5CFCB

Crystal structure of human cardiovirus safv-3
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
232
structure length
232
Chain Sequence
SPFPVTVREHAGTFFSTTPDTTVPVYGNTISTPFDYMCGEFTDLLSLCKIPTFLGNLDSNKKRIPYFSATNSTPATPLVTYQVTLSCSCMANSMLAAVARNFNQYRGSLNYLFVFTGSAMTKGKFLISYTPPGAGEPKTLDQAMQATYAIWDLGLNSSYNFTVPFISPTHYRQTSYNTPTITSVDGWLTVWQLTPLTYPLGVPNDSHILTLVSGGDDFTLRMPVTFTKYVPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords VP1
publication title Structure and Genome Release Mechanism of the Human Cardiovirus Saffold Virus 3.
pubmed doi rcsb
total genus 36
structure length 232
sequence length 232
ec nomenclature
pdb deposition date 2015-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5cfcB00
4IV1C 4CDUC 1NCRC 1RUH2 2RMU1 4N43B 3JD71 4QPIC 4Z92B 3VBFC 1TME1 3FBMA 5K0UB 2HWF3 1AR92 5BNNA 1K5MB 4FTBA 1AR72 1ZBE2 2WWSA 1VBE1 4N43C 2R043 1RUD2 4Y4YA 5L7OB 3ZFGB 1C8M3 1RUH1 1OOPA 1PGL2 2PLV3 1BEV3 1ASJ2 1RMU2 2RR13 1AR91 1R1A2 2Y26A 4FSJA 1X33A 1AR71 1SMVA 1ZBE1 1QQP3 2MEV3 1RUD1 5FMOS 1TMF3 2WS92 4Q4V3 5D8AB 4CEYA 4RS5C 4GB33 1PGL1 1H8TB 4PDWB 1ASJ1 1RMU1 1R1A1 1NCQB 1OHFA 1AUYA 3VBRB 5CFDC 1COV3 4WM7B 1NA1C 2X5IA 1B35B 1FPN2 2WS91 5A32B 3TN92 2HWC3 4JGYB 2XBO2 1EV13 1HRV2 1FOD3 3VBUB 4GMP3 1WCDJ 4N53C 3CJIA 4AEDB 1VBD3 5BNPB 5K0UA 3VBHC 1POV1 2RS53 1K5MA 1FPN1 1RB8G 3TN91 2XBO1 2BBVA 4AEDC 1HRV1 5J98B 3ZFGA 1HRI3 1EAH2 2TBVA 4EJRA 1ZBA2 5C8CA 1VRH2 1RUJ2 1RUG3 4Q4X2 1RVF2 5BNNC 4QPGA 1VBA2 2FZ1A 5D8AA 1FMD2 3M8LA 1VBC2 1EAH1 1IHMA 1OOPC 1H8TA 1QJU2 1C8NA 1ZBA1 4CEWA 1VRH1 2R062 1RUJ1 4Q4X1 1RVF1 1NCQA 1QJX3 1VAKA 1AYN2 2BFUL 1QJY3 1VBA1 1PO22 4WM7A 1B35A 1X36A 3JB8A 3JBG2 1V9U3 4CEYC 1PO12 1FMD1 1VBC1 4JGYA 1POV3 2BPA2 1RUC3 1QJU1 1VB4A 2HWB2 3VBSA 2R061 1AYN1 5BNPA 2HWD2 2GH8A 1PO21 2X5IC 5BNOA 3JBG1 1BBT3 1PO11 3CJIB 2GSYA 1AR82 2HWB1 4YVWA 2FZ2A 1PIV2 1R093 3CJIC 2R072 2HWD1 5K0UC 1RHI2 1ND3B 1Z7S2 4CDWA 1K5MC 2RM22 1RUI3 2QQPA 2DF7A 2HWE3 5GKAC 2WFF3 2WZR2 5C8CB 2RS12 5L7OC 1RUF3 4RQPB 3ZFGC 3J8F2 3JB4C 5AC92 1AR81 4GH4B 4QPGB 4BCUA 1PIV1 4IV3B 1POV0 2R071 1NY72 1OPOA 1RHI1 1RUE2 1Z7S1 2IZWA 2RM21 4QPGC 1AR62 3NAPB 2WZR1 3VDDB 4AEDA 2RS11 4CEWB 1VB2A 1AL22 5D8AC 5AC91 3J8F1 1VBB2 4NWVA 2RMU3 4CDQA 3VBOB 3JD73 1H8TC 4PDWC 2BFUS 4CEWC 1TME3 5DDJ2 1NY71 1RUE1 3LOBA 1NCQC 1AR61 3VBRC 2XPJA 1MQTA 1VBE3 4WM7C 3HAGA 1B35C 1PGW2 1R082 1AL21 3VBSB 2ZZQA 4JGYC 1HXS2 1VBB1 3IDEA 4RHV2 1RUH3 5BNOB 5CFCB 4Q4Y2 5DDJ1 3VBUC 1AR93 4Q4W1 1D4M2 4NWWA 5J96B 1PVC2 5BNPC 1AR73 1ZBE3 5ABJB 5BNOC 1ND3A 4FTEA 1RUD3 4YVWB 1PGW1 1R081 4CDXB 2RS32 1E57A 4YVSB 1F8VA 1ND2B 1HXS1 4RHV1 5C4WA 4RQPA 4CDWB 4RFT0 4GH4A 4Q4Y1 2RS13 1ASJ3 1RMU3 1R1A3 1D4M1 1PVC1 2HWF2 5LK7B 4IV3A 4RR3B 4LLFA 4CDWC 2WS93 2R042 2RS31 3NAPA 3VDDA 5JZGB 3ZXAC 1C8M2 4JGZB 2PLV2 1BEV2 5ACA2 3VBOA 2RR12 2HWF1 5FOJB 3ZFEB 1FPN3 2R041 1QQP2 2MEV2 4CDQB 1TMF2 3TN93 2XBO3 1C8M1 1HRV3 4GB32 2PLV1 1BEV1 1GFF2 1MQTB 4CDQC 5ACA1 1MEC2 4WM8A 2ZAHA 2RR11 5CFCA 1COV2 1QQP1 2MEV1 1MQTC 1TMF1 4N53A 5ABJA 5C9AA 4IV1B 2HWC2 4CDXA 4YVSA 1ND2A 1EV12 4GB31 1EAH3 1FOD2 4QPIB 1MEC1 3VBFB 1ZBA3 2ZTNA 1CD3G 1VRH3 3ZFFA 1RUJ3 1VBD2 4Q4X3 1RVF3 3S6PA 1COV1 5C4WB 2RS52 4RR3A 3DPRA 1VBA3 1ND3C 5A33B 2HWC1 1FMD3 1VBC3 1EV11 4Y5Z0 5C8CC 1FOD1 5C4WC 1HRI2 5JZGA 4RQPC 4GH4C 1QJU3 4JGZA 4GMP1 1DDLA 2R063 1VBD1 4IV3C 1AYN3 1RUG2 2RS51 5ACA3 1PO23 3ZFEA 3JBG3 1QJZA 4RS5B 1PO13 1W39A 3NAPC 3VDDC 1HRI1 4Q4W2 2HWB3 1AYM2 3VBOC 5CFDB 1NA1B 1RUG1 1CJDA 1MEC3 1QJX2 2HWD3 4FTSA 1QJY2 4WM8B 1V9U2 4IV1A 4CDUA 1NCRA 2WLPA 3VBSC 1AR83 4QPIA 1RUC2 1AYM1 4N53B 1PIV3 3VBFA 4WM8C 5C9AB 5CFCC 3VBHB 2R073 1QJX1 1RHI3 1QJY1 1Z7S3 2RM23 4N43A 2WZR3 5ABJC 1BBT2 1V9U1 5C9AC 5A33A 4YVWC 1BMV2 4CDXC 4YVSC 5AC93 3J8F3 3ZFFB 2VQ0A 1ND2C 1RUC1 3DPRB 5L7OA 1R092 5BNNB 1RUE3 3ZFFC 1AR63 4RR3C 3DPRC 1RUI2 4SBVA 1BBT1 2HWE2 2WFF2 1BMV1 1F2NA 1AL23 4RS5A 5FMOL 1RUF2 1VBB3 1OOPB 5JZGC 1HQNA 4JGZC 1R091 5DDJ3 4Q4W3 4Q4V2 5CFDA 1NA1A 4PDWA 1AYM3 1RUI1 3ZFEC 4CEYB 2HWE1 2WFF1 1R083 1RUF1 1HXS3 3VBRA 2BUKA 4RHV3 1HX6A 4GMP0 2RMU2 4Q4Y3 5A32A 3JD72 1TME2 4Q4V1 1D4M3 1NG0A 4CDUB 1PVC3 3VBHA 1NCRB 2X5IB 1M06G 3VBUA 1VBE2 2RS33 1AL0G 1NOVA 1A6CA
chains in the Genus database with same CATH superfamily
2RDRA 2VQUA 5K4LA 2DTYA 1NCRC 5T52A 5CKMA 1U0AA 4AQ2A 2TEPA 3RZZA 1K12A 1YC61 1KS5A 4N43B 4QPIC 4Z92B 3CNAA 3ES4A 3WW3A 2EF6A 4BQXA 1TME1 1N1YA 3FBMA 4EN6B 5D1IA 2X8KA 1JZ5A 1H2LA 2DYCA 2HWF3 3NW4A 4QT6A 3OUHA 1ZREA 1K5MB 1F9KA 3R4DB 3LEKA 1G9FA 1O3SA 1O7FA 2R043 3POYA 4E8DA 3WNPA 1J3PA 1RUD2 4K8FA 4LO8A 3LEIA 1SHWB 2ZMKA 3B01A 4KWJA 4IE5A 4BQ3A 2VTXA 2YZ4A 1W0PA 3MIDA 1C8M3 2P17A 1W8ZA 5J7MA 1ULCA 4Q0UA 5HPOA 1DQ2A 3A7QA 5FXZA 1DFQA 1HB1A 1GYKA 1RMU2 4YGCA 1UOBA 3MLKA 1R1A2 5I8YA 3HVDA 2Y26A 2DU1A 3E97A 4LHSA 4OHZA 2Q0AA 5FMBA 1AR71 4YZ4A 1ZBE1 4CXXA 4FSJA 1DIWA 3CU7A 2MEV3 5HXMA 2Y0IA 2LRPA 3AZVA 2O8QA 2QQWA 3O0XA 3WDTA 4PHZA 4ZKTB 5CKNA 4RS5C 4DUWA 3NKTA 3PTRB 5AVAA 4FPKA 3WNMA 1PGL1 4UFJA 5FR3A 2VBBA 2AACA 3UETA 1ASJ1 1NLQA 3PLQA 4XQWA 5GM0A 3ZYBA 4PI0A 2A75A 3RYPA 3ACIA 2YV8A 1NCQB 1AUYA 3OGJA 1SFPA 5CFDC 1NA1C 1SDWA 1NE6A 2YB7A 3WW1A 1B35B 2OZJA 2WS91 3QCWA 4CU8A 3ZN6A 1SACA 3CLPA 4YGDA 4LPLA 1ZZ6A 3N36A 3GALA 4BYYA 1EV13 1SQ4A 3CEWA 3ZYRA 1D0HA 5T5PA 2HKXA 3PIGA 4Y20B 4BPZA 2R1DA 2VW0A 2G4IA 4QMAA 3NJZA 1Y3TA 5FCCA 3RVHA 1BKZA 2JDNA 3THDA 1DLCA 2G9FA 3VHRA 1S0BA 2DFCA 1ENSA 4GMP3 3SH4A 2J1EA 5BNPB 3UYJA 2D97A 2RS53 3HJRA 3THTA 4CP1A 1OMIA 1FPN1 4XBNA 2Y0OA 2JDPA 5FY4A 3LIHA 3N9LA 1GZWB 4C1WA 1S2BA 2WNVA 4AEDC 1AVBA 5J98B 3ELNA 4HLTA 5LATA 3WY6A 4COWA 2VVEA 1J83A 2PAKA 3WQ7A 5FJHA 1NKGA 4YYOA 3T2QA 3NQHA 1YYNA 4Q26A 5J36A 3FLRA 5C8CA 3AKRA 1UKGA 4JQRA 1OFNA 4XJ9A 2JG9B 4UAPA 5DAXA 1QJFA 5CADA 2JDHA 2BNMA 1OQEA 2P37A 3LFIA 4QPGA 2BEOA 3OF1A 4D3WA 3U0ZA 1KXGA 4YZ3A 4YFZA 2YG0A 1GOGA 1W3VA 2GNTA 5HCFA 5D8AA 3I59B 1OC1A 1QNYA 1RITA 2XJUA 4Q1PA 5CB7A 1V0AA 1O5LA 3M3EA 3T2OA 2ZGKA 5FYIA 1GOFA 2AUYA 4FT8A 4YG6A 1E5RA 2G9ZA 4LKSA 2Q4SA 1W6MB 3THCA 1RUJ1 5APAA 2JB4A 4XFGA 4D6QA 4C0BA 4E4ZA 2XUMA 2E31A 4WM7A 4B4QA 1WBFA 2BW8A 2NP0A 3JB8A 4JKLA 5A70A 2JWPA 2I07B 3VDCA 1US2A 1UYZA 5I0RA 1FMD1 3BYWA 1URXA 1QXRA 1VBC1 1POV3 1RTVA 2BU9A 4JGYA 2VMFA 4MH0E 2V09A 3GZAA 4LTAA 4WZCA 3S7IA 5IFPA 4J1XA 1RUC3 1VB4A 2D6KA 2NM1A 2C9KA 2PQQA 1YI9A 2RDQA 3E5XA 4V2WA 4W6YA 3VBSA 2VOVA 4OHXA 4AVSA 2ZCWA 5FMCA 4OI0A 5FTTC 4NRPA 4P9JA 2VMHA 5IVVA 2DCZA 2A3WA 1ZNPA 1WKYA 3A23A 3PU3A 1CZTA 4G3YC 1POQA 1ONAA 4LNVA 2YC0A 3JBG1 5FP7A 5K8SA 1PO11 3RDIA 1A34A 1N3OA 3V56A 3H7YA 3JXSA 1GOHA 3WXPA 1ZZBA 2VOWA 3ZYFA 4W50A 2FZ2A 5IAXA 1PIV2 3DYOA 4KNCA 2ARBA 3EQEA 1UZVA 1NLSA 4NHKA 3CJIC 5A3TA 1VR3A 3FFZA 4URTA 1RHI2 3DV8A 1C1LA 3QH6A 3V64A 1K5MC 2RM22 1RUI3 1N3PA 2ZGOA 3OJBA 2LROA 5GKAC 4FPYA 4QX1A 2RS12 3SXWA 2X05A 3ACGA 2X09A 5FQ0A 3BUCA 4LT5A 3JB4C 4LBNA 1AR81 2TNFA 4DXRA 2V4AA 4M01A 1FNZA 3OEBA 2ETEA 4BU2A 5IFTA 4D7SA 4EYUA 2QZ3A 1ZRRA 2VTFA 4BCUA 1LOFC 3RWNA 2AGSA 4IV3B 2R071 4A41A 3WW4A 4C1XA 4CCOA 3KVBA 3NWKA 3WDXA 2XL9A 4XPVA 1UYPA 4YWAA 3BKZA 2QQVA 4CEWB 4LO4B 2X10A 2GN7A 4AI8A 5AC91 5LBFA 1I9RA 1O3QA 1K45A 3AZXA 3K2OA 3ZN4A 1FNYA 1H1MA 1W8WA 1V6IA 3DL3A 3MHZA 2OUJA 4OUMA 1OUXA 3VZLA 4CU7A 2BFUS 2ZZJA 2YPJA 4XJAA 3ZPOA 4GALA 2RVAA 5M0TA 1NCQC 4LULA 2DVDA 3LE0A 4N9HA 4P00B 1MQTA 2GC3A 5A7NA 3NRUA 1GP5A 5JXHA 1B35C 1PMIA 3ZYPA 1AL21 1UY2A 5CZKA 1GNYA 1IS4A 1X9TA 2NYYA 1JZ6A 2A6YA 4XE9A 4Y24A 1RUH3 5JXJA 3LZZA 5F5CA 3Q8BA 2SLIA 5CFCB 1O5UA 4LA2A 5A7WB 1UOGA 3A0KA 4QD2A 5L9VA 1TE1B 4QM9A 5FPBA 2XGXA 1JZ7A 3TEWA 3ZR5A 4XUPA 1W04A 1XU2A 2NPIA 5FP9A 3VLBB 1LOGA 2B42B 1SDDB 1CZVA 4W4ZA 3WT3A 4YRDA 5BNPC 4KU7A 2GC1A 3NO8A 4FTEA 1PGW1 3KF5A 3D6EA 2BBAA 4H2AA 3SC7X 4AAXA 4Q8KA 1ODMA 1W6OA 5FY8A 2DTWA 1QGLA 1W03A 1V6MA 1WD4A 4FPOB 1UIJA 4RFT0 4CDWB 3LAGA 3ME2A 2ZEYA 4Q4Y1 4CCKA 2P4EA 2RS13 3NVCA 1QIQA 3USUB 5F3IA 3VUOA 4I0AA 3POEA 2XB6C 2VC9A 5LK7B 1ULGA 2WJSA 4NPRA 3EYPA 2JG9C 5FZOB 1IG3A 1S0IA 1OLME 3DYPA 4PBPA 2WWUA 2WYFA 3UJQA 1UL9A 3N9MA 3DF0A 4E4HA 2JEMA 2A70A 5GLVA 3NAPA 4CPBD 4E27A 3VDDA 2JIGA 2E7QA 1W9SA 5IUQA 2LS6A 1L3JA 3KT4A 5JZGB 2XLAA 3ZXAC 5JWPA 1XNCA 1UPSA 3LOIA 2AYHA 4XAEA 1W2TA 2WWJA 4AAPA 4BQ1A 1BEV2 3AJYA 1A8MA 3AM2A 4WVMA 1MZ5A 2WDBA 1UY4A 2EVXA 2RR12 3I2JA 2HWF1 5DAPA 1ZA7A 2QFEA 3WP4A 4JAAA 1V6KA 4E2SA 3FHAA 3A22A 5JMOA 2R041 1QQP2 1EPZA 3P1IA 3MLJA 5FY9A 4CDQB 5GZGA 2VD7A 1UW8A 1JTZX 2W68A 2WAOA 2XBO3 3WR0A 1JH5A 4E4DX 4QGLA 5IWFA 5KHIA 4LKFA 2XJRA 4Y22A 1C8M1 1HRV3 1S55A 5KR7A 2CY6A 2VNRA 4FOWA 2FDFA 1PK6A 5LASA 3T2PA 3MW4A 2GH2A 4JHTA 3NKGA 4LEJA 1H4HA 1PVXA 1FXZA 5FYUA 3U78A 4MOAA 4CP9B 5ANNA 1QHDA 4XABA 4LBLA 3AP9A 3UJOA 2MEV1 2ZMLA 4HVOA 4CSWA 2PHDA 2YBPA 3CJXA 3TB0A 5ABJA 3EXUA 3WG2A 4ET7A 4IV1B 4HONA 5A3MA 1VMJA 4YVSA 1G9DA 3BB6A 2QBXA 1UU5A 4Z2WA 5FUIA 1F5FA 3E5QA 1YUDA 1RINA 1W0NA 3IB3A 5A7QA 2AC1A 3FMGA 5GLTA 3QD6A 1Q8PA 4BIOA 1BYHA 2P1BA 4MGKE 4XAAA 4HN1A 3LWCA 4Q4X3 2F17A 3I49A 3MBWA 4BWOA 2A5ZA 5ISLA 3INAA 2PAEA 1N1TA 3I3MA 4DY5A 2VZVA 4XIKA 1BK1A 3KGZA 5FY7A 3AFKA 3SH5A 2VU9A 5LB6A 1EV11 1WLDA 3IT8A 4UFHA 1KDMA 2B5HA 2BWCA 2PHTA 3D82A 4QKBA 1HRI2 5TSWA 1NZIA 1VMFA 5C4WC 1US3A 1UWWA 2XH6A 1N1VA 3RMYA 1QJU3 1DQ5A 1OKQA 1VMHA 1YFXA 1F4HA 2VG9A 2XG3A 4GMP1 1YQ6A 4JX0A 1ZYBA 1O4TA 1I5ZA 1IQAA 2P3KA 3LGRA 4IV3C 2VECA 1AYN3 2RS51 4HOOA 4YM2A 4UF0B 4ZONA 2GZWA 1XYOA 3ZFEA 1CAVA 1IPSA 1WCQA 2OIIA 2IC1A 1PNFA 3VKOA 2H0VA 2VZ3A 2VR4A 3HMYA 2QQKA 3PJQA 4DO0A 5BPXA 3ZSEA 4WVVA 1AXZA 1U5XA 4Q4W2 1RXGA 1LAJA 1IG0A 2B46X 2BDRA 2DCJA 2HWB3 3BI3A 3K4AA 5A80A 2Y64A 5K7PA 1VAMA 2LUWA 3IBMA 2Q1ZB 4XACA 2HWD3 5JCTA 3DECA 2D5HA 5FY1A 2W3JA 3MDPA 5C71A 4RFRB 3B69A 1JZ3A 1BVP1 1AZDA 1DZTA 3NNLA 4A7ZA 4ITCA 2XWBB 4PQQA 4S2FA 1NYWA 2ZGLA 4BQ2A 3EJKA 4E4SA 4LUMA 1H0BA 2D98A 3D0JA 3K3OA 1S0CA 1LEDA 1X9PA 2D93A 3UKNA 5FZ3A 4WM8C 5BV6A 5CFCC 5E88A 2VMCA 3U37A 5LZ6A 3IDAA 2EIEA 4IGQA 1GUIA 1I6XA 4N43A 2VCBA 2JENA 2WZR3 4CUBA 4QDSA 4KL1A 5DG2A 4HPKA 1U5IA 5C6CA 4INDA 5FZBA 2VQ0A 5FFOC 2VTXJ 2ZACA 2EIBA 1OLRA 4QKDA 4LKDA 1RUC1 4P9LA 4MGTA 1CAWB 1UIKA 1UXXX 1YRZA 3KVAA 5EHDA 1SLIA 1LEMA 1GWMA 2VUAA 2GDFA 2WZEA 4FPJA 4GAZA 1WA6X 1RUE3 2Z42A 4KH9A 3ZFFC 2O14A 4QX3A 5EFUA 4AYUA 3WV6A 5EIYB 1BMV1 4K1ZA 2Y6HA 4OUEA 1VBB3 1OOPB 1TZOA 3FL7A 5LA2A 4AFMA 4OUSA 4M3CF 1LJ7A 3RJ2X 5JZGC 2FD8A 4AQTA 3T4HB 3NNGA 1HQNA 1OXCA 3RQ0A 2W1WA 5DDJ3 3QBQA 4Q4W3 3T4VA 3J26N 3CKHA 5JAXA 2A3XA 1GWKA 4CPBA 4NHLA 2EICA 4QXKA 1RUI1 2KD7A 3BALA 5EXOA 2UWCA 3HPNA 3BIEA 4AFBA 1ALYA 2OW4A 1DU3D 4HFSA 1VIWB 2A73B 2ARXA 4OMDA 1GLHA 2PHRA 5E16A 2BUKA 4RHV3 2Q8CA 1Q3EA 1SLLA 2RMU2 4GKXA 5FZHA 4TTGA 3JD72 4AGVA 4NMIA 1QNWA 2P3YA 4Q4V1 1D4M3 2FCUA 4XFIA 4ATEA 2P6HA 2R30A 3OBRA 3KT1A 1NCRB 2X5IB 4KQ7A 5FZ1A 3VBHA 3ZX7A 4DY3A 1A8DA 4YM3A 4A6OA 2D44A 3I2IA 1JOBA 1W2UA 3UNPA 4CXWA 1VBE2 4HN0A 2VMIA 4YSFA 2C6SA 2RS33 4GWMA 2JE7A 2B7YA 4DUVA 5FRAA 4IV1C 2W08A 4I0WB 3VDAA 4B29A 1BCXA 1OD5A 4YW4A 1S0FA 5A6XA 3VKFC 3RZKA 1R64A 5KHHA 4D69A 1HQWA 2JD4A 3LSDA 4BXSV 4KBBA 1AR92 5BNNA 4QDRA 4DFSA 2WA4A 1W6NB 3GCWA 1Y9GA 2WWSA 3KCXA 3OYWA 4GWIA 4F3JA 3KZ4C 2R7EB 5EYYA 1IPJA 1PX3A 1XRUA 2JG9A 2QUOA 5HCBA 4E8CA 4XUNA 1RUH1 1DYPA 4BIFA 4FAHA 4XETA 1DYKA 2BWAA 2VGDA 3HN1A 3CMGA 4W65A 4XJWA 4OQ8A 2WQZC 5FBJA 1W0OA 2IXKA 2AEZA 1X8EA 4PCRA 3I59A 4M0HA 4ARYA 5C3SA 5JI9A 2RJ2A 1IS5A 1RJ7A 3UV9A 2UYBA 3AMQA 4W8JA 1WBLA 5FMOS 1TMF3 1O59A 5LBCA 3USSA 2BGCA 2WSUA 4CEYA 3CF6E 4UFMA 1W6MA 1H9WA 4UBGA 5FO8B 3AZYA 3O5SA 4C0HA 1H8TB 2GP3A 3NNFA 1NLRA 3GNEA 4LIUA 4AHYA 4CP2A 4BQWA 4CUAA 4BQ4A 4DEQA 3M2MA 4ZU7A 3B3QE 4YW3A 2WINB 4U2AA 3OB8A 4GJZA 5IHRA 3T3YA 1CN1A 1UCXA 3KMHA 4H14A 4Y5TA 1YO8A 1SCRA 3MGUA 4LITA 4P9YA 3KT7A 5A3UA 5A32B 2B39A 4IE4A 3TN92 1JYIA 2VBPA 5FBZA 3KM5A 3X29B 3V0AB 3EBRA 2JDZA 1KJLA 3BTYA 1FOD3 3LD8A 3WP6A 5BNQA 4CYDA 1MS9A 1UNBA 1Q5OA 2ET7A 3AMHA 1UQXA 4FOYA 4GA9A 2QQIA 3C7OA 1WCDJ 4AEDB 1BVVA 1AXKA 4PJYA 1T2XA 5I0TA 3PVBB 1H30A 5K0UA 2WRAA 3RS6A 3ZYJB 1CIWA 4UYBA 3SCHA 3C7HA 5J37A 4IE7A 4QQHA 2XBO1 2DVBA 1W6PB 5A3NA 2BBVA 4LHNA 4P02B 5DZGA 1HRV1 5F3EA 2OA2A 3ZFGA 4K21A 1EAH2 3RI8A 4OCTA 3ZXFA 3P5BA 3BTZA 4BQYA 1LOCA 2W95A 1ZBA2 1VRH2 1PZ9A 4PIZA 1OH3A 2VQAA 5DQ0A 2V5DA 1RUG3 1RVF2 2WZPP 2DFBA 1OH4A 1Q8QA 1BK0A 4AL9A 5HV0A 5KHGA 1LODA 4IE6A 1VBA2 2FZ1A 4HMZA 4KMQA 2EAAA 1F35A 2K9ZA 1UYXA 1DP0A 1KFUL 3WF4A 4DB5A 4ES9A 1RL3A 3PJYA 4QAWA 4R4XA 4TSVA 4YG3A 3FC0A 1OOPC 2PHLA 3K4DA 3S30A 4CP0A 1RJ8A 1IZ3A 1LTEA 2KA3A 2HEWF 4CEWA 5F1RA 2R062 1DGRA 3N9OA 1DZQA 2VH9A 4XUQA 4Q4X1 4R9CA 3T0AA 3UGFA 4W6WA 2ZABA 2BFUL 1C1FA 1QJY3 1S2EA 4FP3A 3J7NA 2VMDA 1PO22 2DBIA 4Z07A 1C5IA 4ISQA 3J9SA 2J22A 4XUOA 1KJRA 1V9U3 4Q29A 5CIRA 5EP9A 2KXLA 1JYXA 4QHOA 2XQRA 1YFYA 2VNOA 3N9QA 4Q0PA 5C3QA 4B4PA 2I74A 4XF0A 1QJU1 4NROA 3U4SA 2I2SA 2VNGA 2FBEA 3FN9A 2JDYA 2MPFA 2WL1A 2ZGPA 3KV5A 1S0JA 2V73A 1VAVA 1BJQA 1WW6A 3KLSA 2ADDA 4P9WA 3LA2A 2PAMA 2WNUC 4IE0A 1ACCA 2WBKA 1AYN1 4QGNA 3DGTA 4N90A 4EWDA 2X5IC 2VNVA 3O1RA 3CZUA 4GULA 2PQSA 4I01A 1V6JA 5AVPA 1AX1A 5A7WA 2F6BA 1G86A 3ZXJA 4AEKA 4AK3A 5LBEA 5D21A 4L99A 3N7JA 3V0BA 3CJIB 1YJKA 2G9GA 1W2OA 3VD5A 1D0GA 3I2KA 3MPBA 3PDQA 1P8JA 4KGQA 1G7YA 2HWB1 4Y3OA 1XU1A 2I45A 5FP3A 3BIWE 4OZOA 4LO5B 4FOVA 2JDUA 1R093 1ENXA 1HN1A 4BA6A 4JVAA 3CZJA 4HANA 5FPZA 4EN7B 2OXBA 2WNOA 2HWD1 3KV6A 4YGEA 4COYA 5A1LA 4CDWA 1Z7S2 2ZBJA 3I2FA 1OVSA 2QQPA 2V4VA 4LHKA 3USUA 2BQPA 2HWE3 4PLMA 1H1IA 2ZPXA 3O7OA 4ZU5A 5T50A 1LESA 4AG4A 1GQHA 1RUF3 4D6RA 4FFFA 3J8F2 4IXLA 5SV8A 3VDBA 4N8MA 4ZU4A 5FZOA 4J1WA 2ZGMA 3U10A 1LECA 1PNGA 2VZUA 2XMLA 4MZUA 1OUSA 3IKWA 3I7DA 3I3BA 2ID4A 5F6LB 1YNAA 3ILNA 1NY72 1OPOA 1RIRA 1UZZA 3Q8AA 4AGGA 2IZWA 3ETQA 3M3IA 4LHLA 4P5YA 1AR62 4DRVA 4ZHNA 5FZDA 2WZR1 1SZBA 1XE7A 4XURA 1GSLA 2WO1A 3LIGA 1FX5A 1KQRA 2ZA9A 1VB2A 3O0WA 3HOBA 4MG2A 3RZGA 4EE2A 3TNPB 4XXPA 5FREA 5EJZB 4MGQA 1MR5A 3RFRA 4AEMA 4CDQA 1WW5A 1H8TC 2ZS6B 2A71A 1GP4A 4XZPA 5FP4A 5GLUA 1H6YA 1OBNA 1OURA 2FDJA 3E1F1 1RUE1 3MUZ1 5C5TA 1JYVA 4QX5A 5IVJA 2HH9A 2JB8A 5EJ3A 2NZ9A 1UX6A 3UL2A 1U5ZA 3VD9A 1R082 4I0BA 1LENA 4MXWA 4UW6A 4AHWA 3FHQA 4XTPA 5KC6A 1DYOA 2XR4A 1HXS2 1VBB1 1JXNA 2BOJA 3IPVA 2W5FA 3KCYA 1JN2P 3AYEA 4NVPA 1UPIA 2DURA 4AF9A 4XUTA 4DXSA 5DDJ1 3U4XA 4XIOA 3WG1A 4FFHA 1YJLA 3H9AA 4Q4W1 3K77A 1QDOA 1SLBA 5J96B 1PVC2 2ENRA 4ZXKA 4BOWA 1N1SA 5BNOC 1ND3A 3KD4A 1J1TA 1RUD3 4NJ4A 3NV2A 4YVWB 4B4RA 2CYFA 4IEQA 4CDXB 4FO9A 1DHKB 1ND2B 2EALA 1LKNA 4DEVA 4RHV1 3AYAA 1VE0A 1CQ9A 2WQ8A 3IN9A 3MV11 3T09A 4RQPA 3CO2A 3KHBA 2XONA 5FLIA 4GH4A 3OPTA 4YGBA 5F3CA 4CCDA 1AJKA 1RMU3 2Z2SB 4Q8LA 4TLFA 1AHSA 4KWKA 4TXWA 4XQ4A 1DG6A 5T3NA 1R1A3 4AE2A 1D4M1 1YIPA 5FZ7A 4E2GA 4MADA 3SISA 5L19A 1UMIA 3VZKA 4Z1VA 4LA3A 3HD8B 4MX3A 4XBQA 3AZZA 3MPPG 4RSUA 2CGNA 2RS31 4R52A 4XJUA 4ASKA 5JOYA 4UFLA 4JQTA 4A7KA 2C0ZA 3WINE 4G4FA 4FBFA 2DDUA 1XYNA 3K4ZA 4JGZB 1L7QA 4K9SA 1MPXA 2C26A 2PLV2 3TOJA 4NIGA 1EYBA 2OX0A 1LB2A 3DKWA 3VBOA 1YIFA 2Y38A 2CU5A 3PU8A 4OQ9A 3GJAA 3AZWA 2VAUA 3VHPA 1W9WA 3IDBB 4L8QA 2YC2A 3L2HA 3H50A 3DN7A 4GD4A 2IXJA 1GKBA 4AFCA 1C5HA 1EUTA 4HSLA 3MIFA 1S0DA 4C91A 2PTMA 3V65A 5IK4A 1X8MA 4OYUA 2FDIA 2HEYF 1JYTA 4GB32 3NSTA 2EXHA 2XHKA 1Q8VA 1MEC2 2PN5A 4SLIA 3VD7A 5ACA1 2ZAHA 5DZFA 4A3XA 1OA4A 2RG4A 2K46A 3Q8CA 1Q8SA 3WF3A 1GR3A 2VZRA 1DGLA 1UU6A 4R8HA 1W8HA 1COV2 3WSOA 3LF7A 3UKVA 1TMF1 3BPSA 2FCVA 1FAYA 1XQNA 3HWJA 5FPXA 4L97A 2HWC2 2OYZA 4AVVA 3LCPA 5BY5A 3GZUC 1JBCA 2VL4A 4UOJA 3IMNA 1E5IA 2E9QA 5F8PA 5I8SA 1F5JA 5EPAA 5JUVA 5FYZA 1RUNA 4LBMA 1XNKA 2WN3A 1W8FA 4NE9A 4M3CE 3FHIB 5T5LA 3VBFB 2ZTNA 3MIHA 1TQ5A 2IXLA 3WCRA 3AXEA 4MGSA 4D0QA 4NAOA 4F7ZA 1J58A 1VBD2 1REDA 2B9UA 3ZXGA 2FDKA 3AMPA 3FZ3A 5C4WB 3T08A 3OD4A 4RR3A 5IVFA 1CAWA 2FMYA 3WQ0A 2D40A 2Y6LA 4TYSA 5A33B 1DQ1A 5IK8A 1W6QB 3TRSB 5A6YA 1LGNA 1FOD1 3ZSKA 3CL1A 4EWAA 1ZRDA 4MYEA 2A6ZA 4LE3A 2W52A 3A4UA 2W87A 4WBBA 4FVVA 2GNDA 1J59A 3C2UA 1ULDA 1WCUA 2Z4FA 4KWUA 3IMMA 1KRIA 1HJGA 2EIDA 4Y1YA 1GICA 4EV0A 1GANA 3GZTB 3HT1A 2CV6A 1W39A 5FV3A 4Q1RA 5FK7A 4NIIA 1EPWA 2IXHA 2XQXA 2CWSA 4HKOA 5FO9B 3KWVA 5CISA 4UFKA 4RL7A 1QXPA 1WMXA 5FXVA 3MIGA 3PNAA 4A44A 3OG2A 2DCYA 2XUEA 5FAXA 1AYM2 4M00A 2D6NA 1ZVFA 3WG4A 1SBFA 1QH7A 3G6JB 4NRMA 5IAVA 1RUG1 3RMXA 3RYRA 1DQ6A 5ERLA 1CJDA 1J3RA 1MEC3 1QJX2 3J7HA 2XLGA 4LBQB 2DVFA 5FYVA 1V6NA 4CCCA 5L36A 3ZKUA 3BU0A 1WZXA 1GWLA 3WNXA 2WT1A 4KG0A 5FK8A 3PUAA 4FP2A 3LA3A 2Y6JA 4WM8B 3WW2A 2GMPA 3RJRA 2R16A 4AQSA 1NCRA 2WLPA 1T6BX 3EHKA 1FT9A 2XXZA 1H9PA 3RZJA 2NMNA 3POSA 3S57A 4RA0A 2V5YA 4QPIA 3I4IA 4P9GA 2PFWA 4QQLA 4N53B 1PIV3 2D6OX 2ES3A 1CVNA 2ORZA 2SBAA 1XSQA 3D3AA 4GJYA 4QHBA 2W39A 4MLOA 4UBHA 1W8TA 4BMEA 1I1EA 2HYKA 3I97A 3O1TA 3WP3A 1JOPA 1RHI3 4ATFA 3Q8FA 4HXCA 1QJY1 4QXBA 1O3RA 2RM23 5GJ6A 4L11A 3MZHA 4E2QA 1BBT2 1V9U1 3SH3A 2W9XA 3GCXA 5C9AC 5KXCA 4YVWC 5DN2A 4PIXA 4AVAA 1V00A 3T0BA 4CDXC 3ZFFB 5GLWA 1ND2C 2QTWB 2Z5WA 2YFUA 4QX2A 3GZEA 5JOXA 2LALA 4GXLA 2J1VA 3FWEA 1PX4A 4GWJA 3AC0A 3M3OA 3FUQA 2ZX1A 4DZGA 5SV5A 4IETA 4IEWA 1HV1A 2XWJB 5D2AA 4DXZA 4UWDA 2D3SA 4FXKB 2WABA 4YZ2A 2E26A 3DPRC 4NR1A 3RWKX 2WFF2 5JXGA 3ZM8A 4RS5A 5FMOL 1FYUA 3UK9A 3F95A 2F4LA 2DVGA 2ZHLA 1QY4A 4Q2FA 1DF0A 2D5FA 4A45A 3PMSA 4JGZC 1WGPA 3WDVA 3IIIA 4PBOA 1R091 1W9YA 4HKLA 1CGPA 1QWRA 3SMHA 5A6ZA 5CFDA 3K3NA 1NA1A 1SFNA 1AYM3 1ZZ8A 2HWE1 1BXHA 3M4FA 5DUVA 2JD9A 1HQLA 1RUF1 3KB5A 4I3PA 2GNBA 5F9TA 1HX6A 1FV2A 3M3CA 2W1UA 4MHRA 4AWDA 1CPMA 1UYYA 2E63A 3IM0A 4LO7A 5DUXA 4GMP0 2QVSB 5A32A 2KR2A 3ES1A 2NQYA 3J7MA 5L9BA 5CG9A 3ABZA 3V0AA 1TME2 1NG0A 4ES8A 2Y33A 5FLJA 4S2GA 1PZ7A 2ZHKA 2WKKA 3ZN6B 1BZWA 3FFQA 2VXJA 4AEDA 5EZWA 2QE3A 1XNTA 5IVYA 1HB4A 3MF6A 4CDUC 3OCPA 1F15A 1OF3A 5DZEA 4XJ8A 1HIXA 1QMJA 2QNKA 1OI6A 4M4RA 4EN9B 4D6SA 4NHXA 2VZTA 3HT2A 5BUVA 4LO6B 3UGGA 1W6PA 5AFBA 3VBFC 1VPHA 4IW3A 2Q30A 5FMDA 4AOCA 2VZPA 1JODA 5EJ1B 4QPWA 3DXUA 4H55A 1AR72 1ZBE2 5JDBA 1RYYA 1U12A 3H8OA 4Y4YA 4I09A 2BERA 5L7OB 3H8RA 1AX2A 4PLNA 2Q1MA 3ZR6A 5KC5A 3EO6A 5F7UA 3ITQA 4TN7A 5LRSA 1UZ0A 1W8UA 1Q56A 1HB2A 2AZ5A 2ZMNA 3LA7A 5DPNA 3CHXA 4B3NA 1PGL2 4AVTA 1BEV3 2JIJA 1ASJ2 1PMHX 3ETPA 2EXIA 2RR13 4QQPA 1XNAA 2F4PA 4QB1A 3I3DA 1ZRIA 5E6HA 2UURA 1JI6A 2LTNA 1SMVA 2QQNA 4QWNA 4COVA 1QQP3 3F2ZA 1RUD1 4AVBA 3AJZA 1UN1A 2WS92 4P08A 3ZIXA 5D8AB 3LDKA 3QH7A 5T55A 5A7PA 1OPMA 5J1XA 5A1AA 4EQVA 1LU1A 3A0NA 3KV9A 2NN8A 3AX4A 5FO7B 1CZSA 1L7LA 1RMU1 2CTVA 3AP6A 4EN8B 2JE8A 2WZ8A 1R1A1 2Q1FA 3VBRB 4QU1A 1XSRA 4LUKA 3NJYA 1ULPA 1LGBA 4WM7B 2XDVA 4AR2A 1FPN2 2WQ4A 3O1SA 2YC4A 3ZO0B 2QQUA 4JGYB 4A3ZA 5CA6A 4PF1A 4XDOA 5EV7A 1MZFA 4QQ2A 3POFA 2D6LX 4YW7A 5FZIA 3LQCA 2LW8A 1LCLA 4DS0A 3I2OA 4XZUG 3VBUB 4IGPA 3AXDA 4K20A 1NE4A 3WF2A 3EB7A 1I5PA 2QZ2A 4N53C 3CJIA 1CAUB 1S0GA 5JPNB 5A1FA 3ZLIA 2EIGA 3AL6A 1POV1 5IK5A 1K5MA 3I3QA 1HV0A 2YHJA 3PUSA 4RYDA 3POJA 1ZRFA 4B7KA 2W2IA 1RB8G 2RV9A 2FMDA 2GN3A 2J42A 1VLNA 3DEMA 3IDCB 3RZLA 1LHVA 1N47A 1DLLA 3LDRA 3OGSA 1HRI3 1PM4A 3WNLA 2AENA 2RHPA 3NNMA 4UI9L 1GNHA 3AVRA 3OGRA 2TBVA 5I0SA 5F3GA 3D0SA 2UYAA 2WT2A 2CSGA 2HBUA 4CA9A 1LOFA 1NAEA 4XOGA 5F5QA 5L9RA 4PT6A 1OLQA 4AZZA 3S6PA 4BJ0A 1FATA 2GC0A 1RUJ2 4C90A 4K3UA 4IDZA 4IEUA 4LMFA 5LK5A 3U11A 3MICA 4H7MA 3UKTA 4Q27A 1CIYA 5FQ0B 1OQ1A 2C1FA 1YXWA 3AMMA 1FMD2 3BPZA 4ONUA 1VBC2 5DUUA 1MACA 4KBZA 4X6RB 5FPVA 2VOKA 1IHMA 1SG3A 1ULEA 1UZYA 3ACHA 5L73A 3ATGA 2ZOEB 3MFCA 3H3LA 1WCKA 1Y7BA 3OSDA 3MI8A 3ZSLA 4XCBA 3MEPA 5JIAA 1NCQA 1VAKA 1HN0A 2J1AA 3MLLA 4ZS3A 5FXWA 2BYVE 2BP6A 2CAVA 2TUNA 1B35A 1X36A 1WCSA 3JBG2 4Y26A 1PO12 1W28A 5FZ9A 4CE8A 2RDSA 5EWSA 4PIYA 2WNUB 3ROUA 2BPA2 3HNMA 3G7DA 2ZAAA 4FQ4A 4GQ7A 4OHYA 3GXUA 4Y20A 5FYHA 5DUWA 3WVJA 3GYDA 1MS0A 5FY0A 3WHUA 4XVHA 4FOQA 1EUUA 4XFCA 5LA9A 4IGOA 5B4XA 5BYNA 2ZGNA 5HCHA 5BNPA 5FXXA 2GH8A 4XW3A 1Q8OA 4CVUA 3RZHA 1GZWA 3WHTA 4HBNA 4NIDA 2VMGA 1O6UA 2VZOA 3VV1A 1GQGA 3KQ4B 3ZYIB 4IESA 2GSYA 2WSVA 1AR82 2Q5TA 1W3XA 4L2NA 3TWIA 4OVEA 4YVWA 4O9GA 3HNBM 5A3PA 2UWAA 5KXDA 2JKXA 2G19A 4KWLA 1U5YA 2R072 3H1YA 2QJVA 4G9SB 3CBNA 4AQ6A 4LJHA 4Z8BA 4AI2A 4LXLA 3PMEA 2E7TA 5L7OC 5AC92 4S2DA 5FZMA 2WC2A 1WW4A 2XJTA 4AGRA 4PLOA 4JRLA 4XC9A 4D8MA 1PIV1 1UU4A 2OZ6A 5DAVA 2HBTA 1BLZA 1YQ2A 5JVVA 2DBNA 1RHI1 2P2KA 3C7GA 4B7EA 4CU9A 2CWMA 2RM21 4L92A 2Z69A 1Y9MA 4QPGC 3AB0A 4OI2A 2XHNA 3WP5A 1RGSA 3NAPB 4QKNA 4QX8A 2IVIB 3VDDB 3RZMA 4WZFA 2C5DA 2RS11 1AL22 4FXGB 5D8AC 2VJXA 3A21A 1WLTA 1LOAA 4NWVA 5CU1A 4QDQA 3U75A 1YQ5A 4XHBA 4AFAA 5FZFA 1LR5A 1EP0A 2RMU3 1CPNA 3P3NA 4YPJA 4CZSA 3JD73 4EZ4A 5HI0A 3B9CA 4NHMA 1RXFA 2CGPA 2RDNA 4MGYE 1O8SA 3LOBA 3CQOA 1WMEA 4LLOA 5E89A 2VCMA 1HW5A 4NOTA 3VBRC 2VULA 4H7LA 1SLCA 4IL7A 1AX0A 1VBE3 2Y60A 1QF3A 1JU3A 4WM7C 3BTXA 3JU9A 3HAGA 1NXMA 1GNZA 4K7JA 1PGW2 4QHZA 5EQUA 4Y22B 4JKMA 1GZ9A 1IKQA 2ZKNA 3I2GA 4Y33A 4JGYC 4F83A 5J09A 3SKJE 1PK6B 1GZCA 2N7GA 4LE4A 5F39A 5JR7B 3E5UA 5BNOB 4JCKA 3HR9A 4Q4Y2 3SNMA 3HIFA 4KGGA 4IQPA 3VBUC 1AR93 3P6BA 3CDZB 4HG6B 2VY0A 4NWWA 2PHUA 1GQPA 4J25A 1ZZCA 5J3UA 1UO9A 3OGVA 4FCAA 3HN3A 3OD0A 3OBZA 5ABJB 2ZGSA 1LOEA 3U1XA 3W59A 4XFAA 4LK7A 4YVSB 3M70A 3OUJA 4HKWA 4OULA 5C4WA 1Q43A 1OLMA 1PM7A 3WNNA 3O1MA 1CJPA 1FI2A 3N3HA 4UW4A 5B4NA 3D5OA 3EMRA 3NNJA 1GBGA 4BDVB 1DQ0A 2HWF2 3HQXA 4IV3A 4YZ1A 3WZ1A 3GBWA 5I91A 1TNFA 1XBFA 4LR4A 2YUEA 2D43A 4HZFA 3AYCA 2K2SA 2W1QA 4QKFA 2IXCA 2R042 3ZDSA 5FOBB 5GALA 4AFDA 2FQPA 4OLLA 1Y43B 3WX5A 2E53A 1YQCA 5KWRA 2A6XA 1IGOA 4TWTA 4BLIA 1C8M2 1MS5A 5DAQA 2JDMA 2ZGQA 4AW7A 2MNGA 2PMWB 4AHZA 1N3QA 1H2NA 2B8MA 4MO3M 5LRRA 4R4ZA 5CVRA 3AP4A 2WUHA 3ZFEB 1CAVB 2BV4A 2ERFA 2ARCA 2MEV2 3PUQA 3QOPA 3TN93 2YBSA 5FP8A 5FKBA 2ZEWA 5CEHA 2RJLA 5LY2A 4MGIE 4NPMA 3OGGA 4COZA 5FWJA 1BEV1 2IXIA 2ZJCA 4RD7A 1O91A 1PMJX 4WM8A 1OQDA 2RR11 5FUPA 5CFCA 4Q5OA 3E6BA 5FZCA 5KXEA 1AF9A 1SCSA 5LWBA 1SPPB 1WW7A 4YNIA 1QQP1 1XNBA 1BHGA 1HDKA 1MQTC 4Q0QA 4MSVA 1LU2A 4N53A 5HBAA 2VUJA 3D4KA 4BH9A 5GZDA 1DZRA 2VUCA 3W20A 2WT0A 1HJFA 1CONA 3J7LA 4JDOA 1EV12 1IQDC 1EAH3 4P9IA 2E51A 3ZXEA 3DXTA 2WO3A 4GWNA 4XCAA 1W8OA 3OEAA 1ZBA3 1CD3G 1K3IA 3SQOA 1K5JA 1V6LA 1VRH3 3MW2A 3SITA 3UT0A 2GMEA 3ZFFA 1SLAA 1UXZA 3ZN5A 1RVF3 3C3VA 4Z2AA 4XFBA 2VO5A 1QU0A 2RS52 4EN0A 3LPGA 2NLRA 1VBA3 1H1AA 1WWYA 2IVJA 4XMIA 4JV4A 5CNAA 1NT0A 5FZAA 5H9RA 4E9KA 2B4KA 4HPKB 1UY1A 3BVCA 5JOZA 1YFUA 2BGOA 4DQAA 1ZRCA 5JIUA 3RRDA 4HK8A 4CCEA 3U14A 2J1RA 3BTAA 2VVFA 4BXFA 1E5HA 3T2TA 5JZGA 3WOGA 4AI9A 1REEA 1JUIA 4XYXA 2DV9A 4N7UA 5I8TA 3URFA 1DDLA 2R063 1G9CA 2NMOA 2VVDA 4GKYA 1H6XA 4IEPA 1WLWA 3BCWA 1PO23 4DOUA 5HCAA 4CCJA 1ST8A 4P5HA 3W58A 3AFGA 4K40A 4AEJA 3WF1A 3NAPC 3VDDC 1ZZ7A 1J84A 5KXBA 3SEPA 1HRI1 5E8AA 4GZ9A 2ZX4A 4XFHA 4YLZA 5HXVA 4ZZ5A 2O1QA 2VW1A 1JYCA 3PIJA 4P14A 1CESA 1MZ6A 1VRBA 2YGLA 3I8TA 5H9SA 2G1MA 3N4MA 4FFIA 2XL7A 4Y1XA 4CP9A 2ZX2A 1JUHA 3LKJA 4CRQA 1UMZA 2AREA 4BK5A 5JSRA 3TAYA 3VD4A 1LULA 2W1SA 1D4VB 1SLTA 2K0GA 2YBKA 4ZY9A 4IV1A 3N9PA 3MO4A 4Y1ZA 3SKVA 5FZEA 3OOXA 2UY8A 2XJVA 1GV9A 1PK6C 2EXJA 3POIA 4M3CB 4P9XA 1UKRA 2ZGRA 1RUC2 4JTOA 4R9AA 5FYCA 4ZXEA 5E1RA 5B2GB 5EYXA 2X53S 3KCCA 5C9AB 1T6GC 2PELA 3QLQA 4IEXA 3FLTA 3RGBA 2ADEA 1MS1A 3VBHB 1MVQA 1CAXB 1LHWA 1TNRA 2JKBA 1H8VA 2VPVA 4M4PA 1Z7S3 4N7IA 3O1OA 1J1LA 1TVGA 2YMZA 4K1YA 5C3RA 5F37A 3ON7A 1JHNA 3ZXLA 5ABJC 3RI9A 1OT5A 3H1MA 1BMV2 1LGCA 1XB9A 3LDBA 4YVSC 3J8F3 4JHZA 4XQDA 3QACA 4D7YA 4JTNA 1HB3A 2AR6A 2Q8OA 5K9YA 3WDYA 3DPRB 5L7OA 3PUHA 3B94A 3VKNA 1S1AA 3PTYA 2OS2A 5BNNB 2EAKA 5J48A 4A42A 5I93A 5F2SA 1YQ8A 4NIAA 4IEOA 3OYWB 4QX7A 1AR63 5LBBA 2PHXA 4O9EA 4UF0A 3ZSMA 1RUI2 3H1WA 2KM2A 5IVCA 1WLCA 5LEJA 1KITA 4CXYA 4FTSA 2JJ6A 3MIEA 4QGMA 5A3WA 1BQPA 1F2NA 4Y4RA 3POGA 5GLZA 3BGAA 5LW9A 1I3HA 1L7RA 1QJEA 3O12A 3ZOIA 3P3PA 1G8WA 2C9AA 5JOWA 3R0RA 3ZIWA 2ORXA 3JCIA 3MV01 1E5SA 3K48A 2D3RA 2ZHNA 4Q4V2 2PHWA 1X82A 5JXIA 2W46A 2VZ1A 1M4WA 4Q0SA 3SLIA 2BJSA 4MXVA 3WDWA 5KHJA 3AL5A 3I2HA 1PZ8A 3ENRA 5JI7A 3K46A 3ZFEC 4K8RB 3KF3A 4NHYA 4CEYB 3IAQA 1R083 4YG0A 2BNNA 1OD3A 1WUVA 3OY8B 1HXS3 3VBRA 3R4SA 2B9VA 4FPLA 3B9IA 2ZEZA 4HT1T 4FFGA 4LBOA 1TG7A 3K75B 5CKQA 2VXRA 2Q8DA 3SEEA 3JQWA 1SEFA 1W9TA 2DVAA 2WLQA 4DNYA 4XEZA 4CDUB 2A6WA 1PVC3 2QKDA 3OPZA 1SFYA 3E6DA 3ILFA 3WUCA 1M06G 2HJIA 4BQ5A 3VBUA 1F4AA 1JMUB 1XE8A 4UXAA 3WLUA 2DCKA 1A78A 3IWZA 4NUBA 5T5JA 1CAUA 3H0OA 4CU6A 1A6CA 1CX1A 2RE9A 3OPWA 1AJOA 1YWKA 1RUH2 2ATFA 2RMU1 5H9QA 2DCTA 3JD71 1QDCA 2WO7A 3VKLA 5KBFA 5IW0A 4META 4V1PA 3AP7A 5K0UB 2QCSB 3RSJA 1JYWA 3WQBA 4ARXA 4FTBA 5DG1A 5IVBA 1VBE1 2QQLA 3KV4A 4N43C 2P6CA 3S7EA 4BHPA 2P3IA 2HYXA 2PA7A 3ZFGB 2R0FA 2L9LA 1W8NA 2ZGUA 3WQ1A 3MUY1 4LQRA 2Y6KA 1O3TA 1OOPA 2PLV3 4ASMB 1O4ZA 4XXAA 1V6OA 3GM8A 4WVWA 5FUNA 1GU3A 1AR91 1OA2A 1WMFA 2BVVA 3ZXKA 5FZGA 3B93A 1XXNA 1C3HA 5GZEA 1X33A 1ZA4A 3POBA 4IUGA 3HBKA 3JZVA 3CIHA 4JKKA 4Q4V3 3H42B 3O14A 2QDNA 2J1TA 1H2MA 2VCAA 2XVGA 1YHFA 1DBNA 4FPCA 5IYYA 2PXJA 3PVEA 4GB33 2D7FA 3JUUA 1X7NA 1QXJA 4PDWB 1MZEA 4XJZA 3T1MA 3D8CA 3NL1A 3L2YA 3LFMA 2ZX3A 3MFAA 1UOJA 4L0PA 1IKPA 3GBGA 2UU8A 2XKOA 3NV4A 4J6GA 4NN0A 1LHOA 1OHFA 2WNUA 5FJKA 5LA1A 5FPUA 5FZ6A 1W2NA 1COV3 2WA3A 4D94A 5JMCA 2X5IA 4UW3A 3T30A 1LHNA 1ZZ9A 2HWC3 3N9NA 4OHWA 2XBO2 3KGLA 1Y4WA 1W9FA 3WNKA 5DMYA 4XILA 1HRV2 2XJPA 3O1PA 3W5MA 1QH6A 5CG8A 1DCSA 2IUWA 3AKSA 4FQZA 3N35A 2BRTA 2JG8B 4X8NA 4OMCA 4EWEA 3W21A 3TEZA 4IERA 4NAMA 1VBD3 4LOSA 1OKOA 4XBLA 3VBHC 2P5BA 2A7AA 2OQ7A 1W6NA 4FPGA 3WG3A 3ZYHA 3TN91 3GJBA 2YYOA 3ZMNA 5FZ0A 3V0BB 2WYSA 2JICA 2VZQA 4IEVA 2P3JA 3Q8EA 4HETA 4PF5A 3AKPA 2XOMA 1NQDA 3VHNA 1XE0A 5A6QA 3GHNA 3VN4A 3N7KA 3ZPYA 4EJRA 3ZSJA 2H6BA 1YCIA 2E32A 2CGOA 3E6CC 2IFWA 2YPDA 3NJXA 4C8DA 4LORA 4Q4X2 5BNNC 5GZCA 5JSPA 1EY2A 4MGZE 4JRAA 3GBFA 4B1MA 4YW1A 5IT6A 1UMHA 2CHHA 4DRRA 2D3PA 1JU4A 1DGWA 1UOFA 3M8LA 1JHJA 4OFGA 1EAH1 2WAAA 3H8UA 3OBAA 3R05A 5A3LA 3PVOA 3T0DA 1H8TA 2BGPA 1QJU2 1C8NA 1ZBA1 1HKDA 2JDKA 2JECA 2WN2A 4JC1A 1VRH1 1W06A 2GALA 1STMA 1NXD1 4LBJA 1RVF1 3WD5A 1QJX3 1SBDA 4I3GA 4RGKA 1AYN2 2PHFA 1D7PM 1VBA1 1W99A 2VOXA 4XDPA 4CCMA 4XMAA 2YGMA 5GZFA 4DINB 2C24A 3IZOA 2O0OA 3RYKA 1WD3A 4CEYC 1XOYA 2WFPA 4QXHA 5H9PA 1D2SA 5JLVA 3M1HA 4K6BA 5C8WA 3RNSA 4RN5A 2OUHA 2PYTA 3B7MA 2HWB2 1HLCA 2W0XA 3KS7A 4Y5SA 3L9JT 2GAUA 1DGRN 1H2KA 2R061 1FV3A 1ZX5A 3H3UA 5T5OA 4DMIA 3LB9A 2DWRA 1GMMA 4IEYA 2R49A 4OZXA 2HWD2 3WF0A 3W5NA 1PO21 1OF4A 5BNOA 1LHUA 1XNDA 4MXWB 3AKTA 3ZKYA 1BBT3 2BOIA 1R1ZA 1W2AX 2UY9A 1UX7A 5I0UA 2CL2A 4YW5A 3AYDA 5A3OA 1S2KA 1NZCA 3B02A 3IPVB 2CDOA 3MIBA 1UY3A 3TEYA 4BE3A 3HQRA 5IVEA 1LOBA 1SBEA 2WNVB 3BOPA 1O4YA 2JE9A 1MS4A 2QQMA 2Y6GA 2DU0A 3VKMA 5K0UC 1CX4A 1ND3B 4RGAA 3ACLA 2JDAA 1REFA 4RGGA 2DF7A 2WFF3 2WZR2 3GGLA 3PURA 3O1UA 5C8CB 1MVEA 4A4AA 2YFZA 2QQOA 4RQPB 2Y6FA 3ZFGC 5F32A 4GH4B 3H8XA 4QPGB 4KI5M 3WNOA 2W92A 3AKQA 3OUIA 3TYJA 1S0EA 2C4XA 3UESA 4TLGA 4B1LA 1Z78A 2GP5A 3I54A 1POV0 3AP5A 1RUE2 1TEIA 1NX9A 1Z7S1 1ENRA 2OQ6A 1OVPA 4UW5A 1UAIA 2QQJA 5FZ8A 1ODNA 3VL9A 4DIQA 5F6KA 4NO4A 1XJAA 3K51A 1QOTA 1YLLA 4UT5A 3APBA 4XF3A 5LCWL 4U36A 2DUPA 3J8F1 1VBB2 3ZYGA 4KG8A 2VUDA 4XF4A 3VBOB 2GC2A 5IK7A 3ALQA 4LBKA 2R1BA 4PDWC 4AI1A 4XDQA 1TME3 2R6QA 3KSCA 4JZRA 5DDJ2 1NY71 4CEWC 3KHCA 5FZLA 5FKCA 4LKEA 5AFEA 1JZ4A 1AR61 1QKQA 2XPJA 4A7YA 4A6SA 1PGSA 1QOOA 4HSJA 3MW3A 4XF1A 5ANQA 3VBSB 2ZZQA 3IDEA 1QEXA 4RHV2 2YDEA 1SPPA 4QXCA 1A3KA 1AXYA 3JQXA 2XJSA 5DXDA 1RC6A 1XYPA 2Y34A 2MHFA 3NMBA 4Z82A 2JG8C 1D4M2 5C33A 1K42A 3LEMA 1AR73 1ZBE3 3C7FA 4ASLA 1R081 1YEWA 5C70A 2RS32 1E57A 4QX0A 1F8VA 1APNA 2W47A 5FY5A 1HXS1 5FWEA 4XFFA 3ILRA 4N9IA 5FYBA 1S4CA 2OT7A 2D6PA 4YW2A 2WR9A 1C28A 2DUQA 3M7AA 4DUXA 5LY1A 1ASJ3 1H4GA 3BODA 4NPLA 3HNYM 5FYYA 4IEZA 3VZOA 1UF2C 1PVC1 1GZTA 4RR3B 5KHKA 4LLFA 2EXKA 3LEGA 4JDMA 5LEKA 4CDWC 3GDBA 3DYMA 1UY0A 2AEYA 2YROA 2XVLA 2WS93 3GF6A 2ILMA 3IIAA 3ORJA 1JW6A 4JDNA 1IPKA 2ZEXA 4O61A 4MV2A 2GNMA 2WIIB 1PHMA 3M3QA 3FJSA 3BN6A 1XC6A 2ARAA 2IWGB 2VM9A 4FPHA 4ZPIA 2R32A 2VCCA 4LBQD 4ZZ8A 1JZ8A 4A2UA 5FLHA 2ZXQA 3VHOA 2BVBA 4QPYA 3WEZA 4URAA 4H3WA 5ACA2 3TEXA 4LOTA 1CR7A 3POWA 2P34A 2JXAA 2JX9A 2BTVC 3DUIA 4AVCA 4AXOA 2ET1A 5FOJB 3HBZA 3FBYA 1IOAA 2R0HA 4CCNA 1FPN3 1JOJA 1O8PA 5IJRA 3VL8A 1KD7A 1TMF2 1CWPA 2W94A 3O1VA 4HL0A 2VMEA 3PHMA 3C8XA 2GU9A 3PUIA 2J1SA 2PLV1 1GFF2 1MQTB 4CDQC 5FDBA 2O8OA 1J3QA 4UFIA 4Y1VA 5DABA 2OKXA 3H3ZA 5CAZA 1ENQA 4L9BA 5DAWA 2J7MA 5T54A 3OTFA 1YI7A 3S0MA 2E6VA 4HVRA 1YFWA 2A1XA 4M3CA 4KU8A 5FPAA 4R9DA 5C3OA 4YARA 3RG0A 4BK4A 3HQUA 4MVTA 4F8AA 2X29A 3NV1A 5C9AA 3KQRA 2V72A 4QM8A 4CDXA 4COUA 4DXTA 1CAXA 4DPNA 5LA0A 1ND2A 1VALA 4MHUA 4GB31 1FOD2 1OFSA 4QPIB 3VB9A 1MEC1 4AI0A 3AVSA 5JR2A 5FZ4A 4CUGA 1RUJ3 1W6OB 4XTMA 2UWBA 1XPWA 2VOTA 1COV1 2WNVC 3PL0A 4Y1UA 2EA7A 4YM0A 2A6VA 2ZGTA 2FDGA 3DPRA 4XF9A 5IATA 2FDHA 1ND3C 4EROA 1MS3A 1G6NA 2HWC1 3ST7A 3C7EA 4X8PA 4BM8A 1MS8A 3ZVXA 2ZX0A 4QQOA 3LPFA 1FMD3 3THPA 4HVQA 1B09A 1VBC3 2CDPA 1WA4A 3ASIA 3B5LB 4Y5Z0 5FYTA 5C3PA 5C8CC 1LNSA 3H7JA 4AHXA 1JYNA 3FE5A 2XJQA 4RQPC 4TZDA 3S5AA 4GH4C 2H0BA 3ECQA 3O0VA 4FPFA 4JGZA 4CUCA 4M0NA 3LSEA 1VBD1 4V2VA 4GIQA 5FPLA 4BLJA 4FAGA 3SHRA 1RUG2 4O7XA 2H6CA 1OA3A 1ULOA 2YU2A 5ACA3 1RUOA 1JS9A 5G04L 1DGWX 3JBG3 5HV4A 1QJZA 4RS5B 4WVMB 1IS6A 1PO13 3NV3A 3R6SA 3TBDA 3IAPA 5G05L 4ORFA 1KDKA 3DKQA 1VJ2A 2ZKLA 3I2DA 1NQJA 3RPQA 3OBTA 3VBOC 3OY8A 3N7MA 2Y8KA 4YM1A 5CFDB 4XHXA 4D7TA 4I2OA 1NA1B 3TNQA 4PI2A 2YU1A 2OPKA 3ZMOA 1QJY2 3N7LA 1GP6A 4ISRA 3I3EA 3MF9A 2OVUA 1NUKA 2CAUA 3ACFA 1V9U2 2WO2A 3AK0A 2Q8EA 3UGHA 2GMMA 4CDUA 4EZHA 2VQTA 3VBSC 4I02A 1AR83 3AMNA 2HLEA 5C5UA 4Q0VA 3WUDA 5JSOA 1AYM1 3VBFA 1V70A 4B8EA 4HK9A 4YFWA 3SCFA 2XKPA 2FHRA 2B45X 2R073 1QJX1 5I0DA 1F31A 1X50A 4FPEA 1IS3A 5FIXA 2E33A 2YXSA 4YW6A 2HEVF 5C7GA 1G9BA 1W90A 4OI4A 2BNOA 3GHMA 1DQ4A 2OPWA 2QDRA 5A33A 1JZ2A 3HEIA 4AI3A 3VZNA 4NRQA 3S5QA 5A7OA 5AC93 1W6QA 2XVKA 4W6XA 3FX3A 3ZXDA 1UD1A 2RJKA 1W05A 1KS4A 4WVZA 3BU7A 3Q9OA 5FYMA 3BOWA 1Y9QA 2BZDA 2CNAA 1R092 5A7SA 2IFRA 4CTEA 1KGYA 2D6MA 5FYSA 3T1LA 2W91A 4PQ9A 4WV8A 3VGIA 3B00A 2AH2A 5BXXA 1G9AA 4RR3C 4SBVA 1BBT1 2E7AA 2ZHMA 4BZ4A 2DUOA 2HWE2 1UZWA 1AL23 4LIVA 2WNEA 4FI9A 4QB2A 1OSGA 1RUF2 2VE1A 3FLPA 2LM3A 4LK6A 4BB3A 4R9BA 3PVNA 3SCGA 4BMBA 4O65A 3NJVA 1VP6A 3DCQA 3WCSA 3VZJA 3WDUA 2XLFA 5F5AA 2VW2A 4S2HA 4CCLA 4QB6A 4PDWA 3FUOA 1ZM1A 2Z79A 1C4RA 1QOSA 4LBQA 5JPMB 1D2QA 2WFF1 3R4UA 3MYXA 2A3YA 2VBDA 2YY1A 1C57A 5F2WA 3J4UH 1WMDA 4QU2A 4Q4Y3 4OI1A 3ZDVA 3W9AA 4MUVA 4X6QB 5CYYA 1KEXA 1KFXL 4BISA 4NIHA 1ULFA 5CBLA 3VZMA 4YZ5A 5F5IA 3VD3A 5FZKA 2J1UA 2FCTA 3U07A 4ZS2A 2VZSA 2JG8A 4OHVA 1Z0HA 1LRHA 1AL0G 1NOVA 4I30A
chains in the Genus database with same CATH topology
2DTYA 1NCRC 5T52A 1U0AA 4AQ2A 2TEPA 3RZZA 1KS5A 4N43B 4QPIC 4Z92B 3CNAA 3ES4A 3WW3A 2EF6A 1TME1 1N1YA 3FBMA 4EN6B 5D1IA 2X8KA 1H2LA 2DYCA 2HWF3 3NW4A 4QT6A 1ZREA 1K5MB 1F9KA 3R4DB 1O3SA 1G9FA 1O7FA 2R043 3POYA 1J3PA 1RUD2 4K8FA 4LO8A 2ZMKA 3B01A 4KWJA 2YZ4A 1W0PA 3MIDA 1C8M3 2P17A 5J7MA 1ULCA 4Q0UA 1DQ2A 1DFQA 1GYKA 1RMU2 4YGCA 3MLKA 1R1A2 5I8YA 2Y26A 2DU1A 3E97A 4FSJA 4OHZA 2Q0AA 1AR71 4YZ4A 1ZBE1 1DIWA 3CU7A 2MEV3 2Y0IA 3AZVA 2O8QA 3O0XA 3WDTA 4ZKTB 4RS5C 3NKTA 5AVAA 4FPKA 1PGL1 1ASJ1 3PLQA 4XQWA 5GM0A 3RYPA 2A75A 2YV8A 1NCQB 1AUYA 3OGJA 5CFDC 1NA1C 1SDWA 1NE6A 3WW1A 1B35B 2OZJA 2WS91 3QCWA 3ZN6A 1SACA 3CLPA 4YGDA 1ZZ6A 3N36A 3GALA 4BYYA 1EV13 1SQ4A 3CEWA 3ZYRA 1D0HA 5T5PA 2HKXA 4BPZA 4Y20B 2R1DA 2VW0A 2G4IA 4QMAA 3NJZA 1Y3TA 5FCCA 1BKZA 2G9FA 3VHRA 1S0BA 2DFCA 1ENSA 4GMP3 3SH4A 5BNPB 2D97A 2RS53 3THTA 4CP1A 1OMIA 1FPN1 4XBNA 2Y0OA 1GZWB 4C1WA 1S2BA 2WNVA 4AEDC 1AVBA 5J98B 3ELNA 4HLTA 3WY6A 4COWA 2VVEA 2PAKA 3WQ7A 4YYOA 1YYNA 4Q26A 5J36A 3FLRA 5C8CA 3AKRA 1UKGA 4JQRA 1OFNA 4XJ9A 2JG9B 5CADA 2BNMA 1OQEA 2P37A 4QPGA 2BEOA 3OF1A 4D3WA 3U0ZA 1KXGA 4YZ3A 4YFZA 2GNTA 5HCFA 5D8AA 3I59B 1QNYA 1RITA 2XJUA 4Q1PA 5CB7A 1O5LA 3M3EA 2ZGKA 2AUYA 4FT8A 4YG6A 2Q4SA 1W6MB 1RUJ1 4XFGA 4E4ZA 4C0BA 2XUMA 4WM7A 4B4QA 1WBFA 2BW8A 2NP0A 3JB8A 2I07B 5I0RA 1FMD1 1URXA 1QXRA 1VBC1 1POV3 1RTVA 4JGYA 4MH0E 2V09A 3GZAA 4LTAA 4WZCA 3S7IA 4J1XA 1RUC3 1VB4A 2D6KA 2NM1A 2PQQA 1YI9A 3E5XA 4W6YA 3VBSA 2VOVA 4OHXA 4AVSA 2ZCWA 4OI0A 5FTTC 4P9JA 2VMHA 2DCZA 2A3WA 1ZNPA 4G3YC 1ONAA 4LNVA 2YC0A 3JBG1 5K8SA 1PO11 3RDIA 1N3OA 3V56A 3H7YA 3WXPA 1ZZBA 2VOWA 2FZ2A 1PIV2 4KNCA 2ARBA 3EQEA 1NLSA 4NHKA 3CJIC 1VR3A 3FFZA 4URTA 1RHI2 3DV8A 1C1LA 3QH6A 3V64A 1K5MC 2RM22 1RUI3 1N3PA 2ZGOA 3OJBA 5GKAC 4FPYA 2RS12 3SXWA 5FQ0A 4LT5A 3JB4C 4LBNA 1AR81 2TNFA 4M01A 1FNZA 2ETEA 4D7SA 2QZ3A 1ZRRA 4BCUA 1LOFC 3RWNA 2AGSA 4IV3B 2R071 4C1XA 3WW4A 3NWKA 3WDXA 2XL9A 4XPVA 4CEWB 4LO4B 4AI8A 2GN7A 5AC91 1I9RA 1O3QA 3AZXA 3ZN4A 1FNYA 1H1MA 3DL3A 1V6IA 2OUJA 4OUMA 3VZLA 2BFUS 2ZZJA 2YPJA 4XJAA 1NCQC 4LULA 2DVDA 4N9HA 1MQTA 2GC3A 1B35C 1PMIA 3ZYPA 1AL21 1IS4A 2NYYA 2A6YA 4XE9A 4Y24A 1RUH3 3LZZA 2SLIA 5CFCB 1O5UA 4LA2A 3A0KA 4QD2A 1TE1B 4QM9A 2XGXA 1XU2A 2NPIA 3VLBB 1LOGA 2B42B 3WT3A 5BNPC 4YRDA 4KU7A 2GC1A 3NO8A 4FTEA 1PGW1 3D6EA 4Q8KA 1W6OA 2DTWA 1QGLA 1V6MA 1WD4A 4FPOB 1UIJA 4RFT0 4CDWB 3LAGA 3ME2A 4Q4Y1 2RS13 3NVCA 3USUB 3VUOA 4I0AA 2XB6C 5LK7B 1ULGA 2WJSA 4NPRA 2JG9C 1S0IA 4PBPA 3UJQA 1UL9A 3DF0A 2JEMA 2A70A 5GLVA 3NAPA 4E27A 3VDDA 2E7QA 5IUQA 1L3JA 3KT4A 5JZGB 2XLAA 3ZXAC 5JWPA 1XNCA 1UPSA 3LOIA 2AYHA 4BQ1A 1BEV2 3AJYA 1A8MA 3AM2A 4WVMA 1MZ5A 2EVXA 2RR12 2HWF1 2QFEA 3WP4A 4JAAA 1V6KA 4E2SA 2R041 1QQP2 1EPZA 4CDQB 3MLJA 5GZGA 1UW8A 1JTZX 2W68A 2XBO3 3WR0A 1JH5A 4E4DX 4QGLA 5KHIA 2XJRA 4Y22A 1C8M1 1HRV3 1S55A 2CY6A 2VNRA 4FOWA 1PK6A 3MW4A 2GH2A 3NKGA 4LEJA 1H4HA 1PVXA 1FXZA 1QHDA 4LBLA 3AP9A 3UJOA 2MEV1 2ZMLA 4HVOA 2PHDA 3CJXA 3TB0A 5ABJA 3EXUA 3WG2A 4IV1B 5A3MA 4YVSA 3BB6A 1UU5A 4Z2WA 1F5FA 3E5QA 1YUDA 1RINA 3FMGA 4BIOA 5GLTA 3QD6A 1Q8PA 1BYHA 4MGKE 4HN1A 3LWCA 4Q4X3 4BWOA 2A5ZA 3INAA 2PAEA 1N1TA 4DY5A 4XIKA 1BK1A 3KGZA 3AFKA 3SH5A 2VU9A 1EV11 1WLDA 3IT8A 1KDMA 2B5HA 2BWCA 2PHTA 3D82A 5C4WC 1HRI2 5TSWA 2XH6A 1N1VA 3RMYA 1QJU3 1DQ5A 1OKQA 1YFXA 2VG9A 2XG3A 4GMP1 1ZYBA 1O4TA 1I5ZA 1IQAA 2P3KA 3LGRA 4IV3C 2VECA 1AYN3 2RS51 4YM2A 2GZWA 1XYOA 3ZFEA 1CAVA 2OIIA 2IC1A 1PNFA 3VKOA 2H0VA 3HMYA 3PJQA 5BPXA 3ZSEA 4WVVA 1AXZA 1U5XA 4Q4W2 2B46X 2DCJA 2HWB3 5K7PA 1VAMA 2LUWA 3IBMA 2Q1ZB 2HWD3 5JCTA 2D5HA 3MDPA 3B69A 1BVP1 1AZDA 1DZTA 4A7ZA 4ITCA 2XWBB 4S2FA 1NYWA 2ZGLA 3EJKA 4E4SA 4LUMA 1H0BA 2D98A 3D0JA 1S0CA 1LEDA 2D93A 3UKNA 5BV6A 4WM8C 5CFCC 5E88A 1I6XA 4N43A 2JENA 2WZR3 4KL1A 5DG2A 4HPKA 1U5IA 5C6CA 4INDA 2VQ0A 5FFOC 2ZACA 1OLRA 1RUC1 4P9LA 1CAWB 1UIKA 1YRZA 1SLIA 1LEMA 2VUAA 2GDFA 4FPJA 4KH9A 1RUE3 2Z42A 3ZFFC 5EFUA 4AYUA 3WV6A 1BMV1 4K1ZA 1VBB3 1OOPB 4AFMA 4OUSA 4M3CF 1LJ7A 3RJ2X 5JZGC 4AQTA 1HQNA 3RQ0A 5DDJ3 3QBQA 4Q4W3 3J26N 5JAXA 2A3XA 4NHLA 4QXKA 1RUI1 3BALA 5EXOA 2UWCA 4AFBA 1ALYA 2OW4A 1DU3D 4HFSA 1VIWB 2A73B 2ARXA 1GLHA 2PHRA 5E16A 2BUKA 4RHV3 1Q3EA 1SLLA 2RMU2 4GKXA 3JD72 4AGVA 1QNWA 4Q4V1 1D4M3 4XFIA 4ATEA 2R30A 4KQ7A 3OBRA 3KT1A 1NCRB 2X5IB 3VBHA 4DY3A 3ZX7A 1A8DA 4YM3A 2D44A 1W2UA 1VBE2 4HN0A 2VMIA 4YSFA 2RS33 4GWMA 2JE7A 2B7YA 5FRAA 4IV1C 2W08A 4I0WB 4B29A 1BCXA 1OD5A 4YW4A 1S0FA 3VKFC 4D69A 5KHHA 1HQWA 2JD4A 3LSDA 4KBBA 1AR92 5BNNA 4DFSA 2WA4A 1W6NB 2WWSA 3KCXA 3OYWA 4F3JA 3KZ4C 5EYYA 1IPJA 1XRUA 2JG9A 2QUOA 5HCBA 1RUH1 1DYPA 4BIFA 4FAHA 4XETA 1DYKA 2BWAA 2VGDA 3HN1A 4W65A 4XJWA 2WQZC 1W0OA 2IXKA 4PCRA 1X8EA 5JI9A 3I59A 4M0HA 1IS5A 1RJ7A 3UV9A 2UYBA 3AMQA 1WBLA 5FMOS 1TMF3 3USSA 2BGCA 2WSUA 4CEYA 3CF6E 1W6MA 1H9WA 4UBGA 5FO8B 3AZYA 3O5SA 4C0HA 1H8TB 1NLRA 3GNEA 4AHYA 4CP2A 4ZU7A 3M2MA 3B3QE 4YW3A 2WINB 4U2AA 1CN1A 1UCXA 3KMHA 4H14A 1YO8A 1SCRA 3MGUA 4P9YA 3KT7A 5A32B 2B39A 3TN92 1JYIA 5FBZA 3KM5A 3X29B 3V0AB 3EBRA 2JDZA 1KJLA 1FOD3 3WP6A 5BNQA 4CYDA 1MS9A 1Q5OA 2ET7A 3AMHA 4FOYA 4GA9A 1WCDJ 4AEDB 1BVVA 1AXKA 4PJYA 5I0TA 3PVBB 1H30A 5K0UA 3RS6A 3ZYJB 1CIWA 3SCHA 4QQHA 2XBO1 2DVBA 1W6PB 2BBVA 4LHNA 5DZGA 1HRV1 3ZFGA 2OA2A 4K21A 1EAH2 3RI8A 3ZXFA 1LOCA 1ZBA2 1VRH2 1PZ9A 4PIZA 2VQAA 1RUG3 1RVF2 2WZPP 2DFBA 1Q8QA 5KHGA 1LODA 1VBA2 2FZ1A 4HMZA 2EAAA 2K9ZA 1KFUL 4DB5A 4ES9A 1RL3A 3PJYA 4R4XA 4TSVA 4YG3A 3FC0A 1OOPC 2PHLA 3S30A 4CP0A 1RJ8A 1IZ3A 1LTEA 2KA3A 2HEWF 4CEWA 5F1RA 2R062 1DGRA 1DZQA 2VH9A 4Q4X1 4R9CA 4W6WA 2ZABA 2BFUL 1C1FA 1QJY3 4FP3A 1PO22 4Z07A 1C5IA 4ISQA 3J9SA 1KJRA 1V9U3 4Q29A 5CIRA 2KXLA 1YFYA 2VNOA 4Q0PA 4B4PA 2I74A 4XF0A 1QJU1 2I2SA 2VNGA 2FBEA 2MPFA 2WL1A 2ZGPA 1S0JA 2V73A 1VAVA 1BJQA 1WW6A 3KLSA 4P9WA 4QGNA 3LA2A 2PAMA 2WNUC 1AYN1 3DGTA 4N90A 4EWDA 2X5IC 4GULA 5AVPA 4I01A 1V6JA 4AEKA 1AX1A 2F6BA 1G86A 3ZXJA 4AK3A 4L99A 3N7JA 3V0BA 3CJIB 1YJKA 2G9GA 1D0GA 3MPBA 4KGQA 1G7YA 2HWB1 1XU1A 2I45A 3BIWE 4LO5B 4FOVA 1R093 1ENXA 4BA6A 4JVAA 5FPZA 4HANA 4EN7B 2HWD1 4YGEA 4COYA 4CDWA 1Z7S2 2ZBJA 2QQPA 3USUA 4LHKA 2BQPA 2HWE3 4PLMA 1H1IA 2ZPXA 3O7OA 4ZU5A 5T50A 1LESA 4AG4A 1GQHA 1RUF3 4IXLA 3J8F2 5SV8A 4ZU4A 4J1WA 2ZGMA 3U10A 1LECA 1PNGA 4MZUA 3IKWA 3I7DA 5F6LB 1YNAA 3ILNA 1NY72 1OPOA 1RIRA 1UZZA 4AGGA 2IZWA 3ETQA 3M3IA 4LHLA 1AR62 4DRVA 2WZR1 1XE7A 1GSLA 1FX5A 1KQRA 2ZA9A 1VB2A 3O0WA 3TNPB 4XXPA 5FREA 1MR5A 4AEMA 4CDQA 1WW5A 1H8TC 2ZS6B 2A71A 4XZPA 5GLUA 1RUE1 4QX5A 5EJ3A 2NZ9A 1UX6A 3UL2A 1U5ZA 1R082 4I0BA 1LENA 4MXWA 4UW6A 4AHWA 4XTPA 5KC6A 1HXS2 1VBB1 1JXNA 3IPVA 3KCYA 1JN2P 3AYEA 4NVPA 1UPIA 2DURA 4AF9A 5DDJ1 3U4XA 4XIOA 3WG1A 1YJLA 3H9AA 4Q4W1 1QDOA 1SLBA 5J96B 1PVC2 2ENRA 4ZXKA 4BOWA 1N1SA 5BNOC 1ND3A 3KD4A 1J1TA 1RUD3 1J59A 3NV2A 4YVWB 4B4RA 2CYFA 4IEQA 4CDXB 4FO9A 1DHKB 1ND2B 2EALA 1LKNA 4RHV1 3AYAA 3IN9A 1CQ9A 4RQPA 3CO2A 5FLIA 4GH4A 4YGBA 1AJKA 1RMU3 2Z2SB 4Q8LA 4TLFA 1AHSA 4KWKA 5T3NA 4XQ4A 1DG6A 4AE2A 1R1A3 1D4M1 1YIPA 4E2GA 3SISA 5L19A 3VZKA 4Z1VA 4LA3A 3HD8B 4MX3A 4XBQA 3AZZA 3MPPG 4RSUA 2CGNA 2RS31 4R52A 4XJUA 5JOYA 4A7KA 2C0ZA 3WINE 4G4FA 4FBFA 1XYNA 4JGZB 4K9SA 2PLV2 3TOJA 1EYBA 1LB2A 3DKWA 3VBOA 1YIFA 2Y38A 3AZWA 3VHPA 3IDBB 4L8QA 3L2HA 3H50A 3DN7A 2IXJA 1GKBA 4AFCA 1C5HA 4HSLA 3MIFA 1S0DA 4C91A 2PTMA 3V65A 5IK4A 1X8MA 2HEYF 4GB32 3NSTA 2EXHA 2XHKA 1Q8VA 1MEC2 2PN5A 4SLIA 5ACA1 2ZAHA 5DZFA 4A3XA 1OA4A 1Q8SA 1GR3A 1DGLA 1UU6A 4R8HA 1COV2 3UKVA 1TMF1 1FAYA 1XQNA 3HWJA 5FPXA 4L97A 2HWC2 2OYZA 4AVVA 3LCPA 5BY5A 3GZUC 1JBCA 3IMNA 1RUNA 2E9QA 1F5JA 4LBMA 1XNKA 3VBFB 5T5LA 4M3CE 3FHIB 2ZTNA 3MIHA 1TQ5A 2IXLA 3WCRA 3AXEA 4F7ZA 1J58A 1VBD2 1REDA 2B9UA 3ZXGA 3AMPA 3FZ3A 5C4WB 3OD4A 4RR3A 1CAWA 2FMYA 3WQ0A 2D40A 4TYSA 5A33B 1DQ1A 5IK8A 1W6QB 3TRSB 1LGNA 1FOD1 3ZSKA 3CL1A 4EWAA 1ZRDA 4MYEA 2A6ZA 4LE3A 2W52A 3A4UA 4WBBA 4FVVA 2GNDA 3C2UA 1ULDA 1KRIA 4Y1YA 1GICA 4EV0A 1GANA 3GZTB 3HT1A 2CV6A 1W39A 4Q1RA 1EPWA 2IXHA 2CWSA 4HKOA 5FO9B 4RL7A 1QXPA 3MIGA 3PNAA 2DCYA 5FAXA 1AYM2 4M00A 2D6NA 1ZVFA 3WG4A 1SBFA 1QH7A 3G6JB 3RMXA 3RYRA 1RUG1 1DQ6A 1CJDA 1J3RA 1MEC3 1QJX2 5L36A 2XLGA 4LBQB 2DVFA 4FTSA 1V6NA 3WNXA 2WT1A 4KG0A 4FP2A 3LA3A 4WM8B 3WW2A 2GMPA 3RJRA 2R16A 4AQSA 1NCRA 2WLPA 3EHKA 1FT9A 1H9PA 2NMNA 3POSA 4RA0A 2V5YA 4QPIA 3I4IA 4P9GA 2PFWA 4QQLA 4N53B 1PIV3 2D6OX 2ES3A 1CVNA 2SBAA 4QHBA 1I1EA 4UBHA 2W39A 4MLOA 4BMEA 2HYKA 3WP3A 4ATFA 1RHI3 1QJY1 1O3RA 2RM23 5GJ6A 4L11A 3MZHA 4E2QA 1BBT2 1V9U1 3SH3A 5KXCA 5C9AC 4YVWC 4PIXA 4AVAA 1V00A 4CDXC 3ZFFB 5GLWA 1ND2C 2Z5WA 5JOXA 2LALA 4GXLA 3FWEA 3M3OA 3FUQA 2ZX1A 4DZGA 5SV5A 4IETA 4IEWA 1HV1A 2XWJB 4DXZA 2D3SA 4FXKB 4YZ2A 3DPRC 4NR1A 2WFF2 4RS5A 5FMOL 1FYUA 3UK9A 2DVGA 2ZHLA 1QY4A 4Q2FA 1DF0A 2D5FA 3PMSA 4JGZC 1WGPA 3WDVA 4PBOA 1R091 4HKLA 1CGPA 1QWRA 3SMHA 5CFDA 1NA1A 1SFNA 1AYM3 1ZZ8A 2HWE1 1BXHA 3M4FA 5DUVA 1HQLA 1RUF1 3KB5A 4I3PA 2GNBA 5F9TA 1HX6A 1FV2A 3M3CA 4AWDA 1CPMA 4LO7A 2E63A 3IM0A 5DUXA 4GMP0 2QVSB 5A32A 3ES1A 2NQYA 5CG9A 3V0AA 1TME2 1NG0A 4ES8A 5FLJA 4S2GA 1PZ7A 2ZHKA 2WKKA 3ZN6B 1BZWA 3FFQA 4AEDA 5EZWA 2QE3A 3MF6A 4CDUC 3OCPA 5DZEA 4XJ8A 1HIXA 1QMJA 2QNKA 1OI6A 4EN9B 3HT2A 5BUVA 4LO6B 5AFBA 1W6PA 3VBFC 2Q30A 4H55A 1AR72 1ZBE2 5JDBA 1U12A 4Y4YA 4I09A 5L7OB 1AX2A 4PLNA 2Q1MA 5KC5A 3EO6A 5LRSA 3LA7A 1Q56A 2AZ5A 2ZMNA 4B3NA 1PGL2 4AVTA 1BEV3 1ASJ2 4QQPA 2EXIA 2RR13 2F4PA 2UURA 2LTNA 1SMVA 4COVA 1QQP3 4AVBA 1RUD1 3AJZA 1UN1A 2WS92 3ZIXA 5D8AB 5T55A 3QH7A 1OPMA 1LU1A 3A0NA 2NN8A 3AX4A 5FO7B 1RMU1 2CTVA 3AP6A 4EN8B 1R1A1 3VBRB 4LUKA 1LGBA 4WM7B 1FPN2 2WQ4A 3ZO0B 4JGYB 5CA6A 5EV7A 1MZFA 4QQ2A 2D6LX 1LCLA 4DS0A 3VBUB 3AXDA 4K20A 1NE4A 2QZ2A 4N53C 3CJIA 1CAUB 1S0GA 5JPNB 2EIGA 1POV1 5IK5A 1K5MA 1ZRFA 1HV0A 2YHJA 4B7KA 1RB8G 2FMDA 2GN3A 1VLNA 3IDCB 1LHVA 1N47A 1DLLA 1HRI3 2AENA 2RHPA 1GNHA 2TBVA 5I0SA 3D0SA 2UYAA 2WT2A 1LOFA 4XOGA 5F5QA 1OLQA 1FATA 2GC0A 1RUJ2 4C90A 4K3UA 5LK5A 4IEUA 3U11A 3MICA 4H7MA 3UKTA 4Q27A 5FQ0B 1OQ1A 2C1FA 1YXWA 3AMMA 1FMD2 3BPZA 4ONUA 1VBC2 5DUUA 1MACA 4X6RB 2VOKA 1IHMA 1ULEA 1UZYA 5L73A 3ATGA 2ZOEB 3MFCA 1WCKA 1Y7BA 3MI8A 3ZSLA 3MEPA 5JIAA 1NCQA 1VAKA 3MLLA 2BYVE 2CAVA 2TUNA 1B35A 1X36A 1WCSA 3JBG2 4Y26A 1PO12 5EWSA 4PIYA 2WNUB 3ROUA 2BPA2 3G7DA 2ZAAA 4FQ4A 4GQ7A 4OHYA 4Y20A 5DUWA 3WVJA 3GYDA 1MS0A 3WHUA 4FOQA 4XFCA 5BYNA 2ZGNA 5BNPA 2GH8A 4XW3A 1Q8OA 1GZWA 3WHTA 4HBNA 2VMGA 3ZYIB 3VV1A 1GQGA 4IESA 2GSYA 2WSVA 1AR82 2Q5TA 4L2NA 3TWIA 4OVEA 4YVWA 4O9GA 2UWAA 5KXDA 4KWLA