4N9IA

Crystal structure of transcription regulation protein crp complexed with cgmp
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
202
structure length
202
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catabolite gene activator
publication title Structures of inactive CRP species reveal the atomic details of the allosteric transition that discriminates cyclic nucleotide second messengers.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator
total genus 62
structure length 202
sequence length 202
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4n9iA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4n9iA01
1R1TA 2GC0A 4LD5A 4WBBA 3SHRA 1OI6A 1UPIA 4M9SA 5D4SA 1O3SA 1LRHA 2IW5A 4Z82A 1OYYA 1YW9A 2OQRA 2DT5A 5D5XB 1FP1D 2V09A 2IVMA 4MTEA 2OZJA 1TQ5A 3SQNA 1J58A 3LA7A 2XHKA 3WGHA 2KXLA 3GFMA 4P96A 3QPHA 2XKPA 3L09A 5J3UA 1IN8A 1K7AA 4ZYHA 5ICEA 1ZG3A 3D5LA 2HR3A 3F72A 2STTA 2ZO4A 2MH9A 3IDBB 3HTSB 2VT3A 1TBXA 4M74A 4ZYDA 2IT0A 2OPKA 3HHGA 3FF5A 1WQ2A 2Z33A 1KU7A 4L5JA 1NHAA 2MHFA 4UVCA 4BHBA 4XFGA 1LKNA 3IHUA 2OA2A 1UCRA 1K79A 1UCXA 2P6SA 3IWFA 3U2RA 3EBRA 1NYWA 2E9QA 3WTXC 4AVCA 3NRVA 3T0YA 4FX0A 4MEXF 1F9NA 3UKVA 4CDGA 4ESBA 3NSTA 3L2HA 5BPDA 4D7TA 1KU3A 3TO9A 3MPBA 5CVIA 1FYMA 4AIKA 4CHUA 4A0ZA 3KP5A 5CU1A 1ZX5A 3K69A 1CAWB 2GA1A 1YS6A 1IRGA 1FNNA 1OPCA 1J59A 3ELKA 4Q29A 4IEZA 1YFXA 5E8IA 4QM9A 2XLAA 4CZZA 1IN5A 1SFNA 2Q1ZB 1DZTA 2M5WA 3FZVA 3OV8A 2Y75A 2A61A 2J5OA 5LBQA 4GYIA 1XE8A 2FBIA 2QWWA 4NHJA 5KVRA 3HT2A 1IZ1A 2HFHA 5BV6A 1XMKA 2EFOA 2PYTA 3FZ3A 5L3BA 3QAHA 3V8LA 4XEZA 5LHHA 3RKYA 3TO6A 3LQQA 1WI9A 1HW1A 4IEUA 4UBGA 1YTYA 1ON1A 2DU9A 2BNOA 1O5LA 4U0VA 2EAAA 3MDPA 4O5VA 1LDDA 1X8MA 1XSVA 1OMIA 4JBAA 3T1BA 4L18B 1OD5A 2L54A 5DV5A 3K2ZA 3RPQA 4XETA 1Z7UA 4BIFA 5D8KB 2GC3A 1H1IA 5E18F 2VQAA 4MGRA 1UFMA 4UXAA 1QXJA 3U9GA 3VODA 3SXWA 1MJBA 4OIRF 2CW0F 1X3UA 1EP0A 3SZPA 4GXOA 1FZPB 5E1XA 2GH2A 3EYYA 5FFXA 4XFFA 5FQ0A 4ENMA 2GC1A 2CQKA 2F5DA 2XKOA 2ETEA 2JZYA 4AVPA 1FBSA 2VC1A 3P9IA 5ERIA 4BH9A 2QNKA 4KUMA 5JFRA 3F6VA 2GC2A 5F6FA 2VBWA 3E6BA 1REPC 2KIFA 1HSTA 1WSUA 2PAKA 1LDKB 3V8KA 3WTTC 4BNCA 4WWCA 1MJAA 2XL7A 3MQ0A 3BZ6A 5FFZA 2ZMEA 3ABTA 5LLQA 5FO5A 4ZU7A 3K9TA 3N4MA 5LEKA 2MPFA 2NNNA 4JQFA 4UUVA 1O7LA 1J3QA 3G7DA 2H6CA 4CGZA 3LAJA 5D5WB 3NKTA 2CYYA 3E6CC 1P92A 2MC3A 4OU0A 1T38A 3HSFA 1BC8C 5KHKA 2KRFA 2HYGD 4PGHA 3KP6A 1ZNPA 2BE5F 4RD7A 5LHGA 4MZUA 1WLTA 4MGZE 3DP7A 2FE3A 2EWNA 4IESA 4ZU4A 2W24A 3OGJA 4LLNA 4ENKA 2XGXA 2E1NA 1LR5A 4HYEA 4LK0F 4IRHA 4YRDA 2Q8KA 3GFIA 2VBZA 5E1ZB 3J80K 1T39A 4Q4ZF 2UZKA 2O0YA 2P7VB 2R3SA 2NS0A 2DI3A 3F8FA 4JTOA 1W7PB 4RGUA 1FC3A 1ZHFA 1FSHA 2DBBA 4LA2A 1CX4A 1FYLA 1YFYA 3CUQA 1ZZ9A 4WZCA 2V79A 3MCZA 2XROA 1MKMA 1TW2A 3ACLA 5BMZA 2STWA 1UD1A 3LA2A 4EQQA 4MHGA 3EQEA 2GXGA 1TTYA 3FXQA 1UHMA 1Z1DA 2M1BA 3F8CA 2XASA 2MLGA 2ACJA 2IXIA 2H0VA 2RVCA 2XL9A 2FEZA 2XUBA 1USTA 4EM2A 1CF7A 4QLCU 4XF9A 3HRMA 3HYIA 4DQ2A 4KU8A 2W85A 2YPRA 1J7KA 2XRNA 1R58A 3FMQA 2QBYB 1JGSA 4O9EA 4M73A 1SD6A 2P6TA 2ZCWA 2EK5A 2HYFA 2JRTA 4L9VA 3ERED 2OA4A 1Z91A 4G8XA 1XSXA 1GHCA 1FX7A 3DKWA 4J1XA 4M9ZA 3RKXA 4L5IA 1T2KA 1KQ9A 3ZMUA 1XB4A 1SD4A 2HDCA 1BI3A 4YFNF 5TRDA 2B9UA 3JTHA 3H7YA 3QU3A 1E17A 1HKTA 3VHRA 2Z3YA 2H6BA 1TQIA 3WGIA 4B29A 1FBQA 4ENJA 4G94A 5KHHA 1W7PD 4CYDA 2VE8A 3WU0A 4AXOA 4WCGA 4QM8A 3Q9SA 5JI6A 2IA1A 2QQAA 3BU7A 1XGMA 1KYWA 2XLGA 3SCHA 3GUDA 2ELHA 4L0ZB 5AIQA 4EGYA 4N0BA 3ETQA 2DFIA 4RAYA 5IT9K 4P9GA 2BGCA 5LGNA 2MNGA 2QDRA 4HF1A 2XV4S 1A04A 1F5TA 5KBFA 3RZZA 1KQ0A 4HMZA 5D4RA 4RGXA 4QGLA 4XFIA 1U2WA 1BI1A 4M71A 4KU7A 3EETA 4BXUA 3M8FA 3IKTA 2PAEA 3H9AA 1S7AA 3FM3A 1B1BA 4ON0A 5HI0A 1TQMA 2EJRA 4I02A 2Q4SA 2Y0OA 1D3YA 1DPRA 3I59B 2ET7A 4R8HA 2WC2A 1KQ8A 3CO6C 3H1WA 3WW1A 3P9CA 5FGMA 3L9FA 2F2EA 4UNOA 3JW4A 4HF2A 3R60A 1ULYA 1LEAA 4OMZA 4XSXF 5HS8A 4RGSA 3WW2A 4MV2A 4MGKE 3F8MA 2ISYA 4NVPA 3F22A 4I0AA 2K9ZA 2K4JA 1WA4A 2B0LA 1I6XA 4HX7A 1XDUA 3ML6A 4Y17A 2HOEA 1S29A 1J9IA 1F4KA 2AS5F 1SFUA 2IXJA 3E6MA 4LB5A 2RQPA 2KIUA 2HWVA 1UHWA 2FNAA 1ZZ6A 4KT5C 3TNQA 5H20A 3SZTA 4BHPA 1EPZA 2OD5A 4IERA 1AWCA 2EV6A 2GQQA 3IRQA 1O4TA 3BALA 4S04A 1L3LA 2WWYA 1MDMB 3LA3A 2IRFG 1NZCA 2JPBA 3F8BA 5IT9Z 4LG0B 1AOYA 4LUMA 3VOEA 4MQ9F 4HX8A 1ZZCA 4A5NA 2KJCA 3OCPA 2LDUA 4R52A 4KA4A 1JXSA 3E3VA 4A5MA 2JSCA 1IPJA 4HOBA 3E5UA 3GW2A 1JE8A 3PVBB 3JSPA 2IP2A 4OMYA 3RKWA 3BPZA 3J81Z 3R4KA 2Z69A 3OOPA 2DW4A 4PCQA 4O9GA 4YIIA 1XN7A 3BPXA 4UHTA 5A2QK 2OQGA 1RZ4A 3M7GA 4PIXA 4E70A 4HVRA 5E17F 1ZREA 1KU9A 4EVIA 2GWRA 3WTSC 5E16A 4IEYA 2QM3A 5K5RA 3EDPA 1O3TA 4HF0A 2DTRA 4Q0QA 4A0XA 1U5TA 2YU3A 5L3CA 1SMTA 3V8JA 3EJKA 3FM5A 1XCBA 2M30A 3TDZC 1IN4A 1XDSA 2P5LC 1ZLKA 4Q5SF 2D40A 2JT1A 3FXUA 2PHDA 4YFXF 4A12A 1RUOA 5DYMA 2ETHA 3JZVA 4D0PA 4KWKA 3S7IA 1S7OA 1B9NA 3RIRA 5CADA 1K78A 3TKYA 3LWCA 4G7ZF 4IVNA 4G7HF 1ZGJA 4PJYA 3NJZA 4QGNA 4JTNA 1RGSA 3E5XA 4I09A 4WK8F 2MD5A 1JHFA 3GO5A 4RB3C 4YARA 2IC1A 1T0FA 2BEOA 2RDPA 4A0YA 1FYKA 4UXNA 1G3SA 1B59A 2IA0A 4AQ2A 4G6DA 3WE3A 3HOSA 5I91A 1ZG5A 1DGWA 3TQNA 3HTUA 3FMRA 1EH8A 5DUKA 1OR7A 1W5TA 3ZQ7A 2VOPA 3ZMZA 5JSPA 4HN1A 2IXHA 1ZH5A 3K1NA 4IEQA 5ILVA 2PFBA 1CAWA 4ONUA 3RI4A 1ZARA 1DP7P 1YLLA 2RC4A 4XF3A 1XGOA 2ZJ2A 2WV0A 3I71A 4WXCA 1WKMA 5IT3A 2M8EA 1J5YA 4GYGA 4KIFA 5LHIA 2A07F 5TJJA 2CAVA 2R7DA 1RC6A 2EB7A 2V1DA 4HSJA 5I93A 3UKTA 4KFCA 3ZP5A 3O3KA 5CVUA 2ZNZA 2ESHA 2IJLA 4JVAA 4E2SA 2V6CA 2D1HA 4OOIA 5D5UB 2P5KA 3DPLC 1H9TA 1STZA 2VT2A 3IL2A 2CSOA 1RIOH 1J3PA 2QVSB 3CO7C 3RPUA 2GA2A 1YG2A 3FX3A 1D8JA 2WTEA 1U6GA 2YSRA 4FAGA 4WXDA 2V1UA 4G6QA 3QRFF 1J0RA 5ICCA 3RYPA 1HBXG 2GIVA 1Q43A 4IXAA 4KDPA 4IEXA 4MUVA 4P9FA 1EH6A 1UIJA 4AIJA 4XLPF 5JCTA 4LJZF 2HJIA 3M9AA 4GCVA 2QQ9A 4LFUA 2FF4A 2ESNA 4H0EA 2VXZA 3FFQA 2DLLA 4L9TA 3KP3A 5J8FA 2W57A 4IF4A 1S6LA 2O8XA 3O2PE 1QZYA 2HEOA 1FI2A 3DEUA 3I54A 4ORFA 2O61A 5AONA 1G4DA 1T6SA 1YFWA 2PG4A 3LOIA 3I64A 5DUIA 2QLZA 1ONVA 2RGVA 2DPDA 4CO8A 2ZXJA 5K8SA 2MA3A 3IC7A 3ISPA 5E1RA 2WFPA 1FPQA 5EFUA 5CJ9A 1BN5A 4LMYA 3VEPA 2EV0A 2PQQA 3D0JA 4PGGA 1VP6A 4YNIA 3I58A 2P17A 3TNPB 3IIAA 4K2EA 1YWKA 4U7DA 3OTFA 2H27A 2W25A 4HBNA 5CVRA 4IEVA 5HDNA 1WGPA 1HKSA 4IHTA 5FQ0B 2A5YB 3VFZA 4KYWA 2JPCA 1MJ9A 4ZYEA 2CAUA 2UYBA 4G7OF 4J1WA 3HHHA 5BPIA 4PIYA 4ZYGA 3KP2A 3KLNA 5J7MA 3ABUA 1QPMA 2LSOA 5EEGA 4EM0B 2NYXA 2UY9A 1YO5C 5KHJA 3FHIB 4O6JA 1QGPA 2L3DA 4LGWA 3V4GA 1O7FA 3DN7A 5FLXK 4YFKF 1Y0UA 5JAXA 2O3FA 4BHCA 3U1DA 1PMIA 2VC0A 4I01A 4IRGA 4TLFA 5C8WA 4KIBA 4L11A 3B73A 5BPXA 4L9NA 4YIFA 5FLHA 1LVAA 1R5HA 3NW4A 3CDHA 5D6FA 5BOXA 3QPTA 3FJSA 1CAXB 2MH2A 4GGGA 2DK5A 2BBYA 1KA8A 3WTYC 4L2NA 1BM9A 5FD5A 4IEWA 2OAZA 4B09A 1R1UA 5DCMB 1OFNA 2XIGA 2DK8A 3N97A 2O6GE 2QVOA 4LK1F 4Q0UA 4WVZA 3SFZA 2XAHA 4EJOA 3GYDA 1W7PA 3BDDA 3V7CA 1TW3A 4IRIA 4ESFA 3JSOA 1XSDA 2HGCA 3QP6A 4RAZA 4Q0PA 3ULQB 3MYXA 1T98A 3HOTA 3WGGA 1K6OA 1B9MA 4L9JA 4LLOA 3H3UA 4LULA 2GAUA 4MTDA 1OKRA 3LAPA 1CAUB 2B8MA 1TQPA 4E2GA 3QU6A 3CJNA 1R22A 1IF1A 1QXRA 2LNBA 2K4BA 4BQAA 5FCCA 4KMFA 5L3GA 1I27A 5L3EA 5KK1A 3S7EA 3KEOA 2QBYA 4XSZF 5FLXZ 2OBPA 1BC7C 4XBFA 2IXKA 4IEOA 2EFPA 1DGRA 4FT8A 3BJAA 1O3RA 1QNTA 1FOKA 1X82A 4MGIE 4RB0A 5HS9A 3BWGA 2PAMA 2UWMA 4D7SA 4MNUA 2XAFA 4XFCA 3EQLF 5I0TA 3CO2A 2OU2A 2XAJA 4EMSA 2JTVA 2Y48A 3KE2A 2PTMA 1P6RA 3M70A 5EEHA 3WTVC 3J80Z 2H09A 1CAVB 2FMYA 3LZZA 3ST7A 2FSWA 1VTNC 4ETSA 4X6RB 4BAYA 2A68F 5DDGA 1VJ2A 2C0ZA 5CYVA 3C1DA 3LFKA 3CF6E 1RI7A 2G7HA 2VBXA 1D8KA 2PMUA 3D82A 4OFGA 5HOOA 2EFNA 3AAFA 1IW7F 3K1MA 2OZ6A 3MWMA 3KCCA 4XLNF 5FPZA 1GVJA 2PMHA 4HV6A 1J3RA 2UXXA 2FQPA 3HQXA 2MLKA 2R7FA 2A6EF 2A6HF 4MX3A 2V9VA 3CEWA 6PAXA 3M3IA 1FSEA 1NXMA 2K27A 3KSCA 3KGLA 1XE7A 4HA8A 1ODDA 4KNYA 2O1QA 2CFXA 1PDNC 1U3EM 2EV5A 4RB1A 5BUVA 1CGPA 4Y13A 1QO0D 3S0MA 4YSFA 1D5VA 1TNSA 3I7DA 1RUNA 4AVBA 1UIKA 3PNAA 1FT9A 3T8RA 1S8NA 3BB6A 5H6RA 5JVTA 3JAMK 4FX4A 4EJTA 3RYKA 2FNPA 1IRFA 4AIHA 4UV8A 1O57A 4KL1A 4OINF 4LTAA 3Q5FA 5FD6A 2ZKZA 4EJVA 3I59A 3L2CA 2G9WA 2BNNA 1SD5A 3DQVC 4NB5A 1QQIA 3KP7A 1XD7A 3H7JA 3U0ZA 1Q5OA 1Y9QA 5I8SA 5JR3A 1HQCA 3FMSA 3ES4A 1I1SA 4EGZA 2UXNA 3WW3A 3KP4A 3QOPA 3T8TA 3WE2A 3KEQA 3ZMDA 3NL1A 5HLHA 5D8LB 1WWXA 1MZBA 4I0BA 2Z99A 2MBFA 4A2UA 1L3JA 1JUHA 3SXYA 3ZPLA 4HW0A 2VONA 5I0SA 2EA2A 3BJOA 1ZLJA 1ZAOA 1ZGAA 2LF7A 1FLIA 1KYZA 1NE6A 3CLOA 5LRRA 3JTGA 1EV7A 4QXKA 2CWEA 3PQJA 1RNLA 3TO7A 1MDMA 3HT1A 1L0OC 4Q47A 2H94A 3KFWX 4LG0A 1W4MA 1U5TC 3V7RA 3G73A 1XGNA 3I53A 1DZRA 3GZ5A 3ZMTA 3HSEA 4M6YA 1ZN2A 1YIOA 1FP2A 1O5UA 3JAMZ 3O6BB 3MFKA 1GXQA 4YYOA 4LA3A 1EY2A 4ZZDA 3BJ6A 2HS5A 2X4HA 3OF1A 3ECHA 1ZYRF 3CTAA 4CXFA 1UW8A 3DXJF 4KWLA 3W6KB 1YW8A 4XF1A 3BOQA 4EWEA 5JSOA 2FMLA 1FXZA 4F8AA 3E5QA 2VECA 3T5XA 3MZYA 1LB2A 1DDNA 2PJPA 1BBYA 2D93A 4LLLA 3IDCB 1PP8F 2OYZA 1R00A 2D1VA 2HKXA 5E1WA 4I3PA 2J5PA 3RYRA 4P55A 3ZMVA 3GX4X 2M87A 1EYBA 1ZRRA 5KHIA 4HLTA 4UVAA 1KU2A 3UKNA 2NAZA 2L4AA 1IPKA 4M72A 1IXCA 2KKOA 2O03A 3GLXA 2CV6A 1H1MA 4UV9A 4META 5LEJA 4HDUA 5J6XA 2RNJA 1GQGA 5AVPA 1U5TB 2E1CA 1Z9CA 3TOAA 2PA7A 1F1ZA 2E7WA 4KICA 3WODF 1BJAA 1HXDA 4KN7X 5FDBA 3DL3A 3KLOA 3ZN0A 1U12A 1XMAA 2HTJA 2QQBA 2F5CA 3CUOA 5D6EA 3LQRA 3P7NA 1BI2A 1LJ9A 2L01A 1LEBA 2ATFA 4AVAA 2VOOA 3HUGA 3RDIA 4LLGF 1K78B 2UYAA 2G7UA 1YW7A 2F5EA 1GXPA 4EJWA 4A6DA 4B8XA 2UY8A 1LDJA 3GEZA 2NNYA 4K8FA 3CLPA 3B02A 5ILUA 3R0JA 4U0WA 3M1EA 5I8YA 1ZZBA 4UBHA 1Y3TA 5I0RA 3IWZA 4RB2C 5HDGA 1USSA 2HQNA 1O3QA 2VPVA 4ENNA 2Z2SB 3C3VA 2QYOA 4DINB 4M6XA 4G9YA 5A2QZ 2GXBA 2Z9OA 3H8UA 2HTSA 5H6QA 2FBHA 1DUXC 1SFEA 2CGPA 4UVBA 3VB2A 1H0MA 3ZMSA 4QMAA 2A3SA 3CL1A 1NE4A 4QX5A 3G3ZA 3L00A 4KIGA 4QWQA 4DNCA 4EM1A 2PFWA 3MZHA 3D0SA 4XFAA 2XVCA 2EA7A 4ESJA 4BYYA 5CVJA 4QGMA 2DO7A 2O8QA 2Q2EA 1V4RA 4U88A 3GYHX 2X0LA 4HBLA 4HQEA 4MH0E 4PDKA 3RTRA 4AQ6A 2PN6A 3PFIA 4KMUX 1G6NA 1RL3A 1P4WA 2FRHA 2PHLA 3O14A 2EA4A 5JR7B 3LAGA 5FPXA 5ICFA 1W5SA 2A69F 2DPUA 2DCTA 2P7CB 1Q1HA 2EFQA 5CVVA 5D5VB 2BV6A 4HDVA 2VODA 3EO6A 4EV0A 2KJBA 5AIPA 4WF2A 4IJAA 5CLSA 3F6OA 1EH7A 2HZTA 4HAMA 2ISZA 3U10A 3GF2A 4L0YB 3WTWC 2V1XA 3EUHA 4HVOA 2LKPA 1G3TA 2YX4A 2F4PA 3KZYA 4FAHA 1IXSB 2PLYA 2BYVE 3BROA 3F21A 2RN7A 1OYIA 2FA5A 3C3WA 3RNSA 1X7NA 1YS7A 3EHKA 2COMA 3BPVA 2TDXA 1S3JA 5HVQC 1ON2A 3BP8A 5BQTA 2NRAC 5L3FA 2F5FA 1YLFA 2XAQA 1FWZA 2E7XA 4M9XA 3EYIA 3H50A 2XLFA 3RJPA 1R5GA 3FE5A 3ZN1A 1BOAA 4LUKA 4U0YA 4O3MA 3IRRA 1LNWA 1PP7U 3TGNA 3PLQA 2FU4A 4HLXA 5DD8A 3DV8A 3KGZA 3OD0A 4Q48A 3WU1B 3F3XA 1ZRDA 2RV8A 4OIPF 3WW4A 2L4MA 1J75A 1X8EA 3NVCA 1UB9A 2GZWA 3KZZA 2HQRA 2L02A 1J2XA 1P4AA 1B4AA 1R36A 5K5QA 2LF8A 5I8TA 2IXLA 2M45A 4S05A 1XCVA 3S2WA 1YYVA 2XAGA 3CUQC 2N7GA 4E2QA 1GQHA 5JSRA 5E8GA 2ZMEB 5BY5A 2CG4A 3COAC 1IN6A 1SMYF 2EVXA 1HW2A 1QBJA 4IHSA 5DCFA 3ROUA 1OYWA 1P4XA 4RGRA 2KIMA 1YHFA 4XF4A 4FBFA 2BNMA 1DPUA 2ZKLA 1ZZ7A 4HSLA 1QWRA 4ZU5A 4HVQA 2Q0AA 2QUFA 1YUDA 1R7JA 1SEFA 2VE9A 1CAXA 5ILSA 3FWEA 4MEYF 5C6CA 4PIZA 1TNTA 4EWAA 5J48A 3MEXA 5DCMA 1ZRCA 2VN2A 3BY6A 5ED4A 3GBFA 3PQKA 3LSTA 2FOKA 4Q0VA 3IBMA 1SAXA 3J7AO 4IPAA 1PUEE 3W6JB 3GWZA 4IEPA 5T3NA 4WXHA 2VBYA 1YFUA 4XFBA 5DEQA 4WX9A 1I5ZA 1C0WA 3NEUA 3KMHA 3I4PA 3FXRA 4KWJA 4CICA 3GXOA 2RKHA 1U8RA 3CUQB 1YFHA 2D2WA 4OLLA 2C6YA 4Y15A 1IXRC 1V70A 1CAUA 3SHFA 1JHHA 2HKOA 2ZFWA 3GFJA 3K1PA 1BIBA 1FY7A 2IA2A 4I98B 5BS6A 1QY4A 1P2FA 4R79A 5HLIA 1IN7A 2Y0MA 5ICGA 4HN0A 4F7ZA 4YG2F 2K02A 5L3DA 4RS8A 1H9GA 1CF7B 1G3WA 4JK1X 1XRUA 4MGYE 1Z05A 4A6EA 1U78A 1XGSA 3REOA 2DQRA 4P9UA 1LQ1A 5J8CA 1ZVFA 2K86A 4NQWA 3FHZA 4HZFA 3HSRA 2GU9A 3TOBA 2K0GA 3F8NA 3DPTA 1YQAA 1SD7A 1HW5A 4ASNA 5K1YA 3DFGA 1CAVA 4HV5A 3I0TA 3E6DA 2CO5A 3SCGA 1BIAA 1PM7A 3BCWA 4EWDA 3LWFA 3ECOA 3K0LA 1MD0A 4ZH4F 1SQ4A 2ZNYA 3R6SA 3IKVA 2P8TA 2D5FA 4LEJA 2OZUA 3TDUC 2PEXA 3WTZA 4AD9A 4U7BA 2Z5UA 1Z6RA 5DD4A 2FXAA 1B6AA 3GFLA 3ZDSA 5F1RA 4HX4A 1QZZA 1TLHB 2YX7A 1WRJA 5HLGA 4JV4A 1R1VA 2B5HA 2D5HA 4XF0A 1RTVA 4Q0SA 5FB2A 3NQOA 3C18A 3QP5A 3R61A 3HRSA 3GZ6A 5LGTA 3HIFA 1BI0A 1I1GA 3P9KA 4ZZLA 4XFHA 3DF8A 4AWXB 2K7LA 3H1YA 1G3YA 2I45A 3HRUA 1J1LA 4R1HA 2DAOA 1Q3EA 5FLIA 4Z07A 1Z6TA 1KGSA 2IXCA 1ZRFA 2QENA 1HKQA 4N9IA 4PZJA 3J81K 1IAWA 4Z2YA 2YR2A 2P4WA 3ES1A 5F64A 2Q0OA 3USSA 1R23A 5K5OA 4P5OA 4EROA 5KHGA 4FHTA 4TV7A 2QCSB 3F23A 2AXLA 3QACA 4XRFA 2ET1A 1MGTA 5E20A 4N9HA 2D45A 1VR3A 4X6QB 5D1IA 1ZZ8A 2P5VA 5BXXA 3ELNA 4OIQF 5LRSA 2FBKA 5HS7A 2ZBKA 3R0AA 3KETA 3M8EA 4HQMA 2PI0A 1IUYA 3L7WA 2PBIA 3H92A 3Q9VA 1ZG1A 2Q30A 3U11A 4HLYA 5JHUA 3H3ZA 2ADUA 2EFWA 1E2XA 3H1MA 4GO1A 1HSJA 3I5UA 5EZWA 2FQ3A 4OIOF 4MQVA 3GVAA 5HDKA 2DQLA 4KN4X 3HRTA 4LB6B 5LGUA 3C7JA 4GULA 5FLJA 4H7LA 5I0UA 3WTUC 2IPQX 2W84A 3CJXA 3SMHA 3V7SA 4I2OA 3MAJA 3E97A 2QJVA 2PQ8A 1V3FA 3WG9A 4EJUA 1FBUA 3SCFA 1SFXA 4IETA 4I7HA 2QZ8A
chains in the Genus database with same CATH superfamily
5CFCB 2GC0A 4P9IA 2V1NA 4LD5A 2WAFA 4YVWB 3HOUJ 2X53S 4X0GA 1VBD3 4DZPA 3CESA 4N4NB 2XVGA 4Z82A 3WF1A 3M07A 2OQRA 2DT5A 5D5XB 2YPDA 1M06G 3PURA 4AG4A 3M3CA 2G4IA 4AYBN 5EZGA 1TQ5A 4RHV3 3BYWA 1BL0A 3DYMA 1BJQA 3LA7A 2XHKA 3WGHA 1WLCA 4PFPA 1WZXA 4P96A 4AWDA 1K45A 1L7RA 2WDBA 2XKPA 5EZHA 4TYSA 1A36A 1UL9A 3NV4A 5ICEA 5LA2A 2BY3A 1SCRA 1Q8PA 3KVBA 3D5LA 3K6GA 4PFOA 3F72A 4B7KA 1QJZA 3OBAA 2MH9A 1W04A 2VMFA 1R4MB 1JW6A 1MNDA 1SFOJ 4PF5A 3HHGA 1VBE2 4K40A 2MHFA 5DAVA 5CBLA 1ACIA 4XFGA 2G9ZA 3IHUA 1FV2A 1K79A 4QPOA 2P6SA 3U2RA 3EBRA 3IH3A 1W36D 4XIOA 2VNVA 1VNDA 3NRVA 1N1VA 4FX0A 4MEXF 5GZDA 1UOBA 4CDGA 1FMD2 3VBHB 4BMEA 1KU3A 4W6XA 3TO9A 2WKKA 1WH7A 1MH4A 2XC7A 4Y4RA 2J1VA 1XSQA 3OGVA 5FY9A 5E3OA 2IGNA 1IRGA 1HRV1 4BQQA 3AL5A 4Q29A 2O0OA 1UMIA 3N35A 4U87A 1OLMA 4S2DA 1IN5A 4IGQA 2OQ6A 4HT1T 3HQUA 4YG0A 3OV8A 1JS9A 1VFCA 2RJ2A 1N3PA 4PJ0C 4GYIA 1VE0A 2Y33A 4A3IJ 4Y4YA 2A6TA 2QWWA 2YBPA 2ZGKA 5LK5A 2HFHA 2BVVA 4MOAA 4M3GA 4ZTFA 4P00B 1RKTA 3L9JT 1V6JA 1D1BA 3ILFA 3FZ3A 3U14A 5EHDA 2DA6A 5LHHA 3TO6A 2WNUC 3LQQA 1HW1A 2R043 4UBGA 4QB6A 5ISLA 3ZFEB 3B01A 2PHRA 3EUKL 1DYKA 2DU9A 2VO5A 2D6OX 1O5LA 1LDDA 4BACA 1X8MA 2R32A 3E1SA 2VZQA 3T1BA 3N7KA 2LR8A 1VIWB 2IWGB 5FZ7A 1IRZA 3C2HA 1Z7UA 4BIFA 1W3XA 1WJBA 5CFDB 4IV1C 5ACA3 4R9AA 3CCQI 3ZQFA 2E1MC 3G2BA 1I1EA 4BDYA 1LU1A 3MLLA 1LESA 3EYYA 5FFXA 1FYUA 2D44A 1I3HA 3VKMA 4LBJA 4UB6C 2WO7A 2O8KA 4M4PA 2JZYA 3VDDA 2YUEA 2J1SA 5JFRA 3F6VA 1OQEA 2WWSA 3O1UA 5F6FA 3FN9A 3E6BA 2KIFA 1HSTA 1ZRIA 4L8QA 2PAKA 3V8KA 1LVKA 3WTTC 2HWB1 2NP0A 1ETKA 4LXLA 3LSEA 2LS6A 1MQTA 3MQ0A 3BZ6A 4FCAA 3NWKA 2KM2A 5FFZA 3A4CA 2ZMEA 4NWVA 5LLQA 4OAZA 1RUE2 5K0UB 5A70A 4UUVA 1ZA4A 4CXXA 3GDBA 1I5PA 3Q8EA 3AZWA 1WKYA 3JRFA 5EJ1B 3B7MA 4RL7A 2CYYA 3E6CC 1JI6A 4OU0A 3DBRB 1B8IB 2E2JJ 4ZDPA 1YQ6A 1NOVA 3TP3A 1WLTA 2JJ7A 4QWNA 2FE3A 3OS2A 1Y7BA 2VZUA 3OYMA 2LW8A 1DGWY 2CJJA 2KISA 1K6YA 4A3XA 1UU6A 4NE9A 1BA5A 3KQRA 4IRHA 2PLV3 3GFIA 2VBZA 3J80K 1T39A 4X8PA 2Y69H 1N75A 2UZKA 1X1BA 3LEGA 3I56I 2R3SA 4Q4V1 4QPIB 2NS0A 1W7PB 3POWA 3HMYA 2K5CA 4CXWA 4BDZA 3BPSA 4LBQA 3ACFA 2XROA 1X19A 1B35C 2LVSA 2STWA 1D4M3 3LA2A 1NT0A 4XKWA 2R063 2XJVA 1VQ9I 3V0AB 3IPVA 3FXQA 1UHMA 1RUJ1 2M1BA 2BBVA 5FR3A 2ACJA 1S5LC 3MKYB 5H9PA 1RUI3 2HEWF 5FFOC 2QSGX 3BG7A 4TSVA 2FZ1A 1S1AA 3LB9A 3WNXA 4XBLA 2F4IA 1UF2C 5DUUA 3OYFA 1O4XA 3OIQA 5DZGA 3T09A 2YPRA 1SANA 5L7OA 4Z2AA 3M3EA 4ZXKA 1JGSA 4O9EA 1YC61 3ASNH 1K4TA 2FDGA 4YGCA 4L9VA 3ERED 3K10A 5FZ0A 2F48A 1GU3A 3DKWA 3RKXA 4L5IA 4AI2A 3S32A 2LROA 3H9GA 5JVVA 5ABJC 1X4OA 1RUC2 2WS93 3JTHA 1W8NA 1E17A 2Z3YA 1RUG2 1TQIA 2D6PA 2DA4A 4WM8B 3CQZJ 2GN7A 3MF6A 4E9KA 1C3HA 3H3LA 4OHYA 4QM8A 3HPHA 5L9VA 2ECBA 4BQ4A 3GTPJ 2QQAA 2ZSHB 2VVEA 1QPIA 1XGMA 3USUA 1KYWA 1C8M2 3SCHA 3PJYA 2LKSA 4OUSA 4B8EA 2VZPA 3CP8A 1Z7S2 3HEFA 1VMJA 4N0BA 3ETQA 4LOCA 4RAYA 5IT9K 5IHRA 3W21A 2GXAA 4A69C 2QDRA 2CUEA 3QYEA 3OOUA 4DYCA 1KQ0A 4HMZA 1U2WA 2HZDA 5K7HA 1PX4A 3VKFC 4BXUA 1B1BA 1TME3 3ACIA 1TQMA 5K7PA 1SLBA 2YDEA 1W0TA 3N3HA 4CP0A 4AM3A 1D3YA 3I59B 1GT0C 3MW3A 3WP6A 3P9CA 3L9FA 1CJPA 3ZOBA 5C8CA 3T1LA 1BBT1 5FP8A 3R60A 3PUHA 1ULYA 1KFUL 5C44J 3IDEA 1TG7A 2ISYA 4GMP3 1P7IA 4B3NA 4I0AA 1WA4A 2M4GA 1I6XA 3PJQA 1WJAA 1ZTRA 4DOZA 2AS5F 5AC93 1SFUA 5KCMA 3KV9A 2C26A 2HWVA 2FNAA 4RGAA 2E5ZA 2GNBA 2OD5A 3U4XA 1CX1A 2R16A 4H4KC 4S04A 1A3KA 2BWAA 3RZKA 5H2FC 2JPBA 3OYKA 2NVTJ 3F8BA 4BWOA 4D94A 3S2HJ 4CUGA 1AOYA 1QQP2 4LUMA 1T95A 3FL7A 2FD8A 2DCKA 3VD5A 4RA0A 1FOYA 2G1MA 2HWD1 2VIXA 3OB8A 4KA4A 3E3VA 1QA6A 4AAPA 4UUTA 1IPJA 1JE8A 1AA7A 3RKWA 2JG8A 3BPZA 3J81Z 1PO21 3OOPA 2CRGA 2IS4A 4CP1A 5FBJA 4YIIA 1XN7A 2IGOA 2ZA9A 2XR4A 1XNCA 5IUQA 4IE4A 3WR0A 4HVRA 2RV9A 2HWC3 3K2AA 4N7IA 4F92B 1TT0A 3ZDVA 4EVIA 2I8DA 3AP4A 4IEYA 3ZFGA 3SEEA 3EDPA 4HF0A 1JOBA 5DMYA 3Q9OA 4A3BJ 4AI0A 4Q4Y3 2WYFA 1XCBA 2KZVA 5FYZA 2MEV2 3AJYA 1XDSA 1W8TA 4CUAA 2D40A 3A02A 1SPPA 2E34A 5DYMA 4DZGA 4C0HA 4XCBA 2LFBA 3W2WA 4EN9B 4BLIA 4L0PA 1F4AA 2VY0A 5HV0A 4IVNA 1ZGJA 5CPRB 3T08A 1VPHA 4QPGA 4I09A 3BIEA 5FROA 5L9BA 4FPLA 4GXLA 4CTEA 1F2NA 2BEOA 2RDPA 2ZEXA 3IIIA 5G05L 4RS5C 1AF9A 2CV0A 2IA0A 4AQ2A 2C4XA 3HOSA 2XONA 4CCOA 3OJBA 1EH8A 5FXXA 1OLQA 1OR7A 1W5TA 1ZELA 5FZOB 2VQ0A 3SQOA 3ZMZA 4HN1A 1ZH5A 1JMUB 3CJTB 1ZBE3 4IEQA 3EUAA 1CAWA 2Q8EA 1AYM1 1PZ9A 1YLLA 2EZKA 5FBZA 4AEDB 2XJSA 4A3EJ 2ZJ2A 3OYEA 2FHRA 3LSIA 4MHRA 1J5YA 5LA9A 3KIOA 3BIWE 5TJJA 2VTFA 2VQTA 5I93A 1GMMA 4LBMA 3A7QA 2ESHA 2QSHX 4JVAA 2DVFA 2Q2EB 1OBNA 2V6CA 1JYNA 3DPLC 1UXXX 1STZA 2ECCA 3TN93 1RIOH 3RPUA 1QGLA 2GA2A 4FE7A 4DQAA 3FX3A 4RAGA 4RM3A 4GB33 4OQ9A 1CR7A 5C3QA 1UKRA 2D97A 1J0RA 3RYPA 1HBXG 3CCYA 3RSJA 4HETA 3C2BA 1N25A 4MUVA 5LBFA 3VDDC 1EH6A 1UIJA 3LSPA 4GQ7A 3A2KA 1POV3 4BXSV 4H0EA 3FFQA 2UUZA 4L9TA 5J8FA 2CGOA 5FWEA 4LHKA 1QZYA 3DEUA 3I54A 4QQLA 3DYOA 1X2NA 5C33A 2KLOA 1GYKA 4NR1A 3LOIA 2D6LX 1DGWX 5FMOL 2DPDA 4CCKA 3Q8CA 2EIKH 5K8SA 2MA3A 3ISPA 2KD7A 1Z0XA 2WFPA 4OZXA 4JYKA 3JBG1 4V2VA 1UZCA 1DP0A 5FO7B 2PQQA 4YNIA 3I58A 2P17A 4HBNA 1HB2A 5CVRA 4HKLA 1PMJX 2XOMA 1WGPA 4IHTA 1MJ9A 1AZDA 2CAUA 3B9IA 4QPQA 3QLQA 2L7MP 4QX0A 2R92J 1VB4A 4AHZA 1VRH2 1MIJA 3OYHA 3ZN5A 3ZO0B 4E4DX 3SDBA 4O6JA 1WMXA 2LOOA 5HBAA 2L3DA 4JDMA 4XNFA 4CDXC 1IV8A 5EJCA 1N47A 1JJ8C 2IVIB 4DW6A 2MFZA 4OVEA 3TEXA 1LFPA 2JVHA 2V4JC 4TLFA 2VC0A 4PDWB 3B73A 5BPXA 1JH5A 1R5HA 3NW4A 5JOZA 1V6NA 2I2SA 1WJCA 1AL23 4LG3A 2D6KA 1LTEA 2VNGA 2VOKA 3LE0A 2C1FA 4XHBA 5GAGJ 2X5IA 5C7GA 1O4YA 1KA8A 1PZ7A 3SDGA 5FD5A 2XIGA 2DK8A 3N97A 1SG3A 2FDJA 4WVZA 3OD4A 1TW3A 3K51A 2L9SA 1XSDA 4HL0A 3QP6A 2VXDA 4RAZA 3ULQB 1HQWA 2DYRH 4NHXA 4JOMA 2DVGA 5FYIA 3H3UA 2DV9A 1OPOA 1OKRA 4BDVB 2YUSA 4B48A 3CJNA 1VQKI 2DOFA 4EQVA 1W06A 3NQHA 1QXRA 3HB9A 1BVP1 2K4BA 4Y1XA 2VVFA 4XLAA 1W8FA 5L3GA 4GWJA 3T0DA 4UAPA 1LOGA 3S7EA 4XSZF 5M3MJ 2OBPA 4IEOA 3KV6A 3BJAA 2DTYA 5C4XJ 5HS9A 3THCA 4XFCA 4JC1A 3EQLF 3CZ6A 3ESWB 1Y9MA 2VZ1A 4FFIA 4P5HA 3PUIA 3WTVC 3J80Z 4LMFA 2FMYA 1BEV1 1GP5A 1W3VA 3H42B 2A68F 1VJ2A 4A6OA 1FMVA 4XXAA 5FO9B 1RI7A 1JUPA 1H8TA 1D8KA 3AX4A 2VVDA 1UOGA 1E57A 2B63J 5KHDA 4DXSA 3HQXA 1QDOA 2MLKA 1HOMA 3AG1H 4OHXA 4UWDA 2J1AA 1HRI3 2NM1A 2V9VA 3VWBA 4ES9A 3AP6A 3T2QA 1LFBA 1HN1A 3ACHA 3FLTA 1XE7A 4MXVA 1KS4A 1ODDA 4KNYA 1PDNC 1MZ5A 4FPOB 1TWCJ 3HN1A 1TNSA 1JYXA 4B43A 4AVBA 1FOD2 4URTA 3VDXA 3DEEA 4M3BA 3VBRA 2RJLA 1S8NA 3AP9A 3HR9A 5JOWA 1XYNA 4FX4A 3I2KA 3RYKA 1HLCA 4UV8A 4XZPA 1O57A 4B4QA 1DYOA 3IAM2 2JG9A 5LA1A 3FMGA 1MBKA 4NB5A 5KXDA 2ZJQF 1CONA 4QXHA 2V9KA 1RPWA 3FMSA 2OCEA 1I1SA 1UQXA 2UXNA 1LOBA 3KF5A 2BXYA 1AX0A 4ZC3A 1Q8SA 1AR62 1R1ZA 3T8TA 4CU9A 2YS9A 3U78A 5EYRA 2LBFA 3CC4I 1EUTA 1SFKA 1L3JA 2JG8C 4NIIA 3OYBA 1JUHA 1UMZA 4MYEA 2EA2A 2LALA 5DPNA 3RZLA 2LF7A 1FLIA 2A73B 5LRRA 3OR1C 1EV7A 4QXKA 1ULFA 1RNLA 3DEWA 2KA3A 4FETA 2R073 1L0OC 3ZQHA 4Q47A 1Q1VA 2H94A 3QBQA 3R4SA 3SITA 1W4MA 3J8F1 3N36A 2BERA 1DQ5A 1XGNA 1PX3A 4LO5B 3I53A 1HJGA 5FREA 3HSEA 5DAWA 3H5NA 3B6AA 3WT3A 2HOTA 1VBA3 2G9FA 5IFPA 3OF1A 1D7PM 2VLAA 2LG4A 2XPUA 4KWLA 2VPRA 3W6KB 4Y1YA 2FDFA 5F6KA 4UW5A 5JSOA 4XC9A 4YVWA 3T5XA 1REDA 4NC8A 5KWRA 1LB2A 2L7KA 4QPGC 3IDCB 1PP8F 3LFIA 2OYZA 2D1VA 1JKQC 1XB9A 5DN2A 3PUQA 4XOPA 4P55A 3GX4X 1S0EA 5BNOA 2FCVA 4HONA 4M3CA 4C2TA 1IPKA 3EPZA 1F15A 1Q8VA 3VBUB 3BG3A 3J9SA 3WNNA 2CV6A 3R0RA 1OR7C 4D7NA 4META 2Z4FA 4HDUA 2RNJA 2JWTA 4YW2A 1GQGA 2Y6JA 1U5TB 3J7HA 1RYYA 2D6NA 3S3NA 1D5YA 1W99A 4XCAA 1BKZA 2AEZA 1A31A 4KN7X 2F6BA 2ZKNA 2VGDA 2HTJA 5TSWA 4GWNA 4NO4A 4A41A 3MMYB 2WNEA 1BK0A 2IUWA 2V9PA 5FV3A 1VQ8I 1YI7A 1PMHX 1YW7A 5FRNA 4RSUA 3T2OA 5FPBA 4BEHA 3AMPA 3WNLA 3B02A 3VBHA 3M1EA 3LCPA 5HODA 5I0RA 5H9QA 3IWZA 4RB2C 5HDGA 1USSA 3WD5A 4C3HJ 2VPVA 3NAPC 3U75A 3J7ZI 2JJ6A 2AENA 2VASA 2IFRA 4DNYA 2ZJRF 4AVSA 3O5SA 5D2AA 2Z9OA 2ZX1A 2DFEA 2XH6A 3R4UA 4GRIA 3HKZA 3UKGA 2RR12 4BQXA 3CL1A 4LBOA 1MSEC 2VMGA 2ZX3A 4DNCA 2D98A 5CKNA 4XFAA 1REEA 5CQGA 2R49A 1PIV1 2DO7A 3JD72 1JZ7A 4BJTA 4JX5A 4JDNA 4MH0E 4PDKA 5J37A 4AQ6A 1POQA 3VB9A 4KMUX 1RL3A 2R041 3OIOA 3RI9A 5ICFA 1EAH3 2DPUA 4CU6A 5M5YJ 2P7CB 2EFQA 4AHWA 5D5VB 3HN3A 4HDVA 2VODA 3EO6A 2KJBA 3ZFEA 4WZFA 4A6SA 4IJAA 1R081 4IL6C 3ZSEA 4XW3A 4Q4W2 2GM4A 4IV3A 3U10A 2ZC2A 4L0YB 1WZ2A 1U0AA 3S5AA 4MFEA 3EUHA 2PLYA 2PX9A 5CFDA 3HJEA 4KQ7A 1W2NA 3C3WA 4XXPA 1XTAA 2CH0A 3EHKA 2YC0A 4COYA 1K83J 1WBFA 4X6AJ 2IS2A 5L3FA 2JDPA 1NA1B 1D2SA 1WW7A 3D3AA 1VBE1 5A7WA 1U0JA 2W0XA 3H50A 2XLFA 2WA4A 2EXJA 1JKPC 4CCJA 4CCEA 4U0YA 2H1LA 2GMPA 2BP6A 3TGNA 5IY5H 4CEYB 2FU4A 3VBSB 3SYTA 3SJMA 3OD0A 4Q48A 2X5IC 3F3XA 5A6ZA 1UU4A 4YM2A 2PQSA 1J75A 1UB9A 3IN9A 5IYBJ 5I8TA 1DGLA 2M45A 1ERDA 1FMD3 1XCVA 3S2WA 3ZSMA 5K0UA 3G71I 3GJAA 3WHUA 2JKBA 4ZS2A 2XAGA 2DOEA 3CUQC 3AL0C 2GP5A 2VMHA 4E2QA 5ANQA 1GQHA 5LBCA 2KFDA 5JSRA 4UW6A 4QQHA 3LSGA 3WNPA 3J7AY 1VBB3 2AREA 4GMP0 3VPRA 1P4XA 1Y1WJ 1B8IA 3I4MJ 2RAEA 1YHFA 1IPSA 1KGYA 1US2A 5F3IA 5J1XA 4HSLA 4QXBA 4AGGA 2PLV1 2Q0AA 4S2HA 1R7JA 1H88C 1SEFA 2CU5A 4YZ1A 2VE9A 2BGPA 4IE0A 4MEYF 4PLMA 1ZBA2 4EWAA 2EBIA 3S3MA 1LULA 5J36A 2VN2A 4QPIA 2FOKA 3CJQB 3IAQA 2NYYA 3KS7A 2DMTA 3BQZA 4YM0A 2R061 2RS32 4C1WA 1CD3G 4D0QA 1CVNA 5J4VA 2X09A 2W4SA 4N43C 4CCNA 3NEUA 5DZFA 4XIKA 3WXPA 1RUI1 2XWBB 3GXOA 2RKHA 5DZEA 3G1LA 2RDNA 5F37A 1RC9A 5A80A 4RQPB 1IXRC 1V70A 1CAUA 3SHFA 1HKDA 5FO8B 3PFYA 2R7TA 4UUSA 1BIBA 3JUUA 1ZGWA 1P2FA 4R79A 1QY4A 4N90A 5HLIA 3ECQA 4UT5A 1U8BA 4YG2F 2WV1A 1TMF2 4BU2A 1G3WA 3BZCA 5IVEA 4QU2A 1XE0A 1ZVFA 2K86A 3MF9A 3DTIA 4PSXA 4HZFA 1NG7A 3Q0VA 3F8NA 1N77A 1YQAA 4CPBA 1LOCA 1RUD1 1XXNA 2G0EA 4V1PA 1R4NB 2YC2A 1FMWA 1ZYBA 4EN8B 2NXNB 2ZTNA 1KS5A 4QKNA 1BIAA 1WJEA 3Q3SA 1RUE1 1VBC3 3NWSA 3ZPYA 4BE2A 4HSTA 3AM2A 3CZUA 1SQ4A 5KAIC 2ZNYA 3R6SA 1AR73 4GFBA 2OZUA 1EKEA 4LBQD 2VJIA 2PEXA 2M0MA 2NVUB 4U7BA 2VBDA 3CDIA 2PELA 5JWPA 2A5ZA 3GFLA 1ACCA 2ZBJA 2CUFA 2DA7A 5CYYA 5F5IA 1B72B 1TME1 1M4WA 3I4IA 3MIGA 2NQYA 5HLGA 4IEJA 4FOYA 5K4LA 1RUF3 3AVRA 4A42A 1RTVA 4Q0SA 5FB2A 3RWNA 3KV5A 3OSFA 3R61A 2R7UA 3HIFA 4EEFG 4ATFA 1MEC3 2P3YA 4NHKA 4YGBA 3DF8A 1GWMA 1Z3XA 3OBZA 2WNVA 3T2PA 2I45A 1J1LA 4YW1A 4BJ0A 3AC0A 4IHYA 1LPQA 2WQZC 1A6IA 5FLIA 4N7UA 1KGSA 1ZR4A 2QENA 4G3YC 2XG3A 4PZJA 2QQPA 4GH4B 5FYYA 1W9YA 2YR2A 1CQTA 3AMNA 3DPRB 4E27A 3HDDA 4J25A 2Q0OA 5KHGA 2K85A 2JUCA 5JUVA 3K3OA 2QCSB 3J7YJ 1MR5A 4QXCA 5CFCC 4XRFA 1I3AA 1MGTA 2D45A 5A3NA 2XSDC 4FP3A 3TW7A 2D3SA 4YVWC 1POV0 3L2YA 1ITYA 1GKBA 3HGGA 3RZDJ 5FRAA 3THPA 1YITI 3BTIA 3KETA 3M8EA 2W87A 4HRIA 4RA2A 3H92A 3N7JA 4CP2A 3ZXEA 1ZG1A 1JU4A 4GJYA 3U11A 4HLYA 2ZGQA 2WWUA 1RIRA 4CU8A 3I5UA 3C7OA 4QHOA 3GTMJ 1VI0A 4MQVA 1RUC3 4LB6B 1Y39A 3C7JA 2X51A 1XMXA 4GULA 5FLJA 2CV1A 2WAEA 3WOGA 2BOJA 2WR9A 2ID4A 3BCBA 2D6MA 4I2OA 3PDQA 3E97A 1IS5A 2K9NA 3U07A 1A6CA 2ZHKA 4EJUA 3OMYA 1AKHB 4WM7A 4IETA 4CUCA 1R1TA 5IOYA 5EJZB 1FV3A 1X2MA 1C8M3 4CDWA 1PVC1 5FRMA 1PGL1 2Q5TA 3JXSA 1O3SA 1MZEA 2YROA 1OYYA 1YW9A 1Z7S3 4H7MA 4B4CA 3B94A 1DU0A 1FP1D 3VBHC 3RZOJ 4CYCB 3CCMI 2VZOA 4B44A 2DDAA 1J58A 5GLTA 4EN6B 2KXLA 3NV2A 1GZWB 3BT9A 4K3UA 3IMMA 3QPHA 4KGGA 2DA5A 2BPA2 3L09A 3THTA 2OC6A 2HWE1 4YG3A 5J3UA 1IN8A 3JRBA 4ZYHA 2HVRA 3CMEI 2ZO4A 2LRDA 2QCOA 4ZYDA 3D5SC 1SCSA 2EIDA 4FTSA 1KU7A 2Z33A 4BHBA 1TT5B 4J19A 1UN1A 3OPZA 2EZHA 2OA2A 1UCRA 4M0HA 1UCXA 3IWFA 3PIGA 1ZBE1 3GZNB 3UETA 5FZOA 1HB3A 3T0YA 2VCCA 2WSVA 4BCUA 2K9QA 3L2HA 3JRDA 3MZ8A 1AXKA 1D4VB 3ZFEC 1HDPA 2VG9A 4AEDA 3KP5A 1ZX5A 3HOXJ 2MW8A 2B7EA 5DDJ3 5JXJA 4YZ5A 1VB2A 2JICA 2WFF1 3OY8A 3K4MA 5J4YA 3ATGA 2K3FA 2XBO1 1FNNA 2ELJA 3EUHC 3ELKA 5K7ZA 3TN91 3FBYA 1QQP3 5CFDC 1HQLA 4GB31 2M5WA 5EYYA 3ZFFB 2VMDA 1ND2A 1JUIA 2VQHA 2J5OA 1XNAA 4ISRA 5LBQA 4XR6A 1NLQA 2FBIA 5FZIA 3DGTA 4DYQA 2DUQA 3DYPA 3K46A 5FMBA 2Y8KA 2VL8A 2VW2A 4XRSG 3ZMNA 3I3DA 5EQUA 2JA6J 1DDLA 2PMZN 1D0ZA 1VQOI 3ZIWA 2X1DA 1YTYA 3N9LA 1XNKA 2WAOA 3ZN6A 2OTLI 2EAAA 4Q4V2 2XGDA 1ULPA 1PNFA 1XSVA 2B9SA 2WB1A 4ITVA 2L54A 2PMZA 2B4KA 5K0UC 2GC3A 3ZIXA 1H1IA 2XB0X 2VQAA 3O1PA 2GIZA 2IS6A 4NOTA 4LIVA 2IGMA 3K7AJ 3VODA 1IHMA 1UY4A 3CJIA 5FZDA 5E79C 1MJBA 4NC7A 2AQFA 1GLHA 3SZPA 2GH2A 1BR1A 2F5VA 2FDIA 4QDRA 3PUFA 2NN8A 1QJY1 2VC1A 3P9IA 4GKYA 1GV2A 3J7NA 3AKQA 2VE1A 2GC2A 5K7FA 3KF3A 2JXAA 5C9AA 2ZOEB 4QPIC 4OHZA 4CRQA 1GZ9A 1V9U1 1O8SA 1DIWA 1RETA 4BNCA 4U2AA 1MJAA 2XL7A 3BTZA 3BG5A 3ABTA 5JXGA 2P34A 4ZU7A 3N4MA 2MPFA 2O14A 4RM2A 3I55I 2NNNA 3JRHA 2EXHA 3ZPOA 1NTCA 1J3QA 3G7DA 1RJ7A 3NKTA 4MGTA 4X8NA 1P92A 2MC3A 1ULCA 1WW6A 1T38A 1G8XA 2KRFA 4MSVA 2MABA 1ZNPA 4RD7A 2JQ7A 4MZUA 1UX7A 3DP7A 4AEKA 3I2HA 3OGJA 1DQ2A 2KT0A 4ENKA 1LR5A 1LKXA 5LA0A 3O1OA 1JT0A 4OMCA 1XG1A 5E1ZB 4AQSA 3D4KA 4AI9A 2JDYA 1C5HA 2P7VB 4S2GA 2DI3A 1YJNI 2EILH 1ZHFA 1X33A 4LNVA 2BFUS 1OF3A 3MGUA 2DBBA 4LA2A 2P6CA 3NNMA 1V6MA 1YFYA 1ZZ9A 4WZCA 3KZ4C 1IDYA 1MKMA 3ACLA 5BMZA 1UD1A 3VDCA 3WQ0A 1SVLA 2JDUA 3CIHA 1S7EA 4WM8C 4Y26A 2OT7A 2BWCA 1IZ3A 5G04L 1X3WB 1RUH2 1TTYA 3K4KA 3X2QH 2GDFA 2MLGA 3SFIA 1BBT2 2ZEYA 5A7QA 2RVCA 1GZTA 2J42A 2XUBA 1USTA 1UYYA 1CF7A 2VZ3A 4RR3B 4XF9A 3HYIA 4QX2A 1CZVA 4XUNA 3OGGA 3SISA 2XRNA 1R58A 2QBYB 3WQ1A 4AHXA 2P6TA 2ZCWA 5IK5A 1Z91A 1GHCA 4DUWA 4J1XA 3NAUA 3WQ7A 1T2KA 3B9CA 1XB4A 1SD4A 3PL0A 4D1QA 4QX7A 5FY8A 4DBRA 2JA8J 1A35A 3VHRA 2BJSA 2H6BA 1YRNB 2WAQN 2BDRA 3BGAA 1VRH3 1HRI1 4G94A 2VE8A 2LY1A 5FUIA 3Q9SA 1ODMA 3IKWA 1W0OA 1XU2A 2IA1A 2HWD2 2WAQA 3AKPA 2X6WA 4HK8A 4GWMA 3POFA 2J22A 4XKBA 4BJ5C 1ULDA 4M0NA 5FY4A 3DLLF 4Q4X2 3N9PA 3BG9A 4DYRA 3I3QA 2KRHA 1LE8B 3OY9A 3H1CA 2BGCA 4DY3A 2MNGA 4W50A 5JZGB 4HF1A 1GP4A 5F3GA 3CMYA 5EIYB 1PK6A 1YIFA 5D4RA 1RHI3 3R4DB 5GTIC 5JLXA 4L5EA 3DKYA 2M4KA 2YGLA 4QAWA 3MFAA 4ABZA 1R71A 1FEXA 4ON0A 2EJRA 2W46A 1DPRA 4P9XA 4Y7NJ 2ET7A 5BNPB 2WC2A 2WL1A 3H1WA 3UV9A 3JCIA 1QJU2 5FGMA 4DXTA 2F2EA 4XOGA 5FXZA 5LZ6A 1OOPA 3V0BA 5C71A 5C3EJ 4Y24A 4XSXF 4RGSA 5GTHC 1IC8A 3WW2A 3LSHA 2WZEA 4MIMA 2K4JA 4QQOA 4BQWA 1OUXA 2B0LA 2M0CA 4Y17A 1SLLA 4NBQA 1S29A 1J9IA 2A71A 3K4ZA 4A3FJ 3G6EI 2RQPA 2ZAAA 1ETOA 2BV4A 2KIUA 4KGQA 3SH4A 4KT5C 3TNQA 4RLFA 3BI3A 1D0YA 1O4TA 2WINB 1VBA1 3AG3H 3LA3A 4XZUG 1NZCA 5EYXA 3QYFA 4PHZA 5FYVA 1YCIA 2ZGPA 1JBCA 4LBNA 5EEAA 4MQ9F 4B3XA 3WDXA 1ZZCA 2KJCA 2LDUA 2H8RA 2CQ7A 1WA6X 1WJDA 3WLUA 3PIOF 2A05A 1QU0A 2JA5J 4M00A 1TL8A 4LPLA 4HOBA 3E5UA 3GW2A 5F27A 3JSPA 1JT6A 3ZN4A 4OMYA 3MPPG 3VHPA 3R4KA 2CDPA 2Z69A 2O8OA 1S0CA 1RZ4A 4FASD 4W97A 4PIXA 2W92A 4RBOA 1JU3A 3OYIA 5E17F 2P4EA 3AYEA 3DCQA 5E16A 5D8AB 2QM3A 5K5RA 5FY7A 1V0AA 5A3OA 1KXGA 2YU3A 1U5TA 2EICA 4KH9A 1FOD3 4B1RA 5LK7B 4XYXA 4RFRB 1Z77A 2V73A 4AEDC 2QFEA 3KM5A 1FNZA 2VQCA 1M1EB 3LL7A 2EXKA 1RUOA 3RQIA 4JX4A 3K48A 2X6OA 5EF6A 3RMYA 4UOJA 3JZVA 4DY5A 3T4HB 3S7IA 5CKMA 1B9NA 3RIRA 4XACA 5CADA 3AZZA 2VJXA 1JYWA 3GBWA 2HWF2 3LWCA 2FDHA 4JKMA 3WDTA 2NS7A 3E5XA 2VNRA 2YU9J 4ASLA 4WK8F 4QKBA 3JBG2 4LO8A 3HUGB 1AR63 1KEXA 3DTKA 5E3LA 5LBEA 4UFLA 1LOFA 1B59A 3SEPA 1AU7A 2VL4A 3SNMA 4D7MA 3Q0UA 3HTUA 3I3MA 4DUVA 2C6SA 4LITA 4D6RA 4B47A 2P2KA 3Q8FA 5T55A 1V6IA 2IXHA 3K1NA 2OS2A 5ILVA 2PFBA 2DVDA 3RI4A 1ZARA 3C8XA 2VQGA 1JHJA 2RC4A 5JDBA 2Y6KA 3I71A 2K40A 1GLNA 5IW0A 2M8EA 4JHZA 3DKXA 4IX7A 3LNQA 4BL0B 1LNSA 2VZSA 3HNBM 1RC6A 1QHGA 4HSJA 3UKTA 2Z1DA 5F6LB 2VOTA 3SH3A 5CVUA 4U36A 2IJLA 1QVUA 3T1MA 1S2BA 4E2SA 1H9TA 1HC8A 1FTTA 1QJX3 4BS9A 2CSOA 4BQ2A 5JMOA 3KYLA 3LOCA 2W7NA 1SLIA 3KPHA 1D8JA 1W6MB 2WTEA 4FAGA 4WXDA 2RS53 4LQRA 4G6QA 3QRFF 4KT6A 1Q43A 2GIVA 1BVVA 4KDPA 2GBYA 4V2WA 2JIJA 3O7OA 3CCRI 4GIQA 3V65A 3M9AA 4GCVA 3IH2A 5IVJA 2QQ9A 2FF4A 2ESNA 2VXZA 1NK2P 2L7FP 2W57A 1S6LA 3O2PE 2HEOA 1FI2A 3CBNA 3HJRA 2O61A 5CEHA 5AONA 1T6SA 4LHNA 1ONVA 1MMNA 3OYWB 1W6OA 1YRZA 2ZXJA 3ZSJA 1UMQA 4PDWC 5JIUA 5EFUA 5CJ9A 1NH3A 1H6YA 5I0DA 4Y22B 1E5SA 3BZKA 4CEYA 4PGGA 3PVNA 4JP0A 3HBLA 3IIAA 3RZGA 4K2EA 5C4JJ 2W25A 4E6KG 3RG0A 5HDNA 5FQ0B 2A5YB 3AG4H 2ZJCA 4FVVA 4O65A 1TWFJ 1OFSA 3HHHA 5BPIA 3T0AA 4PIYA 2ZX0A 1SACA 4ZYGA 3KP2A 1YQ2A 1VBB1 3ABUA 4CDUB 2DDBA 3NJVA 2G9GA 4HXCA 2W68A 2LSOA 5GP9A 4EM0B 2NYXA 2R7OA 5F5CA 3TP0A 1YO5C 5KHJA 3TW6A 4LHSA 4AHYA 3AVSA 1WMFA 4L97A 4LGWA 4OMDA 2YU2A 3H8OA 3M8LA 5F5QA 3FXOA 4Q1PA 2A6XA 4C90A 5A1LA 1IRXA 5FLXK 5IK4A 3W5MA 3LOBA 1Y0UA 3M4OJ 1HV0A 2O3FA 2KPMA 1CN1A 4HKOA 4KIBA 4L11A 4L9NA 2GMMA 4XONA 3JD73 1BK1A 2BOIA 4GGGA 1DFQA 2NMNA 3POEA 4LO7A 4C3JJ 1BM9A 3C2GA 4HPQA 3VLBB 1R1UA 4XBNA 2PJRA 3AFGA 2O6GE 2VI6A 4DMIA 3KHBA 2XAHA 1LHOA 3HOBA 3V7CA 4ESFA 2ZACA 1WW4A 4Q4W1 1QEXA 4P08A 3PVEA 1W9WA 3JSOA 4NIGA 3O12A 2AHQA 2KDZA 1G9CA 5A3WA 4Q0PA 4AFMA 5JMCA 4Q8KA 3U4SA 4M01A 2RDSA 2QA4I 2W1OA 1K6OA 1B9MA 4L9JA 4AFBA 5IYYA 2EPFA 1NCQB 3FBNB 2ERFA 4MTDA 3ALQA 1W2UA 3GJBA 3LAPA 4Z6YA 1TQPA 2VJ4A 3QU6A 4EN7B 1ENRA 1UZ0A 1R22A 4Q5OA 4KI5M 1SBDA 3PVOA 4BQAA 3WNMA 3VZKA 3WF4A 1RMU1 3LSRA 2B42B 3KWVA 3LF7A 4K1YA 1BQPA 1R092 5KK1A 5FYMA 3VDBA 3MBWA 4G9SB 5KAFC 4AC0A 1Z7LA 5J1YA 1DGRA 4P9LA 1FOKA 4IQPA 4FPEA 1S2KA 1W28A 2IEKA 2H8WA 3BWGA 1UU5A 2B46X 2CHHA 4HANA 4MNUA 1VBC1 4W8JA 1XBFA 4LR4A 2XAJA 4FISA 4EMSA 2TBVA 3OSGA 2L7ZA 5EEHA 1ASJ3 2EIMH 1AR71 2R4GA 3AKRA 3ST7A 2FSWA 3MLKA 1TNRA 1VTNC 4ETSA 5DDGA 2C0ZA 3LFKA 3J8F2 4ASMB 1P7JA 2VBXA 2ADDA 1AXYA 4FFFA 4LO6B 1E3PA 1N1TA 4I6ZA 2WA3A 2UXXA 4BOWA 2W52A 5FZ4A 1VBD2 1HXS3 3ZQCA 4HG6B 3A01A 5F0CA 1B72A 4ZS3A 3GNEA 6PAXA 2UV1A 3BTJA 1MEC1 3KSCA 4ARYA 3KGLA 3NKGA 1ZBA1 5IVFA 1MZFA 4RHV2 5BUVA 1CGPA 4A7YA 3AXEA 3I7DA 1UIKA 3N7MA 3PNAA 1SLAA 3WVJA 2DMNA 1IV6A 3BB6A 1UYXA 5JVTA 5ABJA 2B9VA 2E7AA 2ZGNA 4EJTA 1IRFA 2JB8A 1G9BA 4MLOA 4AIHA 2XQXA 4OINF 3Q5FA 1OCTC 5FD6A 1OH3A 2ZKZA 1OCOH 1EV11 1UY2A 3MIDA 3DQVC 1QQIA 4XRSA 4AOCA 4LBLA 3DPRA 2FOWA 1Q5OA 1G86A 5I8SA 1DQ0A 1HQCA 1T08B 1V55H 1H8AC 2KZGA 2I74A 4Q26A 2LTPA 3W9AA 1CQ9A 2XGCA 1OUSA 1TMF1 3MIBA 1IUFA 5D8LB 1WWXA 1MZBA 4JHTA 3J4UH 1TP4A 4XN0A 2LMDA 1D1AA 4A2UA 5C5UA 2KL4A 3SXYA 1T56A 4XAEA 2VM9A 4JGYB 3BJOA 1W90A 3FFZA 2LKXA 3CLOA 3JTGA 4A3LJ 1ENSA 4ZZ5A 3KLSA 3VBUC 1DQUA 3P3PA 4IE6A 2MD0A 4K1ZA 3AP7A 1MDMA 1S0BA 2OVUA 3KFWX 4LG0A 1V5GA 1U5TC 3V7RA 1PO13 1T2XA 1DZRA 4JDOA 3GZ5A 3OBTA 1VAMA 1ZN2A 1YJKA 3VKLA 2R7ZJ 3JAMZ 3MFKA 5CIRA 4CEWB 4FTBA 2X1EA 4ZZDA 3BJ6A 2HS5A 4ANJA 2W94A 1UW8A 3DXJF 1PIV2 1ULOA 4TN7A 1YW8A 2L9NA 3H8XA 3BOQA 4XN3A 1FXZA 4YM1A 4F8AA 3E5QA 3O8GA 4BK4A 4BXXJ 1YJWI 1PVXA 3USUB 1BBYA 2D93A 2R042 2Q8OA 4DRRA 3WG7H 5HNHA 2I10A 3AYCA 2HKXA 5E1WA 1Z3YA 5GZCA 5IK7A 4HPKB 4I3PA 3I3EA 2J5PA 1LOFC 2R1DA 5BNNB 1EYBA 2RMU1 3UGFA 4HLTA 4UVAA 3UKNA 2YG0A 2ZXQA 1R082 4M72A 3ZYFA 1IXCA 2ZPXA 5LEJA 3OYJA 4E8CA 5AVPA 5IT6A 3NWTA 4MGSA 5F0FA 1OKOA 4E8DA 3FXMA 2K2SA 2XF7A 1Z9CA 4KICA 1XNBA 2NLRA 2YFZA 4R4XA 1N78A 2Y38A 3WODF 1BJAA 1HXDA 4FPFA 3DL3A 5KC5A 4XTMA 1U12A 2I07B 1XMAA 5D6EA 3U1KA 2F5CA 1APNA 1IQAA 2CW8A 4GDFA 3P7NA 3CCJI 4ZZ8A 2XVKA 5FP7A 2VD7A 2ATFA 3RDIA 2DXIA 2X1CA 2UYAA 5APAA 5A33A 3W58A 5J3LA 1FTZA 1HJFA 1GXPA 4BK5A 4UFKA 1YO8A 3I2DA 1AR91 4KBBA 4U0WA 1ZZBA 4UBHA 2JVGA 1WLWA 2VC9A 1GNHA 4BQYA 5FZ9A 3HEIA 2Z2SB 4M6XA 3WF2A 3LGRA 2YZ4A 1W6NA 2IZWA 1DUXC 3VB2A 3ZMSA 1SEUA 4MADA 5T5OA 4XDOA 2VQUA 1NE4A 1OLTA 2EIGA 4PT6A 4EM1A 3MW4A 3ZFFA 5IK8A 3TEYA 1OCZH 4BJ6C 2OUJA 3MZHA 2PFWA 2PXJA 2JKXA 3D0SA 2W1WA 3LDKA 2XVCA 3DCFA 4ESJA 4BYYA 3PUBA 4QGMA 3K77A 3FLRA 4XJ9A 3VZNA 1HRV3 3FUQA 1V4RA 1AR81 1NA1C 3GLLA 1COV1 1VZ0A 3RTRA 2Y34A 3PFIA 2PLV2 5A6QA 4OUEA 1G6NA 4RS5A 2EA4A 3RRDA 3LAGA 4AYUA 1W5SA 2VZVA 2DCTA 1E5RA 4CEYC 5CVVA 3PNTA 3VBSC 2VCBA 5EG0A 4Y3OA 5JXIA 5AIPA 5CLSA 3F6OA 2BZTA 1CPNA 4HAMA 1D4M2 5GM0A 2RM23 2R062 1YYNA 3SEZA 2OXBA 3B69A 4HVOA 2LKPA 1AYN1 1D0XA 2F4PA 4EZ4A 2ZHMA 1SDWA 3BR2A 1X4PA 2BYVE 1WD4A 1RUI2 3BR3A 3M3OA 3POIA 5F3EA 5CKTA 1X7NA 3WSOA 3I2IA 1G9FA 2X05A 1S3JA 3PL8A 2VULA 4D6SA 3MW2A 2JB4A 3BP8A 5BQTA 4PK4A 2TRTA 2XAQA 4M9XA 2BBAA 3EYIA 4NUBA 3FE5A 4RGGA 4AGRA 4LUKA 4O3MA 4EZHA 3IRRA 1LNWA 2W82A 2XF5A 1PP7U 1N3QA 3MEPA 5DD8A 3DV8A 1V5EA 3RCOA 2L9RA 3KGZA 1IOAA 1ZRDA 2RV8A 1NQDA 3ZYHA 1KRIA 4OIPF 3LQCA 1X8EA 3NVCA 4L9BA 2GZWA 3TAYA 4E7ZA 1B4AA 1R36A 5K5QA 1HLVA 1RUD2 1PZ8A 4QQPA 3BODA 4A45A 3HD8B 3OIPA 3ZXFA 2N7GA 2XDVA 1MQTB 2ZMEB 5LCWL 2CG4A 4RQPC 1Y1VJ 2DCZA 3POYA 2HWB3 2EVXA 3WU2C 4D5FA 5A7PA 4KMQA 2AYHA 1W0UA 2KIMA 2JECA 3O0WA 4OYUA 3ACGA 1OPMA 1ZZ7A 1W2TA 4XDPA 4HVQA 1LAJA 4WVWA 2NOGA 5F8PA 1CAXA 3FWEA 2WNOA 1QKQA 1TNTA 3ZLIA 1QNYA 3TRSB 3M7AA 1PGW1 3KYDB 4XDQA 5DCMA 1ZRCA 2YB7A 3GTKJ 1O8PA 3JCUC 4YGDA 2Y0IA 3UGGA 2VUJA 1TME2 3ZXAC 3QCWA 1U9NA 3A22A 1BXHA 1R64A 2IAIA 1YFUA 4WVMA 3BCAA 5DEQA 4WX9A 2JDZA 3MFCA 1C0WA 4KG0A 3KMHA 3ZQGA 1FIPA 3GHNA 5IP7J 4CICA 1YQ5A 1YFHA 4LBQB 4Q4V3 2D2WA 2A7AA 1Y56A 2VXRA 4CDXA 2CY6A 1AX2A 3ZQQA 2HKOA 1YNAA 2IVJA 2WABA 3ABKH 3GFJA 3IPVB 1T6BX 4RR3A 3JRAA 2IA2A 5BS6A 1HDDC 2CTVA 3P5BA 5AC92 5L3DA 4RS8A 2A6WA 4YZ3A 1YEWA 2JMWA 1RUJ3 2BW3A 2MYSA 4A6EA 3REOA 2DQRA 3MUZ1 3NJXA 5L7OB 5J8CA 4JQRA 1EUUA 3I2FA 2Y2ZA 2TUNA 2M3AA 3FHZA 3IB3A 4MFDA 4Z92B 3CF5F 2GU9A 3TOBA 1BR4A 4LE4A 1SD7A 3UT0A 2AR6A 2R7SA 4G4FA 4ASNA 5K1YA 3DFGA 1YRNA 5FZ8A 1CAVA 3LDRA 4OUMA 3I0TA 1OLRA 5B1AH 2L0KA 2CO5A 1JGGA 1GICA 4AEJA 1F31A 1IGOA 5GLZA 3SCGA 4XM3A 1RITA 2JUGA 3LWFA 1MBHA 2WT2A 3D8CA 4LOSA 3PHMA 4GH4C 4ZH4F 4DEVA 1X3ZB 1V6OA 1H4GA 5GALA 1SC7A 3DPRC 4LEJA 2YV8A 4Y33A 3TDUC 1T6GC 3ZQLA 4AD9A 4D3WA 4XLFA 1K5MB 1B6AA 1RHI1 5CAZA 4HX4A 3H9JA 2LK2A 4XHXA 3DXUA 1QZZA 2YX7A 1WRJA 4JV4A 4Q4Y2 3AYDA 1PVC2 2D5HA 2B5HA 4XF0A 1PGL2 5LGTA 2HOSA 4OHWA 3FLPA 1VQMI 4MXWA 3P9KA 1FPN3 2QQVA 1TNFA 4ZZLA 1KFXL 1OKQA 2HDDA 3W6VA 2E6VA 2FMDA 1F9KA 4F3QA 3HRUA 4CZSA 2DAOA 1Z6TA 4E4HA 1HKQA 4N4OB 1IG0A 2HWE2 3P5JA 1I6HJ 1RUH1 1FIAA 2QQOA 2DT7B 1R9TJ 5C8CB 4ISQA 2HPMA 1XNDA 3CNAA 2YXSA 5F64A 1W36C 4IQ4A 4P5OA 4EROA 4FHTA 2JE7A 4BLJA 2E51A 2WZPP 1BBT3 2AXLA 2QGUA 5E20A 1URXA 3BTXA 2ZEZA 2VMIA 4X6QB 1ZBE2 4JQTA 3T2TA 5LRSA 2Y0SN 4TZDA 4HQMA 3NNFA 1BR2A 3L7WA 2RS11 3Q9VA 1ULGA 1RR8C 2R7EB 2WZR3 4CXYA 1UG0A 3FDYA 1AHSA 2Q30A 2JENA 5JHUA 2L9LA 2EFWA 4FXGB 3VYRB 3H1MA 1UNBA 4GO1A 3H35A 2Y0SA 1CESA 5LY1A 4OIOF 3VHNA 2DQLA 2WFF2 4XUPA 2XBO2 5CA6A 1QHHD 1U9OA 2OIIA 1JN2P 3TN92 4K20A 2B7YA 2W84A 3CJXA 4GB32 3MAJA 2QJVA 4XE9A 2BY1A 4XUTA 1FBUA 3SCFA 1SFXA 2HWD3 5FUPA 2QZ8A 1WW5A 3AB0A 3SHRA 1NX9A 2Y31A 5A32A 4Q4X1 1XJAA 3MKLA 3TYJA 5D8AA 4M9SA 4AZZA 1R6RA 2IW5A 1PO23 3WQBA 4DO0A 4A93J 4H55A 5B2GB 2V09A 2IVMA 3ZFGB 1TZOA 1OJLA 3SQNA 1YIPA 3GFMA 2V26A 3ETPA 2B45X 4QQ2A 3BR5A 4PJNA 1D2QA 2VNOA 5HV4A 1SPPB 4E7HA 1QJU1 1OC1A 2Y6FA 1RXFA 2HR3A 3GALA 1NG6A 2STTA 3ZFFC 3IDBB 2E32A 2VT3A 4M74A 2OPKA 2DMPA 3FF5A 5DG2A 1WQ2A 4BE0A 1SHWB 4ARXA 1LKNA 4GKXA 2RJKA 4IGPA 3O8HA 1HB4A 1NYWA 2E9QA 2J1TA 4AFDA 5T5PA 3WTXC 3JQXA 1AUYA 1QJY2 4AVCA 5C5TA 5IOZA 2XWJB 4ESBA 4IO9F 3NSTA 5BPDA 4D7TA 3K75B 2BXZA 3MPBA 3UNPA 1FYMA 4CHUA 2ZEWA 3VD3A 4A0ZA 3WCRA 3PO3J 4QPYA 1S0FA 1V9U2 1ODNA 2W00A 3RQ0A 3K69A 1CAWB 2GA1A 1YS6A 3HBZA 2IS1A 4E4ZA 4AIDA 1OPCA 3I2JA 1J59A 1D0GA 4IEZA 5E8IA 4QM9A 2CL2A 2XLAA 2DDUA 1AYM3 2ILMA 1SFNA 2Q1ZB 5LASA 3FZVA 1AL22 1F5JA 1GV9A 5HCAA 4UW4A 2RS51 2A61A 2X9DA 1XE8A 3B93A 3BU0A 4NRPA 1XC5A 4ZDOA 2UWBA 3RI8A 3AL6A 3HT2A 1HDKA 2P3IA 4O61A 1X1CA 4HKWA 1O59A 3OS1A 3FIWA 5JI9A 2DMQA 1CPMA 5L3BA 3QAHA 5FPUA 4F3JA 1QXPA 2XQRA 3NAPA 4ITCA 3AYAA 2EIEA 4MHUA 3BR1A 4N53A 5EWSA 1DQ4A 3QYBA 2DTWA 1ON1A 2BNOA 5GZEA 4U0VA 1HX6A 2BVMA 3QPSA 4BGDA 1OMIA 2NS8A 5F04A 4M6VA 1OD5A 5DV5A 4F83A 3RPQA 3AXDA 4XETA 2WT1A 5D8KB 4RMNA 2N8GA 2K9LA 1VRBA 1G8WA 4MGRA 5IVYA 4A3JJ 4UXAA 3JR9A 3U9GA 3SXWA 4M3CF 3D5OA 3M1HA 5FZHA 1EP0A 2HWF1 4GXOA 3AZVA 4AR2A 5C4WB 5E1XA 1QOOA 2WWJA 5A6XA 2AZ5A 5FQ0A 4ENMA 1U5ZA 4RLQA 2GC1A 1OXCA 2IGKA 2CQKA 2F5DA 1A5JA 5ERIA 4BH9A 2QNKA 3IM0A 4XJUA 4COZA 4KUMA 3HVDA 4ZTJA 3DBLB 2ARCA 2Z79A 2W5FA 2F17A 1REPC 3EMRA 5DUWA 5IYCJ 4CCCA 4JX0A 1TZLA 2YHJA 3Q0WA 5E3NA 5FIXA 2QZ3A 1GOFA 5LEKA 3RZJA 3THDA 5TGTA 4AVZA 4DEQA 1HRI2 4CGZA 3HOZJ 5JOYA 3FHAA 1JZ3A 4A7ZA 1Z21A 2V72A 5KHKA 1ZR2A 2HYGD 4RR3C 2BE5F 2DMUA 1A34A 3WF0A 2A75A 5FMCA 4IESA 3C7FA 2W24A 3CF2A 1OA4A 3JRCA 2QQJA 2OQ7A 2E1NA 1YI9A 2J1RA 2DFFA 3DLAA 2X6XA 5DS9A 3BC8A 4LK0F 4QX8A 3VDAA 4YRDA 2Q8KA 4B4RA 5KXBA 3ZXSA 1NAEA 2EZIA 4Q4ZF 1DU3D 2X10A 2O0YA 4A3CJ 1QU3A 3VHOA 5FTTC 4JTOA 2VW1A 1FNYA 1FSHA 1W03A 4YZ2A 4BMBA 1CX4A 3KYCB 3S15J 3CUQA 4F55A 1NCQA 2GP3A 3GZEA 1LEMA 1TW2A 3HL2A 2ZXHA 5FWJA 4MHGA 2R7VA 1LOEA 2O7OA 1Z1DA 2XASA 2OUMA 4CCDA 2C9AA 3VKNA 2ARXA 2JD9A 3N7LA 4IW3A 2XL9A 2FEZA 1WPKA 3VZMA 4EM2A 5BNGA 3DWLE 2R0HA 1GP6A 2OKXA 4DQ2A 2W85A 1J7KA 3I3LA 3OS0A 4K21A 4M73A 2HBUA 3H0OA 1SD6A 4NHMA 2CU7A 3VBOB 2JRTA 2GNMA 2OA4A 4YEJA 2JA2A 4G8XA 3NRUA 3D1NI 1FX7A 1W9TA 5JZGC 3W20A 4QTRA 1KQ9A 3ZMUA 3HBKA 4N43A 2HDCA 1BI3A 4YFNF 1ALYA 1OHFA 5TRDA 3T4VA 1LGCA 1VBA2 1MS9A 2WADA 3WGIA 4B29A 1FBQA 1Y9GA 5BNPC 1YIJI 3BTLA 4ENJA 3HPNA 2R93J 5KHHA 2VTXA 4S0HB 1H8TB 3M2MA 1BEV3 5FZ3A 3TOJA 4DFSA 3FUOA 5GKAC 5JI6A 3POSA 2RE9A 3VZOA 5C3PA 2ZJPF 3HC7A 3ASIA 2RVAA 2XLGA 1WJFA 5FYCA 4L0ZB 2WIIB 3TBIA 5CISA 2BHYA 3WHTA 4URAA 5FKNA 2IFWA 5E3MA 1S72I 2BOLA 2DFIA 1BHGA 1HQNA 2WLQA 5A3MA 3K4DA 2VR4A 3KQ4B 5HLTA 2XV4S 1A04A 1F5TA 4LKSA 5KBFA 3RZZA 4RGXA 4QGLA 4Y20A 1OCPA 3VBRB 4M71A 4KU7A 3EETA 3IKTA 4AU7A 3HM5A 3H9AA 4DIQA 4J00A 1OA2A 2HYKA 1TWGJ 3C2UA 1W0PA 4BQ5A 4I02A 2JG9B 2GALA 4R8HA 1YQCA 1D1CA 1SFYA 3VYUB 3WW1A 1VQNI 3INAA 3WCSA 2WAAA 2WA0A 2YY1A 4C9YA 2E7QA 2ES3A 3I2OA 1LEAA 4OMZA 1X1PA 2XB6C 4XORA 4MV2A 2ZHLA 2QKDA 4NVPA 3F22A 4DB5A 4HX7A 3H8RA 2A3YA 1R091 1R1A3 2HOEA 2LBFB 1F4KA 1J1TA 1XSRA 1JTXA 1RVF1 1UYPA 2IXJA 2MG4A 3JRIA 1PO11 1XYOA 3GHMA 1OURA 4V2GA 1DCSA 1ZZ6A 5D8AC 5M5WJ 5D21A 3ZYJB 3SZTA 1EPZA 3MIHA 1PUFB 1AWCA 2EV6A 1DZQA 2GQQA 3IRQA 2QQUA 3BALA 2EXIA 1L3LA 2WWYA 2IRFG 1MS4A 4FCYA 5IT9Z 3R05A 4CEWA 2LREA 3OCPA 4A5NA 3CLQA 4EYUA 2EQRA 2WUHA 1JJ6C 5DM7F 3IUOA 1SFPA 3PVBB 5JR2A 2RDRA 1VBD1 1F36A 5CFCA 3ON7A 4GALA 4PCQA 3NNGA 4HPKA 2A3XA 4O9GA 3PSIA 1VQ4I 4UHTA 5A2QK 2OQGA 4LE3A 2HXIA 1WUVA 2WBMA 5BNNA 3G1MA 4SBVA 5HCFA 4E70A 4RHV1 1ZREA 1KU9A 3ILNA 3WTSC 4PJLA 1QRYA 1SLCA 5BNOB 2DTRA 3ZYBA 4M3CB 2KDOA 4YVSB 1U5XA 1TWAJ 3EJKA 3NJYA 3FM5A 4FPKA 2HNHA 2M30A 3TDZC 4ZDLA 1IN4A 4AYBA 2K46A 1ZLKA 4Q5SF 1B09A 2BU9A 2JE9A 3BLYA 3FXUA 2PHDA 4A12A 4JAAA 1OQDA 1NQJA 1Y8RB 1W8UA 1G9AA 2CDOA 4D0PA 1U5IA 3AFKA 4AL9A 4R4ZA 4G7HF 3NJZA 4QGNA 4JTNA 2DVBA 4P5YA 4QB2A 2MD5A 1JHFA 1BLZA 4BBSJ 1HCRA 1UZWA 4KG8A 5KXCA 2IC1A 1T0FA 3L2UA 3WP4A 2HVQA 1L7LA 2EINH 5CKQA 4AQTA 1G3SA 4BEHB 2XF6A 3PU8A 4G6DA 3WE3A 4XBQA 4NAMA 3ME2A 3TQNA 1XQNA 3FMRA 3HKZN 1IS3A 5H9RA 5JSPA 2DURA 4TTGA 2ARAA 3CCEI 1GANA 4NMIA 3BQYA 1VBB2 3EB7A 2D43A 4N53C 4LK7A 3VBFB 3ZX7A 1UWWA 5E6HA 4WXCA 3VYTB 4MO7A 3MHZA 2A07F 2W08A 2LY2A 5JLWA 2HDWA 2EB7A 5FUNA 3ZP5A 2ZNZA 3WDYA 4E7LA 1G7YA 4A3MJ 1H9WA 2D1HA 4OOIA 3POBA 4QDSA 2R7XA 1AL0G 4C0BA 3CQOA 2ID6A 3IL2A 2QVSB 1PIV3 3CO7C 2RM21 1YG2A 2L5QA 2M7AA 3WUDA 2M7BA 1DQ6A 1GWKA 1WHUA 2YSRA 2RQQA 2F4OB 3WNKA 1PHMA 4D9JA 2VMCA 5ICCA 2UWAA 4IXAA 4PQQA 4IEXA 3CC7I 1NY71 3DUIA 1MVEA 5FZFA 2QQIA 4AIJA 4XLPF 5JCTA 4XICA 2HJIA 1X36A 4LFUA 4CDUC 2PHTA 4IV3B 2OCCH 1UPSA 3VZLA 1YE9A 1R083 3WG3A 4IF4A 2O8XA 4QU1A 2CSGA 3TEDA 3PSFA 5ACA1 1G4DA 5T5JA 1H2LA 2CWSA 1YFWA 3B00A 5DUIA 1A8MA 2RGVA 3K4CA 3O0XA 3OG2A 3C7GA 1JZ8A 5E1RA 2XUEA 4B4PA 2HQ5A 1MBEA 1KZHA 4LT5A 5GAEJ 1UYZA 3VEPA 1UOJA 5A7WB 3D0JA 1RMU2 1E5IA 3TNPB 4BUPA 3HOYJ 4ES8A 1N1SA 1Y6IA 1W9FA 1VBE3 4IEVA 1H89C 1Z0HA 1HKSA 2DTZA 2WO3A 2ICWG 4UFIA 4ZYEA 4LLFA 5L9RA 2UYBA 2A6YA 2ELKA 1C1LA 1VBC2 2EIBA 4DXZA 5J7MA 5FZBA 3W2AA 5EEGA 2F6CA 1W6QB 2XB5A 2UY9A 3FHIB 2QQMA 1BW5A 3ZR5A 1AR72 4GAZA 3QD6A 1VALA 3V4GA 2VJJA 3LEIA 1O7FA 3I4NJ 1NCQC 1MS8A 3DN7A 4XAAA 4YFKF 2ZGRA 2CQXA 2DYSH 4RYDA 1FX5A 1HV1A 5JAXA 2D3RA 5DUVA 4BHCA 1PMIA 3S17J 4I01A 4IRGA 5C8WA 4NNJA 4YIFA 5FLHA 3OYNA 4II3A 5FP9A 1RUF2 3F95A 4AAXA 3CDHA 5BOXA 3WG4A 3QPTA 3FJSA 1H9PA 5HXVA 3NARA 1MMSA 3ZMOA 3PIPF 4XKCA 3WTYC 4L2NA 1MEC2 4H14A 4IEWA 2OAZA 4AFAA 4E4SA 1KONA 2Z16A 2QVOA 3ZSKA 4LK1F 5J96B 3I97A 4Q0UA 2BW8A 1W7PA 4QIWN 3BDDA 1D4M1 5C3RA 2Y26A 2HGCA 1JYTA 2ZX4A 1DBNA 1REFA 2X48A 5JI7A 3RJRA 3MYXA 1T98A 3WGGA 1RJ8A 4YIRX 4LLOA 3V0AA 1EV12 4LULA 4F91B 2D3PA 3IZOA 1CAUB 2B8MA 3QH7A 4JRAA 1AJKA 1WD3A