2YBKA

Jmjd2a complexed with r-2-hydroxyglutarate
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
349
structure length
349
Chain Sequence
TLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 4A
publication title The oncometabolite 2-hydroxyglutarate inhibits histone lysine demethylases.
pubmed doi rcsb
source organism Homo sapiens
total genus 105
structure length 349
sequence length 349
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2011-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 2ybkA01
2OQ6A 5FZKA 3ZLIA 3KV5A 5LY2A 2XXZA 5FP3A 5A7PA 5FXXA 3U4SA 4CCLA 4BU2A 5FYHA 4LITA 5F2WA 4Y4RA 5FZ6A 5FYTA 3PURA 2W2IA 2OQ7A 3PU8A 3ZPOA 3KV9A 5FWJA 5ANQA 4QX8A 2YU1A 5FZCA 2GP5A 5FZFA 4QXBA 5F5CA 4AI9A 4Y33A 4LXLA 5FP8A 2XDVA 2XUEA 5FPUA 2XMLA 4QXCA 5FZDA 3PUQA 5FY0A 5IW0A 5K4LA 4EZHA 4CCJA 3N9PA 4XDOA 5FYUA 2OT7A 5LW9A 5FY4A 5FXVA 5FV3A 5FWEA 5FXZA 2WWJA 4IGPA 5FY8A 5FZ4A 5IVEA 4CCMA 3OPTA 5LY1A 5FZBA 4IGOA 5FP9A 5A7OA 5FZGA 4GAZA 5A80A 5FYSA 5A3NA 4D6SA 4D6QA 2YBSA 5F3IA 3N9LA 5FZ1A 5FZ8A 4CUGA 4NUBA 3N9NA 5F3GA 2GP3A 5FPVA 3PUAA 4V2WA 3K2OA 5IWFA 4D6RA 4AAPA 4LIUA 2YBKA 3KVBA 3UYJA 3DXUA 5FY7A 5FPBA 3KV4A 5F5IA 5FP7A 5FYYA 4C8DA 5IVFA 5F39A 3AVSA 5A7WA 5FZ9A 5FP4A 5IVCA 5A7QA 2VD7A 5F32A 5FPLA 4E4HA 5LWBA 3K3OA 3KV6A 5FBJA 3LD8A 4GD4A 2P5BA 5A7SA 4UF0A 4TN7A 5FZ3A 4HONA 4XDPA 4CSWA 4EYUA 2Q8DA 5A7NA 3PDQA 2Q8CA 3U78A 5FJKA 5FYVA 5A7WB 5IVVA 5ISLA 3LDBA 5A3PA 3AVRA 3DXTA 5A3TA 3PTRB 5FYZA 5FZIA 5FY5A 3N9MA 1VRBA 3AL6A 5FZEA 4UF0B 5FYCA 2OX0A 4QWNA 5CEHA 5F2SA 4IGQA 2PXJA 4Y3OA 2YPDA 5F3CA 5F3EA 5FYBA 4BISA 4BXFA 2YU2A 5FZAA 5FZOA 4LIVA 2YBPA 4URAA 2Q8EA 2OS2A 4CCOA 5F37A 5FPAA 4QX7A 5FZMA 5IVYA 4CCNA 3OPWA 5IVBA 5A3WA 5A1LA 3K3NA 5FUNA 5FYMA 3PUSA 4V2VA 4QXHA 5FXWA 3AL5A 5KR7A 3N9QA 5E6HA 4ASKA 5FZ7A 5FUPA 3N9OA 5A1FA 5FYIA 5FZOB 4GJZA 4CCKA 3RVHA 4QU1A 5FY1A 5FZLA 4GJYA 4DO0A 5FZ0A 4DIQA 4HOOA 5F5AA 3PU3A 5FY9A 5IVJA 2WWUA 3KVAA 5FJHA 5FZHA 4EZ4A 3NJYA
chains in the Genus database with same CATH superfamily
1H4GA 2EICA 3VDDA 3ZFGB 2LUWA 3HT2A 3I3BA 2X5IC 1AUYA 4HN1A 4B29A 2JDYA 1SLBA 2Q1FA 2RM23 2WN2A 4AI1A 2RDSA 1ALYA 1HXS2 1RIRA 1I6XA 4BIFA 1JODA 5E1RA 3JD71 1V6OA 1G9AA 3KF5A 1DZRA 3P5BA 2Y8KA 3GJBA 4PIYA 1LU1A 2Y6KA 1W6QB 4PCRA 4OCTA 1T6BX 3PHMA 4PBOA 4DINB 4XACA 4XETA 4YGEA 1N1VA 1QNYA 4EZHA 1FNZA 1HB1A 1KXGA 1ND3B 1ZNPA 3AMPA 3ZN4A 1ASJ2 3FUQA 4CCJA 1R64A 1UX7A 4ORFA 1UU5A 3S5QA 5FY4A 3THCA 5A32B 2ZGMA 2XGXA 4BQ4A 2GN7A 1NCQA 1PO13 1WW7A 3NNLA 4IGPA 4JX0A 5DUUA 3NJZA 4OI0A 3NL1A 3KCYA 3H8UA 4IETA 4DY3A 1GP4A 1ZBE2 3D5OA 3WY6A 1IKPA 3SEPA 1BK0A 1RUG2 3H3UA 2Z69A 4D69A 4O9GA 1U5YA 2R042 1Y4WA 4EN9B 1ULDA 3ECQA 5LB6A 4AE2A 2ARCA 2P1BA 3NQHA 3T4HB 3MPBA 2VZ1A 4ZY9A 1YEWA 5JIUA 3DXUA 3JQXA 1FPN1 1KD7A 3KV4A 4NJ4A 3MGUA 2MEV1 4QPWA 1HB4A 1BK1A 4JKLA 4Q4X2 5CU1A 4FPFA 3RQ0A 3PMEA 4Y26A 1QOSA 3OEBA 4XVHA 1GICA 4CEWA 3KV6A 2C0ZA 3QOPA 1MVQA 3E97A 3I2HA 2CYFA 1OSGA 2YXSA 5T3NA 2VZUA 2VUJA 3N7LA 1PX3A 4MGZE 5CFCA 4CSWA 1NCQC 2DWRA 4QDRA 3E5XA 4XBNA 3CLPA 3IBMA 4JVAA 4YZ4A 4XIOA 3OY8A 3KF3A 5IVVA 4UW4A 3SKVA 1H1IA 1NYWA 3VL8A 1X9PA 1J84A 3ORJA 2RS31 1RUH1 4LBLA 2D93A 3RYRA 3THTA 3WSOA 2BNOA 2QZ3A 3AL6A 2ZX3A 2WSVA 1PZ9A 2YC0A 1DGRN 5JXGA 5JZGA 1X9TA 4MSVA 4KQ7A 2OX0A 3V56A 3R0RA 4IGQA 2GSYA 1NZCA 2HWF1 5L73A 5JDBA 2E53A 3TEYA 2RDQA 5L9BA 4QKBA 2DU0A 3D82A 4XOGA 4URAA 1W0OA 1YQ5A 3FZ3A 5JI7A 2WNVB 1LR5A 3NAPB 3EQEA 1QOOA 2GNTA 2K9ZA 2QBXA 5A3LA 4JDNA 3T4VA 2XLGA 5FYMA 4J1XA 4QAWA 4FO9A 2WLPA 4HMZA 4ZPIA 2F4LA 3ENRA 2ZKLA 3AL5A 4NHMA 2W0XA 3N9QA 2Y26A 2XBO3 4P9GA 4XXPA 2HKXA 5CFCC 1SFNA 5JPNB 4XZUG 3W58A 5GZEA 4QU1A 1CONA 1AR71 5DZEA 4U2AA 3WNMA 4DIQA 5FOJB 3T1LA 1UKGA 5FQ0B 1RUE3 3POEA 3POSA 4K8RB 1LOGA 4K20A 4A41A 3M7AA 3ZLIA 1GWKA 2W47A 3FBMA 4RSUA 5A7PA 3I2GA 2JWPA 4IEWA 3JD72 4FTEA 4BU2A 1RXFA 1UOFA 2PHTA 1PVC2 1OC1A 3GHNA 5KWRA 4Y4RA 1EUUA 2FHRA 3LZZA 2RS13 2W1QA 4NAOA 2BYVE 1QQP3 2WUHA 3R4SA 4GMP0 4XFFA 3PU8A 4NMIA 3JB4C 3LA2A 4PI2A 1Q8OA 3H8XA 3BI3A 4KI5M 4BQWA 3D8CA 4FAGA 5HBAA 5AFBA 2QQLA 3R05A 2W92A 3AX4A 3ILFA 1OUXA 4X8NA 5EYYA 3ZYHA 4B1LA 2RR11 4DXTA 4QKFA 1DDLA 3GZTB 3NV4A 1W6PA 5T55A 4N53B 2GNBA 5J1XA 4AHYA 1ENRA 3AMMA 5AVAA 4RHV3 1V0AA 3CZJA 2BJSA 2Y6JA 1YJKA 3ACGA 3ZDVA 1AXKA 1DIWA 3NNJA 4CXYA 5FZGA 4GMP1 4GAZA 4LBNA 4QD2A 4ISRA 1AYM3 1XYNA 3N36A 1Q8PA 4XUOA 1F5JA 1OQ1A 1O59A 1DU3D 2G9FA 2ORXA 4MGQA 5HCBA 4XE9A 3O0XA 1FPN2 2MEV2 3KGLA 2F6BA 2QNKA 1WUVA 2IFRA 3Q8AA 1OUSA 3CNAA 4Y1XA 2VVFA 4AI8A 3H0OA 2HWE3 3UNPA 1W39A 4YW2A 1MZ5A 5FPLA 1GQHA 1X8MA 5C70A 5EXOA 1QJY1 4M3CF 4AR2A 2F17A 1W6MB 2VULA 2YPJA 3BTAA 1S0BA 4QQHA 1TME1 1H1AA 3NWKA 2X5IB 1OPMA 4EYUA 3S57A 3MO4A 4QPGB 5FBZA 2RS32 1RUH2 2P3KA 2QTWB 3AXDA 3HQXA 4FPYA 4QX3A 4UFIA 5F8PA 3VZMA 2BU9A 2IXIA 4N43A 1LGCA 1TNFA 5DMYA 1FYUA 1OKQA 3AP9A 4Q4V3 1MZEA 1JMUB 2D6NA 2HWF2 1ZRIA 3SCFA 1LEMA 2DFBA 3UESA 2G9ZA 3PLQA 3DPRC 4COYA 1SZBA 3ABZA 3GXUA 2JB8A 4I3GA 3ZDSA 5ABJB 2D6PA 3UETA 5F3CA 4N90A 4BXFA 4P9YA 4D7TA 1JTZX 4UFKA 4AWDA 1CAUB 2XJQA 3HWJA 1W28A 3PVNA 2XQRA 3J7MA 1SDDB 2DYCA 3X29B 4PIZA 1QJX3 1O4TA 3FLTA 1HV1A 1HB2A 1W8HA 5E6HA 4EN7B 4UYBA 1AR72 3K4ZA 5IK4A 1IGOA 4INDA 4IE7A 1OVSA 2V5YA 4CE8A 1Q5OA 2WQZC 3DKWA 1Y9GA 2VXRA 3C7OA 4KNCA 5JR2A 1S0CA 4BOWA 1HKDA 1VMJA 3WZ1A 4MGTA 2FCVA 4WM7C 2YMZA 2P2KA 5E16A 3ZPYA 3WXPA 3BTYA 4QT6A 1ND2A 3DCQA 5EP9A 4CEYA 2ZJCA 2VW0A 5FYHA 4YZ2A 5K7PA 2JG8B 4LBQA 2FDHA 1JHJA 1QGLA 1EAH2 1BVVA 4PBPA 3UGFA 4TLFA 2HLEA 2WQ8A 2QDNA 4ASLA 2RR12 3VBRC 1D4M1 1OURA 2QFEA 2ZXQA 4LTAA 4BIOA 2PLV2 2O8OA 5FY0A 5HXVA 2W5FA 3LDKA 2WN3A 3B01A 1AL23 5CNAA 1RUD3 3WX5A 2G1MA 3CHXA 2WWJA 3VBUC 5FY8A 3WG4A 1JYNA 1L7QA 2ZGKA 3AYAA 5LA1A 5ACA3 1I5ZA 3AMHA 3PIJA 5JUVA 2L9LA 1U5XA 1BBT1 3O5SA 4GKXA 3BCWA 3OUIA 4KGGA 2RE9A 4FSJA 1YNAA 3AKPA 1ND2C 1S0IA 1OF3A 2DTYA 2VZ3A 3N9NA 4X8PA 2ZAHA 3WW1A 4CDXA 1WMFA 4UT5A 2FDFA 1DZTA 1WMEA 4QHZA 4V2WA 2PHFA 2JDAA 3WLUA 4CDUC 2Y64A 3N7JA 3ZFEA 1RJ8A 4K7JA 1IHMA 2WZR3 4QB2A 5GLVA 1NZIA 3WQ0A 4NWVA 1QJY2 1VBE2 1YIPA 4A6SA 2EXJA 2IXJA 1G9BA 1TME2 2Q4SA 1NG0A 2GMPA 5A7SA 1AR83 1QNWA 1SHWB 2NM1A 3LGRA 2E6VA 1XBFA 2GALA 2W87A 2O1QA 4UFJA 2IFWA 2OPWA 2Q8CA 4DMIA 2VQ0A 3M3OA 4IEQA 4YM1A 5ISLA 2WNUC 2QE3A 4Z2AA 4HK9A 3OB8A 3ZXFA 2ZEYA 4N7UA 1UWWA 3E6BA 4RQPA 4LE4A 3RMYA 4BQ2A 1UXXX 4FFGA 1QOTA 4RR3C 3RDIA 3TBDA 4CDXC 3LKJA 2QJVA 3RZJA 5F2SA 1FNYA 4ZZ8A 2W91A 2LRPA 3LEIA 3OUHA 4XC9A 1NXD1 2AZ5A 1ZYBA 1YXWA 3BPSA 1RUI3 2R0HA 2DURA 2I45A 1CZVA 2ET1A 3PVOA 1YUDA 4OHVA 2ERFA 4NHKA 4HFSA 3AJZA 2DF7A 2IXCA 1A78A 1Z7S1 3TNPB 1O5LA 2VUCA 3GYDA 4JDMA 1VB4A 4A7ZA 5DG2A 3RI8A 2FMYA 4LLFA 3VD9A 1QU0A 2XLAA 3ZOIA 2VO5A 3SITA 2BQPA 3R6SA 1OT5A 1R1A3 4FAHA 3T09A 1QXRA 4Q8KA 2R1DA 4FPLA 5IYYA 1BKZA 4XFBA 4HOOA 4W6XA 3K75B 5IVCA 1IS6A 2WINB 3WF4A 4FCAA 1LOFA 2VTXA 4CP2A 1FXZA 1GZ9A 3C7EA 1AJKA 4H3WA 4CVUA 2RM21 2YFZA 2QCSB 3FLRA 2ZGOA 4QX5A 4G9SB 5IAXA 2QQMA 4DZGA 3ETPA 3ZN6A 5F2WA 2VZQA 5D1IA 3MYXA 1UZVA 2C26A 2BFUS 2X10A 3MBWA 2QQUA 1D4M2 4GZ9A 2VXJA 5LCWL 1YJLA 5FZFA 1PK6A 5D8AC 3VV1A 4D94A 3O12A 1VJ2A 3NJXA 5HV4A 4I0BA 2XMLA 1W9SA 2XJRA 2WC2A 1SLCA 5B4XA 4XDOA 4MHRA 2CU5A 4LLOA 1JH5A 2HYXA 1PO11 2AH2A 3CF6E 4L9BA 3DPRB 1MS5A 4CCMA 1BBT2 4A7YA 3U07A 2GNDA 1C5HA 1UIKA 4EN8B 1HN1A 3PUIA 4NAMA 4LKEA 4Z07A 4AGGA 3DYOA 1LOFC 1LENA 1XC6A 3M3QA 4QU2A 4UI9L 4CDQC 1ULCA 3T0BA 1Q8SA 3MIHA 4LKSA 2JD4A 2PHDA 4M0NA 4QX1A 3ZR6A 3L2YA 5FCCA 1LB2A 5I8YA 3NNGA 2BW8A 1F15A 1QH7A 5DDJ3 1CAXA 1RUJ3 3MZHA 1N3PA 3I2IA 1PNFA 5GLUA 1F9KA 2PA7A 3POIA 3V0AA 1OLQA 4Y20B 2Y0IA 3WNNA 1PK6C 4FPKA 4BMBA 1PZ7A 5I8TA 2XL9A 2ZEXA 4H7LA 5LBFA 3WNLA 1B35B 2XJPA 1WLDA 3AMQA 4META 4BPZA 4WM7B 4OI2A 4HONA 4AFCA 4F83A 1VR3A 4XUNA 1XE0A 3VBSA 4PIXA 5DUVA 1QIQA 2VMGA 1Y9MA 1PGL1 2AUYA 1VBC3 2W1UA 1MQTC 1GOGA 1XNBA 3ACHA 4LO8A 2CNAA 1SFYA 2SBAA 1WCDJ 4M3CA 4XBLA 5BNOC 2WS93 3VBRB 3NV1A 3ACLA 3BYWA 3OYWB 4QWNA 3KWVA 1DQ5A 1IKQA 3W20A 2JE9A 3FFZA 1RVF3 4O65A 2B9VA 4UBGA 1H8TA 1PM4A 4FOQA 1S0JA 2E26A 1PNGA 4KMQA 3VBUB 1PMIA 1RB8G 2A6VA 2RS53 2C9KA 4ZU4A 5DABA 3VHNA 4IL7A 5KR7A 2VAUA 2GC0A 2I07B 2XBO1 4ASKA 2QDRA 4XPVA 3D3AA 5FYIA 1H2NA 1US2A 2O8QA 3T3YA 1YI7A 3WDYA 1TNRA 1Q3EA 2Q8OA 4J6GA 4QMAA 4YGDA 3ZX7A 2PTMA 5F5AA 3U75A 4AI3A 1ZRFA 5FZHA 2BRTA 1EV13 2JDKA 3LA7A 5FJHA 5H9QA 3UJOA 3H8OA 3VD5A 1F35A 1RUE1 2R16A 2V72A 3QH6A 2RM22 4CDUB 4ARYA 3HQUA 4HL0A 4XTPA 3WVJA 5B4NA 4SLIA 1H6XA 3ZYPA 1ZRDA 3FHQA 1DP0A 4QPIB 4NRMA 4MX3A 3J8F3 4Q4Y3 4LITA 3MLKA 1YYNA 2WQ4A 1UPIA 5FYTA 4BH9A 3PURA 2RS11 2DFCA 2FBEA 1QQP1 5IUQA 1GR3A 2ZX1A 1MS3A 1UYXA 4M4PA 2W94A 4IEPA 2HEYF 4ZONA 4YVWC 3VBOA 4HPKB 1XJAA 2ZHLA 4FT8A 4MGKE 4QX8A 4BXSV 5BNNC 2GC3A 3O0WA 3VDCA 2X09A 4OQ8A 1ULFA 2XL7A 3RNSA 2DCKA 2WNUB 2Y60A 1LESA 3AP5A 5BUVA 3AJYA 1PO12 4UBHA 1LTEA 4BM8A 4FTBA 1KJLA 4Y24A 1W6NA 1Q8VA 2D44A 4IV1C 1NY72 3L9JT 1UCXA 3M2MA 4IUGA 2RMU3 3KHBA 4GB33 1G6NA 4RHV1 3P6BA 4QHBA 4RGAA 4RR3B 1V6MA 5T5JA 4CYDA 5IVEA 2H6BA 1ZZ9A 5CYYA 5FZBA 3VBHC 3INAA 1KITA 2VMFA 1ODNA 1WD4A 2IXHA 4XJ8A 1W9TA 1GZWB 1AYM1 4PLMA 3POBA 3N4MA 2AEYA 5JMOA 3K4AA 1JS9A 4QGNA 2D40A 2R32A 4LIUA 4Q1PA 1SLLA 5JAXA 2HYKA 2PQQA 3A4UA 5FYYA 1JU4A 1K42A 3T2OA 2C6SA 4LO7A 4LBJA 2JKBA 4ATEA 2HWE1 2FMDA 3T1MA 4MOAA 4NIHA 1RYYA 1IZ3A 4U36A 3NV2A 4E27A 4BK5A 1OKOA 1WCSA 4XMIA 5B2GB 1ZRCA 1HLCA 1XU1A 1W8WA 5EPAA 3UKTA 3ON7A 5FQ0A 2W39A 4BQXA 1QDOA 1PGL2 1RUC2 4PQ9A 4DNYA 5IFTA 5HCHA 3PDQA 3VL9A 3RZGA 3LPGA 4QDSA 1W99A 4JGZB 5AC93 4GA9A 3UKVA 2VQTA 3DXTA 3PTRB 1GWLA 1UX6A 1Z78A 1SG3A 4Q4V1 1X36A 4Y1VA 4CU8A 2P37A 4JCKA 5JCTA 3S0MA 4S2FA 3HBKA 1ENSA 2ZGSA 3M3EA 3ST7A 1NLSA 3MW3A 2EAAA 5FYCA 3JU9A 5D8AB 4QGLA 4GH4A 3Q8FA 3WT3A 4Y3OA 2RJKA 1XNAA 3IPVB 4CU9A 1R093 5C8CC 4YM3A 3ZIXA 5FZOA 4LIVA 1OPOA 1CIWA 1V6KA 3I3EA 5F9TA 3A21A 2J22A 3BB6A 1JZ4A 1W6OB 3CL1A 3K51A 4M3CE 3AZYA 2J1AA 4O61A 3GF6A 3MFAA 5LA9A 4CPBA 5KC5A 1LHUA 4R9AA 2ETEA 4OULA 1O3QA 1QJU3 3IMNA 1QDCA 1QJX1 1XNDA 2DVBA 2XBO2 2B45X 4V2VA 5I0UA 2CSGA 5L7OC 1V00A 2PFWA 5E88A 4QQLA 1JZ3A 4CDQB 2B46X 1ACCA 4ZZ5A 5C3QA 1XE7A 3O1UA 3DV8A 3VKNA 3OSDA 5J7MA 4IW3A 3KT1A 5FZ0A 4YWAA 4GIQA 5IVJA 3AYCA 3RZHA 2C4XA 2WT2A 2FQPA 4EZ4A 4OI4A 1DFQA 3KQ4B 4YW1A 3WF1A 2ET7A 1PGW1 4B1MA 3IT8A 1VBD3 4W50A 1K5MC 2Y33A 2VC9A 4KWUA 1L7RA 4PLOA 3HEIA 4E4ZA 5DAVA 3O7OA 2RS12 1QQP2 5T5LA 2WT0A 4OHZA 1WCQA 1RGSA 2YZ4A 2UWBA 4P9XA 5I0TA 4BMEA 5J96B 5CB7A 2FCTA 5JXJA 3I2FA 2WAAA 1Z7S3 1DF0A 2JG9A 4NIIA 5FWJA 4QGMA 4Y22B 3AK0A 4L92A 5T5OA 5EIYB 1F5FA 5FZCA 1C1LA 2ZS6B 4PT6A 4AI9A 5LRRA 5LA0A 5FP8A 4JQTA 2IC1A 4KGQA 2VH9A 2OZ6A 5BNPA 1MQTB 4A3ZA 3ZXEA 2V5DA 2VNRA 1AL21 4HVOA 4RHV2 2BP6A 5A3MA 2A3WA 3E5QA 4V1PA 5JSPA 4XJAA 3JXSA 1RUD1 1NCRA 3E1F1 5CAZA 1Q8QA 1XSRA 5BNOB 1FMD3 2VCCA 3ZSJA 1AXYA 1AYM2 1MEC3 4DQAA 4E2GA 4K6BA 4Y4YA 1OOPC 5ACA1 2ZEZA 2VOWA 2DCJA 5K0UC 3GCWA 4Q5OA 1CZSA 1GU3A 1H4HA 1VAVA 1O3RA 1CAVA 5CFDC 2TNFA 3VHRA 4QKDA 1CPNA 4BQ1A 4D7YA 2CTVA 2Y38A 4AG4A 2GZWA 1FT9A 2DTWA 4JHTA 4DPNA 2XVKA 4FQ4A 4WM8C 4XILA 4OQ9A 1K45A 4AAPA 3LEGA 2MHFA 2JB4A 3KVBA 5FOBB 4SBVA 3JQWA 2HWE2 3TN93 5FP7A 1WZXA 3JBG3 4MZUA 4BE3A 3IN9A 1V6NA 5F39A 2WZR1 1W8ZA 1I1EA 1W8TA 4I09A 1ODMA 1OQEA 2Y34A 3SHRA 3VKMA 5BNPC 2A6YA 3CJIA 4Q0UA 4JGYB 4ZS3A 3B69A 3POWA 2HWB2 3ZIWA 1GWMA 1IPKA 2A6ZA 1BMV1 1GNZA 1X33A 4XDPA 5EQUA 3ZXGA 1AR81 4BYYA 2R0FA 5F7UA 3VDDC 2NYYA 2ZMKA 3UV9A 2G4IA 1W8FA 3MW4A 3WW2A 4OMDA 5A3OA 3ATGA 2BDRA 2FZ2A 1FOD2 4PDWB 4LA2A 4Q4V2 5DAQA 4I2OA 3IAQA 4XYXA 1YQCA 5FYZA 2GC2A 2JG8A 2TBVA 2VQUA 4CP9B 1LOBA 4YVWB 3O1OA 2WDBA 2ARBA 2GU9A 1NUKA 3ZSLA 3IDAA 3AZXA 5IT6A 4KG8A 4IEOA 2PXJA 3T08A 2PN5A 3E5UA 1X50A 4NN0A 1RUI1 3JUUA 1QJFA 2D3SA 3KB5A 5FZMA 1QJX2 3USUA 4IV1B 3RS6A 1A8MA 1GQGA 4DEVA 1HRV3 4JQRA 1F4AA 1MVEA 2W95A 3U0ZA 2ZGPA 1TMF3 3HNMA 1L7LA 3URFA 2VZTA 1R1A1 1JZ6A 3TB0A 1DQ2A 4A4AA 2ZGRA 1HQWA 1PGW2 3TNQA 5F6LB 5BV6A 1SCRA 1DGWX 1MACA 2QQNA 4JAAA 2JDHA 3JCIA 1LODA 4XFCA 3F95A 5C3RA 2WL1A 1UAIA 3J7NA 2N7GA 2IUWA 1GQPA 2EXKA 4CDWB 1UMHA 1PVXA 1ENXA 1UZ0A 5LASA 3U14A 4MADA 4BZ4A 2A1XA 4CEWC 3WNKA 4AVBA 2RDRA 1SEFA 5AVPA 2GH8A 4LXLA 1AL22 2YHJA 4HKOA 5FIXA 5IW0A 5LEKA 1JI6A 1VP6A 1RUD2 5JI9A 5KBFA 2QQVA 4E2SA 4RA0A 3NNMA 4UOJA 4BQ5A 5FLHA 3I97A 4M01A 2JDUA 1XPWA 1WLCA 4K9SA 3ZKYA 5ACA2 4OHXA 3IKWA 3OPTA 2X53S 5JZGC 2ADEA 2XVLA 4FOWA 1YWKA 2EAKA 2E63A 1NA1B 1STMA 1YIFA 3ZMNA 3ZYBA 4CUGA 5SV5A 1REEA 1XNKA 4NUBA 1NKGA 1VMHA 1NE4A 1WLWA 3DEMA 3MW2A 4NRQA 2A70A 2ZX2A 1NLRA 2GMEA 5DDJ1 1Y43B 1F2NA 5FXZA 5L7OB 2WZR2 1RUJ1 4IE5A 3UYJA 5F5IA 3K4DA 4YM0A 5T54A 1IG0A 2A5ZA 2VMHA 1YLLA 4AGVA 4RS5B 4QXKA 5F32A 3I2DA 4LOSA 1BMV2 4ONUA 1AR82 1G9FA 1C28A 1R083 2DUQA 4OMCA 2VZOA 5GZGA 3ZO0B 1K5MB 2R063 5DN2A 3ZR5A 5C9AA 2Y6HA 2WO1A 3U1XA 4YFZA 1GV9A 1LNSA 4CP0A 5FMBA 3DGTA 3GM8A 1VBC1 1UW8A 2W1WA 3KT7A 4WVMA 3UGHA 3VBFB 1KDKA 3MUY1 2VQAA 3W59A 1JYTA 4KWKA 1KJRA 2AREA 3OUJA 4S2HA 2OYZA 5LK7B 4UF0B 2JDZA 2XVGA 3ZXAC 1LAJA 1HN0A 1KFUL 2VMEA 2WS91 3Q9OA 5EJZB 3OOXA 5I91A 2C1FA 3CIHA 1RUI2 2XJVA 1C1FA 4LHLA 3ZFFA 2WYSA 3BN6A 3GBGA 2YYOA 4BLIA 1UOGA 2CWSA 3H9AA 2E7QA 3WG3A 3BKZA 1U12A 3RZMA 3OBRA 2IZWA 1RVF1 3ZYRA 1DGWA 1QJZA 4IV3A 1JYCA 1W06A 3OPWA 3OGVA 3G7DA 4CZSA 4AEMA 5FUNA 4Q4W3 4XZPA 4AGRA 4GULA 4CXWA 2BOJA 2DUPA 5A33B 1JHNA 4NIGA 2RS51 3JZVA 2WZ8A 1OOPB 4RGGA 5BNQA 2ZCWA 2ARAA 4O9EA 1BQPA 4HKLA 1R1A2 3RYPA 5FMOS 2WYFA 3LEKA 5CFDB 1RHI3 1VAMA 1W03A 1J3PA 2CHHA 4MHUA 4NIAA 3DN7A 5C9AC 1NAEA 4BB3A 1HIXA 2UY8A 4Z82A 3EHKA 3PIGA 5JVVA 2JE8A 2PQSA 4OVEA 1CESA 4WM8B 3MF9A 1EV11 1KGYA 2WIIB 5FY9A 3VHOA 2VY0A 1VLNA 3BTZA 4FXKB 4R9BA 1UZZA 4XAAA 2CY6A 1YQ2A 2JIGA 3MUZ1 1JUHA 4RGKA 1M4WA 2BNMA 2O14A 2RJ2A 3WHTA 4K21A 1N3QA 3ZFFC 2RVAA 2CGNA 1SPPB 3J8F1 4FOYA 4Q4Y1 2BNNA 1QF3A 1VBB3 2ZABA 3E6CC 4OUMA 4IV3C 3LE0A 3MIEA 3O1SA 5EV7A 1UYPA 2WO2A 2WLQA 1M06G 1GP6A 1YO8A 3VDDB 5KXEA 1HW5A 4QXBA 1REDA 1WA6X 2VOKA 1GUIA 5L36A 2XDVA 4TTGA 3S5AA 3RWKX 5FUIA 3PUQA 5BPXA 2ZMLA 1O3SA 4N43C 4COVA 1J58A 4Q1RA 1NE6A 4DS0A 1CX1A 4QX2A 2RMU1 1W3VA 1OA3A 1DCSA 1H0BA 2VOXA 4GB31 4UFHA 1GSLA 5LY1A 1MS8A 1ZVFA 1Q56A 4FFFA 3AZWA 3RG0A 2E33A 4PLNA 1VIWB 3HAGA 4XXAA 4MLOA 2RG4A 2NMNA 1YFWA 4QB1A 3ROUA 4DOUA 3O1TA 4B8EA 1KS5A 2VVDA 4MXWB 5DDJ2 5J09A 3ILNA 1RUJ2 4W65A 2D6KA 2NP0A 1NCQB 2Z2SB 1XNTA 3QBQA 4P9IA 2WBKA 1W90A 1OQDA 3U4XA 4JDOA 1BEV3 2ES3A 1LKNA 1OVPA 4XABA 3OGSA 4HKWA 4COUA 3POGA 3BU7A 3R4UA 4FPHA 3VD3A 4OHWA 4Y5TA 1GLHA 4H14A 1S55A 3ALQA 4XUPA 2ZZQA 2WFF3 2P5BA 1G7YA 1BZWA 4JZRA 4XF9A 1E57A 3AP6A 1UZYA 5FZ3A 3M8LA 5E8AA 3KMHA 3M3CA 2E7TA 3LFIA 3GBFA 4A7KA 2LROA 4W4ZA 3WQBA 4AEDA 3LCPA 4GWJA 5AC91 2JX9A 4CEYC 2VUDA 3VKFC 5HPOA 4H2AA 1XE8A 1YFUA 3HQRA 3N9MA 2WS92 2A6WA 4H7MA 3OGGA 2VJXA 2RHPA 3V0BA 1OMIA 2PMWB 1DQ0A 4HT1T 2PYTA 1TVGA 3IZOA 2E9QA 1E5RA 5CFCB 1UO9A 2HH9A 3CZUA 4RFT0 1RVF2 1YCIA 3PNAA 3A23A 5D21A 4OI1A 1R091 1WMDA 3ZSMA 3LSDA 3OY8B 2DUOA 1LJ7A 3I59A 2ZACA 2BFUL 5I0DA 2DCTA 4YVSA 5FREA 1H6YA 4MV2A 3SLIA 1EPZA 2RS52 4OYUA 3LOIA 3AM2A 1YQ6A 1QJU1 1UOBA 1PVC3 1XU2A 2J1SA 5GLZA 3EB7A 4AVSA 3VUOA 4A3XA 5JZGB 3Q8CA 4UFLA 5GLWA 1W05A 1AYN3 1NXMA 2AR6A 4XCBA 5CIRA 3AZVA 4YW6A 5DG1A 3OF1A 5FUPA 1GNHA 2XB6C 1KFXL 3FHIB 4GJZA 4YARA 1EV12 1NX9A 3CMGA 3D0SA 3MHZA 1COV3 3PU3A 5LRSA 5IK7A 2UU8A 2XG3A 4NHXA 3KCXA 5J36A 3ME2A 3O1MA 5J98B 1VBD1 5FZKA 4WVZA 2VU9A 3RJRA 2AYHA 3J8F2 4Q4Y2 4Y1ZA 5GALA 3W5NA 1W2NA 1ZZ6A 4NRPA 4QKNA 1UKRA 2VR4A 3C7GA 3ZFEC 4MO3M 2BPA2 3RPQA 1FATA 2MNGA 3M3IA 3CBNA 4LK7A 3ACIA 3MIFA 1U0AA 4XFGA 3KV9A 4YVSC 4RFRB 1PIV3 2D6LX 5A1AA 3LIHA 3CEWA 1TG7A 3ZSEA 3LEMA 2FDJA 5FO9B 2BVVA 5F5CA 5FO7B 5JWPA 3PJQA 3ZYIB 1EUTA 1APNA 2VCMA 1DG6A 2R6QA 2VW2A 4AVCA 1ENQA 4FOVA 2RMU2 3IMMA 3BOPA 4GB32 4LKFA 5FYUA 5FV3A 4TYSA 1POQA 3UT0A 3BUCA 1FMD1 1LULA 4RQPC 2EVXA 2WZPP 1MEC1 1OXCA 2ENRA 2KD7A 3WD5A 1VBA3 2OZJA 5HCFA 3POFA 1PGSA 2C5DA 5GKAC 3NV3A 2KR2A 1LU2A 3H3ZA 3LFMA 4CCEA 2VBBA 3I49A 2GN3A 3Q8EA 1W6PB 2YB7A 1KQRA 3K2OA 3WQ1A 2VMDA 3C3VA 5GM0A 4PF1A 3LOBA 3TN91 3FX3A 4C0HA 3JBG1 3B93A 4AOCA 2JEMA 5A7WA 3LAGA 2NQYA 4XMAA 4A2UA 3GALA 4UWDA 4JKKA 3H3LA 5FP4A 5FTTC 3UGGA 1KDMA 2BTVC 2BWCA 4O7XA 5LWBA 5C4WA 4JKMA 4M4RA 4B4RA 4WZFA 4UW6A 4L11A 3HN1A 5AC92 2JIJA 3PVEA 4QQOA 1E5SA 4XJUA 4YNIA 5JXIA 1ST8A 2K46A 5C6CA 4KWLA 4XDQA 1CQ9A 1VRH3 2BBAA 1DYPA 1US3A 1MS1A 3KS7A 4GWMA 4Y1UA 1URXA 4AAXA 4MH0E 1H2KA 1R092 2E51A 3MICA 2BEOA 1JYXA 4HSLA 2DVFA 1HX6A 1HV0A 4AFAA 1WWYA 3KHCA 4KWJA 4AQSA 1WCKA 1YHFA 2OS2A 3AMNA 4I0WB 1QJU2 5FPAA 3IIAA 3ZXJA 2EF6A 1J3QA 5CADA 1GANA 4FTSA 3PUSA 3SCGA 5GZCA 3LPFA 2W68A 1IS4A 3ZFGA 1O6UA 1HRV1 5FXWA 4AQ2A 2WABA 1A6CA 4PJYA 1EAH3 2VCBA 5DXDA 5FZ7A 1TMF1 3NSTA 5G04L 2WKKA 2VVEA 4MXVA 3OD0A 4IEVA 1VBD2 2PLV3 1F8VA 4AF9A 4L0PA 5DAWA 1W6QA 1YFXA 4G3YC 4PI0A 3IDCB 4HANA 3LB9A 1QEXA 1YRZA 4D3WA 1ND3A 1S2EA 1SMVA 3MPPG 4HZFA 1SLIA 3WP3A 5C5TA 1DHKB 1Z7S2 5LEJA 2JDNA 2OPKA 3GNEA 4YG6A 2K0GA 2XONA 5IAVA 3TOJA 5A32A 5BXXA 4J25A 3NMBA 5FPXA 2JENA 1LGNA 4Z1VA 3I54A 3P3PA 1FX5A 4EWDA 4AI2A 3P1IA 3AC0A 2TUNA 4BK4A 2GP5A 1JZ7A 1DGLA 2MPFA 1UMZA 3BALA 2GAUA 1POV3 4C90A 1LECA 5EWSA 3V64A 1ND2B 2AGSA 4FPJA 3VBSC 4PDWA 2V4AA 4XTMA 4Z8BA 2NMOA 5TSWA 4LBQB 1FMD2 3DKQA 4B3NA 5FWEA 1MEC2 1MS4A 1UZWA 1RUF3 4COWA 2I2SA 5JSOA 3I3MA 1VBE3 4EJRA 4A6OA 2FD8A 3D0JA 4BJ0A 4I3PA 4CXXA 3M1HA 1GZCA 2D43A 2XJTA 1SBFA 2XWJB 1IPJA 3N9LA 4CRQA 3H1MA 1TZOA 2LALA 1ZZ8A 1DLLA 1H8TC 5F3GA 5FO8B 3MIGA 3KZ4C 2PHRA 4QM9A 1ZA4A 3TN92 1F4HA 3JBG2 4I02A 3RMXA 2AENA 2I74A 2P6CA 4CUCA 4TLGA 1BVP1 2PHWA 5BY5A 3ZXKA 3ES1A 1JZ5A 5I93A 5JPMB 3AZZA 1Q43A 1QY4A 2IVIB 2WO7A 5T50A 4QB6A 1X7NA 3A0NA 3JB8A 5FBJA 4CDXB 3LD8A 1R081 2BERA 4GD4A 4AHZA 2YUEA 2P3IA 1HQLA 1I9RA 1RMU3 2CWMA 2J1VA 2R061 4YM2A 5JLVA 4FFHA 3DL3A 4YGCA 3RFRA 1FI2A 4X6RB 2OA2A 4AHWA 1G86A 1CX4A 1CD3G 3OPZA 2WNVA 1K5JA 2D3RA 1LOCA 2BGOA 3NAPA 2OKXA 1CIYA 5A3TA 3BU0A 2E7AA 3SMHA 1QKQA 4NHLA 5EFUA 2B7YA 4LHNA 4ASMB 3VBOC 3RJ2X 4IDZA 2BGCA 4DUXA 3WG1A 2ILMA 3MV11 5FFOC 4XFHA 2ZHNA 4B4QA 1E5HA 1MS0A 2HWC3 3IIIA 3NKTA 2JKXA 1LHWA 2WA4A 3NJVA 2YBPA 4OLLA 4TXWA 1SACA 4XHXA 3FL7A 2ZBJA 5IVYA 3SXWA 5CG9A 3ETQA 1HRV2 1H30A 3K3NA 1W8UA 4Q4W1 3M4FA 2HBUA 3VD7A 4R9DA 3ASIA 2AEZA 2Y0OA 3AYEA 1UU4A 1H9WA 1TMF2 4CUAA 1AR93 3OGRA 4UW5A 2WWSA 5JOWA 3UJQA 4LBMA 4MYEA 1OLMA 1RHI1 1V70A 2Z5WA 3FFQA 3T0AA 1NA1A 2Q30A 3IWZA 3TYJA 4DRVA 4DO0A 2FDGA 3HT1A 2WNVC 2WZEA 1LOAA 4DXRA 1C8NA 3NJYA 4ET7A 1XXNA 3SC7X 3HR9A 2YV8A 3KV5A 2NPIA 2DBNA 3VZJA 4AFDA 2XXZA 5FP3A 3MIBA 3VD4A 4YPJA 3I2JA 4E2QA 3HPNA 4IESA 4LBQD 4CCLA 1W0NA 4FXGB 2A6XA 4Z2WA 3RZLA 1MPXA 1BYHA 1VPHA 4IE0A 1VBB1 4AEJA 3QACA 4N53A 4NOTA 1WKYA 2KA3A 3WW4A 5FLJA 1UU6A 4I0AA 3TRSB 4AHXA 3C8XA 2Z42A 1JYVA 4EE2A 5J48A 1W9WA 1D0GA 4QXCA 2V4VA 4P02B 4LO6B 3FWEA 5CBLA 1RUE2 4CCCA 4XF0A 1HB3A 4HSJA 4LK6A 4CP1A 5FMDA 3VBFA 4CA9A 2JE7A 4IEUA 3D6EA 4Q29A 5CKMA 4IGOA 1PK6B 2G9GA 1Y9QA 2RJLA 2OVUA 4GH4C 5A80A 3P3NA 1W2UA 5HV0A 2YBSA 4LR4A 1DYKA 3VDBA 5FZ1A 5FZ8A 5HCAA 4DUWA 4C0BA 1A34A 4XQDA 4F3JA 3NO8A 3FLPA 1ULGA 3KD4A 4GALA 1W6MA 4MG2A 3O14A 4N53C 1REFA 4FVVA 2X5IA 4UAPA 1BEV1 4QPGA 4D7SA 1MR5A 1S0FA 4Q0QA 1Z0HA 2QZ2A 2ZMNA 4HETA 4OUEA 1R082 2LM3A 2DU1A 2R062 4ARXA 3B3QE 2DCYA 2WFF1 1LRHA 1UF2C 4Q0VA 4TN7A 2ZX0A 4B7EA 4GWIA 1DQ1A 3B7MA 4R4ZA 3WCSA 3PUHA 5ABJA 4N8MA 2JXAA 5H9RA 4A42A 1J1LA 2YG0A 1GFF2 3V0AB 5FJKA 1CAUA 2DDUA 3AFKA 5H9PA 2C24A 2QQKA 4K1YA 3RSJA 3I7DA 2VCAA 1GP5A 1OA4A 2EIBA 3V65A 1OLRA 2P17A 1O3TA 2WSUA 2IXKA 4D8MA 3HNYM 4YLZA 1N1SA 2JG9C 2VZPA 2ZGQA 3WNPA 4FBFA 3VGIA 5FYBA 3VBSB 4WBBA 2YU2A 4MGSA 4QPGC 5IATA 1NQDA 4Q4W2 2ATFA 2GH2A 4JRAA 5IVBA 1XRUA 2PAMA 1H8VA 2J1TA 2XQXA 2J42A 4M3CB 5FPUA 1PVC1 1V6IA 1NCRC 3KLSA 4MVTA 2FDIA 4QXHA 1S1AA 4B7KA 3C7HA 1AYN1 1RHI2 1QXPA 1VE0A 2D5FA 2QUOA 3PJYA 1JYWA 4QQ2A 5ABJC 2B4KA 4J1WA 1H8TB 5A6QA 5FRAA 1C57A 5JR7B 5C7GA 2PAKA 2VL4A 1COV1 3U37A 5JOXA 4MXWA 5BNNB 4XF4A 4AFBA 3UK9A 1RUNA 3KSCA 1JYIA 4LBKA 3LQCA 5LY2A 1EPWA 2P3YA 2LS6A 1W9YA 1ONAA 1OLME 1VBB2 3ES4A 1D0HA 4JRLA 5LBEA 1XYOA 5CISA 1WMXA 3WDWA 1CZTA 5LK5A 3J9SA 2ZGLA 3BVCA 2VGDA 3SNMA 4RL7A 2VOVA 4YG0A 3CJIC 1B09A 3VBHB 1AR63 1PIV1 4YZ5A 4BCUA 1VB2A 3S30A 2DBIA 2HBTA 3B02A 5EZWA 2EIGA 4LQRA 2NN8A 2VZSA 5LW9A 1FAYA 1SBEA 1YQ8A 2BUKA 1KRIA 2JG8C 3H1WA 2D98A 3ILRA 1YC61 4DRRA 3VBOB 4YW3A 4AQ6A 1PX4A 3B5LB 4UXAA 4NPRA 5JXHA 3USSA 1UNBA 2ADDA 1VBA1 5FYSA 4FP2A 4D6SA 5A6ZA 3AFGA 3AP7A 5C3PA 1PO23 1UD1A 2R073 2VM9A 3AKRA 3EMRA 4WV8A 2D6MA 5CKQA 1D4VB 2YROA 1RUC3 3OBAA 2W1SA 2EXHA 3VB9A 2WR9A 1QWRA 2EA7A 2QQJA 3N3HA 3WCRA 4BDVB 1LOEA 1W6NB 1WW5A 3IM0A 5FPVA 4DB5A 1D2QA 5IWFA 1BEV2 2UY9A 3LA3A 4HBNA 3VHPA 3FBYA 3PL0A 2J7MA 1CAWB 1DGRA 2BGPA 1WA4A 1OFNA 1UXZA 3RZKA 1V9U3 3G6JB 3PMSA 1CJDA 2A75A 3AXEA 3FN9A 4JTOA 2WFF2 1J59A 1CN1A 4XJ9A 3DYMA 4YZ1A 5FMOL 5C8CB 3GCXA 2W9XA 5F5QA 1G8WA 2H0BA 3GZAA 4GKYA 4OZXA 4XQ4A 3WQ7A 1ZBA3 4LHKA 4Q0PA 5FYVA 2VW1A 4MGIE 1QH6A 1LHOA 3LDBA 4MGYE 5FK8A 4AEKA 2X8KA 3AVRA 4Z92B 2UWCA 2AACA 1OBNA 3B9CA 5FZIA 5LBBA 2Q5TA 4YZ3A 2GDFA 2ZEWA 5EJ1B 1VRBA 1VRH1 3F2ZA 1QMJA 4LPLA 3ZYFA 1NQJA 1HRI3 3WV6A 1O7FA 4LO4B 4KBZA 2V73A 3K48A 4FFIA 3POJA 4A45A 4BISA 4TZDA 1OA2A 2BWAA 2ZAAA 1W2AX 1T2XA 1AHSA 4N7IA 3CU7A 1WCUA 1V6LA 2RV9A 1AYN2 1C8M3 4Q2FA 1IS3A 1DZQA 1EAH1 2EIEA 4GH4B 2QQPA 5KHHA 5A1FA 1LEDA 4N9IA 5FZOB 1COV2 3TAYA 3C7FA 4ZU5A 3RVHA 2VZVA 4JC1A 2GMMA 2CDPA 3A0KA 4S2GA 4NO4A 3I3QA 5C33A 4UFMA 3MEPA 2PLV1 2WO3A 1POV0 4HLTA 1I3HA 4C91A 4EWAA 2BV4A 3T30A 4AFMA 2HWD3 5LBCA 4KBBA 2Q0AA 4KU7A 5DZFA 5L9VA 1YFYA 1EP0A 3MI8A 4GXLA 1RUOA 2R7EB 2VTXJ 5EJ3A 1W8NA 4XJWA 3U10A 3IAPA 1YI9A 3CQOA 3HJRA 1PIV2 4JV4A 5FZ6A 3DF0A 2TEPA 1V6JA 2OQ7A 1HXS3 1GOHA 4P5HA 1HQNA 1CJPA 4W6WA 4NR1A 4XUQA 2JICA 3DPRA 5DUXA 4E9KA 5K0UB 1VAKA 5C3OA 1NLQA 3WDTA 1AF9A 3AB0A 1POV1 2CGOA 2H6CA 1NOVA 2XUEA 3QLQA 5FZDA 5K4LA 5T52A 3T2QA 4HVQA 3N9PA 4E4DX 1SLTA 2YC4A 1K3IA 5FXVA 3S7EA 3TEXA 1ASJ3 3APBA 4LA3A 4IXLA 1RUF1 4N9HA 4DFSA 2JG9B 1VBE1 1VBA2 3J7LA 4DUVA 3SQOA 4XJZA 1N1TA 1WW4A 5A3NA 1S4CA 2VNGA 1H2MA 2A71A 1LHNA 2AC1A 2HWB3 2Y6LA 2Z79A 4Y20A 4LT5A 3IDEA 5LATA 5BNPB 1ZBE3 1W0PA 3HBZA 3TEWA 4CCDA 1B35A 4P5YA 1RUG3 1S2BA 1FOD3 4K3UA 4DEQA 1OHFA 1NCRB 2R043 3LIGA 4WM7A 5JSRA 1OF4A 3WR0A 1JZ8A 3WDUA 3J7HA 1GNYA 5IVFA 4AZZA 5K9YA 4IERA 4XIKA 2JDPA 4P9LA 3AYDA 4BWOA 3N35A 2CV6A 3H42B 4LKDA 3RRDA 1CAVB 1XSQA 3H7YA 3GZEA 5IK8A 3WF3A 4Q4X3 1FV3A 3KCCA 4M00A 4XFAA 5LZ6A 5GJ6A 4W6YA 2A73B 4R52A 2RDNA 1RMU1 5E89A 1S2KA 3VBRA 3OYWA 3WHUA 3ZYJB 3KGZA 2Q8DA 3VDAA 1OH4A 1W8OA 3HNBM 2ARXA 3WINE 1VRH2 4YRDA 1WBLA 3T2TA 5FY5A 2P6HA 1RC6A 3CJIB 3VBUA 2UURA 3MIDA 5FZEA 3L2HA 3SKJE 1B35C 4AI0A 5I0SA 2QKDA 3FE5A 2YC2A 4Q26A 5DPNA 5J3UA 5G05L 5CEHA 1AVBA 5JMCA 5HXMA 3NVCA 3IB3A 4WZCA 2HWC1 2VTFA 1H2LA 3WF2A 4FQZA 5FZAA 4CPBD 3PTYA 2Q8EA 2YGMA 3WDVA 1N47A 4YGBA 5HI0A 4CCNA 4AVTA 4M0HA 5CVRA 4XW3A 5A3WA 2OUJA 1CWPA 3FHAA 3I3DA 3ZXDA 2XWBB 3CO2A 2P3JA 3K46A 4XAEA 3VZKA 4CDUA 1VBC2 1AJOA 1AR91 3AP4A 1JZ2A 2WAOA 3CKHA 5GLTA 5C8WA 2HJIA 3WG2A 4QPIA 5FR3A 2OIIA 1IQAA 3W21A 4KU8A 5I8SA 4CEWB 4E4SA 2VE1A 5FZLA 4YYOA 4H55A 2XLFA 3VZOA 3OGJA 3USUB 4GWNA 4Y5Z0 4B4PA 3QCWA 2XHKA 2XHNA 4GQ7A 4HPKA 5A70A 5FDBA 1DQ4A 2IWGB 4AVAA 5KC6A 3EBRA 2GC1A 2UYAA 4ZS2A 5F6KA 3U4SA 5C3SA 3OBTA 2WNUA 3LF7A 3OTFA 2ZGTA 4QM8A 4FP3A 1MZFA 2QVSB 4HG6B 2EIDA 1W04A 2DVDA 1MZ6A 3JD73 4AW7A 5KHGA 2WRAA 2W52A 3WP5A 3ZPOA 5FLIA 5KHJA 4RR3A 1UY1A 1E5IA 1P8JA 2CDOA 3LWCA 4QPYA 3OD4A 1SQ4A 3EXUA 3RGBA 1GZWA 3OEAA 4LE3A 1U5IA 2W3JA 4AEDC 1RUF2 4ISQA 2OT7A 3GGLA 3KQRA 4QPIC 3I8TA 1C5IA 3VN4A 4OFGA 5C71A 2VBPA 4FPEA 4ZHNA 2G19A 2YDEA 5FZ4A 4AXOA 2PAEA 4D0QA 3OG2A 1O91A 3PVBB 5A7OA 1W3XA 2X05A 4P00B 3VKLA 3WW3A 3U11A 2FCUA 3VZLA 1G9DA 4AK3A 1EYBA 3IDBB 5EYXA 2P4EA 3SCHA 1CPMA 4QX0A 4ES8A 2XJSA 3SH4A 1LGBA 3BOWA 2XJUA 1JXNA 2W08A 1TEIA 3AKSA 3A7QA 1R1ZA 3NW4A 5FK7A 4D6RA 2VMIA 4ZKTB 2YBKA 3FUOA 3KT4A 2VECA 4ITCA 1FPN3 1EY2A 3I2OA 2MEV3 3AVSA 3GDBA 4JGZA 2YY1A 4YSFA 2WJSA 2CAVA 2JECA 3BODA 3K77A 1JU3A 3I4IA 5FZ9A 4LJHA 4NE9A 5FKBA 4XCAA 5A7QA 1BJQA 4EWEA 1RMU2 2VG9A 2WA3A 5FPZA 2R1BA 3AKQA 1PM7A 1PHMA 2A7AA 2B8MA 3TEZA 1C3HA 3OCPA 5D8AA 4YW5A 4ZXKA 3WEZA 2OUHA 3IPVA 5A7NA 5F1RA 4MUVA 3MF6A 5A3PA 3QD6A 4RD7A 1W6OA 1HJGA 1OD3A 1RUH3 2RS33 4P9JA 4COZA 5IHRA 1GKBA 2B42B 1UY3A 3A22A 3VKOA 2UYBA 3VLBB 3HN3A 4IEXA 4AVVA 1O8PA 2VOTA 3SISA 4DY5A 1HJFA 2HWC2 3WNXA 5EHDA 5CG8A 2XKOA 4URTA 1ZA7A 4NROA 2HWF3 5C9AB 2QQOA 5F3EA 3J26N 3OJBA 4CDQA 1D2SA 1SFPA 1LCLA 1UY4A 4WVMB 4AYUA 2XUMA 1IS5A 4HK8A 4JGZC 4KH9A 2FDKA 2YGLA 1ZM1A 2Q1MA 4IEYA 5A1LA 4JTNA 1AX0A 5APAA 1AR92 4DXZA 3W9AA 2B5HA 4ZU7A 3T0DA 4K8FA 3O0VA 4ZXEA 5A6XA 3RYKA 3HMYA 4PQQA 3ZFFB 4FPGA 2FZ1A 1AX1A 2HEVF 2DCZA 5JOYA 3SEEA 3TWIA 4CCKA 1AR73 4IV3B 1K12A 2O0OA 4BQYA 1DYOA 1JOPA 3SH3A 2UWAA 2WWUA 3E6DA 4PHZA 4Y22A 1SBDA 3O1PA 5KXDA 1RJ7A 4YW7A 3OBZA 4BHPA 1NY71 5BYNA 3ZM8A 1BLZA 2X29A 1MQTA 1X8EA 4HVRA 2IVJA 1W9FA 2CAUA 4N43B 3Q8BA 4KG0A 5CA6A 2WNOA 3N7MA 4L99A 3ACFA 4RYDA 2W2IA 2J1UA 5A6YA 2Y6FA 4OHYA 5BNOA 5C4WC 4XHBA 1A3KA 1AR61 4G4FA 5C5UA 3BIWE 1UOJA 2XPJA 2YU1A 2BZDA 1SLAA 3DUIA 1ULPA 3MLJA 4FPOB 4Y33A 2RR13 2ZGNA 4HXCA 4EN6B 4EN0A 4EQVA 3WUCA 1UY0A 1ZREA 3MFCA 1NT0A 1UN1A 3NNFA 4W8JA 3O1VA 1H1MA 3N7KA 5FAXA 1J1TA 4F7ZA 1GZTA 5JIAA 5ERLA 1JBCA 2D7FA 2Z4FA 3ZSKA 2QQIA 4AQTA 2B9UA 5IJRA 1O4YA 4WVWA 3HD8B 4LHSA 4R4XA 4GMP3 5ANNA 2V09A 4P14A 4IE6A 4KL1A 1PO21 1UL9A 1Y3TA 2R071 5F3IA 1WW6A 2D97A 1RUC1 3NKGA 1N1YA 4NPLA 4JGYA 2GP3A 1JUIA 2XKPA 1O8SA 3PUAA 4NPMA 3KM5A 2DVAA 2LW8A 1D7PM 5D2AA 3ZFGC 1A8DA 2ZPXA 5FPBA 1HDKA 4CEYB 1RTVA 1SCSA 1V9U1 4PF5A 4Q0SA 3ITQA 4R8HA 3ZYGA 2ZZJA 1RITA 1UY2A 2VD7A 3FJSA 4CP9A 2ZTNA 1AZDA 4XQWA 4YVWA 1QJY3 5IFPA 3EO6A 2ZOEB 3THDA 3WP4A 2VZRA 5BNNA 3BPZA 2C9AA 3CDZB 2E31A 1TME3 1J83A 1IG3A 2A3XA 2D5HA 4LUKA 1O4ZA 1JN2P 4X6QB 3UL2A 3WOGA 3H50A 1AX2A 2PHUA 3SH5A 3U78A 2R49A 4K1ZA 1L3JA 1ZBA1 4IE4A 3C2UA 1JOBA 1J3RA 1ND3C 1I5PA 1TQ5A 3W5MA 5CKNA 4IV1A 2P34A 3O1RA 1UYZA 2D3PA 4NIDA 4OUSA 4CUBA 1HRI1 1PMHX 1PZ8A 1S0EA 1C4RA 1U5ZA 1DLCA 2VMCA 3R4DB 4JGYC 3VBHA 4E8CA 4F8AA 5JOZA 3AKTA 2ZA9A 1FV2A 2YPDA 1LHVA 3GZUC 4LULA 1KEXA 4NHYA 3UKNA 1ULOA 4E8DA 5GZFA 1QHDA 3ZMOA 4AEDB 2ZGUA 1IOAA 1WBFA 4PDWC 3RWNA 1CR7A 4FPCA 4QX7A 1VMFA 2H0VA 4A44A 4EROA 4RN5A 2J1EA 1Y7BA 5L9RA 5KXBA 3V0BB 4WVVA 1C8M1 3RZZA 4Q8LA 3ZKUA 5K8SA 4XURA 2NLRA 3ZFEB 2ZKNA 3N9OA 3MLLA 4CDWA 3I59B 4Y1YA 3FMGA 3DYPA 3M70A 1IQDC 4UW3A 4YVSB 1JOJA 4FI9A 3THPA 2J1RA 3I2KA 1OH3A 2D6OX 1BHGA 5DQ0A 1H9PA 2BVBA 1WGPA 2EXIA 2OQ6A 4XBQA 3GHMA 2HWD1 3EJKA 3H7JA 2KXLA 2YFUA 2VPVA 3MDPA 1CAWA 3B94A 3GBWA 5H9SA 5FXXA 5DUWA 5AFEA 1RINA 2ZHKA 5KHKA 1RL3A 5I0RA 1XB9A 1KS4A 2E32A 4LORA 2KM2A 1AR62 5L19A 1ZZBA 4RQPB 1HXS1 4JHZA 5FKCA 1DQ6A 1X82A 2R30A 2PHXA 5ANQA 3WUDA 1GBGA 1DBNA 4LUMA 4BA6A 1D4M3 5C8CA 3NRUA 3GJAA 4Y5SA 1ZRRA 1S0GA 3WNOA 1UIJA 3B00A 4I30A 2JDMA 2F4PA 5LA2A 4NWWA 1ZX5A 4P08A 2B39A 1RXGA 4XF3A 2DV9A 2CGPA 3NAPC 4CDWC 2BBVA 5GZDA 1ASJ1 5T5PA 1OD5A 2Y6GA 1ZZ7A 2ORZA 5KXCA 2LTNA 2BOIA 5L7OA 5DAXA 1PO22 2EALA 4CU6A 2R072 1S0DA 5FP9A 3VZNA 3POYA 4K40A 2IXLA 3S7IA 3EYPA 2HWB1 4TSVA 1BBT3 1AL0G 4LEJA 3ZN5A 4D6QA 5KHIA 4L97A 5CZKA 4TWTA 1OFSA 5J37A 1ZBE1 2GNMA 2NZ9A 3HOBA 4Q27A 4RS5A 4XF1A 3B9IA 4XUTA 1QJEA 4ES9A 2QQWA 1RUG1 3FC0A 1FOD1 2OXBA 4P9WA 1MS9A 1ULEA 3WP6A 2R041 3WDXA 1K5MA 1OI6A 3D4KA 2WNEA 2PELA 1W2OA 2A3YA 3H8RA 1BXHA 1V9U2 3DECA 1GMMA 5FY7A 2XH6A 2XOMA 3RI9A 4C8DA 4AL9A 1G9CA 2WT1A 3ZN6B 1SDWA 4Q4X1 1NA1C 2K2SA 4BLJA 2SLIA 3K3OA 4E4HA 2W46A 4CU7A 1F31A 1WD3A 1QXJA 3T2PA 4UF0A 4YW4A 2VNOA 3BTXA 1UQXA 1N3OA 1ZBA2 4QQPA 2VUAA 1O5UA 4LMFA 1GYKA 4NVPA 1UPSA 4QHOA 1XOYA 3H1YA 5A7WB 5SV8A 3LSEA 2PHLA 2JD9A 2DVGA 4LOTA 1HRI2 4C1WA 5M0TA 1VALA 4XEZA 4L8QA 1AXZA 5C4WB 4RS5C 1T6GC 5A33A 4QDQA 3CJXA 4IQPA 1TE1B 5DZGA 4YFWA 1OOPA 1BCXA 4S2DA 1ZZCA 3J4UH 3QH7A 1XYPA 4YG3A 5K0UA 2XR4A 4OZOA 4CTEA 2ID4A 5CFDA 1XNCA 3HVDA 5A3UA 3ZXLA 4LNVA 4CCOA 5F37A 1JW6A 2VBDA 3HIFA 1CVNA 1C8M2 4I01A 3S6PA 4WM8A 1XQNA 3VBFC 1UYYA 2HEWF 3LDRA 3WF0A 1CAXB 1W2TA 3ELNA 3ZVXA 3BGAA 3MV01 4LO5B 1GOFA 1PMJX 4L2NA 1WLTA 3BIEA 1UMIA 4XFIA 2Q1ZB 4R9CA 5FMCA 4BQ3A 4HN0A 4DXSA 1SPPA 1IPSA 2OW4A 5DAPA 5FY1A 5IK5A 4GJYA 2ZX4A 2CL2A 4ATFA 4EV0A 1CGPA 4IEZA 4LBOA 2JJ6A 3KVAA 2HWD2 2WFPA 2ZHMA 4C1XA 2VNVA
chains in the Genus database with same CATH topology
2OQ6A 5FZKA 3ZLIA 3KV5A 5LY2A 2XXZA 5FP3A 5A7PA 5FXXA 3U4SA 4CCLA 4BU2A 5FYHA 4LITA 5F2WA 4Y4RA 5FZ6A 5FYTA 3PURA 2W2IA 2OQ7A 3PU8A 3ZPOA 3KV9A 5FWJA 5ANQA 4QX8A 2YU1A 5FZCA 2GP5A 5FZFA 4QXBA 5F5CA 4AI9A 4Y33A 4LXLA 5FP8A 2XDVA 2XUEA 5FPUA 2XMLA 4QXCA 5FZDA 3PUQA 5FY0A 5IW0A 5K4LA 4EZHA 4CCJA 3N9PA 4XDOA 5FYUA 2OT7A 5LW9A 5FY4A 5FXVA 5FV3A 5FWEA 5FXZA 2WWJA 4IGPA 5FY8A 5FZ4A 5IVEA 4CCMA 3OPTA 5LY1A 5FZBA 4IGOA 5FP9A 5A7OA 5FZGA 4GAZA 5A80A 5FYSA 5A3NA 4D6SA 4D6QA 2YBSA 5F3IA 3N9LA 5FZ1A 5FZ8A 4CUGA 4NUBA 3N9NA 5F3GA 2GP3A 5FPVA 3PUAA 4V2WA 3K2OA 5IWFA 4D6RA 4AAPA 4LIUA 2YBKA 3KVBA 3UYJA 3DXUA 5FY7A 5FPBA 3KV4A 5F5IA 5FP7A 5FYYA 4C8DA 5IVFA 5F39A 3AVSA 5A7WA 5FZ9A 5FP4A 5IVCA 5A7QA 2VD7A 5F32A 5FPLA 4E4HA 5LWBA 3K3OA 3KV6A 5FBJA 3LD8A 4GD4A 2P5BA 5A7SA 4UF0A 4TN7A 5FZ3A 4HONA 4XDPA 4CSWA 4EYUA 2Q8DA 5A7NA 3PDQA 2Q8CA 3U78A 5FJKA 5FYVA 5A7WB 5IVVA 5ISLA 3LDBA 5A3PA 3AVRA 3DXTA 5A3TA 3PTRB 5FYZA 5FZIA 5FY5A 3N9MA 1VRBA 3AL6A 5FZEA 4UF0B 5FYCA 2OX0A 4QWNA 5CEHA 5F2SA 4IGQA 2PXJA 4Y3OA 2YPDA 5F3CA 5F3EA 5FYBA 4BISA 4BXFA 2YU2A 5FZAA 5FZOA 4LIVA 2YBPA 4URAA 2Q8EA 2OS2A 4CCOA 5F37A 5FPAA 4QX7A 5FZMA 5IVYA 4CCNA 3OPWA 5IVBA 5A3WA 5A1LA 3K3NA 5FUNA 5FYMA 3PUSA 4V2VA 4QXHA 5FXWA 3AL5A 5KR7A 3N9QA 5E6HA 4ASKA 5FZ7A 5FUPA 3N9OA 5A1FA 5FYIA 5FZOB 4GJZA 4CCKA 3RVHA 4QU1A 5FY1A 5FZLA 4GJYA 4DO0A 5FZ0A 4DIQA 4HOOA 5F5AA 3PU3A 5FY9A 5IVJA 2WWUA 3KVAA 5FJHA 5FZHA 4EZ4A 3NJYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OQ6 A;  5FZK A;  3ZLI A;  3KV5 A;  5LY2 A;  2XXZ A;  5FP3 A;  5A7P A;  5FXX A;  3U4S A;  4CCL A;  4BU2 A;  5FYH A;  4LIT A;  5F2W A;  4Y4R A;  5FZ6 A;  5FYT A;  3PUR A;  2W2I A;  2OQ7 A;  3PU8 A;  3ZPO A;  3KV9 A;  5FWJ A;  5ANQ A;  4QX8 A;  2YU1 A;  5FZC A;  2GP5 A;  5FZF A;  4QXB A;  5F5C A;  4AI9 A;  4Y33 A;  4LXL A;  5FP8 A;  2XDV A;  2XUE A;  5FPU A;  2XML A;  4QXC A;  5FZD A;  3PUQ A;  5FY0 A;  5IW0 A;  5K4L A;  4EZH A;  4CCJ A;  3N9P A;  4XDO A;  5FYU A;  2OT7 A;  5LW9 A;  5FY4 A;  5FXV A;  5FV3 A;  5FWE A;  5FXZ A;  2WWJ A;  4IGP A;  5FY8 A;  5FZ4 A;  5IVE A;  4CCM A;  3OPT A;  5LY1 A;  5FZB A;  4IGO A;  5FP9 A;  5A7O A;  5FZG A;  4GAZ A;  5A80 A;  5FYS A;  5A3N A;  4D6S A;  4D6Q A;  2YBS A;  5F3I A;  3N9L A;  5FZ1 A;  5FZ8 A;  4CUG A;  4NUB A;  3N9N A;  5F3G A;  2GP3 A;  5FPV A;  3PUA A;  4V2W A;  3K2O A;  5IWF A;  4D6R A;  4AAP A;  4LIU A;  2YBK A;  3KVB A;  3UYJ A;  3DXU A;  5FY7 A;  5FPB A;  3KV4 A;  5F5I A;  5FP7 A;  5FYY A;  4C8D A;  5IVF A;  5F39 A;  3AVS A;  5A7W A;  5FZ9 A;  5FP4 A;  5IVC A;  5A7Q A;  2VD7 A;  5F32 A;  5FPL A;  4E4H A;  5LWB A;  3K3O A;  3KV6 A;  5FBJ A;  3LD8 A;  4GD4 A;  2P5B A;  5A7S A;  4UF0 A;  4TN7 A;  5FZ3 A;  4HON A;  4XDP A;  4CSW A;  4EYU A;  2Q8D A;  5A7N A;  3PDQ A;  2Q8C A;  3U78 A;  5FJK A;  5FYV A;  5A7W B;  5IVV A;  5ISL A;  3LDB A;  5A3P A;  3AVR A;  3DXT A;  5A3T A;  3PTR B;  5FYZ A;  5FZI A;  5FY5 A;  3N9M A;  1VRB A;  3AL6 A;  5FZE A;  4UF0 B;  5FYC A;  2OX0 A;  4QWN A;  5CEH A;  5F2S A;  4IGQ A;  2PXJ A;  4Y3O A;  2YPD A;  5F3C A;  5F3E A;  5FYB A;  4BIS A;  4BXF A;  2YU2 A;  5FZA A;  5FZO A;  4LIV A;  2YBP A;  4URA A;  2Q8E A;  2OS2 A;  4CCO A;  5F37 A;  5FPA A;  4QX7 A;  5FZM A;  5IVY A;  4CCN A;  3OPW A;  5IVB A;  5A3W A;  5A1L A;  3K3N A;  5FUN A;  5FYM A;  3PUS A;  4V2V A;  4QXH A;  5FXW A;  3AL5 A;  5KR7 A;  3N9Q A;  5E6H A;  4ASK A;  5FZ7 A;  5FUP A;  3N9O A;  5A1F A;  5FYI A;  5FZO B;  4GJZ A;  4CCK A;  3RVH A;  4QU1 A;  5FY1 A;  5FZL A;  4GJY A;  4DO0 A;  5FZ0 A;  4DIQ A;  4HOO A;  5F5A A;  3PU3 A;  5FY9 A;  5IVJ A;  2WWU A;  3KVA A;  5FJH A;  5FZH A;  4EZ4 A;  3NJY A; 
#chains in the Genus database with same CATH topology
 1H4G A;  2EIC A;  3VDD A;  3ZFG B;  2LUW A;  3HT2 A;  3I3B A;  2X5I C;  1AUY A;  4HN1 A;  4B29 A;  2JDY A;  1SLB A;  2Q1F A;  2RM2 3;  2WN2 A;  4AI1 A;  2RDS A;  1ALY A;  1HXS 2;  1RIR A;  1I6X A;  4BIF A;  1JOD A;  5E1R A;  3JD7 1;  1V6O A;  1G9A A;  3KF5 A;  1DZR A;  3P5B A;  2Y8K A;  3GJB A;  4PIY A;  1LU1 A;  2Y6K A;  1W6Q B;  4PCR A;  4OCT A;  1T6B X;  3PHM A;  4PBO A;  4DIN B;  4XAC A;  4XET A;  4YGE A;  1N1V A;  1QNY A;  4EZH A;  1FNZ A;  1HB1 A;  1KXG A;  1ND3 B;  1ZNP A;  3AMP A;  3ZN4 A;  1ASJ 2;  3FUQ A;  4CCJ A;  1R64 A;  1UX7 A;  4ORF A;  1UU5 A;  3S5Q A;  5FY4 A;  3THC A;  5A32 B;  2ZGM A;  2XGX A;  4BQ4 A;  2GN7 A;  1NCQ A;  1PO1 3;  1WW7 A;  3NNL A;  4IGP A;  4JX0 A;  5DUU A;  3NJZ A;  4OI0 A;  3NL1 A;  3KCY A;  3H8U A;  4IET A;  4DY3 A;  1GP4 A;  1ZBE 2;  3D5O A;  3WY6 A;  1IKP A;  3SEP A;  1BK0 A;  1RUG 2;  3H3U A;  2Z69 A;  4D69 A;  4O9G A;  1U5Y A;  2R04 2;  1Y4W A;  4EN9 B;  1ULD A;  3ECQ A;  5LB6 A;  4AE2 A;  2ARC A;  2P1B A;  3NQH A;  3T4H B;  3MPB A;  2VZ1 A;  4ZY9 A;  1YEW A;  5JIU A;  3DXU A;  3JQX A;  1FPN 1;  1KD7 A;  3KV4 A;  4NJ4 A;  3MGU A;  2MEV 1;  4QPW A;  1HB4 A;  1BK1 A;  4JKL A;  4Q4X 2;  5CU1 A;  4FPF A;  3RQ0 A;  3PME A;  4Y26 A;  1QOS A;  3OEB A;  4XVH A;  1GIC A;  4CEW A;  3KV6 A;  2C0Z A;  3QOP A;  1MVQ A;  3E97 A;  3I2H A;  2CYF A;  1OSG A;  2YXS A;  5T3N A;  2VZU A;  2VUJ A;  3N7L A;  1PX3 A;  4MGZ E;  5CFC A;  4CSW A;  1NCQ C;  2DWR A;  4QDR A;  3E5X A;  4XBN A;  3CLP A;  3IBM A;  4JVA A;  4YZ4 A;  4XIO A;  3OY8 A;  3KF3 A;  5IVV A;  4UW4 A;  3SKV A;  1H1I A;  1NYW A;  3VL8 A;  1X9P A;  1J84 A;  3ORJ A;  2RS3 1;  1RUH 1;  4LBL A;  2D93 A;  3RYR A;  3THT A;  3WSO A;  2BNO A;  2QZ3 A;  3AL6 A;  2ZX3 A;  2WSV A;  1PZ9 A;  2YC0 A;  1DGR N;  5JXG A;  5JZG A;  1X9T A;  4MSV A;  4KQ7 A;  2OX0 A;  3V56 A;  3R0R A;  4IGQ A;  2GSY A;  1NZC A;  2HWF 1;  5L73 A;  5JDB A;  2E53 A;  3TEY A;  2RDQ A;  5L9B A;  4QKB A;  2DU0 A;  3D82 A;  4XOG A;  4URA A;  1W0O A;  1YQ5 A;  3FZ3 A;  5JI7 A;  2WNV B;  1LR5 A;  3NAP B;  3EQE A;  1QOO A;  2GNT A;  2K9Z A;  2QBX A;  5A3L A;  4JDN A;  3T4V A;  2XLG A;  5FYM A;  4J1X A;  4QAW A;  4FO9 A;  2WLP A;  4HMZ A;  4ZPI A;  2F4L A;  3ENR A;  2ZKL A;  3AL5 A;  4NHM A;  2W0X A;  3N9Q A;  2Y26 A;  2XBO 3;  4P9G A;  4XXP A;  2HKX A;  5CFC C;  1SFN A;  5JPN B;  4XZU G;  3W58 A;  5GZE A;  4QU1 A;  1CON A;  1AR7 1;  5DZE A;  4U2A A;  3WNM A;  4DIQ A;  5FOJ B;  3T1L A;  1UKG A;  5FQ0 B;  1RUE 3;  3POE A;  3POS A;  4K8R B;  1LOG A;  4K20 A;  4A41 A;  3M7A A;  3ZLI A;  1GWK A;  2W47 A;  3FBM A;  4RSU A;  5A7P A;  3I2G A;  2JWP A;  4IEW A;  3JD7 2;  4FTE A;  4BU2 A;  1RXF A;  1UOF A;  2PHT A;  1PVC 2;  1OC1 A;  3GHN A;  5KWR A;  4Y4R A;  1EUU A;  2FHR A;  3LZZ A;  2RS1 3;  2W1Q A;  4NAO A;  2BYV E;  1QQP 3;  2WUH A;  3R4S A;  4GMP 0;  4XFF A;  3PU8 A;  4NMI A;  3JB4 C;  3LA2 A;  4PI2 A;  1Q8O A;  3H8X A;  3BI3 A;  4KI5 M;  4BQW A;  3D8C A;  4FAG A;  5HBA A;  5AFB A;  2QQL A;  3R05 A;  2W92 A;  3AX4 A;  3ILF A;  1OUX A;  4X8N A;  5EYY A;  3ZYH A;  4B1L A;  2RR1 1;  4DXT A;  4QKF A;  1DDL A;  3GZT B;  3NV4 A;  1W6P A;  5T55 A;  4N53 B;  2GNB A;  5J1X A;  4AHY A;  1ENR A;  3AMM A;  5AVA A;  4RHV 3;  1V0A A;  3CZJ A;  2BJS A;  2Y6J A;  1YJK A;  3ACG A;  3ZDV A;  1AXK A;  1DIW A;  3NNJ A;  4CXY A;  5FZG A;  4GMP 1;  4GAZ A;  4LBN A;  4QD2 A;  4ISR A;  1AYM 3;  1XYN A;  3N36 A;  1Q8P A;  4XUO A;  1F5J A;  1OQ1 A;  1O59 A;  1DU3 D;  2G9F A;  2ORX A;  4MGQ A;  5HCB A;  4XE9 A;  3O0X A;  1FPN 2;  2MEV 2;  3KGL A;  2F6B A;  2QNK A;  1WUV A;  2IFR A;  3Q8A A;  1OUS A;  3CNA A;  4Y1X A;  2VVF A;  4AI8 A;  3H0O A;  2HWE 3;  3UNP A;  1W39 A;  4YW2 A;  1MZ5 A;  5FPL A;  1GQH A;  1X8M A;  5C70 A;  5EXO A;  1QJY 1;  4M3C F;  4AR2 A;  2F17 A;  1W6M B;  2VUL A;  2YPJ A;  3BTA A;  1S0B A;  4QQH A;  1TME 1;  1H1A A;  3NWK A;  2X5I B;  1OPM A;  4EYU A;  3S57 A;  3MO4 A;  4QPG B;  5FBZ A;  2RS3 2;  1RUH 2;  2P3K A;  2QTW B;  3AXD A;  3HQX A;  4FPY A;  4QX3 A;  4UFI A;  5F8P A;  3VZM A;  2BU9 A;  2IXI A;  4N43 A;  1LGC A;  1TNF A;  5DMY A;  1FYU A;  1OKQ A;  3AP9 A;  4Q4V 3;  1MZE A;  1JMU B;  2D6N A;  2HWF 2;  1ZRI A;  3SCF A;  1LEM A;  2DFB A;  3UES A;  2G9Z A;  3PLQ A;  3DPR C;  4COY A;  1SZB A;  3ABZ A;  3GXU A;  2JB8 A;  4I3G A;  3ZDS A;  5ABJ B;  2D6P A;  3UET A;  5F3C A;  4N90 A;  4BXF A;  4P9Y A;  4D7T A;  1JTZ X;  4UFK A;  4AWD A;  1CAU B;  2XJQ A;  3HWJ A;  1W28 A;  3PVN A;  2XQR A;  3J7M A;  1SDD B;  2DYC A;  3X29 B;  4PIZ A;  1QJX 3;  1O4T A;  3FLT A;  1HV1 A;  1HB2 A;  1W8H A;  5E6H A;  4EN7 B;  4UYB A;  1AR7 2;  3K4Z A;  5IK4 A;  1IGO A;  4IND A;  4IE7 A;  1OVS A;  2V5Y A;  4CE8 A;  1Q5O A;  2WQZ C;  3DKW A;  1Y9G A;  2VXR A;  3C7O A;  4KNC A;  5JR2 A;  1S0C A;  4BOW A;  1HKD A;  1VMJ A;  3WZ1 A;  4MGT A;  2FCV A;  4WM7 C;  2YMZ A;  2P2K A;  5E16 A;  3ZPY A;  3WXP A;  3BTY A;  4QT6 A;  1ND2 A;  3DCQ A;  5EP9 A;  4CEY A;  2ZJC A;  2VW0 A;  5FYH A;  4YZ2 A;  5K7P A;  2JG8 B;  4LBQ A;  2FDH A;  1JHJ A;  1QGL A;  1EAH 2;  1BVV A;  4PBP A;  3UGF A;  4TLF A;  2HLE A;  2WQ8 A;  2QDN A;  4ASL A;  2RR1 2;  3VBR C;  1D4M 1;  1OUR A;  2QFE A;  2ZXQ A;  4LTA A;  4BIO A;  2PLV 2;  2O8O A;  5FY0 A;  5HXV A;  2W5F A;  3LDK A;  2WN3 A;  3B01 A;  1AL2 3;  5CNA A;  1RUD 3;  3WX5 A;  2G1M A;  3CHX A;  2WWJ A;  3VBU C;  5FY8 A;  3WG4 A;  1JYN A;  1L7Q A;  2ZGK A;  3AYA A;  5LA1 A;  5ACA 3;  1I5Z A;  3AMH A;  3PIJ A;  5JUV A;  2L9L A;  1U5X A;  1BBT 1;  3O5S A;  4GKX A;  3BCW A;  3OUI A;  4KGG A;  2RE9 A;  4FSJ A;  1YNA A;  3AKP A;  1ND2 C;  1S0I A;  1OF3 A;  2DTY A;  2VZ3 A;  3N9N A;  4X8P A;  2ZAH A;  3WW1 A;  4CDX A;  1WMF A;  4UT5 A;  2FDF A;  1DZT A;  1WME A;  4QHZ A;  4V2W A;  2PHF A;  2JDA A;  3WLU A;  4CDU C;  2Y64 A;  3N7J A;  3ZFE A;  1RJ8 A;  4K7J A;  1IHM A;  2WZR 3;  4QB2 A;  5GLV A;  1NZI A;  3WQ0 A;  4NWV A;  1QJY 2;  1VBE 2;  1YIP A;  4A6S A;  2EXJ A;  2IXJ A;  1G9B A;  1TME 2;  2Q4S A;  1NG0 A;  2GMP A;  5A7S A;  1AR8 3;  1QNW A;  1SHW B;  2NM1 A;  3LGR A;  2E6V A;  1XBF A;  2GAL A;  2W87 A;  2O1Q A;  4UFJ A;  2IFW A;  2OPW A;  2Q8C A;  4DMI A;  2VQ0 A;  3M3O A;  4IEQ A;  4YM1 A;  5ISL A;  2WNU C;  2QE3 A;  4Z2A A;  4HK9 A;  3OB8 A;  3ZXF A;  2ZEY A;  4N7U A;  1UWW A;  3E6B A;  4RQP A;  4LE4 A;  3RMY A;  4BQ2 A;  1UXX X;  4FFG A;  1QOT A;  4RR3 C;  3RDI A;  3TBD A;  4CDX C;  3LKJ A;  2QJV A;  3RZJ A;  5F2S A;  1FNY A;  4ZZ8 A;  2W91 A;  2LRP A;  3LEI A;  3OUH A;  4XC9 A;  1NXD 1;  2AZ5 A;  1ZYB A;  1YXW A;  3BPS A;  1RUI 3;  2R0H A;  2DUR A;  2I45 A;  1CZV A;  2ET1 A;  3PVO A;  1YUD A;  4OHV A;  2ERF A;  4NHK A;  4HFS A;  3AJZ A;  2DF7 A;  2IXC A;  1A78 A;  1Z7S 1;  3TNP B;  1O5L A;  2VUC A;  3GYD A;  4JDM A;  1VB4 A;  4A7Z A;  5DG2 A;  3RI8 A;  2FMY A;  4LLF A;  3VD9 A;  1QU0 A;  2XLA A;  3ZOI A;  2VO5 A;  3SIT A;  2BQP A;  3R6S A;  1OT5 A;  1R1A 3;  4FAH A;  3T09 A;  1QXR A;  4Q8K A;  2R1D A;  4FPL A;  5IYY A;  1BKZ A;  4XFB A;  4HOO A;  4W6X A;  3K75 B;  5IVC A;  1IS6 A;  2WIN B;  3WF4 A;  4FCA A;  1LOF A;  2VTX A;  4CP2 A;  1FXZ A;  1GZ9 A;  3C7E A;  1AJK A;  4H3W A;  4CVU A;  2RM2 1;  2YFZ A;  2QCS B;  3FLR A;  2ZGO A;  4QX5 A;  4G9S B;  5IAX A;  2QQM A;  4DZG A;  3ETP A;  3ZN6 A;  5F2W A;  2VZQ A;  5D1I A;  3MYX A;  1UZV A;  2C26 A;  2BFU S;  2X10 A;  3MBW A;  2QQU A;  1D4M 2;  4GZ9 A;  2VXJ A;  5LCW L;  1YJL A;  5FZF A;  1PK6 A;  5D8A C;  3VV1 A;  4D94 A;  3O12 A;  1VJ2 A;  3NJX A;  5HV4 A;  4I0B A;  2XML A;  1W9S A;  2XJR A;  2WC2 A;  1SLC A;  5B4X A;  4XDO A;  4MHR A;  2CU5 A;  4LLO A;  1JH5 A;  2HYX A;  1PO1 1;  2AH2 A;  3CF6 E;  4L9B A;  3DPR B;  1MS5 A;  4CCM A;  1BBT 2;  4A7Y A;  3U07 A;  2GND A;  1C5H A;  1UIK A;  4EN8 B;  1HN1 A;  3PUI A;  4NAM A;  4LKE A;  4Z07 A;  4AGG A;  3DYO A;  1LOF C;  1LEN A;  1XC6 A;  3M3Q A;  4QU2 A;  4UI9 L;  4CDQ C;  1ULC A;  3T0B A;  1Q8S A;  3MIH A;  4LKS A;  2JD4 A;  2PHD A;  4M0N A;  4QX1 A;  3ZR6 A;  3L2Y A;  5FCC A;  1LB2 A;  5I8Y A;  3NNG A;  2BW8 A;  1F15 A;  1QH7 A;  5DDJ 3;  1CAX A;  1RUJ 3;  3MZH A;  1N3P A;  3I2I A;  1PNF A;  5GLU A;  1F9K A;  2PA7 A;  3POI A;  3V0A A;  1OLQ A;  4Y20 B;  2Y0I A;  3WNN A;  1PK6 C;  4FPK A;  4BMB A;  1PZ7 A;  5I8T A;  2XL9 A;  2ZEX A;  4H7L A;  5LBF A;  3WNL A;  1B35 B;  2XJP A;  1WLD A;  3AMQ A;  4MET A;  4BPZ A;  4WM7 B;  4OI2 A;  4HON A;  4AFC A;  4F83 A;  1VR3 A;  4XUN A;  1XE0 A;  3VBS A;  4PIX A;  5DUV A;  1QIQ A;  2VMG A;  1Y9M A;  1PGL 1;  2AUY A;  1VBC 3;  2W1U A;  1MQT C;  1GOG A;  1XNB A;  3ACH A;  4LO8 A;  2CNA A;  1SFY A;  2SBA A;  1WCD J;  4M3C A;  4XBL A;  5BNO C;  2WS9 3;  3VBR B;  3NV1 A;  3ACL A;  3BYW A;  3OYW B;  4QWN A;  3KWV A;  1DQ5 A;  1IKQ A;  3W20 A;  2JE9 A;  3FFZ A;  1RVF 3;  4O65 A;  2B9V A;  4UBG A;  1H8T A;  1PM4 A;  4FOQ A;  1S0J A;  2E26 A;  1PNG A;  4KMQ A;  3VBU B;  1PMI A;  1RB8 G;  2A6V A;  2RS5 3;  2C9K A;  4ZU4 A;  5DAB A;  3VHN A;  4IL7 A;  5KR7 A;  2VAU A;  2GC0 A;  2I07 B;  2XBO 1;  4ASK A;  2QDR A;  4XPV A;  3D3A A;  5FYI A;  1H2N A;  1US2 A;  2O8Q A;  3T3Y A;  1YI7 A;  3WDY A;  1TNR A;  1Q3E A;  2Q8O A;  4J6G A;  4QMA A;  4YGD A;  3ZX7 A;  2PTM A;  5F5A A;  3U75 A;  4AI3 A;  1ZRF A;  5FZH A;  2BRT A;  1EV1 3;  2JDK A;  3LA7 A;  5FJH A;  5H9Q A;  3UJO A;  3H8O A;  3VD5 A;  1F35 A;  1RUE 1;  2R16 A;  2V72 A;  3QH6 A;  2RM2 2;  4CDU B;  4ARY A;  3HQU A;  4HL0 A;  4XTP A;  3WVJ A;  5B4N A;  4SLI A;  1H6X A;  3ZYP A;  1ZRD A;  3FHQ A;  1DP0 A;  4QPI B;  4NRM A;  4MX3 A;  3J8F 3;  4Q4Y 3;  4LIT A;  3MLK A;  1YYN A;  2WQ4 A;  1UPI A;  5FYT A;  4BH9 A;  3PUR A;  2RS1 1;  2DFC A;  2FBE A;  1QQP 1;  5IUQ A;  1GR3 A;  2ZX1 A;  1MS3 A;  1UYX A;  4M4P A;  2W94 A;  4IEP A;  2HEY F;  4ZON A;  4YVW C;  3VBO A;  4HPK B;  1XJA A;  2ZHL A;  4FT8 A;  4MGK E;  4QX8 A;  4BXS V;  5BNN C;  2GC3 A;  3O0W A;  3VDC A;  2X09 A;  4OQ8 A;  1ULF A;  2XL7 A;  3RNS A;  2DCK A;  2WNU B;  2Y60 A;  1LES A;  3AP5 A;  5BUV A;  3AJY A;  1PO1 2;  4UBH A;  1LTE A;  4BM8 A;  4FTB A;  1KJL A;  4Y24 A;  1W6N A;  1Q8V A;  2D44 A;  4IV1 C;  1NY7 2;  3L9J T;  1UCX A;  3M2M A;  4IUG A;  2RMU 3;  3KHB A;  4GB3 3;  1G6N A;  4RHV 1;  3P6B A;  4QHB A;  4RGA A;  4RR3 B;  1V6M A;  5T5J A;  4CYD A;  5IVE A;  2H6B A;  1ZZ9 A;  5CYY A;  5FZB A;  3VBH C;  3INA A;  1KIT A;  2VMF A;  1ODN A;  1WD4 A;  2IXH A;  4XJ8 A;  1W9T A;  1GZW B;  1AYM 1;  4PLM A;  3POB A;  3N4M A;  2AEY A;  5JMO A;  3K4A A;  1JS9 A;  4QGN A;  2D40 A;  2R32 A;  4LIU A;  4Q1P A;  1SLL A;  5JAX A;  2HYK A;  2PQQ A;  3A4U A;  5FYY A;  1JU4 A;  1K42 A;  3T2O A;  2C6S A;  4LO7 A;  4LBJ A;  2JKB A;  4ATE A;  2HWE 1;  2FMD A;  3T1M A;  4MOA A;  4NIH A;  1RYY A;  1IZ3 A;  4U36 A;  3NV2 A;  4E27 A;  4BK5 A;  1OKO A;  1WCS A;  4XMI A;  5B2G B;  1ZRC A;  1HLC A;  1XU1 A;  1W8W A;  5EPA A;  3UKT A;  3ON7 A;  5FQ0 A;  2W39 A;  4BQX A;  1QDO A;  1PGL 2;  1RUC 2;  4PQ9 A;  4DNY A;  5IFT A;  5HCH A;  3PDQ A;  3VL9 A;  3RZG A;  3LPG A;  4QDS A;  1W99 A;  4JGZ B;  5AC9 3;  4GA9 A;  3UKV A;  2VQT A;  3DXT A;  3PTR B;  1GWL A;  1UX6 A;  1Z78 A;  1SG3 A;  4Q4V 1;  1X36 A;  4Y1V A;  4CU8 A;  2P37 A;  4JCK A;  5JCT A;  3S0M A;  4S2F A;  3HBK A;  1ENS A;  2ZGS A;  3M3E A;  3ST7 A;  1NLS A;  3MW3 A;  2EAA A;  5FYC A;  3JU9 A;  5D8A B;  4QGL A;  4GH4 A;  3Q8F A;  3WT3 A;  4Y3O A;  2RJK A;  1XNA A;  3IPV B;  4CU9 A;  1R09 3;  5C8C C;  4YM3 A;  3ZIX A;  5FZO A;  4LIV A;  1OPO A;  1CIW A;  1V6K A;  3I3E A;  5F9T A;  3A21 A;  2J22 A;  3BB6 A;  1JZ4 A;  1W6O B;  3CL1 A;  3K51 A;  4M3C E;  3AZY A;  2J1A A;  4O61 A;  3GF6 A;  3MFA A;  5LA9 A;  4CPB A;  5KC5 A;  1LHU A;  4R9A A;  2ETE A;  4OUL A;  1O3Q A;  1QJU 3;  3IMN A;  1QDC A;  1QJX 1;  1XND A;  2DVB A;  2XBO 2;  2B45 X;  4V2V A;  5I0U A;  2CSG A;  5L7O C;  1V00 A;  2PFW A;  5E88 A;  4QQL A;  1JZ3 A;  4CDQ B;  2B46 X;  1ACC A;  4ZZ5 A;  5C3Q A;  1XE7 A;  3O1U A;  3DV8 A;  3VKN A;  3OSD A;  5J7M A;  4IW3 A;  3KT1 A;  5FZ0 A;  4YWA A;  4GIQ A;  5IVJ A;  3AYC A;  3RZH A;  2C4X A;  2WT2 A;  2FQP A;  4EZ4 A;  4OI4 A;  1DFQ A;  3KQ4 B;  4YW1 A;  3WF1 A;  2ET7 A;  1PGW 1;  4B1M A;  3IT8 A;  1VBD 3;  4W50 A;  1K5M C;  2Y33 A;  2VC9 A;  4KWU A;  1L7R A;  4PLO A;  3HEI A;  4E4Z A;  5DAV A;  3O7O A;  2RS1 2;  1QQP 2;  5T5L A;  2WT0 A;  4OHZ A;  1WCQ A;  1RGS A;  2YZ4 A;  2UWB A;  4P9X A;  5I0T A;  4BME A;  5J96 B;  5CB7 A;  2FCT A;  5JXJ A;  3I2F A;  2WAA A;  1Z7S 3;  1DF0 A;  2JG9 A;  4NII A;  5FWJ A;  4QGM A;  4Y22 B;  3AK0 A;  4L92 A;  5T5O A;  5EIY B;  1F5F A;  5FZC A;  1C1L A;  2ZS6 B;  4PT6 A;  4AI9 A;  5LRR A;  5LA0 A;  5FP8 A;  4JQT A;  2IC1 A;  4KGQ A;  2VH9 A;  2OZ6 A;  5BNP A;  1MQT B;  4A3Z A;  3ZXE A;  2V5D A;  2VNR A;  1AL2 1;  4HVO A;  4RHV 2;  2BP6 A;  5A3M A;  2A3W A;  3E5Q A;  4V1P A;  5JSP A;  4XJA A;  3JXS A;  1RUD 1;  1NCR A;  3E1F 1;  5CAZ A;  1Q8Q A;  1XSR A;  5BNO B;  1FMD 3;  2VCC A;  3ZSJ A;  1AXY A;  1AYM 2;  1MEC 3;  4DQA A;  4E2G A;  4K6B A;  4Y4Y A;  1OOP C;  5ACA 1;  2ZEZ A;  2VOW A;  2DCJ A;  5K0U C;  3GCW A;  4Q5O A;  1CZS A;  1GU3 A;  1H4H A;  1VAV A;  1O3R A;  1CAV A;  5CFD C;  2TNF A;  3VHR A;  4QKD A;  1CPN A;  4BQ1 A;  4D7Y A;  2CTV A;  2Y38 A;  4AG4 A;  2GZW A;  1FT9 A;  2DTW A;  4JHT A;  4DPN A;  2XVK A;  4FQ4 A;  4WM8 C;  4XIL A;  4OQ9 A;  1K45 A;  4AAP A;  3LEG A;  2MHF A;  2JB4 A;  3KVB A;  5FOB B;  4SBV A;  3JQW A;  2HWE 2;  3TN9 3;  5FP7 A;  1WZX A;  3JBG 3;  4MZU A;  4BE3 A;  3IN9 A;  1V6N A;  5F39 A;  2WZR 1;  1W8Z A;  1I1E A;  1W8T A;  4I09 A;  1ODM A;  1OQE A;  2Y34 A;  3SHR A;  3VKM A;  5BNP C;  2A6Y A;  3CJI A;  4Q0U A;  4JGY B;  4ZS3 A;  3B69 A;  3POW A;  2HWB 2;  3ZIW A;  1GWM A;  1IPK A;  2A6Z A;  1BMV 1;  1GNZ A;  1X33 A;  4XDP A;  5EQU A;  3ZXG A;  1AR8 1;  4BYY A;  2R0F A;  5F7U A;  3VDD C;  2NYY A;  2ZMK A;  3UV9 A;  2G4I A;  1W8F A;  3MW4 A;  3WW2 A;  4OMD A;  5A3O A;  3ATG A;  2BDR A;  2FZ2 A;  1FOD 2;  4PDW B;  4LA2 A;  4Q4V 2;  5DAQ A;  4I2O A;  3IAQ A;  4XYX A;  1YQC A;  5FYZ A;  2GC2 A;  2JG8 A;  2TBV A;  2VQU A;  4CP9 B;  1LOB A;  4YVW B;  3O1O A;  2WDB A;  2ARB A;  2GU9 A;  1NUK A;  3ZSL A;  3IDA A;  3AZX A;  5IT6 A;  4KG8 A;  4IEO A;  2PXJ A;  3T08 A;  2PN5 A;  3E5U A;  1X50 A;  4NN0 A;  1RUI 1;  3JUU A;  1QJF A;  2D3S A;  3KB5 A;  5FZM A;  1QJX 2;  3USU A;  4IV1 B;  3RS6 A;  1A8M A;  1GQG A;  4DEV A;  1HRV 3;  4JQR A;  1F4A A;  1MVE A;  2W95 A;  3U0Z A;  2ZGP A;  1TMF 3;  3HNM A;  1L7L A;  3URF A;  2VZT A;  1R1A 1;  1JZ6 A;  3TB0 A;  1DQ2 A;  4A4A A;  2ZGR A;  1HQW A;  1PGW 2;  3TNQ A;  5F6L B;  5BV6 A;  1SCR A;  1DGW X;  1MAC A;  2QQN A;  4JAA A;  2JDH A;  3JCI A;  1LOD A;  4XFC A;  3F95 A;  5C3R A;  2WL1 A;  1UAI A;  3J7N A;  2N7G A;  2IUW A;  1GQP A;  2EXK A;  4CDW B;  1UMH A;  1PVX A;  1ENX A;  1UZ0 A;  5LAS A;  3U14 A;  4MAD A;  4BZ4 A;  2A1X A;  4CEW C;  3WNK A;  4AVB A;  2RDR A;  1SEF A;  5AVP A;  2GH8 A;  4LXL A;  1AL2 2;  2YHJ A;  4HKO A;  5FIX A;  5IW0 A;  5LEK A;  1JI6 A;  1VP6 A;  1RUD 2;  5JI9 A;  5KBF A;  2QQV A;  4E2S A;  4RA0 A;  3NNM A;  4UOJ A;  4BQ5 A;  5FLH A;  3I97 A;  4M01 A;  2JDU A;  1XPW A;  1WLC A;  4K9S A;  3ZKY A;  5ACA 2;  4OHX A;  3IKW A;  3OPT A;  2X53 S;  5JZG C;  2ADE A;  2XVL A;  4FOW A;  1YWK A;  2EAK A;  2E63 A;  1NA1 B;  1STM A;  1YIF A;  3ZMN A;  3ZYB A;  4CUG A;  5SV5 A;  1REE A;  1XNK A;  4NUB A;  1NKG A;  1VMH A;  1NE4 A;  1WLW A;  3DEM A;  3MW2 A;  4NRQ A;  2A70 A;  2ZX2 A;  1NLR A;  2GME A;  5DDJ 1;  1Y43 B;  1F2N A;  5FXZ A;  5L7O B;  2WZR 2;  1RUJ 1;  4IE5 A;  3UYJ A;  5F5I A;  3K4D A;  4YM0 A;  5T54 A;  1IG0 A;  2A5Z A;  2VMH A;  1YLL A;  4AGV A;  4RS5 B;  4QXK A;  5F32 A;  3I2D A;  4LOS A;  1BMV 2;  4ONU A;  1AR8 2;  1G9F A;  1C28 A;  1R08 3;  2DUQ A;  4OMC A;  2VZO A;  5GZG A;  3ZO0 B;  1K5M B;  2R06 3;  5DN2 A;  3ZR5 A;  5C9A A;  2Y6H A;  2WO1 A;  3U1X A;  4YFZ A;  1GV9 A;  1LNS A;  4CP0 A;  5FMB A;  3DGT A;  3GM8 A;  1VBC 1;  1UW8 A;  2W1W A;  3KT7 A;  4WVM A;  3UGH A;  3VBF B;  1KDK A;  3MUY 1;  2VQA A;  3W59 A;  1JYT A;  4KWK A;  1KJR A;  2ARE A;  3OUJ A;  4S2H A;  2OYZ A;  5LK7 B;  4UF0 B;  2JDZ A;  2XVG A;  3ZXA C;  1LAJ A;  1HN0 A;  1KFU L;  2VME A;  2WS9 1;  3Q9O A;  5EJZ B;  3OOX A;  5I91 A;  2C1F A;  3CIH A;  1RUI 2;  2XJV A;  1C1F A;  4LHL A;  3ZFF A;  2WYS A;  3BN6 A;  3GBG A;  2YYO A;  4BLI A;  1UOG A;  2CWS A;  3H9A A;  2E7Q A;  3WG3 A;  3BKZ A;  1U12 A;  3RZM A;  3OBR A;  2IZW A;  1RVF 1;  3ZYR A;  1DGW A;  1QJZ A;  4IV3 A;  1JYC A;  1W06 A;  3OPW A;  3OGV A;  3G7D A;  4CZS A;  4AEM A;  5FUN A;  4Q4W 3;  4XZP A;  4AGR A;  4GUL A;  4CXW A;  2BOJ A;  2DUP A;  5A33 B;  1JHN A;  4NIG A;  2RS5 1;  3JZV A;  2WZ8 A;  1OOP B;  4RGG A;  5BNQ A;  2ZCW A;  2ARA A;  4O9E A;  1BQP A;  4HKL A;  1R1A 2;  3RYP A;  5FMO S;  2WYF A;  3LEK A;  5CFD B;  1RHI 3;  1VAM A;  1W03 A;  1J3P A;  2CHH A;  4MHU A;  4NIA A;  3DN7 A;  5C9A C;  1NAE A;  4BB3 A;  1HIX A;  2UY8 A;  4Z82 A;  3EHK A;  3PIG A;  5JVV A;  2JE8 A;  2PQS A;  4OVE A;  1CES A;  4WM8 B;  3MF9 A;  1EV1 1;  1KGY A;  2WII B;  5FY9 A;  3VHO A;  2VY0 A;  1VLN A;  3BTZ A;  4FXK B;  4R9B A;  1UZZ A;  4XAA A;  2CY6 A;  1YQ2 A;  2JIG A;  3MUZ 1;  1JUH A;  4RGK A;  1M4W A;  2BNM A;  2O14 A;  2RJ2 A;  3WHT A;  4K21 A;  1N3Q A;  3ZFF C;  2RVA A;  2CGN A;  1SPP B;  3J8F 1;  4FOY A;  4Q4Y 1;  2BNN A;  1QF3 A;  1VBB 3;  2ZAB A;  3E6C C;  4OUM A;  4IV3 C;  3LE0 A;  3MIE A;  3O1S A;  5EV7 A;  1UYP A;  2WO2 A;  2WLQ A;  1M06 G;  1GP6 A;  1YO8 A;  3VDD B;  5KXE A;  1HW5 A;  4QXB A;  1RED A;  1WA6 X;  2VOK A;  1GUI A;  5L36 A;  2XDV A;  4TTG A;  3S5A A;  3RWK X;  5FUI A;  3PUQ A;  5BPX A;  2ZML A;  1O3S A;  4N43 C;  4COV A;  1J58 A;  4Q1R A;  1NE6 A;  4DS0 A;  1CX1 A;  4QX2 A;  2RMU 1;  1W3V A;  1OA3 A;  1DCS A;  1H0B A;  2VOX A;  4GB3 1;  4UFH A;  1GSL A;  5LY1 A;  1MS8 A;  1ZVF A;  1Q56 A;  4FFF A;  3AZW A;  3RG0 A;  2E33 A;  4PLN A;  1VIW B;  3HAG A;  4XXA A;  4MLO A;  2RG4 A;  2NMN A;  1YFW A;  4QB1 A;  3ROU A;  4DOU A;  3O1T A;  4B8E A;  1KS5 A;  2VVD A;  4MXW B;  5DDJ 2;  5J09 A;  3ILN A;  1RUJ 2;  4W65 A;  2D6K A;  2NP0 A;  1NCQ B;  2Z2S B;  1XNT A;  3QBQ A;  4P9I A;  2WBK A;  1W90 A;  1OQD A;  3U4X A;  4JDO A;  1BEV 3;  2ES3 A;  1LKN A;  1OVP A;  4XAB A;  3OGS A;  4HKW A;  4COU A;  3POG A;  3BU7 A;  3R4U A;  4FPH A;  3VD3 A;  4OHW A;  4Y5T A;  1GLH A;  4H14 A;  1S55 A;  3ALQ A;  4XUP A;  2ZZQ A;  2WFF 3;  2P5B A;  1G7Y A;  1BZW A;  4JZR A;  4XF9 A;  1E57 A;  3AP6 A;  1UZY A;  5FZ3 A;  3M8L A;  5E8A A;  3KMH A;  3M3C A;  2E7T A;  3LFI A;  3GBF A;  4A7K A;  2LRO A;  4W4Z A;  3WQB A;  4AED A;  3LCP A;  4GWJ A;  5AC9 1;  2JX9 A;  4CEY C;  2VUD A;  3VKF C;  5HPO A;  4H2A A;  1XE8 A;  1YFU A;  3HQR A;  3N9M A;  2WS9 2;  2A6W A;  4H7M A;  3OGG A;  2VJX A;  2RHP A;  3V0B A;  1OMI A;  2PMW B;  1DQ0 A;  4HT1 T;  2PYT A;  1TVG A;  3IZO A;  2E9Q A;  1E5R A;  5CFC B;  1UO9 A;  2HH9 A;  3CZU A;  4RFT 0;  1RVF 2;  1YCI A;  3PNA A;  3A23 A;  5D21 A;  4OI1 A;  1R09 1;  1WMD A;  3ZSM A;  3LSD A;  3OY8 B;  2DUO A;  1LJ7 A;  3I59 A;  2ZAC A;  2BFU L;  5I0D A;  2DCT A;  4YVS A;  5FRE A;  1H6Y A;  4MV2 A;  3SLI A;  1EPZ A;  2RS5 2;  4OYU A;  3LOI A;  3AM2 A;  1YQ6 A;  1QJU 1;  1UOB A;  1PVC 3;  1XU2 A;  2J1S A;  5GLZ A;  3EB7 A;  4AVS A;  3VUO A;  4A3X A;  5JZG B;  3Q8C A;  4UFL A;  5GLW A;  1W05 A;  1AYN 3;  1NXM A;  2AR6 A;  4XCB A;  5CIR A;  3AZV A;  4YW6 A;  5DG1 A;  3OF1 A;  5FUP A;  1GNH A;  2XB6 C;  1KFX L;  3FHI B;  4GJZ A;  4YAR A;  1EV1 2;  1NX9 A;  3CMG A;  3D0S A;  3MHZ A;  1COV 3;  3PU3 A;  5LRS A;  5IK7 A;  2UU8 A;  2XG3 A;  4NHX A;  3KCX A;  5J36 A;  3ME2 A;  3O1M A;  5J98 B;  1VBD 1;  5FZK A;  4WVZ A;  2VU9 A;  3RJR A;  2AYH A;  3J8F 2;  4Q4Y 2;  4Y1Z A;  5GAL A;  3W5N A;  1W2N A;  1ZZ6 A;  4NRP A;  4QKN A;  1UKR A;  2VR4 A;  3C7G A;  3ZFE C;  4MO3 M;  2BPA 2;  3RPQ A;  1FAT A;  2MNG A;  3M3I A;  3CBN A;  4LK7 A;  3ACI A;  3MIF A;  1U0A A;  4XFG A;  3KV9 A;  4YVS C;  4RFR B;  1PIV 3;  2D6L X;  5A1A A;  3LIH A;  3CEW A;  1TG7 A;  3ZSE A;  3LEM A;  2FDJ A;  5FO9 B;  2BVV A;  5F5C A;  5FO7 B;  5JWP A;  3PJQ A;  3ZYI B;  1EUT A;  1APN A;  2VCM A;  1DG6 A;  2R6Q A;  2VW2 A;  4AVC A;  1ENQ A;  4FOV A;  2RMU 2;  3IMM A;  3BOP A;  4GB3 2;  4LKF A;  5FYU A;  5FV3 A;  4TYS A;  1POQ A;  3UT0 A;  3BUC A;  1FMD 1;  1LUL A;  4RQP C;  2EVX A;  2WZP P;  1MEC 1;  1OXC A;  2ENR A;  2KD7 A;  3WD5 A;  1VBA 3;  2OZJ A;  5HCF A;  3POF A;  1PGS A;  2C5D A;  5GKA C;  3NV3 A;  2KR2 A;  1LU2 A;  3H3Z A;  3LFM A;  4CCE A;  2VBB A;  3I49 A;  2GN3 A;  3Q8E A;  1W6P B;  2YB7 A;  1KQR A;  3K2O A;  3WQ1 A;  2VMD A;  3C3V A;  5GM0 A;  4PF1 A;  3LOB A;  3TN9 1;  3FX3 A;  4C0H A;  3JBG 1;  3B93 A;  4AOC A;  2JEM A;  5A7W A;  3LAG A;  2NQY A;  4XMA A;  4A2U A;  3GAL A;  4UWD A;  4JKK A;  3H3L A;  5FP4 A;  5FTT C;  3UGG A;  1KDM A;  2BTV C;  2BWC A;  4O7X A;  5LWB A;  5C4W A;  4JKM A;  4M4R A;  4B4R A;  4WZF A;  4UW6 A;  4L11 A;  3HN1 A;  5AC9 2;  2JIJ A;  3PVE A;  4QQO A;  1E5S A;  4XJU A;  4YNI A;  5JXI A;  1ST8 A;  2K46 A;  5C6C A;  4KWL A;  4XDQ A;  1CQ9 A;  1VRH 3;  2BBA A;  1DYP A;  1US3 A;  1MS1 A;  3KS7 A;  4GWM A;  4Y1U A;  1URX A;  4AAX A;  4MH0 E;  1H2K A;  1R09 2;  2E51 A;  3MIC A;  2BEO A;  1JYX A;  4HSL A;  2DVF A;  1HX6 A;  1HV0 A;  4AFA A;  1WWY A;  3KHC A;  4KWJ A;  4AQS A;  1WCK A;  1YHF A;  2OS2 A;  3AMN A;  4I0W B;  1QJU 2;  5FPA A;  3IIA A;  3ZXJ A;  2EF6 A;  1J3Q A;  5CAD A;  1GAN A;  4FTS A;  3PUS A;  3SCG A;  5GZC A;  3LPF A;  2W68 A;  1IS4 A;  3ZFG A;  1O6U A;  1HRV 1;  5FXW A;  4AQ2 A;  2WAB A;  1A6C A;  4PJY A;  1EAH 3;  2VCB A;  5DXD A;  5FZ7 A;  1TMF 1;  3NST A;  5G04 L;  2WKK A;  2VVE A;  4MXV A;  3OD0 A;  4IEV A;  1VBD 2;  2PLV 3;  1F8V A;  4AF9 A;  4L0P A;  5DAW A;  1W6Q A;  1YFX A;  4G3Y C;  4PI0 A;  3IDC B;  4HAN A;  3LB9 A;  1QEX A;  1YRZ A;  4D3W A;  1ND3 A;  1S2E A;  1SMV A;  3MPP G;  4HZF A;  1SLI A;  3WP3 A;  5C5T A;  1DHK B;  1Z7S 2;  5LEJ A;  2JDN A;  2OPK A;  3GNE A;  4YG6 A;  2K0G A;  2XON A;  5IAV A;  3TOJ A;  5A32 A;  5BXX A;  4J25 A;  3NMB A;  5FPX A;  2JEN A;  1LGN A;  4Z1V A;  3I54 A;  3P3P A;  1FX5 A;  4EWD A;  4AI2 A;  3P1I A;  3AC0 A;  2TUN A;  4BK4 A;  2GP5 A;  1JZ7 A;  1DGL A;  2MPF A;  1UMZ A;  3BAL A;  2GAU A;  1POV 3;  4C90 A;  1LEC A;  5EWS A;  3V64 A;  1ND2 B;  2AGS A;  4FPJ A;  3VBS C;  4PDW A;  2V4A A;  4XTM A;  4Z8B A;  2NMO A;  5TSW A;  4LBQ B;  1FMD 2;  3DKQ A;  4B3N A;  5FWE A;  1MEC 2;  1MS4 A;  1UZW A;  1RUF 3;  4COW A;  2I2S A;  5JSO A;  3I3M A;  1VBE 3;  4EJR A;  4A6O A;  2FD8 A;  3D0J A;  4BJ0 A;  4I3P A;  4CXX A;  3M1H A;  1GZC A;  2D43 A;  2XJT A;  1SBF A;  2XWJ B;  1IPJ A;  3N9L A;  4CRQ A;  3H1M A;  1TZO A;  2LAL A;  1ZZ8 A;  1DLL A;  1H8T C;  5F3G A;  5FO8 B;  3MIG A;  3KZ4 C;  2PHR A;  4QM9 A;  1ZA4 A;  3TN9 2;  1F4H A;  3JBG 2;  4I02 A;  3RMX A;  2AEN A;  2I74 A;  2P6C A;  4CUC A;  4TLG A;  1BVP 1;  2PHW A;  5BY5 A;  3ZXK A;  3ES1 A;  1JZ5 A;  5I93 A;  5JPM B;  3AZZ A;  1Q43 A;  1QY4 A;  2IVI B;  2WO7 A;  5T50 A;  4QB6 A;  1X7N A;  3A0N A;  3JB8 A;  5FBJ A;  4CDX B;  3LD8 A;  1R08 1;  2BER A;  4GD4 A;  4AHZ A;  2YUE A;  2P3I A;  1HQL A;  1I9R A;  1RMU 3;  2CWM A;  2J1V A;  2R06 1;  4YM2 A;  5JLV A;  4FFH A;  3DL3 A;  4YGC A;  3RFR A;  1FI2 A;  4X6R B;  2OA2 A;  4AHW A;  1G86 A;  1CX4 A;  1CD3 G;  3OPZ A;  2WNV A;  1K5J A;  2D3R A;  1LOC A;  2BGO A;  3NAP A;  2OKX A;  1CIY A;  5A3T A;  3BU0 A;  2E7A A;  3SMH A;  1QKQ A;  4NHL A;  5EFU A;  2B7Y A;  4LHN A;  4ASM B;  3VBO C;  3RJ2 X;  4IDZ A;  2BGC A;  4DUX A;  3WG1 A;  2ILM A;  3MV1 1;  5FFO C;  4XFH A;  2ZHN A;  4B4Q A;  1E5H A;  1MS0 A;  2HWC 3;  3III A;  3NKT A;  2JKX A;  1LHW A;  2WA4 A;  3NJV A;  2YBP A;  4OLL A;  4TXW A;  1SAC A;  4XHX A;  3FL7 A;  2ZBJ A;  5IVY A;  3SXW A;  5CG9 A;  3ETQ A;  1HRV 2;  1H30 A;  3K3N A;  1W8U A;  4Q4W 1;  3M4F A;  2HBU A;  3VD7 A;  4R9D A;  3ASI A;  2AEZ A;  2Y0O A;  3AYE A;  1UU4 A;  1H9W A;  1TMF 2;  4CUA A;  1AR9 3;  3OGR A;  4UW5 A;  2WWS A;  5JOW A;  3UJQ A;  4LBM A;  4MYE A;  1OLM A;  1RHI 1;  1V70 A;  2Z5W A;  3FFQ A;  3T0A A;  1NA1 A;  2Q30 A;  3IWZ A;  3TYJ A;  4DRV A;  4DO0 A;  2FDG A;  3HT1 A;  2WNV C;  2WZE A;  1LOA A;  4DXR A;  1C8N A;  3NJY A;  4ET7 A;  1XXN A;  3SC7 X;  3HR9 A;  2YV8 A;  3KV5 A;  2NPI A;  2DBN A;  3VZJ A;  4AFD A;  2XXZ A;  5FP3 A;  3MIB A;  3VD4 A;  4YPJ A;  3I2J A;  4E2Q A;  3HPN A;  4IES A;  4LBQ D;  4CCL A;  1W0N A;  4FXG B;  2A6X A;  4Z2W A;  3RZL A;  1MPX A;  1BYH A;  1VPH A;  4IE0 A;  1VBB 1;  4AEJ A;  3QAC A;  4N53 A;  4NOT A;  1WKY A;  2KA3 A;  3WW4 A;  5FLJ A;  1UU6 A;  4I0A A;  3TRS B;  4AHX A;  3C8X A;  2Z42 A;  1JYV A;  4EE2 A;  5J48 A;  1W9W A;  1D0G A;  4QXC A;  2V4V A;  4P02 B;  4LO6 B;  3FWE A;  5CBL A;  1RUE 2;  4CCC A;  4XF0 A;  1HB3 A;  4HSJ A;  4LK6 A;  4CP1 A;  5FMD A;  3VBF A;  4CA9 A;  2JE7 A;  4IEU A;  3D6E A;  4Q29 A;  5CKM A;  4IGO A;  1PK6 B;  2G9G A;  1Y9Q A;  2RJL A;  2OVU A;  4GH4 C;  5A80 A;  3P3N A;  1W2U A;  5HV0 A;  2YBS A;  4LR4 A;  1DYK A;  3VDB A;  5FZ1 A;  5FZ8 A;  5HCA A;  4DUW A;  4C0B A;  1A34 A;  4XQD A;  4F3J A;  3NO8 A;  3FLP A;  1ULG A;  3KD4 A;  4GAL A;  1W6M A;  4MG2 A;  3O14 A;  4N53 C;  1REF A;  4FVV A;  2X5I A;  4UAP A;  1BEV 1;  4QPG A;  4D7S A;  1MR5 A;  1S0F A;  4Q0Q A;  1Z0H A;  2QZ2 A;  2ZMN A;  4HET A;  4OUE A;  1R08 2;  2LM3 A;  2DU1 A;  2R06 2;  4ARX A;  3B3Q E;  2DCY A;  2WFF 1;  1LRH A;  1UF2 C;  4Q0V A;  4TN7 A;  2ZX0 A;  4B7E A;  4GWI A;  1DQ1 A;  3B7M A;  4R4Z A;  3WCS A;  3PUH A;  5ABJ A;  4N8M A;  2JXA A;  5H9R A;  4A42 A;  1J1L A;  2YG0 A;  1GFF 2;  3V0A B;  5FJK A;  1CAU A;  2DDU A;  3AFK A;  5H9P A;  2C24 A;  2QQK A;  4K1Y A;  3RSJ A;  3I7D A;  2VCA A;  1GP5 A;  1OA4 A;  2EIB A;  3V65 A;  1OLR A;  2P17 A;  1O3T A;  2WSU A;  2IXK A;  4D8M A;  3HNY M;  4YLZ A;  1N1S A;  2JG9 C;  2VZP A;  2ZGQ A;  3WNP A;  4FBF A;  3VGI A;  5FYB A;  3VBS B;  4WBB A;  2YU2 A;  4MGS A;  4QPG C;  5IAT A;  1NQD A;  4Q4W 2;  2ATF A;  2GH2 A;  4JRA A;  5IVB A;  1XRU A;  2PAM A;  1H8V A;  2J1T A;  2XQX A;  2J42 A;  4M3C B;  5FPU A;  1PVC 1;  1V6I A;  1NCR C;  3KLS A;  4MVT A;  2FDI A;  4QXH A;  1S1A A;  4B7K A;  3C7H A;  1AYN 1;  1RHI 2;  1QXP A;  1VE0 A;  2D5F A;  2QUO A;  3PJY A;  1JYW A;  4QQ2 A;  5ABJ C;  2B4K A;  4J1W A;  1H8T B;  5A6Q A;  5FRA A;  1C57 A;  5JR7 B;  5C7G A;  2PAK A;  2VL4 A;  1COV 1;  3U37 A;  5JOX A;  4MXW A;  5BNN B;  4XF4 A;  4AFB A;  3UK9 A;  1RUN A;  3KSC A;  1JYI A;  4LBK A;  3LQC A;  5LY2 A;  1EPW A;  2P3Y A;  2LS6 A;  1W9Y A;  1ONA A;  1OLM E;  1VBB 2;  3ES4 A;  1D0H A;  4JRL A;  5LBE A;  1XYO A;  5CIS A;  1WMX A;  3WDW A;  1CZT A;  5LK5 A;  3J9S A;  2ZGL A;  3BVC A;  2VGD A;  3SNM A;  4RL7 A;  2VOV A;  4YG0 A;  3CJI C;  1B09 A;  3VBH B;  1AR6 3;  1PIV 1;  4YZ5 A;  4BCU A;  1VB2 A;  3S30 A;  2DBI A;  2HBT A;  3B02 A;  5EZW A;  2EIG A;  4LQR A;  2NN8 A;  2VZS A;  5LW9 A;  1FAY A;  1SBE A;  1YQ8 A;  2BUK A;  1KRI A;  2JG8 C;  3H1W A;  2D98 A;  3ILR A;  1YC6 1;  4DRR A;  3VBO B;  4YW3 A;  4AQ6 A;  1PX4 A;  3B5L B;  4UXA A;  4NPR A;  5JXH A;  3USS A;  1UNB A;  2ADD A;  1VBA 1;  5FYS A;  4FP2 A;  4D6S A;  5A6Z A;  3AFG A;  3AP7 A;  5C3P A;  1PO2 3;  1UD1 A;  2R07 3;  2VM9 A;  3AKR A;  3EMR A;  4WV8 A;  2D6M A;  5CKQ A;  1D4V B;  2YRO A;  1RUC 3;  3OBA A;  2W1S A;  2EXH A;  3VB9 A;  2WR9 A;  1QWR A;  2EA7 A;  2QQJ A;  3N3H A;  3WCR A;  4BDV B;  1LOE A;  1W6N B;  1WW5 A;  3IM0 A;  5FPV A;  4DB5 A;  1D2Q A;  5IWF A;  1BEV 2;  2UY9 A;  3LA3 A;  4HBN A;  3VHP A;  3FBY A;  3PL0 A;  2J7M A;  1CAW B;  1DGR A;  2BGP A;  1WA4 A;  1OFN A;  1UXZ A;  3RZK A;  1V9U 3;  3G6J B;  3PMS A;  1CJD A;  2A75 A;  3AXE A;  3FN9 A;  4JTO A;  2WFF 2;  1J59 A;  1CN1 A;  4XJ9 A;  3DYM A;  4YZ1 A;  5FMO L;  5C8C B;  3GCX A;  2W9X A;  5F5Q A;  1G8W A;  2H0B A;  3GZA A;  4GKY A;  4OZX A;  4XQ4 A;  3WQ7 A;  1ZBA 3;  4LHK A;  4Q0P A;  5FYV A;  2VW1 A;  4MGI E;  1QH6 A;  1LHO A;  3LDB A;  4MGY E;  5FK8 A;  4AEK A;  2X8K A;  3AVR A;  4Z92 B;  2UWC A;  2AAC A;  1OBN A;  3B9C A;  5FZI A;  5LBB A;  2Q5T A;  4YZ3 A;  2GDF A;  2ZEW A;  5EJ1 B;  1VRB A;  1VRH 1;  3F2Z A;  1QMJ A;  4LPL A;  3ZYF A;  1NQJ A;  1HRI 3;  3WV6 A;  1O7F A;  4LO4 B;  4KBZ A;  2V73 A;  3K48 A;  4FFI A;  3POJ A;  4A45 A;  4BIS A;  4TZD A;  1OA2 A;  2BWA A;  2ZAA A;  1W2A X;  1T2X A;  1AHS A;  4N7I A;  3CU7 A;  1WCU A;  1V6L A;  2RV9 A;  1AYN 2;  1C8M 3;  4Q2F A;  1IS3 A;  1DZQ A;  1EAH 1;  2EIE A;  4GH4 B;  2QQP A;  5KHH A;  5A1F A;  1LED A;  4N9I A;  5FZO B;  1COV 2;  3TAY A;  3C7F A;  4ZU5 A;  3RVH A;  2VZV A;  4JC1 A;  2GMM A;  2CDP A;  3A0K A;  4S2G A;  4NO4 A;  3I3Q A;  5C33 A;  4UFM A;  3MEP A;  2PLV 1;  2WO3 A;  1POV 0;  4HLT A;  1I3H A;  4C91 A;  4EWA A;  2BV4 A;  3T30 A;  4AFM A;  2HWD 3;  5LBC A;  4KBB A;  2Q0A A;  4KU7 A;  5DZF A;  5L9V A;  1YFY A;  1EP0 A;  3MI8 A;  4GXL A;  1RUO A;  2R7E B;  2VTX J;  5EJ3 A;  1W8N A;  4XJW A;  3U10 A;  3IAP A;  1YI9 A;  3CQO A;  3HJR A;  1PIV 2;  4JV4 A;  5FZ6 A;  3DF0 A;  2TEP A;  1V6J A;  2OQ7 A;  1HXS 3;  1GOH A;  4P5H A;  1HQN A;  1CJP A;  4W6W A;  4NR1 A;  4XUQ A;  2JIC A;  3DPR A;  5DUX A;  4E9K A;  5K0U B;  1VAK A;  5C3O A;  1NLQ A;  3WDT A;  1AF9 A;  3AB0 A;  1POV 1;  2CGO A;  2H6C A;  1NOV A;  2XUE A;  3QLQ A;  5FZD A;  5K4L A;  5T52 A;  3T2Q A;  4HVQ A;  3N9P A;  4E4D X;  1SLT A;  2YC4 A;  1K3I A;  5FXV A;  3S7E A;  3TEX A;  1ASJ 3;  3APB A;  4LA3 A;  4IXL A;  1RUF 1;  4N9H A;  4DFS A;  2JG9 B;  1VBE 1;  1VBA 2;  3J7L A;  4DUV A;  3SQO A;  4XJZ A;  1N1T A;  1WW4 A;  5A3N A;  1S4C A;  2VNG A;  1H2M A;  2A71 A;  1LHN A;  2AC1 A;  2HWB 3;  2Y6L A;  2Z79 A;  4Y20 A;  4LT5 A;  3IDE A;  5LAT A;  5BNP B;  1ZBE 3;  1W0P A;  3HBZ A;  3TEW A;  4CCD A;  1B35 A;  4P5Y A;  1RUG 3;  1S2B A;  1FOD 3;  4K3U A;  4DEQ A;  1OHF A;  1NCR B;  2R04 3;  3LIG A;  4WM7 A;  5JSR A;  1OF4 A;  3WR0 A;  1JZ8 A;  3WDU A;  3J7H A;  1GNY A;  5IVF A;  4AZZ A;  5K9Y A;  4IER A;  4XIK A;  2JDP A;  4P9L A;  3AYD A;  4BWO A;  3N35 A;  2CV6 A;  3H42 B;  4LKD A;  3RRD A;  1CAV B;  1XSQ A;  3H7Y A;  3GZE A;  5IK8 A;  3WF3 A;  4Q4X 3;  1FV3 A;  3KCC A;  4M00 A;  4XFA A;  5LZ6 A;  5GJ6 A;  4W6Y A;  2A73 B;  4R52 A;  2RDN A;  1RMU 1;  5E89 A;  1S2K A;  3VBR A;  3OYW A;  3WHU A;  3ZYJ B;  3KGZ A;  2Q8D A;  3VDA A;  1OH4 A;  1W8O A;  3HNB M;  2ARX A;  3WIN E;  1VRH 2;  4YRD A;  1WBL A;  3T2T A;  5FY5 A;  2P6H A;  1RC6 A;  3CJI B;  3VBU A;  2UUR A;  3MID A;  5FZE A;  3L2H A;  3SKJ E;  1B35 C;  4AI0 A;  5I0S A;  2QKD A;  3FE5 A;  2YC2 A;  4Q26 A;  5DPN A;  5J3U A;  5G05 L;  5CEH A;  1AVB A;  5JMC A;  5HXM A;  3NVC A;  3IB3 A;  4WZC A;  2HWC 1;  2VTF A;  1H2L A;  3WF2 A;  4FQZ A;  5FZA A;  4CPB D;  3PTY A;  2Q8E A;  2YGM A;  3WDV A;  1N47 A;  4YGB A;  5HI0 A;  4CCN A;  4AVT A;  4M0H A;  5CVR A;  4XW3 A;  5A3W A;  2OUJ A;  1CWP A;  3FHA A;  3I3D A;  3ZXD A;  2XWB B;  3CO2 A;  2P3J A;  3K46 A;  4XAE A;  3VZK A;  4CDU A;  1VBC 2;  1AJO A;  1AR9 1;  3AP4 A;  1JZ2 A;  2WAO A;  3CKH A;  5GLT A;  5C8W A;  2HJI A;  3WG2 A;  4QPI A;  5FR3 A;  2OII A;  1IQA A;  3W21 A;  4KU8 A;  5I8S A;  4CEW B;  4E4S A;  2VE1 A;  5FZL A;  4YYO A;  4H55 A;  2XLF A;  3VZO A;  3OGJ A;  3USU B;  4GWN A;  4Y5Z 0;  4B4P A;  3QCW A;  2XHK A;  2XHN A;  4GQ7 A;  4HPK A;  5A70 A;  5FDB A;  1DQ4 A;  2IWG B;  4AVA A;  5KC6 A;  3EBR A;  2GC1 A;  2UYA A;  4ZS2 A;  5F6K A;  3U4S A;  5C3S A;  3OBT A;  2WNU A;  3LF7 A;  3OTF A;  2ZGT A;  4QM8 A;  4FP3 A;  1MZF A;  2QVS B;  4HG6 B;  2EID A;  1W04 A;  2DVD A;  1MZ6 A;  3JD7 3;  4AW7 A;  5KHG A;  2WRA A;  2W52 A;  3WP5 A;  3ZPO A;  5FLI A;  5KHJ A;  4RR3 A;  1UY1 A;  1E5I A;  1P8J A;  2CDO A;  3LWC A;  4QPY A;  3OD4 A;  1SQ4 A;  3EXU A;  3RGB A;  1GZW A;  3OEA A;  4LE3 A;  1U5I A;  2W3J A;  4AED C;  1RUF 2;  4ISQ A;  2OT7 A;  3GGL A;  3KQR A;  4QPI C;  3I8T A;  1C5I A;  3VN4 A;  4OFG A;  5C71 A;  2VBP A;  4FPE A;  4ZHN A;  2G19 A;  2YDE A;  5FZ4 A;  4AXO A;  2PAE A;  4D0Q A;  3OG2 A;  1O91 A;  3PVB B;  5A7O A;  1W3X A;  2X05 A;  4P00 B;  3VKL A;  3WW3 A;  3U11 A;  2FCU A;  3VZL A;  1G9D A;  4AK3 A;  1EYB A;  3IDB B;  5EYX A;  2P4E A;  3SCH A;  1CPM A;  4QX0 A;  4ES8 A;  2XJS A;  3SH4 A;  1LGB A;  3BOW A;  2XJU A;  1JXN A;  2W08 A;  1TEI A;  3AKS A;  3A7Q A;  1R1Z A;  3NW4 A;  5FK7 A;  4D6R A;  2VMI A;  4ZKT B;  2YBK A;  3FUO A;  3KT4 A;  2VEC A;  4ITC A;  1FPN 3;  1EY2 A;  3I2O A;  2MEV 3;  3AVS A;  3GDB A;  4JGZ A;  2YY1 A;  4YSF A;  2WJS A;  2CAV A;  2JEC A;  3BOD A;  3K77 A;  1JU3 A;  3I4I A;  5FZ9 A;  4LJH A;  4NE9 A;  5FKB A;  4XCA A;  5A7Q A;  1BJQ A;  4EWE A;  1RMU 2;  2VG9 A;  2WA3 A;  5FPZ A;  2R1B A;  3AKQ A;  1PM7 A;  1PHM A;  2A7A A;  2B8M A;  3TEZ A;  1C3H A;  3OCP A;  5D8A A;  4YW5 A;  4ZXK A;  3WEZ A;  2OUH A;  3IPV A;  5A7N A;  5F1R A;  4MUV A;  3MF6 A;  5A3P A;  3QD6 A;  4RD7 A;  1W6O A;  1HJG A;  1OD3 A;  1RUH 3;  2RS3 3;  4P9J A;  4COZ A;  5IHR A;  1GKB A;  2B42 B;  1UY3 A;  3A22 A;  3VKO A;  2UYB A;  3VLB B;  3HN3 A;  4IEX A;  4AVV A;  1O8P A;  2VOT A;  3SIS A;  4DY5 A;  1HJF A;  2HWC 2;  3WNX A;  5EHD A;  5CG8 A;  2XKO A;  4URT A;  1ZA7 A;  4NRO A;  2HWF 3;  5C9A B;  2QQO A;  5F3E A;  3J26 N;  3OJB A;  4CDQ A;  1D2S A;  1SFP A;  1LCL A;  1UY4 A;  4WVM B;  4AYU A;  2XUM A;  1IS5 A;  4HK8 A;  4JGZ C;  4KH9 A;  2FDK A;  2YGL A;  1ZM1 A;  2Q1M A;  4IEY A;  5A1L A;  4JTN A;  1AX0 A;  5APA A;  1AR9 2;  4DXZ A;  3W9A A;  2B5H A;  4ZU7 A;  3T0D A;  4K8F A;  3O0V A;  4ZXE A;  5A6X A;  3RYK A;  3HMY A;  4PQQ A;  3ZFF B;  4FPG A;  2FZ1 A;  1AX1 A;  2HEV F;  2DCZ A;  5JOY A;  3SEE A;  3TWI A;  4CCK A;  1AR7 3;  4IV3 B;  1K12 A;  2O0O A;  4BQY A;  1DYO A;  1JOP A;  3SH3 A;  2UWA A;  2WWU A;  3E6D A;  4PHZ A;  4Y22 A;  1SBD A;  3O1P A;  5KXD A;  1RJ7 A;  4YW7 A;  3OBZ A;  4BHP A;  1NY7 1;  5BYN A;  3ZM8 A;  1BLZ A;  2X29 A;  1MQT A;  1X8E A;  4HVR A;  2IVJ A;  1W9F A;  2CAU A;  4N43 B;  3Q8B A;  4KG0 A;  5CA6 A;  2WNO A;  3N7M A;  4L99 A;  3ACF A;  4RYD A;  2W2I A;  2J1U A;  5A6Y A;  2Y6F A;  4OHY A;  5BNO A;  5C4W C;  4XHB A;  1A3K A;  1AR6 1;  4G4F A;  5C5U A;  3BIW E;  1UOJ A;  2XPJ A;  2YU1 A;  2BZD A;  1SLA A;  3DUI A;  1ULP A;  3MLJ A;  4FPO B;  4Y33 A;  2RR1 3;  2ZGN A;  4HXC A;  4EN6 B;  4EN0 A;  4EQV A;  3WUC A;  1UY0 A;  1ZRE A;  3MFC A;  1NT0 A;  1UN1 A;  3NNF A;  4W8J A;  3O1V A;  1H1M A;  3N7K A;  5FAX A;  1J1T A;  4F7Z A;  1GZT A;  5JIA A;  5ERL A;  1JBC A;  2D7F A;  2Z4F A;  3ZSK A;  2QQI A;  4AQT A;  2B9U A;  5IJR A;  1O4Y A;  4WVW A;  3HD8 B;  4LHS A;  4R4X A;  4GMP 3;  5ANN A;  2V09 A;  4P14 A;  4IE6 A;  4KL1 A;  1PO2 1;  1UL9 A;  1Y3T A;  2R07 1;  5F3I A;  1WW6 A;  2D97 A;  1RUC 1;  3NKG A;  1N1Y A;  4NPL A;  4JGY A;  2GP3 A;  1JUI A;  2XKP A;  1O8S A;  3PUA A;  4NPM A;  3KM5 A;  2DVA A;  2LW8 A;  1D7P M;  5D2A A;  3ZFG C;  1A8D A;  2ZPX A;  5FPB A;  1HDK A;  4CEY B;  1RTV A;  1SCS A;  1V9U 1;  4PF5 A;  4Q0S A;  3ITQ A;  4R8H A;  3ZYG A;  2ZZJ A;  1RIT A;  1UY2 A;  2VD7 A;  3FJS A;  4CP9 A;  2ZTN A;  1AZD A;  4XQW A;  4YVW A;  1QJY 3;  5IFP A;  3EO6 A;  2ZOE B;  3THD A;  3WP4 A;  2VZR A;  5BNN A;  3BPZ A;  2C9A A;  3CDZ B;  2E31 A;  1TME 3;  1J83 A;  1IG3 A;  2A3X A;  2D5H A;  4LUK A;  1O4Z A;  1JN2 P;  4X6Q B;  3UL2 A;  3WOG A;  3H50 A;  1AX2 A;  2PHU A;  3SH5 A;  3U78 A;  2R49 A;  4K1Z A;  1L3J A;  1ZBA 1;  4IE4 A;  3C2U A;  1JOB A;  1J3R A;  1ND3 C;  1I5P A;  1TQ5 A;  3W5M A;  5CKN A;  4IV1 A;  2P34 A;  3O1R A;  1UYZ A;  2D3P A;  4NID A;  4OUS A;  4CUB A;  1HRI 1;  1PMH X;  1PZ8 A;  1S0E A;  1C4R A;  1U5Z A;  1DLC A;  2VMC A;  3R4D B;  4JGY C;  3VBH A;  4E8C A;  4F8A A;  5JOZ A;  3AKT A;  2ZA9 A;  1FV2 A;  2YPD A;  1LHV A;  3GZU C;  4LUL A;  1KEX A;  4NHY A;  3UKN A;  1ULO A;  4E8D A;  5GZF A;  1QHD A;  3ZMO A;  4AED B;  2ZGU A;  1IOA A;  1WBF A;  4PDW C;  3RWN A;  1CR7 A;  4FPC A;  4QX7 A;  1VMF A;  2H0V A;  4A44 A;  4ERO A;  4RN5 A;  2J1E A;  1Y7B A;  5L9R A;  5KXB A;  3V0B B;  4WVV A;  1C8M 1;  3RZZ A;  4Q8L A;  3ZKU A;  5K8S A;  4XUR A;  2NLR A;  3ZFE B;  2ZKN A;  3N9O A;  3MLL A;  4CDW A;  3I59 B;  4Y1Y A;  3FMG A;  3DYP A;  3M70 A;  1IQD C;  4UW3 A;  4YVS B;  1JOJ A;  4FI9 A;  3THP A;  2J1R A;  3I2K A;  1OH3 A;  2D6O X;  1BHG A;  5DQ0 A;  1H9P A;  2BVB A;  1WGP A;  2EXI A;  2OQ6 A;  4XBQ A;  3GHM A;  2HWD 1;  3EJK A;  3H7J A;  2KXL A;  2YFU A;  2VPV A;  3MDP A;  1CAW A;  3B94 A;  3GBW A;  5H9S A;  5FXX A;  5DUW A;  5AFE A;  1RIN A;  2ZHK A;  5KHK A;  1RL3 A;  5I0R A;  1XB9 A;  1KS4 A;  2E32 A;  4LOR A;  2KM2 A;  1AR6 2;  5L19 A;  1ZZB A;  4RQP B;  1HXS 1;  4JHZ A;  5FKC A;  1DQ6 A;  1X82 A;  2R30 A;  2PHX A;  5ANQ A;  3WUD A;  1GBG A;  1DBN A;  4LUM A;  4BA6 A;  1D4M 3;  5C8C A;  3NRU A;  3GJA A;  4Y5S A;  1ZRR A;  1S0G A;  3WNO A;  1UIJ A;  3B00 A;  4I30 A;  2JDM A;  2F4P A;  5LA2 A;  4NWW A;  1ZX5 A;  4P08 A;  2B39 A;  1RXG A;  4XF3 A;  2DV9 A;  2CGP A;  3NAP C;  4CDW C;  2BBV A;  5GZD A;  1ASJ 1;  5T5P A;  1OD5 A;  2Y6G A;  1ZZ7 A;  2ORZ A;  5KXC A;  2LTN A;  2BOI A;  5L7O A;  5DAX A;  1PO2 2;  2EAL A;  4CU6 A;  2R07 2;  1S0D A;  5FP9 A;  3VZN A;  3POY A;  4K40 A;  2IXL A;  3S7I A;  3EYP A;  2HWB 1;  4TSV A;  1BBT 3;  1AL0 G;  4LEJ A;  3ZN5 A;  4D6Q A;  5KHI A;  4L97 A;  5CZK A;  4TWT A;  1OFS A;  5J37 A;  1ZBE 1;  2GNM A;  2NZ9 A;  3HOB A;  4Q27 A;  4RS5 A;  4XF1 A;  3B9I A;  4XUT A;  1QJE A;  4ES9 A;  2QQW A;  1RUG 1;  3FC0 A;  1FOD 1;  2OXB A;  4P9W A;  1MS9 A;  1ULE A;  3WP6 A;  2R04 1;  3WDX A;  1K5M A;  1OI6 A;  3D4K A;  2WNE A;  2PEL A;  1W2O A;  2A3Y A;  3H8R A;  1BXH A;  1V9U 2;  3DEC A;  1GMM A;  5FY7 A;  2XH6 A;  2XOM A;  3RI9 A;  4C8D A;  4AL9 A;  1G9C A;  2WT1 A;  3ZN6 B;  1SDW A;  4Q4X 1;  1NA1 C;  2K2S A;  4BLJ A;  2SLI A;  3K3O A;  4E4H A;  2W46 A;  4CU7 A;  1F31 A;  1WD3 A;  1QXJ A;  3T2P A;  4UF0 A;  4YW4 A;  2VNO A;  3BTX A;  1UQX A;  1N3O A;  1ZBA 2;  4QQP A;  2VUA A;  1O5U A;  4LMF A;  1GYK A;  4NVP A;  1UPS A;  4QHO A;  1XOY A;  3H1Y A;  5A7W B;  5SV8 A;  3LSE A;  2PHL A;  2JD9 A;  2DVG A;  4LOT A;  1HRI 2;  4C1W A;  5M0T A;  1VAL A;  4XEZ A;  4L8Q A;  1AXZ A;  5C4W B;  4RS5 C;  1T6G C;  5A33 A;  4QDQ A;  3CJX A;  4IQP A;  1TE1 B;  5DZG A;  4YFW A;  1OOP A;  1BCX A;  4S2D A;  1ZZC A;  3J4U H;  3QH7 A;  1XYP A;  4YG3 A;  5K0U A;  2XR4 A;  4OZO A;  4CTE A;  2ID4 A;  5CFD A;  1XNC A;  3HVD A;  5A3U A;  3ZXL A;  4LNV A;  4CCO A;  5F37 A;  1JW6 A;  2VBD A;  3HIF A;  1CVN A;  1C8M 2;  4I01 A;  3S6P A;  4WM8 A;  1XQN A;  3VBF C;  1UYY A;  2HEW F;  3LDR A;  3WF0 A;  1CAX B;  1W2T A;  3ELN A;  3ZVX A;  3BGA A;  3MV0 1;  4LO5 B;  1GOF A;  1PMJ X;  4L2N A;  1WLT A;  3BIE A;  1UMI A;  4XFI A;  2Q1Z B;  4R9C A;  5FMC A;  4BQ3 A;  4HN0 A;  4DXS A;  1SPP A;  1IPS A;  2OW4 A;  5DAP A;  5FY1 A;  5IK5 A;  4GJY A;  2ZX4 A;  2CL2 A;  4ATF A;  4EV0 A;  1CGP A;  4IEZ A;  4LBO A;  2JJ6 A;  3KVA A;  2HWD 2;  2WFP A;  2ZHM A;  4C1X A;  2VNV A; 
#chains in the Genus database with same CATH homology
 2OQ6 A;  5FZK A;  3ZLI A;  3KV5 A;  5LY2 A;  2XXZ A;  5FP3 A;  5A7P A;  5FXX A;  3U4S A;  4CCL A;  4BU2 A;  5FYH A;  4LIT A;  5F2W A;  4Y4R A;  5FZ6 A;  5FYT A;  3PUR A;  2W2I A;  2OQ7 A;  3PU8 A;  3ZPO A;  3KV9 A;  5FWJ A;  5ANQ A;  4QX8 A;  2YU1 A;  5FZC A;  2GP5 A;  5FZF A;  4QXB A;  5F5C A;  4AI9 A;  4Y33 A;  4LXL A;  5FP8 A;  2XDV A;  2XUE A;  5FPU A;  2XML A;  4QXC A;  5FZD A;  3PUQ A;  5FY0 A;  5IW0 A;  5K4L A;  4EZH A;  4CCJ A;  3N9P A;  4XDO A;  5FYU A;  2OT7 A;  5LW9 A;  5FY4 A;  5FXV A;  5FV3 A;  5FWE A;  5FXZ A;  2WWJ A;  4IGP A;  5FY8 A;  5FZ4 A;  5IVE A;  4CCM A;  3OPT A;  5LY1 A;  5FZB A;  4IGO A;  5FP9 A;  5A7O A;  5FZG A;  4GAZ A;  5A80 A;  5FYS A;  5A3N A;  4D6S A;  4D6Q A;  2YBS A;  5F3I A;  3N9L A;  5FZ1 A;  5FZ8 A;  4CUG A;  4NUB A;  3N9N A;  5F3G A;  2GP3 A;  5FPV A;  3PUA A;  4V2W A;  3K2O A;  5IWF A;  4D6R A;  4AAP A;  4LIU A;  2YBK A;  3KVB A;  3UYJ A;  3DXU A;  5FY7 A;  5FPB A;  3KV4 A;  5F5I A;  5FP7 A;  5FYY A;  4C8D A;  5IVF A;  5F39 A;  3AVS A;  5A7W A;  5FZ9 A;  5FP4 A;  5IVC A;  5A7Q A;  2VD7 A;  5F32 A;  5FPL A;  4E4H A;  5LWB A;  3K3O A;  3KV6 A;  5FBJ A;  3LD8 A;  4GD4 A;  2P5B A;  5A7S A;  4UF0 A;  4TN7 A;  5FZ3 A;  4HON A;  4XDP A;  4CSW A;  4EYU A;  2Q8D A;  5A7N A;  3PDQ A;  2Q8C A;  3U78 A;  5FJK A;  5FYV A;  5A7W B;  5IVV A;  5ISL A;  3LDB A;  5A3P A;  3AVR A;  3DXT A;  5A3T A;  3PTR B;  5FYZ A;  5FZI A;  5FY5 A;  3N9M A;  1VRB A;  3AL6 A;  5FZE A;  4UF0 B;  5FYC A;  2OX0 A;  4QWN A;  5CEH A;  5F2S A;  4IGQ A;  2PXJ A;  4Y3O A;  2YPD A;  5F3C A;  5F3E A;  5FYB A;  4BIS A;  4BXF A;  2YU2 A;  5FZA A;  5FZO A;  4LIV A;  2YBP A;  4URA A;  2Q8E A;  2OS2 A;  4CCO A;  5F37 A;  5FPA A;  4QX7 A;  5FZM A;  5IVY A;  4CCN A;  3OPW A;  5IVB A;  5A3W A;  5A1L A;  3K3N A;  5FUN A;  5FYM A;  3PUS A;  4V2V A;  4QXH A;  5FXW A;  3AL5 A;  5KR7 A;  3N9Q A;  5E6H A;  4ASK A;  5FZ7 A;  5FUP A;  3N9O A;  5A1F A;  5FYI A;  5FZO B;  4GJZ A;  4CCK A;  3RVH A;  4QU1 A;  5FY1 A;  5FZL A;  4GJY A;  4DO0 A;  5FZ0 A;  4DIQ A;  4HOO A;  5F5A A;  3PU3 A;  5FY9 A;  5IVJ A;  2WWU A;  3KVA A;  5FJH A;  5FZH A;  4EZ4 A;  3NJY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...