4N9IA

Crystal structure of transcription regulation protein crp complexed with cgmp
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
202
structure length
202
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catabolite gene activator
publication title Structures of inactive CRP species reveal the atomic details of the allosteric transition that discriminates cyclic nucleotide second messengers.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator
total genus 62
structure length 202
sequence length 202
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4n9iA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4n9iA01
2OZJA 4JQFA 4CYDA 2GA2A 2CV6A 5KK1A 3GYDA 4Q29A 2Q4SA 1YHFA 3GUDA 3O2PE 1SQ4A 2ZXJA 4HDVA 5LHIA 1J58A 4YFXF 3CUOA 1PM7A 3WTSC 2CAVA 1B1BA 1PP7U 5HLHA 1ZAOA 4AIHA 3TDUC 3FM5A 2PG4A 4PDKA 3NVCA 3SXWA 3UKNA 3HSRA 3MYXA 1B9MA 2M8EA 3WW4A 5KHHA 3LA2A 4A2UA 4KN4X 3OF1A 4A0XA 1K79A 2K0GA 5E1XA 3FFQA 1AOYA 1HSJA 4OLLA 3KP7A 4BAYA 4A0ZA 3JW4A 2DBBA 3OD0A 3KEQA 4ZU4A 5I8SA 2EAAA 4Y13A 1CAWA 4HAMA 2RKHA 4N9HA 5ILUA 1F5TA 4XEZA 1ZG3A 1DZTA 4ENKA 4KN7X 2V1DA 3T8TA 3FHIB 4IERA 1XGMA 2G7UA 5DD4A 2YSRA 3CO2A 4FHTA 3BPZA 3H3UA 4IRHA 4XFCA 4Q48A 4ZYDA 2A6EF 3QP6A 3MWMA 1XB4A 3HRUA 4AQ2A 2NS0A 3V8KA 1Q5OA 4IETA 4LLGF 3H92A 4HYEA 5FPXA 2W25A 2P5LC 3SQNA 4G7HF 2P6SA 1F4KA 2IXKA 2DO7A 5CVUA 1I27A 2YPRA 1OMIA 2YR2A 4XF1A 4MEYF 4UBHA 4L9VA 3KP5A 4HSLA 4F8AA 1ZG1A 1BBYA 1BIBA 2QM3A 4ONUA 3BZ6A 3DKWA 3TNQA 1XGNA 3PQJA 2MA3A 3QU3A 3IRRA 3KMHA 2TDXA 1HBXG 4I2OA 1LDKB 4H7LA 1AWCA 4A5NA 4LG0A 3USSA 2BNNA 3IHUA 5JSOA 2Z5UA 1T2KA 3KLNA 2HQRA 1O5LA 2F5FA 3U9GA 3MZYA 4M72A 5J7MA 3KSCA 2HKOA 4HX7A 3WTXC 1TQMA 2F5EA 1IPKA 2Q2EA 4KMUX 1W7PB 4EGZA 2PMHA 1C0WA 4EJVA 1BOAA 1HQCA 3K1NA 1TNSA 4LLOA 3LA3A 1P4WA 3IWFA 3ZMZA 2VODA 2HS5A 2DFIA 1VR3A 2HYGD 4OOIA 3NW4A 3JZVA 2B5HA 4M73A 1RUOA 5HOOA 4EV0A 2WWYA 2MH2A 3H7JA 4IEUA 3GF2A 3NSTA 1DPRA 3MZHA 3FM3A 2OA4A 5DCMB 4WX9A 3FXRA 4DQ2A 2FE3A 2O8QA 3SHFA 1MDMA 2YU3A 3JTHA 4FT8A 3DPTA 4NVPA 1BC7C 4ENNA 4I09A 2IRFG 5FQ0B 2R7DA 4TLFA 2EFQA 3VHRA 3M70A 1SFNA 4HX4A 4M9ZA 2FNPA 2W24A 4LTAA 3I58A 4DNCA 1G3TA 1R1UA 2A69F 4LK1F 1WWXA 3DL3A 3V7RA 3OV8A 1CF7A 3K9TA 2E7XA 1QNTA 1K78A 4LB6B 3SZTA 4YFKF 5LGUA 2H6CA 4HVQA 2RV8A 1I1SA 3BALA 3WTYC 4IJAA 4OIQF 2DQLA 2DK8A 1HKTA 2XIGA 2PMUA 3C7JA 2DAOA 1RIOH 4JTOA 4E70A 2CO5A 1Q3EA 3V7SA 1IAWA 3T0YA 5I0SA 3GFMA 4RB2C 3MQ0A 3ES4A 4I98B 3RTRA 1Z05A 5LGNA 4IEWA 2MH9A 1LDDA 1SMYF 4YYOA 2HTSA 3F21A 4BHCA 4O9EA 2XAHA 4PIZA 5I91A 2V1UA 3BCWA 2M1BA 4KWJA 2PEXA 1LJ9A 1CAXB 2WV0A 4MGKE 1Q43A 1LR5A 3RI4A 3ACLA 2EA2A 2QVOA 4S05A 3BJOA 1QXJA 1JHHA 1KU3A 2M30A 2XVCA 5D5WB 2Y0OA 3N4MA 1UHWA 1ZGJA 4MTEA 3RPUA 1QGPA 2XASA 1I1GA 3CUQA 4RS8A 1FYKA 2LF7A 4HN0A 1UIKA 1TW3A 1WKMA 2CYYA 1EH7A 2FXAA 5D5UB 4EM2A 4D7TA 4P9GA 3E5UA 4HLXA 3SMHA 1YFWA 3SFZA 3EHKA 2VT3A 5EEHA 1B59A 5K5RA 3WGIA 1K7AA 3ZDSA 5E1WA 4AWXB 2K9ZA 2DK5A 3RDIA 2LNBA 2PN6A 2GC3A 3JSPA 5HDGA 3W6KB 2ETHA 2PAKA 3CL1A 1V3FA 1IPJA 4WXHA 3I7DA 3KLOA 3M8EA 3WGHA 3ZN0A 2M5WA 4ENJA 4PCQA 2VBWA 1ODDA 3LA7A 3V4GA 2XV4S 3PVBB 3RKYA 1V70A 3QRFF 1ZZCA 1ZX5A 1SD5A 1SFUA 2VBXA 1Y0UA 5AVPA 2FEZA 2PHDA 4MUVA 3U1DA 4XSXF 4IPAA 2BNOA 5ED4A 5HI0A 1ZYRF 2OZ6A 2R7FA 3RKXA 1YYVA 1TLHB 1LQ1A 2W84A 1RTVA 1E2XA 4L18B 2XAJA 2KRFA 3TO6A 1IF1A 4KYWA 4IEOA 4E2QA 6PAXA 5EZWA 4EJTA 3CF6E 1XDSA 4QLCU 3U0ZA 1OYIA 4XF0A 4DINB 2GC0A 3F8BA 3QPTA 2NNYA 1HW5A 3CO6C 1QWRA 4YSFA 2OA2A 4L11A 5L3GA 3RKWA 2DI3A 4HVOA 4FAGA 4IEYA 2ZKZA 3LZZA 4KA4A 1IXRC 1RUNA 3U2RA 5FD6A 4QX5A 2L3DA 2XLAA 1EYBA 4KIBA 4B8XA 2Z3YA 1U5TA 4KNYA 2ZO4A 1PMIA 1ZZ7A 3CDHA 1MD0A 2QQAA 1XGOA 1Z6TA 4GXOA 4XFGA 4CDGA 3GYHX 1FLIA 1O5UA 3I64A 2ESNA 1J75A 4Q0UA 4KMFA 1L0OC 4AQ6A 1T6SA 4META 1J3PA 3T5XA 2QJVA 3P9KA 3F8NA 2FU4A 3TGNA 4HX8A 2C0ZA 2VPVA 4K2EA 5K5OA 3F6OA 1IUYA 3IBMA 1DPUA 1FBSA 3F72A 1H9TA 1ZG5A 3V8JA 4ESBA 2FRHA 3GX4X 3ECOA 3UKVA 4ENMA 5D8LB 1P6RA 2GWRA 2IP2A 2F5DA 1XSXA 3FMRA 4OINF 3DEUA 2D40A 4L0YB 5E8IA 2AXLA 2PA7A 4OU0A 3LAJA 4OIRF 1ZRCA 1UW8A 3WW2A 3NKTA 4XFAA 2QDRA 1YWKA 2XHKA 5DDGA 5KBFA 1U12A 4AIJA 2NRAC 2RNJA 2E1CA 5HVQC 2ACJA 5BS6A 5ICGA 3WODF 2OU2A 3CLOA 3BROA 2OYZA 2H0VA 4AVCA 3BPVA 3SZPA 5DCFA 1ZZBA 1F9NA 2VE9A 2VOPA 2LDUA 1YFXA 3C1DA 4M74A 1KU7A 5E8GA 1GXPA 3KE2A 4MQVA 3I59B 1IN4A 1WQ2A 4RB3C 2BV6A 4P5OA 3IIAA 3OOPA 1O3SA 2PLYA 4J1XA 4M9XA 3PFIA 4XF9A 2K02A 3KETA 4BHBA 2ETEA 5E1ZB 5IT9Z 2A68F 2B9UA 1T98A 4ESJA 2D93A 5FGMA 4E2SA 4XLNF 3Q5FA 4ZYHA 4MGYE 1B9NA 4I02A 3FHZA 3FZVA 3ELNA 2FNAA 1FY7A 5BOXA 2P5KA 1JE8A 4HF0A 2QENA 4EVIA 4YARA 1EH8A 4L5IA 5BUVA 2ZNZA 4LFUA 3I71A 3TKYA 2FBIA 4HQMA 1ZZ6A 1ZLJA 5LLQA 1ULYA 3FMSA 4AD9A 3H50A 2KXLA 3BWGA 2D2WA 3OCPA 3QACA 2G9WA 4UUVA 5IT9K 5L3FA 2HOEA 3BPXA 5AONA 4P9UA 4WZCA 5D5VB 1CAUA 1LEAA 3F6VA 1D8KA 2PI0A 4GCVA 1P4AA 5I8TA 1IXCA 4E2GA 1MGTA 4XSZF 1CAWB 3R6SA 2CFXA 2DPUA 4IHSA 2O6GE 4LD5A 1FYLA 2DW4A 5FFXA 3JSOA 2BGCA 4FAHA 1PP8F 1T39A 4O6JA 4EQQA 5ERIA 1XDUA 5JHUA 4XFBA 5E17F 2A07F 4UVAA 2JPCA 1BJAA 3IKVA 3MAJA 4GGGA 3EBRA 4EJWA 1WRJA 1YFHA 1XE7A 1UIJA 4UVBA 3HHHA 4XFHA 3EDPA 2ET1A 1J2XA 1IXSB 1EPZA 4U88A 5EEGA 1WGPA 1O4TA 2H27A 4QGMA 1J0RA 1IRFA 4TV7A 2GXGA 4D0PA 3IDCB 2JPBA 1WI9A 1ZH5A 2ISYA 2V79A 2A6HF 3ABUA 5FB2A 4ZU7A 5JCTA 2JT1A 4ZZDA 3V7CA 4LG0B 2GIVA 2VC0A 3JTGA 3PLQA 3F8MA 3F3XA 2O0YA 5ICEA 1Z1DA 4OFGA 5LHHA 2UYBA 4IEZA 2VQAA 2VOOA 5D1IA 5K8SA 4YG2F 1EY2A 4MQ9F 4PGGA 5D6FA 4O3MA 4L2NA 3T1BA 4RB1A 4AVPA 1JGSA 2HR3A 3L09A 4XRFA 1QZYA 3HUGA 4MEXF 4ESFA 2FOKA 3NQOA 1KQ9A 3HSEA 1OKRA 2Q0OA 2CSOA 3ERED 2ZJ2A 4CXFA 3CEWA 2RN7A 5CADA 1KQ8A 1H9GA 4YFNF 2HZTA 2H94A 2Q0AA 1QQIA 4GULA 3HT2A 5DEQA 4FBFA 4A12A 3TO7A 4AVBA 1T0FA 1IN8A 4MTDA 1RGSA 1J59A 3TDZC 1R22A 1YQAA 4EJUA 1HW1A 1MDMB 1G6NA 1Z91A 2KIMA 3ZMSA 5LEKA 3G7DA 4MGRA 2LF8A 2XL9A 4EWAA 3LAGA 4U7DA 3R0AA 1G3WA 4BIFA 5HDKA 2H09A 2D5HA 1FSEA 2A5YB 2EJRA 4X6RB 1FSHA 2ELHA 2L02A 2FQPA 2STTA 4UBGA 2P6TA 5H6QA 3BY6A 2E9QA 1W5TA 2V9VA 2O61A 2KIUA 4YIIA 2QYOA 1RZ4A 1K78B 2HGCA 2HEOA 2P17A 2IT0A 1TTYA 1S7OA 2K86A 3H3ZA 4L9JA 1NYWA 3F22A 4N9IA 5FD5A 3EJKA 5HDNA 1IW7F 4Z2YA 1EP0A 4Q0SA 3ZN1A 1U78A 2PAEA 4N0BA 5D8KB 3F8CA 1J1LA 4UHTA 5FCCA 4AVAA 5DCMA 5DV5A 1ZLKA 3TO9A 1OR7A 2PFWA 1FNNA 1J9IA 1USSA 1WLTA 3DP7A 3GXOA 1U8RA 3BB6A 3DPLC 2NAZA 4HBLA 1P2FA 1R1TA 4S04A 4HLYA 1UCXA 3B02A 5E18F 1QPMA 2IW5A 4QXKA 5ICFA 4P96A 5ILSA 3ABTA 3GEZA 1XMKA 4HF2A 2CQKA 3VFZA 1O7LA 2KJCA 3I4PA 4KICA 4LA3A 1ON1A 2G7HA 3LOIA 2ZKLA 1YTYA 2O3FA 1ONVA 2VBZA 1O3QA 4OIOF 2ZMEB 4HSJA 2KIFA 1NE4A 2A3SA 3CUQB 1FWZA 5L3CA 3KFWX 1DGRA 1P92A 1ZHFA 1IN5A 2QQBA 5JR7B 5JSRA 3BOQA 3RYPA 3L00A 3FXUA 5J8CA 5FFZA 1HSTA 4LUMA 2V6CA 5DYMA 3HT1A 2O8XA 2R3SA 3ZMDA 1ZRFA 3H1WA 4UV8A 4KIGA 1FP2A 5D4SA 1SEFA 4UV9A 1SFEA 1XE8A 1VTNC 1J7KA 4H0EA 1SMTA 4ZYEA 5FDBA 2JSCA 3C3WA 2D5FA 2Z69A 4I3PA 1BC8C 4KWLA 4KIFA 1CAVA 4OMZA 5AIQA 5LGTA 5A2QZ 3BDDA 2ZFWA 4YNIA 1G4DA 4KFCA 2UY8A 3F8FA 3P9IA 4RAYA 1X7NA 4Q0PA 3DF8A 1U5TC 2OBPA 3HHGA 3ECHA 1XCVA 4KL1A 4IVNA 3U11A 3HSFA 1O7FA 5C8WA 3GW2A 5F6FA 1S3JA 2MD5A 5FO5A 5TJJA 1QBJA 2BEOA 2E7WA 4JBAA 4EM0B 4ETSA 1PDNC 1Y9QA 3FZ3A 5BMZA 1QY4A 1FOKA 4XLPF 2BYVE 1KYZA 5I8YA 4GYIA 4M6XA 4G6DA 1LB2A 3IC7A 1LDJA 2K4JA 4HOBA 2GA1A 4FX4A 4MHGA 5A2QK 3HRMA 4CHUA 2EFWA 3C18A 3FJSA 3HIFA 4A0YA 1FBUA 4RB0A 4CICA 2CGPA 1CGPA 4HW0A 4PIXA 1U5TB 1BI0A 2ZBKA 2UWMA 3GO5A 4LULA 2DTRA 4Y17A 1UPIA 1O57A 2PQ8A 3MPBA 2Z9OA 4O5VA 2Y75A 3O14A 3EO6A 5LHGA 4G7ZF 3HRTA 2HQNA 2OZUA 4JK1X 4WXDA 3M1EA 1R36A 1ZGAA 1S7AA 2EK5A 5D6EA 3EQLF 5EFUA 3HOSA 1MZBA 4IXAA 2EV5A 4LA2A 2X4HA 3LFKA 3ZMTA 3SXYA 3HOTA 1IN7A 3CJXA 4EM1A 4LUKA 4QGNA 2QNKA 3L9FA 5L3DA 1SFXA 3LQRA 3NEUA 2YX4A 1ZREA 2QBYB 3M3IA 2HTJA 1TBXA 3ETQA 2K4BA 4WF2A 4XFFA 3CJNA 4WWCA 5BPXA 3IWZA 4Q0QA 1BM9A 2EFPA 2OQGA 1NE6A 1USTA 3D0SA 4D7SA 2FSWA 4JVAA 3S0MA 2ZCWA 5KHJA 2KKOA 3FF5A 3WTVC 4JV4A 2FMLA 1FPQA 1OFNA 1D3YA 2L54A 1BI1A 1MJ9A 4CO8A 3DQVC 1ZRDA 3I5UA 5I0UA 5CVJA 4CGZA 1ZNPA 3CO7C 5BXXA 3K2ZA 2EFOA 4LLLA 2IXIA 5DUIA 4L9NA 4ON0A 1Z7UA 2OPKA 3M7GA 3DV8A 2XROA 4QM8A 3K69A 1R5HA 3GFJA 3R0JA 2UYAA 4X6QB 5BY5A 2W57A 4ZU5A 2VT2A 1JXSA 1H1MA 4HV5A 1YW8A 2EA7A 4IEPA 2HWVA 2HYFA 2DT5A 1TQPA 3D82A 5CJ9A 4UXNA 4G7OF 2Z99A 1BI3A 2L4AA 4G9YA 2IXHA 1J3QA 2XAGA 2P5VA 5J6XA 1OPCA 2HFHA 5JSPA 1LRHA 4EGYA 4ZZLA 3BJ6A 5CYVA 2UZKA 3KP4A 1SD4A 3IRQA 2BE5F 2EV0A 3QU6A 2QZ8A 3GZ6A 3E5XA 3WTZA 2M45A 4ORFA 1U3EM 1MKMA 4EWDA 4EROA 2CWEA 3EUHA 4LMYA 1V4RA 3E5QA 2OD5A 3COAC 4A6EA 3BU7A 1XN7A 4R52A 4O9GA 1STZA 3DN7A 5ICCA 4F7ZA 5FLJA 2CG4A 3FWEA 3VEPA 4G8XA 3B73A 1UD1A 3S7IA 5KHKA 2MHFA 4KU7A 5FLXZ 4QWQA 2COMA 3RPQA 5HS7A 1KU2A 4WK8F 2QVSB 1XSVA 4M71A 1I5ZA 1HXDA 5KVRA 3O3KA 4LB5A 3L2CA 2B8MA 4HN1A 2J5PA 1D8JA 4Q47A 2VONA 5JAXA 4XBFA 1ZVFA 4BQAA 4I01A 2QLZA 1NXMA 5LRRA 3H1MA 4NQWA 2N7GA 4NHJA 3NRVA 1P4XA 4U0YA 3WU0A 3I0TA 3EYYA 4WVZA 2XAFA 3QPHA 1W7PD 4Z82A 3SCGA 5FLXK 2MPFA 2MBFA 2EB7A 2UXXA 5E1RA 3KZZA 1IZ1A 1H1IA 4Q4ZF 1Y3TA 3ES1A 5J8FA 4IRGA 4KT5C 4BHPA 1X82A 4U0WA 5FLHA 3KZYA 2PJPA 3WTWC 2QUFA 4HF1A 4R8HA 2MLGA 3F23A 3UKTA 2WTEA 2RVCA 4LEJA 2E1NA 1VP6A 4R79A 3G73A 1R58A 3S7EA 1RC6A 1ZZ9A 4KUMA 3WTTC 1QZZA 2GZWA 2UY9A 4IEVA 1TNTA 3DXJF 3WW3A 3VB2A 4NB5A 1U2WA 2UXNA 2K7LA 2IXJA 1XSDA 4WXCA 5C6CA 2CW0F 1B4AA 1GQGA 4FX0A 4BH9A 1YS6A 4HV6A 1YLFA 1UHMA 1YO5C 4I0BA 2F2EA 4LJZF 2VN2A 3E6CC 4HA8A 2F5CA 3RZZA 4MH0E 1S8NA 3GBFA 5JVTA 2D1VA 1FBQA 5CVIA 5I0RA 2IC1A 1KYWA 2VE8A 4XETA 5TRDA 2MC3A 1TQIA 1XMAA 4M6YA 4WCGA 3H8UA 2A61A 3GFIA 2ET7A 3N97A 5BQTA 1UCRA 2DLLA 2P8TA 2ZNYA 3TOBA 3W6JB 2VBYA 2XL7A 4EWEA 3WE2A 1YS7A 3KEOA 3U10A 5DUKA 2XKPA 2P7VB 3I54A 3HYIA 2IXLA 4U0VA 3DFGA 3KP2A 2FF4A 2BBYA 5JR3A 3NJZA 4KU8A 4GO1A 4ZH4F 1T38A 1ZZ8A 4MGIE 1G3SA 4LK0F 3J80Z 4PGHA 5CU1A 4RGXA 3P9CA 5LBQA 5D4RA 3OGJA 4YRDA 2LKPA 1W7PA 5FLIA 1U6GA 1IN6A 4IEXA 2DPDA 2XAQA 2XUBA 1R7JA 4G94A 2Z2SB 4Y15A 1CF7B 4RGRA 5J48A 1RL3A 2QQ9A 1ZRRA 3O6BB 2RC4A 1XRUA 2LSOA 4MV2A 3KCCA 3EQEA 2X0LA 3CUQC 3ST7A 4L9TA 3LSTA 1YW7A 4Z07A 5L3EA 4U7BA 3J80K 3KP6A 5HS9A 3AAFA 2O1QA 3RJPA 3D0JA 5AIPA 2GQQA 2PHLA 2FA5A 2CAUA 2GU9A 1FXZA 4QM9A 4RAZA 1KU9A 5FQ0A 2J5OA 2WFPA 3SCHA 2GH2A 4HMZA 1QO0D 2PFBA 2QCSB 2DU9A 4AXOA 1GVJA 1CX4A 3QAHA 5H20A 2ATFA 1YFYA 1XD7A 1KQ0A 1E17A 3PNAA 2DCTA 3JAMZ 1JHFA 3R61A 4IESA 4R1HA 4JTNA 2MLKA 5HLGA 1X3UA 4MX3A 2HDCA 3H9AA 4GYGA 1S6LA 4CZZA 4XF3A 3E97A 1LNWA 3HTUA 1NZCA 5BPDA 2IA0A 2D1HA 1DZRA 3WE3A 4K8FA 2OAZA 2Y0MA 3KGZA 2IJLA 3WU1B 2KJBA 4HVRA 4B09A 3GZ5A 3LQQA 2P4WA 3RYRA 3J81Z 3CTAA 1HKSA 2VECA 1FX7A 1ZARA 2HJIA 4A5MA 1UB9A 2VC1A 2V1XA 1DUXC 2BNMA 3GFLA 1CAVB 2EWNA 1FP1D 3JAMK 5BPIA 3Q9SA 3QP5A 2H6BA 3R4KA 1KA8A 2ZMEA 1LKNA 2RGVA 4ASNA 1J3RA 1CAXA 3RNSA 5KHIA 5CLSA 2EV6A 1TQ5A 2GAUA 4BNCA 4QGLA 2NYXA 2L4MA 4RGSA 3BP8A 2K27A 4KDPA 3V8LA 5J3UA 1MJAA 3L2HA 3TNPB 2Q30A 1TW2A 2Q8KA 2PBIA 3PQKA 4B29A 1NHAA 1XCBA 1FYMA 1IRGA 1OI6A 2IA1A 3J81K 2ISZA 1MJBA 2FMYA 3K1PA 2DQRA 4PZJA 2JTVA 4I7HA 3FE5A 2EA4A 3BJAA 4OMYA 2Y48A 1OYYA 1FT9A 3TQNA 2I45A 2XGXA 3CLPA 4P9FA 3ZP5A 1WA4A 5CVRA 3HQXA 1BI2A 5LRSA 5BV6A 4Q0VA 2FBHA 1GXQA 1RNLA 3ML6A 2O03A 3VODA 3E3VA 2GXBA 5F1RA 4BYYA 1F1ZA 1LVAA 2C6YA 2W85A 3H1YA 4HZFA 3IL2A 1Z6RA 5ILVA 1SD6A 5K5QA 1YLLA 1SD7A 5HLIA 4UNOA 1HKQA 3Q9VA 4I0AA 4OIPF 3EYIA 3RYKA 2WC2A 1X8MA 3GWZA 1O3RA 4HQEA 1RI7A 3K1MA 5E16A 4RD7A 3SHRA 3E6MA 3ZMUA 3GVAA 1QXRA 2F4PA 2JRTA 4IHTA 3ELKA 4KWKA 3LWCA 3GLXA 4L5JA 3SCFA 5I0TA 2XRNA 4HDUA 1R00A 1KGSA 1DGWA 3MEXA 2Z33A 3VOEA 2HKXA 1GHCA 2L01A 4ZYGA 1B6AA 2YX7A 2IVMA 1SAXA 1I6XA 3OTFA 2M87A 3R60A 3TOAA 4YIFA 3MCZA 1XGSA 3ZQ7A 5CVVA 1ZN2A 1OD5A 1Q1HA 4PIYA 1WSUA 2FBKA 3QOPA 2PYTA 3FX3A 3K0LA 5JFRA 2XLFA 4HLTA 1FI2A 4MZUA 2B0LA 1K6OA 1W4MA 4M9SA 2V09A 5IT3A 4PJYA 3ZPLA 4HBNA 4MNUA 3WGGA 2IPQX 1YG2A 3C3VA 4UVCA 3LAPA 2Q1ZB 3ZMVA 3RIRA 2VXZA 1ON2A 3IKTA 4G6QA 1BN5A 4J1WA 4QMAA 2ESHA 1YW9A 5E20A 1J5YA 2JZYA 1FZPB 4WBBA 2MNGA 1EV7A 3T8RA 1LEBA 3L7WA 5D5XB 3J7AO 5L3BA 5F64A 1YUDA 3KP3A 3MFKA 5FPZA 1FC3A 1Z9CA 4IRIA 2GC2A 1BIAA 2NNNA 1GQHA 1A04A 1G3YA 2XKOA 5I93A 3ULQB 3HRSA 1H0MA 5T3NA 2FQ3A 3S2WA 3D5LA 1L3LA 1PUEE 1X8EA 4P55A 2IA2A 1L3JA 3FMQA 4MGZE 4XF4A 5K1YA 2EVXA 3E6DA 1O3TA 3ROUA 2QBYA 1D5VA 4EMSA 5H6RA 2PTMA 1R5GA 4EJOA 1DDNA 5KHGA 3WG9A 5HS8A 3I53A 3REOA 3WTUC 3HTSB 5JI6A 3NL1A 1YIOA 4RGUA 2P7CB 1YFUA 2D45A 2OQRA 3LWFA 2QWWA 2STWA 3M9AA 1REPC 2PAMA 4LLNA 1EH6A 2ADUA 1UFMA 3EETA 4Q5SF 3M8FA 4A6DA 4BXUA 4UXAA 1DP7P 2AS5F 3E6BA 4LGWA 4XFIA 1R23A 4IF4A 3G3ZA 3ISPA 2EFNA 2IXCA 3P7NA 1W5SA 2GC1A 3I59A 3MDPA 3IDBB 1CAUB 3WW1A 1JUHA 2XLGA 2RQPA 4AIKA 3FXQA 3H7YA 1OYWA 4L0ZB 1VJ2A 4IEQA 3KGLA 5LEJA 1R1VA 1HW2A 2PQQA 1S29A 5DD8A 2RDPA
chains in the Genus database with same CATH superfamily
5FP8A 1B8IA 5FKCA 2CV6A 1WJ5A 2VXJA 4RMNA 1A6IA 4M3CA 1TZLA 3VBRC 3PU8A 4YFXF 1PM7A 3CCVI 3GHMA 4ITVA 1IGNA 1VBC2 2BHYA 1OCRH 1PP7U 4AIHA 1JKRC 3VDAA 3KIOA 5BNPC 4QB2A 1N47A 2PG4A 3NVCA 2DYCA 4AAXA 3LA2A 3D1NI 3WU2C 2J1SA 3FFQA 1WJEA 4A0ZA 2YROA 4EZ4A 1BBT3 5F8PA 1LNSA 4Y13A 1GWMA 2WRAA 2WAEA 3BR5A 2F4OB 1WW4A 1XNTA 1HF0A 5IT6A 4N9HA 5F6KA 2NVYJ 5ILUA 2WY8Q 4KN7X 4CZSA 3OYMA 5BNOA 5DD4A 1LGNA 5APAA 4BEHB 2LOOA 1IKQA 2ZEYA 2Q5TA 1T2XA 4XFCA 1JTZX 2A6EF 3QP6A 4CCEA 2D6PA 3MWMA 5H9PA 2W00A 2NS0A 3HBLA 4HYEA 2P5LC 2ZGKA 4FFFA 1JYCA 3HUGB 2CUEA 4IO9F 3B93A 4CCNA 4JDMA 5CVUA 4ZYAA 5K9YA 4OWRB 2YR2A 2DOFA 1QH7A 2ZX3A 1CZSA 3KP5A 2DA2A 1BBT2 4QQLA 1VBC1 2DCYA 1BEV2 2R49A 3FK6A 1KXGA 4TWTA 4Y5Z0 3ZFGB 1P7JA 3TW7A 1LGCA 2R7XA 3QU3A 2JDYA 2TDXA 5FJ8J 1LDKB 5JXIA 4H7LA 4IV3B 4A5NA 3U1XA 2YS9A 4OYUA 1HA8A 5JSOA 1FEXA 2ARCA 2JJ6A 2VVEA 2PMZA 2YY1A 4AGVA 2KT0A 3U9GA 3MZYA 4AIDA 3KSCA 2Q1FA 2HKOA 2R30A 3OYAA 4E7LA 1BR1A 3GTMJ 1W7PB 4EGZA 3ZYBA 3PUBA 1WLCA 4LO8A 2DOEA 1HQCA 3FN9A 2HQ5A 4LLOA 3ZMZA 4E6KG 4P00B 2QUOA 1VR3A 1JH5A 3CCQI 1Q8PA 5D21A 3PMSA 2GP5A 1RUOA 2KHMA 4JCKA 1R091 4PI0A 4H55A 2CS3A 1QDCA 2ZABA 3CCMI 2DCEA 4IEUA 2LKSA 2YYOA 1X4PA 5IYDJ 4UFJA 1UU6A 5DCMB 3NNJA 2MD0A 3W6VA 2VM9A 4C1WA 3J7HA 3AG3H 2B9VA 1UG0A 1BC7C 2IVIB 1OJLA 3M3EA 2R7DA 3MLJA 1BEV1 2D97A 1T8IA 2Z4FA 4HX4A 5HV0A 4UF0A 3VBHC 3RZKA 1AXKA 3ZVXA 3ACFA 1R1UA 2VZ3A 2ECCA 1D2SA 4ZHNA 3HJEA 3SZTA 1V6MA 4KG8A 2IAIA 3A2KA 1X1AA 1W9SA 4A3FJ 4DXRA 3WTYC 4FTEA 4IJAA 4W6XA 1HKTA 2DK8A 2OF7A 3I2OA 2PMUA 2DAOA 4JTOA 1D4M3 2H1KA 1R083 1Q3EA 1K5MB 2HNHA 2DU0A 1Z05A 3FXMA 2MH9A 1SMYF 2FHRA 1NY72 1SLCA 5CQEA 2XAHA 1MMDA 1S72I 3W5MA 5FZ3A 5FKOA 4UW4A 1CAXB 5EJZB 4E7KA 2KLOA 1LR5A 2EA2A 5A7WB 1R49A 1QXJA 3JB8A 1KU3A 5D5WB 1QOSA 2Y0OA 5JMCA 1MW7A 1RMU3 2ZMLA 4N43A 3JCIA 3Q8EA 1TEIA 3THTA 1QGPA 2XASA 2WN3A 3T0DA 5GAHJ 5EPAA 1UIKA 1ENRA 3Q8CA 2XXZA 5BYNA 1LOGA 2D6NA 1R082 3I3EA 4AOCA 1QEXA 2GM4A 2FXAA 4KNCA 5D5UB 5FRAA 3IAM2 3GLLA 2Q8EA 4LKEA 3SFZA 3EHKA 3TW6A 2WB1N 2VT3A 5EEHA 1K7AA 3WGIA 1I3AA 3H8RA 3HKZN 2HDWA 2PAKA 3OSGA 1TVGA 4F52A 4B4QA 1KJLA 1SACA 4E7JA 4KISA 1YRNA 3S32A 2M5WA 4ENJA 3IPVA 4PCQA 3LA7A 4CPBD 2JRMA 1SLBA 3UYJA 1ZZCA 1ZX5A 4KMQA 4XUPA 2ZKNA 1SFUA 3LKJA 5L36A 2ID4A 1NY71 4N53B 1HRV3 4B4RA 1HN0A 4B48A 4D7NA 4C2TA 2BNOA 5HI0A 5LK7B 4IQPA 5IVEA 3RKXA 4JP0A 2CUZA 3HM5A 3CJIC 3OSFA 2LY9A 1E2XA 4L18B 2KRFA 1IF1A 4KYWA 1JN2P 4IEOA 4NN0A 4BQXA 1F4AA 3FXKA 1DCSA 1XDSA 3ABMH 3GHNA 5JZGB 4DINB 1AF9A 4JKKA 3QPTA 4V1PA 3ZFEA 1DQ2A 3J7ZI 2XWJB 1HW5A 2VIXA 5LK5A 1K12A 4B43A 2OA2A 4R9CA 1O4YA 1H8TB 1JGGA 2VE1A 4XJWA 1TME3 2G19A 2FCVA 4KA4A 1IXRC 1RUNA 5E3NA 1BOBA 4BK5A 4NHYA 4QX5A 3NNGA 4Y1VA 2BBVA 2X1DA 4KIBA 2K46A 2Z3YA 4PK4A 2D43A 1S1AA 3T2TA 3RI9A 4AFMA 1FMD3 1HJGA 4ZZ5A 3PTRB 2ESNA 3M07A 2XB0X 5F37A 2XGCA 4JX6A 1US3A 1XC6A 2EXKA 1ODNA 5K4LA 2A3YA 3LEKA 4GAZA 1Z78A 4XICA 4K2EA 2VPVA 1DGRN 5K5OA 4CTEA 1IUYA 1DPUA 2A5WA 3GX4X 3DLAA 3UKVA 3E7LA 4I99C 5D8LB 2A6YA 3MHZA 2IP2A 3DEUA 3OBZA 1V55H 1SMVA 1TWGJ 3VBFA 3LAJA 5C8CA 1ZRCA 2VQHA 3WW2A 3NKTA 4QX3A 3FXOA 4WM7C 4HNTA 5ACA2 1GOFA 5BNNA 3DPRA 1U12A 5A3UA 4AIJA 1BQPA 1U9OA 1U0AA 5HVQC 5BS6A 3BROA 2YC4A 1E3HA 2H0VA 3I2FA 4AVCA 5J3LA 2FMDA 4NAOA 2MSYA 3WEZA 4HG2A 5IYBJ 3PUSA 2DDAA 1C8NA 2UV1A 3NV3A 3FUOA 1FNZA 1XPXA 1Y9MA 2X5IB 1MBHA 4J1XA 3ABKH 2D6LX 4ARYA 2K02A 3KETA 2COBA 4BHBA 1QJFA 5J1UA 2PHTA 1Y1WJ 1UMHA 2B9UA 1T98A 4XJUA 4AYBA 1B8IB 4E2SA 3BIEA 1HCRA 1B9NA 1LJ7A 4HPKA 2XJPA 4M3CB 3ZYFA 3ELNA 1FY7A 4A3JJ 5JI9A 2Y2ZA 4HF0A 2QENA 4EVIA 2FUG2 5BUVA 3LDRA 1ENSA 3I71A 1SFPA 2QGUA 1FOYA 1T56A 3AL0C 4NQWB 3H9QA 3H50A 1MMAA 2RG4A 3BWGA 4CCCA 2D2WA 5IP6A 2R072 1S5LC 2G9WA 5IT9K 2RDSA 4FPGA 5L3FA 2LS6A 2GP3A 5ACA1 3UV9A 5D5VB 2R92J 4XRSA 5L9RA 4P9WA 5C4JJ 4XXPA 1IS6A 1OQYA 5I8TA 4R9DA 4E2GA 1MGTA 2O5RA 3AX4A 4IHSA 3T09A 4PJ0C 2O6GE 3P3PA 4LD5A 3S1QJ 1AX1A 1OF3A 4L0PA 2BGCA 2X29A 5J1RA 3VSLA 1RESA 1VQ8I 1OHFA 2EIMH 4DUXA 1XC5A 3OWTA 1IQAA 3ZN5A 2A07F 1XNAA 2HYKA 3BTXA 3IKVA 1FATA 3VKMA 4GGGA 2B7YA 3EBRA 5DPNA 4OZOA 1GNHA 1BJQA 1F9KA 5CYYA 4UVBA 2WNOA 1HDKA 3UJOA 3A0HC 1G59A 1J2XA 4YZ1A 3ZXFA 5CKNA 5GPCA 2IBDA 1WGPA 1LFUP 2H27A 4QGMA 3AXDA 4TV7A 2BZTA 4Y7NJ 3PU3A 2ZGTA 3LGRA 3GTLJ 3TP3A 4RLFA 2ISYA 1ZH5A 2VUAA 3THDA 1Z3XA 4Z8BA 5FZOA 1VRBA 5HCBA 4NIAA 3H8XA 5DUVA 2R071 2ZZQA 2WNVA 2VC0A 3JTGA 1DG6A 2L5QA 5E3LA 2BHZA 2O0YA 5F1JA 4OFGA 1YJNI 3BG9A 5D1IA 5K8SA 5F5CA 1POV3 4MQ9F 5D6FA 5BNQA 4L2NA 3T1BA 4AVPA 4XKWA 3NNFA 1K42A 3ASOH 3MLKA 1NK2P 3NQOA 3HSEA 2Q0OA 4AI2A 3ERED 4LMFA 4CXFA 1URXA 3WXPA 1KFUL 1H9GA 2HZTA 3D5RC 3AM2A 3WNXA 3ZXGA 5DZGA 3HT2A 3U75A 1LFPA 3JQWA 4A12A 1CONA 4Y5TA 3VZNA 1T0FA 1ND2A 4XKVA 2DA7A 1J59A 4YGBA 1O4ZA 4X8PA 4YM3A 3T1MA 1JU4A 2G9FA 2WY7Q 1OPMA 2YGMA 3TOJA 1QU3A 2I5UA 5F2WA 1XQNA 2P4EA 4CDQA 2CU7A 4RA2A 1G3WA 2V4JC 5CA6A 3ZMOA 2H09A 1PIV3 2A5YB 1FSHA 2DTYA 2ELHA 3W2AA 2L02A 2FQPA 3K77A 2STTA 1BK1A 4JGZA 3M4OJ 2V9VA 2O61A 3FLTA 1JTYA 4CDUB 3F2ZA 1WJFA 2QYOA 1AX2A 2JVHA 4OI2A 3LIGA 3LSPA 5GZFA 3ZKYA 3EJKA 2QKMB 4Z2YA 1JU3A 2JJ7A 2ZMEC 4B3XA 4Q0SA 2PAEA 2RS33 3F8CA 1J1LA 4UHTA 5DV5A 5I0DA 3TO9A 3N35A 2PFWA 2QTWB 5LASA 3GXOA 3JXSA 3DPLC 2QQUA 3B02A 5E18F 4AQSA 1W05A 2IW5A 5FO8B 2ZGRA 4XAAA 2EF6A 2X10A 4P96A 3K4CA 3GEZA 1ETOA 1N3OA 1F36A 2G7HA 3VKFC 3OGGA 3BC8A 2W87A 3NWTA 3WDTA 3QPLA 1WZ2A 1KFXL 3WQBA 1U8BA 4BLIA 1VBE2 5IFTA 3BTIA 2W47A 4PDWA 5JSRA 3OIPA 3FXUA 5J8CA 1UY4A 3WR0A 2V6CA 1E0EA 2R3SA 3QWLA 5M3FJ 4UV8A 1W8HA 1WLDA 5J40A 1YRNB 4XMIA 1KRIA 2VTXJ 4GQ7A 3IPVB 1AL0G 2OJED 1SMTA 2Y31A 4ZYEA 2Z69A 1UPSA 4K8RB 4AC0A 1GV2A 1CAVA 2TCTA 3DBHB 1UF2C 5A2QZ 3VDCA 2HDDA 4JRLA 4YNIA 3F8FA 3PIOF 2M34A 3P9IA 2W1SA 4Q0PA 1FOXA 3ECHA 1O7FA 5FRMA 3GW2A 1SBFA 2Y6FA 3OPTA 3PJRA 2XF6A 5TJJA 1GOGA 2V72A 4CDWA 2RJ2A 1ZA7A 4EM0B 3VD4A 4ETSA 3M2MA 3RS6A 3MGUA 4D9JA 3RSNA 1Y9QA 3OYNA 3WX5A 3ZXAC 1LULA 1QY4A 5IAVA 2YZ4A 3ZFEB 3QYBA 4ZDLA 1UOJA 1POQA 5I8YA 5EGOA 3VGIA 4CYCA 1VQLI 4QX2A 1JZ3A 1LB2A 4UW3A 3BPSA 3DKYA 1VBE1 2GA1A 3CDZB 5C5TA 4CHUA 2JENA 3C18A 4NIIA 2E5NA 5A3PA 2LTNA 2E36A 4RB0A 3GGLA 1YRZA 3T30A 5FZ7A 2RV9A 5C4XJ 1E3OC 2Y64A 4PIXA 2ZBKA 3AMPA 4LULA 2FDFA 5IFPA 4I0WB 2DTRA 1UPIA 1KDMA 5J09A 4NHLA 1BW5A 2IGKA 1MBEA 2B4KA 3ECQA 2PHUA 2W92A 1QMJA 3EO6A 4RQPC 4LO5B 1RPWA 3MD2A 4LOCA 3X2QH 1CQTA 4WXDA 1RRJA 1NCRC 1DGWX 3M1EA 5EFUA 5TSWA 2OV7A 4TYSA 1W28A 3RQ4A 3GXUA 4X1EA 2EV5A 4LA2A 3J7YJ 2Y38A 3CJTB 3PVEA 1JODA 3CJXA 3CCLI 5AFEA 3ZX7A 2NMOA 1QDOA 2E34A 4XC9A 5L3DA 1SFXA 3FC0A 3LQRA 3VBFB 1ZREA 2HTJA 3S2HJ 4HKOA 2HWE3 2E32A 3CJNA 4DUVA 5BPXA 4Q0QA 2G1MA 5BNNB 4UI9L 3D0SA 4D7SA 3DPRB 2FSWA 2W3JA 1MH4A 2ZHKA 4XUQA 3FF5A 1XU1A 4JV4A 1FOWA 2FMLA 3BR0A 1OFNA 1D3YA 2YBPA 1UZWA 1YIPA 1MJ9A 2AHQA 4CO8A 2AO9A 1OLQA 2RHPA 2QQOA 5DUIA 4ON0A 3M7GA 1PZ9A 3DV8A 5DM6F 2XROA 2XUMA 4IE7A 2XJTA 1JXSA 4IEPA 5L73A 2HYFA 1QQP3 3O1TA 3WLUA 1TQPA 3D82A 1HRI2 3C2HA 1JUIA 5CJ9A 2VVFA 4XQ4A 4P08A 1BR4A 2HWE2 5EYRA 3NWSA 2EIBA 3M4FA 1PO13 1XMXA 2WV1A 3NAPC 2P5VA 3G6JB 4ZZLA 2JDMA 3BJ6A 1QHDA 1VBB2 3IP4B 1SD4A 1VB2A 2BE5F 5EZGA 2EBIA 2WABA 3E5XA 1P9QC 4CEYC 2M45A 3LPGA 4ATEA 1VQKI 1V4RA 3MW3A 5FAXA 3BU7A 4MO7A 4R52A 4G12A 1H9PA 5FLJA 2RNGA 1BMV2 3VZJA 3WQ7A 3B73A 3S7IA 5KHKA 2WA4A 4IKFA 4BE0A 5HS7A 1PO12 1OQEA 5JWPA 4WK8F 1JBCA 2QVSB 2YPJA 1I5ZA 2Q8OA 5KVRA 2FBEA 3O3KA 2E31A 3USUA 1QA6A 2VLAA 3B6CA 1MS1A 3LIHA 2VONA 2HWC1 4BQAA 1NXMA 1PGL2 2DDBA 2LR8A 1HRI1 4XCAA 1P4XA 4U0YA 1Y39A 3QPHA 2V26A 1W7PD 4UB8C 1JOBA 5FLXK 1XNCA 2W46A 2Y0SN 5D8AA 2UXXA 4QU2A 1VBB1 3JRFA 3MIEA 1X3WB 2VCAA 5JLWA 1W9WA 4PLMA 1QJY2 4Q4ZF 5DG1A 4NHKA 2OTLI 5EYYA 2G4IA 4XUNA 4M4RA 5FZOB 2R1BA 1X82A 5FLHA 1ZRIA 2WNVB 3Q8BA 5C9AA 4BMEA 3VHNA 3WDVA 2VUMJ 3UKTA 4Q4W2 1IUFA 4LEJA 2E1NA 1DU6A 2CWMA 5CAZA 3S7EA 2MFZA 3WTTC 3DF0A 2XJSA 3VB2A 3BUCA 5K0UA 2K7LA 2A3XA 3RFRA 2R7OA 4H14A 5C6CA 3GMEA 4CCJA 3T0BA 3VYSB 3O12A 1H6YA 5A3TA 5IATA 5F08A 4OHZA 4MH0E 1STMA 3HGYA 1VAKA 1FBQA 1MSFC 1PGL1 1GZ9A 4PJJA 3QCWA 4AFDA 5I0RA 5FWJA 1ND2B 4BB3A 5TRDA 2ZJQF 2MC3A 1QJZA 3BTZA 3F9KA 4LPLA 1RUC2 3KM5A 3W21A 2O8OA 5CG9A 2O8KA 1QJU3 2WB1A 1Y9GA 2DLLA 2ZNYA 3TOBA 3W6JB 2XL7A 3HKZA 4CDQB 3WE2A 1YS7A 1K6YA 2VZVA 3HOYJ 1R4NB 1QJY1 4XONA 3Q8FA 2XKPA 1W8UA 3I54A 3G6EI 1LU1A 2IZWA 4QX8A 3LDBA 2M7BA 5DAVA 4JGZB 3NJZA 4BPZA 2DFEA 4ZH4F 1T38A 5EXOA 4Q4W1 3J80Z 2DVGA 3S17J 1UZYA 1WWYA 3OS1A 3OGJA 3CNAA 4QKBA 1JT6A 3JD73 4XLFA 3B9IA 4GMP3 1WMXA 5FLIA 5C4WB 4CUGA 1IN6A 2VJJA 2YG0A 3G1MA 1VBD3 2PHWA 1Z7S3 1OOPC 3KWVA 3BU0A 2NVUB 5C3RA 2X51A 3ZXKA 3E0JB 4RGRA 3O1VA 3I97A 3AVRA 2QQ9A 1ZRRA 4F3QA 1ULDA 2MEV2 4MV2A 1QJU2 4BIOA 3EQEA 5JPMB 2WO2A 3ST7A 1S2BA 3DTKA 2VQLA 2WQ4A 4FOWA 2Q8CA 4JZRA 2AEZA 4Z07A 4U7BA 3AAFA 4QWNA 1O6UA 3OG2A 4P14A 2OUMA 2PHLA 2FA5A 5F3IA 4QM9A 2ZHNA 5LBBA 4K6BA 5FQ0A 1RUC1 4Z2AA 3SCHA 4QU1A 4NHXA 1D2QA 3AZVA 1A31A 1QO0D 3WDYA 2DU9A 4C8DA 2X9DA 1FYUA 3GZTB 1XD7A 4B4CA 1GP4A 4FFIA 3W20A 3A23A 1JHFA 3IKWA 4B8EA 5D2AA 2MLKA 3ZOIA 5HLGA 4PDWB 1YIFA 2R93J 2GIZA 3H9AA 5FR3A 1S6LA 3CMEI 4CZZA 4XF3A 4LNVA 3HTUA 3FXJA 1DBNA 2IA0A 1PZ7A 5FKKA 5FY7A 2OAZA 4BLJA 2IJLA 1P8JA 3ESWB 4HVRA 4LO4B 3GZ5A 3RYRA 4XTMA 1HKSA 1E3PA 1C3HA 1RKTA 4ZTFA 4V2WA 3VBUA 1ZARA 4BXXJ 2W1WA 2MEV1 1CAVB 2BTVC 2L7MP 4OHYA 5KXDA 2AGSA 1KA8A 3K3OA 1LKNA 3I9V2 2JUGA 2JKBA 2WZR3 2X05A 1DQ0A 1FPN2 2NYXA 2L4MA 1YJ9I 3H3VK 3SKJE 4D8MA 1W39A 1OSGA 2K27A 4CDWB 1XCBA 1OI6A 4XLEA 4H3WA 1LOFA 5T54A 2ISZA 3ORJA 5J96B 3FISA 4SBVA 2DQRA 4YVSC 4NBQA 4PZJA 5HXVA 1TZOA 4D6QA 4I7HA 3ZXLA 5EGOB 4IW3A 4ET7A 2Y48A 2I45A 3ZPOA 5CVRA 4F83A 1ULPA 2VZRA 4Q0VA 2OPWA 1ULOA 2GMMA 4A3KJ 4A3IJ 3VODA 3E3VA 2Y6KA 1OURA 1KDKA 1PZ8A 3H1YA 5A3NA 2VOTA 1DLCA 4XMAA 3RKQA 1DP0A 1N1VA 5HLIA 4IEJA 4UNOA 3BZCA 3Q9VA 4OIPF 2NYYA 1X8MA 1U0JA 1RI7A 4ZONA 2HYJA 3K1MA 5E16A 3SHRA 5F39A 5IYYA 2DT7B 3HMYA 1DU0A 3SCFA 4IHVA 4LKSA 3VD9A 1PGSA 3ILNA 4C2MJ 1KGSA 5FZHA 3O1MA 1RUG2 1B6AA 1WMFA 4NPMA 4XE9A 1DGLA 1SCRA 5JUVA 3AP6A 1R1ZA 1XGSA 1UZ0A 1ZN2A 1VMHA 3VZLA 1FPN1 2JMWA 1WSUA 2YFUA 2R0HA 2ZZJA 4HLTA 3VDDC 1FI2A 3J7LA 4M9SA 4AVVA 5FZ1A 2OVUA 1T33A 2VW2A 4YW2A 5IT3A 4PJYA 2X8KA 3O1OA 2RMU3 2WJSA 3LL7A 3DLLF 4LO7A 2VXZA 2DV9A 4PJLA 1POGA 4G6QA 4BJ0A 4J1WA 2WIIB 1NH3A 1H0BA 1FZPB 3C8XA 3T8RA 3CJIA 1J84A 3L2UA 2CY6A 4QX1A 3T4VA 1YUDA 3KP3A 4AI8A 1BK0A 1Z9CA 2R5ZB 5DTDA 2RS11 1GQHA 3ZO0B 1G3YA 1Z67A 5T3NA 1B09A 2X1CA 1L3LA 4HSTA 1S0CA 4P55A 1X8EA 2E7TA 2K3PA 2PHXA 1L3JA 4MGZE 4XF4A 4BY1J 1RUG1 1O3TA 3OBRA 1WUVA 2OQ6A 1LHUA 2P2KA 4L9BA 3B01A 2VW1A 3WUCA 3SDGA 3WF1A 1VNDA 3I53A 4LR4A 4Q8KA 5JI6A 1BVP1 4HK8A 3K4NA 2OQ7A 1TMF2 1XBFA 1GP6A 5CKMA 4LJHA 4OHXA 5J47A 3S93A 2NQYA 1GOHA 4BBRJ 3LWFA 3M9AA 1V9U2 3HQRA 1Y4WA 4UUSB 1MQTA 3M8JA 3S5QA 3H9JA 4CEWC 2BVBA 2XHNA 4F92B 4A6DA 1AVBA 4GA9A 3POEA 2JA7J 1LFBA 2CGOA 4UXAA 2B42B 3P1IA 4L99A 4OZXA 4XFIA 2VG9A 4ZXEA 3ISPA 2IXCA 3WG3A 4EN0A 3RZGA 1EAH3 5B4XA 1IO2A 3GJBA 3IV5A 2RQPA 1APLC 3H7YA 2P3YA 4L0ZB 3KYCB 4JKLA 4Q27A 2AREA 4QKFA 3USUB 2RDNA 1W2NA 4P5YA 2TBVA 1WPKA 2OZJA 3N3HA 5KK1A 4PLOA 3RI8A 4C91A 3WINE 2DMUA 2VJXA 3GUDA 4QDSA 2VTXA 1BL0A 3O2PE 4YW3A 4D6SA 2VTFA 2WZ8A 4AGGA 1MS4A 2DCKA 5LWBA 3I3LA 1DQ6A 2GDFA 3JBG2 3U07A 5FLVA 2P3JA 3WTSC 2CAVA 2YHJA 1B1BA 2JD9A 5HLHA 3LEGA 5BNGA 1BCXA 2A5ZA 3KVBA 4GH4C 1TMF1 4C3HJ 3MYXA 4KN4X 5IK8A 4A0XA 2K0GA 5E1XA 1AOYA 4OLLA 5FJKA 1ZYBA 4BAYA 1V9U1 5LFAA 4PSWA 2DBBA 4EATA 4X6AJ 3OD0A 3ZGKA 4ZU4A 2ORZA 1W0UA 1HLVA 5FK7A 1LENA 1VFCA 5C9AB 4HAMA 4Y5SA 1ETVA 2RKHA 4CP0A 1F5TA 4JDNA 3VPRA 1DZTA 4ENKA 2V1DA 3T8TA 3I4IA 1XGMA 2C4XA 2C6SA 2G7UA 1NG0A 2W82A 5A7QA 5K0UB 1AL22 1WI3A 1V5FA 3H3UA 5A80A 4LK6A 2ZBJA 1TT5B 4Q48A 4ZYDA 3AL6A 3ZFFC 5BNPB 3FHQA 2PN5A 3K6GA 3VKLA 5CFCC 1Q5OA 3EUKL 3PO2J 3RWNA 5HPOA 3K4LA 4LLGF 1BVVA 3SQNA 1PVEA 3ZR6A 3G71I 3VL9A 2YPRA 2YV8A 4AM3A 2E5ZA 4HSLA 4FTHA 5A33B 3JBG1 4FFHA 2QM3A 4ONUA 3SDBA 2JA2A 1T6BX 1ACIA 3QYEA 2ZGQA 1X1PA 3KMHA 3V0AA 2WBMA 3BG5A 1XYOA 2BNNA 3JRAA 3IHUA 3OUJA 1OFCX 3AP4A 2Z5UA 1UZVA 4BE3A 2YXSA 2DA6A 1AHDP 3KLNA 4A6OA 5DM7F 2HQRA 1ITYA 2F5FA 2VQUA 2LK2A 3JU9A 4WVMB 4PQ9A 4EEFG 3HEFA 3VBOC 4BS9A 1TQMA 2F5EA 2QQWA 3UNPA 1W6NA 4S2HA 2PMHA 1C0WA 2DCZA 1BJZA 1NOVA 3K1NA 1TNSA 3LA3A 1AL21 1P4WA 4YGDA 3HDDA 3NW4A 2B46X 2VASA 1JJ6C 3JZVA 2QQVA 2B5HA 3WF4A 4UOJA 3M3QA 2R7EB 4TTGA 4EV0A 3PIGA 2DJIA 2MH2A 3AYCA 2EQRA 3LB9A 3D4KA 3MZHA 1DHKB 3BIWE 2OA4A 1AU7A 3S2DJ 4DQ2A 2IFWA 4XK4A 2OX0A 1LOAA 4OAZA 3DPUA 3H0DA 5C5UA 4ENNA 1B35A 1A3KA 5FQ0B 5LA1A 1IGOA 4M9ZA 1V6OA 1RXFA 1UL9A 5M5XJ 3CBNA 3I58A 5IP7J 1CN1A 4LK1F 1Y8RB 1WWXA 3V7RA 4UYBA 1GWKA 3K9TA 2BGPA 2ELJA 4D7YA 4H4KC 2I2SA 4YFKF 3DCQA 4HVQA 2XBO3 3BALA 3WOGA 5JDBA 4MGQA 2XIGA 4AI9A 1RIOH 4NO4A 4QXCA 1C5HA 1Z77A 3ZSMA 4C0HA 4I98B 3O1UA 5LGNA 3EYPA 3TB0A 3VBUB 4RAGA 4GALA 4PIZA 5FO7B 4RS5C 3VBHB 4CA9A 1IV8A 5I91A 1LUJB 5EWSA 3BCWA 2M1BA 3KHBA 1D5YA 1W3VA 4HEA2 3RI4A 4RDUA 2A75A 3ACLA 1R5ID 5FZLA 3KZIC 5J4YA 2QA4I 3WF3A 3BJOA 2VC9A 2QFEA 2XVCA 4OAYA 5G05L 3N4MA 1UHWA 4MTEA 5DZFA 2WS93 4HANA 5F3GA 5TISC 1K45A 1JZ4A 3LSKA 4RS8A 1FYKA 2LF7A 4C3IJ 2FOWA 1V5EA 1I50J 1CD3G 2JA6J 1AYM3 1WKMA 3PMEA 3C7OA 2PLV2 5F3EA 4EM2A 1NQJA 4D5CA 5HBAA 2EXIA 3E5UA 3N9PA 3H42B 2K9ZA 3J8F2 4GJZA 3RDIA 5FV3A 3JSPA 5HDGA 3PO3J 1V3FA 2YU2A 4A3ZA 2K40A 1UAIA 3I7DA 2E71A 1KJRA 3M8EA 3WGHA 4NMIA 4BDVB 5IPAA 2VBWA 3V4GA 4D94A 2W1QA 1IRZA 3TEXA 1VQ6I 4RBOA 5ABJC 2V9PA 3PUFA 3GTOJ 2PHDA 1WD3A 5JMOA 4MSVA 4W50A 4DXZA 4XSXF 3DBLB 1F31A 3MW4A 2X85A 5A7OA 3CESA 3D6EA 1RTVA 2DOAA 1X1DA 2XAJA 3APBA 5EZHA 5EZWA 3CF6E 4UW6A 1OYIA 3BT9A 4BBSJ 3F8BA 2LVSA 4QHOA 2I07B 4YSFA 3K70D 3RKWA 4HVOA 4Y33A 2ZKZA 3NJYA 5J1YA 5FKLA 1QVTA 1V0AA 2PLV1 1HOMA 4ANJA 1ONAA 3ILRA 2W1OA 4F93B 2ZO4A 1PMIA 1OLRA 2QQAA 3J8F1 3K46A 2X48A 4FPEA 4GXOA 5FROA 4AEDC 3GYHX 3CJIB 4XIKA 3BVCA 4FVVA 1FLIA 2BV4A 5FLMJ 3OOUA 1COV2 4RA0A 3DGTA 4DIQA 2Y0SA 3HOVJ 1UYPA 1J3PA 2QJVA 2WL1A 1C8M2 1DGWY 1IPSA 1KS4A 3AP7A 2FU4A 3TGNA 1OCCH 3BG7A 2C0ZA 2VOKA 1B72A 3MUZ1 3P3NA 1MNMC 2F4LA 3ZSLA 1DU3D 2F5DA 1XSXA 2R7UA 2ZEWA 3DU6A 3PNVA 2VMDA 5JLVA 4HT1T 3UT0A 4CCLA 2PA7A 4OU0A 3H1CA 4PBPA 4Q4Y2 4CCDA 3BOWA 1Q8QA 2H0BA 1YWKA 1RETA 4NWWA 2K3FA 3VZKA 5FY1A 1MQTB 3AZYA 4XCBA 1LHOA 1NCRA 2JE9A 2E1CA 3K51A 1LCLA 4AHZA 1K4TA 4Y1YA 1XJAA 3L1PA 5ANQA 3BPVA 4PBOA 1VE0A 2DXIA 3SZPA 2RE9A 5DCFA 4AU7A 1ZZBA 3CF2A 2VE9A 2P6CA 1YFXA 4RYDA 5EF6A 3LDKA 3C1DA 4BM8A 1KU7A 4MQVA 5IP9J 3AKZA 4PCRA 4PFPA 3IIAA 4PSXA 2LFBA 3OOPA 4QPGC 4M3FA 2TUNA 3SZGA 4M9XA 3PFIA 1ZA4A 2E7AA 4XF9A 4Y1ZA 3ZYJB 3MF9A 1COV1 1FTZA 2AQFA 2A68F 4GB33 5T5LA 1X50A 4ESJA 1C8M1 4WM7B 1W6MA 2QQ8A 4XLNF 2ZX4A 2IFRA 4D5FA 3FHZA 3FZVA 2HWF2 1YCIA 2WINB 1OLTA 4TZDA 2VQCA 1G8WA 1IQDC 2FQ4A 4L5IA 2ZNZA 4PT6A 2FBIA 4FETA 3POBA 3FMGA 3FMSA 1IS5A 1JZ5A 3IDAA 2AUYA 1D0YA 4Q4Y1 5FUIA 2VCBA 4Y1XA 3QACA 2GBYA 2HOEA 4WZCA 2Q1MA 3HG9A 2PI0A 1ND3C 1P4AA 4I30A 5C3QA 5L7OA 4D3WA 4JHZA 1IXCA 4IXLA 5KC6A 5FXWA 2LRDA 2DW4A 5FP9A 1QOTA 3NAPA 1PP8F 1T39A 1H4HA 2ZMNA 3W3CA 1W8ZA 2WAFA 2KDZA 2Y30A 2L9RA 2A05A 4XUTA 5CFDC 3TEDA 1ASJ3 3QBQA 5B4NA 3DXUA 2Y60A 3A4CA 2JUCA 1D0ZA 4RAFA 1MH3A 4XQFA 4XFHA 2ICWG 3EDPA 4XZUG 1IXSB 5LD2C 3B9CA 4U88A 1IRXA 2LW8A 1U5YA 2WKKA 1W06A 2E6VA 2HWF1 4BXFA 3TN93 2JDUA 1JJ8C 1S2KA 1DIWA 4P9XA 1AKHB 2DCJA 1RUH2 1WI9A 2XH6A 4AHYA 2A6HF 3ZR8X 3OOXA 4ZU7A 2D6MA 2M2EA 1RUE3 2AH2A 3UGHA 4LKFA 2W0XA 3V0AB 4BEHA 1QU0A 2GIVA 2VMHA 2WFF2 3ITQA 1GSLA 3F3XA 1YQ6A 1QZEA 3N9MA 2VOOA 1PUFA 2MGQA 4IV1C 3A22A 2K9MA 4YG2F 1EY2A 4PGGA 2V5YA 1QJX1 3L09A 4RSUA 2W68A 4E7ZA 3HUGA 1LVKA 1W6NB 1V6LA 4BQ1A 3FHAA 5F9TA 4YM0A 4MGSA 1OKRA 2RM22 3RJRA 2CSOA 2BY1A 4E8CA 2ZTNA 2P6HA 1KQ8A 5JIAA 2A6XA 1ENXA 2H94A 5JVVA 2VKDA 3ZFGA 3TO7A 4AVBA 3Q8AA 2JE7A 2CQNA 3TDZC 2O9LA 3GCXA 4IV3A 1KITA 4YW5A 4A3EJ 4HFSA 1WD4A 1G6NA 1Z91A 3FKJA 3CHXA 4YW4A 3G7DA 4MGRA 4I3GA 1PJRA 4E4HA 4BXSV 1B35B 1UZZA 1PHMA 1RUH1 2BWAA 4KH9A 4V2GA 5HDKA 1FMVA 5C71A 1AR82 1UQXA 4WV8A 4X6RB 5LCWL 5FXXA 2WAQA 2RR13 5GAEJ 5CNAA 4A4AA 2P6TA 5H6QA 3K4BA 2E9QA 1I3QJ 2WFF1 1TTYA 2CSGA 5A70A 1VIWB 5C3EJ 2JDHA 1FOD2 3ZN1A 1U78A 2Q8DA 4TLGA 5DCMA 5C7GA 2RM21 1WLTA 3DP7A 4KGQA 4QB6A 3BB6A 2KP6A 2NAZA 2VUJA 2WLQA 3PVOA 5FZMA 1QPMA 4OQ8A 4UFKA 4QXKA 2CV0A 2EIJH 4YM1A 4LBLA 4OUEA 1XMKA 2CRGA 4KICA 5GP9A 5FREA 1ON1A 3ZLIA 2HZDA 4AFCA 2OCEA 4B7EA 3FLRA 2ZMEB 1HXS3 4Q4V2 3M3CA 1UMIA 1IJWC 4IL6C 3DXTA 1AR81 4N8MA 1VBA3 1M4WA 2M4GA 1CPMA 1PK6A 1K5MA 5JR7B 1W2AX 3L00A 4PHZA 5FFZA 5FP3A 1HSTA 4G6TB 2ZMKA 4DBRA 3HT1A 3ZMDA 3H1WA 2NS8A 4KIGA 3LSDA 5GLVA 1SEFA 1FOD1 2EZHA 4WZFA 3KQRA 3AZZA 1J7KA 4OMZA 5AIQA 5JXGA 5IVCA 3MIFA 1G4DA 3HEIA 2D3RA 2BDRA 1U5TC 4M3CE 2XB5A 3EB7A 5CB7A 5ISLA 5C8WA 2GNMA 1GV9A 1WCDJ 3BYWA 2MD5A 5FO5A 1QBJA 1BA5A 5E89A 2E7WA 4JBAA 4YGEA 4LOTA 3LSRA 1FOKA 1V6NA 1MBFA 2X6OA 3A01A 2BYVE 1KYZA 4AHWA 3AG1H 1AR63 2RS51 4Q4V1 2IUWA 4G6DA 3RRDA 2MC4A 5FFOC 4MHGA 1CPNA 3S5AA 3DU5A 3HIFA 4A0YA 4CICA 4PJMA 3OPZA 2WWJA 3C2BA 3AG2H 1BI0A 4CH7A 4ATFA 4N53A 2D7FA 1JMUB 4M00A 1FJLA 1NAEA 2E7QA 2Z9OA 2W4SA 5FYIA 3BOPA 4JHTA 2VOVA 2Y75A 4XPVA 5LHGA 2Y9ZA 1W36D 3VSKA 4JK1X 4YVSA 2WT0A 1UMQA 2EK5A 3MV11 2BXYA 3EQLF 5JZGA 3ZXEA 4LHNA 3HOSA 2AEYA 1XNDA 1MZBA 1X2MA 4NC6A 1NQDA 4P9YA 3LF7A 3C2GA 2LP0A 4AR2A 2R0FA 4XN3A 1W2OA 3AMHA 4EE2A 4FFGA 2NMNA 1OA2A 3L9FA 2K2SA 1OCPA 2KZGA 1MS3A 3CP8A 4B3AA 1N75A 4FCYA 3ETQA 3BCAA 3G1OA 4WF2A 4XFFA 3T0AA 3IWZA 1MNEA 5FZDA 4FOVA 1NA1A 4IHYA 4RQPB 1SDDB 1CZVA 4COWA 5T52A 4JVAA 3S0MA 3OYDA 1NCRB 4AF9A 1BI1A 2QCOA 5FYZA 1Z3YA 2XF7A 4BJTA 3SITA 5I0UA 5CVJA 4LORA 5A6XA 1RUF1 4CGZA 1ZNPA 1Y0NA 3K2ZA 2EFOA 1XB9A 1XYNA 3KHCA 1Z7UA 3WHUA 4IL7A 5JXHA 1R5HA 1CX1A 4X6QB 3TMOA 5BY5A 2BVLA 4QPQA 3AFHA 4HV5A 3VDDA 3ALQA 2HPIA 4C2UA 4LIVA 3M1CA 1L7QA 3WQ1A 2YDEA 4OMCA 1W6MB 2Z99A 3POYA 1BI3A 1IC8A 3IB3A 2DVDA 2HXOA 1J3QA 2XWBB 4DPNA 1UOBA 2XAGA 5J6XA 5JSPA 2VZTA 1LRHA 3I3QA 1V6IA 2JA8J 2GOXB 1MEC3 2HWB2 4Y3OA 3IAS2 1K4SA 3BTLA 2JICA 1RB8G 1US2A 2EPFA 3QU6A 3WHCA 4RHV2 1RUI2 4JRAA 4ORFA 2EIDA 4G9SB 3DTIA 1U3EM 2NM1A 4Q4X3 4EWDA 5BNOC 2LALA 4EROA 2CWEA 3C2UA 2OD5A 4A93J 1N77A 4CRQA 1RXGA 1XN7A 3L2RA 4HONA 3I2JA 4O9GA 1STZA 3DN7A 3Q9OA 1NXD1 4XRMA 2XUEA 5L7OB 5DS9A 4MXVA 5M5WJ 3HL2A 3FWEA 2ZSHB 2AC1A 3VEPA 3AXEA 4HKWA 4G8XA 3K4JA 4XL9A 1UD1A 2V6EA 4KU7A 3RZHA 1CR7A 3NAPB 3ZN4A 1KU2A 4XMYA 5LBEA 2DTWA 2R7QA 4D69A 2DBIA 3PDQA 2WNUA 3MICA 2WO1A 4HN1A 5GTIC 2J5PA 3K7AJ 4CEYB 5JAXA 3TBDA 2X6WA 4XBFA 3DEMA 4I01A 1V00A 5J1XA 5FP4A 2VBPA 4NQWA 1ENQA 1POV0 4ARXA 1CIWA 3N9LA 1FTTA 1A8DA 3O0WA 1FNYA 3H0OA 3I0TA 4WVZA 4UB6C 1BXHA 3MIGA 1GZTA 1GYKA 4FTSA 3SCGA 4Q2FA 3H5RA 2MPFA 2EB7A 3KF5A 4EYUA 2HWB1 1J1TA 1IZ1A 1GUUA 5FZ8A 2W5FA 2FX0A 1HX6A 4RHV1 2W1UA 4FP2A 3ES1A 1YE9A 5J8FA 3I3DA 1D1CA 1RUI1 3BZKA 4KT5C 4BHPA 1VRH3 2A7AA 3AKTA 4LE3A 3SEEA 4PI2A 3WTWC 5EJ1B 2MLGA 3I49A 3ZQHA 4BQNA 2Y69H 4DXSA 3IH3A 4NC7A 1R58A 3HN3A 3LMMA 1RC6A 4COUA 5A3MA 2EAKA 4KUMA 1PUFB 1TNTA 5HV4A 1U2WA 4JGYC 4V19K 1S7EA 1BW6A 2IXJA 4MFDA 2ZXIA 1PO23 2J42A 1QNYA 2VNOA 4V2FA 2C26A 1YLFA 4IHWA 2LH9A 4M01A 2VPLA 4HA8A 1EV13 1KQRA 2LD5A 1S8NA 2E2IJ 2D1VA 5CZKA 2A6TA 4DMIA 5FBJA 1F35A 4C1XA 2WDBA 4LHKA 4QPWA 1OT5A 4BOWA 4WCGA 3GFIA 2ET7A 4QAWA 5BQTA 2NZ9A 3DYOA 1OR7C 4JX5A 3CCJI 2VMFA 2EINH 5IOZA 3Q0VA 4EWEA 1W0OA 5DUKA 2P7VB 2VKVA 1PGW2 4U0VA 3KP2A 2VBBA 2FF4A 4W6WA 5JR3A 2ZOEB 2DF7A 1LE8A 4KU8A 1W0NA 1ZZ8A 4PGHA 3P9CA 3A0KA 5LBQA 1AR73 1RUD3 3RZOJ 4DZJA 1LEDA 5KXBA 2DPDA 2XUBA 1G9AA 3LEIA 1R7JA 1W0PA 4G94A 5GALA 2F4IA 1CF7B 3ABZA 2OPTA 5CIRA 2OXBA 2CDPA 2IGNA 1JHNA 3SLIA 5JR2A 1VPHA 5H2FC 4Y4YA 3CKHA 2LG4A 3IAQA 2LSOA 3N7MA 3ZIXA 4N43C 4U36A 1BBT1 1YJWI 1MVEA 2DU1A 3LSTA 3T1LA 1FAYA 3CCSI 3KP6A 2O1QA 3RJPA 3UETA 5AIPA 3UNGC 1RINA 3AP9A 2GU9A 3WF2A 2GNTA 2R7SA 1FXZA 4CU6A 4RAZA 2YBSA 2J5OA 2DT6A 1JT0A 4CDUA 3BR3A 2PFBA 3OBAA 1AR72 3K2AA 2ES3A 1GVJA 3S1MJ 3QAHA 3VLBB 1OOPB 1MIJA 3AB0A 4RR3C 3PNAA 4GDFA 2XPWA 4ZDPA 3OL4A 4CZCA 3N7LA 4IESA 4CXWA 1CWPA 1PGW1 1PK6B 2BY3A 4INDA 4DB5A 4GYGA 2GN3A 2ID3A 1YXWA 1MZFA 4K3UA 3T3YA 4XTPA 1LNWA 1W04A 3KV9A 1H2NA 3HR9A 3WE3A 4K8FA 3BTYA 3AG4H 1DP3A 3KGZA 5C3SA 5DZEA 3J81Z 3PFYA 1JOPA 1TNFA 2ZEXA 4ZDOA 3CC4I 2ZX1A 4A5MA 2V1XA 1NUKA 1DUXC 3JAMK 3QH7A 1GV5A 3ZFEC 3Q9SA 1UYXA 3R4KA 3V56A 2RGVA 3O8GA 1J3RA 3LEMA 2PMZN 3WY6A 4XJZA 4RGSA 1D4M2 4KDPA 4FXKB 1WBFA 1DZQA 4URTA 5KHDA 3EUAA 2EZIA 3PQKA 2DJNA 1QKQA 4DO0A 1IRGA 1LOEA 4JQRA 2VQGA 2KM2A 1MJBA 2RJLA 3WP3A 2FMYA 5LBCA 3GTQJ 3A01B 4NPLA 3OYJA 1FT9A 1A6CA 3CLPA 4P9FA 3ZP5A 2HVRA 1WCKA 1RUJ3 1BI2A 3JB4C 5BV6A 2FBHA 1GXQA 3OIOA 2DUPA 1ZBA3 1GLNA 1SZBA 2GXBA 2BWCA 1F1ZA 1LVAA 4ZKTB 3PUIA 2C6YA 3VKOA 1RMU2 2C9KA 3N7KA 2XQRA 4D6RA 1Z6RA 4B47A 1SD6A 5K5QA 3AL5A 1HKQA 2A1XA 3KV6A 2GLOA 3EYIA 2WC2A 3GWZA 1O3RA 4HQEA 5DDJ3 1D0HA 4PF1A 1VF9A 2JSPA 3ZMUA 3GVAA 2F4PA 4BE2A 1XU2A 2JRTA 4FOQA 5HNFA 4IHTA 3S3OA 4MIMA 3GLXA 5J37A 1ZBE3 2XRNA 4HDUA 4ABZA 4CDXC 3WVJA 5C8CC 4YVSB 2HKXA 4Y22A 1GHCA 1I6XA 2M87A 1OH3A 3AYDA 1RKWA 1X33A 3ZQ7A 2YUEA 1OD5A 1LTEA 1D4M1 1R081 3ZYIB 4FPFA 1ZBA2 1S4CA 2PYTA 2GOMA 2XLFA 1W6OB 1W4MA 1VQOI 1PYVA 1WKYA 2ZGLA 1IZ3A 3HNMA 1HRV2 1N1SA 5FKNA 1AR93 4QX0A 5IVYA 4LBMA 4HBNA 3JRBA 3CZ6A 1NA1B 3RZLA 4UVCA 5ABJA 4EN9B 3ZMVA 1ON2A 3IKTA 3K70C 2NN8A 1W9YA 2ZAAA 1WCQA 4DYCA 2DN0A 2JZYA 1JZ6A 1SVMA 3KPHA 5DAPA 1RMU1 2LROA 3BTJA 1PVC3 1X4OA 1N1YA 1N25A 5FPZA 5FYYA 4IRIA 2GC2A 1TME2 2NNNA 3TP0A 3ULQB 2HOAA 1YJLA 1H0MA 3D5LA 3VDDB 1A78A 4TXWA 1PUEE 2X6YA 2D98A 3WNOA 1RHI3 3ROUA 4ZS3A 4RN5A 4AHXA 1D5VA 2XC7A 1UN1A 3U21A 1DDNA 1AR92 4LOSA 2KFDA 1C5IA 1FMD2 1NCQC 3OEAA 3JRGA 4CCMA 2R043 3POJA 3KYLA 3I56I 4RGUA 4Q1PA 4LKDA 4AEDA 2W2IA 3PURA 2OQRA 5LB6A 2STWA 4DRVA 5FY9A 1REPC 1R1A3 4CVUA 1H88C 4XM3A 2OUJA 1UFMA 9ANTA 1V54H 4UAPA 1HRV1 1YITI 4BQQA 3NMBA 3VV1A 1HQLA 1GKBA 3MIBA 3ZYHA 1E5RA 1DP7P 2AS5F 3KZ4C 1R23A 3VKNA 3R4UA 3LFUA 3VDBA 2GC1A 4BUPA 4XBQA 4FASD 3ETPA 1CAUB 3KT1A 3O0XA 2XLGA 1HC8A 1OYWA 1VJ2A 1R1VA 2WNUB 2D44A 1TME1 1WH7A 3ME2A 3LCPA 4LIUA 2R4GA 4JQFA 4CYDA 4DFSA 3GYDA 1UYZA 4Q29A 2XAUA 2O7OA 4L8QA 5IUQA 2Q4SA 3WZ1A 1SQ4A 2ZXJA 5LHIA 2VUCA 1UAAA 3P5JA 2ZGUA 1RVF3 3DYPA 4QQHA 3LNQA 4OHVA 1FMD1 1GICA 1ZAOA 1WMDA 4DGWB 4URAA 1AXZA 4PDKA 4A45A 3WW4A 1B9MA 4JKMA 5KHHA 4CP9A 2BXZA 1Z21A 4K7JA 4A2UA 2JA5J 1SAUA 3OF1A 2AXTC 1K79A 2BY2A 1UU4A 1HSJA 1REFA 3KP7A 4BQ5A 3JW4A 5KC5A 3VBSC 2EAAA 3WG7H 1CAWA 2MG4A 1AYN3 3T4HB 2AQEA 4R4ZA 4XEZA 5JVGF 3CO2A 4FHTA 4Y4RA 3BPZA 5IJRA 2CJJA 1UNBA 1WHUA 4IRHA 3JCUC 2BGOA 3ZSEA 2ZXWH 2JECA 4HXCA 4GH4B 4AQ2A 2P5BA 3V8KA 1FIAA 3H92A 5FPXA 1ZM1A 4GIQA 4CXYA 1BLZA 4CDQC 1D4VB 4G7HF 3ZQGA 3ASNH 3HOZJ 1F4KA 2D6KA 2NVXJ 2HEWF 2DO7A 4GMP0 1I27A 1OMIA 4BZ4A 4XF1A 4MEYF 4ZJZA 3RZJA 4DEVA 3AJYA 4F8AA 2KL4A 3T08A 4AFBA 5IVFA 1BIBA 4E27A 4NROA 3Q3SA 3DKWA 3F0CA 3ZRGA 5CFDA 1XGNA 3PQJA 3IRRA 1OUSA 3NV2A 2R063 3H0GJ 4II2A 1HBXG 4I2OA 4KQ7A 4AUXA 1D0GA 1AWCA 5FO9B 3BLYA 2VI6A 2IEKA 1ODMA 2ZHMA 5H9RA 2JX9A 5CFCB 2XPUA 5AC93 1BYHA 1O5LA 4QQ2A 2CV2A 1XXNA 1LE8B 2ELKA 4HX7A 3KYDB 1IPKA 3EPZA 4KMUX 1JYXA 1T6GC 4BE1A 4DS0A 4EJVA 1BOAA 1SC7A 3IWFA 3HOWJ 2IGOA 1XNBA 2GMPA 4OOIA 2H8WA 3SKVA 5KAIC 3S15J 3IM0A 4X8NA 2WWYA 2BZDA 4Y52J 1M06G 4AFAA 2R062 5F7UA 3FM3A 3VZOA 3LSIA 3ZCOA 3KT4A 3NNMA 4PJNA 3FXRA 2O8QA 3SHFA 2YU3A 3JTHA 4IV1A 3ILFA 4NVPA 4MO3M 1UY1A 3IUOA 4P02B 1XYPA 2Z16A 2IRFG 5CEHA 2EFQA 3PIPF 5HXMA 2TRTA 2FNPA 4UFMA 2W24A 5C4WA 4AWDA 4DNCA 4IE0A 1QVUA 3IN9A 1G3TA 2A69F 4B1MA 3MEPA 1W8FA 3DL3A 3CCRI 3O7OA 4NAMA 3OV8A 3GCMA 1IG3A 2E7XA 1QNTA 5FYUA 1K78A 3UR3C 4XNFA 2XQXA 5LGUA 5EJCA 1TG7A 2H6CA 4IHXA 5GAGJ 2EH3A 2LKXA 4OIQF 2DQLA 1UHSA 2ZGOA 1R64A 2M7AA 1MZ5A 1GUIA 3NV4A 4E70A 2CO5A 3OYIA 3HC7A 3T0YA 4XJAA 4NRMA 4RB2C 3DEEA 3MQ0A 5GADJ 2VQTA 1PIV2 3ES4A 4XZPA 3PL8A 3POIA 2C5DA 3RTRA 4A44A 5E8AA 3WHTA 4YW6A 3HZJA 1LDDA 2Z79A 4YYOA 2HTSA 4BHCA 3BR2A 1NLRA 2HWD3 1YX3A 2V1UA 3GTKJ 1NG7A 3CJRB 1SLTA 2K9NA 1POV1 3RG0A 3GM8A 4KWJA 2PEXA 1LJ9A 5FXVA 1Q43A 2RS32 3LOBA 3GDBA 2QVOA 3JREA 2V9KA 3OY8B 4S05A 3GBWA 4IOCF 2QSHX 2OIIA 1EPWA 3HJRA 1TWFJ 3RPUA 1I1GA 1ALYA 3CUQA 3ZPYA 1XS9A 4XDPA 1TW3A 2EALA 1D1AA 4FE7A 4R9AA 5FZ0A 1KZHA 1EH7A 2CYYA 3H9GA 1ULCA 4E4ZA 4D7TA 2CHHA 4P9GA 5M5YJ 4RS5B 4HLXA 3SMHA 2BW3A 3W58A 2M9HA 5K5RA 3ZDSA 5E1WA 3CDIA 5LA0A 1CVNA 2LNBA 2PN6A 3W6KB 1S0DA 3IH4A 1IPJA 4WXHA 3OPWA 1MS8A 1WJDA 3KLOA 2JXAA 3N9NA 3ZN0A 1NLSA 4X0GA 1ODDA 2XV4S 3RKYA 3GJAA 1V70A 2LY2A 2DDUA 3FBIB 3ZSKA 1PIV1 2F4MB 1SD5A 2FJ1A 4XR6A 1Y0UA 5AVPA 2FEZA 1N1TA 3U1DA 3RZDJ 4Y22B 2R7FA 4KBBA 1YYVA 2ENRA 1TLHB 1LQ1A 4NRPA 2W84A 5FY0A 4NIGA 2E1MB 3TO6A 2RS31 1ZELA 3LPFA 1AJKA 4CP2A 4QLCU 3U0ZA 2X6XA 4XF0A 1O91A 4QB1A 2NNYA 2VQ0A 5JLXA 3CO6C 5LY1A 4L11A 2J1RA 4L97A 4FAGA 1TP4A 2DFBA 2C9AA 2YUSA 1H2MA 3U2RA 4GKYA 3DCFA 2L3DA 4GWNA 4XQWA 2XLAA 3A1YA 3TWIA 5ABJB 2OW4A 1EYBA 2QDNA 3LOCA 2CMPA 4KNYA 1U5TA 3DYMA 2FCTA 1ZZ7A 3CDHA 1MD0A 1JYTA 1WW6A 2GSYA 4XFGA 4CDGA 2BQPA 2WR9A 2ZJRF 1O5UA 1H30A 3KV4A 1MACA 1L7RA 3IMNA 4Q0UA 4QPIC 1L0OC 4AQ6A 1G9BA 3BQYA 4META 3T5XA 3P9KA 1G9FA 3F8NA 3QD6A 4A3BJ 3S3MA 1LHVA 2HXIA 1UX6A 3OGRA 3IBMA 3F72A 2HEYF 1ZG5A 3V8JA 1W36C 4ESBA 4LQRA 4XHBA 3ECOA 2DMTA 4QTRA 4ENMA 4K1YA 3FXLA 4MOAA 2JD4A 1P6RA 2WA3A 5E8IA 2B63J 2AXLA 1YOVB 4EN8B 4OIRF 2JWPA 1UXXX 2W52A 1G7YA 5HCFA 4AEDB 3NV1A 4XFAA 1GT0C 1E57A 5IAXA 2GALA 3WNLA 2KZVA 1QHHD 1W9TA 4BL0B 2VPRA 2PQSA 3PHMA 2R5ZA 3WODF 2OYZA 3K4AA 3C7GA 1X9TA 5DMYA 1UKGA 4C9YA 5A6QA 1DF0A 1F9NA 2VOPA 2LDUA 4M74A 2K9LA 1GXPA 1VBC3 1JOJA 3KE2A 4QKNA 1IN4A 1O3SA 3RCOA 1HKDA 1MSEC 3KT7A 2KQRA 5IT9Z 5AFBA 3HBKA 5D8AC 4JDOA 1JYWA 3OYLA 5J36A 2D93A 1OLME 2CW7A 3ZQFA 1IDZA 2BERA 4ZYHA 1PM4A 1SHWB 2J1EA 2VZPA 4UUSA 5BOXA 5DAXA 1QGLA 2ARAA 5C9AC 2HBTA 4NDLA 1KONA 1EH8A 4YARA 3TKYA 4AQTA 3AVSA 1ZZ6A 4XOTA 1X9PA 3MIHA 1ULYA 1HJFA 4M3EA 4XIOA 1QQP2 2GXAA 1UOFA 2VMEA 1CJPA 4CP9B 5K0UC 4N7UA 4UUVA 2D6OX 4QPGB 3BPXA 3EXUA 5AONA 3H36A 4GWMA 1LEAA 1F15A 2JB4A 3F6VA 4ASMB 2L9VA 1R093 3PSIA 4CU8A 5B1AH 4HOOA 3MI8A 1CAWB 2DPUA 4B4PA 4LG3A 2XR4A 3SFIA 3UGFA 1EA3A 3JSOA 4FAHA 2A73B 4EQQA 4ISQA 3WNKA 3I8TA 1WLWA 4UVAA 2JPCA 1BJAA 1I6HJ 1BEV3 3NARA 5KWRA 2HWE1 2E60A 1NLQA 1WJBA 2DBNA 3GTPJ 2O0OA 4EJWA 2J1TA 3HGGA 1UIJA 3HHHA 2ET1A 5F5QA 4FO9A 3VHPA 3N05A 4D1QA 1J0RA 1ND3B 2JG9C 1IRFA 2QQLA 2E35A 4XJ9A 1R092 2R7ZJ 2QQMA 4LBQB 4YM2A 2Y6HA 3AKRA 2JPBA 1R71A 2ARBA 1BHGA 2V79A 3ABUA 3U1KA 5FB2A 2FZ1A 5CFDB 4AI1A 5JCTA 3VBRA 2JT1A 1QQP1 1BMV1 4MGTA 2XG3A 1UOGA 2ILMA 1DLLA 2BUKA 1HV0A 3V7CA 2QBXA 3K4ZA 3CDLA 5DAQA 2WWSA 2CW8A 4XLAA 3CJQB 2WQZC 5ICEA 4IGOA 1XE0A 5LHHA 2UYBA 1PO11 1W6PA 5BNPA 3M3YJ 1SANA 4XYXA 4XABA 1JUMA 2LC2A 4O3MA 5E79C 4OULA 2TEPA 2NLRA 2QQIA 3K48A 1JGSA 1QH6A 2WA0A 4XRFA 1QZYA 4BQYA 2QQJA 4MEXF 4ESFA 5JOXA 2FOKA 2QQPA 1KQ9A 4QPYA 2ZJ2A 2R7TA 3CEWA 4LHLA 5FPUA 2LBFB 2RN7A 5A33A 3JRIA 4YFNF 5LA2A 3OS0A 2GNBA 3TEZA 1SBDA 4GULA 5DEQA 1W0TA 1IN8A 4DW6A 3CC7I 1RGSA 3ZQLA 1C1LA 1FV3A 2LY1A 2HYXA 4IDZA 2EIEA 5GJ6A 3VD5A 1R22A 1YQAA 2JG8C 3N9QA 1HW1A 1PMHX 1JTXA 4IV1B 5F6LB 5GLZA 2KIMA 2P37A 2XL9A 4JGYA 1VZ0A 3LAGA 3MLLA 1JZ8A 3CCUI 4WVMA 1H8VA 4COVA 5IY5H 3CF5F 3RJ2X 2D5HA 1FSEA 2EJRA 3QH6A 3SEZA 2XJUA 5FYBA 4QDQA 4A7ZA 3BY6A 1NKGA 3KLSA 3RQ0A 3WUDA 3FBYA 5FYCA 1FIPA 4YIIA 4Q26A 1JZ2A 3VBUC 1K78B 1X58A 5FD5A 5HDNA 1IW7F 1EP0A 2VNRA 5D8KB 4OMDA 4BWOA 4AVAA 1A5JA 1OR7A 3CCYA 1UYYA 4S0HB 1H6XA 5FRNA 4WVWA 2J1UA 2W95A 2BFUL 2JK3A 4RFRB 1MS0A 1U8RA 3KCXA 5JXJA 1ACCA 1P2FA 2ZJCA 3ZDVA 1SFKA 4HLYA 4ASKA 1LOFC 3ZXSA 5DXDA 2A70A 5K7PA 3JD72 1Y8QB 4JOMA 3W9AA 1IS3A 4E7HA 1H8AC 1VBD2 5ILSA 4K9SA 3ABTA 4HF2A 2FDKA 2CQKA 1Z7S2 1O7LA 2KJCA 3I4PA 3T2OA 4GKXA 3K4KA 1WH5A 2ZKLA 1YTYA 4YG6A 2O3FA 1K3IA 2LLKA 2VBZA 1O3QA 3I2HA 1G2HA 1GWLA 1NE4A 3CUQB 3S16J 1IS4A 5CBLA 3K4MA 3KFWX 3TYJA 3CZUA 1DGRA 5FZBA 2ZEZA 1XTAA 1ZHFA 1IN5A 2QQBA 4M4PA 3BOQA 2YB7A 2M4KA 2VZOA 4DNYA 4LO6B 1PX4A 4LUMA 2VL8A 5DYMA 3AYEA 2BW3B 2O8XA 4QQOA 3VBHA 3WP5A 4P9JA 4XURA 5D4SA 3SH5A 1QJU1 4NHMA 4BISA 1SFEA 5A1FA 2VZQA 2ZACA 2JVGA 2R1DA 4CUCA 1W8NA 3DKQA 4H0EA 4DXTA 5ERLA 2NOJB 4XORA 2HQAA 2P34A