3S7IA

Crystal structure of ara h 1
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
416
structure length
369
Chain Sequence
RNNPFYFPSRRFSTRYGNQNGRIRVLQRFDQRSRQFQNLQNHRIVQIEAKPNTLVLPKHADADNILVIQQGQATVTVANGNNRKSFNLDEGHALRIPSGFISYILNRHDNQNLRVAKISMPVNTPGQFEDFFPASSRDQSSYLQGFSRNTLEAAFNAEFNEIRRVLLEENNEGVIVKVSKEHVEELTKHAKSEGDITNPINLREGEPDLSNNFGKLFEVKPDKKNPQLQDLDMMLTCVEIKEGALMLPHFNSKAMVIVVVNKGTGNLELVAVRKESNREVRRYTARLKEGDVFIMPAAHPVAINASSELHLLGFGINAENNHRIFLAGDKDNVIDQIEKQAKDLAFPGSGEQVEKLIKNQKESHFVSAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Allergen Ara h 1, clone P41B
publication title Structural and Immunologic Characterization of Ara h 1, a Major Peanut Allergen.
pubmed doi rcsb
source organism Arachis hypogaea
molecule tags Allergen
total genus 98
structure length 369
sequence length 416
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00190 Cupin_1 Cupin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3s7iA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3s7iA01
4LEJA 5I0SA 1CAUA 4JTNA 3KCCA 4PJYA 1QWRA 4XF3A 4E2SA 3RZZA 3IWZA 3ES4A 4RD7A 4IEWA 4ONUA 1O5LA 1LKNA 3DKWA 3BB6A 4BH9A 1DGWA 4PIYA 1DZTA 4OLLA 2EAAA 2WFPA 4LA2A 3ACLA 2CAVA 4YSFA 5I0RA 2ET7A 2PAEA 5BXXA 4HN1A 3SCHA 5LEJA 4D7SA 3LZZA 2H0VA 2ZCWA 4BIFA 1YFXA 1LB2A 5KHGA 2PHDA 3WW2A 2IXKA 5F1RA 5BUVA 4CYDA 1X8MA 4UXAA 3NKTA 4XF1A 3M70A 1H1MA 3VHRA 2XHKA 4BYYA 4E2GA 2PAMA 3TNPB 3EO6A 4XFFA 2Q1ZB 2XLAA 4IEVA 3PLQA 4HN0A 3SHRA 1XE7A 1OFNA 1CAVB 4I0AA 3IIAA 4QMAA 5FCCA 5HI0A 2MPFA 2EA7A 2OYZA 4J1WA 1UIKA 4QXKA 3USSA 2OZ6A 3WW4A 3IDCB 5FLIA 4QGNA 2QVSB 5LRRA 4AQ6A 3ST7A 2B9UA 2XL9A 2F4PA 2CV6A 3H3ZA 5JAXA 5KBFA 1RUOA 1RUNA 2IXIA 4D7TA 5I8YA 3NW4A 1YFYA 2CAUA 3QACA 4YNIA 3ES1A 1ZZ7A 4FT8A 1TQ5A 4LUKA 1Q5OA 3H1WA 3NVCA 4XF0A 2D5FA 4HZFA 3MPBA 1YFWA 2H6CA 2V09A 2UY8A 4TLFA 1ZZ8A 2VQAA 3SMHA 3D0SA 4WBBA 5CVRA 3PNAA 5D1IA 1Y9QA 1UCXA 1O3SA 2GZWA 4I2OA 4Q0SA 4EWAA 1VP6A 4Q0VA 4ZU4A 2IXJA 3H9AA 4KU7A 3DN7A 1ZRCA 1OMIA 1X82A 3H7YA 2UYBA 5I93A 3UKTA 5EZWA 2IXLA 4IETA 4WZCA 5KHHA 5FLJA 5JSPA 3ELNA 1J3RA 1RTVA 1DZRA 3GYDA 5EFUA 1H1IA 1QXJA 3EQEA 2D93A 2OZJA 1X8EA 1YLLA 3SCGA 1QXRA 4MGKE 3TNQA 1PM7A 3L2HA 3NL1A 1ZZCA 4MGZE 4BHPA 2PA7A 1Q3EA 3I59B 1ZZ9A 2OA2A 2Z2SB 3RNSA 5FQ0B 4IEZA 3FWEA 3H3UA 3E5QA 1FI2A 4X6RB 4UBGA 3C3VA 4IEYA 2BNOA 3GBFA 4FBFA 2Q30A 5LEKA 2FQPA 4XFAA 4Z07A 4F7ZA 4L11A 4P9GA 4IEPA 4UBHA 1VR3A 1QY4A 3OCPA 5I91A 4XF9A 1CX4A 4XFIA 2N7GA 5C6CA 1U12A 4FAGA 1ZRDA 1EYBA 3MZHA 1ZZBA 1CAWB 4AQ2A 1J3PA 5K8SA 4MV2A 4YYOA 3DV8A 4KWLA 4MGIE 2GC0A 3M3IA 3KMHA 5CADA 4KU8A 2GU9A 2BGCA 5FPZA 4EV0A 4MH0E 4AXOA 1L3JA 4QGLA 2VPVA 4QGMA 3IBMA 3H7JA 1SFNA 4HSLA 3CF6E 4EWEA 2ATFA 1O3QA 2OPKA 5FDBA 2K0GA 5J48A 4I02A 3E6CC 4B29A 4IEOA 3BPZA 5BV6A 1DGRA 3EHKA 1ZREA 4Q0QA 1NZCA 4Z82A 3U0ZA 2QJVA 1O3RA 5J7MA 3CLPA 3E5XA 2BEOA 1CAXB 4I09A 4AVBA 1UIJA 5I8TA 3CJXA 5JCTA 1O3TA 2HKXA 4K8FA 1CAUB 4EROA 4XFHA 3E6DA 4JTOA 4YRDA 3I7DA 1IPJA 1LR5A 5CU1A 2P17A 1YHFA 4MZUA 1WGPA 4IEXA 3KGZA 3RYRA 1VJ2A 2PFWA 3R6SA 3O14A 4WVZA 5KHKA 4FAHA 1NE6A 4Q0PA 2HJIA 3DL3A 3E97A 4QM8A 4IEUA 2FMYA 1EY2A 1EP0A 4N9IA 1NYWA 5KHIA 2Q4SA 2H6BA 2D40A 4XF4A 3H8UA 2XLGA 2C0ZA 4ZU7A 2PTMA 4I0BA 3RYPA 1I5ZA 1J58A 3D82A 3BU7A 1GQHA 1G6NA 1XE8A 2WC2A 1OD5A 3RPQA 3D0JA 1SQ4A 3ETQA 3N4MA 2EVXA 2QDRA 1ZRFA 4Q29A 1WA4A 3E6BA 3I54A 2MHFA 2XLFA 1FXZA 3FJSA 3CEWA 1UD1A 4LLOA 4MGYE 1OI6A 4KL1A 3HIFA 2VECA 2UYAA 3S0MA 4HVOA 1O5UA 5KHJA 3FE5A 4O9GA 2IXCA 3LWCA 3BCWA 1GQGA 3MYXA 1J3QA 5AVPA 2D5HA 3RYKA 3E5UA 3CO2A 3WW1A 2PQQA 3S7EA 4HLTA 3OD0A 4KWJA 4AVAA 4AVCA 1CAVA 4LUMA 2Q0AA 4OFGA 3ROUA 4HSJA 2GC3A 4QX5A 4NVPA 5I0TA 2ET1A 4LULA 3LOIA 4R8HA 5C8WA 5E1RA 4A2UA 4GULA 3WW3A 1V70A 1YWKA 1YFUA 3ZDSA 5FPXA 1O7FA 1IPKA 4HVQA 3FZ3A 3U11A 4XEZA 4IEQA 1NXMA 2O8QA 2ZKLA 3HT2A 4F8AA 1YUDA 4ORFA 4KWKA 3NJZA 1ZVFA 1SEFA 1UPIA 3NSTA 1RL3A 3KGLA 3HQXA 5BPXA 2ETEA 3LA7A 2IXHA 4HBNA 2Z69A 4Q0UA 4X6QB 2GAUA 3JZVA 2B5HA 3IDBB 3SCFA 4HMZA 2PYTA 3B02A 3EBRA 2KXLA 3OTFA 2PHLA 5FLHA 3OF1A 1UW8A 4MX3A 4XFCA 1JUHA 1ZNPA 3LA3A 2DCTA 3H1MA 1NE4A 2I45A 4I3PA 3HT1A 4JV4A 3SXWA 3FX3A 2BNNA 3PVBB 2CGPA 5BY5A 5I0UA 3CL1A 1RC6A 3KSCA 4IERA 4META 2UY9A 1RGSA 1ZRRA 2XKPA 4YARA 3UKNA 3EJKA 3UKVA 3I59A 4QM9A 3FFQA 1WLTA 3OGJA 5FQ0A 3LAGA 3FHIB 2BYVE 1CGPA 1Q43A 3H50A 4XFBA 3G7DA 2QNKA 1X7NA 1FT9A 4XETA 2K9ZA 3QOPA 4I01A 5J3UA 2IC1A 2MNGA 3LA2A 1J1LA 2Y0OA 5E16A 3BALA 5I8SA 1CAWA 2XL7A 4XFGA 5LRSA 4EWDA 4IESA 5JR7B 2QCSB 5T3NA 2GC1A 1XRUA 3S7IA 4R52A 3U10A 4N9HA 2E9QA 1HW5A 2BNMA 4LA3A 4E2QA 4HVRA 4DINB 5JSOA 1O4TA 1I6XA 1LRHA 4MUVA 4L2NA 4ZU5A 1J59A 2GC2A 2O1QA 1PMIA 1EPZA 3H1YA 4H7LA 4PIXA 1ZZ6A 1Y3TA 4O9EA 2B8MA 5JSRA 3MDPA 2GH2A 3RDIA 4LTAA 4PIZA 1CAXA 2PAKA 1ZX5A 4J1XA 2XKOA 4JVAA 2XGXA
chains in the Genus database with same CATH superfamily
4XUQA 4PI0A 1R082 2VTXA 2ZX1A 3TBDA 3ILRA 5C3SA 2C26A 4PJYA 5IK8A 4YM1A 1EUTA 2HWD1 3POSA 3WNKA 1W6OB 2KD7A 3KWVA 4XVHA 3IWZA 3ES4A 4CA9A 2WL1A 3INAA 4IEWA 2OT7A 1GZ9A 4JC1A 4OVEA 4CEYA 1Z0HA 4Z1VA 4UFMA 5CIRA 1U5ZA 3GF6A 3VLBB 3M1HA 4PIYA 1L7LA 1TMF3 2R0FA 1AX1A 2BGOA 2AYHA 4BDVB 3NRUA 4RFT0 4OLLA 2FBEA 2VJXA 3TEWA 2HEVF 1ULGA 4A42A 2XBO1 4JKKA 4AHYA 3ACLA 1CVNA 1GZCA 4OMCA 5I0RA 1NCQA 1RUG1 4S2DA 4XJ9A 2VZOA 4CDWC 3RI9A 3V0BB 2CY6A 2HWD2 2HWF1 3VBFB 3BGAA 3ZYRA 1APNA 3POGA 3GNEA 1W03A 3DEMA 2H0VA 3B9CA 1ZA7A 5KHGA 1UNBA 2P3IA 5A3NA 4ARYA 2QQPA 2BPA2 1BVP1 4NE9A 4CYDA 5C5TA 4Q4W2 5EJ3A 3NAPA 2R6QA 4UXAA 5C70A 4XF1A 3OD4A 5A33A 3N35A 2YHJA 4K1YA 1OQDA 1CPMA 2PAMA 4QQOA 3EO6A 2Q1ZB 1W6MB 1G86A 3HNBM 4IEVA 1V9U1 3U37A 3RWKX 2W95A 1JZ6A 1S2BA 2QQLA 5GKAC 5A3TA 5FREA 4UW6A 1IHMA 3AP9A 3RZGA 3PDQA 1A8DA 2OZ6A 2OUJA 2YY1A 3GXUA 1CZVA 2VAUA 4QHZA 3VL8A 5G04L 1HRV2 4Z2AA 1QDCA 5DZFA 2E33A 4MXWB 5C9AC 1C8M2 3ST7A 2VMIA 4BMEA 1UY2A 3SQOA 3WCSA 2F4PA 4DUVA 1D4M1 1W2NA 3VZMA 1RUNA 2IXIA 2JDZA 2QQNA 4WM8B 5T52A 1JYVA 3O1VA 4B4PA 4D7TA 5LY1A 3NW4A 2J22A 1JYCA 1ACCA 1V9U2 5A7OA 4JGZB 3BN6A 1JOJA 1W05A 4FT8A 2G19A 5DUWA 3JBG3 3ZYHA 4AFAA 3C7GA 1Y4WA 1DU3D 1VB2A 2D5FA 4DS0A 2V72A 1SLBA 3PVNA 4XJZA 3WNMA 4MO3M 4BQ2A 1GLHA 1XQNA 3SMHA 3B00A 3D0SA 1W6QB 1GQPA 1UY0A 3AFGA 3CNAA 1AR93 5H9QA 1MQTA 4Y20B 1IOAA 1O3SA 2GNDA 2GZWA 3RG0A 4I2OA 2IZWA 4Q0SA 4WZFA 4CDQC 2JKXA 3M2MA 1BBT1 2R061 4ISQA 4XXPA 1L7RA 3NV3A 5DZGA 1IGOA 2PLV3 3OPWA 4ZU4A 2IXJA 2JENA 1HX6A 4YVWB 1RUJ3 1AX2A 1F4AA 4KU7A 1DYPA 3V0AA 4DY3A 1ZRCA 3AP6A 3VBUA 1H9WA 1ODNA 3H7YA 2SLIA 4LBJA 3TOJA 3WP6A 5FMDA 1BZWA 1YQ8A 2KR2A 3UJOA 1EAH1 4IETA 4WZCA 5T54A 4AI9A 4U2AA 3ELNA 1V6LA 5FRAA 1GBGA 1J3RA 3WUCA 1RTVA 1DZRA 1S1AA 2VUCA 1GKBA 4Y26A 5EFUA 4DXZA 4DO0A 1NLSA 5FZBA 2JECA 1TE1B 1K5MC 5E89A 5IWFA 3LIGA 4FPEA 1YLLA 2ZS6B 5EYXA 5IVBA 1BBT2 2R062 2VULA 3FLTA 1QNYA 3HEIA 5FV3A 3L2HA 4BHPA 4A45A 4IV3C 1ZBE1 3KCXA 1BVVA 2ARXA 1GFF2 3WX5A 2Z2SB 4BQWA 1SFYA 2E7TA 5FQ0B 3J8F2 2BFUS 3FWEA 3H3UA 3LDRA 4H3WA 4YPJA 4RS5A 5FK8A 4C8DA 4FPGA 4UF0A 1E57A 2VZSA 3ZYFA 2F4LA 4IEYA 2FCVA 2Q30A 3MFCA 5A7SA 4XFAA 4Z07A 1AYM3 4QHOA 4IEPA 5FMCA 3J7NA 2XJUA 2MEV1 2E32A 4XF9A 1HRI2 4MLOA 1NX9A 4XFIA 5FWEA 2OQ6A 1RYYA 2AZ5A 4FAGA 1QMJA 5C33A 1ZRDA 1ZBE2 1NZIA 3MZHA 4Y1YA 3VV1A 4A44A 1YRZA 4YYOA 5I0DA 1SCRA 4LO8A 4X8PA 4YZ4A 2J42A 3JQXA 1S0JA 3AMQA 3B5LB 4MGIE 3F2ZA 5ACA2 1VRH1 2GC0A 3JB4C 3POYA 3WZ1A 1N3PA 3VDDC 2GU9A 5FPZA 4Y5TA 5HCAA 3SITA 1LOFA 2BDRA 2VZVA 3PTYA 4MH0E 1OF4A 2D43A 2FDGA 3WLUA 4QGMA 1UZZA 2F6BA 4LBMA 1PMHX 3H7JA 4JDMA 5J98B 1SFNA 1AR71 4YZ5A 2MEV2 5IVYA 2WWJA 4IUGA 3S5QA 2ATFA 3ZKUA 4NPRA 2OPKA 3NO8A 2CDOA 5J48A 4FCAA 1HKDA 4B29A 1POV3 3BPZA 4COZA 5D8AA 1RUH1 2R071 3BKZA 4JKLA 1NKGA 1IS3A 4NIIA 5FYUA 3OBAA 1QH7A 5ERLA 3KS7A 5FZ0A 2E7AA 1CAXB 3VDAA 1LHOA 3ECQA 4IE0A 3WDWA 1LHNA 1SFPA 4XAEA 3P3PA 3WF4A 4K8FA 4Q5OA 1KRIA 2J1AA 4COYA 1H2LA 5AFBA 2ID4A 4TLGA 3RZJA 5A80A 4M3CB 3DYMA 4XFHA 2XVKA 3I7DA 4LHNA 3O1SA 5CFCA 1UOGA 1CIYA 3R4SA 1G8WA 5J36A 1D4VB 4XAAA 2TUNA 4L97A 2BERA 4GQ7A 3R05A 2ZGNA 1RUH2 4IEXA 3I49A 3IDAA 1V6JA 4QDRA 1K42A 2QBXA 1NQJA 4IDZA 3WG2A 2R30A 2NQYA 1DLCA 4JDOA 1JW6A 3R4DB 4R4XA 1ENSA 4AFDA 4FAHA 1NE6A 4Q0PA 3M3EA 5DQ0A 2FDKA 1WLCA 2XWBB 3MUZ1 2DF7A 2DVFA 3E97A 2X53S 2FMYA 1W2TA 4V2VA 4ASKA 3NWKA 5ABJA 4D8MA 2AUYA 3AMNA 4LIVA 5FMBA 3GGLA 1NYWA 3HJRA 2IVJA 2P37A 5FY7A 4Y3OA 1PGW1 2VVFA 4QX1A 1RUF2 5J37A 3SLIA 4AL9A 3PL0A 3B7MA 2OUHA 4I0BA 1I5ZA 2VOWA 3RYPA 2YROA 5LWBA 3LDKA 2RJLA 2B7YA 1GOFA 2RJKA 5F39A 1EV13 3M7AA 1W8HA 1OD5A 1NCQC 4LBKA 5DN2A 4MGTA 2BJSA 1KXGA 3T0DA 4C91A 3ETQA 4TSVA 1R091 4MG2A 2R16A 2RG4A 1GP4A 1WMXA 2X8KA 1TZOA 1ND3B 2JDAA 2JKBA 1WA4A 3PIGA 2Y6LA 3I2GA 4DIQA 1JH5A 2XLFA 4LLFA 1XYOA 3DKQA 2PHUA 2VO5A 2JG8A 3JD71 1TMF2 1UD1A 2P1BA 2WKKA 3LPFA 3S0MA 4LT5A 4HVOA 3X29B 1URXA 3ZSEA 5FPLA 1PNGA 1IS6A 1PK6C 1GP5A 4O9GA 5BNPA 3ORJA 3WDTA 2RS31 3IIIA 1KITA 5L36A 4CCMA 1DGRN 4LO6B 5BNNC 2OW4A 1OUXA 2HWE3 4AQSA 1LOAA 4D0QA 5AVPA 2FHRA 3AXDA 3FFZA 2ARCA 4JX0A 5C4WC 3OEAA 5C71A 3LKJA 5CG8A 3IAPA 3POBA 5IATA 4AG4A 5JZGC 1H8TC 1AXKA 3C7HA 3AC0A 4AVCA 3UK9A 4B1MA 1UZ0A 2Q0AA 2JE8A 4XABA 4BQXA 2WJSA 3ON7A 4E9KA 1HB4A 2ZEYA 3AZWA 1KQRA 1W8WA 2Z4FA 4QX5A 4NVPA 5FKBA 1UU4A 5I0TA 4XIOA 5HV4A 4HPKB 3S6PA 4NPLA 2NN8A 3WDVA 1J84A 1W8UA 4PDWA 1RUD1 3VBHA 4XCBA 1BKZA 1REDA 4GULA 5FMOL 4A2UA 1BQPA 4A6SA 2WZEA 2W0XA 4GWMA 1W3VA 4CDWB 1LEDA 4MSVA 1BHGA 1YFUA 3WDYA 5IVVA 1RUI3 5DXDA 1OPMA 2VUAA 2D3SA 3ZX7A 4DNYA 4HVQA 2PN5A 4FPOB 4QQHA 3U11A 2A1XA 2WWSA 4UYBA 4IEQA 5T50A 1HQWA 4V2WA 2V73A 5B4XA 2XVGA 4F8AA 1S2EA 2YUEA 3W9AA 1XU1A 1O59A 4YG6A 4ASLA 2DVAA 2W5FA 5FP4A 1NLQA 1WKYA 5C3OA 1NY71 2NYYA 4ISRA 2DYCA 3JBG2 2EIDA 2GN3A 1AXZA 2E26A 2ZMNA 2ETEA 4LK6A 3UGGA 3PUHA 5FK7A 3WNOA 2IXHA 4LE4A 3AMMA 3KV6A 4HBNA 3RJRA 2VXJA 2B46X 1JYNA 2ORZA 1F15A 4Q0UA 4KNCA 2HYXA 1LAJA 1AR92 1VLNA 2YU1A 3JZVA 3IPVA 3UETA 4CCDA 4HMZA 2VH9A 2W2IA 3B02A 1AR81 4FI9A 3AL5A 5FO7B 1CWPA 5T5PA 2WAAA 1AL23 1QIQA 1LULA 3OF1A 4P9WA 3RZKA 2WQZC 4MX3A 5L9RA 4ZPIA 3M3OA 3I2HA 1GICA 1RUJ2 4Q4X1 3J4UH 2TEPA 3LSDA 4I3PA 2ES3A 2E31A 4JV4A 4N43C 1GWMA 4XMAA 1UOBA 1C5HA 1I5PA 1YO8A 2RR11 5BY5A 3NKGA 3FMGA 2CGPA 1WUVA 3AP7A 5I0UA 3VD5A 3VDBA 2R32A 3GZEA 4IERA 4XDPA 2HWD3 1XNKA 3HNYM 4QKFA 1K5JA 4ET7A 4JAAA 4Z2WA 4S2HA 1GNZA 3UKNA 1ASJ1 3ZKYA 3EJKA 4K40A 1G9DA 4QXHA 4OHZA 5FZ8A 4GWJA 3ZSJA 1AR82 2ZGKA 1MEC1 1MPXA 2ZEWA 1BCXA 1DYOA 3LAGA 2J1TA 1RVF3 4K8RB 3ZN4A 4CDQB 4Z8BA 1CGPA 1W2OA 2Y60A 3CBNA 2YC0A 1Q43A 1V6OA 1X36A 2L9LA 2YZ4A 4YM3A 4CEWA 2XBO3 5FY9A 2RR12 1X7NA 5F3GA 2WYSA 2VNGA 5FZMA 1BJQA 5T5OA 2AH2A 2CWMA 1RUG3 3P5BA 3V65A 4RGAA 2HWF3 4BOWA 3I2OA 3LA2A 1AYM2 3EB7A 4R9DA 3M3CA 2P34A 5CAZA 5I8SA 1IKPA 5L73A 2XL7A 1MEC2 1G9FA 2QQVA 5H9PA 2X10A 1K5MB 2PHTA 3ZYJB 3TWIA 5FZFA 5FZHA 1K45A 2WUHA 2VCBA 4N53A 1SPPB 5JR7B 1XNBA 1RB8G 1PM4A 1VMJA 1J1TA 2C9AA 2NMOA 4AVSA 3NNFA 4IV3B 3DECA 1HN0A 2P6HA 2CTVA 4M3CE 2GC1A 1UN1A 1J83A 5CKQA 1V9U3 5EQUA 3MIHA 3LFMA 2WDBA 3POJA 3U10A 3I2DA 1H2MA 4G4FA 5GZDA 3DYPA 2E9QA 4L0PA 3JCIA 4E2QA 1JZ2A 1B35A 2ENRA 2WR9A 1JUIA 3PUSA 4HVRA 1OH3A 4JHTA 3BPSA 2EXKA 5A7NA 3I8TA 4AFCA 3R0RA 4TTGA 1S55A 3KF3A 3MW2A 4DOUA 5FZEA 4FPYA 2C6SA 1PMIA 3H1YA 4XBQA 1NA1B 4K21A 3KT7A 4PIXA 1Y3TA 4O9EA 1D4M3 4ZXKA 1Q8VA 1WMDA 2B8MA 3LB9A 1W9YA 2Y33A 3MDPA 2JE7A 4JDNA 4NUBA 2D97A 4LTAA 1UZWA 5F32A 5FXVA 4FPLA 4YZ1A 2WNUA 3OUHA 4G3YC 1Q8SA 2V4VA 4FTSA 2ZEXA 3HAGA 4QKNA 2W1WA 5A32B 1SHWB 3GHMA 4LEJA 5FR3A 1W6PB 1V6KA 1FNYA 3LEKA 4JTNA 4XZUG 4F83A 2ZHKA 5DUUA 3ZSMA 1QWRA 3K4DA 4JQTA 3GCXA 3VDDB 1WCUA 3THCA 2BGPA 4YZ2A 1CESA 4RD7A 4CE8A 1LECA 2HWB1 1PZ8A 2VE1A 4P08A 1SACA 1DGWA 3WSOA 1QJFA 1MS5A 5FYBA 3WQ0A 1HV0A 1OA2A 1QXPA 3N9NA 1UMHA 2YBPA 3Q9OA 1IQDC 4LORA 5K0UA 1DZTA 2P4EA 2VQTA 4HONA 2WZ8A 4QX7A 3GZUC 1DHKB 3MV11 4HT1T 2YFUA 1W99A 1LGCA 1XPWA 1IS4A 2XONA 3PIJA 4YSFA 4YG0A 2PAEA 3OB8A 4GD4A 2D44A 5BXXA 1EAH3 4A7YA 4KGQA 2DBNA 3GBWA 3SCHA 3LGRA 4CCOA 5A70A 3J7LA 2A3XA 3KQRA 1DP0A 4FPCA 3ZMNA 4AW7A 2Z79A 4BIFA 3IMMA 3PHMA 2PHDA 1LB2A 2D6MA 1W8NA 1WZXA 5EJZB 1X8MA 4XZPA 5FZ9A 1NCRA 1UMZA 3PJYA 3PMEA 3DPRA 2ARAA 3RSJA 3RJ2X 1JS9A 3MGUA 4LO5B 2Q8DA 4LQRA 2WAOA 1ZBE3 2XLAA 4AEMA 3PLQA 4Q8KA 1RMU1 4HN0A 5C8CB 1PHMA 3ZXDA 1XE7A 2WWUA 3SISA 3DYOA 3IIAA 4CU7A 4CUCA 2JD9A 2A6XA 2RM21 4LOTA 2Q8CA 1VPHA 2XQRA 3D5OA 5A3MA 2OYZA 1OQEA 2ZZQA 4QXKA 3USSA 1EV12 4QB2A 3I3MA 4GA9A 4NRMA 5LA1A 1US2A 1VBE1 3VBRA 4E4HA 3WW4A 3IDCB 1IPSA 4B4QA 2QVSB 1CJDA 1E5SA 2J1RA 2UWCA 4FQ4A 1QEXA 3WQBA 2RDQA 2B9UA 2CNAA 1HJGA 2XL9A 2MEV3 2VTFA 5JUVA 2CV6A 4LR4A 5JAXA 1RUOA 1COV1 1K12A 4C1XA 2W52A 2JDKA 2QTWB 3WVJA 1GNYA 4BK5A 3T0BA 5DDJ1 1CZTA 4YNIA 3ES1A 4BU2A 4JGYC 1LGBA 1Q8QA 3N7JA 2JX9A 1UL9A 4UOJA 2HWE2 3NVCA 4GJZA 1H6XA 1VRH3 2A6ZA 2WNVA 1YFWA 3MPBA 2DCKA 4PBOA 4NPMA 1C3HA 4Y1XA 4TLFA 2FDIA 1O8SA 4FXGB 3ZIXA 3GDBA 2HBTA 5FYMA 1RUI1 1NCQB 1MZ5A 1QOSA 3FN9A 3VUOA 1C57A 2JIJA 1Y9QA 4Y1UA 3BIEA 1AR73 5JXIA 4YW3A 2ZGLA 5FIXA 4UW5A 3A22A 3ZFFC 2WN2A 2XDVA 4RGKA 4H14A 4PHZA 4YGBA 3U4XA 1COV2 4CCNA 3URFA 3KM5A 5F3IA 5KXDA 1JBCA 1W0OA 1YCIA 2EALA 4FO9A 4LHKA 3H9AA 4Q0VA 1OFSA 4B3NA 1OC1A 3DN7A 4NRQA 5A6ZA 1O91A 1OMIA 3I2KA 4QX3A 4DY5A 2UYBA 2AACA 5EZWA 1RUH3 2JICA 2R073 1PK6B 4FPKA 5IVFA 5FLJA 5BNNB 3C7EA 1LGNA 2ZBJA 1QKQA 2CYFA 4AEDC 1AF9A 2YG0A 1VAVA 5FWJA 2X5IC 1RUI2 1H1IA 1LOGA 1G9AA 3W5MA 3EQEA 4E8CA 5C4WB 1NQDA 4ZONA 4CP2A 2QDNA 2D93A 1X8EA 4GIQA 2OVUA 4UFKA 5LK7B 4HK9A 5JZGB 1KS4A 4MGKE 5L9VA 4GALA 1H8TB 2P2KA 4PLMA 2J1VA 1ZZCA 3NL1A 4UI9L 5HCBA 4AF9A 1JYIA 2E53A 3I59B 3JQWA 1ZZ9A 4P9YA 5H9RA 3U07A 2VMCA 1ZBA1 3RNSA 4IEZA 4BQ4A 3LEIA 2QZ3A 1IS5A 1T6GC 2AEYA 2P3YA 4QB6A 3WD5A 2WS91 5A6QA 4FBFA 4R9AA 4TXWA 5ACA3 4M01A 1W9WA 4RSUA 1WLDA 1OHFA 5KC5A 5A7PA 3M8LA 4F7ZA 1NXD1 2XOMA 2QQMA 2RS11 1AVBA 1VR3A 4UBHA 1UX7A 2AREA 4D6SA 1PVXA 1BEV1 1POQA 1VAMA 1AL22 2VZUA 3VBOC 1QJY1 1OOPA 1X50A 5FY0A 2R041 2N7GA 4IV1A 4LBQA 4TYSA 1RVF1 4LBNA 5F6KA 4QQPA 1XC6A 3CZUA 4RL7A 4MVTA 1NUKA 3TB0A 4C90A 5LW9A 1J3PA 1XBFA 5K8SA 4A41A 1OUSA 1HIXA 4KWLA 2YC2A 3WCRA 4PCRA 1US3A 2KM2A 1JYXA 3WF2A 2VZRA 1OBNA 3NV1A 3KMHA 5CADA 5A7WA 4KU8A 4GH4A 1OPOA 1GZWB 4EV0A 4J25A 1R1A1 3KF5A 4QGLA 5GALA 4MHUA 2VPVA 4XDOA 1Z78A 4B7KA 3VD9A 5F8PA 4Q1RA 1R093 4NMIA 3C7FA 4AEKA 2JWPA 2RV9A 4GWIA 3VBSA 4EWEA 1H2NA 3VZKA 5FDBA 1RVF2 1F31A 2G9GA 3NNMA 2K0GA 4E4SA 3JD73 3CZJA 5FZOB 2W94A 3E6CC 1GUIA 4FTBA 1REFA 2WFF1 1UQXA 4QPIC 4UFHA 4AI1A 5JI9A 1ZREA 5ANQA 4RQPA 5E6HA 2XBO2 1AR61 5CYYA 1UY3A 4RN5A 4N43B 2RS33 4RR3A 3WF1A 1SLCA 2QJVA 1RUG2 2BVVA 4QPGA 2UWBA 5J7MA 1C5IA 4XJWA 2HWF2 3E5XA 1P8JA 1DQ2A 4AVBA 2EF6A 3OJBA 2FD8A 4ZY9A 5JCTA 3WXPA 4D6RA 1CAUB 3ZYGA 4EROA 5L7OC 2JG9C 1UXXX 4QQ2A 4HFSA 3E6DA 3AVRA 3SEPA 2ZHLA 4TN7A 1IPJA 3KB5A 2EXHA 3ACIA 2P17A 4GKXA 1H30A 3RWNA 5IFTA 4MZUA 3T1LA 5APAA 3EYPA 1ODMA 2R7EB 1AYN1 3APBA 4YGDA 2VL4A 3T0AA 4DXRA 1RUD3 4PT6A 4FPJA 3IMNA 4CCLA 1E5IA 3D4KA 5ISLA 3MFAA 3R6SA 2Z5WA 2Z42A 4WVZA 2B45X 2V5DA 4CDXA 5BNOA 5HXMA 5FY1A 5A1LA 4W4ZA 4YVSB 5CA6A 5JLVA 4WVWA 2BW8A 5FXZA 1PO23 3IAQA 4J6GA 4M4PA 5DAQA 4K3UA 1D7PM 4N9IA 2XQXA 3ZXEA 4D69A 2ZGQA 1D4M2 5KHIA 2KA3A 4G9SB 5CKNA 4XF4A 2D40A 1YIFA 4L99A 1SLAA 1FPN1 2XJSA 3HOBA 4PF1A 4D6QA 2D98A 2XLGA 1AYN2 1JU3A 1UXZA 1W6OA 4JRLA 4URAA 3H8XA 4ZU7A 4LJHA 2PTMA 4OZXA 4Y4YA 3AP5A 4GAZA 5DAPA 2JB4A 3AX4A 5FOJB 2BV4A 3BU7A 3QH6A 1XNCA 2WC2A 2YB7A 3N9OA 4KBBA 5FZAA 3RPQA 1LODA 2VTXJ 3ZFEC 2RDNA 2EVXA 2W1QA 1UMIA 4FOVA 1E5HA 1JHNA 3K75B 4Q29A 1QNWA 3E6BA 3NJXA 1AR83 3LFIA 1UYPA 4YM2A 2HEWF 1PX3A 4QHBA 2C1FA 1NCRC 1F2NA 5IFPA 4KL1A 3DPRC 3V0BA 2W87A 1V6NA 4Q4X3 1Q56A 5LBBA 3KT1A 4Q4Y1 5DPNA 3VBFA 4OHYA 2JDUA 2RVAA 2YDEA 3BCWA 2VCMA 3MYXA 4K9SA 4P02B 1J3QA 1EAH2 1PIV3 1OSGA 2RR13 3LDBA 4IGQA 2D3RA 3WP3A 4M00A 2VOKA 3E5UA 4H2AA 2O0OA 3QCWA 2BOIA 2K46A 4QWNA 3VGIA 1GWKA 1ASJ3 1W6MA 1PVC3 4PLOA 1ZYBA 1MEC3 4LUMA 1KGYA 1KDMA 4LMFA 4OI0A 2J1EA 4XDQA 3MPPG 4ZXEA 3OPZA 4HSJA 2VXRA 5FZ3A 4Q4Y2 4Y24A 3WDXA 3EMRA 3PTRB 1DZQA 3U78A 5C8WA 3Q8EA 1O4YA 3N9LA 3OGSA 1WD3A 3A0NA 1KD7A 3O12A 4MXWA 5E1RA 5GLTA 2BOJA 3W21A 3AKTA 1JODA 1LESA 4AAPA 2PHFA 4GMP0 1VB4A 1V70A 3N9QA 1YWKA 1HB1A 4DMIA 3ZFGC 5LA0A 1WCDJ 3HBZA 4WM8A 1O7FA 4EN8B 2I74A 1JXNA 3HBKA 5FTTC 4DXTA 1V0AA 4MADA 1G7YA 2WLQA 3P3NA 5F2WA 4JGZA 1NXMA 5FY4A 4I30A 3MIGA 5FZ1A 4MXVA 3ITQA 3KLSA 2FMDA 5DABA 3WOGA 4OULA 4OUMA 1F35A 3TN91 2FZ2A 5FZKA 4AVVA 5ANNA 4AGRA 2OQ7A 1W6QA 3POFA 2VQUA 4CUAA 1RL3A 1GWLA 2RMU1 3HQXA 3KGLA 5BPXA 5JOZA 1YXWA 2A7AA 1VRH2 3OY8B 4Y20A 1SLTA 2GSYA 2P3JA 2X09A 1FV2A 3LA7A 2JIGA 2P5BA 2Z69A 3Q8AA 3U14A 2CHHA 3J26N 2GAUA 5IW0A 4YVWA 2J1UA 2ZMLA 3SCFA 4B1LA 4Q26A 3EBRA 1AR72 2KXLA 2LS6A 2VMGA 5KC6A 5FLHA 2PXJA 1UZYA 4XBLA 1UW8A 3MLKA 1PZ7A 2VW0A 1O8PA 3LA3A 3TN92 4WVVA 2DCTA 2ORXA 4FOWA 5L9BA 3VD7A 3ZXKA 1NE4A 3VKMA 5FFOC 3NJYA 1RUE1 4AE2A 2LRPA 2R072 2BNNA 4XXAA 3KCYA 1W9TA 5FAXA 3PVBB 1RUC1 2DFCA 3OPTA 4JGYB 2DTYA 1PX4A 4CXYA 4CPBD 3S5AA 4META 1YYNA 1W8TA 4YARA 5FJHA 5SV5A 5CFDB 5IT6A 5GJ6A 3T2QA 2Y26A 2HWB3 2ZX0A 1LHVA 1GR3A 3POIA 1MS9A 2JDHA 4AI3A 2ZGRA 2QUOA 4BXFA 5FQ0A 5JWPA 4HL0A 3ZYBA 1MZEA 5G05L 4UW4A 3ZFFB 1NLRA 4CEYC 1QJX1 5FY5A 5J96B 1OOPC 5B2GB 3BTZA 1OA3A 4XFBA 4CTEA 2QZ2A 3G7DA 2WZR3 2QNKA 5FZ7A 3NV4A 2K9ZA 3GBGA 2GALA 4FFFA 3QOPA 4FXKB 2DVGA 4A3ZA 3MHZA 1DQ1A 1WW5A 4N7IA 1YJKA 4W50A 5LASA 1XXNA 3DXUA 5F37A 3POEA 4AEDB 1GANA 2A6YA 1BLZA 3GZTB 4V1PA 2X5IB 5FPUA 4GH4C 3POWA 3ZN5A 4OUSA 5LBEA 3PU3A 3JXSA 5LRSA 3BU0A 4DZGA 3BTAA 5JPMB 4NHXA 4GZ9A 2IUWA 2DVBA 2BRTA 2W92A 3NAPC 1PGW2 2QCSB 1QOOA 3OOXA 2YFZA 5T3NA 5FY8A 1XRUA 3ZR5A 4EN0A 1RMU3 4EYUA 2VC9A 2ZX4A 4SLIA 1I3HA 4BQ1A 2QE3A 2RM23 3THPA 3VZLA 4AR2A 1MS0A 4RQPC 2VW2A 1HW5A 1X9TA 2BNMA 2Y6FA 4LA3A 4RR3C 1ST8A 1VBE3 4QPGC 4AHZA 4DINB 2FCUA 2DURA 1R092 1O4TA 1WMFA 3N3HA 2WSUA 4ZU5A 4W8JA 5LBFA 3CHXA 4E4ZA 2WO7A 1NOVA 4NAOA 2O1QA 4HKOA 1EPZA 3J7MA 4MGSA 1VRBA 4Y5Z0 5H9SA 3GM8A 3N7MA 3SKJE 3VBOB 3JD72 3LEMA 5EP9A 1COV3 5FPVA 3S57A 4N90A 4BIOA 3H8OA 3T3YA 1CAXA 1ZX5A 5DDJ3 2XKOA 5BV6A 3VKLA 1IZ3A 2RS32 5IK4A 5I0SA 4GB31 3IN9A 1VIWB 3KCCA 2A3WA 1H8VA 5HPOA 2ZABA 4LBLA 3I2IA 3LPGA 4M3CA 4XF3A 1T2XA 1H1AA 3RZZA 3WP5A 4E2SA 3ZIWA 5FMOS 4CDUA 1REEA 4AHXA 4XUOA 5L19A 1N1VA 4AGVA 4TZDA 1PO21 3BI3A 1O5LA 1LKNA 1UZVA 2CGOA 3DKWA 1ZA4A 3BB6A 3ZXGA 4ATFA 4BH9A 4K20A 1H6YA 1QJU1 1MQTC 4YW6A 5LY2A 4FOYA 5JMOA 1PGL1 2DWRA 2JE9A 1DQ6A 1TNRA 2EAAA 1CN1A 2I07B 2A6VA 4NOTA 1SCSA 4QPIB 4YW2A 1N1YA 2CAVA 4CCEA 1RUD2 3AYCA 1PO11 2ET7A 5D21A 5FYIA 5IAXA 3O0XA 1W06A 1CJPA 4HN1A 1NAEA 3VBUC 4ITCA 2OX0A 3CJIA 1ULEA 2VVEA 1OLQA 3L2YA 3QBQA 2Q1FA 1SLIA 3WW2A 2IXKA 5F1RA 4UW3A 4LK7A 1PO22 2IWGB 2VBBA 5FBZA 2EIEA 5C7GA 4WM7A 4QPYA 4RHV1 3M70A 5JOYA 5C9AB 3VHRA 2B4KA 2XHKA 5L7OB 2JG9B 1U5XA 4N8MA 4BYYA 4E2GA 3BODA 2WA4A 1JZ4A 1QJEA 1ULCA 2OS2A 2YV8A 4XFFA 4I0WB 4DB5A 1SG3A 4FOQA 3DUIA 1NY72 1CAVB 4Y22B 1ZBA3 3WF0A 4QMAA 1PO12 5FCCA 3VBFC 5A3WA 5HI0A 1PIV1 2DUOA 1N1SA 1FOD1 4J1WA 1S0GA 4YW4A 1ND3A 4GJYA 2E7QA 4LKSA 5IYYA 2WS93 5FUIA 5FLIA 3UGHA 4QGNA 4RS5C 5LRRA 2A5ZA 4AQ6A 1IQAA 2NP0A 1DGWX 2RS13 1PVC1 4RHV2 4ES8A 3T2PA 1BEV3 1VBC1 2PHXA 4LE3A 1QJY3 2B42B 3P1IA 2R043 4U36A 3KV4A 4M4RA 5F3EA 2G9ZA 3SC7X 5DG2A 3UNPA 1BK0A 1YFYA 4Q4X2 3WG3A 4BM8A 1QU0A 2CAUA 2ZOEB 3ME2A 1A3KA 5K9YA 1UAIA 4YZ3A 5IUQA 4QD2A 3WP4A 1I1EA 1HJFA 2CSGA 4LUKA 1PIV2 1Q5OA 3ILFA 2VNVA 3H1WA 3N9MA 2XR4A 4LITA 2H6CA 1N1TA 4CSWA 1JYWA 4EJRA 2ARBA 2HWC1 4UWDA 3RRDA 1R1A3 3M3QA 4Y5SA 4BPZA 4FP3A 5D1IA 1ASJ2 3T30A 3D3AA 3ZFEB 1PVC2 4JHZA 1UCXA 1LOFC 4HPKA 4JRAA 2ZTNA 3MW4A 2ZGSA 5FXXA 2ILMA 1W0PA 2VUDA 2ZPXA 4EZ4A 4OCTA 1XYNA 4EWAA 1VP6A 2QFEA 1TG7A 1D2SA 1OH4A 1U0AA 4JGZC 5HV0A 3U75A 2W46A 4CDWA 2WFF3 1VAKA 5I93A 3UKTA 1JZ3A 1N3OA 2Y6GA 1OVSA 3ZN6A 4IQPA 1AR63 1ND2A 1WD4A 1X9PA 2IXLA 1W8OA 3WR0A 3K48A 3NV2A 2GNBA 4YGCA 3W59A 1ULFA 5D8AC 2OKXA 3HNMA 1Q8OA 2ZX2A 3GYDA 1H2KA 2V4AA 4WV8A 1QXJA 4QX8A 3KVAA 1SDWA 2XJTA 4IGPA 5A3LA 1UU5A 2DDUA 3IKWA 4EZHA 1UYXA 2OZJA 5AC91 4PF5A 1QXRA 3AFKA 4P5YA 5HCHA 3KV9A 3TNQA 1OURA 4BQ3A 1W6NB 3B69A 3T2OA 2GNTA 1ENQA 2RDRA 5F3CA 4DEQA 4NHLA 3FHAA 2OA2A 1AX0A 1QQP1 3BTXA 3VHNA 5CFCC 4KQ7A 1AYN3 3HR9A 1KJLA 1FI2A 3JU9A 4X6RB 3O1PA 2Q5TA 1XYPA 2J7MA 3FBYA 3IM0A 4ES9A 5B4NA 2BNOA 1VMFA 2BBVA 1TME1 4ZHNA 2RHPA 2FQPA 4JCKA 4LO4B 3MEPA 3U4SA 5FYYA 3ZFGB 2J1SA 4QX0A 2R1DA 4XURA 5I91A 3O1TA 4AK3A 1EPWA 4R9BA 5FKCA 4KMQA 5K7PA 1N3QA 5C6CA 3AMHA 3USUB 1EYBA 3A21A 2YBSA 2GDFA 5ABJC 4MYEA 4P14A 5TSWA 1ZZBA 1CAWB 1FPN3 2VQ0A 4MV2A 4QDQA 1NG0A 1T6BX 2JXAA 2GMPA 1X33A 2WZR1 3WDUA 3WV6A 5A6YA 5EHDA 5FYHA 3M3IA 4QU1A 1S0FA 2BGCA 4KGGA 1W8FA 4AXOA 1OQ1A 3PVOA 4CP9B 3AM2A 1YQCA 4CDQA 4XYXA 5FYSA 1ULPA 3IBMA 1XSRA 3ZSLA 2HWB2 2A75A 2IFWA 3HMYA 3NNJA 4HSLA 3CF6E 2VW1A 4BQ5A 2NZ9A 3VKOA 2WT1A 1WCQA 1O3QA 3LCPA 2FDFA 3AVSA 4EN9B 3OGGA 1QGLA 1ZM1A 4I02A 2VMDA 3RS6A 4BWOA 4IEOA 4BLJA 5JVVA 1GMMA 1UOFA 3MICA 3EHKA 3BTYA 1UKRA 2JG8C 1DYKA 4Q4Y3 4YFZA 2WZR2 1NZCA 1W2AX 4WVMB 4Z82A 1EUUA 1FYUA 3U0ZA 4NWVA 3B3QE 4A6OA 3O1UA 2ZGPA 1OLME 5AVAA 3A7QA 3CLPA 3PJQA 1K5MA 2BEOA 5BNPC 1VBB1 2ZXQA 3VD4A 1UIJA 1Y9GA 5FP9A 3CJXA 5I8TA 3FLPA 5JR2A 1OD3A 1SPPA 5LZ6A 1W3XA 2ZGOA 2Y6JA 4IV3A 1NT0A 2VMFA 5DUXA 3SH5A 1JZ5A 3AKRA 1LEMA 3LIHA 3NNGA 4JTOA 4QAWA 1DLLA 1GV9A 1VBD1 4YRDA 1LCLA 1LR5A 5CU1A 1JZ8A 1YHFA 4CEYB 1G9BA 2A3YA 4PQQA 4E8DA 2XXZA 1RMU2 3AZXA 3CDZB 1WGPA 2C9KA 4CXXA 3KGZA 1UYYA 2XJRA 3RYRA 4FFGA 1VJ2A 2NM1A 5FBJA 4BLIA 3AXEA 2RM22 5E88A 2PFWA 4UFJA 1WMEA 5EPAA 4YLZA 4P5HA 3ZLIA 3UGFA 3O14A 4QKDA 2YPDA 5FYCA 1NA1A 1VBE2 4PDWC 5F9TA 2WYFA 4Q27A 4YG3A 3VBHC 2CL2A 2DCZA 2HJIA 3LD8A 2VMHA 3KHBA 4QPWA 5FZLA 3DL3A 1ONAA 4YFWA 4QM8A 2VZ3A 4IEUA 3RZLA 3OBTA 1ULDA 5LBCA 2WZPP 4CDUC 3OBZA 4A3XA 4UFLA 2CDPA 4NROA 5A32A 2ZMKA 1CR7A 1JU4A 4K7JA 1W6PA 2H6BA 2NMNA 4AVTA 3H8UA 3WQ1A 3NAPB 4FQZA 3TN93 5DDJ2 3EXUA 3VDDA 1GZTA 5A33B 2R0HA 3K4ZA 2XG3A 5F5CA 1J58A 1HQLA 2RMU3 3D82A 3MIEA 4FVVA 5FUNA 4QX2A 4RFRB 1XE8A 4FPHA 1MVEA 4RQPB 4BJ0A 1ENRA 1JZ7A 1SQ4A 1KS5A 2QQKA 3N4MA 5C3PA 1POV0 1WBLA 3CJIC 2H0BA 1AZDA 2DTWA 2QDRA 2W3JA 2XMLA 3FLRA 3MLJA 1ZRFA 4NIGA 1F8VA 3I54A 1XNAA 2WQ8A 1OT5A 3C7OA 4OHVA 1GP6A 3CQOA 2CU5A 4PBPA 1ZRIA 4WM7C 4LLOA 4MGYE 1OI6A 3KHCA 1BMV1 2W9XA 4KBZA 3RVHA 4AGGA 3HIFA 4IXLA 1LOCA 2UYAA 1O5UA 1WW7A 4XUNA 5SV8A 2UURA 1RUE3 3KZ4C 3ZO0B 5F7UA 1GQGA 4XMIA 5FJKA 1R081 2ZAHA 1RUC3 1M06G 2AEZA 1IG3A 3WNLA 1DF0A 1DQ0A 3CO2A 3LSEA 2VCCA 2W47A 4QB1A 2PQQA 3S7EA 4HLTA 3OD0A 2PELA 2WNOA 4KWJA 2EAKA 5C8CA 4OI4A 4EN6B 4XHBA 3CMGA 3FHQA 2WRAA 3OBRA 4XHXA 3FUOA 4PLNA 1AL0G 4OFGA 5JIUA 1LHWA 2GC3A 1QJX3 2ZEZA 4XPVA 5C3QA 1MQTB 5EV7A 3ILNA 3LOIA 4HKWA 4R8HA 1ZBA2 4QQLA 2YBKA 2BUKA 2D6NA 3FL7A 1QHDA 3BOWA 4ARXA 3DF0A 5IK5A 1XNTA 2WBKA 4OMDA 3SNMA 3W20A 4SBVA 2WS92 3L9JT 3ZXJA 3V0AB 2TBVA 2B9VA 2Y34A 3VBUB 4W6YA 3K3NA 4CEWC 4CUBA 3ZDSA 1MS1A 1IPKA 1FMD3 4Q4W1 2RS12 2BVBA 3FZ3A 4Y33A 3MW3A 3PMSA 4XEZA 5EJ1B 1BEV2 4GMP1 5FP3A 1QJY2 2ZKLA 3THTA 2HLEA 2R042 3HT2A 3W58A 1JOBA 3PVEA 3O0WA 3HWJA 3T4HB 5DAWA 4ORFA 1BK1A 2DBIA 4KWKA 2PMWB 2RS53 3NJZA 4N53C 1SEFA 1HB2A 1TEIA 4XBNA 2W1UA 3UJQA 3AMPA 2BU9A 5HXVA 2ZZJA 5FO9B 2C5DA 5JMCA 1A34A 4AI8A 3AKPA 2Y6HA 3I2FA 2Q1MA 5FYVA 4L8QA 1ND2C 1R1A2 1HRV1 5JOXA 2D6KA 2DFBA 3IDBB 1C8M1 4RS5B 4NHYA 3OYWA 4UF0B 1B35C 1LU2A 4QKBA 4W65A 2PHLA 1FV3A 2QQOA 2VG9A 3WQ7A 4RGGA 4XQDA 1PK6A 1JUHA 2VD7A 1GOHA 1R64A 5JXGA 3KV5A 2VY0A 5BNNA 1UWWA 2DUPA 5DUVA 5GM0A 2FDHA 2WFF2 1SBEA 3AZYA 3HD8B 4XACA 3FX3A 1AR62 3WG4A 2BTVC 2D6OX 2XJQA 5C4WA 4M0NA 3PUAA 5LK5A 5IVEA 1CPNA 1PGSA 2WNUC 3ENRA 4GB33 1RC6A 1QOTA 2UY9A 1RGSA 5A6XA 3RZHA 5JZGA 2XKPA 1RHI3 1H8TA 2XJPA 3UKVA 2DVDA 3I59A 3IB3A 1RITA 1N47A 1WW6A 1QDOA 3FFQA 1HDKA 1F5JA 1S0DA 3W5NA 2ERFA 3ZXLA 2DCYA 5A3OA 1DG6A 3IZOA 3UESA 2Q8EA 3MF6A 1B09A 1QJU3 5F5IA 4L9BA 4LKDA 4M0HA 3RMXA 4COVA 2A71A 1UX6A 5K0UC 3UL2A 1FT9A 2BP6A 4XETA 1PO13 5FZDA 2YC4A 4Q4V3 1CQ9A 1UU6A 1S0EA 3V56A 5J3UA 4YW1A 2IC1A 5D8AB 1W28A 1RJ7A 1J1LA 1VALA 2QKDA 2NLRA 2Y0OA 4NAMA 4QXBA 5E16A 3S30A 4A4AA 4IE5A 1XJAA 4O7XA 4NO4A 4RHV3 1G9CA 2VNOA 5FPBA 4EWDA 1IG0A 4IESA 4AQTA 1XSQA 3MF9A 1MS4A 4AFMA 2PHRA 3QD6A 3WF3A 2NPIA 3MI8A 1FPN2 1GZWA 2HEYF 1OXCA 5CNAA 5HCFA 4AEJA 4BE3A 3S7IA 3J8F1 1SZBA 1HV1A 1UKGA 4QU2A 3ABZA 1V6IA 2IVIB 2XB6C 5CFCB 4DUXA 5FOBB 4R52A 2A6WA 3B94A 4I3GA 4XTMA 3BYWA 1FOD3 1AHSA 5IAVA 2V5YA 1S0IA 1A8MA 5FZOA 4XUTA 2JJ6A 2QQWA 5CEHA 1I6XA 4QXCA 4DQAA 3VBRC 1J59A 1HRI1 1GYKA 4AI2A 3ACHA 1YIPA 1DIWA 1FX5A 2WT2A 2Y38A 4UT5A 1DDLA 1VBC3 1ZZ6A 2YMZA 2ZGUA 3P6BA 5IK7A 4N43A 1KJRA 2D6LX 3Q8BA 4N7UA 1BYHA 4JQRA 2BFUL 4R4ZA 5ABJB 4J1XA 1OA4A 4JVAA 5J09A 5ACA1 3A4UA 1CAUA 4HOOA 3WUDA 1OLRA 2XH6A 3WINE 4E4DX 2HWC3 4DEVA 5FYZA 4ONUA 2WNVC 1D2QA 3ZR6A 1NA1C 2UU8A 1WWYA 1Y7BA 3RMYA 4FP2A 4PI2A 5A1FA 4XE9A 4O65A 4BB3A 3ZDVA 4NJ4A 2XUEA 4C1WA 2QQIA 2UWAA 1Z7S1 4K1ZA 2WFPA 3N7KA 3I3BA 4LA2A 4ZS3A 4YVSA 5GZCA 2JG8B 2DUQA 5F6LB 2O8OA 4NIHA 2RDSA 1AJKA 3QH7A 5LEJA 2VMEA 4IW3A 4D7SA 4HANA 3PU8A 1KFXL 3LZZA 1F4HA 2AC1A 2LUWA 5BNPB 2ZCWA 1YFXA 5EIYB 1TVGA 4LKEA 5LA9A 2WNEA 1ALYA 5BUVA 1GNHA 3G6JB 4FFHA 3NKTA 1WW4A 5T5LA 1H1MA 5AC93 1LOEA 3J7HA 4JKMA 3J9SA 4AZZA 5IVCA 1JN2P 3TNPB 3Q8FA 2BQPA 5GZFA 3R4UA 1Z7S2 5DMYA 1CX1A 3VHPA 2BWAA 4NRPA 3SEEA 1OFNA 4I0AA 1C1FA 1GOGA 1QQP3 3IT8A 4P9LA 3SHRA 2RMU2 2D7FA 2EICA 3D8CA 2MPFA 2EA7A 1C1LA 4ZZ8A 4UAPA 1UIKA 5M0TA 5IVJA 4BA6A 3H8RA 4FSJA 2G1MA 1TME3 4PDWB 3OUIA 3VBHB 3T4VA 3OGVA 1K3IA 3HN3A 3V64A 4H55A 3O1OA 1F9KA 4XQ4A 5DZEA 1L7QA 3H3ZA 4TWTA 1LTEA 4CDUB 5KBFA 4HXCA 1WA6X 5LA2A 3ZM8A 1Y9MA 4HETA 5C8CC 2A73B 5HBAA 5I8YA 1S0BA 5JDBA 3ZXFA 1XOYA 4YW7A 2YPJA 1RUF1 1AJOA 5EWSA 1KFUL 2G9FA 4IV1C 3VZOA 1VBA3 1RUE2 3QACA 4CCJA 1ZZ7A 4AWDA 3O1RA 3CU7A 2C4XA 3DGTA 1TQ5A 5JIAA 5GZEA 4COWA 5CBLA 1RUC2 2FCTA 1UYZA 5GLZA 4XF0A 4DRVA 4Y1ZA 4HZFA 2V09A 4CU9A 2UY8A 4CZSA 1ZZ8A 2PQSA 2VQAA 4WBBA 4S2GA 4AYUA 3VD3A 3NMBA 2JEMA 5CVRA 3PNAA 4NIDA 2WA3A 1FMD1 2GMEA 1JYTA 4CCKA 4Z92B 1MVQA 3CJIB 3SH4A 1Q8PA 1MZFA 2EXJA 4PQ9A 1TMF1 3C8XA 1W2UA 1OF3A 1QJX2 5AFEA 3VBSC 3IPVB 4WM7B 3NJVA 2BBAA 2RS51 2EIBA 4XUPA 3ZMOA 1X82A 4GXLA 5CKMA 3K77A 3O1MA 4OHXA 3I3QA 3TEZA 1WCKA 2EXIA 2TNFA 5KHHA 5J1XA 2VBPA 5JSPA 3N7LA 4LNVA 3E1F1 2HBUA 2HH9A 1VBB3 3A0KA 3OEBA 3WNXA 4AOCA 2YXSA 1FMD2 2R1BA 1MS8A 2XJVA 4W6WA 3TYJA 5FXWA 4B4RA 5FPAA 2X05A 3SCGA 2E6VA 1YJLA 3LE0A 1U5YA 1AUYA 1PM7A 1VBD3 2I2SA 3O0VA 4MGZE 3OY8A 2PA7A 1Q3EA 3U1XA 2RS52 2ADEA 3BVCA 3AP4A 4OI2A 4C0BA 1H4GA 2RJ2A 3E5QA 3VN4A 3LOBA 1KDKA 1YNAA 2XWJB 5JOWA 4P9JA 4DXSA 1LENA 4UBGA 3VB9A 2G4IA 2P3KA 3C3VA 2Y64A 3GBFA 5DAVA 3VL9A 5LEKA 3GHNA 1RHI1 5DAXA 4CEWB 2D3PA 5FO8B 2E63A 4L11A 4H7MA 3N9PA 4P9GA 1QF3A 3O5SA 4DRRA 1QY4A 4CDXC 5BNOC 1LU1A 2IFRA 3OCPA 2WABA 1O4ZA 3HVDA 2FDJA 1CX4A 2W1SA 2BZDA 1H4HA 4D94A 1U12A 4JGYA 3K51A 3ZYPA 4BQYA 4CCCA 4AQ2A 3TAYA 5T55A 3NQHA 3DV8A 4OZOA 3JBG1 5E8AA 5EYYA 5LATA 1PNFA 2OIIA 2QQUA 4N53B 5CFDA 2XHNA 4GB32 3BUCA 4KG0A 1RJ8A 4Q4V1 3ZPYA 3H42B 4LHLA 4XQWA 1RHI2 2HYKA 1D0GA 1L3JA 3MIFA 5CZKA 3ZFFA 3ZN6B 1JMUB 1AR91 1HXS3 1ND2B 2PHWA 4XTPA 4W6XA 4INDA 5FP7A 5C3RA 4R9CA 2GP5A 2VZ1A 1IKQA 1B35B 2PLV1 1HQNA 1RXFA 2YU2A 1QJU2 1RUJ1 4XJUA 1UY1A 4XJAA 2YGMA 4OUEA 3SH3A 1PGL2 1C28A 2WN3A 1DGRA 4BCUA 2WT0A 4Q8LA 4AEDA 1V6MA 4XC9A 4Q0QA 2X5IA 2WO2A 3KT4A 4OQ8A 2GP3A 1DQ4A 1SLLA 1R083 1JOPA 1MZ6A 3AL6A 3GJAA 3K3OA 1O3RA 2VZTA 2WSVA 3AZVA 4KG8A 3K4AA 4Q4V2 5LCWL 2WNUB 4I09A 4IGOA 3ZPOA 3AYDA 4E27A 4EE2A 1O3TA 2DU1A 2HKXA 3ATGA 3LQCA 4BXSV 5GZGA 4HKLA 3ZYIB 1I9RA 2VBDA 3AYEA 4RYDA 1Y43B 3TEXA 1U5IA 1TNFA 4FTEA 5CB7A 1HB3A 2PLV2 3HPNA 3UV9A 2SBAA 2VOXA 3K46A 3DXTA 3AB0A 4B7EA 3B93A 5KWRA 3UT0A 3AKQA 2EIGA 1W8ZA 4MOAA 5JI7A 2VZPA 2Y6KA 1RINA 3I3EA 3PURA 1YQ5A 3AZZA 5BNQA 3VDCA 5CISA 2ZGTA 2X29A 1W0NA 2AENA 3ASIA 2VR4A 5FZCA 5C5UA 5K0UB 2ADDA 1FOD2 3MUY1 3WY6A 3AK0A 2JDNA 4CVUA 3B01A 1FAYA 3BIWE 1SBFA 5KHKA 2FZ1A 3VBOA 1AYM1 3MO4A 3PUIA 2DCJA 1H0BA 1QJZA 1OLMA 3MV01 4OYUA 1EY2A 4Q4W3 5CG9A 1EP0A 2OPWA 1C8NA 3N36A 1VBC2 3GJBA 4WM8C 3ZSKA 4GMP3 2YYOA 4LKFA 4D7YA 1LJ7A 2WO3A 3F95A 2Q4SA 4K6BA 5F5AA 5K4LA 1JTZX 1CD3G 4RA0A 1GU3A 2LROA 3T09A 4IE7A 1NCRB 4UFIA 3WT3A 2C0ZA 3DPRB 3AKSA 5IJRA 1R1ZA 1W9FA 1D0HA 3B9IA 2AR6A 3ALQA 4CUGA 2D6PA 4MHRA 4QT6A 1UO9A 2VOVA 2W08A 4AFBA 4ZZ5A 4YVSC 1GQHA 1G6NA 2P6CA 2WLPA 4IE6A 1ULOA 2ZKNA 3D0JA 4M3CF 1UF2C 2Q8OA 2HWC2 1HRV3 4CPBA 4LBQD 4JZRA 4URTA 1C8M3 2C24A 4NHKA 2MHFA 1FXZA 4QPIA 3FJSA 3VBRB 3CEWA 4YVWC 1YQ6A 3WHUA 4DFSA 2VUJA 1V00A 1POV1 3I97A 3H0OA 1YI9A 1YI7A 2VECA 3IDEA 4KWUA 4DUWA 3FUQA 5F5QA 3H3LA 5JXHA 1ENXA 3FE5A 5KHJA 3OSDA 2IXCA 3LWCA 4GWNA 5KXCA 2RE9A 2WIIB 4O61A 4OQ9A 3T1MA 2D5HA 3I3DA 4YM0A 3RYKA 5C9AA 5KXBA 3KD4A 1RXGA 2JG9A 5FZGA 5L7OA 1UOJA 3VKNA 3ACGA 3WW1A 2JB8A 2ZJCA 1KEXA 3OG2A 1LOBA 2ZGMA 1S0CA 2WNVB 4P00B 5GLVA 4AVAA 5AC92 3TEYA 1CAVA 2VZQA 3K2OA 4Y22A 3RQ0A 4LBOA 3UYJA 5JPNB 2DV9A 1WBFA 3OUJA 3AJZA 1GSLA 3DCQA 4IL7A 5GLWA 3ROUA 3T2TA 3WNPA 1MACA 1DFQA 2AGSA 5IHRA 2ET1A 4LULA 4KH9A 3RFRA 5BYNA 2VNRA 1VBA1 1QQP2 4HK8A 1XE0A 3NNLA 4XIKA 5A7QA 1WCSA 4GKYA 2BWCA 5FZ4A 4C0HA 4Q2FA 4BZ4A 4A7ZA 3I4IA 3CIHA 3WW3A 4L92A 4NR1A 4COUA 2QQJA 4ASMB 4P9XA 1LNSA 2ZHMA 2R49A 1CZSA 4CU6A 3ETPA 1TME2 2Y0IA 5FPXA 5EXOA 1H9PA 2VOTA 3CKHA 3GALA 4LXLA 5FUPA 3LF7A 2GMMA 3GCWA 1VMHA 1YC61 2O8QA 4XOGA 2E51A 1BBT3 1FNZA 2R063 1A78A 2WO1A 3GZAA 4ZS2A 1LHUA 1FATA 1YUDA 4S2FA 2Y8KA 1CONA 4B8EA 1SDDB 3I2JA 1SBDA 1VBA2 1ZVFA 3VZNA 4D3WA 1UPIA 3AJYA 3NSTA 2VCAA 3J8F3 4Q1PA 4NIAA 3ZVXA 4ZKTB 2ZAAA 1S2KA 3ZFEA 1HLCA 1EV11 4EQVA 2VVDA 3VHOA 3A23A 5GLUA 4X8NA 4X6QB 2ZX3A 3HQRA 2B5HA 2YGLA 1XB9A 2PYTA 1JHJA 1YEWA 3OTFA 1A6CA 2JD4A 1OKOA 3LEGA 1HRI3 4EN7B 2GH8A 4CXWA 4KI5M 4XFCA 1YQ2A 2JDPA 1DQ5A 1ZNPA 1AXYA 2K2SA 2GN7A 3H1MA 2OXBA 2I45A 3HT1A 4CU8A 2ZHNA 1OOPB 3JB8A 2A70A 4LOSA 5T5JA 3SXWA 4CRQA 4LBQB 4IV1B 3RZMA 2HWE1 2F17A 1UY4A 1W04A 1E5RA 1W9SA 2W68A 3BOPA 1BXHA 2ZA9A 3CL1A 5F2SA 4AAXA 3KSCA 4CP1A 2DU0A 4BISA 4F3JA 2XUMA 1VBB2 3MIBA 1ZRRA 1C4RA 3WNNA 4DPNA 3C2UA 4NWWA 3RGBA 1W6NA 5FZ6A 2CWSA 4NN0A 1VE0A 3FC0A 4QM9A 3TRSB 3ZXAC 5A7WB 1WLTA 3OGJA 4GH4B 4LHSA 3M4FA 5FZIA 4ATEA 3OGRA 4Y1VA 5JXJA 1VBD2 3PUQA 3FHIB 2BYVE 3Q8CA 3FBMA 1PZ9A 3H50A 3VBSB 3JUUA 4Y4RA 2LW8A 4MGQA 2LM3A 1F5FA 1Z7S3 3WHTA 4XJ8A 5A3PA 1MS3A 4OI1A 3O7OA 3ZFGA 1DBNA 3KQ4B 5KXEA 4I01A 4YW5A 3ZOIA 5CFDC 4LO7A 2LTNA 2MNGA 1MR5A 1W39A 1HXS1 5FP8A 3USUA 1XU2A 4RR3B 3BALA 4QPGB 1S4CA 1CAWA 4XCAA 4BK4A 4OHWA 1W90A 4XFGA 4LIUA 1STMA 4CP0A 4XILA 1OVPA 4FPFA 1RIRA 5A1AA 2W91A 1M4WA 3SKVA 2WQ4A 3OYWB 3WG1A 1DGLA 2WINB 2B39A 1WLWA 3AYAA 3QLQA 3HN1A 4AI0A 4CP9A 3MLLA 1QH6A 2W39A 3HQUA 3WEZA 1HN1A 3VKFC 4N9HA 4AHWA 2JDMA 4QDSA 1XNDA 5D2AA 3KVBA 2O14A 4BMBA 4LPLA 4HG6B 2GNMA 2VGDA 1HXS2 5KR7A 4NHMA 4A7KA 5JSOA 2LALA 4IE4A 1DCSA 1ND3C 1SMVA 1LRHA 2VU9A 4MUVA 4L2NA 4YWAA 5FYTA 3T08A 1AL21 1JI6A 2GC2A 3THDA 2CGNA 4CDXB 5BNOB 4H7LA 4YGEA 3ACFA 4P9IA 1O6UA 1CIWA 4XW3A 4WVMA 2VM9A 5A3UA 1UPSA 5DG1A 2XVLA 3RI8A 5JSRA 2GH2A 1BMV2 2JDYA 3RDIA 4PIZA 1PMJX 3MIDA 2PAKA 2ZACA 1OKQA 1RUF3 3D6EA 4FFIA 5LB6A 3MBWA 3VZJA 2XPJA 2XGXA
chains in the Genus database with same CATH topology
1R082 2ZX1A 3TBDA 3ILRA 4PJYA 5IK8A 4YM1A 2HWD1 3POSA 1W6OB 3IWZA 3ES4A 2WL1A 3INAA 4IEWA 1GZ9A 4JC1A 4OVEA 4CEYA 1Z0HA 4Z1VA 5CIRA 1U5ZA 3GF6A 3VLBB 3M1HA 4PIYA 1TMF3 2R0FA 1AX1A 2AYHA 4RFT0 4OLLA 2FBEA 2HEVF 1ULGA 2XBO1 4AHYA 3ACLA 1CVNA 1GZCA 5I0RA 1NCQA 1RUG1 4S2DA 4XJ9A 4CDWC 3RI9A 3V0BB 2CY6A 2HWD2 2HWF1 3VBFB 3ZYRA 1APNA 3GNEA 2H0VA 3B9CA 5KHGA 2P3IA 2QQPA 2BPA2 1BVP1 4CYDA 4Q4W2 5EJ3A 3NAPA 2R6QA 4UXAA 4XF1A 3OD4A 5A33A 3N35A 2YHJA 4K1YA 1OQDA 1CPMA 2PAMA 4QQOA 3EO6A 2Q1ZB 1W6MB 1G86A 4IEVA 1V9U1 1S2BA 5GKAC 5FREA 4UW6A 1IHMA 3AP9A 1A8DA 2OZ6A 2OUJA 2YY1A 3VL8A 1HRV2 1QDCA 5DZFA 4MXWB 5C9AC 1C8M2 3ST7A 2VMIA 4BMEA 3WCSA 2F4PA 1D4M1 3VZMA 1RUNA 2IXIA 2JDZA 5T52A 4WM8B 4B4PA 4D7TA 3NW4A 1JYCA 1V9U2 4JGZB 1JOJA 4FT8A 5DUWA 3JBG3 4AFAA 1DU3D 1VB2A 2D5FA 4DS0A 1SLBA 3PVNA 4XJZA 1GLHA 1XQNA 3SMHA 3B00A 3D0SA 1W6QB 3AFGA 3CNAA 1AR93 5H9QA 1MQTA 4Y20B 1IOAA 1O3SA 2GNDA 2GZWA 3RG0A 4I2OA 2IZWA 4Q0SA 4WZFA 4CDQC 3M2MA 4ISQA 1BBT1 2R061 4XXPA 5DZGA 3NV3A 1IGOA 2PLV3 4ZU4A 2IXJA 2JENA 1HX6A 4YVWB 1RUJ3 1AX2A 4KU7A 1DYPA 3V0AA 4DY3A 1ZRCA 3AP6A 3VBUA 1H9WA 3H7YA 2SLIA 4LBJA 3TOJA 3WP6A 1BZWA 3UJOA 1EAH1 4IETA 4WZCA 5T54A 4U2AA 3ELNA 1V6LA 5FRAA 1GBGA 1J3RA 3WUCA 1RTVA 1DZRA 1S1AA 1GKBA 4Y26A 5EFUA 4DXZA 1NLSA 2JECA 1TE1B 1K5MC 5E89A 4FPEA 5EYXA 1YLLA 2ZS6B 1BBT2 2R062 2VULA 3FLTA 1QNYA 3L2HA 4BHPA 4IV3C 1ZBE1 3KCXA 1BVVA 2ARXA 1GFF2 3WX5A 2Z2SB 1SFYA 2E7TA 5FQ0B 3J8F2 2BFUS 3FWEA 3H3UA 4H3WA 4RS5A 4FPGA 1E57A 4IEYA 2Q30A 3MFCA 4XFAA 4Z07A 1AYM3 4IEPA 2XJUA 2MEV1 4XF9A 1HRI2 4MLOA 4XFIA 4FAGA 2AZ5A 5C33A 1QMJA 1ZRDA 1ZBE2 3MZHA 4Y1YA 3VV1A 1YRZA 4YYOA 1SCRA 4LO8A 4X8PA 4YZ4A 3JQXA 1S0JA 3AMQA 3B5LB 4MGIE 5ACA2 1VRH1 2GC0A 3JB4C 3POYA 3WZ1A 1N3PA 3VDDC 2GU9A 5FPZA 5HCAA 3SITA 1LOFA 3PTYA 4MH0E 2D43A 3WLUA 4QGMA 1UZZA 2F6BA 4LBMA 3H7JA 4JDMA 5J98B 1SFNA 1AR71 4YZ5A 2MEV2 2ATFA 4NPRA 2OPKA 3NO8A 5J48A 4FCAA 1HKDA 4B29A 1POV3 3BPZA 4COZA 5D8AA 1RUH1 2R071 1IS3A 1QH7A 3KS7A 2E7AA 1CAXB 1LHOA 3ECQA 3WDWA 1LHNA 3P3PA 4K8FA 1KRIA 4COYA 1H2LA 5AFBA 4M3CB 4XFHA 2XVKA 3I7DA 4LHNA 5CFCA 3R4SA 1G8WA 5J36A 1D4VB 2TUNA 4L97A 4GQ7A 3R05A 2ZGNA 1RUH2 4IEXA 1V6JA 1NQJA 3WG2A 2R30A 2NQYA 4JDOA 1JW6A 3R4DB 4R4XA 1ENSA 4AFDA 4FAHA 1NE6A 4Q0PA 3M3EA 1WLCA 2XWBB 2DF7A 2DVFA 3E97A 2X53S 2FMYA 3NWKA 5ABJA 2AUYA 3AMNA 1NYWA 2P37A 1PGW1 2VVFA 1RUF2 5J37A 3SLIA 3B7MA 2OUHA 4I0BA 1I5ZA 2VOWA 3RYPA 2YROA 2RJLA 2B7YA 2RJKA 1EV13 3M7AA 1OD5A 1NCQC 4LBKA 1KXGA 4C91A 3ETQA 4TSVA 1R091 2R16A 2X8KA 1ND3B 2JKBA 2FZ2A 1WA4A 1JH5A 2XLFA 4LLFA 1XYOA 3JD71 2PHUA 2JG8A 1TMF2 1UD1A 2WKKA 3S0MA 4LT5A 4HVOA 3X29B 1URXA 3ZSEA 1PNGA 1IS6A 1PK6C 4O9GA 5BNPA 3WDTA 2RS31 1KITA 5L36A 1DGRN 4LO6B 5BNNC 2OW4A 4AQSA 2HWE3 1LOAA 5AVPA 2FHRA 3AXDA 3FFZA 5C4WC 3LKJA 5CG8A 4AG4A 5JZGC 1H8TC 1AXKA 4AVCA 3UK9A 2Q0AA 2WJSA 4E9KA 3AZWA 1KQRA 4QX5A 4NVPA 5I0TA 1UU4A 4XIOA 4HPKB 3S6PA 2NN8A 3WDVA 4PDWA 1RUD1 3VBHA 1BKZA 1REDA 4GULA 5FMOL 4A2UA 1BQPA 2W0XA 4GWMA 4CDWB 1LEDA 4MSVA 1YFUA 3WDYA 1RUI3 5DXDA 1OPMA 2VUAA 2D3SA 3ZX7A 4DNYA 4HVQA 2PN5A 4FPOB 4QQHA 3U11A 2WWSA 4IEQA 5T50A 1HQWA 2V73A 2XVGA 4F8AA 2YUEA 3W9AA 1XU1A 4YG6A 4ASLA 2DVAA 1NY71 2NYYA 4ISRA 2DYCA 3JBG2 2GN3A 1AXZA 2ZMNA 2ETEA 2IXHA 4LE4A 3AMMA 4HBNA 3RJRA 2B46X 4Q0UA 4KNCA 1AR92 1VLNA 3JZVA 3IPVA 4HMZA 2VH9A 3B02A 1AR81 5FO7B 5T5PA 1AL23 1LULA 3OF1A 4P9WA 2WQZC 4MX3A 3M3OA 1GICA 1RUJ2 4Q4X1 3J4UH 2TEPA 3LSDA 4I3PA 2ES3A 4JV4A 4N43C 4XMAA 1C5HA 2CGPA 1YO8A 2RR11 5BY5A 3NKGA 3FMGA 1WUVA 3AP7A 5I0UA 2R32A 4IERA 2HWD3 1XNKA 4JAAA 4Z2WA 4S2HA 1GNZA 3UKNA 1ASJ1 3EJKA 4K40A 1G9DA 4OHZA 3ZSJA 1AR82 2ZGKA 1MEC1 1BCXA 3LAGA 1RVF3 3ZN4A 4CDQB 4Z8BA 1CGPA 2YC0A 1Q43A 1V6OA 1X36A 2YZ4A 4YM3A 4CEWA 2XBO3 2RR12 1X7NA 2VNGA 1BJQA 5T5OA 2AH2A 2CWMA 1RUG3 3V65A 4RGAA 2HWF3 4BOWA 3LA2A 1AYM2 4R9DA 3M3CA 2P34A 5CAZA 5I8SA 1IKPA 5L73A 2XL7A 1MEC2 1G9FA 5H9PA 1K5MB 2PHTA 3ZYJB 3TWIA 4N53A 5JR7B 1RB8G 1XNBA 1J1TA 2C9AA 2NMOA 4AVSA 4IV3B 5L19A 4M3CE 2CTVA 2GC1A 1UN1A 1V9U3 3MIHA 3U10A 3I2DA 1H2MA 4G4FA 5GZDA 2E9QA 3JCIA 4E2QA 1B35A 2ENRA 1JUIA 4HVRA 2EXKA 4AFCA 3I8TA 3R0RA 1S55A 3MW2A 4DOUA 4FPYA 1PMIA 3H1YA 4XBQA 1NA1B 4K21A 3KT7A 4PIXA 1Y3TA 4O9EA 1D4M3 4ZXKA 1Q8VA 1WMDA 2B8MA 3LB9A 3MDPA 2JE7A 4JDNA 2D97A 4LTAA 4FPLA 4YZ1A 2WNUA 4G3YC 1Q8SA 4FTSA 3HAGA 5A32B 3GHMA 4LEJA 1W6PB 1V6KA 1FNYA 4JTNA 4F83A 2ZHKA 5DUUA 3ZSMA 1QWRA 3VDDB 4YZ2A 1CESA 4RD7A 1LECA 2HWB1 1PZ8A 1SACA 1DGWA 1MS5A 3WQ0A 1HV0A 1OA2A 1QXPA 3Q9OA 5K0UA 1DZTA 3GZUC 1DHKB 4HT1T 1LGCA 1IS4A 4YSFA 4YG0A 2PAEA 2D44A 5BXXA 1EAH3 4A7YA 4KGQA 3GBWA 3SCHA 3LGRA 2A3XA 3KQRA 4FPCA 3ZMNA 4AW7A 2Z79A 4BIFA 1LB2A 3PHMA 2PHDA 2D6MA 1X8MA 4XZPA 1NCRA 1UMZA 3PJYA 3PMEA 3DPRA 3RSJA 3RJ2X 3MGUA 4LO5B 1ZBE3 2XLAA 4AEMA 3PLQA 4Q8KA 1RMU1 4HN0A 5C8CB 1PHMA 3ZXDA 1XE7A 3SISA 3IIAA 2A6XA 2RM21 3D5OA 5A3MA 2OYZA 1OQEA 2ZZQA 4QXKA 3USSA 1EV12 4GA9A 1VBE1 3VBRA 3WW4A 3IDCB 4B4QA 2QVSB 1CJDA 2UWCA 4FQ4A 2B9UA 2CNAA 2XL9A 2MEV3 2CV6A 4LR4A 5JAXA 1RUOA 1COV1 4C1XA 2W52A 3WVJA 5DDJ1 4YNIA 3ES1A 4JGYC 1LGBA 1Q8QA 3N7JA 2JX9A 1UL9A 2HWE2 3NVCA 1VRH3 2A6ZA 2WNVA 1YFWA 3MPBA 2DCKA 4PBOA 1C3HA 4Y1XA 4TLFA 4FXGB 3ZIXA 1RUI1 1NCQB 1MZ5A 1QOSA 3VUOA 1C57A 1Y9QA 4Y1UA 1AR73 4YW3A 2ZGLA 3ZFFC 4UW5A 3U4XA 4H14A 4YGBA 1COV2 5KXDA 3URFA 3KM5A 1JBCA 1W0OA 1YCIA 2EALA 4FO9A 4LHKA 3H9AA 4Q0VA 1OFSA 4B3NA 3DN7A 1O91A 1OMIA 4DY5A 2UYBA 5EZWA 1RUH3 2JICA 2R073 1PK6B 4FPKA 5FLJA 5BNNB 1LGNA 2ZBJA 1QKQA 2CYFA 4AEDC 1AF9A 1VAVA 2X5IC 1RUI2 1H1IA 1LOGA 1G9AA 3EQEA 5C4WB 1NQDA 4CP2A 2QDNA 2D93A 1X8EA 4GIQA 2OVUA 5LK7B 4HK9A 5JZGB 1KS4A 4MGKE 4GALA 1H8TB 2P2KA 4PLMA 3NL1A 1ZZCA 5HCBA 4AF9A 1JYIA 2E53A 3I59B 3JQWA 1ZZ9A 4P9YA 5H9RA 3U07A 1ZBA1 3RNSA 4IEZA 2QZ3A 1IS5A 1T6GC 3WD5A 2WS91 4FBFA 4R9AA 4M01A 4RSUA 1WLDA 1OHFA 5KC5A 3M8LA 4F7ZA 1NXD1 2RS11 1AVBA 1VR3A 4UBHA 2AREA 1PVXA 1BEV1 1VAMA 1AL22 3VBOC 1QJY1 1OOPA 1X50A 2R041 2N7GA 4IV1A 4LBQA 4TYSA 1RVF1 4LBNA 5F6KA 4QQPA 4RL7A 4MVTA 3TB0A 4C90A 1J3PA 5K8SA 1HIXA 4KWLA 3WCRA 4PCRA 2KM2A 3NV1A 3KMHA 5CADA 4KU8A 4GH4A 1OPOA 1GZWB 4EV0A 1R1A1 4QGLA 5GALA 2VPVA 1Z78A 4B7KA 4Q1RA 1R093 4EWEA 4AEKA 3VBSA 1H2NA 3VZKA 5FDBA 1RVF2 1F31A 2G9GA 4E4SA 2K0GA 3JD73 3E6CC 4FTBA 1REFA 2WFF1 4QPIC 4AI1A 5JI9A 1ZREA 4RQPA 2XBO2 1AR61 4N43B 2RS33 4RR3A 1SLCA 2QJVA 1RUG2 2BVVA 4QPGA 2UWBA 5J7MA 1C5IA 4XJWA 2HWF2 3E5XA 1DQ2A 4AVBA 2EF6A 3OJBA 5JCTA 3WXPA 1CAUB 3ZYGA 4EROA 5L7OC 2JG9C 4QQ2A 4HFSA 3E6DA 2ZHLA 1IPJA 3KB5A 2EXHA 2P17A 4GKXA 1H30A 3RWNA 4MZUA 3T1LA 1AYN1 3APBA 4YGDA 1RUD3 4FPJA 3IMNA 3D4KA 3MFAA 3R6SA 2Z5WA 2Z42A 4WVZA 2B45X 4CDXA 5BNOA 4YVSB 5CA6A 5JLVA 4WVWA 2BW8A 1PO23 4J6GA 4K3UA 4N9IA 3ZXEA 4D69A 2ZGQA 1D4M2 5KHIA 2KA3A 4G9SB 4XF4A 2D40A 1YIFA 4L99A 1SLAA 1FPN1 2XJSA 2D98A 2XLGA 1AYN2 1W6OA 4JRLA 4ZU7A 4OZXA 2PTMA 4Y4YA 3AP5A 3AX4A 5FOJB 3BU7A 3QH6A 1XNCA 2WC2A 4KBBA 3RPQA 1LODA 3ZFEC 2EVXA 4FOVA 1JHNA 4Q29A 1QNWA 3E6BA 1AR83 4YM2A 2HEWF 4QHBA 2C1FA 1NCRC 1F2NA 4KL1A 3DPRC 3V0BA 1V6NA 4Q4X3 1Q56A 3VBFA 3KT1A 4Q4Y1 4OHYA 2YDEA 3BCWA 3MYXA 4K9SA 1J3QA 1EAH2 1PIV3 1OSGA 2RR13 2D3RA 3WP3A 4M00A 2VOKA 3E5UA 2O0OA 3QCWA 3VGIA 1ASJ3 1W6MA 1PVC3 4PLOA 1ZYBA 1MEC3 4LUMA 1KDMA 4OI0A 4XDQA 3MPPG 3OPZA 4HSJA 2VXRA 4Q4Y2 4Y24A 3WDXA 1DZQA 5C8WA 1O4YA 1WD3A 3A0NA 1KD7A 3O12A 4MXWA 5E1RA 5GLTA 3AKTA 1LESA 2PHFA 4GMP0 1VB4A 1V70A 1YWKA 4DMIA 3ZFGC 1WCDJ 3HBZA 4WM8A 1O7FA 4EN8B 2I74A 1JXNA 5FTTC 1G7YA 2WLQA 3P3NA 4JGZA 1NXMA 4I30A 3MIGA 4MXVA 3KLSA 2FMDA 3WOGA 4OULA 4OUMA 3TN91 4AVVA 4AGRA 1W6QA 1RL3A 2RMU1 3KGLA 3HQXA 5BPXA 5JOZA 1YXWA 2A7AA 1VRH2 3OY8B 4Y20A 1SLTA 2GSYA 2P3JA 1FV2A 3LA7A 2Z69A 3J26N 2GAUA 4YVWA 2ZMLA 3SCFA 4Q26A 3EBRA 1AR72 2KXLA 2VMGA 5KC6A 5FLHA 1UZYA 4XBLA 1UW8A 3MLKA 1PZ7A 2VW0A 3LA3A 3TN92 4WVVA 2DCTA 4FOWA 3ZXKA 1NE4A 3VKMA 5FFOC 4AE2A 1RUE1 2R072 2BNNA 4XXAA 3KCYA 5FAXA 3PVBB 1RUC1 2DFCA 4JGYB 2DTYA 4META 1YYNA 4YARA 5SV5A 5CFDB 5IT6A 5GJ6A 2Y26A 2HWB3 2ZX0A 1LHVA 1GR3A 1MS9A 4AI3A 2ZGRA 2QUOA 5FQ0A 5JWPA 4HL0A 1MZEA 4UW4A 3ZFFB 1NLRA 4CEYC 1QJX1 5J96B 1OOPC 5B2GB 1OA3A 4XFBA 4CTEA 2QZ2A 3G7DA 2WZR3 2QNKA 3NV4A 2K9ZA 3GBGA 2GALA 3QOPA 4FXKB 2DVGA 1DQ1A 1WW5A 4N7IA 1YJKA 1XXNA 4AEDB 1GANA 2A6YA 3GZTB 4V1PA 2X5IB 4GH4C 3POWA 3ZN5A 4OUSA 5LRSA 4DZGA 3BTAA 5JPMB 2DVBA 3NAPC 1PGW2 2QCSB 1QOOA 5T3NA 1XRUA 4EN0A 1RMU3 2ZX4A 4SLIA 1I3HA 4BQ1A 2QE3A 2RM23 3THPA 3VZLA 1MS0A 4RQPC 2VW2A 1HW5A 2BNMA 4LA3A 4RR3C 1VBE3 4QPGC 4AHZA 4DINB 2DURA 1R092 1O4TA 1WMFA 3N3HA 2WSUA 4ZU5A 4E4ZA 1NOVA 2O1QA 4HKOA 1EPZA 4Y5Z0 5H9SA 3N7MA 3VBOB 3JD72 1COV3 4N90A 4BIOA 1CAXA 1ZX5A 5DDJ3 2XKOA 5BV6A 3VKLA 1IZ3A 2RS32 5IK4A 5I0SA 4GB31 3IN9A 1VIWB 3KCCA 2A3WA 1H8VA 2ZABA 4LBLA 4M3CA 4XF3A 1H1AA 3RZZA 3WP5A 4E2SA 3ZIWA 5FMOS 4CDUA 1REEA 4AHXA 1N1VA 4AGVA 4TZDA 1PO21 1O5LA 1LKNA 2CGOA 3DKWA 1ZA4A 3BB6A 3ZXGA 4ATFA 4BH9A 4K20A 1QJU1 1MQTC 4FOYA 1PGL1 2DWRA 2JE9A 1DQ6A 1TNRA 2EAAA 1CN1A 2I07B 2A6VA 4NOTA 1SCSA 4QPIB 4YW2A 1N1YA 2CAVA 1RUD2 3AYCA 1PO11 2ET7A 3O0XA 4HN1A 1CJPA 3VBUC 4ITCA 3CJIA 1ULEA 2VVEA 1OLQA 3L2YA 3QBQA 3WW2A 1SLIA 2IXKA 5F1RA 4UW3A 1PO22 2IWGB 5FBZA 4WM7A 4QPYA 4RHV1 3M70A 5JOYA 5C9AB 3VHRA 2XHKA 5L7OB 2JG9B 1U5XA 4BYYA 4E2GA 3BODA 2WA4A 1ULCA 2YV8A 4XFFA 4I0WB 4DB5A 4FOQA 3DUIA 1NY72 1CAVB 4Y22B 1ZBA3 4QMAA 1PO12 5FCCA 3VBFC 5HI0A 1PIV1 2DUOA 1N1SA 1FOD1 4J1WA 1S0GA 4YW4A 1ND3A 2E7QA 2WS93 5FLIA 4QGNA 4RS5C 5LRRA 2A5ZA 4AQ6A 1IQAA 2NP0A 1DGWX 2RS13 1PVC1 4RHV2 4ES8A 1BEV3 1VBC1 2PHXA 4LE3A 1QJY3 2B42B 2R043 4U36A 5DG2A 1YFYA 4Q4X2 3WG3A 4BM8A 1QU0A 2CAUA 2ZOEB 3ME2A 1A3KA 5K9YA 1UAIA 4YZ3A 5IUQA 4QD2A 3WP4A 1I1EA 4LUKA 1PIV2 1Q5OA 3ILFA 3H1WA 2H6CA 1N1TA 4EJRA 2ARBA 2HWC1 3RRDA 1R1A3 3M3QA 4BPZA 4FP3A 5D1IA 1ASJ2 3ZFEB 1PVC2 1UCXA 1LOFC 4HPKA 4JRAA 2ZTNA 3MW4A 2ZGSA 2ILMA 1W0PA 2ZPXA 1XYNA 4EWAA 1VP6A 2QFEA 1D2SA 1U0AA 4JGZC 4CDWA 2WFF3 1VAKA 5I93A 3UKTA 1N3OA 3ZN6A 4IQPA 1AR63 1ND2A 1WD4A 2IXLA 3WR0A 3K48A 3NV2A 2GNBA 4YGCA 3W59A 1ULFA 5D8AC 1Q8OA 2ZX2A 3GYDA 1H2KA 4WV8A 1QXJA 1SDWA 2XJTA 5A3LA 1UU5A 3IKWA 2OZJA 5AC91 4PF5A 1QXRA 3AFKA 3TNQA 1W6NB