4I01A

Structure of the mutant catabolite gen activator protein v140l
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
202
structure length
202
Chain Sequence
PQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDLTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modulation of global low-frequency motions underlies allosteric regulation: demonstration in CRP/FNR family transcription factors.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords Catabolite gene activator
total genus 63
structure length 202
sequence length 202
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4i01A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4i01A01
4U0VA 3SZTA 1OYYA 2EV6A 4YFNF 1SD6A 5ILSA 2XL7A 2QDRA 5DDGA 3CO2A 3IDCB 4YYOA 2EV0A 1IPJA 2QWWA 1I1GA 2A07F 1UW8A 1QGPA 2ELHA 1CAUB 2NAZA 4M74A 2P6SA 3LAPA 2UXNA 3R60A 4P55A 5H6RA 1YIOA 3BJOA 1KGSA 1FOKA 1UCRA 1E2XA 2IW5A 3H1WA 1ON1A 2ISZA 4LLOA 1PMIA 3HIFA 1XB4A 1J0RA 2EFPA 1SFUA 2H09A 3ECHA 2PAKA 1ZGJA 3QAHA 2D2WA 3H1MA 2M45A 2ISYA 2WC2A 4EJUA 4L9NA 3GFMA 3KGLA 4LEJA 3SCHA 1DGRA 3GYDA 4EJTA 3SHRA 2J5PA 1MJ9A 1RL3A 2PMHA 1G3YA 1CX4A 3WTZA 4AVPA 1A04A 3KCCA 3HTUA 3BROA 4LB5A 4ZYEA 4J1XA 1W5SA 2OQGA 3L2CA 1QNTA 4WXCA 4EQQA 4L2NA 2P7VB 4UV8A 2AXLA 4UXNA 5D1IA 2W57A 2MLGA 3OOPA 4Y17A 2RC4A 1MZBA 3M70A 2QCSB 3REOA 5LGNA 4M9ZA 5D4SA 2DO7A 4B8XA 3FMSA 4F8AA 1YTYA 1HKTA 3NRVA 3ZPLA 1XSXA 4AIKA 3T0YA 3QP5A 2HYGD 3WGHA 3T1BA 3LWCA 2A6EF 3QU3A 4Q29A 4P9UA 2XAGA 4NQWA 1U5TA 3R0JA 3P9CA 1F5TA 2HR3A 2DU9A 1ZZ8A 2B9UA 3R61A 2O1QA 3ZMUA 2FXAA 4E2QA 1CAXA 1XGNA 3LWFA 4OOIA 3MAJA 3MDPA 1VP6A 1OYIA 4M9XA 3ZN1A 4EWDA 3F8NA 2XVCA 3IC7A 2HTJA 4LLGF 4G8XA 2D45A 1FX7A 3LAGA 5JFRA 1EH8A 1TQ5A 1AWCA 1QZZA 1YWKA 1OPCA 1UD1A 3ZMVA 3WTUC 2FOKA 4EV0A 4MGIE 2HFHA 3WE3A 1J75A 2FE3A 1P4AA 1GXQA 4WBBA 4QM8A 3JTGA 1IXSB 1QWRA 2IXCA 3TKYA 4I0BA 4G6DA 2XAFA 1XN7A 3I54A 4EM2A 1W4MA 4IXAA 4ZH4F 2HJIA 5FGMA 3RDIA 3F3XA 3KE2A 1LEBA 1R23A 1ZRDA 2A61A 4KICA 3UKNA 1PP8F 1S6LA 1XMKA 3RYKA 2PFBA 4L0ZB 1XGOA 4L9VA 2XKOA 4CDGA 1LQ1A 4YFXF 5I91A 5LEKA 3KFWX 2QUFA 1QQIA 3LZZA 2RV8A 2ADUA 3WW3A 2O0YA 1DGWA 2D1HA 4BHPA 4IHTA 5L3FA 5DUKA 5FPXA 3FM5A 4Y13A 3M8FA 5BV6A 2V1UA 2DI3A 2FBKA 5DV5A 2IPQX 2DPDA 2NNNA 2LDUA 5CLSA 2IT0A 1D5VA 3NQOA 5KHHA 4Y15A 4G7HF 2W84A 5H20A 1WKMA 1JE8A 4HLYA 5JR7B 5K8SA 2LNBA 2R3SA 5TJJA 3S7IA 2FBIA 2RDPA 4IEZA 3LQRA 5D8KB 2H0VA 4UNOA 5BQTA 5FQ0B 3GUDA 1CF7B 3IRQA 2EVXA 4KU7A 2IXHA 4KWLA 4U7DA 4WWCA 4J1WA 4XFGA 5DEQA 4TV7A 3OCPA 4A0XA 4BXUA 1UB9A 4XF3A 4WCGA 1TNSA 4Q0QA 1IAWA 4XLPF 4BQAA 2VOOA 1J2XA 3CO6C 4XLNF 1P4WA 3GVAA 3F8BA 3EUHA 3GFLA 5AIPA 3RPUA 4ZZDA 1LJ9A 3VFZA 1ZHFA 2L54A 3RYPA 4M73A 1HW2A 1K78A 2YSRA 1IRFA 3BOQA 1NHAA 2OQRA 3MCZA 2EV5A 3DXJF 2A3SA 3H3UA 4I0AA 4KIFA 3KGZA 3JSPA 2LKPA 1OI6A 2V09A 3V7RA 1SFXA 3GZ5A 1L3LA 2VONA 4WK8F 1LR5A 4MNUA 3HT1A 5AIQA 3EYIA 4U88A 1O3RA 2PN6A 3DEUA 5FLXZ 4F7ZA 1CGPA 3F6VA 2F5EA 2DQLA 1J7KA 2MA3A 2UYBA 2NS0A 4YNIA 2Z3YA 2PG4A 4N0BA 2BEOA 3F21A 3WG9A 1WA4A 2OA2A 4QGMA 4ZZLA 2ZKLA 2BBYA 4MZUA 4RAYA 1YFHA 4LUKA 5D4RA 2KXLA 2MLKA 1G3SA 2IC1A 2KIUA 2EJRA 5JR3A 1ULYA 2Z99A 4KIGA 3DP7A 1QZYA 4QMAA 1X8EA 2PHDA 1SAXA 4LULA 4LG0B 5CU1A 4IERA 2VC0A 1Z9CA 2FQ3A 5H6QA 3GF2A 3U1DA 2KIMA 4I02A 1EH7A 1YFXA 4Q0UA 3E3VA 1TQIA 1XGSA 3KP2A 3D0JA 3SZPA 5CYVA 5LGUA 6PAXA 4D0PA 1R36A 1MJBA 3CJNA 2M8EA 2PQ8A 2K7LA 3ML6A 2IA0A 2C0ZA 2UY8A 3RKXA 3GO5A 1OMIA 4PGGA 3JSOA 2YX7A 4YRDA 2ETHA 1YFWA 1TQMA 4M9SA 1BIBA 2PHLA 2CW0F 1FWZA 5D8LB 1XMAA 2QQAA 5KHGA 1DPRA 2Z5UA 3MZHA 1V3FA 1P6RA 1WI9A 3F8CA 4CICA 4IEPA 2GC3A 1ZYRF 1FC3A 3C18A 1YYVA 1S29A 3VB2A 3F8FA 3ZMSA 2V1DA 4UHTA 2YX4A 3HYIA 2WWYA 4MQVA 1OR7A 5E8IA 5C6CA 2FNAA 5D5VB 4RB2C 1XD7A 1NE6A 1EH6A 3T8RA 2ET7A 1FZPB 3ZMDA 3KEQA 4EJVA 3WU1B 2Q0OA 2MHFA 1XDSA 4OIPF 3WU0A 4KMUX 4DINB 1P4XA 4JTNA 1ZRRA 3MWMA 4CGZA 4AIHA 4HBNA 1USTA 4HF1A 1YS6A 2COMA 3WTSC 1SMTA 2GXGA 4KT5C 4MGYE 4BH9A 3G73A 1NYWA 4RGXA 3IDBB 4M6YA 1EPZA 1HW1A 2K4BA 3C1DA 3L7WA 5LLQA 3KETA 2CG4A 2OPKA 4A5MA 4B29A 3R0AA 1DZTA 4KWKA 4IVNA 4MGKE 4LMYA 4AXOA 3K1NA 4ON0A 1BM9A 5FO5A 1IXCA 4KUMA 2F5CA 2XROA 3L9FA 3I59B 1YHFA 3HRTA 2PQQA 1H9TA 3RJPA 1XDUA 3FX3A 4I01A 2VECA 4LLLA 1U3EM 5FFZA 4ESJA 2W25A 2C6YA 1DUXC 4A0ZA 3FZ3A 3Q9SA 1KYWA 2IP2A 3QACA 3OV8A 1I1SA 4HVOA 4PJYA 3VHRA 3KP4A 2EK5A 2VBZA 1KU9A 2M1BA 3MQ0A 4Q4ZF 3BY6A 1GXPA 2VBXA 4UXAA 2PA7A 1MJAA 4K2EA 1ZZ7A 3KLOA 4ENJA 1TNTA 1J9IA 1ZZBA 5J6XA 1FBSA 1LDKB 2FBHA 3F22A 4QM9A 2ZNZA 3KLNA 2EWNA 1K7AA 2EFNA 5ILVA 4EM1A 4LA2A 4RD7A 4PIXA 2XLFA 2OZUA 2R7DA 2IVMA 3ABUA 3N97A 4QGLA 4BIFA 2B5HA 1W5TA 5I0UA 1RC6A 4ENKA 4L9TA 2Z69A 2XASA 2UYAA 3H1YA 1UFMA 2STWA 3U0ZA 1ODDA 3BWGA 3TQNA 5LHIA 2PAEA 4GO1A 2JPBA 2G9WA 3ERED 1Z05A 1Z6RA 4MQ9F 5IT3A 1J3RA 4LGWA 4O5VA 3HRSA 4HX7A 1XSDA 5HLHA 4G6QA 1MKMA 3V8JA 4EWEA 2Q2EA 2D5HA 2P8TA 1BOAA 2NYXA 2PJPA 1X82A 1YG2A 5BMZA 3H50A 3E6BA 1XRUA 2P5KA 3N4MA 4IRIA 4KU8A 3EO6A 3ZMTA 4R79A 5EEGA 3FF5A 3H9AA 1FI2A 2ZO4A 3IRRA 3QPTA 4KYWA 4ZU4A 3HOTA 3ULQB 5EZWA 4AQ6A 5FFXA 1REPC 3E6DA 3TO7A 2M5WA 3IWZA 1SQ4A 5HS8A 3TOAA 4Q48A 1JUHA 4ZYDA 1SMYF 2O61A 2GWRA 5BS6A 5I8SA 1UPIA 1J1LA 3W6JB 1IN7A 3PQJA 3KP6A 4G7OF 1IUYA 3ISPA 4HZFA 2RVCA 2ZBKA 1ZNPA 1LVAA 4EVIA 1YFUA 1AOYA 4LK0F 1FPQA 4EJOA 1RGSA 3ZDSA 4UBGA 1ON2A 1KU3A 5E1ZB 5LRSA 3I4PA 5K5OA 4UBHA 3IHUA 3CUOA 1LRHA 1D8KA 3GEZA 5J8CA 3IIAA 4XFHA 5FDBA 2JSCA 3KZYA 1Y9QA 1T2KA 3C3VA 1YFYA 1VJ2A 5K5QA 5L3BA 2D93A 5LGTA 3CF6E 1YW8A 3TDUC 1SD4A 2F5FA 1WSUA 4NVPA 3HRUA 1YW7A 1O4TA 3P9KA 3TO9A 3HHGA 5F1RA 3IKTA 3SCFA 5CVJA 4MUVA 4RS8A 1YW9A 2EFQA 3WW4A 3EDPA 5E18F 2B0LA 3HQXA 3GW2A 3I64A 3CUQC 5AONA 4NHJA 4AVCA 2M30A 1YQAA 3S2WA 4DQ2A 3M9AA 1CAUA 3O3KA 2CAUA 4N9IA 1EY2A 4P9FA 2UZKA 2EA7A 4ENMA 2IXLA 1PUEE 1BIAA 3CL1A 1BBYA 2QQ9A 3FXRA 3DF8A 2VODA 2XUBA 4EMSA 2H6CA 3TOBA 2XAHA 4XBFA 3BP8A 2OU2A 1JHHA 2EFWA 1KYZA 1Q43A 2WTEA 2VN2A 1B1BA 3SHFA 3V8LA 3J81Z 5E17F 1OD5A 2STTA 3EBRA 5ICEA 2FF4A 4XFCA 2QQBA 2PAMA 2Q4SA 4EROA 3TGNA 2OAZA 2Y75A 1ZX5A 2F5DA 4EJWA 1CAVA 2PBIA 4OMZA 2GU9A 3J80Z 3MFKA 1RNLA 1Q3EA 4IEXA 3SQNA 3FXUA 4MTEA 5BOXA 3CDHA 4L9JA 4BNCA 1O57A 3LFKA 3NKTA 1U5TC 1QXRA 5D5XB 2RN7A 4XFFA 1LNWA 3J81K 3NJZA 4OLLA 5DD8A 2M87A 3MZYA 4I98B 4A0YA 1NE4A 4G94A 2Z33A 1MDMA 3K1MA 1FSEA 4UVBA 4ONUA 1XGMA 2XAQA 2ESHA 5CVRA 1PDNC 1B59A 4HN1A 5BUVA 1Y3TA 5HI0A 4FT8A 4BHBA 1YO5C 1UCXA 2IRFG 3D0SA 3GWZA 2E7WA 1H1IA 3E5UA 5HLIA 5L3DA 2RNJA 4N9HA 2PFWA 5D5WB 3F23A 3LA3A 4LUMA 1FBQA 1SFEA 2JTVA 3R6SA 2X0LA 4XFIA 3RTRA 5LBQA 2YU3A 5HDKA 3JAMZ 1IN4A 4PIYA 2P5VA 4EGYA 3LQQA 4YIFA 4HW0A 4KN4X 2E1NA 5BY5A 4NB5A 1TTYA 1Z6TA 2KRFA 2EAAA 1FP1D 1FYMA 5JAXA 1S8NA 4KDPA 3U11A 1Y0UA 3BDDA 1BI1A 2WFPA 5KHKA 4MHGA 3FM3A 2CQKA 5F6FA 2D5FA 1O5LA 4XETA 3ETQA 1U8RA 3W6KB 1ZRCA 3BJAA 3KP5A 3B73A 4LA3A 4OIOF 5L3EA 1CAWA 2XHKA 2IXKA 5E8GA 4P9GA 3V7SA 2CV6A 4R1HA 4GYGA 4RAZA 2QBYB 3CLOA 2EA4A 2DK8A 2VT2A 2BNNA 1WRJA 2QM3A 1X7NA 2YPRA 3ST7A 3AAFA 1G3WA 4ZU7A 2DK5A 4MEYF 2H6BA 2O8XA 3PFIA 2BNMA 5AVPA 3E97A 4OFGA 5HS7A 2P5LC 4JBAA 5FCCA 5A2QZ 4MV2A 3WTXC 3QP6A 4XF4A 1IF1A 5HVQC 4OIQF 4P5OA 3KP3A 1T39A 2ZNYA 4AD9A 5HDNA 2LSOA 3HUGA 1SFNA 1J5YA 2DLLA 1L0OC 1CF7A 1I5ZA 4QXKA 5FQ0A 1RIOH 1HXDA 4P96A 1NXMA 4KA4A 3USSA 1R1UA 3DPLC 3K69A 2V79A 1ZZCA 2Q1ZB 1ZG3A 4PDKA 2EA2A 1BC7C 1HKSA 2O03A 1ZARA 3GLXA 4XRFA 4DNCA 2L02A 4IESA 1YS7A 3FZVA 1U2WA 1TW3A 4HF0A 3UKTA 5JVTA 2E1CA 2O8QA 5KHJA 1OFNA 5BPXA 1ZLJA 3BB6A 1P92A 1O7FA 1J3PA 3TDZC 2W85A 4FAHA 4U0YA 4PCQA 2GC2A 3GX4X 3CLPA 3K9TA 3KP7A 4LK1F 2KJCA 2Q30A 3C3WA 5CVIA 3J7AO 1CAXB 1G3TA 4META 1ZZ6A 3FJSA 3S0MA 3M3IA 5I8YA 1K6OA 4O3MA 1NZCA 2UY9A 1GQGA 4A2UA 1TBXA 2GIVA 4H0EA 3E6CC 5FD6A 2VQAA 1E17A 3BPXA 1O7LA 2MNGA 3HOSA 4HVRA 4WXHA 4CXFA 2ET1A 5ICCA 3ELNA 1R5HA 2L01A 3CEWA 1HKQA 1S7AA 3DFGA 4FX0A 4CYDA 3DV8A 4WXDA 3LA7A 2K27A 1RI7A 3ACLA 1L3JA 2CWEA 2R7FA 5D6FA 1O3TA 2GH2A 2QNKA 4L11A 5I93A 1R7JA 4Z07A 1XCBA 2G7UA 4G7ZF 4LTAA 1U12A 1F1ZA 2QBYA 2IXIA 2CFXA 4QLCU 4ASNA 5CADA 4RGSA 2QLZA 5JSOA 3H7JA 1CAWB 3CUQB 2Y48A 4GULA 3ES1A 4O9EA 2V9VA 4CO8A 4S05A 4BAYA 4A6DA 5FLIA 1X3UA 1D8JA 1O5UA 2HYFA 4HLTA 3CJXA 3I7DA 2DCTA 1T0FA 5CJ9A 4HMZA 4HAMA 4AQ2A 1LDDA 2JT1A 2IJLA 2H27A 4XSZF 2HKOA 4Z2YA 3U9GA 3HSEA 1ZZ9A 4I3PA 1U78A 4HX8A 3PNAA 1FT9A 3RNSA 5IT9K 4KWJA 2JPCA 3ABTA 2WV0A 4O9GA 1TW2A 3V4GA 2A69F 1EP0A 1R5GA 2EB7A 4RGRA 5J8FA 4XF0A 1B9MA 2BV6A 4IHSA 1R58A 5CVUA 4TLFA 3LAJA 4IEUA 4IEWA 2A5YB 2L4MA 3DPTA 2HOEA 1G6NA 4AWXB 3OF1A 4QGNA 2ESNA 3HSRA 3ROUA 5JSRA 2MPFA 4HOBA 1ZH5A 3QU6A 1K78B 3I58A 1J58A 5F64A 3DN7A 1WGPA 3IKVA 4RB1A 3F72A 2QJVA 4HYEA 3B02A 1O3SA 4HV5A 4I09A 3VOEA 1DPUA 3RI4A 3FE5A 2HQNA 2UXXA 4HQEA 4Q47A 1KU7A 1ZRFA 3VEPA 4UVAA 5JI6A 3T8TA 1UHMA 1UIJA 5J48A 3RKWA 2QVSB 4MH0E 1QY4A 1KQ8A 3WE2A 2QVOA 1B9NA 2VPVA 3BJ6A 5DUIA 2L4AA 4FBFA 4CZZA 4I7HA 3I59A 1V70A 4XFBA 2GQQA 5DCMA 1FYLA 3CTAA 1RUOA 2LF8A 1LKNA 2VE8A 3TO6A 2FRHA 5FB2A 2JRTA 3O6BB 3TNPB 1QPMA 3E5QA 3ZQ7A 3ECOA 4PZJA 5L3GA 4R8HA 2ZMEA 4FX4A 4XF9A 4HDUA 4KIBA 1EYBA 4JTOA 2DFIA 1RZ4A 3RIRA 1EV7A 2DAOA 3BPZA 2FMYA 1X8MA 2GA2A 3O2PE 2F2EA 3WW1A 3GFJA 4HF2A 1Z1DA 4RGUA 3RPQA 3E6MA 1D3YA 4HQMA 5ED4A 4HVQA 4ENNA 3GZ6A 5E1RA 4RB3C 4KNYA 4LFUA 3BU7A 4Q0PA 2I45A 3L2HA 1OKRA 3FWEA 4I2OA 3FHIB 2HKXA 3WGGA 2D40A 1ZG1A 3GBFA 2UWMA 1B6AA 3M7GA 1WLTA 1QO0D 1S7OA 3JZVA 4IETA 4GGGA 3K0LA 3MEXA 1LDJA 2LF7A 1YLLA 4PGHA 1DP7P 2Z9OA 3RZZA 2VC1A 1XE8A 2ZCWA 3RYRA 3GYHX 1H0MA 3U10A 3JTHA 3IWFA 2NRAC 5DYMA 3F6OA 1FNNA 5BXXA 2VT3A 1QBJA 2P4WA 2XL9A 1SD7A 3KEOA 5E20A 5DCFA 3WGIA 3G3ZA 2XIGA 1T38A 2VOPA 2HZTA 2GAUA 4GXOA 4L5IA 1HBXG 4XF1A 2DQRA 1KQ0A 4EWAA 2F4PA 2HWVA 3FMRA 1O3QA 3HT2A 2KKOA 3LA2A 4GYIA 2HEOA 5E1XA 4D7TA 1ZVFA 3E5XA 2K02A 5HS9A 3FMQA 4E2SA 3SMHA 4YARA 5I0SA 2RGVA 1BI0A 1MD0A 3M1EA 4KFCA 4U0WA 3D5LA 3OGJA 4WZCA 4L5JA 4B09A 3EQLF 4LJZF 3BCWA 3RKYA 2ZKZA 3QRFF 2MBFA 2PTMA 4Z82A 3K2ZA 1Z7UA 3L00A 2PMUA 1USSA 3GXOA 5ICFA 1XCVA 3KMHA 5EFUA 1S3JA 2VXZA 3VODA 3KSCA 5J3UA 3KZZA 3EQEA 4IEVA 4G9YA 5KK1A 3ZMZA 4L18B 1ZN2A 2X4HA 4FHTA 4HN0A 5CVVA 2N7GA 5K5RA 3MYXA 2CO5A 4MEXF 2K4JA 4Q0VA 2XAJA 3MPBA 3S7EA 4LB6B 4HA8A 4A5NA 1WWXA 3I5UA 5JCTA 2CSOA 1ZAOA 2MH9A 3H3ZA 3H8UA 4PIZA 2VBWA 4ZYGA 1TQPA 4UV9A 1BC8C 1ZGAA 5FLJA 2MD5A 4BYYA 2JZYA 4HLXA 5DCMB 5EEHA 1YUDA 3V7CA 2GC1A 4E2GA 2A68F 1ZG5A 2CGPA 1FXZA 1H9GA 1I27A 2P7CB 2K0GA 3ES4A 4YG2F 1BI2A 5FD5A 3PLQA 1UIKA 3D82A 4JV4A 5TRDA 3WW2A 3BPVA 1V4RA 1B4AA 4OU0A 5IT9Z 1IPKA 2DT5A 3HSFA 3ELKA 3V8KA 2GA1A 1FY7A 3I0TA 2IXJA 3QOPA 2OBPA 4H7LA 4YSFA 4U7BA 1IN8A 4YIIA 1FBUA 2PLYA 1W7PB 1R1TA 2HGCA 2XV4S 1JGSA 5HDGA 4IRGA 2D1VA 1T98A 3CO7C 2DTRA 2ACJA 2QYOA 4OMYA 5ICGA 1OYWA 4FAGA 4LD5A 2QZ8A 4MGRA 2HTSA 5DD4A 1R22A 4WF2A 1FP2A 3WTTC 2ZXJA 5HOOA 1XSVA 4AVBA 2PI0A 2ATFA 4M71A 3FFQA 5I0TA 5FLHA 4LG0A 3BALA 4A6EA 5E1WA 1J59A 4O6JA 2BYVE 1HW5A 3IBMA 4YFKF 4JK1X 4QX5A 2DW4A 1HQCA 3DQVC 4OINF 1QXJA 3PVBB 4AIJA 2HDCA 4ORFA 2GXBA 2J5OA 2NNYA 3Q9VA 3HRMA 4GCVA 1R1VA 1G4DA 5I8TA 4Q0SA 3SFZA 4XSXF 1Q5OA 3FHZA 1IW7F 2HQRA 4X6RB 1MDMB 4IJAA 3HTSB 2XLAA 2Y0OA 2BE5F 3OTFA 2O6GE 3CUQA 1FSHA 3T5XA 2FEZA 3COAC 4ESBA 4ZYHA 1Z91A 2P6TA 2P17A 5BPIA 3QPHA 3WTWC 3G7DA 3HHHA 3WTYC 2K9ZA 4M6XA 1IZ1A 5ERIA 1BI3A 3TNQA 3EHKA 4KL1A 3I71A 1KA8A 4OIRF 4A12A 2FNPA 1GQHA 2FA5A 5I0RA 1PP7U 2KIFA 3P7NA 2ZFWA 2RQPA 4R52A 3ZN0A 3Q5FA 5JSPA 5LEJA 3L09A 1I6XA 1CAVB 1LB2A 2OD5A 2XGXA 2ETEA 2CAVA 2OYZA 4MGZE 5FPZA 4KN7X 4EM0B 3PQKA 1IN6A 5FLXK 2FU4A 4JQFA 4EGZA 3ZP5A 1ONVA 2FSWA 3LSTA 2HS5A 1H1MA 4IEQA 2V6CA 4RB0A 3FXQA 3IL2A 1ZLKA 3UKVA 1BJAA 4ETSA 2BGCA 2Q0AA 3P9IA 4KMFA 5HLGA 2G7HA 1MGTA 2DPUA 3I53A 5KVRA 3JAMK 5LHHA 5D6EA 2VE9A 1ZREA 2OZ6A 1SD5A 2IA1A 2E7XA 2O3FA 1IN5A 3BZ6A 2CYYA 1DZRA 1LEAA 4Q5SF 1IXRC 1RUNA 3DL3A 2MC3A 4S04A 2K86A 4HV6A 5A2QK 4IF4A 1XE7A 3SXWA 3GFIA 1HSTA 1VR3A 4HX4A 1WQ2A 4UUVA 1JHFA 4HBLA 1BN5A 2GZWA 4E70A 3WODF 2Z2SB 4D7SA 5L3CA 2KJBA 3WTVC 3OD0A 2XRNA 3NEUA 3SCGA 4IEOA 3U2RA 3NVCA 3J80K 1J3QA 1Q1HA 4IEYA 1YLFA 4IPAA 1P2FA 1DDNA 2H94A 4AVAA 2OZJA 1C0WA 5BPDA 1KQ9A 3LOIA 2ZMEB 5J7MA 2L3DA 5LHGA 1VTNC 3EETA 4IRHA 2FQPA 1IRGA 3H7YA 1F9NA 2B8MA 5LRRA 2W24A 1U6GA 2AS5F 1HSJA 4HSLA 3R4KA 4XEZA 4UVCA 3EYYA 2Q8KA 1FLIA 2EFOA 3H92A 4WVZA 1U5TB 1F4KA 4ESFA 2E9QA 3EJKA 4MX3A 1KU2A 2PEXA 2XLGA 4HDVA 4HSJA 1STZA 1PM7A 4MTDA 2FMLA 2IA2A 3K1PA 1GHCA 2OA4A 2BNOA 5KBFA 1T6SA 3C7JA 3NSTA 4WX9A 4L0YB 5JHUA 2VBYA 2TDXA 2ZJ2A 4K8FA 4JVAA 4X6QB 4CHUA 3O14A 2QENA 5T3NA 3F8MA 2A6HF 4QWQA 2V1XA 5ILUA 3SXYA 1UHWA 1FYKA 1TLHB 5C8WA 1JXSA 5K1YA 2XKPA 5D5UB 1RTVA 2GC0A 2YR2A 1W7PD 1R00A 3JW4A 1GVJA 5KHIA 1W7PA 2PYTA 1K79A 2MH2A 3NW4A 4M72A 4BHCA 2Y0MA 5E16A 3M8EA 4LLNA 4ZU5A 2RKHA 2DBBA 1SEFA 3NL1A 4XFAA 3DKWA
chains in the Genus database with same CATH superfamily
4XJWA 5DDGA 4YYOA 2VCAA 4U36A 1QGPA 4XBQA 3U14A 1TMF1 2P6SA 2MEV2 1FEXA 3PIJA 5FY5A 1DQ5A 1GUIA 1FTTA 5JXIA 2RE9A 3H1WA 2Q8DA 4LLOA 4IE6A 3J7AY 2P2KA 3HIFA 1GOGA 2XJPA 2EFPA 4N7IA 5DPNA 3BTYA 1V6MA 5EG0A 3H1MA 2M45A 4QQ2A 4C30A 3TW7A 4LEJA 5IPAA 5A7QA 3IAM2 2KRCA 2CQNA 1RL3A 2BY0A 4AVPA 1A04A 3OGRA 5F08A 3O1TA 3BROA 1S55A 1M1EB 1GUUA 3CCJI 5FMOS 1OVSA 1BLZA 1NY71 4WXCA 4EQQA 1MH4A 4RFT0 4K21A 2LMDA 2W57A 1JUPA 2WINB 2W2IA 2NVXJ 4CCNA 1MZBA 2QCSB 1AF9A 3IDEA 3FMSA 3LSGA 1PK6A 3AZWA 3GM8A 1XSXA 3QP5A 5B2GB 2FQ4A 2XOMA 4FI9A 2XB6C 3T1BA 3LWCA 4NPMA 4QDSA 1A31A 3QU3A 1YRNB 2EIMH 2O8KA 3FL7A 4NQWA 5FZKA 2M7BA 3R0JA 4B1RA 3P9CA 5A33A 1F5TA 3T0AA 5JVVA 2HR3A 3Q0VA 3RZMA 3AX4A 4OHXA 4E2QA 3WDUA 3MDPA 4A3GJ 2UWBA 3WP6A 3PU8A 5FOJB 2P81A 2LY2A 4IGQA 2V73A 5DAWA 4CCKA 3IC7A 5F9TA 4AM3A 5DTDA 2D45A 3LSDA 2VNOA 4PDWB 4B1LA 4WM8C 4UB8C 1UYXA 4NHXA 1MNEA 3ETPA 2HFHA 2R7SA 3PJQA 2NMNA 1X58A 1WMEA 2FE3A 5EQUA 1P4AA 4DBQA 4WBBA 4QM8A 4XVHA 4HT1T 1UYZA 1RUI1 2IXCA 2W1QA 4I0BA 2XAFA 4EM2A 4IXAA 5C9AA 3F3XA 4OUSA 5A3TA 2A61A 3UKNA 2ME0A 1UZWA 1HKDA 1VBE2 1XMKA 5EJZB 3H9GA 1D1BA 4Y24A 2PFBA 4TYSA 4YFWA 2ENRA 3MUY1 4GMP3 5I91A 4YG6A 5LEKA 1OH3A 2E7AA 3L2RA 4RM3A 3M3QA 1NLRA 4FO9A 1XNTA 5DUKA 1PX3A 3NJXA 3M8FA 2V1UA 2J1UA 2DI3A 5DV5A 2RJ2A 4RMNA 1AR61 4XJAA 3KS7A 2R072 1GLNA 1HQWA 4Y15A 1NAEA 1RHI2 4N43A 4Q4X1 5H20A 1JE8A 5CFDC 4NIIA 2WNVB 1ETKA 3V0BB 4CTEA 4CDXC 2R3SA 2Y9ZA 2GM4A 1GOHA 5TJJA 2FBIA 2OPTA 3LQRA 5D8KB 5EDNA 3H0DA 3GUDA 5HCHA 2KFDA 4LLFA 2EVXA 4KU7A 4U7DA 4FXGB 2R0FA 2A75A 2KA3A 1DZQA 5H9PA 3WCSA 5FMCA 4ZKTB 2A6YA 5E3NA 4M4RA 2VOOA 4GKYA 2JA6J 1P4WA 3LEMA 3F8BA 3ZX7A 2QTWB 1XYNA 3M07A 2OF7A 1ZHFA 3RYPA 2L54A 3VFZA 2XVLA 3I2JA 4IE0A 2MSYA 2YSRA 4WZFA 5F04A 1ZBE2 1NHAA 3MCZA 1IDZA 2OT7A 4KIFA 4CCCA 2AHQA 3FKIJ 2LKPA 1VQKI 1PMJX 3J8F2 4TTGA 1HLCA 1W1WE 2VONA 5J4YA 1W6QB 4A42A 3EYIA 2E7TA 4U88A 1YQCA 4BLIA 3DEUA 3KYLA 1OLME 5FLVA 2QZ2A 2F5EA 2UYBA 3GZNB 4P5YA 1WCSA 4COWA 2PG4A 5JLXA 2LBFB 1KQRA 2BEOA 2IGNA 2VJJA 3WG9A 3F21A 1VF9A 1WZXA 1WA4A 3B7MA 3S1MJ 1MBFA 1JOPA 4QGMA 2AH2A 2BBYA 4XTPA 1V5FA 1ETQA 2KPMA 2E33A 3GNEA 5D4RA 1TL8A 2KXLA 2CJJA 2VZRA 1XB9A 5L7OB 3CMGA 4KIGA 5F7UA 2J1EA 1N25A 3Q0UA 2VZ1A 5FZBA 2L7MP 1OHFA 1SAXA 5CU1A 3C7GA 4IERA 5GPAA 2EF6A 2KIMA 2WAAA 1SFYA 4ES9A 1QGLA 3RSJA 1DQ0A 3W59A 3E3VA 1UZZA 1TQIA 2VB6A 1NCQB 3LSKA 3SZPA 3AL6A 3Q8AA 2YG0A 4YW2A 4QTRA 2M8EA 5ISLA 4JKMA 1D1CA 5FZ6A 2K7LA 5A6XA 5M5WJ 2IA0A 1PHMA 4XKWA 3CZUA 3GTPJ 3AZVA 1MSFC 3FFZA 5M5YJ 4Y20B 4PGGA 3T30A 4CPBA 4A45A 2ZXIA 3BIEA 4IHYA 1O91A 3UJOA 5IAVA 2VL8A 5EXOA 2BDRA 3BR3A 1XMAA 2QQAA 2VUCA 2BVBA 1DPRA 3D8CA 1V3FA 1K4SA 3NJVA 1W36C 5FFOC 3F8FA 1W05A 4Y52J 1O4ZA 1W8WA 3HYIA 1W9WA 3N9PA 4UFHA 4MQVA 1D7PM 2NYYA 3V42A 5E8IA 5D5VB 4RB2C 2JG9C 3L2VA 3T8RA 3RZKA 2RM22 3KEQA 4EJVA 3WU1B 2Q0OA 1XDSA 2X51A 3OSDA 5F3GA 1HN0A 3Q8FA 3MWMA 4XLCA 2WT0A 2QSHX 4KH9A 1NG6A 3S5AA 5CA6A 1USTA 1W8OA 3WTSC 3GTKJ 1SMTA 2GXGA 3QYFA 2V72A 3OYHA 5JOXA 2CRGA 4HANA 3PJRA 4M6YA 3BZKA 2DUQA 2K4BA 2OPKA 2R5YA 4QKBA 1N1TA 5A32B 4B4QA 3KZIC 3W21A 1UY4A 5CB7A 1DZTA 4KWKA 4IVNA 4LMYA 2KMUA 1BM9A 1Q8QA 5FO5A 3RQ0A 1IXCA 4KUMA 2V5DA 5FYZA 3HRTA 3SH4A 1XDUA 3B9CA 2ZFUA 3FX3A 2VECA 1U3EM 3HPNA 2ZSHB 1RVF1 2W25A 4GMP1 3BLYA 4XOGA 2VUDA 2M0CA 3OV8A 3GTMJ 1RUF1 1I1SA 4OHYA 2JE9A 1X1BA 1DU6A 2M1BA 3MQ0A 4P9IA 2UURA 2VBXA 3KV4A 3MD2A 1R49A 3UJQA 4IE7A 3TEWA 1ZZBA 4QU2A 5J6XA 1FBSA 3BODA 1LDKB 4QQPA 2ZNZA 3RZLA 1COV3 3JCIA 3VKFC 2CYFA 2AUYA 3BIWE 4QT6A 3ZSLA 3H9QA 4TSVA 2O14A 4CDWC 4BIFA 1RC6A 3H1YA 2VW2A 1W0OA 2PAEA 4GO1A 4AFAA 2QQLA 4MQ9F 3LIGA 3LEIA 2UWAA 3ZGKA 4CA0A 3VBUC 3J7NA 3ACFA 4XUPA 3IAS2 2WN2A 3WHTA 3V8JA 2Q2EA 2P8TA 4Y4RA 3FBNB 1X82A 4Q2FA 1U0AA 2LRPA 3E6BA 3ZN5A 2P5KA 3N4MA 5FZCA 2PLV1 4RFRB 3S30A 2ZO4A 3IRRA 3WHBA 3KHBA 2D3PA 4ZU4A 3ZFEA 3ULQB 3QH7A 9ANTA 3OGGA 4LHSA 1I9RA 2M5WA 5FTTC 4Q48A 1JUHA 3VDAA 1SVLA 5HNFA 1ZK8A 4DJAA 4ITCA 3L2QA 5BS6A 1IN7A 3PQJA 4G7OF 3ISPA 3ZN6A 2RVCA 2ZBKA 4RHV1 4E4DX 3NQHA 4PJLA 1LVAA 1AOYA 4LK0F 1OQDA 3C7FA 4Q26A 1UXXX 4KBBA 3ZDSA 1PM4A 4YGEA 3VBUB 1MACA 3GEZA 2K85A 4XCBA 1MVEA 1ULEA 1OJLA 4LBOA 1H2NA 4XFHA 1VQOI 5FDBA 1W8FA 1WCQA 4MO3M 3RZDJ 1GZWA 2YS9A 3A03A 5ANQA 1OVPA 3C3VA 1YFYA 2WZR3 4COVA 2V4JC 5LZ6A 3PDQA 1WSUA 1QXPA 1SLLA 1SBEA 5FZHA 4Z1VA 2XXZA 2IGOA 3S15J 1VBC2 4EEFG 1UKGA 4MUVA 4ZTFA 4Y1XA 4P9XA 4ES8A 2B0LA 2ERFA 3TW6A 3O8GA 4NHJA 1MZEA 3SDBA 3LE0A 2M30A 1YQAA 5E79C 1JI8A 2JIJA 1ENHA 1HOMA 2DU0A 1SLIA 3CJRB 4II3A 2ZX0A 3CL1A 3WF2A 3FXRA 2QQ9A 4FE7A 4BMBA 2XUBA 4IHXA 3HBLA 3GBWA 4XMAA 1NTCA 4G3YC 3IZOA 2CQ7A 5JMCA 1JTZX 2WTEA 2VQTA 3J81Z 4LE3A 1LNSA 3EUKL 1HDPA 2FF4A 2WQ4A 2IGMA 3TGNA 3S2HJ 2Q8CA 2Y75A 4EJWA 1W39A 4MGSA 2GU9A 3J80Z 4DRVA 4Q4Y2 1IQDC 3SQNA 1V9U2 4AWDA 2E35A 5DUXA 4M0NA 1BR1A 3TEDA 1I1EA 4NHLA 2HEYF 2XB0X 5M0TA 1U5TC 5FMBA 5CISA 2RN7A 4XFFA 4HRIA 4XLFA 3NJZA 4OLLA 3ERMA 1JZ8A 3NNLA 4XABA 1CZVA 1SFKA 5DUUA 2IAIA 5DUVA 3AMHA 4JHZA 4G94A 2Z33A 4NC6A 2AQFA 1FOD2 3J26N 3W5NA 1F35A 4IE4A 3RS6A 3T2QA 2YMZA 4JRLA 4Z2WA 1DFQA 2JWPA 1YO5C 3D0SA 3GWZA 2DV9A 4IHVA 1H1IA 3E5UA 1GLHA 5DAVA 5DQ0A 4LUMA 2JTVA 2X0LA 2C26A 4XUQA 4HKOA 3N9OA 2YU3A 3M3OA 3JQWA 1IN4A 1MS5A 2P5VA 3POSA 5LBBA 2PHUA 1ZBE1 2R7UA 3ZSKA 3NNMA 1WJCA 1V6OA 1G59A 2Q8OA 4XPVA 4D69A 2KRFA 1OURA 3OUIA 5FUPA 2COBA 2FDFA 3AKZA 4KDPA 2BVLA 3U11A 5JOYA 4GDFA 1LGBA 1BI1A 1W6PB 3PFYA 5KHKA 5BNGA 2CQKA 3ZSMA 2VULA 1MQTB 3AKSA 3DKQA 3OPZA 5TGTA 1E57A 3ETQA 1UY0A 1ZRCA 2E6VA 3B73A 3KP5A 4F92B 1RUC3 4LA3A 4RSUA 1AX0A 2M7AA 4BU2A 1FV2A 4D6QA 2D97A 2BW3B 4DYRA 4P9GA 4RAZA 2ZGNA 3CLOA 4C90A 2BNNA 1WRJA 1YRNA 2IZWA 1LOBA 2XJRA 2YPRA 4UFMA 4LITA 1G3WA 2H6BA 3E97A 4PLNA 5HS7A 2P5LC 3QP6A 4Q4X2 2JVGA 4OIQF 1OF4A 5HV4A 2RJKA 2CNAA 2V5YA 5BNPC 1EAH1 2KZGA 1ZYBA 1V6LA 3QBQA 5HXVA 2DLLA 2OXBA 1L0OC 5FQ0A 4JQTA 2VR4A 4CUAA 3BPSA 2JJ6A 1HXDA 3QLQA 5JMOA 4EN6B 1NXMA 5DM7F 1UXZA 5FKMA 2Q1ZB 2G19A 2ARAA 1C4RA 5LBEA 3DTKA 2O03A 4XRFA 2L02A 1YS7A 3FZVA 1I6HJ 4LOTA 2W48A 4M3CA 3OYGA 3BG5A 4HF0A 2QKMB 4DFSA 1S2BA 1EKEA 1JOJA 5BPXA 1N1SA 4CDXB 1QHDA 5CIRA 3AP9A 2GC2A 3IKWA 3OPTA 4J01A 5BNOA 3M4OJ 4NNJA 3J7AO 3FIWA 3MF9A 5DZEA 1X9PA 1FOD1 4JGYB 1K6OA 3ZQGA 2PX9A 1AVBA 5LA9A 5BNNA 1GV9A 3V0BA 4XUOA 1S0IA 2VQAA 1MS3A 2VNVA 2MNGA 2XGCA 4H4KC 3K4KA 1YJNI 2XBO3 3HOSA 4QU1A 3TN92 2OS2A 2ET1A 5ICCA 3EMRA 4P9JA 3T2PA 3DFGA 3F0CA 4FX0A 2R041 3U21A 3JRGA 3HOXJ 1HIXA 2DCYA 2CWEA 2BGPA 3J7ZI 4IV3B 4YIRX 3SKJE 4W6YA 2QNKA 4FPKA 3K75B 3KCYA 1R7JA 3MHZA 1BW5A 1ULOA 4G7ZF 4LTAA 1F1ZA 1H89C 3FUOA 1RMU2 3LGRA 1LKXA 1RVF3 2QLZA 3RQIA 2R7XA 1S2KA 2VQUA 4PJMA 4O9EA 2R7OA 1ZQ3P 2YBPA 5G04L 5FLIA 1X3UA 1YX3A 2VJ5A 3FDYA 1D8JA 1RPWA 2ZZJA 4JAAA 1VLNA 3AFKA 3SQOA 5C44J 1LDDA 3R0RA 2TUNA 4HNUA 2IJLA 5B66C 2QQUA 3U9GA 3O8HA 4CP9B 4B3NA 4I3PA 2UU8A 2IS4A 2X5IA 1Q8PA 5JR2A 2JPCA 3ABTA 3AK0A 2WV0A 3ZYBA 4NIHA 1TW2A 2EB7A 2BOIA 2VM9A 1B9MA 1R58A 3GALA 2BOJA 4IEUA 3OSFA 4IEWA 2L4MA 4C2UA 3OF1A 4DUXA 2MPFA 4KWUA 3I4MJ 2EZHA 3N7KA 2C9AA 4LBKA 1CX1A 1AX1A 1IKQA 5HV0A 5J1RA 4RB1A 1AR92 2WNUC 5FYUA 3VOEA 1DPUA 4C91A 1TWFJ 3FE5A 1S0BA 3DPUA 1BJQA 2YV8A 1JMUB 2QQIA 1QVUA 3OYJA 4Q47A 3ATGA 1A34A 3C8XA 4BM8A 3ZR8X 1S9HA 1UIJA 3OBAA 5J48A 3OGVA 1HJFA 2HOAA 3BJ6A 1MEC1 2KT0A 5DUIA 1W2NA 4DOZA 4FBFA 2CUFA 3I8TA 1C8M1 1V70A 3U75A 1SG3A 4J25A 3POJA 1U5XA 1A6CA 3I49A 2LF8A 2QSGX 5A6YA 2VE8A 3ABKH 3TO6A 2X10A 1QKQA 2ZJCA 4ZZ5A 4DW6A 1OCZH 5L3GA 1EV12 2HLEA 4A44A 1MZ6A 2FCVA 2ZPXA 2ZMEA 5F3IA 5FKBA 4XF9A 1TME3 1HQNA 4HPQA 1PVC2 3HOVJ 1HB4A 3RIRA 3BPZA 2EIJH 2FZ1A 1X8MA 3KV9A 2YUSA 3O2PE 2F2EA 3WW1A 3GJAA 1PVC3 4HF2A 1UY1A 3AZXA 1BCXA 2ZGSA 1ZKGA 1EJ9A 3E6MA 3JUUA 3IH3A 5ED4A 3GZ6A 3G1MA 4KNYA 4L99A 1W28A 4I2OA 1QJFA 3FHIB 4ASMB 2HKXA 1ZG1A 3BR6A 3HXLA 2UWMA 4QQLA 3C7HA 3M7GA 1WLTA 5IVEA 1QO0D 4HG2A 1ENXA 1LDJA 2LF7A 1XNBA 2XONA 2ZABA 5DAQA 2A3YA 3CF5F 3BVCA 4M01A 2GNDA 4XBLA 3KD4A 2X09A 1H0MA 3U10A 5E3LA 2DYSH 2BHZA 2VUMJ 3KF5A 4QX8A 4Y1YA 1FNNA 2ID4A 1MMAA 3MW2A 1QBJA 3AP4A 1UMIA 3HJRA 4XTMA 1FJLA 3MMYB 5E20A 2PLV2 1W0NA 2W91A 2M34A 5DCFA 2HWF1 1T38A 1JJ8C 1UO9A 1XTAA 4XF1A 3M2MA 1Z3YA 4FCYA 1IG7A 1YI9A 3S3MA 2HWVA 1MS9A 4DS0A 2ZHKA 4JOMA 2KKOA 3LA2A 4GYIA 2HEOA 5E1XA 2Y9YA 5KHDA 1ZVFA 2K02A 5HS9A 3FMQA 2B7YA 4QHOA 1JJ6C 1PZ9A 4AI0A 3BCAA 1DYPA 1URXA 4XZPA 1A5JA 4CDWA 4YARA 5FZFA 4KISA 5I0SA 4FASD 1S0FA 1F8VA 2RGVA 1BI0A 1MD0A 2VXDA 5HNHA 4O61A 3IPVA 1OFSA 3B94A 3K4BA 3D5LA 1H8AC 4L5JA 1EV11 3EQLF 2P6CA 4K40A 4WM7A 5J4VA 2PTMA 3OWTA 1HB3A 2ZTNA 2PMUA 3TRSB 2C5DA 3GXOA 3K70D 4LORA 5CKQA 1S3JA 4EN8B 3IUOA 4FE4A 5J3UA 2EIGA 3EQEA 4IEVA 1JYTA 3JQXA 1Q8VA 3BG9A 1H4GA 3S8PA 5T54A 1SAUA 2CWMA 4LOSA 1ULPA 2HWF3 2J22A 3B5LB 4HN0A 5FKOA 3OOXA 2B9SA 2OTJI 1V54H 5K5RA 2BTVC 2E63A 1RVF2 1YCIA 2Q1FA 4X8NA 3W5MA 2Y60A 4X1EA 1PIV1 4LB6B 4W65A 4ITVA 4A5NA 2XWJB 5DG1A 1WWXA 3VBHC 4XXPA 5M3MJ 2UV1A 4ZYGA 5FLJA 2MD5A 4BYYA 3K4DA 2KDZA 5FZOB 1PYVA 3KCXA 4U2AA 2GC1A 2ZSIB 2VL4A 2HEWF 5J1UA 1KD7A 5DDJ2 2HXOA 2DFFA 2P7CB 3DEEA 1OLMA 2YHJA 3M8JA 1DQ2A 4JV4A 3ZFGB 3ON7A 4AG4A 4Y22A 3WW2A 1B4AA 4Q4X3 3M4FA 1BR2A 1GDTA 2R063 3M3EA 2JVHA 2IXJA 2BWAA 5L9BA 2HWC3 1IN8A 2LD5A 5T5JA 5DDJ3 2VOKA 4A41A 5A3UA 5HDGA 2D1VA 1T98A 4DXSA 4QPGB 5J37A 3GTLJ 1JUMA 3DYOA 1AU7A 4OMYA 3AYDA 4QPIC 1WCUA 1X1AA 2QZ8A 4OI0A 1R22A 4BBRJ 2VPRA 2W4SA 3T2OA 3UYJA 3WTTC 3J8F3 5HOOA 1XSVA 1BEV1 4M71A 5I0TA 3JBG1 2ZEYA 3BALA 4A6EA 4O6JA 2BYVE 3CCYA 4RLQA 2BERA 1Q8SA 1ZBE3 4P9LA 4N4NB 2ORZA 2PMZA 3PVBB 4HXCA 2IS6A 1OBNA 2VPLA 2NNYA 1QJU2 3AL0C 4FPJA 2SLIA 3KT1A 3V64A 3SFZA 1G9CA 5FY9A 2CDPA 3FHZA 2ZBJA 4RS5A 5K9YA 2E7QA 5CKTA 2HQRA 1VB2A 4FPYA 4UY8I 1R6RA 1W2AX 1H1AA 4S2FA 3VLBB 2DF7A 1FSHA 2BQPA 3FBMA 3T5XA 3ZRGA 3PM1A 1P7JA 4XHBA 2A73B 4BQ1A 1G7YA 5LCWL 2K9NA 4PI2A 3WTYC 1HRV3 2WS91 1ONAA 4EN9B 5CZKA 3LSPA 3FBIB 3I71A 4Q4W3 3NNGA 4W50A 4IV1B 1VFCA 4IV3A 2ZFWA 4R52A 3PIOF 2HWC1 3ZN0A 2E2JJ 4MYEA 4RR3C 1VQ8I 2WB1A 1HC8A 2GNTA 2HWC2 1T2XA 4AQTA 4CE8A 3USUB 3WP5A 2PJRA 3NWKA 2E31A 4NQWB 2R062 3TL4X 1E3HA 4MGZE 2XJUA 4EM0B 1CJDA 4GWMA 1TVGA 1IN6A 1BKZA 3WF4A 4BJ6C 2RDSA 4XILA 4FSJA 3RZOJ 2HS5A 1QJX3 4X0GA 1AL23 4RB0A 3FXQA 3IL2A 3WQBA 1BJAA 1OQEA 2RDRA 4QSHA 1AR71 1DBNA 2QQVA 2DPUA 5KVRA 3CCQI 1IO2A 2JDNA 5D6EA 3WQ7A 3ZFGA 2VE9A 1D4M3 1MQTC 2FCUA 1Y56A 4LHLA 3ZPOA 2Z79A 1TEIA 1B35A 1JZ2A 4MXWB 1UG2A 4A3ZA 2EINH 2MC3A 3AVRA 4S04A 3PURA 4K8RB 4DYQA 3SXWA 4COYA 2Q1MA 5K7FA 1JHFA 1VAKA 3WODF 4G9SB 3OD0A 4IEOA 3NVCA 3I4IA 3J80K 3PO3J 2DYCA 4UUSB 1TME2 1YLFA 2HWB2 1DDNA 1ZR4A 3LOIA 3H3LA 5J7MA 1HRI1 5FJ8J 1RHI1 5EYRA 2ZX1A 3H7YA 2TNFA 3A1YA 3MGUA 3CMAI 5LRRA 4JHTA 2A5WA 2ELKA 5JHFA 4JDNA 3R4KA 1V9U3 2Q8KA 3CZJA 1NH3A 4ESFA 1MMNA 2HYXA 5H2FC 5SV5A 2XLGA 2ZHNA 2DBIA 2K3FA 2VXJA 1LOFA 4HSJA 1PM7A 3ZN6B 5BYNA 4XBNA 4KI5M 4QPIA 3C7JA 2HXIA 4BGDA 4XUNA 3F2ZA 4WX9A 1W8NA 2VBYA 1AR93 2R073 4K8FA 4JVAA 2VCMA 2BY3A 1YQ8A 2QENA 2PLV3 2V1XA 1OQ1A 1N75A 2Y69H 3SXYA 4RBOA 5J36A 1UZYA 4IHWA 4PLOA 3K3OA 2ZZQA 2DCEA 5H9QA 3CP2A 1W90A 1GVJA 2JG8A 5KHIA 2MH2A 4M72A 3RMYA 5E16A 3GTOJ 3WVJA 3MEPA 4TZDA 4XFAA 3NL1A 4U0VA 3SZTA 1YI7A 1OYYA 2R0HA 2EV6A 3P3NA 2WAQA 1SD6A 2VY0A 3MIHA 4P02B 4A3IJ 3GHNA 2EV0A 2VIXA 3D5OA 2W39A 2A07F 1X1CA 3VBHA 2QFEA 2WR9A 4C1WA 3LAPA 3R60A 5H6RA 4IE5A 2Y33A 1AR81 3BJOA 3I2FA 2LALA 1FOKA 5FZEA 2CL2A 3CNAA 1ON1A 3P5BA 2DTYA 2ISZA 1PMIA 4OVEA 2QQWA 2H09A 3ECHA 2PAKA 1H8TA 3QAHA 1YRZA 1E5RA 2ISYA 1Z7LA 4AI2A 4EJUA 1Z21A 2OKXA 2BBVA 3GFMA 5CPRB 3NNFA 2ZX2A 3GYDA 4EJTA 1MJ9A 2YGMA 5LK7B 3ASOH 4GJZA 1CX4A 3WTZA 3KCCA 3TEYA 3NAPB 3B3QE 2L5QA 2E32A 1XXNA 1W5SA 3FBYA 4UB6C 2NMOA 3L2CA 4L2NA 2P7VB 4UV8A 4FTEA 2Y26A 5D1IA 2MLGA 5ERLA 3OOPA 4Y17A 2RC4A 2WZ8A 4Y1ZA 1WW5A 1AL22 3ZOBA 1QJX2 4M9ZA 5GAEJ 5A32A 4LO4B 3JD71 2E1MC 5FZ4A 3OYBA 1L7LA 1HKTA 3OL3A 3NRVA 3T0YA 4DY3A 3H5AA 4U87A 2HYGD 1RESA 1DIWA 1OOPB 4HFSA 4D9JA 4BQQA 2XH6A 3UL2A 4Q29A 1XC6A 3NV3A 5F32A 3ZXLA 1AX2A 2VVEA 2O1QA 2WZR1 5FYIA 1MR5A 4B3AA 2R7QA 4OOIA 4MXVA 4M9XA 1MQTA 2E53A 4FQGA 1GNHA 2XVCA 2CS3A 2B7EA 3ACIA 5FRMA 3NV4A 1FX7A 4QQOA 2LY1A 2WNUB 5J3LA 2VJIA 5JFRA 1EH8A 4LG3A 1QZZA 3A21A 5T50A 1MVQA 4XXAA 3OGSA 1PO23 4MGIE 1YO8A 3S3OA 3H0GJ 4C0BA 2JKXA 1RRJA 2TEPA 2MG4A 2OUMA 2GP5A 2PMZN 1GXQA 1AXKA 1QWRA 2WWUA 3TBIA 4Y4YA 4WM7B 1POV3 2Y0SA 1XN7A 4KQ7A 4ZH4F 3OD4A 2HJIA 5FGMA 4QB2A 1AKHA 1FMD1 4A7ZA 1SPPB 1R083 4KICA 5C4WA 3ZFFC 3C2GA 1PP8F 4C9YA 4L9VA 2XKOA 1LQ1A 4YFXF 3VBFC 3KFWX 1QQIA 4FCAA 2WFF2 2GBYA 2MW8A 2O0YA 1ERDA 4FVVA 5L3FA 2P1BA 3RZGA 5G05L 4Y13A 5EJ1B 1ASJ3 4GXLA 1VBA1 1GWLA 4N7UA 1DYOA 1YE9A 4BWOA 2FBKA 5FREA 3S5QA 4XLEA 3TMOA 2JD9A 2BXZA 2LDUA 4RS5C 1ZBA3 2UUZA 1C57A 4DMIA 3WG1A 5LA2A 2WFF3 3UK9A 4HLYA 4E7IA 2EZIA 1JXNA 2WA3A 3Q9OA 1XU2A 3MW4A 3S7IA 5FY8A 4FPLA 2H0VA 3W2VA 2VMHA 4CP9A 2LP0A 4WWCA 4BDZA 4J1WA 2DODA 2EZKA 3PL8A 5DEQA 3AG1H 3ZFFB 3LSHA 1UB9A 2W1WA 1RXGA 2WIIB 1TNSA 5GZCA 1IAWA 2RS33 4BQAA 4Q5OA 5AIPA 3RPUA 4ZZDA 4XR6A 1LJ9A 2TRTA 4PJJA 1UU6A 4D94A 5ABJA 3A0NA 4G4FA 4YW1A 3DXJF 2EV5A 4D7NA 2NN8A 3WZ1A 4I0AA 1NQJA 4P9WA 4M3CE 5KAFC 5B5EC 2QQPA 3RVHA 3OYWA 3GZ5A 1L3LA 3MV11 4MNUA 3HT1A 4I76A 2X1CA 2PN6A 2I07B 1VRBA 1UX6A 1K45A 1J7KA 1MIJA 3GZUC 2P0WA 3T2TA 2Z3YA 1YC61 5FJKA 3H9JA 1YEWA 2CSGA 2OA2A 1GNYA 4ZZLA 3NO8A 1QA6A 5E6HA 4RAYA 3CCRI 2XVGA 2WFF1 2MLKA 3VZKA 4NHMA 2IC1A 1ULYA 3BR5A 2DOFA 2DMNA 2Z99A 1ND3C 4QMAA 1X8EA 1FATA 2PHDA 2R6QA 4URAA 4CCLA 4LG0B 4DYCA 4Q27A 1IUFA 1VBA3 4ASKA 1YFXA 4Q0UA 1EUUA 3ZKUA 2M4GA 3LMMA 3MKZA 5C4JJ 2WY7Q 1NT0A 3D0JA 1C8M3 4MADA 5LGUA 1XBFA 4UAPA 1R36A 1CWPA 3CJNA 2PQ8A 3S1RJ 3HL2A 2BRTA 2JECA 4CP2A 2P3YA 1W6NA 2FDHA 1MMGA 3RKXA 2KHMA 3OPWA 4QX7A 1BL0A 1OLTA 3JSOA 1MPXA 1YFWA 3DKYA 5FK7A 5GTHC 1ETVA 1G8WA 1QJY2 2JDKA 3W20A 5D8LB 3KT7A 3MZHA 5FWEA 2WL1A 1S29A 3VB2A 3ZMSA 4GFBA 1RKWA 1PO12 3X2QH 2WZR2 1XNAA 3PHMA 5C6CA 4WM8B 3RGBA 4Y20A 1NE6A 2XVKA 1FOD3 3D4KA 1K5MB 3HOYJ 1JZ4A 3O1MA 2DBNA 4KBZA 4CGZA 3TAYA 1EV13 4CUCA 4UW6A 2RG4A 2COMA 2BJSA 3ZR6A 2J1TA 2V7FA 1OXCA 4MGYE 2XJQA 1HXS3 1S2EA 4AHYA 3IDBB 1LEDA 1EPZA 1HW1A 3AKRA 5LLQA 3SDGA 5FY4A 4B29A 3R0AA 1LU2A 2I74A 2B9VA 4AXOA 3K1NA 3PMSA 1LFBA 2F5CA 3V0AB 3I59B 1XNDA 1FPN2 4AEJA 4LLLA 3Q0WA 5FFZA 2PN5A 2C6YA 3LPGA 1VBB2 3QACA 3W58A 2JJ7A 4HVOA 3C2BA 3ZQLA 3NWTA 3NAPC 3JU9A 1KU9A 1FMD3 3BY6A 4F91B 3LSJA 3UKGA 1NG7A 3OYWB 3O1PA 4UXAA 2PA7A 3LOCA 4QXBA 1ZZ7A 4Y26A 5GZDA 2YFUA 1TNTA 1HJGA 2HWB3 4CZCA 2RMU1 2G1MA 4QM9A 2WNUA 2EWNA 1AZDA 1LHUA 1IG0A 5ILVA 4EM1A 2WY8Q 2WABA 4LA2A 1PVEA 2XLFA 5IHRA 1TZOA 2VZ3A 3PUFA 2OZUA 2R7DA 3ABUA 5I0UA 1OOPC 2PQSA 4C8DA 2VZQA 2XF7A 2Z69A 4P08A 1ODDA 3TQNA 2WBKA 2E1OA 3T1MA 3T1LA 4YVWC 2VNRA 1Z05A 1J3RA 1D4M2 4K3UA 1ENQA 4XQ4A 4O5VA 4BKXA 1VALA 1A36A 1Z3XA 1GT0C 1NX9A 2RMU3 1Y43B 1MKMA 3AJZA 4EWEA 2WBMA 1WCMJ 1XOYA 1YG2A 5BMZA 4NN0A 3H50A 4W6XA 4IRIA 4KU8A 4WVVA 3ZMTA 4R79A 4BY1J 4AR2A 3FF5A 3H9AA 1FI2A 3V65A 3THDA 2WRAA 4M0HA 5FYMA 3BR1A 5IVBA 4XN3A 1REPC 1GP5A 1REEA 1SFPA 5ACA1 4Q8LA 1HXS2 3VD5A 1UHSA 3IWZA 5CG8A 3TOAA 1X50A 4ZYDA 1DYKA 3NAPA 1SMYF 2O61A 5IP6A 4QKFA 5I8SA 1ULFA 2OW4A 2FDJA 2DDBA 4CA9A 4B4RA 1HLVA 4EVIA 1YFUA 4XC9A 4OAYA 1FPQA 1JTXA 4EJOA 1B8IA 3PO2J 1SBDA 1QZEA 1W04A 1XYPA 4UBGA 1KU3A 5E1ZB 5LRSA 2ZGTA 1SDDB 2QKLB 5K5OA 4UBHA 3IHUA 3VBFB 3CUOA 1LRHA 1D8KA 5LA0A 1FV3A 3HM5A 3ZQHA 1UPSA 1VBD3 2MFZA 4AAPA 3KZYA 4AFBA 1Y9QA 4NE9A 3KHCA 1BMV1 1T2KA 3ZMOA 3ABMH 5L3BA 1WA6X 1MMSA 1YW8A 1NKGA 2A1XA 1F4AA 2OJED 5K7PA 2OPWA 2VZSA 1QJU3 3HRUA 4NVPA 1YW7A 5EP9A 5LB6A 3KQ4B 3P9KA 1P7IA 1X2MA 3M3CA 2GP3A 3DF0A 3SCFA 3WDWA 4RS8A 1YW9A 4DBRA 3WW4A 3VBUA 3HQXA 1RR7A 3GJBA 4AVCA 1DQ4A 3S2WA 1CAUA 4N9IA 4P9FA 2NVUB 1PGL1 2KLOA 2IXLA 1PUEE 2R49A 2FD8A 1BBYA 3PNTA 4LXLA 3BG6A 3I97A 4EMSA 5FZIA 4Y22B 1SPPA 1OF3A 1JHHA 2RNGA 1KYZA 1Q43A 1RITA 3OY9A 2VN2A 2VKHA 1CVNA 2LBFA 1W8TA 3K6GA 2YB7A 2NOGA 2VMDA 3PTRB 5ICEA 2WUHA 3BG7A 1T08B 1W6MB 2PAMA 2Q4SA 5C3PA 2OAZA 5K0UA 1ZX5A 4KGQA 2F5DA 5J98B 4OMZA 2JQ7A 3MFKA 1RNLA 1Q3EA 1QOOA 4FETA 3B01A 3FXUA 2HVRA 1WGXA 4YVSA 3BUCA 5HXMA 1QRYA 3CDHA 1W8ZA 3CQZJ 1ODNA 5D5XB 4RHV2 3BQYA 2XJTA 1HRV2 5DD8A 3O0VA 4AEKA 2M87A 3JRIA 5FO7B 1HA8A 2WAFA 1NE4A 1VQNI 4LMFA 1LJ7A 5FJHA 1GZ9A 1XGMA 2ESHA 1B59A 4HN1A 2HWF2 5HI0A 2LTNA 4QX2A 4FT8A 1C3HA 2K9MA 2E7WA 2VJ4A 4PJ0C 3BTIA 1IHMA 5L3DA 4N9HA 2PFWA 3F23A 2CV2A 3OYEA 1WH7A 2KR2A 1SACA 1VRH1 5KXCA 1CD3G 4XFIA 1WBFA 2WSVA 5HDKA 2VTFA 3VD9A 3LDKA 3L1PA 3VBSC 3D3AA 5LFAA 1XQNA 1GZWB 4HW0A 3OR2C 4KN4X 1K61A 2L9SA 5KWRA 3SEEA 4CEWA 2GXAA 5FP7A 2EAAA 3BKZA 4UUTA 5JAXA 1V6NA 1S8NA 5FKCA 4AVSA 5FYBA 3SEQA 5K7ZA 3BDDA 3W2AA 2WFPA 5KXBA 2ZHLA 5IJRA 2XG3A 1H8TB 4OIOF 5L3EA 2EH3A 2XHKA 1VPHA 1R71A 3V7SA 2W68A 2BXYA 3JRCA 4R1HA 2QBYB 1AYM3 1VQPI 4TXWA 3ST7A 1DCSA 2DK5A 3PFIA 2W1UA 4CXWA 1PK6B 1OT5A 3KPHA 1OD3A 3WTXC 1KZHA 5FAXA 5HVQC 4K6BA 4P5OA 3KP3A 2ZNYA 1ACCA 2IVJA 4ZYAA 4ZC3A 3FLTA 3SYTA 1HB2A 2JDPA 3DXTA 5LY1A 1NCRB 2Y34A 1CF7A 1I5ZA 5LBFA 4XKVA 3OIQA 1MBHA 3D1NI 4P96A 2DA7A 3VN4A 1V6JA 3K69A 1ZZCA 4BISA 3UNPA 3DYMA 4BUPA 1HKSA 4Y7NJ 3GLXA 4DNCA 3DECA 4NRMA 1REDA 2DYRH 4NBQA 5KHJA 2CV1A 4BB3A 4A3KJ 1ZLJA 5HLTA 1P92A 5FP9A 1UZVA 3OYMA 4P14A 3ZIXA 3TDZC 3I3MA 2V9PA 2ZA9A 4Q1PA 4JDMA 4XNFA 5C4XJ 3KP7A 1LE8B 1PUFA 2KJCA 3J7LA 4A3BJ 2ILMA 5CVIA 3ZXGA 3IV5A 2AYHA 1QDCA 4META 2Z1DA 3S0MA 4INDA 4Q4Y3 5I8YA 1DQUA 2VMFA 4O3MA 2LM3A 2VTXJ 5IVJA 2O9LA 2Y30A 1LULA 4H0EA 4CDUB 5IAXA 3VDBA 2DT7B 3OL4A 1E17A 3KV5A 3VHPA 4NPRA 1F4HA 4FP2A 4HVRA 4WXHA 1O8PA 5FZOA 1R5ID 3OYAA 4OZXA 5C4WC 1OCOH 2PHTA 3N7LA 4WXDA 3MKLA 4PDWC 1RI7A 2YY1A 4DXZA 2R7FA 2QQOA 4IV1A 5ACA3 1BK0A 4UFIA 4HK8A 4L11A 1FIPA 3K4NA 5I93A 4HG6B 4Z07A 1XCBA 3WV6A 4MXWA 3JBG3 4RA0A 3ZN4A 1R092 4QLCU 4BQ5A 2J1AA 3GGLA 4QX1A 5JSOA 3G71I 3HBZA 2Y48A 1GU3A 2YU1A 1WMFA 1PIV3 3ES1A 4YM3A 2WO7A 1SHWB 1LOCA 2NS8A 2XQRA 1OKQA 1QH7A 2JE7A 1QJX1 3NARA 3MVPA 3DBLB 3CJXA 1X4PA 2MEV3 3HQRA 2EIDA 2R043 1NQDA 4HAMA 4BJTA 2VU9A 4XSZF 3JRFA 4CP0A 2HKOA 4Z2YA 3K3NA 3IB3A 4NAMA 5FYSA 2K3PA 1FX5A 4GZ9A 4R9BA 2HWE1 1PK6C 5IT9K 2A6VA 3UETA 1O6UA 4Q4W1 1R5GA 3QYEA 4RGRA 2Z42A 5J8FA 3PL0A 3PUBA 3SISA 5CVUA 4JCKA 1PVXA 3LAJA 1LODA 5JLVA 2JUCA 4IL7A 3DPTA 1QDOA 2AQEA 4AWXB 4QGNA 3HSRA 1G2HA 2R7EB 1ZH5A 4MLOA 4PHZA 4UWDA 4BQXA 2ID6A 3VBOB 5T5LA 1BMV2 5L9RA 3SLIA 3F72A 4FOQA 5L7OA 4HYEA 3B02A 3TP0A 4HV5A 4I09A 5M5XJ 2CU5A 4HQEA 4NIAA 4UVAA 2FCTA 2XAUA 2QVSB 3WE2A 1IS4A 3S57A 4AK3A 1OCPA 2VPVA 2GNBA 5DZGA 1FIAA 4GA9A 3DCQA 4CZZA 4I7HA 2ZGLA 3J8F1 5F5QA 2GQQA 1FYLA 4L5EA 3X29B 1CR7A 4ET7A 2FRHA 2DJNA 1R1A3 5FB2A 4BQ3A 3ECOA 4PZJA 2X53S 4ATFA 3M8LA 4R8HA 3HOUJ 1JKOC 4HSRA 4HDUA 1LPQA 5JZGB 3ZDVA 1QNYA 3K4CA 1SCSA 4M3BA 1RZ4A 3KIOA 3HC7A 2D6LX 4YW3A 1WW7A 1O8SA 1SANA 5BNPB 1EAH2 4XDOA 1TP4A 2CV0A 1YXWA 4CDQC 5EG0B 1FNZA 1GV5A 3AP5A 1AXYA 4HVQA 3DU6A 4Q0PA 2I45A 1U5ZA 1ZR2A 4GH4B 1OKRA 1UL9A 2YBSA 2ZEXA 4IV1C 3HDDA 3DCFA 2QCOA 1S7OA 4IETA 2YDEA 4BBSJ 5CFDA 3HVDA 4PGHA 2Z9OA 3N9QA 1XE8A 3RYRA 5FKKA 2BW3A 1ND2B 2HWB1 2FHRA 1EUTA 2ECCA 1UAAA 4PSXA 2G9FA 2VT3A 2VZVA 4JX5A 3BYWA 4Q8KA 3KEOA 3WP4A 2A6TA 4XKCA 2FBEA 2NVQJ 4XIDA 4W8JA 3G3ZA 2XIGA 1CESA 5JXGA 1BK1A 3LL7A 2OQ6A 2DQRA 2XBO2 3I3LA 3VBSB 1KQ0A 2QDNA 5DMYA 2M0MA 4KG8A 3GZTB 2F4PA 3OEBA 4Q4Y1 2DA5A 3FMRA 1O3QA 3HT2A 2EICA 3MIBA 2VKVA 2BY1A 2VD7A 4OI1A 2BU9A 4GB33 4KFCA 2DDUA 2V4AA 4HNVA 4B09A 4LJZF 3RKYA 2ZKZA 2EAKA 1U0JA 2B45X 4IV3C 4V2WA 3H8OA 1Z7UA 3L00A 3AYEA 2C24A 3V0AA 1PO22 3T09A 3KMHA 4XMIA 3VODA 3IAPA 3KSCA 1XG1A 2FDKA 4XURA 2DVDA 4A93J 4JDOA 1AYN2 5FUNA 5AC91 1WCKA 4IEJA 5CVVA 2N7GA 3MYXA 2CO5A 3OJBA 3LKJA 1R64A 4FPOB 2XAJA 3LSRA 2QQJA 1V55H 4EN7B 4O65A 1MBGA 1ULDA 3DKXA 3CCUI 5JCTA 1ZAOA 2MH9A 2VBWA 1NCRC 1LAJA 4UV9A 1BC8C 1ZGAA 4I0WB 5F5AA 3IIIA 2IFWA 3IT8A 4QXHA 2I5UA 4HLXA 5EEHA 3V7CA 2CGPA 2VZUA 2YYOA 3WNOA 1VBE1 3W9AA 5AC93 2K0GA 2VOXA 5FR3A 3HKZA 3CCEI 3LSIA 2WN3A 1UMQA 4CP1A 1VMFA 3PLQA 1APLC 2ZGOA 3WUCA 2GLOA 4XACA 1B72A 3BPVA 3UNGC 2AC1A 2RAEA 2HWE3 1IPKA 3HSFA 2W95A 3ELKA 3V8KA 1H9PA 5IWFA 2CUJA 1FY7A 1IC8A 1SC7A 5F0FA 1ETWA 3JXSA 1W9SA 1X1DA 1LE8A 1E3OC 3WG7H 5KXDA 1W8HA 2OUHA 1R1TA 3FHNA 2I10A 1Y1VJ 2DTWA 4AQSA 1ORKA 4GH4A 4AHZA 2DTRA 2VBBA 2OC6A 3B6CA 5ICGA 4LD5A 4IO9F 4AGVA 1NLQA 3K46A 1CONA 3DEWA 1VRH3 1V00A 2DFCA 2ZXJA 2X8KA 3FFQA 1JS9A 4LG0A 1OUXA 4QPYA 3HB9A 1J59A 1GSLA 1HW5A 4JK1X 2DW4A 3VKNA 3OIPA 3DQVC 3GTGJ 3ME2A 2HDCA 2JDUA 2GXBA 2J5OA 4G12A 1B72B 3Q9VA 1UZ0A 3VPRA 1VBD2 2RHPA 2LKXA 4GCVA 1R1VA 3R4DB 5C5UA 2YFZA 1X2NA 4XSXF 3NNJA 2IXSA 4NJ4A 4XAEA 1Q5OA 1APNA 3H5RA 5C9AC 4A3XA 4X6RB 3HTSB 2GIZA 2VAUA 3OTFA 2JDZA 3CUQA 3PSIA 1OR7C 3WG3A 1GMMA 3O1RA 2B42B 3COAC 4NMIA 1REFA 1KXGA 2BW8A 4Q4V1 2P6TA 3N9NA 2P17A 5BPIA 3QPHA 1RHI3 2K9ZA 2R7TA 1IZ1A 5ERIA 2DTZA 1BI3A 3PVOA 5JPMB 1OSGA 2FA5A 1PP7U 3FHQA 2LY9A 1AXZA 3P7NA 3GCWA 2X05A 4WM8A 1VQ7I 2DFBA 3L09A 2DA4A 4FTBA 1LFPA 4N43B 1CAVB 1LB2A 4XOPA 1LECA 1W6PA 2Y6LA 4X8PA 2OD5A 5EGOA 1VQMI 3TEZA 2ETEA 5IVCA 4E7JA 1M06G 5IOYA 3UESA 4ARYA 3QOEA 2ZAAA 3PQKA 3LDRA 1TMF2 2MEV1 3CCLI 1RJ7A 4RQPA 2WO3A 3VWBA 3ZP5A 3LSTA 2QZ3A 5APAA 4A6SA 1ASJ1 3R4UA 1WZ2A 4PFPA 3UKVA 3S3NA 3HN3A 4ETSA 2E1MB 1QMJA 2G7HA 3I53A 3ILRA 3JAMK 3O7OA 1YJKA 4XONA 3LSEA 3ENRA 2OZ6A 3MI8A 4IOAF 4XUTA 5A1LA 2O3FA 3BZ6A 1MS0A 3KB5A 1IXRC 1TT5B 3W3CA 5LY2A 4HV6A 4RAGA 5A2QK 4IF4A 2LW8A 4JX4A 2X1EA 2DXIA 4HBLA 5IK4A 2Z2SB 3QQAA 4YW7A 3WTVC 1IV8A 1FMD2 4JKLA 3U2RA 5C33A 2Y6GA 4W4ZA 3L2YA 1SLCA 2VOTA 4W1UA 1BHGA 3RWNA 4B4CA 1LCLA 1KQ9A 2ZMEB 4CCJA 4FTSA 3VZLA 3VD4A 4FP3A 1FPN3 3FN9A 1SEUA 2XF6A 3EETA 4IRHA 1IRGA 4RGAA 1F9NA 2P34A 5A70A 2WWSA 1N3OA 1JGGA 4UVCA 4AL9A 5JI9A 3CHXA 2X1DA 5J1XA 3LPFA 1F4KA 3WLUA 4MX3A 1YIFA 2DVGA 1IRZA 2KP6A 1STZA 3K4JA 1GHCA 2OA4A 1LESA 3UGGA 5KBFA 4QPQA 1CQTA 4JC1A 2VQCA 1W99A 2ES3A 5FXVA 4L0YB 5LBCA 4IZZA 5GJ6A 2TDXA 2ZJ2A 3FC0A 2V26A 4Q4W2 3F8MA 3H3VK 1CIYA 2A6HF 4QWQA 5ILUA 1UHWA 1FYKA 4PF1A 5C8WA 4LIVA 1YOVB 2E71A 5BNQA 5A3PA 5D5UB 1D2QA 2GC0A 2YR2A 2Y6FA 3L2UA 1W7PD 1R00A 2AGSA 2NVTJ 4BDVB 5JWPA 1RUF2 1W7PA 1K79A 3ZVXA 4YM2A 4BHCA 3ZQQA 4AF9A 2DBBA 1GICA 2W9XA 3DKWA 2W0XA 4YFNF 5FO8B 4MGQA 2XL7A 2Y6HA 3CO2A 3IDCB 1UKRA 1I1GA 5C3RA 4QX0A 1UW8A 3VBFA 2NAZA 4QIWN 3OMYA 2H0BA 1YIOA 1C8M2 1KGSA 1N77A 1GR3A 5FP4A 2MYSA 4E7KA 5JOZA 1COV2 4P00B 2P6HA 1SFUA 3MIEA 1ZGJA 2D2WA 3JRDA 3URFA 1E5HA 2WC2A 3IN9A 2XWBB 4L9NA 4RR3B 2Y8KA 1D4M1 3INAA 3E7LA 1T0FC 3SCHA 1DGRA 4MFDA 3VBRA 1YIJI 2WT2A 2PJRB 1G3YA 2RM21 1HRI2 2YUEA 2R5ZB 2A71A 2GMMA 5AFEA 4ZYEA 1OUSA 3CJIB 2MABA 1AR72 1Z7S1 1QNTA 2LUWA 2PHXA 1XMXA 4AFDA 4UXNA 4Y3OA 5IOZA 1UNBA 3M70A 3PVEA 1FOYA 4LOCA 2CQQA 2ZXHA 2DO7A 1MBKA 4G6TB 2GSYA 4I99C 4NPLA 4F8AA 1YTYA 4QDQA 4OHZA 3S32A 4AIKA 3R4SA 1SVOA 2EPFA 3WF3A 4MIMA 4JQRA 4QB1A 3TN91 2A6EF 4OMDA 3VBSA 4P9UA 2XAGA 3OS1A 1U8BA 1I39A 1U5TA 1T95A 3K77A 2K46A 1ZZ8A 2B9UA 4DO0A 1LOEA 2DN0A 5D8AB 3ZMUA 2DUPA 2OCEA 1Q1VA 3PUIA 3SITA 3LWFA 3MAJA 1OYIA 2IGKA 2D98A 3WNKA 2R7RA 1LGNA 4YW4A 3ZN1A 2WS92 2KL4A 3VZOA 4G8XA 2M4KA 3LAGA 4YM1A 4BZ4A 2YC4A 5FPLA 2W82A 4DRRA 1AWCA 2DOEA 4M3CB 1OPCA 1UD1A 3WTUC 5D21A 3S14J 4EV0A 1QU3A 2XF5A 5KNLA 1D5YA 5IFTA 1J75A 1QQP3 1VAVA 1T6BX 3BTLA 3HOBA 1PGSA 4QPGA 1LGCA 3PSFA 1UF2C 4XDPA 1IXSB 1X4OA 3I54A 3HNMA 3RDIA 3KE2A 1IKPA 2EZLA 1LEBA 2J1RA 5DN2A 4CXXA 3RYKA 3MUZ1 1R081 1JYVA 3BG3A 4K7JA 4CDGA 3MIDA 3TBDA 2QUFA 3LZZA 4OUEA 3LD8A 2ADUA 3R05A 3S93A 1DGWA 2D1HA 2KZVA 2WJSA 5FPXA 1XSQA 4F55A 1HDDC 2RS11 5BV6A 2E5ZA 4OWRB 4LPLA 1LFUP 1KFXL 1BYHA 3CJTB 2IPQX 2DPDA 2NNNA 5CLSA 2IT0A 2VZTA 3TWIA 1D5VA 3NQOA 5CG9A 5KHHA 3WP3A 2A3XA 1FMWA 2W84A 3O1VA 1W2OA 5JVGF 2HYKA 5GLZA 3QYBA 3APBA 5T52A 3KT4A 4GD4A 1XC5A 1NUKA 1W3XA 2LNBA 3LFIA 2X5IB 2L7FP 4RDUA 1VBE3 1W06A 1TNRA 1R1ZA 4E7HA 4UNOA 5BQTA 3ZQCA 1PX4A 1CF7B 1G9BA 2KDOA 4CSWA 3D5SC 2DJIA 3GDBA 1ITYA 4KWLA 3THCA 2VGDA 3OCPA 4A0XA 3H36A 5LA1A 4XF3A 2YC2A 2XPUA 5GAHJ 2AACA 5CBLA 5CQGA 2JX9A 2HNHA 1X9TA 5C8CB 4M3EA 4MG2A 1J2XA 3OSGA 5EZGA 3AXEA 2K9LA 4IQJA 4BOWA 3LFUA 2EBIA 4N4OB 4HONA 4M73A 1HW2A 2DA3A 1K78A 2A7AA 3POWA 2JWTA 3BQZA 1LOGA 1ETYA 1KITA 1RINA 3T4VA 2A3SA 3H3UA 1RUI2 1NCQC 1TWHJ 1CIWA 2V09A 1RUJ1 3V7RA 1MW7A 1JYNA 1O3RA 3U37A 3IDAA 5FLXZ 1FOWA 4H55A 1T8IA 3VB9A 2DQLA 5CQEA 5E3OA 2NS0A 2RS52 4CEWB 5J96B 2D6KA 1VQ9I 3ZIWA 1IRXA 4N0BA 3CZ6A 2WWJA 3VDDC 1AYM1 1D0XA 3GZEA 3S2DJ 1OH4A 1YFHA 4LUKA 1US2A 4QQHA 3VKMA 1H2MA 4N53C 5JR3A 4AYBA 4LO5B 1OCCH 1QZYA 1D0GA 4LULA 1BR4A 4AIDA 3HAGA 2VC0A 1H6YA 4QHZA 4Y5SA 1Z9CA 1R091 3GF2A 3U1DA 4I02A 2LOOA 2AO9A 2RJLA 3PUQA 1XGSA 5KCMA 3KP2A 3WEZA 5CYVA 5E8AA 4IDZA 1JHNA 6PAXA 1MJBA 1RUE1 5CAZA 4GRIA 3ML6A 3Q3SA 2Z4FA 3ITQA 2VJXA 1GOFA 2C0ZA 4LBJA 1VBC3 3CIHA 3GO5A 1TNFA 4KJZA 1OMIA 3MPPG 1UY3A 2AEZA 2YX7A 2AXTC 4YRDA 2ETHA 1BIBA 3BTJA 1DP0A 3VYTB 2IS2A 2CW0F 1W6OA 3VDDB 1FWZA 3WF1A 1WJAA 3FMGA 3BN6A 5KHGA 2Z5UA 1WI9A 3USUA 4CICA 4IEPA 1Q56A 3C18A 5CFDB 3K4LA 3AKPA 4CCEA 3POIA 2E60A 4UHTA 1PO21 2J1SA 1W6MA 1X33A 2GOXB 2DUOA 2FNAA 1C1LA 5CFCA 1XD7A 2GMPA 2XGDA 4LHNA 1EH6A 1UMHA 1UYYA 2ET7A 2W7NA 4A3LJ 3DTEA 1CQ9A 4A7YA 2MHFA 2LLKA 3WU0A 4KMUX 4DINB 1P4XA 4JTNA 4AEDB 3TB0A 3A01B 1D0YA 1IJWC 1RIRA 4AIHA 5FZAA 1YS6A 1NLSA 4XHXA 3WDYA 4IUGA 4UI9L 4SLIA 3ZYJB 3G73A 4RGXA 1P9QC 4ZS3A 3L7WA 3KETA 3DU5A 4A5MA 2QUOA 2ZGRA 2M3AA 5FYCA 4MGKE 1Y8QB 2ZGMA 2WO2A 3L9FA 1YHFA 2C6SA 3OY8B 4C0HA 4M3DA 5C9AB 3C7EA 4DZGA 1LU1A 3DBRB 3ESWB 4LBLA 1HQLA 3FZ3A 1KYWA 1J83A 2BV4A 2IP2A 5FV3A 5F8PA 4PJYA 2EK5A 2VBZA 4Q4ZF 1GXPA 4LR4A 1M4WA 1GZTA 1YJ9I 3A0HC 2O5RA 4LBQD 3F22A 4SBVA 1AL21 4UFLA 3FXOA 3N3HA 5EPAA 4A7KA 4RD7A 3T0DA 1RUG1 2IVMA 3N97A 1X3ZB 2B5HA 1AJOA 1WCDJ 2F48A 4B1MA 4AI9A 2UYAA 5A1FA 3U0ZA 3BWGA 4ZPIA 5LHIA 2G9WA 2E19A 3ERED 1Z6RA 5IT3A 2XB5A 1C8NA 4LGWA 4H3WA 3HRSA 4HX7A 1IS5A 3FUQA 1XSDA 5KC6A 1VMJA 5HLHA 4G6QA 1H2LA 3GLLA 4DZJA 4M3FA 4JGZC 2L0KA 1JT0A 2JB8A 1BOAA 3JR9A 4Y33A 1XRUA 3EO6A 1D4VB 1GFF2 4KYWA 4HK9A 2DT6A 1XNKA 1LOFC 5EZWA 4AQ6A 2XDVA 2ARCA 3J9SA 2CUZA 3E6DA 3TO7A 3ABZA 5A3WA 4AYUA 4H14A 1KRIA 4LKDA 5D8AA 4H2AA 4GB32 4UW3A 1F2NA 1WH5A 4JGYA 1UPIA 5A3LA 3KP6A 1IUYA 4HZFA 3K2AA 2EILH 2E2HJ 1ZNPA 3C2HA 2QQMA 1OCTC 1Y6IA 1MS1A 1RGSA 2WNOA 1GKBA 2G0EA 1BVVA 2JB4A 4CDXA 3DEMA 1OQYA 2XC7A 5JI7A 3VBHB 5J8CA 3IIAA 4YW6A 2DMTA 5CYYA 1U5IA 1BZWA 3GTQJ 3CJQB 1VJ2A 5I0DA 5K5QA 5A6QA 1A35A 4UFKA 4JRAA 1SD4A 2OTLI 2P37A 4LE4A 5DZFA 5JLWA 2LH9A 1O4TA 3I55I 3ZFGC 1K5MC 2XRLA 4PLMA 3HHGA 5F1RA 3IKTA 3MLJA 5LD2C 4FPFA 3JB4C 5GLWA 1UAIA 1X19A 1STMA 2EFQA 2JG9A 3EDPA 2F4OB 3CU7A 4OAZA 4BMEA 3I64A 3CUQC 3SH3A 5IP9J 1WVRA 3S1NJ 2CW8A 5CNAA 3POEA 4DQ2A 3M9AA 4M6VA 2X6WA 3A23A 2CAUA 4D5CA 4B44A 3CCVI 1ND3A 4ZS2A 1EY2A 3KX2A 2HVSA 1S0CA 2UZKA 1KS5A 2KM2A 4R9CA 1BIAA 3MIFA 2P4EA 3DF8A 2DCKA 2N8GA 1PGW1 3PIPF 4NC7A 3TOBA 2XAHA 3BP8A 2OU2A 1DLCA 2B46X 1WD4A 2Y0IA 1B1BA 4JX6A 3SHFA 3V8LA 1YYNA 4GWJA 5C3EJ 5E17F 4BQNA 1OD5A 1W8UA 2BWCA 3WG4A 2G9ZA 1JZ7A 3HUGB 2HBUA 2STTA 3EBRA 1NCRA 4XFCA 2QQBA 4B8EA 3JRHA 2NOJB 4CUGA 4YW5A 3PUSA 4CPBD 1RMU1 5FXWA 4IEXA 1J09A 1B8IB 1G86A 4IKFA 4PDWA 4BNCA 3LFKA 5HPOA 3WF0A 1F15A 1QXRA 4C3IJ 5FPVA 3FK7A 5F2WA 4JZRA 5FRAA 2Y38A 3MZYA 4I98B 4A0YA 4I30A 2QQ8A 5EHDA 2IUWA 1MDMA 4E4HA 5FY7A 1W9FA 2PXJA 1OCRH 5F37A 3OYNA 5CVRA 4L97A 1JUIA 1F5FA 4FFHA 2KISA 5BUVA 4YGCA 4ARXA 5E3MA 1Y3TA 5KXEA 4JKKA 3DBHB 4BXXJ 2OVUA 1UCXA 1S0EA 3BI3A 1OA4A 2F4MB 5HLIA 2RNJA 1NK2P 5D5WB 1NA1B 5KAIC 3WCRA 3LA3A 5FZ7A 1FBQA 1SFEA 4YZ2A 4BEHB 3RTRA 2BUKA 3NV2A 4JGZA 3BC8A 4EGYA 4YIFA 2JDAA 4DXRA 3HZJA 4HSTA 1SLBA 5D8AC 2A6WA 1KJLA 5BY5A 4NB5A 1TTYA 3GCXA 1FYMA 1Y0UA 2IWGB 1L7RA 4Z6YA 4CDQB 2D5FA 1U8RA 2P3KA 1YQ5A 2BVVA 2NXNB 1CAWA 2IXKA 5FY1A 1JZ5A 5FP8A 1UOBA 2JXAA 3JBG2 1ZA7A 2CV6A 2PHWA 2RREA 4LBNA 2EA4A 2DK8A 2VT2A 4KT6A 4AE2A 2QM3A 1OISA 5GKAC 1GVDA 5A2QZ 4MV2A 4QPOA 3E1F1 4HL0A 2Q5TA 2VZOA 4NR1A 3OYCA 1WJFA 1T39A 4RL7A 5HDNA 4ZHNA 2LKSA 2LSOA 1SLAA 4DY5A 4S2DA 4UF0A 1ZRIA 1W36D 3HUGA 1SFNA 3N36A 1JYIA 3KF3A 2VO5A 4QXKA 3ZM8A 1Y4WA 3OY8A 1T6GC 1YHQI 1WJ5A 3USSA 3WY6A 5IY5H 1R1UA 5BNNC 1BC7C 3C7OA 2EXJA 3IMMA 1TW3A 4F52A 4A3CJ 2E1CA 2O8QA 1JYXA