4N9IA

Crystal structure of transcription regulation protein crp complexed with cgmp
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
202
structure length
202
Chain Sequence
b'DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catabolite gene activator
publication title Structures of inactive CRP species reveal the atomic details of the allosteric transition that discriminates cyclic nucleotide second messengers.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator
total genus 62
structure length 202
sequence length 202
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4n9iA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4n9iA01
4QLCU 1U2WA 5D5UB 3KZZA 5LEJA 2UXNA 3W6KB 2NYXA 4EJWA 4CICA 1QWRA 2EV6A 2HZTA 2OBPA 3SHRA 4BHBA 5KHKA 2FNAA 5HLGA 4EMSA 3F6VA 2IC1A 3Q5FA 4PJYA 4IJAA 4ASNA 1YHFA 4HV5A 4B09A 1XMKA 3K2ZA 5IT3A 3WTVC 1I1GA 3PQKA 3ETQA 2IA0A 1OI6A 4GXOA 5T3NA 4Y17A 4LLOA 1XRUA 3QP5A 3USSA 1OMIA 3C3WA 3L00A 3EHKA 4MUVA 4Q29A 2C0ZA 3RIRA 5TJJA 2HQRA 5ICFA 2P4WA 3KP4A 3V7RA 1WSUA 3GO5A 3AAFA 3PVBB 3CUQA 2HOEA 1X82A 4PDKA 4RAYA 4HLYA 3WW2A 3TOAA 2UXXA 4XF1A 3RZZA 4LA2A 4HQEA 1ZRRA 4D7SA 1H9GA 3Q9VA 1S6LA 2EA4A 3DPLC 3BOQA 4Y13A 4Y15A 3K1MA 3HYIA 1J5YA 4G7OF 4CZZA 1IPKA 1Y9QA 4MEYF 2VOOA 1HQCA 3V8LA 4HBLA 2EFWA 2CAUA 2L4AA 1OPCA 1YW8A 2AXLA 2QNKA 5E18F 1J7KA 4AIJA 2D2WA 4KN7X 2QVOA 4G8XA 1ON1A 3QACA 4MTDA 1MZBA 3EDPA 2FQ3A 2RVCA 3RKXA 4EM0B 4UBGA 1YYVA 2M45A 2ZNYA 2QBYB 1K78A 3ZPLA 3B02A 4XLNF 1IN7A 3H7JA 4GGGA 1UHMA 3F22A 4G7HF 1T2KA 3E3VA 1R1VA 4KIBA 1FSHA 2DQLA 4M73A 3FM5A 1CAWB 3SZTA 2F5EA 1J59A 2M8EA 3CF6E 1F9NA 4FT8A 1BI3A 2QM3A 3ULQB 3GZ5A 1IN5A 2ESNA 3IRQA 2RN7A 4MGRA 4B8XA 4MEXF 1HSJA 1FSEA 5BMZA 1U5TB 4Z07A 2IVMA 2XAJA 1QBJA 4I2OA 2E7WA 2VONA 3IKTA 2GQQA 3KCCA 4LLGF 3H1WA 4HVOA 2B0LA 2BV6A 5D5WB 1F4KA 2YPRA 4HN0A 2GIVA 1HKQA 5HLIA 5BQTA 2QQBA 5K1YA 2GU9A 2ZJ2A 1DZRA 1ON2A 2K4JA 3IDBB 1ZZ8A 5C6CA 2QENA 2JZYA 2FXAA 3BPZA 3MZHA 1UIJA 3HRMA 2GZWA 3HSRA 4M71A 2UYBA 1OFNA 2D93A 2K02A 1W7PD 3ELNA 1EH7A 1FWZA 1FZPB 5I0TA 2IW5A 2M87A 4M72A 4A5NA 5CADA 4HSJA 4E70A 1USSA 3HRSA 1T6SA 2A68F 3P9IA 4P5OA 3R6SA 3DKWA 1W7PB 2E1CA 4AVAA 1Q43A 3MDPA 2DCTA 4MQVA 3UKVA 1IXRC 3FMQA 2DU9A 3T5XA 5H20A 5ICEA 5D5XB 1RNLA 1UW8A 2MH9A 4QGNA 5E1XA 5HS9A 1ZRFA 1YFXA 3SHFA 5J8FA 2OU2A 2P7CB 2A61A 4EWDA 2PQ8A 4HA8A 5AONA 2VBYA 4M9SA 4UVCA 4O3MA 5E20A 2P6SA 4CHUA 1S7OA 1JXSA 4HX7A 2JT1A 2W85A 1Z05A 1B6AA 5FFXA 1XGMA 3BJ6A 5JFRA 1O3SA 1UPIA 4IF4A 1XSXA 3WODF 1YLLA 4LEJA 4YYOA 4XFHA 2KXLA 4HYEA 4WCGA 1RZ4A 2HKOA 1YS6A 1RI7A 4ZYGA 1BM9A 1Z6TA 1MD0A 3C18A 1LR5A 5LRRA 5CVIA 4HLXA 1WA4A 5E16A 2V1UA 5KBFA 2GA2A 2V1XA 2VT3A 1BC8C 3QPHA 1T38A 5CLSA 4ONUA 3RI4A 3WW3A 4H7LA 4RS8A 4OIRF 4ENJA 4A0XA 2PFBA 4E2SA 2F5FA 4O6JA 2Q4SA 3QAHA 1ZLKA 4WVZA 1BJAA 3ABTA 2O1QA 2NRAC 4K2EA 4QM8A 1QY4A 1O57A 4HN1A 5FLIA 4QWQA 1R1TA 1ZAOA 5DV5A 3F21A 4EGYA 2OA4A 1CF7A 2G7UA 4IRHA 5LRSA 5LHIA 2PAMA 1IN6A 2BGCA 4RAZA 1K7AA 3EQEA 3U10A 2W57A 4MHGA 1ZN2A 3U9GA 4BH9A 2PMUA 1U8RA 3LAJA 3ES4A 3WW4A 4KYWA 3JW4A 1OYWA 1FBUA 4OOIA 3BCWA 2BNNA 2CGPA 1ZYRF 4EWAA 4AQ6A 1A04A 2STWA 3O14A 1CAUB 4P55A 3R0AA 1O7LA 2OZ6A 2A07F 2E9QA 4Q0PA 1R5HA 3PQJA 3GFLA 5FD6A 2Y0MA 2EFPA 4PIYA 1E2XA 3WGHA 4M6XA 1TW3A 1YLFA 2GAUA 5F64A 2ZMEB 1IXSB 4I98B 3VHRA 5I93A 1QZZA 4HV6A 5JSOA 3FM3A 1JGSA 1YFUA 5HI0A 3MYXA 4RGRA 5E1ZB 1MJBA 3HSEA 3GBFA 1FT9A 2FBIA 5JCTA 1KYZA 3CJXA 1XGSA 1H1MA 2JPBA 5KHGA 1KQ8A 2FQPA 2A3SA 1T39A 4I0BA 3CUQC 2B9UA 3CLOA 2L02A 3HTUA 2FEZA 3KETA 4LUKA 1I6XA 3DV8A 3C3VA 2IXKA 2ISZA 4XSZF 3NKTA 4I3PA 2K9ZA 1IRGA 3WTUC 3F72A 3RYKA 1ZZ7A 2XAQA 3GEZA 3CLPA 2EB7A 4OINF 3TKYA 2IXIA 4PZJA 1HXDA 1FI2A 4G9YA 3WTXC 1SAXA 3ML6A 3T8RA 4ETSA 2OZJA 2FOKA 4L0YB 1BI1A 4OIQF 4META 3I71A 4QGLA 1K6OA 1MJ9A 1F5TA 4Q0SA 2YX7A 2Q0OA 1U6GA 5DD4A 1CX4A 2ZFWA 3SQNA 1KU2A 4AVCA 4R79A 3L9FA 3J81Z 1PMIA 3WGIA 2D5FA 3FXUA 5FB2A 3LFKA 4J1XA 4ZU5A 3DEUA 4Q0QA 3LOIA 5LGTA 1KU7A 5FPXA 2QQ9A 2WC2A 3I59B 2O3FA 3BALA 2MHFA 1B59A 3WTTC 3ZMUA 4YSFA 5L3BA 3SCGA 4F8AA 2RV8A 1RTVA 1UD1A 4DQ2A 2XAGA 4I01A 5JI6A 1BIAA 4HQMA 5HDNA 5BS6A 1F1ZA 4MV2A 1R7JA 4MTEA 1KQ9A 2FMYA 1TLHB 5E8GA 3SMHA 2P5KA 2I45A 2XGXA 2MBFA 4ZU7A 1IN4A 2XAHA 2YSRA 5DCMA 1ZGJA 4Q5SF 2JSCA 3RYPA 3UKTA 4IETA 2CWEA 3KLOA 4TLFA 2QCSB 3I7DA 1W5TA 5K5OA 3WU0A 2W24A 3ERED 4G94A 3U11A 2RGVA 5A2QZ 5FLHA 4DINB 3KGLA 1TNSA 1VTNC 1R1UA 2EK5A 2OZUA 3U2RA 3HQXA 2IT0A 3FMSA 3D5LA 4PGHA 3K69A 1BI0A 2RC4A 5LGUA 1BC7C 4Q0VA 4UV8A 1YUDA 3JTGA 1IN8A 1USTA 2OD5A 2CW0F 2OAZA 1Z1DA 1LDJA 2VODA 4XSXF 2H94A 4UVBA 1Y3TA 4IEWA 5I8SA 2E7XA 1CAVB 3H3ZA 1KU9A 3QPTA 2N7GA 2XROA 4A6DA 2CYYA 5DDGA 3BY6A 5K5RA 3KZYA 2HTJA 1H9TA 2ET1A 4BHPA 4AWXB 2ZKZA 3FE5A 5L3FA 2QVSB 3H9AA 1GVJA 3GW2A 3HT2A 4D0PA 3I64A 2LDUA 1IRFA 4JV4A 1GXPA 1E17A 4J1WA 2JTVA 3BU7A 5JAXA 2FBHA 2LKPA 2CQKA 3E5QA 4IEXA 2DK8A 3K1NA 1SEFA 3OGJA 3ZMTA 1RC6A 2W25A 4IERA 3CJNA 1TBXA 3JSPA 5K8SA 2BBYA 5FFZA 4CXFA 3FX3A 4U0YA 5I0SA 2PG4A 4MGIE 5HDKA 1W5SA 4BXUA 2BYVE 2DQRA 3O2PE 2LF8A 4EJOA 3E97A 4ON0A 4LMYA 5J48A 1G3SA 1IAWA 4LLNA 2PAEA 1VJ2A 3TNQA 1I27A 3BJOA 3WGGA 4P9UA 4NHJA 2TDXA 5EEGA 4XF9A 2IP2A 3I0TA 3TO6A 2XRNA 4IRIA 1OD5A 2FSWA 5DCFA 4RB3C 1XD7A 3ZN1A 2ETHA 2HS5A 4MX3A 4KN4X 2DW4A 3GX4X 4G6DA 3LA3A 3F3XA 3TO7A 3IWFA 3GLXA 4AD9A 3J81K 2IA1A 5LGNA 5LLQA 2H6CA 2CG4A 2VPVA 2RKHA 3HUGA 1I1SA 3HRUA 2EV0A 2QYOA 3C1DA 1B4AA 2Z5UA 4KA4A 2F5DA 1K79A 2H0VA 1SFUA 1EY2A 3MEXA 3KGZA 4RGXA 4EQQA 1S7AA 3FXRA 1HW1A 1JHFA 4BNCA 3CO6C 4WX9A 2W84A 1PM7A 1R23A 3VOEA 1BIBA 5ICCA 3FHZA 4XFCA 4IHSA 3E6DA 4MQ9F 4H0EA 5HS8A 3SXYA 2V1DA 4X6RB 2D5HA 2XVCA 5FD5A 3ZMVA 4KNYA 4GYIA 4L2NA 3DQVC 1MKMA 1HBXG 1PUEE 2OQGA 4UV9A 3KE2A 3GZ6A 2UZKA 1EH8A 3K0LA 4QXKA 1NZCA 1U3EM 4FAGA 1J2XA 4AXOA 1SD6A 4XFBA 1KGSA 3GFIA 2RNJA 2J5PA 5HOOA 2M1BA 1CGPA 2A6HF 1ZH5A 1LDDA 5A2QK 3U1DA 1REPC 2DT5A 3WE3A 4FX0A 2KRFA 3TNPB 1RL3A 2V6CA 1XCBA 1B9MA 3CO7C 5K5QA 1O3TA 1LEBA 1CAXA 4AQ2A 5DD8A 3BP8A 3S7EA 2MC3A 1YIOA 3EYIA 1PP8F 2NS0A 3BROA 5BXXA 4LG0B 5FQ0A 3ZN0A 2GXBA 2EVXA 2Q2EA 4AIHA 3L09A 1VP6A 4EM2A 2KJBA 1RGSA 3IBMA 3QU3A 5LHHA 2Y48A 1T0FA 2H6BA 3V4GA 5F6FA 5J3UA 4LK0F 3ZQ7A 2GC2A 4A12A 4CYDA 4KT5C 4KMUX 4RB2C 2X0LA 1B1BA 2RQPA 4ZH4F 5ILUA 2XLGA 3F8BA 1QXRA 5BPDA 1ZNPA 1SMTA 1FXZA 2EAAA 2ET7A 3JAMZ 3ZP5A 4WXHA 1FYLA 2OQRA 1D3YA 4JVAA 4IEZA 1ZX5A 1UCRA 5LEKA 4KU8A 2COMA 3RPUA 3KP3A 5HS7A 2XASA 3V8JA 2QZ8A 3FWEA 1YW7A 5BV6A 1WI9A 4ENMA 3CUQB 1FYMA 3R4KA 2ZKLA 5EEHA 4P9GA 2L4MA 2ADUA 1FY7A 3IC7A 2O0YA 2DI3A 1P4WA 2HQNA 4KIGA 2FNPA 4ZZLA 2P5VA 3P9CA 1J1LA 3L2HA 1P4XA 4HX8A 5KHJA 3CDHA 4PIXA 3ECOA 1O3RA 3E6CC 5D1IA 3CO2A 1QQIA 4MH0E 4ZYEA 4UUVA 1ZLJA 2JPCA 3QRFF 2VC1A 3HTSB 4HVRA 4GYGA 1SMYF 2ZCWA 3OOPA 2F4PA 1R00A 1DGWA 1FBSA 3MZYA 1IF1A 1JHHA 2MNGA 4NQWA 4IXAA 2D1HA 3ZMDA 3V7SA 3IL2A 5D6FA 1TQ5A 1G3TA 3EYYA 4LTAA 1K78B 3SCFA 2Z9OA 3TO9A 4LD5A 2VOPA 4EJVA 2A69F 3J80Z 4LB5A 5DYMA 3HT1A 2HKXA 4A0ZA 2EV5A 2FU4A 1ZG5A 4XF3A 2GA1A 1ZRDA 3GXOA 5D4RA 4MNUA 2F5CA 3FZ3A 1GXQA 2EWNA 4I09A 1U5TC 2VE9A 2NNYA 2HTSA 5BOXA 2MLKA 5KHHA 2HWVA 4WK8F 2HEOA 2D45A 3EBRA 1Q3EA 4YIFA 3PLQA 1ZG3A 1TQIA 4IHTA 4LGWA 1EYBA 2JRTA 3H1YA 1X3UA 3GFMA 3KP6A 3DL3A 3MFKA 3FHIB 4P9FA 4Q48A 5E8IA 4XEZA 1NHAA 5JSRA 3LA7A 5J6XA 2DTRA 2D1VA 3GFJA 3IDCB 1KA8A 3RNSA 2PI0A 5H6QA 3TDZC 3PFIA 4YNIA 2HGCA 2Z99A 5I8YA 3F8CA 4HF2A 2Q1ZB 4BAYA 3F23A 3NL1A 2Y0OA 3QOPA 3B73A 3RDIA 3G73A 2K7LA 1JUHA 3NQOA 4F7ZA 1L3JA 4U0WA 2L01A 5BUVA 3P7NA 4LUMA 3U0ZA 2DPDA 4JTOA 4Z2YA 2UY9A 5E1WA 2O6GE 2Q0AA 3FXQA 3LSTA 4LFUA 3EUHA 5ICGA 4U7BA 1KYWA 2V09A 3M8EA 2VBXA 1QZYA 1ZVFA 2A5YB 2XKPA 4R1HA 1LNWA 3P9KA 2CO5A 2Z33A 2FF4A 3BDDA 5BY5A 4ESJA 3LA2A 2VBZA 3F8FA 4MZUA 4A2UA 2MD5A 3JAMK 4IEUA 4WWCA 2G9WA 4A0YA 4DNCA 4OMYA 2GXGA 3CEWA 5I0UA 1MJAA 4RB1A 4XBFA 2O61A 2M30A 2HFHA 4E2QA 4KFCA 5IT9Z 5AIQA 1ZZ9A 3HRTA 1XGNA 3SZPA 1ULYA 2MA3A 2HJIA 2FRHA 2ZXJA 2O8XA 5ILSA 1J0RA 1FOKA 1QNTA 1Q1HA 2P7VB 3HSFA 1D8KA 5LBQA 3GF2A 1UCXA 1OYYA 1S8NA 3E6BA 3MAJA 4FHTA 3SFZA 3FZVA 1IPJA 3M1EA 4XETA 5EFUA 5AIPA 2VXZA 1DP7P 1WWXA 2DFIA 3EJKA 4XLPF 4N9HA 4EWEA 2KKOA 2QDRA 4NVPA 4BIFA 4U0VA 3IIAA 3TGNA 3WTZA 3LZZA 2ZBKA 3I4PA 3OV8A 1JE8A 1XE8A 2GC1A 4L0ZB 4IEOA 1B9NA 1ONVA 2FA5A 2GWRA 2QBYA 2FMLA 1NXMA 2RDPA 5CJ9A 1S29A 4LA3A 3JSOA 4LULA 3H8UA 3M70A 4IEPA 1WRJA 3F8MA 4ORFA 4Z82A 3J80K 3I54A 2VQAA 1PP7U 1CAWA 2DLLA 3ZMSA 4IVNA 3BWGA 3LQRA 4FAHA 5FPZA 3GYDA 3JTHA 5D8LB 1SQ4A 3R61A 3DF8A 3K9TA 2PQQA 1YWKA 2O8QA 2D40A 5D8KB 3ST7A 1U5TA 5EZWA 1O7FA 5FDBA 2HYFA 3S7IA 1D5VA 1VR3A 2K0GA 4UHTA 3IKVA 4OIPF 3DFGA 2IXCA 3ROUA 4KDPA 3F8NA 1HSTA 4BQAA 1WGPA 3DN7A 1U12A 2J5OA 2XV4S 1FP1D 1G4DA 2P6TA 5CYVA 3ZDSA 1EH6A 2X4HA 3HOSA 4LG0A 4MGYE 1XMAA 3Q9SA 5KHIA 1FC3A 4LJZF 1W4MA 3ISPA 5H6RA 4YRDA 1H1IA 2PEXA 2LNBA 2YX4A 4QX5A 4FX4A 2VN2A 4Q47A 1O4TA 1RUNA 2XL9A 2KIUA 2ESHA 3JZVA 4L18B 3ES1A 2BNMA 4PGGA 4I0AA 1PDNC 4MGKE 1NE4A 1P6RA 3KLNA 3T0YA 3KSCA 3L2CA 1W7PA 1YG2A 2YU3A 4D7TA 4YIIA 5D5VB 2IXHA 3IWZA 1BI2A 2PHDA 3UKNA 2UYAA 4O9EA 2BEOA 2MH2A 1X8EA 1HW2A 4U88A 1RUOA 4M74A 5IT9K 4XF0A 3I58A 4I7HA 3EETA 1SD5A 5JVTA 3RPQA 4S04A 1EV7A 2PFWA 3HHGA 3N97A 1R58A 4OIOF 4QGMA 3KEQA 3WU1B 2P8TA 3NJZA 4PCQA 4P96A 4YFKF 3MCZA 3LWFA 4KWJA 2WWYA 5DEQA 1Z91A 1HKTA 3ABUA 4GO1A 4Q0UA 4FBFA 3K1PA 3O3KA 3L7WA 5DUKA 4XFIA 3WW1A 2V9VA 1I5ZA 3WE2A 5ILVA 2QJVA 1DDNA 4KWKA 3E6MA 1SD7A 5I0RA 1X7NA 1YS7A 4JK1X 4JQFA 3FMRA 3R0JA 4IEYA 1Z6RA 4HW0A 3G3ZA 3GYHX 4WZCA 5JHUA 1XB4A 4TV7A 3IHUA 3C7JA 1LDKB 1EPZA 4YARA 4ESFA 1LRHA 2EFNA 2OPKA 1OR7A 1WLTA 3WTYC 4UXNA 1UHWA 2WV0A 4UBHA 4K8FA 1YFYA 1BOAA 3FJSA 2V79A 1Z9CA 3DP7A 1FLIA 2IXLA 4CDGA 2GC3A 1FX7A 5DCMB 2PN6A 1FBQA 1ZG1A 1EP0A 3GVAA 2ELHA 2HYGD 3VB2A 1MDMB 4Q4ZF 1WQ2A 1IZ1A 1R5GA 3TDUC 2CAVA 1XCVA 1MGTA 2IPQX 3RJPA 4YFNF 4S05A 2XL7A 1G3YA 2PA7A 4E2GA 1FNNA 4M9ZA 3BB6A 2IRFG 2EFOA 4RGUA 5I8TA 1BBYA 2PBIA 1LKNA 2XUBA 4JBAA 1CAUA 2CFXA 3R60A 2EFQA 3BZ6A 3J7AO 1TNTA 5D6EA 3EQLF 4IPAA 1X8MA 2OA2A 4A6EA 1BN5A 2CV6A 4RB0A 4HF1A 1H0MA 1J3RA 2H27A 2ZMEA 2R3SA 1V70A 3LAGA 1UIKA 3WG9A 4HF0A 4CGZA 2VECA 4L5JA 2OYZA 4L9VA 1FP2A 5BPXA 2ZNZA 1YQAA 1QPMA 2HR3A 3V8KA 5FCCA 1QXJA 3LQQA 5JSPA 4BYYA 4HBNA 1R22A 3BJAA 3RYRA 3G7DA 4AVBA 3M8FA 5D4SA 4HAMA 1L3LA 1DUXC 1GQHA 1J3QA 1ODDA 2FE3A 4I02A 3OF1A 2VC0A 4WXDA 3ACLA 4G6QA 2CSOA 2QLZA 5L3GA 4ENKA 4HMZA 1L0OC 5C8WA 2QQAA 1HKSA 1XN7A 3HIFA 3OTFA 4AIKA 1FPQA 5I91A 2PAKA 3V7CA 1Q5OA 4EVIA 2F2EA 3RKWA 3T1BA 2E1NA 4HDVA 3TQNA 4RD7A 3MQ0A 1QGPA 1ZZBA 2VE8A 3D82A 2BE5F 4IEQA 2Y75A 4L11A 2L54A 1ZARA 3HOTA 1LQ1A 1LVAA 5FO5A 2DBBA 1ZZCA 3W6JB 1ZRCA 1SFXA 3RTRA 1ZGAA 5FLJA 1FYKA 4OFGA 3KP2A 5E17F 4XFGA 1SFNA 4ZYHA 4HZFA 1LB2A 3I59A 4LB6B 5L3EA 4U7DA 3D0JA 2KIMA 5E1RA 2IXJA 1LJ9A 2PTMA 1TQPA 1QO0D 3COAC 1AOYA 3D0SA 5CVRA 2VBWA 2BNOA 1XGOA 4ESBA 1Y0UA 3CL1A 2EJRA 4ZYDA 4IESA 2ISYA 1AWCA 1T98A 5JR7B 1GHCA 3SCHA 2O03A 4HOBA 2GC0A 5HVQC 1P2FA 1UB9A 3DPTA 1DZTA 1ZZ6A 5F1RA 4EM1A 1J58A 4QM9A 5CU1A 2B8MA 4CO8A 2DPUA 2DK5A 4EJTA 3NVCA 3KFWX 1G6NA 2LF7A 3NW4A 1IXCA 2A6EF 3OD0A 3S0MA 1V3FA 1SFEA 3H3UA 1V4RA 4X6QB 3ZMZA 3MPBA 2Q8KA 3NSTA 2PYTA 3F6OA 1O5LA 2PLYA 1YTYA 2H09A 4LK1F 3BPXA 1KU3A 1XSDA 1GQGA 4NB5A 5ED4A 3WTWC 4WBBA 2PHLA 5L3CA 4L9TA 5FLXZ 4XRFA 3H50A 3M7GA 4R52A 4UXAA 3NEUA 1CAXB 1STZA 2ATFA 2P5LC 4RGSA 2HDCA 4ZU4A 4KL1A 4N9IA 5ERIA 3LWCA 2XLAA 2IA2A 3FF5A 3ELKA 2DAOA 2VT2A 1XDSA 5FQ0B 1TTYA 4A5MA 4UVAA 1XSVA 1CAVA 5CVUA 1IUYA 4GCVA 3ECHA 1D8JA 2ZO4A 2QUFA 2XIGA 3BPVA 2XAFA 3VODA 4R8HA 1XE7A 4EGZA 3EO6A 5J8CA 4QMAA 3NRVA 2YR2A 2K86A 2NNNA 1TQMA 3I53A 4L9NA 2UWMA 4YFXF 2MPFA 2Z2SB 1HW5A 3GWZA 5J7MA 1DPUA 1Z7UA 2M5WA 2XKOA 2KJCA 4KMFA 4XFAA 3GUDA 5FGMA 2Z3YA 1SD4A 4AVPA 4KWLA 1LEAA 3S2WA 4YG2F 4KICA 4HDUA 2GH2A 5KVRA 1YFWA 2QWWA 4XF4A 4IEVA 1TW2A 4BHCA 4HX4A 1NYWA 1O3QA 1NE6A 2WFPA 1O5UA 1XDUA 2PMHA 3H7YA 1ZHFA 2LSOA 3M9AA 4O5VA 4JTNA 5L3DA 2K27A 1S3JA 3QP6A 3H92A 1J3PA 3I5UA 2ACJA 2AS5F 2P17A 4EV0A 4ENNA 3CUOA 1DPRA 3KP7A 2Z69A 3O6BB 2Q30A 1ZREA 4MGZE 4OLLA 2WTEA 4EJUA 2PJPA 4EROA 5BPIA 4LLLA 1KQ0A 2NAZA 1YFHA 4ZZDA 3WTSC 3REOA 2XLFA 1P92A 3M3IA 1IW7F 1UFMA 5AVPA 3VEPA 4N0BA 1DGRA 2R7DA 5CVVA 4M9XA 3RKYA 1U78A 3TOBA 2EA2A 1J75A 3CTAA 1WKMA 3QU6A 1OYIA 5HLHA 1YO5C 2MLGA 3HHHA 4KUMA 2STTA 4L9JA 4PIZA 3OCPA 5TRDA 3VFZA 2ETEA 5CVJA 5DUIA 4HSLA 4KU7A 3KMHA 4L5IA 3E5XA 3N4MA 1J9IA 5JR3A 2UY8A 1R36A 1CF7B 2R7FA 5HDGA 5LHGA 2KIFA 2EA7A 4GULA 4HVQA 4HLTA 4M6YA 2K4BA 1RIOH 1C0WA 3E5UA 3H1MA 3LAPA 2FBKA 4KIFA 6PAXA 2L3DA 4IRGA 3FFQA 4OMZA 4XFFA 2B5HA 3KP5A 1MDMA 4WXCA 2G7HA 4O9GA 3KEOA 2C6YA 2IJLA 4WF2A 2DO7A 4G7ZF 3PNAA 1G3WA 4OU0A 5KK1A 4B29A 3DXJF 3SXWA 4UNOA 5FLXK 2XHKA 3MWMA 1OKRA 1YW9A 1P4AA 3IRRA 3T8TA
chains in the Genus database with same CATH superfamily
1MEC2 5D5UB 4UFJA 2UXNA 1G9CA 1VBE1 4AEMA 2SLIA 1PK6B 2HZTA 3SHRA 2XPJA 4G3YC 5KHKA 2FNAA 1OLRA 5IW0A 1F31A 3AMHA 3CKHA 4ASNA 5ACA3 4HV5A 2DA4A 2LRPA 5IT3A 3WTVC 3P6BA 3KD4A 3ETQA 2DCYA 3BCAA 5T3NA 2RS11 4Y17A 4LLOA 1KQRA 1XRUA 3SDBA 2W0XA 3NNFA 3S30A 4MFDA 3EHKA 2C0ZA 1GOFA 2YFZA 5TJJA 5LASA 4D5FA 2E31A 4PK4A 4JRLA 5IVYA 5HODA 3KP4A 5JOYA 3KB5A 1WSUA 3AAFA 1AR91 3RQ4A 3E1SA 3D4KA 5FY1A 2HOEA 4HRIA 1MMAA 2L7MP 3QYEA 2D3RA 2XB5A 4LITA 2RR13 3CESA 1N77A 4BJ5C 4HQEA 1WW4A 1S1AA 3PUHA 4EEFG 1GICA 1JT0A 2RS13 4Y13A 3K1MA 1HRV2 1J5YA 3VZJA 4CZZA 1IPKA 2XB6C 2ZXIA 3R4UA 1Y9QA 3MV11 1HQCA 3V8LA 2AQEA 5CQGA 1WUVA 2CAUA 2L4AA 4PI2A 1OPCA 1YW8A 2AXLA 4QHBA 2VL4A 2X6XA 2E33A 1O8SA 4KN7X 1GZ9A 5F0CA 3GGLA 1GOGA 5EWSA 1Y9MA 4XE9A 1RUF2 4QPIC 3OIOA 2A5WA 5EG0B 4MADA 1FMVA 3RKXA 3J7ZI 1UYXA 1LHUA 1RB8G 2NVUB 2XJUA 4M6VA 2WAQN 3MLLA 5DUUA 2W48A 2M9HA 5CISA 3E0JB 1MBFA 3HEFA 5A3UA 1WBLA 3WLUA 1V6MA 4G7HF 1T2KA 4M73A 2D97A 3ZYIB 2W39A 3L9JT 1T33A 2NM1A 3JREA 5IP7J 5I0DA 2F5EA 3CF6E 2JE9A 1MR5A 1BI3A 2QM3A 3VD5A 2RJ2A 3VBHA 2WAFA 4E7HA 2XJQA 4MEXF 1FSEA 1U5TB 3JD73 4A7YA 3AM2A 1UAAA 2XAJA 4I2OA 3AP5A 3W2AA 2P2KA 4CEYA 1DF0A 4LLGF 1LGBA 2GDFA 1V6NA 4HVOA 3ZR8X 3UL2A 2B0LA 1RVF1 5J1UA 1V9U2 5HLIA 4YFZA 4CP2A 1F35A 1FYUA 2CL2A 1L7LA 2XPUA 3CCLI 2EIEA 3T1LA 3TW7A 1TT0A 2CHHA 1COV1 1GZTA 3QH7A 3X2QH 5D8AC 1ZZ8A 5C6CA 2QENA 1LU2A 2JZYA 2YHJA 3MZHA 1MMDA 1UIJA 4ARYA 3HRMA 2GZWA 3HSRA 4COZA 4M71A 2UYBA 1OFNA 3ZIWA 4S2DA 4OWRB 4IO9F 4UFLA 2IW5A 1OCRH 3IAM2 3ZQQA 1I3AA 1T6SA 5JXJA 1RUD2 1PYVA 1V5FA 4P5OA 3RCOA 1ZA7A 4NHYA 1F8VA 1Q43A 1FJLA 3MDPA 3VL8A 1PZ7A 1JKPC 1KDMA 2DU9A 1SVMA 5L7OB 1YRNB 1UW8A 5HS9A 3LSDA 1YFXA 1OA3A 4N7IA 4ZZ5A 4KNCA 4PDWB 4A3LJ 2OU2A 1AHSA 2A61A 2PQ8A 2TNFA 2VBYA 1CJDA 2LTPA 2P6SA 4AAXA 2Y64A 1B6AA 5EGOB 1V6OA 5JFRA 3VDDC 3AC0A 4IF4A 4LOTA 3WODF 4W4ZA 1P7JA 2R7TA 2CYFA 3WF1A 4HYEA 3DBHB 1RZ4A 1ST8A 3GTJJ 1RI7A 4QPWA 4DUXA 1BM9A 1LR5A 4IXLA 4ASKA 5CVIA 3AKTA 3TN91 4AF9A 5E16A 4DQAA 5KBFA 4RA2A 2V1XA 1JKOC 4XICA 2ZS6B 5CLSA 4ONUA 1YRZA 3RI4A 4XKCA 3GXUA 4OIRF 5EDNA 1OUXA 2WB1A 1ENXA 4E2SA 5FIXA 2F5FA 1YQ8A 3L2RA 2LREA 1BJAA 5IOZA 1LE8A 2O1QA 5EF6A 3FXLA 3GTQJ 2VW0A 1OLTA 2LY9A 4HN1A 2FZ2A 1XX5A 1ZAOA 2OA4A 3ZXFA 2GM4A 1CF7A 2OQ6A 2CW8A 3LCPA 1R64A 1AJOA 1X1BA 3KPHA 3TN93 1DGLA 2DTYA 3U10A 3OOXA 3A7QA 2PJRB 1LGNA 1XQNA 2HI3A 2PMUA 4FQ4A 3THTA 1ASJ1 2Y8KA 3B6AA 1OYWA 3UNGC 1PIV1 1FBUA 2WO7A 2JD9A 3BCWA 4AEDB 2CGPA 3RZJA 4AQ6A 2OXBA 2QSHX 2CQQA 2DOFA 4P55A 3R0AA 2DODA 1O7LA 2OZ6A 1ZBE1 2CQNA 3W9AA 4XTMA 5LATA 3GFLA 3SEQA 3AP7A 2Y0MA 1UOBA 2DCKA 3WGHA 1S0CA 4AEJA 1WCMJ 1GV5A 2GAUA 4B47A 5F64A 2VULA 1Z7S2 1VAMA 4I98B 5I93A 1QZZA 4CH7A 4N53C 2LP0A 2O14A 1JGSA 1RXFA 2PQSA 1AR63 3S93A 4MGTA 1ENQA 1D1CA 3HSEA 1FT9A 5DAVA 3CJXA 4NHXA 1XGSA 1OOPC 2QQLA 4CDQC 1QZEA 4K21A 4HNTA 4CEWA 2TUNA 1P9QC 3CLOA 4EATA 2L02A 1ND3B 1J09A 2Z1DA 4LHKA 2R073 1V5EA 4EJRA 2IXKA 2ISZA 4A3FJ 1JODA 1H6YA 1TP4A 3WQ1A 3F72A 2AACA 3RYKA 2ZXWH 2I8DA 4JDNA 3CLPA 1PUFA 4NC6A 4OINF 1JZ6A 1SAXA 3ML6A 4ETSA 1Y39A 4L0YB 4META 1XYPA 4CU9A 4LIUA 5JPNB 1QQP3 4Q0SA 5BNNB 2ZPXA 4P9JA 1AX0A 1OUSA 3UNPA 4DBQA 2CNAA 2VQTA 3TEDA 3DXUA 3SQNA 4RR3B 4AVCA 1QJX2 1YI7A 3J81Z 1YOVB 3WGIA 1APLC 1HN0A 1PMIA 3LIGA 4CU7A 3LFKA 1Y8QB 4GMP1 3DEUA 4ZU5A 1WW6A 4XZPA 2GN3A 2QQ9A 2WC2A 3POSA 3SH5A 4YSFA 1WJEA 5F08A 5TGTA 4DFSA 1AZDA 2XAGA 5JI6A 1U5ZA 2K9MA 4HQMA 3ASIA 3QD6A 2X09A 1OPOA 3HN3A 3FUOA 3SMHA 1G9AA 2YSRA 1D4M2 4Q5SF 3JCUC 2EZHA 2JSCA 1Q8VA 5CIRA 1W2NA 3UKTA 4XN3A 4IETA 3G1OA 4AGGA 3DBRB 1UY0A 1H88C 3MIBA 1K45A 4TZDA 1TL8A 1UYPA 2QCSB 3ACFA 4JDMA 1W5TA 2W24A 2VKHA 2VUDA 5A2QZ 2BDRA 1R71A 5FLHA 3KGLA 1VTNC 2FDHA 1R1UA 2EK5A 5FY4A 4ZXEA 3O1UA 2OZUA 3FMSA 3D5LA 1G59A 1FPN2 4LG3A 4KWUA 4QPYA 1RUG2 2A75A 2RC4A 2OPTA 4DIQA 4NRQA 4E7KA 4M3GA 1OCPA 1W06A 4N43C 3ABKH 2JG8C 1XU1A 4COUA 1VBA1 3A22A 4Y1YA 3ZYPA 3CDIA 4XSXF 2H94A 2E60A 3MPPG 1FV2A 1NUKA 3SEPA 3KCYA 2HPMA 4AR2A 1AYM2 4ASLA 5DDGA 3N7LA 1OA2A 1ODNA 2ET1A 1OCZH 5GAGJ 2ZGUA 3AG2H 4X8PA 4N53A 2W08A 2EQRA 2XPVA 2LDUA 3I64A 4QQLA 5K7PA 2R7SA 3BU7A 4CDXA 2LKPA 3E5QA 5EPAA 1VBA3 1SEFA 2V72A 3HKZA 3SISA 3ZMTA 1RC6A 1UPSA 4IERA 2RS51 5KNLA 3JSPA 5EJCA 4CZCA 4CXFA 4QB1A 5HDKA 2L7FP 2DQRA 2DA2A 3ZGKA 1RHI1 4Y4RA 1X19A 5FMBA 1T6BX 5J48A 1YQ5A 1NTCA 3J7HA 5C9AC 5J3LA 2DTWA 2J1AA 2TDXA 3LNQA 5DCFA 4A3EJ 3ZN1A 1W6PB 4Y24A 4OAZA 2ETHA 4MX3A 3S2HJ 4KN4X 4G6DA 4C2UA 4E4DX 3GLXA 4Q4X1 3GNEA 3B6CA 4QT6A 2IA1A 5LLQA 5A7QA 1TMF1 5KXCA 4ARXA 4ZJZA 2W95A 5B66C 2JECA 4XUOA 2LFBA 4CU8A 2NS8A 3WDUA 3HRUA 2EV0A 2E35A 1B4AA 4GB32 3AL6A 2JD4A 2QZ3A 5GPCA 1K79A 2H0VA 3BR0A 3HOBA 3J8F2 4NRMA 1EY2A 4XZUG 4V2WA 3KGZA 3O0WA 4EQQA 5FOBB 3FXRA 3WXPA 4BNCA 4IL6C 1H4GA 3L1PA 4WX9A 1PM7A 1Q56A 2OPWA 3ORJA 5ICCA 3FHZA 4XFCA 1RIRA 3E6DA 4H0EA 2AH2A 1FIAA 3HB9A 2BBAA 5FD5A 3ZMVA 3K4DA 4AIDA 2GMMA 4LE3A 1LOFA 5LW9A 1YCIA 1GVDA 4UV9A 2UZKA 1U3EM 3BG9A 1J2XA 3CU7A 1D7PM 3GF6A 1HDDC 1CQ9A 3B5LB 4NHLA 2J5PA 3BOPA 2A6HF 3IUOA 4OYUA 1ZH5A 5K7HA 1REPC 3A0NA 5ANQA 5AFBA 5C70A 4OZXA 1VQLI 4FX0A 3AVSA 3CO7C 3ZXDA 3BT9A 1LPQA 1X4OA 1PK6C 4XNFA 2E5NA 4LG0B 3MW2A 1JH5A 1GLHA 5FQ0A 5DAXA 5T55A 2DDBA 1AKHA 4AIHA 4L97A 1XC5A 1VP6A 4EM2A 4CCLA 5LHHA 4R9BA 2A6XA 3CF2A 2H6BA 4ZKTB 2R7EB 1DQ5A 4C2TA 1NY71 1MBEA 4PHZA 5IT6A 4RB2C 2X0LA 2Y6GA 3MIDA 1H4HA 1QXRA 2XWBB 1FXZA 3JXSA 1GU3A 3M8JA 3MGUA 1D3YA 1Y1WJ 1UCRA 4QD2A 4JKMA 3WHUA 3V8JA 1WLDA 2BV4A 3S2DJ 1YW7A 2KM2A 4AK3A 4PLMA 3CJIC 2ZKLA 3TMOA 1S9HA 2R1BA 3EB7A 2P6HA 4Q4V1 1FY7A 4RSUA 2VJ4A 1P4WA 2HQNA 4M3EA 1XU2A 2E53A 1GT0C 4ATEA 3G6JB 3OS0A 3B00A 5E8AA 4BY7J 4HX8A 1R1A3 2YFUA 4EZHA 1QA6A 3VB9A 3AB0A 1O3RA 3LSIA 2JDKA 5GZDA 4O65A 2WB1N 3GCXA 1HX6A 4U87A 4CP9A 1YXWA 1ZLJA 3QRFF 3HL2A 4B4RA 4HVRA 4NRPA 4GYGA 2F4PA 4CVUA 2CDOA 2JDAA 2D5VA 1CIWA 1UZCA 1IF1A 2ZGSA 3GMEA 2MNGA 4IXAA 3HWJA 3ZMDA 3IL2A 4LTAA 4I3GA 4TN7A 2ZGKA 2ZGMA 3WVJA 5FYUA 1K78B 2X9DA 2D3PA 2BZDA 1DHKB 3TO9A 4PSXA 1IG0A 2B39A 1XMXA 2A69F 1C57A 4OCTA 4A0ZA 4HANA 1ZG5A 4XF3A 1ZRDA 5EEAA 3P3PA 1EAH3 3A0KA 3HR9A 2EWNA 2XOMA 4ZXKA 1U5TC 5FZCA 2KD7A 2HWVA 3EBRA 2D45A 4XACA 2X6OA 1Q3EA 4YIFA 3PLQA 4IW3A 1VAVA 3GJAA 3VV1A 2Q1FA 4LGWA 4YM0A 2ARXA 1I3HA 3DL3A 3MFKA 1SMVA 3FHIB 2QQPA 5FPAA 4HOOA 3K51A 4YW1A 3LA7A 1RUF1 2D1VA 1ZKGA 1CN1A 5FPBA 3RZLA 3TDZC 3N9LA 3MLJA 3P5BA 1C3HA 3CC4I 4HF2A 4RGKA 1XYOA 4Y20B 3B73A 1PK6A 2K7LA 1JUHA 1JT6A 1MQTB 5FPUA 2E2IJ 3P7NA 4LUMA 1JYVA 4AW7A 3NAUA 1PVC3 2JJ6A 2HU9A 1UKGA 4U36A 1VB4A 4NMIA 1SLAA 4LFUA 3AL0B 5ICGA 4JZRA 1NA1B 2QQOA 1KYWA 2OIIA 3HPHA 2Z33A 1W90A 2FF4A 5AC92 5BY5A 4ESJA 5J40A 5C5TA 4MZUA 4PDWC 3ZQCA 4UUTA 2ZHKA 4A0YA 5D21A 3W5NA 4RB1A 4XBFA 4QPQA 2OQ7A 2M30A 4E2QA 4KFCA 3OPWA 1XGNA 3RWNA 5CFCA 4CSWA 1UQXA 1UOJA 5FFOC 4N7UA 3I2IA 5ILSA 3M3YJ 3AYCA 2R92J 2JA8J 3C2BA 4PLOA 4AI1A 1N75A 3SKVA 3GF2A 3RMXA 2K2SA 3CLQA 2A70A 3SFZA 3OYHA 3RMYA 1LULA 1IS4A 4XETA 5F5IA 3OYMA 4BKXA 4BU2A 2O9LA 2XPWA 4N9HA 4EWEA 1HQNA 4NVPA 2VCCA 3S3OA 4BIFA 1RUD1 2Z16A 5LCWL 5EG0A 1VMHA 4XMIA 2B7EA 4QQ2A 2XAUA 2FUG2 2QSGX 1XE8A 4L0ZB 1ONVA 2GWRA 1NXMA 2HWD1 1DYOA 4UF0A 4EE2A 4LULA 3ZQFA 4QKNA 4IZZA 4ORFA 3AKRA 3CZUA 1LFUP 3O1MA 2X5IB 4Z82A 2E7QA 4K9SA 3K48A 4IE7A 1PP7U 2LUWA 3VBSB 4JCKA 1GP4A 4IVNA 4FPHA 5HCAA 3RZKA 4CDUB 1XNKA 4OMDA 2Z4FA 3LQRA 4A3KJ 1VQPI 5D8KB 3K3NA 1U5TA 2Y6KA 5EZWA 2VKDA 1OCOH 4S0HB 1JZ4A 2CUZA 2HWD3 2HYFA 3S7IA 3WUDA 1UU6A 3VBFB 1RR8C 3POFA 4KDPA 5M3FJ 1ITYA 1HSTA 3VD3A 1MBHA 4JGZB 5FXZA 4L8QA 1MS1A 3WG2A 5FRNA 1I3QJ 3A21A 1JZ5A 1I39A 1HJGA 2X4HA 3HOSA 4XXPA 5EIYB 2P34A 5JLXA 1W4MA 5H6RA 1EAH2 4DXZA 3ZXKA 3LMMA 2R5YB 1LNSA 4JKLA 3HKZN 5A6XA 4FX4A 1PVEA 1RUNA 1ND3C 3W6VA 2JA2A 2I07B 4UFHA 2WO1A 3VD9A 2R7UA 4MGKE 1NE4A 3KLNA 5KXBA 4YZ2A 1N47A 2WY7Q 4K40A 3TEXA 1ULDA 4NC8A 3NARA 3AZYA 3IWZA 5LA1A 1BI2A 3DEWA 4Z2AA 5L7OA 1YRNA 4O9EA 2BEOA 2MH2A 4KJZA 1H8TB 1NKGA 5IT9K 4QHOA 3I58A 1E57A 1NCQC 2ZABA 5JVTA 4AFBA 1EV7A 4XM3A 5BNNC 3HHGA 4C30A 3KEQA 2BY2A 1WJAA 4P96A 5EGOA 1Z7S1 3MCZA 2BW8A 4IE4A 3NJYA 4AVZA 3MIGA 2DVBA 1YNAA 2DN0A 3OUJA 1MIJA 4Q0UA 3OY9A 4A44A 4LBOA 3L7WA 4XFIA 3WW1A 1YX3A 3WE2A 1VAKA 3RZMA 2BVVA 5FKNA 5ABJB 3VLBB 4Y1UA 2M3AA 1UG0A 1C8M2 4LR4A 3R0JA 3SDGA 1QF3A 3G3ZA 3MHZA 4XKWA 3TW6A 3HNYM 5DG2A 2WNOA 1XB4A 2HEWF 5HXMA 1T08B 3IHUA 1EPZA 1LHNA 1UHWA 3OBZA 4UBHA 3WDVA 1IUFA 1KGYA 5E3OA 5KWRA 4H3WA 1IRXA 4ANJA 1EP0A 2ELHA 3OJBA 2O7OA 3K4LA 3B69A 4RHV2 2PJRA 4RLQA 3AYEA 3G6EI 1HCRA 5E6HA 2EBIA 4KG0A 1R5GA 1MGTA 2XUEA 1QJX1 4S05A 2DYSH 3K46A 4AEDA 1G3YA 2W87A 1HB4A 4M9ZA 1JYCA 3BB6A 2IRFG 3APBA 4RGUA 2PBIA 4FFFA 1VNDA 2LRDA 3N7KA 4DOUA 2VVFA 2BGPA 2M7BA 3N7MA 1TNTA 4WM8B 3FLRA 4C9YA 3HMYA 2RMU2 5FZKA 1RUI1 2OA2A 2M34A 2EZIA 2PHFA 2CV6A 4TLGA 4HF1A 4AI9A 5A1LA 2VZ1A 2XWJB 2A7AA 3IPVB 3FK7A 1RUC1 1V70A 3LAGA 2OUHA 4HF0A 5EJ1B 3K7AJ 2EXIA 4XHBA 2X1DA 4CCEA 1D4M1 2ZNZA 3MI8A 4JKKA 3LQQA 1ULEA 1R22A 2EH3A 4TTGA 3RYRA 2VTXA 3BR2A 4AVBA 3I3LA 2EAKA 4F93B 1J3QA 2FE3A 2K5CA 4I02A 1RUI3 1QGLA 3ZRGA 2Q8EA 4L9BA 1BVVA 5F6LB 1QIQA 4ENKA 2L7ZA 2RJLA 1L0OC 3JUUA 4XJAA 4XJ9A 3A1YA 1FPN1 5C3PA 1RUC3 5DZGA 4GD4A 1RUG1 2CSGA 5FK7A 3CNAA 1OVSA 2EXKA 1FPQA 2FCUA 3HXLA 3K4KA 4L92A 2GXAA 3U21A 3WQBA 3R4SA 3T1BA 1US3A 4Z6YA 3WHTA 3B01A 2E1NA 2M8GX 3S1NJ 5BNOC 3T2PA 1QGPA 1ZZBA 3UESA 4YM1A 4NIGA 4XXAA 1OSGA 2ZEYA 3HOTA 1LQ1A 1AYM1 3NO8A 1G7YA 4D6RA 2H8RA 1ZZCA 3HN1A 1OLMA 1SFXA 5FZDA 4RR3A 4DEQA 4MVTA 5FLJA 1APNA 4OFGA 1U9OA 1TZLA 3LGRA 5FZ0A 2WZR3 3BU0A 4ISRA 2E19A 2ZOEB 5L3EA 3HUGB 2CU7A 4U7DA 3LIHA 2R93J 2LY2A 5F7UA 2PTMA 3COAC 4XVHA 3I8TA 1H6XA 2CH0A 2C4XA 2ZEZA 3D0SA 2ZZQA 2WA3A 2M0MA 1W6NB 2EJRA 1AWCA 2VCMA 1PO22 1BEV3 1NCRB 2JMWA 1GHCA 2H8WA 3SCHA 4LBQD 3CZ6A 1O8PA 5HVQC 1P2FA 3HVDA 4AGRA 4XDOA 3DPTA 4LT5A 2WDBA 5FKMA 1AL22 1QU3A 4NR1A 4XAAA 1X50A 3QQAA 1JI8A 1HQLA 5A6ZA 2V1NA 4NUBA 2DPUA 2DK5A 3POEA 1G6NA 3NW4A 3CDLA 3AP4A 4LBQB 3W21A 2DJIA 3NV3A 4AOCA 1V4RA 3S17J 2Q8KA 5KHDA 1V00A 1OPMA 1ETXA 1XSDA 1RR7A 1GQGA 5LA9A 3BQZA 3NJVA 2VZOA 2AXTC 5FLXZ 1VQ5I 1IRZA 3A2KA 3M7GA 1Z78A 4KI5M 4GB31 2LYCA 2AC1A 2WNVA 4LOSA 4AU7A 2P5LC 1A6QA 1OC1A 2W2IA 4NROA 1XPXA 3J8F1 4PJJA 2ZACA 4KL1A 1JZ7A 4N9IA 5ERIA 5IVVA 3EUKL 1QJEA 3RQIA 2DAOA 2K40A 5HNFA 2VT2A 2VXJA 1RITA 4A5MA 3K77A 5CVUA 1GKBA 5K4LA 2XIGA 2KA3A 5EYYA 3OWTA 2WN2A 4R8HA 3EO6A 3V0AA 1BCXA 4A3IJ 4Q4Y1 1TWAJ 1J83A 2YR2A 3T3YA 2K86A 3BG3A 2NNNA 1TQMA 2WS93 3I53A 2E1OA 1QHHD 4MHUA 5FUPA 1D0XA 4BQWA 5FBZA 1E3PA 4KG8A 3QODA 4KMFA 5FGMA 4BACA 4IHXA 5GAHJ 4AVPA 2A6WA 5T5OA 4D6SA 2GH2A 1YFWA 2QWWA 5GLZA 4HX4A 3BG7A 1EV13 3TBDA 2WFPA 1A34A 1XDUA 2PMHA 1ZHFA 3M9AA 1S3JA 1XJAA 3MV01 1J3PA 4Q4Y3 2QTWB 4CZSA 4PJ0C 2WN3A 4OUEA 3FUQA 2VOVA 4ENNA 3S32A 4A69C 2HOAA 3KP7A 1W0UA 3O6BB 4MGZE 2WTEA 5FO8B 4LLLA 3IV5A 1HC8A 3F9KA 4AHZA 2ZAAA 4Q2FA 1SFKA 1DDLA 1V5GA 4KH9A 1LJ7A 2VOXA 2NYYA 5B1BH 2BOLA 1ENRA 5JI7A 2YUSA 5FWJA 4ZS2A 4YG0A 1S5LC 5TRDA 1WA6X 2HPIA 3VFZA 4KU7A 3IZOA 4XCBA 1JUIA 4W1UA 3ZQHA 4AHYA 5JR3A 4BQQA 1R36A 2R7FA 3DBLB 3DPRB 2KIFA 4JAAA 2OF7A 4LKDA 4YFWA 3BZCA 1JMUB 2YBKA 2JB4A 2D6PA 4LO8A 4M6YA 1RIOH 3KVBA 3H1MA 4O61A 4Y1ZA 4KIFA 3BR1A 1AXKA 2B5HA 1MDMA 2ZMLA 3DGTA 3O1SA 4NNJA 5JXHA 2XJSA 5K7FA 2BXYA 4BLIA 4AL9A 3SFIA 2WNEA 4YZ1A 1C8NA 4G7ZF 1ZBA2 1N3OA 4OU0A 1KFXL 4B29A 1MNEA 5BNPB 4PJNA 2WL1A 3SEZA 1YW9A 1ULOA 4E7JA 3BTIA 3AYAA 5FKCA 3MD2A 1MQTC 1W28A 1XTAA 5IATA 2VL8A 2HWB2 3VBOA 3W6KB 3J7AY 4CDWC 4UB8C 4EJWA 1UHSA 4CICA 2F5VA 1QWRA 4EN6B 2EV6A 5FV3A 5A80A 5HLGA 4WZFA 5KCMA 2DYCA 2R4GA 2FHRA 2VMEA 4W6YA 3PUFA 4EMSA 4B3AA 1JYNA 3WCSA 5DUWA 3ZXLA 1UYZA 2LKXA 2YGMA 4QX1A 3Q5FA 4PJYA 4PBOA 1RMU1 1XMKA 3ASOH 4AG4A 3PQKA 3AVRA 1ND2B 3M1CA 1D0YA 1QVTA 2IA0A 3POGA 3CMYA 1U5YA 5FYCA 4Q29A 3RIRA 4AYBA 3AG1H 3L2QA 3AZZA 2HQRA 1X4PA 3BTJA 4XBNA 2Q5TA 1Z7LA 3EUAA 3WG1A 5JVVA 1N1YA 1BW6A 3WZ1A 4IHWA 4YW6A 4A4AA 2VW1A 4PDKA 3TOAA 3LSPA 1YQ2A 1RMU3 4YVWC 3OUHA 5CKNA 4XF1A 4LA2A 1DQ6A 1UZYA 4II2A 3Q9VA 1S6LA 4IV3B 3DPLC 1WBFA 2CS3A 4Y15A 3TP0A 2P3IA 2JKBA 2VOOA 4DUWA 2WS92 3Q9OA 3VBUB 2QNKA 1HRI2 3BI3A 2QVOA 2IGOA 1O6UA 1UMHA 1AYN2 1AVBA 3MF9A 4ES9A 3PMEA 4J00A 1E3OC 2Y6LA 1BBT2 5FZLA 5AC91 2LR8A 2M45A 3PSIA 3FN9A 1VMJA 3CCEI 3UYJA 2QBYB 3ZSJA 2LC2A 4KBZA 1K78A 3HJEA 3KX2A 3CCQI 3OEBA 3VBSC 3ZPLA 4YWAA 1I6HJ 3D3AA 3H7JA 1D5YA 4CDUC 2QE3A 2IZWA 3NRUA 1FSHA 4KIBA 2DQLA 5FREA 1VPHA 4FTHA 3FM5A 4YM2A 4AI8A 1UU4A 5CA6A 4DXRA 1C5IA 3OYGA 4LJHA 5J98B 3ULQB 3KV6A 3GZ5A 1ULFA 1KS4A 2Y30A 1S0BA 3R4DB 5FZAA 3PNTA 3IRQA 3K2AA 5JVGF 2RN7A 4MGRA 4B8XA 2IFWA 5BMZA 3FXJA 3FDYA 1H0BA 3O12A 3ZFFC 1W36D 1QBJA 2GQQA 4NO4A 5B3SH 1AU7A 2XQXA 3AKZA 2F4MB 2Y2ZA 1VQ8I 2BV6A 3LD8A 2FMDA 4ZDPA 3BGAA 2GIVA 1MSEC 1MS8A 2ZX0A 5BNGA 2OUJA 3VD4A 4D8MA 2GU9A 5CYYA 4BS9A 4Y20A 2K4JA 1HXS3 3H8XA 4FPLA 1MQTA 3OBTA 1TNFA 1HA8A 1J84A 4XDPA 2CQ7A 3V65A 2IGKA 5F3CA 2VKVA 2D93A 5FZ1A 4IGOA 2L9RA 1TE1B 3M3CA 5I0TA 1NA1A 5JI9A 1W99A 1A6IA 4A5NA 3ZX7A 4QIWN 3HOUJ 4E70A 4BJ6C 2HWF2 5IAVA 1OF3A 1W04A 4EN8B 1TME3 3I4MJ 1H8TC 2VJ5A 3R6SA 1W8FA 2K3PA 3FC0A 3C8XA 2LBFB 5H20A 5ICEA 4JX5A 5D5XB 1RNLA 2XJPA 1X1CA 5K0UB 2F48A 2XONA 3CZJA 1WFXA 2P7CB 4EWDA 1SC7A 3OGRA 3AJYA 2ARAA 5E20A 2YC4A 1EUTA 1RYYA 2BTVC 3LSEA 4CXWA 5FFXA 3BJ6A 1FMD3 1DG6A 4LEJA 5ABJC 1NLQA 2RM22 2JVHA 2Z42A 4R9CA 1AUYA 2HYXA 4ZYGA 2WBMA 5IP9J 3C18A 4IX7A 5LRRA 1CWPA 4YW4A 2V1UA 2GA2A 1R092 1Z21A 2QKLB 2C9KA 4COYA 4WM7B 4PI0A 4LORA 4FSJA 2VXDA 4RS8A 2YC0A 1SLBA 3QCWA 5H2FC 2RDQA 5F9TA 3IMNA 2ZBJA 1W39A 4QM8A 2NVXJ 1QY4A 5JIUA 1UNBA 4FPYA 1O57A 1JUPA 1VF9A 2X5IA 5FLIA 3LDRA 5FO7B 4BQXA 4X6AJ 4EGYA 3VBSA 1AXYA 2WQ4A 4IRHA 5LRSA 2Y0IA 3I3DA 5FUNA 5JZGB 1IN6A 5A33A 1OCCH 1K7AA 5SV5A 4WVVA 4QAWA 2RHPA 3B9CA 2OVUA 3WW4A 3FHAA 3EYPA 1N1SA 2FJ1A 4OOIA 1GANA 2KZGA 1A04A 3VBFA 3FXMA 3A03A 1SLLA 2E9QA 3AFKA 2X6WA 3S1QJ 3ALQA 3PUBA 4JGZA 4GH4B 3VZOA 5FZOA 3PU3A 1VBC1 3PQJA 1VRH3 1ETQA 2Y0SA 4PIYA 2VZRA 1E2XA 5A32A 3PJRA 3VBRA 5GLUA 3WD5A 3ZYBA 3VHRA 5DQ0A 1NT0A 1E0EA 3ZFEA 1RESA 1O91A 5FYSA 3MYXA 4RGRA 5E1ZB 4MG2A 3GBFA 4FETA 3CP2A 2FBIA 1BK0A 1WZXA 5KHGA 5DG1A 1KQ8A 1IJWC 3ZN5A 4CU6A 1S4CA 3K4JA 3CUQC 2FEZA 2XB0X 4NIIA 2XJRA 4HK9A 4BDVB 4XL9A 4I3PA 2WO3A 4XORA 3VZMA 3H9JA 2D6LX 5FP4A 1H8TA 3WY6A 3WTUC 1TNRA 1ZZ7A 3GEZA 1ZELA 2RMU1 2EB7A 1F15A 2XGCA 1AF9A 3TKYA 1JZ2A 2JWPA 1H89C 1B09A 2VZUA 3WTXC 3IAQA 3T8RA 2XGDA 3H9GA 2FOKA 4OIQF 2I74A 5DZFA 3WP5A 1MJ9A 1LOGA 2YDEA 2Q0OA 3UJOA 1RJ8A 3JQWA 2IVIB 1NAEA 1CX4A 2YUEA 2R041 4AI3A 3L9FA 1SFPA 1CD3G 1D0HA 2W1SA 1SDWA 4FOWA 3C2GA 3LOIA 1K3IA 1XSRA 4PF1A 1MH4A 4QKDA 3OY8B 2V26A 2LTNA 3ZSMA 3WTTC 1NCRC 3ZMUA 3S6PA 3ONQA 1NQJA 5L3BA 2PX9A 3HOWJ 1GMMA 1UD1A 1VIWB 2DVAA 1GWLA 3TEYA 2MEV3 2NXNB 3LEGA 4Y5Z0 4QPIB 3OYJA 4Y4YA 1WJ5A 2PHUA 3ERMA 4MV2A 2CRGA 1TLHB 1W6MB 4BQYA 2MBFA 1IN4A 4H4KC 4Y1XA 4IQ4A 1ZGJA 1G8WA 4E4ZA 2JIJA 4YGEA 5FRMA 3AJZA 2CWEA 3KLOA 1REFA 4TLFA 4HSTA 5G04L 4RGGA 3ZN6B 2WUHA 3ERED 1FOYA 2RGVA 5LBFA 3MFCA 2LMDA 1OBNA 2GMEA 2IT0A 4IGPA 2QEXI 2EIBA 1JHJA 2IGMA 1R083 3PU8A 2JG9B 1MSFC 3OOUA 3MIEA 4BQNA 1NOVA 5H9SA 5LGUA 1ZRIA 2WYSA 4WM8A 4UV8A 3JTGA 4E4HA 3VZNA 3ACIA 1DQ1A 4IV1B 4URTA 1LDJA 1DQ2A 1US2A 1Y3TA 4DNYA 1T0FC 4IEWA 4A3XA 1YIPA 3IPVA 3T0DA 2DDUA 4HKLA 4URAA 3OYNA 2EIKH 1H9PA 3GDBA 3QLQA 4A6OA 1AL21 3T30A 3LSGA 4DB5A 2CYYA 5K5RA 4FPFA 4QB2A 2HTJA 5FLVA 1RXGA 4BHPA 1U0JA 1JTXA 2ZKZA 2A6ZA 3GW2A 5D8AB 3HT2A 4J1WA 2XHNA 1Y43B 3B93A 5C3OA 2FBHA 4UAPA 4IEXA 2DK8A 1KFUL 4HFSA 1SHWB 3DYMA 2A73B 2W25A 1UN1A 3CJNA 1W8HA 1GBGA 5K8SA 3FX3A 3PO3J 4QQHA 4BXUA 2BYVE 3O2PE 2LF8A 4EJOA 2V5DA 4F3JA 1XOYA 3TNQA 4COWA 4XLCA 3WNXA 2J1UA 1GV9A 4XMAA 1MVEA 2ZXQA 4P9UA 1CVNA 1K83J 4NHJA 1MS5A 4XAEA 4Z8BA 3P1IA 2JN6A 3S5QA 4ITCA 5GLVA 3AMQA 1RRJA 2XRNA 2FSWA 4RB3C 1GWMA 2DFEA 1XD7A 2HS5A 2K3FA 3FMGA 1VI0A 3LA3A 2WQ8A 5C4WB 4AD9A 3Q0UA 1DQUA 3HUGA 3D1NI 3C1DA 3TBIA 2BU9A 3WOGA 4YW5A 3RSJA 4KA4A 1PNGA 1W6NA 2PLV3 4Q8KA 2XRLA 4RGXA 2E7TA 2HZDA 3DPRC 4DYQA 3CO6C 5A3PA 5D2AA 2RDSA 2M7AA 3VOEA 4HKWA 5AFEA 1BIBA 2Y26A 4IHSA 2HWE2 2ZB9A 4F3QA 2M4KA 4GYIA 4B7KA 1MKMA 2WAQA 2K9SA 4XJWA 2OQGA 3KE2A 2H1KA 2VC9A 1EH8A 3K0LA 3NNMA 4CA9A 4AXOA 4NN0A 5FY5A 4XFBA 1OXCA 1KGSA 2RNJA 4MO7A 4DGWB 1LDDA 5LK7B 3K75B 3WE3A 2XBO3 2VQLA 1POV0 3TNPB 1MMSA 2KL4A 2DU0A 2V6CA 1B9MA 2IGNA 5K5QA 4P08A 2HLEA 3S7EA 1W9YA 2MC3A 1YJWI 2NS0A 4IHYA 2X05A 3DXTA 3LF7A 4QXCA 4XOGA 3SJMA 2GXBA 3IBMA 2KJBA 1Y9GA 4IE5A 2B4KA 1N78A 2XVLA 5LBBA 1T0FA 1BZWA 1ND2C 3ECQA 1VQOI 2NS7A 2EIJH 1SAUA 3GTMJ 4KT5C 1RUH2 4ZC3A 1LU1A 1MPXA 4KGQA 1EF4A 1PZ8A 4IHVA 3AMMA 1ZNPA 4BISA 2EAAA 3JAMZ 4BJTA 3ZP5A 5B2GB 4JVAA 4L0PA 3ZIXA 1ZX5A 5LEKA 3JRFA 4KU8A 4LBLA 3MICA 2COMA 3RPUA 3KP3A 5FZGA 1ZBA1 1WCQA 4QXBA 4CDQB 5HS7A 3MUY1 2XASA 2QZ8A 3C7HA 3OL4A 2IS1A 3N9MA 4ENMA 3R4KA 5EEHA 4H55A 1F43A 5C4JJ 2X48A 2D6MA 3VKOA 3D5RC 2RS31 1Z0XA 1M06G 2HWB1 4FPCA 4KIGA 2FNPA 3C7GA 2DXIA 2YS9A 2FX0A 3A0BC 4ZYAA 3IH2A 3OYEA 5FJKA 5KHJA 5CKQA 2LS6A 3BC8A 1QOTA 3ECOA 4YG3A 1QQIA 2R062 1VBD2 2JPCA 3LDBA 1FOD2 1TG7A 3BG6A 1SMYF 2ZCWA 2EXHA 2RS33 1LHVA 5D6FA 3UGHA 1G3TA 1I5PA 2YXSA 1WGXA 1S0IA 3WV6A 4XLFA 2VXRA 1UX6A 4FISA 1RUJ2 2GP5A 2VPRA 4EJVA 3QH6A 3USUB 4LB5A 2HKXA 3GJBA 4I30A 2GA1A 2DJNA 3AZWA 4PBPA 3FISA 4MNUA 4I09A 2VASA 5FYZA 2R7VA 4CCDA 2HTSA 5A3WA 2W00A 5BOXA 2EF6A 2ADDA 4WK8F 2VQUA 4M3DA 1RUE2 2X10A 4IHTA 2WQZC 3HZJA 1SPPB 2MGQA 3VL9A 4E9KA 1HRI1 1OT5A 3Q8CA 1AYN1 1W36C 5JSRA 1GYKA 1BBT1 2X85A 5BNPA 3OYWB 3VSLA 3BR5A 4QKBA 4LMFA 4YNIA 4DRRA 1HQWA 1UELB 5I8YA 3F8CA 1WPKA 4FPKA 3NWSA 4XPVA 3OMYA 3F23A 1B35C 2Y0OA 2RAEA 3RDIA 1ZYBA 4F7ZA 2L01A 5BUVA 2VJIA 4FTBA 2JG8B 2O6GE 3FXQA 3F2ZA 2BXZA 3WHCA 3AFHA 4D1QA 2VBXA 1QZYA 1ZVFA 1PGW2 2A5YB 4R1HA 4JOMA 1LECA 1LNWA 3P9KA 2CO5A 4Q4W2 1LKXA 2VB6A 2VUCA 2G9WA 3V64A 2J1SA 3HJRA 5I0UA 3PURA 3VYUB 2PHWA 3ZYJB 5CG9A 2HFHA 5AIQA 1ZZ9A 2W91A 4XONA 4OHVA 3LPGA 1ULYA 2PELA 3J9SA 4QX3A 2ZXJA 1FOKA 1OCTC 2P7VB 5HLTA 3JBG2 1ETOA 3HOZJ 1MMNA 5C5UA 4IV3A 1RINA 1ZR2A 3WDXA 1ETYA 3TL4X 3E6BA 2JENA 4FHTA 5C9AB 4QPGB 4A7ZA 3H5AA 3FZVA 3FKJA 1IPJA 3M1EA 1D2SA 3GCWA 3VBUA 2KRHA 4Y33A 1IO2A 1QJU3 4LIVA 3ZYFA 5CFDC 2KKOA 2HWF1 5J1XA 3IIAA 4OUMA 4BEHB 2VR4A 1JW6A 2GC1A 4IEOA 3VSKA 2QBYA 1PO13 1BJQA 1VQKI 3MEPA 4LKFA 3N3HA 5CJ9A 4CCKA 4NAMA 3HG9A 3M70A 2K85A 5C71A 4IOAF 5GM0A 5F0FA 5JZGC 2A3YA 1LGCA 3J80K 4FPJA 1ENHA 3I54A 3MBWA 2V6EA 2GBYA 2VQAA 1VRBA 2DLLA 3ZM8A 3ZMSA 4HPQA 5L9VA 2GN7A 3MO4A 4FAHA 5JLVA 3JTHA 5D8LB 3R61A 3K9TA 2PQQA 1BA5A 2O8QA 2RM21 5JLWA 4R9DA 5FZ3A 4EQVA 4V19K 3GZTB 3ST7A 1SLCA 2L0KA 4D5CA 1O7FA 4FP2A 2X51A 5FDBA 2XXZA 2WBKA 4QX8A 5FMOL 3PMSA 2VKEA 3IKVA 5A1AA 4YW3A 1R091 3VYRB 1UZWA 3KV5A 3GTLJ 1F5FA 2JX9A 1BLZA 2P3JA 3A01B 1W9WA 2J5OA 1FP1D 2J22A 2EXJA 1CZSA 2P6TA 1RPWA 3JRBA 1EH6A 2WFF2 3O1RA 4HXCA 1JOPA 2R7XA 1XMAA 2QQUA 4LJZF 4Q1RA 5DABA 4YRDA 2WZ8A 2PEXA 3WQ7A 2E63A 2XSDC 2LNBA 2YX4A 3A02A 1OH3A 5C8CC 2KIUA 2ESHA 4GJZA 2R0HA 3B9IA 5B4NA 5A7WB 4B48A 3M3QA 1PDNC 1P6RA 2J1VA 2F6CA 3K6GA 3T0YA 1VBB2 3L2UA 1GOHA 1HDKA 1K5MC 3L2CA 3MVPA 3JU9A 4WVWA 4D7TA 5D5VB 2IXHA 3VUOA 2LBFA 3UKNA 1OKQA 1OISA 1VBE3 5K0UA 1HW2A 4U88A 4TSVA 2DUQA 3AXDA 4D69A 4XF0A 3HDDA 2IWGB 4I0WB 3RPQA 4S04A 5EYXA 2PFWA 3LPFA 1R58A 4OIOF 1WJBA 3WU1B 3NJZA 4AUXA 2DT6A 4PCQA 3JCIA 4YFKF 3PIOF 5GADJ 3I3BA 3IKWA 3CJIB 1BL0A 1DP3A 4OQ9A 4KWJA 3BZKA 3ETPA 1FOWA 1Z91A 1HKTA 4GO1A 2VJXA 4FBFA 2A6YA 2JSPA 2HWC2 5IYDJ 2QJVA 3VGIA 1DDNA 2QFEA 3CBNA 3MUZ1 2EIGA 1CZTA 3KCXA 2ZMNA 1CPNA 1TWHJ 1AR93 5I0RA 4XMYA 1CJPA 2P6CA 4JK1X 4JQFA 3NJXA 3PSFA 2JDYA 4WM7A 3CCUI 1Z6RA 4HW0A 4LHLA 1QJY1 4WZCA 4W65A 5JHUA 4E7IA 4IEJA 1GNHA 4TV7A 3DU6A 2F4OB 4ESFA 1NLSA 2EFNA 1AR82 1UX7A 2OPKA 1OR7A 5F5QA 3DCFA 2CY6A 1MZFA 3IN9A 1ACIA 1O4YA 4BOWA 4K8FA 1BOAA 3FJSA 2ZGRA 3ACGA 2V79A 1Z77A 2GALA 1FX7A 5DCMB 2PN6A 4UFIA 4RLFA 4J6GA 3ZDVA 2R7WA 4HG6B 3BTCA 2JG9C 1IZ1A 4AHWA 2IPQX 4YFNF 1QJU2 3VHNA 2PA7A 3DKXA 4F52A 2P1BA 2P3YA 2XH6A 2OTLI 3GBWA 1BBYA 4IV1C 4XQWA 4JBAA 4XJ8A 5IYYA 2CUEA 3PNYA 2AEYA 3EQLF 4QSHA 3PDQA 4GH4A 4Y52J 2HQAA 5A1FA 4RB0A 1OQ1A 1H0MA 1J3RA 3S8PA 3H8RA 3EUHC 1QNWA 3SEEA 2GNTA 2R3SA 3OGSA 4YEJA 3HPNA 1UIKA 1TEIA 4CGZA 2PN5A 3LKJA 1ERDA 2OYZA 1AR72 4L9VA 2WAAA 5BPXA 2WRAA 4A3ZA 4BE3A 3LEIA 5FZ4A 2W3JA 3V8KA 1QXJA 2E32A 4F83A 3OGVA 3BJAA 3M8FA 5D4SA 1HOMA 1RVF3 1Y1VJ 3OF1A 4WXDA 2XR4A 2ZJQF 2CSOA 1URXA 5L3GA 3GALA 2IS6A 2A6VA 4HMZA 4FPGA 5EXOA 2ZSIB 2NOGA 4XOTA 1XN7A 4FP3A 1COV3 3HIFA 4GRIA 5B1AH 4AIKA 2DFCA 3PIJA 5I91A 2A3WA 1Q5OA 4IUGA 5DAWA 3OSFA 4FO9A 2E2JJ 1YE9A 4RD7A 1YO8A 1VE0A 4LBMA 1LOBA 2FBEA 3D82A 2V4VA 4IEQA 2Y75A 1N1TA 5JXGA 5C4WC 2ZTNA 1LVAA 3WNKA 2DBBA 5ANNA 3RTRA 1IDZA 2BY0A 4CCOA 5ACA2 1LHOA 4E4SA 2ZKNA 5FP3A 4LB6B 4V2FA 1R6RA 1OQYA 4BLJA 1QO0D 3IH4A 1WH7A 4ZPIA 1AOYA 2WSUA 1NG7A 2DCEA 5CVRA 5FXVA 2BNOA 4HPKB 4ESBA 3CL1A 1KRIA 4Y5TA 4ZYDA 4IESA 1T98A 2HXOA 3FXKA 4QPIA 4BJ0A 3M1HA 2JVGA 1W6MA 3E7LA 4EM1A 2WO2A 3DKQA 5DPNA 2XVGA 4A7KA 2VLAA 5CU1A 5HNHA 3RZDJ 2RR12 5T50A 3OS2A 5L9RA 5LK5A 3C7EA 4EJTA 3KFWX 1A8DA 1XYNA 1IXCA 2VOTA 3OD0A 2W4SA 1T6GC 1G86A 4AQTA 1SFEA 3KLSA 2RS12 4X6QB 4E7ZA 3ZN6A 2PYTA 3F6OA 5IPAA 2VBPA 1HB3A 3ENRA 2H09A 2A05A 4LK1F 4RFRB 4A6SA 5G05L 4CEYB 4B44A 5C3RA 1IV6A 4NB5A 4LE4A 5L3CA 4D0QA 2ID4A 1PGL2 2JG9A 3DU5A 2NMOA 1TT5B 3NEUA 4M00A 2W7NA 1OQEA 3GBGA 5M0TA 3JRGA 2AGSA 4IV1A 3LWCA 3FF5A 3ELKA 1XDSA 1GSLA 5FZHA 5C33A 4JGYC 4UVAA 3WNPA 1XSVA 1Y8RB 1YEWA 3T0AA 2ZO4A 3HQRA 2HWE1 1GNYA 4BQ1A 2AO9A 3VODA 1ASJ3 3KM5A 1XE7A 3H0OA 4EGZA 2VU9A 2MC4A 1PIV3 4QMAA 3JRIA 3NRVA 2YU9J 1OH4A 5D8AA 2QZ2A 3T2OA 2UWMA 3MF6A 4YFXF 2MPFA 4Y22A 1K61A 1KONA 2E6VA 4Y1VA 5FLMJ 1ZBE3 3JD72 1WKYA 5EZGA 3CJTB 3I3EA 1PJRA 4XFAA 2Z3YA 3UK9A 4KWLA 5F3GA 1ZR4A 4HDUA 4IEVA 2FD5A 4YRVA 1NYWA 1O3QA 3LSKA 3H7YA 2LSOA 4QU2A 2LD5A 1JKRC 4RQPC 5A70A 3I5UA 2ACJA 1ZM1A 1IS3A 1QJZA 2ORXA 3RVHA 4N4OB 3UGFA 4HSRA 1OLME 1WMFA 1ZREA 3WCRA 3VYSB 2B7YA 5BPIA 1NCQB 4ZZDA 3Q0VA 1P92A 5KAFC 2ZEXA 3N05A 3G71I 3VEPA 1RUH1 3GTKJ 1RVF2 3VDDA 4M9XA 2P0WA 2QKDA 3G1MA 2EA2A 2CMPA 3IAPA 2NVTJ 4B3XA 4NQWB 1J75A 3CTAA 1WKMA 1OYIA 5HLHA 1YO5C 4FXGB 2MLGA 4MIMA 5JHFA 3WG3A 2STTA 4L9JA 2KP6A 5J96B 1QU0A 5T5JA 4JQTA 3EMRA 2ETEA 5DUIA 3WF2A 3KMHA 4CE8A 3E5XA 2ZXHA 1J9IA 1CF7B 3CMGA 1FOXA 5LHGA 4GULA 1BVP1 5KXDA 3LFUA 5LBEA 3H36A 2JDPA 3P5JA 3E5UA 1Q8OA 3H5NA 2ADEA 1E5IA 3VZKA 4GMP3 2CV0A 4QB6A 2R5ZB 2OC6A 3FFQA 2CFOA 4LXLA 2R061 1VBD1 4QKFA 2IJLA 1DGWX 1JYTA 2VGDA 2DO7A 1FOD1 1YJLA 1VQMI 3PNAA 4BXSV 3ZSKA 1H30A 4CCCA 2WNUC 1Z3YA 4NPMA 4AGVA 2ZFUA 3LB9A 3I2HA 2OS2A 2VTFA 2Y38A 4QLCU 3L2VA 3ZFGB 3KZZA 3NMBA 5LEJA 2DA6A 4DY5A 1RUJ1 5DN2A 2ZC2A 4BHBA 1YC61 4B7EA 1BR4A 3KT7A 2KMUA 2IXSA 2WR9A 1UY1A 4IJAA 5E3LA 1B8IB 4HNUA 1YHFA 2YBSA 3TN92 3K2ZA 3J4UH 1I1GA 4NWVA 2K9QA 2XMLA 1UL9A 1RUE1 2LKSA 1OI6A 5EJZB 4GXOA 4BIOA 4KBBA 1UG2A 1SFOJ 4UYBA 4MUVA 5IK7A 1V54H 3HBKA 1IS6A 1OOPA 5ICFA 4CDQA 1MACA 2P4WA 3V7RA 2IBDA 3MW3A 4GALA 3GO5A 1IC8A 4BZ4A 2VZTA 4YPJA 4AFAA 1UY2A 1SANA 5FZ9A 2ZGLA 2M4GA 4RAYA 5IK8A 3DUIA 4HLYA 1PZ9A 3WW2A 2KT0A 1D2QA 1YITI 4QPGC 2R7ZJ 1ZRRA 4D7SA 1H9GA 4BE2A 2JRMA 3RS6A 1FX5A 1MH3A 5FUIA 5F8PA 4BMBA 5J4YA 3HYIA 1YJ9I 1D1BA 1PIV2 1AR62 4G7OF 2VUJA 5IOYA 5GJ6A 5BNOB 4HBLA 2EFWA 3B94A 5E18F 1J7KA 2RS53 2D2WA 2W9XA 2YG0A 1PGW1 3LL7A 4MTDA 1RHI3 3MKYB 4Q4W1 2RVCA 4UBGA 4SBVA 3OSDA 1YYVA 2R072 3KWVA 1FTTA 1HB1A 2BUKA 2E1MC 1LCLA 3DPUA 4QX2A 2R6QA 3B02A 4XLNF 1IN7A 1TWCJ 3USUA 3E3VA 2VG9A 1R1VA 2LY1A 4RFT0 3BR3A 3VPRA 1JI6A 2JUGA 2Q1MA 4LO7A 5DDJ1 3WSOA 3JBG1 1J59A 2M8EA 4XK4A 1F9NA 1MS3A 4Q4X3 2X8KA 2HXIA 1TMF3 2YZ4A 1OQDA 1QQP2 3OPTA 4BBRJ 2FCVA 1HSJA 4Z07A 3W3CA 1SPPA 2E7WA 4NWWA 2YYOA 3IKTA 1A78A 4BPZA 3KCCA 3H1WA 5IWFA 2ENRA 4XILA 3OYWA 1F4KA 2YPRA 4IL7A 3QPLA 1AA7A 3PUAA 1H8AC 5DDJ3 2NZ9A 4XCAA 5BQTA 2QQBA 3HGYA 5FP7A 2G0EA 3BTAA 5K1YA 3G4SI 2WAEA 1UAIA 4XLEA 1HB2A 2K46A 3IDBB 2AHQA 3PJQA 2Y9ZA 3FHQA 3M3EA 3JRCA 2FXAA 3BPZA 3RJ2X 4XJUA 1SFYA 1D1AA 3GLLA 4A3JJ 5C3EJ 1ULPA 1PVXA 2JG8A 1TZOA 4N43A 3SLIA 1W05A 3OYLA 1W7PD 4XIOA 4FQGA 1FZPB 3PL8A 4Z1VA 2BW3B 4NHMA 4M72A 4FQZA 3PO2J 5CADA 2YU1A 3PTYA 4HSJA 1USSA 3HRSA 3PM1A 3WNNA 1KJRA 1MS0A 3P9IA 1F2NA 3DKWA 1W7PB 2E1CA 4UWDA 4MSVA 1AHDP 2DCTA 1BQPA 3UKVA 3FMQA 5FXWA 3T5XA 5E1XA 1ZRFA 3S15J 3NAPC 3SHFA 4LK7A 5C3SA 5J8FA 1O59A 4G4FA 2EZLA 4HA8A 3ZMNA 2DMPA 1P8JA 4M9SA 4UVCA 4O3MA 4P1WA 3RFRA 4CHUA 1WD3A 1MEC1 1S7OA 2UURA 1JXSA 3IMMA 4HX7A 2JT1A 2W85A 4XC9A 4KITB 1ZQ3P 1XGMA 2C5DA 1UPIA 5C9AA 1XSXA 1YLLA 4XFHA 3VDAA 3BOWA 4WCGA 1B72A 3G1LA 2HKOA 1YS6A 4COVA 3UJQA 4P9YA 4AWDA 1MD0A 5CBLA 2FOWA 4HLXA 2EILH 3K4NA 4ZY9A 5FJ8J 4G9SB 1ALYA 4BEHA 1T38A 2IAIA 1VBA2 3WW3A 4Q4V3 4H7LA 5TSWA 3FBIB 4ENJA 1MEC3 4QDSA 4FOYA 2Q4SA 3QAHA 1ZLKA 1OHFA 2ELKA 5GTHC 3BIEA 3H42B 1R1TA 3MMYB 1LOAA 3MW4A 2J1TA 3O7OA 1JUSA 4IOCF 2PAMA 2BGCA 3IP4B 1HV0A 2W57A 1ZN2A 4CXYA 2PHTA 3WDWA 1U8RA 3ES4A 1IPSA 2C6SA 3JW4A 1HRV1 2A3XA 2BNNA 2HWC1 1HF0A 1T56A 1S0GA 5CQEA 4G12A 2W68A 4JP0A 2LK2A 3N9PA 4D94A 1CAUB 1W03A 1R5HA 2KRCA 1IGNA 3TRSB 3A01A 2DVDA 1CZVA 5FJHA 4AEKA 1AKHB 2DF7A 1YLFA 2UWAA 2B9VA 1IXSB 5JSOA 3FM3A 3ZO0B 1HRV3 3CD6I 3SZGA 1W9TA 1MJBA 4CDWB 5JCTA 1KYZA 3UGGA 1R9TJ 2JPBA 4M3FA 2V4AA 5CNAA 2A3SA 1RUF3 1T39A 4I0BA 2B9UA 3HTUA 3OB8A 3KETA 4LUKA 3I2FA 3Q8FA 4A42A 1UWWA 1QDOA 3DV8A 5J47A 3C3VA 3T08A 2ZZJA 1UKRA 4C91A 3NKTA 4XSZF 1HIXA 4UI9L 2VUMJ 2XAQA 1AXZA 3ASNH 3JQXA 2WY8Q 3UKGA 3H9QA 1ZTRA 2OCCH 2XF6A 2IXIA 3L2YA 1V9U1 1HXDA 1FI2A 2XF5A 1I50J 5GTIC 1BI1A 5K9YA 4R4ZA 3I71A 4QGLA 1F5TA 3CJIA 1CONA 2ORZA 3ZMOA 2YX7A 1U6GA 2MW8A 1AR71 5DD4A 2ARBA 2ZFWA 1K6YA 1KU2A 1W2AX 4YVWB 4R79A 3ZYRA 1GR3A 2D5FA 3FXUA 4J1XA 5FPXA 3I59B 2O3FA 2L9NA 2CV1A 3KHCA 2QDNA 3BALA 2BRTA 1B59A 2MHFA 2KIQA 3LEKA 2JA5J 4DY3A 3BCBA 1XC6A 3RWKX 3I4NJ 2K9NA 1C1FA 4F8AA 1RTVA 1GZCA 4DQ2A 2E7AA 4P00B 4AZZA 2YY1A 3PVNA 1F1ZA 4C3JJ 5EYRA 3VBHC 4MTEA 5F39A 4LHNA 2P5KA 4UW6A 2BVBA 3MFAA 4OHZA 4ZU7A 4QX0A 2XAHA 5DCMA 4XBQA 2BOJA 2VPLA 4P9XA 4CEYC 1JYXA 1R1A2 3CHXA 2QQWA 1DCSA 2HVRA 1Q1VA 3WU0A 1RUD3 2A1XA 1REDA 1W9FA 3U11A 3B3QE 4PT6A 4DINB 5FOJB 1TNSA 5ACA1 3POBA 4YW7A 4EN9B 5FY8A 3THDA 1SZBA 1VQNI 2D44A 4OI2A 3GZAA 1KJLA 3PUQA 1BI0A 4MYEA 4B4QA 5LBCA 1PHMA 1BC7C 4Q0VA 4ISQA 1IN8A 1USTA 3ZFFB 2CW0F 1PX3A 1G9BA 1QJFA 2OAZA 1Z1DA 3TP3A 1FEXA 5F3IA 2DA3A 2WYFA 3AZVA 2E51A 5I8SA 2E7XA 1CAVB 2QKMB 3H3ZA 1KU9A 3QPTA 3OIQA 3AP6A 2MG4A 4XR6A 5J1YA 4A6DA 3IH3A 3U75A 2RR11 4LK6A 3O1VA 4XUTA 4AWXB 3FE5A 3LDKA 2QVSB 1ENSA 1GVJA 3TYJA 4PF5A 3BYWA 2EICA 1NG0A 1GXPA 2VI6A 2CQKA 1W5CC 2KPMA 4AYUA 2XSJC 4PUSA 3K1NA 3HEIA 3OGJA 5FTTC 1BHGA 2VOKA 1NK3P 4BGDA 1UO9A 2YPDA 1TBXA 1UY3A 1PGL1 2W1QA 3ZCOA 3JB4C 5I0SA 2YV8A 4MGIE 1W5SA 2HNHA 5CFCB 1HDPA 1IG7A 2BWAA 3N35A 2PMZA 4MGQA 1G3SA 1IAWA 4LLNA 2ES3A 5L19A 1VJ2A 4F92B 1I27A 4PDWA 1X1PA 3ZR5A 4XF9A 1E5SA 3I0TA 1OD5A 3WNLA 4K20A 2YMZA 1PVC2 4LPLA 2AENA 4KGGA 2DW4A 4NIDA 5FYBA 3F3XA 3TO7A 5FZ7A 2VE1A 4DO0A 3J81K 5LGNA 1IHMA 1M4WA 4MFEA 2RKHA 2LROA 2QYOA 3S1MJ 3JD71 3FXOA 3WP3A 1IGOA 1DU3D 2Z5UA 2F5DA 2VBBA 4HPKA 3ZVXA 1CPMA 4UF0B 5F5CA 2R49A 2XUMA 4XQFA 1S7AA 1Z7S3 4YELA 4JX6A 1R23A 2HBUA 3D8CA 3WF4A 3GZNB 5M5XJ 4L99A 2X1EA 2DTZA 2FQ4A 5HS8A 3SXYA 2D5HA 2XVCA 3OBRA 1GUUA 1JGGA 4Y3OA 2VQ0A 2Q8CA 1REEA 1V0AA 1SD6A 1R49A 1YIJI 5HOOA 3AYDA 1CGPA 3T2QA 2R0QC 3DCQA 4MXVA 2WV1A 5A2QK 3U1DA 2DT5A 3ZQGA 2KRFA 4BCUA 3ZFGC 3GZEA 1XCBA 1LEBA 1O3TA 2H0BA 2V73A 3BP8A 3CJQB 3KF5A 1YIOA 3EYIA 2VAUA 5BYNA 1BK1A 4LQRA 1SEUA 3TWIA 2JJ7A 3VKNA 5JXIA 4P9WA 4GQ7A 3ZN0A 3L09A 2PHRA 4ITVA 3MIFA 4CEWC 3DTIA 2Y6HA 4Z92B 1YI9A 4LHSA 3QWLA 1VQ9I 3ZQIA 1QJX3 1ZA4A 1X58A 3V4GA 4YLZA 4CPBD 2QQVA 1QH7A 2GC2A 4CYDA 4KMUX 1AJKA 2VCAA 5F32A 3HBLA 3FHNA 1B1BA 1GV2A 2RQPA 4ZH4F 5ILUA 3IT8A 1YYNA 3F8BA 3RQ0A 2ET7A 3J7YJ 5FAXA 4E6KG 5IFPA 2HWD2 4XRSG 1ND3A 5IP6A 4LO4B 4BK4A 4EZ4A 4BDYA 4I6ZA 1DZQA 3Q8EA 5BV6A 3CUQB 4D3WA 2LOOA 3BPSA 1BMV2 5CAZA 4BY1J 5JR2A 3IC7A 5FYYA 5A3OA 4J19A 2DI3A 2ZHLA 2HYKA 4DUVA 2IS2A 1D4M3 4CCMA 5CEHA 4ZZLA 3P9CA 1J1LA 4JX0A 5IVJA 3KZ4C 2BVMA 3DTKA 2QQMA 1WJFA 1NCQA 4RAFA 4GFBA 5L73A<