3S7IA

Crystal structure of ara h 1
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
416
structure length
369
Chain Sequence
RNNPFYFPSRRFSTRYGNQNGRIRVLQRFDQRSRQFQNLQNHRIVQIEAKPNTLVLPKHADADNILVIQQGQATVTVANGNNRKSFNLDEGHALRIPSGFISYILNRHDNQNLRVAKISMPVNTPGQFEDFFPASSRDQSSYLQGFSRNTLEAAFNAEFNEIRRVLLEENNEGVIVKVSKEHVEELTKHAKSEGDITNPINLREGEPDLSNNFGKLFEVKPDKKNPQLQDLDMMLTCVEIKEGALMLPHFNSKAMVIVVVNKGTGNLELVAVRKESNREVRRYTARLKEGDVFIMPAAHPVAINASSELHLLGFGINAENNHRIFLAGDKDNVIDQIEKQAKDLAFPGSGEQVEKLIKNQKESHFVSAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Allergen
molecule keywords Allergen Ara h 1, clone P41B
publication title Structural and Immunologic Characterization of Ara h 1, a Major Peanut Allergen.
pubmed doi rcsb
source organism Arachis hypogaea
total genus 98
structure length 369
sequence length 416
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00190 Cupin_1 Cupin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3s7iA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3s7iA01
1ZRDA 2PAKA 3ST7A 4KU8A 3TNQA 4BH9A 1CAXA 4OFGA 3S7IA 3DN7A 4PIXA 3IBMA 4TLFA 2B8MA 2UY9A 2P17A 2UYBA 2GC0A 4EWAA 1YHFA 4HN1A 1ZNPA 3JZVA 4QX5A 4L2NA 2PA7A 2Z2SB 2ET7A 1UPIA 3CO2A 4R8HA 2PYTA 4LEJA 2KXLA 4DINB 1YFYA 1V70A 5CADA 3H8UA 1IPJA 3OTFA 2XLAA 1EYBA 2I45A 4IESA 2OYZA 4WVZA 3CEWA 4XF1A 2GC2A 1VP6A 4IERA 4O9EA 4XF9A 4QXKA 3M70A 2IXHA 2IXKA 4UBHA 3KMHA 3IWZA 1J3QA 1SFNA 2CAUA 3MYXA 1IPKA 4EROA 1L3JA 2FMYA 5D1IA 4IEVA 3CJXA 3EJKA 1CX4A 5BPXA 2O1QA 2EVXA 3DL3A 3FFQA 3SHRA 1NZCA 3I59B 4I2OA 4IEOA 4PIYA 3IIAA 3R6SA 2QDRA 3I7DA 4UXAA 4XF0A 3N4MA 1ZZ7A 3GYDA 3RYRA 2PQQA 1NYWA 2MPFA 1UIKA 5KBFA 4I09A 4MGYE 3CL1A 1ZZ9A 1JUHA 4A2UA 4Z82A 5J48A 4MUVA 1RUNA 3WW3A 4YRDA 4XFAA 4AXOA 5KHKA 3NSTA 3PNAA 4MV2A 5FPZA 4ZU7A 2VECA 5K8SA 4XF3A 1XE7A 4B29A 3NKTA 1ZZ8A 2CAVA 2Q0AA 4HZFA 1FXZA 2XL7A 2QJVA 1WLTA 1OI6A 1LB2A 4IEQA 5I8YA 2WFPA 4FAGA 4FT8A 5J3UA 1HW5A 4QM9A 1Q5OA 4LA2A 1ZZ6A 5LRRA 4J1WA 1WGPA 4XFGA 3BALA 4IEXA 1J59A 4OLLA 3MZHA 3H7YA 4IEPA 1DGWA 4MH0E 2IXIA 1NE4A 2D40A 3S7EA 4N9HA 4EWDA 4XFBA 2GZWA 1CAWA 1CAVB 3RDIA 1X8MA 5FPXA 4KWJA 3LOIA 4XFHA 4X6RB 3E97A 5E16A 4AQ2A 2XKPA 2HKXA 3D82A 4IEZA 3D0SA 1EP0A 3WW4A 1CGPA 2H0VA 4MGIE 5BXXA 4WZCA 2QNKA 1ZZBA 4HVQA 1TQ5A 2K9ZA 2GC3A 5LRSA 2VQAA 4MGZE 4QGMA 1QY4A 1X8EA 3M3IA 2MHFA 4F7ZA 1CAXB 1YFWA 3DV8A 4J1XA 2ZKLA 1EY2A 2BEOA 3HIFA 5I0UA 5HI0A 2ATFA 5LEJA 3RPQA 3ELNA 1Y3TA 4QGLA 3O14A 2OZJA 2D5FA 4AQ6A 2FQPA 1O3SA 4LTAA 5JAXA 4KL1A 1U12A 4KWKA 4UBGA 1Q43A 3DKWA 2MNGA 5C6CA 2PAMA 3QACA 4Q29A 3LA7A 3NVCA 3OF1A 4E2GA 3B02A 2N7GA 3NJZA 2QCSB 1FI2A 1YFUA 3LAGA 3U11A 3IDCB 3FE5A 4ONUA 3H1YA 4YSFA 1ZREA 2B9UA 3MPBA 5KHHA 5FCCA 4BHPA 3EQEA 4I0BA 4LA3A 1Q3EA 1RTVA 4I0AA 1ZRFA 3HT1A 5J7MA 4EWEA 1ZZCA 4IEYA 1RL3A 1VR3A 3E6CC 1QWRA 3E6DA 4HBNA 3OGJA 2VPVA 3RYKA 2IXLA 5JR7B 1YFXA 4Q0PA 2ET1A 2O8QA 1NE6A 5I0TA 1J1LA 3SCHA 1XRUA 5CVRA 1DZTA 3EO6A 4Z07A 2EA7A 2PFWA 4D7SA 4Q0SA 2Z69A 1OMIA 3E5QA 1OD5A 4FBFA 2BNOA 2BYVE 3ROUA 4MGKE 5I93A 1GQHA 1O3QA 5FLIA 4RD7A 1ZX5A 3S0MA 1CAUB 1SEFA 5FLJA 1PM7A 3H9AA 2CV6A 3H50A 5BV6A 1UD1A 3ES4A 4AVAA 2PHDA 2OA2A 3NL1A 3I54A 4ZU4A 5FQ0A 4QGNA 3FHIB 2PHLA 3SXWA 5KHIA 4XFIA 4PJYA 4HMZA 5JSRA 2B5HA 4LULA 3UKVA 2K0GA 4EV0A 1H1IA 4FAHA 5FLHA 3FZ3A 3KGLA 4WBBA 1NXMA 3ZDSA 5JSOA 4CYDA 1CAVA 4HN0A 4MX3A 4AVCA 4I02A 2GU9A 3SCFA 4K8FA 4I01A 1QXJA 3PVBB 3ACLA 4HLTA 4JV4A 1EPZA 3UKNA 3LA2A 4XETA 3TNPB 3WW1A 2F4PA 2PTMA 4NVPA 4IEWA 5T3NA 3HQXA 2OZ6A 3FJSA 1G6NA 2Q1ZB 2CGPA 4JVAA 1O7FA 4I3PA 2Y0OA 2D93A 5I8TA 1UW8A 2WC2A 2Q4SA 4E2SA 2C0ZA 3VHRA 1DZRA 3BB6A 5KHGA 3ETQA 3PLQA 4XF4A 2ETEA 3E5XA 4YNIA 4LUKA 5BUVA 3U0ZA 4META 1LR5A 2IXJA 5JSPA 3MDPA 4QM8A 3RYPA 1O3RA 3KGZA 4ZU5A 2UY8A 5C8WA 3WW2A 3EHKA 2V09A 3IDBB 4KU7A 3E5UA 5I0SA 1J58A 3I59A 3C3VA 3OD0A 3E6BA 3H1MA 1O5LA 1O4TA 3H3ZA 1LKNA 5JCTA 2XL9A 3EBRA 1X7NA 4YARA 3SCGA 3L2HA 1OFNA 4XFFA 1YUDA 3KCCA 3QOPA 2GH2A 4P9GA 2E9QA 1I5ZA 1RC6A 2UYAA 4L11A 2XHKA 4IEUA 3CF6E 2EAAA 4HSLA 2GAUA 3BCWA 3H3UA 1X82A 3GBFA 3SMHA 3BU7A 1RGSA 3RZZA 4LUMA 4D7TA 3HT2A 3FWEA 5EFUA 2XGXA 5I0RA 2BGCA 1FT9A 4LLOA 4PIZA 2DCTA 1CAUA 4BYYA 5I91A 2D5HA 2IXCA 3ES1A 3LZZA 2HJIA 3CLPA 4ORFA 3USSA 2H6CA 4Q0UA 4AVBA 3UKTA 3H7JA 4IETA 1O3TA 3LA3A 4KWLA 1PMIA 3G7DA 1DGRA 2BNMA 2IC1A 1Y9QA 4Q0QA 4N9IA 1UIJA 1QXRA 3U10A 4F8AA 2GC1A 2XLFA 1YWKA 1ZRRA 2XKOA 1WA4A 3OCPA 1GQGA 1YLLA 2OPKA 3FX3A 5F1RA 2ZCWA 3H1WA 4HSJA 5FQ0B 5KHJA 1H1MA 4GULA 4H7LA 4XEZA 4JTOA 1ZRCA 2H6BA 4R52A 4XFCA 2BNNA 4BIFA 5EZWA 3BPZA 4QMAA 5CU1A 5E1RA 5AVPA 5LEKA 1SQ4A 1ZVFA 4E2QA 1RUOA 4Q0VA 5I8SA 1CAWB 4YYOA 5BY5A 1LRHA 3NW4A 3LWCA 4MZUA 5FDBA 1I6XA 2Q30A 3D0JA 4O9GA 1UCXA 1XE8A 2PAEA 2QVSB 4JTNA 4X6QB 3KSCA 4HVRA 1J3PA 1J3RA 1VJ2A 4HVOA 1O5UA 3RNSA 2XLGA
chains in the Genus database with same CATH superfamily
1FMD3 1ZRDA 2V4VA 5FY8A 3JD73 4KU8A 4XXAA 2VH9A 1PO12 4XQWA 1T6BX 2C6SA 4OI0A 3T2PA 5IAVA 4N53A 3KHBA 1OKQA 5KWRA 3VDDA 3IBMA 3OBZA 2UY9A 1BBT3 2P17A 2XVLA 4XTPA 4CUGA 2GC0A 2GN3A 1S0CA 4IV3A 4QD2A 4EWAA 3JZVA 2A3YA 3WF3A 1JUIA 2FCTA 2ET7A 3OUIA 1C1FA 1JU4A 1W8NA 2DCKA 2ERFA 4LO5B 5EJ3A 4DMIA 1NCQB 4LO4B 4LEJA 1RHI1 4XAAA 3O0WA 5GALA 1GZCA 4W6WA 3PUSA 5CADA 1Q8PA 5IK8A 2EXKA 2QFEA 3OTFA 4WM8C 2I45A 2YV8A 3LFMA 3V0AB 2JXAA 5A6QA 2OYZA 5FR3A 2PHTA 2RS12 3VL9A 3O0VA 5JZGC 3OGGA 4OULA 3RMXA 4K3UA 5JPMB 4URTA 2Y6FA 5EYXA 2KA3A 5BNOB 4IERA 4XF9A 3WNLA 2Y64A 4QXKA 1W9TA 1DQ1A 2IXHA 3N3HA 1I9RA 1PIV3 3IT8A 1QJX1 3IWZA 2YB7A 1TMF3 1L3JA 5C5UA 4AEMA 2RS32 3JXSA 5B4NA 3EJKA 1BK1A 1CX4A 1BEV2 4Q4V2 3I3MA 1ND2B 3DL3A 1NZCA 3I59B 4P9LA 1G9AA 1CX1A 4RGGA 4Y20B 2A5ZA 3BVCA 1FMD2 2VO5A 3POEA 2I2SA 2VCAA 1J1TA 1HV1A 1O8SA 4CDWB 3MLLA 4JHZA 1MQTA 1VBE3 3PVEA 5JIAA 4MYEA 3ZKUA 2QQJA 5CKQA 4NHMA 3M8LA 3ALQA 2RJKA 4QPYA 4I09A 4RS5C 4NPRA 2ZKNA 3NNFA 5CEHA 1REFA 4P9JA 2D6MA 3IZOA 2XMLA 1JUHA 4CEYA 3KQRA 4W6YA 1UF2C 4MUVA 2CL2A 1YEWA 2FDIA 1YI7A 4N7IA 3OJBA 2Z4FA 1V6LA 3V56A 1H9WA 2SBAA 4COYA 1VAKA 2WWUA 2WBKA 3ZFEB 1LAJA 1AJOA 1QJU3 2ZGNA 4UF0B 4AAXA 1ZBE3 2DWRA 4PCRA 3ZVXA 3SH4A 5D8AC 1WW7A 2GN7A 1AYN1 4BQXA 4DRVA 1HDKA 3WQ7A 5K0UC 1HN0A 3B01A 5FY9A 3I49A 1VRBA 5FYUA 4H14A 2R32A 5F5QA 2Q1MA 3N9MA 4QXCA 4CDQA 2JDPA 1W2OA 1UOFA 3WNPA 1VRH1 5BNNC 4HXCA 5C7GA 4LHNA 1NLSA 4NHLA 2Y34A 3NV4A 4O61A 5LBCA 3ZYGA 1Q5OA 2WNUC 2RV9A 4GZ9A 1EPWA 2VGDA 2W2IA 4B1LA 5DG1A 5GM0A 1HV0A 1GFF2 3WCRA 4RL7A 3JQXA 3WUDA 4AVTA 5IK4A 4MH0E 3I2OA 4ZS3A 1VBE2 4XE9A 1ULPA 2E6VA 2VCMA 1UY0A 2BOIA 3AKQA 3S7EA 4AGRA 4N9HA 4XFBA 5DDJ1 1CAVB 4KWJA 4QHOA 1B09A 1AR61 1G86A 3AX4A 3JBG3 3OG2A 3E97A 2P4EA 4M4PA 4X6RB 4YW6A 3T3YA 4CDXB 2V5DA 5A33B 2BPA2 1F5JA 4DY5A 2ES3A 4XCBA 4BPZA 2HWB1 4GWMA 3D6EA 1GICA 5BNPA 4YW2A 4ASMB 4BE3A 4DS0A 2AYHA 1CGPA 3OYWA 4WM7A 1PO23 4MGIE 4WZCA 4W4ZA 4NHXA 3VDDC 3QH6A 2ZGLA 1QJU2 2QQWA 3C7OA 5KR7A 3P3NA 1ZBE2 2YC2A 3JUUA 1TZOA 5LBBA 4YW5A 2K9ZA 1OQEA 1W6OB 2GC3A 2D6KA 2Y8KA 3LEIA 3WEZA 1I1EA 3M1HA 3ETPA 4D0QA 2QKDA 3A0KA 2A3WA 5DQ0A 2VBPA 1UKGA 2RS51 4JKKA 3WP5A 5E88A 2WSVA 1C28A 3K3NA 5CFCC 5E8AA 3WP3A 3VZMA 4CCDA 1UY4A 2BEOA 3LD8A 4L0PA 1ZRIA 3JCIA 5I0UA 4K8RB 1LJ7A 2BV4A 4LITA 4Q4Y3 5HI0A 5LEJA 5JMOA 1UZWA 1K5MB 2HWC3 1Y3TA 2I74A 1XBFA 2OZJA 2W46A 2D3PA 3O14A 4AQ6A 1FX5A 2P1BA 3P3PA 1O3SA 1PGSA 4XOGA 4Q4W3 3WHUA 3CJIB 1XYPA 5IVCA 4JRLA 4KL1A 4FFIA 1LENA 3V0AA 4KWKA 4UBGA 3WY6A 5L19A 1CPNA 1MPXA 3DKWA 3WP4A 4HL0A 5IVFA 4ZXKA 2XJQA 1UY3A 4HG6B 3DECA 3LB9A 1MS9A 4J25A 3WSOA 3DXTA 1JMUB 3QACA 2ZABA 5BNOA 2HEWF 2UURA 2W5FA 1LECA 4YM0A 2RJ2A 3O1PA 2N7GA 3NJZA 2QCSB 1A34A 3ZYBA 3U11A 1ODNA 3JBG2 1WLCA 4OHVA 3HR9A 2R0FA 2VD7A 5F5AA 1WW5A 3AFGA 2EIDA 1TVGA 4K6BA 1QDOA 4M3CB 4KWUA 5C8CC 3MPBA 4SBVA 4CDUC 4CCLA 4BHPA 2MEV3 3GBWA 4CXWA 2YROA 2D6PA 3OBAA 3OPWA 1QQP1 3GALA 1PO22 4I0BA 4DXTA 1PO11 1Q3EA 4LA3A 1PZ9A 4RN5A 1ULDA 3K46A 4OQ9A 3NAPA 4XJZA 4EWEA 2VOTA 2GMEA 3IAPA 4B1MA 4CDWA 4CPBA 1PK6C 2W08A 2R1DA 3I2FA 3E6CC 1SDDB 4HBNA 3RYKA 3OGJA 2VPVA 2WNVC 5JR7B 5ABJA 4IGPA 1JZ8A 3B69A 2ET1A 2O8QA 1NE6A 3RMYA 3VZNA 2AREA 4Y1YA 1DCSA 1CJDA 1LOAA 1OVSA 4YZ3A 3SCHA 2XUEA 1XRUA 5CVRA 1DZTA 2OIIA 4BU2A 2Q8CA 1F5FA 2D97A 4MG2A 4XAEA 4Q4Y2 2Z69A 2ZEZA 2D6LX 2HWC2 3E5QA 4Y3OA 1HQLA 4Y22B 4LKDA 4YM1A 3ZFEA 2BYVE 3MI8A 3ROUA 1C8NA 2HH9A 2WO1A 4Q4W2 4UF0A 3WV6A 4YVSB 5CG9A 1PGL2 1O3QA 2RS11 5FLIA 1WMEA 3NWKA 1PMHX 2O0OA 5K4LA 3V0BB 4CDQC 2EXHA 2PHXA 1SEFA 2C26A 4Y1VA 1W39A 3UGHA 5FO8B 3H9AA 4CU8A 2CV6A 1S2BA 4WVMA 3LIHA 4IE6A 3ZYJB 2A73B 4AI3A 5L9RA 5J98B 4Z8BA 1JYIA 4RQPB 2OKXA 1PVC3 1W2TA 1YQ6A 1NX9A 2RS31 4K1YA 4AVAA 4Q4V1 1AX1A 1O4YA 2VOKA 3APBA 4ZONA 3WF4A 5A3WA 1BHGA 2X53S 2VVEA 3AP5A 1V6MA 3ZPYA 2MEV2 5T54A 1GOFA 5KHIA 4LKSA 3MO4A 1OQDA 3W5NA 2JE9A 4QPGB 5T5LA 4ZXEA 2YGMA 4UFMA 3I3EA 5GJ6A 4PJYA 1SLIA 5JI9A 3I2GA 4AI2A 3PHMA 5FZ4A 3NNLA 5FYMA 1QOTA 3WHTA 4QHBA 4URAA 2BDRA 1H1IA 2EIEA 4XVHA 3S6PA 1FATA 3EYPA 5FLHA 3KGLA 4WBBA 4RR3B 3UESA 1LEDA 5JSOA 4DUXA 1CAVA 4HETA 4MX3A 5C4WA 1UXXX 1DGRN 4CDXA 4I02A 3WINE 1QGLA 1DLLA 2GU9A 3SCFA 1EUTA 3W5MA 4K8FA 4YZ1A 1H4GA 1OOPB 2BWCA 3WNKA 1KJRA 3F95A 3DYMA 4LPLA 3GZAA 2VULA 1EPZA 4NAMA 2WO3A 2FBEA 3UKNA 4OUEA 1OF4A 1S55A 1VBD3 2VNOA 5DZGA 2D7FA 3AMQA 5F37A 3T30A 1A8DA 2KD7A 5A3PA 1W6OA 4Y1UA 1PZ7A 4NIIA 3ZM8A 3K2OA 2LRPA 2NMNA 1LHOA 3GDBA 1OA4A 3O0XA 2JG8B 3PVOA 1NCQC 3ZYRA 1GUIA 4ZKTB 4N90A 5A6XA 4W65A 3ZXLA 5L73A 2DVDA 2NPIA 3FJSA 3M3OA 4PHZA 4MOAA 3O1MA 1PVC2 2J1VA 2VAUA 4XIKA 4A45A 2Y0OA 5JPNB 3HVDA 1K5MA 4NRPA 4B4RA 2PMWB 1EAH1 1AYM1 5T55A 2VMGA 4FPFA 4D6SA 5BNOC 2GALA 3BB6A 4EN9B 5A7NA 1KXGA 4MGTA 3Q8BA 2VNGA 4XF4A 4CU9A 4YM3A 3BIWE 5BUVA 3MW3A 1W2UA 5G05L 1XU1A 3ZXDA 4X8PA 1FPN3 2WZEA 2BBVA 2R063 4QM8A 3FLRA 1NG0A 3I3QA 1BMV2 3PMSA 1LODA 1QOOA 4YG6A 3TEXA 2UY8A 1ND2C 1XNAA 3WDYA 3EHKA 3WW2A 4C1XA 1UX6A 2E53A 1R1A3 2V09A 3HEIA 3P5BA 3E5UA 3MBWA 5JZGB 3M3QA 1J58A 4O7XA 4XDQA 5EWSA 4NROA 3HNMA 3VD5A 3WT3A 1W9YA 4M3CA 2DYCA 1FNYA 1H30A 4H55A 4WZFA 5A32A 2DU1A 1O4TA 5FMOL 2VZTA 4DB5A 2OXBA 2W39A 5CA6A 1ZBE1 1DDLA 1G9BA 1E57A 1XSRA 3CHXA 1X7NA 3ACHA 1VBD2 3RVHA 1UYYA 1JYVA 3C7FA 4FXGB 2YC4A 2ZAHA 4V2VA 1AL0G 2LW8A 2YBSA 3C2UA 4LKFA 1WZXA 3QOPA 4QB6A 2PHWA 4A3XA 4QKFA 4OCTA 2XHKA 2YU1A 4IEUA 4JZRA 3ZFEC 2XWJB 1VIWB 4P02B 5LB6A 2DCJA 2P3YA 3EXUA 1POQA 1RGSA 3DF0A 5FUPA 3BGAA 2GNBA 3M7AA 2OUJA 4LBQA 3ASIA 3TEZA 4Y22A 4HK9A 4S2DA 2JDYA 2VCCA 2XGXA 3SISA 3WNXA 4LHKA 2D6OX 3PURA 4QDQA 2BGCA 5J96B 3AYEA 1URXA 5JIUA 3ZLIA 3AB0A 1S0EA 4PF5A 3I97A 5GLUA 4HOOA 4YZ5A 3IMMA 1FPN2 3RZHA 2JG9B 2R062 4NUBA 4UYBA 3VKNA 1G9CA 1F15A 1U5YA 3JBG1 1WKYA 4AI8A 2H6CA 2HWD1 4AVBA 4RQPA 1E5RA 4IETA 3UKTA 3S5AA 3G7DA 3R4SA 1DGRA 1ZA7A 2PHUA 4Z2WA 1JOBA 2TBVA 5J37A 1ACCA 4L92A 3ZXFA 1RUJ3 1PO21 1VPHA 3C7GA 3IKWA 5L9BA 5EV7A 2CY6A 4N9IA 4UT5A 4C90A 2VJXA 1UIJA 4FPOB 5T52A 5C3PA 2GC1A 3ZSJA 1YWKA 1WA4A 3U4SA 3OCPA 2ZX4A 5F3GA 1TE1B 3AJYA 2OPKA 3AP4A 2P5BA 2R0HA 4CDXC 1SLLA 2A6YA 4IE7A 4QX8A 5KHJA 3PUIA 3FBMA 2JKBA 3GJBA 2H6BA 2NYYA 2R073 2BNNA 5AVAA 2VOXA 4BIFA 5EZWA 3BPZA 4Q4X3 1UQXA 3J7MA 3KT7A 1GNZA 1N1VA 1NCRB 1SQ4A 4JKLA 1V6KA 2VXRA 4NOTA 4AL9A 4QU1A 4E2QA 2Z5WA 4DPNA 5GLZA 3VDCA 4Q4Y1 4DUWA 4JC1A 4Q0VA 1CAWB 1MVQA 4XJ8A 3ZR6A 4YYOA 2XONA 1GBGA 2G9FA 1POV0 3LWCA 4UW5A 1RXFA 4G3YC 4FPHA 1I6XA 4WVVA 5CIRA 4H3WA 5FYHA 1POV1 1WW6A 3N36A 3D0JA 1PGL1 1EUUA 1UCXA 1XE8A 4Q1RA 4ATFA 3N7KA 2PAEA 4JTNA 3ZYPA 4E4ZA 4QX2A 4CU7A 1GANA 4LE3A 1J3PA 1J3RA 3QBQA 2D6NA 4AOCA 4D6QA 2ARBA 2RR13 2VTXJ 1YQCA 3QLQA 4PQ9A 4AQSA 4YPJA 3WF2A 2ARXA 1K5MC 4OFGA 3ME2A 3PTYA 2ZX0A 4LHLA 4PIXA 5EPAA 4TLFA 1IKQA 1AL23 3CJIC 1E5IA 4XBLA 3TWIA 4D8MA 2WSUA 2AEYA 2XH6A 3KCXA 1YHFA 4HKWA 4QXHA 2VBBA 1UXZA 3FMGA 3WOGA 3VD7A 2DBNA 3W20A 1RUJ2 5FZ8A 1F2NA 4YG3A 3HBKA 4XZPA 1VBB3 2XJPA 5JOXA 1YNAA 3WF0A 5KC5A 2P6CA 3PJYA 3O1OA 1V70A 2PLV3 4PDWC 1IPJA 5FXVA 4NN0A 5F5CA 1IG0A 1E5SA 2C9KA 1FNZA 2ZZQA 4KMQA 5A3LA 4OMCA 4CCKA 4RGKA 5ACA3 4WVZA 2VNVA 2ZGTA 3MUY1 3IPVB 4P00B 2R072 3CEWA 2VUJA 2NLRA 4Q4X2 4BLIA 1KFXL 4A7YA 1KFUL 2Q8OA 2GC2A 2A7AA 3PUAA 3VKFC 4DEQA 5JZGA 5F6LB 1JZ6A 2DTWA 5DPNA 4JGZC 2FDHA 2IXKA 2BTVC 2P34A 3CNAA 3BTAA 4QQLA 1OF3A 5FYTA 1VBC2 2G9ZA 2VR4A 3AMPA 3HQUA 3MYXA 1IPKA 3ACFA 4LJHA 4YM2A 1DIWA 5D1IA 2AH2A 5TSWA 1BQPA 2BU9A 3U75A 4RGAA 5KXEA 5FO9B 1W0OA 1Q8QA 1XNCA 3H0OA 1OFSA 2A6WA 2BW8A 1H2LA 3HNBM 1DG6A 2SLIA 5GLVA 4XHBA 4CDUB 5C71A 2DURA 2RR12 2F6BA 3N9NA 4N7UA 5A6YA 3RYRA 1NYWA 3WDUA 1VB2A 3AXEA 1R093 3AZYA 1PVC1 2J1RA 3T4VA 4CP9A 2NP0A 1LCLA 1MZ6A 3TEWA 5D2AA 1AL22 1UU4A 2JEMA 2RMU3 1PHMA 4QKDA 4YVSC 5LBFA 1HN1A 5FOJB 3ZYIB 2VY0A 2Q1FA 2V4AA 4A2UA 1DZQA 1YQ2A 4P9IA 3WNOA 1CZSA 2VZVA 2QBXA 3BIEA 4QQPA 1VBB2 2QUOA 4BQ5A 1RUNA 3ZX7A 2VMIA 4GJZA 5D21A 1GYKA 3D5OA 5EJZB 4RQPC 2PLV2 5IUQA 4DOUA 2ZJCA 1BMV1 2HYKA 4CUCA 3A23A 1C4RA 2LM3A 1K5JA 1BK0A 1RUD3 1M4WA 2WR9A 2XG3A 4MV2A 1R64A 5FPZA 4OHXA 1QKQA 5FZEA 4B7KA 1XE7A 5K8SA 4B29A 4ZY9A 3URFA 1QJY1 2LUWA 5D8AA 1FXZA 2YMZA 4DEVA 4BK5A 2QJVA 2DTYA 1WLTA 4JRAA 4QPGC 5K0UA 4XPVA 1N3QA 4IEQA 3A7QA 3MV01 1HJFA 3M3CA 2OS2A 3VBOB 5I8YA 1CJPA 4FAGA 3WDWA 1AR93 5JUVA 3MIHA 2A71A 2LROA 3LF7A 3NO8A 4XUOA 1VBD1 4L99A 5J3UA 3B9CA 1HW5A 1RYYA 4OUSA 4RR3C 5FPVA 1BZWA 4QM9A 5LRRA 1WGPA 2WKKA 2HBUA 1US2A 1RUG3 1PGW2 2G1MA 3AMMA 4Q27A 2EICA 1Z7S1 2CDOA 4OLLA 3I3DA 4LE4A 3HOBA 1S0GA 4HKLA 3H7YA 4IEPA 4KGQA 1OOPC 2W95A 4P14A 5IHRA 3H3LA 2IXIA 1K42A 4XBNA 1NE4A 2XXZA 4BQ3A 1R092 5FV3A 2W1SA 4XDPA 1JU3A 2WQZC 4AGVA 1JZ7A 2GZWA 1CAWA 2RMU2 3GBGA 4COZA 5FPXA 3AVSA 3LOIA 1GZWB 1C8M3 5FZ7A 1UL9A 4PT6A 3T2OA 4AQ2A 2J1AA 2R7EB 1GNYA 2VZRA 5F39A 1W6NA 1QJZA 4YVWB 3D0SA 4GWNA 2UWCA 5M0TA 3UETA 5FZIA 1DHKB 2JG8C 5F3CA 4CXYA 1EP0A 2VUCA 5DMYA 3AZWA 4NWWA 2H0VA 1W8OA 3ZN6B 4COUA 1COV1 2QNKA 4DFSA 2R061 1SPPB 2ZX1A 4LIUA 4P08A 3VD4A 4QWNA 4K40A 2WA4A 2CYFA 4LHSA 3ZMOA 4LNVA 4HVQA 1V00A 2FD8A 1TQ5A 1V6JA 4BK4A 1RUD2 1Z0HA 1RJ7A 3NV2A 2RE9A 3K48A 4MGZE 1AZDA 2VE1A 1QY4A 1SLBA 3ILNA 3WZ1A 3M3IA 5CBLA 4Y4YA 3PIJA 2YC0A 3VD3A 3OD4A 1CAXB 1YFWA 3UGFA 4H2AA 4LBLA 4XJWA 4BM8A 4J1XA 2Y6KA 3OEAA 3I2JA 1AR92 4OMDA 5CFCA 2R30A 4E4HA 3POBA 4LO8A 5HV0A 1LOBA 1W6PB 1HRI3 1N1SA 2ZGQA 4FPCA 4MLOA 5FZOB 4NWVA 3R4UA 1ENXA 3RPQA 2ZEXA 3IDEA 2FQPA 1H0BA 1AR73 5FMBA 2WS91 1RUG2 4LOTA 1JZ3A 5ERLA 2NZ9A 4LMFA 5DN2A 1U12A 4FVVA 3ZDVA 3IPVA 4AR2A 1KD7A 4SLIA 5C6CA 2NMOA 1US3A 1DQ4A 1JZ4A 1WLDA 2PAMA 3IMNA 1F4HA 4QX1A 5LA9A 3WDTA 1O59A 3LA7A 3NVCA 2ZS6B 4BLJA 2BP6A 3JQWA 4TYSA 3RRDA 4NIGA 1XQNA 3RZGA 3THDA 1FI2A 1K3IA 1YFUA 1C8M2 3X29B 1RUH3 2VVDA 2WFF3 5FYVA 3FE5A 4PLMA 1JYXA 4JDNA 4OVEA 4YSFA 4IXLA 2B9UA 4FCAA 4V2WA 3W59A 1IQAA 1BLZA 1GR3A 5KHHA 5T5OA 4D3WA 1KEXA 1DU3D 5C8CA 3JD72 5K9YA 3KM5A 3FBYA 4CDUA 3DYPA 1LTEA 3VZKA 1H6XA 1QXPA 1W3XA 5EHDA 1H6YA 1RXGA 2OVUA 4PQQA 4A4AA 1RL3A 5IK5A 2B7YA 1BBT2 2BGPA 1NUKA 4TXWA 3MV11 1LHNA 3I4IA 3MFCA 4QT6A 4ET7A 1UWWA 1YFXA 1PK6A 3J9SA 4UI9L 3POGA 4YFZA 3PVNA 3WQBA 2LS6A 2FCUA 3ILRA 1PNGA 2WNVA 1KDKA 3AYAA 5I0TA 2ORXA 2OX0A 2ZOEB 2PHRA 2QQPA 4NHKA 1GWMA 2EA7A 2JG9C 1RUF3 3FC0A 1QMJA 3N7MA 4GXLA 4EN6B 1ND3B 1HRI2 3GHNA 4XJ9A 4FBFA 4AFBA 4MGQA 4AG4A 2BNOA 2WL1A 3AC0A 4MGSA 1AR72 4HKOA 3DCQA 4GKXA 4MGKE 4INDA 1W6QB 4KI5M 2R071 2A70A 2ZMLA 1H1AA 4Q4X1 1D4M3 5IATA 4OI1A 4AFCA 2BQPA 3I2KA 4KG0A 2W0XA 1PM7A 3K4DA 3GJAA 3NQHA 5L7OB 1S2EA 4BXSV 1PIV2 1ENSA 2VNRA 5C3QA 4QHZA 3MIEA 5JOZA 5FZ1A 1RVF3 1TMF2 1VBC1 3MIDA 4AQTA 2XOMA 1V9U3 1GMMA 2PHDA 2OA2A 5H9QA 1RUH2 2W9XA 2WFF2 5FYZA 1NLQA 3TBDA 2D3RA 3ZN5A 4BMEA 2WRAA 1CVNA 3M3EA 3VBUB 5AFEA 3VBSB 3CQOA 2DVGA 1SCSA 4XUNA 4AI1A 5FQ0A 1XNTA 1W06A 1LULA 5JWPA 2RR11 1KGYA 3SXWA 1NCRC 2HWE3 1ULFA 1SMVA 1W8FA 2JDNA 5LY2A 2A1XA 3RJRA 4Y5SA 3KD4A 3CIHA 2R16A 1OQ1A 2ENRA 1SZBA 4LULA 3VBHC 4E4DX 1LU1A 3OY8B 1RB8G 1AL21 1JYNA 3ZPOA 2P37A 2ZEYA 4FAHA 1NXMA 1ASJ1 4FQ4A 2BVVA 5KXDA 1D4VB 1B35C 1XYNA 2XVKA 3ZFFC 1YI9A 1FOD3 2YZ4A 1JI6A 3GGLA 5DZFA 5BYNA 1QH6A 4BQYA 1NAEA 5FKBA 4NRQA 5FXWA 1HXS3 1H8VA 1ULCA 2RG4A 3V64A 1RUF2 1GKBA 1CZTA 2VG9A 5FP8A 4FOQA 5JI7A 2PLV1 1QXJA 2J1SA 1X9TA 3Q8EA 1IPSA 4HLTA 4JV4A 4UW6A 1PX4A 1CONA 2W1WA 1SBFA 4ISRA 5ACA1 5FZKA 1CN1A 1U5XA 5GZFA 3AJZA 2BJSA 1S0BA 3I3BA 5FP9A 1D4M2 1DQ6A 5FPUA 5IVEA 4R9DA 2A3XA 2F17A 2W3JA 2BFUS 4CRQA 4IEWA 5A3MA 4LT5A 4JGYB 1LOGA 1N1TA 3ITQA 5LBEA 2XPJA 5FZBA 4OZOA 1RVF2 3B93A 4A6OA 1E5HA 4EQVA 1NCQA 2Q1ZB 3ACGA 3JB8A 1V9U2 3IN9A 4MO3M 3GHMA 4DZGA 1W8TA 3D4KA 1DBNA 1W6PA 4PF1A 1UW8A 2WC2A 4AI0A 2GP5A 1PGW1 3AYDA 5FZOA 4FFFA 2XDVA 1GP5A 5JOWA 4BOWA 3O1UA 1YQ5A 4BA6A 1DZRA 5FJHA 2OQ7A 3R05A 2HWE2 1RIRA 2AZ5A 5KHGA 5FUNA 3N7JA 4AHXA 3E5XA 4CE8A 1AXZA 4FP3A 1R091 1LR5A 3NJYA 1OH4A 2AGSA 4FOYA 5LASA 5DAPA 5JSPA 1UN1A 3USUB 2YXSA 4PDWB 4XCAA 4EZ4A 1O3RA 5B2GB 3O1RA 1HKDA 3UT0A 3GCWA 5C8WA 1Q8SA 3K3OA 1FOD2 3VBHB 4CSWA 2X5IB 3HPNA 2W1UA 1ND2A 2VMDA 1S4CA 4DXZA 3WD5A 3I59A 1H8TB 3H8RA 1HXS2 3OBRA 4Y20A 2GSYA 2WUHA 4JGZB 1LKNA 4G9SB 4LXLA 5JCTA 2XL9A 3BOWA 3LFIA 3EBRA 3VLBB 5JXHA 1JXNA 4XMIA 4CUAA 3I2HA 4YARA 5FIXA 5DUUA 1YO8A 2DVBA 3HN1A 2JKXA 1OVPA 3N9OA 1YJKA 4FO9A 4IE0A 4XFFA 1YUDA 3FFZA 3EMRA 1QJFA 5FMDA 1OA3A 2WT1A 1T6GC 3KCCA 2GH2A 4P9GA 2XBO3 1NLRA 2E9QA 1I5ZA 3E1F1 3G6JB 4YGDA 2UYAA 2VZQA 3R0RA 4A44A 2DVFA 3A4UA 3ACIA 3FUOA 3KF5A 4FFHA 3WR0A 4AZZA 3KS7A 1RUE3 3GBFA 3BU7A 2WLPA 4LUMA 3HT2A 1ZM1A 4HPKB 1RUG1 1W90A 1ODMA 3BPSA 3VHPA 5I0RA 1LHVA 1FT9A 3LKJA 4LLOA 2OUHA 1UO9A 2X8KA 1W6QA 3DEMA 4AYUA 3DXUA 5FY4A 4XILA 2ZGMA 1C3HA 3VBOC 3SC7X 1Q8OA 1PZ8A 1WCSA 3D3AA 3Q8AA 2BOJA 2J1UA 4JKMA 1UOJA 5JVVA 1D0GA 3K51A 5JLVA 1UYZA 1C8M1 1RMU3 1BEV1 4ORFA 1CZVA 2Y33A 3H7JA 5EQUA 1GLHA 4NIAA 4AHYA 3FL7A 4CP1A 2L9LA 2TNFA 3NNMA 4MSVA 2IC1A 1FMD1 1Y9QA 1Y7BA 1G9FA 3VDBA 3JD71 3PUHA 1V6NA 1SG3A 4D94A 2FHRA 2ZGOA 3BTZA 4GH4B 1GSLA 2WO2A 3U10A 1LHUA 1QXRA 4FSJA 4F8AA 1DQ2A 1IG3A 1MS3A 4YG0A 1BBT1 1ZRRA 2XKOA 4AFAA 4AHWA 4IL7A 5FWJA 3FX3A 1UZYA 4Y24A 3H1WA 4HSJA 2JENA 2WIIB 5FK8A 2VTXA 1GU3A 4EZHA 4JTOA 1ULOA 4YVWC 5A33A 3TN93 4XFCA 1JBCA 2XBO2 3TYJA 5A3TA 5I0DA 5CU1A 1OSGA 4PLNA 4FPEA 4I30A 2ZGUA 2J7MA 3U37A 5J36A 2Q5TA 1RUE2 2QQNA 2BZDA 1Y9GA 1R1ZA 2WQ8A 3KV9A 3NW4A 1F8VA 3CBNA 4GMP3 3RWNA 2X09A 3UNPA 4M3CE 4O9GA 3RG0A 3LE0A 5FAXA 2XJVA 5IW0A 4X6QB 3B7MA 3KSCA 4HVRA 4M00A 1K45A 3TRSB 1DQ0A 5F5IA 3B94A 4YWAA 2XLGA 4BISA 1HX6A 1PIV1 2PAKA 1MS4A 2PQSA 3UYJA 3KHCA 3TNQA 4BH9A 5LA0A 1TMF1 3JU9A 4JGYA 3ZOIA 2ZGRA 1V6OA 2E63A 2EXJA 1PX3A 1GWLA 3S7IA 3RZLA 1WLWA 1AX2A 2RHPA 1RMU2 1RUH1 1X36A 2WFF1 4NR1A 3ZSLA 3KVAA 3ZFGB 3U4XA 3MIGA 4FXKB 2Y26A 2JD9A 4GJYA 3MICA 3OOXA 4HN1A 4CU6A 1ZNPA 3T1LA 5C3OA 2VQ0A 2FMDA 4QX5A 3CJIA 2PA7A 5SV8A 1UPIA 3AP9A 2YBKA 4QPIB 4R8HA 4YW4A 2IFWA 3RGBA 1VBE1 1MR5A 2GNDA 1FYUA 3J7HA 4KGGA 5APAA 4NRMA 5FY0A 2YHJA 5AFBA 3FN9A 1AUYA 1EV13 2CDPA 2KXLA 2RDQA 2EIGA 3I2IA 3HWJA 4NPLA 2W1QA 3BTXA 1YFYA 2YBPA 3H8UA 4E4SA 2WA3A 2XLAA 1EYBA 2ZTNA 2ZZJA 2J42A 1MS8A 3WF1A 4PDWA 3POWA 3TN92 4AEDB 4BCUA 4XF1A 4M0NA 4NJ4A 2CHHA 3BI3A 2JE8A 3ENRA 1RUF1 1H2NA 1W05A 3B00A 1H8TA 1QJU1 2VMEA 1JZ5A 4UBHA 1KJLA 2RJLA 3KMHA 5CFDB 4F83A 2CAUA 1NA1B 4JGZA 5F8PA 1H2MA 3WG4A 4EROA 4ZHNA 2FMYA 3B5LB 3ZSMA 1N3OA 5BPXA 2O1QA 3QCWA 4BQ1A 4XW3A 1BXHA 1D4M1 1QIQA 1UPSA 3QD6A 5GLWA 3SHRA 2VUAA 3ZR5A 4I2OA 4W50A 3EB7A 1UMIA 5FK7A 3IIAA 3M4FA 3N4MA 2QDRA 1L7QA 3I7DA 4UXAA 1JH5A 1UYXA 4XF0A 3S30A 3GYDA 4AI9A 4DO0A 5GZGA 2PQQA 1RVF1 2GDFA 2ILMA 2P3IA 4EN0A 2P6HA 1ND3C 1OA2A 4LKEA 1V9U1 5FOBB 2FDGA 1RHI3 2ZHLA 1XJAA 2XQRA 3KF3A 3OSDA 3O1TA 2AEZA 2XJUA 3N35A 4N43C 2B4KA 3ZYFA 4YFWA 5JR2A 3CL1A 4LR4A 1W0NA 4CUBA 3PMEA 3PUQA 4FQZA 4HPKA 4XQ4A 4YVSA 4TTGA 3GXUA 2HWE1 2WNEA 4Z82A 5J48A 3V0BA 5L7OC 4LBJA 4IV1B 1GV9A 4CCNA 3WW3A 4YRDA 1O8PA 3KV4A 3AP7A 3J4UH 4MXWB 5FJKA 4BQ4A 4K20A 4Q8KA 4OHYA 5JMCA 4HFSA 3VBUC 1WUVA 1R1A2 3PNAA 1FOD1 3VBRB 1FV2A 3VBSC 3VHNA 4UOJA 1FV3A 1BVP1 3NKTA 3CU7A 4HZFA 3U07A 2IFRA 3INAA 2B9VA 5DG2A 2XL7A 1HXS1 1IS6A 4LORA 3BODA 1W8HA 2QDNA 1GOHA 2B39A 2YUEA 2DUPA 4QX3A 5HCHA 5ANQA 4G4FA 2WFPA 4QPGA 2VVFA 2DUQA 2CTVA 5A1LA 2QTWB 2VM9A 2PHFA 5LWBA 3IDAA 4FT8A 1R083 2QQUA 2YDEA 3ZXJA 3IB3A 3O1SA 1SACA 4LA2A 1VMFA 1ZZ6A 4J1WA 5LZ6A 4XFGA 3BALA 4RR3A 3PL0A 1J59A 2RDSA 1JYWA 3NJXA 1N47A 2VXJA 3MZHA 3GZTB 4U36A 1DGWA 3HAGA 2JDKA 4B4PA 1KS5A 2W68A 1APNA 2CSGA 2QE3A 2HWC1 2VZOA 1RHI2 2R043 1OOPA 1GQPA 3NNJA 4JAAA 4S2GA 5F2WA 5A7QA 5FPLA 4Q4W1 1X8MA 4UFHA 4DXRA 2E33A 3UJOA 3MHZA 2OQ6A 5E16A 1B35B 1HB4A 3ORJA 2XKPA 3ZFFB 2HKXA 3AKRA 3D82A 4IEZA 1YXWA 5KXCA 1AYN3 4JGYC 4OHWA 3ZIXA 1S0DA 2ARCA 1SBEA 4B8EA 3MIFA 5BXXA 5HV4A 2JG8A 3RI8A 3LEKA 1HRV3 2CNAA 1X50A 3OGRA 1JYTA 4FPGA 4NHYA 1LOFC 2JICA 4XDOA 1JN2P 2ZMNA 3MF6A 3R4DB 5LRSA 5LK7B 2YG0A 1OT5A 3ZFGA 2VQAA 5CAZA 2MEV1 3OB8A 3GCXA 4NMIA 4QGMA 4LBOA 2BVBA 3HBZA 2MHFA 1ENQA 3RWKX 1DGLA 4F7ZA 4XACA 4CVUA 5GZCA 1CPMA 1XB9A 4QPWA 4N53B 2ZKLA 4KH9A 1WBLA 2Q8EA 3MPPG 2XR4A 2KR2A 2ATFA 3H8OA 4IE5A 3ZIWA 3NNGA 1R082 1BYHA 4M3CF 2Q8DA 4IV3B 4K7JA 4IQPA 5A3NA 2GNTA 5J1XA 1SLAA 5CZKA 1NZIA 2D98A 4YW7A 4LTAA 5FWEA 2X5IC 5JAXA 1LNSA 3QH7A 3WG2A 4D69A 4BWOA 1H8TC 5GLTA 3VHOA 1Q43A 2YYOA 1PVXA 3T2TA 2MNGA 2HLEA 2OT7A 1XSQA 2OW4A 3P1IA 4FPLA 4PBOA 2V73A 1RUE1 3BOPA 4A7ZA 5AC93 4TWTA 2FCVA 2R042 3K75B 3OF1A 1OD3A 3B02A 4P9YA 3MLKA 3POFA 2IVJA 4Y4RA 2BGOA 5DUXA 3K4ZA 4QAWA 5CFDA 5BNQA 3WUCA 4QKNA 4TN7A 1NA1A 3AKTA 5FREA 1NXD1 2AC1A 2PN5A 5FZAA 3FLTA 1VE0A 1PNFA 1AYN2 1UYPA 1ZREA 1W28A 2GP3A 5GZEA 1KQRA 1JYCA 3NRUA 1X9PA 3EQEA 4I3GA 2EF6A 1XXNA 1C1LA 5F3EA 5LCWL 3L2YA 3HT1A 1G9DA 1ZRFA 1HRV2 4MHRA 4OUMA 4IEYA 1RMU1 1RINA 5FZ3A 3W58A 5FZ6A 5FYCA 3BYWA 3KV5A 4RA0A 4DRRA 2IXLA 4AEJA 1ZYBA 4YGBA 4XC9A 2A75A 3WQ0A 2VMCA 5HCBA 2X05A 5JXIA 3BTYA 5DAVA 2K46A 2CGOA 1UY2A 1ENRA 1HLCA 1SLCA 1IS4A 4IW3A 2ZA9A 2VTFA 1MQTB 2NN8A 2ZGKA 5FXXA 3VZOA 1NKGA 2I07B 2PFWA 4IV1A 4XUPA 2BFUL 2VMFA 4Q0SA 1OMIA 2VZPA 1HQWA 1W2AX 3HMYA 2JG9A 2JWPA 3AKSA 2JDAA 4ZZ8A 4UFIA 3THPA 4ARYA 2YFUA 2QQIA 4CEYB 4BZ4A 3TN91 3WNNA 5I93A 1W8ZA 2WLQA 4R9AA 4RD7A 4FTBA 2D44A 1ZX5A 3S0MA 1UMZA 5FLJA 1WMFA 3BU0A 1C5IA 1XNDA 4GH4C 5AC92 1GNHA 3GM8A 4GALA 4GMP0 3UK9A 1QQP3 4GMP1 2ID4A 5EP9A 1CR7A 4JQRA 5FP3A 3ZYHA 5BV6A 2WT2A 4XUQA 1XC6A 1MZFA 2QZ3A 4H7MA 4ZPIA 3NL1A 4YZ2A 1ONAA 1I5PA 5FY1A 4QGNA 4GD4A 3LEMA 3WCSA 2W94A 2WQ4A 3MLJA 4FFGA 3SNMA 4XFIA 3C8XA 5HCAA 1W3VA 2J1EA 4FTEA 3N7LA 3W9AA 1NCRA 2PELA 4HMZA 4M4RA 4Z2AA 2XVGA 4XUTA 5H9SA 4CCOA 3J26N 4EV0A 2WJSA 1L7LA 3PDQA 5A7OA 3VBHA 4GB33 1Y4WA 3SLIA 1UZ0A 4K9SA 4CYDA 4GA9A 4ASKA 3D8CA 4KQ7A 5FMOS 1OPMA 5JOYA 1QU0A 1B35A 4AK3A 3ZFFA 1JZ2A 1YCIA 4YW1A 2WT0A 1C57A 2QQLA 2E31A 4I01A 4IDZA 5LK5A 2LALA 1FPN1 3PU8A 4OQ8A 1KDMA 1T2XA 2W52A 4QKBA 2JIGA 3WQ1A 3ZFGC 4CP2A 3LA2A 1G8WA 1R1A1 3RI9A 2ARAA 5BNPB 1BCXA 2F4PA 1AVBA 1TNRA 3AMHA 4RYDA 5FYBA 4YZ4A 3OYWB 4QPIC 4WM7B 2B45X 3IIIA 5GZDA 3HQXA 2OZ6A 1QQP2 3HQRA 3U14A 4FOVA 2C1FA 3VL8A 4ISQA 3ZN4A 4ATEA 4FPKA 1AJKA 2J1TA 4DXSA 3HNYM 1O7FA 4I3PA 5C3RA 2RDRA 5C9AA 4B3NA 3U1XA 4NO4A 5I8TA 4AEDC 4HT1T 2WO7A 1ZBA3 2C0ZA 4FP2A 4JDMA 3VHRA 2IUWA 1LGNA 2ZX3A 2ETEA 2ZAAA 4META 3WVJA 4OI4A 1DQ5A 1MEC3 2IXJA 3WX5A 5CFDC 3TOJA 3KWVA 1NA1C 3MDPA 3O5SA 4Y33A 1F4AA 3RYPA 4ZU5A 4E8CA 3T0AA 4GB32 5T50A 4A7KA 1RUI3 4EJRA 1MZEA 2BUKA 3DYOA 3MF9A 5I0SA 2DUOA 3O12A 4C1WA 3MW2A 3FHQA 4NIDA 1PMJX 4COVA 5J09A 4LO7A 1W9WA 4NPMA 1O5LA 2VUDA 1D2QA 3ECQA 1KITA 3IM0A 1WD3A 5A7SA 1GZ9A 1HB1A 4AAPA 4IUGA 4XJAA 5EIYB 4S2FA 3VBFC 5FUIA 3L2HA 4CPBD 1SCRA 1H9PA 2Y6JA 5FRAA 2WYFA 3J8F3 1RUJ1 1VAVA 2GH8A 4P9WA 1I3HA 3RJ2X 1EAH3 1AYM3 3T08A 4ZZ5A 4IV1C 1RC6A 3LSDA 4L11A 2WYSA 4XIOA 2WINB 3NAPB 1W0PA 3CF6E 2EAAA 4QDRA 1OBNA 1OC1A 1R081 1U5ZA 1WD4A 2ZHMA 2B42B 2VZ3A 1HJGA 4FI9A 3RZZA 3SMHA 5ABJB 1DF0A 3RSJA 3VBRC 2XWBB 1W8WA 1D7PM 1HB3A 2JDUA 4N43B 1ZBA2 3VKLA 1SFYA 1HB2A 3CZUA 4RHV3 5CNAA 1LOCA 2P3KA 2R041 1MEC2 4CXXA 2IXCA 2WWJA 3ES1A 3T09A 3VBOA 2HJIA 3ZMNA 3CLPA 3LDBA 3POIA 1RUI2 4FPYA 5HPOA 4OHZA 2C5DA 4QDSA 1PMIA 5DUWA 1S1AA 5DAQA 3J7LA 2QQOA 1VLNA 5CYYA 4Z1VA 4BMBA 2JB4A 3OUHA 3PJQA 4HONA 4DY3A 3KLSA 4WVMB 4CCEA 4Q0QA 2D43A 2EIBA 4OI2A 2RDNA 3OUJA 1DYOA 1HRV1 3K77A 4JHTA 4W6XA 5FPAA 4V1PA 5C5TA 4R4ZA 1UY1A 3ILFA 4BXFA 2Z42A 3N9QA 4UW4A 4Q5OA 1TNFA 4UW3A 1YLLA 5EXOA 2W91A 5C3SA 1U5IA 2ZCWA 2ZACA 3KQ4B 2AENA 4U2AA 4C8DA 2LTNA 2K2SA 3ZXKA 1H1MA 3THCA 3OEBA 3J8F2 1GZWA 4H7LA 4XEZA 1VMJA 1ZRCA 4QX7A 1EAH2 1AYM2 1YYNA 2CGNA 1VBB1 1N3PA 2AACA 2WWSA 4UWDA 5E1RA 3WLUA 4YVWA 2XQXA 1ZVFA 2XJSA 1S0JA 5A1FA 2YGLA 2JE7A 3AZXA 1WCDJ 4M01A 4YGCA 5I8SA 5BY5A 1LRHA 3UV9A 3ZN6A 1SPPA 2JD4A 1DLCA 1JODA 5IYYA 2J22A 1OHFA 2Q30A 1SDWA 1W9FA 2XB6C 3H42B 4Y1ZA 4AFDA 5C4WB 3I2DA 2RM23 2Z79A 5JXJA 2EALA 2QVSB 2HWD3 4Q26A 4RHV2 3ZSEA 1VBA3 1XOYA 2WZ8A 3THTA 5AC91 1WW4A 4N53C 3ST7A 5ANNA 1W9SA 1X33A 5G04L 1CAXA 2VL4A 5A80A 2DFCA 3AKPA 5IJRA 4Y26A 3DN7A 1QJEA 2HBTA 4IV3C 4AW7A 2ZPXA 2R6QA 2B8MA 3H8XA 3A21A 1AHSA 1CIYA 3HJRA 3SKVA 2UYBA 2ZGSA 1L7RA 5E6HA 4EN8B 1KRIA 3SITA 2ZX2A 4IGOA 3RZMA 4L2NA 2AUYA 1AXKA 4P5HA 4QQHA 1BJQA 2Z2SB 3SQOA 3CO2A 1IS3A 1V6IA 2PYTA 3OGVA 3T4HB 4XZUG 1WBFA 2W47A 3AZZA 2Y6LA 5CKMA 1WWYA 2RMU1 2TEPA 1DFQA 4DINB 2G9GA 4AGGA 2JDHA 2WN2A 3AP6A 3MW4A 5L9VA 3AK0A 4IESA 1Q8VA 4ARXA 3ZXEA 1POV3 2WZR3 4C91A 2YPJA 4HK8A 3UL2A 1LU2A 1QH7A 3N9LA 5SV5A 2JX9A 1ULEA 1ULGA 4R9BA 4HANA 1VP6A 4O9EA 4CZSA 5KXBA 3MIBA 1A6CA 4CEWB 2HEVF 5IVJA 4CP0A 2CU5A 3M70A 2ZBJA 4LK6A 2D3SA 1RUC3 2VZUA 1F31A 4LOSA 1J3QA 1SFNA 1RUD1 4F3JA 2WABA 4R9CA 4X8NA 4CCJA 2XHNA 5DZEA 4IEVA 2ZGPA 1S2KA 3CJXA 2RM22 3LPFA 2AR6A 1XNKA 4QXBA 1OURA 2HWD2 2EVXA 3FFQA 1VBA2 4GWIA 5FBZA 4IEOA 1AR83 5FZLA 4PIYA 1BVVA 3LDKA 3M2MA 5A32B 3R6SA 3T2QA 1SBDA 1MQTC 4FTSA 1ZZ7A 1AR91 4GIQA 4FOWA 2MPFA 2QQKA 2KM2A 2VZSA 2O8OA 5FXZA 3WDXA 1U0AA 1UIKA 1FAYA 3A0NA 4O65A 5KBFA 1ND3A 4MGYE 4CEYC 4QB2A 3BKZA 1VAMA 2DBIA 1IGOA 4LBQD 4YLZA 1ZZ9A 3AYCA 5LA2A 3VD9A 3LQCA 4XHXA 4AHZA 4N43A 1OUXA 4J6GA 3CDZB 3WG3A 4BQ2A 3PTRB 2W92A 2FZ1A 2YU2A 5L7OA 4XFAA 3UJQA 1SHWB 3VUOA 5FZCA 4Q2FA 2V72A 4AXOA 4LBQB 5DXDA 3SEPA 4GKYA 1TG7A 4GB31 5KHKA 4XQDA 3NSTA 2WZR2 5FYSA 2VECA 4ZU7A 1C5HA 4TZDA 4XF3A 4BQWA 1WCQA 1ZZ8A 2CAVA 2O14A 2Q0AA 3Q9OA 5DUVA 3VBUA 1OXCA 3VBSA 1J84A 3KVBA 5FZ9A 3NMBA 4NE9A 5FY7A 4D6RA 1OI6A 1LB2A 2DV9A 5B4XA 2E32A 5IVYA 1RUC2 1KS4A 2FDJA 4LQRA 1UU6A 2ADEA 1CIWA 2FDKA 2R49A 2UU8A 4AE2A 3OY8A 2V5YA 1IZ3A 5F2SA 2YY1A 3ON7A 3KT4A 4IEXA 1AR82 1W6MB 3DPRB 1ZA4A 5FZHA 4KG8A 2A6XA 4LBKA 1MZ5A 5FO7B 5EJ1B 1TME3 4E9KA 1UOGA 3POSA 2HWF3 4IGQA 1HRI1 4JQTA 2D40A 4EWDA 5LY1A 5KC6A 1AR71 2GMPA 4I0WB 3RDIA 4MADA 4P9XA 2XJRA 5E89A 4UFKA 4XFHA 4CCCA 1QNWA 1GOGA 1WCUA 1ZBA1 3PIGA 5BNPC 1Y9MA 2XJTA 4ES9A 4E8DA 3KZ4C 2VW0A 2G19A 4WM7C 2NQYA 3RZKA 5H9PA 2C9AA 1SLTA 1QJY3 5C9AB 3WW4A 4QB1A 3CMGA 1MEC1 1O91A 5CB7A 5ACA2 5EYYA 1H2KA 5K7PA 1LGCA 1QNYA 1YC61 3AL6A 1ZZBA 2DF7A 3CKHA 1OH3A 3ZSKA 1RUI1 1CESA 2Y60A 5FZFA 2JDMA 5LW9A 3CZJA 1GP6A 3FHAA 1H4HA 1LOFA 3BUCA 1X8EA 4WV8A 3WG1A 5FP4A 1Z7S3 5A70A 1GP4A 3DV8A 1HIXA 4L9BA 1NY72 1LHWA 2X29A 1A8MA 2VC9A 1EY2A 4DIQA 3HIFA 3KB5A 2VW2A 1YRZA 2P2KA 2FDFA 2BBAA 1IKPA 1STMA 3ZKYA 3ELNA 4QGLA 2UWBA 2VZ1A 2D5FA 2HEYF 3USUA 2JDZA 3J7NA 1GZTA 1XYOA 1JHJA 2YFZA 3J8F1 5FYIA 5CG8A 1F9KA 4Q8LA 2IVIB 4JCKA 4UFLA 2E26A 2X5IA 3U78A 2UWAA 1TME2 5FZGA 5DAXA 4IE4A 2HWF2 2Y38A 2ZHKA 3W21A 2F4LA 4ASLA 1UAIA 4LLFA 2Y6GA 4Q29A 2VQUA 3ATGA 4E2GA 5F32A 4CEWA 4WVWA 1COV3 4A3ZA 3LAGA 1MACA 4WM8B 5IWFA 3IDCB 5FKCA 4D7YA 3C7EA 4ONUA 4RHV1 3H1YA 1Q56A 1NQJA 1NQDA 3Q8FA 1D0HA 1MS0A 3AM2A 5FCCA 3B9IA 4L8QA 1QJY2 2ADDA 5DABA 2WN3A 1RUOA 3NAPC 4YW3A 3DGTA 5FMCA 2ZEWA 5C70A 2G4IA 2CWSA 4CDWC 1RTVA 3V65A 3OGSA 4I0AA 3MFAA 5J7MA 1ZZCA 4Q1PA 5ABJC 5T5JA 4RFRB 1DYKA 1VR3A 2B46X 1W04A 5A1AA 4PI0A 1QWRA 1UU5A 3E6DA 3VBFB 4B4QA 1LEMA 1QF3A 4Q0PA 4GQ7A 2WS93 3OBTA 4BJ0A 2DDUA 3KV6A 3VZLA 1Z7S2 1MS1A 3WP6A 1J1LA 1UNBA 2E7AA 4UFJA 4Y5Z0 2R1BA 3RS6A 1CQ9A 1EV12 4CP9B 4XYXA 3EO6A 4Z07A 5ISLA 1AXYA 4MXVA 4D7SA 5GKAC 1OD5A 4XJUA 1QJX3 3B3QE 3AL5A 2BRTA 1JTZX 4RS5B 1RITA 2ZHNA 3DUIA 1N1YA 1GQHA 1OUSA 3LCPA 4DUVA 3HN3A 2DCZA 3SKJE 4TLGA 4W8JA 2QQMA 4LO6B 1CAUB 4CA9A 1CWPA 4KBBA 3LDRA 3LPGA 3KT1A 5IFTA 4K1ZA 3H50A 5FZDA 5FZ0A 1COV2 1W03A 4GH4A 4PBPA 1UD1A 5T5PA 1A78A 3ES4A 4K21A 2WNOA 3T0BA 2RM21 5FFOC 4OYUA 2YPDA 3I54A 1VBA1 1PM4A 3Q8CA 5D8AB 5LA1A 1XU2A 1TEIA 2IZWA 2QZ2A 4JX0A 4ZU4A 2JB8A 4AEKA 1OLME 1DGWX 3FHIB 4P5YA 2PHLA 5A3UA 5K0UB 5A7WB 1W6MA 3DPRA 4RSUA 5H9RA 5IVVA 4A6SA 1WMXA 4GAZA 5JSRA 3RZJA 3A22A 2B5HA 5A3OA 3UKVA 1YJLA 2VBDA 3L9JT 2K0GA 3RQ0A 3TB0A 4AF9A 5BNNB 4AWDA 2VW1A 4DNYA 1VMHA 2ZMKA 1JS9A 3FZ3A 3ZDSA 4CCMA 5C4WC 3PU3A 1UOBA 2WNUB 4A41A 4HN0A 5C33A 2WS92 2OPWA 4M0HA 1AF9A 4AVCA 5F6KA 3JB4C 2WZPP 3C7HA 3WDVA 1S0IA 1JW6A 2XUMA 4COWA 5CISA 1V0AA 5IFPA 3PVBB 3ACLA 1QJX2 4ES8A 3MUZ1 1VRH3 1OPOA 2C4XA 1VBC3 4XETA 1DP0A 1IOAA 2A6ZA 3TNPB 4S2HA 1UZVA 3VKMA 2WZR1 3WW1A 1W6NB 1RJ8A 4C0HA 4LBNA 2TUNA 3RFRA 1J83A 2EAKA 1NOVA 3LIGA 2PTMA 1XE0A 3AFKA 3OPTA 1JOPA 2P3JA 2Y6HA 3NJVA 4GWJA 4NVPA 4Y1XA 5HXVA 4CTEA 3SEEA 1G7YA 5T3NA 3NV1A 1RUC1 2WAOA 3MGUA 4MVTA 1OKOA 4QPIA 1OLMA 1P8JA 3S5QA 3VDDB 1G6NA 1LESA 2CGPA 1UZZA 4JVAA 3GZUC 2E51A 2WDBA 4Z92B 5DDJ3 3P6BA 1LOEA 4E27A 2D93A 1WA6X 4JDOA 2DU0A 2Q4SA 1AR81 1AR63 1S0FA 2NM1A 1REDA 2VOVA 1ASJ3 2X10A 2XBO1 1BKZA 4C0BA 4E2SA 2C24A 5JXGA 1IHMA 4QU2A 4AEDA 3NKGA 2HWB3 3ETQA 1IQDC 5FY5A 3PLQA 3VN4A 3AVRA 4CEWC 5CFCB 2VU9A 4YNIA 4LUKA 1CD3G 3U0ZA 2A6VA 3VZJA 2H0BA 3HD8B 2GNMA 5FBJA 3VV1A 2BWAA 3VGIA 2HYXA 3KGZA 4LIVA 4NAOA 4R4XA 1QOSA 5A7PA 5LATA 2CWMA 4AVSA 1YIFA 1WMDA 3WXPA 1M06G 3IDBB 4KU7A 1REEA 4WM8A 4B7EA 1NT0A 2VQTA 4ITCA 2DVAA 4ZS2A 2JJ6A 1W8UA 2RS53 3C3VA 3OD0A 1QEXA 3E6BA 3H1MA 5HXMA 5IT6A 1WCKA 3GNEA 1QHDA 4MHUA 3H3ZA 4XURA 1VRH2 4QX0A 1A3KA 4XBQA 3VB9A 5FPBA 2DFBA 3SCGA 3O7OA 4XMAA 3T0DA 3AXDA 4QQ2A 4XXPA 1OFNA 4EN7B 4PI2A 2JECA 3VBFA 1YIPA 3KCYA 3ABZA 5C8CB 1AX0A 5IAXA 1Z78A 3OPZA 1VALA 3AZVA 3LEGA 1NY71 4PLOA 1O4ZA 1OLQA 2WAAA 4RFT0 4TSVA 3VDAA 4EE2A 2QQVA 4HSLA 5IVBA 3F2ZA 2GAUA 5FP7A 3BCWA 1UKRA 3H3UA 1X82A 3UGGA 4MXWA 4D7TA 3FLPA 5DDJ2 3FWEA 3WNMA 1PK6B 3K4AA 4BIOA 3ZXAC 5EFUA 1AR62 2E7QA 1DYPA 1ASJ2 2WNVB 4RS5A 3VBRA 4A42A 1QDCA 4PIZA 4LK7A 1JOJA 2DCTA 2VMHA 1IS5A 2HWB2 5HBAA 4AFMA 1ST8A 1TME1 1UX7A 4YGEA 3VKOA 2HWF1 1HQNA 1CAUA 1XNBA 5F3IA 4BYYA 5I91A 1VB4A 2D5HA 1PO13 3TEYA 3LZZA 3NV3A 4AVVA 2DCYA 4Y5TA 3USSA 1W99A 1GWKA 2ZXQA 2JIJA 4Q0UA 3LGRA 4N8MA 1D2SA 2GMMA 1LGBA 3POYA 1O3TA 3DPRC 2VOWA 3LA3A 4KWLA 3GF6A 3LSEA 5FTTC 2BERA 2BNMA 4L97A 2RS52 2PXJA 4BB3A 4CDQB 1O6UA 1MVEA 5L36A 5IK7A 4KBZA 1F35A 5FZMA 5A7WA 1XPWA 4NIHA 4BDVB 1MS5A 2XLFA 3ZO0B 4EYUA 4FPJA 1GQGA 3SH5A 3TAYA 3MEPA 5FYYA 5F1RA 5BNNA 5FQ0B 1K12A 1ALYA 5CKNA 1JHNA 3DKQA 4GULA 4DQAA 1SFPA 5JDBA 2RS13 4R52A 2W87A 2WNUA 4QMAA 2RVAA 5DAWA 4XABA 3IAQA 5AVPA 2E7TA 5A6ZA 2ORZA 5C9AC 5F9TA 3T1MA 1EV11 5LEKA 1Y43B 3AMNA 3N9PA 4QQOA 4UAPA 2VCBA 2EXIA 3O1VA 3LOBA 1W2NA 1UMHA 5F7UA 4MZUA 5FDBA 2IWGB 4LBMA 4XTMA 1OLRA 1YQ8A 2RS33 3FUQA 5HCFA 3POJA 3S57A 4Q4V3 1BEV3 4OZXA 4KNCA 3SH3A 3GZEA 2Y0IA 1VJ2A 3ZXGA 2FZ2A 3I8TA 4HVOA 1O5UA 3RNSA 3BN6A
chains in the Genus database with same CATH topology
1FMD3 1ZRDA 3JD73 4KU8A 4XXAA 2VH9A 1PO12 4XQWA 4OI0A 4N53A 1OKQA 5KWRA 3VDDA 3IBMA 2UY9A 1BBT3 2P17A 2XVLA 4XTPA 2GC0A 2GN3A 1S0CA 4IV3A 4QD2A 4EWAA 3JZVA 2A3YA 1JUIA 2ET7A 1C1FA 2ERFA 2DCKA 4LO5B 5EJ3A 4DMIA 1NCQB 4LO4B 4LEJA 1RHI1 3O0WA 5GALA 1GZCA 4W6WA 5CADA 1Q8PA 5IK8A 2EXKA 2QFEA 3OTFA 4WM8C 2I45A 2YV8A 3V0AB 2JXAA 2OYZA 2PHTA 2RS12 3VL9A 3O0VA 5JZGC 3OGGA 4OULA 3RMXA 4K3UA 5JPMB 4URTA 5EYXA 2KA3A 5BNOB 4IERA 4XF9A 4QXKA 1DQ1A 2IXHA 3N3HA 1I9RA 1PIV3 3IT8A 1QJX1 3IWZA 1TMF3 1L3JA 4AEMA 2RS32 3EJKA 1BK1A 1CX4A 1BEV2 4Q4V2 1ND2B 3DL3A 1NZCA 3I59B 4P9LA 1G9AA 4RGGA 4Y20B 2A5ZA 1FMD2 2I2SA 1J1TA 1HV1A 4CDWB 3MLLA 1MQTA 1VBE3 3PVEA 5JIAA 4MYEA 4NHMA 3M8LA 3ALQA 2RJKA 4QPYA 4I09A 4RS5C 4NPRA 2ZKNA 1REFA 4P9JA 2D6MA 1JUHA 4CEYA 3KQRA 4W6YA 1UF2C 4MUVA 2CL2A 1YI7A 4N7IA 3OJBA 1V6LA 3V56A 1H9WA 2SBAA 4COYA 1VAKA 3ZFEB 1AJOA 1QJU3 2ZGNA 1ZBE3 2DWRA 4PCRA 3ZVXA 3SH4A 5D8AC 1WW7A 2GN7A 1AYN1 4DRVA 1HDKA 3WQ7A 5K0UC 3B01A 4H14A 2R32A 5F5QA 2Q1MA 4CDQA 1VRH1 5BNNC 4LHNA 1NLSA 4NHLA 3NV4A 3ZYGA 1Q5OA 2WNUC 1EPWA 2VGDA 5DG1A 5GM0A 1HV0A 1GFF2 3WCRA 4RL7A 3JQXA 3WUDA 4AVTA 5IK4A 4MH0E 1VBE2 4XE9A 3S7EA 2E6VA 3AKQA 4AGRA 4N9HA 4XFBA 5DDJ1 1CAVB 4KWJA 1B09A 1AR61 1G86A 3AX4A 3JBG3 4X6RB 3E97A 5A33B 4CDXB 2BPA2 1F5JA 4DY5A 2ES3A 4BPZA 2HWB1 4GWMA 3D6EA 1GICA 5BNPA 4YW2A 4ASMB 4BE3A 4DS0A 2AYHA 1CGPA 3OYWA 4WM7A 1PO23 4MGIE 4WZCA 3VDDC 3QH6A 2ZGLA 1QJU2 3P3NA 1ZBE2 3JUUA 4YW5A 2K9ZA 1OQEA 1W6OB 2GC3A 2D6KA 1I1EA 3M1HA 2QKDA 3A0KA 2A3WA 1UKGA 2RS51 3WP5A 5E88A 2WSVA 1C28A 5CFCC 5E8AA 3WP3A 3VZMA 2BEOA 3JCIA 5I0UA 5HI0A 1LJ7A 4Q4Y3 5LEJA 1K5MB 2HWC3 1Y3TA 2I74A 3O14A 2OZJA 2D3PA 4AQ6A 1FX5A 3P3PA 1O3SA 1PGSA 4XOGA 4Q4W3 3WHUA 3CJIB 1XYPA 4JRLA 4KL1A 1LENA 3V0AA 4KWKA 4UBGA 3WY6A 5L19A 1CPNA 3DKWA 3WP4A 4HL0A 4ZXKA 2XJQA 3LB9A 1MS9A 5BNOA 3QACA 2ZABA 2HEWF 2UURA 4YM0A 1LECA 2N7GA 3NJZA 2QCSB 3U11A 3JBG2 1WLCA 4OHVA 3HR9A 2R0FA 5C8CC 1WW5A 3AFGA 4K6BA 4M3CB 1QDOA 3MPBA 4SBVA 4CDUC 4BHPA 2MEV3 3GBWA 2YROA 2D6PA 1QQP1 3GALA 1PO22 4I0BA 1PO11 1Q3EA 4LA3A 1PZ9A 1ULDA 3NAPA 4XJZA 4EWEA 2GMEA 4CDWA 1PK6C 2W08A 2R1DA 3E6CC 4HBNA 3RYKA 3OGJA 2VPVA 2WNVC 5JR7B 5ABJA 3B69A 2ET1A 2O8QA 1NE6A 3RMYA 3VZNA 2AREA 4Y1YA 1CJDA 1LOAA 4YZ3A 3SCHA 1XRUA 5CVRA 1DZTA 2OIIA 1F5FA 2D97A 4Q4Y2 2Z69A 2D6LX 2HWC2 3E5QA 1HQLA 4Y22B 4YM1A 3ZFEA 2BYVE 3MI8A 3ROUA 1C8NA 4Q4W2 3WV6A 5CG9A 4YVSB 1PGL2 1O3QA 2RS11 5FLIA 1WMEA 3NWKA 2O0OA 3V0BB 4CDQC 2EXHA 2PHXA 1SEFA 4Y1VA 1W39A 5FO8B 3H9AA 2CV6A 1S2BA 4WVMA 3ZYJB 2A73B 4AI3A 1JYIA 5J98B 4Z8BA 4RQPB 1PVC3 4AVAA 2RS31 4K1YA 4Q4V1 1AX1A 1O4YA 2VOKA 3APBA 2X53S 2VVEA 3AP5A 1V6MA 3ZPYA 2MEV2 5T54A 5KHIA 1OQDA 2JE9A 4QPGB 5T5LA 2YGMA 5GJ6A 4PJYA 1SLIA 5JI9A 4AI2A 3PHMA 1QOTA 3WHTA 4QHBA 3S6PA 1H1IA 1FATA 5FLHA 3KGLA 4WBBA 4RR3B 1LEDA 5JSOA 1CAVA 4HETA 4MX3A 5C4WA 1DGRN 4CDXA 4I02A 3WINE 1QGLA 1DLLA 2GU9A 3SCFA 4K8FA 4YZ1A 1H4GA 1OOPB 2BWCA 1KJRA 3GZAA 2VULA 1EPZA 3UKNA 2FBEA 1S55A 1VBD3 2VNOA 5DZGA 2D7FA 3AMQA 1A8DA 1W6OA 4Y1UA 1PZ7A 2NMNA 1LHOA 1OA4A 3O0XA 2JG8B 3PVOA 1NCQC 3ZYRA 4ZKTB 4N90A 4W65A 3ZXLA 5L73A 2DVDA 2NPIA 3FJSA 3M3OA 1PVC2 4XIKA 2Y0OA 5JPNB 1K5MA 4B4RA 1EAH1 1AYM1 5T55A 2VMGA 4FPFA 5BNOC 2GALA 3BB6A 4EN9B 1KXGA 4XF4A 2VNGA 4YM3A 3BIWE 5BUVA 3MW3A 1W2UA 1XU1A 3ZXDA 4X8PA 1FPN3 2BBVA 2R063 4QM8A 3FLRA 1NG0A 1BMV2 3PMSA 1LODA 1QOOA 4YG6A 2UY8A 1ND2C 3WDYA 3WW2A 3EHKA 4C1XA 1UX6A 2E53A 1R1A3 2V09A 3E5UA 5JZGB 3M3QA 1J58A 4XDQA 5EWSA 3WT3A 4M3CA 2DYCA 1FNYA 1H30A 4H55A 4WZFA 5A32A 2DU1A 1O4TA 5FMOL 4DB5A 2W39A 5CA6A 1ZBE1 1DDLA 1G9BA 1E57A 1X7NA 1VBD2 4FXGB 2ZAHA 1AL0G 3C2UA 3QOPA 2PHWA 4A3XA 2XHKA 4IEUA 3ZFEC 2XWJB 1VIWB 2DCJA 3EXUA 1RGSA 3DF0A 2GNBA 3M7AA 2OUJA 4LBQA 3ASIA 4Y22A 4HK9A 4S2DA 2XGXA 3SISA 3WNXA 4LHKA 2D6OX 5JIUA 2BGCA 5J96B 3AYEA 1URXA 3AB0A 1S0EA 4PF5A 5GLUA 4YZ5A 1FPN2 2JG9B 2R062 3VKNA 1G9CA 1U5YA 3JBG1 4AI8A 2H6CA 2HWD1 4AVBA 4RQPA 3UKTA 4IETA 3G7DA 3R4SA 1DGRA 2PHUA 4Z2WA 5J37A 2TBVA 4L92A 3ZXFA 1RUJ3 1PO21 3IKWA 4C90A 5EV7A 2CY6A 4N9IA 1UIJA 4FPOB 5T52A 2GC1A 3ZSJA 1YWKA 1WA4A 3OCPA 2ZX4A 1TE1B 3AJYA 2OPKA 3AP4A 2R0HA 4CDXC 1SLLA 2A6YA 5KHJA 3FBMA 2JKBA 2H6BA 2NYYA 2R073 2BNNA 5AVAA 2VOXA 4BIFA 5EZWA 3BPZA 4Q4X3 3KT7A 1GNZA 1N1VA 1NCRB 1SQ4A 1V6KA 2VXRA 4NOTA 4E2QA 2Z5WA 4DPNA 5GLZA 5C9AA 4Q4Y1 1RUOA 4JC1A 4Q0VA 1CAWB 1MVQA 4XJ8A 4YYOA 1GBGA 2G9FA 1POV0 3LWCA 4UW5A 4WVVA 4G3YC 4FPHA 1I6XA 5CIRA 3VBHB 4H3WA 1POV1 1WW6A 3N36A 3D0JA 1PGL1 4Q1RA 1UCXA 1XE8A 4ATFA 3N7KA 2PAEA 4JTNA 3ZYPA 4E4ZA 1GANA 4LE3A 1J3PA 1J3RA 3QBQA 2D6NA 2ARBA 2RR13 3QLQA 4PQ9A 4AQSA 2ARXA 1K5MC 4OFGA 3ME2A 3PTYA 2ZX0A 4LHLA 4PIXA 4TLFA 1IKQA 1AL23 3CJIC 4XBLA 3TWIA 2WSUA 2XH6A 3KCXA 1YHFA 4HKWA 3FMGA 3WOGA 1RUJ2 1F2NA 4YG3A 4XZPA 1VBB3 2XJPA 5JOXA 1YNAA 5KC5A 3PJYA 1V70A 2PLV3 4PDWC 1IPJA 4NN0A 1FNZA 2ZZQA 5A3LA 5ACA3 4WVZA 2ZGTA 3IPVB 2R072 3CEWA 2VUJA 2NLRA 4Q4X2 4BLIA 1KFXL 4A7YA 1KFUL 2Q8OA 2GC2A 2A7AA 3VKFC 5JZGA 5F6LB 2DTWA 4JGZC 2IXKA 2BTVC 2P34A 3CNAA 3BTAA 4QQLA 1VBC2 3AMPA 3MYXA 1IPKA 4YM2A 1DIWA 5D1IA 2AH2A 5TSWA 1BQPA 5KXEA 4RGAA 5FO9B 1W0OA 1Q8QA 1XNCA 3H0OA 1OFSA 2A6WA 2BW8A 1H2LA 1DG6A 2SLIA 5GLVA 4XHBA 4CDUB 2DURA 2RR12 2F6BA 4N7UA 3RYRA 1NYWA 3WDUA 1VB2A 3AXEA 1R093 3AZYA 1PVC1 2NP0A 1LCLA 1MZ6A 1AL22 1UU4A 2JEMA 2RMU3 1PHMA 4YVSC 5FOJB 3ZYIB 2VY0A 4A2UA 1DZQA 4P9IA 4QQPA 1VBB2 2QUOA 1RUNA 3ZX7A 2VMIA 1GYKA 3D5OA 4RQPC 2PLV2 5IUQA 4DOUA 2ZJCA 1BMV1 2HYKA 1C4RA 2LM3A 1RUD3 4MV2A 5ACA2 1M4WA 5FPZA 2XG3A 4B7KA 5K8SA 4OHXA 1QKQA 1XE7A 4B29A 3URFA 1QJY1 2LUWA 5D8AA 1FXZA 2YMZA 2QJVA 2DTYA 1WLTA 4JRAA 4QPGC 5K0UA 4XPVA 1N3QA 4IEQA 3M3CA 3VBOB 5I8YA 1CJPA 4FAGA 3WDWA 1AR93 3MIHA 2A71A 3NO8A 1VBD1 4L99A 5J3UA 3B9CA 1HW5A 4RR3C 4OUSA 1BZWA 4QM9A 5LRRA 1WGPA 2WKKA 4Q27A 1RUG3 1PGW2 3AMMA 1Z7S1 4OLLA 4LE4A 1S0GA 4HKLA 3H7YA 4IEPA 4KGQA 1OOPC 4P14A 2IXIA 4XBNA 1NE4A 1R092 2WQZC 4AGVA 2GZWA 1CAWA 2RMU2 3GBGA 4COZA 5FPXA 3LOIA 1GZWB 1C8M3 1UL9A 4AQ2A 1W6NA 1QJZA 4YVWB 3D0SA 4GWNA 2UWCA 1DHKB 2JG8C 1EP0A 3AZWA 4NWWA 2H0VA 3ZN6B 4COUA 1COV1 2QNKA 4DFSA 2R061 2ZX1A 4K40A 2WA4A 2CYFA 3ZMOA 4HVQA 4LNVA 1V00A 1TQ5A 1V6JA 1RUD2 1Z0HA 1RJ7A 3NV2A 2RE9A 3K48A 4MGZE 1AZDA 3ILNA 1QY4A 1SLBA 3WZ1A 3M3IA 5CBLA 4Y4YA 2YC0A 3OD4A 1CAXB 1YFWA 4LBLA 4XJWA 4BM8A 4J1XA 1AR92 5CFCA 2R30A 4LO8A 1LOBA 1W6PB 1HRI3 1N1SA 2ZGQA 4FPCA 4MLOA 3RPQA 4NWVA 3R4UA 1ENXA 3IDEA 2FQPA 1H0BA 1AR73 2WS91 1RUG2 2NZ9A 1U12A 4FVVA 3IPVA 1KD7A 4SLIA 5C6CA 2NMOA 1DQ4A 1WLDA 2PAMA 3IMNA 3WDTA 3LA7A 3NVCA 2ZS6B 4BLJA 3JQWA 3RRDA 4TYSA 1XQNA 1FI2A 1YFUA 1C8M2 3X29B 1RUH3 2VVDA 2WFF3 3FE5A 4PLMA 4JDNA 4OVEA 4YSFA 4IXLA 2B9UA 4FCAA 3W59A 1IQAA 1GR3A 5KHHA 5T5OA 4D3WA 5C8CA 1DU3D 3JD72 5K9YA 3KM5A 3FBYA 4CDUA 1LTEA 3VZKA 1QXPA 2OVUA 5IK5A 1RL3A 2B7YA 1BBT2 1LHNA 3I4IA 3MFCA 4QT6A 1YFXA 1PK6A 3J9SA 4YFZA 3PVNA 3ILRA 1PNGA 2WNVA 1KDKA 3AYAA 5I0TA 2ZOEB 2PHRA 2QQPA 4NHKA 2EA7A 2JG9C 4GXLA 1RUF3 3FC0A 1QMJA 3N7MA 4EN6B 1ND3B 1HRI2 3GHNA 4XJ9A 4FBFA 4AFBA 4AG4A 2BNOA 2WL1A 1AR72 4HKOA 4GKXA 4MGKE 4INDA 1W6QB 2R071 2A70A 2ZMLA 1H1AA 4Q4X1 1D4M3 4OI1A 4AFCA 2BQPA 4KG0A 2W0XA 1PM7A 5L7OB 1PIV2 1ENSA 2VNRA 3MIEA 5JOZA 1RVF3 1TMF2 1VBC1 3MIDA 4AQTA 1V9U3 2PHDA 2OA2A 5H9QA 1RUH2 2WFF2 3ZN5A 4BMEA 3TBDA 2D3RA 1CVNA 3M3EA 3VBUB 5AFEA 3VBSB 2DVGA 1SCSA 5FQ0A 4AI1A 1LULA 5JWPA 2RR11 3SXWA 1NCRC 2HWE3 1ULFA 1SMVA 3RJRA 3KD4A 2R16A 1OQ1A 2ENRA 4LULA 3VBHC 4E4DX 1LU1A 3OY8B 1RB8G 1AL21 2P37A 4FAHA 1NXMA 1ASJ1 4FQ4A 2BVVA 5KXDA 1D4VB 1B35C 1XYNA 2XVKA 3ZFFC 1YI9A 1FOD3 2YZ4A 5DZFA 5BYNA 1QH6A 1HXS3 1H8VA 1ULCA 3V64A 1RUF2 1GKBA 2VG9A 5JI7A 4FOQA 2PLV1 1QXJA 4HLTA 4JV4A 4UW6A 1CONA 1SBFA 4ISRA 5ACA1 1CN1A 1U5XA 5GZFA 3AJZA 1S0BA 1D4M2 1DQ6A 4R9DA 2A3XA 2BFUS 4CRQA 4IEWA 5A3MA 4LT5A 4JGYB 1LOGA 1N1TA 2XPJA 1RVF2 3B93A 1NCQA 2Q1ZB 3JB8A 1V9U2 3IN9A 3GHMA 4DZGA 3D4KA 1DBNA 1W6PA 1UW8A 2WC2A 4AI0A 1PGW1 3AYDA 5JOWA 4BOWA 4BA6A 1DZRA 3R05A 2HWE2 1RIRA 2AZ5A 5KHGA 3N7JA 4AHXA 3E5XA 1AXZA 4FP3A 1R091 1LR5A 2AGSA 4FOYA 5JSPA 1UN1A 3USUB 2YXSA 4PDWB 1O3RA 5B2GB 1HKDA 5C8WA 1Q8SA 1FOD2 2X5IB 1ND2A 4DXZA 3WD5A 3I59A 1H8TB 1HXS2 3OBRA 4Y20A 2GSYA 4JGZB 1LKNA 4G9SB 5JCTA 2XL9A 3BOWA 3VLBB 3EBRA 1JXNA 4XMIA 4YARA 5DUUA 1YO8A 2DVBA 3HN1A 1YJKA 4FO9A 4XFFA 1YUDA 3FFZA 1OA3A 2WT1A 1T6GC 3KCCA 2GH2A 4P9GA 2XBO3 1NLRA 2E9QA 1I5ZA 3G6JB 4YGDA 2UYAA 3R0RA 2DVFA 3A4UA 3WR0A 3FUOA 3KS7A 1RUE3 3GBFA 3BU7A 2WLPA 4LUMA 3HT2A 1ZM1A 4HPKB 1RUG1 3VHPA 5I0RA 1LHVA 1FT9A 3LKJA 4LLOA 2OUHA 2X8KA 1W6QA 4AYUA 4XILA 2ZGMA 1C3HA 3VBOC 1Q8OA 1PZ8A 1WCSA 5JLVA 5JVVA 1D0GA 3K51A 1C8M1 1RMU3 1BEV1 4ORFA 3H7JA 1GLHA 4AHYA 4CP1A 2TNFA 4MSVA 2IC1A 1FMD1 1Y9QA 1Y7BA 1G9FA 3JD71 1V6NA 4D94A 2FHRA 2ZGOA 4GH4B 1GSLA 3U10A 1LHUA 1QXRA 4FSJA 4F8AA 1DQ2A 1MS3A 4YG0A 1BBT1 1ZRRA 2XKOA 4AFAA 4AHWA 4IL7A 3FX3A 1UZYA 4Y24A 3H1WA 4HSJA 2JENA 2WIIB 4JTOA 4YVWC 5A33A 3TN93 4XFCA 1JBCA 2XBO2 3TYJA 5CU1A 1OSGA 4PLNA 4FPEA 4I30A 2ZGUA 5J36A 2Q5TA 1RUE2 1R1ZA 3NW4A 1F8VA 4GMP3 3RWNA 4M3CE 4O9GA 3RG0A 5FAXA 2XJVA 4X6QB 3B7MA 3KSCA 4HVRA 4M00A 3TRSB 1DQ0A 3B94A 2XLGA 1HX6A 1PIV1 2PAKA 1MS4A 3TNQA 4BH9A 1TMF1 3JU9A 4JGYA 2ZGRA 1V6OA 2E63A 2EXJA 3S7IA 1WLWA 1AX2A 2RHPA 1RMU2 1RUH1 1X36A 2WFF1 4NR1A 3ZSLA 3U4XA 3ZFGB 3MIGA 4FXKB 2Y26A 3MICA 4HN1A 1ZNPA 3T1LA 2VQ0A 2FMDA 4QX5A 3CJIA 2PA7A 5SV8A 1UPIA 3AP9A 4QPIB 4R8HA 4YW4A 2IFWA 1VBE1 1MR5A 2GNDA 1FYUA 4KGGA 2YHJA 5AFBA 1AUYA 1EV13 2KXLA 2EIGA 3HWJA 1YFYA 3H8UA 4E4SA 2WA3A 2XLAA 1EYBA 2ZTNA 2ZZJA 1MS8A 4PDWA 3POWA 3TN92 4AEDB 4BCUA 4XF1A 4M0NA 3ENRA 1RUF1 1H2NA 3B00A 1H8TA 1QJU1 4UBHA 1KJLA 2RJLA 3KMHA 5CFDB 4F83A 2CAUA 1NA1B 4JGZA 4EROA 1H2MA 3WG4A 2FMYA 3B5LB 3ZSMA 1N3OA 5BPXA 2O1QA 3QCWA 4BQ1A 4XW3A 1BXHA 1D4M1 1UPSA 3QD6A 5GLWA 3SHRA 4I2OA 2VUAA 3IIAA 3M4FA 3N4MA 2QDRA 3I7DA 4UXAA 4XF0A 1JH5A 3S30A 5GZGA 3GYDA 2PQQA 1RVF1 2GDFA 2ILMA 2P3IA 4EN0A 1ND3C 1OA2A 1V9U1 5FOBB 1RHI3 2ZHLA 2XJUA 3N35A 4N43C 4YFWA 3CL1A 4LR4A 3PMEA 4FQZA 4HPKA 4YVSA 4XQ4A 2HWE1 2WNEA 4Z82A 5J48A 3V0BA 5L7OC 4LBJA 4IV1B 1GV9A 3WW3A 4YRDA 3AP7A 3J4UH 4MXWB 4K20A 4Q8KA 4OHYA 5JMCA