4I01A

Structure of the mutant catabolite gen activator protein v140l
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
202
structure length
202
Chain Sequence
b'PQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDLTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catabolite gene activator
publication title Modulation of global low-frequency motions underlies allosteric regulation: demonstration in CRP/FNR family transcription factors.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 63
structure length 202
sequence length 202
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4i01A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4i01A01
3HTSB 5LHHA 2VPVA 4DINB 4X6RB 4OIRF 1Q3EA 4Y15A 5H6RA 1D5VA 1V70A 3NQOA 3EQLF 1JXSA 1ZREA 4ZZLA 2ZXJA 1O5LA 1W5TA 3NVCA 2DT5A 2K4BA 3F8MA 2PMHA 3DP7A 4LLLA 3SZTA 1PP7U 1MDMB 4BAYA 1FPQA 4JK1X 1J3QA 5T3NA 3F22A 4IRIA 2LSOA 2O1QA 4HW0A 4UNOA 4FT8A 4R1HA 4OLLA 3SCFA 1SFEA 3FMSA 4JQFA 3TOAA 5ICEA 3S0MA 2FOKA 3DXJF 1VR3A 3H3UA 4P5OA 4RGUA 1CAWA 4A12A 4HF2A 5L3CA 4HYEA 1I1GA 2OPKA 3F8FA 3ZP5A 5HLIA 5HI0A 4HX8A 4AWXB 4O3MA 5I0SA 1IRGA 4EJUA 1FI2A 2VQAA 4IJAA 3EYYA 1F1ZA 1I27A 5CVUA 3WE2A 2EV5A 2XKPA 4L5JA 4HQMA 2PJPA 3T0YA 3HSFA 2MHFA 3GW2A 4HVQA 3K1PA 4YFNF 3T8RA 4UV8A 4ESFA 5ILUA 3ECHA 1S29A 2M45A 3KGLA 3RPQA 2STTA 3BZ6A 3ABTA 4UXNA 2YX4A 2KXLA 5D1IA 4HV6A 3KP5A 4KA4A 1XCVA 5LRRA 4A0XA 3L2CA 2HTJA 3KP4A 3BY6A 2IA0A 4OU0A 4MGIE 5FLIA 4Z82A 3JZVA 1XD7A 3HRSA 4XRFA 2OA2A 2LF8A 2FF4A 2HYGD 3QU6A 1D3YA 1FWZA 2M8EA 2ELHA 2RNJA 3I5UA 4WVZA 1X8MA 1H1MA 2Y0OA 1IN8A 3RIRA 3ES4A 2O3FA 1R23A 3I64A 2OQRA 2V09A 4NVPA 5FQ0A 2NNYA 3F6OA 3KGZA 4XLNF 5FD6A 1ZGAA 3L2HA 3MFKA 1P4WA 4FAGA 4HDVA 2LF7A 1GXQA 4I2OA 1HXDA 2IRFG 3GUDA 1Y0UA 2G7HA 5E20A 4KIGA 5BPDA 4A5MA 4ENMA 4XF0A 2EB7A 2K9ZA 5KHJA 1U2WA 4GCVA 2QQ9A 1TW2A 1R22A 3KEQA 1ZGJA 1RI7A 1KYZA 4WBBA 3P7NA 2F2EA 4JBAA 3R60A 4TLFA 1TQPA 1FBUA 2WV0A 5AIPA 4HDUA 2X0LA 1KQ8A 1W7PD 4QWQA 1SAXA 1TW3A 2A6HF 4HSLA 3CF6E 2DAOA 2E9QA 4IVNA 4IEVA 4HZFA 5C8WA 4IEYA 4U0YA 5DD4A 1LB2A 4XF9A 3EYIA 4L18B 3OV8A 3L09A 4YYOA 1J0RA 2O61A 3ZQ7A 3WW4A 1OR7A 4M73A 1T38A 4PGHA 4KUMA 2WTEA 3H1YA 1VTNC 3H9AA 1SFXA 5D5XB 3PQKA 1YFWA 3KFWX 3KP6A 3HT1A 4R79A 5D6EA 1R5HA 4RD7A 2QZ8A 3LWCA 3GFIA 4BNCA 2RKHA 2HWVA 3TDUC 4JTNA 1F4KA 3HOSA 2ZBKA 1QBJA 4ETSA 1H1IA 5A2QK 3H50A 1YFHA 4YFXF 4AQ6A 4AD9A 3SCHA 1WRJA 3DPTA 5FPZA 4XSXF 4MQ9F 4LUMA 2Z99A 2L4AA 5FO5A 1P6RA 3JSPA 1VJ2A 1G3TA 2W85A 4A6DA 2X4HA 3LWFA 1B9MA 1X7NA 3CDHA 5D5WB 3GF2A 1XSVA 1FLIA 1UHWA 2R3SA 3BB6A 3IBMA 2VC0A 3HRMA 1LDDA 1FSHA 2F5FA 4A2UA 2UYAA 3USSA 2V9VA 4M6XA 4EGYA 3RDIA 2E7WA 5DCMB 1O5UA 2P6TA 4XBFA 4HMZA 3CUQA 3LA7A 2D93A 1EP0A 2XAFA 2QQBA 2QUFA 4L0YB 1FBSA 5H6QA 5FDBA 4DNCA 2MC3A 4WXDA 3NRVA 4KT5C 3LAPA 2G9WA 2XL9A 2VT3A 3EUHA 1U5TB 4CGZA 1RUOA 2K27A 1LEBA 2Z33A 3WW1A 3LSTA 5AONA 4Q0SA 3IHUA 2DPDA 5K5OA 2VC1A 2UY8A 1RZ4A 3D82A 5E8GA 3LQRA 3BALA 1UHMA 4Q0UA 3IKTA 4ESJA 3BDDA 4HV5A 1P2FA 1XN7A 3U0ZA 3O2PE 5D8KB 3NW4A 3LAJA 4ENNA 1BJAA 4K2EA 2EA2A 3IDCB 4LG0B 4X6QB 1L3LA 5FLJA 1FYLA 4IERA 3GWZA 1ZVFA 4F8AA 1ZLJA 3ECOA 2NAZA 4E2QA 3TKYA 2MNGA 1HKSA 1BI2A 3F3XA 1UD1A 3KLOA 4FAHA 2BNOA 3BJOA 3L9FA 2VONA 1YFXA 3E6MA 1MJ9A 5ED4A 5LGTA 3QACA 1ZRFA 3S7IA 1ZAOA 3Q9VA 5HDGA 2F5CA 4I01A 1BOAA 1FOKA 4WX9A 3K1NA 3F6VA 3RKWA 2QNKA 3FHZA 2XAHA 3WG9A 5L3EA 4M6YA 1NYWA 3HYIA 5KHIA 1OPCA 3UKVA 2Z2SB 3WTSC 3ACLA 3FMQA 2MLKA 3ERED 2JPBA 4XFAA 3ES1A 3F72A 1YFYA 1W7PA 5HLHA 1FC3A 4KICA 4KIBA 2FQ3A 4EGZA 1ZYRF 4AVBA 1J3RA 3TO7A 1B9NA 5KK1A 5F1RA 3WU0A 4PGGA 1K7AA 2QENA 4MQVA 4IHTA 1BC8C 2QBYA 1ZHFA 1HW5A 4G6DA 5K1YA 2QVSB 2MBFA 1UPIA 3E6DA 1G3YA 3NSTA 3K9TA 2VECA 1P4XA 1TQ5A 2A3SA 4WCGA 1W5SA 4LA3A 4MTEA 2Q1ZB 1WWXA 4GO1A 4L0ZB 3RYPA 4KMUX 1CAVB 4ZU4A 2M30A 3ZN1A 2J5OA 5DYMA 1QY4A 1V3FA 2BE5F 2KIFA 4G8XA 4BHCA 5JSRA 3TNQA 1XRUA 4EJWA 2GQQA 4IRHA 4JVAA 3KEOA 4G7ZF 1PP8F 1TNTA 3V4GA 4U0VA 3T8TA 4M72A 5J6XA 4MNUA 2K86A 2EVXA 2F5EA 4XETA 2Y0MA 3BU7A 4J1WA 2Q30A 2PA7A 3SXYA 4RGXA 2OYZA 1QGPA 1EH8A 1REPC 3MZHA 3ZMZA 1I1SA 4OIPF 4DQ2A 4HSJA 3C18A 1GQHA 1BIBA 5JR7B 4EWDA 1XGOA 4HVRA 2EFOA 3IKVA 1HQCA 3ST7A 2BNMA 4LLOA 4KN4X 3M1EA 2XLFA 3MDPA 3KP3A 2A5YB 2H09A 2VOOA 4LTAA 1IXCA 4M9SA 4META 2ZNYA 4KWLA 3P9KA 4HVOA 2XVCA 2EK5A 3BPZA 4I0AA 4MX3A 1XDSA 5HLGA 2ZO4A 2N7GA 5BOXA 3RYKA 3I59A 2FA5A 4QM8A 4ZH4F 2JPCA 4I09A 4Y17A 4UUVA 2W25A 4L9TA 4ESBA 3O14A 4UVBA 3EHKA 2P5VA 3HOTA 1SMTA 4O9GA 3LQQA 2ETHA 3E5UA 4LFUA 1OFNA 5K5RA 3EBRA 5EZWA 2XAJA 3FM5A 4N9HA 1S3JA 4XFBA 3DFGA 2D45A 1SFNA 5CADA 5ILVA 3GVAA 2FSWA 4PCQA 3RKXA 5DCFA 5L3GA 4OIOF 1SD4A 4UBGA 4OMZA 2OZ6A 1ULYA 2Y75A 2W24A 3DKWA 3ZN0A 3BJ6A 3F8CA 1PDNC 1AOYA 1Z7UA 3EDPA 3S7EA 1IUYA 5FQ0B 4KU7A 2LKPA 3BJAA 1Y3TA 4AVPA 1ZNPA 3IRQA 4MEXF 4A5NA 4RB0A 4HLYA 1DGWA 3ZDSA 1QZYA 3JTGA 2XROA 2UWMA 3LAGA 2FBKA 1D8JA 4RGSA 4BQAA 3IL2A 4NHJA 2GC2A 2PBIA 2O03A 5JSOA 1G6NA 1Z6TA 3V8JA 3WODF 4G9YA 4CYDA 1NE6A 1YQAA 4XFIA 1KA8A 5E1RA 2V1DA 2CGPA 2P7VB 3J7AO 2M5WA 4WK8F 1UW8A 2DO7A 4CDGA 4HN0A 3BP8A 1XGNA 2HR3A 4GYGA 4MH0E 4P96A 5BPXA 4HBNA 1O3QA 4L2NA 3BWGA 1YUDA 3JSOA 3O3KA 2Z69A 2EFPA 3U9GA 2WFPA 1FY7A 1WLTA 1BIAA 2GA1A 2FQPA 4G7OF 4EWAA 1ZZ8A 3E6BA 2GA2A 4I98B 1KU9A 4NQWA 1I6XA 1DP7P 1LDKB 2H6BA 2YSRA 3K1MA 1EY2A 5BXXA 4Q4ZF 1O3TA 3B02A 3RTRA 3MYXA 4XEZA 3HHHA 4MGRA 4KN7X 2ZMEA 3FXUA 2GH2A 4KL1A 2VODA 2HS5A 1XE7A 4XFCA 2A61A 4KYWA 5JR3A 2GXGA 1IN7A 2RV8A 2OZUA 2PAEA 1R36A 2YX7A 4AVCA 2HJIA 4YG2F 1SFUA 2W84A 1XMAA 4L9JA 1LVAA 1BBYA 1Z6RA 2VXZA 3Q9SA 2IPQX 2GAUA 2FNPA 4IEUA 4U0WA 1T39A 4HLTA 5KHHA 1QO0D 1YW8A 5KVRA 2L02A 2PLYA 3PLQA 2H0VA 4YARA 2PQ8A 2VBXA 3FXRA 4YRDA 2JTVA 5ICGA 2HKXA 4D7SA 3SZPA 4L11A 3ZPLA 1KGSA 4XFFA 4L9VA 3ZMDA 1C0WA 2QVOA 2RC4A 2CWEA 2KIUA 1SMYF 5DDGA 3SFZA 1J3PA 1R1UA 3M8EA 4IXAA 1TTYA 1FBQA 3KCCA 5HDKA 3SXWA 4Q0QA 2O8XA 4H7LA 2AXLA 1XGSA 1CX4A 2P8TA 3N97A 4IF4A 4BYYA 3F21A 1HW2A 3R0AA 1H9TA 2CFXA 4EWEA 5D5VB 4CO8A 3MEXA 1YG2A 3V7RA 1CGPA 5CVVA 3AAFA 5BMZA 1KU2A 2RGVA 3NEUA 4LB6B 2YPRA 1SQ4A 5LEKA 4QX5A 5I8YA 4ZYGA 3TGNA 2L54A 2H6CA 4JV4A 2D1VA 4IEPA 1G3SA 2CO5A 5FFXA 4MUVA 4UBHA 1YWKA 2CSOA 1SEFA 2NS0A 4LULA 4L5IA 2E1NA 5D4RA 5LLQA 4B8XA 3C1DA 4WWCA 3FF5A 5FGMA 2PTMA 4B29A 3VOEA 3MZYA 5DEQA 2MPFA 5JVTA 1JHFA 1LDJA 3HQXA 3RI4A 2FBHA 4E2GA 1ZG5A 2IXIA 4LK0F 2JSCA 3GFJA 1LQ1A 2EA4A 4KIFA 4XF3A 2CAVA 5H20A 5FLXZ 5HS8A 2GC3A 4MV2A 4OFGA 4ONUA 3LZZA 2CYYA 4KNYA 4S04A 3BPXA 2VBZA 2B0LA 2L01A 1W4MA 1FP2A 3BOQA 4AIKA 2IXJA 1T0FA 5EEGA 2MLGA 3U2RA 1UIJA 1E2XA 4HLXA 3CO6C 1W7PB 1O57A 4ZYHA 4KMFA 4ZZDA 4I02A 3HRTA 1HBXG 3I54A 1LKNA 2K0GA 4M71A 2OU2A 5HS9A 1Q5OA 5EFUA 1ZG1A 5CLSA 1S8NA 2HKOA 1UFMA 1DPUA 1U78A 2QBYB 4RAYA 3G73A 2KJBA 2Z9OA 3VODA 2FMYA 2ACJA 5JAXA 2RQPA 4GYIA 5FPXA 3H1MA 1KYWA 1J1LA 4RS8A 2CG4A 1OYIA 5CVRA 2A68F 4OOIA 1Q43A 3M3IA 2OD5A 5BQTA 1CAXA 3OOPA 1RIOH 4ENKA 2DFIA 1T98A 3DL3A 4I3PA 4ON0A 2O8QA 3C3VA 1CAUA 1G4DA 2ADUA 5J7MA 3MAJA 4ENJA 3WW3A 2DK5A 1Y9QA 4ZU7A 5BS6A 1B6AA 2HQNA 3LFKA 5BY5A 2DQLA 1QZZA 2I45A 5KBFA 1R00A 1IN6A 3PFIA 4UXAA 2XAQA 3VB2A 1YLLA 3R6SA 4A6EA 2Q0AA 2GWRA 1ZN2A 2BBYA 3ZMTA 2V1XA 2IJLA 3TO6A 1J7KA 3SHRA 3FZVA 5CJ9A 1I5ZA 1R1TA 5FLXK 1ZRDA 4O9EA 4A0ZA 3J81Z 2TDXA 3CLPA 4GXOA 3OTFA 2HFHA 3K2ZA 1TNSA 3HSEA 3KLNA 5E8IA 2QQAA 3QP5A 4PIYA 2EFWA 1DGRA 3CJNA 3JAMZ 2ET7A 4LUKA 2XIGA 1TBXA 1Q1HA 2JT1A 4U7BA 1ZZ7A 4E2SA 2ZKLA 2CV6A 4BHPA 4FHTA 4UV9A 2D1HA 1XCBA 2CQKA 3DF8A 4R8HA 5LHGA 2ESHA 1ON2A 3IC7A 4ZU5A 4PJYA 2GZWA 1QXJA 2HQRA 4E70A 4N0BA 3DN7A 3I59B 4MGZE 1H0MA 4QXKA 2Q0OA 3EJKA 4HF0A 4PDKA 3ULQB 2ISZA 5IT3A 4I7HA 2K02A 5DCMA 5JI6A 4G94A 1JE8A 4MZUA 5J8CA 4XF1A 3JTHA 4S05A 1ODDA 2E7XA 2L3DA 2NNNA 5I0UA 2QWWA 1XDUA 1FYKA 5ERIA 1XE8A 3KE2A 3NJZA 2XKOA 1G3WA 2CW0F 1RNLA 3H3ZA 1ZH5A 4PIXA 2HTSA 3QPHA 5BUVA 1LR5A 1F9NA 3FE5A 4R52A 1DZRA 3NL1A 3QPTA 1J59A 2Y48A 3J81K 1HW1A 1MJAA 1P92A 3WGGA 5FCCA 2PFBA 5BV6A 5LGNA 3EO6A 1J58A 2AS5F 3GXOA 2RVCA 4QM9A 3GFMA 1ONVA 2P5KA 1V4RA 5D4SA 3OCPA 4LJZF 3ETQA 1NHAA 3FHIB 3HTUA 5KHGA 2MD5A 3ZMSA 5JHUA 4LMYA 2COMA 5K5QA 2PMUA 2EV0A 2FBIA 2PN6A 3JW4A 3U1DA 4YSFA 1KQ9A 3FWEA 3RNSA 2RDPA 1NZCA 1XSDA 4PZJA 4EM0B 3QP6A 4RAZA 3OF1A 5LEJA 3V7CA 2DPUA 1O7LA 3Q5FA 5FB2A 2F5DA 1SD6A 3E5QA 4RB1A 1R5GA 3CUOA 1GQGA 2PAKA 1CAWB 4YNIA 2UYBA 5AVPA 1BC7C 4XSZF 3PNAA 2HDCA 4QLCU 1S7OA 5E16A 4Q29A 4OIQF 1YS6A 5E18F 2A07F 4EQQA 2H27A 5KHKA 3T5XA 1XB4A 3WTTC 1GVJA 2M87A 2G7UA 2B9UA 4LEJA 3KZYA 1IXSB 4RGRA 1KU7A 3W6JB 4IRGA 3CJXA 2XASA 4WXCA 1OYWA 3DQVC 2QCSB 3ZMVA 1OD5A 3QU3A 5HS7A 1H9GA 1L3JA 2Z5UA 1YIOA 3LA3A 3H7JA 1B4AA 2ZNZA 3CO2A 4P9FA 2ZMEB 3MPBA 2IA1A 2ZCWA 2STWA 1T6SA 3QRFF 1QWRA 3BCWA 3KETA 4GULA 2Z3YA 3G3ZA 2KJCA 2QJVA 3WTUC 1QXRA 1CAVA 1RGSA 1BI3A 5I0TA 5J48A 4M74A 2V1UA 2DLLA 1OMIA 2O6GE 3NKTA 1HSTA 2Q2EA 4EVIA 1WKMA 3IIAA 3I4PA 2XLGA 4WXHA 1EV7A 1IAWA 4EJTA 2PHLA 2QYOA 1ZARA 1F5TA 2P17A 3B73A 1LRHA 1RTVA 1ZZBA 1KU3A 4HX4A 3DEUA 2E1CA 2EWNA 1B59A 5TRDA 4RB2C 5DUIA 3I0TA 4ZYEA 5L3BA 2YR2A 3GYDA 3LOIA 2JRTA 5E1WA 3ELNA 1K78A 3KZZA 3V8LA 4G6QA 1IRFA 2IP2A 1ON1A 2IXHA 1EH6A 2XL7A 5HVQC 1TQMA 1USSA 1MZBA 4M9XA 2DQRA 1U3EM 4ASNA 3FM3A 2UXXA 1HKTA 4QGMA 2FXAA 1AWCA 1YTYA 4BH9A 2EA7A 4O6JA 1IW7F 5E1XA 2OBPA 3D0JA 4IEOA 5LHIA 3FMRA 4KWJA 5I8TA 3HT2A 1CF7A 4LD5A 1YW9A 3CO7C 4IETA 1K79A 1MD0A 2ESNA 3FZ3A 3RJPA 4LLNA 3DV8A 3F23A 5HDNA 4Q0PA 1JUHA 3FFQA 2C0ZA 2V79A 4LB5A 2PI0A 2M1BA 5DV5A 5ILSA 3WTWC 3IWZA 2PAMA 4K8FA 4Z2YA 1S6LA 3GO5A 2ZFWA 3L00A 1O4TA 4EM2A 1JHHA 1OI6A 3TQNA 5E17F 3GYHX 2O0YA 1TLHB 4KFCA 3M7GA 4Y13A 3P9CA 4P9GA 1XGMA 4QGNA 2BYVE 2A6EF 4O5VA 1WSUA 1UCRA 3HHGA 2OAZA 4BHBA 4AVAA 1E17A 3U11A 1U5TC 1HKQA 4FBFA 3H7YA 2D5FA 1EH7A 4D0PA 3K0LA 5A2QZ 1BN5A 2BGCA 2JZYA 4MGYE 3CUQB 4OMYA 3D0SA 2BEOA 1JGSA 4G7HF 2GIVA 2J5PA 3LA2A 3W6KB 2UY9A 1MJBA 2RN7A 6PAXA 1IF1A 4MGKE 1XMKA 3UKTA 1MDMA 2PHDA 1O7FA 5ICCA 3RZZA 1J75A 3H1WA 4N9IA 2MH2A 1UIKA 2OQGA 1B1BA 2GXBA 1PM7A 1CAXB 2KIMA 4XFGA 2DTRA 5D6FA 3I71A 1MKMA 4EMSA 1CAUB 3ML6A 3KP2A 1VP6A 2QM3A 2R7DA 3O6BB 3CL1A 3GZ6A 4IESA 1Z9CA 5JCTA 1IPJA 5FFZA 1IN5A 1DDNA 3KMHA 3TNPB 4BIFA 3BROA 1UCXA 2BV6A 2ET1A 4MHGA 1UB9A 2FE3A 3RPUA 2IW5A 4MTDA 2EFQA 2VBYA 5F6FA 1S7AA 2B8MA 2ZJ2A 1BI1A 3VFZA 4Q48A 2P6SA 5JFRA 4D7TA 5HOOA 4Z07A 3PQJA 1QNTA 4EV0A 5I0RA 3OGJA 2DU9A 5I91A 4Q47A 2DK8A 3C3WA 3TDZC 1R1VA 5D8LB 4WZCA 1IN4A 5TJJA 4TV7A 2UXNA 3FX3A 3E6CC 4AXOA 2Q8KA 4HQEA 3E3VA 5L3DA 1YLFA 1RC6A 2PFWA 3I7DA 4OINF 3GLXA 2L4MA 3IWFA 4CXFA 3WGHA 2YU3A 1LJ9A 1GXPA 1T2KA 2D2WA 1NE4A 3WGIA 1FYMA 4IPAA 5IT9Z 3ISPA 3GBFA 2BNNA 1PUEE 2CAUA 1FZPB 2IA2A 3HRUA 5I8SA 1ZX5A 1WA4A 4MEYF 3L7WA 1ZLKA 2EFNA 3MQ0A 1KQ0A 2HOEA 3WTVC 4Q0VA 2XRNA 2K7LA 1A04A 3PVBB 4LA2A 3HIFA 1P4AA 4WF2A 2B5HA 4IEWA 5L3FA 2KRFA 2XLAA 4KWKA 1K6OA 1PMIA 4JTOA 2VE8A 5CVIA 4H0EA 1FT9A 5AIQA 4A0YA 3R0JA 5CVJA 1LEAA 2WC2A 2XGXA 3F8NA 3WTZA 1BM9A 3IDBB 5DD8A 5F64A 1RUNA 4M9ZA 2P5LC 5I93A 2ISYA 2HZTA 1ZZ6A 1FSEA 2EV6A 1YO5C 1HSJA 1XSXA 2LDUA 2IXCA 3C7JA 3KP7A 5FD5A 3FJSA 3E5XA 4EJVA 3GZ5A 4P9UA 2DW4A 3IRRA 3HSRA 4KU8A 3GFLA 4HX7A 4L9NA 2ZKZA 4QGLA 4HAMA 4IHSA 3REOA 1R7JA 3WE3A 1LNWA 1QPMA 4IEQA 2F4PA 3KSCA 1J2XA 5E1ZB 2GC1A 4AIHA 4HOBA 2KKOA 4IEZA 2QDRA 2QLZA 5IT9K 3H8UA 4Q5SF 2XUBA 3UKNA 1MGTA 5DUKA 3BPVA 3J80Z 5LBQA 3WTXC 4HN1A 4U88A 3CLOA 3E97A 1DUXC 1EPZA 2HGCA 2LNBA 4I0BA 1X3UA 4HF1A 4QMAA 2UZKA 3I58A 1QQIA 3GEZA 5K8SA 4IEXA 2HEOA 3ZMUA 3EQEA 4PIZA 3GX4X 4B09A 2FMLA 1YS7A 2EJRA 2D40A 2ETEA 3EETA 3ELKA 2NRAC 4ZYDA 3WU1B 3P9IA 1U6GA 1YHFA 2R7FA 4U7DA 1O3SA 3SCGA 1WGPA 4J1XA 2K4JA 5J8FA 3T1BA 1O3RA 4AQ2A 2WWYA 2PG4A 4P55A 1U5TA 2HYFA 2IVMA 4FX0A 1R58A 2IXKA 4EM1A 2FU4A 3RKYA 1ZRRA 3R61A 1ZG3A 2PYTA 3VEPA 1Z1DA 5ICFA 3SMHA 1WQ2A 2DBBA 3JAMK 1GHCA 3M70A 1DPRA 2XAGA 5CYVA 3CEWA 2XV4S 3TOBA 4LG0A 2H94A 3QOPA 2OA4A 3ABUA 3MWMA 1STZA 4F7ZA 3SHFA 3M8FA 3MCZA 4NB5A 1OKRA 2PQQA 3I53A 3J80K 1WI9A 1YW7A 2MH9A 2XHKA 4XF4A 4CHUA 2NYXA 1U12A 2W57A 1TQIA 4XFHA 2EAAA 4AIJA 1IXRC 2IT0A 2P7CB 2DI3A 2IC1A 2D5HA 3HUGA 2VBWA 1YYVA 5EEHA 4XLPF 4FX4A 1K78B 3TO9A 2VN2A 1U8RA 4GGGA 2VOPA 3D5LA 4LGWA 4RB3C 3ROUA 1ZZCA 2VT2A 2V6CA 4UHTA 5LRSA 3VHRA 3QAHA 4EROA 3SQNA 2MA3A 5D5UB 3RYRA 1ZRCA 4CZZA 2PEXA 4UVCA 1USTA 3G7DA 4BXUA 1SD7A 5BPIA 3CTAA 3S2WA 2DCTA 3N4MA 1DZTA 3U10A 3FXQA 5C6CA 3V8KA 3WW2A 3DPLC 2Q4SA 2P4WA 4ORFA 1CF7B 2IXLA 1FP1D 2FRHA 1Z05A 1IZ1A 1NXMA 1RL3A 4UVAA 1SD5A 1Z91A 1FNNA 2ATFA 3K69A 4YIFA 1X8EA 1IPKA 1FX7A 2A69F 3R4KA 4CICA 3V7SA 4YIIA 2GC0A 3M9AA 2FEZA 4EJOA 3F8BA 1X82A 5FLHA 2C6YA 1D8KA 1YFUA 2GU9A 3CUQC 5LGUA 5JSPA 5J3UA 1J5YA 1OYYA 1BI0A 3COAC 3WTYC 4LK1F 3H92A 2FNAA 1EYBA 4KDPA 1ZZ9A 2VE9A 4HA8A 1FXZA 5CU1A 2OZJA 4LLGF 1J9IA 4YFKF 1L0OC 4HBLA 3OD0A
chains in the Genus database with same CATH superfamily
5LHHA 4LKFA 4OIRF 5H6RA 1JXSA 1NOVA 4UB6C 2FDFA 2ZXJA 1O5LA 4CTEA 2UV1A 3VBFA 4LPLA 1OQ1A 2FDJA 3AVSA 2ZA9A 3DWLE 3KS7A 2DYCA 5T3NA 2R7QA 4DXSA 1PZ8A 2LSOA 4HW0A 5A1AA 2DOEA 4NOTA 3H5NA 2X1CA 4LO8A 4CDWC 3FMSA 2FOKA 3G71I 3DXJF 2A5ZA 1PO12 1GT0C 4PT6A 1NG6A 1CVNA 4LBQD 2DMTA 4A12A 2FZ2A 2ZXIA 5L3CA 1W90A 4W50A 1BK0A 3C7EA 3F8FA 1J09A 1YIPA 2R7ZJ 5HI0A 4AWXB 3FHNA 1RVF3 5GKAC 2VQAA 4IJAA 2NPIA 5CVUA 5IP7J 2V5YA 5FWEA 3GW2A 3U75A 3K1PA 1M4WA 3TAYA 1GU3A 4UV8A 3ECHA 2M45A 1J1TA 1JMUB 2BDRA 1HXS3 2KXLA 3ZXJA 5D1IA 2VUDA 3IH4A 3KP5A 4KA4A 1XCVA 2ZJCA 4A0XA 1YQCA 2G9GA 2IA0A 4OU0A 5FLIA 1G8WA 3KM5A 3JZVA 5L9RA 3HRSA 2ZKNA 4XRFA 4X6AJ 2LF8A 2GXAA 3W59A 3D8CA 5TSWA 1H1MA 1ZRIA 4HK9A 2LY1A 2ZBJA 3RIRA 3ES4A 1A6QA 3W5MA 3I64A 2OQRA 2V09A 4NVPA 3DKQA 5FY5A 3S3OA 4MGSA 2E51A 2VIXA 3F6OA 4F83A 4MFDA 2LRDA 4LITA 4PDWA 4HDVA 2LF7A 2HU9A 4I2OA 3GUDA 1Y0UA 1IRZA 4LG3A 1SDDB 3H36A 1XNTA 2NZ9A 1TT0A 5BPDA 2HWC3 4ENMA 1ZTRA 3VBHA 1RVF2 3BUCA 2EB7A 1OH4A 3ESWB 4BMBA 3CQZJ 1ZGJA 1KYZA 2YC4A 3P7NA 3FHQA 4JBAA 4TLFA 2JKBA 4AHZA 4L97A 2WV0A 3NJXA 2Y0IA 4QWQA 3K10A 3P3NA 1FMWA 1HXS2 2N8GA 2M3AA 2GSYA 1B35C 3OGSA 3CF6E 1BW6A 3W20A 2JN6A 3FXMA 5DD4A 1LB2A 4XF9A 2VKHA 1XU1A 1H30A 4IXLA 3D6EA 1T33A 3L09A 5JOWA 4YYOA 3KD4A 4PJNA 3K4ZA 1V0AA 2IZWA 2XPJA 3WSOA 1VBA1 4PGHA 4KUMA 4PF1A 1IRXA 5FY9A 5M3FJ 1VTNC 3H9AA 1SFXA 5D5XB 4XOGA 1PVC1 4AI0A 4R79A 5A7SA 2QKMB 2QZ8A 4UT5A 2YPDA 3LWCA 3HL2A 4BNCA 4A3IJ 1QBJA 4ETSA 1H1IA 1CJPA 3EXUA 1JZ5A 5A2QK 2L7KA 3FXLA 3G2BA 3A21A 5EJCA 4YFXF 3TEZA 2HWC2 5LBCA 4WM7B 5FPZA 5JPMB 4PSWA 3ZFGB 1LGBA 2L4AA 1C8M1 1P6RA 2ME6A 1K5MB 4A6DA 1ZKGA 4XLEA 4M0HA 3VZNA 3JREA 3QYFA 4LOTA 4E7HA 3CJIA 1OOPB 3IN9A 1GLNA 1LDDA 4N4NB 5DAPA 1W0UA 3O12A 3RDIA 5DCMB 3OL3A 4D8MA 2JA5J 3PL8A 4HMZA 3CUQA 3LA7A 4WVMA 4ES8A 2DV9A 2QQBA 2GNMA 2VKEA 5FY7A 1POGA 2WAQA 5H6QA 3S6PA 5FDBA 4KT5C 3LAPA 1X2MA 2AQEA 1CPMA 2VULA 2NXNB 3GTGJ 3R05A 2YBPA 4CGZA 1P9QC 3VLBB 2K27A 1LEBA 3ZDVA 2Z33A 2VCBA 3DKXA 3AP5A 1MBHA 3PNYA 2DPDA 2VC1A 2DFBA 5GZGA 2XC7A 3LQRA 1YRNB 4XQWA 4ESJA 4HV5A 1W2TA 3BIEA 1QMJA 1MBGA 4D0QA 5D8KB 4KNCA 3NW4A 3LAJA 1MBEA 4BQYA 4ENNA 3IDCB 5EDNA 4KH9A 2XPUA 5BNOB 3K46A 1L3LA 1FYLA 2R5YA 2JWPA 1XC6A 3VBRA 4F8AA 1N75A 4D6SA 2WNVB 4QPOA 3I56I 4ASLA 2NAZA 4ZONA 1CIWA 2MNGA 3F9KA 5IYDJ 1QNYA 5DM6F 2PQSA 4BMEA 4YLZA 3L9FA 4EN6B 1LKXA 4FTHA 2VONA 1MJ9A 4XDOA 5LGTA 1ZRFA 3PFYA 1ZAOA 2PHXA 3GF6A 1BMV2 2F5CA 3AKTA 4WX9A 3K1NA 3OBTA 4E7JA 4QQHA 2R4GA 2XAHA 3GZNB 4LHLA 3W58A 5EV7A 1JYIA 1NYWA 4BK4A 2VZPA 3HYIA 1OPCA 2RHPA 3UKVA 2Z2SB 1MPXA 1GZ9A 2ADDA 4UW5A 5FOJB 2MLKA 4DY5A 4S2GA 1MS1A 2XBO1 4XL9A 3SFIA 3K7AJ 3F72A 3BKZA 2ZC2A 1YFYA 1W7PA 1EV11 4EGZA 3GGLA 2GOMA 1B9NA 5KK1A 4D6QA 4PGGA 1U9NA 3N7JA 5C5UA 2WLQA 4ITVA 4EN9B 1ZHFA 1HW5A 5EZGA 2QVSB 1AUYA 4LHNA 2HPMA 3L2RA 2JG9C 5FZ9A 4HNVA 3K4NA 4QX2A 1XQNA 2B7EA 1UZZA 4LA3A 3DEMA 4MTEA 1GP6A 1MBFA 2Q1ZB 1AR81 2JRMA 3RYPA 1MEC3 2M30A 4I3GA 1QY4A 2TRTA 3AZWA 4XQ4A 5J40A 2BE5F 2KIFA 5BNNA 3TNQA 5JIUA 5EJ1B 2A6TA 2VVFA 1GUUA 4IRHA 4C2UA 3FFZA 4RMNA 1W36D 3V4GA 1JI8A 2DJIA 4M72A 3KT4A 1AKHA 1ETKA 2K86A 3KF3A 2F5EA 2X5IA 3BU7A 4J1WA 4Q4Y1 5JUVA 2K9LA 2M0CA 1YIJI 4RGXA 5CZKA 1QGPA 4XJ9A 3ZMZA 4C1XA 5FLVA 4OIPF 4DQ2A 4IV1A 3QH6A 3C18A 2VBBA 2J1VA 4EWDA 3UKGA 2CQQA 2EFOA 4XHXA 1UOFA 1VBE3 3IKVA 3HVDA 4UWDA 2TUNA 3SNMA 3M1EA 5IYBJ 3BTLA 2A5YB 2RMU3 1R1A3 3A22A 5DQ0A 4META 3GBWA 4KWLA 2JB4A 4I0AA 3AFGA 1WD4A 3AL0B 5FAXA 2V1NA 5HLGA 1MEC2 3T30A 4XICA 2KLOA 4RS5A 4IE5A 3UNPA 2XVKA 2B42B 1V6MA 3OUHA 4CPBA 2JPCA 2A3XA 3I4IA 4XTMA 4L9TA 1UZYA 4N53C 1MQTB 5A33A 3EHKA 3AFHA 3VHNA 1SMTA 2GALA 2W1WA 3EBRA 5K5RA 1ZBE3 1BLZA 1Z0XA 1NK3P 4XFBA 3KCXA 3OYWB 5CADA 4ISQA 1HN0A 2ZGSA 1R4MB 5L3GA 2ZSIB 4OIOF 1KDKA 1SD4A 4PJMA 4OMZA 2OZ6A 1ULYA 1ULCA 2HWB2 1VBE2 3ZXAC 3EDPA 3HB9A 3CMMA 3DU5A 5ANQA 2ZZJA 5FP9A 1IUYA 3LF7A 1TWHJ 4KU7A 2LKPA 1KITA 2Q1MA 4QSHA 3OMYA 2RMU2 1R1A2 1I39A 1Q56A 3AKRA 4YRVA 3PSFA 3ZDSA 5EGOA 2J1RA 3JTGA 2AEZA 2XROA 4AK3A 5FV3A 4NHJA 2GC2A 2FUG2 2FCVA 3WODF 5FP3A 5E6HA 1I3QJ 3BTCA 2Y6JA 1F4AA 1AZDA 3WF2A 1MNEA 2DO7A 4FASD 2VUCA 1BKZA 3ASNH 2HR3A 4GYGA 4P96A 4RLFA 2XVLA 1DGRM 1E5IA 3V0BA 1ZBE2 4L2NA 4YFZA 4CCDA 4II3A 1GICA 2AREA 4DS0A 4CCMA 2EFPA 1ETVA 1FY7A 2ZGTA 3FHAA 2BUKA 4PBPA 2VJ5A 4DB5A 1U5ZA 3E6BA 2GA2A 1N3QA 1I6XA 5HV4A 1VAKA 1WJEA 4FI9A 1SBDA 1EY2A 1A3KA 3NNJA 1K5MC 4LBNA 4Q4ZF 5B2GB 1O3TA 3B02A 2XVGA 4XEZA 4MGRA 3AM2A 4JGZA 1QQP3 4OAZA 4AVSA 5BNGA 2CH0A 1G9CA 3OGRA 2XWBB 1DLCA 1EA3A 3SH3A 3JB4C 4WV8A 2YX7A 1UYYA 1BHGA 2Y8KA 2HJIA 3DXUA 2VXRA 4YG2F 2VXZA 1BBYA 3AXEA 2OKXA 5A3LA 5KHHA 1YW8A 3S1QJ 3HBZA 3HN3A 2PLYA 3CJIB 3WNPA 4MXVA 2VL8A 1W2NA 5E3OA 4I6ZA 2WZ8A 4HOOA 5ICGA 3AYCA 3HD8B 2WY8Q 4L11A 1KGSA 1H88C 4WVMB 4B44A 3JD73 1TTYA 3VUOA 2AXLA 2K5CA 5M5YJ 2IBDA 5BNOC 2LR8A 2WNVC 3LSEA 1H9TA 1QQP2 2BVVA 3H1CA 1FV3A 1LOFA 1ZBA1 3MEXA 2DOFA 4C3HJ 1YG2A 3V7RA 5F3EA 5CVVA 3HNMA 2RGVA 3NEUA 1V5GA 5K4LA 4QB6A 5HCFA 1L7LA 1PX4A 3VKNA 3TP3A 4IEPA 5L9BA 1G3SA 4UFMA 2R5YB 3BTZA 2KDZA 2HOSA 4L5IA 1UAAA 4Y7NJ 5FIXA 2E1NA 3C1DA 4G3YC 5K9YA 4B29A 2SBAA 3MZYA 5DEQA 1QKQA 3RI4A 3S3MA 5FMBA 3T08A 2V26A 1SLBA 2NVUB 1MSEC 4YZ1A 2EA4A 3JD72 3BVCA 4MV2A 3VL9A 2ID4A 4AYBA 1DU3D 3VZLA 1RKTA 3L2QA 2B0LA 3N7LA 1YE9A 1OVPA 1W03A 2W2IA 2IXJA 1YO8A 3U2RA 3POGA 5L9VA 1W7PB 4AE2A 2HBTA 3HRTA 1HBXG 1DQUA 3I54A 2HLEA 1O4ZA 1GZWA 4CZSA 4DBQA 4L99A 2W82A 1S8NA 2HKOA 4DEQA 1UFMA 2VCAA 3VODA 2FMYA 5JAXA 3HN1A 1UG2A 4IOAF 5FPXA 4OQ9A 3ZOBA 1J1LA 5CVRA 1Q43A 1VQLI 3K70C 5BQTA 1CAXA 2CV0A 1RIOH 3SEEA 1NG0A 3RZGA 4I3PA 4LO5B 4CPBD 1CAUA 5BNNB 4PFOA 1G4DA 5J7MA 5FZOA 5DS9A 2PJRB 3WDWA 3MAJA 2F4MB 1WWYA 2QQLA 1JOPA 1Y9QA 4A7YA 1UPSA 1B6AA 2HQNA 3LFKA 4PLOA 5FKNA 3I4MJ 3FBIB 1QZZA 2K9MA 2WO3A 1WD3A 1AKHB 5IYYA 4BQNA 3R6SA 2XUEA 3AB0A 1P8JA 3TP0A 2V1XA 4CDUA 3TO6A 5H9RA 1YI7A 1J7KA 3AKZA 4UYBA 3FZVA 1R1TA 4O9EA 3J81Z 4IE4A 1MW7A 1GDTA 1AR63 2CGOA 3L2YA 3HUGB 5A7PA 3HSEA 4R4ZA 5EXOA 3AL0C 1GFF2 4IV1B 5GADJ 4QXBA 1DGRA 1UY2A 2ET7A 1Q1HA 4U7BA 5GAEJ 2DYSH 4BHPA 2RJLA 1VMHA 4UV9A 4EZ4A 2EZLA 1XCBA 2CQKA 1C8M3 3DF8A 4MGQA 4GMP1 2ESHA 1OLRA 1YJLA 1MQTC 3GZAA 4AI9A 5F5AA 1JKOC 2GZWA 1JOJA 2VL4A 1ULGA 3CD6I 2DF7A 2VOXA 4EN8B 4LHSA 1HLVA 2FCUA 4RYDA 1RUF3 4OYUA 4RS5B 1C5HA 3DN7A 3OG2A 1A6IA 1ETYA 5LK5A 4QXKA 2ZABA 2Q0OA 4ZJZA 5B3SH 2GBYA 1RUG3 3EJKA 3AZYA 4W6XA 2FMDA 3QODA 5JI6A 4G94A 1JE8A 4Q1PA 1YI9A 1S55A 2GMEA 1IKPA 1WZXA 1JZ6A 2X6YA 4ZPIA 5I0UA 2L3DA 4AEJA 1QJY1 5FREA 3ECQA 1V6NA 3MFCA 2HVQA 2QWWA 1VBA2 5KCMA 5ERIA 3NJZA 4C91A 1RNLA 3H3ZA 2WRAA 3LSGA 1PVC2 4PIXA 1LR5A 1AR62 3FE5A 1OA4A 1DZRA 1J59A 2W95A 4QDQA 4XAEA 1HW1A 4YIRX 2PFBA 1GP4A 3HKZA 2CUJA 2ZPXA 1UX7A 4RGKA 2GNDA 1F36A 2DMQA 1C8M2 4QM9A 3GFMA 3NAUA 1VQMI 5D4SA 5FZIA 3OCPA 2OX0A 3ETQA 1C28A 2P3JA 2DMNA 5KHGA 4XUOA 5EGOB 2HDDA 2VBPA 4XN3A 5E3MA 3VYRB 2YPJA 3LSDA 2O14A 1XSDA 1RUF2 4EM0B 3H8RA 2QEXI 3JRCA 5JHFA 4RR3A 1O7LA 1RUG2 5BNPA 1VQPI 1OH3A 1COV1 1W3XA 5LA9A 3LDRA 4IHYA 3KZIC 1KD7A 1GQGA 1RR7A 2W91A 3Q8EA 3FLTA 4QLCU 1S7OA 3V0BB 4Q29A 1R093 1O4XA 2VMEA 4F91B 4OCTA 2H27A 4HRIA 3T5XA 2DODA 2LALA 1YNAA 3APBA 2B9UA 5CKNA 3KZYA 4XZPA 3IDAA 5FZ1A 3ILFA 1OYWA 2QCSB 1S9HA 4C0BA 5LBFA 4HNTA 5AC91 2ZXWH 1MMDA 1GMMA 2K9NA 1CESA 3LA3A 3CO2A 2RVAA 3MPBA 4JGZB 3WOGA 4IEJA 2ZCWA 2STWA 2P1BA 4FTBA 4FFIA 3X2QH 3CJIC 1LCLA 1Y56A 4UI9L 3KETA 1AR83 3ZMNA 1QJU1 3G3ZA 2Q5TA 4XABA 3WTUC 3WR0A 4JDMA 1CAVA 1G86A 5I0TA 1BJQA 3CQOA 4M74A 2WWSA 1UKGA 3SKJE 1GSLA 5LZ6A 1AA7A 2O0OA 2Q2EA 3CCRI 3I4PA 5IK7A 3PNVA 2WB1N 2LY9A 3WX5A 1W3VA 1IAWA 1V9U3 4IQJA 1NLSA 4ZYAA 4YM0A 3D5OA 3DECA 5FZDA 1R092 4FOQA 1JKQC 2VCCA 2KA3A 4ET7A 3VD4A 1BA5A 3FK7A 2P4EA 5GP9A 2XG3A 2Y0SN 2GMMA 4QPGA 4HX4A 2JA8J 3BR2A 2EWNA 1BXHA 1RUI1 3K4CA 1MH3A 1IQAA 2YR2A 3LOIA 5FK7A 1JUMA 2JRTA 4QHZA 2WA0A 1TME3 2M34A 2X1EA 5CIRA 3A1YA 2FBEA 3BPSA 1ON1A 2IXHA 4DW6A 2XL7A 5HVQC 4XLAA 1Z3XA 4RDUA 2CU5A 1FMD1 4M3BA 4NRQA 3H42B 1AR82 1UXXX 4GWIA 2A3YA 5JLXA 4P02B 4B1LA 4QGMA 1YTYA 1N3OA 4BH9A 2EA7A 3WDUA 4QKBA 4FPJA 4ZS2A 2AUYA 3J26N 3GCMA 5I8TA 2YC2A 4H7MA 2ESNA 4XIKA 2LM3A 3ACIA 5CB7A 3DV8A 4M01A 5HDNA 1JUHA 2V79A 1V9U2 5ILSA 1VMJA 1S6LA 2V4AA 2ZFWA 2DA3A 3IUOA 5KXBA 3L00A 4EM2A 4ZY9A 4J25A 5KXDA 1JHHA 5E17F 3GYHX 3GTOJ 4GRIA 3UR3C 4ZDOA 3P9CA 4OUMA 5JI9A 3K75B 1XGMA 2MEV1 5K0UA 4B4RA 1SDWA 1E17A 1TME2 1U5TC 4FBFA 3LPFA 4Y24A 3K0LA 5A2QZ 1BN5A 4KBZA 5C3PA 4MGYE 1NQJA 1IV8A 1IOAA 5H9QA 1UOJA 3I2DA 5BNNC 1PGW1 3W6KB 3D3AA 1MJBA 2RN7A 2VNGA 3UKTA 4PI2A 2ZX4A 3VZKA 2VMGA 3QWLA 3AYEA 4JAAA 5J4VA 3T09A 1CAXB 2BXYA 2KIMA 4LO6B 2ZAHA 1LHNA 2ZGPA 4EMSA 1WW4A 1CAUB 3MV11 3KP2A 5FZOB 3C7FA 3O6BB 3IAM2 4J00A 1Z9CA 1AX1A 3VD5A 4IO9F 1A34A 4IV1C 1QDOA 1IN5A 2JE9A 4COUA 2WIIB 3TNPB 4TZDA 2BV6A 4Q5OA 2FE3A 5G04L 4CDUB 2EFQA 2XGDA 5F6FA 1AXZA 1PMHX 2A6VA 4D7TA 2NYYA 2ELJA 3PIJA 3AX4A 3AZXA 2KISA 1URXA 5FZKA 3BTIA 3C2GA 4FISA 2RJKA 1BEV1 1HV1A 1NCQA 5L3DA 2HYJA 1YLFA 2PFWA 1Q1VA 2HI3A 5HNHA 4OINF 2L4MA 3AKSA 4CXFA 3BTAA 4FETA 2YU3A 2IS4A 4BQWA 5BYNA 2R0QC 4CP0A 1O6UA 5FMOL 4S0HB 3A0NA 4IPAA 3ISPA 3GBFA 1YC61 5DG1A 5I8SA 2XDVA 5C3RA 1ZX5A 1O91A 4MEYF 3MQ0A 2HWE1 3WTVC 1DZQA 2XRNA 2DOAA 3HOBA 4LA2A 1HJFA 3ZYBA 2B5HA 4IEWA 2XLAA 2V73A 1RUJ1 5CVIA 4H0EA 1FT9A 5AIQA 3POEA 1LEAA 4BXXJ 3WXPA 3NNFA 1BM9A 4YGDA 1KRIA 3ZQQA 1OKQA 2O5RA 2P5LC 2NOJB 1WBFA 4YELA 2EQRA 5DUUA 2I07B 3P5JA 1CONA 2LDUA 1LE8A 3O8HA 3FJSA 3KIOA 3DUIA 4XIOA 3RQ0A 4EJVA 4CEWA 4KU8A 3BQZA 1X1PA 4IHSA 4ASKA 3NNMA 2NVTJ 3KSCA 1REDA 2EXHA 2WINB 1FOWA 2YUEA 4B8EA 5FBZA 5FXVA 5FJKA 1VI0A 2VZVA 4JKLA 3AXDA 5BNPB 3O1RA 5T5OA 2KKOA 3WDXA 4CU8A 4GB33 5CG9A 3T4VA 4Q5SF 2XUBA 1W2AX 1I3HA 3HDDA 5FP7A 1RC9A 4B7EA 5M0TA 2MFZA 1EPZA 2HGCA 1BJZA 1X3UA 4XBNA 1I6HJ 4JGZC 3I58A 2LYCA 1JOBA 5FMDA 5K8SA 3ZMUA 2DUQA 4B09A 1ULOA 3VBUA 4MGTA 3ELKA 1KJLA 4OHWA 3WU1B 1U6GA 1RMU1 4Y4RA 1QJEA 5FZHA 2ZOEB 4N8MA 1JODA 4YG6A 3AP4A 2PHTA 3FBNB 1N77A 2EIKH 2K4JA 3HM5A 2WWYA 1Q8PA 3I55I 1U9OA 5LA2A 3R61A 2PYTA 3VEPA 4FOYA 1D2QA 1LFBA 5F04A 1BBT1 2NMNA 3PIGA 1GHCA 1DQ5A 2V9PA 4GB32 5CYVA 3CEWA 2XV4S 4LG0A 2VMFA 3QOPA 1LTEA 2BJSA 5FYHA 4D5FA 5B5EC 2EIMH 3V65A 3ZMOA 3OPTA 4ZZ5A 3KQ4B 1LPQA 2MH9A 4MYEA 5J96B 4XF4A 5H2FC 3PMSA 4CHUA 4AIDA 2W57A 4QPGB 4YGCA 1LOFC 2XJUA 2CHHA 4Z8BA 4V2GA 4P14A 1WKYA 3RMYA 4DUXA 1DBNA 4RBOA 4QKNA 4MHRA 5DZFA 4FOVA 4JZRA 3K4LA 4XLPF 1U8RA 4GGGA 1LEMA 4JX6A 2NS8A 1ZZCA 2VT2A 2YV8A 4EROA 4XMYA 2E35A 1FEXA 3ZYIB 5DTDA 4TYSA 2VH9A 2R30A 3UL2A 4BXUA 2XUMA 1S5LC 2DCJA 5C8CB 1T08B 1A35A 1DZTA 5L36A 2WNEA 3C7GA 4Q4W1 5C6CA 3V8KA 1BVP1 4YW1A 2IXLA 1EJ9A 2W4SA 1LNSA 1RL3A 2A7AA 2TEPA 3WG4A 4AVZA 1NAEA 5CYYA 3TW6A 3PU8A 2A69F 4Q4V3 3R4KA 3OYEA 2YG0A 2XXZA 1C8NA 2QZ3A 2BPA2 1UY3A 4EJOA 1D8KA 3NNLA 3TB0A 1Q8QA 5JSPA 4XIDA 5J3UA 1J5YA 1BI0A 4LK1F 4ZS3A 2QSHX 3POSA 2VE9A 1U5YA 3K4JA 2K9SA 1R081 1TL8A 3ZXSA 3AZVA 3FXJA 4YFKF 1VAVA 1L0OC 2VQCA 3W6VA 3HTSB 4NO4A 4V1PA 4DINB 2P34A 3A01B 3OY8A 5KR7A 3NRUA 3WD5A 3OYCA 2YFUA 1Q3EA 4Y15A 3NQOA 3ZXDA 5FPAA 3OIQA 4ZZLA 1LU1A 1W5TA 1DQ0A 4YW5A 4OI0A 3NVCA 2K4BA 4GZ9A 3BR5A 4JQRA 5ANNA 3IMMA 3I3DA 3B7MA 1COV3 1LVKA 1OLQA 1R64A 5B4NA 1YQ8A 4E7IA 1KJRA 4GD4A 2OV7A 1JHNA 2H8RA 4JQFA 3TOAA 1CAWA 4Q4V2 4HF2A 4FQZA 2R0FA 2W39A 4HYEA 5EIYB 2OPKA 1QU3A 3AC0A 4HX8A 4O3MA 1W8OA 2DA7A 5FZGA 5F32A 1QEXA 1EAH3 4L5JA 4HQMA 2PJPA 4QPIA 2MHFA 5K7PA 4IQPA 2XRLA 1RUD3 1WGXA 1S2BA 1W9TA 5AC93 4YFNF 5IVCA 4ESFA 1QRYA 2EILH 1RINA 5FKCA 4YZ3A 3KGLA 1Y43B 1YEWA 2STTA 1UYZA 4D7YA 1FIPA 4JCKA 3NWTA 2YX4A 4HV6A 3N7KA 3L2CA 4W1UA 1WMEA 5GPCA 3BY6A 3C2BA 1TWCJ 3JBG1 4MGIE 4AFAA 1DQ2A 3ACFA 1QJU3 2D3SA 4M3CE 4LBKA 2OA2A 2HYGD 3QU6A 1E3PA 1D3YA 3JQWA 2ELHA 2RNJA 1NCQB 3I5UA 1X8MA 1YJKA 1LU2A 2Y0OA 1IN8A 1COV2 3AP9A 2ZGUA 1ND3B 5C3QA 1VALA 4GH4B 1N1VA 2C26A 3KGZA 4XLNF 5FD6A 2Q8EA 1BQPA 4FAGA 4HEA2 1Y1VJ 3OGGA 3M4OJ 1X1BA 4X8NA 2IRFG 3N9MA 4XUQA 1WJBA 4KIGA 1U8BA 2JDHA 2X53S 2IXSA 4BE1A 2E2IJ 4NE9A 4XRSG 1HB3A 3OEBA 3B5LB 3ZYPA 3BG9A 2HBUA 4NPLA 1TW2A 1EAH2 2CDPA 2E6VA 1R22A 5HXVA 1RB8G 1DGWX 4XZUG 4MVTA 4A7KA 4XLHA 2F2EA 1RUD2 2D3PA 4XW3A 3ZFEA 5AC92 3E1F1 1TQPA 2WA3A 3F2ZA 4HDUA 1KQ8A 4PUSA 5CFDB 5LY1A 4KGQA 2WNUA 1GBGA 2E9QA 3KHBA 4IEVA 3ZYJB 4DXRA 3OL4A 1QJU2 2WZPP 3OV8A 1IZ3A 5BNPC 4EQVA 3RRDA 1J0RA 2X8KA 4CEWB 2O61A 3WW4A 2O7OA 4COWA 1OR7A 1UJ8A 2R041 3OEAA 2WTEA 5IPAA 3S15J 4XJWA 2BW8A 3G6EI 1YFWA 3KFWX 4AL9A 3IAPA 5D6EA 1R5HA 3TWIA 4XLFA 3GFIA 2HWVA 1TNRA 2AHQA 3HOSA 2Y38A 1GOHA 1Z21A 1MS8A 1G8XA 3H50A 4Q4X3 4AD9A 1Y7BA 1LJ7A 3D5SC 4LUMA 5E3LA 5FO5A 2QSFX 2KQRA 1IDZA 5FO7B 3ON7A 2MEV3 3CMAI 3WG2A 2X4HA 3LWFA 2ELKA 3M3QA 2W0XA 2KZVA 5D5WB 3GF2A 4D6RA 5FYZA 3BB6A 3HRMA 1NLQA 1FSHA 3BODA 3H5AA 2UYAA 2JG8A 4M6XA 1OLTA 1PVXA 4ABZA 2CQXA 4XBFA 3N05A 2D93A 1N1TA 2I74A 1WJ5A 1SBEA 2QUFA 3MKZA 4JC1A 1FBSA 3HOXJ 3KV6A 4WXDA 1BZWA 4DUVA 4E4SA 3NRVA 3O0VA 2XL9A 2VT3A 1H0BA 2AYHA 2EIJH 1FOXA 4D94A 5AONA 3IHUA 2ZAAA 1H8VA 2QDNA 3NNGA 1RZ4A 1GZCA 5E8GA 5GLZA 2WO1A 1WJDA 4QPGC 4Q4X2 1XN7A 4GWNA 3DF0A 3O2PE 3ACHA 3MUZ1 2A73B 3ITQA 5C5TA 4LG0B 4JQTA 2X9DA 5FP8A 1N78A 4IERA 3BR3A 1ZVFA 2MEV2 4AGRA 2IEKA 3AMMA 5LASA 3ECOA 4M6VA 4E2QA 3N7MA 3BR0A 1BI2A 5JXHA 5IK8A 3F3XA 1E0EA 1UG0A 1XNDA 1K4SA 1YFXA 1H1AA 5ED4A 2HXIA 1HQNA 3VB9A 2JDMA 3CCMI 3Q9VA 3PTYA 5HDGA 5C8CC 3F6VA 1E3OC 1BEV3 4M4RA 3RKWA 2QNKA 2R7SA 1ND2C 1W8WA 4M6YA 3WF1A 5KHIA 3K2AA 4XM3A 4UFJA 3ACLA 4H2AA 3FMQA 4DOZA 2ARBA 3A0BC 4RGAA 1M1EB 4NPRA 1OVSA 4KIBA 2VQHA 5FZFA 4XXAA 2FQ3A 4L0PA 4AVBA 1UU4A 4LE4A 4XCAA 2HEYF 2HWE3 4XDPA 4A45A 1IUFA 2QENA 4MQVA 4IHTA 2QBYA 2D6LX 4DOUA 5A80A 1DIWA 4BPZA 3CDIA 5A1LA 3DYOA 4BACA 4RFT0 2AGSA 2WQ8A 3E6DA 1G3YA 1GP5A 4FCYA 1TQ5A 2A3SA 4FPGA 1PO11 5A1FA 3S1NJ 2VMCA 4KMUX 2H1LA 2B9SA 2WO2A 2E36A 2J5OA 1S1AA 2HVSA 1QOOA 3CESA 3USUB 4EJWA 2GQQA 1RITA 3TEXA 2K3FA 5DAQA 1PP8F 1TNTA 5KNLA 5GPAA 4LR4A 1BEV2 5J6XA 1PNFA 2Y0SA 2EVXA 4XETA 3JRBA 3OY8B 5FZLA 4BE2A 1VQ6I 2OYZA 5T55A 4YW2A 1EH8A 3PVEA 4RSUA 4C90A 1REPC 2CUEA 1I1SA 4FO9A 3Q8BA 5FYMA 3MLLA 1B35A 4HSJA 4Y33A 4CU7A 1PMJX 1GQHA 4NIDA 1BIBA 1W0OA 2HWE2 1CQ9A 1KZHA 4ANJA 3ST7A 3VSLA 2BNMA 4H3WA 1AL23 3MDPA 3MKWB 3K4DA 1WA6X 4MO3M 2VOOA 2FDHA 1IXCA 4HVOA 2EK5A 3ZO0B 1FJLA 2COBA 4D7MA 2ZO4A 1C3HA 3K77A 2DA5A 1G59A 4A3JJ 4KGGA 2FA5A 2WJSA 3GXUA 3ZXFA 1WW7A 4QM8A 1RVF1 2LMDA 3BLYA 2X6OA 1LENA 2ZHNA 1JS9A 3J9SA 4I09A 4QPIB 4FPOB 2W25A 2Y6LA 2V9KA 4UVBA 1WLWA 1T0FC 5GTIC 2OCEA 1ND3C 4GH4C 2DFHA 4NRPA 1OFNA 3VKFC 4XAAA 2XAJA 4N9HA 1S3JA 1HXS1 2PN5A 4QU2A 3GVAA 2NOGA 4PCQA 3UESA 3MN2A 4UF0A 2WAAA 1HIXA 1OSGA 3LEIA 2W24A 4O65A 4CU9A 4XBLA 3J4UH 5J37A 3ZXLA 3S7EA 1Z7UA 1Q8VA 4HK8A 2KFDA 2QSGX 1AL22 3BJAA 1ZNPA 5LBBA 4GMP0 3IRQA 2M7BA 4CCKA 3BC8A 4PJ0C 4HLYA 5CFDC 1QZYA 2RS31 4YVSA 2VE1A 3DTKA 1GQPA 2DTWA 2RAEA 2B45X 1G6NA 1Z6TA 1UKRA 2Y6GA 4HT1T 5DZEA 2HWC1 5J1XA 2R073 2OF7A 1KA8A 2YDEA 5E1RA 2V1DA 2P7VB 3VDAA 1PUFB 5FOBB 4CDGA 4HN0A 3BP8A 1X58A 1XGNA 2WNUB 3CLQA 3V0AA 2DVGA 3RZLA 2VC9A 4II2A 1O3QA 4YW4A 5J09A 1MS4A 1W6NB 3O3KA 1RR8C 1W8UA 3U9GA 2EXKA 4S2FA 5LB6A 1R6RA 2GA1A 2FQPA 4Y1VA 4EWAA 1ZZ8A 1N47A 1KU9A 2HOAA 2WFF3 3R4UA 1TEIA 2QQOA 2D6KA 3ZGKA 2H6BA 2YSRA 1MVQA 1U5XA 2QQNA 3U21A 4KN7X 3FXUA 5CKQA 2GH2A 1XE7A 5E79C 2A61A 4KYWA 3OSGA 2KMUA 2GXGA 2M2EA 4XBQA 1IN7A 4YG3A 2VU9A 2VKDA 2PAEA 3OD4A 2LREA 3S1RJ 2R072 1RETA 1SFUA 4GQ7A 4L9JA 1LVAA 3TEWA 2GAUA 2FNPA 1W28A 4HPQA 1T39A 3A0HC 2WYFA 2L7MP 2KZGA 2L02A 1WMXA 3JRAA 5FYCA 2ZEYA 3PLQA 2H0VA 4MIMA 2JG9A 2PQ8A 1C1FA 2VBXA 4YRDA 1HA8A 2HKXA 4D7SA 5IVBA 3Q8CA 1JW6A 4P08A 4I76A 2DVFA 4L9VA 3URFA 2WY7Q 2WADA 2QVOA 2PHUA 1BMV1 4JKMA 2JE8A 4CEYA 1R1UA 3POYA 2Z42A 5G05L 1FBQA 2DA1A 5C3OA 4Q0QA 3FBMA 1XGSA 2WFF2 1CX4A 1F2NA 2P8TA 3F21A 4CE8A 2CYFA 3HGYA 4ATEA 2RS51 3IPVB 4P1WA 2D6PA 4CO8A 2AQFA 1R9TJ 1ONAA 1BL0A 1KU2A 4BDYA 4LB6B 2YPRA 4X8PA 3T0DA 5I8YA 2L54A 4Z1VA 2W46A 4JV4A 2YC0A 2VQGA 5L7OB 3OS2A 1YWKA 4K40A 1QJX3 4WWCA 4HKWA 3VOEA 2PMZA 2MPFA 2VOWA 3O1PA 5K7HA 1LDJA 3HQXA 1Q8OA 4QHBA 2Z4FA 1SLLA 2FBHA 1ZG5A 3M3CA 2OPWA 2JSCA 3GFJA 2DTZA 1LQ1A 4KIFA 1RXFA 3DPUA 4OFGA 4ONUA 3HJEA 2P6HA 2DA4A 2B46X 3BPXA 3Q0VA 2VBZA 4N53A 2L01A 5H9SA 1M06G 3BOQA 3W3CA 2W1QA 2R16A 5FYUA 1ZA4A 2ZJRF 4K20A 3WDYA 2P81A 3A03A 1ST8A 2X09A 2WUHA 2UURA 4Y1YA 3WP5A 2LBFB 5IAVA 4KMFA 4DZPA 2YUSA 5HS9A 1Q5OA 2DCZA 2HNHA 1ETXA 1RXGA 4XJUA 1DPUA 1U78A 2QBYB 3S8PA 4RAYA 3G73A 2Z9OA 2LH9A 2VZSA 2E31A 1YOVB 1YXWA 4CDQA 3K3NA 1KYWA 4FQ4A 2CG4A 3WLUA 4KQ7A 4RL7A 3K48A 1QJX2 4ENKA 2DUOA 2Z16A 1T98A 3J7ZI 2BRTA 4ON0A 3C3VA 1GLHA 1MEC1 4ENJA 4BQ5A 5BS6A 1H2NA 2I45A 5GALA 2CMPA 3PFIA 2CUZA 5J47A 4CCEA 2XAQA 2LRPA 4Z92B 4A6EA 2Q0AA 1IGOA 2EF6A 2IJLA 4ZKTB 1W8ZA 3ABKH 1IO2A 3SHRA 1ZRDA 4A0ZA 2TDXA 3CLPA 4GXOA 1B8IA 3K2ZA 2QCOA 3KLNA 1NG7A 2V72A 5E8IA 1B35B 2QQAA 3CF5F 3QP5A 3LIHA 2EZIA 2B7YA 2Z5WA 2J7MA 1W6MA 1NQDA 1S0EA 1TBXA 1ZZ7A 2BY3A 3LB9A 4E2SA 2CV6A 4COZA 4FHTA 1BR4A 5CG8A 3OJBA 4QPIC 1VBE1 3O1VA 2NVQJ 3PVOA 5FPVA 4A3ZA 5IAXA 4O7XA 1QXJA 4A6OA 2HQRA 2RMU1 1EUTA 1R1A1 4E70A 3I2GA 5F8PA 3H9GA 2EIGA 1RJ8A 1Q8SA 1JYCA 2M0MA 2EPFA 4MGZE 2DU1A 4P9YA 4HF0A 3ULQB 1JYXA 4I7HA 2QQPA 5DCMA 3OYAA 4S05A 1ODDA 2E7XA 2NM1A 4RHV1 2AR6A 3DPRC 1FYKA 4XJ8A 1XE8A 2IGKA 1HLCA 2L9NA 4PFPA 1KEXA 2JJ6A 2YU2A 1ZBE1 1K45A 5BUVA 3POJA 1F9NA 4R52A 4BQ2A 3NL1A 5FY4A 1YCIA 3PVNA 4BIOA 1VQNI 4BB3A 3J81K 4CDXA 5LGNA 4RM3A 2AS5F 4C9YA 4IV3C 1XNCA 3A4CA 4CYCB 1V4RA 1YQ6A 4FTEA 4COYA 3LMMA 2GLOA 1HRI3 4AOCA 2MD5A 3EPZA 1AYN3 2COMA 5K5QA 1AHSA 2CY6A 4JOMA 2FBIA 4YVSB 2WNUC 4IKFA 4YSFA 3FWEA 1BR2A 2RDPA 1NZCA 3PHMA 3QP6A 4CSWA 4RAZA 3T2QA 1CWPA 3OBAA 3Q5FA 3EYPA 3CCEI 2PELA 4I30A 3WDTA 3E5QA 2A75A 3BOPA 4M3CF 2BGPA 2BFUS 1OR7C 3CUOA 1LULA 1KFXL 5AVPA 1BC7C 4Y3OA 4JDOA 3V0AB 2HDCA 1AL0G 3DYPA 3POBA 4PF5A 3S5AA 1XYPA 2CW7A 5KHKA 1UNBA 1CQTA 4EZHA 2VJJA 2M87A 5JIAA 1UY0A 3OYLA 3VDCA 1PO23 4IRGA 2XASA 4RAGA 3HG9A 3ATGA 3HOUJ 2QUOA 2ZEWA 4OULA 1OD5A 1KXGA 2AEYA 4QQLA 5JZGC 5KWRA 1YIOA 1B4AA 5T54A 3PU3A 1HRI2 1VQ5I 1AYN2 4CXWA 1I50J 3AP7A 3BCWA 1QQP1 2NVYJ 3MO4A 1YIFA 3TOJA 5DM7F 3TYJA 5FXWA 1QXPA 2KJCA 2QJVA 3RZHA 2XMLA 3A4UA 2E19A 2V1UA 3HQUA 3DLLF 4EN0A 4EVIA 3ZR6A 1WKMA 5J1YA 1X33A 1GANA 1RRJA 4AFCA 1EV7A 1S0FA 2JG9B 2PHLA 4XILA 3WP3A 3ZN4A 2YS9A 5IVJA 4OI2A 2WNOA 3TEDA 3D1NI 2P0WA 3OBRA 1NLRA 1LRHA 2W08A 3LDBA 2EICA 3HKZN 3K6GA 2DMPA 3INAA 5TRDA 2BOIA 1AF9A 5DUIA 4CEYB 3E7LA 5L73A 1PO22 4ZYEA 2ZGKA 5L3BA 3JD71 4N7IA 4BY7J 3RS6A 5GJ6A 5E1WA 5KHDA 4QPWA 1K78A 5L7OC 4V2VA 4G6QA 4DZGA 1D5YA 2W47A 3U14A 4GKYA 2P5BA 4M9XA 4XCBA 1U3EM 3MIBA 1JH5A 2EZHA 2UXXA 4AVTA 4UB8C 4NAMA 2FXAA 2HYXA 3FLPA 2D3RA 4A3LJ 1ZM1A 4AQTA 4BQ3A 2OBPA 3D0JA 4IEOA 4W6YA 4H14A 3FMRA 5EYYA 4IE7A 4KWJA 3HZJA 3AG2H 3RJRA 5JXGA 1CF7A 1SLIA 2VZQA 3VKMA 2VR4A 3GNEA 1MQTA 1J84A 4Q0PA 4LB5A 3L2WA 3WTWC 2PAMA 3GO5A 2E7AA 5B66C 2QTWB 3W21A 4UW6A 3TQNA 1SMVA 4KBBA 3OYWA 3F0CA 2O0YA 2ZFUA 3ZIXA 4DGWB 3M7GA 1RUH3 1E5HA 1AR73 2MGQA 4K21A 4KG0A 5F9TA 1W9YA 4BGDA 3DU6A 1WSUA 1UU6A 4N53B 1I5PA 2LS6A 3JRFA 4BHBA 1C1LA 3RGBA 2VTXJ 1EH7A 5DUWA 2BVLA 1HF0A 3OUIA 1NCRB 2FHRA 2RS33 5EWSA 2GIVA 3LA2A 5FPUA 3POIA 4MGKE 4M3EA 1V00A 4WM8A 4A3BJ 4PSXA 3BTJA 2XSJC 3VBSB 4CDQB 5ICCA 1J75A 3W2AA 1YQ2A 2JDNA 4V19K 1S4CA 2VLAA 4LKDA 1JYVA 3ASOH 1B1BA 2GXBA 5C9AC 2R0HA 4Q27A 2OIIA 4UAPA 3I71A 3ZYGA 3ZIWA 3U4SA 2ADEA 5LATA 1VP6A 3CDLA 3GZ6A 1D7PM 4IESA 1NA1B 2EIEA 3D5RC 3IZOA 1VQKI 4P9LA 5CBLA 4NDLA 3WHBA 2HZDA 3BROA 4DRVA 1X50A 2ET1A 1RUH2 1AR72 2R93J 4Y5Z0 3HJRA 3RPUA 2IW5A 4DIQA 4AF9A 4DQAA 3ZFFA 2VBYA 2WN3A 4DXTA 4LO4B 2ZJ2A 1BI1A 2LG4A 4QXCA 4Q48A 2P6SA 5JFRA 1YYNA 4K1ZA 3L2VA 1B8IB 3BG5A 2CFOA 2VNOA 4EV0A 3OGJA 3WVJA 1AR61 5C4WA 3RQ4A 3C3WA 1W6MB 2RS32 5D8LB 4WZCA 4LBOA 3J8F3 4IE6A 5JXIA 5CEHA 5JLVA 4YGBA 3PDQA 4QX8A 4XRMA 1UY4A 1QGLA 3I7DA 5IATA 3WG1A 1POQA 3IWFA 3WGHA 3JRHA 1ZELA 3KEYA 5L19A 1T2KA 2OJED 4XJAA 2VPLA 4BQ1A 4B3AA 4GKXA 4LQRA 1RHI3 4P5HA 1K6YA 1PUEE 2CAUA 4ZXEA 2IA2A 3HRUA 4MG2A 2WYSA 4QX0A 2IGOA 1RUF1 2DMUA 5FRAA 3AG1H 5HCAA 2CS3A 1RUG1 3GALA 2R7RA 1A04A 3MIDA 2KRFA 4KWKA 1K6OA 4P00B 4A93J 2BQPA 4K1YA 3GJAA 4A0YA 3VBOC 3R4SA 4QQ2A 1CR7A 4Y1XA 4PLMA 5CVJA 3LOCA 1W6OA 4QPQA 2R7UA 3WTZA 2J22A 4P9JA 4HSRA 3LKJA 4FPYA 2RS53 2E2JJ 1FATA 4YVSC 1K3IA 2ISYA 1JJ6C 4CDXB 3AKPA 1TWAJ 3J8F2 5C33A 3QCWA 2K9QA 3GFLA 4L9NA 2P3IA 4HETA 4HAMA 3OGVA 3REOA 4C30A 4XKWA 1JGGA 5EYXA 1LOAA 1RHI2 1TZLA 4GWMA 5B1BH 4CCOA 1HDPA 2QDRA 4LT5A 5IVFA 3WTXC 2BBAA 1MSFC 3K70D 1OPMA 4XMIA 4L8QA 3SLIA 1W6PB 2G19A 2Q8OA 2L9SA 2LNBA 4XPVA 4AFDA 4CVUA 4AFBA 1JU4A 2WS93 4BBRJ 1R091 3GEZA 4HL0A 2OXBA 2RS52 1FV2A 1KGYA 3ZPYA 2EJRA 2NRAC 2ORZA 1A5JA 2HVRA 1YHFA 4BE3A 3AK0A 3I3BA 4BLIA 4U7DA 1ENQA 1WGPA 4TLGA 5J8FA 2JIGA 2VW1A 2HWF3 2SLIA 2PG4A 2Q1FA 1U5TA 2AENA 2IVMA 3QQAA 1R58A 2C9AA 2UWAA 2IXKA 2BOLA 2FU4A 1ZRRA 1POV3 1ZG3A 4H55A 3MW4A 4BUPA 4TSVA 1QPIA 1VQ8I 3CF2A 2LD5A 3A23A 2PJRA 3JAMK 3M70A 1QVTA 1DPRA 4CEYC 4GJZA 1LHOA 4NWVA 5LFAA 2XQXA 4JHTA 3CDZB 3MIFA 2ZTNA 1JBCA 5FYVA 3MWMA 5ACA3 1STZA 3SHFA 3DCQA 3S16J 3M8FA 4AW7A 1V9U1 3ZN5A 2CDOA 1JZ4A 1OBNA 2QQJA 2NYXA 2WS92 2EAAA 4AIJA 5FY8A 4BKXA 3RVHA 2IC1A 3HUGA 2E71A 2MW8A 1DU0A 2VBWA 4NHMA 4LBJA 1JZ3A 1WCSA 3SJMA 1YYVA 3WNNA 1Y6IA 1G9DA 1V5FA 4R4XA 3T3YA 2K46A 1XX5A 5E8AA 2D43A 4FX4A 1K78B 2ZMLA 3CP2A 4XHBA 4LGWA 1TME1 3PUIA 3NJYA 1VBC3 2HWF2 5LRSA 3ERMA 2HPIA 2ICWG 3VHRA 4NR1A 1RUC3 5D5UB 2FD8A 2R5ZB 2PEXA 4JYKA 2G4IA 2BZDA 3G7DA 3CTAA 3U1XA 4Y22A 2DCTA 3N4MA 3U10A 4Y4YA 2Y64A 3DPLC 1MH4A 2L5QA 1CF7B 3JQXA 4HKLA 1FP1D 4RHV3 5FXZA 5ACA2 4YIFA 1IPKA 3RI9A 2H8WA 2IVIB 2J42A 5EHDA 5A7OA 4NHLA 3M9AA 1A36A 1X82A 4LKEA 4FVVA 3IH3A 2C6YA 1YFUA 5FZ3A 2GU9A 4JKKA 4DJAA 1R5ID 1NCRC 4E27A 3COAC 1LGCA 3H92A 2F4IA 4KDPA 1ZQ3P 1ZZ9A 5CQGA 4FCAA 3AYAA 5IK5A 2OC6A 2WBKA 1FXZA 4F52A 3MGUA 2OZJA 4LLGF 1J9IA 3VBSC 4CDQC 3P5BA 1IDYA 3E0JB 2F4LA 3OD0A 2VPVA 4DO0A 1UF2C 4YZ2A 4CXXA 1Z7S3 2VAUA 2EINH 4X6RB 2WAEA 1VBC2 4BS9A 1D5VA 3THCA 1V70A 1RUC2 5JDBA 1ZREA 2A71A 2F6BA 1NA1C 4GIQA 4WM8B 3F8MA 2HXOA 2PMHA 4LLLA 3SZTA 3BR1A 4BAYA 1VB4A 2VW0A 1FPQA 4JK1X 5FYTA 1J3QA 2JENA 4ZTFA 3F22A 1OURA 5LCWL 5IHRA 4IRIA 2O1QA 1AVBA 2DBIA 4NRMA 4RHV2 5ICEA 1VR3A 5CKMA 4KG8A 3NJVA 2KT0A 1I1GA 3MLJA 5BNQA 2Q8DA 3ZP5A 2QKLB 1GV5A 2WT1A 5J3LA 5I0SA 1JI6A 3O1TA 2RDRA 2JDPA 3EYYA 1I27A 2YBKA 3N36A 2EV5A 2JA7J 4P9IA 4DNYA 3HSFA 3UYJA 1FTTA 3ZFFB 1W39A 3O0XA 1YX3A 3CZUA 3T8RA 2EH3A 1SFPA 2XAUA 1D2SA 3RPQA 3BZ6A 1Y9GA 4HPKB 1Z7S2 5LRRA 2XJRA 3GMEA 3KP4A 4ES9A 5C4WB 5GM0A 1LFUP 3GTKJ 1XD7A 1W8TA 3LFMA 3B9CA 2FF4A 1FWZA 3MKLA 3NAPB 1JYTA 4GJYA 2DYRH 1JZ7A 1BK1A 1XG1A 2EIDA 2BWCA 2O3FA 1R23A 1PJRA 5J98B 5A7NA 3B6CA 2NS7A 2ZX2A 2KHMA 4Y20A 3L2HA 4ZDLA 1P4WA 3MFKA 4AEDC 3EMRA 3RSJA 1QNWA 1JTZX 1HX6A 1OCZH 1GXQA 5DUVA 1R1ZA 2ZHLA 3LEMA 1JUIA 2K9ZA 2W52A 5KHJA 4CDXC 4GCVA 2Y33A 5FZEA 3ZSLA 2EXIA 5JWPA 4WZFA 1F5FA 3B69A 1RI7A 4JHZA 1A8MA 1X2NA 3R60A 2RM23 3LFIA 1W6OB 3HEFA 5IVEA 5AIPA 2X0LA 1SCSA 3WCSA 3KZ4C 1W7PD 3WF0A 3THTA 1TW3A 4A3CJ 3EUKL 5LY2A 4HSLA 2ID6A 1XYOA 2DAOA 1I9RA 4P9XA 3WNXA 2X6WA 3HXLA 4XTPA 2E32A 3HOWJ 3EYIA 4L18B 2V4JC 3ZQ7A 2VPRA 4M73A 1T38A 3IKWA 5FR3A 3H1YA 3DGTA 4EE2A 1GV2A 3L2UA 2E1OA 3PQKA 5TISC 3G1LA 3KP6A 3HT1A 5GZEA 4MFEA 4RD7A 3NV3A 1MS0A 2RKHA 5A3OA 4Q2FA 2FQ4A 5DDJ3 4CP9A 3ZOIA 4IQ4A 3GZUC 4OQ8A 1HV0A 4AQ6A 3VV1A 2ZX0A 1OT5A 3AL6A 9ANTA 1PHMA 2V7FA 1XPWA 1U0JA 2W68A 1YITI 4TWTA 1BCXA 3ZVXA 4GB31 3JSPA 3ABMH 1O8PA 2X48A 4YG0A 4D5CA 1B9MA 1VQ7I 3ZRGA 2DA2A 4ZTJA 3I2JA 3CDHA 1XSVA 5AFEA 2RM22 1UHWA 2R3SA 5GZFA 3IBMA 4M3FA 1W6QA 2AZ5A 2GN7A 2A6ZA 5FUNA 2F5FA 3USSA 4EGYA 1FOD3 3WQ0A 1O5UA 1HDDC 4QDSA 2P6TA 5CA6A 1WCUA 4R9CA 2VZ1A 3WQ1A 3BU0A 4XN0A 2XAFA 1EP0A 3NMBA 4L0YB 2ID3A 2MC3A 1D0ZA 3CZJA 2XPWA 1FYUA 2G9WA 3G1MA 2YFZA 3EUHA 3A02A 3H5RA 4OZXA 1U5TB 1RUOA 1IG7A 1DYOA 3WW1A 4M3DA 2VMDA 4RA0A 4Q0SA 5K5OA 3WG7H 1SFYA 3LD8A 2RREA 5DDJ2 4Z2AA 1UHMA 4Q0UA 2R92J 4XMAA 3BDDA 1W9FA 3RZDJ 3I9V2 2JUCA 3U0ZA 2ZXQA 1BOBA 4CA9A 2Y6HA 2JWTA 2WL1A 5FLJA 5F27A 5FO8B 2VB6A 3GWZA 2RJ2A 1ZLJA 3NO8A 1NK2P 5A7WA 3UGFA 3TKYA 2ZACA 1AYM3 1UD1A 1UOGA 4FAHA 2BNOA 3B93A 5F6LB 4K6BA 1GVDA 1FOD2 3AP6A 3I49A 3KVAA 1UZWA 3QACA 3PMEA 1OCOH 3S7IA 3EB7A 3GM8A 1AX2A 2YGMA 4NHYA 3I3MA 3A0KA 4YWAA 3VDDC 3FHZA 3WG9A 5FRMA 4Q8LA 3NV1A 5A3TA 4UFHA 4NJ4A 2MYSA 5HLTA 1S0CA 5FYSA 3WTSC 4E7KA 2VUMJ 4F3JA 4IGOA 5B4XA 3ERED 3PO2J 5FMCA 1WJAA 4CCJA 2HOTA 2HQAA 4XYXA 5HLHA 1FC3A 2EBIA 4KICA 3UJOA 2YHJA 1J3RA 4B47A 4Y22B 3AJYA 3WNMA 1YRZA 1G9FA 1BC8C 1VIWB 4SLIA 4BM8A 4X1EA 1XPXA 3ZQHA 3K9TA 1SEUA 1P4XA 4WCGA 1UY1A 1W5SA 3PIOF 2WDBA 4Q4V1 1WWXA 4GO1A 4L0ZB 4XK4A 5DYMA 1AYM2 4G8XA 5JSRA 3OOUA 1XRUA 5IVVA 5F0CA 1H6YA 4G7ZF 3K4BA 1EKEA 4U2AA 4XR6A 1PGSA 1WCKA 1QA6A 4WM8C 1KFUL 3GTQJ 3S5QA 1X19A 3KX2A 2B4KA 4MNUA 2M8GX 2XF7A 2UWBA 2LTNA 2B9VA 1GWKA 2Q30A 2R7TA 2PA7A 1DU6A 5DZGA 3SXYA 2CW8A 1OC1A 5EG0B 2WBMA 2YROA 2GOXB 1IJWC 1UQXA 3CCUI 4BE0A 1NT0A 1SFKA 5ABJB 3QLQA 5JR7B 2J1AA 2QZ2A 1XGOA 3I2HA 3ZYRA 1X1AA 3LFUA 2CGNA 2DVBA 4LLOA 4KN4X 5FJ8J 3SISA 5HV0A 2XLFA 3ZFFC 2ZB9A 3KP3A 3ZSMA 2WT0A 3AKQA 1PYVA 2XVCA 2V5DA 3NQHA 3BPZA 4MX3A 1XDSA 2FX0A 3LSPA 5E89A 2N7GA 5BOXA 5C4WC 3RYKA 1US3A 1S0BA 1TC3C 5K7ZA 1OLME 4LO7A 3BZCA 3GZTB 5HODA 3FN9A 3ZYHA 1XNBA 2G1MA 3IH2A 3S93A 4Y17A 3SH4A 1IS6A 3CZ6A 1EAH1 1WCMJ 3NAPC 4RM2A 3O14A 3THPA 2D6NA 4YPJA 4YZ4A 1SACA 4V2WA 1RUD1 1DQ1A 3GLLA 4HSTA 3LQQA 1AR91 4JGYA 4C8DA 3MLKA 4I0WB 4LFUA 5EZWA 3FM5A 4GA9A 1VAMA 3ABZA 4B4QA 1SFNA 2ZEZA 2DDUA 4E4HA 4BOWA 2JSPA 2XSDC 2FDIA 3RKXA 1OFSA 3OYMA 2W3JA 5DCFA 2GH8A 4LOSA 2F48A 3H35A 5FFOC 2Y75A 3ZN0A 5FKBA 4PQQA 3MIHA 2GMPA 4YVWB 3F8CA 1D1BA 5JOZA 1Y9MA 3I2OA 1AOYA 4Y20B 1Y3TA 4AVPA 4I99C 2KP6A 4D1QA 1AXKA 4MEXF 3MHZA 5FY0A 5F1JA 1D0HA 1DGWA 2VVDA 1OCPA 1VB2A 5JXJA 3LAGA 1D8JA 1CPNA 3IL2A 2W1OA 2B39A 3V8JA 4CYDA 2QQ8A 1NE6A 4L5EA 1YQAA 1AHDP 2R49A 4XFIA 1GNHA 2DN0A 1VBB1 4D3WA 4WK8F 1UW8A 2E2HJ 4A3FJ 2BHYA 3B9IA 5JLWA 5IYCJ 1W0NA 2LVSA 4MH0E 5BPXA 4R9DA 5KC5A 4HBNA 3O1MA 3BIWE 3BWGA 1I3AA 2JIJA 2VQTA 4FPFA 1YUDA 4NN0A 2Z69A 1W5CC 3U4XA 4YM2A 1UWWA 3O8GA 1WLTA 3KYLA 4MLOA 3OPZA 5FROA 1ORKA 4G7OF 4NIGA 3J7AY 2UWCA 1EPWA 5C8CA 2FOWA 1DP7P 2GP5A 1LDKB 2XF6A 3K1MA 5BXXA 2E53A 1ND2A 3BGAA 1SG3A 1UZVA 3RTRA 3MYXA 3HHHA 2X85A 2ZMEA 4UUSA 2K85A 1CD3G 3OS0A 3OYKA 4CP9B 2VODA 2HS5A 3Q9OA 1WJCA 1DF0A 1MMGA 5JR3A 4FFGA 1LOCA 2XR4A 2ORXA 2ZHKA 4KISA 3C8XA 2OZUA 1OPOA 4Q4X1 3VDBA 1R36A 4AVCA 1NY72 3ZXEA 2JICA 4XUTA 3Q9SA 1Y39A 4IEUA 4QB1A 3TEYA 2AXTC 2A3WA 4AEKA 1W6QB 1EUUA 4CRQA 3RG0A 2A5WA 1XMXA 1Z67A 4LBQB 2L7FP 3GCXA 3A01A 3DBHB 1ZK8A 1H8TB 3W2VA 3SZPA 4G12A 3ZMDA 3HOYJ 5IFPA 3BTYA 1C0WA 4BK5A 1VFCA 4XLCA 4IXAA 2YZ4A 3AL5A 5HDKA 2VVEA 3SXWA 1UYXA 4AHWA 1DP0A 3M07A 4Y5TA 2BVMA 1ETWA 4Z2WA 3HC7A 2JMWA 1K5JA 4XUNA 1LESA 1RKWA 2HEVF 1LFPA 3R0AA 2JDKA 2IGMA 1MVEA 3H8OA 4LJHA 5A3NA 1CGPA 3AAFA 5BMZA 3DEWA 2VOKA 4FFHA 5F0HA 5LEKA 4ZYGA 3TGNA 1D0GA 3VYUB 3ZQIA 1MZEA 3O7OA 2D1VA 5FFXA 4BQQA 4MUVA 3ZQCA 4BJ6C 3AJZA 4AGGA 4AHXA 1SEFA 2ZGMA 4FPKA 5A7WB 3RCOA 5LLQA 4OI1A 3FF5A 5FGMA 2PTMA 3UETA 1MS5A 3ZLIA 1IQDC 4FSJA 1JHFA 2LLKA 4CXYA 4OVEA 1N3PA 2IXIA 2BY0A 4JDNA 2IVJA 5FYIA 4GALA 2LP0A 2CAVA 3ZR5A 3A2KA 3TBDA 2O8OA 2DVDA 1LHWA 5FLXZ 5HS8A 1W05A 4AG4A 1XBFA 4A41A 1ACCA 2LUWA 2W1UA 2CYYA 2ENRA 1FP2A 4AIKA 5F37A 1T0FA 5EEGA 2MLGA 1UIJA 1ND3A 1E2XA 4UOJA 4GH4A 3SZGA 3LGRA 1XXNA 2C9KA 4Y26A 3WEZA 4I02A 1H4HA 2CQ7A 5C71A 2K0GA 2J1UA 1AX0A 2OU2A 4F93B 4N90A 1JXNA 5EFUA 1LOBA 2Y30A 1ZG1A 5CLSA 4INDA 3MMYB 2KJBA 4GYIA 4E9KA 3H1MA 4M3CA 2RR13 2NLRA 4OOIA 1GKBA 3JRGA 2OD5A 3CC2I 1JYNA 3N9LA 2W5FA 4PJLA 3AVRA 1YX5A 2BHZA 3DL3A 4YFWA 1OA2A 1GWLA 2O8QA 1B72B 4AFMA 1LAJA 1SLCA 1E5SA 3OB8A 5IP6A 5CFDA 3KV4A 4KI5M 4NNJA 1UU5A 3M4FA 2DQLA 5KBFA 1O4YA 2OUHA 5ABJC 2VJ4A 4UXAA 2WWUA 2BTVC 1QOTA 4E8CA 3ZMTA 1S2KA 3HBLA 1SBFA 3UNGC 4NHXA 3BOWA 5EF6A 3WCRA 2E63A 4CUCA 4AUXA 1TNSA 3BZKA 1W0PA 2EFWA 3CJNA 2MC4A 3JAMZ 2C1FA 2JT1A 4QQPA 5FZ8A 3RZOJ 3LEGA 1ENSA 3G1OA 5I0DA 3L1PA 3JUUA 3MW3A 1KDMA 2PMZN 3IC7A 2RR12