4N9IA

Crystal structure of transcription regulation protein crp complexed with cgmp
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
202
structure length
202
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of inactive CRP species reveal the atomic details of the allosteric transition that discriminates cyclic nucleotide second messengers.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator
molecule keywords Catabolite gene activator
total genus 62
structure length 202
sequence length 202
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4n9iA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4n9iA01
4FBFA 1UD1A 4YYOA 1SD4A 3WG9A 4E70A 4S05A 2L4AA 3OV8A 2FU4A 3FFQA 4KUMA 4M9SA 2YR2A 4OIQF 1BIAA 3D82A 2RV8A 4ZYDA 1XSXA 1K7AA 1QY4A 1SMYF 3E3VA 5K5OA 4IJAA 1L3JA 4D7TA 1U3EM 1KYWA 2BV6A 2LDUA 5I8YA 2H94A 3USSA 1OKRA 1Y0UA 1MZBA 2IPQX 5DUKA 4HDVA 2BBYA 3NRVA 3G7DA 3PNAA 4FAGA 3TO6A 1CF7B 5BOXA 1ZZ6A 4M73A 3J7AO 2M87A 2D1VA 2BNNA 2QQAA 4IPAA 1YO5C 1E17A 2D2WA 4Q47A 4HF1A 1I1SA 2ZKLA 2DLLA 2Z3YA 3JAMZ 2ESHA 3BOQA 2Y48A 2BNOA 4P9UA 3H7YA 4PGGA 3U11A 1KU7A 3KEQA 2W85A 4A6DA 4EJOA 2XLFA 3MYXA 4I01A 4YFKF 2Z9OA 3M70A 2STWA 1GXQA 2RVCA 2R7FA 2B0LA 2UY9A 4UBGA 3HSFA 2CFXA 2HOEA 4R52A 4YSFA 2ISZA 4A5NA 3QACA 1G3SA 3ST7A 3KZYA 3ECHA 4GYIA 3HYIA 1TQMA 1YLFA 2Y0MA 3ZQ7A 1XCBA 1MGTA 3ISPA 1STZA 2CW0F 3P9IA 3IDCB 1ZZ8A 1FOKA 5L3DA 4HBLA 3ROUA 3L9FA 3EO6A 4LMYA 4L18B 1IF1A 5HS8A 2JZYA 2AS5F 3TGNA 4PIZA 4YG2F 3K0LA 4MQVA 3QU6A 4Z2YA 4ESFA 2QDRA 3DPLC 1WSUA 1I27A 3BY6A 4ENMA 4PCQA 4IEVA 1OMIA 2NYXA 2IJLA 5FLXZ 3EYIA 1DGRA 4IESA 5EEGA 3WTSC 1OYYA 3GZ6A 2GH2A 1ZG1A 2P5KA 2ZNZA 4OMZA 2XKOA 4EM0B 1IUYA 2QJVA 3JAMK 3HRUA 2UZKA 4AIKA 2FOKA 3F6VA 4EJVA 1R7JA 2LNBA 1BI0A 2HYFA 2OA2A 1R00A 4XLNF 1W4MA 3SXYA 2HWVA 4EJTA 3DV8A 1ZZ9A 3CUOA 4XF3A 1CAWB 4BXUA 1GQHA 2Z2SB 1NZCA 5D4RA 1I5ZA 2DCTA 2HJIA 1XN7A 3FMRA 4F7ZA 3ZMUA 1YFXA 2ETHA 4G7ZF 4L9VA 4LK1F 2EA7A 3F22A 1PM7A 1IXCA 5LEJA 2E1NA 3RTRA 4EJUA 3HOSA 3DP7A 3VOEA 4BQAA 4QX5A 4KA4A 1FI2A 2O8QA 4LLNA 1O5UA 1XGMA 3CF6E 1TQPA 1ZVFA 2XLAA 2KIMA 5AIPA 3WTWC 4GULA 4QGNA 3IIAA 1QGPA 1B6AA 2PAKA 3P9KA 3V8LA 2PMHA 3NVCA 5E16A 5I8TA 4QM8A 1YLLA 5FDBA 3D5LA 1YYVA 4MTDA 3FJSA 4OIRF 2IA0A 3BPZA 4QM9A 2GWRA 2NAZA 1U8RA 4HQEA 2Q0OA 4M6XA 2JPCA 2KIFA 3R61A 3WTYC 3KP7A 1G4DA 2MD5A 2V1XA 1R23A 1Y9QA 4ZYEA 1X7NA 5BXXA 1B1BA 5HOOA 3BJAA 4NB5A 5DCMA 5JI6A 2A6EF 2FMLA 5KBFA 3C3VA 2DFIA 4XFBA 4GGGA 3H50A 4L9NA 4CO8A 5LRSA 4PJYA 1F4KA 5A2QZ 5KHJA 2KKOA 3GX4X 5T3NA 2XIGA 5L3FA 3MZYA 1FYMA 4HVRA 4QGLA 4B29A 1XB4A 4BNCA 2PHLA 4KDPA 4HA8A 4WCGA 2FF4A 1K78A 2VXZA 2K0GA 4EM2A 1D3YA 4I98B 1ZRFA 3ETQA 3ELNA 3GVAA 3S7EA 3FWEA 2VC0A 4KIFA 1ZARA 4N0BA 2Q4SA 3WW4A 4BIFA 2IXHA 3K69A 5FLJA 5FCCA 3QP6A 2PHDA 2PAEA 3Q9SA 1BBYA 4LA2A 4ONUA 2GAUA 3TKYA 1SEFA 2OZ6A 4EWDA 1O5LA 1XCVA 2ZFWA 4PIXA 1EY2A 3WGIA 2RKHA 2XUBA 3KCCA 2HQRA 2K86A 2P6TA 3S7IA 1ZHFA 4BAYA 4BHPA 3FXUA 4MNUA 4KNYA 5JR3A 1O3RA 2B8MA 4HX8A 1KQ0A 2M1BA 5KHIA 1JHFA 2HDCA 3KEOA 1RZ4A 3T1BA 1XD7A 1OD5A 3ES4A 4RB1A 1IZ1A 3R0AA 2CGPA 1ONVA 3DPTA 2A69F 4MEYF 4NHJA 2XAQA 1MJAA 1R58A 2E1CA 1EYBA 2ZMEB 2CAVA 5C8WA 2F5CA 5DUIA 2OYZA 3FHIB 3KGLA 4G7OF 3E6MA 4A2UA 4Y15A 4ENNA 1Z91A 3FM3A 1FY7A 4LK0F 2FQ3A 2H6CA 1E2XA 2BYVE 1FX7A 4TV7A 3BROA 5DDGA 3N4MA 4META 2KXLA 4UVAA 2PYTA 5I93A 2D5FA 3FHZA 3QP5A 2EJRA 3KSCA 4AQ6A 4AQ2A 5FPXA 1HQCA 1XMKA 3SZPA 2A07F 3WU0A 2PFBA 2YU3A 3J81K 3RKXA 1ZAOA 1HW5A 2HYGD 2F4PA 2QQ9A 1R5GA 2ZMEA 3NSTA 5FPZA 1YIOA 2PN6A 3DKWA 4HLXA 4P96A 2OU2A 3GXOA 4HDUA 3MZHA 2F5EA 2ETEA 4HZFA 5CYVA 4UXAA 3VODA 2P5LC 2MC3A 2W57A 4H0EA 3K1PA 1RUNA 3ZMSA 4IHSA 5D5UB 4LUKA 2JRTA 4KWJA 1SQ4A 1OR7A 4ZZLA 3H1MA 3Q5FA 3JSPA 1ZRDA 4CDGA 2GC0A 1Z9CA 1U2WA 5EFUA 3KE2A 4ESJA 3PQKA 3RJPA 3EHKA 4LB5A 4MZUA 4U88A 1CGPA 1PMIA 4P9GA 4CGZA 1KYZA 3U2RA 3R60A 4HLYA 2JSCA 1R5HA 3VFZA 3I59A 4MEXF 3J80Z 2GIVA 4J1XA 1TW2A 4AVAA 4A5MA 1QNTA 1HSTA 3H3UA 1QWRA 3WW2A 4D0PA 3SMHA 4L0YB 5DD8A 5DYMA 5I0SA 1Z6TA 1Q3EA 3TOBA 2O8XA 5HVQC 3IRQA 1J5YA 1C0WA 3L09A 5AVPA 4OFGA 4P9FA 3GF2A 1TBXA 4LG0B 4XBFA 1IAWA 3KZZA 2F2EA 3O14A 2ZO4A 1OFNA 4O3MA 4Q0QA 4A6EA 2QBYB 4HMZA 1PP7U 4EWEA 3S2WA 1J9IA 2QWWA 2O1QA 4KIGA 4RGXA 3QOPA 4DINB 5D5XB 2IXKA 1HKTA 1G6NA 4RB0A 5E8IA 1SAXA 3F21A 5HI0A 1FSHA 2L01A 1NE4A 3HUGA 1IXSB 3ERED 4MGRA 3FZVA 3RPQA 1ON2A 4IF4A 2XAHA 4OOIA 5ICFA 2XASA 1V4RA 3L7WA 3WGGA 4RS8A 5HLIA 3G73A 4ORFA 4M6YA 5D8KB 4X6RB 2E7XA 3KP3A 3R0JA 3F3XA 4UHTA 3E6DA 2GQQA 5CJ9A 4MH0E 2ZXJA 4IRGA 2VE8A 3M7GA 1RL3A 2GZWA 2DI3A 2V6CA 2XAGA 3WTUC 5LBQA 2DQLA 4JQFA 5FLHA 5LHGA 3L2HA 5BQTA 1UFMA 4K8FA 1T38A 4IEXA 4EMSA 4YFNF 1V70A 2Q1ZB 1X8MA 1YHFA 2C0ZA 1H9TA 4ZZDA 3WTVC 3O2PE 1KA8A 5JR7B 4S04A 1BOAA 2VC1A 3U9GA 4QWQA 4Q0PA 1H9GA 5E20A 2D45A 3LSTA 1FLIA 3KP4A 5HLHA 5D6FA 1ZG5A 3KETA 4AVPA 4N9IA 2A3SA 2E9QA 4EROA 4HLTA 1AOYA 1LRHA 3OCPA 4L9TA 5ILSA 4B09A 1EH7A 1T0FA 3ZPLA 1U6GA 4RAYA 3QAHA 3GLXA 1YQAA 2D93A 1S7OA 4KMFA 3HIFA 2EFNA 3IBMA 4GCVA 1JXSA 3LZZA 2FSWA 4HN0A 2VODA 1D8KA 1TLHB 4XF9A 3GW2A 3EBRA 4UXNA 1HBXG 5BY5A 1YFUA 1ZLJA 4AVBA 1S29A 2ELHA 4UUVA 1P4WA 1CAWA 3MWMA 2UWMA 1B9MA 4I0AA 4UV8A 3TDUC 5FD5A 1O57A 1QXRA 5FFZA 3D0JA 5BUVA 2I45A 2QM3A 2B9UA 3GYHX 4CYDA 2DQRA 4A0YA 2KRFA 2EFOA 2E7WA 3IDBB 3KP2A 3ABTA 1T39A 3N97A 2ZNYA 2Q8KA 3LAGA 5EEHA 4EM1A 2F5DA 3HHHA 3KFWX 3OGJA 5J48A 3DQVC 1FBSA 1EP0A 3CEWA 4Z07A 1LNWA 1MDMB 2X0LA 5D5WB 4LTAA 4IEUA 1R1VA 2OZJA 1U78A 2VOPA 1QZZA 3OTFA 1YS6A 2MH9A 3CTAA 2VONA 2XVCA 1SFNA 5L3CA 2ET7A 5JCTA 4KWLA 3GO5A 2Q30A 4R1HA 2CWEA 3LWFA 4E2QA 1MKMA 2XHKA 4LUMA 3ZN0A 4WF2A 3F8BA 3Q9VA 1VR3A 4DQ2A 3LWCA 3HT1A 2O03A 3JW4A 2VT3A 2IC1A 1BM9A 3NW4A 4NVPA 4KICA 3LQRA 1ZG3A 3VB2A 5D6EA 4UVBA 4M72A 2FBIA 2GC2A 1ZRRA 1SFEA 4RGRA 2HKOA 2NS0A 2D1HA 3HOTA 1CAVA 2HQNA 2MLGA 4ETSA 4Z82A 1S7AA 1B4AA 5H6RA 1W7PD 4MGZE 3ZN1A 2O61A 3NL1A 2FBHA 2Z99A 3M1EA 4LEJA 1IN4A 3TO9A 1LEBA 1S8NA 1U5TB 5FLIA 4I3PA 1FYLA 3V7CA 5IT9Z 3SCGA 3LQQA 4MX3A 4HVQA 3BB6A 1FP2A 4XFFA 3HTSB 4MV2A 3WTXC 4Q0UA 5D5VB 1ZREA 3E6BA 2FQPA 4KU8A 2UYBA 1RC6A 1OYIA 3H1YA 4HQMA 5FD6A 4RAZA 4RD7A 3WU1B 5LGTA 3ZMTA 3EQLF 3UKNA 3GBFA 4G6DA 3T8TA 5ICCA 3E5QA 5CVJA 3F23A 2QQBA 4IEOA 1WRJA 1GHCA 4I02A 4HYEA 4CXFA 2RDPA 1DZTA 3ZDSA 4JV4A 4G8XA 5JSOA 2DTRA 1Q1HA 5LGUA 3OOPA 2N7GA 4ZU4A 4MHGA 3IL2A 2GC3A 3GEZA 2DPDA 2CSOA 2EVXA 3HTUA 1BN5A 2QUFA 1K6OA 3ZMZA 3R6SA 5A2QK 2P7VB 3KLOA 2KJCA 2WTEA 4Q0VA 4KFCA 3EJKA 2EFPA 1O4TA 2A5YB 3K1NA 3PQJA 3GFLA 4XSXF 2R7DA 3CUQA 1YW9A 3W6KB 4IEYA 1YUDA 2IW5A 4ON0A 3IC7A 4HF2A 3M9AA 2UXXA 2GXBA 2DK8A 4UNOA 4XFHA 1K78B 2H09A 1O3TA 2OPKA 4AIHA 2ADUA 1KU3A 1DP7P 4XSZF 1D5VA 5F64A 3ACLA 2G7UA 1Z1DA 4J1WA 2OQGA 3BJ6A 1F9NA 3B02A 2RC4A 1LQ1A 1K79A 3DF8A 4OIOF 4E2GA 4LJZF 2TDXA 5ICGA 3I59B 2EK5A 2MA3A 1XE7A 1WLTA 3SXWA 1D8JA 2EV6A 2VE9A 3RKWA 1RNLA 2L54A 3F8MA 3ZMDA 3W6JB 2AXLA 3RI4A 3QRFF 4IRHA 1R1TA 3CJXA 3I53A 3CLPA 1TNTA 4L9JA 3H1WA 5K1YA 1CAXB 3V4GA 4ENKA 4WK8F 2Q0AA 4I2OA 4BYYA 1DUXC 2P4WA 4QLCU 3HRSA 1TW3A 3M8EA 1LDDA 2XAFA 3TQNA 1J3PA 2COMA 4KWKA 1ZYRF 2CV6A 4G7HF 3WODF 2ATFA 2MBFA 1V3FA 4EGZA 3CUQB 4P55A 5J6XA 3E5XA 2RGVA 1JGSA 1DPUA 1SFXA 3MAJA 3RYRA 2XROA 1Z6RA 3U1DA 3IKTA 1ZZCA 2WC2A 5F6FA 5E1ZB 3F72A 5DCFA 2PQ8A 1ZZBA 2RNJA 2CQKA 2HZTA 3H7JA 4Q29A 4I0BA 1W5TA 2FA5A 4KIBA 3RKYA 5I91A 5E1RA 2P8TA 1QXJA 2EB7A 3FXRA 1G3WA 3FMQA 3JTHA 5K5RA 1XGNA 1KU9A 4EV0A 3E5UA 2EWNA 2M30A 1H1MA 1WGPA 1UHMA 3LAJA 1FWZA 2M45A 3AAFA 4LLOA 1KU2A 3HT2A 2VECA 4O5VA 3ML6A 2IRFG 1O7LA 3I7DA 4LFUA 1ZLKA 5BPXA 2K4JA 3IKVA 2YPRA 2IA2A 3QPHA 3ZMVA 5L3EA 5LHIA 1A04A 3OF1A 3K9TA 4JTOA 3FM5A 4XFGA 2ZJ2A 3ABUA 2HTSA 2OA4A 1P4XA 3TO7A 3V7SA 4PGHA 1O3QA 2DU9A 3D0SA 2BGCA 1U5TA 2PEXA 2QVSB 1LDKB 3KGZA 4O9EA 1IW7F 1JE8A 1NHAA 4RB3C 1J7KA 2YSRA 1SMTA 5ERIA 1YW8A 1J1LA 1HKSA 2FEZA 2IP2A 3L00A 4LLGF 1YTYA 3GFIA 5L3BA 4IERA 5E17F 2FE3A 2MH2A 2OZUA 3EDPA 5KHHA 1L3LA 5J7MA 3K2ZA 2GU9A 2ACJA 3PLQA 4IETA 1LKNA 3WE3A 4R79A 1WQ2A 3I71A 1DPRA 3T8RA 4YARA 2VPVA 4XFAA 3TNQA 4XRFA 2OBPA 3U0ZA 5HLGA 2QYOA 1FXZA 1JHHA 4DNCA 4EJWA 1XDUA 5BMZA 3RYKA 4U0VA 2RN7A 5C6CA 3SQNA 3JSOA 3LOIA 4IEQA 1W7PB 1T98A 3SFZA 2K7LA 2HKXA 3I4PA 3HSRA 4IVNA 3VEPA 4M9ZA 5JSRA 4RGUA 3JZVA 4ZYGA 3FF5A 6PAXA 3L2CA 5E8GA 4BHBA 2LKPA 1QPMA 3SCHA 5D8LB 3K1MA 4OIPF 4NQWA 1X82A 2DO7A 4I7HA 4CICA 3GWZA 2V09A 5ICEA 4F8AA 4ZYHA 3WTZA 4CHUA 2B5HA 4A0XA 2EV0A 2P17A 5HS7A 2MLKA 3RZZA 2LSOA 2UXNA 4WVZA 2XKPA 5BPDA 4HOBA 4EQQA 4KN4X 1CX4A 3ELKA 1PP8F 3IHUA 4OINF 4CZZA 2IXCA 4N9HA 5D1IA 4XF1A 4G9YA 1HW1A 2LF7A 2QZ8A 2QBYA 4AIJA 4OMYA 3CJNA 5F1RA 5HS9A 3LFKA 3C3WA 1J75A 3LA2A 3V8JA 4LLLA 1XMAA 1P6RA 4WXCA 1IPKA 5CVIA 2V1DA 3ECOA 2BE5F 5E1XA 2W24A 2PG4A 1SD5A 4XEZA 3H8UA 1GXPA 1VJ2A 3EUHA 3COAC 2O0YA 2HTJA 2NRAC 2NNNA 2BNMA 4O6JA 1FP1D 1WI9A 3DN7A 2PAMA 3HSEA 1FC3A 3LA7A 1ZGJA 3F6OA 2ISYA 3ES1A 2DT5A 5K8SA 1BI2A 1IN6A 4MGIE 1J2XA 1Q5OA 4HN1A 4IEWA 1WKMA 3IWZA 2K27A 3H92A 5IT9K 3J80K 1HSJA 2CO5A 2IA1A 1I1GA 3PVBB 1Q43A 3KP5A 1EH6A 3RPUA 1O3SA 3REOA 2OQRA 3BCWA 4LULA 4P5OA 4U7DA 2BEOA 2O6GE 1MJ9A 2DAOA 4HAMA 3MQ0A 4KN7X 5HDKA 4YNIA 1EV7A 4KL1A 1J0RA 2GC1A 1EH8A 4K2EA 4IXAA 2PJPA 3TNPB 3V7RA 2GXGA 5FQ0A 1RTVA 2P5VA 1ULYA 3DFGA 2P6SA 2VBXA 2MPFA 4MQ9F 4L2NA 2EAAA 1ZX5A 1ZN2A 4HSLA 1YWKA 4PDKA 1USTA 2ZCWA 5TJJA 4MTEA 1IN7A 5JVTA 5CADA 1SFUA 4HX4A 3EYYA 2V1UA 1UW8A 1FZPB 1UB9A 2WFPA 4ASNA 4RGSA 2PTMA 1NE6A 3F8FA 1PUEE 1L0OC 4FX4A 1P2FA 1HW2A 2VBZA 1LDJA 1DZRA 2W25A 1Z7UA 4ZU5A 5I0RA 3IWFA 1X3UA 2WWYA 1DGWA 4KU7A 1U12A 2W84A 3CLOA 4B8XA 2K02A 1QQIA 1FYKA 2D40A 2IT0A 3UKTA 5AIQA 1IRFA 1FT9A 2VBWA 1UPIA 1U5TC 1W5SA 2UY8A 2QNKA 4JTNA 1VP6A 1X8EA 4ZU7A 5BV6A 4TLFA 3ZP5A 4RB2C 3KLNA 2IVMA 3GFMA 4E2SA 4EWAA 1IPJA 3C7JA 4XF0A 5FFXA 2GA1A 4FT8A 5ILVA 2ZKZA 3DL3A 4WZCA 2Y75A 1IRGA 3R4KA 5IT3A 3O3KA 2GA2A 4XFCA 1XE8A 2H6BA 5E18F 3U10A 5AONA 1I6XA 4X6QB 4UVCA 3NEUA 5I0TA 5EZWA 4O9GA 1R22A 4MUVA 1RI7A 1NXMA 4QXKA 1J3QA 1R1UA 4ESBA 2R3SA 5ED4A 3LAPA 1WWXA 1W7PA 4D7SA 2JT1A 1BC7C 2Q2EA 5JHUA 2CYYA 2X4HA 3QPTA 1ZZ7A 2XLGA 2H27A 3CDHA 2VOOA 3BPVA 4EVIA 2JTVA 1XRUA 4WXHA 2PLYA 3HQXA 4IEZA 1H1IA 3P9CA 3M3IA 4IHTA 1HXDA 5E1WA 1IN8A 2IXJA 3BZ6A 2QLZA 1YFWA 3MCZA 4L11A 2WV0A 3BU7A 4MGKE 1P92A 1WA4A 5KHGA 1OPCA 1ON1A 4Y17A 2PFWA 5FQ0B 1O7FA 2A68F 3I58A 4AVCA 4HV5A 4UBHA 5KK1A 1REPC 2FRHA 5CU1A 3FX3A 5JSPA 2HGCA 3NKTA 4L5IA 2DPUA 2DW4A 4R8HA 4AD9A 4WWCA 3F8NA 2Y0OA 1G3TA 1XGSA 3S0MA 5K5QA 2VN2A 4FAHA 3BP8A 1BC8C 3I54A 2HEOA 3T0YA 4JK1X 2L02A 2ESNA 5I8SA 4GYGA 1TQIA 2HFHA 4GXOA 4YRDA 1BJAA 1EPZA 2Z5UA 3H3ZA 4M9XA 3WW3A 3WTTC 2D5HA 3IRRA 5I0UA 2PMUA 1YFYA 5D4SA 5LRRA 4BH9A 5H6QA 1HKQA 1FSEA 2QCSB 5DD4A 2FMYA 4FHTA 2V79A 4IRIA 3RNSA 1ZGAA 5LGNA 1ZRCA 4HBNA 3CUQC 2KIUA 2PBIA 5J8FA 3KP6A 4LG0A 4BHCA 4XF4A 3GUDA 4LA3A 4UV9A 4KT5C 1LVAA 1ODDA 2PQQA 3I5UA 2EA4A 1J3RA 3BJOA 3SHFA 3GZ5A 2MNGA 3BALA 2VT2A 3EQEA 3GFJA 3KMHA 1MDMA 4HW0A 5KHKA 5FO5A 1CF7A 3MPBA 1B9NA 3MFKA 1UCXA 2OAZA 3CO6C 5FB2A 1FBUA 1FPQA 5BPIA 4WXDA 4Q4ZF 2MHFA 4ZH4F 1TQ5A 1T2KA 2NNYA 2A61A 3HRMA 2YX7A 1AWCA 2IXLA 1FBQA 4JBAA 1KQ8A 1F1ZA 3SZTA 3GYDA 1RIOH 1OYWA 5J8CA 3BWGA 4M74A 4XFIA 3WW1A 1USSA 3BPXA 1BI1A 1QBJA 5JFRA 4OU0A 3T5XA 4QGMA 2Z33A 5HDGA 3C18A 4LB6B 2G7HA 4ENJA 5ILUA 2DBBA 1YW7A 4XETA 5CLSA 1LJ9A 4KMUX 1CAUB 4PZJA 1P4AA 4L0ZB 3VHRA 1CAXA 2KJBA 2F5FA 3BDDA 2ET1A 4YIFA 3CO2A 2M8EA 2P7CB 3OD0A 4I09A 1T6SA 1R36A 2XAJA 1GQGA 2EFQA 1MJBA 2CG4A 2RQPA 2M5WA 3HHGA 1UIJA 3CL1A 2ZBKA 5CVUA 2VBYA 1KGSA 5BS6A 3MDPA 1OI6A 1IXRC 4JVAA 2XRNA 2J5OA 3ULQB 1GVJA 2A6HF 3I64A 3NJZA 4Q48A 3FXQA 4WBBA 5LEKA 1JUHA 2DK5A 1NYWA 2FBKA 3RYPA 5H20A 2XL7A 4EGYA 4L5JA 3O6BB 4KYWA 3B73A 4U0WA 4A12A 3EETA 4XLPF 3CO7C 5FLXK 1RUOA 5DCMB 1S3JA 4M71A 3I0TA 1LR5A 3FMSA 4HV6A 4IEPA 1FNNA 4WX9A 5LHHA 2IXIA 2HS5A 3NQOA 3MEXA 4PIYA 2J5PA 5KVRA 2H0VA 3FE5A 1YG2A 4HSJA 1LEAA 3FZ3A 4GO1A 1VTNC 1H0MA 2QVOA 4YIIA 1XSVA 3TDZC 2O3FA 4G6QA 1SD6A 2JPBA 5HDNA 1XGOA 3F8CA 3E6CC 4Q0SA 1B59A 3SHRA 1LB2A 5LLQA 3QU3A 2EA2A 4Y13A 3G3ZA 1IN5A 2QENA 4A0ZA 3RDIA 2FNPA 4LD5A 4MGYE 3P7NA 1QZYA 3J81Z 1J59A 5DV5A 3C1DA 4HX7A 3H9AA 1BIBA 3HRTA 2UYAA 1Y3TA 3JTGA 2STTA 3DXJF 1F5TA 5DEQA 3V8KA 1QO0D 1UCRA 2XGXA 2VQAA 2XV4S 4LGWA 5FGMA 1PDNC 4AWXB 4G94A 4OLLA 1Z05A 2HR3A 3LA3A 5TRDA 5CVVA 3M8FA 2K4BA 1YS7A 2PA7A 1KQ9A 1UHWA 1DDNA 1BI3A 3PFIA 1TNSA 3WE2A 2OD5A 2LF8A 1MD0A 1TTYA 1SD7A 4YFXF 2EV5A 1CAUA 2CAUA 2PI0A 3E97A 2YX4A 2G9WA 2XL9A 2EFWA 2Z69A 4H7LA 3SCFA 1XSDA 2L4MA 5JAXA 5J3UA 1J58A 2FXAA 5L3GA 2C6YA 1XDSA 4HVOA 4HF0A 1UIKA 1RGSA 5CVRA 4Q5SF 4QMAA 2L3DA 1CAVB 3UKVA 1ZH5A 3DEUA 1S6LA 2FNAA 1ZNPA 3WGHA 1YFHA 1G3YA 2V9VA 3TOAA 2K9ZA 4U0YA 4AXOA 4FX0A 4U7BA 3RIRA
chains in the Genus database with same CATH superfamily
4AYBA 2R93J 1UD1A 5CBLA 1SD4A 4E70A 2FDJA 1V6KA 3VBOB 1BIAA 2JA7J 4ZYDA 3I2FA 2Q2EB 1XSXA 1QY4A 1JZ4A 1L3JA 4D7TA 1U3EM 1UOJA 2BV6A 5DUKA 2L7KA 2VU9A 2CQQA 2OJED 4HDVA 3O1UA 2DCZA 3CESA 2BFUS 3I2KA 3AB0A 4MHRA 4E4DX 2MC4A 3PIGA 1RUI3 2XF5A 3J7ZI 1YO5C 3ACIA 5D8AB 1NY72 4HF1A 3JB4C 2ZX2A 5SV8A 2DLLA 4CUAA 2BV4A 1MNMC 3AYEA 4P9UA 2XVKA 1W8NA 3U11A 2ELKA 1FOD1 3OYGA 4A6DA 1LOCA 3MYXA 1JT6A 4I01A 2EILH 1WH5A 4RA2A 3AL6A 1OQ1A 4KGGA 4R52A 4CEYA 4YSFA 4E7SA 2ISZA 1G3SA 4OI1A 3DU5A 1E0EA 1LOAA 3ECHA 4GYIA 1MH4A 5DAXA 4WVMA 3LSGA 4RGGA 1GZ9A 3BPSA 3ZQ7A 1ZA7A 1OR7C 1K6YA 1IRXA 5BNGA 5F2SA 4M3GA 2R7UA 1STZA 4FOQA 2WS92 3IDCB 4HNUA 3L9FA 3EO6A 2XJSA 2JZYA 4YG2F 4KBZA 4MQVA 3GDBA 2R30A 3FXLA 3HM5A 5FY1A 2XJUA 1ST8A 2YC2A 2WT0A 4PCQA 1GNZA 4S2HA 1OMIA 2NYXA 2ZMKA 3WSOA 1H6YA 1D0GA 1YQ8A 3EYIA 3HN1A 4HETA 4QB6A 4BJ0A 2XVLA 1ZG1A 4UFKA 5D8AA 4C3HJ 2VCMA 3TB0A 1YI2I 1UY0A 1L7QA 4FSJA 3ASIA 1S2EA 2VUAA 4AGRA 2V72A 3PVNA 3Q8FA 5CEHA 3VUOA 3TL4X 2FOKA 2JG9C 3ETPA 3F6VA 4EJVA 2W82A 1E5HA 1SANA 2BZDA 3I2JA 4GIQA 2VGDA 4Y22A 4M3CB 1W4MA 1K4SA 3KT1A 1W03A 2HWVA 1V0AA 4NHXA 4OUMA 1R1A2 2W87A 2FDKA 2BGPA 1RKWA 3H9GA 3RZOJ 4O7XA 3WV6A 4QHZA 3SDBA 4BXUA 4IOAF 2NS7A 4LKSA 3ZFGB 1I5ZA 2A6XA 2HBUA 2LY9A 1XN7A 2BHZA 4DB5A 1MS5A 2YPDA 4G7ZF 4L9VA 2EA7A 2ES3A 1HJFA 1IXCA 2E1NA 1LPQA 2CWMA 4BQAA 3GZTB 3C7HA 3IKWA 4QX5A 3UGFA 3WNOA 2FDFA 3VD4A 3VD7A 2O8QA 5C4XJ 1E5IA 1LU2A 4C30A 4LLNA 2WT2A 2NOGA 4Q4W3 3BTCA 1APLC 1UN1A 4EN9B 2XLAA 3WTWC 4QGNA 4YVWB 4COVA 3JU9A 5E88A 1QGPA 2WZR2 4UAPA 1AJOA 1YYVA 2DVAA 1AYN3 1RHI3 1URXA 4OCTA 1W2UA 3BPZA 1N3QA 1U8RA 2Q0OA 4M6XA 3K70D 2DURA 1WCMJ 3KP7A 4XHBA 3IPVA 2RMU1 2CUFA 1HB3A 1SACA 3SEZA 2QZ3A 3FLTA 1DZQA 1R23A 1X7NA 5BXXA 3BYWA 4P14A 4X1EA 4GDFA 3JBG3 3THTA 2A6EF 2FMLA 1QDCA 5KBFA 2DFIA 5EYYA 1EUTA 3AFKA 1B8IA 1OLMA 2VPRA 2E6VA 3HOUJ 2WNUA 4Y20B 1Q8VA 4PDWB 1Y56A 4BMBA 1UNBA 1UWWA 4RFT0 5A7NA 3OSGA 4B29A 4BNCA 3U4SA 4HA8A 1K78A 1DU6A 2GBYA 3NV1A 2K0GA 4QWNA 3EXUA 3PJQA 2JG8C 4TWTA 1ZRFA 3ETQA 3ELNA 3S7EA 3BQYA 4ISRA 1RUI2 2VC0A 4N0BA 3HQUA 3WW4A 5F0CA 4UOJA 4HPKA 3P6BA 5FCCA 3RZMA 3Q9SA 3S8PA 1QQP3 1YIJI 3U21A 4UW3A 4UFLA 2YUEA 1WJ5A 2M4GA 2OZ6A 2Y9YA 2RR12 4BJ5C 4FQ4A 4EWDA 2ZFWA 5HLTA 4NHMA 4W6XA 1EY2A 5EYXA 3IH3A 2JE9A 4QKDA 4BQQA 1HCRA 3IPVB 4BQNA 2K86A 4KQ7A 1PO12 4FPJA 2P6TA 5A3LA 5FZAA 4AQTA 1XNAA 5JR3A 4L9BA 2XHNA 4DRRA 2M1BA 1NQJA 1X4PA 3ON7A 1A36A 1FOYA 4JHTA 1RZ4A 3T1BA 4R4XA 2E2HJ 1LODA 1OD5A 3T09A 3R0AA 2CGPA 2A75A 1C1FA 4MEYF 2JDZA 1MJAA 2E1CA 1VQOI 1EYBA 4PDWA 1A3KA 2ZMEB 2CAVA 3PTRB 2F5CA 5DUIA 1TME2 3FHIB 4A4AA 4UFJA 3WUCA 4Y15A 4S2DA 1F5JA 4ENNA 1LOBA 1AR93 2R5YB 3T2OA 3ZYGA 1E2XA 4TV7A 4MXVA 4F3JA 3N4MA 2PYTA 2BW3B 2BUKA 3QP5A 1IG0A 1WW7A 3KSCA 1BLZA 1CONA 1BK0A 1BYHA 2OF7A 2O5RA 5FKOA 2A07F 4A3JJ 4BEHA 3J81K 4XMAA 1ZAOA 3RKXA 5F5AA 1M06G 2A3XA 3R4SA 3VN4A 2G19A 3H3LA 3DKWA 4NC7A 1FIAA 1VE0A 3ECQA 5F6KA 4MIMA 2HYJA 3LMMA 2P5LC 1C8NA 5H9RA 2BVMA 2MC3A 5FZFA 3CMYA 3KT7A 3QYFA 1RUNA 4XM3A 4LUKA 4QT6A 1SQ4A 2JDUA 4ZZLA 3AG1H 3Q5FA 2ILMA 4FFGA 4A42A 1ZRDA 3PIOF 5LY2A 4N7IA 1SPPA 2DFEA 4MZUA 1CGPA 2OW4A 3OUJA 4P9GA 3R60A 4ZZ5A 2IZWA 1PM4A 1C8M3 3JQXA 1OH3A 2WNVC 2CUJA 3OYIA 5CISA 3ATGA 3DYOA 4Y5TA 3ERMA 3H3UA 1Y9MA 3D4KA 3BG3A 4D0PA 3SMHA 3KV5A 3TEDA 1AL23 5DYMA 1PVC3 5FPAA 4R4ZA 4Q4X1 4BACA 1C0WA 5AVPA 3ZR6A 3GF2A 2VNRA 4LG0B 3ZXKA 4YW1A 3O14A 2ZO4A 1XYPA 3W20A 1OFNA 1JOJA 3FXOA 3S2WA 4PF5A 3VBFA 2HOTA 1IS3A 5LFAA 4XZPA 2O1QA 4KIGA 4LG3A 2L7ZA 1P9QC 2PLV3 3S2DJ 5FKMA 5E8IA 2IVJA 5HI0A 3KHCA 1SVMA 3ZXGA 5FR3A 2OS2A 2XAHA 4OOIA 5L36A 1LULA 3WF0A 1N47A 5FZMA 2WAQA 3PTYA 4ORFA 4M6YA 2XJVA 4LIUA 2HZDA 3FXJA 1GT0C 3MGUA 3EMRA 1DYKA 3R0JA 4UHTA 2VZQA 3E6DA 2M0MA 4P9IA 5DMYA 3DPRC 2DI3A 1CWPA 5IVFA 3M3QA 2XAGA 4RN5A 2VJJA 1SLBA 1R1A3 1IGNA 2OV7A 1RHI2 4YFNF 3WNXA 1S0BA 3OPWA 2HQAA 3LSDA 2C0ZA 2IEKA 5BNNB 4RM2A 3ZQFA 1KA8A 3WP4A 5JR7B 3K46A 1LTEA 4Q4Y3 4S04A 3HNBM 3JB8A 1BOAA 4QWQA 4Q0PA 3VSLA 2GSYA 3ZQQA 3LSTA 2M7AA 3BR0A 3KP4A 5D6FA 2A3WA 1FYUA 3FFZA 4N9IA 2A3SA 3DTEA 3WDXA 4YGEA 1I3HA 2BDRA 5ISLA 4B44A 1EH7A 3POWA 1SFYA 1X50A 4RAYA 5KR7A 3QAHA 2WZR1 3D5RC 3PFYA 2O14A 4UUSA 1K83J 1YQAA 5FYVA 4KMFA 2YV8A 5GLZA 2EFNA 2H1KA 1ULPA 2AEYA 3HN3A 3ME2A 1OCZH 5GP9A 5K7ZA 2G1MA 3AC0A 4XF9A 2WQZC 3EBRA 4UXNA 4M4PA 3WDYA 1YFUA 1BW5A 1S29A 3D8CA 3PURA 4PCRA 4D9JA 2UWMA 1B9MA 1CJDA 2QBXA 4I0AA 2Y38A 3TDUC 5IK4A 1O57A 1QXRA 5FFZA 5BUVA 1HF0A 1OQYA 1VQNI 3NWKA 2WT1A 1W1WE 4CYDA 3IUOA 5DAQA 1YITI 2LC2A 2EFOA 4FTHA 5A7SA 1T39A 3ZDVA 2PMZA 2Q8KA 3LAGA 3CKHA 1U9NA 4HNTA 5FXVA 5LBFA 1DBNA 3CD6I 5A32A 1EP0A 4B4QA 1W6OA 4AU7A 2Q5TA 4IEUA 1R1VA 2AEZA 2A7AA 1W04A 3WF4A 1QZZA 4LE3A 1V5FA 2W7NA 3CTAA 4AC0A 1MVEA 1SFNA 2BY1A 2I8DA 1WCSA 3PVOA 2ET7A 3I3QA 1P8JA 5JCTA 5JZGA 3MI8A 1W8ZA 4J00A 3W3CA 2CWEA 2JVGA 3LD8A 2X05A 2H0BA 1RR7A 1AKHA 3N9MA 3F8BA 3Q9VA 1QQP1 4XLHA 1N3PA 4XQWA 3U14A 2O03A 4XHXA 5JHFA 2IC1A 2ZGLA 1BM9A 1FX5A 4KICA 1ZG3A 1O4ZA 2L7MP 3SKJE 3AP6A 2EQRA 2FHRA 5DABA 4UVBA 2B7YA 2GC2A 1ZRRA 2HKOA 1RVF2 2NS0A 1I39A 4BDZA 3BG5A 4HRIA 1CAVA 3UT0A 2MLGA 2PX9A 1UYPA 1S7AA 1B4AA 4HXCA 3CQOA 4WM8C 2O61A 4KISA 4NIGA 1JJ8C 4OI2A 5CFCC 4LEJA 1LEBA 4HSTA 2D6KA 1SC7A 1XG1A 2V4AA 1FYLA 2A1XA 3OGVA 1RXGA 2P6CA 3BR2A 4BS9A 3UYJA 4HVQA 5L7OC 3BB6A 1ETOA 2ZXQA 3SJMA 4MV2A 3ZFGC 5D5VB 2BBVA 4KU8A 4RBOA 3SC7X 1RC6A 4AVTA 3DF0A 4RD7A 4YRVA 3RVHA 1F35A 3VBOC 4AI8A 1NCQA 5C44J 3MKZA 2ZKNA 3IH2A 5ICCA 4XJWA 2XPJA 2EH3A 4I02A 4BCUA 1QIQA 1UKRA 5C3SA 1NKGA 1UZ0A 1Q1HA 5LGUA 2TCTA 4A3DJ 4ZHNA 4MO3M 2B46X 5HXMA 4MHGA 5A7QA 3M4OJ 3IL2A 2G9ZA 1BN5A 2XQXA 4DBQA 3GALA 1RUF3 1VQ8I 2P7VB 2WTEA 1C1LA 4Q0VA 2EFPA 4NIHA 4XSXF 1GYKA 5DG2A 5L7OA 1YUDA 3T0AA 4CP2A 5FZLA 3SH4A 3AP7A 2VQLA 2DK8A 4UNOA 2BWCA 2DYCA 2H09A 4BKXA 3WR0A 2E63A 1REEA 2HWB1 2R062 1TVGA 1VB4A 4L0PA 4AHWA 1GOGA 5FY8A 1YJ9I 2E2IJ 4GH4A 4YVSA 3BJ6A 1UKGA 3VHPA 5IK8A 1NA1B 2VZ1A 5EDNA 2WBKA 4URAA 2YU1A 5BYNA 4Q4Y1 2WSUA 1FV3A 3ILRA 5BNQA 3BG6A 2O8KA 2EK5A 1XE7A 2ZB9A 1TNRA 5LASA 2QSHX 4I30A 4M3FA 1OC1A 3F8MA 1NG6A 3FHQA 5F2WA 2VQUA 5H9QA 4IRHA 3HNMA 3W58A 3CJXA 1GVDA 1ZKGA 3BZKA 4FE7A 5JR2A 1MMSA 1XNDA 1Y7BA 5E3LA 1R083 4TXWA 3KZIC 4WK8F 2X6XA 2WQ8A 2P4WA 4Q4W2 1WW6A 3HRSA 3M8EA 4DRVA 2XH6A 4KWKA 5HNFA 4XABA 5FROA 2DWRA 3MN2A 1ZYRF 1JUIA 2CV6A 2ATFA 3NMBA 1CQ9A 4YIRX 5J6XA 2DA6A 5J4VA 4XIDA 2A6WA 3OPZA 1W6QA 1BW6A 3RYRA 2JG9B 3IAM2 4NRMA 2JB4A 3IKTA 5L9RA 5F6FA 5E1ZB 4LO8A 4NHKA 1K45A 5FKKA 1QGLA 4KIBA 2YPJA 4GWJA 4ZZ8A 5G04L 1QXJA 1TNFA 2EB7A 3QLQA 3FXRA 2X9DA 1DQ6A 3JTHA 2LTPA 3HG9A 2RS53 2HVRA 4C2UA 4W6YA 2WUHA 3C2HA 3LAJA 2YG0A 1FWZA 1GR3A 3AAFA 1Z7S3 1KU2A 2Y0SA 4QPIB 2VECA 2J1RA 3PHMA 4DUVA 4XTMA 2BFUL 2K4JA 1W0UA 2ZMLA 1A04A 1FAYA 3ZN5A 2Y64A 3WDVA 1IQDC 3V7SA 1HC8A 4PGHA 3A0NA 2DU9A 4N90A 1EKEA 3NWTA 1LDKB 1JE8A 1YO8A 4RB3C 5ERIA 2Q8OA 2G9FA 2FEZA 2RHPA 4M3CF 3GFIA 5L3BA 1R1A1 4IERA 5KHHA 1L3LA 3T2QA 4H3WA 5KXBA 1TME3 4YFWA 4IETA 3AJYA 3SITA 1VQPI 4CU6A 1DPRA 2YY1A 2ENRA 4AEMA 5HLGA 2QYOA 2W1SA 1LOGA 1ENQA 2X8KA 1ERDA 3RYKA 4U0VA 5C6CA 3JSOA 3LOIA 1QJY3 5J37A 3MIFA 4DOZA 3NJVA 2WB1A 3V0AB 2KM2A 1X19A 1UU6A 3LDKA 2HKXA 1ZRIA 4Q4W1 3J9SA 3HSRA 2DT6A 2RS11 1BMV2 1GWLA 4CU7A 4RGUA 3WT3A 4QPOA 6PAXA 3L2CA 4CCEA 4BHBA 2LKPA 5EYRA 4OIPF 5G05L 4RHV2 2JRMA 4W50A 4F8AA 2XJQA 4W4ZA 4MLOA 4ZYHA 4C2TA 3WTZA 4CCJA 5CG9A 4U2AA 2P17A 2MLKA 3RZZA 2LSOA 1DFQA 1W8FA 2D3PA 2HWC1 3TEXA 5BPDA 4Y20A 2DDUA 4KN4X 1IHMA 3UJOA 3H8RA 3IHUA 4IV3C 1R4NB 4OINF 4Y22B 5FWEA 4CZZA 3OYJA 5BNOA 1J83A 4XF1A 2JDNA 4RMNA 1HW1A 4OAZA 1NLQA 2QBYA 1G9BA 3CJNA 2C6SA 5HS9A 1UOGA 1HV1A 1LJ7A 4AGGA 3C3WA 3V8JA 1MNDA 4GB32 5CVIA 1AKHB 2V1DA 4ZDPA 5FYUA 5FREA 1F2NA 4ZC3A 1BR1A 4XEZA 3BIWE 1UY2A 2O0YA 2XB5A 3NQHA 1WI9A 5GLUA 4AVZA 3HSEA 3BTLA 3ES1A 4PFOA 1J2XA 4L92A 4Y4YA 1X58A 1PMJX 2K27A 3H92A 5IT9K 3J80K 2CO5A 2DMNA 1I1GA 3PVBB 1Q43A 1PMHX 4I0WB 4QHBA 1ENSA 3RPUA 1JYVA 4QXBA 4LXLA 4XBNA 2V5DA 2OQRA 1PIV2 4GJZA 4CDQA 2BEOA 4QHOA 4HAMA 1RB8G 2BXYA 3AFGA 1ZBA3 4J25A 3M07A 3LOBA 2DA7A 5HDKA 4YNIA 3CDIA 4A3CJ 3N9OA 1SBFA 5GM0A 3BCAA 3P1IA 4K2EA 1N25A 1WUVA 4CUGA 3V7RA 2GXGA 5A3TA 3VBSA 5FMDA 3DFGA 2ZGOA 4L2NA 2DVDA 2EAAA 3OD4A 4PDKA 4CVUA 2XPUA 3CJIC 4A7YA 4QX7A 2V1UA 1FZPB 4BXFA 1Q8PA 3BIEA 2PTMA 1HRV3 4NQWB 2W25A 3DEWA 4K1ZA 4QX3A 2X1DA 4Y1YA 2XJTA 2Z5WA 4RA0A 1G9FA 1TWHJ 1HLCA 5GPCA 3A1YA 5FZDA 2W84A 2K02A 2YS9A 4ZKTB 2IT0A 3PVEA 1LFUP 1IRFA 5EG0B 3VZJA 1FT9A 4AZZA 1OOPA 4RM3A 4JTNA 1X8EA 4XRMA 1QH7A 4ZU7A 3ZSJA 4TLFA 2IVMA 5C3OA 3GFMA 1RUD3 2EINH 4K6BA 3T1LA 2H8WA 4YZ4A 4LO7A 1YJWI 1BEV3 1PZ9A 3C2UA 1YC61 2WZPP 2GA1A 2D6NA 3WG3A 1XTAA 2JWPA 2ZKZA 1W6PB 1TZLA 2YU9J 1XE8A 5FKBA 2H6BA 1PO21 3S1NJ 4BDVB 1AR63 1QKQA 2P3KA 2E1OA 4P9XA 3WHTA 3N9LA 3NEUA 2VBPA 4XLEA 5FZHA 5EZWA 3S5AA 1Q1VA 2XAUA 1ND3A 3W6VA 3KCXA 3NV3A 3SH3A 2P2KA 1WWXA 4R9CA 5ERLA 3KVAA 2X4HA 3QPTA 5J40A 5TGTA 2BVLA 5LA1A 1HJGA 1TC3C 5EGOB 3FL7A 1H1IA 3P9CA 9ANTA 2GNBA 1HXDA 1P7IA 3CDLA 3M7AA 4INDA 1CIWA 2IXJA 1FMVA 2EPFA 3KT4A 5CNAA 3ZYBA 3U1KA 1VAVA 5LK7B 1GV2A 4AI9A 1C28A 4JX6A 1ZK8A 3EPZA 5A1FA 1T95A 1YHQI 3HC7A 1BA5A 2IUWA 4AVCA 1A31A 2FCTA 2NVQJ 1JYNA 5KK1A 4PJLA 2G4IA 2VXDA 2JDKA 2FRHA 1Y43B 3CP8A 1N78A 1N75A 2Y6JA 4NUBA 5FZIA 1H4HA 1F15A 1YJKA 3GTJJ 3K75B 1XGSA 4PI0A 3QPSA 2VN2A 4PLOA 1WCKA 3BP8A 2OUHA 4Q1RA 1BR4A 4AL9A 1EV11 2NVXJ 2DMQA 1JOPA 2HEOA 1QU3A 1B8IB 3T0BA 3M2MA 1HX6A 4JK1X 2DU1A 2A5ZA 3NARA 2YB7A 3ZOIA 2ESNA 4LO5B 2OXBA 1EPZA 3H3ZA 3WW3A 1WJCA 1QJY2 3WTTC 4JGZC 2D5HA 3IRRA 1SCRA 2JWTA 1U5ZA 2PMUA 3ACFA 5LD2C 2SLIA 1WMEA 4JGYA 4BH9A 3LIHA 1XE0A 3CLQA 1GBGA 3VKFC 2FMYA 1P7JA 2RDSA 2ZZJA 2WYSA 3DWLE 3D6EA 2FDGA 2CV1A 3KP6A 2HPIA 4BHCA 4Q2FA 3GUDA 4KT5C 1JBCA 3RI9A 3I5UA 4LBMA 3GZ5A 2MNGA 1PGW1 1MDMA 1ZQ3P 3KB5A 1G8WA 5FO5A 4B4PA 4FASD 1AJKA 2XF6A 1IRZA 5FB2A 5F5IA 4NDLA 1TQ5A 1IKQA 4QXCA 1UMIA 2NNYA 1BJZA 2A61A 2V9PA 2WLPA 4AYUA 1AWCA 2MEV1 2R5ZA 4X8PA 4RGAA 4JBAA 4CYCA 2E19A 1F1ZA 1O59A 1FIPA 3H0DA 3BWGA 5B4NA 4N43C 1GOFA 4J6GA 1V5EA 1ETYA 2CGOA 2R6QA 5JFRA 3HBZA 1G9CA 4YZ1A 5DUWA 4G6TB 1HN1A 4LB6B 2G7HA 4NE9A 3IB3A 3BGAA 5ILUA 2DBBA 3MW4A 1YW7A 2K9LA 2JA2A 1QJX2 1LJ9A 1SLCA 1FOD2 2KJBA 4GH4B 4YVSB 2M8EA 2XXZA 5F7UA 2EFQA 3VDXA 2CG4A 2ZHKA 4FOWA 2M5WA 4HG6B 1UIJA 4D7NA 3K2OA 3ABMH 3SH5A 2WIIB 2XB0X 1OI6A 4OHVA 4HNVA 1YQCA 3NJZA 3K2AA 4BM8A 4Q48A 4FI9A 2PHWA 4A3MJ 1JUHA 2DK5A 1MPXA 2FBKA 3ZXLA 5H20A 2FZ2A 2DOEA 5DDJ2 2D44A 2XR4A 3WG1A 2R7WA 3DECA 2LALA 4D0QA 3EETA 5FLXK 3ONQA 5C8CC 1R092 2JB8A 4CDWC 2JX9A 4J19A 2Y6FA 3N05A 3FMSA 3AP9A 4HV6A 3WOGA 5FMOS 1STMA 5C9AC 1R091 4Y4RA 1AR81 2HS5A 1U0JA 4DFSA 2J5PA 3FE5A 5CFDB 2JSPA 1RUJ3 2P1BA 3PDQA 4JOMA 2VZPA 3CCUI 4PJJA 5EF6A 1G9DA 3ZN4A 2QVOA 2F4IA 4YIIA 4Q4V1 4K21A 4KG8A 2ZHNA 1C8M1 1XMXA 1WFXA 1UMQA 1XGOA 3A23A 4NIIA 3F8CA 4P9LA 3D5SC 2LP0A 2DCYA 4Q0SA 4WVVA 4LO4B 2P37A 3RDIA 2RR13 3VBSB 4NPLA 4DXTA 5FZ3A 3M3YJ 4DPNA 3P7NA 3WQ0A 1JXNA 1OPMA 4IL7A 3H9AA 4CDUB 2DDBA 1BIBA 2UYAA 4OVEA 4NRPA 1JZ5A 3DXJF 2O9LA 3V8KA 3OYEA 2P3JA 2XV4S 1BJQA 5FGMA 2DT7B 1PDNC 2Y26A 3UESA 4AWXB 1HB4A 2WR9A 2B39A 2Z42A 2GNTA 4IE7A 4N53B 3RPUD 1BI3A 1TNSA 4DYCA 3OGSA 2LF8A 1LHWA 1MD0A 1S0DA 1SHWB 2CAUA 2PI0A 3HPNA 1POV0 4YVWA 2XL9A 2G0EA 1WJEA 1FNYA 5FZ9A 2K9SA 4M3DA 2VUMJ 5L3GA 4IE6A 4W65A 1APNA 5D2AA 4FPEA 3AKSA 2E32A 3VGIA 3DEUA 3CC4I 3OYCA 2C5DA 2M3AA 3TRSB 2FNAA 2WYFA 1GICA 1G3YA 1R6RA 1NG0A 2L9VA 2V9VA 4IDZA 3HEFA 5M0TA 4U0YA 4U7BA 2LLKA 4KITB 3WZ1A 4QX0A 1BVVA 3THDA 4FBFA 3ITQA 2Y2ZA 3QOEA 4YYOA 3LEMA 3WG9A 1DU0A 4S05A 2XUMA 2L4AA 3CJIA 5C9AB 4S2GA 2XWBB 2DXIA 3CCVI 2GXAA 4OI0A 2VMFA 1OCOH 1K7AA 3HOZJ 5K5OA 4I6ZA 1FMD1 5C4WA 4I76A 5I8YA 1KYWA 2LDUA 2VZSA 3NRUA 4QXHA 5A80A 5J1XA 1KQRA 1JUSA 2OTJI 1F8VA 4E7IA 1CF7B 5BOXA 3X2QH 3LSRA 4M73A 3J7AO 2M87A 4F92B 2QA4I 1E5RA 1ENRA 3WINE 2VMIA 4V1PA 3ZR8X 2KR2A 1VBB1 2OC6A 3T1MA 3BOQA 3B00A 3M4FA 2Y48A 2BNOA 3L2YA 4XJZA 3ZFFB 2WO2A 2W85A 4CTEA 1IO2A 1NA1C 4EJOA 5T5LA 2STWA 2W47A 1FATA 1NTCA 2RVCA 3HSFA 2CFXA 2WO3A 2HOEA 1H2MA 4RHV3 5AC91 2WWUA 5IWFA 3AKRA 1A8MA 2LBFA 5LW9A 4B3NA 2CY6A 3MIGA 3PUAA 2GNDA 2Y0MA 2F48A 2OPWA 1XCBA 5EEAA 4Y24A 4L97A 1MGTA 2KPMA 3ZCOA 1HB1A 5FZOB 3P9IA 1VI0A 4HBLA 3OYAA 2V4JC 4LMYA 3OSDA 3H8XA 2AS5F 3TGNA 2RS31 3AMMA 4EQVA 2ZXIA 4Z2YA 4ESFA 2QDRA 5CFDC 3ZFFA 1QU0A 2I07B 3H42B 4LPLA 3OY8B 2DA2A 3KCYA 3RSNA 4LBQD 1T33A 2BY0A 4IESA 5EEGA 1OYYA 2GH2A 4XUTA 2W94A 1U8BA 1IUYA 2QJVA 5FPLA 4DY5A 3JAMK 2R0FA 3HRUA 4K40A 4AIKA 1YJNI 4OHXA 4YWAA 5IAVA 2LNBA 2EF6A 4Q8KA 5A1LA 1BI0A 4L8QA 2HYFA 3VBOA 3MPPG 1Z67A 1Z78A 4Y7NJ 2ZEYA 3T3YA 3H9JA 2HXOA 4BU2A 3SXYA 5KAFC 1F9KA 2W1UA 2RS52 4PK4A 2QKLB 3D3AA 2YFUA 2D6MA 4N53A 4XF3A 3J8F3 2IS4A 2QQIA 3A2KA 3OS2A 4NMIA 4BQ3A 1QJZA 2W1OA 3VSKA 1CAWB 1IG3A 1NX9A 1LHUA 4KT6A 1GQHA 2Z2SB 4BZ4A 2XBO2 1TE1B 3K3OA 2F4LA 3ZMUA 3CC2I 4YW6A 4LK1F 5F37A 1T0FC 3N7KA 4IV3A 3MHZA 1I50J 3F22A 4COYA 3VZKA 5LEJA 4AIDA 2V9KA 3HOSA 1YRZA 3VOEA 1F36A 1RJ8A 3S3NA 4XAAA 4HKWA 4ES9A 2XWJB 2CDOA 4YG3A 1BEV1 2ZMEC 4LOSA 4D7YA 1TQPA 4P5YA 4CDXA 3DCQA 4YW4A 2PAKA 2R32A 4PF1A 5KC6A 1G59A 5E16A 1YLLA 2LROA 3D5LA 3BT9A 2IA0A 2WABA 1F43A 5FRMA 2YGMA 2GWRA 3OYBA 2YROA 3WTYC 4M0NA 4DOUA 1UG2A 1R093 1G4DA 2WNVB 2MD5A 3OIPA 4II2A 3FUOA 2C9AA 2BQPA 1Y9QA 5F0HA 4QQLA 4RL7A 4C91A 2DTWA 1MS3A 2FDIA 3WG2A 5CFDA 1HQLA 1UG0A 4NB5A 5JI6A 2KLOA 4GWMA 3BOWA 2KDZA 2VM9A 4L9NA 4CO8A 1QH6A 1X9TA 4JRAA 2EZHA 5CKNA 4PJYA 1FNZA 1F4KA 4LBKA 1Z77A 5KHJA 2KKOA 2JK3A 3GX4X 4XURA 1Y39A 2CQ7A 4CXYA 4HVRA 4BQ4A 4QGLA 4HEA2 3DU6A 2HNHA 4WCGA 1HB2A 5DUUA 4A3GJ 3H36A 2VXZA 1GZWB 5A6XA 1R5ID 4LE4A 4EM2A 1D3YA 3A01A 1BK1A 2FBEA 5CAZA 3GVAA 3FWEA 5K0UA 2Q4SA 5EGOA 4BIFA 2JD9A 2LW8A 1QNYA 4ZDLA 2ICWG 2UU8A 4E7LA 3ZSMA 2JMWA 2PHDA 3ACHA 3J7AY 1GWKA 4LA2A 5FP3A 4LQRA 2GAUA 4LKEA 4BISA 1SEFA 2RS12 2V4VA 4KMQA 1OOPC 2Z1DA 1IKPA 2HOSA 1O5LA 2P4EA 5JMOA 4LIVA 4PIXA 4IQJA 4Y5Z0 1OCCH 1EAH2 4C8DA 5SV5A 3QQAA 1PX3A 2PMWB 2R7SA 2XMLA 2Y30A 4OWRB 4BHPA 3CCJI 3WP6A 4BIOA 1O3RA 3HOWJ 3GBGA 3VBUB 2ZACA 5FZ7A 3L2VA 4B4CA 3ES4A 1PIV3 2XPWA 4RB1A 2R7RA 1IZ1A 2QQUA 4YLZA 2LMDA 2HVQA 1SCSA 2CH0A 4CP1A 4O61A 2OYZA 2A6VA 1Y8QB 4IV1A 3LSKA 1FTTA 1R4MB 2DUQA 1Z91A 3K6GA 4LK0F 2FQ3A 4META 2KXLA 2I5UA 4UVAA 5I93A 1FPN2 4CYCB 4SLIA 2EJRA 4H7MA 1NQDA 4AQ6A 1CZVA 2XC7A 2RDNA 3ZXJA 2GDFA 2YU3A 4KNCA 1POQA 4NROA 2XGDA 2ZMEA 3NSTA 2PN6A 4UF0A 1VBE3 2D6PA 4W1UA 2JIJA 4HDUA 1W90A 3WY6A 2X1EA 3BR3A 4HZFA 4UXAA 3BTJA 2GP5A 4BJTA 1JODA 2ZA9A 1XQNA 1DLCA 4AF9A 2P6HA 3DEEA 2GALA 1K5MA 4H0EA 1VMJA 3ZMSA 5D5UB 4KWJA 5GZGA 2ME6A 2ZX3A 2VCAA 4UW6A 4AAXA 3JSPA 2XDVA 4CDGA 3KE2A 1WBLA 4LO6B 3ASOH 1PGW2 5DUVA 1Y6IA 1MSFC 4U88A 2EIJH 2R0QC 3AKPA 3U2RA 3APBA 3HBLA 2AH2A 1GNYA 4HLYA 4KH9A 2VMGA 1R5HA 3W9AA 3H5NA 3VFZA 4KG0A 3J80Z 3BTYA 3ZSKA 2GIVA 4AVAA 4XJ8A 4J01A 3GLLA 1EA3A 4A6SA 4EN7B 1LKXA 4CU8A 4E8CA 2VTXA 4L0YB 5DD8A 5IP6A 2B4KA 1RUG1 5F5CA 1Z6TA 1IS5A 1Q3EA 3TOBA 3IRQA 4FFIA 2Y0SN 4D5CA 1RUF2 3L09A 4OFGA 4ZY9A 3PMSA 4XUPA 1LEMA 4MGTA 3IP4B 1HDKA 2F2EA 3AXEA 4FQZA 2QBYB 1V5GA 1EV13 4EWEA 1J9IA 3MUZ1 1Z7LA 4DINB 3NAPC 4CEWC 1G6NA 3CZUA 2VOKA 5CQGA 5FZ1A 1FSHA 2SBAA 1B72A 4ZONA 4MGRA 3HD8B 3RPQA 1ON2A 2K40A 4LLFA 1T08B 4FPGA 3RZKA 4XOPA 3B01A 4YG0A 1KZHA 1N1SA 1W06A 3KP3A 1JI6A 4CUBA 3OBZA 1AYM3 3CF2A 3ZR5A 2HWD2 2AHQA 2GQQA 4IRGA 3UR3C 1RL3A 3I49A 3I2GA 1OA3A 2WV1A 1MS0A 4QQPA 1N1TA 1VBC1 1UFMA 3AKZA 4EN8B 4AM3A 4IEXA 4EMSA 1V70A 2VCBA 1X8MA 3AMHA 4ZZDA 5JDBA 1VBB3 2RS32 3CCMI 3ABLH 3PMEA 4JDMA 2K9MA 4BE2A 2VC1A 3U9GA 1A6IA 3FIWA 1H9GA 3AL0C 3LFUA 5GZCA 2YU2A 4EN6B 1Z3XA 3DGTA 4IGOA 1XX5A 2E9QA 4HLTA 1AOYA 3O1PA 3KVBA 2W4SA 3OCPA 1VBA3 1VMFA 1WD4A 3OL4A 4AAPA 1D1BA 2HXIA 2XRLA 2RS13 3ZPLA 4LBQA 3GLXA 2D93A 3VD5A 2VQTA 4K7JA 1JKOC 3HIFA 3O1TA 2HWD1 2ORZA 3ILNA 5FOJB 4GCVA 1JXSA 3TN93 3LZZA 4MYEA 4HN0A 4WZFA 2ZGMA 2VODA 4GMP0 4XRSG 4XN3A 1TLHB 1GKBA 1A8DA 2XOMA 1AYM1 1PNGA 3I3EA 3G6JB 5BY5A 4AVBA 1YEWA 5FKNA 1QJEA 1OLQA 2NMNA 4AEKA 4EYUA 1P4WA 2HWE2 3D1NI 1W9SA 2WQ4A 1HXS3 4FPLA 4QU1A 3ZFGA 2QGUA 1PIV1 5LWBA 5FZ8A 4DZGA 3ZSEA 3X29B 2VULA 3WQ1A 1W0OA 1W3VA 2DQRA 3ZFEA 4BQYA 1U0AA 4HK8A 3IDBB 3SZGA 4COUA 3KP2A 3N97A 3HHHA 3KFWX 3OGJA 3DQVC 4Z07A 1MDMB 2X0LA 5DG1A 4LTAA 4BXSV 4IQ4A 2OZJA 5FWJA 1YE9A 5CZKA 1U78A 4K20A 3P3NA 1PO22 1YS6A 1E3HA 1FOD3 1MW7A 3A4CA 2E7AA 1V6LA 4YVWC 4D1QA 1IV6A 4QIWN 1F4HA 2B42B 5H9PA 2C4XA 3HOXJ 1NH3A 3AVRA 5T50A 4E2QA 1MKMA 2XHKA 3OIQA 3ZN0A 1WW4A 4WF2A 2AC1A 5IVYA 1AX0A 3LWCA 1AX1A 3HT1A 2FCUA 2LRDA 2HVSA 2L9LA 4B7EA 2CNAA 1PVC1 3LQRA 5FZ6A 2X09A 1FEXA 2COBA 5FYHA 3VV1A 4FXKB 3HOYJ 4CCCA 4JCKA 1PVC2 5DZFA 2D1HA 3GZNB 3HOTA 1R9TJ 2X29A 2HQNA 4Z82A 1B35B 1HOMA 5H6RA 4FCAA 4MGZE 1QHHD 3SNMA 1V9U1 2WNUB 2G9GA 1VBC2 1AXYA 1WW5A 2YDEA 2W1WA 5IOZA 1RHI1 4Q4V3 3V7CA 5A3WA 3SCGA 1IC8A 1QHGA 2MYSA 4MX3A 4V2FA 4QB1A 3HTSB 1X1DA 4RAGA 1QJX1 2K3PA 2KHMA 3E6BA 2LS6A 2UYBA 1OYIA 1A5JA 4U36A 4KI5M 3H1YA 5FD6A 2HWB2 5LGTA 3EQLF 2HWE3 4ITCA 4G6DA 4E9KA 4YZ5A 2WFF1 3FK6A 5HCAA 3OL3A 4HPKB 1DZTA 5JSOA 2DTRA 2N7GA 5C9AA 1YQ6A 3CHXA 4ATFA 2DPDA 1GP4A 3CCQI 1K6OA 3ZMZA 1OCTC 4CDXC 1VBE1 5C4WB 5FKCA 3K1NA 1XB9A 2R7DA 4IEYA 3VDAA 1NG7A 4JRLA 4HF2A 5KXDA 5LZ6A 1X2MA 2B63J 4GZ9A 1K78B 1O3TA 3KV4A 2FZ1A 1DP7P 1LFPA 1CPMA 1D5VA 5F64A 1PVXA 1JYTA 1OURA 2G7UA 1Z1DA 3CCEI 4V19K 2IVIB 3RG0A 1F9NA 3B02A 3G2BA 2VZOA 2ZHLA 4E4HA 3VDCA 3DPUA 1A35A 3DF8A 2CYFA 4UUTA 2BY3A 3NNLA 4LJZF 3A22A 3WUDA 1JKRC 2VD7A 1GUIA 2OPTA 3ZQCA 2WNOA 3SXWA 3AKQA 3KEYA 5F39A 1Y8RB 2EV6A 2VE9A 2QKDA 3RKWA 3WDWA 4OQ8A 1RNLA 2L54A 4NIAA 3IDAA 1PZ7A 3RI4A 1YIFA 3QRFF 1R1TA 1H8TC 3CLPA 5IVBA 5C71A 1RUF1 1AHSA 3UV9A 3OS0A 4QD2A 1G86A 1RR8C 2Q0AA 3ENRA 1DUXC 4QLCU 1TW3A 2B7EA 1LDDA 2XAFA 5HV4A 3TQNA 2BZTA 4G7HF 2IS1A 3I4NJ 3ZXEA 4QPGA 1JGSA 1DPUA 1XNTA 4AI0A 1LVKA 1SFXA 3MAJA 3J4UH 2QCOA 1QOOA 2PJRA 1ZZCA 2EZIA 3I4MJ 1XXNA 4AFBA 1ZZBA 2RNJA 3H7JA 4I0BA 1YIPA 3VD3A 2FA5A 3RKYA 1W2OA 5JOYA 5E1RA 2P8TA 3GXUA 2QSFX 1RUC2 3E5UA 1SBDA 3IDEA 3NNGA 2B9VA 4Y1ZA 1WGPA 2LD5A 2HOAA 4M0HA 1LHNA 3Q9OA 2GMPA 3KHBA 4LLOA 2IFRA 4HL0A 2YUSA 4O5VA 1K5JA 3ML6A 1OQEA 4HANA 2HDWA 3ZMVA 5LHIA 3K9TA 1YX5A 3FM5A 1F5FA 2OA4A 3TO7A 2ZX0A 2Y0IA 2BOJA 3PUBA 2PEXA 1W3XA 1CX1A 1O4XA 1IW7F 2XSDC 1SZBA 3GTGJ 2ZTNA 5FRAA 4LORA 2CUZA 2DV9A 1SMTA 5KXCA 1HKSA 4XQ4A 3L00A 4LLGF 2I10A 2FE3A 4LBQB 4B8EA 2E31A 2ACJA 3PLQA 2X6YA 3WE3A 4R79A 3JD72 4IV1B 2R063 2ZAAA 4UFHA 1ETXA 4C0BA 4LKFA 5JXHA 5GADJ 3GCXA 4EJRA 1UXZA 1FPN3 3IAPA 2HEYF 4XUOA 1FJLA 3SQNA 4YFZA 1FMD2 4N4OB 3PU3A 4CCDA 4W8JA 2QQOA 1T98A 4SBVA 3GHNA 1GUUA 3I4PA 1H88C 1QNWA 5JI7A 4R9DA 4URTA 2DCEA 4QX2A 4M9ZA 1QJFA 4ABZA 5JSRA 4AW7A 2LYCA 2WO1A 2YC4A 5BNNC 2ZMNA 5E8GA 3N9QA 5D8LB 3K1MA 1X82A 5GLWA 2LFBA 2CTVA 2V09A 2C26A 5A6QA 4BLJA 3JD71 4A0XA 3VL8A 5JI9A 2UXNA 5FP7A 2XKPA 2JXAA 4EQQA 1CX4A 1ETKA 1VBC3 3O5SA 1ETQA 3H0OA 2VKHA 1VRH2 4N9HA 4G9YA 3UNGC 3NNJA 1WD3A 2QZ8A 4WM8A 1RUJ1 3AMPA 2VUDA 3BN6A 4CSWA 1J75A 3LA2A 2PQSA 1XMAA 3H0GJ 1P6RA 5K0UB 4QPIA 3S17J 1XS9A 4PJNA 4A93J 3ECOA 1COV3 2DUPA 1XOYA 4AFAA 3EUHA 3WNPA 3JRBA 3OUIA 4O6JA 1FP1D 2VB6A 2PAMA 1ODMA 3LA7A 3FKJA 2DT5A 3AX4A 4CDUC 3OGRA 1IN6A 5J4YA 1Q5OA 4IEWA 3RGBA 5ACA3 1UZYA 5FBZA 1HSJA 5FY4A 2IA1A 4DYRA 2P81A 4OI4A 4XKVA 1MR5A 2F4OB 3GGLA 1JYCA 1JHNA 5FP9A 1WHUA 2ECBA 4LULA 5FYSA 4KGQA 2O6GE 3VDDB 5DM7F 2X5IB 3MQ0A 2M9HA 4LR4A 1KDMA 4AVSA 1GFF2 3BODA 3IMNA 5EHDA 2NVYJ 3S1QJ 4KL1A 5GAHJ 1J0RA 2BW3A 1RTVA 2RJLA 5A33A 2ZGQA 2VBXA 4C2MJ 2A6TA 4GMP3 3NV4A 3H8OA 5JPNB 4GWNA 1ZN2A 1UX6A 1YWKA 2BBAA 1USTA 4NN0A 5TJJA 1QVUA 5JVTA 1SFUA 1UW8A 2WFPA 1MIJA 4LMFA 4UW5A 3HDDA 1JZ6A 1NE6A 1UYXA 3GTOJ 3F8FA 1S7EA 3CIHA 1HW2A 4CPBD 1LDJA 2RAEA 1DZRA 3POJA 4CA9A 2WWYA 5TISC 2VQCA 3R4DB 3HNYM 1RKTA 3AM2A 1HDDC 2RMU2 2Q8CA 1U12A 4Q1PA 4Q8LA 3CLOA 4B8XA 1FYKA 3KPHA 1JN2P 3OIOA 1BZWA 3WHUA 3DBLB 2VBWA 4XYXA 4KJZA 1VP6A 1VBA1 1RUE3 2DMPA 4XUQA 3KLNA 3DBHB 4E2SA 2TBVA 2PLV2 2XGEA 3C7JA 4XF0A 2D6OX 2KFDA 2JQ7A 4V2WA 4BY7J 5K0UC 4LBNA 4FT8A 1W8TA 3DL3A 4AOCA 4GFBA 1IRGA 4CCKA 3R4KA 1W2AX 3GCMA 2TNFA 2GA2A 5M3MJ 1VBB2 4XQDA 5E18F 3GJBA 1DQUA 3HAGA 2L9NA 3DLAA 5AONA 2JENA 4FETA 1J84A 4X6QB 4A7ZA 5K4LA 1X3WB 4FPFA 2QQJA 1ITYA 1NXMA 1J3QA 1HDPA 1R1UA 4ESBA 3AFHA 1BR2A 4OHWA 5ED4A 1W7PA 2JA6J 5JHUA 4CCLA 2XLGA 3BPVA 4EVIA 3MIHA 2QDNA 2JTVA 1XRUA 4WXHA 4CEWA 3CCSI 2WFF2 3QBQA 3HQXA 4IEZA 3M3IA 1IN8A 3O7OA 2WWJA 3BZ6A 2RDRA 4QDRA 3MCZA 2VH9A 4QTRA 2WV0A 4CDQC 3BU7A 1DIWA 1DGWX 1KFXL 5KHGA 4Y17A 1A34A 1MEC3 4CRQA 5HODA 2A68F 3ORJA 4PLMA 4Q4X3 3UKGA 4D7MA 5JLWA 3SISA 3DYMA 4UBHA 1REPC 1HLVA 5CU1A 3FX3A 3JR9A 4OMCA 4BQ1A 2YBSA 1PYVA 3MIDA 1DGWY 1LOEA 4FAHA 3JD73 1OXCA 4D69A 4JDOA 1S55A 2L02A 5BNPA 5I8SA 4A69C 4OQ9A 2Z5UA 3VB9A 2JG8A 3HZJA 2VQ0A 1B35A 2VXRA 2ID4A 4UUSB 3JCUC 5D4SA 5H6QA 4GKYA 2QCSB 2KA3A 5DD4A 3J7LA 3B69A 2HYKA 1MQTA 2ZGKA 3OB8A 4Z8BA 2E36A 1OVPA 3RNSA 1S2KA 5LGNA 1ZRCA 5F08A 1N1VA 2KIUA 4COZA 5FUPA 2Q8EA 1PGSA 4Y3OA 4Z6YA 3L9JT 4LA3A 3PIPF 1LHVA 2R061 1H9WA 2J1UA 3BI3A 1MZFA 1J3RA 4R9BA 2BWAA 5EZGA 3BALA 3GFJA 1R081 3PUIA 3MLKA 3KIOA 3CP2A 4HW0A 2LOOA 3RQ0A 2V26A 1L7LA 3WQ7A 1M1EB 3MFKA 2EIKH 4MFDA 1DGRM 1WI3A 3IMMA 2OAZA 3U07A 2HYXA 4AGVA 1T2KA 2E1MC 1AZDA 4M6VA 4CCMA 5M5YJ 3F0CA 3GYDA 4QDQA 5LB6A 4M74A 4XFIA 5FO8B 1QJU2 1JS9A 3BKZA 1ALYA 1QBJA 2WY8Q 2CV0A 2Z33A 2C24A 1W0PA 4EN0A 1E57A 4ENJA 4XORA 1CAUB 3H3VK 1AUYA 4L0ZB 1QDOA 4XONA 4YIFA 4WVMB 5H2FC 4BWOA 1T6SA 2XAJA 1GQGA 5FPUA 3C7GA 2ZBKA 1KGSA 3ABKH 5JVGF 2ZEXA 5BS6A 1IXRC 4QPIC 2J5OA 4ASKA 1GVJA 2W91A 2A6HF 3DLLF 3LOCA 4WBBA 4RS5C 2VKVA 5FZOA 2O0OA 2QEXI 2XL7A 4AHXA 3VKMA 4L5JA 3O6BB 4U0WA 4QKBA 3CO7C 1WCQA 1S3JA 1WZ2A 1RIRA 5J36A 4IEPA 1FNNA 4F93B 1JKPC 2DCJA 2IXIA 3KQ4B 3LNQA 5KVRA 2MSYA 3U78A 2LY2A 5DAPA 4HSJA 1LEAA 1SDWA 1SFPA 1VTNC 1OLRA 1H0MA 4ES8A 5D8AC 4FOYA 3LGRA 3TEWA 4FXGB 2C9KA 4G6QA 4AUXA 3NO8A 4NAOA 3O0VA 1MBKA 2VZRA 4AG4A 3E6CC 4XXPA 4MSVA 5C7GA 5LLQA 4NPMA 1MS9A 3QU3A 4BUPA 1D4M3 2RG4A 2QENA 1O8PA 4A0ZA 5DN2A 3AYAA 3M3CA 5DAWA 1OJLA 1UQXA 3J81Z 3KYLA 2GLOA 3VBFB 1MMNA 4CXXA 3DBRB 5DV5A 1OISA 4M01A 3SYTA 3C1DA 2Y9ZA 3DXTA 1LFBA 4RR3A 2Z79A 5IYBJ 1Y3TA 3A21A 1TWGJ 2STTA 2JDMA 3J8F2 1UCRA 2XGXA 2VQAA 1V00A 4O65A 3T08A 4OLLA 2GNMA 3TOJA 2PA7A 2VUJA 1LGCA 2RJ2A 1E3PA 1MNEA 2EZKA 3I9V2 1Z0HA 2OD5A 1NA1A 4JX4A 5A3OA 3KQRA 4GH4C 4YVSC 1KS5A 3E97A 2KP6A 3W59A 3WNNA 1IGOA 3JRIA 1S9HA 2W1QA 4B48A 2EFWA 2Z69A 3MLLA 4W97A 1XSDA 3WDUA 5JZGB 3JXSA 2Y6HA 4P9JA 1J58A 1U5XA 3VDBA 1XDSA 1AR61 1ZBA1 4HF0A 1Y1VJ 3AP5A 1NCRC 2QQWA 1EAH3 1RGSA 4E7HA 4XQFA 2HWC2 1V6NA 2D3SA 4YZ2A 3W2VA 2J1EA 1QJX3 2FDHA 5FTTC 4OMDA 5E3MA 3I2DA 1YFHA 2ZS6B 3K3NA 3GNEA 3V56A 1VAMA 2KD7A 3KZ4C 2K9ZA 4XK4A 5F27A 4FX0A 3LFMA 2K9QA 4XLAA 3PUFA 3OWTA 4NNJA 4LT5A 3OV8A 1AR82 2FU4A 5LA9A 2L9SA 1IV8A 4KUMA 2YR2A 4OIQF 4Z2AA 3POSA 3VBHC 2KQRA 2RV8A 4LHKA 1PVEA 1W2NA 2IGMA 2J7MA 1TEIA 3E3VA 3Q0VA 4XBQA 2H94A 2V6EA 1OKRA 1Y0UA 3A0BC 3UGGA 4FCYA 1QZEA 2IPQX 4CH7A 3IZOA 5DPNA 5J1RA 5L73A 2WA0A 3PNAA 2DYRH 2VNOA 1ZZ6A 2ID6A 5IYDJ 2QQAA 1NCRA 1LOFC 1ACCA 1Y0NA 2R1BA 5EJ1B 2WAQN 2NM1A 4LK7A 2VOVA 1VFCA 2Z3YA 2VJIA 1ND2A 4HSRA 1WMFA 3H7YA 4IXLA 3LSMA 3KD4A 2XLFA 4DUXA 1VMHA 2Z9OA 5KXEA 5FP4A 5FYZA 1GXQA 2R7FA 2B0LA 3LKJA 3BG9A 2UY9A 4UBGA 2K46A 1VBD2 3Q8CA 4A5NA 1RYYA 1OUXA 3ST7A 3IAQA 1V6JA 1XJAA 1AL22 3KZYA 2E5ZA 3AG3H 2MEV2 2ZZQA 2GOMA 2UV1A 1CN1A 4ZS3A 4JZRA 2DMTA 1GZCA 1S0CA 5ACA1 1WLDA 4LHNA 5EIYB 1JJ6C 4A45A 2JJ7A 3ROUA 2MABA 1US3A 4L18B 1LU1A 5HS8A 4PQ9A 4QB2A 1MBFA 1BCXA 2ARCA 1TL8A 1RUI1 1HN0A 1RUG2 1ND2B 3QU6A 1WBFA 1POV3 5A6ZA 2ZGSA 3RCOA 3DPLC 4P08A 1WSUA 5FO9B 4RQPB 2BTVC 1I27A 1C5HA 2VO5A 5J1YA 2VJ5A 3BVCA 5FLXZ 2NQYA 4YGCA 2D6LX 1MMDA 3K4DA 4BBRJ 1VBD1 3WTSC 1GMMA 3KYCB 2Y6KA 3AL5A 2ZNZA 3KWVA 4L5EA 2Q1FA 2XONA 2XKOA 5B4XA 4EM0B 4CPBA 1VB2A 3WNMA 2R16A 2BOIA 5I0DA 2E7TA 5LA0A 1R00A 2GN3A 2HEVF 5C70A 2VKDA 1ASJ3 2QF7A 3DV8A 1ZZ9A 5IAXA 4RGKA 4V2VA 4C90A 4B3AA 4XN0A 4PLNA 5JOZA 2YBPA 5GZEA 1MZ5A 1ULGA 1VBE2 2YFZA 3K4NA 4XMYA 2WA4A 5J1UA 4JGYB 1CIYA 3FUQA 5JMCA 2J1TA 3SKVA 2HWD3 1NZCA 4GXLA 5ABJB 3POIA 5AC92 2QUOA 1G2HA 3RTRA 3DP7A 2FX0A 2J42A 2WN3A 4PSXA 3W2AA 1LENA 3TWIA 3D5OA 1MZ6A 1X3ZB 4KA4A 1FI2A 5GTIC 1VQ9I 4GRIA 3IV5A 1O5UA 1VBD3 3CF6E 4HK9A 1CVNA 3P3PA 5B3SH 2HWF1 3K4MA 1DP0A 2KIMA 2ARAA 2KISA 2VBBA 1AF9A 5CA6A 1B6AA 3V8LA 1UU5A 3ZMOA 3NVCA 4I99C 4QM8A 2K9NA 5FDBA 4QQHA 3FJSA 2Y60A 4OIRF 2LBFB 4UYBA 1UELB 4QM9A 1GP6A 4M3CE 1M4WA 5KAIC 4HQEA 2BPA2 1CPNA 3OYWB 1V9U2 2IXSA 3I3LA 3CCRI 1MBEA 4UFIA 5ANNA 4FPCA 4FP2A 1B1BA 5IP7J 5F5QA 5HOOA 2Q1MA 4UW4A 3Q8BA 4YW5A 3KX2A 3K70C 5DCMA 1WJAA 3QYEA 4A3XA 1QRYA 3K4ZA 3DEMA 1EPWA 3RFRA 2UUZA 2BHYA 3J7HA 1YYNA 3FXMA 1AYN2 1H2KA 5L3FA 2KZGA 4PFPA 3MZYA 2R7ZJ 2LR8A 3HKZA 3VKOA 1YRNB 4FTSA 1VAKA 2W46A 4RLFA 4HPQA 4KDPA 2JDPA 2J1AA 5A3PA 1PJRA 3I3BA 3HOVJ 5J47A 5CPRB 1GV9A 2YYOA 4I98B 1IPSA 1H1AA 4KIFA 3WCSA 1FOWA 3JBG2 4NPRA 3AG2H 5LY1A 1WLCA 3K69A 5FLJA 3BR6A 3QP6A 4UY8I 1GANA 3BTZA 3CQZJ 1MSEC 3VBUC 2W0XA 2PAEA 4ONUA 3PL0A 2FOWA 3MV11 1QQP2 3RWKX 2OVUA 5D21A 4XJAA 2RKHA 3ALQA 2AENA 2RE9A 2HQRA 5HXVA 4EATA 3MD2A 2M8GX 5FUIA 3S7IA 3R4UA 1ZGWA 4BAYA 1V6IA 4NWVA 2VJ4A 1IQAA 5C4WC 4OUEA 2NVTJ 1KQ0A 5KHIA 2W08A 2OQ6A 3R05A 2K3FA 3L2WA 1W9TA 5B1BH 1XD7A 2X5IC 5FZGA 5IUQA 1VQMI 3DPTA 3BUCA 2LKSA 2RMU3 2XAQA 1O6UA 1R58A 1RC9A 3FISA 1S0JA 4H55A 1UU4A 5C8WA 1YI7A 3NJYA 1GLHA 4ZXKA 2F17A 3UJQA 3H35A 4HG2A 1KRIA 2ZGTA 1XU2A 3FM3A 3SLIA 1R082 1FY7A 2H6CA 2BYVE 1G7YA 5DDGA 2L9RA 4PJ0C 1SFKA 2VQHA 2IGKA 5C4JJ 2BERA 3UL2A 5FPXA 1QVTA 1HQCA 3SZPA 1EAH1 1QEXA 4LBJA 3DYPA 3WU0A 2PFBA 4QDSA 4NOTA 1HW5A 5T5PA 3T0DA 3CC7I 2F4PA 3ZO0B 2QQ9A 1YCIA 4JX0A 3AG4H 3OYKA 2XF7A 2CHHA 3AL0B 2OU2A 4FP3A 2ETEA 2A05A 3VODA 3TMOA 2W57A 3N7LA 5IVCA 3I3DA 2JVHA 4G4FA 2WZEA 4IHSA 1UZWA 2DJIA 2JRTA 4JHZA 1ASJ1 1IOAA 2VG9A 2D97A 3CJRB 2HI3A 4Z92B 4IUGA 1LESA 4DUWA 5EFUA 5FOBB 2X48A 3PQKA 3RJPA 3EHKA 4XOTA 1MZEA 4JKLA 5FMCA 2I2SA 5BNPC 3GCWA 4CGZA 2P34A 3LSIA 4MEXF 5FRNA 1IUFA 4J1XA 1TW2A 3OYNA 5F0FA 5GAGJ 5IFTA 1QNTA 1QWRA 2GOXB 1QF3A 5F6LB 2OQ7A 3E7LA 3QYBA 4S2FA 2F6CA 2IGOA 3DCFA 1BOBA 4UF0B 2DA4A 5T52A 4G3YC 3KV6A 3N9NA 1S0EA 4NC6A 2TEPA 1TBXA 3POGA 1CR7A 1U9OA 3EUAA 4QPGC 1IAWA 3KZZA 5CIRA 1FV2A 4S0HB 4Q0QA 4MOAA 4A6EA 1PP7U 4XW3A 3A02A 1X1CA 3GTMJ 3QOPA 1NOVA 5D5XB 2WNUC 1OF3A 2FUG2 1NK2P 4Q4Y2 1SVLA 2L01A 3HUGA 2NN8A 5GLTA 3FZVA 4IF4A 3A0KA 3ZFFC 1H8TA 1V4RA 3G73A 5DDJ3 1DU3D 5D8KB 4BB3A 1AYN1 5CJ9A 2GZWA 4QQOA 4IE0A 2V6CA 3EUHC 5LBQA 5FLHA 2F5VA 2YZ4A 3L2HA 4PDWC 5BQTA 1T38A 3QODA 3GF6A 1YHFA 5A70A 2E51A 3WTVC 3O2PE 3PO2J 1DDLA 2VVDA 4ZJZA 5E20A 5FY9A 2D45A 1FPN1 4FTBA 3G4SI 1FLIA 3AYDA 5HLHA 1ZG5A 3KETA 4CE8A 3EYPA 4QSHA 4F91B 2HWC3 1UZVA 1LRHA 4QU2A 1BMV1 1ZBA2 2R041 4L9TA 4C0HA 4DXSA 4GAZA 5JOXA 1T0FA 2TUNA 1U6GA 2R073 3U1XA 3MKYB 3GTQJ 2Z4FA 5J98B 2VVFA 2ARXA 1S7OA 2LG4A 1DQ5A 2WY7Q 4XRSA 4PBOA 2FSWA 1OFSA 1D8KA 3J7YJ 1HBXG 2WINB 2ELHA 1LAJA 5DXDA 4UUVA 1CAWA 2WBMA 4NJ4A 2LKXA 3K4BA 3C7FA 5C8CB 3J8F1 5FZ4A 4LBOA 3Q0WA 3RMXA 3Q0UA 3VBRB 4BJ6C 1BVP1 3D0JA 1CESA 5T5OA 2I45A 2RJKA 2QM3A 2B9UA 1EV12 2KRFA 2E7WA 5EZHA 2VTXJ 2VCCA 1VPHA 2ZNYA 3VYTB 5EEHA 1E5SA 2PHXA 3WVJA 1VQ7I 2QE3A 1FBSA 3CEWA 1AA7A 1LNWA 5D5WB 3ZOBA 3VBFC 1AX2A 5IJRA 2KIQA 4WM8B 3VHOA 2MH9A 2K2SA 1AR83 3RQ4A 4CDUA 2E7QA 1YOVB 1TP4A 1AYM2 2OIIA 3SDGA 5L3CA 1GSLA 3INAA 2DA5A 3ZFEB 2X85A 4KWLA 4WV8A 3GO5A 2Q30A 5L7OB 4AHZA 4R1HA 4FPHA 4MFEA 3LWFA 1JUMA 4LUMA 3VBRA 2EXKA 1Z0XA 1VR3A 3Q3SA 2VT3A 2WNVA 1AVBA 4NVPA 5JPMB 5GKAC 3VB2A 2XJRA 4E8DA 1HXS1 4PSWA 1ULDA 4M72A 2FBIA 4MO7A 4UB6C 4ETSA 1UOBA 2CSGA 3IH4A 4FVVA 4D94A 3NL1A 2FBHA 2Z99A 3I56I 3P5JA 2LK2A 3TO9A 1JI8A 2E35A 4I3PA 1JZ7A 2JKXA 3NAPA 5K7FA 5IT9Z 2ZOEB 1K5MC 2VIXA 4R9AA 1I3QJ 2P5BA 2FMDA 1FP2A 4XFFA 5EPAA 4Q0UA 1ZREA 1GZWA 1QMJA 3WCRA 5K9YA 3KS7A 3SEEA 3VZOA 3WU1B 3A01B 4HKOA 1DF0A 3T8TA 1NCQC 3NAUA 3L2QA 3E5QA 5CVJA 4CDWA 5FFOC 4IEOA 1BHGA 1GHCA 3ZDSA 4JV4A 3OYLA 1NAEA 4ZU4A 1LECA 3VHNA 4JDNA 2CSOA 2WAFA 2WS91 3HTUA 2Y6LA 1W9YA 3OGGA 3M8JA 5A2QK 3KLOA 4EZHA