5CFCB

Crystal structure of human cardiovirus safv-3
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
232
structure length
232
Chain Sequence
b'SPFPVTVREHAGTFFSTTPDTTVPVYGNTISTPFDYMCGEFTDLLSLCKIPTFLGNLDSNKKRIPYFSATNSTPATPLVTYQVTLSCSCMANSMLAAVARNFNQYRGSLNYLFVFTGSAMTKGKFLISYTPPGAGEPKTLDQAMQATYAIWDLGLNSSYNFTVPFISPTHYRQTSYNTPTITSVDGWLTVWQLTPLTYPLGVPNDSHILTLVSGGDDFTLRMPVTFTKYVPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP1
publication title Structure and Genome Release Mechanism of the Human Cardiovirus Saffold Virus 3.
pubmed doi rcsb
molecule tags Virus
total genus 36
structure length 232
sequence length 232
ec nomenclature
pdb deposition date 2015-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5cfcB00
1B35B 1RUG3 1RUG1 5J98B 2ZZQA 1VRH3 4IV3A 1VRH1 5K0UA 1V9U2 2FZ1A 5BNPC 1AYM2 1VBB3 1VBB1 2RR12 1PVC2 1PGL1 1CD3G 1VAKA 1QJU3 3ZXAC 2X5IC 1QJU1 2RMU2 3VBSC 3TN92 1V9U3 1IHMA 1AYM3 1V9U1 4RQPC 4CEWC 5L7OC 1AYM1 3JB8A 3JBG2 1VBD2 2RR13 1BMV2 1PVC3 4CDUC 2RR11 1R1A2 1PVC1 2FZ2A 1NA1A 2Y26A 4RHV3 4RHV1 1RHI2 3VBUB 5A33A 3HAGA 2RMU3 4Q4W3 2RMU1 4Q4W1 1OOPA 3TN93 4Q4Y2 1AR92 3TN91 1D4M2 5ACA2 2WFF3 4RS5A 2WFF1 3JBG3 1VBD3 3JBG1 1VBD1 1B35C 5JZGA 4RR3B 1RHI3 5CFDA 3FBMA 1RHI1 4SBVA 4Z92B 3CJIA 3DPRA 1RMU2 1NCRA 4JGYB 2R072 1AR93 4JGZA 1D4M3 1AR91 3IDEA 5ACA3 1D4M1 3VBHC 5ACA1 5CFCA 1ND2A 4GMP3 1R082 2DF7A 4GMP1 1AR73 4YVSB 1AR71 3VBOA 4PDWC 4QPGB 5C4WB 2HWE3 4NWVA 1VB2A 2HWE1 1QJY3 1RMU3 1QJY1 1RMU1 3ZFFB 1POV0 5D8AB 4RFT0 2RS13 2RS11 4IV1A 5BNPB 1H8TC 2XPJA 4WM7A 2BUKA 1EV12 1BBT2 3S6PA 4RR3C 1WCDJ 2X5IB 3VBRA 1HRV2 4AEDC 2RS52 3ZFEA 1VBC3 4QPIA 1VBC1 1AYN2 5A32A 5L7OB 4N53A 4GH4C 1VBE3 1Z7S2 1NOVA 4EJRA 1VBE1 2XBO1 1RUG2 1K5MA 1R092 1MQTA 4N43A 1HXS3 1EV13 1HXS1 1EV11 1BBT3 1RUH2 1MEC2 1BBT1 2HWB1 4QPGC 1HRV3 5C4WC 4FTEA 1HRV1 2RS53 4Q4X2 4CDWA 4CDXA 2RS51 5FMOS 3ZFFC 4CDQC 1PGL2 1AYN3 3ZFGA 1AYN1 1Z7S3 1Z7S1 4WM8A 1QJU2 1NCQB 1R093 3VDDB 1R091 1ND3B 1RUH3 1MEC3 4GB33 1RUH1 1MEC1 4GB31 2HWC1 3LOBA 4Q4X3 4Q4X1 1RB8G 5BNOA 3VBHB 4CEYB 4RHV2 1POV3 1POV1 1VBA3 3VBSA 1VBA1 2RM23 2RM21 4Q4W2 4RQPA 4CEWA 4PDWB 1ASJ2 1HX6A 1RUI2 4CDUA 2WFF2 4YVWB 4IV3C 5K0UC 2GSYA 4FSJA 2ZAHA 2GH8A 2QQPA 2RS32 1ASJ3 1ASJ1 1H8TB 1RUI3 5C8CB 1B35A 1HQNA 1NY71 1RUI1 2BPA2 3VBFB 1NCQC 3VDDC 1AR72 1ND3C 2HWE2 4AEDB 1QJY2 2RS33 1NA1C 2RS31 1TME3 1TME1 4GH4B 4Q4V3 4CEYC 1X33A 1PGW2 4Q4V1 1E57A 2RS12 1OOPC 1SMVA 4RS5C 1FMD2 1RUF3 5DDJ3 1BEV3 2BFUS 1RUF1 5DDJ1 1BEV1 4YVWC 4CDQB 5CFDC 3VBUA 1RUD2 3CJIC 1PGW1 1NCRC 1W39A 2R043 5ABJB 4FTSA 2R041 4JGZC 4N53B 1VBC2 2BFUL 1FMD3 5C8CC 1FMD1 5BNNB 1VBE2 5C9AB 2XBO2 1AR83 3VBOC 1AR81 3VBFC 1HXS2 1RUD3 2HWB2 1RUD1 1FOD2 3NAPB 3JD72 1F2NA 4JGYA 2VQ0A 1TMF2 2XBO3 4IV3B 5K0UB 4YVSA 2WWSA 4QPGA 5C4WA 1ZBE3 2HWB3 4GB32 1ZBE1 2HWC2 1FOD3 2BBVA 3ZFFA 3JD73 1FOD1 3JD71 5D8AA 2R063 2R061 2IZWA 1AUYA 1TMF3 2MEV3 1TMF1 3VBRC 2MEV1 2PLV3 2PLV1 1VBA2 5ABJC 4Y4YA 2RM22 1RUJ2 5BNPA 4N53C 4Y5Z0 1M06G 1OHFA 2HWC3 1QJZA 5FMOL 5BNNC 4N43C 1NA1B 5C9AC 2X5IA 5A33B 1QJX3 1C8NA 1FPN2 1QJX1 4CDXC 1PO23 1OOPB 1PO21 3NAPC 4GMP0 1RUJ3 5AC93 3ZFGC 5L7OA 1RUJ1 5AC91 4RS5B 4WM8C 1NY72 1ZBA2 2HWD2 5JZGB 1QQP2 5CFDB 3JB4C 1HRI3 1RVF2 3CJIB 3DPRB 1FPN3 1HRI1 1PO13 1NCRB 1FPN1 2HWF2 1PO11 1X36A 4JGZB 5BNOC 2TBVA 5CFCB 1ND2B 1TME2 4LLFA 1ZBA3 1AL22 1ZBA1 2HWD3 4Q4V2 1NCQA 3VDDA 2HWD1 1ND3A 1QQP3 3VBOB 1QQP1 1AR62 1RVF3 1RVF1 3J8F2 2HWF3 2HWF1 1RUF2 1OPOA 5DDJ2 1BEV2 3VBHA 4CEYA 1AL23 1AL21 2WLPA 1RUC2 2R042 4PDWA 1AR63 4IV1B 2WZR2 1AR61 3J8F3 1R1A3 1BMV1 3J8F1 1R1A1 4YVWA 4WM7B 5LK7B 5JZGC 1AR82 3VBRB 1NG0A 4Q4Y3 1RUC3 3DPRC 4Q4Y1 1RUC1 3ZFEB 4QPIB 5A32B 1RUE2 5J96B 1H8TA 2WZR3 1PIV2 5C8CA 2WZR1 5CFCC 1ND2C 1K5MB 4N43B 1MQTB 3VBFA 1C8M2 1F8VA 4RR3A 2R073 1EAH2 4AEDA 5FOJB 4CDWB 1ZBE2 2R071 3M8LA 4CDXB 4FTBA 1RUE3 3ZFGB 1PIV3 1RUE1 2R062 4GH4A 1PIV1 1R083 3VBUC 1R081 4WM8B 2MEV2 2PLV2 1DDLA 1C8M3 2ZTNA 1C8M1 4IV1C 1EAH3 1EAH1 4CDQA 4WM7C 5BNOB 4BCUA 5GKAC 1COV2 1AL0G 3VBSB 1VB4A 5ABJA 1QJX2 4JGYC 4RQPB 4CEWB 1PO22 3ZFEC 2WS92 4QPIC 4CDUB 5AC92 5BNNA 1VRH2 5C9AA 4YVSC 1K5MC 4NWWA 1A6CA 1MQTC 1COV3 1VBB2 1COV1 1HRI2 3NAPA 1GFF2 1PO12 4CDWC 5D8AC 1CJDA 2WS93 2WS91
chains in the Genus database with same CATH superfamily
1B35B 1RUG3 5FZKA 1HQWA 4P00B 4QXBA 1S2EA 1VRH3 2YUEA 4I09A 1OPMA 4IV3A 4QQPA 5K0UA 1HB3A 3O1UA 3ZYGA 5JIUA 4CCMA 1MS3A 1XE0A 2JENA 5F3GA 1VBB1 5AFEA 3KVAA 4UW6A 2RR12 5CKNA 4XXAA 4AVSA 4PIYA 1A8DA 3VKMA 4CU6A 2ZMKA 3ACGA 4WBBA 5KWRA 3VB9A 4MVTA 5HI0A 3NQHA 3HNMA 5LBBA 5LATA 3VL8A 4Z82A 3RNSA 2AR6A 4QHZA 2XMLA 5FMDA 4MUVA 1OF3A 2A71A 1V9U1 3K2OA 4RQPC 4UW3A 4YW3A 4CEWC 3B7MA 1AYM1 5K9YA 5J09A 5F9TA 2AEZA 1CVNA 1WBLA 5FOBB 3DL3A 2C9AA 2RR13 5F1RA 3GDBA 4NRPA 4P08A 4CDUC 4KMQA 1R1A2 2UWBA 1V6KA 1CPNA 3EHKA 4QX0A 4M3CB 5FXXA 3KT7A 5FXZA 2Y26A 1W6OA 4RHV3 4YYOA 5I0RA 3O0WA 5FPUA 3RZHA 3C7FA 5CG8A 3EJKA 2AZ5A 2HEWF 3LSEA 4B8EA 2WT1A 3D3AA 2FCTA 2WNOA 4LO5B 5DZGA 3VBUB 3WNOA 4LBJA 1K5JA 1SBDA 4B1LA 4Q4W1 1GWLA 3FE5A 4Q4Y2 1BVP1 4CUBA 1AR92 4BQ1A 4J25A 3WQBA 4B7EA 2ZX4A 2V5YA 2WFF3 4NO4A 3NV2A 2XR4A 1HQLA 1DZRA 4RS5A 3KCCA 1NX9A 2IUWA 4Y1UA 3H7YA 1VBD1 3OF1A 5F8PA 1PVXA 3ASIA 4KH9A 5FYTA 3L2HA 5JZGA 1SPPA 4QX2A 4RR3B 2OXBA 3T3YA 1JBCA 2UY8A 1QNYA 4SBVA 4Z92B 2NN8A 1O91A 3FJSA 4DUWA 1NLRA 1KDKA 4QX5A 2W94A 4A45A 1AR93 2CWMA 4JGZA 1ZRDA 1JU3A 3H8UA 1D4M1 1BQPA 3H7JA 3VBHC 1DQ5A 1ND2A 1UY3A 4H14A 2BDRA 1XC6A 4PQQA 1ULGA 3CJXA 4GMP3 4NIGA 2DUQA 5GM0A 3HQRA 3THDA 3OYWB 4FPLA 3WG1A 2QQWA 1MVQA 2YBSA 4I0BA 4PDWC 4M0HA 4QPGB 5C4WB 1LR5A 2OVUA 3OGJA 2BERA 3HPNA 1QJY1 5F39A 1CAUA 3VZMA 3O1RA 2WNVC 3IDBB 3OEAA 4COVA 2W52A 2D98A 2UYAA 3AB0A 2CGOA 3ILFA 5SV5A 1H4GA 5FZ0A 1GR3A 2OA2A 4Y26A 4FOQA 5H9QA 4C0BA 5CZKA 3ZYHA 1QIQA 5FK8A 1B09A 1W0PA 4HOOA 2WNUC 1EYBA 5CYYA 4DB5A 4EWDA 2WYFA 4GWMA 4JRLA 4Y5TA 2XPJA 4DZGA 4K9SA 4XUQA 2VMEA 3AMPA 2HYKA 4WM7A 4AGVA 4AXOA 1AX2A 2QTWB 3MW4A 2Q0AA 2ZMNA 1XNCA 1WCDJ 3PVNA 1UY1A 4OCTA 1VP6A 4K21A 4AEDC 2RS52 4AVTA 2EIBA 1WKYA 5A7QA 1YEWA 4HETA 2P6CA 5I8YA 1K45A 3HD8B 4LK7A 4ZXEA 2K46A 2VW2A 3AKSA 4AFCA 4KG8A 5JI7A 5A32A 4GH4C 4EJRA 1VBE1 1S0BA 2GMMA 4BE3A 1W2OA 1K5MA 5HV0A 5JSRA 1PX3A 1MZFA 1W2NA 1HXS1 1EV11 1QKQA 2H0BA 2BRTA 2RG4A 4A6OA 4Y4RA 2YC4A 5L73A 4BISA 1C5IA 4DY3A 2L9LA 5IFPA 2RS53 4Q4X2 1US3A 4QU1A 1F31A 4CDWA 1O5LA 5DQ0A 5GZEA 1IZ3A 3ZFFC 2LS6A 3I97A 1ZZ8A 3WNPA 3ITQA 1AYN1 4AQ6A 4Q0SA 2QQVA 4ZY9A 1T6GC 3KT1A 1GQHA 2BWCA 4MO3M 4URTA 4Y3OA 4TWTA 2IVJA 4OZOA 1O7FA 1G6NA 3SMHA 4HFSA 2G9FA 1MEC1 2FMDA 2HWC1 4JC1A 4F3JA 3E6CC 1PNFA 3OGGA 1CX4A 4Q4X3 3ST7A 3LOBA 2QQKA 4FPHA 1S4CA 2PHLA 3MFCA 5KHGA 2P3KA 2AYHA 4ES9A 1JODA 2CYFA 1RB8G 2XGXA 5BNOA 4Q0PA 3VDAA 4FXKB 1WWYA 4OLLA 3KV9A 4Z1VA 2GC1A 3R0RA 1VBA1 2E31A 2VQAA 1JZ8A 5T54A 4CA9A 2RM23 4IQPA 4Q1PA 3O0VA 4Q4W2 1DQ2A 4O9GA 2LW8A 3ELNA 1RUI2 3SLIA 3HN1A 4EZ4A 2BGPA 1WLCA 4URAA 4R8HA 1DQ4A 1OH4A 2CDOA 1KS5A 3LDBA 4QXKA 4YG6A 5FO8B 5E16A 4ARYA 2E26A 4OI4A 1HN0A 2R6QA 3I2GA 3D4KA 5GLTA 3TYJA 4FVVA 4UAPA 4XZPA 1LOFA 4YGEA 3RRDA 4CXYA 3VZOA 4LULA 1D2SA 3CNAA 4W65A 2VMFA 5E1RA 1DGRA 5ANNA 1NLQA 2VUAA 2ZGKA 4Y20A 5F6KA 4D6SA 1W0OA 2GH8A 2HEVF 2QQPA 3WF2A 2VW0A 1ASJ1 3A0KA 1RUI3 1Y3TA 2W92A 1HQNA 5T50A 2Y64A 4M4RA 1EPWA 2ETEA 3KHBA 4MGSA 4QB2A 3ACHA 1GP6A 2Q1ZB 4LK6A 3UGHA 2W91A 1H2LA 1LHVA 5BY5A 4BQXA 3BOPA 1CZVA 3QACA 4H2AA 3W58A 3BIEA 3O1MA 2ZA9A 1OURA 3V56A 4IGQA 4NRMA 3T2QA 4JZRA 4JDNA 3VDCA 5FYBA 1CAWA 4E2QA 4YRDA 1QJY2 1ULCA 3KZ4C 5H9SA 2V73A 2VY0A 2CAVA 1LGBA 1NA1C 1V6MA 2ET1A 2P3IA 2WDBA 5T5JA 3ZSEA 4KBZA 2DVGA 4CP9A 1JZ7A 1TME1 5FY9A 1W6MB 2AENA 3WF3A 4Q4V3 4CEYC 1X33A 2LRPA 2LTNA 5GLUA 2XVGA 3RMYA 4FBFA 5GLZA 1OOPC 2C0ZA 1Y9GA 4N90A 1H2MA 4YSFA 1JZ3A 4XJ9A 3MICA 2FDHA 1YI7A 3K46A 5IK7A 1FMD2 3D82A 1BEV3 3C7EA 3MIEA 1RUF1 4JTOA 4LBOA 4YVWC 3AXEA 3R4UA 4OI0A 1A3KA 2VBDA 2VVEA 2VW1A 4AVVA 1JYTA 2YBKA 3I2KA 2D5FA 3ZSLA 3H0OA 2VG9A 4GALA 2XQRA 1S0CA 3CJIC 5I93A 1RXFA 2JG9B 1NCRC 4MHRA 1Y7BA 5FY8A 4E9KA 5ABJB 4FTSA 2R041 3ZN6A 3SITA 4Z2AA 5EP9A 5LA0A 3POGA 3OG2A 4HT1T 3GCWA 5IVBA 2BFUL 1MR5A 1FMD3 4P5YA 2CGNA 3RWKX 1UU6A 2YPJA 3WR0A 1VBE2 5C8CC 5KBFA 3B93A 1CIYA 3AZYA 2GN7A 2HYXA 3BI3A 1U5ZA 4XFHA 3VBOC 4XMIA 5LB6A 1MS5A 2VH9A 1HXS2 4FPCA 4QXHA 4FPKA 5T5OA 2UWAA 2VPVA 4XXPA 2QQIA 4PLNA 1YQCA 3ZKUA 3H50A 3NAPB 2JDMA 1POQA 5JXHA 4COYA 2J1UA 3LEMA 5FUIA 2XLGA 4I02A 1HB1A 2GNDA 5CADA 2E7AA 2H0VA 2IFRA 1OUXA 4YVSA 5KXBA 3GJBA 5F5AA 1Q3EA 4Y1YA 1BYHA 4YPJA 5A6XA 1O3SA 3I2JA 2CL2A 2PHRA 3V64A 5CVRA 2HWC2 4IE5A 3CBNA 2BBVA 3MDPA 2RJKA 4AI9A 3PJYA 1QEXA 2C6SA 2BW8A 2R063 5D8AA 1RC6A 1BMV2 5FBZA 4GZ9A 2QVSB 2IZWA 2VZTA 3M2MA 2MEV3 2WSUA 1UPSA 3ILRA 4D8MA 4A7YA 4LKEA 1VBA2 4QKDA 1AHSA 2MNGA 2R1BA 2BEOA 1SBFA 3VZNA 5JMOA 1HV0A 3AMNA 2VVDA 1RUJ2 3LAGA 4FCAA 3IKWA 1LKNA 2JB8A 4I30A 2HWC3 4HLTA 4EN6B 3IAQA 1CIWA 4AZZA 3VD7A 5C7GA 4KU8A 5EJ3A 3K4ZA 2VNRA 4QM8A 5FZHA 4WZCA 3RZLA 3USUB 5F6LB 2E53A 4AI0A 4NJ4A 5FJKA 3VZKA 3O1TA 2P34A 4GQ7A 1LU2A 1S0IA 3AZXA 3KV6A 1UXZA 2TEPA 3N36A 4CPBA 3HVDA 1RUJ3 4M00A 1HJGA 3ZFGC 5FMBA 4ORFA 5AC91 4PI2A 3MZHA 4ATFA 4WM8C 1NXD1 3W9AA 4ONUA 2XJQA 3SKVA 1Z78A 2A3YA 2DU1A 5A3TA 1QQP2 1J84A 1Y9QA 1QF3A 2EXKA 4AGGA 5EIYB 3VLBB 2QE3A 3PMEA 1OA2A 1ULFA 2AGSA 3ME2A 5FZBA 2Q5TA 1PO13 2PHTA 1OFSA 3M4FA 3T1MA 1OD3A 5IVYA 1TVGA 5FZ8A 3TEYA 3M3OA 1TME2 4LLFA 1TNRA 1XBFA 3J26N 5EHDA 1ZBA1 3LIHA 3AKTA 1NCQA 3VDDA 2HWD1 4QM9A 1GZTA 4LUMA 1LNSA 1ND3A 1OXCA 1QQP3 4GIQA 4WVZA 3PU3A 1AF9A 5L9VA 3QCWA 1TEIA 5JOWA 3K4AA 3J8F2 3CF6E 2QDNA 1O8SA 1SG3A 4CCLA 2YU1A 5FYIA 2QZ3A 2HWF1 3OBZA 5L9RA 3WHTA 1RUF2 2XQXA 3DECA 3J7MA 5KHHA 1ENXA 1DU3D 1UPIA 2JICA 1PX4A 4I01A 4KQ7A 4C0HA 2PFWA 3VBHA 2VUJA 3H42B 4BXFA 1AL21 4CPBD 1JN2P 1HW5A 1W8NA 1U5IA 3GZUC 4MOAA 1AX1A 2R042 3GALA 3LKJA 4PDWA 4GWJA 5ISLA 2VM9A 4JKKA 4LBQB 3O14A 4X6QB 3J8F3 1WA6X 2Z42A 3BVCA 1OF4A 2O0OA 2Y0OA 3OUIA 4K8RB 2WNVA 3GNEA 2W1WA 4NR1A 4RSUA 1LOAA 4ITCA 1QOOA 2LROA 1W2UA 3PHMA 2YV8A 3BU0A 5JZGC 2WBKA 1D0HA 1YFUA 1C28A 2HH9A 3UGGA 5GZDA 3O7OA 1SACA 1NG0A 4KGGA 1PK6A 5FQ0A 5IATA 2DWRA 1FT9A 4YGBA 3K3OA 3I3DA 3ZFEB 1ENQA 5F37A 4HSLA 2R1DA 1VE0A 2DV9A 4QPIB 2VZ1A 4OQ8A 1YNAA 4IERA 4EWEA 2JDPA 3GZAA 4KNCA 5DABA 1KFXL 1JOPA 1MS4A 1ND2C 2ZHLA 1VPHA 3AK0A 1C5HA 2BP6A 3ZIXA 2BNNA 1YLLA 1GNYA 1GQPA 2OZJA 2VBBA 5GZCA 3VBFA 2WQ4A 3WDWA 3ZYJB 3CMGA 2BBAA 4CE8A 4MGZE 3CDZB 4NPRA 3U07A 3POIA 5K8SA 2DCTA 3ALQA 1YO8A 2GP3A 4AEDA 4MG2A 4CDXB 3M8LA 4XYXA 4MGKE 3L9JT 2DCZA 4FTBA 3AJYA 3AZZA 3K51A 2Y0IA 3HWJA 4XOGA 2BYVE 1RUE1 4NHLA 4GH4A 1PIV1 3SQOA 3LOIA 3VBUC 3WNKA 1QH7A 4SLIA 4L97A 2PQQA 2ZJCA 1O6UA 1DZTA 4FP3A 3AP4A 2EAAA 5EZWA 2G4IA 4YGCA 2A7AA 2CAUA 3WV6A 1C8M1 3U75A 2EXJA 1H9WA 1JOJA 1JYIA 2JE9A 3LA2A 4QKBA 2D40A 2OW4A 1TZOA 1LOEA 1PM7A 2XHNA 4F8AA 3OUHA 4WM7C 4BCUA 5JPMB 1IGOA 1UNBA 3U0ZA 1ZVFA 1COV2 4BMBA 2ZX2A 2WUHA 3KD4A 5FY7A 3UGFA 4BJ0A 3UNPA 1IG3A 2QQMA 1SCRA 2B39A 4UW4A 2VVFA 3NNGA 1JOBA 1RUOA 1UYXA 2WO7A 5AC92 5C9AA 2EIGA 1OKQA 1Y4WA 1K5MC 2YC2A 4E8DA 1A6CA 1XE8A 1UQXA 2RDQA 3VN4A 5FP8A 3C7GA 1COV3 3G7DA 2ES3A 4I0WB 4LO6B 1OBNA 1F9KA 2NQYA 4L99A 4PHZA 2HEYF 3B01A 2Y38A 3MPPG 4YM1A 5A7SA 1J59A 1W8FA 1E5RA 3ZN4A 4CDWC 5A6YA 4C1WA 2F6BA 2WT0A 2FBEA 2WN3A 3C7OA 5FKBA 3I3MA 5LA1A 5C71A 2EALA 1PMHX 1RUG1 5J98B 4NROA 2WN2A 4BK5A 3A21A 3K75B 4BIFA 1VRH1 5FZ7A 1Y9MA 4LBNA 4CXXA 1WCSA 3FL7A 3EBRA 4WVWA 1JTZX 4QD2A 4XFAA 3I59A 4HVQA 5IVVA 2JWPA 1QHDA 3AL5A 3FWEA 3KV5A 4FPYA 4O61A 4QHBA 2CNAA 5F5CA 5FP4A 3IB3A 5BXXA 5LASA 3MO4A 2VMHA 1PVC2 2ZABA 2ZGQA 1VRBA 4UF0B 3V0AB 2WIIB 5T5LA 3ZXAC 3V65A 1WW4A 5KC6A 5DAPA 1IKQA 4QQOA 1NKGA 1GICA 3I2HA 4PBPA 5FKCA 2RMU2 3E5QA 3O1SA 3KSCA 4DRRA 1ZRRA 4DXSA 2PHDA 2E6VA 1D7PM 1KJRA 2D97A 3IMMA 1URXA 3FC0A 1YRZA 3JB8A 2DCKA 1RTVA 4PLOA 5FZOB 1PVC3 2RR11 2FDFA 2GZWA 4W6XA 1NA1A 1H30A 4IEQA 4RHV1 3WNLA 1FX5A 1ZRIA 4CCDA 1RHI2 5FV3A 2D6PA 2B7YA 1LOFC 2E7QA 2RMU3 2NZ9A 1PZ9A 5GALA 5JOZA 1CESA 1OOPA 2G9GA 2W1SA 3RZGA 1N1TA 3WNNA 4YG3A 2R0HA 4BOWA 2E33A 1S0GA 2WFF1 3N35A 4XF9A 2BVVA 3BU7A 4JDOA 1BVVA 1KITA 1OMIA 3KF5A 1OI6A 3URFA 4ASMB 1NQJA 3LWCA 3RMXA 1RHI3 5DUXA 4NHKA 3FBMA 2JDZA 2J1EA 4LIVA 5FYVA 2NPIA 3CJIA 3D0SA 3KQ4B 4EZHA 1NCRA 1C3HA 4Y22A 2CGPA 2JG8B 4JGYB 5BV6A 4OUMA 1UO9A 3INAA 1ZZBA 2ERFA 1AR91 1A8MA 3U37A 3GYDA 3QH7A 3WQ0A 1DGWA 3HNYM 2VQTA 2Q1FA 5FPVA 2JXAA 4XBLA 4HVRA 2P5BA 2LUWA 2VZ3A 2DF7A 4GMP1 1AR73 1OH3A 1ST8A 1ZX5A 2ATFA 2PAEA 5CIRA 3S5QA 1H1IA 2OIIA 3VBOA 2YBPA 4QGMA 4QHOA 1JU4A 2NM1A 1ZZ9A 1X9TA 1LOGA 4HMZA 4LA2A 3RYRA 3N4MA 3GJAA 5EWSA 1POV0 1Q5OA 3GM8A 1TG7A 1NAEA 1CAVA 2KM2A 2RS13 2ZEZA 2OX0A 1RYYA 5JCTA 4RFRB 3WP6A 3SCHA 1GV9A 2PMWB 2WA3A 4IV1A 2ZGOA 5FTTC 5BNPB 1W0NA 2ET7A 4A4AA 1CZSA 5IWFA 5FLJA 3NJZA 4Q8LA 5CBLA 4JX0A 4WV8A 3RZMA 5T52A 3T2OA 3WCRA 2FDKA 1HIXA 3L2YA 1EUUA 2Y6JA 3AP5A 1BBT2 4MXWB 3S6PA 4AE2A 4PLMA 4LA3A 4MX3A 4XETA 5FUNA 4MHUA 4PI0A 2HLEA 3MPBA 4GJZA 4OVEA 1VBC3 2Y60A 3DUIA 3AL6A 1RUNA 4KWUA 3LGRA 3U10A 2JD9A 4CYDA 5LBEA 1Z7S2 1NYWA 2J42A 4XJZA 5SV8A 5IK5A 1RUG2 4H7LA 3WY6A 5JOYA 2YPDA 1VJ2A 4NAOA 1ULEA 5CB7A 4AK3A 2GP5A 1UYPA 1UOGA 1BBT3 1VR3A 1RUH2 2PHXA 4Y24A 4OUSA 1HB4A 5IAVA 4KU7A 4EYUA 4YW5A 3Q8AA 5C8WA 4CP1A 3ETQA 2PAMA 1GNHA 1YYNA 2RS51 3EXUA 3T2PA 1ZRCA 1WBFA 3WDXA 2XJUA 3RQ0A 1N1SA 4DXTA 2ZHMA 3ZFGA 3N7LA 1Z7S3 2GN3A 4GXLA 4IEXA 4WM8A 5J3UA 4G4FA 5LA2A 4Q0QA 3WCSA 2JEMA 5LEJA 4QX8A 4BIOA 5JVVA 5DG2A 1RUH3 5A7OA 4A3XA 3AKQA 4NHMA 4K3UA 5FO7B 1OQDA 4IEWA 3ZSMA 1W6PB 2C5DA 3AJZA 4Q4X1 3PIJA 3FUOA 4AVAA 4AL9A 4D6RA 4C91A 1A34A 4YM3A 1SDWA 2K2SA 4RHV2 4MGYE 1TE1B 3WD5A 3LPGA 3QH6A 3VBSA 4K8FA 3RVHA 2WT2A 5KHKA 4QB1A 4P02B 5LBFA 4UBGA 5HCBA 2RM21 1WMDA 3DXUA 1H1AA 3OY8B 3I4IA 3FBYA 3G6JB 3I2IA 1DLLA 4NUBA 2WFF2 4AEKA 4DEQA 2CDPA 5BYNA 1DBNA 1N47A 3CL1A 3VKFC 2VZRA 3VGIA 3IM0A 1T2XA 4L9BA 5FO9B 3SXWA 4BYYA 3UETA 1GOHA 1IPKA 3POSA 4XF4A 1DGWX 3MIBA 3O0XA 1GZWA 5JXJA 1PZ8A 2DTWA 2V4AA 2HJIA 1WW6A 2RS32 3IAPA 1S0FA 4IDZA 4P9IA 3DYOA 4V1PA 1H8TB 1MPXA 3KCYA 1B35A 1NY71 4BPZA 1RUI1 1GBGA 1XPWA 3NKGA 1G9BA 3VHRA 4COWA 1JYXA 1R64A 3KV4A 3CZUA 1NCQC 3VDDC 2O14A 3WHUA 1O3RA 3HOBA 1OLRA 1ND3C 1YFYA 2D5HA 3T0AA 3ZOIA 4JKMA 5LBCA 1DQ6A 4IETA 4J1WA 2RS33 1REFA 3UJQA 4GKYA 2P4EA 3FX3A 3ETPA 3DYPA 4Y33A 4IL7A 4ZS3A 3PLQA 1CN1A 1PGW2 1LCLA 5C5TA 4N9IA 4Q4V1 2ADEA 3WEZA 1E57A 1JZ2A 5EV7A 5IT6A 3NJYA 2B8MA 3JZVA 4CP0A 5DXDA 3OEBA 1CPMA 4QGNA 4XACA 4X8NA 1FATA 2BFUS 3GZTB 4IEUA 3FLTA 1OQ1A 1BEV1 4MYEA 1M4WA 1QXJA 2IXLA 1XU1A 4M3CA 4OHZA 4CDQB 4HPKB 4QAWA 4DUVA 4IGOA 5F5QA 4ZHNA 4JVAA 4CUAA 3MUY1 3VBUA 4BLIA 3E5UA 4M3CF 5FY1A 3S57A 4QX3A 5DUWA 3MGUA 1PK6C 4WZFA 5J48A 1MVEA 3GHMA 4Y5SA 5JI9A 2VTFA 3OGVA 4B1MA 1JYWA 3DV8A 2I74A 3A4UA 1OKOA 2Y6GA 2R16A 2QQLA 1W04A 1W8ZA 3DGTA 2I2SA 1FMD1 2J1SA 5BNNB 2ARXA 1W8HA 2ZXQA 1AR83 4IEZA 4JHZA 2EVXA 2WR9A 3E97A 5GJ6A 2VD7A 3VBFC 5HV4A 2VOWA 3MUZ1 5HCAA 1BK0A 2YHJA 1LEDA 4MLOA 5JSOA 2E51A 2P2KA 1FOD2 3JD72 1UMHA 2A1XA 2VZPA 2VOKA 2TUNA 2H6CA 1XOYA 3BPZA 3PUSA 2VQ0A 4YW4A 3LA7A 1KJLA 1TMF2 4LT5A 2GC3A 2ZX3A 2C9KA 3D6EA 5CKMA 1S2BA 3ATGA 2JKXA 3LEGA 1O3TA 1F4AA 3WX5A 3OYWA 4XC9A 1H6YA 4HKLA 4QPGA 5C4WA 4BHPA 2BZDA 2Y6LA 4HKOA 1ZBE3 3I3BA 1FOD3 3IDAA 3PTYA 3JD73 1GANA 4BQ3A 4DXZA 2F4PA 1QXRA 2R061 3T0BA 1AUYA 1TMF3 5JDBA 3WOGA 1GSLA 2MEV1 2VE1A 4D7SA 5DMYA 4PJYA 4Y4YA 2E7TA 3IZOA 2RM22 3IPVB 4S2HA 4NIIA 1SCSA 4A3ZA 3RYKA 4N53C 1OHFA 5D21A 5EYXA 2HBUA 3TRSB 4AAPA 3NW4A 2NYYA 1OC1A 4RYDA 1AX0A 4ZU5A 2KR2A 4UXAA 3WDYA 1MZ5A 5C9AC 3FMGA 4P9JA 2GALA 4WVMB 3PU8A 2B4KA 4PF5A 5E6HA 1WLDA 1W06A 2BTVC 5A33B 2ZKNA 3LFMA 1FPN2 3E6DA 1QDOA 4XHXA 4HBNA 4BQYA 1O4YA 4CDXC 2GNTA 4OUEA 4GMP0 1O3QA 1IS3A 3LD8A 1RUJ1 1YQ5A 2G19A 3FLPA 1NY72 2NMNA 3LEIA 3ES1A 2XDVA 3AYEA 5JR2A 2X05A 3WVJA 1DLCA 5A1LA 2D6OX 4FFHA 5CFDB 3MIDA 2VCBA 1W9TA 3DPRB 1FPN3 3WP3A 3QOPA 5F3EA 1PZ7A 1PO11 4GULA 5GLWA 4Q8KA 1CR7A 2B45X 1UY4A 2X53S 4YZ1A 2TBVA 1IS4A 3SH4A 5CFCB 5DAQA 3WW4A 4FPEA 5FYHA 1UF2C 3UESA 2RHPA 4Q4V2 1BJQA 3HN3A 5A3WA 3OCPA 4NHXA 5I0SA 4XCBA 3TBDA 3W21A 5FP9A 3KS7A 1QQP1 2A6VA 2VQUA 3WNMA 4EN0A 2BV4A 4Q1RA 3NNJA 3SCFA 4FOYA 1NZCA 3RJRA 4BDVB 4TYSA 1IG0A 1OPOA 4Y1ZA 1BEV2 2P17A 2R30A 3MEPA 3IBMA 1V6OA 1G86A 1W6QA 2OYZA 2ZGUA 2W39A 3UYJA 5F2SA 1H1MA 1C1LA 1CJPA 1RUC2 3HJRA 4P14A 3KLSA 4M3CE 1UMZA 3RS6A 3KWVA 1Q8SA 2DVBA 2WZR2 4LKFA 3ZXFA 3PUIA 3J8F1 1H9PA 1CQ9A 2QQNA 1REEA 5FZEA 5LA9A 4B3NA 1JH5A 4PQ9A 3U78A 4E2GA 5B4NA 2B46X 3BN6A 3VBRB 3DF0A 4AFBA 3VD3A 1UZYA 3LSDA 4OFGA 1ULPA 2JX9A 4AAXA 2O8QA 1RUC3 3ZXJA 4XJ8A 4BQ2A 3ORJA 1ZZCA 1VALA 1KDMA 3V0BB 1MACA 2WZR3 3P3PA 3M3EA 4FPJA 3N7MA 5CAZA 2W0XA 3LQCA 4CU8A 1US2A 3AKPA 1MQTB 2OUHA 4N43B 4RGAA 1NT0A 5HBAA 4Q27A 4ZZ8A 1X7NA 4LO7A 2KXLA 3RWNA 4ZPIA 5GZGA 4V2WA 4OHWA 2ZS6B 4Q26A 4YFWA 3IWZA 2R073 1EAH2 5FOJB 4FPFA 3UJOA 3THCA 4XZUG 4E8CA 1PNGA 3N9OA 4V2VA 3MW3A 4EQVA 2R062 4QWNA 3VD4A 1R083 1W6MA 1WMXA 4PBOA 4AG4A 3BTAA 3PURA 4TSVA 2JDUA 2MEV2 4Q0UA 5FMCA 4XF0A 1FNYA 4IXLA 1DP0A 2XLFA 1UZ0A 1WCKA 1QMJA 3NWKA 1DYOA 4CSWA 1LJ7A 4IV1C 1EAH3 4KWKA 2FQPA 3ZSJA 3LPFA 1NUKA 2Y33A 4AHYA 4E4DX 2HBTA 4JV4A 2ZGTA 1G7YA 1H4HA 3ZR5A 2O1QA 2GMEA 1HV1A 2D44A 1JZ5A 2QZ2A 2DYCA 2W46A 3VKLA 2A5ZA 3KM5A 5GKAC 4BMEA 3WLUA 5FK7A 5FYUA 4CCEA 1U0AA 2JG9A 4Q0VA 3JQXA 5FZGA 3SNMA 5ABJA 2NP0A 2JG8C 3N7JA 4JGYC 3TEXA 1DHKB 3M70A 4RQPB 4CEWB 1FI2A 3ZYPA 1Q43A 3HT1A 2XG3A 1KRIA 2Z4FA 4CDUB 2WQ8A 4XF1A 2GH2A 2VJXA 3J7NA 1ONAA 2AACA 4X6RB 2QCSB 3H3ZA 3ZDSA 1UYZA 4NWWA 4MGTA 1H0BA 2I45A 4D7YA 1UZVA 1OA3A 1IS5A 2WSVA 2JB4A 1UMIA 2V09A 2WZEA 1COV1 1LGNA 1UAIA 3NAPA 3MLLA 1PO12 4QKFA 3PVEA 1CJDA 1WMFA 1F35A 3APBA 4OYUA 3EB7A 3F2ZA 1ZZ7A 4XE9A 4G9SB 4R4XA 1OA4A 1LOBA 3P6BA 4AI2A 4XUPA 2KA3A 4C8DA 2XXZA 3IMNA 3B00A 1QOTA 3BTZA 4QDSA 5EXOA 3WDVA 2FZ1A 3U4XA 3NV1A 4IW3A 5BNPC 4ZONA 5I0UA 2VZSA 1J58A 2B9UA 5APAA 4FAGA 1W2TA 4H3WA 4QDRA 1IPJA 2D6MA 2JE8A 4XJUA 4DNYA 5FZ3A 3B02A 3UK9A 4UFJA 2QDRA 2W1QA 2Q8EA 3MLKA 3TB0A 1QJU3 1KFUL 2NMOA 2VUCA 2ZBJA 3BIWE 1ACCA 3NKTA 4PF1A 2ZCWA 3VBSC 4LO4B 5DAVA 3TN92 3AM2A 3N9PA 4GD4A 2DTYA 4R9AA 5DPNA 1PGSA 1QOSA 5JAXA 4COUA 1IPSA 4XFCA 3JBG2 1YCIA 1G9AA 4CZSA 1PVC1 4AI1A 1ALYA 1LHUA 5T3NA 3D5OA 5A1AA 2D7FA 1XYPA 3USUA 2E9QA 5FPZA 3ZMNA 4DUXA 3HAGA 4OHYA 2RMU1 2UURA 5GLVA 3GCXA 1RL3A 3AZWA 2EXHA 2VECA 1MS8A 4L0PA 5LK5A 3TN93 2WNUB 4D69A 2W87A 4ARXA 5JMCA 5ACA2 4BM8A 2IXCA 2W47A 4IEYA 3JBG3 5A7WB 2AH2A 5FZ6A 1DYPA 1V6IA 1B35C 2I07B 3EYPA 4LHKA 1DF0A 2UY9A 1JS9A 4YZ4A 2BNMA 4XJAA 3K4DA 5FWEA 2PHUA 1RHI1 5JOXA 2QKDA 4UT5A 2DFBA 4AHXA 2AC1A 2XH6A 1ODNA 1RMU2 2WO3A 3B69A 4AVBA 2ZX0A 4KWLA 5C5UA 1JI6A 1CGPA 1XNDA 3UT0A 2D3PA 3IDEA 5ACA3 4XPVA 1GP4A 2XKPA 5CISA 1D2QA 3BGAA 3PTRB 5L19A 2VTXJ 3AXDA 5KXDA 1QXPA 5G05L 2A6WA 1AR71 2DUOA 2V5DA 1FV3A 1U5XA 2PQSA 1JUIA 3ENRA 3KCXA 2HWE3 2Y6HA 3AYAA 4NWVA 5FJHA 1ZA7A 4K40A 1RMU3 5F3CA 2RV9A 3ZFFB 3H8OA 1X8MA 4FT8A 1HLCA 3T30A 1YFWA 4RFT0 4AQSA 4DOUA 3ABZA 4YZ2A 4P9YA 4LORA 3ES4A 2ZGLA 5JXGA 1N3QA 3E5XA 1ZZ6A 2EF6A 4XCAA 4IE4A 2RS11 5JPNB 3M7AA 5KXCA 4LHLA 2Y6KA 2Z2SB 5LEKA 2YGLA 3AYCA 1H8TC 5FBJA 4LBQA 1CONA 1W9YA 3HNBM 4XQDA 2J1AA 4BK4A 3OPWA 3TNQA 3WG4A 3OBRA 4XILA 1CWPA 2ARAA 1P8JA 2BUKA 4IGPA 4XQWA 3RGBA 5FPXA 2K0GA 2AUYA 1XRUA 2VO5A 4YFZA 3IDCB 4B29A 4RR3C 2X5IB 3DYMA 2ZEYA 1HRV2 3BTYA 3TAYA 4UOJA 5FFOC 4U36A 1MS0A 3WP4A 1RITA 4UFIA 4NIDA 3ZFEA 4LXLA 1YJKA 4QPIA 4Y1VA 1VBC1 1NXMA 3C8XA 1J1LA 5L7OB 4N53A 3SEEA 4QB6A 4I3GA 3W5NA 2DURA 3S30A 4CCKA 2DVFA 4H55A 1R092 1ENSA 1LULA 4Z8BA 3WQ1A 1BBT1 4LE3A 4QPGC 5C4WC 1HRV3 3VL9A 1EUTA 4RA0A 3JQWA 2W2IA 3KGLA 3M3CA 4AWDA 4CDXA 4CDQC 4NAMA 2BJSA 3WG2A 5T5PA 1PMIA 5J37A 1S0EA 5LW9A 4A42A 3NV3A 1Z7S1 2XOMA 4QMAA 1CAXB 2OQ6A 2WABA 1AZDA 1R093 2ZHNA 2OT7A 3FFQA 5FXWA 4LBQD 1X9PA 1K42A 2LALA 3HQUA 4GB33 1RUH1 4P9LA 4K20A 4S2FA 3R6SA 1WCQA 5FZCA 4DMIA 2DU0A 1WUVA 1QDCA 2PN5A 2OS2A 4XEZA 5KXEA 5K4LA 3RI9A 4K1ZA 2DBNA 3MLJA 2W9XA 1GMMA 4CEYB 1POV3 4C1XA 1JMUB 5JUVA 3OPTA 5D1IA 4Z2WA 2F4LA 1I1EA 3ZDVA 2EXIA 1DIWA 2Q8OA 3ZSKA 1V00A 1SHWB 4A7KA 1BXHA 3JU9A 4D94A 2J22A 4FFFA 3RG0A 4YVWB 2E63A 3AVRA 1ZNPA 3ZXKA 2KD7A 1W9FA 2ENRA 4XFGA 3GGLA 2VULA 2ZGSA 4FSJA 4XUTA 1NE4A 2J1VA 5IK4A 2R32A 3MBWA 1CZTA 1F15A 5JIAA 3UV9A 1BK1A 1Z0HA 4BB3A 2ZAHA 3R4SA 4OI2A 1YQ8A 2ARCA 2A73B 2OKXA 3MIFA 2WYSA 4A7ZA 2D3RA 5FUPA 1L7RA 5C8CB 5A7NA 3CZJA 2BPA2 1AJOA 1VMFA 1YHFA 1H8VA 1LHOA 3I2FA 2XKOA 4FFIA 1AR72 2WA4A 1AJKA 4BZ4A 1WA4A 3M3QA 5IVFA 1V70A 4QQ2A 1AXKA 3BUCA 1UL9A 1V0AA 3P1IA 3GXUA 1UYYA 5C6CA 2RS31 4UF0A 1OLQA 2A75A 4QGLA 2ORZA 4OI1A 4EN7B 3V0AA 2VZQA 1QJEA 4AHWA 4LITA 2ZAAA 3RSJA 1W6NB 5FZ1A 4NPLA 2ZOEB 2RS12 2WC2A 1UW8A 5BUVA 1SMVA 2IXKA 3OBAA 3OD0A 4XMAA 1UKRA 5D2AA 5EJZB 3VHNA 4EN9B 1LODA 2G9ZA 5DDJ3 1GKBA 1UKGA 4FO9A 5FZOA 5DZEA 3RYPA 4AW7A 2FDIA 4ISQA 3W5MA 2XL7A 5JXIA 4JDMA 2TNFA 3OB8A 5DUUA 3AP6A 5CFDC 2WJSA 1WLWA 1RUD2 1PGW1 3ZYIB 4A6SA 2GC2A 1I5PA 5FP7A 1JXNA 4XABA 4YLZA 1YIPA 1XSQA 5A3NA 1SLTA 1VBC2 1NE6A 3I3QA 3NVCA 3N9QA 2OPWA 4BQ4A 2OPKA 3CLPA 1ZYBA 1X50A 4PIXA 2D3SA 3WXPA 4FQZA 1YI9A 1UIJA 5FWJA 1OD5A 5FZIA 1AR81 3EO6A 3POJA 4OHXA 5FDBA 2XWBB 1ENRA 4AVCA 2BGOA 1RUD3 3F95A 2K9ZA 3VHOA 2PELA 2GDFA 5FCCA 5B4XA 1VMJA 2JG8A 4JGYA 1F2NA 4LO8A 4E2SA 2ZGMA 2OZ6A 3A23A 3N3HA 1Y43B 3LB9A 4NIHA 1DFQA 1Q8VA 4FOVA 5FYSA 3JCIA 2P3YA 2WNEA 5B2GB 1FNZA 4QQLA 4IV3B 1XSRA 3TEZA 5K0UB 1C1FA 1SQ4A 5LZ6A 2B9VA 3R4DB 1H2KA 1HN1A 2A3XA 2A70A 2P6HA 2WZ8A 3LIGA 1FXZA 3I2OA 1ZBE1 2WAAA 3AMMA 1AVBA 1FOD1 5FZAA 3DKWA 3PUQA 3WF1A 3JD71 4YW7A 3OPZA 2XWJB 5FY0A 2SLIA 2X10A 1ULOA 4JAAA 3N9LA 5LY1A 2YB7A 4KG0A 1TMF1 3VBRC 2PLV3 4M01A 2N7GA 1GU3A 4GWNA 2JG9C 5ABJC 1G9CA 5BNPA 1M06G 4W6WA 1OFNA 3B3QE 5FZ9A 2B42B 1I5ZA 4K7JA 4N43C 2CTVA 2JDNA 1W6OB 2JD4A 1UX6A 4IE7A 4QT6A 4R9CA 5C3OA 4NHYA 4R9BA 2RDRA 2VZUA 2XJRA 1V6LA 4MXWA 4UFLA 1GZWB 3TEWA 3KGZA 1QJX3 1C8NA 1N3OA 3BYWA 3UKNA 3I7DA 5A1FA 2RDSA 1CX1A 1PO23 4LPLA 5EJ1B 5FZDA 3NAPC 1IS6A 1WD4A 1K12A 4AEMA 2IXJA 1O8PA 1JYVA 4XDPA 1PM4A 1SLCA 3DXTA 2W1UA 5G04L 4RS5B 4L8QA 3K48A 4RL7A 4XAAA 4QXCA 4RGGA 3ZN5A 2ZGRA 4LLOA 1WD3A 5JZGB 1SPPB 4O9EA 2XUEA 3GBGA 4MXVA 3E1F1 2MHFA 4E4SA 3HIFA 1HRI3 1J3QA 1RVF2 3FUQA 4GJYA 4UYBA 2DCYA 4JTNA 3WUCA 4FOWA 2GU9A 3WZ1A 1FPN1 3SHRA 4AEJA 1ZRFA 1X36A 2UWCA 4JGZB 5FLHA 4D7TA 3RZKA 2ZGNA 1ND2B 1YQ6A 4HN1A 2IFWA 2R7EB 4DS0A 3MF9A 5C3SA 1YJLA 1KGYA 4QKNA 2WQZC 2ZMLA 2GNBA 4PT6A 2B5HA 1AR62 1RVF3 3R05A 1N1YA 3PVOA 4CCJA 1W6PA 1CAUB 2Q1MA 3LF7A 4DY5A 4S2DA 2BOIA 1NZIA 3CEWA 4TLFA 3A22A 5FP3A 3CIHA 4JQRA 3WW2A 1UX7A 4DFSA 1RXGA 4LBLA 3ZYFA 3AKRA 3WF0A 1Q8OA 5AFBA 1JYCA 1SEFA 3ACIA 3OGRA 4C90A 3ZXDA 3ROUA 1MS9A 1F4HA 3OY8A 4LR4A 5IJRA 1AR63 3H1YA 3PUAA 4OMDA 4OULA 1QWRA 5I91A 1BKZA 1R1A3 5F3IA 4QDQA 1ZM1A 4WM7B 1SLBA 1NLSA 2C26A 2BU9A 2VNGA 3C2UA 1AR82 2R0FA 2CV6A 3VKOA 3NV4A 4GWIA 4LOSA 1L3JA 1X82A 3OBTA 4Q4Y3 4LKDA 1VMHA 2PHWA 1RUC1 1BLZA 2UYBA 2FMYA 4K6BA 5BPXA 2CU5A 4YGDA 5A32B 1H8TA 4ZKTB 2WZR1 3AFKA 4XDQA 3N9MA 1I6XA 4IUGA 4F83A 5J36A 1K5MB 4FXGB 4XJWA 4DO0A 2QFEA 1REDA 5LRSA 4BLJA 1F8VA 1JW6A 1N3PA 4RR3A 2IVIB 4KL1A 1GP5A 2PTMA 4E4HA 5IVCA 2PA7A 1W28A 5CU1A 1ZBE2 2R071 4CDWB 3MF6A 2FHRA 3T4HB 1HDKA 3W59A 3S7EA 1EPZA 2X29A 3POFA 1OLME 3VHPA 3U11A 4LHNA 3AZVA 1R081 2JIJA 2MPFA 4HL0A 4AFDA 4TTGA 4RD7A 5I8TA 1RJ8A 2WO1A 2WWJA 4J1XA 1RINA 2A6XA 3DN7A 2VOTA 5FYYA 3MIHA 5IYYA 5H9PA 1UOJA 5AVAA 1JYNA 1EAH1 4W50A 4JRAA 4NIAA 1I3HA 1WLTA 2PXJA 4MGIE 4CDQA 1VLNA 2J7MA 2JIGA 4HPKA 2XVKA 4XFIA 5BNOB 2IXHA 4IEOA 1H2NA 4YW2A 3WF4A 4N7IA 1AL0G 1J3PA 5DZFA 1ODMA 4CU7A 2AREA 4L92A 3CHXA 5CA6A 2IWGB 1W8UA 3ZFEC 2WS92 4QPIC 5HCHA 2CWSA 2AEYA 5JR7B 2D6LX 5BNNA 1G8WA 4XBQA 5ANQA 2QBXA 3K3NA 1X8EA 1UOBA 1H6XA 3O5SA 3IT8A 4HK8A 3T4VA 2RJLA 4N7UA 4AI8A 4DRVA 1VBB2 4P5HA 1S55A 1R1ZA 1UWWA 5FZFA 1J1TA 4FAHA 4Y20B 3BB6A 3I8TA 1GFF2 2FCVA 3ECQA 4NE9A 1S1AA 1XQNA 2X8KA 2WS93 4HKWA 2X09A 2C1FA 1UOFA 3B9CA 4FPGA 5CKQA 4DPNA 2PAKA 2VMGA 4XIOA 4AGRA 2ZZQA 2WWUA 2XONA 5LRRA 2EIDA 1JZ4A 5FZMA 1LENA 2VAUA 1LRHA 1V9U2 1DQ1A 2WLQA 1WGPA 3FHAA 1AYM2 4EWAA 1VBB3 4R9DA 4UI9L 3ZIWA 3HBZA 4CCCA 1W3VA 1XB9A 1SFYA 5A7PA 1CAWB 5FR3A 3ZLIA 2RVAA 4XTPA 3O1OA 1PGL1 1UIKA 1DG6A 4CP9B 1W6QB 3GZEA 1CD3G 3NJXA 1YIFA 1LHNA 1VAKA 2H6BA 3TNPB 4DINB 2X5IC 1QJU1 5EFUA 1A78A 2A3WA 2XUMA 1JZ6A 3GF6A 3BPSA 3ILNA 5E88A 1N1VA 5FAXA 1LECA 3DCQA 4JKLA 1V9U3 1IHMA 3IPVA 1G9FA 2JDKA 3ACLA 1AYM3 5L7OC 1HKDA 3PMSA 2ZX1A 2YY1A 4KI5M 1PHMA 2DFCA 5LY2A 1VBD2 1XU2A 3N9NA 2ILMA 1RGSA 1XE7A 1E5SA 1LESA 4RN5A 4B4RA 2FZ2A 1GZ9A 3ZXLA 2XB6C 4YWAA 1HB2A 4XVHA 4WVMA 3X29B 5A33A 1KS4A 2Z69A 1XYOA 2RDNA 4A2UA 1WZXA 4Q4W3 3NJVA 1IOAA 4MH0E 3GBFA 3ZN6B 4ZZ5A 3TN91 3WDTA 1D4M2 2CHHA 3P5BA 1F5FA 4CP2A 4QX1A 3BALA 3T1LA 1VBD3 4HN0A 4ET7A 1GOFA 3JBG1 2Z79A 4IEVA 5CG9A 1SLLA 4EN8B 1W3XA 4NMIA 5I0DA 1VAVA 3Q8EA 3KF3A 1SLAA 2Q4SA 5CFDA 1AXYA 3DPRA 1XJAA 4I2OA 3AP7A 3FN9A 2BWAA 1RIRA 2R072 2QUOA 5F5IA 1D4M3 1SDDB 4OHVA 3UKVA 3SH5A 2JJ6A 5A70A 4LHSA 3S7IA 5ACA1 5CFCA 4EV0A 1W9WA 1MS1A 2CY6A 4UFKA 2QNKA 1R082 3Q8BA 4YVSB 3OUJA 4XQ4A 3S5AA 4UFHA 5A3LA 1IQDC 1UN1A 1QNWA 1VB2A 5C3PA 2YFZA 2HWE1 1QJY3 3M3IA 5DAWA 4E27A 1RMU1 2VOVA 4XURA 4AFMA 5D8AB 4M4PA 2EA7A 3B9IA 5F7UA 4BU2A 3MV01 2IXIA 2JECA 2Z5WA 3CU7A 2XJPA 4XHBA 3AC0A 3ZPOA 5A80A 2JE7A 2W3JA 5FYZA 2RE9A 3AX4A 2XHKA 3SCGA 1YXWA 2YDEA 4XFBA 2W08A 1W8OA 3Q9OA 5FLIA 4QX7A 5A3UA 3PL0A 1LAJA 2P37A 4R52A 3LA3A 4BQWA 4NPMA 3S0MA 3J7LA 2VC9A 3ACFA 4XW3A 3TOJA 1QU0A 4LTAA 1EV12 3ZKYA 5AVPA 4CCOA 4ASKA 3LDKA 3BOWA 1Q8PA 3WW3A 3VBRA 4LNVA 1UY2A 1BCXA 1W8TA 4YW1A 1OUSA 4A41A 5IK8A 5HXMA 2DCJA 4LBMA 4D6QA 2P1BA 2VMDA 3V0BA 4TZDA 1AYN2 2OUJA 3IIAA 1W05A 3KT4A 4HG6B 4CRQA 1VBE3 1NOVA 2DDUA 3HT2A 2XBO1 3LFIA 4QPWA 5C3RA 5J1XA 3POWA 4AF9A 2E32A 1BHGA 1MQTA 3A0NA 1HXS3 1EV13 3MIGA 4LMFA 4N43A 1DGLA 1W99A 3H8XA 4CVUA 1MEC2 4AR2A 2HWB1 2Q30A 3RI8A 5K7PA 4FTEA 1HRV1 1ZA4A 2Y34A 1SZBA 1YC61 4L2NA 4PCRA 5FMOS 1PGL2 1AYN3 1QH6A 3NSTA 2C24A 4WVVA 4LEJA 1DZQA 3POEA 4YM2A 3QD6A 5F32A 1QJU2 1D4VB 4KWJA 1WW5A 1NCQB 3HR9A 3N7KA 4P9WA 3VDDB 4IE6A 2CSGA 1R091 4J6GA 2FDJA 2WZPP 1ND3B 4LJHA 2C4XA 3MW2A 3WNXA 1MEC3 2BOJA 2R49A 2ZEWA 4GB31 3HMYA 3PVBB 4BQ5A 2VXRA 3O1PA 3Q8FA 4QQHA 4INDA 1XNTA 4CCNA 5L36A 1PMJX 2VZOA 4G3YC 3VBHB 5FPBA 4COZA 4HVOA 3KQRA 2VGDA 1OVPA 3J9SA 1POV1 1VBA3 2W5FA 3WDUA 2YFUA 3H1MA 4I3PA 2ZACA 1STMA 1GNZA 1GYKA 2VMIA 3POYA 4NVPA 2BVBA 1D0GA 3P3NA 4RQPA 4YM0A 4CEWA 4PDWB 1L7LA 2VCMA 1ASJ2 4IEPA 1UZZA 3C7HA 1HX6A 2VR4A 4HZFA 2Y6FA 2XLAA 5IUQA 4CDUA 3FLRA 5JSPA 1UD1A 3RDIA 2ID4A 4IV3C 2WNVB 5K0UC 1FYUA 3POBA 3PIGA 2GSYA 1QY4A 4MSVA 5IHRA 4QPYA 5DAXA 3H8RA 3ZYRA 5E89A 1PK6B 5FQ0B 5LWBA 2O8OA 2ZPXA 3A7QA 1S2KA 3CQOA 5FPLA 1SLIA 4W8JA 1ASJ3 1E5HA 2FD8A 5FYCA 4H7MA 4JHTA 3VV1A 5FZ4A 4LIUA 4TXWA 3UKTA 1AXZA 2QJVA 5FRAA 3ZMOA 3LZZA 4GKXA 1V6NA 2LM3A 4I0AA 5CNAA 3VBFB 5FREA 3D8CA 3CO2A 3VD9A 3DKQA 5J7MA 5EPAA 1GZCA 1K3IA 2GC0A 3RZZA 4R4ZA 4L11A 2HWE2 4ISRA 4AEDB 2ORXA 5HXVA 4CUGA 3B94A 1TME3 3MV11 4GH4B 4LQRA 5FIXA 1HJFA 2BQPA 5IAXA 5JLVA 5DN2A 5IVJA 3ZVXA 3T0DA 1UZWA 3PJQA 2JKBA 5E8AA 3RFRA 3ZPYA 2Q8CA 3ZR6A 1ULDA 2UU8A 4N9HA 4RS5C 3ZO0B 1RUF3 4P9XA 2BNOA 5DDJ1 5FY5A 4X8PA 1ZREA 2G1MA 2GMPA 3MI8A 4AQ2A 5BNQA 2QQJA 1LEMA 3PDQA 2A6YA 1W9SA 4AOCA 3ON7A 4YZ5A 3WSOA 4Q29A 2XVLA 1SFPA 5H9RA 3VZJA 5C3QA 4B4PA 2PYTA 1W39A 1C57A 2R043 2VU9A 2F17A 1KQRA 1EY2A 4IESA 3NO8A 4JGZC 2WNUA 1VIWB 4N53B 3IN9A 2SBAA 3WQ7A 4HXCA 3WG3A 1Q8QA 5A7WA 3U4SA 5C9AB 2XBO2 1UU4A 5FXVA 1V6JA 2RJ2A 4TN7A 5FPAA 4U2AA 2ZKLA 3SISA 2FDGA 2D43A 2HWB2 2A6ZA 1RUD1 5I8SA 4AFAA 3PUHA 3T09A 3DEMA 1F5JA 4GA9A 3U14A 3SKJE 1TQ5A 3QBQA 4D3WA 3AMHA 1IKPA 1GUIA 4CXWA 4MADA 2YXSA 1G9DA 5ERLA 4FPOB 2XBO3 1O5UA 4CUCA 4BH9A 1SFNA 1XNBA 2VNVA 2NLRA 2WWSA 3LCPA 1OT5A 2QQOA 2HKXA 4GAZA 5JWPA 3ZXEA 3OOXA 2J1TA 3I59B 3J4UH 3OTFA 2HWB3 2DVDA 4GB32 1XXNA 4W4ZA 2VTXA 3ZFFA 2JDHA 5HPOA 4LOTA 4XIKA 3O1VA 1OQEA 2ADDA 1W8WA 3AFGA 4UWDA 4LUKA 3VKNA 4XF3A 2PLV1 3AMQA 4YW6A 3I49A 4B7KA 4BXSV 4YG0A 4BA6A 4AHZA 2VNOA 3LEKA 4Y5Z0 1QGLA 2GNMA 2YMZA 4META 3JXSA 3FHIB 1IQAA 3NL1A 2XJSA 1FV2A 2VCAA 3VDBA 1QJZA 5FMOL 3RJ2X 1LOCA 3U1XA 3O12A 1NA1B 2YYOA 1GQGA 5BNNC 3BKZA 1TNFA 3GHNA 3B5LB 4YNIA 4AYUA 2VXJA 1T6BX 3M1HA 4B4QA 2WO2A 4HSJA 1W03A 4LKSA 1LHWA 3UL2A 3WT3A 2X5IA 4M0NA 2YU2A 1QJX1 4RGKA 4NRQA 4O7XA 1OOPB 3EMRA 4LE4A 1PO21 4XDOA 5HCFA 3NMBA 5C33A 4IE0A 1O59A 5AC93 2IC1A 3H9AA 1O4ZA 5DG1A 5L7OA 1OVSA 4S2GA 5C70A 1L7QA 2EAKA 1ZBA2 3LE0A 1XNAA 3OD4A 4UBHA 2HWD2 4ZU7A 5EQUA 4OQ9A 1OSGA 3JUUA 1U5YA 4ASLA 1J83A 4CU9A 5A3PA 3NNMA 3JB4C 4FI9A 3D0JA 3CJIB 1HRI1 1KD7A 2ZHKA 3C3VA 1JHJA 1NCRB 2VL4A 2HWF2 4Y22B 2VCCA 4OMCA 5KHJA 2ARBA 3H3UA 2WRAA 5BNOC 1C4RA 4ATEA 5KHIA 1GLHA 4EE2A 1ZBA3 4CTEA 1I9RA 1AL22 4Q2FA 1CAXA 5TSWA 4DIQA 5KR7A 2HWD3 4JQTA 2VOXA 3THPA 3RPQA 1DYKA 1W2AX 1NQDA 2VZVA 3NRUA 5F2WA 3WW1A 1UCXA 3VBOB 5A3MA 2QQUA 2V4VA 2DVAA 2XJTA 1RVF1 3H1WA 5A6QA 2HWF3 3VZLA 4ZU4A 3MHZA 1MZEA 5DDJ2 4AQTA 1SBEA 2D6KA 3AP9A 4HONA 2OQ7A 1E5IA 3WP5A 2FCUA 2WKKA 3H3LA 4YZ3A 2VUDA 3NNFA 4CEYA 1CAVB 4FP2A 4XUNA 1AL23 4MGQA 3ZXGA 4FQ4A 4TLGA 4YARA 5T55A 3VUOA 2WLPA 4UW5A 3FHQA 3CKHA 5A6ZA 1LGCA 4IV1B 4XFFA 1AR61 1Q56A 2BGCA 2WL1A 1GOGA 1BMV1 2ZGPA 2P3JA 1LTEA 1R1A1 1VAMA 4YVWA 4ZXKA 1S0JA 3OJBA 5LK7B 5IVEA 2YZ4A 4MZUA 1UU5A 1YWKA 2YG0A 4PIZA 3Q8CA 1WW7A 4OZXA 3SC7X 3J7HA 2PHFA 1YUDA 1QJFA 4KBBA 2ZEXA 4EROA 1WCUA 3USSA 3KHCA 3DPRC 4NOTA 4Q4Y1 4K1YA 2YROA 3HQXA 1MZ6A 4XTMA 1RUE2 3VD5A 2WFPA 5J96B 1PIV2 2YC0A 1GWMA 5FY4A 1YFXA 5C8CA 3RZJA 3HEIA 5DUVA 5CFCC 2YGMA 5FYMA 5L9BA 3QLQA 3WUDA 3OSDA 3HBKA 4AI3A 4DEVA 1WMEA 1APNA 1C8M2 2EICA 3NNLA 1XNKA 5M0TA 5I0TA 3T2TA 4E4ZA 1J3RA 3FZ3A 3KVBA 3IIIA 3W20A 4A44A 3E6BA 1EP0A 4W6YA 4D0QA 1RUE3 4O65A 3ZFGB 1PIV3 3KB5A 3LDRA 1DQ0A 1XYNA 2W95A 3EQEA 2WINB 3KMHA 4WM8B 2WAOA 1W6NA 2VBPA 2Y8KA 2PLV2 2XJVA 3AYDA 4ZS2A 3MYXA 4FFGA 3PNAA 1DDLA 1C8M3 1JHNA 2ZTNA 4F7ZA 4JCKA 4P9GA 2D6NA 2J1RA 1KXGA 1LB2A 1OLMA 4KGQA 3BCWA 3T08A 2JDAA 3GBWA 2VMCA 3I54A 1YQ2A 4N8MA 5IFTA 4NN0A 4HANA 3TWIA 4UFMA 4HK9A 3VBSB 1DCSA 1VB4A 3ZM8A 1W90A 5CEHA 1QJX2 3K77A 1UY0A 2ZZJA 3OGSA 4Z07A 1PO22 3AVSA 1S0DA 5KC5A 3ZX7A 3BTXA 4XBNA 1RJ7A 4DXRA 1BZWA 4ES8A 5GZFA 3ZYBA 2D93A 5A3OA 3I3EA 1VRH2 4LBKA 5LCWL 1JUHA 2XL9A 4YVSC 4DQAA 3FFZA 1O4TA 1MQTC 4BWOA 1U12A 3I2DA 4Y1XA 3WINE 4QU2A 4XAEA 2JDYA 1GWKA 1FAYA 3BODA 4XUOA 5FZLA 1KEXA 2GAUA 1HRI2 1DGRN 1LU1A 3MFAA 5EYYA 5IW0A 4Q5OA 2V72A 5D8AC 2EIEA 3SEPA 3SH3A 2W68A 4MV2A 2Q8DA 2DUPA 2DBIA 2WS91 1UXXX 3THTA
chains in the Genus database with same CATH topology
1B35B 1RUG3 1HQWA 1VRH3 2YUEA 4I09A 4IV3A 1OPMA 4QQPA 5K0UA 3ZYGA 5JIUA 1MS3A 2JENA 1VBB1 5AFEA 4UW6A 2RR12 4XXAA 4AVSA 4PIYA 1A8DA 3VKMA 2ZMKA 4WBBA 5KWRA 4MVTA 5HI0A 3VL8A 4Z82A 3RNSA 2AR6A 4MUVA 2A71A 1V9U1 4RQPC 4UW3A 4YW3A 4CEWC 5K9YA 3B7MA 1AYM1 5J09A 5F9TA 5FOBB 1CVNA 1WBLA 3DL3A 2C9AA 2RR13 5F1RA 1BMV2 4CDUC 1R1A2 2UWBA 1V6KA 1CPNA 3EHKA 4M3CB 4YYOA 3KT7A 2Y26A 1W6OA 4RHV3 5I0RA 3O0WA 5CG8A 3EJKA 2AZ5A 2HEWF 3LSEA 4B8EA 2WT1A 4LO5B 5DZGA 3VBUB 4LBJA 1SBDA 4Q4W1 3FE5A 4Q4Y2 1BVP1 1AR92 4BQ1A 4B7EA 2ZX4A 2V5YA 2WFF3 4NO4A 3NV2A 1HQLA 1DZRA 4RS5A 3KCCA 4Y1UA 3H7YA 1VBD1 3OF1A 1PVXA 3ASIA 4KH9A 5JZGA 3L2HA 4RR3B 1JBCA 2UY8A 1QNYA 4SBVA 4Z92B 2NN8A 1O91A 3FJSA 1NLRA 1KDKA 4QX5A 1AR93 2CWMA 4JGZA 1ZRDA 3H8UA 1D4M1 1BQPA 3H7JA 3VBHC 1DQ5A 1ND2A 4H14A 1ULGA 3CJXA 4GMP3 2DUQA 5GM0A 3OYWB 4FPLA 3WG1A 1MVQA 4I0BA 4PDWC 4M0HA 4QPGB 5C4WB 1LR5A 2OVUA 3OGJA 1QJY1 1CAUA 3VZMA 2WNVC 3IDBB 4COVA 2W52A 2D98A 2UYAA 3AB0A 2CGOA 3ILFA 5SV5A 1H4GA 1GR3A 2OA2A 4Y26A 4FOQA 5H9QA 4C0BA 1B09A 1W0PA 2WNUC 1EYBA 4DB5A 4EWDA 4GWMA 4JRLA 2XPJA 4K9SA 3AMPA 2HYKA 4WM7A 4AGVA 4AXOA 1AX2A 3MW4A 2Q0AA 2ZMNA 1XNCA 1WCDJ 3PVNA 1VP6A 4K21A 4AEDC 2RS52 4AVTA 4HETA 5I8YA 3HD8B 5A32A 2VW2A 3AKSA 4AFCA 4KG8A 5JI7A 4GH4C 4EJRA 1VBE1 1S0BA 2GMMA 4BE3A 1K5MA 5JSRA 1MZFA 1HXS1 1EV11 1QKQA 2H0BA 4DY3A 5L73A 1C5IA 2RS53 4Q4X2 4CDWA 1F31A 1O5LA 5GZEA 1IZ3A 3ZFFC 1ZZ8A 4AQ6A 1AYN1 4Q0SA 1T6GC 3KT1A 1GQHA 2BWCA 4URTA 4TWTA 1O7FA 1G6NA 3SMHA 4HFSA 2G9FA 1MEC1 2FMDA 2HWC1 4JC1A 4F3JA 3E6CC 1PNFA 3OGGA 1CX4A 4Q4X3 3ST7A 3LOBA 4FPHA 2PHLA 3MFCA 5KHGA 2P3KA 2AYHA 4ES9A 2CYFA 1RB8G 2XGXA 5BNOA 4Q0PA 4FXKB 4OLLA 4Z1VA 2GC1A 3R0RA 1VBA1 2VQAA 5T54A 2RM23 4IQPA 4Q1PA 3O0VA 4Q4W2 1DQ2A 4O9GA 3ELNA 1RUI2 3SLIA 3HN1A 1WLCA 4R8HA 1DQ4A 1KS5A 4QXKA 4YG6A 5FO8B 5E16A 4DZGA 4OI4A 2R6QA 5GLTA 3TYJA 3D4KA 4FVVA 4XZPA 1LOFA 4YGEA 3RRDA 3VZOA 4LULA 1D2SA 3CNAA 4W65A 5E1RA 5F6KA 1DGRA 2VUAA 2ZGKA 4Y20A 1W0OA 2GH8A 2HEVF 2QQPA 2VW0A 1ASJ1 3A0KA 1RUI3 1Y3TA 5T50A 1HQNA 1EPWA 2ETEA 2Q1ZB 1H2LA 1LHVA 5BY5A 3BOPA 3QACA 3W58A 2ZA9A 3V56A 4JDNA 1CAWA 4E2QA 4YRDA 1QJY2 1ULCA 3KZ4C 5H9SA 2V73A 2VY0A 2CAVA 1LGBA 1NA1C 1V6MA 2ET1A 2P3IA 5T5JA 3ZSEA 2DVGA 1TME1 1W6MB 2AENA 4Q4V3 4CEYC 1X33A 2LTNA 5GLUA 2XVGA 3RMYA 4FBFA 5GLZA 1OOPC 2C0ZA 4N90A 4YSFA 1H2MA 4XJ9A 3MICA 1YI7A 5IK7A 1FMD2 3D82A 1BEV3 3MIEA 4LBOA 1RUF1 4JTOA 4YVWC 3AXEA 3R4UA 4OI0A 1A3KA 2VVEA 2VW1A 4AVVA 3ZSLA 2D5FA 3H0OA 2VG9A 4GALA 3CJIC 1S0CA 5I93A 2JG9B 1NCRC 4E9KA 1Y7BA 5ABJB 4FTSA 2R041 3ZN6A 3SITA 4HT1T 2BFUL 1MR5A 1FMD3 2CGNA 5C8CC 1UU6A 2YPJA 3WR0A 1VBE2 5KBFA 3B93A 3AZYA 2GN7A 1U5ZA 4XFHA 3VBOC 4XMIA 1MS5A 2VH9A 1HXS2 4FPCA 5T5OA 4FPKA 2UWAA 2VPVA 4XXPA 4PLNA 3H50A 3NAPB 4COYA 2XLGA 4I02A 2GNDA 5CADA 2E7AA 2H0VA 2IFRA 4YVSA 5KXBA 1Q3EA 4Y1YA 1BYHA 1O3SA 2CL2A 2PHRA 3V64A 5CVRA 2HWC2 2BBVA 3MDPA 2RJKA 3PJYA 5D8AA 2BW8A 2R063 1RC6A 5FBZA 2QVSB 2IZWA 3M2MA 2MEV3 2WSUA 1UPSA 3ILRA 4A7YA 1VBA2 1AHSA 2MNGA 2R1BA 2BEOA 1SBFA 3VZNA 1HV0A 3AMNA 2VVDA 1RUJ2 3LAGA 4FCAA 3IKWA 1LKNA 4I30A 2HWC3 4HLTA 4EN6B 1CIWA 4KU8A 5EJ3A 4QM8A 2VNRA 4WZCA 3USUB 5F6LB 2E53A 4AI0A 3VZKA 2P34A 4GQ7A 1LU2A 1S0IA 3AZXA 3N36A 2TEPA 1RUJ3 4M00A 3ZFGC 4ORFA 5AC91 3MZHA 4ATFA 4WM8C 1NXD1 3W9AA 4ONUA 2XJQA 1Z78A 2A3YA 2DU1A 1QQP2 1Y9QA 4AGGA 1QF3A 2EXKA 3VLBB 2QE3A 3PMEA 1OA2A 1ULFA 2AGSA 3ME2A 2Q5TA 1PO13 2PHTA 1OFSA 3M4FA 3T1MA 3M3OA 1TME2 4LLFA 1TNRA 3J26N 1ZBA1 3AKTA 1NCQA 3VDDA 2HWD1 4QM9A 4LUMA 4WVZA 1ND3A 1QQP3 4GIQA 1AF9A 3QCWA 1TEIA 5JOWA 3J8F2 3CF6E 2QDNA 2QZ3A 2HWF1 3WHTA 5CAZA 1RUF2 5KHHA 1ENXA 1DU3D 1UPIA 2JICA 4I01A 4KQ7A 4C0HA 2PFWA 3VBHA 2VUJA 1AL21 1JN2P 1HW5A 3GZUC 1U5IA 1AX1A 2R042 3GALA 3LKJA 4PDWA 4LBQB 3O14A 3J8F3 2Z42A 2O0OA 2Y0OA 2WNVA 3GNEA 4NR1A 4RSUA 1LOAA 4ITCA 1QOOA 1W2UA 3PHMA 2YV8A 5JZGC 1D0HA 1YFUA 1C28A 5GZDA 3O7OA 1SACA 1NG0A 4KGGA 1PK6A 5FQ0A 2DWRA 1FT9A 4YGBA 3ZFEB 1ENQA 4HSLA 2R1DA 4QPIB 2DV9A 1YNAA 4IERA 4EWEA 3GZAA 4KNCA 1KFXL 1MS4A 1ND2C 2ZHLA 3AK0A 1C5HA 3ZIXA 2BNNA 1YLLA 2OZJA 5GZCA 3VBFA 2WQ4A 3WDWA 3ZYJB 4MGZE 4NPRA 3U07A 5K8SA 2DCTA 3ALQA 1YO8A 4AEDA 4CDXB 3M8LA 4XYXA 4MGKE 3L9JT 2DCZA 4FTBA 3AJYA 3AZZA 3K51A 2Y0IA 3HWJA 4XOGA 2BYVE 1RUE1 4NHLA 4GH4A 1PIV1 3LOIA 3VBUC 1QH7A 4SLIA 4L97A 2PQQA 2ZJCA 1DZTA 4FP3A 3AP4A 2EAAA 5EZWA 2G4IA 4YGCA 2A7AA 2CAUA 3WV6A 1C8M1 2EXJA 1H9WA 1JOJA 1JYIA 2JE9A 3LA2A 2D40A 2OW4A 1LOEA 1PM7A 4F8AA 4WM7C 4BCUA 5JPMB 1IGOA 3U0ZA 1ZVFA 1COV2 4BMBA 2ZX2A 3KD4A 1SCRA 2B39A 4UW4A 2VVFA 1RUOA 5AC92 5C9AA 2EIGA 1OKQA 1K5MC 1A6CA 1XE8A 3VN4A 1COV3 3G7DA 2ES3A 4I0WB 4LO6B 2NQYA 1F9KA 4L99A 2HEYF 3B01A 2Y38A 3MPPG 4YM1A 1J59A 3ZN4A 4CDWC 2F6BA 2WT0A 2FBEA 2EALA 1RUG1 5J98B 4BIFA 1VRH1 4LBNA 1WCSA 3EBRA 4WVWA 1JTZX 4QD2A 4XFAA 3I59A 4HVQA 3FWEA 1QHDA 4FPYA 4QHBA 5BXXA 4I2OA 2CNAA 2VMHA 1PVC2 2ZABA 2ZGQA 3V0AB 2WIIB 5T5LA 3ZXAC 3V65A 1WW4A 5KC6A 1IKQA 4QQOA 1GICA 4PBPA 2RMU2 3E5QA 3KSCA 4DRRA 1ZRRA 2PHDA 2E6VA 1KJRA 2D97A 1URXA 3FC0A 1YRZA 3JB8A 2DCKA 1RTVA 4PLOA 1PVC3 2RR11 2GZWA 4W6XA 1NA1A 1H30A 4IEQA 4RHV1 1FX5A 1RHI2 2D6PA 2B7YA 1LOFC 2E7QA 2RMU3 2NZ9A 1PZ9A 5GALA 5JOZA 1CESA 1OOPA 2G9GA 1N1TA 4YG3A 2R0HA 4BOWA 2WFF1 1S0GA 3N35A 4XF9A 2BVVA 3BU7A 4JDOA 1BVVA 1KITA 1OMIA 1OI6A 3URFA 4ASMB 1NQJA 3LWCA 3RMXA 1RHI3 5DUXA 4NHKA 3FBMA 2JDZA 2NPIA 3CJIA 3D0SA 1NCRA 1C3HA 4Y22A 2CGPA 2JG8B 4JGYB 5BV6A 4OUMA 3INAA 1ZZBA 2ERFA 1AR91 1A8MA 3GYDA 3QH7A 3WQ0A 1DGWA 2JXAA 4XBLA 4HVRA 2LUWA 2DF7A 4GMP1 1AR73 1ZX5A 2ATFA 2PAEA 5CIRA 4C1WA 1H1IA 2OIIA 3VBOA 4QGMA 2NM1A 1ZZ9A 1LOGA 4HMZA 4LA2A 3RYRA 3N4MA 5EWSA 1POV0 1Q5OA 1CAVA 2KM2A 2RS13 5JCTA 3WP6A 3SCHA 1GV9A 2WA3A 4IV1A 2ZGOA 5FTTC 5BNPB 2ET7A 5FLJA 3NJZA 4Q8LA 5CBLA 4WV8A 5T52A 3WCRA 1HIXA 3L2YA 3AP5A 1BBT2 4MXWB 3S6PA 4AE2A 4PLMA 4LA3A 4MX3A 4XETA 3MPBA 4OVEA 1VBC3 3DUIA 1RUNA 3LGRA 3U10A 4CYDA 1Z7S2 1NYWA 4XJZA 5SV8A 5IK5A 1RUG2 4H7LA 3WY6A 5JOYA 1VJ2A 1ULEA 5CB7A 4AK3A 1BBT3 1VR3A 1RUH2 2PHXA 4Y24A 4OUSA 4KU7A 4YW5A 5C8WA 4CP1A 3ETQA 2PAMA 1GNHA 1YYNA 2RS51 3EXUA 1ZRCA 1WBFA 3WDXA 2XJUA 3RQ0A 1N1SA 2ZHMA 3ZFGA 3N7LA 1Z7S3 2GN3A 4GXLA 4IEXA 4WM8A 5J3UA 4G4FA 4Q0QA 3WCSA 2JEMA 5LEJA 4BIOA 5JVVA 5DG2A 1RUH3 4A3XA 3AKQA 4NHMA 4K3UA 5FO7B 1OQDA 4IEWA 3ZSMA 1W6PB 2C5DA 3AJZA 4Q4X1 4AVAA 3FUOA 4C91A 4YM3A 1SDWA 2K2SA 4RHV2 4MGYE 1TE1B 3WD5A 3QH6A 3VBSA 4K8FA 2WT2A 5KHKA 4UBGA 5HCBA 2RM21 1WMDA 1H1AA 3OY8B 3I4IA 3FBYA 3G6JB 1DLLA 2WFF2 4AEKA 5BYNA 1DBNA 1N47A 3CL1A 3VKFC 3VGIA 3IM0A 4L9BA 5FO9B 3SXWA 4BYYA 1IPKA 3POSA 4XF4A 1DGWX 3MIBA 3O0XA 1GZWA 1PZ8A 2DTWA 2HJIA 1WW6A 2RS32 1S0FA 4P9IA 4V1PA 1H8TB 3KCYA 1B35A 1NY71 4BPZA 1RUI1 1GBGA 3NKGA 1G9BA 3VHRA 4COWA 1NCQC 3VDDC 3WHUA 1O3RA 1OLRA 1ND3C 1YFYA 2D5HA 1DQ6A 4IETA 4J1WA 2RS33 1REFA 3UJQA 4GKYA 3FX3A 4IL7A 3PLQA 1CN1A 1PGW2 1LCLA 4N9IA 4Q4V1 1E57A 5EV7A 5IT6A 2B8MA 3JZVA 4CP0A 5DXDA 4QGNA 1CPMA 4X8NA 1FATA 2BFUS 3GZTB 4IEUA 3FLTA 1OQ1A 1BEV1 4MYEA 1M4WA 1QXJA 2IXLA 1XU1A 4M3CA 4OHZA 4CDQB 4HPKB 5F5QA 4JVAA 3VBUA 4BLIA 3E5UA 4M3CF 5DUWA 3MGUA 1PK6C 4WZFA 5J48A 1MVEA 3GHMA 5JI9A 3DV8A 2I74A 3A4UA 2R16A 3DGTA 2I2SA 1FMD1 5BNNB 2ARXA 1AR83 4IEZA 2EVXA 3E97A 5GJ6A 3VBFC 2VOWA 5HCAA 2YHJA 1LEDA 4MLOA 5JSOA 2E51A 2P2KA 1FOD2 3JD72 2VOKA 2TUNA 2H6CA 3BPZA 4YW4A 2VQ0A 3LA7A 1KJLA 1TMF2 4LT5A 2GC3A 2ZX3A 3D6EA 1S2BA 3ATGA 1O3TA 3WX5A 3OYWA 4HKLA 4QPGA 5C4WA 4BHPA 4HKOA 1ZBE3 1FOD3 3PTYA 3JD73 1GANA 4DXZA 2F4PA 1QXRA 2R061 1AUYA 1TMF3 5JDBA 3WOGA 1GSLA 2MEV1 4D7SA 4PJYA 4Y4YA 2E7TA 2RM22 3IPVB 4S2HA 1SCSA 3RYKA 4N53C 1OHFA 5EYXA 3TRSB 3NW4A 2NYYA 1AX0A 4ZU5A 4UXAA 3WDYA 1MZ5A 5C9AC 3FMGA 4P9JA 2GALA 4WVMB 4PF5A 5A33B 1WLDA 2BTVC 2ZKNA 1FPN2 3E6DA 1QDOA 4XHXA 4HBNA 4CDXC 1O4YA 2GNTA 1O3QA 4GMP0 1IS3A 1RUJ1 3FLPA 1NY72 2NMNA 3ES1A 3AYEA 3WVJA 2D6OX 5CFDB 3MIDA 3DPRB 1FPN3 3WP3A 3QOPA 4Q8KA 1PZ7A 1PO11 4GULA 5GLWA 1CR7A 2B45X 2X53S 4YZ1A 2TBVA 1IS4A 3SH4A 5CFCB 3WW4A 4FPEA 1UF2C 2RHPA 4Q4V2 1BJQA 3OCPA 5I0SA 3TBDA 3KS7A 1QQP1 2A6VA 4EN0A 3SCFA 4Q1RA 4FOYA 1NZCA 3RJRA 4TYSA 1OPOA 4Y1ZA 1BEV2 2P17A 2R30A 3MEPA 3IBMA 1V6OA 1G86A 1W6QA 2OYZA 2ZGUA 2W39A 1H1MA 1C1LA 1CJPA 1RUC2 4P14A 3KLSA 4M3CE 1UMZA 3RS6A 1Q8SA 2DVBA 2WZR2 3ZXFA 3J8F1 1H9PA 1CQ9A 1REEA 4B3NA 1JH5A 4PQ9A 4E2GA 2B46X 3VBRB 4AFBA 3DF0A 5C33A 1UZYA 3LSDA 4OFGA 2JX9A 2O8QA 1RUC3 3ZXJA 4XJ8A 1ZZCA 1VALA 1KDMA 3V0BB 1MACA 2WZR3 3P3PA 3M3EA 4FPJA 3N7MA 2W0XA 5HBAA 3AKPA 1MQTB 2OUHA 4N43B 4RGAA 4Q27A 1X7NA 4LO7A 2KXLA 3RWNA 5GZGA 4OHWA 2ZS6B 4Q26A 4YFWA 3IWZA 2R073 1EAH2 5FOJB 4FPFA 3UJOA 1PNGA 3MW3A 2R062 1R083 1W6MA 4PBOA 4AG4A 3BTAA 4TSVA 2MEV2 4Q0UA 4XF0A 1FNYA 4IXLA 2XLFA 1WCKA 1QMJA 3NWKA 1LJ7A 4IV1C 1EAH3 4KWKA 2FQPA 3ZSJA 4AHYA 4E4DX 4JV4A 2ZGTA 1G7YA 1H4HA 2O1QA 2GMEA 1HV1A 2D44A 2QZ2A 2DYCA 3VKLA 2A5ZA 3KM5A 5GKAC 4BMEA 3WLUA 1U0AA 2JG9A 4Q0VA 3JQXA 5ABJA 3SNMA 2NP0A 2JG8C 3N7JA 4JGYC 1DHKB 3M70A 4RQPB 4CEWB 1FI2A 3ZYPA 1Q43A 3HT1A 2XG3A 1KRIA 4CDUB 4XF1A 2GH2A 1ONAA 4X6RB 2QCSB 3H3ZA 3ZDSA 4NWWA 1H0BA 2I45A 4D7YA 1OA3A 1IS5A 2WSVA 2V09A 1COV1 1LGNA 1UAIA 3NAPA 3MLLA 1PO12 3PVEA 1CJDA 1WMFA 3APBA 1ZZ7A 4XE9A 4G9SB 4R4XA 1OA4A 1LOBA 4AI2A 2KA3A 3IMNA 3B00A 1QOTA 5EXOA 3WDVA 2FZ1A 3U4XA 3NV1A 5BNPC 5I0UA 1J58A 2B9UA 4FAGA 4H3WA 1IPJA 2D6MA 4DNYA 4XJUA 3B02A 3UK9A 2QDRA 3MLKA 3TB0A 1QJU3 1KFUL 2NMOA 2ZBJA 3BIWE 3NKTA 3VBSC 2ZCWA 4LO4B 3TN92 3AM2A 2DTYA 4R9AA 1PGSA 1QOSA 5JAXA 4COUA 4XFCA 3JBG2 1YCIA 1G9AA 4CZSA 1PVC1 4AI1A 1ALYA 1LHUA 5T3NA 3D5OA 2D7FA 1XYPA 3USUA 2E9QA 5FPZA 3ZMNA 3HAGA 4OHYA 2RMU1 2UURA 5GLVA 1RL3A 3AZWA 2EXHA 2VECA 1MS8A 5LK5A 3TN93 4D69A 2WNUB 5JMCA 5ACA2 4BM8A 2IXCA 4IEYA 3JBG3 2AH2A 1DYPA 1V6IA 1B35C 2I07B 4LHKA 1DF0A 2UY9A 4YZ4A 2BNMA 4XJAA 2PHUA 1RHI1 5JOXA 2QKDA 2DFBA 4AHXA 2XH6A 1RMU2 3B69A 4AVBA 2ZX0A 4KWLA 1CGPA 1XNDA 2D3PA 3IDEA 5ACA3 4XPVA 2XKPA 1D2QA 5L19A 3AXDA 5KXDA 1QXPA 2A6WA 1AR71 2DUOA 1FV3A 1U5XA 4X6QB 1JUIA 3ENRA 3KCXA 2HWE3 3AYAA 4NWVA 4K40A 1RMU3 3ZFFB 1X8MA 4FT8A 1HLCA 1YFWA 4RFT0 4AQSA 4DOUA 4YZ2A 4P9YA 3ES4A 2ZGLA 1N3QA 3E5XA 1ZZ6A 2EF6A 2RS11 5JPNB 3M7AA 5KXCA 4LHLA 2Z2SB 5LEKA 2YGLA 3AYCA 1H8TC 4LBQA 1CONA 4XQDA 3TNQA 3WG4A 3OBRA 4XILA 5FPXA 2BUKA 4XQWA 2K0GA 2AUYA 1XRUA 4YFZA 3IDCB 4B29A 4RR3C 2X5IB 1HRV2 3TAYA 5FFOC 4U36A 1MS0A 3WP4A 1RITA 3ZFEA 1YJKA 4QPIA 4Y1VA 1VBC1 1NXMA 1J1LA 5L7OB 4N53A 4I3GA 2DURA 3S30A 2DVFA 4H55A 1R092 1ENSA 1LULA 4Z8BA 3WQ1A 1BBT1 4LE3A 4QPGC 5C4WC