A 3H42B 5GTIC 4RMNA 1PIV2 3IPVB 1OCZH 5JLXA 2E1OA 2J42A 3CJRB 3KZ4C 3K70C 2ET1A 3A0HC 2BGPA 4EZHA 4GWJA 2R1DA 1UY4A 1DGRA 1HSTA 2K9SA 4MNUA 4MGSA 5CU1A 3GYHX 4Y1VA 1R091 2K9ZA 4QX3A 3C7FA 1XGSA 4LOSA 4WXDA 5FMCA 2I74A 4AAXA 3MFKA 4AFMA 5C3QA 4M9ZA 1W0OA 4JKKA 4C1WA 5LA0A 3JRDA 4GWIA 1XNCA 2A6XA 1QU0A 1OH4A 4KL1A 5FUPA 4UVAA 3U07A 3OBAA 1WLCA 4NIIA 1AZDA 3HWJA 2XXZA 5D4SA 2ZZQA 1AR72 2DYCA 5A3NA 1Y1WJ 2DMNA 4JQFA 1ZGJA 1AR83 4JDOA 4YWAA 2XGCA 3WW1A 2OU2A 2PQ8A 1XBFA 5HI0A 4OFGA 3TRSB 3JREA 1QNTA 1SFYA 1W9WA 5GP9A 1H2NA 5HLIA 4G12A 5CZKA 2IXSA 3WOGA 2PJPA 4S05A 1LULA 1S0IA 3NAUA 2R7EB 2UYBA 2ZXJA 1IW7F 1VQ7I 3TQNA 2VC0A 1OCOH 3KV9A 5HNFA 4KU7A 4UW3A 5FKMA 4YW3A 2G9WA 1QA6A 2EBIA 4LIUA 4DZJA 2D5VA 2L9SA 3JAMK 1UU6A 5F32A 2FSWA 3H0OA 3AP9A 3U4SA 4BJ6C 2ZHKA 3ZQGA 5JMCA 3B9CA 3KYDB 3HGGA 2I5UA 4OAZA 2ZCWA 2FMDA 2BNMA 2N7GA 1UHWA 4HPKB 1L7RA 4A3MJ 4C2TA 1ZBE3 1SFNA 1OVPA 3FXQA 3BTYA 2HVQA 3MZ8A 2LREA 4BUPA 2DK5A 3PLQA 3ZIXA 4IEYA 1FOD1 1UZZA 3K2AA 4XUTA 3UGHA 3PUFA 2LD5A 3NV4A 4W6XA 4MFEA 3KMHA 3RMXA 2VBYA 4MO3M 2ZJCA 4M0NA 3QODA 3ZXDA 2EIBA 5L3GA 3BOPA 4DO0A 5JFRA 1D8JA 5KXCA 1LKNA 3T8TA 1Y56A 1K5JA 1Q1VA 4FCYA 3BZ6A 4CUBA 1QQP1 3ZSLA 3ZPOA 3IH3A 4LKEA 1WJ5A 3ZQIA 2OW4A 5KC6A 3AG3H 2OUJA 2X09A 2YYOA 3IC7A 3BIWE 3GJBA 1IJWC 2QQKA 5J6XA 5J48A 3FBIB 2WDBA 1POV3 1Z6RA 3PIGA 4Y22A 5F8PA 1RB8G 1X1PA 1FV2A 3ZPYA 1TNFA 2E60A 3L7WA 2P3KA 4K9SA 5F3EA 3ROUA 2X85A 1W6OB 2XVKA 2WLQA 2A07F 4XF1A 1PDNC 5DDJ3 1BEV3 3F22A 1V4RA 3K2OA 1T6SA 3T4HB 3MIFA 5KXEA 1JOBA 1PUEE 3MUY1 3TL4X 4NAOA 4P55A 3CU7A 2NS0A 4XLAA 3CP8A 4MGYE 2H6BA 1UN1A 2F2EA 1BK0A 3N9QA 3KQRA 1LDKB 1G6NA 2YFUA 1XC5A 1XTAA 3OEBA 3HSFA 3J4UH 1RNLA 1O4ZA 2RS32 5E1WA 1J84A 5E1XA 2IC1A 1VBC3 4Q4Y3 2DVBA 2E5NA 3FLTA 2R071 4CTEA 3WCRA 1KJLA 2AQFA 1UAAA 4WVMA 2ORXA 4UI9L 4RB2C 1RVF1 1DP3A 3ZXJA 4B8EA 2P7VB 2QWWA 4XRSA 4D69A 3NJXA 2VBPA 1NLRA 2B8MA 2F4LA 3VHNA 2VMCA 2OZ6A 4K8RB 3BC8A 4S2GA 5ICGA 4GKYA 2JG8C 4LBQB 1Y39A 4BQOA 3EYYA 4CHUA 5A3TA 5EZHA 3KYCB 4Q27A 5LBFA 1C8M3 1H8VA 3VYSB 2VQ0A 3ZMVA 2CNAA 2XMLA 2NQYA 4NIDA 4I09A 5JIUA 2WAQA 1V5FA 4ZYAA 1UELB 3PJQA 4OHVA 1J5YA 1BM9A 3GW2A 5DABA 3ZLIA 4XF9A 1K4SA 1DYPA 4B48A 2Y8KA 2WFPA 4GB31 2G7UA 4HSLA 2K5CA 1RUI2 3WP4A 2L54A 4XLEA 4ARYA 5FZCA 1TT5B 5F39A 3HOUJ 5DS9A 4F55A 4X6AJ 3J26N 1AR91 3AYAA 3SLIA 2V9PA 2JSCA 4ZU7A 4G9YA 2XOMA 4C2UA 4AIJA 1S0BA 2O61A 3NO8A 5GLWA 3OGGA 4BHBA 2C0ZA 3BG6A 2JD4A 4DJAA 1R23A 1ACCA 2VZQA 5LZ6A 3BCAA 3F9KA 2DPUA 2HVSA 2OA4A 2NXNB 4BHCA 1DGRN 3OGJA 2ZFWA 2PHTA 3VBHA 4G9SB 3FK6A 1A36A 1W7PB 3UKGA 4IEPA 3K7AJ 2HOAA 1VBA2 2OIIA 1BVVA 4JOMA 2IJLA 1JKPC 1O5UA 2A3XA 3GHNA 2X48A 1H8TA 3ZFGC 2V6CA 4CCOA 4TYSA 5FLXZ 2L4AA 1X3WB 2E51A 3M2MA 2YS9A 5E88A 2JKBA 4A42A 2Y26A 4AGGA 1R5GA 2VUDA 3AC0A 2AH2A 1HW1A 4Q0VA 4X6RB 4ARXA 5FZ7A 4F8AA 4QHBA 3CMYA 2O3FA 5FKKA 4P9UA 1VQ4I 4HOOA 4AC0A 1TWHJ 1GXQA 1W5SA 4FQZA 3K4MA 1VQMI 5FPXA 2XROA 2X05A 3PNYA 2COMA 4HG2A 4FFHA 2NNYA 2RM23 1GV2A 2WB1A 3LA7A 1QWRA 3VKNA 2YY1A 1CZSA 2YB7A 4D8MA 3HC7A 5IK5A 3NNGA 4RFT0 4WK8F 2XB6C 1CF7A 1XGNA 3FHZA 4CCCA 5BNNC 2WBMA 4UWDA 5FKOA 5HOOA 1MBGA 2C4XA 2DTZA 4P96A 4QPYA 1HXDA 3IRRA 2JK3A 3BG5A 3OYDA 2RDPA 3T2QA 4MXWB 1WWXA 3VDDC 3P3NA 3PQJA 4N9HA 4Y20B 4FE4A 5K1YA 4DXSA 1JOJA 3EYPA 1ASJ1 2AACA 3PSFA 2DFIA 4Y3OA 1PZ8A 2LS6A 4M0HA 1GNZA 2RG4A 1CJDA 4BH9A 4O9EA 2HQ5A 1TME3 3OIQA 5A7SA 4A5NA 3CCUI 3Q8AA 4GULA 5IK8A 1NK2P 1TTYA 5BOXA 1RUG1 1H4GA 2MLGA 3OCPA 3QH6A 1H4HA 1I3HA 1HRI1 3POEA 4XRFA 1RPWA 4H55A 4H2AA 4LTAA 3PSIA 4R9CA 4CE8A 1F8VA 4XDPA 4CXYA 2IFWA 4HL0A 3WG3A 2FZ1A 1H88C 1KU2A 3O1PA 1H0BA 2R041 2LROA 5J7MA 3RNSA 3S1RJ 5LGTA 1TEIA 5IWFA 4BLIA 1ZRFA 1W3VA 2FBKA 3WGGA 3RCOA 4JKMA 1AL0G 2QUFA 3PVBB 1PHMA 3CDHA 4NHMA 4BAYA 3VBOC 4FX0A 1F5JA 1AL22 1XMAA 5FZ0A 4B4RA 1WWYA 4LFUA 5LASA 2L9VA 2Z5UA 3A23A 3WF1A 3TO7A 2AZ5A 5J40A 4XBQA 1QZZA 1XNDA 5CKNA 3LQQA 3DYPA 2EF6A 5DN2A 1COV2 1EAH3 3PFIA 4L0ZB 2UZKA 1K5MB 1IGNA 1DGRM 3KE2A 5C7GA 3AYEA 2X1DA 2B63J 1FX7A 4X6QB 3MZYA 3UT0A 2EFNA 4KICA 2R5YA 3ORJA 3JTHA 4ZDOA 3BI3A 5JR7B 3LD8A 1CONA 3VB9A 4FO9A 3V8KA 2HWC3 4BM8A 1OOPC 3GCMA 2JA7J 2YPJA 1KQ9A 1CX4A 1SHWB 2DI3A 1UFMA 3GF6A 3IAQA 1EP0A 5DAQA 4M01A 4O6JA 4YG2F 2BU9A 3BR1A 1VR3A 1UZVA 2C6SA 3HUGB 1ZZ9A 3V7CA 1DQ2A 1U5TB 4XSXF 3AXEA 3OD4A 4OVEA 1R092 4ASKA 1R1ZA 4CP9B 2VQGA 3USUA 4ES9A 4Q4X3 2FOKA 2M1BA 1R58A 1FI2A 4XTPA 3LSGA 1DG6A 2QBYA 1YO8A 1PGL1 4XUQA 2WAQN 4XFHA 4ASLA 2QJVA 3CJNA 2O03A 3J8F1 3V8JA 1BW6A 4EWDA 2ZMEC 3ZFEA 5FLXK 2P17A 3ZFGB 1NKGA 1HKQA 3RGBA 4KDPA 5EYYA 2XKOA 4DS0A 4HOBA 2HYGD 1WJDA 3E1SA 2WAEA 5C5UA 1MQTC 1CGPA 2HNHA 3CJIA 4MGRA 5JXIA 2BBAA 3M8JA 3TN93 1D5VA 4UF0A 2FBHA 1UOBA 4A3ZA 3OBRA 1W0TA 5IJRA 1MS0A 5IAXA 4XQFA 4XFGA 2W52A 2AHQA 1MACA 4OI2A 2XF7A 5JDBA 2VE8A 5KXBA 1W8UA 5LATA 1ACIA 4J6GA 3ZN6A 1W9SA 1P4XA 1JHFA 2IGOA 4GDFA 1DDNA 4NO4A 1HQCA 4CDWA 4HF2A 2D3RA 5B2GB 3AMQA 1LE8B 1A6CA 3UETA 3ACGA 3KP7A 3NAPA 4D7SA 2E7XA 3J7AY 1U5ZA 2WNOA 2YBSA 5HDGA 1JMUB 1RUJ1 2QQWA 4CDXC 5HCAA 1V6NA 5BNNB 5A3LA 2QUOA 4QPIB 3HN3A 1OXCA 3CQOA 5A2QZ 1N3PA 2Z69A 2QQBA 1SBEA 1MJAA 1H1MA 2OYZA 4YVSC 5KAFC 1UOFA 4N7UA 1O6UA 2A6YA 1FOD2 4W1UA 4IHWA 3CNAA 3PO3J 5FJKA 1GZCA 2DBBA 3SDBA 2W2IA 2ACJA 3S7EA 2QBXA 3JRCA 2UWMA 1TWGJ 1TE1B 4ZU4A 2XAJA 1QDCA 2CUZA 3OPWA 2RKHA 2WB1N 4DYCA 3WF0A 3N9LA 5APAA 1FJLA 4IGOA 5CVVA 4D94A 3GZ5A 2NRAC 3BQYA 1QQP2 3NKTA 4Z2YA 3SXYA 1ZK8A 4HKWA 4ES8A 5D5WB 1B72B 3BU7A 1WLDA 3F8MA 1D3YA 1J3QA 4RQPC 2GP3A 2JZYA 3P1IA 3IH2A 5KWRA 3DP7A 1ND2B 3PQKA 2HXIA 3ZFFC 4MYEA 2M2EA 2QVSB 2XVLA 1ODNA 2OD5A 4XFAA 2NVXJ 2D1HA 4YIRX 3G7DA 4K1YA 3IB3A 3X29B 3D0JA 4A6SA 2ZXHA 1VF9A 2EIMH 1Z0XA 4JGYB 5E3MA 3AYDA 2VT2A 3C7OA 1AXZA 4AHWA 3SKVA 1SDDB 1JZ4A 2O8KA 3MWMA 4BXXJ 3ZSKA 3HM5A 2EAAA 2ID6A 4HEA2 5LRRA 2CMPA 3RVHA 1HRV3 3OYLA 5DAXA 1CAUA 5F37A 1KFXL 4OCTA 4QKDA 3T08A 2LY2A 3ZDVA 3ZXSA 1S0GA 5CFCA 2LP0A 1NQJA 5E16A 4S04A 2XKPA 1RVF2 1VMFA 1OOPB 1XDUA 2JDAA 4G7OF 4A12A 3FISA 3WW2A 4LBKA 3RSNA 3BWGA 4IX7A 2LF7A 1R1A2 4MZUA 1HBXG 5HS8A 4WM7C 1XMKA 1LGNA 4FTHA 3FUOA 5F6FA 1UXZA 2IXHA 1MNMC 1RUE3 4M3CA 4AQ2A 2P4WA 3GNEA 4ANJA 1R4MB 1G9DA 2ZEXA 2E2JJ 4UFJA 5J8CA 2Z42A 2ZZJA 4PIXA 2B4KA 2M4KA 1SEFA 3VBUC 1BK1A 5J98B 4GB32 3E3VA 1LHOA 3WY6A 2LVSA 5H2FC 4M3BA 1ZR2A 3NRVA 4CU8A 1EV7A 3OY8B 2PEXA 3VB2A 1QO0D 3JRFA 2Q1MA 1GOGA 3EUHA 3PM1A 1JS9A 3WD5A 1D7PM 3L2UA 1MQTB 3OD0A 5A3WA 2JDHA 5FO9B 2NLRA 3BR3A 1LODA 3FF5A 2QYOA 1VTNC 4Q0SA 2MFZA 1NLSA 2P6SA 1ZTRA 1WW7A 4URAA 4MHUA 3BTJA 2NVQJ 3OTFA 1FTZA 3ABMH 4FPKA 3H5NA 2KHMA 1LNWA 1BI3A 3MQ0A 1EUUA 2W1SA 4Z07A 3L2WA 4OHZA 4YZ5A 4CDGA 1W9YA 5J09A 4IZZA 5DCMA 5JCTA 3VZJA 2GU9A 1MZ6A 4IV1A 1MH4A 2FOWA 4JVAA 4V19K 5BNOC 4O9GA 2L9NA 3O8HA 1JYVA 4U36A 3MUZ1 3BQZA 2QTWB 2CDPA 4CDXB 2XAFA 2JX9A 1BR1A 1P4AA 3QYEA 3G1MA 1MMSA 2Q2EA 5A2QK 4BNCA 2XJQA 5A3OA 2D40A 4MEXF 3WP3A 2LMDA 3BYWA 4AVVA 3B94A 3SZPA 3W21A 5EEHA 4Y5Z0 3VD4A 1O4YA 3MIEA 5FKBA 1RUF2 2W1WA 5DEQA 1OSGA 5D5UB 2UXXA 3S5QA 4BGDA 1APLC 1W2NA 2NZ9A 3MLKA 2QKLB 4RM3A 3J7NA 3DCQA 3KLOA 3TEZA 1QBJA 1Y1VJ 2VIXA 1IS5A 1YQAA 4CEWC 2BBVA 4YFNF 1FNZA 1ZZ7A 1LFPA 2CYYA 3Q5FA 1NCRB 1IS3A 2H09A 4XONA 1W8WA 5A1LA 3TBDA 3HBKA 2NN8A 1F5FA 3C1DA 1YOVB 5LY2A 1HA8A 1JZ2A 4HA8A 4K6BA 5IT3A 4AVCA 1VAVA 3HSEA 1CQTA 4XIOA 1GSLA 4BQNA 5G05L 1G3YA 1OUSA 3BN6A 3D0SA 4P5OA 2RMU1 1W5TA 2K9NA 4OU0A 4FFIA 3W2VA 2HJIA 2DOAA 2BV4A 4D7NA 2AQEA 4WM8C 4RQPB 3SH3A 4C0HA 4QX5A 1MS8A 4KIFA 4Y52J 3LFKA 1ASJ2 1D4M1 3O7OA 1G9CA 4WWCA 1FIAA 5F2SA 3WNKA 4BS9A 4MHGA 2VZUA 5JVVA 3JXSA 3KZIC 1OBNA 2Y75A 4ISRA 2E31A 2OAZA 2ZMLA 3OL3A 4IL6C 2ETEA 2VBDA 1OKQA 1V5GA 3HOSA 3RZOJ 4PLNA 4CDQA 1CR7A 4M3GA 4M9XA 3H3LA 2WN2A 3M4OJ 4C90A 1RUG2 1V70A 4EN9B 1Y6IA 4V2VA 5JI7A 1SLAA 2DCKA 1S72I 1VBD1 1ZRCA 5I0DA 3O2PE 2FUG2 1HRI2 4DIQA 1VQKI 1O8PA 1RYYA 2CAVA 1O3TA 3KLNA 3N3HA 2YU2A 1JZ5A 1ULFA 3V0BA 3P9KA 4EEFG 3OS2A 5LBBA 5E3LA 2PMWB 4R9DA 4MLOA 5C71A 4CZZA 1W8HA 4IHXA 4HX4A 3S1NJ 1RJ8A 1WBFA 4C2MJ 1SFPA 4H4KC 5L19A 1HB1A 3C18A 1D4VB 4D7TA 4Z1VA 1H6XA 1DHKB 1NA1C 1LKXA 2XAUA 5FYBA 4LK6A 2UV1A 1K4TA 3QBQA 5FYYA 4PSWA 2PELA 4AI0A 3TB0A 2ZA9A 2C1FA 1FLIA 1HN0A 2W3JA 1UZCA 3E6DA 1VQNI 3FBMA 4BCUA 1L3LA 2HWD3 2JQ7A 3DPRC 5DZGA 2MNGA 1X7NA 1ZH5A 3M8LA 4HK9A 3FHNA 1GQGA 1AOYA 4EJUA 1DGWA 3ZO0B 4E4HA 4ZYHA 3VBUB 2P5LC 2W00A 3FHQA 3LL7A 2PHLA 2PHXA 1ZZ6A 1QJU1 2A1XA 2PAMA 1TT0A 3H1MA 4AFAA 4GYGA 4RB0A 4BOWA 2CU7A 2ETHA 1QGPA 2HI3A 4ATEA 3EJKA 4Y5TA 4XR6A 3NQOA 3WG9A 1WZ2A 2K9MA 4AF9A 1BZWA 4Q4W1 2BGCA 3OG2A 4JTOA 2VXZA 3B02A 3HT2A 4YW7A 2PHWA 3AMPA 2VZVA 5JAXA 2IVJA 1TME1 2IW5A 1CQ9A 2D6PA 3I3DA 3FC0A 3FHAA 1G9FA 4M9SA 3DYMA 4MGKE 3GO5A 4AW7A 5FPBA 3NV2A 3WTSC 2YR2A 1MBJA 3EYIA 1PGL2 4CCLA 3AJZA 3J8F2 3I53A 3BOQA 2ZSIB 4BHPA 1SVLA 2BDRA 1AR61 5A32A 4BDYA 1EKEA 3EB7A 1RUD3 4HN1A 5LA9A 4CCNA 3QP5A 4QQPA 3H8RA 1C0WA 1DGWY 1V6LA 3OF1A 3HDDA 1GQHA 4JK1X 2G7HA 4KISA 4CZSA 4IRHA 4UV9A 2QCSB 2JEMA 1SMVA 2PHRA 3UKTA 1GP4A 2ZX2A 4PJMA 3RZHA 3AYCA 5CVIA 4UUSB 4XKVA 3KYLA 3CZUA 4QQLA 3KZYA 1Q8SA 5FZ8A 1UG2A 4RHV3 3KETA 4FFFA 2KIQA 3F72A 4N43A 4V2WA 3PL0A 1TNSA 3LWCA 4EQVA 2BW3B 2WZ8A 2DDUA 1B6AA 5F9TA 3O0XA 4IW3A 5EXOA 4CYCB 2P5BA 3DBRB 2JE7A 1RUJ2 2KPMA 3CCLI 2QSGX 5ANNA 5FZHA 5FY4A 2JB8A 5FP4A 3SISA 2OCEA 2QQOA 3HQRA 2E7WA 4FVVA 4NC7A 5F1JA 1ETVA 1N77A 3MLJA 2D43A 2RDSA 1REFA 2MD0A 3OIPA 2Z9OA 2YUEA 2AR6A 2DDBA 1OA2A 1WLTA 4DZPA 1N1TA 5GZFA 1J83A 4QQ2A 1OCCH 4A2UA 2UURA 2HVRA 4Z92B 2WT1A 3IAS2 1B1BA 2IA1A 4C9YA 4PCRA 1QXPA 4IEUA 5EHDA 1PK6A 1R4NB 3R05A 2W92A 4A3KJ 1ZBA1 2HPIA 3R0JA 3S2WA 3ZSJA 4RLQA 2VJ5A 1UOJA 4FETA 1Y4WA 2Q1ZB 1H89C 3EQEA 2DW4A 3OUIA 5D8AB 1VB2A 2RR11 4JZRA 5LBEA 4NMIA 4IEOA 4IQPA 1YFUA 4OWRB 2R7XA 5EPAA 3ZSMA 4P9WA 3RSJA 5JPMB 4HVOA 1W06A 4CDUA 3LSJA 1C4RA 1ALYA 4E2QA 3MZHA 2BERA 1CZTA 2WN3A 4AHZA 3DV8A 3SH5A 3ACFA 5FXXA 2X51A 1LVAA 4X1EA 2XLAA 1O7LA 2DMUA 3OJBA 4XICA 2O0YA 3ZOBA 5FYZA 2B9UA 3CP2A 2HTSA 2HWE3 5K9YA 3GFMA 4IOCF 4GQ7A 4IOAF 3JB8A 5GPAA 4S2HA 1NA1B 4E7JA 2VZOA 4UAPA 5GAGJ 1SFOJ 1MKMA 1XPXA 4XOTA 2GA1A 2FMYA 2A61A 4NDLA 4BQQA 2VZTA 1HB2A 1W0PA 4G7HF 5LBCA 2W87A 2ZEZA 2F5EA 5K0UB 3GMEA 3DPRB 1J0RA 4EROA 1KJRA 3B5LB 1GNHA 5KCMA 4AI3A 2VJXA 3MW4A 4YVWB 4XBLA 4M74A 5T5PA 4L92A 3A01A 3FXRA 4LLFA 2H0BA 3MYXA 5CA6A 1UL9A 3N7KA 2DJIA 3GTQJ 1CAWB 2RREA 5FMBA 1Q56A 1RMU1 2R7VA 3AZVA 3F23A 2WY7Q 2JA6J 2VKHA 3I9V2 4D0PA 1K6OA 4J00A 1UHSA 2HBUA 2ZGMA 4EWAA 2WQZC 1IHMA 3QPHA 5I8SA 2DOFA 1FV3A 2PLV1 5FPZA 1RUH3 3JRBA 3VBHC 1XX5A 3WGIA 4BBSJ 2VR4A 4YARA 4DXRA 1UPSA 2XLGA 3LAJA 4Y1YA 1SLCA 2DA7A 1HKDA 1RKTA 2EFOA 4D3WA 5H9QA 3MFCA 3J80Z 3OGSA 4XL9A 2L2OA 1H8TC 3OYEA 2VL4A 3AXDA 4YZ4A 1JU4A 2JDMA 1RUNA 2XSDC 3KT4A 4CEYA 4COZA 5B1AH 4LK7A 3AMMA 5LCWL 4ZTFA 2UWAA 3ZXAC 2GXGA 1AYM3 3E0JB 2GM4A 2R16A 2RS11 1Z9CA 1MEC3 2WNVA 1Z7S3 2CWSA 1QJY3 4QPGA 1YI2I 3G1OA 2TNFA 3E6CC 4UYBA 1XNAA 3M4FA 2GMMA 3JBG3 2OTJI 3TNQA 4QQHA 4FPJA 3ZMDA 2NVUB 3GZNB 2DA1A 3N7JA 2W08A 4DEVA 1LU2A 1LR5A 2JXAA 4DOZA 3ZQFA 3PUSA 2GOMA 1BCXA 3ZPLA 2PFBA 2D1VA 3L2QA 4LO8A 4FTSA 4NHLA 4LKDA 5CG9A 2IA0A 1YIPA 5DZFA 4YW4A 4U88A 4XLHA 1WCSA 2IUWA 5AC91 3FXOA 1ZRRA 1Y7BA 1F4AA 4WV8A 5FLHA 2L7FP 1G86A 1NCQB 1GUUA 2VTXJ 4V2FA 3PUQA 2EA4A 3HBZA 4XDQA 2QQNA 3RZDJ 2P6HA 1FIPA 2CO5A 4LR4A 2P5VA 2L01A 3POSA 5EG0A 1H9PA 4NE9A 2BFUS 1YW9A 1DUXC 2BE5F 3DXUA 2EICA 2WS91 4GIQA 4NAMA 4BEHA 1RUE1 3GFIA 2Y2ZA 3S57A 2W24A 2A6VA 3KX2A 3FWEA 3REOA 2VOXA 1UW8A 1JUSA 1IS4A 3JCIA 5HV0A 1W6NB 4DQ2A 5DXDA 2LY9A 3OUJA 3OIOA 1SLBA 4NN0A 5J36A 5ILSA 1UAIA 2EQRA 2YMZA 2HKOA 1XGOA 4IXLA 1PO11 3M07A 3K3OA 3P5BA 2PLYA 3OYJA 1IZ1A 2KD7A 3KEYA 5E8GA 2ELKA 4WVMB 5A1AA 3DTKA 4Q0UA 5DAWA 4XN0A 3VBFA 2RN7A 2B46X 1D2SA 1MBFA 5DUWA 4DOUA 3V7RA 2DU9A 1D4M2 4A3LJ 2Y60A 3OGRA 2R32A 3HVDA 1OLTA 1VBE1 4AAPA 2DCYA 3U9GA 4AWXB 1JE8A 4META 4URTA 5GTHC 3JB4C 4L9NA 3HRMA 4MIMA 1IXSB 3ABLH 1R083 4AG4A 2GP5A 2ZHNA 4AQTA 3BT9A 2E1CA 4QM9A 2HWE2 1VBD2 4BWOA 2QVOA 4ZZDA 2GZWA 2W57A 3FUQA 5HDNA 3EQLF 3D4KA 3AP4A 2VI6A 3KP2A 2E53A 4XLFA 3I3LA 2KZGA 2P4EA 1U3EM 2VOKA 3CJQB 4XFCA 1SMYF 5JOYA 4BXSV 4I2OA 3OSDA 2PJRA 1ZA7A 2WNUB 1B35A 2ZXWH 1LVKA 2WFF1 4AYBA 2CU5A 2KIUA 4JX4A 3I0TA 2VOTA 1PVC3 2VASA 3CHXA 1NY71 5GZGA 2JE9A 5A33A 3LIHA 4LLGF 5BNPB 3RIRA 1W0UA 2OQ7A 3SH4A 3I55I 3WQ0A 3J80K 1D0XA 4HW0A 3NQHA 2LSOA 4PF5A 1H8TB 3ZFEC 1SLLA 5M3MJ 3OSFA 4AQ6A 1TG7A 1QVUA 1QDOA 1PO21 4LD5A 4XBFA 1QJU2 1Y43B 3WU0A 4Q4V1 1F1ZA 1REDA 2IXLA 1D1CA 5FYTA 2VNRA 3ZQLA 4X8NA 1WVRA 1TWCJ 3W9AA 3H0GJ 3OS1A 4OUEA 3BR5A 4XJUA 4Q4W2 1HOMA 1NUKA 1XCVA 2FCUA 3BTIA 3TAYA 2A68F 2JIGA 3H5AA 3BY6A 3WV6A 3AKPA 3ONQA 3HOXJ 2F4PA 2FD5A 2HWF3 2DVAA 2DCZA 3F8CA 4TXWA 3E5QA 2G1MA 5J1UA 2BVVA 3NAPC 5IUQA 3DQVC 1AJKA 3UJQA 5GJ6A 1S7AA 4RSUA 1G3TA 2VZPA 4XIDA 2MBFA 1CF7B 1CIWA 4XF0A 1BMV1 1HQLA 3I7DA 3BG9A 4RB3C 1FPN1 1AR62 1LEDA 4O65A 2X4HA 1WW6A 2WIIB 2DFEA 3CL1A 1W99A 3HPGA 3FK7A 3ZN1A 5FKLA 3GF2A 1XE7A 2YX7A 2K46A 3T5XA 5DCFA 1YQCA 1M4WA 4XBNA 1WJBA 2MH2A 2VGDA 1HLVA 1X50A 1R5HA 1WCMJ 4YIIA 1I3AA 4G8XA 4WCGA 2OC6A 5EGOA 1KGYA 3G2BA 2K9LA 4GH4B 3FXLA 3U10A 4R79A 1C3HA 3S3MA 1HLCA 4XYXA 5C8CA 5FLMJ 3ZN0A 3SZTA 1PYVA 1OA4A 2ZX0A 4XLNF 3FZVA 1L7LA 4IHVA 1W8TA 4BA6A 1E5SA 2W46A 3RJRA 2K4BA 3CCVI 3CUQB 1SLIA 5FZOB 2VCCA 4SBVA 2VQCA 1VQ8I 5L9RA 4GFBA 5L9BA 3OYFA 1RUOA 5A7WA 1ULCA 1ZAOA 4P9GA 4RR3C 5T54A 2NYYA 4ZJZA 3FZ3A 2G19A 2AYHA 2Q0OA 4COYA 4SLIA 4AI1A 2E1MC 1ZZBA 5C3EJ 3AL0B 2EFPA 2GNMA 3C2UA 5ABJA 4QIWN 1DDLA 2D3SA 2QDNA 1D8KA 1S0DA 1SPPB 3GTMJ 3WTZA 2I2SA 4CPBD 4CCMA 1Q1HA 3I59B 2BRTA 2QF7A 3PTRB 2LC2A 2R7FA 1J7KA 2A6ZA 4GMP3 4QX1A 1URXA 2VXDA 1ZBA2 4P14A 3K2ZA 1WCDJ 5L7OA 1AXYA 5H9RA 4JGZA 3CF6E 1HXS3 5T5JA 1FPQA 3RYRA 5JLVA 3FMSA 4CGZA 1VQ6I 2RR12 3ZYGA 3CMMA 1SC7A 2ZHMA 5KXDA 3DPTA 4M71A 3BKZA 2G9ZA 2R5YB 2HWB3 3I8TA 1SD6A 2ZGKA 2V5DA 4AOCA 4EM0B 4BMEA 3WEZA 1IAWA 4KWLA 2LM3A 1WBLA 1N25A 5LA2A 3M3QA 4RFRB 5J8FA 2KFDA 1H6YA 3IAM2 1R71A 4YZ2A 4NIHA 4JQRA 1SMTA 4AXOA 2YDEA 1YHQI 3HR9A 2JDZA 1AYN3 1TLHB 1LB2A 4XIKA 2F6CA 3ECHA 3HOTA 3IKWA 5FP7A 1GICA 1Q3EA 4OIPF 3GZUC 2YUSA 1NK3P 4ZZ5A 4OMYA 5BY5A 3ZOIA 1WMDA 2W84A 1P92A 3UYJA 4KG8A 4G94A 1OFNA 4EATA 3O1RA 5HXVA 1IV6A 3UESA 1VNDA 5F5AA 1N1VA 3CLPA 2ZJRF 4YW5A 5EEGA 5D8KB 1VAKA 3GFJA 4HMZA 2P0WA 2FDGA 3WVJA 1UQXA 1XB4A 4GKXA 1UCRA 3EMRA 3X2QH 2XIGA 5TGTA 2BFUL 2WZR3 3K4NA 1RMU2 3WG1A 1EUTA 4UNOA 2X5IA 1A8DA 2EIJH 5D6FA 4NVPA 2B7EA 4PLOA 1V9U3 5C9AC 4WVZA 2B9VA 3IIAA 3MI8A 4IEZA 1SQ4A 3ZN6B 5J1RA 2PLV2 4AYBN 3LGRA 5FGMA 3HYIA 3IMMA 2H94A 1OCTC 1B8IA 3BVCA 2YHJA 1Y3TA 4XORA 4W6YA 1FX5A 3BTZA 1Z3YA 2J1UA 1EF4A 4IV1C 5IY5H 3NKGA 4X8PA 3ZDSA 2R7SA 4IE4A 3AVSA 4LE3A 2LKPA 5M0TA 1R64A 2ELHA 4RB1A 1ONVA 2CH0A 3POYA 4GYIA 3DTIA 3HKZA 3HRUA 4CRQA 5C4WA 1G59A 5B5EC 1S7OA 1Y8QB 5F3CA 4FXKB 2J1RA 1YIFA 5F08A 4KWKA 1KYWA 4LBJA 1W9FA 2EZHA 4OMZA 5A7QA 2RS12 4IV3A 2VBZA 1RUC3 4NHKA 3VSKA 5EZWA 2LUWA 2W48A 4LHLA 2WQ4A 1UNBA 4NR1A 3SCFA 3WTVC 3CDLA 3EUAA 2IPQX 1SCRA 3GCWA 4XCBA 1XE0A 4OI0A 5FP3A 2ZABA 3VV1A 1UYPA 5ICEA 4WVWA 3HEFA 1NTCA 3JSPA 2VTFA 2YBKA 1OQEA 5I0SA 4GXLA 3HOVJ 4DBQA 1Z6TA 1I6HJ 3LCPA 3DFGA 4F93B 4PJJA 3L9JT 1VMJA 1HJGA 3OSGA 4F91B 3H3UA 2VMGA 1PGSA 5AC92 5T50A 3E6BA 5DUKA 4AUXA 2UY8A 4QT6A 4EGYA 4MG2A 2W94A 2VT3A 4RR3B 1MDMB 1RHI1 3N4MA 1FY7A 1POV0 2WT2A 1UOGA 4HDVA 3HZJA 3GTLJ 3IP4B 2IA2A 2ZNYA 5GPCA 5FYVA 1D1AA 1ZYRF 2ZGPA 3NJZA 2ISYA 3WHBA 2EAKA 3KV4A 2E1MB 2WS92 4HG6B 1QQIA 3L09A 3M7GA 3RPUA 3ML6A 1J9IA 2CL2A 3A1YA 3OUHA 4CDQC 2H8WA 5BQTA 1Z05A 3GZ6A 3GTGJ 5L3DA 1YUDA 2HXOA 2QZ2A 1US3A 1JHHA 2B0LA 3JZVA 3INAA 1U0AA 2CS3A 2VE9A 2GWRA 1VE0A 5F1RA 2R30A 2F5VA 2J1AA 2GC3A 1VZ0A 3FL7A 3J7MA 1F31A 5T3NA 3T2OA 2VQTA 1PO12 1KU9A 1OYIA 1CAUB 4W50A 2XPUA 4C8DA 2HWVA 1V6OA 2WAAA 2D5HA 5HVQC 4NHJA 3VYRB 2DOEA 2HU9A 2LLKA 4W65A 4Y1XA 2DA6A 3LSKA 3ZN4A 1WA6X 2DURA 2Q8OA 3OYWA 1NE6A 1PUFA 1H2LA 4QU1A 5FP8A 5FY5A 3IPVA 4DY3A 2XVGA 2AS5F 3LSMA 2JRMA 2DVDA 2JICA 1VBE2 1TQPA 4E2GA 1K61A 3I97A 2EIGA 2KXLA 2W1UA 4PLMA 2L7ZA 4PI0A 1N3OA 2DT6A 4M3CB 1WD4A 3I2GA 4YM2A 2DTWA 3ENRA 4XEZA 1WPKA 2VUJA 2R7RA 2BY0A 1ZNPA 2M0CA 4KBBA 4PQQA 1T33A 2XSJC 2E1NA 1OF4A 3HMYA 1GFF2 3U1DA 4YRDA 2E35A 1WJAA 3K9TA 4ZTJA 1XGMA 3HNYM 2QM3A 1Q43A 5JSPA 3ATGA 1FYKA 1O5LA 1QJEA 4QM8A 4AEDB 4YFZA 4LHNA 4DY5A 1XRUA 1JT0A 4MH0E 2A7AA 5H20A 1RITA 2V1XA 3IWFA 1QJX1 1V5EA 1SFKA 2BWAA 5K5OA 1WKMA 4XFBA 5HCBA 2JDUA 1VBB3 2JJ7A 2J5OA 1X9TA 3R4DB 1PVXA 2WFF2 1OURA 4QGLA 4M3FA 3S0MA 4KWUA 2VW2A 3K70D 1WQ2A 1YQ5A 4PFOA 4HETA 5C9AB 4MGZE 3RMYA 3UNPA 1NY72 1GOHA 2IS4A 4CCKA 5F6LB 3WNNA 5F7UA 3OMYA 2CAUA 1BBYA 1Q8VA 2EINH 2LFBA 1SLTA 3ILFA 3BR0A 1VJ2A 2WWJA 2OTLI 3H92A 1BQPA 1YYNA 3NSTA 2ZGUA 2BHZA 1RZ4A 1XD7A 4IV1B 1IDYA 2QKDA 3F3XA 4ZC3A 2VBBA 1OLRA 3VBRB 2R7ZJ 3LAPA 2CUFA 4N7IA 5HNHA 2Q1FA 4PJLA 1PO22 3TYJA 3WDUA 4Q4V2 3VZOA 2Q2EB 3RQ4A 5BUVA 2FBIA 4HPKA 2E6VA 3Q9VA 1RRJA 3K4ZA 4M3CE 3TNPB 3WINE 1AR73 5ACA1 5HLHA 2HS5A 2XRNA 4U0VA 2LF8A 3C2HA 3AMNA 1JKOC 4UVCA 4ENNA 3V8LA 5FK8A 1BYHA 2NMNA 1Z21A 3VKFC 1POQA 2OA2A 1IS6A 1J3RA 2IXKA 2Y6JA 2XPVA 3UNGC 1UKGA 3WQBA 1QHDA 4IE7A 2P2KA 3OR2C 3OV8A 3WF4A 2K3PA 4NPMA 4N43C 4NQWB 3ASIA 3W6KB 1LOFC 3ZYBA 4OMDA 1SVMA 2MW8A 2YV8A 2MHFA 2E32A 3WP5A 2MPFA 1X2MA 5ILVA 3D8CA 1X3UA 1C28A 2A69F 2YPDA 2R5ZA 1BMV2 4NC8A 5JZGA 3S3NA 2WUHA 1TZLA 3IHUA 5IAVA 1SD5A 1LOCA 1QHGA 3S17J 2Y64A 1FPN2 1IN4A 2OQ6A 3N9PA 5JSRA 4I98B 3HKZN 3BALA 1ZREA 2VONA 2V5YA 4QX0A 3QPTA 2CGNA 5K7HA 1M06G 5L73A 5FBZA 2TEPA 2Y6LA 1LJ9A 4K20A 4TWTA 2JA5J 5F3GA 2GLOA 4UXNA 1VB4A 2ARCA 1OMIA 4KGQA 3AKTA 4A93J 3ACIA 4RS5B 2BGOA 4QB1A 1OD5A 1W6OA 3ZP5A 5GZEA 1PK6C 1KS4A 1JYIA 4S2DA 5KHIA 5IATA 2E19A 5A7PA 5J1XA 4MUVA 2F5FA 3BUCA 1MS5A 4IJAA 4HONA 3DECA 5E1ZB 3GEZA 2ZJPF 4EM1A 2FXAA 3I2OA 4TTGA 2ECBA 1YXWA 1BI2A 4QHOA 1R1VA 2K9QA 2ZBKA 3NV3A 1ZLKA 3UGGA 4FPOB 3CCEI 3LA2A 1QZEA 1PX4A 2PG4A 5HDKA 2EXKA 2R1BA 2QQ9A 4XUNA 3IUOA 1IPSA 1A31A 2KRHA 5A70A 1W04A 1LOBA 5DUIA 2JWTA 4B1LA 3CUOA 3A03A 5F64A 4PJ0C 2R0QC 3PVEA 4YFWA 3KQ4B 4DUXA 3U1KA 3PU3A 5GM0A 1J09A 1UYYA 3PDQA 3OEAA 5J47A 3DF8A 1OHFA 3ZKUA 2RS51 4LBQA 4QTRA 1WMEA 3U75A 1OQ1A 2L9RA 3BPVA 5E18F 1JYWA 4HZFA 2VH9A 2EPFA 3W2WA 4PT6A 2K7LA 3QYBA 3W2AA 2VW1A 1XSVA 5LY1A 2LR8A 4RM2A 5HCFA 1ENXA 3PJRA 5HBAA 2EVXA 2W91A 2RS33 5HCHA 2ZX3A 1MZBA 1XSXA 1T6GC 2AEYA 4LO7A 4LT5A 3AZWA 1EV11 3I4IA 4C91A 3FN9A 2OXBA 2PBIA 4A3XA 3EO6A 2ZFUA 4LK0F 5ILUA 3GBWA 5FLVA 4LHSA 3ZYRA 3AKQA 2BW8A 4QHZA 2EIEA 2VG9A 2BHYA 4B09A 3V42A 3H1CA 4ATFA 3LSEA 3LSPA 5LWBA 3WR0A 2Y6FA 2ZB9A 1IXCA 4HVQA 2VULA 2DA3A 1U9OA 2O5RA 2LDUA 3BG7A 1W7PA 5DV5A 4CEYC 1LOAA 4D6QA 1MS3A 2OQGA 1BC7C 2Y69H 3SFIA 4FP2A 3FM5A 2LTNA 1TVGA 2JDNA 5A32B 2P1BA 1DCSA 3P7NA 2M30A 2B45X 5I8YA 3FFZA 1ZKGA 2MH9A 1C1FA 4B4PA 2F17A 2VQHA 2WNVC 1RUI3 4QPGC 1A3KA 3ST7A 1O3RA 4PSXA 3H1WA 4N53C 2FRHA 1X19A 3OYNA 1XQNA 5DM6F 4HXCA 3ELKA 2AGSA 1N75A 3JD71 2HOSA 1YIJI 2W95A 1WFXA 3EPZA 2Q8KA 3I4MJ 4B3XA 2HLEA 1KXGA 3DU5A 3RFRA 4H7LA 5H9SA 2RQPA 1KGSA 4Y1ZA 1A6QA 1VBA3 2MEV1 3CMEI 3LEMA 2JPBA 2HEVF 4KG0A 4PJNA 2JT1A 2NYXA 2WTEA 2XQXA 4OIRF 1NG0A 1UMIA 4JHZA 3NJYA 2VQAA 1LEAA 2ET7A 5L3EA 3J7HA 4FT8A 4AVPA 2P6CA 4MXWA 5CPRB 3UJOA 5FB2A 1H30A 3W5NA 2CV1A 5KK1A 4Y20A 1IN5A 1T0FA 4UW4A 3OBZA 2CQXA 4D7MA 2WYFA 5KR7A 2DJNA 1K7AA 2O1QA 3PNAA 5FQ0A 5L3CA 2KRFA 2VMHA 3IRQA 3PJYA 4E4ZA 1X1AA 4QLCU 3LPGA 5FRNA 3CESA 2CJJA 5LA1A 1FMD1 2FQ3A 1X4PA 2F4OB 1H9GA 1P2FA 2HTJA 2K3FA 3BTLA 2HQNA 4RGKA 3VZLA 4CCDA 4I7HA 3GLLA 3KP4A 3MICA 2MA3A 2FCTA 3RKWA 2V9KA 5DAPA 4QPWA 3DTEA 3TP0A 2FD8A 2L7KA 2RV8A 1LHUA 3GALA 4XMYA 5GAEJ 2SLIA 1K78B 2RHPA 4LB5A 3FMRA 4ZYGA 5LHIA 4AHYA 3VBFC 1H9WA 2R061 1RHI2 3T0YA 3A2KA 3ZQHA 1X8EA 1R22A 1PP7U 4IRIA 3CLQA 3RKQA 2D97A 5F04A 3CC2I 1W9TA 3WU1B 1IDZA 2VKDA 4FI9A 3S2DJ 3HHGA 3Q0UA 4AIHA 3NMBA 4A7ZA 2XPJA 1FC3A 2MC3A 2VUAA 2VZRA 2TDXA 4Y26A 3KCYA 1LENA 2GOXB 4E70A 5D21A 3HOYJ 3UKVA 4YSFA 4BQYA 5HXMA 1R6RA 4AI2A 1EA3A 2QQIA 4G6DA 5FP9A 5C6CA 2R92J 1FZPB 3H9JA 2ZJQF 2DMTA 1D1BA 3ZIWA 2CW7A 3VZKA 1JKQC 2IGKA 2LW8A 1RETA 2JPCA 1KU3A 3VDBA 1HV0A 1TMF3 3HAGA 2ICWG 2X8KA 5F5IA 2CRGA 1K5MA 1CPNA 1J3PA 3LB9A 2B9SA 4YG6A 4D6SA 3QOEA 3VODA 1XDSA 1F4HA 2K86A 2JG9B 1QRYA 2UWBA 1B35C 3IDBB 1VIWB 3POGA 2WRAA 1LPQA 5HS9A 3UV9A 5FXWA 4H0EA 5B66C 1H1IA 1BBT1 5JIAA 5GLVA 3RI9A 2OJED 1GZ9A 3HUGA 4I0WB 4L2NA 3BG3A 1U5TA 3JW4A 3DKQA 3CDZB 2DMQA 1T95A 5FDBA 1AL23 1C8NA 4FOYA 5KC5A 4COUA 1S8NA 3HQXA 2ZGTA 4QDSA 4QDRA 5BPXA 4CP9A 1OYYA 5GZCA 1L0OC 2STWA 2F5CA 4ON0A 3AB0A 5IFTA 3K4AA 3IM0A 3U1XA 4W4ZA 2DK8A 1UIJA 2VMFA 3NWTA 1YWKA 5A6XA 5M5XJ 5FZIA 4QKNA 3FE5A 1DLCA 3B93A 1TZOA 4M73A 1E5RA 3P6BA 1JN2P 1COV3 3ZFGA 2Z3YA 3DWLE 4BB3A 2KT0A 3A0NA 3DUIA 1IF1A 1DQUA 1X2NA 3WGHA 3IZOA 4HQMA 1GWLA 2A71A 1REPC 4XF3A 2A3SA 4N53B 1QJZA 1VQLI 2CUJA 4XSZF 1UZ0A 4CUGA 3VSLA 4AD9A 1X82A 2V1DA 5CVUA 2E2HJ 1YJNI 3PUIA 3OOUA 4RGRA 1V55H 1J58A 1R093 1LECA 1LE8A 5AFEA 3A7QA 2KISA 1DQ5A 1DU6A 3GXOA 1ULPA 5D5VB 3Q0WA 3MBWA 1UMZA 4RA2A 2W5FA 3WCSA 4QU2A 3ETQA 1U8RA 4A7YA 2V26A 1Z67A 3VBSA 1C5IA 2LALA 2ZX4A 3W5MA 4PFPA 4DNYA 4JRLA 2ZEYA 4QPIA 2BOLA 5LK5A 2DMPA 5FZ6A 5ACA2 4A45A 1KQ0A 4OHXA 1AVBA 5B4NA 2EXHA 3PVNA 4O3MA 1X58A 3QACA 1MW7A 4XUPA 3K1PA 5A6YA 3LOIA 4A3JJ 4U87A 4IGQA 3NVCA 1RKWA 3F8NA 4XK4A 4LG0B 2V79A 3ZXKA 1BJZA 5C8CC 1W28A 3N97A 3C2GA 1JHNA 2XR4A 4Y13A 4AI8A 2XBO1 5LHGA 4Z2WA 3P5JA 3DPUA 4TLGA 2G9GA 1VRH1 2PTMA 4AEJA 3OYAA 2VM9A 3ZR5A 2ZAHA 1FOWA 4PQ9A 1UU5A 4XVHA 4U7DA 4IDZA 1GU3A 3QCWA 2V4JC 2Z16A 1W90A 4QGNA 2XL7A 3NW4A 2ENRA 3N05A 4A3FJ 5HODA 2OPKA 4MV2A 1XYNA 4MXVA 3ELNA 3TEYA 1AX1A 1B72A 2QNKA 1S7EA 3VBFB 3MEPA 2TRTA 5FR3A 4H7MA 2A73B 2O8OA 3POFA 4XJ9A 1PIV1 1ND2A 2Y9YA 3WW3A 1W36D 3WF3A 2PHFA 5ABJC 2HDDA 4PUSA 5LW9A 3HPHA 1FOD3 4Q47A 1NG7A 4L5IA 4FPCA 4BMBA 1ND3C 1AJOA 4KQ7A 4NPRA 3QLQA 2XGEA 3G73A 3SMHA 4AK3A 1IUYA 3PHMA 5FFZA 3KP3A 1RXGA 2HEYF 2V73A 4DRVA 1IZ3A 3OPZA 5L7OC 4YG3A 4JGZC 1JT6A 4V1PA 1G9BA 4J25A 4JGYA 3BZKA 4B7EA 2PI0A 2EK5A 3JRHA 1E0EA 1JJ6C 5LEKA 3NNJA 1YS6A 1O8SA 2VJ4A 1BR4A 1UPIA 3RZMA 4EJOA 2HZDA 4YIFA 1QQP3 2UYAA 1T2KA 4ONUA 3VKLA 1U6GA 3H3VK 4WF2A 1WD3A 1KRIA 2FBEA 2PAEA 1JI8A 4A69C 4L0YB 4AVZA 2BXZA 4M6VA 3LOCA 5CVRA 3F8BA 4G6TB 2CV2A 1L7QA 5F6KA 1TMF2 2X1CA 1OOPA 3SEEA 2V9VA 2XUMA 2OKXA 2WKKA 2A6WA 3FHIB 1S0JA 2RS52 3BTXA 2BEOA 1RJ7A 3C8XA 5FO7B 1F43A 2VOWA 5A33B 1WZXA 2WC2A 3K46A 3DBHB 1LQ1A 4YRVA 5G04L 5BNGA 1OLMA 1W6PB 2R7TA 2KM2A 5FLIA 1S29A 5J4VA 4N0BA 4LBMA 4J1XA 5DUXA 1TP4A 4XZPA 1E17A 1YS7A 4EJRA 1UD1A 2JG8B 1YC61 3TWIA 3RJPA 4LORA 5DG2A 1H1AA 2O7OA 3OY8A 3ZYPA 5K5RA 4I01A 1XC6A 4LJHA 1OQYA 3VUOA 2XHKA 1WRJA 1EV12 4M3CF 2WV0A 3NNMA 1MQTA 3ZYIB 3OYGA 2X5IC 2G4IA 4CVUA 4Q2FA 4IKFA 1S0FA 4XRMA 1RVF3 1P6RA 2M45A 4KT6A 1MMGA 1FOXA 2Q0AA 1H2MA 1VQPI 3KLSA 4NC6A 1R1A3 1T98A 2YC0A 4KNYA 2WO2A 4DB5A 1HJFA 3H1YA 3IDEA 1Y9GA 1SCSA 4FPHA 3DEUA 1UYXA 4AVAA 4IEJA 3TP3A 4WXHA 3OOXA 1W4MA 3S8PA 4E4DX 3BOWA 3PTYA 2ZACA 3IBMA 3S6PA 1DYOA 4AGVA 5AONA 4WZFA 2VKVA 5DTDA 1B9NA 3HQUA 1ULGA 4HSJA 1F35A 1E3OC 3LMMA 5FOJB 1SACA 4GB33 4IV3C 1ENQA 5IP6A 3GZEA 1W8OA 5LHHA 2K85A 2CQNA 3ZR8X 5DYMA 2DDAA 2M3AA 3CO6C 1AUYA 5FLJA 4XFIA 1Z1DA 2BQPA 4XUOA 4N4NB 3VD3A 4GO1A 1NOVA 1EH6A 1UMHA 4ESBA 3B73A 1YFYA 3JD72 2RNJA 3BLYA 2MGQA 1CIYA 1IN8A 4ZPIA 1HB4A 1AKHA 2B42B 3PFYA 2YU3A 4MTDA 2PMZA 2D45A 1NCRA 4LLOA 2H1LA 2WADA 3MD2A 1QH6A 2JSPA 3V7SA 1VI0A 4K2EA 2B7YA 2AXTC 4YEJA 2JWPA 2MEV2 3K48A 1OF3A 4BZ4A 4PDWA 3OYBA 5CQEA 1AWCA 5A7WB 2CY6A 2BJSA 5FTTC 1Q8OA 5KHHA 3U2RA 3HJRA 3O14A 2HOTA 2ZTNA 4NPLA 2VC9A 3ESWB 4IE0A 1BJQA 1EPWA 4M3DA 3PMSA 1RUF3 2D6KA 5ANQA 4FQGA 1XYPA 2Y31A 2PA7A 3JR9A 2RDRA 3AFGA 1ND3B 2AC1A 4FISA 1ZZ8A 3IKVA 3N36A 2HBTA 4HF0A 1W36C 1MNEA 1QY4A 3VDDB 2DA4A 3G71I 5L7OB 3TBIA 1MH3A 2ISZA 5C3OA 4ISQA 3FMGA 2KMUA 2JN6A 3OBTA 1Y0UA 2OT7A 2DFCA 1LHVA 4YZ3A 4Q0QA 4KJZA 4FAGA 3TW7A 1TQMA 4E7ZA 3WNMA 1IO2A 4UVBA 2VBXA 4JTNA 2V72A 2VZ3A 1GV9A 3E97A 2R062 2O8QA 2A6TA 2NAZA 3B6AA 4NIAA 3S93A 3OYHA 2Y0IA 3BDDA 2KDZA 1WW5A 5BMZA 1ULOA 5BNQA 2JVGA 2XWJB 2HZTA 3DEWA 3HOWJ 1PZ7A 4HQEA 1ASJ3 1DGWX 2V4AA 4C3IJ 3CBNA 3WNPA 1P4WA 4I0AA 1AR81 1W3XA 4B29A 4LJZF 1JXNA 4RA0A 4KH9A 2EB7A 5JOXA 2WSVA 4M4PA 2BNNA 4CU9A 2Q8DA 1AX2A 4CP0A 3WG2A 4XHXA 4NUBA 1RUG3 1AU7A 5FRAA 3AFHA 1JBCA 2UUZA 3VBOB 4JYKA 1HRI3 5L9VA 3AX4A 2HYXA 2H1KA 2X1EA 1KONA 5JVTA 4HSRA 1NG6A 1V6IA 1FOYA 1H0MA 1AHSA 2JB4A 3AZYA 2O9LA 1H2KA 4XAAA 1YRNB 1KU7A 3P3PA 1JYXA 1B59A 4BQ4A 3GM8A 4UBHA 4E9KA 5JHUA 1UXXX 1NX9A 4PF1A 3WP6A 1BBT2 4PBOA 2LH9A 1ZBE1 1ORKA 3BB6A 2M7AA 2R072 2VXRA 4OYUA 5CYVA 2LTPA 1P7JA 4AIDA 1MZEA 5J96B 2PMUA 4JP0A 2EIDA 2P8TA 1OFCX 1RL3A 4A3CJ 3JTGA 3I49A 4KN4X 4Y4RA 5C5TA 5FD6A 2ZBJA 5FJHA 3ZMTA 5FYSA 2Q8CA 1KFUL 4BXUA 5J4YA 1WSUA 2R6QA 1GXPA 4EJTA 3SEPA 3M1HA 1GWKA 2A3YA 5DD8A 3C3WA 2P3YA 3NNLA 1V0AA 5JVGF 2XV4S 4HLXA 4MSVA 1Q8QA 3SQOA 1CAVB 5J37A 1W2OA 2Q30A 3AKZA 1C57A 4OAYA 4P9FA 2M7BA 1ENSA 2VVEA 2ZMEB 3J81Z 2LBFB 3EHKA 4OUSA 2DT5A 3OYKA 3P9CA 4L5EA 1MS1A 5GLZA 4HRIA 1POV1 3Q8BA 5I8TA 4Z8BA 5LRSA 3S14J 1D0HA 4DYQA 2XAHA 3I4PA 4XJWA 1AR92 4QXCA 1AHDP 5JZGC 4UBGA 5JOWA 3S1MJ 4B44A 2OX0A 2YFZA 2BW3A 1XE8A 4FOVA 4FOWA 2OZUA 1PM4A 1U2WA 5DDJ1 3M3CA 1BEV1 3HPNA 4KUMA 5E79C 4PGHA 3ZMZA 4CYCA 1QXRA 1RC9A 3N7LA 4A5MA 3J8F3 4ABZA 3BR2A 3QD6A 1XNTA 2YU1A 3OPTA 1BI0A 5T52A 2M0MA 3KGZA 1I27A 3M8EA 2OQRA 5FXVA 1F2NA 2D6MA 4BIOA 1BXHA 2Z1DA 4KI5M 3LWFA 2PHUA 1CWPA 1VBC1 2H6CA 3BJAA 3RI4A 4Q4Y1 1LOEA 4FCAA 3LPFA 1HQNA 5GKAC 4XE9A 4BE0A 3RZKA 2JIJA 2XBO2 3LSDA 5CADA 4AVSA 3G1LA 5JOZA 1O91A 4XZUG 1VRH2 2PXJA 3SCGA 4EM2A 4YVSB