4N9IA

Crystal structure of transcription regulation protein crp complexed with cgmp
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
202
structure length
202
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of inactive CRP species reveal the atomic details of the allosteric transition that discriminates cyclic nucleotide second messengers.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator
molecule keywords Catabolite gene activator
total genus 62
structure length 202
sequence length 202
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4n9iA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4n9iA01
3R0AA 1JXSA 1S29A 1BIBA 1IXCA 4ENMA 1EV7A 1FX7A 1O4TA 4IXAA 1QXRA 4WX9A 3GW2A 2C6YA 3FHIB 4F8AA 3MZHA 3MDPA 2FNPA 1VTNC 4IRHA 4A5NA 1IUYA 4KA4A 2F5DA 3BJAA 2EFNA 4BAYA 3KP4A 3H8UA 1KA8A 1TBXA 2G7UA 3NW4A 4Q29A 4Z2YA 2WV0A 2BEOA 2RDPA 3MAJA 1IRGA 1ZRFA 1ODDA 4HOBA 3SFZA 3I59A 4U0YA 2P4WA 5E20A 1LQ1A 4A0XA 3REOA 5DDGA 3HQXA 3HRTA 1U12A 5A2QZ 1BBYA 5LEKA 1MD0A 2QM3A 3ZN0A 3BPZA 1CAXA 4ZU4A 2HDCA 2RQPA 3I71A 3B73A 4META 1PDNC 2A69F 1I1SA 2IJLA 4HDUA 3IKTA 1AWCA 1EH6A 4M6XA 3AAFA 2NYXA 2IPQX 2PQQA 4JK1X 3RPQA 1FC3A 3TO6A 4L0ZB 3F22A 4WXCA 4R8HA 4JVAA 1TQIA 2RVCA 2GC0A 3VODA 1IAWA 5L3DA 1QZZA 1OMIA 3VHRA 1T6SA 2WTEA 3T1BA 1P2FA 4Q0VA 1GXPA 1RNLA 4XSZF 3OCPA 2XLGA 4JV4A 4L18B 3ZMUA 3GUDA 3QPTA 5IT3A 3WTTC 1PUEE 3I0TA 3NRVA 2JSCA 3EQLF 1GHCA 4MQ9F 4MH0E 3LFKA 1O7FA 2CWEA 2JZYA 2ISZA 1IN6A 4MHGA 5ILVA 2IXLA 3V7CA 1O5UA 2VBYA 1K6OA 1FWZA 4M9ZA 1FPQA 4R1HA 1YFHA 1K79A 1YUDA 2PHLA 4M71A 1UIJA 5DUIA 3WW2A 5LRRA 4Q48A 1EH8A 4XRFA 2A07F 5LGNA 3G73A 2V1UA 1UB9A 2M45A 1W5SA 4FX0A 2VBXA 4FHTA 5I0RA 4MGKE 1WI9A 1U2WA 4Y13A 3T8TA 5CVUA 2OQGA 2QQ9A 4HBLA 1ZZ8A 2EA7A 3U11A 5E8IA 3HSEA 5I0TA 5L3FA 1X7NA 4LD5A 5E18F 4IHSA 3DN7A 2DU9A 4HA8A 4I7HA 3RYKA 3DP7A 4IEZA 3M9AA 3WW3A 3MZYA 3TO7A 3TDZC 2ESHA 3C1DA 1VP6A 5K5OA 1W4MA 1XGOA 5HOOA 3CUQB 3J81Z 1ZN2A 2XL7A 3D5LA 3I53A 3F8CA 4YARA 1Z7UA 5J8FA 4LTAA 5AONA 3E6BA 3NEUA 2EV0A 1J1LA 4L9TA 2OU2A 2UXNA 1MDMB 2DTRA 5I8SA 2P7VB 1RC6A 5F6FA 3TDUC 3C18A 5TJJA 2MNGA 2PQ8A 4UUVA 3I54A 3FXUA 3QOPA 4L9JA 4ESBA 3W6JB 3WG9A 4S04A 2DW4A 1B6AA 2VPVA 5JHUA 1FLIA 3WE2A 4L0YB 2Z2SB 2A3SA 1S7AA 1SFXA 1PMIA 3NL1A 4HSJA 4XLPF 2PAEA 1BI0A 3JAMZ 1SMYF 3S7EA 4LGWA 1T98A 3P9KA 1ZREA 2QQBA 4XF3A 3FM3A 1ZHFA 4MNUA 2DI3A 2WC2A 4ZYGA 1LJ9A 5EFUA 3ZP5A 2VT3A 3UKNA 3I5UA 2QUFA 5D1IA 2O3FA 1YYVA 3JSOA 2DPDA 3RTRA 1GQHA 4OLLA 1O7LA 1SFEA 1J75A 1O3SA 4UNOA 2XAGA 2MLGA 5L3GA 1X82A 3KLOA 4HLYA 4JBAA 1KQ9A 3KEOA 1SQ4A 3Q9SA 4XFFA 1MJ9A 4XSXF 3R6SA 3ZMVA 4WXHA 2KJCA 2PMUA 2D5FA 2GH2A 2XAFA 1XGNA 1XCVA 2MH2A 3IHUA 1BOAA 5BY5A 3OTFA 1XRUA 2DT5A 4YFNF 3FF5A 4OIRF 1UW8A 5C6CA 1G3YA 2L01A 1Q1HA 3V7RA 1ZZ7A 1Q3EA 1FBSA 1DGWA 1X8EA 1RL3A 1UD1A 1QBJA 5F1RA 2O1QA 1ZG3A 2QQAA 3WW1A 4DQ2A 1BC7C 4D0PA 2Q4SA 1H9GA 2ZKLA 3WTSC 4G6DA 1Z6RA 4P9UA 1TW3A 1IRFA 1OR7A 3ZQ7A 4LG0A 2K27A 3ABUA 2PG4A 4KUMA 1LDDA 2RNJA 2QYOA 4HMZA 2VODA 2H09A 3SHFA 3E3VA 3PQKA 2EV6A 3KFWX 4X6QB 4NVPA 3L2CA 1S8NA 4YIIA 2OQRA 2HQRA 2J5PA 4EROA 2I45A 4AIKA 2H94A 1SD7A 1Z05A 1KGSA 1HBXG 5JSPA 3F72A 4HV6A 4QX5A 1QWRA 5HI0A 2EJRA 1ZG5A 2V9VA 3HUGA 3HT1A 2H6CA 3QPHA 3ZMSA 3DF8A 4ESJA 3DV8A 2MHFA 4MV2A 3MPBA 1FBQA 2R3SA 3ES1A 2M30A 2XL9A 5H20A 4HVRA 4D7TA 1K78B 1IXRC 4PIYA 1XN7A 5KHIA 4RB3C 1DZTA 1F1ZA 4RD7A 5CLSA 3H7JA 3P9IA 5FD6A 2ZFWA 5A2QK 2LKPA 5D5VB 4Q5SF 4LG0B 4LA2A 2A68F 4KN7X 3MFKA 4XLNF 5CVVA 4WF2A 3GLXA 4OIOF 4U7DA 4WXDA 4M6YA 4XFBA 3LA3A 3ES4A 1SAXA 3ABTA 2OD5A 5KHKA 4OINF 4M73A 1ZRCA 5AIPA 2ZCWA 3SZTA 1STZA 2JPBA 1MKMA 3ZMZA 3QP6A 2CO5A 3CL1A 3RYPA 4PCQA 1SD4A 2Z9OA 2EFOA 3KE2A 4OFGA 4Q4ZF 4MGRA 4HV5A 4A5MA 2IXKA 1U8RA 5ICFA 2CAVA 2XAJA 4I02A 2IXCA 3WGIA 5E16A 4G94A 5HVQC 2ET7A 4H7LA 3FWEA 4K8FA 3CJNA 1YW7A 3WGGA 2O03A 5KVRA 3DL3A 3GO5A 5CVJA 4GCVA 1MZBA 1EYBA 2E7WA 3E5XA 4U0VA 5D8KB 1QPMA 1WQ2A 3VFZA 3K1NA 5CVIA 4KNYA 1BI1A 2HOEA 3I59B 4MGIE 2KXLA 1Y9QA 3TKYA 3JSPA 4UXNA 3M8FA 3BU7A 2HS5A 2XASA 4EJOA 2YSRA 3KP5A 4P9GA 3NJZA 3ZN1A 1WKMA 2R7DA 1SFNA 2UXXA 4L9NA 2B5HA 1CX4A 2M87A 4AVCA 1T2KA 2OZJA 3J80Z 3G7DA 3F8FA 5K1YA 3LWCA 4Q47A 2Q0OA 4L5JA 3D0JA 3RZZA 1YW9A 3O2PE 2VE9A 1ZGAA 2HFHA 5FFXA 3TNQA 2XAHA 4UVBA 1CAWA 2H6BA 1OYYA 3GFLA 1W7PB 4LK0F 3RKWA 1U3EM 2YU3A 2EB7A 2D5HA 4F7ZA 2DAOA 3EQEA 4N0BA 3ZDSA 3J81K 3FXRA 5E1XA 2Q1ZB 4WBBA 2CG4A 5DCFA 4AVPA 1BM9A 1EP0A 2XLFA 4HX4A 1DDNA 3LOIA 2DPUA 1BN5A 5DD8A 1J58A 4KWLA 3NSTA 3DKWA 1ZG1A 4JTNA 5LHGA 1CAUA 5BV6A 5BUVA 3D0SA 1P4AA 4CDGA 1R36A 1UFMA 1ZYRF 2V79A 2A61A 3RIRA 2EVXA 4A12A 2FE3A 3TQNA 1HKQA 4LB6B 1XSDA 5LLQA 4BQAA 2BBYA 5CVRA 4EM1A 2W84A 4U0WA 4RGRA 2BNMA 5DUKA 1YS6A 5HS9A 1TTYA 4UV8A 3CDHA 4XEZA 4LA3A 5JCTA 3F6OA 4MUVA 3PFIA 3K1MA 4RGXA 2Z69A 1EPZA 4I2OA 4AXOA 1W7PA 2MH9A 1XDSA 1J7KA 1RTVA 3KEQA 4LLLA 1GVJA 5K5QA 1QZYA 3E6CC 4FT8A 5BPDA 3EHKA 3U10A 2BV6A 1RGSA 4RGSA 2VC1A 4R52A 1IN8A 4AQ2A 1L0OC 2VOOA 2XROA 2QNKA 4EJVA 4XFCA 6PAXA 2KIFA 4L11A 2K86A 2HQNA 2K9ZA 4NQWA 4FBFA 3JTGA 2FBHA 1CAUB 2V6CA 1DPRA 2O8XA 2ETEA 4EQQA 1WSUA 3C3WA 5K8SA 3CO2A 5JSRA 2IA1A 2FNAA 3CO7C 1B4AA 2E1CA 4G8XA 1SD6A 1YFYA 1B9NA 3TO9A 1FNNA 2EA4A 2HZTA 3ST7A 5F64A 4KU8A 3V7SA 1U5TB 1MDMA 1ZNPA 1JHHA 2AS5F 2Y0OA 2F5FA 2FU4A 5FLHA 2EAAA 4XBFA 2VBZA 1RUOA 4PJYA 4IEWA 2XIGA 2KJBA 3B02A 4HW0A 1KU3A 1Z9CA 2VE8A 3GZ5A 1ZAOA 1R5GA 2RN7A 2PFWA 3E5QA 1VJ2A 3EO6A 1ZZ9A 4EVIA 1QGPA 3WTZA 2E1NA 3DQVC 1NXMA 1T0FA 3ISPA 1F4KA 3F3XA 1B1BA 1PM7A 3CF6E 5FLIA 5FPXA 3WGHA 3IL2A 2VONA 3E5UA 5L3CA 2G7HA 3UKTA 1BI3A 3L09A 4QXKA 2HWVA 1A04A 4I0AA 4QM8A 3ACLA 2DQRA 3H3UA 3H7YA 4IERA 1WA4A 1XMKA 1LDKB 4WCGA 5KHGA 2P8TA 2BNOA 2A6EF 2PHDA 5I8YA 1D5VA 3KMHA 5BPIA 5HS7A 2IVMA 4FX4A 1Z1DA 2A5YB 3TOAA 5CADA 4IESA 4YNIA 2Y75A 3SCHA 4IPAA 3CJXA 4K2EA 3KP6A 4HF2A 2Y48A 4KIGA 5ERIA 1OYWA 2FXAA 4MEYF 3DPTA 3KP2A 2ACJA 4CO8A 4RS8A 3ZMDA 2GAUA 1R00A 1J59A 1USSA 3J7AO 1UPIA 2HR3A 3ETQA 1FYKA 2EK5A 4QGMA 3R60A 3SCGA 2M5WA 5ILSA 1WWXA 3HRSA 3KGZA 5BXXA 1JGSA 2PMHA 4B09A 1DUXC 2FQPA 4G6QA 1L3LA 3T5XA 3U1DA 2OPKA 1XMAA 1NE4A 3ELNA 4Q0SA 1E17A 2GC2A 1ZZ6A 2VOPA 5D6FA 5LBQA 5FB2A 2MA3A 5ILUA 2PJPA 1TQ5A 3S7IA 5HLIA 1TNSA 1BIAA 3O6BB 5DEQA 1WLTA 5D4RA 4KIBA 2V1XA 1KYZA 4CGZA 3GYDA 4GGGA 3ZMTA 5IT9Z 3UKVA 4KWJA 3F8NA 4O5VA 2LSOA 2NNYA 2LF7A 3HRUA 5D4SA 2A6HF 3FM5A 2IC1A 1G3WA 5E1WA 3KGLA 4IEYA 3S0MA 1HW1A 4A6EA 2XAQA 2P5VA 2UY8A 4LLGF 3FZVA 4O3MA 2Q30A 3KCCA 3FJSA 2VQAA 3LA7A 5HLGA 4Y17A 2PTMA 4J1XA 3V8KA 3EUHA 3OOPA 3V4GA 4IEOA 2PN6A 2RGVA 3BB6A 3K9TA 4M9XA 5LHIA 2HKXA 5H6QA 3IC7A 1R1TA 1S6LA 2QZ8A 3IDBB 4YFXF 4ZU7A 5BOXA 1W7PD 4HDVA 5LHHA 1LEAA 1OKRA 3RKXA 4EV0A 2HYGD 2D93A 2IXHA 3G3ZA 1ONVA 5J48A 4U7BA 2OAZA 4A0ZA 5ICGA 4HYEA 5I0UA 1XD7A 3O3KA 1SFUA 5JVTA 1YIOA 4NHJA 2HJIA 3H1MA 5BPXA 3HTUA 1MGTA 4I98B 4OIPF 5CU1A 1CGPA 4D7SA 4IEVA 4CICA 1UHWA 3SCFA 2Z3YA 4ZH4F 1FI2A 3QAHA 4IEQA 4LULA 2O61A 2ZMEB 4HF0A 1FXZA 2O0YA 2ET1A 3PNAA 2GU9A 2MBFA 2GC3A 3RPUA 4XFAA 4RGUA 3H1WA 4A2UA 1YLLA 1DP7P 1LR5A 3KZZA 1YFWA 5TRDA 5AVPA 1ZH5A 4B29A 4O9EA 3KLNA 4EGYA 3C7JA 3GX4X 5D8LB 2VECA 3GZ6A 4OOIA 1C0WA 3WTYC 3DPLC 5ICEA 1VR3A 4KFCA 4QMAA 2ELHA 2STTA 1K7AA 3P7NA 1YWKA 4E2QA 2QENA 4CHUA 3KZYA 1IPKA 4P5OA 4I0BA 1FSEA 4EGZA 2FMYA 3QP5A 2DBBA 4RB1A 4ZYDA 2Y0MA 1I6XA 2JTVA 5JR7B 3LQQA 2PLYA 1ZX5A 4LLNA 3K0LA 1SEFA 3OD0A 4HF1A 1G3SA 2XKPA 2ZXJA 4FAHA 2ZMEA 5BS6A 3M70A 4GXOA 3ZPLA 1B9MA 4ONUA 4HN0A 5KBFA 1F5TA 4WZCA 2VN2A 3FZ3A 2B0LA 1OI6A 5DCMB 2LNBA 1TLHB 4HVQA 4BH9A 4DINB 3FMSA 3LSTA 2CV6A 2L4AA 1XDUA 1EY2A 5LGUA 4UBGA 4EMSA 2ZNZA 4G7ZF 3MWMA 2Q0AA 1DZRA 3K1PA 1OPCA 4ASNA 5HDNA 3LA2A 4MGZE 2FOKA 4Q0UA 4BNCA 3SMHA 3NQOA 1O5LA 1YS7A 5E17F 1CAWB 4AIHA 2XHKA 2FRHA 2HEOA 2HGCA 4G7HF 4Q0PA 4OMZA 3PLQA 1W5TA 3WW4A 4YRDA 2X0LA 3V8JA 1FSHA 4B8XA 4GYGA 2DLLA 4M9SA 1XE8A 2XGXA 1LRHA 4IHTA 3MYXA 3FE5A 1R7JA 3IRRA 2BE5F 4ESFA 3F8MA 3LWFA 4LLOA 3L00A 1IZ1A 4PIZA 5DCMA 3HT2A 2HTJA 4XF9A 2Z33A 4A0YA 1YW8A 5E1RA 5JR3A 1H1IA 2IXJA 4Z07A 4OMYA 5CJ9A 1FY7A 4MGYE 2EFPA 5FLXK 1JHFA 2BYVE 2Q2EA 2XVCA 1O57A 5J6XA 2ADUA 4HX8A 1SMTA 4QGNA 2CAUA 4LJZF 4O6JA 1HW2A 5EEHA 1R1VA 3M3IA 2D1VA 4KT5C 4IETA 1KQ0A 3SQNA 2K4JA 2XUBA 2QWWA 3VOEA 5HDKA 1B59A 1FT9A 4N9IA 4ZZDA 1FYLA 1UCXA 4GULA 3IDCB 4OU0A 1ZVFA 1MJAA 1UIKA 3WTXC 3OF1A 1BC8C 5FQ0A 5EZWA 2X4HA 4LK1F 3H92A 4RB2C 4MEXF 1HXDA 4IEPA 5EEGA 3M1EA 2OA4A 5JFRA 3HRMA 2UYBA 3WU0A 1IN5A 3RYRA 3HOSA 1P4XA 4PGGA 4N9HA 1TQMA 5C8WA 1U6GA 1E2XA 4M72A 2CGPA 5ICCA 1H0MA 2PYTA 3GYHX 3F8BA 1J3RA 4KICA 2TDXA 2GZWA 2ATFA 3JAMK 3U2RA 2K0GA 3BY6A 2IRFG 1T38A 4EM0B 4UVAA 5JAXA 5J7MA 4KMUX 2P17A 2KKOA 3ROUA 3GBFA 5E1ZB 5CYVA 4KIFA 1PP8F 3DEUA 3HHGA 5FGMA 5HS8A 4ZU5A 1U5TA 2QVSB 4ON0A 3GFIA 1UCRA 4BXUA 1YLFA 2K7LA 4AD9A 2R7FA 5DYMA 4EJUA 5K5RA 2J5OA 1NHAA 3U9GA 4I09A 4NB5A 2FF4A 1R23A 1FYMA 2FSWA 2D45A 2WWYA 3GF2A 4HLTA 1GXQA 2M1BA 3WTWC 3DFGA 2H0VA 2FBKA 4S05A 4BHPA 1H1MA 1HW5A 1KU2A 2HKOA 4AVBA 2W24A 3ECOA 3GFMA 2RKHA 2F2EA 2P7CB 4LMYA 4G7OF 1HKSA 1BJAA 4HAMA 4ENNA 2GXBA 3EBRA 4MX3A 5BMZA 4HQMA 5D6EA 4KYWA 3GVAA 4AVAA 4P9FA 3BROA 3H1YA 1Q5OA 3M8EA 2PFBA 1OD5A 2W57A 3CEWA 3Q5FA 3FXQA 4QM9A 1ZRDA 1DGRA 4AQ6A 1KQ8A 2BGCA 5HLHA 1LDJA 1WRJA 3FX3A 5I0SA 3OV8A 1RUNA 2GXGA 2PBIA 2GC1A 2PEXA 4X6RB 4TLFA 5HDGA 2PAKA 3PQJA 2MD5A 3EDPA 4ENJA 5LRSA 2LF8A 4IRIA 2M8EA 5D5WB 1YHFA 1NZCA 1ZRRA 1H9TA 3H50A 4XFGA 4KL1A 1HQCA 2UY9A 2B9UA 1LVAA 1YFUA 2ETHA 5H6RA 1ON2A 1P92A 2XRNA 3KSCA 1Z91A 4LUMA 4EJTA 3RI4A 4LFUA 2F4PA 5FDBA 1CF7A 2NAZA 1PP7U 5FLJA 3GXOA 2D2WA 1IN7A 2ZBKA 2DO7A 2Q8KA 3IIAA 3EYYA 4JTOA 2KRFA 2UZKA 1O3TA 3RDIA 2VXZA 3BOQA 2CYYA 1QXJA 4KN4X 3N97A 3U0ZA 4UVCA 1KU7A 3BWGA 2FMLA 1XSVA 4UHTA 4IF4A 2VBWA 4BHCA 4L5IA 1Y0UA 1XE7A 2F5EA 1Z6TA 2P6TA 4MQVA 1R5HA 1YG2A 1QO0D 3LQRA 1EH7A 2CFXA 3R4KA 4XF1A 4HSLA 3JZVA 2EFWA 2OZ6A 1MJBA 1HSTA 2IP2A 3IWFA 1SD5A 2KIMA 2QVOA 1J9IA 1HKTA 1U5TC 5BQTA 3HIFA 3P9CA 4EWDA 3GFJA 2COMA 5JI6A 2ESNA 4WWCA 2K02A 3IBMA 4XETA 5I8TA 5KK1A 1CAXB 3BP8A 2L02A 1G6NA 2GWRA 5E8GA 3H3ZA 2PI0A 1X3UA 1U78A 3PVBB 4IJAA 4BHBA 2IXIA 2IW5A 5IT9K 2XKOA 5FO5A 4CXFA 1IPJA 1FP1D 4TV7A 1REPC 3JW4A 3BCWA 1IF1A 2XLAA 2MPFA 4YIFA 1X8MA 1F9NA 5DV5A 3LZZA 3WODF 3KP7A 3HTSB 3EJKA 4WVZA 3CLOA 4JQFA 1R58A 2FA5A 3BPVA 2KIUA 3D82A 3M7GA 4M74A 2O6GE 1L3JA 4IEXA 3HSRA 4QLCU 3BJ6A 1ZLKA 2DK5A 3HSFA 2CW0F 3RKYA 1P6RA 1G3TA 2CQKA 2DFIA 2YX7A 5LGTA 1I27A 2W25A 3W6KB 1QQIA 3HOTA 4HBNA 3J80K 1XGMA 2L4MA 4GO1A 2ZO4A 4HX7A 1ZZCA 4ENKA 4H0EA 4ZYEA 4DNCA 2EV5A 1YTYA 3CLPA 3BDDA 4CYDA 2O8QA 1I1GA 4PGHA 2OBPA 1OYIA 1LEBA 3I7DA 2NRAC 3V8LA 3USSA 3E97A 4AWXB 5LEJA 1ZARA 2ZNYA 1RZ4A 3MCZA 2L54A 4I3PA 4BYYA 4CZZA 1KYWA 1XCBA 1LNWA 2NNNA 5ED4A 5FLXZ 2VC0A 2STWA 3NVCA 2V1DA 1ULYA 4U88A 4PDKA 2GQQA 3ERED 3R61A 4OIQF 3FHZA 4RB0A 2EWNA 3I58A 1G4DA 1R22A 1D3YA 3I64A 5D5UB 4KU7A 4WK8F 4FAGA 4J1WA 3COAC 4ETSA 3WE3A 5I91A 3MEXA 1ZZBA 2D40A 3FMRA 3FMQA 3RNSA 3L9FA 3BJOA 3CUQA 1TW2A 2GA2A 4ZYHA 3ULQB 5JSOA 1QNTA 2AXLA 3F23A 1CAVB 1YO5C 3T0YA 2OA2A 4UBHA 2IA0A 1FP2A 1BI2A 2YX4A 4QGLA 4P55A 3IRQA 2E9QA 3LAPA 4KMFA 1T39A 1KU9A 4RAZA 5L3EA 2YPRA 2VT2A 4G9YA 2JT1A 1J5YA 2NS0A 2ISYA 2UYAA 3CUOA 4PIXA 2ZKZA 4ZZLA 3SHRA 4UXAA 2C0ZA 3QU3A 3VB2A 2GA1A 4MTDA 4HVOA 2UWMA 4XF4A 1Q43A 1FOKA 2LDUA 3VEPA 1S3JA 4LEJA 1YFXA 3O14A 4XFIA 4E2GA 2JRTA 1LB2A 5T3NA 2PA7A 4XFHA 2QBYB 4YG2F 1UHMA 2P5KA 2P6SA 2Z5UA 1USTA 3E6DA 1D8KA 1ZLJA 4HN1A 3CUQC 3TOBA 2RC4A 2GIVA 1CAVA 2N7GA 2W85A 2PAMA 2F5CA 5FQ0B 3C3VA 2B8MA 1I5ZA 3QU6A 3S2WA 3K2ZA 4Y15A 3F21A 5FD5A 3RJPA 1NYWA 4BIFA 2QCSB 3F6VA 2RV8A 1TNTA 5FFZA 4EWEA 2QJVA 2XV4S 3JTHA 4P96A 4R79A 1ZGJA 5J8CA 2DCTA 3BPXA 4E70A 2DQLA 3QRFF 4YYOA 2IT0A 1D8JA 3I4PA 1NE6A 4MZUA 4XF0A 3T8RA 4QWQA 3WU1B 4PZJA 1RI7A 3Q9VA 2YR2A 2Z99A 1JUHA 1RIOH 4LUKA 4E2SA 3IKVA 2FEZA 1J2XA 2MC3A 4HLXA 5I93A 3H9AA 3IWZA 5DD4A 4GYIA 3QACA 3NKTA 3KETA 3HHHA 3EYIA 2QBYA 3LAGA 2H27A 1YQAA 3DXJF 1Y3TA 3CO6C 4KWKA 3MQ0A 1JE8A 3SXWA 1DPUA 5FCCA 1J3PA 3ELKA 2E7XA 2FQ3A 2K4BA 1FZPB 4IRGA 4IVNA 3TGNA 4YFKF 3N4MA 3E6MA 2D1HA 3SZPA 1XGSA 2ZJ2A 4UV9A 3ML6A 1V4RA 1V70A 4O9GA 2CSOA 1R1UA 1OFNA 3TNPB 1ON1A 1TQPA 1J3QA 1HSJA 5KHHA 3FFQA 3GWZA 4HZFA 1FBUA 4ORFA 1IW7F 1WGPA 4Z82A 4A6DA 4HQEA 2MLKA 3SXYA 4EWAA 1IXSB 2FBIA 5FPZA 5J3UA 4Q0QA 3OGJA 1O3RA 4EJWA 2V09A 3BZ6A 4MTEA 2QLZA 1LKNA 2OYZA 3WTUC 2G9WA 3KP3A 2EA2A 5AIQA 4L2NA 2WFPA 3L7WA 4LB5A 1K78A 4I01A 5L3BA 4AIJA 3ECHA 2DK8A 1IN4A 1V3FA 3CTAA 2BNNA 5KHJA 3EETA 4YSFA 1P4WA 1O3QA 4KDPA 2P5LC 1S7OA 3GEZA 3HYIA 2EFQA 2L3DA 3BALA 1J0RA 1XB4A 4L9VA 2HTSA 3K69A 5D5XB 2IA2A 2JPCA 4IEUA 4EM2A 4RAYA 1CF7B 1GQGA 3LAJA 1XSXA 3WTVC 1AOYA 2QDRA 1QY4A 3L2HA 2HYFA 3R0JA 2OZUA
chains in the Genus database with same CATH superfamily
1Z7S1 1MNDA 3T08A 1VPHA 4FETA 3WNXA 3B9IA 4ENMA 3CP8A 1EV7A 1O4TA 2ID6A 3IT8A 3ZOIA 4F8AA 3MZHA 2W94A 3MDPA 2FNPA 5E88A 5DABA 4XPVA 1RESA 4BXSV 2YMZA 1UKRA 4Q26A 4BAYA 2V26A 3FXLA 3KP4A 2B42B 1KA8A 2G7UA 4DFSA 3NW4A 1AR62 3VBSC 1VQ4I 3MAJA 4EZHA 4XRSA 1ZRFA 2AACA 3I3DA 4DBRA 1E5IA 4A3MJ 1LQ1A 2R49A 2EQRA 2KISA 4HETA 3HQXA 2TBVA 2XF5A 2V4JC 1VQ9I 1Y9MA 1BBYA 1GMMA 1AJKA 3D1NI 1UQXA 1FOWA 1CAXA 3K75B 3QYEA 2HDCA 2ZEYA 1RKWA 3APBA 3B73A 4JKKA 3SEEA 3V0BB 4META 1PDNC 2RG4A 1I1SA 1LE8B 1W6OB 5FUNA 2XVGA 2KIQA 1S2EA 4AI3A 3R05A 3AP9A 2IPQX 4EYUA 3WDUA 4D69A 2Y33A 2H8RA 1D4VB 5GLZA 1FOXA 1UKGA 3KF3A 3OYJA 1RJ8A 2R7TA 3POGA 2RVCA 3FBIB 4FP2A 1IGNA 4CDXC 2EH3A 4A7YA 3PSIA 1S72I 5KAIC 2XLGA 3RZKA 5IT3A 3I0TA 3NRVA 2QF7A 2WAQN 4MH0E 2LP0A 3LFKA 2GP3A 3ABZA 1IN6A 5ILVA 1TWGJ 2FX0A 3K7AJ 3K4LA 1VRH2 2VBYA 4NHKA 1K6OA 4M9ZA 3IM0A 4QQLA 3AMPA 1FPQA 1W2TA 1LE8A 1YFHA 5F5CA 1B35B 4WV8A 1K79A 1YUDA 2O8KA 4FE7A 2R063 3PDQA 1EH8A 3ZXEA 5LGNA 5GPCA 4PLOA 3RWNA 5I0RA 4MGKE 3NWSA 3GTOJ 3V64A 1HJFA 3T8TA 2VZ1A 3LFUA 2VXRA 2QQ9A 1UHSA 3WNLA 1ZZ8A 1OPOA 3U11A 3GMEA 4L92A 2X5IB 4IHSA 3DN7A 4IGPA 4HA8A 1UMZA 1UOGA 4A3CJ 3FK7A 3O1MA 3VHOA 5HV4A 5J36A 3A4CA 3ZYFA 4OI4A 1W4MA 3B69A 4DIQA 2Z5WA 2WFF3 5LFAA 4FP3A 3MIDA 2ZEXA 1NLRA 3D5LA 4A69C 5AONA 3E6BA 3NEUA 4QB1A 3CC2I 3TDUC 3SEPA 3OUJA 2VBPA 1BEV2 2MNGA 2X9DA 2FD8A 3I54A 3RS6A 4L9JA 5LK7B 1KFXL 3W6JB 2DW4A 4R9DA 1FLIA 3F9KA 4P1WA 1PMIA 4HSJA 3NL1A 3RVHA 2DFCA 1Q1VA 2LROA 2JDMA 4FO9A 3X29B 4LBQB 1VMHA 2JB4A 2QQJA 1ZREA 3T1MA 2CUJA 5EYXA 2DI3A 4ZYGA 5EFUA 4YVSB 4F55A 1AL22 4AHZA 2F6BA 1YYVA 3JSOA 2VO5A 2PX9A 3MLJA 4H4KC 3RTRA 4OLLA 2IZWA 2KZVA 5HLTA 2KDZA 1RUJ3 4R9BA 3KVAA 4BPZA 2W87A 3FHNA 5JOYA 2ZXHA 1GR3A 4OUMA 3AFHA 3HPHA 2VJJA 3ZXAC 4HLYA 4JBAA 2KT0A 1VBA2 3Q9SA 3GBGA 4LO4B 3O1RA 2NP0A 2P1BA 4CEYB 4WXHA 2PMUA 3LCPA 2D5FA 2DA3A 2XAFA 3CC4I 5LWBA 1I3QJ 1JBCA 2Y26A 4ATEA 3IHUA 1VB4A 2QFEA 3A0BC 4B4PA 2DT5A 3GCWA 3AP7A 1UW8A 5C6CA 4BGDA 2SLIA 4CU9A 1VBA1 1X9PA 1TG7A 5A1AA 2KDOA 1FBSA 1X8EA 2R93J 2LMDA 4PF5A 3VDBA 3A03A 1PHMA 1R64A 5F1RA 3EUAA 3N9NA 3TN92 2X6YA 1RUF1 2DFBA 2OPWA 2LBFA 1F2NA 2Q4SA 2RS13 1H9GA 2ZKLA 3W59A 1E5HA 4G6DA 3AJYA 5TGTA 1NK3P 2DYSH 2Q5TA 1P8JA 4NPLA 3U78A 3AXDA 1LDDA 5EP9A 3SHFA 2EAKA 5LB6A 3BG5A 3CDIA 1OVSA 3M4OJ 3PQKA 3TB0A 4QHZA 4YIIA 4YW1A 1UJ8A 4Y3OA 2J5PA 4EROA 3USUA 4GA9A 1UG0A 2R16A 1TC3C 5ABJA 1KGSA 1HBXG 3TW7A 4HV6A 1R9TJ 4UB8C 1QOTA 1QWRA 1JYCA 5HI0A 1PVXA 3Q8CA 2R7XA 3HUGA 3HT1A 5JLWA 2Y6LA 3ASNH 3JD73 3ZMSA 2FCUA 3DV8A 4MXWB 1Y43B 2MHFA 1T95A 2VJ4A 1FBQA 3ES1A 4AE2A 4AOCA 2M30A 3ZSLA 5H20A 4NWVA 5E3LA 2OTJI 1QJX3 4IE5A 4PIYA 3ALQA 5KHIA 4GD4A 4KWUA 1OA4A 3M2MA 2HLEA 2XJUA 5FD6A 4E7IA 2LKPA 4FQZA 1ORKA 4LA2A 1PO22 3RZGA 2ZGQA 2V9PA 4KN7X 3TEDA 3MFKA 4WF2A 3GLXA 4OIOF 1QMJA 1LU2A 4XFBA 3VZKA 4CCLA 3ES4A 4YM0A 1SAXA 4FE4A 2K85A 3KV9A 3ABTA 2M3AA 5KHKA 2JIGA 4OINF 3JBG1 4GWNA 2ZCWA 3TP0A 5D21A 1RUJ2 3V56A 5H9SA 2JPBA 1ULEA 1N3PA 2WA0A 1QJY1 3R4SA 3CL1A 4HRIA 4KITB 4PCQA 1FTZA 4UFIA 2Z9OA 3NAPC 3WP6A 1RHI2 4MGRA 1W0TA 1U8RA 3GZTB 5EEAA 2OW4A 3BTYA 2Q8OA 4D8MA 2IXCA 3K51A 4ZTJA 5KNLA 3S3OA 1WCKA 4MVTA 1V5EA 1YW7A 5KVRA 2JECA 5BNNB 1W8ZA 4FPKA 5IWFA 1IO2A 3KYCB 3E5XA 5JUVA 1CJPA 5IFPA 1MPXA 1K5MA 4S2GA 4NIIA 3TKYA 3I3MA 3JSPA 2JE7A 3J7MA 4EZ4A 3J9SA 4J25A 3HB9A 3NJZA 4C1WA 2W91A 3NNJA 4NHYA 4QSHA 3OUHA 3TN93 2B5HA 2W82A 4DEQA 4RM3A 1SMVA 4AVCA 4FPCA 1T2KA 1W6PB 3F8FA 2C9KA 1MNEA 3G6JB 5FZEA 1NLQA 1Y1WJ 4HNUA 3A02A 4C2MJ 3D0JA 4B1LA 3O2PE 2VE9A 1Y56A 1SLIA 4Q5OA 5BNGA 1CZVA 1CAWA 2H6BA 5J1YA 1W7PB 2VQHA 5FZ0A 2YU3A 2D5HA 3IZOA 1W3XA 2JDHA 5SV8A 5M5XJ 3J81K 4WM7C 5E1XA 1R083 2FJ1A 5LBFA 4XRMA 3ILRA 4WBBA 2XDVA 1QJZA 3GGLA 2CG4A 3MFAA 4AVPA 1EP0A 3RZMA 5F6KA 2ENRA 3FLPA 3RZLA 4XQFA 2KR2A 2VCAA 4KWLA 2CQQA 3K4NA 3LMMA 3D0SA 2GP5A 4CDGA 1UFMA 2V79A 3RIRA 4RQPC 2EVXA 3WDYA 4KBBA 4EM1A 1UAIA 5FYTA 2W84A 4U0WA 1WLDA 3OBZA 2JJ7A 3DF0A 3ACHA 3GTLJ 1JKQC 2JDZA 2R041 4QX0A 2ZAHA 1XC6A 1MBGA 5F08A 4UV8A 4GZ9A 4XEZA 1STMA 3ZQFA 5L36A 4QKBA 3K1MA 2VB6A 2DXIA 4YFZA 2Z69A 5FK8A 4FPYA 1OA3A 1G7YA 1J7KA 4FPFA 1RTVA 1QEXA 2JVHA 1HOMA 4BJ6C 5DUWA 5K5QA 5FXVA 3TYJA 5JWPA 1QZYA 3E6CC 5HPOA 3EHKA 3U10A 3RSNA 2BVVA 3AP6A 1IN8A 4LOTA 2QNKA 2BUKA 4EJVA 4XFCA 2KRCA 1KS5A 6PAXA 1KDKA 1SFYA 2WBMA 3JTGA 1ETQA 4H2AA 4N43B 2O8XA 4Y7NJ 3CD6I 1X1BA 5K8SA 4P02B 4NHLA 5GZFA 1OOPA 3BG7A 4RN5A 1VQ6I 2WKKA 1T33A 1SEUA 4KU8A 5JXHA 1ZNPA 4D94A 5CFCB 2Y0OA 4I99C 4XKBA 3OD4A 1PVC1 2VBZA 5L9RA 3NJYA 1S0JA 2KJBA 2BHZA 4W8JA 2OPTA 3GJAA 5LY2A 1NCRB 3K4BA 4D7YA 1ZR4A 3E5QA 1VJ2A 1MEC2 2OJED 4IV3B 2QEXI 3WNMA 2R7WA 2HPMA 3CF6E 5FLIA 1NTCA 1QKQA 5JI7A 1SLBA 2VZVA 4N43A 1VBB2 4DXSA 3UKTA 1BI3A 4LBQD 3KF5A 3O1PA 3ZIWA 3H3UA 2QSHX 4LIVA 2VJ5A 4P08A 2IGMA 4OUEA 3OWTA 1R082 4B1RA 3KMHA 5E8AA 4FX4A 3H3VK 2UV1A 4NIDA 2WZR3 1KQRA 1CONA 4YNIA 1Y8RB 1HKDA 3HOZJ 2DTWA 5ERIA 1OYWA 3Q9OA 4CCOA 3DPTA 1U8BA 1PO13 3MW2A 1OKOA 1ZA7A 3J7AO 3SDGA 1UPIA 2M2EA 3ETQA 3ZFFB 1MBJA 1FYKA 3I49A 5BNOA 3R60A 2RR12 2M5WA 1WWXA 3KGZA 5BXXA 3WDTA 4B09A 2FQPA 4G6QA 3MLLA 1XMAA 1G9AA 1YIFA 1NE4A 3ELNA 4OI1A 1LJ7A 3W5NA 1ZZ6A 3W2VA 2VOPA 3POIA 1S9HA 3UNPA 4HOOA 2GDFA 5FB2A 2K9NA 4MIMA 2PJPA 5HLIA 5DEQA 1BIAA 2HEWF 1UXXX 2WV1A 4KIBA 2V1XA 1T8IA 3ZXGA 3ZMOA 2VULA 3ZMTA 4KWJA 3KVBA 4O5VA 3MIFA 2A6HF 2IC1A 4CCCA 1G3WA 4NBQA 1VBD1 4Q4Y1 2JUGA 3KGLA 5E1WA 2V5DA 4IEYA 3S0MA 3QODA 3OEAA 2XAQA 4URAA 4AVTA 2MGQA 1UYXA 2CL2A 3FZVA 5C70A 1YI2I 1DGLA 2Q30A 2VQAA 1H8TB 5EF6A 1WHUA 1W0UA 4FISA 3KV6A 2DV9A 2XAUA 2VE1A 2PN6A 1W6NB 3BB6A 5EYRA 3K9TA 1QJEA 2HWD1 1WWYA 4QX8A 1SZBA 4ZU7A 1OKRA 3HJRA 1I6HJ 5E89A 5IFTA 2B9SA 5F9TA 1ONVA 2YUSA 5BNQA 5I0UA 1SFUA 1YIOA 5HCFA 1Q8PA 4M4RA 4JGYA 1ZKGA 4Y26A 4IEVA 1N75A 1FI2A 4IEQA 1VQNI 2ET1A 3WG7H 3IV5A 4CDUC 3BTCA 4N53A 2HYJA 3RMYA 5EYYA 3PNAA 2GC3A 3O1VA 1S2KA 1YOVB 4RGUA 3QD6A 4TTGA 4A2UA 2DMPA 3HMYA 3MW3A 3CCRI 3KZZA 2ZHMA 2DFFA 3OB8A 1YFWA 1ZH5A 1NCQB 2R071 4KG8A 3D8CA 1W2NA 3B5LB 5D8LB 1VQPI 3GZ6A 5A7OA 4KT6A 4D6SA 3U37A 4BMEA 2JXAA 4P5OA 1RUH3 1GUIA 3RI8A 4RB1A 2R7SA 5F3IA 4BXFA 4ZYDA 1DYKA 1I6XA 2XUMA 2JTVA 5JR7B 3BTZA 5FJ8J 3A0NA 1MQTA 3LIGA 3OD0A 4HF1A 3C7GA 3CMEI 5E3MA 3ZQHA 1GU3A 3J8F1 3M70A 1B9MA 3LGRA 4Y22A 5F0HA 3JB8A 1F5TA 4GH4C 3FZ3A 4X6AJ 5A3NA 1GFF2 4XQ4A 2LNBA 3CZUA 2G9ZA 4D3WA 2ZGKA 4HVQA 4CP9A 3FMSA 1O8SA 1XDUA 1PK6A 4UBGA 5HV0A 4EMSA 4XQDA 2ZNZA 5C4JJ 4C0HA 1IS5A 1RRJA 1V6NA 2BVLA 4ASNA 1H88C 2ZX0A 3LA2A 4P9LA 1V6IA 4Q0UA 2DVAA 3SMHA 3NQOA 3JRAA 2ZXIA 5E17F 5KC5A 3ZCOA 3WHBA 2G4IA 3IMMA 1OLRA 3PLQA 1CX1A 3GTGJ 3OYDA 2GMMA 4FFGA 5FXZA 2GM4A 1WJCA 4XDPA 3VUOA 1XE8A 1LFPA 1JYWA 5F5IA 5HCAA 1XBFA 2R1DA 1D4M1 4LLOA 4BE0A 5DAVA 2EIKH 1IZ1A 4PIZA 5DCMA 2MEV2 1HXS2 4XF9A 4QPGB 3UYJA 3IAS2 4XJ9A 5E1RA 3J7ZI 4Z07A 4OMYA 2CU5A 4ES9A 2EFPA 3ZKYA 5FYZA 2Q2EA 3AL5A 3T0BA 4HX8A 1D4M2 4F3QA 1SMTA 1EUUA 2D6NA 3NAPA 3FXOA 3NWKA 3DUIA 2D1VA 2K4JA 2D6KA 2VCCA 2QWWA 3OSGA 3VOEA 1UYPA 4GULA 1POV3 1ZVFA 3OF1A 1BC8C 3VL8A 5EZWA 3CQZJ 2X4HA 2ZGMA 4BLIA 4LK1F 2Y0IA 2QBXA 4RB2C 2YUEA 2OIIA 5BNPC 1ETVA 5GJ6A 4BB3A 2NVTJ 2OA4A 1KJLA 1OFSA 5DG1A 2DVGA 4YZ3A 3MGUA 4XXPA 4Q4X1 1E2XA 4M72A 2FCTA 2DT6A 1GICA 2PYTA 2WZR2 1ND2B 1OPMA 2GZWA 5JZGA 2LM3A 4AEDB 4IE4A 3B00A 2IRFG 2FHRA 1ULOA 5K0UB 4UVAA 1TMF1 1C8NA 5J7MA 4KMUX 2G9GA 1IOAA 5E1ZB 4KIFA 2JVGA 2VMDA 3HHGA 1LOFC 1S0BA 1Y0NA 3KM5A 3S3NA 3MO4A 3DYPA 4MGQA 3U9GA 4QQOA 3DPRC 3U4SA 5E79C 3AYCA 3BR3A 2W47A 3WQ1A 3ZR6A 3W9AA 2ZMEC 1S0EA 4Z8BA 1RR8C 2R4GA 2JN6A 4AW7A 2HKOA 1JZ8A 3G6EI 4J01A 1Y1VJ 1HKSA 1CQTA 1BJAA 4BU2A 1HN0A 2IBDA 2GXBA 2D7FA 4P9FA 2P3KA 1NZIA 4D0QA 2JG8A 5K0UC 2MEV3 1UZZA 3NQHA 2CU7A 1ZRDA 3AZVA 2Y0SA 3SZGA 1BK1A 1ND2C 1AL0G 4V2WA 1KQ8A 2O14A 2BGCA 5HLHA 2XJRA 4PDWB 2EZKA 4I6ZA 2P5BA 5CNAA 5A7PA 1W05A 2GC1A 5HDGA 3OYAA 3PQJA 3KYLA 2VOTA 5DPNA 5D5WB 4C2TA 3HQUA 2KZGA 3H50A 4KL1A 4QXBA 4ASMB 2UY9A 3I2HA 2IS4A 1O4ZA 1OVPA 1OQDA 2YBPA 2GMPA 2ZGSA 2XRNA 2Z79A 3EUKL 3KSCA 4OULA 1GYKA 1IV6A 4LUMA 5CB7A 4LFUA 3MI8A 3OSFA 5FDBA 3GXOA 3UJOA 3ZSJA 1VB2A 5FY5A 2AREA 3SC7X 3BR0A 3VSLA 2UZKA 3RDIA 5FKBA 1ASJ1 3U0ZA 4UVCA 3BWGA 1KU7A 1ERDA 1F9KA 1MBHA 3INAA 2ZGUA 2VBWA 4RYDA 3LSEA 4XUPA 1W9YA 2NVXJ 2C24A 5JMOA 3AP5A 4L5IA 3BG9A 4Z2AA 4K1YA 3CCQI 3ACGA 3ZYGA 2CFXA 1ZBE1 4R9CA 4F92B 2A1XA 4HSLA 3JZVA 3G4SI 2EFWA 2IP2A 2BV4A 1SD5A 2RHPA 1J9IA 1APNA 1HKTA 3VDXA 3HIFA 3P9CA 3LL7A 1UOFA 4W50A 5KK1A 2AYHA 1DGWY 3PUIA 2D44A 3H3ZA 1QA6A 2M4KA 2XB6C 5J96B 3NARA 1UG2A 5J4VA 3UV9A 5IK8A 2VPLA 3PVBB 4BHBA 1IRZA 1JHJA 5BNOC 5M3MJ 4GH4B 4C2UA 5FO5A 1AYM1 5FO9B 1W8OA 1X2NA 4JQRA 2VJIA 1IGOA 4CXFA 3VYSB 3ZFEA 1AR61 2C1FA 4XKVA 4K9SA 2H1KA 1F4AA 1X8MA 5DV5A 3IP4B 4IQJA 3WODF 2PHWA 3TN91 3GALA 4HNVA 5JOZA 1GZTA 3JRHA 4JQFA 4NR1A 1R58A 1OBNA 1GZWB 3M7GA 3KZIC 3A1YA 2O6GE 2VZTA 3HN1A 3WF2A 4GWMA 3HSRA 2WQ8A 5HODA 1G9FA 2DFIA 1G3TA 4NE9A 3MN2A 2WZEA 1QQIA 4BQQA 4QT6A 3SDBA 4GRIA 4HK8A 3LSMA 2A3WA 5D8AA 1VRBA 2WR9A 3MF6A 4MYEA 4ENKA 4ZYEA 2ZS6B 3BDDA 5A7NA 4UFLA 2PLV2 3I7DA 3S1RJ 4E27A 2GNDA 5EJ1B 4AU7A 4C3HJ 1AKHA 4ZXKA 1Z67A 1GP5A 4OHWA 5C3PA 4I3PA 2AH2A 1MS5A 1W6MA 1GLNA 4A7ZA 1LNWA 2NNNA 5FLXZ 1JUSA 5LA1A 1MS8A 3T4HB 2WQZC 2VC0A 5DUVA 4U88A 3RJRA 5CA6A 3R61A 4OIQF 2RV9A 5FP9A 3DYOA 1R22A 5D5UB 4WK8F 3CLQA 4FAGA 4GDFA 5AFEA 2CV2A 3WE3A 4CUGA 5I91A 1DQ5A 5LW9A 1MBEA 3IIIA 2D40A 2LTPA 3FMRA 5KXEA 3RNSA 4YEJA 4LKDA 3DU5A 3K2OA 5A32B 3KIOA 2AXLA 4AWDA 1YO5C 4UBHA 3T2TA 3BG6A 3C2HA 2E9QA 2W0XA 3LAPA 4KMFA 3JB4C 1V6MA 4YGEA 3N7JA 1H8TC 3JR9A 4YVWB 2FCVA 2YPRA 5EV7A 3AFKA 4G9YA 1SCSA 4XCAA 1J5YA 4BDVB 5F27A 3JD71 3A0HC 3AMNA 4E8CA 2Q1FA 4FTSA 1IG3A 4Z6YA 1F31A 4UXAA 3VB2A 1TL8A 2VXJA 1D1BA 4XZUG 1MMNA 1TME2 4H3WA 4NDLA 1S3JA 3O14A 3RCOA 1P9QC 2DDUA 2JRTA 3E1F1 3OY9A 1OCPA 2P5KA 5IHRA 2P6SA 2Z5UA 1IG0A 5FLVA 3E6DA 1D8KA 4A6SA 3IB3A 3CUQC 2XC7A 1RMU3 4CE8A 3TOBA 5A32A 2WUHA 4HPQA 1CAVA 2E7AA 2W52A 3QWLA 2F5CA 1G9BA 5FQ0B 3C3VA 3T2OA 2W48A 1RUG2 5C9AB 1TP4A 2QQMA 2YC0A 3QU6A 5FY7A 2VUDA 5FD5A 4BIFA 4ZS2A 2RV8A 5FFZA 4FPLA 2ZTNA 1SACA 2XV4S 4R79A 1TZLA 5FREA 4QQPA 3CMGA 2LUWA 1JZ7A 2V4VA 3WF4A 3N7KA 2TRTA 4JQTA 1GLHA 1V0AA 5FKLA 4MZUA 3T8RA 5FRNA 4QWQA 2EICA 4RHV1 4PZJA 1RI7A 3Q9VA 2YR2A 4ET7A 2XWBB 1RIOH 4LUKA 1VBE3 2VMEA 2MC3A 1NXD1 4L97A 4HLXA 3H9AA 2VZSA 2E35A 4B4CA 4DBQA 4HKWA 3QACA 1HC8A 5CPRB 4DY5A 1YQAA 1FIPA 2CDPA 3PTRB 3WP5A 1Y3TA 1MZ6A 4KWKA 3T09A 2VNVA 1UX7A 1J3PA 1FMD2 3OBRA 4IVNA 3S2HJ 4Z2WA 1C3HA 1W6QA 2VOVA 1KFUL 4LO5B 4KJZA 3ZKUA 2OCCH 1NCRC 4QHOA 1OLTA 3K70C 2QQIA 4ASLA 2ZB9A 4UV9A 1V4RA 1MS0A 2AC1A 4HEA2 2CSOA 1OFNA 2Z42A 4LHSA 3CCVI 5KHHA 2ZGTA 2K2SA 3LB9A 4ORFA 3TP3A 4GJYA 4HQEA 3OL3A 4I0WB 2MLKA 3SXYA 3LD8A 4RM2A 5FY8A 5FPZA 5J3UA 1AJOA 3H8RA 3OGJA 2YG0A 1AR81 4G9SB 3OY8B 4W4ZA 2V09A 4Y1UA 4MO7A 4UUSA 4MTEA 2OYZA 4RQPA 2W1QA 5EGOA 3ON7A 3H5RA 4U2AA 2YPJA 3LSKA 3L7WA 3BPSA 1RUI1 4X0GA 3CZJA 2VOKA 3TOJA 1FOD2 3ENRA 3EETA 3GTQJ 4NN0A 1QHHD 4LPLA 1UOBA 3GZUC 5DMYA 1S7OA 1H9PA 1FEXA 2EFQA 3FBMA 5GLVA 2L3DA 4IGOA 4RL7A 2YU9J 4NPMA 3AZXA 3BALA 1J0RA 1RMU2 3FISA 5J4YA 2VD7A 4RAYA 1CF7B 3NV4A 3LAJA 3EB7A 1XSXA 1AYN2 1WJBA 4QPIC 2V73A 3OY8A 1FOD3 5FRAA 2DA7A 3NNGA 3R0JA 1QVTA 2DU1A 5K9YA 4PI0A 2XXZA 4RQPB 1BIBA 3WSOA 4ZDOA 5FZKA 4CXXA 1Z21A 1RVF1 4WX9A 2C6YA 3FHIB 2BXZA 1BHGA 5IK5A 4IRHA 3S1NJ 1PO21 2F5DA 3BJAA 3BLYA 2BVBA 4L8QA 3ZM8A 4BLJA 1IG7A 3K48A 4UWDA 2RDPA 5DG2A 1IRGA 1K83J 1X1PA 1IQDC 3R4UA 4U0YA 2P4WA 1UZCA 3ERMA 5DDGA 3MD2A 2X1CA 4WVVA 1QQP3 1WCMJ 5LEKA 1LOGA 4ZU4A 1W5CC 3I71A 3JQXA 3TEYA 5CFDA 2IJLA 4A3XA 1AWCA 4Y20B 4EN8B 1ND3A 2E2JJ 1AVBA 1A34A 1H6YA 1S5LC 4DUVA 1FC3A 2LKXA 3TO6A 2XPJA 4BS9A 3ZQGA 1RXGA 1C8M3 3GTJJ 3M1HA 4JVAA 4AQTA 2GC0A 1XSRA 2C6SA 1IAWA 3U07A 1VBC1 2E32A 3HNBM 2RJ2A 1QZZA 2Y9ZA 1QDOA 1T6SA 2WTEA 4Q0VA 3U1XA 4NRPA 1RNLA 2ZSIB 2VBBA 2I10A 3AKSA 4XSZF 3ZMUA 2YZ4A 3WTTC 1DP3A 1DLLA 1I3HA 2JSCA 1GHCA 4MQ9F 2L9LA 5FY4A 1CD3G 1VBB1 3WV6A 2B9VA 1FWZA 2RQQA 2W08A 2YC2A 3PIPF 1R1A1 2VNGA 3O8GA 5SV5A 3HC7A 2OF7A 1A3KA 2KM2A 2A07F 4XLCA 2M45A 3GHNA 1RUE2 4FHTA 4OUSA 1H4GA 3VD5A 1EA3A 5ANQA 3DCFA 1DQ4A 4PLMA 3H0DA 1UZYA 3OBAA 1XQNA 4DY3A 5E8IA 4AI1A 4E7KA 2WADA 4Q4W1 1V5FA 3ZVXA 1HCRA 1GWLA 5FYUA 5E18F 1DHKB 2DU9A 4I7HA 3FN9A 3P3PA 3DP7A 5F1JA 2OUJA 4B7KA 3WW3A 2HOAA 3BU0A 2VASA 2EIDA 4OMCA 5L19A 3CUQB 4L5EA 3CJQB 3FUOA 2R5YA 1XNCA 1POGA 1B35A 3ZYBA 4P9IA 2EV0A 1J1LA 2UXNA 4XORA 1WBLA 2KMUA 4FPOB 2A6TA 3C18A 2LOOA 5FZMA 3WXPA 2ADEA 4DEVA 4ZC3A 4UUVA 1NKGA 2WNVB 2ARAA 4ESBA 3WG9A 4FOWA 1YQ6A 3Q0WA 5K7FA 5JHUA 2WLQA 3H42B 4L0YB 2Z2SB 2LALA 5IK7A 3DXTA 1LESA 1SFXA 1JYTA 3ZQCA 4XLPF 2PAEA 1BI0A 3JAMZ 1IV8A 3PSFA 2W5FA 1T98A 4YELA 5KAFC 5C5TA 3P9KA 1K6YA 5FZ4A 5ISLA 4DXRA 3A0KA 2QQBA 1C8M2 4YZ4A 3FM3A 4CZCA 3ZYIB 3DEEA 1LJ9A 2VT3A 4PJLA 2VCMA 4HONA 1REFA 3S5QA 3CIHA 2O3FA 1PGL2 3ASOH 3H3LA 4CDWB 1SFEA 2LKSA 2WA4A 4E4SA 2MLGA 3QYBA 5L3GA 5KHDA 4DYCA 2QTWB 4UFHA 2JK3A 1X82A 2DVDA 2FZ1A 2KL4A 3M3QA 1WD4A 3POBA 2Y9YA 3UK9A 2HVQA 4XSXF 3R6SA 2WAFA 4ZZ5A 2GH2A 3OYWB 1XCVA 2MH2A 3H5AA 3OTFA 1XRUA 4QQHA 3E7LA 2KP6A 4OIRF 1PNGA 1C57A 3V7RA 3K4CA 2JDKA 1ZZ7A 1Q3EA 2O8OA 1K45A 2VW2A 3VD3A 4A3GJ 1RL3A 1BLZA 1VQLI 3IUOA 5IT6A 1WA6X 3OPZA 2IGOA 4UW6A 4MFEA 1TE1B 2FQ4A 2O1QA 2WY8Q 1ZG3A 4AHYA 2QQAA 3WW1A 1VFCA 1BC7C 4D0PA 4S2FA 4E9KA 4K8RB 2Y60A 4RA0A 1J1TA 4IUGA 1Z6RA 2VQTA 3OS0A 1IRFA 1OR7A 2K27A 3JQWA 2ZJPF 3W2WA 1ASJ2 2PG4A 4KUMA 2QYOA 1QHDA 5EG0A 2FDGA 3JXSA 2B63J 2XJVA 4QQ2A 2EV6A 3L2CA 3R4DB 2XBO1 3OYHA 2CWMA 3KQRA 5EJ3A 4HL0A 5JSPA 3F72A 1W39A 4QX5A 3GZNB 4BJ5C 1GZCA 2V9VA 2L9SA 2W1WA 3PUSA 4I30A 5JIUA 1WPKA 5C3RA 3QPHA 2RR11 4ESJA 2EXJA 3MPBA 2VJXA 3QBQA 1CESA 4IHWA 1K78B 3J8F3 1FTTA 2WABA 4HG6B 4AEKA 1IXRC 2W9XA 3AZYA 1DF0A 1F1ZA 4HKOA 1NUKA 2ZFWA 5A2QK 2P3IA 3LOCA 1OUSA 2A68F 3SKJE 4XLNF 3U1KA 5FYSA 4FFIA 4WXDA 4M6YA 4F83A 3HEFA 9ANTA 1V6KA 2OD5A 4PK4A 5AIPA 5DUXA 4RDUA 2HWC2 3H1CA 1MKMA 3ZMZA 3QP6A 4BQXA 3HUGB 1AYM3 5IVVA 2ZHNA 4QXHA 3KE2A 3QCWA 4Q4ZF 2R0QC 1KITA 1GV2A 4D7MA 4UY8I 3NRUA 4RAFA 4A5MA 5C7GA 1IKQA 3CJIB 5JZGC 3RWKX 4Y1YA 3VB9A 1GDTA 2KFDA 3S1QJ 3WGIA 2PHFA 4G94A 1Y8QB 5J3LA 2ET7A 4H7LA 4DQAA 3CJNA 1ZTRA 1DGWX 2JKXA 5L9VA 3ATGA 3DL3A 1DP0A 1R1A2 4GCVA 2VNOA 1MZBA 4NROA 1WQ2A 5CVIA 1CR7A 2OTLI 3I59B 1Y9QA 2F4IA 5FY9A 4NRMA 4XURA 1UY4A 3BU7A 4EJOA 2R7VA 1LEMA 4P9GA 2F5VA 3ZN1A 5JXGA 3K2AA 1WKMA 4PDWC 4GKXA 2UXXA 5C44J 2E19A 3V0BA 2VOXA 5K1YA 2RNGA 3LWCA 2Q0OA 3T0AA 2L7FP 4Y5TA 5FYMA 5CKNA 1JYIA 1W8UA 2HFHA 3PFYA 2ZX1A 1BKZA 1DGRN 1K12A 3GFLA 1RITA 3BKZA 2RDQA 2A5ZA 2DMTA 2RS52 4XVHA 4F7ZA 3LF7A 2DA5A 3L2YA 3NMBA 4AHXA 2DFHA 2Q1ZB 3VBFA 4COZA 5DCFA 2PMZN 1BM9A 2NYYA 1W36D 1DDNA 4XICA 5BNPA 1POV0 4MFDA 3TBDA 4GWJA 3DKWA 1ZG1A 2JQ7A 1UL9A 2RM23 1P4AA 1UPSA 1MS3A 2I8DA 2P34A 1K42A 4LB6B 1XSDA 3JCIA 4BQAA 1W0OA 5LD2C 1W8WA 1HRI2 4RGRA 2R7RA 2X51A 1YS6A 4XHBA 2WWUA 4AI0A 1WZXA 2Y34A 3AMMA 3LPGA 4NPRA 1QNYA 3CDHA 3BR6A 3V0AB 5JCTA 3PFIA 5LK5A 1EPZA 4I2OA 2HU9A 4AXOA 1JTYA 1W7PA 1XDSA 2R043 4BUPA 4UAPA 1PYVA 4LLLA 4RR3C 2CUZA 1GVJA 1IDZA 2VH9A 5BPDA 4COUA 3EXUA 2BV6A 1RGSA 2X05A 1EKEA 4RGSA 1JKPC 2ZX3A 1COV2 4R52A 4RBOA 2DDAA 4AQ2A 1XXNA 4LO6B 4C90A 4Q2FA 2DA2A 3BZKA 2D6LX 2K86A 5BNPB 4O7XA 4NQWA 3FMGA 4IOAF 3T30A 2WSVA 4QKDA 1ASJ3 2YU2A 1MW7A 3BQZA 1R6RA 2OUMA 4DGWB 5JSRA 3K4AA 1WCUA 1BR2A 3TBIA 2FNAA 2V5YA 2MC4A 1B4AA 2XR4A 1QZEA 2E1CA 3AL0C 5DN2A 1W2OA 1UY1A 3MBWA 3WG2A 4NHMA 2EA4A 3ST7A 1OFCX 1N3OA 1U5TB 4XBFA 5FR3A 5GADJ 2K9MA 1UYZA 5F32A 4AVVA 3AG1H 3RFRA 1OR7C 1PX3A 3ZPOA 5KC6A 5FPBA 4N53C 5B4XA 2PFWA 3CBNA 2TEPA 1QGPA 3WTZA 3FBNB 2VBDA 2BXYA 3JRBA 4FTHA 5JHFA 3QPSA 4LOCA 2P3YA 1B8IA 1V9U2 3E5UA 5L3CA 1HN1A 1IDYA 2G7HA 3HKZA 4OQ8A 2ZABA 1A04A 3KEYA 2WLPA 5J37A 3LSIA 1XNDA 1OCTC 3ACLA 2DQRA 4YVSA 5F3CA 3H7YA 3CC7I 1WA4A 1LDKB 5KHGA 2BNOA 5JPMB 3I3EA 1ALYA 5I8YA 1D5VA 1C1LA 1GV5A 1XNBA 3VYTB 5GZCA 2FBEA 2J1AA 4AF9A 5CADA 4IESA 2BW8A 2VOWA 4UB6C 2Y48A 4IV1A 1XU2A 3Q8AA 2FXAA 2A6VA 4IW3A 4DMIA 4CEYA 4CO8A 1NCRA 3GJBA 3ZMDA 1XPXA 3PUBA 1R00A 1DBNA 3ZYRA 4XJUA 2ELKA 3DPRA 3AKRA 4BBRJ 4A41A 4XXAA 5ILSA 4IQPA 3ZDVA 5JLVA 1JGSA 2JX9A 3T5XA 3U1DA 2OPKA 5T50A 2IFRA 4Q0SA 1YC61 1E17A 3P5BA 5T55A 3JD72 2LH9A 5ILUA 1SFPA 2Y69H 1Z0XA 1WLTA 5IW0A 3B6CA 4CGZA 4NHXA 3GYDA 2LBFB 5IT9Z 1NCQC 1XPWA 1NG7A 2HEYF 5CBLA 2NNYA 2LF7A 3HRUA 4FQGA 1QGLA 4CP1A 3I4NJ 3CZ6A 1JUPA 1T6BX 3MIEA 3MMYB 4A6EA 1GOGA 2P5VA 5CQEA 3Q8FA 5L7OC 4H7MA 3KCCA 1ZBA3 2DDBA 3FJSA 2VKDA 3WF0A 4Y17A 4JGZA 4J1XA 3HEIA 4GFBA 4Q27A 2JDYA 3VLBB 2RMU3 3N7LA 4NC7A 4M9XA 5H6QA 1CIYA 4G6TB 2Z16A 1WLWA 1VE0A 2UWAA 4AZZA 1KXGA 3LSPA 4OHZA 4QB2A 1QJFA 3MZ8A 2OZUA 4A0ZA 2QE3A 5JVTA 2HWD3 4NHJA 1D0HA 5BPXA 3HTUA 1NK2P 1DQUA 4OIPF 4MOAA 3ZO0B 4HSRA 2FUG2 4XOTA 4B8EA 3BG3A 2ADDA 4COVA 2BY0A 4LHLA 5GLWA 4ZH4F 4RLQA 2O61A 1QOOA 2ZSHB 4PCRA 2YU1A 3ZXSA 2C26A 3HVDA 3ECQA 4LOSA 1JTZX 2GU9A 3LQCA 1S7EA 4PQQA 1S0CA 3RPUA 1OCOH 2JUCA 4J19A 1Y4WA 2R061 1JYXA 2JA8J 1DP7P 4AM3A 5C8CC 2AQEA 5AVPA 1W6NA 3H9QA 4AR2A 2E5NA 3C7JA 1BEV1 1C0WA 1UY2A 1VR3A 1DYPA 4QMAA 2ELHA 3S30A 1K7AA 4NNJA 1YWKA 1N1YA 3POEA 2FMYA 2BY1A 2VZPA 5K4LA 5C8CA 2CQXA 2VR4A 4JGYB 4D7NA 4CUCA 1ZX5A 4LLNA 2JDNA 2A5WA 1CZSA 3ZFFC 1SEFA 1V5GA 2L5QA 2WB1N 5FAXA 4A45A 1G3SA 3TEZA 4Y24A 5FMOL 5FOJB 2ZGOA 5BS6A 2PHRA 4LKFA 3ZPLA 2MEV1 1K5MB 4ONUA 3HGYA 2Y31A 1BQPA 5KBFA 2OQ6A 1VBB3 2D98A 1PGW2 4BH9A 2XPVA 1YI9A 3LSTA 1MEC3 2L4AA 1HQLA 1EY2A 2I74A 4G7ZF 3IAQA 2R0HA 1E3HA 1DZRA 1YRZA 1OPCA 3WHCA 1O4XA 5HDNA 1URXA 5H9PA 2VMGA 3IH3A 1EV13 2R7OA 1O5LA 1YS7A 1CAWB 4AIHA 2XHKA 2FRHA 4G7HF 5A33A 3WW4A 3UKGA 2DUQA 2X0LA 5ACA2 1TT5B 4B8XA 2DJIA 2ECBA 4XLFA 3THTA 2XGXA 1LRHA 4IV3C 2X6OA 4RHV3 3MYXA 1R7JA 4CPBD 4OHVA 1VBE1 5IPAA 1SVOA 5EZHA 3F8MA 2WNOA 1OF3A 1K5JA 3FDYA 3I3LA 3CJTB 4CP9B 2X1DA 3SEZA 1RHI3 3Q8EA 1YW8A 4AGVA 3FK6A 4EQVA 5CFCC 2HWF2 5CJ9A 4B4RA 3J26N 4AUXA 1RIRA 1GWMA 2BYVE 3WQBA 1O57A 2XGCA 5IOZA 3AC0A 4QGNA 1J83A 2CAUA 1GKBA 4LJZF 1HW2A 2NVQJ 1U5XA 2JD9A 3M3IA 4KT5C 4IETA 3SQNA 2XUBA 3HDDA 1F15A 3WUCA 2IGNA 2DU0A 4XZPA 1FT9A 4N9IA 4ZZDA 1FYLA 5M3FJ 4N43C 3U75A 1NA1B 4QXCA 2EZHA 5FPUA 4SBVA 4PJJA 2R6QA 4MEXF 1LENA 5DZFA 5L7OA 4PBPA 1PZ9A 2UYBA 3WU0A 1FOD1 1RUC2 1G8XA 1YQ8A 3B7MA 1P4XA 3O5SA 2E60A 3JU9A 5C8WA 4ZZ8A 1AR83 1RUF3 2M7BA 2P6CA 5ICCA 5KXDA 3GYHX 3F8BA 5D8AC 3SJMA 3U2RA 4IHVA 2DTZA 3C7EA 4Y5SA 5EJCA 4OYUA 2R7QA 4OHYA 4XACA 1WFXA 1F5JA 3GBFA 2Q2EB 2L7MP 1CPNA 3CJRB 4ANJA 5CYVA 1AYN1 1SBEA 3HM5A 5FGMA 5HS8A 1D4M3 3KLSA 2QVSB 4ON0A 5GALA 3NV2A 3GFIA 1V00A 1TMF3 2K7LA 1HB2A 3NWTA 4AD9A 2R7FA 5DYMA 2HH9A 2V4AA 2ORXA 1QQP1 4XTPA 1R49A 1NHAA 3CCLI 3KQ4B 3BT9A 4GJZA 4XM3A 5A3MA 2FSWA 2D45A 2HWB1 4HLTA 1JU4A 1GXQA 3DFGA 3RQIA 2NVUB 3D5RC 3K4KA 5L7OB 2FBKA 4BHPA 2VL4A 2HQAA 2A71A 1KU2A 2R92J 4LG3A 3OYGA 3ECOA 4GWIA 2RKHA 3OBTA 2P7CB 3WZ1A 4LMYA 5K7ZA 4B1MA 2NM1A 4BJ0A 2DA4A 3HZJA 1XB9A 3DEMA 3HWJA 4MX3A 5BMZA 5D6EA 1DQ2A 2YPDA 1XE0A 4LBKA 1Q5OA 1DIWA 2OS2A 2PFBA 4JP0A 3K4JA 2W57A 1QHGA 1D0ZA 3IH2A 3TMOA 1DGRA 4AQ6A 1SCRA 2XWJB 3THPA 5FMBA 1AR92 3FX3A 5I0SA 4RS5B 5A7SA 2DCEA 2Y38A 4GB33 4LBOA 2ZGNA 4XHXA 4OI0A 4TXWA 2QKMB 2PBIA 1F36A 3MFCA 1Z3YA 5FP8A 5IAXA 5LBEA 4ENJA 2X85A 2WZ8A 2OX0A 5JMCA 1S1AA 5LRSA 2LF8A 2W92A 2M8EA 3CF5F 3ACIA 1YHFA 1HX6A 2HVRA 1NZCA 2HDWA 1H9TA 5BNNC 4XFGA 5DXDA 1ULFA 2ETHA 1UELB 4BJTA 1P92A 4XYXA 3KV4A 3RI4A 5FZBA 2F4PA 2NAZA 1EAH2 3IPVB 2ZBJA 1HDKA 5FZGA 3H0GJ 1OA2A 2CWSA 2VXZA 1AF9A 2CGOA 4A6OA 2NN8A 1QDCA 3M8LA 4RS5A 1ITYA 4PDWA 4C9YA 3K4DA 1W8HA 2LREA 2J1EA 1BBT3 2FMLA 1XSVA 3MKYB 4IF4A 2WB1A 4UW4A 2E53A 3N7MA 4AI9A 2VTXJ 4B4QA 4DW6A 3N05A 4MQVA 4B47A 5FZFA 1QO0D 1O8PA 3LQRA 5E3OA 2OT7A 1ZRIA 4JX6A 1MJBA 2GSYA 3IWFA 3VZLA 1ULPA 1U5TC 4E4HA 5BQTA 2A3XA 3WT3A 1QU3A 3GFJA 2COMA 5JI6A 2ESNA 2K02A 3IBMA 4KMQA 4XETA 2YROA 5LBBA 4YW7A 1TNFA 5F3GA 4Y4RA 1ZBE3 1JI6A 1HRV3 2UWCA 1G6NA 2GWRA 5E8GA 4JC1A 4BY1J 5JOWA 2IW5A 2K9QA 3KB5A 3WNNA 5FZOA 4ZONA 5J47A 2WO3A 3UGGA 1IPJA 1LNSA 2NVYJ 5I0DA 3JW4A 1IF1A 5G05L 1F9NA 5FJHA 4P9JA 4XJ8A 3ZYJB 3X2QH 3A22A 3JBG2 5ACA1 3HTSB 3CLOA 1H2NA 4GIQA 4PFPA 1ULDA 2VIXA 3BPVA 1FPN2 3D82A 1LEDA 3FXJA 4M74A 5JOXA 3HKZN 2VQ0A 1AUYA 2EBIA 3HPNA 3RKYA 2CQKA 5JXJA 4ABZA 2VGDA 2YX7A 5LGTA 1I27A 4AVSA 2JA5J 1MMSA 3VGIA 4CRQA 1CWPA 3B3QE 1TT0A 3AMQA 3LPFA 4AEMA 3CLPA 2HWE1 1I1GA 4PGHA 2OBPA 3D6EA 5CG8A 1OYIA 1LEBA 5FZOB 3V8LA 4GH4A 2UU8A 1RZ4A 5FY0A 5T5LA 3SH4A 4HANA 1ACIA 1KYWA 3BTLA 1XCBA 3QH7A 5ED4A 1IPSA 3ASIA 4ZYAA 1UOJA 3VD7A 3M3EA 1LHVA 3LDKA 2V1DA 2GQQA 3ZGKA 2BTVC 1OSGA 4QWNA 1DLCA 2D6MA 3I58A 3SYTA 5FBJA 1D3YA 5IY5H 1XYPA 4NIAA 2M7AA 3DKYA 1RUC1 2W46A 3MVPA 4C30A 3C2UA 3ZSMA 2WZPP 3COAC 3W21A 1ZZBA 4YG6A 4YVSC 2GA2A 4LKSA 3ULQB 4CP2A 5JSOA 1QNTA 3F23A 5K7HA 4E7HA 1L7RA 1UU5A 1G9CA 2IA0A 1FP2A 4QGLA 2L0KA 1SG3A 3N9MA 4UFJA 3ZSEA 5L3EA 2EIJH 4JDOA 5JPNB 1IC8A 2P4EA 4EN6B 1D2QA 2JMWA 4ZZLA 1TMF2 3SHRA 4XE9A 5FWEA 4FOQA 3QU3A 4BMBA 4M0HA 1DU6A 4MTDA 4O61A 2UWMA 2WO7A 2WZR1 1Q43A 4LEJA 4A3BJ 5GZGA 2ZMNA 3VKNA 2HWF3 1O59A 1LB2A 3RPUD 5T3NA 4WZFA 1YJWI 4XTMA 4E7SA 2QBYB 4YG2F 1LCLA 1USTA 4KQ7A 5FROA 2AGSA 5FZ1A 3K4ZA 3HL2A 4QPQA 3S93A 3A01A 2N7GA 1FMWA 3LEGA 1ONAA 2CV0A 1LVKA 5K7PA 3PNVA 3EUHC 3K2ZA 2VZOA 3F21A 3ZN4A 2X5IC 2B7EA 4PJMA 4YVWA 1VI0A 2W68A 2QJVA 1A6CA 4B3NA 3PNYA 1XYOA 4WVMB 4FFHA 3MPPG 2DCTA 3GDBA 4E70A 4QU1A 1ND2A 4XF0A 1JYNA 1KGYA 4AEDA 3WU1B 5FO7B 3ZQQA 2O9LA 4XCBA 3O0VA 1VBD3 1C8M1 2BGPA 2Y6FA 2RREA 3FC0A 1PJRA 3TAYA 1XYNA 4QPIA 3KETA 2QBYA 2I2SA 5EJZB 5FYIA 2V6EA 1VQ8I 3CO6C 3A01B 3MQ0A 3F95A 1A8DA 3SXWA 4AGRA 5FCCA 4XUNA 3ELKA 5AC93 1REEA 2K4BA 1JT0A 4LO8A 3MEPA 1FZPB 4IRGA 4RGAA 5HBAA 3TGNA 5GZEA 3HG9A 3N4MA 2HQ5A 1IS4A 4JAAA 2XQRA 4O9GA 1X4OA 1RMU1 1R1A3 1R1UA 4QX7A 3G1LA 4HK9A 3VZJA 2PN5A 1J3QA 1HSJA 4BQ1A 1BMV2 1WLCA 3GWZA 1UN1A 4HZFA 1FBUA 1PIV1 3PURA 5GAGJ 2GOMA 4Z82A 3F0CA 4A6DA 4EWAA 4Q0QA 3KD4A 2JG8B 1S4CA 4FCAA 1QJX2 3T2PA 2AO9A 1BVVA 5FKMA 3WTUC 2PJRB 2C5DA 4MXWA 2G9WA 2EA2A 1XNAA 2VPRA 2IAIA 1OJLA 4L2NA 2BY2A 1ZBA1 4LB5A 4W6YA 2K9LA 2R073 1N1VA 3P3NA 1W6QB 5L3BA 1ZBE2 2DMQA 4BQ2A 3ECHA 2DK8A 1V3FA 3CTAA 5KHJA 3TEXA 2YV8A 3VBSB 2X48A 3FBYA 5C5UA 2P5LC 1MZFA 3BIWE 1BVP1 1AX1A 3HYIA 3I97A 4CSWA 2Y64A 5M0TA 4UFKA 3S14J 4CDWC 5D5XB 2JPCA 4EM2A 4A42A 5FYBA 4BK5A 1GQGA 4CDQA 1OOPC 3CCSI 3AKQA 1WMXA 1FPN1 2R30A 2HYFA 4FPEA 1S29A 4XLAA 5FFOC 1GT0C 1X3WB 4WVWA 1IXCA 1KJRA 1V9U1 2IUWA 1FX7A 1JW6A 1MMAA 4IXAA 1QXRA 3GW2A 5ANNA 1JTXA 4TYSA 3WF3A 4P9WA 4QDSA 1IUYA 5FP4A 1YJKA 2RM21 1EAH3 4QTRA 3NNLA 3POJA 1RVF3 3ZQIA 4HFSA 4Q29A 4Z2YA 4XR6A 1ODDA 1A35A 3FKIJ 4CUBA 4HOBA 2FDFA 5E20A 5J1UA 2LS6A 5C3EJ 3WP4A 1U12A 3ZN0A 3BPZA 1ST8A 1GQPA 2HYXA 1EPWA 3JRDA 3OMYA 3IKTA 2RS32 4QHBA 3O1TA 4YW5A 3OR2C 2E34A 2EXIA 2WL1A 3HOBA 4CU7A 3RSJA 3MIBA 2NYXA 2Y6JA 2PQQA 3BQYA 4JK1X 3RPQA 1EF4A 2P37A 3GM8A 4L0ZB 4XABA 2GLOA 1GNZA 3ZFEB 4IKFA 5FMDA 4AYUA 3F22A 4P9YA 1RVF2 4WXCA 1OLQA 4R8HA 1Q8OA 1TQIA 2LLKA 1OLME 2BU9A 3DKQA 3T1BA 2JG9B 1XSQA 2VQGA 2VUAA 1GZWA 2DOAA 3AZZA 3OCPA 3PUFA 4B3AA 1GSLA 3QPTA 5A3PA 3EQLF 4XBLA 4V2VA 3LEIA 3C8XA 1Q56A 1O7FA 2CWEA 2JZYA 2ISZA 4LMFA 4MHGA 5DDJ2 3V7CA 5FMCA 4D1QA 4DXTA 3OYCA 1S0GA 2RJLA 1BZWA 2IEKA 4GQ7A 1WMFA 2PHLA 1FV3A 1UIJA 5DUIA 3WW2A 2K9SA 3W2AA 4XRFA 1TVGA 1KDMA 3G73A 4E4ZA 1W5SA 2R32A 2VBXA 2O7OA 4DZJA 2JA7J 5FY1A 4U36A 4Y13A 3DCQA 4CU8A 4EEFG 1AHDP 2QQOA 5CVUA 4IXLA 1X58A 4HBLA 2YYOA 5L3FA 4LD5A 2QQ8A 4MGSA 3RYKA 2TUNA 4IEZA 2DVFA 5F2SA 3S5AA 3OIOA 3TO7A 4L0PA 3TDZC 4QX2A 2Y2ZA 5K5OA 4YW4A 2D3SA 2X1EA 1Q8VA 2XL7A 3NO8A 2E33A 2X6XA 2W1SA 2R062 5DAWA 4Z92B 4YARA 3C7HA 5J8FA 3S2DJ 4L9TA 2OU2A 2JICA 1MDMB 2DTRA 5I8SA 1RC6A 1W9WA 5F6FA 1H2KA 3HGGA 5TJJA 2JG9C 2LY1A 2PQ8A 2JRMA 3FXUA 5KCMA 2ZZJA 2VUJA 1N1SA 1SLTA 3QOPA 2IVJA 4S04A 1VF9A 2JENA 3LSGA 3RZHA 2DYRH 1B6AA 2VPVA 3P5JA 3B93A 1X1AA 5FYVA 2W1UA 5EDNA 2WJSA 2ID4A 5CAZA 1SMYF 2R042 3AYDA 4G12A 3O12A 1U9OA 5B66C 2VCBA 4K1ZA 3ILNA 3LSHA 1A5JA 4IEJA 2P3JA 1ZHFA 4MNUA 2WC2A 3OGGA 3MF9A 4XBQA 3UKNA 3I5UA 2QUFA 1PO12 2R5YB 1RYYA 3UGHA 4G3YC 1Q8SA 4Q4W3 1GQHA 4AI2A 1JMUB 1TWAJ 3L2RA 1O7LA 1ETXA 3HOXJ 3N9PA 1WMDA 2XAGA 5IVBA 3GCXA 3KLOA 1JZ3A 3WNPA 3KEOA 1AL21 5F37A 5FWJA 3B9CA 3TRSB 1SQ4A 4E6KG 2NOGA 2WS91 1PZ7A 1MJ9A 3LSDA 3ZMVA 2KJCA 4A93J 5IOYA 3MICA 4AFCA 3ZFFA 5M5WJ 4QDQA 4UT5A 1RUF2 1BOAA 1YITI 3ZMNA 4AGGA 4LBLA 2EF6A 3GCMA 3ZXKA 1LHNA 4UI9L 1DGWA 2IWGB 3KT7A 2E63A 1N25A 1JKOC 4YLZA 2GNTA 4M01A 1JODA 3WDWA 2Z4FA 2DBIA 5JVVA 5IVFA 5DZGA 3ZXLA 4BEHA 1A6IA 4M3CF 1BW5A 1VAVA 2RDRA 4Y1XA 1VIWB 4P9UA 1TW3A 4M0NA 3ZQ7A 4Q8LA 4LG0A 3GNEA 1JS9A 3ABUA 3FFZA 4HMZA 2H09A 3OYIA 4NMIA 1R1ZA 3ZYHA 3KFWX 4FOVA 3OJBA 4NVPA 1E3OC 3DBLB 1S8NA 4X6QB 2OQRA 1YRNA 2QQLA 1KEXA 1X33A 1SAUA 1Z3XA 3OYWA 1FV2A 1Z05A 3MHZA 4JKLA 1ZG5A 4UUSB 5FYHA 3OEBA 2JG8C 2XJQA 1B72B 4JRLA 2DURA 2R3SA 1AX2A 3ABLH 4ARXA 4D7TA 4Q8KA 4ISRA 4BQ3A 1VQKI 1OCCH 1XN7A 5IYYA 4BEHB 2RS31 4IQ4A 1SHWB 3P9IA 4YM3A 2CW8A 2CUEA 2MG4A 5C3SA 3WP3A 5D5VB 2J1UA 3JRGA 3I2KA 4LQRA 1WW7A 3LA3A 1HRV1 1YRNB 5A80A 5C9AC 4M73A 4UFMA 4XAAA 5FXWA 1ETOA 4NOTA 4S0HB 3SZTA 1STZA 4AL9A 1NCQA 4QD2A 4IZZA 2GIZA 1SD4A 1LOEA 3J7LA 4OFGA 1UMQA 1SBDA 5A1FA 1JJ8C 1A6QA 2IXKA 4GALA 5FKOA 4YGDA 4OAYA 3S8PA 4AEJA 1K4SA 3PHMA 5ICFA 1ZR2A 2CAVA 4BDZA 2XAJA 2H0BA 4I02A 5IUQA 1APLC 5E16A 4K8FA 2O03A 3NKGA 5F0CA 3GO5A 1TME1 1MQTB 4V19K 4U0VA 4BE1A 1MVQA 1VZ0A 2GMEA 1RHI1 5J40A 3AK0A 3K1NA 4NAMA 2KHMA 1G59A 4D9JA 1BI1A 1NT0A 2KXLA 5FKCA 4Y22B 3GXUA 3M8FA 4YVWC 3JRFA 4IV1C 2HS5A 3BR5A 2VLAA 2PMZA 2YSRA 1D2SA 1VRH3 4FI9A 2G9FA 1NX9A 1SFNA 2Q1MA 2DWRA 2ZJQF 4L9NA 3AKZA 2VTXA 1LOAA 2HWE3 4RFRB 4Q47A 1W6OA 3CCJI 3FLTA 3RZZA 5FFXA 3TNQA 3KT1A 4UVBA 1F43A 4GAZA 4LK0F 1UF2C 1U3EM 2NQYA 1D7PM 3EQEA 3FHAA 3ZR5A 3HNMA 2DT7B 3J7NA 3DTEA 4YZ2A 2CQNA 4CCKA 4PT6A 4UW5A 1S0IA 1NOVA 5JLXA 4HX4A 1JOJA 4LK6A 2RE9A 5DD8A 1J58A 1BW6A 5BV6A 5BUVA 1RUH2 1IS3A 2XG3A 4KG0A 2A61A 4AYBA 4A12A 1LU1A 4EN9B 4INDA 4PFOA 2FE3A 3TQNA 1HKQA 1WJDA 2Z1DA 4FPHA 2BBYA 5CVRA 1KD7A 2NOJB 4NC8A 4XUTA 3WHUA 1TTYA 3IAPA 5CZKA 3CHXA 1WJAA 4RGXA 4MSVA 1MVEA 5DUUA 1KZHA 3HOYJ 2BW3A 2W1OA 1WJFA 2PHXA 3ME2A 2E51A 5DDJ3 3B01A 4BISA 4JCKA 3CMAI 3VBFB 4AFAA 2XROA 4IL6C 4M3GA 1QH7A 2KIFA 1SLCA 4L11A 2CHHA 2X5IA 1ZGWA 2HQNA 4OQ9A 2K9ZA 2FBHA 3BOPA 3DWLE 2V6CA 2W7NA 1I1EA 1DPRA 5H9QA 1G2HA 2NLRA 1WSUA 2K5CA 4BE2A 5HXMA 3CO2A 2XSJC 2D43A 3CO7C 2R7EB 1QNWA 4G8XA 1SD6A 5DTDA 1YFYA 4GB31 1SDDB 4P00B 4B48A 1FNNA 2HZTA 1RB8G 1N1TA 1GVDA 3V7SA 2DA6A 3WNOA 3V0AA 2ZGRA 5CKTA 4A3JJ 2FU4A 4R4XA 2EAAA 4PJNA 1WW5A 4PJYA 2XIGA 4QB6A 2DCJA 1AHSA 3BTXA 2WWSA 1X36A 1G9DA 2VE8A 1Z9CA 3GZ5A 4CDUA 1ZAOA 1R5GA 2RN7A 4EVIA 2E1NA 4K7JA 1WMEA 1DU3D 3ISPA 4C1XA 3F3XA 4LBQA 3CDLA 4CA0A 4J00A 4ARYA 5FPXA 3WGHA 1WCSA 2HWVA 3PJYA 2ILMA 5DAXA 2XSDC 2ZGPA 5AC91 2LRPA 1HV0A 1NG6A 1AA7A 2WAEA 4IERA 4IE6A 5IYCJ 1BA5A 2FDKA 1X1CA 4BXXJ 1CN1A 2A6EF 2VVFA 4C3JJ 4WM8B 5BPIA 1F4HA 2XJSA 3BOWA 2A5YB 1LTEA 3TOAA 1PMJX 3SCHA 3CJXA 4K2EA 4NC6A 4KIGA 3VKMA 4MEYF 3FHQA 2ACJA 4RS8A 4RHV2 2GAUA 2DA1A 1USSA 1W36C 4K6BA 3W58A 3MKWB 3SCGA 3DKXA 4B43A 2WBKA 3HRSA 2XBO2 1QPIA 4DXZA 2LY9A 2TNFA 2EALA 2PMHA 1DUXC 3I56I 1WUVA 3OIQA 2VI6A 2D6PA 3K4MA 4MLOA 1RR7A 3NJVA 2W95A 3CU7A 5D6FA 5LBQA 3W6VA 3I2IA 5C4XJ 1VBC2 2EPFA 5CIRA 2XVKA 2HYKA 4JX5A 4PI2A 4GGGA 3UKVA 4WM8A 2LSOA 5D4SA 3FM5A 1PK6C 3SKVA 3OS2A 2O0OA 1F35A 1ETKA 1RUC3 2A3YA 4LIUA 3VKFC 1LGNA 1HW1A 3AYEA 4CH7A 4O3MA 5GAHJ 1UZ0A 2AUYA 3V8KA 4XMIA 1NQJA 3DPRB 3KWVA 3V4GA 5F7UA 4RS5C 4BKXA 5ABJB 1W0PA 5LHIA 2HKXA 3O0XA 3IC7A 1S6LA 3DBRB 2DCYA 1GNHA 3AKPA 2QZ8A 4YFXF 3NNMA 5BOXA 5LHHA 4JKMA 5A3TA 2HYGD 2D93A 3G3ZA 4A7KA 2OAZA 2R1BA 3MLKA 2EIMH 1XD7A 3O3KA 3H1MA 3IDAA 1QOSA 1Z77A 4CVUA 1MGTA 4I98B 4XIOA 4AQSA 4AEDC 4BWOA 2CFOA 1DG6A 3WUDA 2A6ZA 1UHWA 2Z3YA 3AXEA 4DUXA 2DUOA 2O0YA 1HB3A 4HKLA 2QDNA 3FKJA 1AYN3 4E4DX 3DTIA 3PUHA 2VW0A 2MBFA 1D0XA 1F5FA 2HEVF 1FMVA 5T5JA 5FP3A 3H1WA 1EUTA 2DBNA 4II3A 2WNUB 3GZEA 2YB7A 2CMPA 3HR9A 3O1UA 4O9EA 3WVJA 3KLNA 4OAZA 2CGNA 5LY1A 1X19A 3GX4X 2VECA 4OOIA 3WTYC 5ICEA