4N9IA

Crystal structure of transcription regulation protein crp complexed with cgmp
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
202
structure length
202
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Catabolite gene activator
publication title Structures of inactive CRP species reveal the atomic details of the allosteric transition that discriminates cyclic nucleotide second messengers.
pubmed doi rcsb
source organism Escherichia coli
total genus 62
structure length 202
sequence length 202
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4n9iA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4n9iA01
3U11A 3BJOA 4MEYF 4IJAA 2ISYA 4HVRA 3MZHA 3WTXC 1X82A 1WWXA 4M6XA 3H9AA 4EV0A 3K2ZA 3BALA 1RUNA 2JPCA 3L09A 3WW2A 3RJPA 1ODDA 2K7LA 2O1QA 4LB5A 2LDUA 5FD6A 1UIJA 4IEUA 1RNLA 4JQFA 1OI6A 1J2XA 1J3PA 4M9SA 3S7EA 5E1ZB 1Q5OA 3V7SA 3BPZA 1YFWA 3PFIA 1BI0A 1SD4A 1CAXB 3S0MA 2VPVA 2NAZA 3TNQA 4N0BA 2KJCA 1SMYF 2XROA 5FQ0A 4O3MA 3MYXA 4RAYA 5JSRA 3FMQA 2A6HF 2VE8A 5K5RA 1O3SA 4G94A 2ZJ2A 2QZ8A 1QGPA 3DP7A 5T3NA 3OD0A 1OPCA 1LB2A 2HDCA 4A5MA 5TJJA 1PM7A 1ULYA 4XRFA 3KEOA 5IT9Z 1MJ9A 2KIMA 1B6AA 3M70A 1DDNA 4GCVA 3HRMA 4BXUA 2XIGA 4EQQA 2MHFA 2OYZA 1YO5C 2XHKA 4HDVA 4RB2C 3JSOA 1WI9A 1EP0A 4HOBA 1O5UA 3HTSB 2HWVA 2IA2A 3BROA 3NSTA 3H3ZA 3U9GA 2EK5A 3WTTC 4HA8A 3FXQA 2H0VA 2ELHA 3G3ZA 3Q9VA 1YYVA 5L3CA 1OYIA 5HLHA 2EA7A 2P5VA 2XLAA 3R61A 4S05A 2V9VA 3HRSA 3Q5FA 2B9UA 1NHAA 4YARA 1DGWA 3MEXA 2CG4A 4ZYDA 2K27A 4Y17A 3F72A 5D5WB 1XSVA 1B9MA 2VOPA 3NEUA 3KLNA 3K1MA 4LUKA 1LDJA 3V8KA 3GYDA 5ICFA 5HLIA 3RKWA 2P4WA 4IEOA 4G6DA 1SD7A 1YW7A 3LFKA 4ZZLA 1SD5A 3QRFF 1RI7A 1RTVA 1R23A 3F6VA 4KMUX 3PQKA 1Z6RA 1MD0A 2R7DA 2GA2A 3ST7A 3PLQA 3IIAA 5I93A 2KKOA 1LNWA 2V1UA 3ECHA 3P9KA 4EROA 3LWFA 1U5TC 2MNGA 4A0XA 2PHLA 2NNYA 1ZRCA 4AD9A 5FGMA 4UXAA 4GULA 5JR7B 1WRJA 3ECOA 3CJNA 2N7GA 4OFGA 3I64A 1IPKA 2ZKLA 2QCSB 2PAKA 3KGLA 1H0MA 1KGSA 1EH6A 2DBBA 1KQ9A 2RVCA 4GO1A 3R0AA 1P4XA 4OLLA 2J5PA 4HSLA 1NXMA 3GW2A 4XFFA 4FT8A 1IXRC 5BY5A 4Q29A 2DO7A 3NKTA 4UHTA 3P9CA 4PCQA 3HTUA 3H1MA 5CVUA 2PMUA 1Q43A 4ONUA 1Z91A 3NQOA 1K6OA 1Z6TA 4KICA 2CO5A 1YQAA 5FCCA 4HX4A 2Z99A 1I5ZA 1GQGA 1R1TA 4WVZA 3IRQA 1MDMB 4WXDA 5EEHA 3JAMK 1S29A 1J75A 4X6QB 4KWLA 1VP6A 2Z33A 3L2CA 1ZRDA 3ERED 2H09A 4EJWA 2F5DA 4IEQA 1IN5A 5L3BA 4YIIA 2Y48A 3DV8A 1NYWA 1ZLJA 5J8CA 2JRTA 5HLGA 4Q0PA 2VONA 1UW8A 4K8FA 2RKHA 4YFNF 5HI0A 1LEAA 4K2EA 2E9QA 4M72A 4L18B 4MGIE 4UUVA 3H1YA 3M9AA 2DQLA 3CJXA 5CVRA 4WCGA 3BWGA 4AWXB 2L4AA 4Q0UA 3T0YA 1BIAA 5ICEA 3GF2A 3O3KA 4LFUA 5KHJA 2OQGA 2BE5F 1HSTA 1S6LA 5BPDA 1EY2A 2XLFA 5LLQA 2HGCA 4EM1A 2GH2A 2PQQA 1HKQA 3IBMA 4ESBA 5J48A 2LNBA 1ZNPA 2P17A 1W5SA 4P5OA 3WE3A 4WK8F 4U7BA 1ZLKA 4HV6A 1K78A 1TTYA 2E7XA 5EFUA 2CV6A 2MLKA 2OAZA 4YYOA 4H0EA 2HEOA 1ZH5A 1LEBA 1IUYA 2V1DA 1XSDA 3VB2A 2IT0A 1NZCA 3PQJA 3BCWA 2F5CA 3FM3A 4G7ZF 2W85A 4IPAA 2VBWA 3FXUA 5DV5A 4KU8A 4EJTA 3CTAA 3TDUC 4AQ6A 1P2FA 1YLFA 3M7GA 2IXKA 1YFHA 2Q8KA 2ZFWA 2QNKA 3O6BB 3SCGA 4HBLA 1OMIA 3OGJA 4QM9A 1ZRFA 3FX3A 3I54A 2XAGA 1ZZCA 2DI3A 4IEXA 2NS0A 1IAWA 3CO2A 3F8NA 1V3FA 4G6QA 4MGKE 3I58A 4Q0QA 4IF4A 1JHFA 3RDIA 3S2WA 5JFRA 4U0WA 4XFHA 1D8KA 1R36A 1VR3A 4AVPA 2GXGA 5LGUA 5F6FA 5J6XA 2XKPA 3QAHA 5FFZA 4HMZA 2FSWA 2Z2SB 5H6RA 2FE3A 1ZYRF 3SHRA 2D5HA 3D0SA 5E16A 2ZMEA 2L02A 4CYDA 4RAZA 2Y75A 2IXCA 3N97A 3COAC 2K02A 2KJBA 1S7AA 3WW4A 1W4MA 5FQ0B 1G6NA 3JZVA 5K1YA 4HZFA 4HN0A 2O3FA 2Z5UA 2Z69A 4E2GA 1FBSA 3RPQA 2FQ3A 1XN7A 1R58A 2YR2A 5K5QA 1Z05A 2IJLA 3CUQC 2FXAA 3R4KA 2XAJA 4D0PA 3KE2A 4A5NA 4L5IA 3E3VA 2STWA 4I3PA 3RI4A 3V7RA 3BJ6A 4CDGA 1ZGJA 3C18A 1VTNC 1B4AA 1PP8F 3I71A 2C0ZA 5L3GA 3L00A 2C6YA 2I45A 2EJRA 1FT9A 4HDUA 2F4PA 1W7PD 3CUQA 2QBYB 5CADA 3SXWA 4LLNA 1HKSA 4M9ZA 4G8XA 3WGGA 3TGNA 3DXJF 1HKTA 2MC3A 4X6RB 1H1MA 2D40A 2OA4A 1J1LA 2ZXJA 1R1VA 1DP7P 2H27A 4RGSA 2NRAC 4LD5A 4I0AA 4GYGA 2XV4S 2BGCA 3TOAA 3VOEA 2FNAA 3T1BA 1IRGA 4ASNA 1REPC 3CLOA 2LF7A 3KFWX 2RN7A 3F8FA 1OKRA 5I0TA 2PEXA 4S04A 3C7JA 5F64A 2KIUA 4BHCA 3RYRA 1TNSA 3I5UA 3M8FA 3I4PA 4MNUA 1BC7C 1ZN2A 4UBHA 3ZN1A 1XCVA 3R60A 4J1WA 4XLPF 4OIRF 4KN4X 5ERIA 2EA4A 4KL1A 2B5HA 3ZMZA 5D6EA 4IEYA 2OQRA 2ET1A 2K4JA 1I6XA 1XGNA 3BJAA 2P7CB 3JTHA 4WXHA 4PDKA 1USTA 5AONA 5LGNA 4R1HA 2V09A 4XFCA 1ZREA 4OIPF 1SFEA 3M3IA 4NVPA 2NNNA 3KP4A 5BMZA 5E1WA 2L54A 1X3UA 3O14A 2VECA 4PIZA 2O8XA 1R7JA 4M74A 1QY4A 2XLGA 2W25A 3NVCA 4NHJA 5HDNA 3SXYA 3SCHA 3KMHA 2HQNA 1HW2A 4O6JA 3PNAA 5I8YA 1TQIA 3ZMDA 5EEGA 4ZU4A 1IN4A 2MBFA 5DCFA 5E20A 2OD5A 2PMHA 3M1EA 1T2KA 4A6EA 5J8FA 1SMTA 3HUGA 1FC3A 1I1SA 1JUHA 3SMHA 3QU3A 4XLNF 4E2QA 2YSRA 4O9GA 2EV6A 3L2HA 3GBFA 3ACLA 5CLSA 3J81Z 2M5WA 3ES4A 5J3UA 1U8RA 2X4HA 2EFPA 5HOOA 4Q5SF 4L11A 4IVNA 1R22A 2KRFA 3GXOA 4Q4ZF 4JVAA 2R7FA 1VJ2A 4OIQF 4L5JA 2K4BA 4OU0A 3J7AO 3E5QA 4HVQA 4KMFA 3UKVA 4YIFA 2K86A 3BU7A 5JCTA 2QQBA 1J58A 3M8EA 5ILSA 4XF0A 3KGZA 1PUEE 5LEJA 2P6TA 4AVAA 5CVVA 2Q0AA 1IZ1A 5BQTA 4HQMA 5D5VB 2CWEA 2WFPA 3GYHX 4ENKA 4OINF 1K78B 3TO7A 3HSFA 4BNCA 2HYFA 4LLLA 5HS9A 2IRFG 5LEKA 2GU9A 1XCBA 5FFXA 4OMYA 2EFWA 3HRUA 3GLXA 3E6CC 4G7OF 2UZKA 1SEFA 3FZVA 5IT9K 2AXLA 1QXJA 5F1RA 1LR5A 4MV2A 4I0BA 4PZJA 2FQPA 4IETA 3GZ6A 1CX4A 2QDRA 4YFKF 5JI6A 5DUKA 4IRHA 2PG4A 4MGRA 2W57A 1S3JA 3F23A 3LQRA 4ENNA 3EYYA 4AVBA 6PAXA 5KK1A 4P9UA 1T38A 2P5KA 4KIFA 3KZYA 4HVOA 4EJUA 1YLLA 2QM3A 2Q4SA 2DAOA 5LRRA 3KP6A 3OTFA 1R5HA 3ISPA 2ZMEB 4N9IA 1AOYA 4U88A 2OA2A 1T6SA 5JSPA 4GGGA 2L3DA 3HRTA 1SFUA 4WF2A 4E70A 1EH8A 2FBHA 2KXLA 3RTRA 2CAUA 4ZU7A 4XF4A 3H3UA 2ESHA 4HLYA 1YW9A 3O2PE 1XDSA 4QGMA 1YHFA 2GWRA 2DLLA 4EMSA 3TOBA 4UBGA 3RZZA 2EFNA 1QZYA 1XGOA 1C0WA 4A6DA 1ZHFA 5FPZA 4MHGA 2EWNA 1B59A 1ON2A 5D6FA 4HLXA 3QACA 3RNSA 4BYYA 5BPXA 4A0ZA 5BUVA 1WKMA 5JVTA 2K0GA 3EDPA 4HF1A 3ZN0A 4MX3A 1TBXA 4H7LA 3H1WA 1CAVA 4LK1F 1O7FA 3J80Z 3MQ0A 4AIHA 5H6QA 1X8EA 1NE4A 1QXRA 1FY7A 4DQ2A 3L9FA 3MPBA 1YG2A 2M8EA 3E6MA 3CUQB 1ZZ6A 1BI1A 4LB6B 3U0ZA 2W84A 1U5TA 4A12A 5E8IA 4O9EA 1U78A 5CJ9A 2ETHA 4BQAA 1QPMA 2FEZA 4AIJA 2Q30A 1MGTA 1H9TA 4JV4A 1ZX5A 4F8AA 2JTVA 5D1IA 4HLTA 2CW0F 1A04A 1T98A 5FLXZ 5I0SA 4HBNA 4BHPA 3HHGA 4WXCA 2VBZA 5HS8A 2DPUA 2HOEA 1O4TA 1SQ4A 2EAAA 5FLXK 3BP8A 3LSTA 1ZG3A 1R1UA 5KHGA 4ORFA 2FBIA 2FOKA 4P96A 3WGHA 1YFXA 3WU0A 4CHUA 3C3VA 2M45A 4G7HF 1UD1A 3H7YA 5K5OA 2OZUA 4L2NA 2F2EA 1FP2A 2D1VA 2GZWA 4JTNA 3B73A 3E97A 4L0YB 3F6OA 2GC0A 1ZZBA 3NRVA 3U10A 4FHTA 4L9JA 3ABTA 4HF2A 5I91A 3CLPA 1HXDA 5HS7A 5BS6A 5DUIA 4PGGA 3I59B 2XASA 2O03A 2ZNYA 3H7JA 5LHHA 3HOTA 2JPBA 5ILUA 1BIBA 1ZARA 4MEXF 4EGYA 3F8BA 2Y0MA 2V6CA 3T5XA 1RL3A 3GEZA 2O0YA 1J3RA 1RUOA 1P92A 2IXJA 2GA1A 3IWFA 2PQ8A 1TNTA 2QLZA 5E8GA 2V1XA 3R6SA 2WTEA 3LWCA 4P55A 4WX9A 2HS5A 4AIKA 2GC2A 2LKPA 2UWMA 2OU2A 5HDGA 1QO0D 1L3JA 5I0RA 5LBQA 5CVIA 1CF7B 4RGXA 3FMSA 3D0JA 2PAMA 1SAXA 4IEWA 1Q3EA 1WQ2A 3P9IA 4LA2A 4EWDA 4EWEA 1GXQA 2BEOA 4JTOA 4IEVA 2FNPA 2HYGD 3I0TA 3HSRA 4WBBA 5BV6A 2IW5A 4MGZE 2A3SA 4YSFA 1SFXA 3MFKA 4MZUA 2VXZA 2ATFA 1F5TA 2FRHA 3CF6E 4CXFA 4CICA 3MCZA 3OOPA 2LSOA 1GQHA 5FB2A 5E1RA 4RGUA 4EJOA 4L9VA 3ROUA 4LMYA 1HSJA 1P6RA 2EV5A 4OMZA 4AQ2A 4XFGA 2STTA 1YIOA 3WODF 1FP1D 1YS7A 2PFBA 3F3XA 2G7HA 2RDPA 4FAGA 4Q0SA 4AXOA 3GO5A 2OPKA 4QLCU 4LUMA 3REOA 1V70A 3E5UA 4XSXF 2UY9A 3D5LA 1ZGAA 3CO6C 4Z82A 5E17F 1XMAA 2WC2A 1J3QA 2A5YB 4KNYA 4P9GA 3SZTA 1BOAA 3GWZA 5TRDA 2PYTA 2GC3A 3IDBB 2JT1A 2HKXA 3BZ6A 2BBYA 1BN5A 3DF8A 1J0RA 1G3TA 4B8XA 3VFZA 2MH2A 4YFXF 3GFJA 3KEQA 3QP5A 1IXCA 1YFUA 5H20A 1STZA 4UV9A 2RQPA 3K69A 2XUBA 1BI2A 1XGMA 5KHIA 3WTWC 4QXKA 2PN6A 1H9GA 4HN1A 1ZVFA 1UB9A 4ESFA 3N4MA 4BIFA 1F1ZA 2PAEA 1XSXA 2RGVA 2TDXA 1OD5A 4UVAA 2IXHA 4LGWA 2PHDA 2RNJA 3BPXA 4META 3NL1A 2UXNA 1W5TA 5AIPA 3ZMTA 4Q0VA 4XETA 3U2RA 2X0LA 2MA3A 3WTYC 4MQVA 4PIYA 1LJ9A 2L01A 3C1DA 4MH0E 3FHZA 2GQQA 3DL3A 2D45A 2ZO4A 3KZZA 2FF4A 1KU9A 3HHHA 5LRSA 1KYWA 5D5XB 4EM2A 3AAFA 4IEPA 2BV6A 4KWJA 4KIGA 4QM8A 1BC8C 2QUFA 4L0ZB 2PJPA 2B0LA 3DKWA 4UV8A 2IP2A 2M1BA 2PA7A 1MDMA 3GX4X 2O6GE 1G3YA 5JAXA 2HR3A 5DCMA 4ZU5A 1DZTA 2YX4A 3H50A 2QYOA 2ZBKA 5L3EA 1SFNA 3LOIA 4LG0A 2Q0OA 5BPIA 1CAVB 5D8KB 4EJVA 1EV7A 2P6SA 3L7WA 2D2WA 2EB7A 4WZCA 3JSPA 1XRUA 3WTVC 3F21A 2WWYA 4PIXA 5HDKA 5LGTA 2RV8A 1AWCA 3ES1A 4RB3C 3HQXA 3WTUC 1D8JA 1WLTA 4EGZA 4IRGA 4Z07A 1U5TB 3MZYA 4O5VA 3EBRA 3IKTA 2O8QA 1QNTA 2HQRA 4JK1X 3RYKA 1RIOH 3ETQA 4RD7A 3DPLC 1O7LA 1RZ4A 1DPUA 2A61A 1TQPA 3K9TA 4IXAA 3GUDA 1Z7UA 4ZYGA 4XF9A 3WTZA 3IC7A 4D7TA 1Z9CA 2IVMA 2IXLA 1H1IA 2D93A 4XF3A 4HF0A 2VBYA 4BAYA 3EQLF 3F8CA 3QPTA 2UXXA 1BBYA 3IHUA 4PJYA 4UVCA 3OV8A 5DD8A 2DFIA 1MJBA 4BHBA 2A07F 3FWEA 3J81K 2EFQA 3DPTA 3CUOA 2PTMA 1USSA 1XE8A 3ZDSA 2WV0A 3GVAA 4LK0F 4HV5A 3LA3A 4QGNA 1FNNA 1SD6A 3RPUA 5KBFA 4ZZDA 4FBFA 2FU4A 4RB1A 3E6BA 3KP3A 1UHMA 3EQEA 2XAQA 3DEUA 2ZCWA 4WWCA 4Q47A 3BB6A 4ESJA 1GVJA 3WW1A 1MZBA 4CO8A 3I53A 5LHIA 2ESNA 3TO9A 3ZQ7A 1UCRA 5DDGA 1YW8A 5C8WA 2QQAA 5EZWA 2EVXA 1KU7A 1KA8A 4Y13A 3ELKA 2VT3A 2Y0OA 4U0VA 1IXSB 3QPHA 2M87A 3U1DA 3DFGA 4ETSA 1BI3A 3EHKA 3OF1A 3Q9SA 3ABUA 2ACJA 2DCTA 3V8LA 5BXXA 2DW4A 1CAWA 1KQ8A 1T39A 2MD5A 2A6EF 2PFWA 1TW3A 2HFHA 3E6DA 1DZRA 3HIFA 4IERA 1LKNA 3P7NA 3ZMVA 5HVQC 2VODA 1E2XA 1HQCA 3IL2A 2VBXA 5D5UB 3T8RA 1FX7A 3NW4A 5J7MA 5C6CA 2XRNA 3ELNA 3LA7A 4I7HA 1IRFA 2H94A 2VC1A 4LEJA 2XKOA 3E5XA 4ZYEA 2DK8A 4IESA 2BNOA 2UYAA 1U12A 4UNOA 2MPFA 2LF8A 5JR3A 2DQRA 4OOIA 3KP7A 1EYBA 4PGHA 4M9XA 1LDDA 4R8HA 1K79A 3LAGA 3USSA 1T0FA 1IF1A 5L3FA 1ZZ9A 1XB4A 2PLYA 3TKYA 2QWWA 2F5EA 2F5FA 2EFOA 5E18F 2QBYA 2BYVE 2MLGA 4G9YA 1F9NA 4MTDA 1L3LA 1EH7A 4OIOF 4CGZA 3HT1A 1JE8A 4XSZF 1X7NA 2BNNA 3TO6A 2W24A 2Q2EA 5I8SA 1QQIA 3V4GA 2Z9OA 3UKTA 1QZZA 1PMIA 2L4MA 1J5YA 3CDHA 2EV0A 5KHHA 4XEZA 3LA2A 2QVSB 1CAUA 4LULA 4U0YA 1TQMA 1JGSA 3FE5A 5AVPA 2ETEA 3K0LA 5ICGA 4M73A 1HBXG 3TQNA 4I09A 1YUDA 1B1BA 3HYIA 3HOSA 1FOKA 1O57A 4KYWA 1IN8A 3RYPA 4ENMA 1FPQA 1TLHB 2VN2A 2VE9A 4NB5A 5FDBA 1E17A 3QOPA 1DPRA 4UXNA 1K7AA 3EO6A 2QENA 1UFMA 3C3WA 3J80K 4IEZA 1ONVA 4YNIA 1G3WA 2P7VB 3W6KB 1G4DA 1YWKA 1B9NA 3H8UA 1IW7F 3SZPA 3FHIB 3KSCA 1RC6A 5ED4A 5FLIA 2IA0A 2HKOA 4XF1A 4U7DA 2GC1A 1QWRA 5I0UA 2DU9A 1WA4A 3FXRA 2IA1A 1KYZA 4ON0A 3ZMUA 3FJSA 3ZPLA 3K1NA 1FI2A 2FA5A 3FZ3A 2QJVA 2DT5A 3WG9A 1O5LA 3SCFA 4N9HA 3MDPA 4LTAA 4MQ9F 1CGPA 5K8SA 4XFIA 3SFZA 1R5GA 1WGPA 1I1GA 3RKXA 4ZH4F 2FBKA 1UHWA 1FZPB 5D8LB 4ENJA 1FBQA 5A2QZ 1TQ5A 4HSJA 3JAMZ 4RGRA 5AIQA 1W7PA 4B29A 2D5FA 2HTJA 2P5LC 5A2QK 1QBJA 1Y3TA 4LJZF 5DCMB 3BOQA 1JHHA 2RC4A 4LG0B 3OCPA 4Q48A 3RKYA 4KT5C 4GYIA 2JSCA 4M71A 2VOOA 3ZP5A 4MGYE 1ZAOA 2XL7A 4FX0A 3F8MA 1GHCA 1U2WA 2QVOA 1U6GA 4L9TA 4GXOA 5FLJA 5JSOA 1J7KA 1S7OA 1PP7U 2A69F 1YS6A 3TNPB 3LAJA 3D82A 1KQ0A 4QWQA 2G9WA 4I01A 3GFIA 3LQQA 4L9NA 2QQ9A 4YG2F 1GXPA 4A2UA 1LVAA 2GXBA 2H6CA 1J9IA 1CAXA 2HJIA 3G7DA 3VEPA 2PI0A 5DD4A 3I7DA 3VODA 1Z1DA 4AVCA 1HW1A 1U3EM 3PVBB 3S7IA 1Y9QA 1FXZA 5CVJA 2E1CA 3JW4A 2CFXA 1EPZA 5BOXA 4HX8A 3EUHA 2DPDA 3T8TA 4E2SA 2CSOA 3WTSC 3KP2A 1O3TA 3DN7A 2V79A 4F7ZA 4MTEA 1UCXA 2Z3YA 5JHUA 4KA4A 2YU3A 2H6BA 4UVBA 2JZYA 5ICCA 3IDCB 2YX7A 2A68F 4EM0B 2ZKZA 1LDKB 4M6YA 4RB0A 1FSHA 3KLOA 1YFYA 1RGSA 3GFMA 1BJAA 4IHSA 2GAUA 1XE7A 1F4KA 4KN7X 3K1PA 4HQEA 4XFBA 1R00A 3IKVA 3RIRA 3F22A 1S8NA 4FX4A 1L0OC 2OZJA 4HW0A 5LHGA 2DTRA 4I2OA 3VHRA 3ZMSA 5ILVA 2KIFA 4LA3A 5L3DA 1NE6A 1Y0UA 1FYKA 3ML6A 3QP6A 2M30A 3GZ5A 2COMA 2CGPA 3BY6A 1XDUA 5FD5A 3KP5A 1DGRA 3IWZA 3LZZA 5FLHA 4Z2YA 1D3YA 3HT2A 4P9FA 3NJZA 2P8TA 1FWZA 1ZG1A 1OYYA 1XD7A 2G7UA 1XGSA 1CAWB 4A0YA 1HW5A 5D4SA 1IPJA 4R79A 3FM5A 4KUMA 1FLIA 4IRIA 1OR7A 1JXSA 4QGLA 2VC0A 3V8JA 4EWAA 1IN6A 4R52A 3WW3A 3BPVA 3H92A 3UKNA 2XVCA 3KCCA 5D4RA 2BNMA 2CQKA 1DUXC 4KDPA 1ZZ8A 3KETA 4QX5A 4I98B 2CYYA 1KU3A 1O3RA 4KIBA 4KWKA 2VT2A 4YRDA 1LRHA 1FSEA 3MWMA 2HZTA 1Q1HA 3CL1A 2HTSA 4MUVA 3DQVC 3TDZC 4HAMA 3QU6A 4HYEA 1ZG5A 1BM9A 4Y15A 2DK5A 2XAHA 1ZRRA 3MAJA 1MJAA 4HX7A 2K9ZA 4FAHA 2XAFA 2ZNZA 3SHFA 1UIKA 2UYBA 3WGIA 1PDNC 2O61A 2D1HA 4XFAA 3FF5A 1IN7A 3B02A 2XL9A 5DYMA 2IPQX 3HSEA 3IRRA 1CAUB 3FFQA 4CZZA 1I27A 3SQNA 2OBPA 4IHTA 3CEWA 3EETA 3LAPA 2NYXA 3EJKA 1YTYA 2GIVA 1UPIA 4B09A 4DNCA 4KU7A 3WE2A 1XMKA 1FYMA 4LLGF 3W6JB 1OFNA 4ZYHA 1J59A 2AS5F 4LLOA 1LQ1A 4TV7A 5DEQA 3V7CA 2PBIA 2FMYA 5CU1A 5FPXA 2E1NA 4NQWA 1D5VA 1O3QA 5IT3A 1ON1A 3ULQB 3GFLA 3R0JA 1ZZ7A 3I59A 4D7SA 1OYWA 4BH9A 4EVIA 3JTGA 1P4WA 2FMLA 2IXIA 4RS8A 3WU1B 2ET7A 2ISZA 2CAVA 5FO5A 1X8MA 2IC1A 2VQAA 2ADUA 3EYIA 1KU2A 5CYVA 1WSUA 2Q1ZB 1TW2A 3FMRA 4DINB 1G3SA 5KHKA 2MH9A 1FYLA 1P4AA 5E1XA 2E7WA 4I02A 1V4RA 2XGXA 3G73A 1CF7A 1MKMA 2J5OA 2R3SA 2OZ6A 2YPRA 2UY8A 5I8TA 4J1XA 4TLFA 4XBFA 3BDDA 1W7PB 1FBUA 3CO7C 2B8MA 5KVRA 4QMAA 2EA2A 4KFCA 4JBAA
chains in the Genus database with same CATH superfamily
5DZFA 4HVRA 4CUAA 2W3JA 1X82A 2JN6A 4HNTA 4ZZ5A 2BFUL 3QYFA 1RUNA 1VAKA 2WQZC 4R9CA 4RS5C 2EXKA 3ILNA 1ODDA 2WINB 3ASOH 2VZRA 2EAKA 5FD6A 1UIJA 5FLVA 3GCXA 1OI6A 2HWE2 4MXWB 3E1F1 1J3PA 3OPZA 5J4YA 3V7SA 2VJXA 2WAEA 3NAUA 2X48A 4QPYA 1BI0A 4NHYA 5FO7B 1CAXB 2XB0X 2RR13 1RUC3 3TNQA 3NV1A 1SMYF 3WP6A 4O3MA 4UUSB 4XJUA 3AMMA 1O3SA 4IE4A 2ZJ2A 3DU5A 4YG0A 1QGPA 4JGZB 3H9JA 1VNDA 2V9KA 2HWE1 3ZKYA 3W2VA 2QKLB 3OD0A 1KDKA 2ARAA 2HDCA 1NCQB 3A4CA 3IT8A 3KEOA 5IT9Z 2VMEA 2KIMA 3VBRA 4AWDA 2WN2A 4UFLA 1DDNA 4BXUA 2XIGA 4EQQA 1CZSA 3A0BC 4IZZA 2XHKA 4QQLA 2BVVA 4XYXA 1QRYA 2DFCA 4JRAA 5F2SA 2F4OB 4J6GA 5E3NA 1EP0A 1MQTB 4HOBA 1RUF2 3HTSB 4PLNA 4I0WB 1UKRA 3BROA 3WP3A 1BBT3 3CP2A 3U9GA 1JZ2A 3G3ZA 1C57A 4IV1B 2P5VA 1NH3A 4XBNA 4S05A 1G8WA 3O1UA 5DAPA 3PL0A 1DGWA 3P5BA 1QOTA 4XILA 4NRQA 3KHBA 2OUMA 4GH4A 3GTQJ 5D5WB 5DAXA 3KLNA 3INAA 2P4WA 3AMPA 2KIQA 4YM0A 4IEOA 3VD3A 3L2WA 4G6DA 1UY0A 4BQNA 5M5XJ 3GCWA 3LFKA 2XJUA 1Q8SA 1R23A 4CYCB 1Z6RA 1OQEA 3BZKA 4ASLA 1W8FA 2ORXA 3ECQA 1PO21 1H6XA 1C8NA 4F55A 1YEWA 2ZHNA 3FXOA 3CQOA 1U5XA 5FKCA 5GZEA 4A0XA 5DUVA 1O91A 4AD9A 5FGMA 3GTMJ 4MYEA 3CJNA 2P3YA 1MS1A 2QCSB 3IB3A 2OF7A 3KGLA 2Z16A 2HWE3 2D3RA 1QDCA 3NJYA 1EH6A 4GO1A 1W6NA 3R0AA 4OLLA 2J5PA 1HB4A 3KF3A 5APAA 3VZMA 4XFFA 4FT8A 1IXRC 5BY5A 2LRDA 2XXZA 2F6CA 1DLLA 1BHGA 4A3KJ 2GBYA 2XGDA 2BBVA 3P9CA 3BI3A 4BISA 1W5CC 1AU7A 1ULGA 4RMNA 4NHXA 4P00B 4R9AA 4KICA 3RPUD 1OUSA 5DZEA 3UR3C 1R1TA 1HXS2 2I8DA 4AEDC 1WCQA 1MDMB 4WXDA 4XJ9A 5EEHA 3WCRA 1S29A 4P02B 5E89A 1GKBA 4QPGA 4CP1A 1SEUA 2Z33A 4XBLA 5FY8A 1EPWA 4A7ZA 1ZRDA 3BR0A 1HDKA 3VZKA 2H09A 1PVC2 2VOWA 2DVAA 1IN5A 3ALQA 2Y48A 3TP3A 4NQWB 2VONA 2XAUA 2VVDA 4YFNF 1RUF3 2NN8A 2VKEA 2VUJA 4UUVA 1JN2P 2VD7A 3G1MA 5JXGA 1OFSA 2DQLA 4BWOA 2LR8A 2XHNA 2W08A 1SVLA 4Q0UA 4KMQA 1WI3A 3WHBA 3ABMH 1WFXA 4LFUA 5KHJA 3U21A 2JDUA 2BE5F 4JGYC 1PO23 2BUKA 1EY2A 4GMP0 3QCWA 4BEHA 3IBMA 4I30A 4RM3A 4ESBA 3VBOA 2LNBA 4QHOA 1PVC1 4XUTA 1W5SA 3WE3A 4WK8F 4Z8BA 1DU3D 4U7BA 1WLWA 2VO5A 2C6SA 2E7XA 5EFUA 4YYOA 1LEBA 2E1OA 1OPOA 4ASMB 3JBG1 3BR3A 3DBLB 1YOVB 2M9HA 3FXUA 3LD8A 2A6XA 3KX2A 3ZMOA 1ZR4A 3CTAA 3TDUC 4AQ6A 5JXJA 1DGWX 2RS12 2E7TA 1Z7S1 3GM8A 1A34A 2ZFWA 3WNKA 4QKNA 4HBLA 1OMIA 4B4CA 3JRCA 3FX3A 4Z2AA 1OD3A 2DI3A 4PI0A 2DWRA 2ZMEC 2QSGX 3MFCA 1JTXA 3CO2A 3WNXA 4G6QA 1C3HA 3M1HA 4Q0QA 5C3QA 2IS6A 5FTTC 3S2WA 5JFRA 1VAMA 5HPOA 4BXXJ 1G8XA 4ZDLA 2GXGA 5F6FA 1M4WA 3PUHA 5GZDA 5FFZA 2FSWA 2Z2SB 5H6RA 1B35B 1WW6A 4HG2A 3ZSLA 4RGKA 1ZYRF 3QBQA 3SHRA 4V2FA 3H0GJ 5LBEA 2ZMEA 2RS11 4CYDA 4RAZA 1PGL2 2IXCA 1A6IA 5C3RA 1NQJA 1TNFA 1VRH2 3COAC 1VQNI 4AYBN 4BE1A 3OYEA 4AQTA 5EGOB 4BDZA 1Y9MA 5CISA 4HZFA 4HN0A 1R9TJ 2Z5UA 3POGA 4V2VA 3W6VA 4FFGA 1HXS3 1W3XA 2FQ3A 1W06A 4JX0A 3ETPA 1DP3A 1CPMA 2Y6LA 2M0CA 2IJLA 3AFKA 1PGL1 3WDVA 4A5NA 4L5IA 3E3VA 1VRH1 4D6QA 3BTAA 4D69A 1PVC3 3Q8EA 4P14A 1UAAA 1CJPA 5CQGA 5M3FJ 1OCPA 3I2IA 5GLVA 5IK5A 2C0ZA 3MW4A 2AEZA 3TYJA 3VHNA 2I45A 2EJRA 4HDUA 3K46A 3JBG3 1HJFA 1W7PD 1OLMA 4S2HA 2QQWA 3SXWA 1RUG1 4LLNA 2XBO2 4M9ZA 4G8XA 5IAXA 5FK8A 4G4FA 3OY8B 2X1EA 2MC3A 1I3AA 4X6RB 5FZLA 1OT5A 1YQ8A 1W9SA 2VXJA 5IYYA 5JVGF 3BPSA 1H8TC 2R0QC 3IMNA 2VOKA 3CC7I 1TVGA 1DP7P 2G1MA 4JDNA 1FAYA 3NNMA 4LD5A 2WB1A 4GYGA 2XV4S 3T1BA 3LL7A 1V6NA 4ASNA 5FPVA 2L9SA 3OS1A 3CLOA 1HKDA 2LF7A 2YFZA 3OBZA 2XBO1 1W0OA 4HSRA 1OKRA 2W92A 5A3OA 3HL2A 5F64A 4BHCA 3HMYA 2RS13 2JK3A 5ISLA 3M8FA 2OCEA 5D21A 3I4PA 1D0YA 5FYVA 1ZELA 4UBHA 2JB8A 1CN1A 1GWMA 3M3CA 4KL1A 4XJZA 1N1SA 2B5HA 5K7PA 5D6EA 3D8CA 3VDCA 2ET1A 2K4JA 1T56A 1XGNA 1D5YA 1O4ZA 1X9TA 4PDKA 5KXEA 4R1HA 1L7RA 3NJVA 1GNYA 2QUOA 4NVPA 4ASKA 3KM5A 2NNNA 3KP4A 1YI7A 5FXXA 1C5HA 1X3UA 2RM22 1MMGA 3SNMA 1VRH3 4M74A 1D1CA 3BUCA 2VY0A 2W25A 3OSDA 3OUIA 5HDNA 4CEYC 1HV0A 3KMHA 4O6JA 3LOBA 5JOZA 4IGQA 5TGTA 1DQ0A 3H0DA 2EILH 1SVOA 2DYSH 1AL22 3EMRA 3ZYJB 2OD5A 2QZ2A 1KS5A 2MFZA 4Q2FA 1VMFA 4XKCA 3OYMA 5DMYA 2OPTA 3SMHA 4N90A 4O9GA 5C4WB 3PU3A 1O4YA 4L99A 2CUZA 3K7AJ 2WIIB 5M0TA 4E7JA 4MVTA 3BC8A 3BTZA 2I5UA 3HOWJ 1UHSA 3WD5A 2WAQN 5FZIA 5HOOA 2NMNA 4L11A 4IVNA 1R22A 3GXOA 1W1WE 1RR8C 1D1BA 1ZK8A 4PK4A 4ISRA 4L5JA 2K4BA 4RQPC 1AL21 1YQ6A 4Y20A 3U4SA 2JG8B 4KMFA 4YIFA 1V6IA 4FPGA 1Z0XA 2K86A 3ZFEC 2XBO3 1DQ6A 4OMCA 3KGZA 5KAIC 5CVVA 2W7NA 3OR1C 1UOGA 4OI1A 5D5VB 3S32A 2AHQA 3M4OJ 4HKWA 3GYHX 3PO2J 2ZGQA 4RQPA 2IGMA 4OINF 1K78B 3TO7A 3HSFA 2SLIA 1ZM1A 4LLLA 2QTWB 3ZFEA 2EPFA 5LY1A 2TUNA 2JE8A 3W59A 3U78A 2PELA 3VWBA 1PIV2 2K5CA 2OC6A 2R30A 1ULFA 3BOPA 4G7OF 2L9RA 1SEFA 3FZVA 3ZIWA 2W47A 3C2UA 2JA6J 1DIWA 1QXJA 2LBFA 4MV2A 4PZJA 2ZXWH 1LHWA 3GZ6A 4FVVA 1E57A 1CX4A 2IWGB 2IGNA 4IRHA 3WV6A 1EV12 3LQRA 3PUQA 2XF5A 1H2NA 2IFRA 4S2DA 4C91A 3NAPB 2BZDA 1T38A 4LOTA 3BGAA 4CTEA 3GBGA 1FOXA 4PFPA 4HVOA 2ZA9A 2QM3A 1LU1A 2Q4SA 4AW7A 1RMU2 3H9QA 5LRRA 2HBUA 4M3CB 1R5HA 4FPKA 3Q0VA 2OA2A 5JSPA 4QQHA 3PDQA 1CR7A 4U2AA 4J01A 4GJZA 1UQXA 2EZLA 2XONA 2RDSA 3ACHA 1ETYA 4ZU7A 1EV11 1W6PA 4XF4A 3H3UA 3FMGA 1XDSA 4IE7A 4XC9A 1GOHA 5A7OA 5FKNA 2DLLA 3S30A 4PQ9A 1AL23 1QZYA 1XGOA 3V42A 1MS5A 1ZHFA 3HNYM 2EWNA 1QJY2 1B59A 4HLXA 3RNSA 4OULA 4I76A 5B4NA 4BYYA 1Q56A 2VBBA 1T95A 1WKMA 5JVTA 5F5CA 2LRPA 2Y0SN 2W46A 2EIJH 3OS2A 3VB9A 4MX3A 3ZN0A 4H7LA 1CAVA 2CUFA 3KB5A 1O7FA 4AIHA 4XQ4A 1NE4A 1QXRA 4QU1A 4H3WA 2K9QA 2DT6A 5B1AH 4HNUA 2M8EA 3PHMA 2NVYJ 1YCIA 3U0ZA 3CDLA 1U5TA 1QJY1 4O9EA 4BQAA 2FEZA 1BJQA 1H9WA 1MGTA 2XJTA 4JV4A 1LOFA 2JTVA 4XNFA 4HLTA 1BR1A 1A04A 1T98A 4CCLA 4WM8C 4HBNA 3WP5A 4WXCA 2VBZA 5HS8A 3DWLE 4FOWA 4NHLA 1O4TA 3EUKL 4IV3B 1ZG3A 1CESA 3RKQA 3AP5A 4ORFA 3WGHA 1YFXA 2B39A 1GYKA 1D4VB 2GMEA 4EZHA 3IUOA 2Y6KA 4XDQA 4S2FA 1PIV3 3C8XA 1Q8QA 2D1VA 1IDZA 1XU2A 4TLGA 3ABKH 3B73A 5FWJA 3V0AA 2VIXA 1OQ1A 4UB6C 3AVSA 5HODA 4UY8I 4IE0A 2BVBA 4XJ8A 5HS7A 1S2BA 5DUIA 3A01A 3WF0A 1EV13 2XASA 1O4XA 2VMGA 5LHHA 4C9YA 2DT7B 2VMDA 2YBKA 4MEXF 2CQ7A 5HXMA 3VBFA 5DXDA 1GLHA 3B5LB 2QQPA 1RL3A 4M0HA 2O0YA 5A6ZA 1WJBA 5T5OA 1VQMI 2IXJA 3S1MJ 3WCSA 2OQ7A 2WTEA 4D1QA 3T1MA 2HS5A 4HL0A 3ZSKA 1W2OA 5HDGA 1QO0D 5I0RA 3AZZA 4AAPA 2VUDA 4AHYA 3I3LA 1OVPA 3FMSA 2VZUA 3CCRI 4ES8A 1SAXA 5F5QA 1Q3EA 4BXFA 4SBVA 4LA2A 2RREA 5ANQA 1QJY3 2W95A 2HDDA 5T55A 2BEOA 4JTOA 2HYGD 2CW7A 3SEPA 1S5LC 3HSRA 5C3PA 1RUH2 4AOCA 5BV6A 2HYXA 1W8TA 1SFXA 2XF6A 3MFKA 2HVRA 4QXHA 4OQ9A 3KV4A 4M3BA 4FFFA 3TN92 4LHKA 4KGQA 5E1RA 4V19K 4RGUA 4EJOA 1REFA 1UOFA 1HSJA 1DU6A 1MSFC 1NA1A 4OMZA 2STTA 3O0WA 4IGPA 4HNVA 3TEDA 1H1AA 2OVUA 1FV2A 4AEKA 3ZKUA 4RS5B 3J26N 5FZBA 3M3QA 1F36A 1RUH1 3SKVA 4Q0SA 3IAS2 2OPKA 3JB4C 2G9FA 4QLCU 3REOA 1V70A 3E5UA 2UY9A 3RS6A 1ZGAA 3WF2A 1MBEA 3DKXA 3Q0UA 1E0EA 2HU9A 4ZTJA 1FPN2 3DCFA 1W0TA 2PYTA 3AKQA 1ZA7A 1E3PA 1PZ8A 1AXKA 4IHXA 5FMBA 2AC1A 5CFCA 1J0RA 1G9DA 2CU7A 4RAGA 3VFZA 1V9U2 4E7IA 4AYUA 3PTRB 3HNMA 2MEV1 1TWFJ 3VBSA 1VQLI 5FYIA 1STZA 1MPXA 1OSGA 2RQPA 4XHXA 5A3MA 1XGMA 1JU4A 2LD5A 3LSMA 1R1ZA 1H9GA 4A7KA 1LPQA 1FPN1 3N4MA 2PAEA 3POWA 1UZCA 1OD5A 4JHTA 4UVAA 2IXHA 5A6QA 3ZFGC 2YBSA 1H9PA 1C8M2 1XSRA 1W5TA 2PJRA 1V9U1 1SDWA 3TEYA 1XYOA 4YFZA 1M1EB 3Q8CA 3THTA 2X0LA 4X1EA 1V55H 4DZPA 4PIYA 2KHMA 1G2HA 5T54A 4XUNA 2VG9A 2DVFA 3DL3A 4FCYA 2ZO4A 3PVNA 4E9KA 5HNHA 2Z1DA 1S0IA 1W8HA 3KZZA 1S0EA 1KU9A 3HHHA 3ILFA 3H8OA 4XN0A 2HYJA 4EM2A 1W0NA 2BV6A 4KWJA 1SANA 4Y22B 3I49A 2QUFA 3VDDC 4J19A 3GX4X 3RWKX 1RUH3 2YX4A 2KA3A 2ZAAA 1SFNA 4LG0A 5D8KB 4IXLA 3L7WA 2D2WA 3OGRA 2Q1FA 2WWYA 4PIXA 5HDKA 4D8MA 3OYFA 3VL9A 1PM4A 1YX3A 1EUTA 4CXYA 3QPLA 1D8JA 1W6NB 5IATA 2YXSA 1V6LA 1RB8G 1NX9A 1KD7A 4ITCA 2F5VA 3TEWA 3V65A 4LKDA 2AO9A 1WJ5A 3DPLC 2QQ8A 2WBMA 2JDKA 3C2GA 3N05A 5FRNA 2J22A 3URFA 3GUDA 4CDQC 1ZTRA 2WRAA 3IC7A 1V6OA 4FFHA 1H1IA 1ETXA 3RQ4A 1FPN3 1N1VA 2ZGMA 1BMV2 3QPTA 3GXUA 2V5DA 1XPWA 3IHUA 1SFKA 3PUIA 1V9U3 3J4UH 3OV8A 5DPNA 3AMQA 4BDVB 1K6YA 1UMZA 2BOIA 1ETKA 5J1YA 4AEDB 2VTXJ 4CEWB 4BHBA 4JHZA 4CXXA 5FZ8A 5BNNC 2LH9A 3CUOA 1BOBA 1XE8A 2FOWA 2HBTA 3GALA 1W6MA 3GVAA 3LA3A 5FPLA 2FD5A 2AUYA 1PHMA 1BMV1 1FNNA 2JVGA 2H8RA 4N43C 5FMDA 4MGTA 3LDBA 2A73B 2K85A 2LTPA 3FBNB 2XQXA 3M4FA 4ESJA 1S0FA 2Y6GA 1XS9A 5LHIA 4E6KG 2ZKNA 5FLMJ 5C8WA 4JGYB 5EZWA 5C3EJ 2Y69H 4YGCA 5FOJB 4C90A 2VT3A 2ZXQA 4L97A 2Y0OA 2YZ4A 3AVRA 3MLJA 3DFGA 1FYUA 1WBFA 2LYCA 3Q9SA 2ZZQA 2R062 3V8LA 2R7TA 2BOLA 1KQ8A 1T39A 2P3IA 2PFWA 1TW3A 3E6DA 1GP5A 3ZMVA 2VODA 2DYRH 3SLIA 1HQCA 3O1VA 2VBXA 3AG4H 5F37A 3T8RA 1VMHA 2P6CA 4I7HA 2H94A 4IESA 4LO5B 3WDXA 1IDYA 5FP8A 4UNOA 2GOXB 4IW3A 4PGHA 4C1XA 1K79A 3POJA 5M5YJ 1T0FA 2R061 4OCTA 1XB4A 2F5EA 3ZO0B 1IHMA 2ZS6B 2JG9C 1EH7A 4XPVA 4D94A 3TO6A 5I8SA 1QQIA 1OCZH 3PIGA 3UKTA 2WL1A 1PMIA 1HB1A 5KHHA 1LVKA 2ERFA 2EINH 2G19A 1BVVA 1BVP1 2UU8A 2XH6A 3K0LA 4M73A 1HBXG 2NVQJ 4Y3OA 3DGTA 1N77A 1ZQ3P 1OLME 1WKYA 3KV9A 3J7LA 3OOXA 4ANJA 3LSEA 4A41A 1IUFA 3JU9A 1Z77A 3RYPA 1R71A 2EZIA 3ZXEA 2VN2A 2VE9A 1K5MC 1LOGA 1X3WB 2A3XA 2VZOA 2NVTJ 4UXNA 5EP9A 1K7AA 2FD8A 2VQ0A 2P7VB 3RZKA 3VZNA 1QJEA 3S15J 1W6QA 3OBRA 1RC6A 5ED4A 1K5MA 3WHCA 2HKOA 1IGNA 4NIIA 3OPWA 2GNMA 1JGGA 1IOAA 3A23A 4AQSA 2XQRA 3K1NA 5KXCA 2YY1A 3FZ3A 3MF9A 2DT5A 1O5LA 1RC9A 1CGPA 4QWNA 2R7RA 1H8TB 3RKXA 2FBKA 1FZPB 1XBFA 2DFFA 3JAMZ 3NNFA 2R063 2GNBA 2H0BA 4L5EA 2P5LC 1QBJA 3RZGA 3UKGA 1JHNA 2RC4A 3BQZA 1FATA 2VPLA 3DLLF 1F5JA 4GYIA 2JSCA 4M71A 4PLOA 4L92A 5EV7A 1PK6B 2YMZA 4MHUA 4XXAA 1U2WA 4Q4V1 2QVOA 1U6GA 3EPZA 5JOYA 1YITI 5JSOA 1J7KA 3NWKA 1ITYA 1YS6A 4AG4A 3VYTB 1KQ0A 2LREA 1OVSA 5L9RA 4C2TA 4P9JA 4I01A 3GFIA 4L9NA 2Y33A 2JA5J 1PMJX 4JDOA 4YG2F 1GXPA 4AHZA 1YX5A 1LVAA 2CUJA 2GXBA 2HJIA 2OCCH 4BE0A 5JWPA 3G7DA 1JI6A 3ILRA 4XACA 4E8DA 3VODA 1QJU2 5HV0A 5D2AA 3ASNH 4EZ4A 1HW1A 1Z21A 3BKZA 2Y64A 1LENA 3DTIA 3DPRC 1AR71 2E1CA 3GZUC 4CEYB 1EPZA 1AX1A 5BOXA 2ZJCA 2DPDA 3RZDJ 5F7UA 2WNUB 1R4MB 3T8TA 1LHUA 4UW5A 1Y7BA 5IVCA 4AL9A 3DPRA 3PIPF 1QJU1 2YU3A 2H6BA 1W39A 4Y20B 4QU2A 2YX7A 3RZJA 3KQRA 4QKFA 2ZKZA 4M6YA 4RB0A 1AJKA 5B4XA 3GFMA 4IHSA 1DHKB 4QQ2A 3HJRA 1J1TA 2EIBA 2V6EA 2NMOA 3KV5A 4RA0A 2FHRA 3E7LA 3RIRA 2VBDA 1S8NA 2VMHA 4IOCF 4RQPB 5LA2A 3FHAA 4HW0A 4LR4A 5FP9A 5LHGA 3ZFEB 5HV4A 3VHRA 1IKQA 3ZQLA 4LA3A 5L3DA 3MICA 1Y0UA 3I8TA 3ML6A 3QP6A 5EEAA 1ONAA 4KJZA 2CGPA 1GR3A 5JUVA 3W2AA 3KP5A 4Q4V3 4W65A 1JJ6C 3NJZA 4B4RA 2JRMA 4GDFA 1T08B 2D6KA 2LBFB 2LTNA 1W2AX 5CA6A 2OIIA 1OLTA 4R79A 4A3FJ 5KHDA 2FCVA 4XRSG 4ZKTB 3V8JA 1IN6A 3BPVA 3H92A 4CDXA 5D4RA 2XUMA 1NOVA 2BNMA 2VXDA 4KDPA 5K4LA 3ZYRA 4AI9A 1KU3A 3SQOA 1O3RA 4XOGA 4KWKA 2VT2A 1JOPA 1BL0A 1AR73 3E1SA 2HWD1 3MWMA 2HZTA 1XC6A 3HOVJ 3DQVC 1NG0A 4HYEA 4ZYAA 1ZRRA 2WS92 4KH9A 4FAHA 2QSHX 1XX5A 1K5JA 2EXIA 3WGIA 3N9NA 5JLVA 2WDBA 3OYNA 3PJYA 3FF5A 3AYCA 2IPQX 3HSEA 1Z7LA 3VD7A 1QJU3 2HPIA 1RKWA 4CZZA 5JPMB 4UW3A 2E7AA 3TRSB 1AX2A 4IHTA 1LNSA 3EETA 2NYXA 1C1FA 3EJKA 1M06G 5DM7F 4B09A 4EN8B 1GVDA 4KU7A 2VZSA 1WLDA 2WS91 4LBMA 4ZYHA 3FLTA 4FPFA 5GAGJ 1D7PM 4TXWA 2FMYA 5CU1A 4NWWA 1D5VA 1O3QA 1JHJA 1ON1A 3AB0A 3KCXA 1YQCA 3U1XA 2C26A 4UYBA 4NR1A 4D7SA 1A8MA 3HN1A 1VB4A 2JDZA 3AXDA 1OYWA 1LGNA 3MV11 2IXIA 4RS8A 3WU1B 2ET7A 2FDKA 1FV3A 1T6BX 2CAVA 4PF1A 3ZOBA 2IC1A 5GP9A 2ZGNA 1CZTA 2VQAA 3EYIA 3MEPA 4LJHA 1KU2A 1OLRA 1UU5A 1GICA 5CYVA 3PJRA 1G3SA 2MH9A 2E2JJ 3OYLA 1VBE1 4FPYA 3M7AA 2E7WA 3LIGA 3I2OA 4WM8B 3WZ1A 2XGXA 5EG0B 3ZYPA 2OZ6A 4ZTFA 2GN7A 2HWD3 5A3TA 1L7LA 1AA7A 1T6GC 2Q1MA 1FBUA 3LQCA 4M01A 3U11A 1XPXA 3BJOA 2XJPA 3U07A 3D5RC 4AYBA 4M6XA 4EV0A 1UF2C 3K2ZA 1W04A 4XQFA 3VKFC 2PMWB 3GZTB 1DQ1A 2K7LA 1HA8A 1J2XA 1JH5A 3SISA 4FOYA 2YG0A 1JZ4A 3OEBA 1NT0A 1WCUA 2R1DA 4A3LJ 2WS93 3PFIA 4BU2A 3K75B 5DAVA 3GTKJ 1A6CA 1MW7A 2W48A 1K42A 5FBJA 3FISA 2VE8A 3QOEA 3UGFA 4D9JA 5H9QA 2QZ8A 2CHHA 2J1TA 3DP7A 5EPAA 2QDNA 5LWBA 2QGUA 1OCTC 1WJDA 3A21A 5A6XA 2BY3A 1ULOA 3PIOF 1HJGA 5FY5A 2G0EA 5TJJA 4UFKA 1FNYA 4K20A 3CCLI 2WY7Q 3N9LA 2ARCA 2OYZA 2MHFA 4XIOA 4ES9A 3UESA 2E71A 2MG4A 1B09A 4YEJA 4RB2C 3JSOA 1U0JA 5A1AA 1DYOA 1FMWA 3THCA 3SEQA 2ZAHA 4XCAA 2KT0A 3N9OA 4HA8A 3AFGA 2VQGA 3FXQA 2H0VA 1U9NA 3HOUJ 5L3CA 4M0NA 1U5IA 2XDVA 3RJ2X 3ONQA 4NDLA 3MEXA 1WMFA 4ZYDA 2B7EA 4LOSA 1XSVA 3NEUA 3CIHA 5LD2C 3D5SC 4D6SA 1SPPA 4V2WA 3V8KA 3L1PA 5FZ1A 3BZCA 3FKIJ 2J7MA 2WYFA 2ENRA 4BGDA 3J8F2 2PMZA 2XJQA 5F2WA 2ZJRF 3QRFF 2C24A 5FYTA 4KMUX 3PQKA 1UKGA 2A05A 3ZN4A 4HPKB 1O8SA 1MD0A 2GA2A 1NKGA 3PLQA 3IIAA 1OOPC 3ON7A 1A31A 2V73A 2OPWA 2DCEA 2NVXJ 1SACA 2ZHLA 4COYA 2PHLA 2NNYA 1ZRCA 4UXAA 3FIWA 1DGRN 1MZ5A 4GULA 5JR7B 1WRJA 3J8F1 5EZHA 1BXHA 2O8KA 1IPKA 3LEMA 5FUNA 5JZGC 2PAKA 2CV1A 2UWBA 4E7LA 2WWSA 3WDYA 4KQ7A 3OYCA 3GW2A 4XIKA 2DO7A 3CDZB 4IQPA 1X3ZB 2UWCA 3ZFGB 4QDSA 4YW3A 4PCQA 3OYAA 1EAH2 3IM0A 4ONUA 3NQOA 2WAQA 2ZGPA 1Z6TA 3I3QA 2CO5A 1QJX1 2Z99A 5FYYA 1WW5A 1FJLA 1UZYA 1GSLA 5IOZA 4P5HA 4LORA 3L2CA 4EJWA 5FYUA 2F5DA 3AXEA 5L3BA 2VZ3A 1ZLJA 2JRTA 5KAFC 2EBIA 3I97A 1RINA 1CX1A 4M3FA 3VDDB 1IO2A 4FTHA 2K46A 1LKXA 4K2EA 1MH3A 3H1YA 4YG6A 2I10A 3WNLA 4V1PA 3CJXA 2A7AA 1AHSA 4AWXB 1KONA 1YI9A 1BIAA 5ICEA 4W6WA 3GF2A 4YM1A 4L9BA 2XLFA 5LLQA 4YVWA 4EM1A 2IFWA 3T2OA 5FYSA 2R042 4DZJA 1G9CA 4P08A 1QHHD 2ILMA 1ZLKA 1W90A 3VBHC 5IFPA 1TTYA 2G4IA 4B8EA 2MLKA 3J8F3 3UT0A 3O0XA 1IUYA 2V1DA 3VB2A 2IT0A 3PIJA 3K77A 1NZCA 2ZX1A 1F15A 1Z0HA 4KU8A 4CDQB 3MBWA 2VZPA 4AHWA 1MIJA 4S0HB 2ZJQF 2VVFA 1YLFA 2DTYA 1YNAA 1YFHA 2Q8KA 4UF0B 3O6BB 4WVMA 3OGJA 4AI8A 3LSPA 1ZRFA 2R041 4AF9A 4Y24A 4IEXA 4AZZA 4EEFG 4MGKE 3I58A 4XAAA 5F08A 1R082 1CWPA 5L7OA 3CJIC 5GALA 1D8KA 1WD4A 1MMSA 1QJX3 4LHSA 4AVPA 5LGUA 3RVHA 3NO8A 1PO12 5BNNB 2VJIA 1BEV1 1NLRA 2QQVA 3BIWE 3IH4A 3D0SA 5FUIA 1MBJA 1JTZX 5FYHA 4CSWA 3GF6A 3WG3A 3NKGA 1US3A 1SLTA 2CGOA 1X9PA 3CJIA 3NNLA 2KJBA 4L0PA 2Y0SA 4DUXA 1LFPA 1S2KA 3J7AY 4N43B 4A44A 5FQ0B 4UT5A 4BDYA 1QNWA 3JZVA 5K1YA 2DDBA 1R081 3CKHA 1BJZA 1UMHA 1ODNA 4NBQA 4HSTA 4CPBD 4E2GA 4ZONA 2CRGA 5JI9A 1FBSA 5DAQA 3JB8A 4FTEA 2FX0A 1PO11 3PMEA 3RPQA 4B3AA 4HG6B 1UG2A 1RUD1 4B4QA 1AKHA 2RVAA 5K5QA 3DPUA 4KISA 2FXAA 4CDUA 5HCFA 2QE3A 2ECCA 5EJ1B 4YM3A 3V7RA 3E0JB 4R9BA 4CDGA 2DBIA 1PP8F 5L3GA 4LK6A 3L00A 5A3WA 1SLLA 5DN2A 2VJ5A 3SYTA 2RDNA 1TWGJ 4AFAA 4CCEA 2BWCA 3TGNA 2PHWA 2IS4A 1HKTA 1PMHX 3AG2H 5C8CC 1GNZA 5FZFA 2R7EB 4HXCA 2K3FA 2R043 5IP9J 3KZ4C 1HC8A 2OA4A 1JUSA 2ZXJA 1LCLA 1IJWC 5GZCA 3AKSA 4RGSA 3H1CA 2NRAC 2JG9B 3AYAA 2DFEA 5J09A 2VVEA 2BGCA 3VOEA 2FNAA 1IRGA 2GN3A 1REPC 1ZBE2 1TME2 2YUEA 3HBLA 1UN1A 3K4BA 2Y60A 3KFWX 5C8CA 4G9SB 3R4UA 5EYXA 1BEV3 5I0TA 5L36A 3C7JA 5ACA1 2KIUA 2Q8CA 1O8PA 3I5UA 5IW0A 1OJLA 1UU4A 1BC7C 5JIUA 1ZN2A 4CDWA 4XLPF 4OIRF 1HQWA 5HCHA 4PF5A 5ERIA 3VYSB 2OQRA 1W6QB 1R083 2E63A 4BQXA 3BJAA 1W9FA 3JTHA 1AYN1 4WXHA 3UNGC 1ZBE1 5AONA 1JTYA 4D7MA 5LGNA 1PO13 4KNCA 4GJYA 1RUD3 3IPVB 3NNGA 2L54A 4K40A 3O14A 4FPEA 1ND2A 4NJ4A 1X4PA 2E1MC 3K4MA 1AX0A 3AZVA 5J3LA 3I3EA 4NHJA 3PSIA 1HCRA 1T8IA 4ARYA 1HW2A 3PNAA 3WHUA 5FJKA 3AKZA 5I8YA 4QTRA 3VYUB 3LDKA 3PNYA 4A3ZA 2WKKA 5EEGA 1MSEC 2A75A 3H8XA 3FUQA 2IS2A 2DVGA 1GZWB 1YIJI 1SMTA 1FC3A 1I1SA 5IVYA 1X33A 4E2QA 3LEGA 1YRNA 1C28A 2JDAA 2W9XA 5CLSA 2M5WA 1E5SA 3ES4A 4AAXA 2OT7A 4OHVA 1BR2A 2KRFA 2ZGUA 1YJNI 2R7FA 3PUAA 4DUVA 2VTFA 1QIQA 1LEMA 4C30A 3UKVA 5B3SH 4BOWA 4A3DJ 2HOAA 4P9XA 1PUEE 5JMOA 5LEJA 4AVAA 2A6ZA 4B1LA 1QGLA 1IZ1A 5BQTA 4HQMA 5K7HA 3T30A 3ZXLA 1NCRA 4RGAA 1NY72 4ENKA 1Q8VA 2ZEZA 3Q0WA 1CONA 3KIOA 5HS9A 5H9SA 2GU9A 4OMYA 2KISA 5FFXA 1AYN3 3HPGA 1OQYA 1ZBE3 2RS31 4I3GA 2X09A 3ZR6A 3IH2A 1ACIA 4DEVA 5F9TA 2XSJC 4YVSC 1LR5A 4I0BA 2QDRA 3DPRB 4WM7A 4PLMA 1S0BA 2AQEA 2P0WA 2BDRA 2PG4A 1S3JA 2X5IA 3EYYA 1JT0A 3UGGA 3TL4X 4Y33A 3G71I 1YIFA 2P5KA 4V2GA 1PX4A 3SDBA 3ERMA 2JMWA 1W8UA 3WDUA 1LHNA 5T5LA 4XOTA 3Q9OA 4E70A 1EH8A 3RTRA 2LS6A 4HANA 1JYVA 4HLYA 1OXCA 3O2PE 2LW8A 3LB9A 1HN0A 1X1BA 3LIHA 3LEIA 4UBGA 3RZZA 2EFNA 4OUSA 1US2A 4MHGA 2CMPA 3M3OA 5D6FA 3CZUA 3LF7A 3VHPA 5BPXA 2EF6A 2GP5A 3F9KA 2PX9A 2K0GA 2ZHKA 4HF1A 2DMTA 3V64A 2X85A 2YPJA 2NOJB 5H6QA 1DF0A 2P37A 4QX2A 1FY7A 2AREA 3MPBA 2WBKA 3E6MA 5EDNA 3CUQB 2RS33 1TMF2 3VDXA 1JKPC 2Y6HA 3K4NA 4JCKA 4LMFA 1SAUA 4PJMA 5DG2A 2J1UA 3ORJA 3AMHA 4QSHA 3ZGKA 3CF5F 5D1IA 2R0HA 2CW0F 4Y7NJ 2E6VA 3WUCA 5FLXZ 2VH9A 1QH6A 4BHPA 3JD72 2DPUA 1R091 2HOEA 2EAAA 2HWC2 5FLXK 3LSTA 5JXHA 5FMOS 1R1UA 5KHGA 2WA0A 4HKLA 1Y8QB 3WU0A 3C3VA 4LPLA 3KHCA 5K5OA 1TMF1 1UL9A 1FP2A 3S17J 5FY1A 1QF3A 5CQEA 3KPHA 4DOZA 4CUBA 1JJ8C 4L0YB 3F6OA 2GC0A 3DEEA 1A36A 4CUCA 1F43A 3U10A 2JDPA 4UW4A 3HOZJ 4FHTA 3KLSA 1S4CA 5F8PA 5I91A 3CLPA 3JD71 5BS6A 2HWC1 4PGGA 4BBSJ 4PT6A 2ZNYA 2JDNA 3H7JA 4Q8KA 1H4GA 4RDUA 2ZC2A 5ILUA 1BIBA 2K2SA 4XLEA 4EGYA 2XJRA 2Y6FA 3F8BA 1STMA 3GEZA 1J3RA 2DOFA 4CH7A 4NNJA 4D5CA 2V4VA 2CW8A 2GA1A 3TBIA 1BQPA 2ID6A 2M7BA 1TNTA 4EE2A 2QLZA 1REDA 5GLUA 5E6HA 4EN7B 3OPTA 4AIKA 2GC2A 2CV0A 2LKPA 2UWMA 2WO3A 5CVIA 4ZS3A 4X8PA 4RGXA 4XVHA 2PAMA 2DFHA 3LGRA 2W0XA 4IEWA 3O1TA 3P9IA 1NUKA 2W94A 1WA6X 4EWDA 3HUGB 2KZGA 3FBYA 4IEVA 4I99C 1MMAA 3BCBA 4MGZE 3HBKA 4YSFA 4MZUA 2VXZA 3APBA 1R093 5HCAA 2FRHA 1LHOA 1U9OA 3FC0A 3K70C 2R6QA 3MKZA 3MCZA 4LBLA 2LSOA 4KITB 5F1JA 3N36A 1ZBA2 4MHRA 4FXKB 4LMYA 1P6RA 1TMF3 2WAFA 3FN9A 4H14A 4AQ2A 5IOYA 2ELKA 5AC91 3POBA 2RDPA 4G12A 4FAGA 4PBOA 4C0BA 4AHXA 2AEYA 2XPUA 1EKEA 3LKJA 4PDWC 1Y6IA 5KNLA 4NN0A 4AVVA 3JD73 3H9GA 5D8AC 2HWC3 2KZVA 2JB4A 3GZEA 4Z82A 5E17F 4KNYA 3VGIA 2EXHA 1ZBA1 4TSVA 2FZ2A 1OR7C 1S0GA 3SZTA 1RUJ2 1OBNA 2GC3A 3IDBB 1SLAA 4PDWA 3CZ6A 1BN5A 3UETA 2R16A 3VN4A 4B8XA 3VZJA 3FUOA 5JOXA 2JKXA 3FBMA 5H20A 2F4LA 2ZXIA 4UV9A 4B43A 2XRLA 1E5HA 4BJ5C 2XUBA 1WCSA 4NPLA 1G9AA 2Y8KA 2MW8A 1I3HA 2RAEA 4ESFA 2RGVA 1AVBA 3DLAA 2QQIA 2R93J 4FTBA 2CUEA 1KEXA 3NL1A 2A3YA 2UXNA 3AKPA 1RUI2 3ZMTA 3GZAA 5HNFA 2BW8A 4P1WA 2W52A 3WTYC 4MQVA 4BMEA 2L01A 1EJ9A 4MH0E 1JYCA 5T50A 3LDRA 2EH3A 4UOJA 5LRSA 4RYDA 4IEPA 3AAFA 4A3IJ 1FOD2 2OQ6A 3WG7H 1CVNA 1A35A 2IAIA 3VBUA 4L0ZB 3RMYA 3O1PA 5LZ6A 2FCTA 4UV8A 2M1BA 4HRIA 2PA7A 1RUI1 1XB9A 5DCMA 1E5RA 1LEDA 3ZQGA 1VALA 2OUHA 3H50A 2QYOA 5L3EA 3WEZA 2Q0OA 4HOOA 1EV7A 2P6SA 2NYYA 3OGVA 3H5AA 2EB7A 4WZCA 3WTVC 3F21A 2R5ZB 1S0JA 3W58A 1OOPB 3AL6A 3ES1A 3A4UA 3VSKA 1ZBA3 3WTUC 2DYCA 2DN0A 1WLTA 3T3YA 1MZ6A 4IRGA 5A32B 4Z07A 1FOD1 3ACFA 3EBRA 2O8QA 3KYCB 1QNTA 1OA2A 5C70A 1K83J 2HQRA 3SH3A 4JK1X 3ETQA 2VI6A 1A5JA 5JZGB 4H55A 4CU8A 2A61A 3KF5A 2PHTA 4IKFA 3K9TA 4IXAA 2JDYA 5FKKA 1JKOC 2Q8EA 4Y5SA 5K0UA 4D7TA 3POYA 3LE0A 3HBZA 5IVVA 2WWJA 3JRAA 2XMLA 1RUJ3 3AP6A 3K51A 3EQLF 3F8CA 1IS6A 5FUPA 2VLAA 4CP2A 2X1DA 2YU1A 1TG7A 1OPMA 4PJYA 3IH3A 2PHRA 1JYTA 4UVCA 2EIDA 2VOXA 1XMXA 2I2SA 3J81K 1ETVA 5DUUA 3DCQA 1V0AA 2JA8J 5T5PA 4CU9A 4LK0F 5GAEJ 3JRHA 2WT2A 5EZGA 4QGNA 1GQPA 3O1MA 3RPUA 4RB1A 1UJ8A 3MKWB 1KJRA 1X1AA 3F0CA 1RUI3 2ZCWA 4Q47A 1AUYA 3BB6A 5F5IA 1GVJA 3WW1A 1LOEA 4P9WA 3I53A 4WV8A 5FKBA 3ZQ7A 2I07B 1UCRA 3CCSI 1PZ7A 2M4KA 2VU9A 4DRVA 3H5NA 3WQBA 4ET7A 3VBRC 1KU7A 1ZA4A 3ELKA 5J4VA 1DZQA 2X6WA 4ZXKA 1BI3A 3NWTA 3EHKA 3VZLA 3VUOA 3VBHB 4XUOA 5FZDA 1FOD3 2X51A 3ABUA 2XUEA 3UK9A 3N7MA 4BK5A 5FY0A 1X1DA 5JDBA 5BXXA 2DW4A 4QPQA 2A6EF 3H3VK 3RZLA 1DZRA 4YGDA 1LKNA 1F9KA 1UO9A 3IL2A 1JZ5A 5DDJ2 3DECA 3WX5A 5EJZB 3M07A 1FX7A 2VQCA 3NW4A 1G7YA 2LM3A 4NUBA 2XKOA 2DK8A 4FQGA 2DFBA 2BNOA 3WQ0A 2ZEXA 2Q8DA 1U12A 2P5BA 2LF8A 4OOIA 1EYBA 1LDDA 4R8HA 4GH4C 4Y1UA 2WZEA 3KQ4B 3USSA 2YU2A 1LGBA 4Y1XA 5GZFA 2M8GX 3ZN6B 4ZY9A 2QWWA 5E18F 3W3CA 3BTIA 4G9YA 1L3LA 1OCOH 4DXRA 4CGZA 4OMDA 1PO22 2Q2EA 5DDJ1 3V4GA 2Z9OA 3IAQA 5C9AA 4ZS2A 2FDFA 5GLTA 4YIRX 3ACGA 4LULA 1CAUA 2W1WA 1TQMA 1JGSA 3FE5A 5ICGA 1D1AA 4RR3C 1B1BA 2E33A 3HOSA 2J1EA 1JYXA 2L7MP 1UYYA 5F27A 1FOKA 3K4KA 4QQPA 2HEWF 4KYWA 1HB3A 1WJEA 3I2KA 1DQ4A 4D3WA 4CCJA 1FPQA 4K8RB 5A80A 4NB5A 2VMFA 3CHXA 2VNOA 4AM3A 2F4IA 2DCKA 2XPVA 4AVSA 1W3VA 3EO6A 4RR3A 2CV2A 2QENA 5FZOB 2BGOA 3EYPA 3BR2A 3J80K 4YNIA 3J7NA 4AEJA 4YPJA 3P3PA 4COVA 3N3HA 1B9NA 3H8UA 3SZPA 3BR5A 2VQTA 2IA0A 5ABJC 1QWRA 3JQXA 4JQRA 2DU9A 2JXAA 3RGBA 2O9LA 1F4HA 1KYZA 4ON0A 3FJSA 1KS4A 3ZPLA 1RVF2 3TBDA 4AR2A 2JSPA 2XG3A 3I55I 4XXPA 1AJOA 4E7KA 3CQZJ 1OCCH 1V6JA 2ZMNA 3PUSA 2HZDA 2PQSA 4FPCA 1B72A 2VL8A 4BM8A 4QPIC 5ABJA 3EUAA 4QPGC 4XFIA 1AXYA 4DFSA 1ULCA 4JKKA 3IAM2 2VBPA 1WGPA 1GLNA 4D7NA 1BW6A 1I1GA 2GM4A 2RE9A 2W68A 4ZH4F 4B44A 3W20A 5JXIA 1AF9A 4ENJA 1FBQA 4RGRA 1W36C 3S6PA 5AIQA 4AFMA 1W7PA 1S72I 2JECA 3SEEA 2WFF2 4UFMA 3OMYA 4LJZF 1K12A 1RVF1 4QPIA 5DDJ3 1E3HA 3OCPA 3G6JB 3AYDA 3THDA 4KT5C 4M6VA 3ZXGA 2VOOA 1OH3A 1JXNA 4MGYE 3WG1A 4NAMA 1GHCA 4FASD 2DMPA 5GJ6A 5IAVA 2ZFUA 4L9TA 3VBOC 1PP7U 2A69F 3TNPB 3LAJA 4PHZA 3JBG2 5BYNA 4W50A 3FXMA 2JDMA 3LQQA 3N7KA 2QQ9A 3ZYFA 1RKTA 2WFF1 1MACA 2V26A 4YLZA 5FZ9A 4HKOA 2EIEA 2VMIA 4CCCA 1Z7S2 1CAXA 3LNQA 3UJQA 4DW6A 3HEIA 3I7DA 4UUSA 4AVCA 3PVBB 3S7IA 4JGZA 1TWAJ 1UYXA 1VPHA 2FMDA 2E1MB 1NCQA 3JW4A 2CFXA 1JW6A 3AX4A 3EUHA 2VQLA 5A3LA 2XR4A 4B1MA 3KYDB 1WMXA 5LW9A 4P9IA 2DJNA 4IV1C 2F4MB 4A4AA 3MLLA 1SLBA 2RJLA 4GFBA 4F7ZA 1DBNA 2W1OA 4MTEA 1F8VA 2D6OX 1V54H 1LE8A 3BOWA 2ME0A 3AG1H 3K4CA 1MQTA 1WD3A 3J9SA 4UVBA 4FOVA 5ICCA 3O0VA 3IDCB 1TNRA 4EM0B 1PYVA 1H88C 1LDKB 1U8BA 4NC6A 4BL0B 4IV1A 1FSHA 1YFYA 4BQWA 4JYKA 3DTEA 2R1BA 3WVJA 2GAUA 1R49A 1AR92 1L0OC 1RVF3 1YJ9I 1P8JA 3ABZA 4J25A 4RFRB 1POGA 2CWMA 5ILVA 4PJ0C 1S55A 2M30A 1WVRA 2BU9A 3PM1A 1DGRA 3BQYA 3AKTA 4Q4W2 3IWZA 2FJ1A 4XURA 4P9FA 1FWZA 1ODMA 1OYYA 2VL4A 1XD7A 4LBJA 3GTOJ 4CYCA 4XUPA 1XGSA 1CAWB 3WDWA 1K61A 1HW5A 1RUG2 2PN5A 3HB9A 1AR91 2WFF3 1FLIA 4IRIA 4QXCA 4NROA 3AJZA 3S8PA 2VC0A 1IV8A 3WW3A 4YVSB 1IG3A 1VBD1 2WZPP 2CTVA 2E34A 3TW7A 2NM1A 1UY3A 4CCMA 3KETA 3DU6A 4I98B 2CYYA 4Q4W1 4FISA 2HTSA 3LSJA 3C7EA 5CEHA 3T2QA 4DEQA 1BM9A 3HZJA 4BQ1A 2XAHA 3MAJA 1MJAA 1YJLA 2ZNZA 4Y1VA 2HPMA 1UIKA 3SFIA 2R5YB 2UYBA 2GMPA 1PDNC 2O61A 1Z7S3 4ARXA 4L8QA 1PNGA 1XNCA 5IPAA 2YB7A 3FFQA 1SLIA 3USUA 5BNPB 3V56A 3ESWB 5FZ7A 1YTYA 2GIVA 1UPIA 4RLQA 5FKOA 2KMUA 4LLGF 1OFNA 3OIQA 1J59A 4ABZA 2AS5F 4LLOA 3GTLJ 2VOVA 2CH0A 1A78A 4NQWA 5GAHJ 5IT3A 2JD4A 3ZXKA 4RBOA 4KG0A 1I6HJ 5KWRA 1UY2A 4URAA 1S9HA 3OS0A 2Q5TA 5F3CA 4DY5A 1W6OB 2JD9A 4EVIA 2FMLA 4MSVA 1AHDP 1HLCA 5FO8B 4O61A 2YBPA 5LK5A 3VD4A 5HXVA 1AR93 2Y31A 1Y56A 3PTYA 2W00A 3RCOA 1IG7A 2WABA 3SEZA 3ZQCA 2DA4A 3NARA 3BG3A 1VBD3 3NV3A 3MF6A 1X36A 2CDOA 3FMRA 1VQ5I 4ZPIA 1FYLA 1P4AA 1E3OC 3OYBA 5F5AA 1VQ6I 4Q4W3 4I02A 4KBBA 1VIWB 5A33B 1CF7A 1SFOJ 2J5OA 1TZOA 1PNFA 5C44J 3IKWA 5DZGA 4J1XA 5AFBA 2XC7A 1I9RA 3CO7C 2B8MA 3ATGA 4KFCA 1RUG3 2L5QA 2KRHA 2F48A 4MEYF 1LOBA 4IJAA 3J7MA 3JCUC 4N4NB 4GKXA 3WTXC 2XB5A 2DTWA 3MZ8A 5DS9A 1UY1A 3WDTA 3I3DA 5DTDA 2GP3A 3MIGA 5FZCA 2VE1A 4DUWA 2LDUA 4IEUA 4JQFA 3JXSA 3OYKA 2QF7A 3A0HC 2GSYA 4M9SA 4BA6A 1B35A 3S7EA 4DYCA 3ACIA 4ATEA 2X6YA 3ZXFA 4IQJA 3BPZA 3ABLH 1YFWA 1AXZA 1J09A 4C1WA 4IOAF 5C3SA 3S0MA 4DZGA 4N0BA 5EGOA 4XABA 4B1RA 2XROA 1JKQC 3MYXA 4RAYA 3FLRA 5K5RA 4G94A 4UI9L 1X1CA 3HAGA 2DDUA 5T3NA 1JUIA 3CJQB 4A5MA 1NTCA 3M3YJ 1ULYA 3BTXA 3CJTB 3M70A 3HRMA 2LFBA 4GQ7A 2LP0A 2BVLA 4GD4A 3K6GA 4QD2A 3TAYA 4HDVA 1UX7A 1WI9A 5GADJ 1XXNA 2O8OA 3GHMA 2EQRA 4LT5A 4Q1RA 1GBGA 1O5UA 1DLCA 3DYOA 2QBXA 3QD6A 1JOJA 3LSRA 5F3IA 2EK5A 2AENA 1H4HA 3Q9VA 1YYVA 5LCWL 1OYIA 2UWAA 4MXVA 2EA7A 2DA2A 2YC0A 2MC4A 1H2LA 5A1LA 3SC7X 1KJLA 1VLNA 2V9VA 1N3OA 1WCKA 1RUE2 5FP3A 4FETA 4YARA 4BPZA 1Y4WA 2CG4A 3OY8A 5BNQA 4C3IJ 2K27A 4M3DA 1B9MA 2VCMA 4LBNA 1X4OA 2HQ5A 4LUKA 1LDJA 5ICFA 5HLIA 4II2A 4UW6A 5A7WB 4Q5OA 5EQUA 1YW7A 4PDWB 2GOMA 1SD5A 1RI7A 1I5PA 5IK7A 3T1LA 5FZHA 1OF3A 5D8AB 5HBAA 2JIGA 3VKOA 2YPDA 1UNBA 3T2PA 1SHWB 2R7DA 1RUE1 5B2GB 3ST7A 2GNDA 5I93A 3WNNA 2KKOA 3I2JA 4XE9A 1S0DA 1HDDC 4MGSA 1WMEA 2V1UA 3ECHA 3P9KA 2X10A 3LWFA 1U5TC 4OHZA 2MNGA 4XLAA 1CQ9A 4M4RA 3ECOA 2N7GA 1LOFC 2DA1A 3FHQA 3EB7A 1H0MA 1KGSA 3P3NA 1CD3G 3DF0A 4Y26A 2LG4A 2VASA 2DDAA 2RVCA 2ZGOA 5LB6A 4CP0A 3BG5A 1NXMA 2VGDA 4W6XA 4E27A 1VQ9I 1ENRA 3CZJA 4Q29A 5IK4A 2VMCA 4DGWB 4P9YA 5FOBB 5L9VA 4LBQB 4UHTA 4ISQA 4AGVA 3HTUA 5CVUA 2PMUA 4COUA 4MO7A 3ZXDA 1Z91A 3THPA 5C4WC 4GA9A 4AI3A 4RAFA 4WVWA 3C7HA 5FCCA 4HX4A 1UYZA 4MFEA 3UNPA 1I5ZA 2VM9A 4X6QB 1JYNA 1TT5B 1SFYA 5BNOC 3VZOA 3S3MA 1VP6A 4N7IA 1C5IA 3ERED 5C4WA 3AKRA 4OI4A 3VBFC 4YIIA 3DV8A 2BY0A 4BY1J 1NYWA 5HLGA 4A7YA 2RKHA 2R7QA 1ALYA 1LEAA 3HXLA 4CA9A 4L18B 4MGIE 1IGOA 1TE1B 3OUJA 5FPAA 3HR9A 2VNRA 5BNOA 3CCUI 3BWGA 2L4AA 2JG8A 4YGEA 2DA7A 1OFCX 3O3KA 3DXTA 4ZJZA 1RUE3 3UYJA 5BPDA 1JZ3A 1N3QA 3KT4A 3AC0A 2PQQA 4JX5A 3MLKA 5J48A 1XNKA 2P17A 2WJSA 1VI0A 5C33A 5LK7B 1MS4A 3ZXSA 1K78A 4YGBA 1W0PA 2WZ8A 3OUHA 2VC9A 2WLQA 3BTJA 2OAZA 4H0EA 1ZH5A 2O7OA 5LY2A 1XSDA 2WNVB 3BCWA 1F35A 2Y9ZA 2E19A 4IPAA 3S14J 4K9SA 5CYYA 3B94A 2X9DA 5CZKA 3WLUA 3CCJI 4EJTA 2JJ7A 1QKQA 2QFEA 3M7GA 2IXKA 3CLQA 5FKLA 3VD9A 1GV9A 2QNKA 2W87A 4E7ZA 4NOTA 3SCGA 5FY4A 1FIPA 1RXGA 1NA1C 3WSOA 2XAGA 4GWNA 2B4KA 2NS0A 1IAWA 5J40A 2JA2A 1V3FA 1LGCA 2A3WA 4JX4A 3NAPA 1U0AA 3AP7A 4GALA 1JUMA 3RDIA 5FXVA 3S93A 4XFHA 5FYBA 3I2FA 4LO6B 4KBZA 1MEC2 1ENXA 2XKPA 2JE7A 4HMZA 2VZ1A 1OCRH 2IEKA 2FE3A 4Q26A 4BQ4A 2D5HA 1O6UA 1N25A 1S0CA 4M3CA 2CSGA 5E16A 1YXWA 2L02A 3OR2C 2Y75A 2XWJB 4AI0A 3H8RA 2K02A 3WW4A 1V5GA 1W4MA 4F83A 3PO3J 3UJOA 1G6NA 2MEV2 3HM5A 3ZPYA 5CFCC 2O3FA 2VUCA 2D44A 5F3GA 5FY7A 1MEC1 3S5QA 1P7JA 4F3JA 5K7ZA 4HFSA 3MHZA 3VBSC 1XN7A 2ES3A 1VB2A 1OKOA 3VBRB 4A3XA 1H2KA 5E3MA 1Y43B 1H8AC 3D4KA 1WGXA 3R4KA 3U14A 1SDDB 4D0PA 4QX8A 2ELJA 2MYSA 2STWA 2P4EA 1XQNA 4B48A 3FHNA 1GOFA 5M3MJ 2JJ6A 5DUXA 1QXPA 3GDBA 2AZ5A 1VTNC 3KV6A 3I71A 4XR6A 2V4JC 4MFDA 2C6YA 4F91B 1FT9A 4DIQA 3P6BA 2F4PA 2IVJA 4Z1VA 2BXYA 5FFOC 1YQ5A 3LEKA 1HKSA 4D0QA 5FZGA 3PVOA 5EWSA 5FZ3A 3TEXA 3WGGA 4LHLA 3ZRGA 3DXJF 4GH4B 4BQ5A 1UMIA 4XW3A 4DOUA 3CNAA 1J1LA 3WF1A 1R1VA 3L2RA 5CPRB 2XSDC 1R4NB 4A6SA 1F5FA 2XGEA 5E3LA 2KLOA 3TOAA 2Y2ZA 5L9BA 2XVGA 1HOMA 1XSQA 4TWTA 2D43A 1MS0A 1PGSA 4AFDA 2A5ZA 2CS3A 4FFIA 1DU0A 1TNSA 4HK8A 4NHKA 1RUC1 1XNBA 3ZN1A 4BKXA 4QKDA 3S1NJ 4KN4X 3U37A 4IEYA 2OUJA 3SITA 2OS2A 2P7CB 1K4SA 1UOJA 5IYBJ 4QX0A 1USTA 1MEC3 4Q4X2 2V09A 1ZREA 3NV4A 3K4DA 5EIYB 1SFPA 4LKFA 2NQYA 4OWRB 5IVBA 5IY5H 5BMZA 5E1WA 4XIDA 4MIMA 4COWA 4LO4B 1E5IA 3BYWA 2VECA 1R7JA 3HKZA 3OSFA 1QY4A 4XDOA 3OL3A 4AGGA 3NVCA 3DXUA 5ABJB 2JVHA 1URXA 2RG4A 2VNGA 2CJJA 3Q3SA 1VBA2 2MEV3 4LNVA 3ZMDA 4ZU4A 3HOXJ 1IN4A 2MBFA 5DCFA 1XC5A 5E20A 4Q4X1 1UZVA 4GIQA 1T2KA 3QYEA 4XMYA 4A6EA 3SZGA 4R4ZA 4DS0A 1JUHA 4QPIB 4QPGB 3QU3A 1JT6A 3G4SI 2EV6A 2VJJA 2BVMA 3R4SA 3L2HA 3UL2A 1KZHA 1SMVA 3ACLA 3MIEA 2DMQA 4IDZA 3ZYHA 5J3UA 4M3CF 2TRTA 1U8RA 1VBA1 5SV8A 2EFPA 3BR6A 2B45X 2D6LX 4JKLA 1VJ2A 4N8MA 4OIQF 2WADA 4JAAA 4OU0A 3E5QA 2JENA 4OYUA 4XLHA 5JCTA 1J58A 4XF0A 4RS5A 2K3PA 2Q0AA 4BEHB 5IWFA 2TCTA 3VBOB 2CWEA 2WFPA 3AYEA 1Q8OA 3HGGA 4TYSA 3X29B 1QNYA 2HYFA 2JQ7A 1ND3C 5LEKA 1GUIA 1XCBA 2LMDA 4NC7A 2EFWA 3HRUA 2AGSA 3GLXA 2ZX2A 1WHUA 3RZOJ 2Z42A 1W05A 4URTA 2ZB9A 3ZSEA 1KITA 2UZKA 1WBLA 3RI9A 5IT9K 3DEMA 3H42B 5EXOA 3HQUA 1LE8B 4IETA 4LBQD 1QJZA 1ND3A 4C8DA 4DXTA 5DUKA 2A5WA 1UAIA 1T0FC 2VPRA 4MGRA 4RA2A 2W57A 3F23A 2VAUA 4ENNA 4OI2A 4DY3A 4XDPA 4AVBA 6PAXA 5KK1A 4E4DX 1GZCA 3MV01 3M1CA 4EJUA 1YLLA 3MKLA 4Q4X3 1XNDA 3PSFA 3ZFFC 3KP6A 5FXZA 3ISPA 2ZMEB 4N9IA 2CNAA 1Z67A 1T6SA 3OD4A 4LQRA 1SFUA 4QAWA 4BBRJ 2KXLA 3MMYB 1RUF1 4Y52J 3G6EI 4XM3A 1VBC2 3VL8A 1QA6A 2OJED 2NXNB 3VSLA 2ESHA 1VBA3 2ZGTA 2CYFA 3ZFFA 5KXBA 1GP6A 1LAJA 4HT1T 2HXOA 5F04A 2W2IA 1YE9A 2D98A 5FPZA 3VLBB 2Y9YA 4Y22A 2D3SA 1N78A 1VQPI 1WJCA 3QACA 1GV2A 3TP0A 1V6KA 3ZVXA 3A0KA 3EDPA 2A6TA 1ASJ2 3I4MJ 1U5YA 2X53S 4FE7A 3H1WA 1VBC1 5F3EA 4LK1F 2ZGLA 3OYHA 5F0FA 2ZX3A 2M3AA 1P7IA 1X8EA 2RDQA 1ZRIA 2ME6A 1OLQA 3L9FA 1D4M2 1YG2A 2TEPA 3B01A 2V7FA 3HOBA 5JR2A 2BJSA 2W84A 2EIGA 4A12A 1U78A 1QPMA 4RL7A 4AIJA 2Q30A 4IQ4A 2PHUA 1H9TA 1ZX5A 2COBA 1ASJ1 1IRXA 4HEA2 2ADDA 1SQ4A 4OUEA 4PCRA 3USUB 1RYYA 2FBIA 1ZKGA 3QLQA 1TC3C 1D4M1 4Y5Z0 4G7HF 1UD1A 3H7YA 1AL0G 3N7LA 4CEWC 3ASIA 3LPFA 2QCOA 2OZUA 4Q4V2 2F2EA 4BE2A 2VTXA 1BW5A 2GZWA 1GANA 2WAOA 4JTNA 3E97A 2HI3A 2BWAA 4A42A 1ZZBA 3NRVA 4UWDA 5F6LB 4DPNA 2ZGSA 4DYRA 4Z92B 1DGLA 2E36A 1A3KA 1BLZA 4DRRA 4YZ5A 3ABTA 2K9LA 4HF2A 4AEDA 3WY6A 4CEWA 1HXDA 3PUFA 1UZZA 1RETA 2LKSA 2JPBA 1YYNA 1MVEA 1HXS1 5A3UA</