2YBKA

Jmjd2a complexed with r-2-hydroxyglutarate
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
349
structure length
349
Chain Sequence
TLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 4A
publication title The oncometabolite 2-hydroxyglutarate inhibits histone lysine demethylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 105
structure length 349
sequence length 349
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2011-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 2ybkA01
3KV9A 5FPAA 3KV5A 5FYCA 4CCNA 5A3NA 3DXUA 3KVAA 4LXLA 2GP3A 3NJYA 3PUSA 5FY9A 5FYVA 5FZOA 5FZDA 2XUEA 4IGQA 5A7WB 2YPDA 4URAA 5A7NA 3DXTA 3PUQA 5FYBA 5FY0A 4BXFA 3PURA 5FZKA 4Y3OA 4D6SA 3PUAA 5LY1A 4IGOA 4EYUA 5FYUA 2Q8DA 4XDOA 3KVBA 5FZ7A 5LY2A 4CUGA 5A7OA 4NUBA 5KR7A 5F32A 5A7SA 4DIQA 5IW0A 4V2WA 5FY8A 2WWJA 5K4LA 5A7WA 3U4SA 5IVFA 1VRBA 4QXHA 5FZ4A 5F2SA 4BU2A 3PU3A 5FZGA 5FP9A 5IVYA 4QX8A 2OQ7A 4QX7A 2OS2A 2WWUA 5FZAA 5FYIA 2P5BA 5FXWA 4C8DA 4CCMA 3UYJA 5CEHA 5ISLA 3AL6A 2YU2A 5FZ0A 4HONA 5FYTA 5FXVA 5A7PA 5FZFA 5F3IA 2OQ6A 2W2IA 5FY5A 5FYHA 2PXJA 5FJKA 5FZ8A 4EZHA 3N9NA 4LIVA 5FY7A 5A80A 4CCKA 5FY4A 5LWBA 5IVJA 4XDPA 5E6HA 5A7QA 2Q8CA 4GJZA 2YBKA 2Q8EA 5FY1A 5FP3A 5FZIA 3KV6A 5LW9A 5A3WA 5FXZA 5F3CA 2VD7A 5IWFA 2OX0A 3AL5A 5FZ9A 2XDVA 3PU8A 5FPLA 5FP8A 2GP5A 3N9QA 4QWNA 5FJHA 5FPBA 3KV4A 5IVVA 2XMLA 5FPUA 3N9MA 5FZMA 3PTRB 3OPTA 4QXCA 5FUPA 5A3TA 4CSWA 3RVHA 3N9PA 5A1FA 4E4HA 5FPVA 5F5IA 4BISA 4D6RA 5F2WA 5FYYA 3K2OA 5FZCA 5F5CA 2XXZA 5F39A 5FXXA 5FZBA 4GJYA 5IVCA 5FYZA 5FP7A 4DO0A 2YBSA 4HOOA 3K3NA 5A3PA 5FZ3A 3U78A 5A1LA 5FWJA 5FZLA 4GAZA 4UF0B 5FP4A 3ZLIA 4CCJA 5FUNA 5FZ6A 4LITA 5FBJA 4ASKA 5F3GA 4LIUA 5FWEA 4QXBA 4IGPA 5FZOB 4CCOA 4D6QA 4Y33A 4V2VA 4TN7A 3PDQA 5FZEA 4CCLA 5FV3A 5FZ1A 2OT7A 3K3OA 5F3EA 3ZPOA 5F37A 5FYMA 3N9LA 4AI9A 4EZ4A 5FYSA 3LDBA 3N9OA 3OPWA 2YU1A 5IVEA 3LD8A 4UF0A 4GD4A 2YBPA 5IVBA 5ANQA 4AAPA 4QU1A 3AVRA 4Y4RA 5F5AA 3AVSA 5FZHA
chains in the Genus database with same CATH superfamily
3KV5A 1EV11 3VBSA 3M3EA 1VBB2 3I97A 3ZXGA 3VL8A 2VMIA 3ACFA 3VBFA 1D4VB 2XUEA 2AYHA 1MS8A 3MO4A 2WT1A 1XNBA 4LOSA 1UKGA 3WG2A 3GHNA 3VD7A 1BJQA 3VBOB 4LK7A 1C5IA 4UW3A 4BQ1A 4EE2A 2IXKA 4XF1A 5J48A 1V6IA 4HFSA 1UY1A 3AP6A 2JG8C 2LUWA 1TMF2 2ZX2A 3CJIB 3OOXA 4A6SA 2MEV2 2JE8A 1W9YA 3HQUA 4IL7A 2HWE1 4W8JA 4E27A 2LS6A 1MZEA 1MVEA 4Q0PA 5KR7A 4XXPA 4AI0A 2VZ3A 2PQQA 2OVUA 1WBLA 3H7YA 1RUF1 5F2SA 1V6LA 2HWD1 5K8SA 4JAAA 4UBGA 2WA4A 1HV1A 4K8FA 4FPOB 2VTFA 5EXOA 3ZFGC 4IEXA 4B4PA 1O3TA 3THTA 1ULOA 3ZYFA 2WYFA 2EAKA 3ZFFC 4MLOA 2YC0A 1PVC3 5CEHA 1LOGA 4K40A 3MGUA 1DZRA 2TBVA 2VOWA 1AZDA 2OKXA 3EMRA 2GNMA 3RNSA 1SEFA 2R30A 1ND2A 3OCPA 4RS5B 4IEPA 3K4ZA 1LGNA 3BTYA 4PBOA 1LODA 3KQ4B 1YFWA 2RS13 1J3QA 1F5JA 1FAYA 1NA1A 3Q8EA 4AFBA 2V09A 1DGWA 2D6KA 4XABA 3MZHA 3GALA 4EQVA 5EQUA 1Z7S3 1LNSA 4M0NA 3VDAA 1SPPB 4N9IA 2VNOA 2IUWA 3SH5A 5C9AC 4ZHNA 4JHZA 2BOJA 1W28A 1NCQB 2UYBA 3PTYA 1AF9A 4AEJA 5EFUA 4DEQA 1UX6A 2J42A 2VTXJ 3MPBA 1UW8A 2F4PA 3T2TA 1KDMA 1L7QA 1TME1 2CYFA 4KBBA 1AL23 5CFCB 3NSTA 1OH3A 1ZZCA 3AMMA 3MPPG 4Y5SA 3MDPA 2EA7A 3ACHA 1V9U2 3BU7A 4RL7A 5FZBA 4NRQA 1LOAA 1RUE1 4FPHA 4XFBA 4LKFA 4QKBA 1XE0A 2PLV2 3MF6A 2GNTA 1QJX1 1OF3A 5FZ6A 5SV5A 3ZDSA 1D0HA 5J7MA 1SZBA 4LIUA 3VBSB 4IE0A 5SV8A 1O7FA 2JECA 2X09A 2JWPA 3VBFB 1R1A3 2VMDA 3H1WA 4A41A 2J1VA 3PMSA 3BGAA 1OQEA 3VZLA 1GKBA 1JU4A 1ND3C 2FDKA 2CNAA 2KXLA 4LE4A 1BYHA 4X8NA 1CAVA 1ZNPA 1XBFA 4I09A 4QX1A 2CL2A 2VW0A 1HQWA 1W9FA 3QBQA 4N53A 1ZRIA 4GD4A 2XQXA 4GALA 3LE0A 2IVJA 3AVSA 3SKJE 3VBOC 3ETQA 3FLPA 1GOFA 3FBYA 1FX5A 1LULA 3L9JT 2Q8OA 1YNAA 3WNMA 3ZR5A 1STMA 3DKWA 1JUHA 4AVSA 3TRSB 1HXS2 3RGBA 2VQAA 1RJ8A 2VVFA 5LA9A 3GZEA 1CONA 4P5HA 2Q1ZB 5L7OA 1H2LA 3PJQA 1IKQA 5CIRA 1SCSA 3WT3A 1HLCA 1RUOA 1U5ZA 4Q0QA 1ZRDA 1V0AA 3N4MA 2RR11 1W06A 4XDOA 3KVBA 4G9SB 4HVOA 1G86A 2Z79A 4Q4Y2 4CUGA 3H3LA 4XETA 3UGGA 4JGYA 1HB1A 1K5MA 3N7JA 1COV2 1ND2B 1NQDA 2YZ4A 4YW1A 1VBB1 1M06G 2VOTA 5A7WA 2ZEYA 2RJLA 2QFEA 1RXGA 4CPBA 4DRRA 4QKFA 1NA1B 3T2OA 1DQ2A 3RYKA 2BV4A 3FFZA 3LCPA 4JDMA 2YMZA 1AXZA 2P5BA 4C8DA 3PMEA 5CISA 2HWE3 4RS5C 4UI9L 5GLTA 1VBA2 3O7OA 1MQTA 1E5RA 3S5QA 3F95A 3U11A 1KFXL 1TMF1 2B4KA 2MEV1 5FJKA 4FPGA 1JN2P 4OZXA 4QGLA 2W87A 2HWD3 1AXYA 1BLZA 1F5FA 3U4XA 3BN6A 4YG0A 1UIKA 4AFDA 5JSPA 4IEVA 3KV6A 5LA2A 5KHJA 3MW2A 2ARBA 1DGWX 4Z1VA 1ULGA 5IWFA 1AR81 1NCQC 2F4LA 3VKNA 4CEWA 2XWBB 2RE9A 5JMCA 3AC0A 4XXAA 3ZXJA 4Z2WA 4YZ1A 5CFCC 1S0BA 5CA6A 3JCIA 3LSEA 5EWSA 5JCTA 2XMLA 3O1OA 1H9PA 2QVSB 2OA2A 3MYXA 4L0PA 1W0OA 1O5LA 4P00B 1LR5A 3PTRB 2NP0A 2VVDA 1W8TA 1U12A 3FHQA 3S0MA 4E4HA 2ZCWA 1F35A 4QPYA 1Y9GA 4YGCA 4E9KA 4L2NA 2PQSA 2Y8KA 4NROA 1CAVB 5DZGA 4LE3A 5FKBA 3ZSKA 1MS9A 4DO0A 3VBSC 2D5FA 2QQWA 1XSRA 1JYNA 1ODMA 5FZ3A 5FWJA 3VBFC 3RI9A 4N53B 2GC2A 1Q3EA 4CUCA 4GKXA 4LITA 4ASKA 4LA3A 3VLBB 1OMIA 5IAXA 1OBNA 1OI6A 2JEMA 1W8WA 5EP9A 3POWA 2VZ1A 3OUJA 3JQWA 2VUCA 5A32A 5BNOA 4S2HA 3ASIA 5F8PA 3WINE 3A22A 2JDZA 3WF0A 4AGVA 4URTA 1CAXB 1Y4WA 1GNYA 1V9U1 5BY5A 5L7OB 3RYPA 3M3OA 2YHJA 5EPAA 2WS92 2ZZJA 5FFOC 1MS4A 2X53S 5HV4A 4D8MA 2WKKA 5GZCA 3I2OA 2ET7A 4ZU7A 1ULPA 3IMNA 1X9PA 4GWJA 1OH4A 4JGYB 5F7UA 3OGRA 1K5MB 5FY9A 5HI0A 3GCXA 1LB2A 5FYVA 4BQ3A 4QDRA 3H8RA 5FTTC 5A7WB 2D44A 2RS53 2Y6HA 1KJRA 2F6BA 1ZVFA 3AMNA 1UCXA 2J1EA 3PUQA 2VOVA 1G9BA 2WBKA 3X29B 3VKOA 1VMFA 4DMIA 3T1LA 4OI2A 2W47A 2FZ2A 1ND2C 3ALQA 4NHKA 3H1YA 4LBQA 3WCRA 4AFAA 4XAAA 2HWB3 1MQTB 1Q8PA 4L8QA 4CEYA 4P9YA 1ZRFA 1BEV3 3B02A 3NMBA 1TNRA 4D7TA 2XJPA 3BYWA 4JDNA 5C4WA 1WW4A 3BOWA 1IZ3A 3OBAA 3CQOA 5AC92 3UKNA 3IIIA 4PI2A 2B9VA 3Q8FA 1CWPA 2LALA 3GJAA 1HXS1 4FPCA 4A42A 2HEVF 4XACA 3WF2A 3AJYA 1BZWA 5JOWA 2DUQA 4JCKA 1G7YA 2OQ7A 1GSLA 1PNGA 1UQXA 2R063 4CEWB 3JD72 3LEMA 2W52A 3ON7A 4BQXA 4DUWA 5CAZA 1O3QA 3NNJA 3RJRA 1NY72 4BZ4A 4QPGA 2XLAA 3KF3A 4GB32 4L9BA 4NN0A 3AYEA 1VRH1 4FT8A 5TSWA 4Q27A 4Q4Y1 5H9SA 2BGCA 1A8MA 5T5OA 2R1BA 3C7OA 1AJKA 3TEWA 3ZN6A 1APNA 1COV1 1SCRA 2WLQA 2YBKA 3NWKA 4CDQA 1TEIA 2KA3A 4DXRA 4UFMA 2VM9A 2C9AA 3VZKA 5GZDA 1GOGA 1NXMA 4YM0A 5DZFA 1QXRA 3WDTA 4L99A 1RUNA 1S0GA 4PJYA 4XJUA 5IATA 3T30A 2DDUA 3NJZA 3TAYA 4OVEA 4HSLA 2G1MA 2F17A 1VBA1 1R092 2R0FA 3AKSA 1H4GA 1LOFA 2B5HA 3NQHA 4F3JA 4YRDA 5A32B 5BNOB 5CKNA 3C7GA 3PLQA 4NMIA 5FPVA 3I2GA 4N53C 1AR83 3LB9A 4CPBD 1DG6A 1MS0A 5IK7A 1YIFA 1YQ8A 3U10A 2XXZA 2DUOA 2GH2A 1OLQA 3ETPA 2FDIA 3UJOA 3JQXA 3UETA 3U78A 5LA0A 3KHBA 4XFCA 5I91A 1OC1A 1Y3TA 3RZGA 3M3IA 4UAPA 5EJZB 3KS7A 4KH9A 1G8WA 5AVAA 1A6CA 2ZGNA 5IFPA 3VKMA 2O14A 1GANA 1UO9A 3I8TA 1TE1B 2O0OA 3I2JA 1A78A 1F9KA 5L7OC 1AUYA 1DZQA 1W6MA 2CAVA 2YGMA 2Q1MA 3AXEA 4K1YA 5L73A 2VZSA 4Y20A 2H6BA 4Y24A 4D6QA 5A3MA 5IK5A 2UWBA 3JB4C 5KXEA 2PAKA 3ROUA 4CCLA 5I0RA 4HG6B 3J9SA 3O1PA 3DV8A 2CGOA 4AI9A 3BIEA 1RUD3 3AMHA 2D6LX 2D93A 2JD4A 3LDBA 1K5MC 4KG0A 4YVSA 2B8MA 4LBQB 2VMHA 2DURA 1XQNA 2BWAA 2PHWA 1LESA 4CEYB 5L9VA 2WA3A 1KDKA 3ENRA 1IPSA 3POJA 3WR0A 3QH6A 1PM4A 1WCUA 2VMCA 4BYYA 5C4WB 1BVVA 1MZFA 5FZOA 2VECA 5K7PA 4BA6A 4QM8A 1UYXA 1H2MA 1MQTC 4HN1A 4BXSV 4JV4A 4MGIE 5FYBA 5GJ6A 5BNQA 2ZGKA 3JBG2 1QKQA 2J1SA 2FDJA 3HBKA 3FJSA 5GZGA 1YI7A 5FUIA 1WZXA 1ULFA 4AI2A 3W21A 3WD5A 4EWDA 3IAPA 3EJKA 2DTYA 2WS91 2WDBA 1UZVA 2Y6FA 1AVBA 4JTOA 5FYUA 1JZ8A 5FK8A 4QPGB 4UYBA 1W2AX 5GKAC 2HWF1 4FQZA 4FFFA 3LOBA 1YFYA 2OZJA 2E6VA 3HQXA 3CKHA 3USUA 5B4XA 1WMEA 2RM23 4CEWC 1W39A 3SCFA 3ZKUA 2WWJA 3ZN6B 1WKYA 4CDQB 1ZBE3 2ZAAA 4LUMA 3POIA 3QACA 5FP9A 4W50A 5A6QA 2WZR3 4JGZA 3N7KA 2ZKNA 2ZX0A 4C1XA 2Z69A 1GICA 1WCKA 2YPJA 2WWUA 4JDOA 1W90A 4XUNA 3SH3A 4NRMA 2CDPA 1HDKA 3T4HB 2VTXA 3AL6A 3I2IA 4PDWA 2RS12 1I5ZA 4S2DA 4ES8A 1SBFA 2TEPA 3OUIA 4YZ3A 5FYHA 1CQ9A 3HNMA 1PX3A 3W5MA 1WW6A 5J36A 4AG4A 4AWDA 3CZUA 1EP0A 1H8VA 1Z7S2 4IV1A 4NPRA 4ARYA 5IVJA 5AC91 1X82A 1H8TA 3WP3A 1FNYA 1OQDA 3Q9OA 4RN5A 5KC5A 2WZEA 3OBTA 5FZ9A 4LBQD 5BNOC 1LOCA 1AL22 1VRH3 3MHZA 1Q8SA 2CGPA 4Q4Y3 3LEGA 4L11A 1NY71 2EXJA 2R16A 4FXKB 4BQYA 4BWOA 1NZIA 3BUCA 4GB31 3VV1A 2FCVA 2EXIA 2W95A 2XWJB 3UKVA 1W6MB 1DLLA 4COVA 5JZGA 3V56A 1WW7A 5FREA 4Y20B 2AR6A 3LFIA 5JWPA 2WLPA 4CCCA 3WSOA 2NMOA 4IE4A 1IKPA 2W1SA 4HOOA 1CN1A 3KWVA 4YVSB 1R1A2 2Y6JA 1BKZA 4R4ZA 3WDXA 5T55A 4JRLA 3VHNA 1MEC3 1OPMA 3HWJA 5FUNA 4GMP1 1QXPA 3DKQA 1PMIA 3L2YA 3ES4A 1PGW2 2BVBA 1PX4A 3NJVA 1R091 3TOJA 3ZYHA 1QQP2 2SLIA 2Y0OA 1QGLA 3NV3A 5FZOB 2A71A 1ZYBA 4TTGA 3AFGA 2WZPP 2VJXA 2BDRA 5CVRA 4IV3A 2WQZC 1Q5OA 5FZ1A 4H7LA 4UT5A 1GQGA 2B39A 2EALA 3GXUA 5C4WC 1LCLA 5JI7A 5LATA 4ZU4A 3PUHA 2BBAA 2FBEA 5LEJA 2R32A 2PHUA 2JKXA 2Q1FA 3PJYA 4IEOA 2WNEA 1W2TA 4K21A 4XFAA 2VMGA 4PF5A 4U36A 2ZEZA 2G19A 1CJPA 3QH7A 5A3NA 4S2GA 1RUH3 5LY1A 1Y7BA 1OPOA 1UZZA 1DF0A 2WQ8A 2EICA 3NJYA 3PUSA 4CP9A 2JD9A 3USUB 5FZDA 5JIAA 1KEXA 3ZYGA 4QQ2A 1XE8A 4JVAA 3ELNA 2I07B 5E1RA 4KI5M 5GLWA 4ISQA 3TWIA 1RC6A 2P6HA 2A3YA 4A7KA 4Q0UA 1X50A 3AZZA 4B8EA 4QPGC 3FHAA 4JGZB 3UESA 4XF3A 1GWKA 3VUOA 5FZKA 3SITA 1VAKA 3H8XA 2QQJA 1ALYA 1UZWA 2YYOA 2CU5A 5ABJA 5KHKA 3AMPA 1E57A 5A6ZA 4PDWB 2ZGOA 3POBA 3C7FA 5FZ7A 4CDQC 1ASJ3 3TYJA 1TZOA 3EYPA 3GF6A 3NNGA 1O59A 3TNQA 4QX5A 4XVHA 1UXZA 4CU8A 2HWE2 4IV1B 1VRBA 3JXSA 3VBHA 5C3QA 1H8TB 1Q8OA 1BXHA 2RS33 1DLCA 4TZDA 2NN8A 1NX9A 2WAOA 2WS93 2OS2A 1LOFC 2E33A 3JBG1 1YIPA 3GM8A 4HZFA 2HWF3 2RDQA 3N3HA 2ZGMA 5FOBB 3OBZA 5C3PA 3IT8A 3AZYA 4PHZA 4LO8A 1LU2A 3D4KA 4YYOA 3M3CA 5CZKA 5FRAA 3M8LA 3HT2A 1FOD3 3MLLA 4LIVA 1SMVA 5JZGB 3I7DA 4AGRA 5I0TA 4RYDA 2ZA9A 1KS5A 2C26A 1UF2C 2NZ9A 4LJHA 4E2QA 1WCDJ 3H1MA 4CDUA 5FY1A 4AXOA 1JH5A 4LBNA 1MZ5A 2Y26A 3P5BA 4HN0A 4BCUA 2ZGPA 2VD7A 4H55A 4ASLA 5BYNA 1C5HA 1UL9A 5CG9A 4IE6A 4UOJA 2XJUA 3PU8A 4TLGA 2J1AA 2HEWF 3AYDA 3VL9A 3N9QA 1X8MA 3GBGA 1UOGA 2ZEXA 2XVLA 3VGIA 2RS11 3KGZA 4AVAA 5GZFA 3ZX7A 2L9LA 1WLWA 4QXCA 3CJIA 4WM8A 5A3TA 5E16A 1YEWA 2BYVE 2IXIA 4K9SA 1CPMA 1U5IA 4Y5TA 4I30A 4IV3B 4XOGA 4XBNA 4D6RA 4DOUA 4BQWA 5A70A 5FZCA 4LKEA 1I6XA 4Y1VA 3ZIWA 3HIFA 5IYYA 2VNRA 5DN2A 1W03A 2Z5WA 2VOKA 3VDBA 3NVCA 2E7AA 4YFZA 3LFMA 4CU9A 3OF1A 1XYOA 1KQRA 2ES3A 2ZMKA 1AL21 2GN7A 4XW3A 5FBJA 1O5UA 3AZWA 4CUBA 1XYNA 1T6GC 4D69A 4FQ4A 1BK1A 4XMAA 5H9PA 4AQ6A 4CP9B 1CPNA 1PNFA 2OPWA 3T2PA 2DFCA 2VXJA 1K5JA 4CA9A 4LHSA 1RUJ1 5JOYA 1HN0A 3D8CA 3K3OA 4WVZA 4DRVA 1SBDA 4D7YA 1UMIA 2V5DA 1CESA 2WFF3 3O0XA 1SQ4A 4P9XA 4UXAA 5F6KA 5HCFA 3KGLA 1LGCA 4YARA 1QJEA 3I3EA 2RS52 3OB8A 2H0BA 3LZZA 1R1A1 1DQ4A 2RHPA 3I3MA 2VY0A 3VZOA 3WX5A 3GDBA 2B9UA 3WV6A 3INAA 5JMOA 5FYCA 4NWVA 2W9XA 4Y1XA 1OURA 4LHKA 4GQ7A 4JGZC 5CFDA 5DDJ1 3T2QA 1PGW1 3LA7A 4Z82A 3M1HA 1O6UA 1QQP1 2PHXA 5HCAA 4MGKE 2HWB2 4H14A 1UOJA 2ADEA 2C9KA 2FMYA 4HK9A 4PDWC 3VBHB 1IPKA 1GLHA 4N43A 4W6YA 3OSDA 1BEV2 5FY0A 4AEDA 4AFMA 1WWYA 1GYKA 5H9RA 2AEZA 1UD1A 2B46X 2V72A 3T09A 2GU9A 2X5IA 5JXIA 4IETA 4B29A 4IV1C 4IGOA 2Q8DA 3IBMA 3SKVA 5GM0A 4JQRA 4G3YC 1H8TC 3S6PA 4CCDA 1JMUB 4QMAA 2R062 4DIQA 3E6BA 2OW4A 4YNIA 2ZHNA 3UV9A 5FY8A 5K4LA 1ZRCA 1NZCA 2OZ6A 5LRSA 4CDUB 5A33B 1NUKA 5IVYA 3BB6A 1RVF1 4CP1A 1UY0A 3O5SA 5JZGC 5FR3A 1ENQA 4WZCA 5FXWA 1IGOA 2ZXQA 3ZSEA 4HXCA 2BNOA 3VZMA 1LHWA 3J8F3 5FXVA 2P4EA 5FZFA 2QTWB 4YLZA 2B7YA 4QB1A 5FMBA 5T5LA 3BTAA 4P9IA 4NIAA 1VBE3 4WM8B 2YB7A 5A7QA 1W04A 3ACIA 5JR2A 4GJZA 2VZUA 3JBG3 4EWAA 3NO8A 4LEJA 4MH0E 3TB0A 2A6VA 1RITA 4XHBA 1OT5A 3PVNA 4LKDA 5I0SA 5FXZA 3E6DA 3TEXA 3WQ0A 4GKYA 3T08A 1CZVA 4QM9A 1V6KA 3WP6A 1DQ5A 2NQYA 4LTAA 1AR82 1HQNA 1QMJA 1YI9A 4IV3C 2WJSA 4YW5A 1YRZA 2ENRA 2K2SA 1JYIA 1PO21 4AI8A 4H7MA 2ZPXA 1OLRA 4A2UA 3KD4A 3N9PA 4YWAA 5AFBA 4QU2A 2GDFA 5FYYA 2Y38A 4PLNA 1OVPA 3W9AA 5F39A 5FXXA 2PELA 4GJYA 5FYZA 1CZTA 1WA6X 4QPIA 5A3PA 1Z0HA 3RSJA 3C7EA 4LHNA 2ZJCA 4K7JA 2JG9A 3R6SA 4J1WA 1RUD2 5CFDB 1IS6A 1AHSA 4FI9A 4XE9A 3CL1A 2EIGA 4EN6B 5ABJC 2JIGA 3T0AA 3OJBA 1PO13 1V00A 4CDXA 1SG3A 4N43B 4AEDB 2XKOA 1MR5A 2BVVA 3WCSA 2FZ1A 4RGGA 5ACA3 5DAQA 3H42B 2X5IB 3B93A 5IVEA 4XF9A 1OD3A 2A7AA 4META 4XUOA 5DAXA 4AEKA 4CU7A 4MG2A 2WNVA 1WA4A 1BK0A 1D0GA 3VBHC 2XLFA 2BGOA 4QU1A 4SBVA 5JVVA 1GR3A 5E89A 1H2NA 4W6XA 2GP3A 1JYWA 1RUJ3 4YG6A 3J7NA 2WABA 1XE7A 2VR4A 3KF5A 4URAA 4UW4A 3WEZA 1W6NA 4M0HA 4XTMA 2R0HA 2ZGTA 3PNAA 1S4CA 2RM22 3WP5A 2ID4A 2YG0A 2WT2A 3L2HA 2ZKLA 3AP7A 3RMXA 2EIEA 1WGPA 1ZX5A 1ULEA 2AENA 4EYUA 3ILNA 4UFLA 2RS51 1ZBE2 5DDJ3 4LO7A 4BH9A 4CDUC 1QQP3 2WWSA 4JQTA 2QBXA 4YM3A 2WZR2 1I3HA 3HOBA 2QKDA 1LECA 1H1AA 2E9QA 2Q0AA 1OUXA 5BXXA 4D94A 1JYVA 2YROA 2Y6LA 4ATFA 2ZBJA 3AYAA 3OG2A 2P3IA 2BW8A 4I02A 3ZMOA 3EQEA 4YZ5A 2HWB1 3OGVA 5DAWA 3S30A 3O1MA 4XFIA 1QH7A 2A73B 1BEV1 2Y64A 3KCYA 5EJ3A 3BCWA 4AHWA 3A0NA 3CJIC 5JDBA 4IEWA 3KM5A 2VQUA 1CAXA 1OUSA 4OHWA 5L9BA 3IWZA 4NHMA 1C1FA 3WVJA 4KMQA 2ZGRA 4ES9A 4D7SA 4RA0A 4EV0A 4TXWA 4TYSA 3MW3A 1OLMA 4ORFA 3VN4A 3W59A 4FPYA 4CCKA 2NLRA 2R061 2JX9A 1WLDA 1VRH2 3GCWA 4KWJA 4XDPA 4COUA 1RVF3 2Q8CA 1Y9QA 4I01A 1I1EA 1BQPA 1OQ1A 2A3WA 3AX4A 3UGFA 2UY8A 1ST8A 1C8NA 3ZN5A 4QPIB 2OX0A 1S0JA 1NOVA 1H9WA 4WM7A 2EXHA 3ZM8A 1JZ2A 1OXCA 3FL7A 4OCTA 5GLVA 2JG9B 2CHHA 3ZXDA 3BTZA 3NNMA 3GBFA 5APAA 5CYYA 2AREA 1UIJA 1VLNA 2E63A 2W91A 3ACGA 5ANNA 3WZ1A 1W3VA 3RVHA 3NL1A 4B7EA 2PA7A 3BODA 1MEC2 3R4DB 4CDXB 4FOVA 4M4PA 3N7MA 3UK9A 3DL3A 4BM8A 5L36A 4XUPA 1HRV2 4BJ0A 5CFDC 5FO9B 3WNKA 4BHPA 2VUJA 3DN7A 3D6EA 4XCBA 3GGLA 3I4IA 1PO23 2E32A 2WO7A 2XUMA 3ZLIA 2WNVB 3CZJA 3U07A 2AZ5A 2JICA 4N43C 2Y60A 4R8HA 3WNPA 5I93A 2C4XA 5GZEA 4AEDC 4C90A 3T4VA 1IPJA 3ECQA 4R9AA 2RG4A 3SISA 4C0BA 3MLJA 2G9ZA 2X5IC 3C3VA 4O7XA 5JXHA 1O3RA 2W08A 1W6NB 2DF7A 2OT7A 4MADA 4QB2A 4Y22A 1KJLA 5F3EA 4CXWA 1RUH2 5LRRA 4DS0A 1JZ5A 4DFSA 1MS1A 4DQAA 4FTSA 4RHV1 1W2NA 1SLIA 2DBIA 2O8OA 4NOTA 4R9BA 4DZGA 2YV8A 3H8OA 2C0ZA 3W20A 3ZFEA 5IHRA 4AAPA 1F8VA 5A1FA 1Z78A 4NIHA 1RB8G 4E4DX 5FPAA 2DUPA 4IEYA 4DUXA 5C8WA 1REDA 3FUQA 1RUD1 3WW1A 4R4XA 1CAUA 2WL1A 1LTEA 4OHZA 3IM0A 4Q5OA 3BVCA 2VCCA 4XYXA 1ASJ2 2XLGA 3WUCA 5EJ1B 3MIHA 5FMOL 2DBNA 1ZZ7A 3CMGA 4LORA 5C5UA 2WO3A 4K6BA 1SLCA 2XGXA 1ZRRA 3IDBB 4NAMA 4P14A 4A3XA 3PUAA 3LPGA 4NIIA 1GBGA 4DEVA 4FPLA 5BUVA 3G7DA 2DWRA 2IXLA 4I3GA 2RS32 5J1XA 5D2AA 4IEUA 4AGGA 4DXZA 2HWF2 1SFPA 3A21A 3POYA 2RMU3 4NJ4A 4QXHA 3BU0A 2Y6KA 4JKKA 1L3JA 4HMZA 1TG7A 5KXDA 4YW6A 3NAPA 4J25A 1FOD2 1HIXA 5BNPA 3UNPA 3R4SA 1VAVA 2WO1A 2GH8A 4WM7B 3MIEA 2RM21 1ZZBA 2OYZA 2D6PA 1ODNA 5A7PA 1J59A 4B4RA 1V6NA 3BALA 2OQ6A 2ZGQA 1ZBE1 5CADA 1I9RA 2PXJA 3C2UA 4EZHA 1RYYA 1GZ9A 4PLMA 2WZR1 1LRHA 4NPMA 3B3QE 2ZMNA 4QPIC 5BNNA 3V0BA 4QPWA 3EB7A 5I8SA 5M0TA 1YFXA 1NA1C 2DV9A 4MGQA 3PIGA 4XPVA 5IJRA 4RD7A 4YW3A 1UY3A 2JG9C 2WN2A 4N7IA 1C1LA 4QDQA 5K0UA 5A3WA 1JHNA 2H6CA 3ZPYA 3HNYM 4K20A 4XEZA 2BTVC 5J96B 4Q1RA 1ZM1A 5DXDA 4EROA 3FUOA 3O1TA 5AVPA 1WUVA 4CDXC 1YFUA 1X33A 5FPUA 3WQBA 3S7IA 3WXPA 1C8M1 2A5ZA 5C6CA 5JOXA 3AYCA 2C6SA 4CSWA 1V6MA 3WHTA 5KBFA 3OTFA 2FCUA 3MFCA 1BBT3 2WNVC 4Y22B 5C3SA 5JPNB 4IDZA 1UOFA 3K51A 2OUJA 2GMPA 2BNNA 4FVVA 2W5FA 3NW4A 1CIWA 1MPXA 3WUDA 3O12A 4C91A 4XJ8A 3ZFEB 4QAWA 1W2OA 1H2KA 3HAGA 4HPKA 5F3GA 3KHCA 5FWEA 2WFF2 3WDVA 2W68A 3Q8AA 4XIOA 1CAUB 5CNAA 1NCRA 2FDFA 1G6NA 2PFWA 1NE6A 2PTMA 3BTXA 2VW1A 5JIUA 2PHRA 4HKOA 4HETA 2AACA 1MEC1 4K3UA 3ZYPA 1XSQA 3B00A 2K46A 4BMBA 2VCBA 4BE3A 2KD7A 1HRV1 1OD5A 2DTWA 2YU1A 2V5YA 3AZVA 3FN9A 4XDQA 2QQPA 1WMDA 3ZYBA 2IZWA 2VUDA 2RVAA 2W0XA 3VD9A 4XQWA 4W4ZA 2JDAA 4ARXA 4LXLA 3GZUC 1OA2A 3MV01 2GNDA 3HEIA 5JSRA 4Q4W3 4IGQA 1SLBA 4FPJA 4A4AA 1TQ5A 3M70A 4BIOA 2GC1A 3LOIA 3VD3A 2ATFA 4RHV3 1SHWB 4EJRA 1ACCA 3E6CC 4XQDA 2ERFA 1XOYA 3MIFA 4M00A 4AYUA 3TN92 4CZSA 3NAPB 5BNPB 3WG3A 1EAH3 2HLEA 1RUH1 1EPZA 2QJVA 3J7HA 1FATA 2QCSB 2NMNA 3C7HA 1YLLA 3FFQA 2A3XA 2QQOA 3CIHA 4NE9A 3DGTA 2HWC2 1GZWA 1WCSA 3SHRA 1UOBA 1H4HA 5JLVA 2VZRA 4JGYC 2VG9A 3O1SA 1DP0A 1H30A 1OF4A 2HEYF 1LHNA 5BNNB 4BK5A 1X9TA 1XXNA 2C24A 1QNWA 2EIDA 5IVFA 3V0BB 3SNMA 4MGTA 1NLRA 3J8F2 4X6RB 2BEOA 3HT1A 3FZ3A 4O65A 5FK7A 4GH4A 3VDDA 1W9TA 5K0UB 1AR73 1ASJ1 3KCCA 1VBE2 3Q8CA 3W58A 3FC0A 3WNLA 3O0VA 1VMJA 2W3JA 2YU2A 2ZACA 4MVTA 2P2KA 3I49A 3EBRA 4NR1A 1URXA 1FPN2 2DU0A 2X29A 4KU7A 2VU9A 2RS31 1AYN3 1GNZA 1W6QA 1W9WA 2TNFA 3B94A 5FY4A 3I2FA 5CBLA 1RINA 2XKPA 3ZXFA 3E1F1 3A23A 4LHLA 2JDPA 5B4NA 4FP2A 4UWDA 5EZWA 3HN3A 1AR93 4QX3A 4OHYA 2VNVA 1JUIA 1QJY3 3WLUA 2YGLA 2BBVA 4D3WA 4XBQA 1QF3A 1FOD1 5CG8A 5FP8A 2GN3A 1HJFA 3J7LA 1OFNA 1W8NA 2JIJA 4CU6A 5T50A 4XJZA 1IQAA 5IVVA 1UNBA 2A6YA 1DYOA 2PHFA 4HPKB 1WMXA 3WQ7A 3GZTB 3NKGA 3USSA 4XBLA 5FUPA 3TEZA 1NCRB 2HBUA 3HR9A 3MIBA 4B1MA 2G9FA 3ZYRA 3A0KA 2XJTA 2K9ZA 4IE5A 1PIV3 4AZZA 2Y34A 2AGSA 3ZFEC 2QQLA 1F15A 1CGPA 3MLKA 1RUI1 3SH4A 1S2EA 5JAXA 1CAWA 2WIIB 1QJZA 3GJBA 4QQHA 1P8JA 3NNFA 2EAAA 2Z42A 2CAUA 3LPFA 1ENXA 1C8M3 3AMQA 3FLRA 2VAUA 4HK8A 1PO12 3RDIA 4DY3A 3HPNA 3F2ZA 2ETEA 2JXAA 4COWA 4DY5A 1K42A 4YVWA 4YGBA 2JDHA 5ACA2 1XNKA 2B45X 4LPLA 2JE9A 4OULA 4XJWA 2DCTA 3UKTA 5LB6A 1HW5A 1QJU3 2XL9A 2QNKA 4IQPA 2Y0IA 3ZN4A 2VXRA 2RDNA 5C3RA 2BNMA 1RUJ2 5FYSA 5CKMA 3FBMA 3OPWA 4Q8LA 4XILA 3LD8A 5CU1A 1GZWB 1DGLA 4JZRA 1E5IA 1YQ6A 4E8DA 1FV2A 2VH9A 4Y4RA 5F5AA 1HRI3 1U5XA 2JENA 5FMDA 3DXUA 1YUDA 3NAPC 4CVUA 1D7PM 4AI1A 5BNPC 1LU1A 4MGYE 2WFF1 3SCHA 5DDJ2 1WD4A 4E2GA 2PHTA 3DXTA 4PQ9A 1HRV3 1NYWA 2W94A 2GNBA 3IDAA 1DFQA 4GH4B 3VDDB 5FAXA 3VHPA 1LAJA 3V64A 2D3SA 4RQPA 4CEYC 5BNNC 1XNTA 1JW6A 2O8QA 5GLUA 3SLIA 3ZSLA 5HV0A 2UURA 2P17A 3CJXA 4LNVA 5BV6A 5HBAA 5K0UC 2UWCA 4NHXA 4AQTA 4MGSA 1W6QB 4Y1ZA 5C71A 5D8AA 5JXGA 4HSJA 1AJOA 5T52A 1RMU3 2VCAA 1JI6A 1WCQA 4P08A 2IFWA 3K48A 4XFGA 1LOEA 3LQCA 1S2BA 4Y5Z0 1GQHA 4ZXEA 4KBZA 3TN91 1S0CA 1FMD3 3WDYA 2WRAA 4FTBA 1RVF2 1REFA 4AEMA 2LTNA 2HWC1 3CBNA 2ZHMA 2XBO3 3T1MA 3ORJA 1SLLA 2D6MA 4AAXA 2D43A 2OXBA 3H7JA 3OGGA 4Q2FA 3MF9A 3M2MA 3GBWA 1VP6A 3K75B 3O1RA 4Y4YA 4LULA 2PYTA 3AXDA 4LQRA 3P6BA 4I0BA 4QDSA 5FZIA 2XHNA 4LO4B 3J8F1 4IEQA 5LBFA 3WF4A 2HYKA 4AVTA 1CAWB 1IS5A 2WAAA 4FXGB 2HH9A 2Q30A 4TLFA 2X10A 1AR63 1VBE1 2YY1A 4HLTA 4NWWA 4PIYA 1NCRC 4GULA 2D98A 4LO6B 4BK4A 5EIYB 2I2SA 5FJHA 1UMHA 2HBTA 1HN1A 1B09A 1C28A 1UU5A 3KV4A 1YJKA 1D4M1 4FAHA 4P9LA 4YVWB 4FCAA 4Q4V3 1ZZ6A 1FPN1 1GWMA 2JB4A 5DUUA 4LBMA 1HJGA 1QU0A 1PO22 4KL1A 4YG3A 2VZVA 2HYXA 2IFRA 1YC61 1W8UA 5HPOA 3RZKA 4XTPA 1YJLA 5FMOS 5A33A 4F83A 1Q43A 3ZKYA 1LHUA 4W65A 5J37A 3CU7A 4M4RA 3MIGA 3VBUA 4BDVB 4AR2A 5L9RA 3CEWA 4CCOA 4J6GA 4KU8A 5A1AA 4ET7A 1PVXA 1RUI3 2BJSA 3I3QA 1POV3 3UT0A 5EYYA 3E5XA 5I8YA 2LROA 3OY8A 1UPSA 1ZA7A 1MACA 4YVSC 3CNAA 3MEPA 2BERA 4QX2A 4RQPB 1X8EA 2P3YA 2WFPA 1N1VA 5DAVA 5IAVA 1LGBA 5IVBA 5C70A 1SLAA 1GUIA 5FZLA 1PO11 1J1LA 1EUTA 1DYPA 1JZ3A 5A3LA 5I8TA 4GH4C 3VDDC 4TWTA 4GZ9A 1JODA 5ACA1 5D8AB 5KHGA 5LCWL 1UAIA 4QHZA 4XF0A 1J3RA 3J7MA 4ISRA 2FDGA 2BUKA 4F7ZA 4QXKA 1N3QA 1ZZ8A 4BLIA 2ARXA 1H1MA 3ATGA 1CX1A 1HB3A 1JU3A 4IE7A 4E4ZA 4LK6A 2RDSA 2RMU2 2FDHA 4D6SA 1V70A 5HCHA 1JOJA 1NQJA 1GU3A 1ONAA 2NM1A 4XF4A 4OQ9A 3IDEA 4Q8KA 5A7SA 3CF6E 3RZMA 3RMYA 5LEKA 4ZONA 2PHLA 3CHXA 4FTEA 2A6WA 4GWMA 4YZ4A 4FPFA 1PZ7A 1R64A 2UWAA 2R072 1RTVA 2ZZQA 5T5JA 5DAPA 3ITQA 3HD8B 4J1XA 1VMHA 4BPZA 2WN3A 4A7YA 5FOJB 1PMJX 3SXWA 3PIJA 1UZYA 4YPJA 5ISLA 1XU1A 4HONA 3OPZA 1OKQA 3DF0A 3BPSA 3R05A 2XH6A 3I54A 1KXGA 4NHLA 3WOGA 3I2DA 1RIRA 4Q29A 3RQ0A 3U14A 3LEKA 4OUEA 1UYYA 3TN93 4NHYA 1RUG3 1PK6A 2VE1A 1JOPA 1DGRA 1JXNA 1IS4A 1UZ0A 3VHRA 3RZZA 2BZDA 1QIQA 3LIGA 1XNCA 4YVWC 2E26A 2QQIA 1NE4A 2HWC3 2XDVA 4EN8B 4M3CA 4E2SA 5DMYA 4CRQA 1BBT2 5F6LB 5FPBA 2W92A 5JPMB 3VBUB 3PVEA 3OGSA 5DQ0A 2ZMLA 1GV9A 3ZMNA 3PVBB 2YDEA 4M01A 5C8CA 1JHJA 1QHDA 2E7QA 2EIBA 3CLPA 3H3UA 5DUWA 1RHI3 3OY8B 3JUUA 4DUVA 4A7ZA 5AFEA 1K12A 2E51A 2VMEA 4R9CA 1W05A 1X36A 2J7MA 2O1QA 3PVOA 4YFWA 3OEAA 4XJAA 1D4M3 5LASA 2FCTA 2IVIB 2XVKA 4CCJA 1FPN3 3SEEA 3VKLA 2QDNA 4CCEA 4JX0A 5JSOA 3OYWA 3WDUA 3VBRA 4PLOA 1C3HA 1YO8A 3H50A 4GWNA 1KRIA 4RGAA 4KWKA 1R083 4H2AA 2XOMA 4RQPC 5FLIA 4FOQA 2BGPA 5FZEA 4A45A 3WP4A 1G9DA 5F37A 3MIDA 2XVGA 2D5HA 2FHRA 4DXSA 3WNXA 3KMHA 3MICA 3EXUA 1SBEA 3D5OA 4Q4W2 2H0VA 2OIIA 2WSVA 1VR3A 4GIQA 2WNOA 3A4UA 5D8AC 2VULA 4UF0A 4N8MA 4FPEA 4RHV2 3TEYA 1AX0A 2D6NA 3IPVA 1AYM3 4CCNA 4WZFA 3KVAA 1EAH2 4I0WB 1HQLA 2P34A 5KHHA 2I45A 3NV2A 3VHOA 5A7NA 5LBEA 4LLOA 2GMEA 3OD4A 1DZTA 2EVXA 4P9JA 4WBBA 4Z92B 1JYCA 4EN0A 1HB4A 1DQ1A 2VMFA 1E5HA 2ET1A 3FE5A 3E97A 1T6BX 2ZHLA 2J22A 4C1WA 4EWEA 4LBKA 1DGRN 2JDNA 1ZBA3 4BB3A 1QJFA 4BQ2A 4E4SA 4N9HA 5A6YA 1AR72 2YFUA 3AK0A 4Z2AA 1GP6A 4XFHA 4QT6A 5A3UA 1KGYA 3AP9A 2FMDA 4AOCA 2TUNA 1WW5A 1PK6B 3VB9A 4MXWA 4CXXA 3V0AA 3B9CA 2BPA2 1G9FA 2DCZA 2WC2A 1Q56A 3NRUA 4QX7A 3RRDA 4AF9A 1AYN2 5LK7B 4QQPA 5C5TA 2D3RA 4M3CB 1YYNA 2N7GA 2WSUA 1M4WA 4CTEA 4DNYA 5FZ0A 2RMU1 3R0RA 3U1XA 1AR92 2WR9A 3POEA 4NIGA 1QJY2 1J3PA 2JDUA 2BRTA 2V4AA 3D82A 4IXLA 3WG4A 3ZYIB 2W39A 2WZ8A 4FAGA 3OD0A 4ZU5A 2RV9A 1N1YA 5C8CB 3WNOA 3KCXA 5E6HA 4RSUA 3BKZA 3E5UA 4IUGA 3ZXEA 4PIXA 4A3ZA 1QDCA 5A3OA 2R071 4PF1A 3VBUC 1FNZA 4WVVA 4MYEA 3ZXKA 2ARAA 2CY6A 3AKTA 3K4DA 2JKBA 1QDOA 1CX4A 3KLSA 1PIV2 1O91A 1VBD3 3IAQA 1O3SA 3OYWB 5JI9A 3VBRB 3JB8A 1N3OA 4WM8C 3N9MA 1XB9A 3BI3A 2B42B 5T5PA 3RG0A 4MXVA 4XZPA 1C8M2 4R52A 4N90A 3B7MA 4Z07A 4LA2A 1BHGA 1CD3G 2R041 2GZWA 4Q4X3 1W3XA 2YBSA 3C8XA 5G04L 3K3NA 1UXXX 4FOYA 5J09A 5A1LA 1LEDA 3AP4A 4KG8A 2LRPA 4ZKTB 4UF0B 2Y6GA 3K77A 2ORXA 1UMZA 3RI8A 1QJU2 1BBT1 3THCA 3IPVB 1UYZA 4CP0A 2WT0A 4EN9B 1W0NA 3LA3A 2GAUA 1N1TA 2R1DA 1OLME 1F2NA 3IKWA 1BVP1 4V2VA 5KXBA 4YW7A 1LKNA 5HCBA 2J1RA 2VVEA 3D3AA 1EV13 2RJKA 1HRI2 2EXKA 4O9EA 3VZJA 3CDZB 1LHOA 1AL0G 2PHDA 1S1AA 1S55A 2P1BA 4QQOA 3M3QA 4GWIA 1VB2A 1PGL2 3THDA 1U5YA 4Z8BA 3HBZA 1PM7A 5ANQA 1JZ6A 1SACA 4OHXA 3KQRA 4P5YA 4CCMA 4F8AA 3T0DA 4I2OA 1OFSA 2VUAA 5IK8A 1POV0 3DECA 5FPZA 1GP5A 3FWEA 2BFUL 1L7LA 3FMGA 3O14A 2GSYA 3H0OA 3LF7A 3IMMA 4I0AA 4YM2A 3S5AA 3DYPA 3VD5A 1QEXA 3BOPA 2AEYA 3KT4A 5FIXA 3WQ1A 3AM2A 1UX7A 4MXWB 4LLFA 4XZUG 2Q4SA 4FOWA 3LDRA 4BXFA 3V0AB 2XPJA 3PURA 2ZX4A 3LA2A 5C7GA 2ORZA 1AXKA 1V6JA 2D40A 4PBPA 3LAGA 2GMMA 1RUF3 4OZOA 4Q4W1 2GALA 3QLQA 4YZ2A 1RMU2 3HMYA 3I3BA 1GQPA 2A1XA 1PK6C 2BWCA 1D2SA 2LM3A 3IN9A 2VQ0A 4LBJA 4JRAA 3GNEA 1FMD2 1NT0A 4AI3A 2JDKA 2IXJA 4GA9A 1EAH1 4HANA 4OYUA 4UFJA 1XNAA 2J1UA 4V2WA 1Y9MA 3I2HA 4V1PA 5IUQA 2VZTA 5FZ4A 1I5PA 2V73A 4AQ2A 1G9CA 2XBO2 2VBDA 1KFUL 4H3WA 4HL0A 1W9SA 4K8RB 3ZXAC 4OQ8A 1O8SA 4ZY9A 2EF6A 5C8CC 4B1LA 3AFKA 5T3NA 3HQRA 2XJSA 1W8HA 4JHTA 3B69A 4BQ5A 2BP6A 3ZSMA 1RUC2 1DQ0A 2ZX3A 4PCRA 3RPQA 3POSA 2VCMA 3N9NA 4YM1A 1A3KA 1AR71 1KITA 1OSGA 3D0SA 3AZXA 4JKMA 5FY7A 1XNDA 3ZIXA 1AR62 2ZHKA 4XMIA 4Q0SA 3IB3A 1HB2A 3KT7A 2QQUA 5DG1A 2XG3A 3LKJA 4LOTA 4YW4A 3VBRC 4Q4V2 1SDWA 3OBRA 5KC6A 1TME3 2XL7A 1AYN1 3JU9A 5CB7A 3MBWA 4GMP0 3VDCA 3MV11 4QWNA 3CO2A 2NYYA 4OFGA 3NNLA 1W6PA 2AUYA 4BIFA 5BPXA 2UY9A 1RUE3 1OA4A 3OEBA 4HKLA 1AR91 3OPTA 1QJY1 1VE0A 1YQ5A 1L7RA 3H3ZA 5J3UA 1QJX3 2R073 3DPRA 4XCAA 2R49A 1GZCA 3AKPA 4WV8A 5F2WA 1PGSA 5F5CA 3B5LB 1F4AA 2PLV1 1X7NA 1XU2A 4XIKA 3WDWA 1Y43B 2ZGSA 2BQPA 1RUI2 4BOWA 1LEMA 3ABZA 4O9GA 3H8UA 3TNPB 5CKQA 4WVMA 1EPWA 4MOAA 1PIV1 4AE2A 4DINB 1K45A 4IGPA 1A34A 4QKNA 4FP3A 5HXMA 3O1VA 1N3PA 2R043 2BOIA 4NAOA 2HKXA 3RZJA 3RZHA 2DVBA 2DVFA 1HKDA 2C5DA 5IK4A 2NPIA 1US2A 3DEMA 1U0AA 3N9LA 1VBC2 4HKWA 1YXWA 4MGZE 4P9GA 4QB6A 4BQ4A 1ZZ9A 1PMHX 1UU4A 5H9QA 4KWUA 3N7LA 2JJ6A 1FI2A 2V4VA 1JBCA 1QJU1 1XC6A 1PHMA 2OPKA 3LIHA 4UW6A 3UL2A 1VALA 4RR3A 5DZEA 3WF3A 1Q8VA 1CR7A 1UKRA 4XC9A 2PN5A 1B35A 2RR13 1S0EA 1WD3A 3P3NA 5KHIA 2ZGLA 2AH2A 1JZ4A 4X8PA 2PMWB 2JDMA 2KM2A 4XJ9A 4NPLA 1HRI1 2RJ2A 1VBB3 2DCJA 4UFHA 3LWCA 5JUVA 1ENSA 1QNYA 1RXFA 4MZUA 4WVWA 1PGL1 1HX6A 4LBLA 5A6XA 3KSCA 5LY2A 1GWLA 5A7OA 2CSGA 1JTZX 4NUBA 2QDRA 1SFYA 2WUHA 3WG1A 3DYOA 2G4IA 3RS6A 2XJVA 4AVBA 1H6YA 1TMF3 2YC4A 4BU2A 2MEV3 1TVGA 1NKGA 2AC1A 1TNFA 1H6XA 3ES1A 5J98B 2CGNA 1IG3A 1ULCA 2K0GA 2W1QA 2FQPA 2QUOA 1XPWA 3ILFA 4MSVA 1MS5A 5FYTA 2XR4A 1RUG2 3J4UH 4OHVA 1W6PB 3MW4A 1RMU1 1W8FA 2YXSA 2W2IA 4KGGA 4XUTA 4YGEA 5F3IA 5FBZA 5L19A 4FFIA 1PZ9A 2D3PA 4DPNA 4BLJA 2QQVA 3WW2A 4QHBA 2E7TA 1FMD1 5LWBA 4Q0VA 3DPRB 1NXD1 2WQ4A 5FO7B 2DVAA 2Q8EA 3RZLA 1W8OA 4AK3A 5FP3A 2CWSA 4IERA 3BIWE 4MUVA 4A6OA 1EY2A 2YUEA 2XBO1 2CWMA 4KNCA 5C3OA 5F3CA 4WM7C 1J58A 1DBNA 1O8PA 3FX3A 4NRPA 1LOBA 3JZVA 4UFIA 4Y1UA 3TBDA 3BPZA 3NV1A 1RHI2 1W6OA 2LW8A 4WVMB 3V65A 2VW2A 3PUIA 2UU8A 3O1UA 2VZPA 3ILRA 2DYCA 1RUC1 2D7FA 4CDWA 2A6ZA 1RGSA 1D4M2 2XHKA 5DPNA 1CIYA 4GXLA 1SDDB 5EV7A 1AR61 2ZTNA 4W6WA 4O61A 2VBPA 1W8ZA 1YCIA 3LEIA 3ME2A 2JB8A 4LT5A 5IVCA 3RWNA 3N35A 2PAMA 4Q4V1 1R082 2G9GA 3VKFC 2P37A 4P02B 4PT6A 5LBBA 2X8KA 5K9YA 3G6JB 3J26N 4GAZA 1N1SA 4TSVA 3LSDA 1OOPA 4AHYA 4MX3A 1V9U3 3WNNA 5I0DA 2GC3A 1LHVA 3GHMA 4QXBA 4RR3B 3AKRA 3ZVXA 2I74A 1GZTA 5KWRA 1IS3A 2XJRA 2PLV3 1B35B 1GOHA 1WLCA 3PDQA 3U0ZA 2ADDA 4NO4A 3AKQA 5FV3A 2W46A 3ZPOA 2W1UA 2IC1A 1DHKB 1AYM2 3HNBM 5DUXA 4B4QA 4OUMA 3M7AA 2C1FA 3WHUA 3N9OA 5DUVA 4ZS3A 4CE8A 4C0HA 3NKTA 1C4RA 2VNGA 2Z2SB 3LDKA 4XQ4A 1POV1 2MNGA 5LK5A 4ATEA 3K4AA 1PVC2 4TN7A 3AVRA 5FYMA 3EO6A 4UW5A 4HVQA 1SLTA 1QY4A 2CTVA 1NG0A 2MHFA 1RL3A 2WNUA 2ZOEB 4LUKA 3RFRA 4K1ZA 1OHFA 1ZBA2 2RDRA 4FFGA 5F5QA 1W0PA 1DQ6A 1R1ZA 1YWKA 4R9DA 3U37A 2YFZA 4PIZA 4ZZ5A 4S2FA 1VBC1 3ZR6A 1CJDA 4LBOA 4Y3OA 1A8DA 4AVVA 5LA1A 2P6CA 1BMV2 1DYKA 4DXTA 3AJZA 1HXS3 4PI0A 4QGNA 4OMDA 3DYMA 1SFNA 4B3NA 3N36A 4IEZA 2DVDA 4MV2A 5G05L 5F32A 3R4UA 4IW3A 5KXCA 4Q1PA 3WF1A 3URFA 2QQKA 2W1WA 3U4SA 4MHUA 1POQA 3U75A 1H1IA 2ZX1A 1XYPA 2CV6A 2Y33A 3O0WA 2VGDA 5IT6A 5JXJA 3PU3A 1PZ8A 1QH6A 3JD71 3LGRA 3NV4A 4U2AA 5FZGA 2DVGA 2ZGUA 3ZDVA 3W5NA 1HV0A 3OGJA 3T0BA 5FZAA 2A75A 5FYIA 1COV3 4QX0A 5EYXA 3DPRC 1W6OB 2XB6C 4AVCA 1UY4A 2SBAA 3IIAA 1DDLA 4HT1T 1FV3A 3AB0A 4COZA 4CDWB 2X05A 5A80A 4FFHA 5E88A 5FO8B 4LKSA 2Z4FA 5T54A 1F31A 2JG8A 1US3A 1UPIA 3NJXA 2JE7A 4MHRA 1VBA3 1EYBA 1UYPA 5IFTA 1JYXA 4CXYA 2MPFA 1VBD2 2WINB 3DCQA 3ST7A 2IXHA 5LW9A 3I59A 3VD4A 5D21A 3D0JA 1YQCA 3H9AA 4FPKA 3KT1A 1ZA4A 4XFFA 4AHXA 2DFBA 4KQ7A 1VIWB 2GP5A 4ZS2A 2BU9A 3B9IA 5JR7B 1OOPB 3ZFGA 5FQ0A 1RUG1 4MO3M 1IG0A 1ZREA 4E8CA 4Q4X2 1Q8QA 2HJIA 3ZFFA 4AFCA 1EUUA 1H0BA 2BFUS 2VZQA 2Q5TA 1O4TA 5F5IA 4BISA 5FLJA 3K2OA 1W99A 3B01A 3DUIA 2GC0A 2VOXA 4LMFA 1WMFA 2QZ3A 1LJ7A 1KD7A 3A7QA 3SQOA 4RR3C 4CP2A 1ENRA 2QE3A 2PAEA 4QD2A 3E5QA 5DABA 1B35C 1RUC3 4B7KA 2IWGB 4UBHA 1EV12 1W2UA 4NIDA 1JZ7A 1RHI1 1IQDC 4QQLA 2ZAHA 3I2KA 1S2KA 4D0QA 4I3PA 2WNUB 2VQTA 4OI4A 2XJQA 2XONA 3QOPA 4G4FA 2ILMA 2WO2A 1CVNA 4AW7A 3POFA 2VL4A 3PHMA 3QD6A 3ZXLA 3PL0A 5C9AA 3HVDA 5ERLA 3IZOA 4XURA 1YQ2A 3HJRA 4EZ4A 1T2XA 2VBBA 2E31A 1UU6A 3KZ4C 5JOZA 1R081 4L97A 3ZO0B 4DB5A 3AP5A 4FO9A 2QQNA 5FDBA 4RGKA 5HXVA 4Y1YA 3KV9A 4SLIA 5FKCA 5FZHA 5F9TA 3RWKX 5EHDA 4XAEA 3GZAA 1KS4A 4JKLA 3MUZ1 1RUF2 4INDA 4X6QB 1BCXA 4LR4A 2HWD2 2YPDA 3WW4A 2DCYA 1VJ2A 4QHOA 3K46A 3P3PA 1AX1A 3SEPA 1S0FA 1OA3A 1UWWA 4L92A 1AYM1 5FLHA 3WY6A 4JTNA 3ZYJB 4OI0A 1D2QA 1E5SA 4PQQA 1MVQA 1GP4A 5GLZA 4ZZ8A 1ND3A 4RFT0 1LENA 1VB4A 2VZOA 3MFAA 1S0DA 1PVC1 3VZNA 3FLTA 4BMEA 4Y26A 1J84A 5E8AA 1ULDA 2R7EB 1NAEA 1IOAA 3SMHA 5IW0A 2JG8B 2ZS6B 1XJAA 4KWLA 2FD8A 1K3IA 3THPA 1YHFA 1QOSA 1VBC3 1OKOA 1WLTA 1ZBA1 3OUHA 4EN7B 3VBOA 3I59B 5D1IA 4CYDA 3RJ2X 4QX8A 1MS3A 1QWRA 2VC9A 3MUY1 4CDWC 5DG2A 3QCWA 3S7EA 1FYUA 2WYSA 5AC93 1JYTA 2A70A 4M3CF 3UYJA 4YSFA 1G9AA 4OUSA 1BMV1 3POGA 4UFKA 1DU3D 3ZFGB 5FQ0B 5FY5A 3I3DA 2ZEWA 4QKDA 3IDCB 1Z7S1 4HVRA 4IESA 4XUQA 5FZ8A 2YC2A 5C33A 3ZFFB 1TME2 1O4ZA 1QOTA 2DCKA 3JD73 2QZ2A 4ITCA 1FXZA 1VAMA 3KB5A 4JC1A 3ZOIA 2KR2A 3ZSJA 1C57A 1QXJA 3RYRA 1FT9A 1OOPC 1RUE2 5I0UA 1JS9A 1NLQA 1J83A 4GB33 2P3KA 4OI1A 1O4YA 4P9WA 3AL5A 1VPHA 1CZSA 5FPLA 1QJX2 2D97A 3ACLA 4XHXA 2D6OX 5LBCA 1JOBA 1OVSA 4AL9A 1V6OA 5FZMA 4LO5B 4RS5A 1UN1A 2OUHA 2ARCA 1IHMA 4OMCA 4GMP3 3WW3A 1MZ6A 3HN1A 4QGMA 2ZABA 2J1TA 5C9AB 1GNHA 5ABJB 4FSJA 1R093 1VBD1 2CDOA 2VPVA 4ZXKA 4HBNA 4OLLA 4RFRB 5FP7A 4FBFA 4NVPA 2R042 2WNUC 2XQRA 4YW2A 2A6XA 3T3YA 2P3JA 2R6QA 1SPPA 5FP4A 1N47A 2UYAA 1UY2A 3SC7X 3EHKA 4ONUA 5B2GB 1J1TA 2E53A 1NLSA 1NCQA 3GYDA 4N7UA 4COYA 4Q4X1 1F4HA 1DIWA 5FPXA 1WBFA 1AX2A 2QQMA 3Q8BA 2JDYA 4Y33A 3UGHA 5CFCA 3P1IA 5F1RA 5LZ6A 4AHZA 4CUAA 2IXCA 2VO5A 2DU1A 1RJ7A 3FHIB 1GFF2 4AQSA 5FCCA 3UJQA 4A44A 3S57A 1DCSA 5GALA 1XRUA 3M4FA 1GMMA 2RR12 4ZPIA 5FMCA 4M3CE 1REEA 2YBPA 4Q26A 1QOOA 1S0IA 1ND3B 4KGQA 3APBA 4ASMB 3MI8A 3SCGA 4YGDA
chains in the Genus database with same CATH topology
3KV9A 5FPAA 3KV5A 5FYCA 4CCNA 5A3NA 3DXUA 3KVAA 4LXLA 2GP3A 3NJYA 3PUSA 5FY9A 5FYVA 5FZOA 5FZDA 2XUEA 4IGQA 5A7WB 2YPDA 4URAA 5A7NA 3DXTA 3PUQA 5FYBA 5FY0A 4BXFA 3PURA 5FZKA 4Y3OA 4D6SA 3PUAA 5LY1A 4IGOA 4EYUA 5FYUA 2Q8DA 4XDOA 3KVBA 5FZ7A 5LY2A 4CUGA 5A7OA 4NUBA 5KR7A 5F32A 5A7SA 4DIQA 5IW0A 4V2WA 5FY8A 2WWJA 5K4LA 5A7WA 3U4SA 5IVFA 1VRBA 4QXHA 5FZ4A 5F2SA 4BU2A 3PU3A 5FZGA 5FP9A 5IVYA 4QX8A 2OQ7A 4QX7A 2OS2A 2WWUA 5FZAA 5FYIA 2P5BA 5FXWA 4C8DA 4CCMA 3UYJA 5CEHA 5ISLA 3AL6A 2YU2A 5FZ0A 4HONA 5FYTA 5FXVA 5A7PA 5FZFA 5F3IA 2OQ6A 2W2IA 5FY5A 5FYHA 2PXJA 5FJKA 5FZ8A 4EZHA 3N9NA 4LIVA 5FY7A 5A80A 4CCKA 5FY4A 5LWBA 5IVJA 4XDPA 5E6HA 5A7QA 2Q8CA 4GJZA 2YBKA 2Q8EA 5FY1A 5FP3A 5FZIA 3KV6A 5LW9A 5A3WA 5FXZA 5F3CA 2VD7A 5IWFA 2OX0A 3AL5A 5FZ9A 2XDVA 3PU8A 5FPLA 5FP8A 2GP5A 3N9QA 4QWNA 5FJHA 5FPBA 3KV4A 5IVVA 2XMLA 5FPUA 3N9MA 5FZMA 3PTRB 3OPTA 4QXCA 5FUPA 5A3TA 4CSWA 3RVHA 3N9PA 5A1FA 4E4HA 5FPVA 5F5IA 4BISA 4D6RA 5F2WA 5FYYA 3K2OA 5FZCA 5F5CA 2XXZA 5F39A 5FXXA 5FZBA 4GJYA 5IVCA 5FYZA 5FP7A 4DO0A 2YBSA 4HOOA 3K3NA 5A3PA 5FZ3A 3U78A 5A1LA 5FWJA 5FZLA 4GAZA 4UF0B 5FP4A 3ZLIA 4CCJA 5FUNA 5FZ6A 4LITA 5FBJA 4ASKA 5F3GA 4LIUA 5FWEA 4QXBA 4IGPA 5FZOB 4CCOA 4D6QA 4Y33A 4V2VA 4TN7A 3PDQA 5FZEA 4CCLA 5FV3A 5FZ1A 2OT7A 3K3OA 5F3EA 3ZPOA 5F37A 5FYMA 3N9LA 4AI9A 4EZ4A 5FYSA 3LDBA 3N9OA 3OPWA 2YU1A 5IVEA 3LD8A 4UF0A 4GD4A 2YBPA 5IVBA 5ANQA 4AAPA 4QU1A 3AVRA 4Y4RA 5F5AA 3AVSA 5FZHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KV9 A;  5FPA A;  3KV5 A;  5FYC A;  4CCN A;  5A3N A;  3DXU A;  3KVA A;  4LXL A;  2GP3 A;  3NJY A;  3PUS A;  5FY9 A;  5FYV A;  5FZO A;  5FZD A;  2XUE A;  4IGQ A;  5A7W B;  2YPD A;  4URA A;  5A7N A;  3DXT A;  3PUQ A;  5FYB A;  5FY0 A;  4BXF A;  3PUR A;  5FZK A;  4Y3O A;  4D6S A;  3PUA A;  5LY1 A;  4IGO A;  4EYU A;  5FYU A;  2Q8D A;  4XDO A;  3KVB A;  5FZ7 A;  5LY2 A;  4CUG A;  5A7O A;  4NUB A;  5KR7 A;  5F32 A;  5A7S A;  4DIQ A;  5IW0 A;  4V2W A;  5FY8 A;  2WWJ A;  5K4L A;  5A7W A;  3U4S A;  5IVF A;  1VRB A;  4QXH A;  5FZ4 A;  5F2S A;  4BU2 A;  3PU3 A;  5FZG A;  5FP9 A;  5IVY A;  4QX8 A;  2OQ7 A;  4QX7 A;  2OS2 A;  2WWU A;  5FZA A;  5FYI A;  2P5B A;  5FXW A;  4C8D A;  4CCM A;  3UYJ A;  5CEH A;  5ISL A;  3AL6 A;  2YU2 A;  5FZ0 A;  4HON A;  5FYT A;  5FXV A;  5A7P A;  5FZF A;  5F3I A;  2OQ6 A;  2W2I A;  5FY5 A;  5FYH A;  2PXJ A;  5FJK A;  5FZ8 A;  4EZH A;  3N9N A;  4LIV A;  5FY7 A;  5A80 A;  4CCK A;  5FY4 A;  5LWB A;  5IVJ A;  4XDP A;  5E6H A;  5A7Q A;  2Q8C A;  4GJZ A;  2YBK A;  2Q8E A;  5FY1 A;  5FP3 A;  5FZI A;  3KV6 A;  5LW9 A;  5A3W A;  5FXZ A;  5F3C A;  2VD7 A;  5IWF A;  2OX0 A;  3AL5 A;  5FZ9 A;  2XDV A;  3PU8 A;  5FPL A;  5FP8 A;  2GP5 A;  3N9Q A;  4QWN A;  5FJH A;  5FPB A;  3KV4 A;  5IVV A;  2XML A;  5FPU A;  3N9M A;  5FZM A;  3PTR B;  3OPT A;  4QXC A;  5FUP A;  5A3T A;  4CSW A;  3RVH A;  3N9P A;  5A1F A;  4E4H A;  5FPV A;  5F5I A;  4BIS A;  4D6R A;  5F2W A;  5FYY A;  3K2O A;  5FZC A;  5F5C A;  2XXZ A;  5F39 A;  5FXX A;  5FZB A;  4GJY A;  5IVC A;  5FYZ A;  5FP7 A;  4DO0 A;  2YBS A;  4HOO A;  3K3N A;  5A3P A;  5FZ3 A;  3U78 A;  5A1L A;  5FWJ A;  5FZL A;  4GAZ A;  4UF0 B;  5FP4 A;  3ZLI A;  4CCJ A;  5FUN A;  5FZ6 A;  4LIT A;  5FBJ A;  4ASK A;  5F3G A;  4LIU A;  5FWE A;  4QXB A;  4IGP A;  5FZO B;  4CCO A;  4D6Q A;  4Y33 A;  4V2V A;  4TN7 A;  3PDQ A;  5FZE A;  4CCL A;  5FV3 A;  5FZ1 A;  2OT7 A;  3K3O A;  5F3E A;  3ZPO A;  5F37 A;  5FYM A;  3N9L A;  4AI9 A;  4EZ4 A;  5FYS A;  3LDB A;  3N9O A;  3OPW A;  2YU1 A;  5IVE A;  3LD8 A;  4UF0 A;  4GD4 A;  2YBP A;  5IVB A;  5ANQ A;  4AAP A;  4QU1 A;  3AVR A;  4Y4R A;  5F5A A;  3AVS A;  5FZH A; 
#chains in the Genus database with same CATH topology
 3KV5 A;  1EV1 1;  3VBS A;  3M3E A;  1VBB 2;  3I97 A;  3ZXG A;  3VL8 A;  2VMI A;  3ACF A;  3VBF A;  1D4V B;  2XUE A;  2AYH A;  1MS8 A;  3MO4 A;  2WT1 A;  1XNB A;  4LOS A;  1UKG A;  3WG2 A;  3GHN A;  3VD7 A;  1BJQ A;  3VBO B;  4LK7 A;  1C5I A;  4UW3 A;  4BQ1 A;  4EE2 A;  2IXK A;  4XF1 A;  5J48 A;  1V6I A;  4HFS A;  1UY1 A;  3AP6 A;  2JG8 C;  2LUW A;  1TMF 2;  2ZX2 A;  3CJI B;  3OOX A;  4A6S A;  2MEV 2;  2JE8 A;  1W9Y A;  3HQU A;  4IL7 A;  2HWE 1;  4W8J A;  4E27 A;  2LS6 A;  1MZE A;  1MVE A;  4Q0P A;  5KR7 A;  4XXP A;  4AI0 A;  2VZ3 A;  2PQQ A;  2OVU A;  1WBL A;  3H7Y A;  1RUF 1;  5F2S A;  1V6L A;  2HWD 1;  5K8S A;  4JAA A;  4UBG A;  2WA4 A;  1HV1 A;  4K8F A;  4FPO B;  2VTF A;  5EXO A;  3ZFG C;  4IEX A;  4B4P A;  1O3T A;  3THT A;  1ULO A;  3ZYF A;  2WYF A;  2EAK A;  3ZFF C;  4MLO A;  2YC0 A;  1PVC 3;  5CEH A;  1LOG A;  4K40 A;  3MGU A;  1DZR A;  2TBV A;  2VOW A;  1AZD A;  2OKX A;  3EMR A;  2GNM A;  3RNS A;  1SEF A;  2R30 A;  1ND2 A;  3OCP A;  4RS5 B;  4IEP A;  3K4Z A;  1LGN A;  3BTY A;  4PBO A;  1LOD A;  3KQ4 B;  1YFW A;  2RS1 3;  1J3Q A;  1F5J A;  1FAY A;  1NA1 A;  3Q8E A;  4AFB A;  2V09 A;  1DGW A;  2D6K A;  4XAB A;  3MZH A;  3GAL A;  4EQV A;  5EQU A;  1Z7S 3;  1LNS A;  4M0N A;  3VDA A;  1SPP B;  4N9I A;  2VNO A;  2IUW A;  3SH5 A;  5C9A C;  4ZHN A;  4JHZ A;  2BOJ A;  1W28 A;  1NCQ B;  2UYB A;  3PTY A;  1AF9 A;  4AEJ A;  5EFU A;  4DEQ A;  1UX6 A;  2J42 A;  2VTX J;  3MPB A;  1UW8 A;  2F4P A;  3T2T A;  1KDM A;  1L7Q A;  1TME 1;  2CYF A;  4KBB A;  1AL2 3;  5CFC B;  3NST A;  1OH3 A;  1ZZC A;  3AMM A;  3MPP G;  4Y5S A;  3MDP A;  2EA7 A;  3ACH A;  1V9U 2;  3BU7 A;  4RL7 A;  5FZB A;  4NRQ A;  1LOA A;  1RUE 1;  4FPH A;  4XFB A;  4LKF A;  4QKB A;  1XE0 A;  2PLV 2;  3MF6 A;  2GNT A;  1QJX 1;  1OF3 A;  5FZ6 A;  5SV5 A;  3ZDS A;  1D0H A;  5J7M A;  1SZB A;  4LIU A;  3VBS B;  4IE0 A;  5SV8 A;  1O7F A;  2JEC A;  2X09 A;  2JWP A;  3VBF B;  1R1A 3;  2VMD A;  3H1W A;  4A41 A;  2J1V A;  3PMS A;  3BGA A;  1OQE A;  3VZL A;  1GKB A;  1JU4 A;  1ND3 C;  2FDK A;  2CNA A;  2KXL A;  4LE4 A;  1BYH A;  4X8N A;  1CAV A;  1ZNP A;  1XBF A;  4I09 A;  4QX1 A;  2CL2 A;  2VW0 A;  1HQW A;  1W9F A;  3QBQ A;  4N53 A;  1ZRI A;  4GD4 A;  2XQX A;  4GAL A;  3LE0 A;  2IVJ A;  3AVS A;  3SKJ E;  3VBO C;  3ETQ A;  3FLP A;  1GOF A;  3FBY A;  1FX5 A;  1LUL A;  3L9J T;  2Q8O A;  1YNA A;  3WNM A;  3ZR5 A;  1STM A;  3DKW A;  1JUH A;  4AVS A;  3TRS B;  1HXS 2;  3RGB A;  2VQA A;  1RJ8 A;  2VVF A;  5LA9 A;  3GZE A;  1CON A;  4P5H A;  2Q1Z B;  5L7O A;  1H2L A;  3PJQ A;  1IKQ A;  5CIR A;  1SCS A;  3WT3 A;  1HLC A;  1RUO A;  1U5Z A;  4Q0Q A;  1ZRD A;  1V0A A;  3N4M A;  2RR1 1;  1W06 A;  4XDO A;  3KVB A;  4G9S B;  4HVO A;  1G86 A;  2Z79 A;  4Q4Y 2;  4CUG A;  3H3L A;  4XET A;  3UGG A;  4JGY A;  1HB1 A;  1K5M A;  3N7J A;  1COV 2;  1ND2 B;  1NQD A;  2YZ4 A;  4YW1 A;  1VBB 1;  1M06 G;  2VOT A;  5A7W A;  2ZEY A;  2RJL A;  2QFE A;  1RXG A;  4CPB A;  4DRR A;  4QKF A;  1NA1 B;  3T2O A;  1DQ2 A;  3RYK A;  2BV4 A;  3FFZ A;  3LCP A;  4JDM A;  2YMZ A;  1AXZ A;  2P5B A;  4C8D A;  3PME A;  5CIS A;  2HWE 3;  4RS5 C;  4UI9 L;  5GLT A;  1VBA 2;  3O7O A;  1MQT A;  1E5R A;  3S5Q A;  3F95 A;  3U11 A;  1KFX L;  1TMF 1;  2B4K A;  2MEV 1;  5FJK A;  4FPG A;  1JN2 P;  4OZX A;  4QGL A;  2W87 A;  2HWD 3;  1AXY A;  1BLZ A;  1F5F A;  3U4X A;  3BN6 A;  4YG0 A;  1UIK A;  4AFD A;  5JSP A;  4IEV A;  3KV6 A;  5LA2 A;  5KHJ A;  3MW2 A;  2ARB A;  1DGW X;  4Z1V A;  1ULG A;  5IWF A;  1AR8 1;  1NCQ C;  2F4L A;  3VKN A;  4CEW A;  2XWB B;  2RE9 A;  5JMC A;  3AC0 A;  4XXA A;  3ZXJ A;  4Z2W A;  4YZ1 A;  5CFC C;  1S0B A;  5CA6 A;  3JCI A;  3LSE A;  5EWS A;  5JCT A;  2XML A;  3O1O A;  1H9P A;  2QVS B;  2OA2 A;  3MYX A;  4L0P A;  1W0O A;  1O5L A;  4P00 B;  1LR5 A;  3PTR B;  2NP0 A;  2VVD A;  1W8T A;  1U12 A;  3FHQ A;  3S0M A;  4E4H A;  2ZCW A;  1F35 A;  4QPY A;  1Y9G A;  4YGC A;  4E9K A;  4L2N A;  2PQS A;  2Y8K A;  4NRO A;  1CAV B;  5DZG A;  4LE3 A;  5FKB A;  3ZSK A;  1MS9 A;  4DO0 A;  3VBS C;  2D5F A;  2QQW A;  1XSR A;  1JYN A;  1ODM A;  5FZ3 A;  5FWJ A;  3VBF C;  3RI9 A;  4N53 B;  2GC2 A;  1Q3E A;  4CUC A;  4GKX A;  4LIT A;  4ASK A;  4LA3 A;  3VLB B;  1OMI A;  5IAX A;  1OBN A;  1OI6 A;  2JEM A;  1W8W A;  5EP9 A;  3POW A;  2VZ1 A;  3OUJ A;  3JQW A;  2VUC A;  5A32 A;  5BNO A;  4S2H A;  3ASI A;  5F8P A;  3WIN E;  3A22 A;  2JDZ A;  3WF0 A;  4AGV A;  4URT A;  1CAX B;  1Y4W A;  1GNY A;  1V9U 1;  5BY5 A;  5L7O B;  3RYP A;  3M3O A;  2YHJ A;  5EPA A;  2WS9 2;  2ZZJ A;  5FFO C;  1MS4 A;  2X53 S;  5HV4 A;  4D8M A;  2WKK A;  5GZC A;  3I2O A;  2ET7 A;  4ZU7 A;  1ULP A;  3IMN A;  1X9P A;  4GWJ A;  1OH4 A;  4JGY B;  5F7U A;  3OGR A;  1K5M B;  5FY9 A;  5HI0 A;  3GCX A;  1LB2 A;  5FYV A;  4BQ3 A;  4QDR A;  3H8R A;  5FTT C;  5A7W B;  2D44 A;  2RS5 3;  2Y6H A;  1KJR A;  2F6B A;  1ZVF A;  3AMN A;  1UCX A;  2J1E A;  3PUQ A;  2VOV A;  1G9B A;  2WBK A;  3X29 B;  3VKO A;  1VMF A;  4DMI A;  3T1L A;  4OI2 A;  2W47 A;  2FZ2 A;  1ND2 C;  3ALQ A;  4NHK A;  3H1Y A;  4LBQ A;  3WCR A;  4AFA A;  4XAA A;  2HWB 3;  1MQT B;  1Q8P A;  4L8Q A;  4CEY A;  4P9Y A;  1ZRF A;  1BEV 3;  3B02 A;  3NMB A;  1TNR A;  4D7T A;  2XJP A;  3BYW A;  4JDN A;  5C4W A;  1WW4 A;  3BOW A;  1IZ3 A;  3OBA A;  3CQO A;  5AC9 2;  3UKN A;  3III A;  4PI2 A;  2B9V A;  3Q8F A;  1CWP A;  2LAL A;  3GJA A;  1HXS 1;  4FPC A;  4A42 A;  2HEV F;  4XAC A;  3WF2 A;  3AJY A;  1BZW A;  5JOW A;  2DUQ A;  4JCK A;  1G7Y A;  2OQ7 A;  1GSL A;  1PNG A;  1UQX A;  2R06 3;  4CEW B;  3JD7 2;  3LEM A;  2W52 A;  3ON7 A;  4BQX A;  4DUW A;  5CAZ A;  1O3Q A;  3NNJ A;  3RJR A;  1NY7 2;  4BZ4 A;  4QPG A;  2XLA A;  3KF3 A;  4GB3 2;  4L9B A;  4NN0 A;  3AYE A;  1VRH 1;  4FT8 A;  5TSW A;  4Q27 A;  4Q4Y 1;  5H9S A;  2BGC A;  1A8M A;  5T5O A;  2R1B A;  3C7O A;  1AJK A;  3TEW A;  3ZN6 A;  1APN A;  1COV 1;  1SCR A;  2WLQ A;  2YBK A;  3NWK A;  4CDQ A;  1TEI A;  2KA3 A;  4DXR A;  4UFM A;  2VM9 A;  2C9A A;  3VZK A;  5GZD A;  1GOG A;  1NXM A;  4YM0 A;  5DZF A;  1QXR A;  3WDT A;  4L99 A;  1RUN A;  1S0G A;  4PJY A;  4XJU A;  5IAT A;  3T30 A;  2DDU A;  3NJZ A;  3TAY A;  4OVE A;  4HSL A;  2G1M A;  2F17 A;  1VBA 1;  1R09 2;  2R0F A;  3AKS A;  1H4G A;  1LOF A;  2B5H A;  3NQH A;  4F3J A;  4YRD A;  5A32 B;  5BNO B;  5CKN A;  3C7G A;  3PLQ A;  4NMI A;  5FPV A;  3I2G A;  4N53 C;  1AR8 3;  3LB9 A;  4CPB D;  1DG6 A;  1MS0 A;  5IK7 A;  1YIF A;  1YQ8 A;  3U10 A;  2XXZ A;  2DUO A;  2GH2 A;  1OLQ A;  3ETP A;  2FDI A;  3UJO A;  3JQX A;  3UET A;  3U78 A;  5LA0 A;  3KHB A;  4XFC A;  5I91 A;  1OC1 A;  1Y3T A;  3RZG A;  3M3I A;  4UAP A;  5EJZ B;  3KS7 A;  4KH9 A;  1G8W A;  5AVA A;  1A6C A;  2ZGN A;  5IFP A;  3VKM A;  2O14 A;  1GAN A;  1UO9 A;  3I8T A;  1TE1 B;  2O0O A;  3I2J A;  1A78 A;  1F9K A;  5L7O C;  1AUY A;  1DZQ A;  1W6M A;  2CAV A;  2YGM A;  2Q1M A;  3AXE A;  4K1Y A;  5L73 A;  2VZS A;  4Y20 A;  2H6B A;  4Y24 A;  4D6Q A;  5A3M A;  5IK5 A;  2UWB A;  3JB4 C;  5KXE A;  2PAK A;  3ROU A;  4CCL A;  5I0R A;  4HG6 B;  3J9S A;  3O1P A;  3DV8 A;  2CGO A;  4AI9 A;  3BIE A;  1RUD 3;  3AMH A;  2D6L X;  2D93 A;  2JD4 A;  3LDB A;  1K5M C;  4KG0 A;  4YVS A;  2B8M A;  4LBQ B;  2VMH A;  2DUR A;  1XQN A;  2BWA A;  2PHW A;  1LES A;  4CEY B;  5L9V A;  2WA3 A;  1KDK A;  3ENR A;  1IPS A;  3POJ A;  3WR0 A;  3QH6 A;  1PM4 A;  1WCU A;  2VMC A;  4BYY A;  5C4W B;  1BVV A;  1MZF A;  5FZO A;  2VEC A;  5K7P A;  4BA6 A;  4QM8 A;  1UYX A;  1H2M A;  1MQT C;  4HN1 A;  4BXS V;  4JV4 A;  4MGI E;  5FYB A;  5GJ6 A;  5BNQ A;  2ZGK A;  3JBG 2;  1QKQ A;  2J1S A;  2FDJ A;  3HBK A;  3FJS A;  5GZG A;  1YI7 A;  5FUI A;  1WZX A;  1ULF A;  4AI2 A;  3W21 A;  3WD5 A;  4EWD A;  3IAP A;  3EJK A;  2DTY A;  2WS9 1;  2WDB A;  1UZV A;  2Y6F A;  1AVB A;  4JTO A;  5FYU A;  1JZ8 A;  5FK8 A;  4QPG B;  4UYB A;  1W2A X;  5GKA C;  2HWF 1;  4FQZ A;  4FFF A;  3LOB A;  1YFY A;  2OZJ A;  2E6V A;  3HQX A;  3CKH A;  3USU A;  5B4X A;  1WME A;  2RM2 3;  4CEW C;  1W39 A;  3SCF A;  3ZKU A;  2WWJ A;  3ZN6 B;  1WKY A;  4CDQ B;  1ZBE 3;  2ZAA A;  4LUM A;  3POI A;  3QAC A;  5FP9 A;  4W50 A;  5A6Q A;  2WZR 3;  4JGZ A;  3N7K A;  2ZKN A;  2ZX0 A;  4C1X A;  2Z69 A;  1GIC A;  1WCK A;  2YPJ A;  2WWU A;  4JDO A;  1W90 A;  4XUN A;  3SH3 A;  4NRM A;  2CDP A;  1HDK A;  3T4H B;  2VTX A;  3AL6 A;  3I2I A;  4PDW A;  2RS1 2;  1I5Z A;  4S2D A;  4ES8 A;  1SBF A;  2TEP A;  3OUI A;  4YZ3 A;  5FYH A;  1CQ9 A;  3HNM A;  1PX3 A;  3W5M A;  1WW6 A;  5J36 A;  4AG4 A;  4AWD A;  3CZU A;  1EP0 A;  1H8V A;  1Z7S 2;  4IV1 A;  4NPR A;  4ARY A;  5IVJ A;  5AC9 1;  1X82 A;  1H8T A;  3WP3 A;  1FNY A;  1OQD A;  3Q9O A;  4RN5 A;  5KC5 A;  2WZE A;  3OBT A;  5FZ9 A;  4LBQ D;  5BNO C;  1LOC A;  1AL2 2;  1VRH 3;  3MHZ A;  1Q8S A;  2CGP A;  4Q4Y 3;  3LEG A;  4L11 A;  1NY7 1;  2EXJ A;  2R16 A;  4FXK B;  4BQY A;  4BWO A;  1NZI A;  3BUC A;  4GB3 1;  3VV1 A;  2FCV A;  2EXI A;  2W95 A;  2XWJ B;  3UKV A;  1W6M B;  1DLL A;  4COV A;  5JZG A;  3V56 A;  1WW7 A;  5FRE A;  4Y20 B;  2AR6 A;  3LFI A;  5JWP A;  2WLP A;  4CCC A;  3WSO A;  2NMO A;  4IE4 A;  1IKP A;  2W1S A;  4HOO A;  1CN1 A;  3KWV A;  4YVS B;  1R1A 2;  2Y6J A;  1BKZ A;  4R4Z A;  3WDX A;  5T55 A;  4JRL A;  3VHN A;  1MEC 3;  1OPM A;  3HWJ A;  5FUN A;  4GMP 1;  1QXP A;  3DKQ A;  1PMI A;  3L2Y A;  3ES4 A;  1PGW 2;  2BVB A;  1PX4 A;  3NJV A;  1R09 1;  3TOJ A;  3ZYH A;  1QQP 2;  2SLI A;  2Y0O A;  1QGL A;  3NV3 A;  5FZO B;  2A71 A;  1ZYB A;  4TTG A;  3AFG A;  2WZP P;  2VJX A;  2BDR A;  5CVR A;  4IV3 A;  2WQZ C;  1Q5O A;  5FZ1 A;  4H7L A;  4UT5 A;  1GQG A;  2B39 A;  2EAL A;  3GXU A;  5C4W C;  1LCL A;  5JI7 A;  5LAT A;  4ZU4 A;  3PUH A;  2BBA A;  2FBE A;  5LEJ A;  2R32 A;  2PHU A;  2JKX A;  2Q1F A;  3PJY A;  4IEO A;  2WNE A;  1W2T A;  4K21 A;  4XFA A;  2VMG A;  4PF5 A;  4U36 A;  2ZEZ A;  2G19 A;  1CJP A;  3QH7 A;  5A3N A;  4S2G A;  1RUH 3;  5LY1 A;  1Y7B A;  1OPO A;  1UZZ A;  1DF0 A;  2WQ8 A;  2EIC A;  3NJY A;  3PUS A;  4CP9 A;  2JD9 A;  3USU B;  5FZD A;  5JIA A;  1KEX A;  3ZYG A;  4QQ2 A;  1XE8 A;  4JVA A;  3ELN A;  2I07 B;  5E1R A;  4KI5 M;  5GLW A;  4ISQ A;  3TWI A;  1RC6 A;  2P6H A;  2A3Y A;  4A7K A;  4Q0U A;  1X50 A;  3AZZ A;  4B8E A;  4QPG C;  3FHA A;  4JGZ B;  3UES A;  4XF3 A;  1GWK A;  3VUO A;  5FZK A;  3SIT A;  1VAK A;  3H8X A;  2QQJ A;  1ALY A;  1UZW A;  2YYO A;  2CU5 A;  5ABJ A;  5KHK A;  3AMP A;  1E57 A;  5A6Z A;  4PDW B;  2ZGO A;  3POB A;  3C7F A;  5FZ7 A;  4CDQ C;  1ASJ 3;  3TYJ A;  1TZO A;  3EYP A;  3GF6 A;  3NNG A;  1O59 A;  3TNQ A;  4QX5 A;  4XVH A;  1UXZ A;  4CU8 A;  2HWE 2;  4IV1 B;  1VRB A;  3JXS A;  3VBH A;  5C3Q A;  1H8T B;  1Q8O A;  1BXH A;  2RS3 3;  1DLC A;  4TZD A;  2NN8 A;  1NX9 A;  2WAO A;  2WS9 3;  2OS2 A;  1LOF C;  2E33 A;  3JBG 1;  1YIP A;  3GM8 A;  4HZF A;  2HWF 3;  2RDQ A;  3N3H A;  2ZGM A;  5FOB B;  3OBZ A;  5C3P A;  3IT8 A;  3AZY A;  4PHZ A;  4LO8 A;  1LU2 A;  3D4K A;  4YYO A;  3M3C A;  5CZK A;  5FRA A;  3M8L A;  3HT2 A;  1FOD 3;  3MLL A;  4LIV A;  1SMV A;  5JZG B;  3I7D A;  4AGR A;  5I0T A;  4RYD A;  2ZA9 A;  1KS5 A;  2C26 A;  1UF2 C;  2NZ9 A;  4LJH A;  4E2Q A;  1WCD J;  3H1M A;  4CDU A;  5FY1 A;  4AXO A;  1JH5 A;  4LBN A;  1MZ5 A;  2Y26 A;  3P5B A;  4HN0 A;  4BCU A;  2ZGP A;  2VD7 A;  4H55 A;  4ASL A;  5BYN A;  1C5H A;  1UL9 A;  5CG9 A;  4IE6 A;  4UOJ A;  2XJU A;  3PU8 A;  4TLG A;  2J1A A;  2HEW F;  3AYD A;  3VL9 A;  3N9Q A;  1X8M A;  3GBG A;  1UOG A;  2ZEX A;  2XVL A;  3VGI A;  2RS1 1;  3KGZ A;  4AVA A;  5GZF A;  3ZX7 A;  2L9L A;  1WLW A;  4QXC A;  3CJI A;  4WM8 A;  5A3T A;  5E16 A;  1YEW A;  2BYV E;  2IXI A;  4K9S A;  1CPM A;  1U5I A;  4Y5T A;  4I30 A;  4IV3 B;  4XOG A;  4XBN A;  4D6R A;  4DOU A;  4BQW A;  5A70 A;  5FZC A;  4LKE A;  1I6X A;  4Y1V A;  3ZIW A;  3HIF A;  5IYY A;  2VNR A;  5DN2 A;  1W03 A;  2Z5W A;  2VOK A;  3VDB A;  3NVC A;  2E7A A;  4YFZ A;  3LFM A;  4CU9 A;  3OF1 A;  1XYO A;  1KQR A;  2ES3 A;  2ZMK A;  1AL2 1;  2GN7 A;  4XW3 A;  5FBJ A;  1O5U A;  3AZW A;  4CUB A;  1XYN A;  1T6G C;  4D69 A;  4FQ4 A;  1BK1 A;  4XMA A;  5H9P A;  4AQ6 A;  4CP9 B;  1CPN A;  1PNF A;  2OPW A;  3T2P A;  2DFC A;  2VXJ A;  1K5J A;  4CA9 A;  4LHS A;  1RUJ 1;  5JOY A;  1HN0 A;  3D8C A;  3K3O A;  4WVZ A;  4DRV A;  1SBD A;  4D7Y A;  1UMI A;  2V5D A;  1CES A;  2WFF 3;  3O0X A;  1SQ4 A;  4P9X A;  4UXA A;  5F6K A;  5HCF A;  3KGL A;  1LGC A;  4YAR A;  1QJE A;  3I3E A;  2RS5 2;  3OB8 A;  2H0B A;  3LZZ A;  1R1A 1;  1DQ4 A;  2RHP A;  3I3M A;  2VY0 A;  3VZO A;  3WX5 A;  3GDB A;  2B9U A;  3WV6 A;  3INA A;  5JMO A;  5FYC A;  4NWV A;  2W9X A;  4Y1X A;  1OUR A;  4LHK A;  4GQ7 A;  4JGZ C;  5CFD A;  5DDJ 1;  3T2Q A;  1PGW 1;  3LA7 A;  4Z82 A;  3M1H A;  1O6U A;  1QQP 1;  2PHX A;  5HCA A;  4MGK E;  2HWB 2;  4H14 A;  1UOJ A;  2ADE A;  2C9K A;  2FMY A;  4HK9 A;  4PDW C;  3VBH B;  1IPK A;  1GLH A;  4N43 A;  4W6Y A;  3OSD A;  1BEV 2;  5FY0 A;  4AED A;  4AFM A;  1WWY A;  1GYK A;  5H9R A;  2AEZ A;  1UD1 A;  2B46 X;  2V72 A;  3T09 A;  2GU9 A;  2X5I A;  5JXI A;  4IET A;  4B29 A;  4IV1 C;  4IGO A;  2Q8D A;  3IBM A;  3SKV A;  5GM0 A;  4JQR A;  4G3Y C;  1H8T C;  3S6P A;  4CCD A;  1JMU B;  4QMA A;  2R06 2;  4DIQ A;  3E6B A;  2OW4 A;  4YNI A;  2ZHN A;  3UV9 A;  5FY8 A;  5K4L A;  1ZRC A;  1NZC A;  2OZ6 A;  5LRS A;  4CDU B;  5A33 B;  1NUK A;  5IVY A;  3BB6 A;  1RVF 1;  4CP1 A;  1UY0 A;  3O5S A;  5JZG C;  5FR3 A;  1ENQ A;  4WZC A;  5FXW A;  1IGO A;  2ZXQ A;  3ZSE A;  4HXC A;  2BNO A;  3VZM A;  1LHW A;  3J8F 3;  5FXV A;  2P4E A;  5FZF A;  2QTW B;  4YLZ A;  2B7Y A;  4QB1 A;  5FMB A;  5T5L A;  3BTA A;  4P9I A;  4NIA A;  1VBE 3;  4WM8 B;  2YB7 A;  5A7Q A;  1W04 A;  3ACI A;  5JR2 A;  4GJZ A;  2VZU A;  3JBG 3;  4EWA A;  3NO8 A;  4LEJ A;  4MH0 E;  3TB0 A;  2A6V A;  1RIT A;  4XHB A;  1OT5 A;  3PVN A;  4LKD A;  5I0S A;  5FXZ A;  3E6D A;  3TEX A;  3WQ0 A;  4GKY A;  3T08 A;  1CZV A;  4QM9 A;  1V6K A;  3WP6 A;  1DQ5 A;  2NQY A;  4LTA A;  1AR8 2;  1HQN A;  1QMJ A;  1YI9 A;  4IV3 C;  2WJS A;  4YW5 A;  1YRZ A;  2ENR A;  2K2S A;  1JYI A;  1PO2 1;  4AI8 A;  4H7M A;  2ZPX A;  1OLR A;  4A2U A;  3KD4 A;  3N9P A;  4YWA A;  5AFB A;  4QU2 A;  2GDF A;  5FYY A;  2Y38 A;  4PLN A;  1OVP A;  3W9A A;  5F39 A;  5FXX A;  2PEL A;  4GJY A;  5FYZ A;  1CZT A;  1WA6 X;  4QPI A;  5A3P A;  1Z0H A;  3RSJ A;  3C7E A;  4LHN A;  2ZJC A;  4K7J A;  2JG9 A;  3R6S A;  4J1W A;  1RUD 2;  5CFD B;  1IS6 A;  1AHS A;  4FI9 A;  4XE9 A;  3CL1 A;  2EIG A;  4EN6 B;  5ABJ C;  2JIG A;  3T0A A;  3OJB A;  1PO1 3;  1V00 A;  4CDX A;  1SG3 A;  4N43 B;  4AED B;  2XKO A;  1MR5 A;  2BVV A;  3WCS A;  2FZ1 A;  4RGG A;  5ACA 3;  5DAQ A;  3H42 B;  2X5I B;  3B93 A;  5IVE A;  4XF9 A;  1OD3 A;  2A7A A;  4MET A;  4XUO A;  5DAX A;  4AEK A;  4CU7 A;  4MG2 A;  2WNV A;  1WA4 A;  1BK0 A;  1D0G A;  3VBH C;  2XLF A;  2BGO A;  4QU1 A;  4SBV A;  5JVV A;  1GR3 A;  5E89 A;  1H2N A;  4W6X A;  2GP3 A;  1JYW A;  1RUJ 3;  4YG6 A;  3J7N A;  2WAB A;  1XE7 A;  2VR4 A;  3KF5 A;  4URA A;  4UW4 A;  3WEZ A;  1W6N A;  4M0H A;  4XTM A;  2R0H A;  2ZGT A;  3PNA A;  1S4C A;  2RM2 2;  3WP5 A;  2ID4 A;  2YG0 A;  2WT2 A;  3L2H A;  2ZKL A;  3AP7 A;  3RMX A;  2EIE A;  1WGP A;  1ZX5 A;  1ULE A;  2AEN A;  4EYU A;  3ILN A;  4UFL A;  2RS5 1;  1ZBE 2;  5DDJ 3;  4LO7 A;  4BH9 A;  4CDU C;  1QQP 3;  2WWS A;  4JQT A;  2QBX A;  4YM3 A;  2WZR 2;  1I3H A;  3HOB A;  2QKD A;  1LEC A;  1H1A A;  2E9Q A;  2Q0A A;  1OUX A;  5BXX A;  4D94 A;  1JYV A;  2YRO A;  2Y6L A;  4ATF A;  2ZBJ A;  3AYA A;  3OG2 A;  2P3I A;  2BW8 A;  4I02 A;  3ZMO A;  3EQE A;  4YZ5 A;  2HWB 1;  3OGV A;  5DAW A;  3S30 A;  3O1M A;  4XFI A;  1QH7 A;  2A73 B;  1BEV 1;  2Y64 A;  3KCY A;  5EJ3 A;  3BCW A;  4AHW A;  3A0N A;  3CJI C;  5JDB A;  4IEW A;  3KM5 A;  2VQU A;  1CAX A;  1OUS A;  4OHW A;  5L9B A;  3IWZ A;  4NHM A;  1C1F A;  3WVJ A;  4KMQ A;  2ZGR A;  4ES9 A;  4D7S A;  4RA0 A;  4EV0 A;  4TXW A;  4TYS A;  3MW3 A;  1OLM A;  4ORF A;  3VN4 A;  3W59 A;  4FPY A;  4CCK A;  2NLR A;  2R06 1;  2JX9 A;  1WLD A;  1VRH 2;  3GCW A;  4KWJ A;  4XDP A;  4COU A;  1RVF 3;  2Q8C A;  1Y9Q A;  4I01 A;  1I1E A;  1BQP A;  1OQ1 A;  2A3W A;  3AX4 A;  3UGF A;  2UY8 A;  1ST8 A;  1C8N A;  3ZN5 A;  4QPI B;  2OX0 A;  1S0J A;  1NOV A;  1H9W A;  4WM7 A;  2EXH A;  3ZM8 A;  1JZ2 A;  1OXC A;  3FL7 A;  4OCT A;  5GLV A;  2JG9 B;  2CHH A;  3ZXD A;  3BTZ A;  3NNM A;  3GBF A;  5APA A;  5CYY A;  2ARE A;  1UIJ A;  1VLN A;  2E63 A;  2W91 A;  3ACG A;  5ANN A;  3WZ1 A;  1W3V A;  3RVH A;  3NL1 A;  4B7E A;  2PA7 A;  3BOD A;  1MEC 2;  3R4D B;  4CDX B;  4FOV A;  4M4P A;  3N7M A;  3UK9 A;  3DL3 A;  4BM8 A;  5L36 A;  4XUP A;  1HRV 2;  4BJ0 A;  5CFD C;  5FO9 B;  3WNK A;  4BHP A;  2VUJ A;  3DN7 A;  3D6E A;  4XCB A;  3GGL A;  3I4I A;  1PO2 3;  2E32 A;  2WO7 A;  2XUM A;  3ZLI A;  2WNV B;  3CZJ A;  3U07 A;  2AZ5 A;  2JIC A;  4N43 C;  2Y60 A;  4R8H A;  3WNP A;  5I93 A;  2C4X A;  5GZE A;  4AED C;  4C90 A;  3T4V A;  1IPJ A;  3ECQ A;  4R9A A;  2RG4 A;  3SIS A;  4C0B A;  3MLJ A;  2G9Z A;  2X5I C;  3C3V A;  4O7X A;  5JXH A;  1O3R A;  2W08 A;  1W6N B;  2DF7 A;  2OT7 A;  4MAD A;  4QB2 A;  4Y22 A;  1KJL A;  5F3E A;  4CXW A;  1RUH 2;  5LRR A;  4DS0 A;  1JZ5 A;  4DFS A;  1MS1 A;  4DQA A;  4FTS A;  4RHV 1;  1W2N A;  1SLI A;  2DBI A;  2O8O A;  4NOT A;  4R9B A;  4DZG A;  2YV8 A;  3H8O A;  2C0Z A;  3W20 A;  3ZFE A;  5IHR A;  4AAP A;  1F8V A;  5A1F A;  1Z78 A;  4NIH A;  1RB8 G;  4E4D X;  5FPA A;  2DUP A;  4IEY A;  4DUX A;  5C8W A;  1RED A;  3FUQ A;  1RUD 1;  3WW1 A;  4R4X A;  1CAU A;  2WL1 A;  1LTE A;  4OHZ A;  3IM0 A;  4Q5O A;  3BVC A;  2VCC A;  4XYX A;  1ASJ 2;  2XLG A;  3WUC A;  5EJ1 B;  3MIH A;  5FMO L;  2DBN A;  1ZZ7 A;  3CMG A;  4LOR A;  5C5U A;  2WO3 A;  4K6B A;  1SLC A;  2XGX A;  1ZRR A;  3IDB B;  4NAM A;  4P14 A;  4A3X A;  3PUA A;  3LPG A;  4NII A;  1GBG A;  4DEV A;  4FPL A;  5BUV A;  3G7D A;  2DWR A;  2IXL A;  4I3G A;  2RS3 2;  5J1X A;  5D2A A;  4IEU A;  4AGG A;  4DXZ A;  2HWF 2;  1SFP A;  3A21 A;  3POY A;  2RMU 3;  4NJ4 A;  4QXH A;  3BU0 A;  2Y6K A;  4JKK A;  1L3J A;  4HMZ A;  1TG7 A;  5KXD A;  4YW6 A;  3NAP A;  4J25 A;  1FOD 2;  1HIX A;  5BNP A;  3UNP A;  3R4S A;  1VAV A;  2WO1 A;  2GH8 A;  4WM7 B;  3MIE A;  2RM2 1;  1ZZB A;  2OYZ A;  2D6P A;  1ODN A;  5A7P A;  1J59 A;  4B4R A;  1V6N A;  3BAL A;  2OQ6 A;  2ZGQ A;  1ZBE 1;  5CAD A;  1I9R A;  2PXJ A;  3C2U A;  4EZH A;  1RYY A;  1GZ9 A;  4PLM A;  2WZR 1;  1LRH A;  4NPM A;  3B3Q E;  2ZMN A;  4QPI C;  5BNN A;  3V0B A;  4QPW A;  3EB7 A;  5I8S A;  5M0T A;  1YFX A;  1NA1 C;  2DV9 A;  4MGQ A;  3PIG A;  4XPV A;  5IJR A;  4RD7 A;  4YW3 A;  1UY3 A;  2JG9 C;  2WN2 A;  4N7I A;  1C1L A;  4QDQ A;  5K0U A;  5A3W A;  1JHN A;  2H6C A;  3ZPY A;  3HNY M;  4K20 A;  4XEZ A;  2BTV C;  5J96 B;  4Q1R A;  1ZM1 A;  5DXD A;  4ERO A;  3FUO A;  3O1T A;  5AVP A;  1WUV A;  4CDX C;  1YFU A;  1X33 A;  5FPU A;  3WQB A;  3S7I A;  3WXP A;  1C8M 1;  2A5Z A;  5C6C A;  5JOX A;  3AYC A;  2C6S A;  4CSW A;  1V6M A;  3WHT A;  5KBF A;  3OTF A;  2FCU A;  3MFC A;  1BBT 3;  2WNV C;  4Y22 B;  5C3S A;  5JPN B;  4IDZ A;  1UOF A;  3K51 A;  2OUJ A;  2GMP A;  2BNN A;  4FVV A;  2W5F A;  3NW4 A;  1CIW A;  1MPX A;  3WUD A;  3O12 A;  4C91 A;  4XJ8 A;  3ZFE B;  4QAW A;  1W2O A;  1H2K A;  3HAG A;  4HPK A;  5F3G A;  3KHC A;  5FWE A;  2WFF 2;  3WDV A;  2W68 A;  3Q8A A;  4XIO A;  1CAU B;  5CNA A;  1NCR A;  2FDF A;  1G6N A;  2PFW A;  1NE6 A;  2PTM A;  3BTX A;  2VW1 A;  5JIU A;  2PHR A;  4HKO A;  4HET A;  2AAC A;  1MEC 1;  4K3U A;  3ZYP A;  1XSQ A;  3B00 A;  2K46 A;  4BMB A;  2VCB A;  4BE3 A;  2KD7 A;  1HRV 1;  1OD5 A;  2DTW A;  2YU1 A;  2V5Y A;  3AZV A;  3FN9 A;  4XDQ A;  2QQP A;  1WMD A;  3ZYB A;  2IZW A;  2VUD A;  2RVA A;  2W0X A;  3VD9 A;  4XQW A;  4W4Z A;  2JDA A;  4ARX A;  4LXL A;  3GZU C;  1OA2 A;  3MV0 1;  2GND A;  3HEI A;  5JSR A;  4Q4W 3;  4IGQ A;  1SLB A;  4FPJ A;  4A4A A;  1TQ5 A;  3M70 A;  4BIO A;  2GC1 A;  3LOI A;  3VD3 A;  2ATF A;  4RHV 3;  1SHW B;  4EJR A;  1ACC A;  3E6C C;  4XQD A;  2ERF A;  1XOY A;  3MIF A;  4M00 A;  4AYU A;  3TN9 2;  4CZS A;  3NAP B;  5BNP B;  3WG3 A;  1EAH 3;  2HLE A;  1RUH 1;  1EPZ A;  2QJV A;  3J7H A;  1FAT A;  2QCS B;  2NMN A;  3C7H A;  1YLL A;  3FFQ A;  2A3X A;  2QQO A;  3CIH A;  4NE9 A;  3DGT A;  2HWC 2;  1GZW A;  1WCS A;  3SHR A;  1UOB A;  1H4H A;  5JLV A;  2VZR A;  4JGY C;  2VG9 A;  3O1S A;  1DP0 A;  1H30 A;  1OF4 A;  2HEY F;  1LHN A;  5BNN B;  4BK5 A;  1X9T A;  1XXN A;  2C24 A;  1QNW A;  2EID A;  5IVF A;  3V0B B;  3SNM A;  4MGT A;  1NLR A;  3J8F 2;  4X6R B;  2BEO A;  3HT1 A;  3FZ3 A;  4O65 A;  5FK7 A;  4GH4 A;  3VDD A;  1W9T A;  5K0U B;  1AR7 3;  1ASJ 1;  3KCC A;  1VBE 2;  3Q8C A;  3W58 A;  3FC0 A;  3WNL A;  3O0V A;  1VMJ A;  2W3J A;  2YU2 A;  2ZAC A;  4MVT A;  2P2K A;  3I49 A;  3EBR A;  4NR1 A;  1URX A;  1FPN 2;  2DU0 A;  2X29 A;  4KU7 A;  2VU9 A;  2RS3 1;  1AYN 3;  1GNZ A;  1W6Q A;  1W9W A;  2TNF A;  3B94 A;  5FY4 A;  3I2F A;  5CBL A;  1RIN A;  2XKP A;  3ZXF A;  3E1F 1;  3A23 A;  4LHL A;  2JDP A;  5B4N A;  4FP2 A;  4UWD A;  5EZW A;  3HN3 A;  1AR9 3;  4QX3 A;  4OHY A;  2VNV A;  1JUI A;  1QJY 3;  3WLU A;  2YGL A;  2BBV A;  4D3W A;  4XBQ A;  1QF3 A;  1FOD 1;  5CG8 A;  5FP8 A;  2GN3 A;  1HJF A;  3J7L A;  1OFN A;  1W8N A;  2JIJ A;  4CU6 A;  5T50 A;  4XJZ A;  1IQA A;  5IVV A;  1UNB A;  2A6Y A;  1DYO A;  2PHF A;  4HPK B;  1WMX A;  3WQ7 A;  3GZT B;  3NKG A;  3USS A;  4XBL A;  5FUP A;  3TEZ A;  1NCR B;  2HBU A;  3HR9 A;  3MIB A;  4B1M A;  2G9F A;  3ZYR A;  3A0K A;  2XJT A;  2K9Z A;  4IE5 A;  1PIV 3;  4AZZ A;  2Y34 A;  2AGS A;  3ZFE C;  2QQL A;  1F15 A;  1CGP A;  3MLK A;  1RUI 1;  3SH4 A;  1S2E A;  5JAX A;  1CAW A;  2WII B;  1QJZ A;  3GJB A;  4QQH A;  1P8J A;  3NNF A;  2EAA A;  2Z42 A;  2CAU A;  3LPF A;  1ENX A;  1C8M 3;  3AMQ A;  3FLR A;  2VAU A;  4HK8 A;  1PO1 2;  3RDI A;  4DY3 A;  3HPN A;  3F2Z A;  2ETE A;  2JXA A;  4COW A;  4DY5 A;  1K42 A;  4YVW A;  4YGB A;  2JDH A;  5ACA 2;  1XNK A;  2B45 X;  4LPL A;  2JE9 A;  4OUL A;  4XJW A;  2DCT A;  3UKT A;  5LB6 A;  1HW5 A;  1QJU 3;  2XL9 A;  2QNK A;  4IQP A;  2Y0I A;  3ZN4 A;  2VXR A;  2RDN A;  5C3R A;  2BNM A;  1RUJ 2;  5FYS A;  5CKM A;  3FBM A;  3OPW A;  4Q8L A;  4XIL A;  3LD8 A;  5CU1 A;  1GZW B;  1DGL A;  4JZR A;  1E5I A;  1YQ6 A;  4E8D A;  1FV2 A;  2VH9 A;  4Y4R A;  5F5A A;  1HRI 3;  1U5X A;  2JEN A;  5FMD A;  3DXU A;  1YUD A;  3NAP C;  4CVU A;  1D7P M;  4AI1 A;  5BNP C;  1LU1 A;  4MGY E;  2WFF 1;  3SCH A;  5DDJ 2;  1WD4 A;  4E2G A;  2PHT A;  3DXT A;  4PQ9 A;  1HRV 3;  1NYW A;  2W94 A;  2GNB A;  3IDA A;  1DFQ A;  4GH4 B;  3VDD B;  5FAX A;  3VHP A;  1LAJ A;  3V64 A;  2D3S A;  4RQP A;  4CEY C;  5BNN C;  1XNT A;  1JW6 A;  2O8Q A;  5GLU A;  3SLI A;  3ZSL A;  5HV0 A;  2UUR A;  2P17 A;  3CJX A;  4LNV A;  5BV6 A;  5HBA A;  5K0U C;  2UWC A;  4NHX A;  4AQT A;  4MGS A;  1W6Q B;  4Y1Z A;  5C71 A;  5D8A A;  5JXG A;  4HSJ A;  1AJO A;  5T52 A;  1RMU 3;  2VCA A;  1JI6 A;  1WCQ A;  4P08 A;  2IFW A;  3K48 A;  4XFG A;  1LOE A;  3LQC A;  1S2B A;  4Y5Z 0;  1GQH A;  4ZXE A;  4KBZ A;  3TN9 1;  1S0C A;  1FMD 3;  3WDY A;  2WRA A;  4FTB A;  1RVF 2;  1REF A;  4AEM A;  2LTN A;  2HWC 1;  3CBN A;  2ZHM A;  2XBO 3;  3T1M A;  3ORJ A;  1SLL A;  2D6M A;  4AAX A;  2D43 A;  2OXB A;  3H7J A;  3OGG A;  4Q2F A;  3MF9 A;  3M2M A;  3GBW A;  1VP6 A;  3K75 B;  3O1R A;  4Y4Y A;  4LUL A;  2PYT A;  3AXD A;  4LQR A;  3P6B A;  4I0B A;  4QDS A;  5FZI A;  2XHN A;  4LO4 B;  3J8F 1;  4IEQ A;  5LBF A;  3WF4 A;  2HYK A;  4AVT A;  1CAW B;  1IS5 A;  2WAA A;  4FXG B;  2HH9 A;  2Q30 A;  4TLF A;  2X10 A;  1AR6 3;  1VBE 1;  2YY1 A;  4HLT A;  4NWW A;  4PIY A;  1NCR C;  4GUL A;  2D98 A;  4LO6 B;  4BK4 A;  5EIY B;  2I2S A;  5FJH A;  1UMH A;  2HBT A;  1HN1 A;  1B09 A;  1C28 A;  1UU5 A;  3KV4 A;  1YJK A;  1D4M 1;  4FAH A;  4P9L A;  4YVW B;  4FCA A;  4Q4V 3;  1ZZ6 A;  1FPN 1;  1GWM A;  2JB4 A;  5DUU A;  4LBM A;  1HJG A;  1QU0 A;  1PO2 2;  4KL1 A;  4YG3 A;  2VZV A;  2HYX A;  2IFR A;  1YC6 1;  1W8U A;  5HPO A;  3RZK A;  4XTP A;  1YJL A;  5FMO S;  5A33 A;  4F83 A;  1Q43 A;  3ZKY A;  1LHU A;  4W65 A;  5J37 A;  3CU7 A;  4M4R A;  3MIG A;  3VBU A;  4BDV B;  4AR2 A;  5L9R A;  3CEW A;  4CCO A;  4J6G A;  4KU8 A;  5A1A A;  4ET7 A;  1PVX A;  1RUI 3;  2BJS A;  3I3Q A;  1POV 3;  3UT0 A;  5EYY A;  3E5X A;  5I8Y A;  2LRO A;  3OY8 A;  1UPS A;  1ZA7 A;  1MAC A;  4YVS C;  3CNA A;  3MEP A;  2BER A;  4QX2 A;  4RQP B;  1X8E A;  2P3Y A;  2WFP A;  1N1V A;  5DAV A;  5IAV A;  1LGB A;  5IVB A;  5C70 A;  1SLA A;  1GUI A;  5FZL A;  1PO1 1;  1J1L A;  1EUT A;  1DYP A;  1JZ3 A;  5A3L A;  5I8T A;  4GH4 C;  3VDD C;  4TWT A;  4GZ9 A;  1JOD A;  5ACA 1;  5D8A B;  5KHG A;  5LCW L;  1UAI A;  4QHZ A;  4XF0 A;  1J3R A;  3J7M A;  4ISR A;  2FDG A;  2BUK A;  4F7Z A;  4QXK A;  1N3Q A;  1ZZ8 A;  4BLI A;  2ARX A;  1H1M A;  3ATG A;  1CX1 A;  1HB3 A;  1JU3 A;  4IE7 A;  4E4Z A;  4LK6 A;  2RDS A;  2RMU 2;  2FDH A;  4D6S A;  1V70 A;  5HCH A;  1JOJ A;  1NQJ A;  1GU3 A;  1ONA A;  2NM1 A;  4XF4 A;  4OQ9 A;  3IDE A;  4Q8K A;  5A7S A;  3CF6 E;  3RZM A;  3RMY A;  5LEK A;  4ZON A;  2PHL A;  3CHX A;  4FTE A;  2A6W A;  4GWM A;  4YZ4 A;  4FPF A;  1PZ7 A;  1R64 A;  2UWA A;  2R07 2;  1RTV A;  2ZZQ A;  5T5J A;  5DAP A;  3ITQ A;  3HD8 B;  4J1X A;  1VMH A;  4BPZ A;  2WN3 A;  4A7Y A;  5FOJ B;  1PMJ X;  3SXW A;  3PIJ A;  1UZY A;  4YPJ A;  5ISL A;  1XU1 A;  4HON A;  3OPZ A;  1OKQ A;  3DF0 A;  3BPS A;  3R05 A;  2XH6 A;  3I54 A;  1KXG A;  4NHL A;  3WOG A;  3I2D A;  1RIR A;  4Q29 A;  3RQ0 A;  3U14 A;  3LEK A;  4OUE A;  1UYY A;  3TN9 3;  4NHY A;  1RUG 3;  1PK6 A;  2VE1 A;  1JOP A;  1DGR A;  1JXN A;  1IS4 A;  1UZ0 A;  3VHR A;  3RZZ A;  2BZD A;  1QIQ A;  3LIG A;  1XNC A;  4YVW C;  2E26 A;  2QQI A;  1NE4 A;  2HWC 3;  2XDV A;  4EN8 B;  4M3C A;  4E2S A;  5DMY A;  4CRQ A;  1BBT 2;  5F6L B;  5FPB A;  2W92 A;  5JPM B;  3VBU B;  3PVE A;  3OGS A;  5DQ0 A;  2ZML A;  1GV9 A;  3ZMN A;  3PVB B;  2YDE A;  4M01 A;  5C8C A;  1JHJ A;  1QHD A;  2E7Q A;  2EIB A;  3CLP A;  3H3U A;  5DUW A;  1RHI 3;  3OY8 B;  3JUU A;  4DUV A;  4A7Z A;  5AFE A;  1K12 A;  2E51 A;  2VME A;  4R9C A;  1W05 A;  1X36 A;  2J7M A;  2O1Q A;  3PVO A;  4YFW A;  3OEA A;  4XJA A;  1D4M 3;  5LAS A;  2FCT A;  2IVI B;  2XVK A;  4CCJ A;  1FPN 3;  3SEE A;  3VKL A;  2QDN A;  4CCE A;  4JX0 A;  5JSO A;  3OYW A;  3WDU A;  3VBR A;  4PLO A;  1C3H A;  1YO8 A;  3H50 A;  4GWN A;  1KRI A;  4RGA A;  4KWK A;  1R08 3;  4H2A A;  2XOM A;  4RQP C;  5FLI A;  4FOQ A;  2BGP A;  5FZE A;  4A45 A;  3WP4 A;  1G9D A;  5F37 A;  3MID A;  2XVG A;  2D5H A;  2FHR A;  4DXS A;  3WNX A;  3KMH A;  3MIC A;  3EXU A;  1SBE A;  3D5O A;  4Q4W 2;  2H0V A;  2OII A;  2WSV A;  1VR3 A;  4GIQ A;  2WNO A;  3A4U A;  5D8A C;  2VUL A;  4UF0 A;  4N8M A;  4FPE A;  4RHV 2;  3TEY A;  1AX0 A;  2D6N A;  3IPV A;  1AYM 3;  4CCN A;  4WZF A;  3KVA A;  1EAH 2;  4I0W B;  1HQL A;  2P34 A;  5KHH A;  2I45 A;  3NV2 A;  3VHO A;  5A7N A;  5LBE A;  4LLO A;  2GME A;  3OD4 A;  1DZT A;  2EVX A;  4P9J A;  4WBB A;  4Z92 B;  1JYC A;  4EN0 A;  1HB4 A;  1DQ1 A;  2VMF A;  1E5H A;  2ET1 A;  3FE5 A;  3E97 A;  1T6B X;  2ZHL A;  2J22 A;  4C1W A;  4EWE A;  4LBK A;  1DGR N;  2JDN A;  1ZBA 3;  4BB3 A;  1QJF A;  4BQ2 A;  4E4S A;  4N9H A;  5A6Y A;  1AR7 2;  2YFU A;  3AK0 A;  4Z2A A;  1GP6 A;  4XFH A;  4QT6 A;  5A3U A;  1KGY A;  3AP9 A;  2FMD A;  4AOC A;  2TUN A;  1WW5 A;  1PK6 B;  3VB9 A;  4MXW A;  4CXX A;  3V0A A;  3B9C A;  2BPA 2;  1G9F A;  2DCZ A;  2WC2 A;  1Q56 A;  3NRU A;  4QX7 A;  3RRD A;  4AF9 A;  1AYN 2;  5LK7 B;  4QQP A;  5C5T A;  2D3R A;  4M3C B;  1YYN A;  2N7G A;  2WSU A;  1M4W A;  4CTE A;  4DNY A;  5FZ0 A;  2RMU 1;  3R0R A;  3U1X A;  1AR9 2;  2WR9 A;  3POE A;  4NIG A;  1QJY 2;  1J3P A;  2JDU A;  2BRT A;  2V4A A;  3D82 A;  4IXL A;  3WG4 A;  3ZYI B;  2W39 A;  2WZ8 A;  4FAG A;  3OD0 A;  4ZU5 A;  2RV9 A;  1N1Y A;  5C8C B;  3WNO A;  3KCX A;  5E6H A;  4RSU A;  3BKZ A;  3E5U A;  4IUG A;  3ZXE A;  4PIX A;  4A3Z A;  1QDC A;  5A3O A;  2R07 1;  4PF1 A;  3VBU C;  1FNZ A;  4WVV A;  4MYE A;  3ZXK A;  2ARA A;  2CY6 A;  3AKT A;  3K4D A;  2JKB A;  1QDO A;  1CX4 A;  3KLS A;  1PIV 2;  1O91 A;  1VBD 3;  3IAQ A;  1O3S A;  3OYW B;  5JI9 A;  3VBR B;  3JB8 A;  1N3O A;  4WM8 C;  3N9M A;  1XB9 A;  3BI3 A;  2B42 B;  5T5P A;  3RG0 A;  4MXV A;  4XZP A;  1C8M 2;  4R52 A;  4N90 A;  3B7M A;  4Z07 A;  4LA2 A;  1BHG A;  1CD3 G;  2R04 1;  2GZW A;  4Q4X 3;  1W3X A;  2YBS A;  3C8X A;  5G04 L;  3K3N A;  1UXX X;  4FOY A;  5J09 A;  5A1L A;  1LED A;  3AP4 A;  4KG8 A;  2LRP A;  4ZKT B;  4UF0 B;  2Y6G A;  3K77 A;  2ORX A;  1UMZ A;  3RI8 A;  1QJU 2;  1BBT 1;  3THC A;  3IPV B;  1UYZ A;  4CP0 A;  2WT0 A;  4EN9 B;  1W0N A;  3LA3 A;  2GAU A;  1N1T A;  2R1D A;  1OLM E;  1F2N A;  3IKW A;  1BVP 1;  4V2V A;  5KXB A;  4YW7 A;  1LKN A;  5HCB A;  2J1R A;  2VVE A;  3D3A A;  1EV1 3;  2RJK A;  1HRI 2;  2EXK A;  4O9E A;  3VZJ A;  3CDZ B;  1LHO A;  1AL0 G;  2PHD A;  1S1A A;  1S55 A;  2P1B A;  4QQO A;  3M3Q A;  4GWI A;  1VB2 A;  1PGL 2;  3THD A;  1U5Y A;  4Z8B A;  3HBZ A;  1PM7 A;  5ANQ A;  1JZ6 A;  1SAC A;  4OHX A;  3KQR A;  4P5Y A;  4CCM A;  4F8A A;  3T0D A;  4I2O A;  1OFS A;  2VUA A;  5IK8 A;  1POV 0;  3DEC A;  5FPZ A;  1GP5 A;  3FWE A;  2BFU L;  1L7L A;  3FMG A;  3O14 A;  2GSY A;  3H0O A;  3LF7 A;  3IMM A;  4I0A A;  4YM2 A;  3S5A A;  3DYP A;  3VD5 A;  1QEX A;  3BOP A;  2AEY A;  3KT4 A;  5FIX A;  3WQ1 A;  3AM2 A;  1UX7 A;  4MXW B;  4LLF A;  4XZU G;  2Q4S A;  4FOW A;  3LDR A;  4BXF A;  3V0A B;  2XPJ A;  3PUR A;  2ZX4 A;  3LA2 A;  5C7G A;  2ORZ A;  1AXK A;  1V6J A;  2D40 A;  4PBP A;  3LAG A;  2GMM A;  1RUF 3;  4OZO A;  4Q4W 1;  2GAL A;  3QLQ A;  4YZ2 A;  1RMU 2;  3HMY A;  3I3B A;  1GQP A;  2A1X A;  1PK6 C;  2BWC A;  1D2S A;  2LM3 A;  3IN9 A;  2VQ0 A;  4LBJ A;  4JRA A;  3GNE A;  1FMD 2;  1NT0 A;  4AI3 A;  2JDK A;  2IXJ A;  4GA9 A;  1EAH 1;  4HAN A;  4OYU A;  4UFJ A;  1XNA A;  2J1U A;  4V2W A;  1Y9M A;  3I2H A;  4V1P A;  5IUQ A;  2VZT A;  5FZ4 A;  1I5P A;  2V73 A;  4AQ2 A;  1G9C A;  2XBO 2;  2VBD A;  1KFU L;  4H3W A;  4HL0 A;  1W9S A;  4K8R B;  3ZXA C;  4OQ8 A;  1O8S A;  4ZY9 A;  2EF6 A;  5C8C C;  4B1L A;  3AFK A;  5T3N A;  3HQR A;  2XJS A;  1W8H A;  4JHT A;  3B69 A;  4BQ5 A;  2BP6 A;  3ZSM A;  1RUC 2;  1DQ0 A;  2ZX3 A;  4PCR A;  3RPQ A;  3POS A;  2VCM A;  3N9N A;  4YM1 A;  1A3K A;  1AR7 1;  1KIT A;  1OSG A;  3D0S A;  3AZX A;  4JKM A;  5FY7 A;  1XND A;  3ZIX A;  1AR6 2;  2ZHK A;  4XMI A;  4Q0S A;  3IB3 A;  1HB2 A;  3KT7 A;  2QQU A;  5DG1 A;  2XG3 A;  3LKJ A;  4LOT A;  4YW4 A;  3VBR C;  4Q4V 2;  1SDW A;  3OBR A;  5KC6 A;  1TME 3;  2XL7 A;  1AYN 1;  3JU9 A;  5CB7 A;  3MBW A;  4GMP 0;  3VDC A;  3MV1 1;  4QWN A;  3CO2 A;  2NYY A;  4OFG A;  3NNL A;  1W6P A;  2AUY A;  4BIF A;  5BPX A;  2UY9 A;  1RUE 3;  1OA4 A;  3OEB A;  4HKL A;  1AR9 1;  3OPT A;  1QJY 1;  1VE0 A;  1YQ5 A;  1L7R A;  3H3Z A;  5J3U A;  1QJX 3;  2R07 3;  3DPR A;  4XCA A;  2R49 A;  1GZC A;  3AKP A;  4WV8 A;  5F2W A;  1PGS A;  5F5C A;  3B5L B;  1F4A A;  2PLV 1;  1X7N A;  1XU2 A;  4XIK A;  3WDW A;  1Y43 B;  2ZGS A;  2BQP A;  1RUI 2;  4BOW A;  1LEM A;  3ABZ A;  4O9G A;  3H8U A;  3TNP B;  5CKQ A;  4WVM A;  1EPW A;  4MOA A;  1PIV 1;  4AE2 A;  4DIN B;  1K45 A;  4IGP A;  1A34 A;  4QKN A;  4FP3 A;  5HXM A;  3O1V A;  1N3P A;  2R04 3;  2BOI A;  4NAO A;  2HKX A;  3RZJ A;  3RZH A;  2DVB A;  2DVF A;  1HKD A;  2C5D A;  5IK4 A;  2NPI A;  1US2 A;  3DEM A;  1U0A A;  3N9L A;  1VBC 2;  4HKW A;  1YXW A;  4MGZ E;  4P9G A;  4QB6 A;  4BQ4 A;  1ZZ9 A;  1PMH X;  1UU4 A;  5H9Q A;  4KWU A;  3N7L A;  2JJ6 A;  1FI2 A;  2V4V A;  1JBC A;  1QJU 1;  1XC6 A;  1PHM A;  2OPK A;  3LIH A;  4UW6 A;  3UL2 A;  1VAL A;  4RR3 A;  5DZE A;  3WF3 A;  1Q8V A;  1CR7 A;  1UKR A;  4XC9 A;  2PN5 A;  1B35 A;  2RR1 3;  1S0E A;  1WD3 A;  3P3N A;  5KHI A;  2ZGL A;  2AH2 A;  1JZ4 A;  4X8P A;  2PMW B;  2JDM A;  2KM2 A;  4XJ9 A;  4NPL A;  1HRI 1;  2RJ2 A;  1VBB 3;  2DCJ A;  4UFH A;  3LWC A;  5JUV A;  1ENS A;  1QNY A;  1RXF A;  4MZU A;  4WVW A;  1PGL 1;  1HX6 A;  4LBL A;  5A6X A;  3KSC A;  5LY2 A;  1GWL A;  5A7O A;  2CSG A;  1JTZ X;  4NUB A;  2QDR A;  1SFY A;  2WUH A;  3WG1 A;  3DYO A;  2G4I A;  3RS6 A;  2XJV A;  4AVB A;  1H6Y A;  1TMF 3;  2YC4 A;  4BU2 A;  2MEV 3;  1TVG A;  1NKG A;  2AC1 A;  1TNF A;  1H6X A;  3ES1 A;  5J98 B;  2CGN A;  1IG3 A;  1ULC A;  2K0G A;  2W1Q A;  2FQP A;  2QUO A;  1XPW A;  3ILF A;  4MSV A;  1MS5 A;  5FYT A;  2XR4 A;  1RUG 2;  3J4U H;  4OHV A;  1W6P B;  3MW4 A;  1RMU 1;  1W8F A;  2YXS A;  2W2I A;  4KGG A;  4XUT A;  4YGE A;  5F3I A;  5FBZ A;  5L19 A;  4FFI A;  1PZ9 A;  2D3P A;  4DPN A;  4BLJ A;  2QQV A;  3WW2 A;  4QHB A;  2E7T A;  1FMD 1;  5LWB A;  4Q0V A;  3DPR B;  1NXD 1;  2WQ4 A;  5FO7 B;  2DVA A;  2Q8E A;  3RZL A;  1W8O A;  4AK3 A;  5FP3 A;  2CWS A;  4IER A;  3BIW E;  4MUV A;  4A6O A;  1EY2 A;  2YUE A;  2XBO 1;  2CWM A;  4KNC A;  5C3O A;  5F3C A;  4WM7 C;  1J58 A;  1DBN A;  1O8P A;  3FX3 A;  4NRP A;  1LOB A;  3JZV A;  4UFI A;  4Y1U A;  3TBD A;  3BPZ A;  3NV1 A;  1RHI 2;  1W6O A;  2LW8 A;  4WVM B;  3V65 A;  2VW2 A;  3PUI A;  2UU8 A;  3O1U A;  2VZP A;  3ILR A;  2DYC A;  1RUC 1;  2D7F A;  4CDW A;  2A6Z A;  1RGS A;  1D4M 2;  2XHK A;  5DPN A;  1CIY A;  4GXL A;  1SDD B;  5EV7 A;  1AR6 1;  2ZTN A;  4W6W A;  4O61 A;  2VBP A;  1W8Z A;  1YCI A;  3LEI A;  3ME2 A;  2JB8 A;  4LT5 A;  5IVC A;  3RWN A;  3N35 A;  2PAM A;  4Q4V 1;  1R08 2;  2G9G A;  3VKF C;  2P37 A;  4P02 B;  4PT6 A;  5LBB A;  2X8K A;  5K9Y A;  3G6J B;  3J26 N;  4GAZ A;  1N1S A;  4TSV A;  3LSD A;  1OOP A;  4AHY A;  4MX3 A;  1V9U 3;  3WNN A;  5I0D A;  2GC3 A;  1LHV A;  3GHM A;  4QXB A;  4RR3 B;  3AKR A;  3ZVX A;  2I74 A;  1GZT A;  5KWR A;  1IS3 A;  2XJR A;  2PLV 3;  1B35 B;  1GOH A;  1WLC A;  3PDQ A;  3U0Z A;  2ADD A;  4NO4 A;  3AKQ A;  5FV3 A;  2W46 A;  3ZPO A;  2W1U A;  2IC1 A;  1DHK B;  1AYM 2;  3HNB M;  5DUX A;  4B4Q A;  4OUM A;  3M7A A;  2C1F A;  3WHU A;  3N9O A;  5DUV A;  4ZS3 A;  4CE8 A;  4C0H A;  3NKT A;  1C4R A;  2VNG A;  2Z2S B;  3LDK A;  4XQ4 A;  1POV 1;  2MNG A;  5LK5 A;  4ATE A;  3K4A A;  1PVC 2;  4TN7 A;  3AVR A;  5FYM A;  3EO6 A;  4UW5 A;  4HVQ A;  1SLT A;  1QY4 A;  2CTV A;  1NG0 A;  2MHF A;  1RL3 A;  2WNU A;  2ZOE B;  4LUK A;  3RFR A;  4K1Z A;  1OHF A;  1ZBA 2;  2RDR A;  4FFG A;  5F5Q A;  1W0P A;  1DQ6 A;  1R1Z A;  1YWK A;  4R9D A;  3U37 A;  2YFZ A;  4PIZ A;  4ZZ5 A;  4S2F A;  1VBC 1;  3ZR6 A;  1CJD A;  4LBO A;  4Y3O A;  1A8D A;  4AVV A;  5LA1 A;  2P6C A;  1BMV 2;  1DYK A;  4DXT A;  3AJZ A;  1HXS 3;  4PI0 A;  4QGN A;  4OMD A;  3DYM A;  1SFN A;  4B3N A;  3N36 A;  4IEZ A;  2DVD A;  4MV2 A;  5G05 L;  5F32 A;  3R4U A;  4IW3 A;  5KXC A;  4Q1P A;  3WF1 A;  3URF A;  2QQK A;  2W1W A;  3U4S A;  4MHU A;  1POQ A;  3U75 A;  1H1I A;  2ZX1 A;  1XYP A;  2CV6 A;  2Y33 A;  3O0W A;  2VGD A;  5IT6 A;  5JXJ A;  3PU3 A;  1PZ8 A;  1QH6 A;  3JD7 1;  3LGR A;  3NV4 A;  4U2A A;  5FZG A;  2DVG A;  2ZGU A;  3ZDV A;  3W5N A;  1HV0 A;  3OGJ A;  3T0B A;  5FZA A;  2A75 A;  5FYI A;  1COV 3;  4QX0 A;  5EYX A;  3DPR C;  1W6O B;  2XB6 C;  4AVC A;  1UY4 A;  2SBA A;  3IIA A;  1DDL A;  4HT1 T;  1FV3 A;  3AB0 A;  4COZ A;  4CDW B;  2X05 A;  5A80 A;  4FFH A;  5E88 A;  5FO8 B;  4LKS A;  2Z4F A;  5T54 A;  1F31 A;  2JG8 A;  1US3 A;  1UPI A;  3NJX A;  2JE7 A;  4MHR A;  1VBA 3;  1EYB A;  1UYP A;  5IFT A;  1JYX A;  4CXY A;  2MPF A;  1VBD 2;  2WIN B;  3DCQ A;  3ST7 A;  2IXH A;  5LW9 A;  3I59 A;  3VD4 A;  5D21 A;  3D0J A;  1YQC A;  3H9A A;  4FPK A;  3KT1 A;  1ZA4 A;  4XFF A;  4AHX A;  2DFB A;  4KQ7 A;  1VIW B;  2GP5 A;  4ZS2 A;  2BU9 A;  3B9I A;  5JR7 B;  1OOP B;  3ZFG A;  5FQ0 A;  1RUG 1;  4MO3 M;  1IG0 A;  1ZRE A;  4E8C A;  4Q4X 2;  1Q8Q A;  2HJI A;  3ZFF A;  4AFC A;  1EUU A;  1H0B A;  2BFU S;  2VZQ A;  2Q5T A;  1O4T A;  5F5I A;  4BIS A;  5FLJ A;  3K2O A;  1W99 A;  3B01 A;  3DUI A;  2GC0 A;  2VOX A;  4LMF A;  1WMF A;  2QZ3 A;  1LJ7 A;  1KD7 A;  3A7Q A;  3SQO A;  4RR3 C;  4CP2 A;  1ENR A;  2QE3 A;  2PAE A;  4QD2 A;  3E5Q A;  5DAB A;  1B35 C;  1RUC 3;  4B7K A;  2IWG B;  4UBH A;  1EV1 2;  1W2U A;  4NID A;  1JZ7 A;  1RHI 1;  1IQD C;  4QQL A;  2ZAH A;  3I2K A;  1S2K A;  4D0Q A;  4I3P A;  2WNU B;  2VQT A;  4OI4 A;  2XJQ A;  2XON A;  3QOP A;  4G4F A;  2ILM A;  2WO2 A;  1CVN A;  4AW7 A;  3POF A;  2VL4 A;  3PHM A;  3QD6 A;  3ZXL A;  3PL0 A;  5C9A A;  3HVD A;  5ERL A;  3IZO A;  4XUR A;  1YQ2 A;  3HJR A;  4EZ4 A;  1T2X A;  2VBB A;  2E31 A;  1UU6 A;  3KZ4 C;  5JOZ A;  1R08 1;  4L97 A;  3ZO0 B;  4DB5 A;  3AP5 A;  4FO9 A;  2QQN A;  5FDB A;  4RGK A;  5HXV A;  4Y1Y A;  3KV9 A;  4SLI A;  5FKC A;  5FZH A;  5F9T A;  3RWK X;  5EHD A;  4XAE A;  3GZA A;  1KS4 A;  4JKL A;  3MUZ 1;  1RUF 2;  4IND A;  4X6Q B;  1BCX A;  4LR4 A;  2HWD 2;  2YPD A;  3WW4 A;  2DCY A;  1VJ2 A;  4QHO A;  3K46 A;  3P3P A;  1AX1 A;  3SEP A;  1S0F A;  1OA3 A;  1UWW A;  4L92 A;  1AYM 1;  5FLH A;  3WY6 A;  4JTN A;  3ZYJ B;  4OI0 A;  1D2Q A;  1E5S A;  4PQQ A;  1MVQ A;  1GP4 A;  5GLZ A;  4ZZ8 A;  1ND3 A;  4RFT 0;  1LEN A;  1VB4 A;  2VZO A;  3MFA A;  1S0D A;  1PVC 1;  3VZN A;  3FLT A;  4BME A;  4Y26 A;  1J84 A;  5E8A A;  1ULD A;  2R7E B;  1NAE A;  1IOA A;  3SMH A;  5IW0 A;  2JG8 B;  2ZS6 B;  1XJA A;  4KWL A;  2FD8 A;  1K3I A;  3THP A;  1YHF A;  1QOS A;  1VBC 3;  1OKO A;  1WLT A;  1ZBA 1;  3OUH A;  4EN7 B;  3VBO A;  3I59 B;  5D1I A;  4CYD A;  3RJ2 X;  4QX8 A;  1MS3 A;  1QWR A;  2VC9 A;  3MUY 1;  4CDW C;  5DG2 A;  3QCW A;  3S7E A;  1FYU A;  2WYS A;  5AC9 3;  1JYT A;  2A70 A;  4M3C F;  3UYJ A;  4YSF A;  1G9A A;  4OUS A;  1BMV 1;  3POG A;  4UFK A;  1DU3 D;  3ZFG B;  5FQ0 B;  5FY5 A;  3I3D A;  2ZEW A;  4QKD A;  3IDC B;  1Z7S 1;  4HVR A;  4IES A;  4XUQ A;  5FZ8 A;  2YC2 A;  5C33 A;  3ZFF B;  1TME 2;  1O4Z A;  1QOT A;  2DCK A;  3JD7 3;  2QZ2 A;  4ITC A;  1FXZ A;  1VAM A;  3KB5 A;  4JC1 A;  3ZOI A;  2KR2 A;  3ZSJ A;  1C57 A;  1QXJ A;  3RYR A;  1FT9 A;  1OOP C;  1RUE 2;  5I0U A;  1JS9 A;  1NLQ A;  1J83 A;  4GB3 3;  2P3K A;  4OI1 A;  1O4Y A;  4P9W A;  3AL5 A;  1VPH A;  1CZS A;  5FPL A;  1QJX 2;  2D97 A;  3ACL A;  4XHX A;  2D6O X;  5LBC A;  1JOB A;  1OVS A;  4AL9 A;  1V6O A;  5FZM A;  4LO5 B;  4RS5 A;  1UN1 A;  2OUH A;  2ARC A;  1IHM A;  4OMC A;  4GMP 3;  3WW3 A;  1MZ6 A;  3HN1 A;  4QGM A;  2ZAB A;  2J1T A;  5C9A B;  1GNH A;  5ABJ B;  4FSJ A;  1R09 3;  1VBD 1;  2CDO A;  2VPV A;  4ZXK A;  4HBN A;  4OLL A;  4RFR B;  5FP7 A;  4FBF A;  4NVP A;  2R04 2;  2WNU C;  2XQR A;  4YW2 A;  2A6X A;  3T3Y A;  2P3J A;  2R6Q A;  1SPP A;  5FP4 A;  1N47 A;  2UYA A;  1UY2 A;  3SC7 X;  3EHK A;  4ONU A;  5B2G B;  1J1T A;  2E53 A;  1NLS A;  1NCQ A;  3GYD A;  4N7U A;  4COY A;  4Q4X 1;  1F4H A;  1DIW A;  5FPX A;  1WBF A;  1AX2 A;  2QQM A;  3Q8B A;  2JDY A;  4Y33 A;  3UGH A;  5CFC A;  3P1I A;  5F1R A;  5LZ6 A;  4AHZ A;  4CUA A;  2IXC A;  2VO5 A;  2DU1 A;  1RJ7 A;  3FHI B;  1GFF 2;  4AQS A;  5FCC A;  3UJQ A;  4A44 A;  3S57 A;  1DCS A;  5GAL A;  1XRU A;  3M4F A;  1GMM A;  2RR1 2;  4ZPI A;  5FMC A;  4M3C E;  1REE A;  2YBP A;  4Q26 A;  1QOO A;  1S0I A;  1ND3 B;  4KGQ A;  3APB A;  4ASM B;  3MI8 A;  3SCG A;  4YGD A; 
#chains in the Genus database with same CATH homology
 3KV9 A;  5FPA A;  3KV5 A;  5FYC A;  4CCN A;  5A3N A;  3DXU A;  3KVA A;  4LXL A;  2GP3 A;  3NJY A;  3PUS A;  5FY9 A;  5FYV A;  5FZO A;  5FZD A;  2XUE A;  4IGQ A;  5A7W B;  2YPD A;  4URA A;  5A7N A;  3DXT A;  3PUQ A;  5FYB A;  5FY0 A;  4BXF A;  3PUR A;  5FZK A;  4Y3O A;  4D6S A;  3PUA A;  5LY1 A;  4IGO A;  4EYU A;  5FYU A;  2Q8D A;  4XDO A;  3KVB A;  5FZ7 A;  5LY2 A;  4CUG A;  5A7O A;  4NUB A;  5KR7 A;  5F32 A;  5A7S A;  4DIQ A;  5IW0 A;  4V2W A;  5FY8 A;  2WWJ A;  5K4L A;  5A7W A;  3U4S A;  5IVF A;  1VRB A;  4QXH A;  5FZ4 A;  5F2S A;  4BU2 A;  3PU3 A;  5FZG A;  5FP9 A;  5IVY A;  4QX8 A;  2OQ7 A;  4QX7 A;  2OS2 A;  2WWU A;  5FZA A;  5FYI A;  2P5B A;  5FXW A;  4C8D A;  4CCM A;  3UYJ A;  5CEH A;  5ISL A;  3AL6 A;  2YU2 A;  5FZ0 A;  4HON A;  5FYT A;  5FXV A;  5A7P A;  5FZF A;  5F3I A;  2OQ6 A;  2W2I A;  5FY5 A;  5FYH A;  2PXJ A;  5FJK A;  5FZ8 A;  4EZH A;  3N9N A;  4LIV A;  5FY7 A;  5A80 A;  4CCK A;  5FY4 A;  5LWB A;  5IVJ A;  4XDP A;  5E6H A;  5A7Q A;  2Q8C A;  4GJZ A;  2YBK A;  2Q8E A;  5FY1 A;  5FP3 A;  5FZI A;  3KV6 A;  5LW9 A;  5A3W A;  5FXZ A;  5F3C A;  2VD7 A;  5IWF A;  2OX0 A;  3AL5 A;  5FZ9 A;  2XDV A;  3PU8 A;  5FPL A;  5FP8 A;  2GP5 A;  3N9Q A;  4QWN A;  5FJH A;  5FPB A;  3KV4 A;  5IVV A;  2XML A;  5FPU A;  3N9M A;  5FZM A;  3PTR B;  3OPT A;  4QXC A;  5FUP A;  5A3T A;  4CSW A;  3RVH A;  3N9P A;  5A1F A;  4E4H A;  5FPV A;  5F5I A;  4BIS A;  4D6R A;  5F2W A;  5FYY A;  3K2O A;  5FZC A;  5F5C A;  2XXZ A;  5F39 A;  5FXX A;  5FZB A;  4GJY A;  5IVC A;  5FYZ A;  5FP7 A;  4DO0 A;  2YBS A;  4HOO A;  3K3N A;  5A3P A;  5FZ3 A;  3U78 A;  5A1L A;  5FWJ A;  5FZL A;  4GAZ A;  4UF0 B;  5FP4 A;  3ZLI A;  4CCJ A;  5FUN A;  5FZ6 A;  4LIT A;  5FBJ A;  4ASK A;  5F3G A;  4LIU A;  5FWE A;  4QXB A;  4IGP A;  5FZO B;  4CCO A;  4D6Q A;  4Y33 A;  4V2V A;  4TN7 A;  3PDQ A;  5FZE A;  4CCL A;  5FV3 A;  5FZ1 A;  2OT7 A;  3K3O A;  5F3E A;  3ZPO A;  5F37 A;  5FYM A;  3N9L A;  4AI9 A;  4EZ4 A;  5FYS A;  3LDB A;  3N9O A;  3OPW A;  2YU1 A;  5IVE A;  3LD8 A;  4UF0 A;  4GD4 A;  2YBP A;  5IVB A;  5ANQ A;  4AAP A;  4QU1 A;  3AVR A;  4Y4R A;  5F5A A;  3AVS A;  5FZH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...