4N9IA

Crystal structure of transcription regulation protein crp complexed with cgmp
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
202
structure length
202
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of inactive CRP species reveal the atomic details of the allosteric transition that discriminates cyclic nucleotide second messengers.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator
molecule keywords Catabolite gene activator
total genus 62
structure length 202
sequence length 202
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4n9iA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4n9iA01
3SZTA 4HVQA 3F8FA 4CGZA 1SFNA 3KSCA 3V7CA 4XETA 3I0TA 3FZVA 3O14A 3K1MA 1FXZA 2VOOA 2NAZA 2RC4A 1W7PB 3NEUA 3IDBB 2IXLA 4YARA 4I0AA 3RYPA 1YLFA 3FMRA 2HYGD 3QPHA 4ZYDA 1GXPA 2ZJ2A 3WGHA 2R7FA 4ONUA 4KIBA 2P4WA 3GF2A 4QWQA 3DPTA 4IEXA 5TRDA 4K8FA 4FHTA 4XSZF 3U0ZA 3EYIA 3HRUA 4XFHA 3GX4X 1G4DA 1B6AA 1UB9A 4MX3A 5EEGA 1R7JA 4HQEA 1X7NA 2L4MA 5CU1A 1OPCA 1H1IA 1B1BA 3EUHA 2HOEA 4LA3A 2OA4A 1UFMA 1LKNA 5HDKA 1KQ8A 4IF4A 3F6VA 1P4WA 2ZMEB 4Q0VA 4EROA 1BN5A 4IHTA 5FO5A 1EH7A 3M8FA 1S7OA 1ZREA 2HWVA 4BIFA 4RB3C 2PG4A 2VQAA 4UVAA 2OZUA 4GYIA 3MWMA 2M5WA 1J3RA 3PLQA 1W7PA 3FHZA 2EV0A 2G7HA 1LB2A 5FLXK 3DFGA 2HS5A 3H7YA 5KVRA 1NYWA 3F22A 1XRUA 1XGNA 5JSOA 3KZZA 3QU6A 2MH9A 2QVOA 4XFIA 3E5UA 5KBFA 1T38A 5JAXA 5A2QK 1DGRA 2ATFA 2XL9A 3T8RA 4WXDA 3P9KA 5H6QA 1Q43A 2K0GA 1ZZ9A 5T3NA 2AS5F 4A5MA 2PFWA 1GXQA 3VB2A 1D8KA 2PA7A 3CDHA 1O5UA 3LFKA 1RNLA 5LBQA 1VTNC 3B02A 4Q5SF 5K1YA 2OAZA 2DCTA 1ZZ6A 4ZU7A 3DXJF 1ON2A 2ZBKA 4A0YA 5IT9K 5L3GA 2EV6A 1IN6A 3E6DA 1SFXA 1ULYA 1ZNPA 2HFHA 3HT1A 4ZU5A 4G6QA 1ZX5A 4L0YB 1WSUA 5DUKA 3CO7C 1TLHB 4G94A 4R1HA 2CYYA 3GW2A 4JTNA 1Z91A 3F72A 2BNMA 4U88A 5CVJA 3ZMTA 2F5FA 1FP2A 1ZARA 2UXXA 4OIRF 3GXOA 5D1IA 1W5TA 2EFPA 4L18B 2IT0A 2ZNZA 3BWGA 1X8MA 3ABTA 3U9GA 2CSOA 1LR5A 5KHIA 2F2EA 2COMA 5ICGA 4LGWA 2PAKA 2B9UA 2PI0A 1FPQA 4M71A 2X0LA 3BDDA 1S8NA 2FSWA 1ODDA 2P8TA 1E17A 4EJUA 3M1EA 3CUQA 4RAZA 4HLYA 1CF7A 1OYWA 1RC6A 5DCFA 1I6XA 2B5HA 1T98A 3FM3A 3CLPA 1IN5A 4LLLA 1REPC 5DYMA 2CFXA 1O3SA 1Y3TA 3ABUA 1H9GA 1TTYA 2P17A 5KHHA 2Q2EA 4LEJA 3K2ZA 5I0UA 2BNOA 4XFBA 3H3ZA 1YLLA 3LSTA 1B4AA 1FOKA 2R7DA 1KYZA 3TGNA 2HEOA 4XFFA 4GGGA 2F5EA 1F9NA 1USSA 4CICA 1ZVFA 2VE9A 2IVMA 2GWRA 5K5RA 3BP8A 3H1YA 1YFYA 5L3FA 2FOKA 3O3KA 4IEOA 2Z5UA 2NRAC 1L0OC 1IAWA 3GVAA 2D45A 4A6DA 2V1DA 2QCSB 3E6MA 3HRSA 3DP7A 1XCVA 2AXLA 5AONA 3AAFA 2UWMA 3FXUA 2EA2A 1JE8A 1BM9A 3L2HA 3BJOA 2PAEA 2NNYA 4YIFA 1LEAA 3D5LA 1Q1HA 1MGTA 4LG0A 3D0JA 2BEOA 4M6YA 3U11A 2ESNA 3ACLA 4KNYA 2VECA 2L3DA 1W4MA 3IC7A 1BI1A 1JHFA 1HW5A 2STTA 4IPAA 5HI0A 5KHKA 4XFAA 4FBFA 3LWFA 1L3LA 2G9WA 3DKWA 2D40A 5E1WA 2GAUA 3W6KB 3SQNA 2EAAA 2PAMA 2GXBA 4LULA 2VE8A 3K69A 2XROA 2P7CB 2BV6A 2GC0A 1FT9A 2E1CA 2O8QA 4U7DA 2ISZA 1I1GA 3BY6A 3EQEA 1P92A 1W7PD 2A61A 4Q47A 2EA4A 4L0ZB 3E97A 5FFXA 5BXXA 3LWCA 1R1TA 3WTSC 2Q1ZB 1ZN2A 3TO6A 2V1XA 4IRHA 4PIYA 1QO0D 3U2RA 3K1PA 1YW7A 4ZYHA 4RB2C 1OR7A 1ZH5A 2LSOA 3LA2A 2GC3A 4KWLA 1WQ2A 1E2XA 4S05A 1XSVA 4ZZLA 3F21A 4F8AA 1G3YA 3WTXC 2FBHA 6PAXA 4X6RB 3QACA 4Q29A 4EGYA 1DGWA 2QLZA 2N7GA 1U5TB 4HX8A 4YIIA 4FX4A 5DV5A 3I7DA 1DDNA 4HDUA 4IEWA 2DK5A 5FPZA 4YYOA 3I64A 2OQRA 2O0YA 4GYGA 1QQIA 2QENA 2CG4A 4L9NA 5HS9A 3L2CA 2MPFA 3ECOA 4AVCA 5LHGA 4KYWA 3TDUC 1NHAA 2W24A 3ZDSA 4LMYA 4DINB 1S29A 4RB0A 3ETQA 4ASNA 2KJBA 3HOTA 5JSPA 2Y48A 1S7AA 3JW4A 4I98B 1F5TA 5C8WA 2CAUA 2EFQA 1YO5C 3WW2A 4N9HA 1QBJA 3HQXA 2E7XA 1FYKA 3F23A 4RAYA 4HSJA 2QQBA 4N0BA 2VT3A 4HOBA 1Z9CA 4MGIE 5LEKA 1LEBA 5E17F 2Y0MA 5I91A 1O7LA 3HYIA 3RYKA 5E16A 2IRFG 4LJZF 4O5VA 2VOPA 4R8HA 5E20A 4UXAA 3MAJA 4Y15A 4I2OA 2VBYA 2IXKA 2QM3A 1ZLJA 2W57A 2CO5A 4I0BA 2EVXA 2QZ8A 1T0FA 5LRSA 2ELHA 2PHLA 1YFXA 1Y9QA 4HBNA 2QDRA 5ICCA 1LDKB 4LLOA 4UHTA 2ADUA 1K78A 4CHUA 1X82A 2M8EA 1YYVA 3I54A 3RNSA 4BXUA 2L02A 4U0YA 1DZTA 4KN7X 1TW2A 4AWXB 2FQ3A 1KU9A 2UY9A 1CAXA 3CL1A 1Z7UA 4XEZA 3LAPA 4RS8A 4IEVA 3GEZA 1Y0UA 5LHHA 1S3JA 4IRGA 2GIVA 2OYZA 3CF6E 1EYBA 3LA3A 1XMAA 2V6CA 2VC1A 4GCVA 3LZZA 5DCMA 1YFWA 1HKSA 2RDPA 1NE4A 2W84A 4UXNA 1IN8A 3NL1A 5H6RA 1RUNA 1KGSA 1T6SA 5FLXZ 3ZMUA 4P96A 3EO6A 3CUQC 1IZ1A 4EJOA 4Z07A 2VPVA 2PFBA 1PP7U 5HDNA 5DCMB 4EJVA 1NZCA 4MGZE 3F8NA 3J80K 1QWRA 3ZMDA 4BYYA 1RL3A 1ZG3A 3KP6A 1L3JA 3BPVA 2YSRA 3FMSA 4HV6A 5BPDA 5KK1A 2LNBA 3MYXA 3GZ6A 5E8IA 4JV4A 1F4KA 3KLNA 4JVAA 1CX4A 3EJKA 4B09A 2XAGA 4IJAA 4MQ9F 4QGMA 3WODF 1XE8A 2ISYA 1ZZ7A 5CJ9A 4G6DA 5LHIA 4JK1X 3TO7A 2O3FA 1FX7A 1PUEE 2IA0A 5LGNA 1NXMA 3C3WA 4YG2F 2J5PA 3ELKA 2QQ9A 2FBIA 4I7HA 1OI6A 1ZAOA 3WTUC 4EM1A 1J7KA 1ONVA 5K5QA 1S6LA 4IEUA 1FZPB 5D6FA 2FRHA 3OD0A 2DI3A 3KETA 3IWZA 1KU3A 4AQ2A 3TNPB 2JPCA 4WZCA 3DN7A 1K7AA 1X8EA 5AIQA 1A04A 3VEPA 4ZYGA 4ENJA 3MDPA 2K27A 4ETSA 1TQMA 4O6JA 1T2KA 2VXZA 4G7ZF 4OMZA 3H8UA 4Y13A 4OINF 2E1NA 3JAMK 2JT1A 3RZZA 1YQAA 4H0EA 3IWFA 1MJBA 3J81K 4HVRA 4NHJA 4OIOF 2FNPA 4WF2A 1SMTA 4EJWA 2FA5A 5JFRA 2XLGA 1ZRDA 2NNNA 2EV5A 1ON1A 5EZWA 4FX0A 2KIFA 5J3UA 2JZYA 1O4TA 3LQRA 3JSPA 1OYYA 2VN2A 1O5LA 3HRMA 4A0ZA 3SMHA 5E1XA 3CJNA 4Y17A 3ROUA 1PMIA 2F5DA 4P5OA 4LUKA 4BHCA 2P5VA 3ECHA 2H27A 1K78B 1F1ZA 1JHHA 1IN7A 2FNAA 3GO5A 4WX9A 1PDNC 1QPMA 3COAC 5D4RA 3DF8A 3D82A 2B0LA 2O8XA 1IRFA 1BIBA 3REOA 2BE5F 2EFWA 1HW2A 2HQNA 3T0YA 1H0MA 1R23A 1UW8A 1I5ZA 3DPLC 1ZZCA 2FBKA 1YWKA 3W6JB 4ESJA 3Q9SA 5DUIA 3O6BB 1DP7P 4UBGA 4MGYE 1FC3A 4UVBA 3DL3A 1J58A 4WWCA 2GQQA 2PEXA 2DFIA 1K79A 3GFLA 3PQKA 2ZKLA 4ON0A 3E6BA 3VOEA 3GLXA 4S04A 3F3XA 3F8BA 4MHGA 1Q3EA 2G7UA 1J9IA 4M9ZA 4HW0A 3E5QA 4F7ZA 3ERED 3V7SA 1SAXA 3GUDA 4WXHA 1U8RA 1KQ0A 1IPKA 1BI3A 5CVVA 2A6HF 1FBUA 4M72A 2D5FA 4OOIA 2Y75A 1MKMA 2OBPA 2NS0A 4XF9A 5ICEA 2BGCA 1Z6RA 4L9JA 3KLOA 3TKYA 2HQRA 1LJ9A 1D5VA 3V8LA 4MEYF 2PHDA 1BI0A 3JTGA 3R60A 1NE6A 3ZMZA 5J8CA 3JSOA 4IRIA 2RGVA 1VJ2A 1U5TA 2XGXA 4HQMA 2IXCA 4Z2YA 2JTVA 4FT8A 4KU7A 3CUQB 3N4MA 3RTRA 3MEXA 5FDBA 3C7JA 2A5YB 4PGGA 4HSLA 5FLIA 2EWNA 1KU7A 2Z2SB 4JQFA 1KA8A 1VP6A 3KGLA 1HKTA 1EH8A 2MLGA 2HKOA 4Q0SA 1XN7A 1EP0A 5L3EA 3G3ZA 5CVIA 1V70A 3LOIA 4O9GA 3L7WA 3QOPA 4U0WA 3QP6A 5K5OA 4Q48A 3WTTC 5D5XB 2GC1A 4AVBA 3FM5A 4E70A 2D1HA 3KZYA 3DEUA 4RGSA 1ZZ8A 3M9AA 4A2UA 5JVTA 1R36A 5ICFA 5JHUA 3ISPA 1QZYA 4ZU4A 3MPBA 4YNIA 2O6GE 3HSFA 4DNCA 3V4GA 4WVZA 3RKWA 3FF5A 3H7JA 4K2EA 1CAUA 5D5VB 2E7WA 2D1VA 1LRHA 1QXJA 4JBAA 1ZG1A 2GXGA 3R61A 3RIRA 3R6SA 5L3DA 4LFUA 4WBBA 3BALA 4KFCA 2QJVA 1IUYA 4EWDA 2DW4A 4XFCA 2Q0OA 5ILUA 4ESBA 1MDMA 4MGRA 2HKXA 1ZYRF 2L4AA 3VHRA 1RTVA 1B59A 4EQQA 1SQ4A 1SFUA 3H1MA 5E8GA 4QX5A 3SZPA 3JAMZ 4IXAA 2MNGA 3R0JA 4MTDA 4KICA 1GQGA 4IESA 1YFUA 2DU9A 2F5CA 2H09A 1WKMA 3H92A 3FX3A 2Z99A 3QP5A 3KP3A 2A69F 1YS6A 2ETHA 1YIOA 2KIUA 5IT3A 2MC3A 2RN7A 3USSA 1R58A 3OTFA 4EGZA 4PIZA 3KP4A 2Q0AA 4A6EA 2Q4SA 2P5LC 5F6FA 5I93A 3F8MA 3FZ3A 3ES1A 4KIGA 1PM7A 3BU7A 3NKTA 3K0LA 1BJAA 1SD6A 1O3QA 2FXAA 3ML6A 1P4XA 3WTZA 2PMUA 3KCCA 2MBFA 1YW8A 1HW1A 1U5TC 5BOXA 4KDPA 2PN6A 2VONA 1MJAA 3SCFA 1MD0A 1YUDA 5BQTA 2ETEA 4ESFA 4M9SA 5HLIA 4MV2A 2HTSA 3C3VA 4RGUA 2XASA 1GHCA 3DQVC 1FWZA 2L01A 2ESHA 1IXRC 1U12A 2XUBA 3HSRA 2IXHA 2EA7A 3RPUA 3M3IA 4EMSA 1OYIA 1CAUB 3NJZA 2XIGA 4BHPA 2ACJA 2K02A 2IJLA 4P55A 3E6CC 2WV0A 2Q8KA 4JTOA 2H6CA 2QUFA 4ORFA 2PBIA 5CLSA 5D6EA 5A2QZ 1J1LA 4Q4ZF 2PLYA 2ZKZA 1O57A 4P9FA 5LRRA 1Z6TA 3QRFF 2BBYA 2XRNA 4IEQA 1SD4A 3WE3A 3SCGA 2C6YA 2HR3A 4O3MA 5DDGA 5DEQA 1SEFA 4LTAA 2HZTA 1XSXA 4ENNA 3FXRA 3IL2A 5KHJA 1IN4A 1JUHA 4NB5A 3IKTA 2DLLA 4A12A 1AOYA 2PTMA 2IA1A 3IHUA 4HYEA 3SXWA 5FLHA 5FQ0A 1R5HA 1UIKA 2A07F 5DD4A 4PDKA 2CW0F 1V3FA 4QM9A 1UD1A 3BCWA 4XF0A 2E9QA 1UCRA 1SD5A 3ST7A 4ZYEA 3GWZA 3MQ0A 5FB2A 1OMIA 3WTYC 4UV8A 3IBMA 3M7GA 4WCGA 3I59B 2GH2A 4XF3A 1KU2A 1SMYF 1ZZBA 3BJAA 2OPKA 3H3UA 3WG9A 4A5NA 4CYDA 4RGRA 2ZXJA 4CXFA 1CAWA 1R00A 2P6TA 5LLQA 3PVBB 2A3SA 2ZO4A 3L9FA 3FWEA 3MFKA 1P6RA 3E3VA 1J2XA 4B8XA 3WTWC 4R52A 1UIJA 3CLOA 4CZZA 3RKXA 5AIPA 4EJTA 2NYXA 3I59A 1OD5A 4U0VA 2EJRA 1XMKA 2Q30A 5H20A 3HHHA 2VT2A 4OU0A 1DUXC 3I71A 4FAHA 1G3TA 4QM8A 4HDVA 1CAWB 2FE3A 3FE5A 2I45A 3H50A 3BROA 2UY8A 4I3PA 5CVUA 1HKQA 1UHMA 4LD5A 3WW1A 2YU3A 1SD7A 5K8SA 3S7EA 5D8KB 3NVCA 1I1SA 3RKYA 4M74A 4XLPF 3IIAA 1MZBA 2B8MA 4AIJA 3KP2A 1BOAA 4KL1A 3F8CA 1IXSB 4I02A 1D8JA 5L3CA 2XAQA 4UNOA 3K1NA 1IRGA 2O03A 3IRRA 4MGKE 4IVNA 1FYMA 5FQ0B 2IP2A 4ZZDA 2OA2A 4AXOA 5JSRA 4X6QB 5ED4A 3NRVA 3V8JA 1FBSA 2KKOA 3J80Z 4BAYA 3KP7A 1Z1DA 3J7AO 5CADA 3S2WA 1RI7A 1WA4A 3TO9A 1R5GA 5HOOA 3RYRA 3IRQA 2GZWA 4FAGA 5LGUA 4GULA 1YG2A 4HX7A 5BPIA 1B9MA 2XVCA 1BI2A 3T5XA 1ZGAA 2D2WA 4M6XA 4L5IA 3R0AA 4L2NA 3FXQA 3L00A 2V09A 4IERA 2CWEA 4PCQA 2QBYB 4Q0PA 3TOAA 2ET7A 5ILSA 4L9TA 4EWEA 3I5UA 1DPUA 1XB4A 5FFZA 3WE2A 4D7SA 2UXNA 3RJPA 4U7BA 3GYHX 5HS7A 2GA2A 2VODA 2D5HA 3KMHA 3P9CA 2RV8A 1Z05A 4QLCU 4QXKA 3OGJA 4PGHA 1EY2A 2IC1A 3D0SA 2JSCA 3PQJA 2Y0OA 1ZLKA 2DQLA 5JCTA 5FLJA 1WRJA 2BNNA 5DD8A 3VODA 1FSHA 2MHFA 2OD5A 1CF7B 2JPBA 5L3BA 2K4JA 3ZN0A 3BPXA 4HLXA 2OU2A 3ZQ7A 4YFKF 3GFJA 4OFGA 2P7VB 3FHIB 4UBHA 1FP1D 4LUMA 3HRTA 3ULQB 4AVPA 1WI9A 2XKPA 1QZZA 2KXLA 1MDMB 2DAOA 1B9NA 2VBWA 1T39A 1SFEA 2WC2A 1XCBA 3T8TA 3ZP5A 4L11A 1O7FA 3I4PA 3ELNA 5ERIA 1LNWA 1TQPA 1XDUA 2IPQX 4HN1A 1TNTA 3RI4A 4RD7A 5FD6A 2A6EF 4IEZA 1QGPA 5BS6A 4IHSA 3H9AA 4H7LA 3V7RA 5I0SA 5I8SA 2BYVE 3HTUA 4HA8A 3EYYA 3PFIA 3WGIA 5F64A 4YFXF 1J75A 3SXYA 3HIFA 3WGGA 4AIKA 1XSDA 4Q0UA 1IW7F 4ZH4F 3OOPA 1TBXA 2K7LA 2HJIA 3R4KA 2GC2A 3MZHA 4PIXA 2VBZA 2QWWA 2YX7A 2DO7A 1TNSA 3HTSB 4MZUA 1CAXB 1G3WA 1V4RA 1EV7A 4MNUA 4EV0A 1OKRA 4QMAA 4ENMA 1MJ9A 5BV6A 2MLKA 3U10A 2HYFA 3M70A 2M1BA 4YRDA 1R22A 2STWA 3BJ6A 4QGNA 4KWKA 2FF4A 5BMZA 4MQVA 1R1UA 4RB1A 3JTHA 2FEZA 3SHRA 1HXDA 4XSXF 3M8EA 4LLGF 2H6BA 1Q5OA 5I8TA 5J7MA 3ZMSA 2XL7A 5E18F 4PJYA 3NW4A 1OFNA 5CVRA 2LF7A 3GFMA 2ZNYA 1G6NA 2PYTA 1H1MA 2EK5A 1KQ9A 2EFNA 5LEJA 4KWJA 2YR2A 3BZ6A 1RZ4A 3KEOA 3OF1A 2M30A 4GXOA 3NQOA 4N9IA 1HBXG 3JZVA 4YSFA 1O3RA 3FMQA 2FU4A 1FBQA 1XD7A 4IETA 3F6OA 2CGPA 4UV9A 4LK1F 2PQ8A 5BY5A 1GVJA 3Q5FA 5D5WB 1FY7A 4E2QA 4MUVA 4AIHA 1G3SA 5JI6A 1HSTA 3IKVA 5CYVA 4KA4A 2XAHA 3CTAA 1ZRCA 1BC7C 4Q0QA 2H94A 2PJPA 3BOQA 3KGZA 3CEWA 2Z3YA 1KYWA 3C1DA 3EDPA 3L09A 3FFQA 4P9GA 2C0ZA 2XV4S 5HLHA 3OV8A 3CO6C 5I0TA 3SCHA 2ET1A 3LA7A 1UPIA 3QPTA 1XDSA 4DQ2A 5E1RA 4G7OF 2PMHA 5F1RA 2FQPA 4HAMA 2QVSB 4AVAA 3LAJA 1FLIA 3FJSA 4EVIA 2A68F 3EBRA 2RQPA 4KU8A 1J0RA 4OIPF 4OLLA 1ZG5A 3UKNA 4XF1A 5J48A 2O61A 4HBLA 1U6GA 1H9TA 5FCCA 2XHKA 4HMZA 2XAJA 1EH6A 2KRFA 2K86A 4KT5C 2IXIA 4HVOA 1DZRA 2M45A 4M9XA 1YTYA 4XLNF 1BC8C 3WW4A 1FNNA 5E1ZB 1HQCA 4RGXA 4EM0B 4Z82A 3TQNA 2WTEA 1ZHFA 4HF0A 4ENKA 4G7HF 3LQQA 2KIMA 2DTRA 3E5XA 3G73A 3CO2A 4XF4A 2Z69A 2DPUA 4KMFA 2RVCA 2QBYA 1TW3A 2J5OA 1P2FA 2VBXA 5FGMA 3NSTA 2HGCA 1IXCA 4G8XA 3V8KA 3DV8A 3LAGA 4META 4BQAA 2Z33A 3HSEA 4AD9A 4XRFA 5C6CA 4L5JA 2P6SA 1UHWA 2GA1A 3SHFA 3QU3A 3TOBA 2RKHA 3ES4A 4B29A 2OZJA 5HVQC 1QNTA 4D0PA 4LG0B 1K6OA 4I09A 2DBBA 5EEHA 4L9VA 3GYDA 5D8LB 2WFPA 1EPZA 1DPRA 1GQHA 5EFUA 3H1WA 3OCPA 3G7DA 1FSEA 4LB5A 4HF1A 2L54A 2R3SA 2DT5A 4OIQF 3EHKA 4GO1A 3SFZA 3IDCB 2CQKA 1PP8F 1USTA 3TDZC 3S0MA 2QQAA 2HDCA 2QYOA 1JGSA 1LDDA 3WU1B 3KFWX 3P9IA 5I8YA 2TDXA 2FMLA 4D7TA 3GBFA 3I53A 3ZMVA 1WGPA 1U3EM 4LK0F 1XGOA 2CAVA 1J3PA 3RDIA 3P7NA 5ILVA 4A0XA 5JR3A 4BH9A 3O2PE 2XKOA 3GFIA 2YPRA 5D5UB 2LF8A 3MCZA 2IXJA 2EFOA 4HLTA 2IW5A 2M87A 1CAVB 2YX4A 4HN0A 3KE2A 2GU9A 1P4AA 4EWAA 4MEXF 1FI2A 2IA2A 3U1DA 1HSJA 1QY4A 2RNJA 3EQLF 5AVPA 2MH2A 4YFNF 2CV6A 4XFGA 3TNQA 5FPXA 1BBYA 3CJXA 3ZPLA 2F4PA 4PZJA 2DQRA 2O1QA 2LKPA 3WTVC 4XBFA 4LB6B 5KHGA 3WW3A 4G9YA 4IEYA 3KP5A 1X3UA 4E2SA 5BUVA 3C18A 4KIFA 4LLNA 2ZMEA 4P9UA 2FMYA 4EM2A 3N97A 2OZ6A 1XGSA 2KJCA 3B73A 4MTEA 1I27A 1IPJA 1J3QA 1TQ5A 5HLGA 2W85A 1J59A 2JRTA 3EETA 1LDJA 1ZRFA 4HZFA 1U2WA 3UKVA 3VFZA 2XAFA 3RPQA 3HHGA 2X4HA 4IEPA 1D3YA 3MZYA 1ZRRA 2ZFWA 2MD5A 4TV7A 1IF1A 4QGLA 3ZN1A 1ZGJA 4BNCA 1C0WA 1WLTA 5TJJA 2XLFA 5D4SA 1RIOH 1YS7A 2UYBA 3KEQA 4OMYA 2XLAA 2K4BA 4E2GA 1LQ1A 5JR7B 2V9VA 3BPZA 1RGSA 4J1WA 4I01A 1JXSA 1W5SA 1CGPA 1FYLA 1YHFA 1RUOA 1BIAA 2OQGA 2LDUA 4KMUX 3I58A 1YFHA 5J6XA 2UZKA 1U78A 4BHBA 3S7IA 4WK8F 2W25A 4KN4X 1QXRA 4M73A 4KUMA 2H0VA 3Q9VA 1VR3A 1O3TA 4CDGA 2MA3A 2VC0A 2V79A 4NVPA 3CUOA 1J5YA 5BPXA 4HV5A 4WXCA 4R79A 1R1VA 2DK8A 5HS8A 2Z9OA 4TLFA 4O9EA 5IT9Z 3K9TA 2V1UA 3HOSA 2DPDA 5HDGA 2K9ZA 3HUGA 1CAVA 5I0RA 3PNAA 1WWXA 1YW9A 1AWCA 1UCXA 4NQWA 3UKTA 1LVAA 4UUVA 2QNKA 3BB6A 4LA2A 3HT2A 4HX4A 2PQQA 3WU0A 5FD5A 5J8FA 3J81Z 1STZA 1TQIA 4J1XA 4CO8A 2HTJA 1XGMA 2EB7A 5LGTA 3QAHA 4HF2A 1XE7A 3T1BA 4UVCA 2ZCWA 2UYAA 4MH0E 2P5KA 4AQ6A 2D93A 2WWYA 3GZ5A
chains in the Genus database with same CATH superfamily
4JX6A 4HK9A 3SZTA 4HVQA 4XCBA 3UR3C 4CGZA 2B7EA 2EXKA 3ZQGA 1OLQA 5B66C 3LCPA 3I0TA 5JIAA 2RS32 1LU1A 4BA6A 1W04A 1BZWA 5JOZA 1KDKA 4KJZA 3O0VA 2FJ1A 4BJ6C 2R0QC 4BACA 4BU2A 2M7AA 4YARA 4QXHA 4M6VA 2QQKA 2HYGD 3QPHA 4D6SA 4ZYDA 5A32B 1GXPA 3DYMA 5F27A 1V0AA 1HOMA 2R7FA 1A3KA 4KIBA 3M07A 4Q4V1 5GAEJ 5TRDA 3HEIA 2VNGA 4FHTA 4XSZF 4B4CA 4C1WA 5A7PA 3U0ZA 2W0XA 3IMMA 3H5NA 1G4DA 1HIXA 1V6LA 2ZGKA 4YRVA 2CNAA 1VB4A 1OPCA 1AR62 4Y4RA 1BHGA 1YRNA 2LREA 2Y2ZA 4DUVA 2OA4A 3D6EA 1FTZA 1CWPA 5A1LA 1KQ8A 4PBOA 1OF3A 4YZ4A 1BN5A 2BGPA 4ASLA 2KP6A 1EH7A 4NN0A 1S7OA 2Y9YA 2WABA 4CPBD 4WM7A 2VKEA 3QOEA 1S0EA 4HT1T 2UU8A 4GYIA 4A3ZA 4ZYAA 3MWMA 1AYM3 3PLQA 2HS5A 5A6YA 3H7YA 3M8LA 5FP9A 3KZZA 1KFUL 4MXWA 2RR12 1C8M2 1T38A 1ULEA 5JAXA 1PNFA 3K4MA 3A01A 4A7ZA 1DGRA 3OUHA 4NOTA 1BL0A 4QD2A 1AXYA 2EZKA 4WXDA 5FJHA 1ZZ9A 3IPVB 5T3NA 3ACFA 2PFWA 1GXQA 3VB2A 5IYYA 2HOAA 3CP8A 3CDHA 3LFKA 5LBQA 4GKXA 3B02A 3DXJF 3K2OA 3E1F1 3OBZA 2ZBKA 2P6CA 3WNOA 2EV6A 1IN6A 4QU1A 1X1CA 4RS5C 1OUXA 1ULYA 3FMGA 4G6QA 1ZX5A 4L0YB 5DUKA 3CO7C 3RVHA 1NQJA 2CYYA 4W4ZA 1Z7S1 4JTNA 4HK8A 1TE1B 5CVJA 5C9AB 1FP2A 1ZARA 4R9AA 3GXOA 5D1IA 4L18B 4QPGA 2ZNZA 3W3CA 3C2GA 3GZEA 5C70A 3ABTA 2DVGA 2VUJA 3FL7A 4FOVA 5KHIA 5EYXA 2COMA 3NWSA 3ZXJA 4ISRA 3SDGA 4JOMA 3O1VA 2X0LA 3BDDA 1S8NA 2BZTA 3WUCA 3WHCA 4CEYA 1FMD2 2P8TA 1SACA 1ZQ3P 4EJUA 1CJPA 3M1EA 2OUJA 3CUQA 3DUIA 2Z42A 3NAUA 3VBUB 1CF7A 1FOXA 1RC6A 2VM9A 2O14A 2D6LX 2R062 2B5HA 1G9BA 4N4NB 3CLPA 2WA0A 1IN5A 2TEPA 4A41A 1REPC 3PTYA 1GV2A 3KYLA 2PMWB 1KJLA 3ABUA 3SFIA 3VKOA 2LOOA 5BNOA 1VMJA 4MGTA 1V6JA 3DEMA 4W6YA 4XRSG 4XJUA 3K2ZA 4UW6A 1X1BA 1ENSA 3Q8BA 2BNOA 1ZGWA 2J1VA 3CJIB 1B4AA 2QQOA 1FOKA 4LBJA 2EAKA 4ARYA 1KYZA 3ACIA 1TT5B 2BHYA 2ZXIA 2HEOA 4AI9A 5IUQA 3AC0A 2HEWF 1AR71 1C8M3 1F9NA 1ZVFA 2VE9A 2IVMA 2NVXJ 1JKOC 2V4JC 1YIJI 3H1YA 3J7HA 3QLQA 5JMCA 2R1BA 4II2A 3GVAA 1ULFA 2RMU2 5FY1A 2V1DA 1N25A 3HRSA 3BR3A 4CCDA 2Z1DA 2EA2A 4A3IJ 3NNJA 2VUDA 4FCYA 2WB1N 4XIOA 1W0PA 4LG0A 1KD7A 1DCSA 1ULOA 3D0JA 4NAOA 5HV0A 2I5UA 3PNTA 1YI2I 3T0AA 3U11A 2ESNA 3ACLA 1BR4A 3WUDA 4YGCA 3IC7A 2QSHX 4KGGA 1JHFA 5IVFA 1HW5A 4OHXA 4IPAA 2DDUA 2LY2A 2A1XA 2XDVA 1DZQA 3ZYBA 3LWFA 1EAH3 3DKWA 3R0RA 2D40A 2HWC2 1V6KA 2F5VA 4PJLA 3KT7A 5E1WA 2GN7A 1HN1A 2QUOA 1REEA 2PAMA 3I97A 3Q3SA 4LULA 2VE8A 2P7CB 4Z8BA 2HEVF 2BV6A 5EZGA 4YM0A 1PO12 1MMDA 2Z5WA 3GF6A 4INDA 3UGHA 1US2A 3EB7A 3SISA 1MNEA 3GTGJ 3EQEA 3POIA 5T55A 2JA7J 4QXBA 2WZPP 2N8GA 2X85A 2R7ZJ 4AGRA 2V1XA 3KT1A 2BP6A 1QO0D 5IK7A 2K5CA 3K1PA 3AVRA 4ZYHA 4RB2C 1OR7A 1ZH5A 2LSOA 2VOTA 4B1MA 3K10A 1GZWA 1HRV1 2HWB1 4XHXA 5C3OA 1V54H 4AVVA 2WZR2 5CPRB 5F6LB 2K85A 2HYJA 2VZQA 4A3DJ 4Q1PA 4DXTA 4LHNA 4IEWA 4OYUA 1W2TA 1QQIA 1MZFA 2VBDA 3ECOA 2VQ0A 3TDUC 1K5MC 3T2PA 3S15J 4EN7B 3LMMA 2VNRA 4Y4YA 3CZ6A 3UL2A 2E32A 1LFBA 2X1DA 1W0UA 4RB0A 2AACA 2KJBA 4IOAF 1ZA7A 5JSPA 3MFAA 1U9NA 3JW4A 4I98B 3OYHA 5C8WA 5T52A 3S14J 2CAUA 2JDMA 3H1CA 2VL4A 2EFQA 1BVVA 3HQXA 1IKPA 2VBBA 3RZLA 2RMU1 4FFHA 4HSJA 2OTJI 3NWKA 1VAVA 3GTJJ 3AYDA 4HOBA 1Z9CA 2M2EA 1LEBA 2KDOA 5FZ6A 3VWBA 3MIFA 4XUPA 4K21A 4FASD 2F4LA 5FKMA 3HD8B 4FQ4A 4RYDA 4BBRJ 4N8MA 2IXKA 3OYBA 1MBKA 1O8SA 3OD4A 2K40A 4ASKA 1H4GA 2OPTA 1YFXA 4QQHA 2QDRA 4ES8A 1IV8A 2HOSA 3AK0A 4CDQA 1LDKB 2RR11 1DGLA 4PF1A 3BKZA 4QB1A 4XC9A 4CEWA 3I54A 3VZLA 4Q4W2 4AOCA 2L02A 4OMDA 1QOTA 1MBEA 1WZXA 3DGTA 1TW2A 2LUWA 1Z7UA 4RS8A 3SZGA 4JQRA 2VU9A 5LHHA 4QPYA 4IE4A 2QQPA 1EYBA 1XMAA 4MXWB 1UKRA 2V6CA 1ND2A 2VC1A 2WZR1 2WZ8A 5DCMA 1F2NA 2VPLA 3FK7A 2RDPA 5K9YA 4UXNA 1IN8A 4LHLA 3NRUA 1RUNA 4XQWA 2MFZA 5JLVA 1JYIA 3EO6A 4UW5A 4U2AA 3I2HA 4DXSA 5LW9A 5L7OC 5JZGA 3TB0A 2PFBA 1O8PA 1T6BX 4ZDLA 4DUWA 4EJVA 5IW0A 5IP9J 2KZVA 4LBOA 1QWRA 3ZMDA 4AAXA 2C1FA 3ZN5A 1YYNA 2ORXA 2ZEXA 4HV6A 2BJSA 4EN9B 2R073 2MD0A 1F4KA 3BTLA 3KLNA 1QF3A 1JN2P 3KVAA 4D94A 4QGMA 3WODF 2W2IA 2ISYA 3AKRA 3KQRA 4G6DA 3N9NA 2JVHA 3V65A 2X6YA 2O3FA 3TO7A 4NO4A 2D3SA 1MVEA 2IA0A 1DF0A 1NXMA 5CKQA 3C3WA 2VE1A 1QJFA 4YG2F 2J5PA 3ELKA 3WNPA 2NVQJ 1C5HA 4I7HA 1OI6A 3WTUC 4P9IA 4ET7A 2R7UA 4YG0A 1W6NA 4AW7A 1ONVA 1S6LA 2J1RA 5D6FA 2FRHA 5GTIC 4E7HA 5ABJA 3KETA 3IWZA 4YEJA 1K5MB 2VQUA 3SEZA 5J1UA 1QHGA 4AQ2A 2HXIA 2YPJA 1KITA 4WZCA 3J7LA 1RUI2 3CDLA 1VQMI 2W48A 4YFZA 1OCOH 1K7AA 5ACA2 3ZFEA 5AIQA 5BNQA 2O5RA 1UMHA 3MDPA 4ETSA 3MLJA 1TQMA 4O6JA 5FLMJ 4HRIA 3JU9A 4JQTA 1HDDC 1W99A 5DDJ1 2E1MC 4B47A 4BBSJ 2WWJA 1MJBA 3CJIA 2PLV3 5LA0A 1XNCA 4OIOF 1G9FA 3URFA 3N36A 1SMTA 1NCQA 4YW5A 4EJWA 2JG9A 5JFRA 3I3EA 1REDA 1ON1A 1EUTA 2WJSA 5EZWA 3OYCA 1MACA 2KIFA 3B7MA 2K3PA 1O4TA 3LQRA 3JSPA 2WNVC 3SMHA 3CJNA 1PMIA 1ODMA 3T1LA 3ILRA 1F1ZA 1LFUP 1JHHA 1IN7A 4WX9A 1WA6X 1PDNC 4J01A 3COAC 3DF8A 4DUXA 2XSJC 2O8XA 3GZTB 3ZFFC 3RI8A 5JIUA 5FZ9A 2ICWG 1IO2A 1ETWA 4CCEA 2HPIA 5DUIA 1OCTC 4XTPA 4G3YC 4XORA 2GQQA 2R16A 5CFDC 2ZKLA 4GMP1 1HF0A 3L2RA 3W5MA 3E6BA 3GLXA 1LPQA 4ATEA 2LTPA 1MPXA 3AL0C 1JYWA 4WXHA 2JSPA 1U8RA 1KQ0A 1IPKA 2D98A 2A6HF 1FBUA 1MKMA 2A73B 4MHRA 3ZQLA 4XW3A 4EN0A 4CSWA 3HOVJ 5ICEA 3MW3A 4GZ9A 4L9JA 3MV11 3S8PA 3Q9OA 1STMA 2V5DA 4MEYF 3JTGA 1SFYA 5T5LA 1TWCJ 1NE6A 1VBE3 1UZVA 2E71A 4Z2YA 1W8OA 4XBNA 1R71A 3N4MA 1FAYA 4FPLA 1LFPA 5FDBA 2X53S 2A5YB 1QVTA 4PGGA 4OMCA 1MBGA 3LE0A 4E7JA 1LUJB 1ZR4A 1PVC3 4M00A 1KA8A 1VP6A 2FDIA 2JDHA 4COVA 3X29B 2LH9A 3K4DA 1PX3A 4Q0SA 4BWOA 3G3ZA 1JZ4A 5FWEA 2HBUA 5CVIA 3LOIA 3OSDA 3L7WA 5IJRA 4YZ1A 2Q8EA 1SLTA 5K5OA 2D1HA 2ZAHA 3M9AA 4A2UA 3MW2A 5DXDA 5JXJA 3EYPA 1J1TA 1I6HJ 5FMOS 5FFOC 4C9YA 5IVVA 3IDEA 2DMPA 3ISPA 3N05A 1TMF3 1SPPA 4YNIA 1K4SA 4P9YA 3NARA 3HMYA 3BR5A 3H7JA 5D5VB 1CZTA 4NRPA 4OULA 2NOGA 3LOBA 2E7WA 3NNFA 1HJGA 3RJ2X 4N53C 2KA3A 5C4JJ 2EZLA 2DYCA 1VB2A 3IPVA 1UXXX 4WBBA 3U14A 3OGGA 4AGGA 2QJVA 1WCQA 4EWDA 1U5YA 4XFCA 3GJAA 1NA1A 1B59A 1Y43B 1SQ4A 1Z77A 4XN3A 1SFUA 3OYLA 5E8GA 2JDPA 3SZPA 2WN2A 3KS7A 4ITVA 3R0JA 3PSFA 1GV9A 5JOYA 4MTDA 4IESA 1GQGA 1YFUA 2A6XA 1NY71 4Y20A 3FX3A 2HWE3 2Z99A 4UB6C 3QP5A 1YHQI 2Y6JA 4P9XA 2ETHA 1RMU1 2ECBA 1YIOA 5C4WB 2PMZA 3USSA 1R58A 5HCFA 4FI9A 1IG7A 5C5UA 3H8RA 2Q0AA 2H8RA 4Y26A 5JZGC 3ACGA 1MZEA 5E3MA 2Y38A 4D0QA 5LATA 2WV1A 3FLRA 1ULGA 4CDWA 1O3QA 1IS4A 3NJXA 2BW3B 1EV13 2PMUA 3ZOIA 2BHZA 1POV1 1BR1A 2MBFA 1QMJA 1HW1A 2PN6A 2VONA 3SCFA 1F4AA 5BQTA 4Y1UA 4M9SA 1MS0A 4MV2A 1BEV2 1FWZA 2L01A 1HRI2 3ZYFA 1U12A 4XDQA 2EA7A 3ZYPA 3M3IA 1R1ZA 2VZ1A 2XJRA 3QBQA 2ACJA 2DUPA 2K02A 2XSDC 2JEMA 1DQ5A 3E6CC 3AXEA 4JTOA 3W21A 4A42A 4XMYA 2PBIA 5D6EA 1J1LA 5DDJ3 1O57A 4IEJA 1UOJA 4YM3A 5E3NA 1DP0A 2M0CA 1YEWA 4IEQA 2ZGOA 3S30A 5KCMA 3MICA 2ERFA 3AG3H 3BCAA 5TGTA 5IAXA 4FQGA 3SCGA 4D6QA 1VAKA 1SEFA 1JJ6C 1XX5A 3ABLH 2ME6A 1IN4A 4NB5A 3VD7A 4MG2A 1SEUA 2VZUA 3SXWA 2OS2A 2HLEA 5FQ0A 4MYEA 4W50A 4PDKA 4QPIC 1QU0A 3F9KA 2ZC2A 3K4ZA 5HPOA 4QDSA 3SKJE 4AYBN 3T08A 1PIV1 3JRHA 3WTYC 3IBMA 3I59B 2GH2A 4EZHA 1N78A 2QQNA 2OPKA 2VB6A 4CYDA 1X33A 4AEDA 4RGRA 5LD2C 4V2FA 2VNVA 3CESA 1CAWA 1HV1A 5IP7J 5LLQA 3KB5A 5JXIA 4AFCA 3WTWC 5FZ7A 3CLOA 4AC0A 4EJTA 3IZOA 4XKBA 4ZJZA 1OD5A 5FXZA 1XMKA 4A3FJ 4XUOA 2RVAA 4XUNA 5DM7F 2Q30A 5H20A 2BOLA 5FZEA 4C91A 3ZR8X 1D2SA 3I71A 4A3CJ 1JHJA 2H1LA 2OJED 2GIZA 4ZTFA 3FBMA 4AE2A 1DQUA 2I45A 4UFLA 3H50A 2DA7A 2UY8A 4XJ8A 2HZDA 5FXWA 3ALQA 1IS5A 2E53A 4CU9A 5A1FA 1N1SA 4HG6B 1I1SA 1KS4A 2HYKA 4XJ9A 3IIAA 4ZXKA 2CYFA 1PUFA 4RFT0 1MZBA 5E79C 4KL1A 3F8CA 5FRMA 1D8JA 1WJBA 4FTSA 3WCRA 1QA6A 4UNOA 5K7ZA 2OTLI 3HNYM 2O03A 3BVCA 3HGGA 3QH7A 2ZMKA 3AKSA 1BJZA 4IVNA 5FQ0B 2IP2A 2AEZA 2WSVA 4ZZDA 3B5LB 5A7WB 4AXOA 1ZBE2 3HG9A 4LE3A 4XE9A 3O5SA 3POSA 1GT0C 1PGW2 2WN3A 1Z1DA 3ZYHA 2W08A 3S2WA 1RI7A 1HRI1 1JUMA 2V9KA 4UOJA 5JOXA 3RYRA 3IRQA 5LGUA 4GULA 1UY0A 1YG2A 1WJ5A 1ZBE1 3GJBA 4B8EA 2XVCA 1BI2A 3T1MA 2AR6A 4FSJA 4HG2A 2QBYB 1MH3A 2ET7A 5B1AH 3I5UA 1DPUA 4RLQA 3WE2A 4D7SA 2UXNA 1RHI3 1T95A 2K9SA 2LP0A 1GWMA 1O4YA 1UHSA 5KR7A 2GA2A 3P9CA 2RREA 3K6GA 3TW6A 4A7KA 4IL6C 5CQGA 4QXKA 2YPDA 5IHRA 3OYEA 5C8CA 2VMCA 3A0HC 4ZS3A 2VAUA 1YNAA 2ZX1A 2AREA 1AR82 5DD8A 5B4NA 2E31A 2FDHA 2JPBA 2OU2A 3NMBA 2AEYA 3BUCA 3GFJA 2BOIA 2P7VB 1ETYA 4WVMA 2ZX0A 2DVFA 5FUNA 3HRTA 1G59A 1WI9A 1A35A 2Y30A 1N1YA 2CV0A 1VQPI 2BY2A 2OQ7A 1IC8A 3T8TA 5KXCA 4BJTA 4C0BA 3DXUA 5HCHA 5E88A 2LK2A 1TQPA 2IPQX 2IFRA 3AZZA 4R9BA 5FD6A 2VMGA 3AMQA 5IVJA 2WNOA 3GTMJ 4XHBA 1QGPA 4F3QA 1IOAA 3RQ0A 2WBKA 2YFUA 3V7RA 5ERLA 4DXZA 1RHI1 4UUSB 4HA8A 5A7SA 3PMSA 5J4VA 1J75A 1BMV2 4FXKB 1GWLA 3OOPA 1C8M1 1AR73 1W9FA 2E6VA 2PN5A 3I4IA 3R4KA 1VAMA 2GC2A 4IDZA 3LPGA 4NPMA 1ND3A 1R092 4ZXEA 2VBZA 2QWWA 1XSRA 2DO7A 1BW5A 5F9TA 5GALA 4IE0A 1FOWA 4CDWC 1OLRA 4MNUA 4L92A 4ENMA 1YCIA 3FFZA 5CYYA 5HNFA 4XONA 4FOYA 1MJ9A 3Q0UA 4E4SA 5BV6A 3B01A 5A3PA 1CZSA 2ZHKA 4YRDA 4QGNA 4KWKA 5BMZA 2R043 1R1UA 3SHRA 3WP6A 3RWNA 1TWAJ 3IH3A 4FPGA 2KMUA 1CIWA 3AJYA 3S3NA 2H6BA 1DLCA 1Q5OA 2HVQA 2EZIA 1B35C 1H9PA 3ZM8A 2IEKA 4V2GA 4I30A 4PJYA 2AC1A 4R9DA 5CVRA 2PYTA 1G6NA 1EPWA 4KWJA 1G9CA 4RSUA 1MS4A 3OF1A 4WM8B 3D5SC 2W3JA 2VJJA 1Q8QA 1HBXG 4CDXA 3FMQA 5A6XA 1V5FA 1XD7A 1MNMC 3OGRA 1F9KA 4IETA 2QGUA 3DTKA 1QJX1 3WHUA 2PQ8A 1GVJA 3HZJA 5D5WB 4E2QA 2JJ7A 4KA4A 1AKHA 4BMBA 3OIPA 2VOKA 1Z7S3 2EIGA 1BC7C 1CJDA 4Q0QA 2Y6GA 2XPVA 2H94A 4JDOA 3BOQA 1KYWA 2WLQA 5IYCJ 3L09A 4YLZA 2C0ZA 1HB1A 2QZ3A 2XV4S 2B42B 2YC2A 4M3GA 1H8TA 3OR1C 1H30A 1RUI1 4PCRA 3VD4A 5E1RA 3QPTA 1IRXA 2P3IA 1H6YA 2CH0A 2CWSA 4CU8A 1FLIA 3FJSA 4EVIA 3EBRA 2W1OA 4IE5A 2TBVA 3FISA 2BGOA 3VBUC 1J0RA 4OLLA 4B1LA 4CUCA 3VKLA 1ZG5A 2BV4A 3PUFA 1DQ6A 5J48A 4BKXA 2O61A 1OLMA 1U6GA 5FY9A 2WA4A 5FCCA 4HMZA 3ABKH 2KRFA 5T54A 1S0DA 2IXIA 3ATGA 4HVOA 1DZRA 2M45A 4M9XA 1SC7A 1HQCA 4Q27A 4K6BA 4Z82A 3PU8A 1D4M1 2G9ZA 3WXPA 4NQWB 4CZSA 1C28A 2L7KA 2OPWA 4ENKA 3E5XA 3DXTA 4XF4A 4KMFA 2DMUA 5H2FC 2QBYA 1MH4A 3VUOA 1TW3A 2VBXA 3S16J 2X05A 4RFRB 3AFHA 3V8KA 4Q5OA 3WNXA 3QD6A 3VBUA 1FEXA 4F55A 1PVC1 1FMWA 1JHNA 2Z33A 2BZDA 3WDUA 4XRFA 1WJEA 4L5JA 3H9GA 3CD6I 2M9HA 2RKHA 2MEV2 3PHMA 1MBJA 1RUE3 2OZJA 4DYQA 2D6KA 4GQ7A 1QNTA 3BG7A 2SLIA 5D8LB 4UB8C 3PFYA 1GQHA 1OBNA 3SH4A 3RMYA 4JGZA 4UFHA 4HF1A 2L54A 3N35A 1IHMA 5IK8A 4XR6A 1ETOA 4DZGA 3CP2A 2CQKA 4BJ0A 1RVF2 1IGNA 1R093 1PP8F 2RNGA 3LF7A 3GMEA 4QAWA 3ZSLA 1GQPA 1JGSA 3KFWX 4LBQD 5FMDA 2K3FA 1LEMA 3FXKA 4Y1ZA 3VDDA 3GBFA 2YMZA 5F0FA 4QIWN 1U3EM 1DP3A 3K75B 1E5IA 1VE0A 2XGDA 1A36A 5CAZA 5JR3A 3MKWB 2CJJA 2ZBJA 2NM1A 2A6WA 3GFIA 2YPRA 1CESA 3GM8A 3ITQA 3K4KA 2IW5A 1JZ6A 2YFZA 4W8JA 4HN0A 3KE2A 2GU9A 4QQ2A 1P4AA 4EWAA 3G2BA 2WQ8A 2IA2A 5H9QA 5GPAA 3SYTA 2KQRA 1HSJA 1QY4A 2A3YA 4AFDA 2VNOA 3EQLF 4P1WA 4XFGA 2YXSA 4CU6A 1BBYA 3CJXA 3P5BA 2E2IJ 2F4PA 1W8NA 3JRAA 3POEA 2LRPA 5DG1A 4LB6B 2E5ZA 3OMYA 4IEYA 2WZR3 1X3UA 3LNQA 4Y5Z0 1L7LA 5BUVA 1VBC3 2ZMEA 4FO9A 1WJAA 4P9UA 4EM2A 2OZ6A 3VBSC 3GZNB 3B73A 3ONQA 1CONA 1H6XA 2QQLA 1RR7A 1AKHB 1RIRA 3VFZA 2XAFA 4GIQA 1UELB 1JTZX 1W0OA 4GD4A 3J7MA 4XKVA 1MZ6A 2VMHA 3OS2A 2LY1A 4Y20B 1YS7A 4I76A 3M1CA 1I1EA 2K4BA 2GN3A 2A3WA 1VQ7I 5JR7B 3BPZA 4ZKTB 4DYRA 1JXSA 1JT0A 4GMP3 1W5SA 1GLHA 3S5AA 2XVLA 1BIAA 1VQLI 4J00A 2WLPA 2B9VA 4W6WA 3S7IA 4WK8F 1QXRA 2VXDA 4A3EJ 4M73A 1V00A 3DPRC 2R7QA 4KMQA 4GWJA 1VR3A 2BOJA 4NE9A 4NVPA 4XMAA 3OEBA 3A0BC 1TMF2 1R4MB 2JJ6A 3LFMA 2JENA 1SBDA 1H9WA 1WJFA 4IO9F 5DZEA 5IT9Z 2E2HJ 4XUTA 2LG4A 4JAAA 2JECA 4IOCF 4XXAA 2LVSA 5HDGA 1GOGA 4P00B 3I8TA 4AEJA 4NQWA 4DMIA 3UKTA 3ZFEC 3W5NA 4PLOA 2IGKA 5J8FA 2D5VA 1MBFA 4CO8A 5DN2A 3ZR5A 4CEYC 1POQA 2WWYA 2ZEZA 2OXBA 3S1QJ 1M1EB 4QKDA 4NIAA 3AKTA 3OGVA 3F8FA 5LA2A 2HQAA 1Y9GA 5LBBA 3ETPA 5A6QA 5FKLA 3PJYA 3WQ1A 1JTYA 4GAZA 4XETA 3I2DA 1OFCX 2E7AA 2OUHA 1AR93 4RR3C 4YPJA 2RC4A 1W7PB 1X1AA 2QF7A 4HONA 3NEUA 3UESA 3IDBB 4RBOA 3TN93 3RYPA 1IPSA 1YLFA 1MR5A 1RVF3 3ZPYA 1LCLA 3SH5A 2ZJ2A 2EBIA 4PUSA 3RS6A 5E8AA 1AYN1 4FTEA 1PM4A 1XPWA 3WGHA 4AYBA 3LEIA 2E1MB 4RAGA 3CKHA 3P1IA 3A22A 4IEXA 5H9PA 1WBFA 1A6IA 3K3NA 5L9BA 2VTXA 3K4AA 4MIMA 4MVTA 4XFHA 3GX4X 1WUVA 4M3BA 1X7NA 2JB4A 1VBA3 2XPUA 1BKZA 1W2UA 1C8NA 2G9FA 1H1IA 4CA0A 4COUA 1B1BA 3EUHA 2HOEA 4D6RA 3R4SA 2A7AA 2UV1A 3DTIA 3S5QA 1C1LA 5FKOA 3F6VA 2AXTC 1UG0A 5H9SA 2ZJCA 1ORKA 2GH8A 5DS9A 1ZREA 1OQDA 4B3AA 4A3GJ 3NKGA 2PG4A 5FXVA 3J7YJ 2M5WA 4C8DA 3CZUA 2EV0A 2G7HA 1LB2A 1V9U1 1NYWA 1QIQA 2MEV1 3F22A 1XRUA 3ASIA 3IAPA 4CCLA 2YS9A 3K4NA 3CC4I 3HJRA 1VFCA 3ZO0B 5EF6A 5GKAC 5LK5A 4V2WA 5JWPA 2QVOA 3PIOF 4XFIA 2DODA 1N1TA 1SFOJ 3HOUJ 4OAZA 5BNOC 4IHXA 3OYKA 2GM4A 2CV1A 5M3MJ 2O8OA 1XG1A 2ATFA 3OSGA 2K46A 5H6QA 1ONAA 1AU7A 1DQ4A 2AS5F 2R061 4Y22A 4MGSA 1SCRA 3BR2A 4XIDA 3BU0A 1H8TC 4Q5SF 5C3QA 3VZOA 1ZZ6A 3ZLIA 1AUYA 2CY6A 4A0YA 5IT9K 5L3GA 1UZWA 2NMNA 1SFXA 1MS8A 3PVEA 1CR7A 2W47A 1PMJX 3FUOA 2BRTA 4DOUA 1UZYA 4G94A 4GWMA 3GW2A 1C1FA 4YW7A 4W1UA 5JPNB 1Z91A 2ARAA 3VDAA 4CUGA 5EJ1B 4XL9A 3ZMTA 1QJY2 2F5FA 2UXXA 1VQ4I 2VQTA 3OYJA 3BWGA 1X8MA 3U9GA 5ICGA 1WW4A 3ON7A 1DHKB 3I49A 1K61A 2B9UA 4OHVA 4M71A 2GP3A 1Q1VA 4AHWA 2WYFA 2PXJA 3CCVI 4BGDA 2RS52 1MZ5A 3CQOA 1OYWA 1BA5A 1XE0A 2GOXB 4O7XA 3BTXA 1T98A 5FOBB 3USUB 4LLLA 5DYMA 3S3OA 1RUE2 3S3MA 3C7HA 2CFXA 3DKXA 1SFKA 2HDWA 2FHRA 5FY8A 4XDOA 4XAAA 5FKCA 2R063 1TTYA 1OFSA 1W8HA 1YX5A 2Q2EA 1G8WA 4HKWA 3BN6A 2LFBA 5EQUA 5F5QA 4MO7A 4DFSA 3TEZA 5DPNA 4L97A 4PI2A 2L7FP 3LSTA 1E0EA 1PK6B 5FKNA 3FUQA 3N9LA 2O7OA 3KZIC 1LHNA 4XFFA 2F5EA 1NY72 2WADA 1UX7A 1W36C 2F48A 3UT0A 3ZFEB 1BR2A 5K5RA 3AYCA 3I3MA 1PHMA 4PQQA 1APLC 2VQGA 4IEOA 3V0AA 3H5RA 3ZQIA 5ANNA 2D45A 3KPHA 2E33A 2QCSB 2Q8DA 3AAFA 3N9MA 3KQ4B 5J1XA 1JE8A 2JUCA 1UY1A 1RB8G 2PAEA 1HQWA 1WKYA 3D5LA 1Q1HA 2NOJB 3CCYA 1MGTA 1A78A 2VQHA 3D3AA 4KNYA 3ZOBA 3DPRB 2L3DA 3SNMA 4ZONA 4XFAA 1UZ0A 5EP9A 1JZ5A 4XLFA 4FBFA 5DTDA 1L3LA 2GDFA 3JRIA 4DBQA 2NS8A 3X2QH 3UKGA 1AR92 1Y0NA 1SPPB 3QH6A 2BWAA 2GC0A 2E1CA 1AYN3 4WM8A 4U7DA 2Y6HA 3M3CA 2WWSA 1I1GA 1MQTC 4F91B 1W7PD 5K7HA 3JRFA 4DYCA 1S0BA 3E97A 4LHKA 3IM0A 1KQRA 1R1TA 2JDUA 2VKDA 1R49A 2VOVA 1W6PA 1ZN2A 3ZXDA 4PIYA 2ZFUA 2HYXA 2R041 1XYNA 1BOBA 2R7VA 3NNMA 1YJKA 4NMIA 1V5EA 2GC3A 4S05A 2FDJA 1QJU2 1S0JA 3QCWA 3POWA 5CFCA 2F6CA 4CU7A 6PAXA 5EYYA 3QACA 1UN1A 2C6SA 2QLZA 1U5TB 4HX8A 2ZJQF 4FX4A 3I7DA 4WM8C 5FO7B 2F4MB 5FPZA 3I64A 1I3QJ 3TEXA 2O0YA 2QENA 2XAUA 4AVCA 3Q0WA 2LROA 2VMIA 2UWBA 3O1RA 5DABA 2ZGMA 4LMYA 1S29A 2QQIA 3PUAA 5FZOB 1X1DA 5EGOA 1E3OC 3HOTA 4S2HA 1UPSA 1WHUA 2W1SA 2ZGPA 1YO5C 4LPLA 4N9HA 1QBJA 3WW2A 2E7XA 1PVC2 2K9MA 2QQBA 3VPRA 4N0BA 5FPLA 2ZMLA 3CJIC 1W6OB 2UURA 2X9DA 3O7OA 2QBXA 1FPN1 3HYIA 3C7EA 3RYKA 1R4NB 5T5OA 2HWF2 4LJZF 4O5VA 1PNGA 4YZ3A 4XOTA 3N7LA 2ZJRF 3MAJA 4Y15A 4I2OA 4AF9A 1UOFA 1OURA 2QM3A 1XYOA 1O59A 4XKWA 3ZGKA 2QZ8A 2BBVA 1T0FA 1W8TA 4JKMA 5GAGJ 2ELHA 1JZ2A 2VG9A 4F3JA 3OB8A 3KM5A 2DA4A 2ADUA 1XBFA 3M3QA 5FJKA 4XXPA 2M8EA 3CU7A 4Z2AA 3D4KA 5IYDJ 4CDUA 3WF4A 5B2GB 4YM1A 5ABJC 2X10A 4U0YA 1DFQA 4AWXB 1ZTRA 5FUPA 3CL1A 3J7ZI 3GEZA 1JMUB 1GP4A 3LA3A 3HBKA 1AR83 2M8GX 4BXSV 3QWLA 2XPJA 3ZIWA 4BPZA 2NP0A 3AP6A 5CKMA 5FLXZ 4P96A 3AP9A 4YW1A 3CUQC 4Y1VA 1IZ1A 4Y5TA 1B8IB 4XRMA 2DV9A 1PP7U 5HDNA 4LK6A 4DPNA 2PHFA 5DCMB 4NWWA 1LJ7A 5C44J 1IDYA 4RGKA 3IKWA 1NZCA 3J80K 3WF0A 2OC6A 1RL3A 4HPKB 3KP6A 3BPVA 1OCPA 4X6AJ 3PL8A 5BPDA 2YBKA 2LNBA 3ZFGC 5A3OA 3DKYA 5D21A 5EDNA 3K70C 4WZFA 3F2ZA 4A3LJ 3EJKA 2HWC1 2XAGA 4N7IA 4MQ9F 1JGGA 1A34A 1DBNA 1ZZ7A 1KGYA 1COV1 1Y7BA 5F0HA 3ZFFA 1FX7A 1PUEE 3NJVA 1T56A 4J6GA 3G1MA 2QQ9A 2RS33 3LDBA 4EM1A 4IEUA 2WFF3 1JUSA 1FOYA 1DQ1A 1KU3A 3ECQA 1Q8SA 1UJ8A 3N7KA 2F4IA 4QKNA 4DY5A 1PO22 5DG2A 1X9TA 1NCRC 1POV3 3QPSA 1PZ9A 2XJUA 4ZYGA 4XLEA 2VQLA 3DU6A 4PLMA 2NVUB 4N53A 4E7LA 4OINF 3JAMK 2KDZA 4PDWC 3TBIA 3CQZJ 4DQAA 1ND2B 4NHJA 1B35B 2X51A 3WT3A 2R072 2NNNA 3H3VK 4Z6YA 2P6HA 5KC5A 5H9RA 1IG3A 4QX7A 1JS9A 2HWB2 3CZJA 2R1DA 5GAHJ 3CF2A 2VN2A 1O5LA 3HRMA 5E1XA 1FNZA 4P5OA 4LUKA 3AKZA 4BHCA 2P5VA 1HXS1 1UU6A 4COWA 2DDBA 3KV5A 2DUOA 3DWLE 3EXUA 1RUH3 4NIHA 1RUE1 3HNMA 4AQTA 1IRFA 4D69A 1BIBA 3REOA 1HW2A 3PJQA 1MIJA 2CGOA 3K70D 2XUMA 3MO4A 3LDRA 1H0MA 3JD72 1R23A 2P34A 1ZZCA 1D0HA 4ESJA 5I0DA 2FCTA 1NUKA 3N3HA 1DP7P 2VD7A 1S1AA 3AXDA 2EICA 3H3LA 3L2YA 4MGYE 1FC3A 1V6OA 1J58A 1MEC1 2XB5A 4BEHA 2PEXA 1JXNA 4PBPA 3GFLA 2YDEA 1N3PA 4ON0A 1LGNA 3M7AA 3BTIA 3VOEA 3F3XA 3F8BA 4MHGA 5JZGB 3VBHC 4JDMA 4DZJA 4CCJA 5A3UA 4BE0A 3E5QA 1SAXA 2XMLA 2JD4A 4WM7C 3GTOJ 3VBOC 3TAYA 3PDQA 5JPMB 3ZIXA 4XTMA 1HRI3 4M72A 2D5FA 2DDAA 3VBFB 2WSUA 2Y75A 3GCWA 1DQ0A 3ZVXA 3KLOA 2HQRA 1U0JA 4UF0B 1VBC2 3BYWA 2BY0A 2PHDA 1BI0A 4NHYA 3R60A 4COZA 2VW2A 3ZMZA 4IRIA 2RGVA 1U5TA 4HQMA 2IXCA 5FK8A 2R5YB 4LKSA 4Y7NJ 2NVYJ 1I3AA 3RTRA 2QKMB 2A6TA 4G4FA 5GTHC 4XZUG 1ENHA 3VBOA 1WJDA 4JQFA 1C4RA 3ABMH 1HKTA 3MGUA 3A1YA 1EH8A 2MLGA 1JUPA 4J19A 1XN7A 1EP0A 5L3EA 2P2KA 2JN6A 4U0WA 4YGDA 4XILA 3QP6A 5JLXA 4H7MA 4Q48A 4AVBA 2AQEA 4E70A 1QJY3 4EEFG 1JU3A 2OQ6A 4X0GA 2HBTA 1R36A 1SLCA 5JHUA 1EV12 1QZYA 4MSVA 2B7YA 4M3DA 4A44A 5FYMA 3M3YJ 2O6GE 3HSFA 3M3EA 4WVZA 1QQP3 4YFWA 3HBZA 4FFGA 2J1TA 1QRYA 4AR2A 3PUIA 2GXGA 1LODA 3R61A 5LASA 4CCKA 3ZXGA 1IUYA 2NYYA 2Q0OA 4CDUC 4GFBA 4ESBA 1WZ2A 4MGRA 2M4KA 2HKXA 1ZYRF 2L4AA 3E0JB 1RTVA 2BFUS 2WNUB 3H1MA 1BMV1 3UGFA 3JAMZ 4IXAA 1GNZA 5CA6A 1FIAA 2YC0A 1GYKA 2CUJA 4KNCA 4URTA 2E2JJ 3KP3A 1UYYA 5FZCA 3AJZA 2A69F 4HNTA 1MS1A 2KIUA 5IT3A 3WR0A 4OI0A 4EE2A 4N43B 3UNPA 2QTWB 2YB7A 3KP4A 3VYTB 5F2WA 3K77A 1C57A 4A6EA 1QJU3 3HJEA 2YZ4A 4CP0A 3IH4A 4UFMA 3CCSI 1PIV3 3FZ3A 3ES1A 3HKZN 2HNHA 1PM7A 1UWWA 3K0LA 4E7SA 1SD6A 1W03A 4EN6B 1U5TC 4KDPA 1MJAA 1MD0A 1YUDA 1HX6A 4AYUA 2CFOA 2G4IA 3CMAI 5HLIA 3GXUA 4QQLA 1ZBA2 2FZ1A 2HTSA 1FMD1 4RGUA 4YVSB 2ESHA 4P08A 1IXRC 2XUBA 3OOUA 1FATA 3ZFFB 4CP2A 4M3CB 1OYIA 1YQ8A 2IJLA 4P55A 2NPIA 3OGSA 1MVQA 2RS31 1K4TA 3FXLA 1TME2 3ZXFA 2Q8KA 2H6CA 1NKGA 1YRZA 4ORFA 2JG8B 4RQPC 5IY5H 3FN9A 5LRRA 1Z6TA 2V73A 4C90A 2YGMA 4DOZA 1QNWA 2RAEA 3WE3A 2VKVA 3RRDA 4QX2A 2VZPA 4RM3A 4HANA 5FY4A 4OQ9A 5KHJA 5HLTA 3H35A 3EUKL 1LVKA 1W8WA 2PTMA 2IA1A 3IHUA 2H1KA 1FMD3 3A2KA 3I2IA 4SLIA 2W46A 1Y6IA 1R5HA 1VBB1 2A07F 5K0UA 1M4WA 4AM3A 5HV4A 2CW0F 4L99A 1V3FA 5JHFA 1B35A 1IS3A 1UD1A 4C0HA 5GLTA 1SD5A 3VZKA 3MUZ1 5LZ6A 4CYCB 2OW4A 3GWZA 3KIOA 1OMIA 1OA3A 5SV5A 1FJLA 1RKTA 4XF3A 3WY6A 1SMYF 4Q4Y2 3FXOA 5L9VA 2ZZJA 4PHZA 1VBB3 3WG9A 4YVSC 5A3NA 1OCZH 3IMNA 2XQXA 3LSEA 2WAEA 3PVBB 5EPAA 5G05L 1W2OA 2A3SA 5C3RA 3MFKA 1J2XA 4R52A 3NV4A 2WQ4A 3IAS2 3WCSA 2NYXA 1GZWB 4M0HA 2EJRA 1NA1B 1TP4A 3POGA 4B48A 2W39A 1T08B 1NK2P 2FDKA 2Z4FA 2FBEA 4OU0A 1P7JA 1LTEA 4QM8A 1A8DA 2RHPA 1SLBA 1RITA 3FE5A 4UW3A 1DYKA 5EG0A 3MUY1 2Y60A 2DWRA 5FBZA 3W20A 3OYNA 3L1PA 2VULA 3WW1A 3KD4A 1YQCA 1SD7A 5BYNA 3RKYA 1IS6A 5C3PA 2DU0A 4M74A 5JOWA 2DBIA 3BIWE 3JCIA 2CMPA 1RUI3 2GNMA 1HQNA 1AXKA 1BOAA 3PVOA 1IXSB 4I02A 4OI1A 3IP4B 4UFKA 2XAQA 2XBO2 3K1NA 4BQYA 4BLIA 4NR1A 1TMF1 4MGKE 2EF6A 1V55H 3AYEA 2OA2A 1GVDA 2VMEA 4X6QB 5ED4A 1E5RA 1NCRB 3NRVA 3V8JA 2KKOA 4XUQA 4BAYA 2CQNA 2PX9A 1GOFA 1EUUA 4EQVA 4EJRA 1R5GA 5HOOA 2RR13 2GZWA 3LD8A 2QSGX 1UOBA 4HX7A 4MFEA 1UU5A 5JMOA 5HXVA 4G12A 5BPIA 4M3CA 4OHYA 4FP3A 4AEDB 4QPOA 3A0NA 4L5IA 1YJ9I 5HCBA 4AUXA 5F39A 3FXQA 2DUQA 3MBWA 2CQ7A 4L9TA 2WB1A 1WJCA 3MVPA 3KZ4C 3NQHA 5A3MA 1V6IA 3LQCA 2RS13 1UAIA 1TZOA 3NO8A 1JJ8C 2VODA 3KMHA 2IZWA 1QJY1 3CCJI 2A71A 3GNEA 3MPPG 5FMBA 1RXFA 4Q4X2 2Q2EB 4HFSA 1RHI2 3D0SA 2IC1A 2VJXA 2JSCA 4IX7A 1MSEC 3PQJA 1R081 4UFIA 3E1SA 3CC7I 5FLJA 5LY2A 2DOEA 1FSHA 1D4VB 1TWFJ 1BW6A 1RUJ3 3ZYRA 2K4JA 2R7WA 4YFKF 2PJRB 4MADA 4RHV2 2YBPA 4OFGA 3HXLA 1J84A 3FHIB 3DBLB 4LUMA 3MIDA 1LHOA 1JYXA 3RFRA 4AVPA 5CNAA 1QZZA 2XRLA 2VH9A 1MDMB 1B9NA 2VBWA 3AG4H 1T39A 1SFEA 1SLLA 4GXLA 3SEPA 3FHQA 2E34A 2HWB3 3LKJA 3JRDA 2VZ3A 3SEEA 5ERIA 1LNWA 1XDUA 4HN1A 3FC0A 2PHUA 3W9AA 1TNTA 2W1WA 3RI4A 4CDXC 1YQ6A 3BPSA 3AL0B 4IEZA 1VRH3 5ABJB 1JYTA 4QT6A 5BS6A 3L2UA 4MHUA 3VYUB 3PL0A 3INAA 3BR0A 1GWKA 3D8CA 5LBCA 2JA6J 4NC8A 2VIXA 3WHTA 5I0SA 4S0HB 3HTUA 5FZ3A 3EYYA 3UJOA 2LTNA 4YFXF 3MIGA 4AIKA 4Y1XA 4Q0UA 1IW7F 4ZH4F 2W1UA 1OOPA 1TBXA 1CVNA 4JZRA 1OD3A 2DTZA 1QJX2 5C71A 5DUWA 4KBZA 1AHSA 4MZUA 1ZELA 1G3WA 1V4RA 3JBG1 4S2GA 2X6XA 4YVWC 3BZKA 1J83A 1OKRA 4FQZA 3LEGA 4QMAA 4DNYA 3A03A 4RAFA 3U10A 2IFWA 1H89C 4BQ5A 2STWA 4E4HA 1I9RA 5KAIC 5F3CA 4PSWA 3FLTA 2VZTA 2DYSH 2XGEA 1HXDA 5IYBJ 2BFUL 3HWJA 3M1HA 5FKBA 2FDFA 2WT0A 2OX0A 1SFPA 3B00A 2ZACA 2WIIB 2HWD3 4RLFA 5J7MA 3N7MA 2XL7A 5DUVA 3T0DA 4KGQA 3BTCA 2ZGNA 2DMTA 1OFNA 4Y3OA 4LIVA 2LF7A 1BEV1 3GFMA 2EK5A 1N3QA 1KQ9A 2YR2A 1RZ4A 3KEOA 2DVBA 4N7UA 2GBYA 4DB5A 1HXS2 1W6NB 4GXOA 1P8JA 5C33A 4YSFA 1H2LA 1MS5A 1FBQA 2BBAA 3T30A 1QGLA 3F6OA 2M34A 2CGPA 4FE7A 4XACA 5BY5A 1FY7A 3CMGA 4AIHA 1JKQC 3IKVA 3CTAA 3CJTB 5K0UB 1GUIA 2X1EA 1ZRCA 1X36A 2Q1MA 3JD73 3PIGA 2G0EA 1W05A 4TTGA 3H9QA 1WW6A 2Z3YA 2JWPA 2C4XA 2HH9A 2V5YA 1W8ZA 3FFQA 1LOGA 5HLHA 5LK7B 3OV8A 1PMHX 3ESWB 3CO6C 4PK4A 1GR3A 4LBMA 1NAEA 1XDSA 1LULA 2QA4I 2RDNA 3AZXA 4P9JA 2DVAA 4FISA 4AVAA 1G9AA 3Q8CA 5M3FJ 3IT8A 3ZXKA 2XUEA 3VL8A 2ZSIB 1M06G 3MD2A 4HBLA 4IGPA 4QPWA 3OSFA 1VBD1 2XHKA 3FKJA 3KF5A 5LA1A 4KT5C 1GZ9A 2EALA 3USUA 1YTYA 2R071 3WW4A 1A6QA 3GBWA 4EM0B 3JR9A 4QX3A 5L7OB 1IGOA 2WTEA 1ZHFA 5GP9A 3KWVA 3EUAA 2Z16A 1XB9A 2ORZA 4G7HF 3LQQA 3HOXJ 2Z69A 5ACA3 5LCWL 4H14A 1D1AA 1T6GC 4AWDA 4B4QA 2HGCA 1UKGA 1IXCA 4FOQA 1AF9A 2E7QA 2P1BA 2KHMA 4AVZA 1F31A 3DV8A 1OVPA 3LAGA 4BQAA 4META 4JYKA 3SC7X 2EIMH 2RG4A 1DU3D 4AD9A 5LWBA 2X29A 2DA3A 1HCRA 2P6SA 1UHWA 3ZKUA 4A45A 3ZQQA 3ES4A 3TBDA 4D0PA 3TL4X 4LG0B 2DBBA 4L9VA 1EPZA 3HQRA 5EFUA 3H1WA 3JB8A 4OQ8A 2ZSHB 1FSEA 4LB5A 2DT5A 2MEV3 2DOFA 3IDCB 3AMMA 3OPWA 2H0BA 3WQ0A 5IK5A 3TDZC 3GTPJ 3MIEA 3S0MA 4GDFA 2DJIA 4Y33A 4IE6A 5FREA 3ZX7A 5I8YA 2TDXA 4E8CA 2D3RA 5T5PA 4B4PA 1W36D 5K7PA 3ZMVA 1WGPA 1SZBA 4LK0F 1XGOA 1OKQA 3RDIA 5SV8A 2WYSA 5GLZA 4AI3A 3O2PE 1DQ2A 4OI2A 3IAQA 2XKOA 3MCZA 1R082 2EFOA 4HLTA 3DECA 2EIBA 1EAH1 4IV1C 4JKKA 1CN1A 2YX4A 3POFA 2VZRA 5FPVA 2UWAA 1FI2A 2NN8A 3G1OA 1E5HA 5C4WA 3CBNA 4BCUA 4NC7A 5F1JA 2MH2A 2BW8A 2VBPA 1EJ9A 1MMAA 4XM3A 4C2MJ 4FPOB 2O1QA 1YX3A 5J47A 1PX4A 4E8DA 2B46X 3KP5A 3S2DJ 4LR4A 5IP6A 4E2SA 4KIFA 4LLNA 1UYPA 2DF7A 2IXSA 1YJWI 2FMYA 3T09A 1KS5A 1JOPA 4AIDA 3N97A 2KJCA 5ANQA 4MTEA 1IPJA 3SQOA 1J3QA 4NHXA 1J59A 2JRTA 3AKQA 1ZRFA 1JU4A 1DGWY 3HN1A 5CBLA 1U2WA 1YQ2A 1HQLA 2V72A 1HA8A 1CZVA 2X4HA 3U1KA 1D3YA 1WGXA 4ARXA 1WLCA 1ZRRA 2ZFWA 4N43A 4TV7A 4LO4B 2C9AA 3FIWA 4BNCA 1WLTA 5TJJA 1QKQA 2XLFA 3H0GJ 3MIHA 2YGLA 1RIOH 3I2JA 5FBJA 4KT6A 1LQ1A 3J4UH 4LJHA 2V9VA 1RGSA 1WLDA 4M4RA 2R5ZB 1V6MA 4BB3A 2CDOA 1CGPA 4XOPA 1U78A 5AFBA 3OYDA 4BQXA 2W25A 4O65A 5J37A 2V4AA 1O3TA 3WLUA 3CUOA 1J5YA 3WNMA 2JDYA 2QKDA 1WFXA 3WQBA 4ASMB 1QVUA 1R1VA 4TLFA 4ISQA 3HBLA 4O9EA 1D1BA 4Q2FA 2QE3A 3WV6A 1PK6A 2V1UA 2DPDA 4F52A 5I0RA 2J7MA 1YC61 1UCXA 4UUVA 2DT7B 3GTQJ 2BVMA 3WDTA 2QNKA 4LA2A 4LIUA 3HT2A 4GH4B 4HX4A 2XVKA 3CCUI 3TMOA 1EKEA 3WU0A 2A5ZA 4DEQA 1TQIA 1YRNB 4J1XA 3WNKA 5FPBA 1VQOI 4BQ2A 3T1BA 1JKPC 1PVXA 4UVCA 5KXBA 2Y9ZA 3A02A 2UYAA 4BZ4A 4MH0E 4NROA 2D93A 3VYRB 4PDWA 1RUD2 3H36A 1OLTA 3S2HJ 3WDXA 1X4OA 1D0XA 4RS5A 3RKQA 3KSCA 3V7CA 1H88C 4IHVA 4YELA 2JD9A 2IGMA 3O0WA 3FZVA 3CJRB 4N90A 3K1MA 2VOOA 5FYVA 1K5MA 2LM3A 4I0AA 1Y1VJ 3AG2H 2LY9A 1I39A 2PMZN 1ULDA 4A3BJ 1V9U3 1Y9MA 4K1YA 2CU7A 3PUQA 4IQJA 2P4WA 4XURA 3DPTA 5D8AC 1CX1A 1LENA 5KWRA 1KFXL 2LYCA 1P9QC 3VHOA 5FYUA 5A70A 4A3XA 3HRUA 4I0WB 2E5NA 5EEGA 4HQEA 4CP9A 4XLHA 2ME0A 2L4MA 3ZMOA 2W9XA 3WG2A 3BQYA 2R7EB 1IG0A 1KDMA 4XPVA 4LA3A 2DT6A 4A3KJ 4HPKA 4QWNA 4IF4A 3BR1A 3V64A 3AL5A 5DZGA 2ZMEB 1VRBA 4IHTA 4RGGA 4Q4Y1 4AHXA 1AR61 4FPHA 2WWUA 3A01B 5C8CC 1H2KA 2OZUA 3OIQA 1J3RA 1NQDA 3FHZA 2GP5A 3DFGA 1REFA 5KVRA 2A3XA 2W94A 4UYBA 1VBA2 4AI1A 1XGNA 3W2VA 3QU6A 4E7IA 3ZSJA 2NLRA 1H8VA 3E5UA 5KBFA 5A2QK 5BNOB 1QJU1 2J1SA 4II3A 1COV3 2XL9A 1RUD1 4NNJA 1NZIA 4C1XA 4A5MA 2OUMA 4BM8A 2PA7A 1O5UA 4CDUB 3TN92 1RNLA 4QDRA 2W92A 1GP6A 2DCTA 1ON2A 1FNYA 5F37A 2ZOEB 1ZNPA 5M0TA 3KF3A 2EIEA 2LKSA 4QXCA 4R1HA 2M7BA 3FXMA 1BYHA 5FZ8A 2BNMA 4FE4A 2XGCA 4JRAA 4Y52J 4P9LA 3IIIA 1W5TA 1OPMA 3OYFA 4D5FA 3MKLA 2VZVA 2OCEA 4LQRA 1XS9A 1VQ9I 2CSOA 1LR5A 3I56I 1B8IA 3CF5F 4H3WA 4G9SB 3WNNA 1ALYA 5BNPC 2YHJA 2PAKA 5AC92 1FPQA 3AM2A 1YITI 1ODDA 4GALA 1E17A 2W7NA 1FYUA 4HLYA 1I6XA 3TP0A 5HBAA 3FM3A 4XKCA 4B7EA 3M2MA 1O3SA 4QX8A 1Y3TA 4QSHA 3ZCOA 1W1WE 2CV2A 1WMXA 4H2AA 5CZKA 2VUAA 3ZKYA 1AYM2 2X5IB 3HAGA 5I0UA 4XFBA 3THDA 1FOD3 5IVCA 3RMXA 2OT7A 4CEYB 3T2QA 4YW2A 4CXXA 3EPZA 5FUIA 3UV9A 4R4ZA 3CDZB 4CE8A 4FTHA 4WV8A 2EXIA 1KRIA 4AQSA 1USSA 1OA4A 5DAVA 3OPTA 2GWRA 2VKHA 3H0OA 3BP8A 5L3FA 2FOKA 3O3KA 2ZGRA 2R5YA 1IAWA 1Y8QB 1QJEA 3VBHB 2Y31A 4A6DA 5FPUA 4RN5A 1H2MA 5DDJ2 3E6MA 4A93J 5C9AA 2CQQA 3DP7A 1LHVA 5G04L 2AXLA 5EWSA 5EJZB 2ZGUA 1BM9A 3ZRGA 3L2HA 3BJOA 1PO13 2XVGA 4YIFA 1D2QA 2ZABA 5L36A 2BEOA 4CP9B 1W5CC 4YG6A 4M6YA 3DEEA 1OOPB 1W4MA 1PJRA 1OLME 2WQZC 2STTA 5HI0A 1Z0XA 5KHKA 5FLVA 2QFEA 4QB2A 2G9WA 1ASJ2 2DA2A 4RQPA 2DURA 3W6KB 4CEWC 1KJRA 3NNGA 2KLOA 2E63A 3K69A 3P3PA 1W90A 5DUXA 2YBSA 4JRLA 1KXGA 4PJ0C 2O8QA 4S2DA 3K48A 2A61A 2JG8C 2RJ2A 2RMU3 1HB3A 1SG3A 4L0ZB 1V9U2 5BXXA 2Q1ZB 3BZCA 2DA1A 4W97A 1W6MB 2DFFA 2EH3A 1ND2C 2YYOA 2Y6LA 2AO9A 2XF6A 2ARBA 3TP3A 2VW1A 2W4SA 2HVRA 4KWLA 2OKXA 1XSVA 2VUMJ 1SHWB 5CQEA 1XYPA 1G3YA 3WTXC 2PJRA 4GB32 4Q29A 4EGYA 1W9WA 1Y4WA 2VZOA 1U5XA 3OBRA 2N7GA 4XIKA 4XABA 4TYSA 2Q8OA 5DV5A 2HEYF 4HDUA 1B72B 2DK5A 4YYOA 2PQSA 2IAIA 5A7QA 4GYGA 2CG4A 4L9NA 5HS9A 3OIOA 3L2CA 4HPQA 1V5GA 4LBQA 3N7JA 1VLNA 1SDDB 3RPUD 2W24A 1S0GA 3ZDSA 3PTRB 5F6KA 5J1YA 4JC1A 1GDTA 5GLWA 5CKNA 4GWIA 4DINB 1DLLA 1QNYA 4LKEA 1XMXA 4HNUA 1G9DA 1FOD2 4RAYA 4XMIA 1ZRIA 4JCKA 2PELA 2VT3A 4MGIE 3PO3J 5E17F 4FXGB 5I91A 4QHOA 1O7LA 1RJ8A 3HL2A 2IRFG 3VDBA 2CDPA 2VOPA 3Q0VA 2WO3A 1HLCA 4QKFA 2E60A 2VBYA 1GOHA 1SLIA 1G2HA 4I0BA 3K4JA 5LRSA 1ASJ1 2PHLA 1OC1A 3LL7A 1ETVA 2A6VA 1ITYA 1RUC3 2EQRA 5AVAA 3FXJA 4LBKA 4LLOA 1F4HA 1PZ8A 1PZ7A 4CHUA 2CW7A 3BTYA 1X82A 2HU9A 2LR8A 3OY9A 3HN3A 3RNSA 2YY1A 4BXUA 3JB4C 1CQTA 3THCA 1N77A 3C2HA 3ERMA 1KU9A 2UY9A 3VB9A 5FYYA 4XEZA 3I3LA 2YU1A 3KV9A 1IRZA 4IEVA 1Y0UA 1OQ1A 1S3JA 2BW3A 2GIVA 2OYZA 1A8MA 3CF6E 4KG8A 1DU6A 3BGAA 4WVWA 2RV9A 3WD5A 1GLNA 2HWF1 1HKSA 1W2AX 4Z2WA 2W84A 1LHWA 1XXNA 4CDQC 2M4GA 1AR81 1OUSA 3KV4A 1KGSA 1T6SA 4A6OA 3ZMUA 3VKNA 4LKFA 3O1MA 4EJOA 3LPFA 4AFMA 2WAQN 2Y69H 2VPVA 2VCAA 2VGDA 2RQQA 3NV1A 4C2UA 3PVNA 2XH6A 2X5IA 3F8NA 2JRMA 2WY7Q 3C8XA 5DUUA 4IXLA 5A7WA 2ZKNA 3VSKA 1ZG3A 1L3JA 1HRV2 2ENRA 3FMSA 3MYXA 3GZ6A 3VD9A 2AZ5A 5FYHA 2JQ7A 2R7SA 4JVAA 3JBG2 1HJFA 2G9GA 1DGWX 2BXYA 4B09A 4IJAA 1UAAA 1XE8A 1W9SA 5CJ9A 5LHIA 5FZLA 1U9OA 5LGNA 5FZOA 5EJ3A 2RDRA 2E36A 3CCRI 3SITA 2FBIA 4GH4C 3ZXEA 3WG4A 1GP5A 4Q4V3 1J7KA 5A32A 1D4M3 5IWFA 3O1SA 2DI3A 2VMDA 2W87A 3D5OA 2I8DA 3B6AA 3ZYIB 3OYGA 3S32A 3TNPB 2JPCA 1Z78A 2V4VA 3J8F3 3THPA 4CCMA 3JD71 4XN0A 1W8FA 4LG3A 3O1OA 1X8EA 1K6YA 3CDIA 2LLKA 4YZ2A 1POV0 1JZ3A 4XQ4A 2K27A 5C4XJ 2GMPA 1WMEA 1R1A3 2MSYA 4G7ZF 1F5JA 4P5HA 4HKLA 4DZPA 3ZSEA 2VTFA 4ANJA 2IBDA 5E89A 3O0XA 3RZZA 2R32A 3W2AA 3IWFA 2WNVB 3J81K 4HVRA 2GSYA 1ACCA 3KCXA 3U4SA 3LFUA 1W0NA 4KISA 2FA5A 3AB0A 2ZX3A 2R49A 4YGEA 3J7NA 1JBCA 2AGSA 4Y17A 3ROUA 5DQ0A 5HNHA 1D1CA 5LY1A 2AH2A 2MC4A 1QPMA 3N9PA 4Q1RA 4UUSA 1ENRA 3C2UA 5K0UC 3RZKA 1KONA 1Y8RB 1TVGA 2A70A 3FHNA 3LSJA 4AEMA 1UYXA 2BUKA 3BLYA 1I5ZA 3TRSB 2R6QA 3AZVA 5IVYA 3O6BB 1O6UA 4L9BA 2EIKH 1DG6A 1BCXA 1SANA 1G86A 1QH6A 2YC4A 3LSIA 2ZZQA 4WWCA 3ZN6B 1K12A 2DFIA 1VNDA 1K79A 2WS91 4QHZA 2Y6FA 9ANTA 4OUMA 1ZKGA 1D7PM 4XBQA 2NZ9A 2M3AA 3GUDA 1ZK8A 4FFFA 4LOTA 2ZEYA 5K4LA 3RZOJ 4P9WA 1RUF2 3DKQA 3K7AJ 1UO9A 3OOXA 2DJNA 1R083 2OBPA 1AX2A 4XF9A 3RZMA 4HSTA 1Z6RA 2EIJH 3A21A 3TKYA 1LJ9A 2WY8Q 5C3SA 4CZCA 4YVWB 5J8CA 3JSOA 1VJ2A 2XGXA 3VBRB 5E6HA 2JTVA 4FT8A 3CUQB 3VSLA 1RUH2 1VALA 2W52A 4HSLA 4LE4A 5FLIA 3RQ4A 1HB4A 2Z2SB 2A6ZA 1QXPA 1XNBA 3KGLA 2L2OA 5A7OA 2ID3A 5FZAA 4BL0B 3MKYB 1VQ8I 4XK4A 2HKOA 4AZZA 4MO3M 4BXXJ 5ACA1 3OUJA 3ENRA 1ZYBA 1V70A 4O9GA 1AJOA 2JG9C 5FY7A 2KD7A 5EIYB 4XCAA 4XOGA 2GC1A 3WTTC 3FM5A 2WO7A 3Q8FA 4RGSA 1ZZ8A 2CU5A 5JVTA 2JMWA 1RUG1 2VL8A 4ZU4A 3MPBA 4TSVA 2XPWA 4DNCA 3SLIA 3V4GA 1MEC3 3ZYGA