5CFCB

Crystal structure of human cardiovirus safv-3
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
232
structure length
232
Chain Sequence
SPFPVTVREHAGTFFSTTPDTTVPVYGNTISTPFDYMCGEFTDLLSLCKIPTFLGNLDSNKKRIPYFSATNSTPATPLVTYQVTLSCSCMANSMLAAVARNFNQYRGSLNYLFVFTGSAMTKGKFLISYTPPGAGEPKTLDQAMQATYAIWDLGLNSSYNFTVPFISPTHYRQTSYNTPTITSVDGWLTVWQLTPLTYPLGVPNDSHILTLVSGGDDFTLRMPVTFTKYVPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP1
publication title Structure and Genome Release Mechanism of the Human Cardiovirus Saffold Virus 3.
pubmed doi rcsb
molecule tags Virus
total genus 36
structure length 232
sequence length 232
ec nomenclature
pdb deposition date 2015-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5cfcB00
1MQTC 4YVWC 1FOD2 4CDXB 1NA1A 1QQP3 3CJIC 3VDDC 1OOPA 4QPIC 1PGL2 4PDWB 4FSJA 1AR82 5ABJC 5FOJB 1RHI2 1TMF2 1VBB2 4JGZA 5DDJ2 4EJRA 1EV12 5A33A 1QJX3 2MEV3 2WS91 4CDUC 2R041 2HWC2 1VBA3 5L7OC 1POV1 4IV1A 5JZGA 4NWVA 1C8M3 1RUH3 4CDWC 4FTBA 1FMD3 1R1A2 1BBT2 4IV3C 5D8AC 4AEDC 2RM23 4YVSC 1RUG1 1VB4A 3VBFB 2ZTNA 2X5IA 2HWD1 1B35C 5C9AB 1ND3A 1HRV1 4WM7A 1AR93 1VBC1 1A6CA 1RUI1 1AYN3 2WZR1 1NA1C 5AC91 1RVF2 2ZZQA 1OOPC 1PIV1 4GMP0 4CEWB 1PO21 2HWF2 4Q4W1 3ZFFA 3VBRB 4JGZC 1TME3 1HRI2 3JBG3 4WM8B 1K5MB 4CDQB 4Q4X1 1BEV3 1ND2A 1QJX2 1RUJ1 4Z92B 1ASJ1 1QJU1 2MEV2 4Y4YA 2RR12 1RUF2 4CEYA 4IV1C 4RQPA 1PVC1 5BNPA 5JZGC 3TN93 1PO11 3VBUB 1ZBA1 1MEC2 1RUH2 2HWE3 1FMD2 2RS13 1R083 2FZ2A 2RM22 1RUD3 1X36A 2X5IC 4GMP1 5CFDB 4CDXA 1AR73 4Q4Y3 3ZFGB 1ND3C 2RMU3 1AYM3 2RS32 4WM7C 1PGL1 4PDWA 3ZFEB 4QPGB 1NY72 1AR92 2ZAHA 1AR63 1AYN2 1RHI1 1TMF1 1NCRB 1HXS1 1H8TA 3J8F3 1W39A 2HWC1 1VRH3 1EAH1 2R063 2HWB1 1RMU1 1M06G 1VBD1 3ZFFC 1X33A 1TME2 3JBG2 2Y26A 1RUE2 1ND2C 1R1A1 5J98B 1BEV2 1R091 4JGYB 1OPOA 1POV0 4CEYC 1VB2A 1WCDJ 4N53B 4RQPC 2XBO2 4RR3A 3VBSA 5BNOB 5BNPC 1QJY3 3TN92 4Q4V1 1QJZA 1IHMA 1R082 4GH4B 3ZXAC 3JD73 1RUC3 1AL21 5CFCA 5K0UA 1MQTB 1RUD2 4CDXC 1V9U2 3NAPB 1AR72 3VBHB 1CD3G 1Z7S2 5FMOS 4PDWC 3M8LA 2WFF1 2HWF1 1BMV2 1FPN2 1VBE1 5A32B 1HRI1 1AR62 4CDQA 1K5MA 2RS51 2R072 5ABJB 1H8TC 1SMVA 2WS93 1F2NA 2RR11 1RUF1 4CDUB 1VRH2 2R043 1POV3 1D4M2 4RS5B 2BFUS 3VBUA 5L7OB 1MEC1 2GH8A 4RHV1 4GB32 1COV2 5BNNB 1NOVA 4IV3B 4RR3C 3VBSC 1PGW2 1RUG3 5CFDA 4YVSB 2HWD3 2DF7A 2RS31 1QQP2 1B35B 1HRV3 3JD72 4LLFA 5CFCC 2PLV1 5K0UC 1ZBE1 4QPGA 3ZFEA 4BCUA 1VBC3 1RUI3 2WZR3 5AC93 1E57A 1PIV3 3JB8A 1OOPB 1PO23 1VBA2 4CDQC 1K5MC 4Q4W3 1RUE1 3DPRB 3FBMA 4JGZB 4Q4X3 5ACA1 1C8M2 1RUJ3 4Y5Z0 1ASJ3 1QJU3 2WS92 5A33B 1F8VA 5C8CB 2BPA2 4N53A 2R042 2XBO1 5BNOA 3VBUC 3IDEA 5C4WB 1FOD1 1PVC3 4IV1B 1PO13 4SBVA 1ZBA3 2VQ0A 4GH4A 2BBVA 1RB8G 5CFDC 3NAPA 4GMP3 3VBHA 1V9U1 1AR81 1Z7S1 5DDJ1 1VBB1 1VAKA 1EV11 3ZFEC 1HRV2 4QPGC 1ND3B 4FTEA 4WM7B 1FPN1 5A32A 1VBC2 4N43B 2XPJA 1RHI3 1TMF3 2R071 1HXS3 1BBT1 1PIV2 2HWC3 1EAH3 4RS5A 3VBFA 1D4M1 1RMU3 2HWB3 1PO22 1VBD3 4Q4W2 2IZWA 1R1A3 4GB31 4Q4X2 1COV1 5BNNA 5C9AA 1ND2B 2HWE2 1R093 1ASJ2 1QJU2 1RUJ2 4N53C 2RS12 1NCQB 5BNOC 3VBOB 4RQPB 4YVWB 1PVC2 1PO12 4Q4V3 1ZBA2 4GH4C 1RVF1 4Q4Y2 1QQP1 1AUYA 1AL23 1AYM2 2RMU2 1DDLA 3CJIB 4CEWA 3NAPC 3VBHC 3VDDB 4QPIB 3VBRA 2TBVA 2GSYA 1RVF3 5LK7B 4WM8A 4FTSA 1QJX1 2MEV1 3J8F2 1VBA1 2WFF3 2HWF3 2R062 1VBE3 1HRI3 3DPRA 2WLPA 2RS53 1C8M1 1RUH1 1FMD1 1HXS2 2FZ1A 5C8CA 1OHFA 2RR13 1H8TB 4CDWB 1CJDA 3HAGA 2RM21 1RUF3 4RS5C 3VBFC 5D8AB 1EAH2 5C4WA 4AEDB 2HWB2 1RMU2 5J96B 1VBD2 1MEC3 4RFT0 3LOBA 1QJY2 4RHV3 5BNNC 5C9AC 3ZFGA 1R092 3JB4C 1RUC2 1AL0G 1NY71 4RR3B 3VBSB 1AR91 1AYN1 4Q4V2 1NCRA 1C8NA 2BUKA 1NA1B 2RS33 2QQPA 1NG0A 2PLV3 1AL22 1ZBE3 4CEWC 5CFCB 5K0UB 4N43A 3VBRC 4WM8C 1TME1 3JBG1 5FMOL 1BEV1 4JGYA 2WFF2 3DPRC 1VBE2 1RUE3 3TN91 2RS52 2HWE1 5ACA3 5C8CC 5JZGB 1NCQA 2RS11 1R081 3VBOA 2BFUL 5C4WC 2XBO3 1MQTA 4YVWA 1RUD1 2WWSA 1RUG2 1FOD3 1HQNA 1AR71 3ZFGC 4RHV2 2X5IB 4Q4Y1 4NWWA 2HWD2 1GFF2 2RMU1 1AYM1 3CJIA 3VDDA 4QPIA 1BMV1 1V9U3 1AR61 1AR83 1RUI2 1NCRC 1Z7S3 2WZR2 1VBB3 5DDJ3 5ABJA 5AC92 1HX6A 1EV13 3J8F1 5GKAC 2PLV2 1ZBE2 4CDUA 4N43C 1VRH1 1FPN3 2R061 5L7OA 2R073 3ZFFB 4JGYC 1BBT3 4CDWA 4IV3A 5D8AA 4AEDA 1PGW1 1D4M3 4YVSA 3S6PA 4CEYB 1QJY1 5BNPB 4GB33 1COV3 1NCQC 5ACA2 1B35A 3VBOC 3JD71 1RUC1
chains in the Genus database with same CATH superfamily
1BK1A 3MYXA 3BU7A 4F83A 4GQ7A 4ES8A 5IFTA 4JVAA 4IW3A 4CU8A 3SNMA 4QM9A 2JXAA 1XQNA 4D7TA 1HDKA 2J22A 4BYYA 1W2TA 1NE6A 3KF3A 4AFMA 3M3OA 4C8DA 2AACA 1LJ7A 4NN0A 4XAEA 5KC5A 3PMSA 5FYCA 3NL1A 1UY4A 4HOOA 1OF3A 4QPIC 5KHJA 1PGL2 4YGEA 2VUCA 1CN1A 1JH5A 1JMUB 1KDKA 5DUUA 3SHRA 4XJWA 4MYEA 4A7KA 4I30A 5FOJB 1FI2A 1SPPB 4O9EA 5HXVA 1QJX3 2W1QA 3RI9A 3RMXA 4AFBA 5HV4A 4LO4B 1N1TA 3ORJA 1W2NA 4AHWA 1JU4A 3NV2A 4X8PA 4HN0A 5DXDA 1D0HA 4ET7A 1NYWA 4G3YC 5L7OC 1POV1 3FBYA 3CEWA 2DUQA 2P3KA 2CTVA 4DXRA 1T6BX 3KT4A 4XYXA 3S5AA 4JDMA 5F2WA 1RUH3 2HYXA 2EXKA 2OPKA 4IV3C 4OQ9A 4Y22A 1W8WA 2ZCWA 3HOBA 1XYPA 4HPKA 4IEUA 4XFIA 3HVDA 5LBFA 5FV3A 1LEMA 4DXZA 1RUG1 3VBFB 1ULOA 3F95A 2PYTA 3D6EA 2FDIA 2DFBA 4LIVA 3A23A 1B35C 4QPYA 3PVBB 1JOBA 5FLIA 1ND3A 3RZLA 3GNEA 1GZ9A 3UL2A 2VXJA 1CAXA 3RZHA 3NKTA 2LRPA 1VBC1 3ATGA 2JG9C 4QDRA 1BLZA 1FXZA 1AYN3 1G8WA 3HN1A 3PU8A 4QDQA 4AVVA 4AQ2A 4COWA 2E63A 5AC91 2BW8A 1W8UA 4HSLA 1GYKA 1YHFA 3H3UA 4IXLA 5JI7A 5IVJA 1KQRA 4CU9A 4GAZA 3ZXDA 2BWCA 5FZ6A 2PAEA 3VZKA 2HYKA 2AENA 5EZWA 3E5QA 4D69A 1QXPA 1YRZA 2JDPA 2Y0IA 3K48A 3VBRB 1BCXA 4OHXA 3AYAA 4A6OA 5HPOA 1K5MB 4KWKA 2VTFA 5J1XA 1BEV3 1ND2A 1LAJA 2WSVA 3T4VA 4Z92B 2MEV2 1QJU1 2XL7A 5EJZB 4JAAA 2HEVF 3H8OA 5A6YA 3BODA 1FATA 2RR12 1IKPA 1S0JA 2PAMA 4IV1C 1PVC1 3PL0A 4HZFA 5BNPA 3TN93 3TEWA 5DUWA 3SLIA 3FHIB 3O1MA 3WP6A 1YNAA 3FLTA 2DTYA 3WDUA 4AHZA 1GZWA 1R083 4ZU5A 2RM22 1SACA 3AP4A 4M4RA 4XACA 3U11A 2ATFA 1O91A 2DVBA 2VNRA 3BI3A 4LO6B 4XFGA 3I3QA 3RWNA 2X5IC 1DP0A 5LBBA 2QDRA 2CWMA 5CFDB 1A8DA 2NMNA 2IWGB 4Q4Y3 3BU0A 5T3NA 3ZKUA 3T2QA 3ES4A 3OBAA 4H7LA 3T08A 3WDYA 1PGL1 3C7EA 1D2QA 4OI1A 1OLRA 2ZGKA 1CWPA 3J26N 2YYOA 4TLGA 3SH3A 1VIWB 2RDQA 2QJVA 3OEBA 3WQ7A 3AFKA 2QQUA 3PTYA 5C5UA 1C28A 1NCRB 3LQCA 5EP9A 5LEJA 4RL7A 2WC2A 2OUHA 2OZJA 2VQAA 3M2MA 3K51A 3PVNA 2BV4A 4OFGA 3DKWA 4BQYA 5LW9A 2B46X 4G9SB 1JW6A 1RMU1 3T0DA 3ZFFC 2G9GA 2WNVC 2VULA 5FYZA 1OH4A 4XUPA 1HB1A 1W8FA 4UBGA 4EN0A 2KA3A 2KM2A 3IIIA 5E6HA 4YYOA 4IGOA 1POV0 3LFMA 3MIHA 5FZ7A 2V5DA 5GM0A 1UX7A 1WCDJ 1S0GA 2GP3A 2JDNA 2W87A 3BPZA 4N53B 4RQPC 5FY4A 1GOHA 4AAPA 5FWJA 2FMYA 3L2HA 3PHMA 3OB8A 5DAWA 4A3ZA 2KD7A 2ZEZA 2LALA 1W9FA 5DZEA 3ES1A 4O61A 3GCWA 5F3IA 3N7KA 2LTNA 2DWRA 1UOBA 3SMHA 4BQ1A 1X9PA 1V6LA 4GWMA 4IESA 1ZZ9A 2WRAA 2WSUA 3E6CC 3DKQA 4N9IA 1W6MA 2DCKA 2VXRA 2A70A 4LO5B 3NAPB 4HMZA 1DU3D 1RXFA 3AP9A 3JU9A 3KQ4B 4Y1XA 1V6NA 1V00A 5FMOS 3WNKA 4PDWC 1UU5A 4CSWA 1DYPA 3M8LA 1POQA 3MI8A 4Q27A 2ZAAA 1BMV2 1FPN2 1WBLA 3VHOA 1H8VA 5FZAA 1AR62 1K5MA 3QH6A 1JBCA 4NHMA 1JTZX 2RS51 4QKNA 3VKLA 4BXFA 3SH4A 3SCFA 4A45A 5CEHA 1H8TC 3C8XA 5IT6A 1F2NA 4XUNA 3PDQA 3IKWA 3VD4A 2RR11 3EQEA 2BBAA 1PVXA 3AFGA 1PMHX 2B42B 3IAPA 3HMYA 4AI2A 1MPXA 2BTVC 4QQ2A 2W52A 1AJOA 1US3A 2CWSA 2QZ3A 5IVYA 3C2UA 3LA2A 2D6OX 3DYMA 4M0HA 4MGSA 2P6HA 2R16A 3LF7A 4COUA 4R4ZA 1H2MA 1ZRRA 4FOYA 1W8NA 2EALA 3ZN5A 4Z07A 4OHYA 1X9TA 4QKFA 1KJLA 3GJBA 2MPFA 5HCHA 2EVXA 5SV5A 5CFDA 4OUSA 4YVSB 2PELA 1ZM1A 2D98A 3E6DA 4PI2A 3Q8BA 5BPXA 1GZTA 1V6IA 4V2VA 3VKMA 3AMNA 4LLFA 4URTA 5CFCC 3TNPB 4LQRA 1WWYA 5FXWA 5I0TA 3M4FA 3K3NA 3MW3A 2Y6FA 2W08A 4FPLA 2WZR3 3AC0A 4YARA 5B2GB 1U5IA 1E57A 1WLCA 2YU1A 3I2KA 1IZ3A 2VTXA 3KGLA 4AHXA 4XC9A 3GZEA 2VOTA 3N36A 3D82A 1W6NB 4GZ9A 1PO23 1KRIA 2JDAA 1WW7A 2QTWB 4LT5A 1JYCA 3LIGA 1F9KA 3FC0A 4NHYA 3FBMA 4JGZB 2Y6LA 4Q4X3 4UFIA 5ACA1 1OT5A 1RUJ3 1TNFA 2NPIA 3A7QA 1GWKA 1WLTA 3NNFA 4B1LA 5A33B 2CGPA 3W5NA 4N53A 1WGPA 4XJAA 4NPLA 4OHWA 3VBUC 3ZKYA 2ID4A 2WUHA 1DGWX 2PFWA 2ZHKA 3KSCA 3SITA 5C4WB 4OZOA 5FZBA 2PXJA 2QQNA 3J9SA 1QOOA 1UZWA 3WINE 1HQLA 2GNTA 1MS0A 1VMFA 2MNGA 2AUYA 4MXVA 5CA6A 4XF1A 1YQCA 2O0OA 2VUAA 1V6MA 3BN6A 4UAPA 3ZMNA 4PLNA 5GZEA 1LHVA 1YJKA 4DY5A 4C0BA 1UWWA 3NAPA 1XRUA 1H2KA 1AR81 1SLIA 5BY5A 1Q8SA 3AMHA 1O3RA 1LHNA 3MIFA 1VAKA 5DDJ1 1X7NA 1MZ6A 4R4XA 4ISQA 4IEPA 4QPGC 1SLLA 1DGRA 1QOTA 3PVOA 3W58A 5I0UA 2QVSB 1HQWA 2J1RA 1FPN1 5HXMA 4CU7A 4DMIA 3NV4A 1W6PB 1WBFA 4HVRA 3BVCA 3W20A 3WQ1A 3O0VA 3H3LA 2VBBA 1L7QA 2GALA 2QQWA 3BB6A 4AK3A 5L36A 3NJXA 4XFFA 4Q0QA 2LUWA 4RGGA 3ZX7A 5F32A 1EAH3 3TEXA 1GWLA 4BQ5A 2HWB3 2W94A 2W39A 1VBD3 1AX1A 3DYPA 3G6JB 4Q4W2 3PVEA 3SCGA 4CP1A 2I45A 2IZWA 3WY6A 5SV8A 1LU2A 1R093 4PCRA 1ASJ2 1OC1A 2GNMA 3VKOA 3FWEA 4LUKA 3OD4A 1NCQB 5FZLA 2BGPA 5IW0A 4H2AA 4QQPA 1IS6A 1ULFA 2UWAA 4ASKA 1UIJA 4XJUA 4LR4A 2A3WA 2WO1A 4K21A 4Q4V3 1R64A 4GH4C 2OYZA 1RVF1 4UFHA 4Q4Y2 2Z79A 2ERFA 3MLJA 2JX9A 1GQHA 1AUYA 1V70A 2P4EA 4LKDA 1VAVA 2V4AA 2YFZA 4XIOA 4CEWA 3ETQA 4XCAA 3VBHC 3ZYPA 4COVA 4QPIB 2VVEA 2XHKA 3ZYFA 1XE0A 4QMAA 4AEMA 1SG3A 4Y33A 1H6XA 3UJQA 1QJX1 3KS7A 4MGKE 3WG2A 1S1AA 5H9SA 2WL1A 4IL7A 1K42A 3ACIA 4QB2A 1SFNA 4BOWA 2WFF3 2Y6GA 1VBE3 2Y6JA 4LHLA 3KHBA 4EWDA 1O4ZA 4PBPA 2WLPA 4I02A 5FYYA 3UKVA 1RUH1 2WABA 2FZ1A 1B09A 1HXS2 1E5IA 3ZMOA 1XJAA 4B3NA 5JOXA 3ACGA 1RUF3 4LORA 3I3MA 2ZS6B 5CU1A 3VBFC 3AP5A 2R0FA 4LBKA 5C4WA 5J96B 2JG8C 4YW5A 1KJRA 3LOBA 1OD5A 4RHV3 5BNNC 2Q4SA 3I97A 2C0ZA 3J7NA 1JZ5A 4BA6A 5J3UA 4YW7A 1YO8A 3JB4C 2NM1A 1UX6A 2QQLA 5CIRA 4FT8A 2TEPA 4NHXA 4QKBA 2JB4A 4UFKA 5F3GA 1OD3A 4XPVA 1AYN1 4HXCA 4CE8A 4DXTA 2XLAA 5JXGA 2I74A 4E4SA 2JG9B 2VC9A 5CG8A 1CAVB 1OURA 4LBNA 2VU9A 2BUKA 3WF4A 2QQPA 4IEQA 1NG0A 1W2OA 1XPWA 5JMCA 1ZZCA 2ZX3A 2OKXA 5FPBA 1QJFA 3RJRA 5K0UB 3GXUA 5CVRA 1W6PA 4N9HA 1JYNA 2HEWF 4OVEA 3VBRC 2OS2A 1H9PA 1OXCA 3KQRA 4KH9A 2VMGA 1SCRA 1BEV1 3IAQA 3OGVA 4K40A 2FDHA 5KWRA 4LBLA 2B9VA 1YFWA 2D6MA 2ZGNA 5C71A 3O1SA 4M4PA 4CCCA 5DAPA 3I3BA 3NMBA 1S0CA 2IVJA 3ZYBA 3I2OA 1QMJA 4XIKA 4LBMA 3TN91 2QCSB 4M3CE 4M3CF 5C8CC 2P3JA 2AZ5A 2CAVA 1YLLA 1NCQA 3HNBM 1R081 3ZYGA 1GMMA 1W9TA 5FZFA 1J1LA 3WNMA 5FLJA 1OA3A 3I2IA 3O5SA 2CSGA 1CONA 1UQXA 3O12A 5LB6A 2C26A 3KF5A 2E32A 1IPKA 1XBFA 1V6KA 2VCCA 4KMQA 2UURA 5IVFA 1GNZA 3LGRA 2X5IB 4MV2A 1LNSA 4Q4Y1 4DIQA 1H4GA 3M7AA 3B02A 2XR4A 4QHBA 5CADA 2XJSA 2Y64A 3B01A 3HD8B 4EWEA 1X8EA 2B9UA 5H9PA 4UF0B 1W06A 4LMFA 4QPIA 3AXEA 5FTTC 3R6SA 5CB7A 3B9IA 1QNYA 1V9U3 1VE0A 1QJEA 2DCYA 3PIJA 3VKFC 1NCRC 2WZR2 5EV7A 2IFWA 1HX6A 3K46A 4WVZA 3NNMA 4IETA 3MIBA 2RJLA 4XZPA 5T5LA 3CQOA 5FY9A 4YW4A 4AVTA 2VMDA 2QQJA 1DQ1A 3PURA 1UZZA 5L7OA 1CR7A 1NAEA 2WA4A 4S2DA 2R073 3ZFFB 4AQTA 2VMCA 4OHVA 3T1MA 5GLVA 2WNVB 3N9NA 2YBSA 3B93A 2NN8A 3AYDA 4IV3A 4RFRB 2VY0A 5I0DA 3AVRA 1AXZA 1YJLA 2D6LX 3C7HA 1WZXA 2I07B 4XXAA 5FPLA 1W2AX 2VTXJ 4AHYA 2XWBB 5GJ6A 4LKSA 2RE9A 4QQHA 1W6QB 1COV3 4K1YA 4LULA 1JYTA 4FPGA 5HCFA 3WEZA 1PNFA 4OMCA 1B35A 5T52A 3VBOC 3O0XA 3CU7A 4OZXA 2VCMA 3IPVA 1UN1A 1O4YA 2ZMNA 4YGBA 4YVWC 4OI2A 1WW6A 4ZY9A 3D0SA 4WVVA 2JDUA 3KHCA 3VDBA 4JZRA 5G04L 2JG9A 1CAVA 3N9PA 4XHBA 4FOVA 1MZFA 1DGRN 2VBDA 5KXCA 3CJIC 5T5PA 4Z1VA 4UW5A 5LRRA 2WKKA 3AZYA 4PDWB 4UFJA 3HIFA 1Q8VA 1YC61 1NUKA 3ZDVA 3HQUA 5GZFA 3VD7A 4I09A 1S0IA 4R8HA 1LGBA 2IXCA 1EV12 2MEV3 4EROA 5I8YA 1IPJA 4NAOA 4YW1A 1DQ6A 4ZZ5A 3V64A 2D97A 5ANQA 4LA3A 2ZHNA 2MHFA 1VBA3 3VLBB 4XQDA 2YPJA 4IV1A 3ME2A 5F2SA 3GF6A 4AFDA 2Z42A 2C4XA 2UU8A 2PHRA 2YY1A 4LUMA 3CZUA 3T3YA 3H1WA 4HL0A 1F15A 5KXDA 2RM23 1UY1A 1W05A 2R6QA 4KU7A 4YVSC 3TYJA 1VB4A 4IDZA 3P3PA 4MLOA 4XQ4A 5K9YA 3QLQA 2QQIA 2X5IA 2ZMLA 2OQ6A 4CP9A 1QU0A 4K1ZA 1NZIA 5C9AB 4PJYA 4CCLA 4XDPA 1I1EA 3N9OA 2QZ2A 2VZOA 4KG0A 4UF0A 5HCBA 3WP4A 5A1LA 1PM4A 4AWDA 2W92A 1O7FA 4A7ZA 2ZEYA 1DIWA 1O5LA 1ZA4A 2VNOA 2WZR1 1D2SA 1NA1C 1UMIA 2QDNA 2Y38A 4IEYA 1DGLA 2VOWA 4HLTA 4JKLA 3LEMA 4XF4A 4ZZ8A 2YMZA 4XBLA 1WD4A 5JR7B 1DYOA 4ZXEA 5ANNA 5FYTA 1PO21 2VQTA 3WW1A 3ZSLA 2ZKNA 3NV3A 3ZFFA 4QXHA 4JGZC 4C91A 1PZ7A 2WNVA 4WM8B 5LK5A 3ZYRA 3JQXA 4Q4X1 4N90A 4LPLA 2EF6A 1HN1A 1ZZ6A 1RUJ1 1OBNA 4Y4YA 1NT0A 1UL9A 3TRSB 3N7LA 4BLJA 2RVAA 1RUF2 1CJPA 4E2QA 5JSPA 2YC2A 4RQPA 3BKZA 2ZGPA 5JZGC 1SQ4A 3VBUB 3UESA 1J3PA 4YFZA 2HKXA 2OUJA 2JDYA 3V56A 2OA2A 2C6SA 2LS6A 4XABA 1SLAA 1YFYA 2XWJB 4AAXA 2FZ2A 5LA0A 4AFAA 3VZLA 1Y9GA 4I3PA 3ZIXA 4AEJA 1Y7BA 4IEZA 1GU3A 1ZZBA 2X05A 1WW5A 4AGGA 2PHWA 4UXAA 3MHZA 4YFWA 4XAAA 4AGVA 1QEXA 4XJ9A 3ZFGB 5FXXA 1QDOA 3IMNA 4EZ4A 4UFMA 2P34A 5JMOA 5FZ8A 5F7UA 4IE4A 4PF5A 2E9QA 1LRHA 3I2JA 4LIUA 4PDWA 1NY72 1OQDA 4QPGB 5IJRA 3N7MA 4QX0A 1AR92 2SLIA 2ZAHA 1AR63 3QD6A 3UYJA 4WVMB 5AVAA 2B5HA 3WP5A 2WZ8A 5JAXA 1H8TA 3J8F3 4O7XA 1W39A 2WJSA 1EAH1 1KEXA 2OQ7A 1J1TA 2HWB1 1Y3TA 1VBD1 5CYYA 1TME2 3WW2A 3JBG2 3RFRA 1LECA 2DVDA 1EUUA 1H0BA 1LODA 4FPEA 4LBJA 1W0NA 1R091 2KXLA 2W2IA 2Y6HA 3K4ZA 3NNLA 3ON7A 4GKXA 4JGYB 4LKEA 1LENA 4XMIA 3ZN4A 1VMHA 4XXPA 3OJBA 2XDVA 3ACHA 1TQ5A 4P9JA 2W1SA 4EN6B 4PT6A 1DZRA 4KNCA 1UMZA 2EIEA 4MG2A 4Q4V1 3BGAA 3D5OA 2ZX1A 3R05A 1QJZA 1U5ZA 4E8CA 3NRUA 4GH4B 4W6XA 1YUDA 4AG4A 2H0VA 1QKQA 1RUC3 4HVOA 2P37A 3OBTA 2Q8DA 3URFA 5CFCA 4GWNA 3PJYA 1MQTB 3M3QA 2PAKA 3SKJE 4AZZA 5GLTA 3S57A 4K20A 5L9RA 4JKMA 4NPMA 4PI0A 4YW3A 1V9U2 3VBHB 2AR6A 4XJ8A 2Z2SB 5I93A 1CD3G 3K3OA 5FAXA 3T2TA 2VH9A 3HN3A 3PUAA 3UT0A 3OOXA 3AKQA 3I2GA 4LO7A 2ENRA 2QQOA 3UETA 1XNBA 1IS5A 4PBOA 3WNXA 3FLRA 2WFF1 3D4KA 4YM0A 2ETEA 1GICA 1VBE1 5FZKA 5LZ6A 4R9AA 3USUB 4UW4A 3MV11 3BALA 4XVHA 2K0GA 5LA1A 2ZGUA 5ABJB 2R072 3IZOA 4AVCA 3K4DA 3SKVA 2V73A 4FXKB 3C3VA 3ZN6A 2GNDA 1RUF1 3R4SA 2A73B 2EAAA 4DOUA 4E2SA 2RDNA 1XXNA 1U12A 2PA7A 4QB6A 3PJQA 3VBUA 5JCTA 4NJ4A 3AKSA 4DUWA 2XJRA 4RHV1 2JG8B 1Q8PA 3DCQA 3OGSA 1COV2 5TSWA 2NLRA 5BNNB 5EWSA 4QPWA 2XLGA 5EJ3A 1PGW2 2JE9A 3C7FA 2XG3A 4DRVA 1DQ2A 4P5YA 2Q8CA 3F2ZA 1H4HA 2WO2A 1A3KA 2CHHA 2WNUC 1UCXA 3ZXGA 2DUPA 3KWVA 4QX2A 5C70A 2HWD3 4XETA 2DF7A 2WBKA 1A78A 1YQ5A 3AL6A 3RG0A 2JD9A 4JKKA 1F31A 2ZX2A 3WNOA 5K0UC 4QPGA 4XHXA 3E5UA 3A21A 1ZX5A 1EYBA 2OW4A 1RUI3 2J1TA 2JWPA 4P9LA 4WVMA 5FUIA 4WZFA 1OKOA 4MGTA 5F39A 4TN7A 1HB2A 3WP3A 4B4PA 3VD9A 5I0SA 3B69A 1C3HA 3A22A 4NIGA 1SLTA 5FUPA 3DXUA 2W91A 3JB8A 4MUVA 1SHWB 4QD2A 1OOPB 1C5HA 1D4VB 3D3AA 1QXJA 4X6QB 3GHNA 3WF2A 2XHNA 3E1F1 3DF0A 4QAWA 1VBA2 2CGNA 4LKFA 4Q4W3 4LE3A 5FXZA 1GWMA 1PX4A 1SDWA 1ASJ3 2WS92 1X82A 4TLFA 4P14A 5C8CB 2B45X 1DCSA 2F17A 2WQZC 3OY8A 5F8PA 2GNBA 5JXJA 2R042 5KHIA 1JYWA 2P1BA 3WLUA 4QHOA 5FP7A 3IDEA 1ALYA 1XE8A 3ZSJA 3B7MA 1UOGA 3P3NA 2VQ0A 2O8QA 4Z2AA 4GH4A 5JPNB 2BVBA 3MPPG 1OA2A 4A3XA 2A3XA 4WVWA 1BZWA 1XU1A 2CY6A 2AEZA 2OZ6A 2VZRA 3GHMA 4JV4A 3PTRB 4LXLA 2CAUA 1BHGA 2G19A 3IDAA 3WT3A 2GU9A 3VBHA 3UGGA 1V9U1 4CVUA 2E53A 3PU3A 1N3PA 2Z5WA 4NIIA 5A3TA 2XJPA 1SPPA 3RZZA 2Q8OA 1O3QA 2A75A 4YNIA 1UY0A 1HRV2 3ZFEC 1ZRIA 4BXSV 3CIHA 5A7PA 3NQHA 4A44A 4WM7B 4YM2A 3VDAA 4FFHA 3OGRA 1GLHA 1K45A 4KBBA 4EN8B 1G6NA 3QCWA 4LK6A 5JOWA 1JS9A 1TMF3 3EHKA 2R071 2DVFA 2CU5A 4HKLA 2CYFA 2F4PA 5FZHA 5IK5A 4TZDA 4EZHA 4QGLA 1O59A 1HXS3 1CESA 1PIV2 3V0BB 2AEYA 4HFSA 3K2OA 2HWC3 5FPXA 1Y9QA 4W65A 3VBFA 3U78A 3H50A 3I3DA 2JJ6A 5J7MA 1EP0A 3WDVA 4E4ZA 5C3PA 2JG8A 4FQ4A 5IAXA 2BERA 3O0WA 1COV1 3MIGA 5BNNA 3RYKA 3MDPA 4XDOA 3M70A 3ZSEA 4AFCA 2W3JA 4LJHA 1DF0A 5DZGA 2W95A 3W59A 2C5DA 3VBOB 3OF1A 1AXYA 3TAYA 2ZEWA 4XEZA 3ZOIA 3OUJA 4YVWB 4DPNA 1ODNA 1UYPA 1PO12 1ZBA2 4H7MA 1JUHA 1VMJA 1Y4WA 3KV6A 2VBPA 3AJZA 2ZEXA 1WA4A 4I01A 4ZPIA 3ROUA 3ZM8A 1GP6A 4QX5A 4YZ5A 2VZVA 5E16A 2ARCA 1QOSA 1UXZA 2XJUA 5F5AA 1GR3A 2ZZJA 4CXWA 1G9DA 2PHTA 3CJIB 3RSJA 1O8PA 1G86A 3WCSA 5IVCA 3FHAA 1JYIA 5FZIA 1LCLA 1J3RA 1ENQA 2E7TA 2EXJA 1RIRA 4QX1A 5T5OA 3VBRA 3P5BA 1YIPA 4MVTA 4AW7A 1ZA7A 5C6CA 5LK7B 5DABA 2TNFA 4PIYA 1RJ8A 2MEV1 4A42A 3WW4A 2JDMA 1ZYBA 3ALQA 3J8F2 4KL1A 1ZRCA 3UGHA 2HBTA 1ZNPA 3MF9A 3SISA 1VBA1 4IE5A 2B7YA 1XE7A 2K9ZA 5HI0A 1HRI3 3IWZA 4LBQB 2DV9A 3KCYA 5T54A 2ADEA 2VCAA 4EN7B 1TE1B 4NE9A 5J48A 5KBFA 2BU9A 2EICA 5C8CA 1NX9A 5GLZA 1OHFA 3GZTB 1AVBA 1RUOA 2RM21 4RS5C 4OYUA 5FLHA 4A6SA 5FRAA 2BQPA 3A0NA 4CP2A 3HJRA 3WG1A 1LHWA 3Q8CA 5FDBA 4DEVA 4RFT0 1IS3A 2JKBA 3RGBA 5C9AC 4FPOB 4UFLA 3HBKA 3INAA 3T1LA 2FDJA 1Q8QA 2JDHA 2YROA 1RUC2 1TNRA 3RZMA 4RR3B 1WMDA 3OYWB 3VBSB 2BWAA 1LGCA 2WFPA 1RYYA 5C33A 2W1UA 1RUNA 1H2LA 4UBHA 4AEKA 5FMCA 3EMRA 2ZBJA 3U4XA 1NCRA 2JENA 3MPBA 1NA1B 1S2BA 4DUXA 3NV1A 3WF3A 4AI1A 1AL22 1JZ8A 5A6ZA 3LE0A 2H0BA 2ARXA 3ACLA 3QH7A 1CZVA 4QGNA 1NLSA 4META 4WM8C 4D7YA 4HETA 4TXWA 1J59A 2HBUA 5EXOA 4EYUA 4MX3A 5HV0A 1ULEA 1UZ0A 4TSVA 3POEA 4HK8A 3OSDA 2ZGMA 2D3SA 1V6JA 1W90A 1WCSA 3HEIA 3QOPA 4IEXA 4CYDA 2VMIA 5FFOC 1I5PA 1SEFA 1VPHA 4HG6B 4LA2A 5GZGA 4B7EA 5KR7A 1RUE3 4GIQA 1EPZA 4BK4A 5JSOA 1PZ9A 3DYOA 1GOGA 4LOTA 5JZGB 4QQOA 2C9AA 4Y5TA 2DCJA 4EWAA 4Q1PA 2QUOA 4LBQD 5C3QA 1I9RA 4FP2A 2BFUL 4OULA 3VBOA 3OUIA 2PHLA 2BYVE 1OF4A 4YVWA 4NHLA 3T30A 3JZVA 3RMYA 3ZFGC 1W99A 3AXDA 4LOSA 2DURA 2J1VA 5KHGA 2HWD2 1F4AA 2GH2A 1KITA 1WCKA 2DUOA 2WWUA 3B94A 4YG6A 1KFXL 3CJIA 2Z4FA 1KD7A 3HBZA 1BMV1 2EXHA 4FVVA 2J1EA 4NIHA 1XC6A 1KGYA 1SFPA 1AR61 2P3YA 1RUI2 2XUMA 2ZHLA 3NJZA 3OBRA 4LHNA 5FYVA 5GALA 4XBNA 4XF3A 3WNLA 4D8MA 1EV13 2VVDA 4XUOA 2XKOA 1JYVA 1J58A 1DYKA 2XVLA 3J8F1 2WN3A 4GWJA 2PLV2 4UT5A 2QE3A 1ZBE2 1FV2A 3OUHA 4N43C 1OLQA 2WR9A 1CX4A 1N1SA 2EXIA 5LASA 1RINA 4MGYE 4D6QA 5KXEA 1N47A 4LBQA 1IQDC 3UGFA 2RJKA 3KV4A 4NMIA 4TYSA 3AX4A 1Y43B 4JGYC 3N9MA 1CQ9A 2DCTA 5C3SA 1OVPA 5A3PA 5EYYA 5T50A 5T55A 2YBPA 3RYPA 3JQWA 1O4TA 4Q0UA 2FDKA 1GP4A 1D4M3 4YPJA 3Q8EA 1OVSA 4FCAA 4YVSA 3S6PA 2D43A 2YXSA 3EO6A 5L73A 1TEIA 2GMPA 2XKPA 3PUSA 5AVPA 3N3HA 3ZVXA 4MGIE 2CV6A 4ASLA 2D6NA 1RUC1 1UMHA 3GDBA 2K46A 1MQTC 3PUIA 3O1PA 1GP5A 1VP6A 3OYWA 4FAGA 3WDWA 1LOBA 1UF2C 1FOD2 2BDRA 1S0FA 2RV9A 2JD4A 1MS1A 4QXKA 4PLOA 2OIIA 3PMEA 1NA1A 2ET1A 2PTMA 4OI0A 2GAUA 1QQP3 1KS5A 2JE7A 2VG9A 3PUQA 4EN9B 2GC3A 2YC4A 4L9BA 3O1UA 3IN9A 1W6NA 4GA9A 2UYBA 4ZHNA 2XXZA 2RDSA 3AZVA 4J1WA 1W8TA 4GALA 4PLMA 4FSJA 3LEKA 5ABJC 2WO3A 3KT7A 3UKTA 4QGMA 4XILA 3SXWA 1TMF2 1VBB2 4JGZA 5F3EA 3VB9A 4EJRA 5A33A 3U14A 3MFCA 3FX3A 2D6PA 1HV0A 1XYOA 2ZMKA 4K3UA 2UWBA 3BCWA 5E1RA 4L99A 2HWC2 3CNAA 5K4LA 2Y33A 5IATA 2BEOA 3KCCA 4HN1A 1UKGA 4CP0A 4E9KA 2ZACA 1Y9MA 4MSVA 5JZGA 4A7YA 4Q2FA 5FOBB 1C8M3 3TEZA 4UOJA 4Y4RA 2A6YA 2J1UA 3B00A 1BBT2 3K75B 2YV8A 5KXBA 4AEDC 1E5SA 1UOJA 2IXHA 4S2HA 4JHTA 1RC6A 2DTWA 3I8TA 2Q30A 5FQ0A 3O1TA 3ZSMA 1L3JA 2ZTNA 3VN4A 4ATFA 2A7AA 2W9XA 2ZGSA 4BWOA 3UNPA 3POWA 4YZ4A 5I8TA 2WNUB 3S7EA 2HWD1 4TTGA 4QKDA 4Y20B 4Q0PA 4B1MA 1BVP1 2PHFA 4CCMA 2E26A 1BKZA 1DQ5A 4Z8BA 2UY8A 1S2EA 2J42A 1LOCA 3BPSA 4AVSA 4F8AA 3VUOA 1AR93 1RUI1 5DAVA 5C3OA 2GZWA 5JOYA 4Y5SA 3AYCA 4JDOA 1YQ8A 1DBNA 2N7GA 4H3WA 4JHZA 4IUGA 4GD4A 3THTA 1IGOA 2JEMA 1F5FA 1HB3A 1MS3A 1OOPC 1PK6B 4FPYA 4QXCA 5I91A 5JUVA 4AQSA 1QXRA 4GMP0 4GULA 4E4HA 1TG7A 1OFNA 1UZVA 4OQ8A 2Q5TA 4Q4W1 5EYXA 1BXHA 5FYSA 1TME3 1HRI2 1ULCA 3JBG3 1IKQA 2UY9A 1S0EA 1YI9A 3FE5A 3KVBA 5LA9A 3ACFA 3WD5A 1ASJ1 5LA2A 1J83A 4KGGA 3GGLA 2R0HA 3AP6A 4LEJA 1OUXA 1WW4A 4Q8KA 5KHKA 1WCQA 4FPFA 1MVQA 1XNKA 2VAUA 3EYPA 3AVSA 4L92A 1LOFC 1N1YA 5FYUA 5CKMA 3CKHA 3ZYHA 4HBNA 4B8EA 5JIUA 1FMD2 3M3CA 2R1DA 2RS13 4KWJA 3MFAA 4X6RB 4EV0A 1YFUA 3ITQA 3THDA 3VL8A 4ATEA 2JB8A 1X36A 4YRDA 2JIGA 2EAKA 4FFFA 2A5ZA 3GYDA 5JVVA 3O14A 2GN3A 3MUZ1 3PIGA 4CCJA 2VZTA 3ILFA 1JOPA 1AYM3 1NE4A 4WM7C 4C90A 1ODMA 3X29B 2W1WA 4K6BA 3ZFEB 1W3VA 3ELNA 3MW4A 5FO7B 2WT2A 1UYXA 5E8AA 2DCZA 1RJ7A 1XNTA 1TMF1 4L97A 1H1AA 5K7PA 3MO4A 3NJYA 2VW2A 2NYYA 1UAIA 1HXS1 1PGSA 3UJOA 4KQ7A 4QWNA 2HWC1 1LGNA 3R0RA 1KFUL 1JN2P 2R063 1IQAA 1M06G 1GQPA 5A7QA 1OSGA 3KCXA 5FYHA 1GOFA 1UU4A 5FZOB 3K4AA 3U37A 4NVPA 1RUE2 2D93A 3H9AA 4IE7A 4GKYA 5FP3A 5J98B 1J84A 1W03A 3DXTA 4OI4A 3AB0A 1FNYA 4P9YA 5FZ4A 5IHRA 5DUXA 1JZ3A 3IT8A 3LPFA 4XFBA 4CEYC 4DQAA 2VE1A 3W9AA 1PHMA 2OT7A 2VPVA 3FJSA 3BIEA 1NLQA 2R1BA 5FKBA 1XOYA 2CL2A 2TUNA 4OUMA 1QJY3 2VO5A 2WNUA 4I3GA 5A6QA 1U5XA 3N9QA 4CCDA 5IVEA 4CA9A 5A7SA 3ZXAC 2JDZA 3RDIA 5I8SA 5L9VA 2LW8A 5FIXA 1W8OA 5LBEA 4FBFA 2WN2A 4XF0A 5K0UA 1FYUA 1RUD2 2YU2A 3A0KA 3M3IA 1MZ5A 4CDXC 3H7YA 2G4IA 1AR72 1SZBA 4HK9A 3ZPOA 4OHZA 2X10A 4ITCA 2P5BA 3NSTA 3RS6A 3UV9A 3NNJA 3BTYA 2H6CA 2VNGA 3BOWA 1VR3A 3IB3A 1W6OB 3S5QA 5I0RA 2WT0A 3LA3A 2WO7A 3J7MA 3MIEA 1LOAA 5A32B 1HRI1 5JDBA 4QX8A 4FFGA 1I6XA 3B5LB 5F1RA 3D8CA 3GJAA 1SMVA 2WS93 5FZDA 3ABZA 2WYFA 4KWUA 4CDUB 1VRH2 1IG0A 2R043 1HJGA 1Z78A 1PNGA 1D4M2 4RS5B 3ZSKA 1V6OA 5FY0A 4UW6A 2GH8A 3CZJA 3JUUA 3FHQA 4QU1A 3E5XA 4YW2A 4D0QA 3POFA 4KWLA 3CDZB 1QNWA 1NOVA 2FQPA 4J25A 3RJ2X 3VHPA 2GC0A 4O65A 4RR3C 3VBSC 5DAXA 2A6VA 2AH2A 5FZ0A 4RD7A 4IEOA 5FKCA 1ULDA 3T4HB 1H9WA 2E7AA 1PM7A 2FMDA 3WNNA 3MV01 1QIQA 1QQP2 1HRV3 2IXKA 3JD72 5JI9A 5CNAA 3ZFEA 3THPA 3LFIA 2AREA 4BCUA 2RHPA 1DHKB 4N8MA 5B4NA 4CXXA 1LHOA 3LCPA 2H6BA 4FI9A 4QDSA 2FDGA 1W8HA 2YG0A 5IK8A 3USSA 3CBNA 2R7EB 3WDTA 3ZXFA 4KU8A 4XMAA 1OH3A 3ZR5A 1ZVFA 2XJTA 2IUWA 2Y0OA 1PIV3 2JICA 1QDCA 3LOIA 1VALA 3FL7A 4K9SA 1CZTA 4J6GA 2VMEA 5FZOA 4CDQC 3RZKA 2HLEA 1RUE1 4DNYA 4BQXA 1W6QA 1QH7A 1CX1A 2VOVA 1C8M2 4Y5Z0 1DLCA 3IBMA 3S30A 2YZ4A 2WIIB 1WCUA 3I2DA 2ARBA 2ZOEB 4FPJA 2P2KA 1GKBA 4OMDA 1ACCA 1S2KA 1TZOA 4GJZA 1FV3A 2Y8KA 2QFEA 4LO8A 4TWTA 2VZ1A 3WNPA 4EQVA 1PO13 5FZGA 1ZBA3 4YZ3A 3T0BA 3LD8A 1QH6A 1DZTA 1QF3A 2I2SA 2Q0AA 1A8MA 5FZMA 4Y22B 1UYZA 2BBVA 2NZ9A 2OX0A 1RB8G 4AYUA 2WQ8A 5FYBA 3SC7X 4ZU7A 4GMP3 4Q1RA 3J4UH 5A7WB 5FREA 2PQSA 2P17A 3KV9A 1NQDA 2WNEA 3K77A 1EV11 4M0NA 1JUIA 1WKYA 4CPBD 4BPZA 3RWKX 3TB0A 3RZJA 4DB5A 1ND3B 4BQ3A 2VOKA 3M1HA 4JTOA 4R52A 3N4MA 3LKJA 4RN5A 4BDVB 3GCXA 4J1XA 4PF1A 5A32A 1VBC2 4N43B 5EPAA 2XVKA 3G7DA 4NR1A 2XPJA 1RHI3 2W5FA 1BJQA 1DGWA 1NXD1 4XURA 4YGCA 4CCEA 4ASMB 3DUIA 3RZGA 2B8MA 4QT6A 2GDFA 3OGGA 2A6XA 5J36A 3T09A 1UXXX 5BUVA 4HKOA 4RS5A 1D4M1 5IFPA 3MIDA 1Q3EA 4E2GA 2A6ZA 4NRQA 1DQ0A 1KS4A 1ONAA 5FYIA 3U07A 3KLSA 1R1A3 2Y60A 3PNAA 4P02B 4BJ0A 4D6SA 2ZGRA 1E5HA 1ND2B 5C9AA 4PIZA 1QJU2 4DUVA 2XOMA 2RS12 2OXBA 4AGRA 4BZ4A 5BNOC 1LHUA 4XFCA 4XOGA 3AZZA 1APNA 4UI9L 3WDXA 4CZSA 1IS4A 2Y34A 1PVC2 4NIAA 5A3UA 2J1AA 4L0PA 1UKRA 4AL9A 5GLWA 4Y1UA 1BYHA 3MLLA 2E7QA 5A80A 3O7OA 1QQP1 1T6GC 2LROA 3CHXA 3KMHA 4Q5OA 1AL23 1AYM2 1MS5A 1UY2A 2IXJA 4JRLA 4C1XA 5FCCA 5DN2A 2A71A 2ZGQA 1GSLA 3DEMA 4CU6A 5AFEA 4Y3OA 1LB2A 4QX3A 2RDRA 5FK8A 2TBVA 3WVJA 3CLPA 1SBFA 1RVF3 3WG3A 5JXIA 4WM8A 2AGSA 4Y24A 4Q8LA 4ARYA 4RA0A 3HQRA 1MS8A 1SBDA 4QM8A 1O6UA 2EA7A 3T2OA 3V0AB 3JXSA 4D3WA 3J7HA 1GQGA 1F4HA 2HWF3 4AI8A 2R062 4FOWA 4W50A 1J3QA 4W6WA 5D2AA 2VR4A 3OPZA 1W04A 3N7JA 1C8M1 3I3EA 4IE0A 3L2YA 1FAYA 2O14A 4FXGB 3VZOA 4PHZA 1CJDA 3HAGA 3H42B 1C1FA 4XTPA 2HH9A 4CCNA 4DRRA 4AEDB 1RMU2 3M3EA 2W0XA 4JC1A 5DG2A 4H14A 4XCBA 1R1ZA 3RYRA 4V2WA 5FPUA 1MEC3 1QJY2 4GXLA 4DS0A 4FQZA 3AP7A 3ZFGA 3POGA 1FT9A 5EFUA 5C5TA 4BE3A 3CL1A 1BQPA 5ERLA 1CAWB 4AVBA 3UKNA 1XSQA 1REDA 1NY71 5A7WA 5EHDA 1AR91 1YI7A 4NPRA 2E51A 4R9BA 3AL5A 4MXWB 3BTXA 1XSRA 1C57A 1L7LA 4RSUA 1PK6C 1I5ZA 1C8NA 4NAMA 2RS33 1BVVA 2IXLA 4XW3A 4NROA 3MBWA 4XZUG 2PLV3 3C7GA 4O9GA 1ZBE3 4IERA 1YQ2A 2PHDA 3HQXA 4COYA 4N43A 2ZX0A 4CXYA 3RI8A 1W6MB 1JZ2A 1WMFA 2C24A 2FBEA 1TME1 4MZUA 3JBG1 5FMOL 1LOEA 4XDQA 4IE6A 4JGYA 1OPMA 1JODA 4UWDA 1WUVA 5JWPA 4AOCA 3MICA 3DPRC 2XONA 1GV9A 5T5JA 1JZ7A 3DECA 3I54A 4HSJA 2RS52 3KB5A 2XJVA 1I3HA 3ST7A 3VZNA 5LRSA 2Z69A 2CDPA 1CPMA 2RS11 4MGQA 2FCUA 4I0AA 5LY2A 4AE2A 1LKNA 4XFHA 5FY8A 5CKQA 2XBO3 1DQ4A 5IVVA 3OCPA 1VJ2A 1MQTA 5CKNA 2WQ4A 3APBA 3UK9A 4CUBA 3ZO0B 4E27A 1FOD3 5A7NA 1HN0A 4S2GA 1LEDA 2VW1A 1JI6A 2YPDA 4NWWA 2RJ2A 3AMPA 4LHKA 2D7FA 1AYM1 5BV6A 4IEVA 2DBNA 2WDBA 5GZCA 4KG8A 2BGCA 3ZXJA 4BH9A 1NKGA 5DUVA 2BNMA 3USUA 2VNVA 5FZEA 3OG2A 1Z7S3 4FOQA 1VBB3 1O8SA 5ABJA 3EBRA 2OVUA 3N9LA 3Q8AA 3HR9A 2QKDA 3KV5A 3V0AA 5IWFA 2DU1A 3MLKA 3D0JA 3I59B 3QACA 3POSA 4L8QA 4URAA 2D3PA 2R061 1XNAA 3GZUC 2ZJCA 5FY1A 2BVVA 2KR2A 4FO9A 1NQJA 3U0ZA 1C4RA 3AZWA 4QU2A 2ILMA 4NUBA 1YCIA 1LESA 3KD4A 5D21A 5FP8A 2VMFA 5A3MA 4A2UA 2WYSA 1BBT3 2B39A 5DQ0A 5C3RA 4AEDA 2W68A 3ENRA 1PGW1 2AC1A 4FPKA 2E6VA 1WA6X 4BB3A 3AMMA 4CEYB 3VL9A 1QJY1 3C7OA 3ILNA 4Y1YA 3SEEA 2VZUA 4BM8A 2PHXA 4GB33 3MGUA 5F3CA 2ORZA 4CUGA 5ACA2 2QQMA 2WZPP 3WOGA 4X8NA 2WNOA 1C1LA 1Q56A 2C9KA 1CAWA 2VCBA 2GN7A 2K2SA 2WINB 2J1SA 3H1YA 2V4VA 1JU3A 4LTAA 1S0BA 2R32A 1QY4A 1D7PM 4BU2A 1VRBA 3WF1A 4MXWA 4HVQA 5KC6A 5D1IA 5BXXA 5JPMB 4CDXB 1LOGA 2VVFA 3TNQA 1JYXA 1UU6A 5A3LA 4AXOA 4G4FA 3OEAA 2W46A 3VDDC 1OOPA 4V1PA 1F35A 1QHDA 4R9DA 3KM5A 4QX7A 2WWJA 1AR82 2IFRA 5FBZA 3WV6A 4ZS2A 5L19A 1GNYA 4Q0VA 1RHI2 1AXKA 4JTNA 5DDJ2 3NO8A 4XQWA 4ZXKA 1ENRA 1RXGA 2WS91 1K12A 4MHUA 3R4UA 4CDUC 4BIFA 2A6WA 3FFQA 1LR5A 1NLRA 2R041 2FHRA 1AX2A 1W8ZA 1TVGA 1JOJA 5A7OA 1GZCA 1LOFA 2JE8A 4IGPA 4NWVA 3ILRA 1WMEA 3FZ3A 2XH6A 1FMD3 1R1A2 3PLQA 3WZ1A 4CDWC 4FTBA 5D8AC 5B4XA 4AI0A 4CRQA 2ZKLA 2Y6KA 4I2OA 2D5HA 3VZJA 4MOAA 5A3OA 4AI3A 1PMIA 3EJKA 3GBWA 4GWIA 3LPGA 1ZRFA 2A1XA 4YLZA 3WHUA 5M0TA 5DAQA 4WV8A 1UD1A 2JECA 2YFUA 5FY5A 3H7JA 4BHPA 1HRV1 2ZX4A 4Y1VA 1BK0A 3LWCA 4AVAA 4WM7A 5FPVA 4E8DA 4NRMA 2D3RA 2O1QA 3GM8A 4ZONA 2BOJA 3LDKA 1A6CA 3O1RA 1XU2A 1UYYA 3ECQA 5CAZA 3P1IA 1NXMA 4HANA 2VZ3A 1RVF2 2ZZQA 2BGOA 4M01A 5A6XA 4SLIA 4H55A 3I59A 3V0BA 1PIV1 2VD7A 4FAHA 3HWJA 1URXA 2QNKA 3CMGA 3GZAA 4CEWB 4BIOA 2PQQA 2R30A 2XMLA 5JSRA 2HWF2 3R4DB 4ARXA 4BQ2A 1XNDA 3NKGA 3WR0A 4CDQB 3RNSA 4FP3A 3ZXLA 4E4DX 4I0WB 5EQUA 1QJX2 3VKNA 1VLNA 3WUDA 2XVGA 5JIAA 1ULPA 5FUNA 2J7MA 2CNAA 3ZYIB 3GALA 3IDBB 4CEYA 5DPNA 2EIBA 4N7IA 5A70A 1ULGA 5APAA 1PO11 1HLCA 1ZBA1 5JXHA 1MEC2 1LU1A 1MVEA 1RUH2 2HWE3 3I2HA 4L11A 5FYMA 1VAMA 1W28A 1FX5A 1YIFA 2VW0A 3EB7A 2YB7A 1MS9A 4EE2A 2JIJA 2GC1A 5LY1A 3SCHA 3IIAA 1KXGA 1RUD3 5FR3A 3NJVA 3WCRA 3HPNA 1OQ1A 4GMP1 3POBA 4CDXA 5CG9A 3BYWA 4JX0A 1AR73 4WBBA 3MZHA 1UO9A 2QQVA 1ND3C 3OPTA 2WLQA 2RMU3 2RS32 3OPWA 3JCIA 2XUEA 1Z0HA 1PX3A 4XTMA 3ZXEA 5GLUA 3IMMA 2BNOA 1AYN2 3VD5A 1W9SA 1RHI1 4YW6A 3V65A 1REFA 1WLDA 4YM1A 3AZXA 3AM2A 3NW4A 1CIYA 1VRH3 3LEIA 1GNHA 4ONUA 2A3YA 1SCSA 1UNBA 2DFCA 1SFYA 1X33A 3FMGA 4DY3A 1HJFA 3TEYA 2FDFA 5J37A 1HB4A 4XJZA 2PN5A 1NZCA 2Y26A 1ND2C 1R1A1 5F9TA 1BEV2 1AX0A 1IG3A 1OPOA 2P3IA 3W21A 1JZ6A 3I4IA 4C0HA 5C7GA 1EPWA 5IAVA 3WUCA 1JHNA 1VB2A 4RR3A 2XBO2 3VBSA 5BNOB 5BNPC 1RL3A 4COZA 2BP6A 1SLCA 4XBQA 4NOTA 3TN92 3A4UA 4LLOA 2E33A 5FO9B 4FPHA 2ZHMA 1OFSA 5FJKA 4CTEA 1IHMA 3BUCA 1MACA 1R082 3AKRA 3LZZA 4D94A 1ZZ7A 5ISLA 3JD73 5IVBA 4PQ9A 1AL21 1AJKA 4PIXA 4QB1A 1Q8OA 1K5JA 2BJSA 2GC2A 1UPSA 2WAAA 3WF0A 3WW3A 5FBJA 2VZQA 5FMDA 1Z7S2 2YGLA 2AYHA 5FJHA 3DGTA 3U1XA 1UPIA 2RG4A 5E88A 1G9BA 4IGQA 1OMIA 2G9ZA 3QBQA 2HWF1 1W2UA 2X8KA 2NMOA 2DBIA 4LK7A 3H8XA 4CUCA 3H0OA 4CDQA 3VD3A 5FK7A 2F4LA 1ZREA 4I0BA 4IEWA 2WT1A 4MADA 1YEWA 4DEQA 5K8SA 3O1OA 3NNGA 3T2PA 4LBOA 3WXPA 3H1MA 3FLPA 4BMBA 1SLBA 1H30A 5HBAA 1POV3 4BISA 3KVAA 3LDBA 3MEPA 4AQ6A 2BFUS 5L7OB 2IVIB 1ENXA 1MEC1 3SEPA 4AF9A 3SQOA 3N35A 4YG0A 2YUEA 4GB32 2ET7A 3U10A 5FQ0B 3AYEA 5EIYB 4IV3B 2E31A 2VZSA 4NO4A 1RUG3 5LATA 1O3SA 4M3CB 3WHTA 4MH0E 5FY7A 2VMHA 3HT2A 1QGLA 4DINB 1RGSA 4P5HA 5DMYA 3TOJA 2CDOA 2RS31 1MS4A 2D5FA 1B35B 2PLV1 1ZBE1 2GP5A 3IPVB 2VL4A 5HCAA 4PQQA 1VBC3 4XF9A 3SH5A 3LB9A 4XE9A 3ASIA 1DZQA 5AC93 1O5UA 1UW8A 3W5MA 1US2A 2ZGOA 4ZS3A 2GMMA 3ZPYA 1OI6A 2V09A 3NVCA 1ENSA 1AZDA 4HONA 4IQPA 1X8MA 2VZPA 4F7ZA 4Y26A 3FUQA 2OPWA 2ARAA 3S0MA 5FWEA 4AR2A 4LITA 3BOPA 4NRPA 1K5MC 3KGZA 5G05L 2VM9A 3DPRB 4CCKA 1V0AA 5JOZA 1QJU3 1OA4A 2YGMA 3I49A 2BPA2 3AK0A 5JR2A 1F8VA 3HNMA 4ISRA 2IC1A 2XBO1 3ZDSA 5BNOA 1G7YA 1D0GA 5AFBA 4QHZA 2O8OA 3FFZA 1XYNA 4U2AA 1CIWA 1FOD1 1PVC3 4N7UA 1LULA 4IV1B 4JDNA 4W6YA 1M4WA 3S7IA 1W0OA 1YFXA 3BIWE 4SBVA 3ZLIA 1GBGA 1S0DA 1WMXA 1STMA 4A41A 1OQEA 5CZKA 2XLFA 3THCA 4XUQA 4B29A 3Q9OA 5CFDC 2DYCA 4JRAA 2WA3A 5H9QA 3I7DA 5DZFA 4WZCA 2G1MA 3CJXA 4NHKA 3BTZA 1HV1A 5A3NA 3RPQA 1Z7S1 1VBB1 4KBZA 5FZCA 1UIKA 3LAGA 2YBKA 4CP9B 4RGAA 2V5YA 1DFQA 2QQKA 3WQ0A 2BRTA 2ZXQA 1QWRA 4DZGA 4FTEA 3AKTA 2LM3A 2CGOA 2D40A 3ETPA 5LCWL 3HT1A 4W8JA 2ADDA 1IPSA 2V72A 3POYA 4FFIA 3TBDA 4B4QA 4R9CA 1GANA 3LDRA 5FP9A 5KHHA 4P9WA 4Q29A 1BBT1 1ST8A 3AJYA 2L9LA 5FZ9A 5A1FA 1YWKA 1KDMA 1RMU3 4MHRA 5CBLA 1PO22 2G9FA 3OBZA 3VV1A 4ES9A 1L7RA 3IDCB 4JQRA 4GB31 4Q4X2 4K8FA 2FD8A 5H9RA 1PMJX 1RUJ2 2HWE2 2QBXA 1UY3A 4Y20A 2EIDA 3H8UA 4YG3A 4N53C 2ZPXA 4MO3M 3PUHA 4HKWA 2X09A 4M3CA 4Z2WA 2XJQA 5A3WA 5BYNA 2YDEA 1W9WA 4RQPB 5E89A 3RVHA 4YSFA 1CGPA 1YQ6A 2B4KA 5LWBA 4ORFA 4A4AA 2NP0A 1XB9A 1W9YA 1H2NA 1EY2A 3DV8A 1H1MA 1PK6A 1HKDA 4NIDA 5JLVA 2RMU2 2FCTA 1DDLA 5C8WA 4C1WA 1CPNA 4U36A 1SDDB 3MW2A 3GBFA 3NAPC 4YWAA 1CAUB 3VDDB 2XL9A 1W0PA 3VDCA 1N1VA 2GSYA 4HT1T 1CZSA 4XUTA 2XQRA 3AMQA 3OTFA 4FTSA 1HW5A 3LA7A 2DVAA 4DFSA 1LTEA 4D7SA 3P6BA 3U75A 3ZXKA 4INDA 3KT1A 2F6BA 2ORXA 2VUDA 1ZZ8A 3U4SA 1DLLA 1AHSA 4YGDA 1YYNA 3AKPA 3B3QE 3DPRA 3Q8FA 3E97A 4LHSA 3LSDA 4W4ZA 2Q8EA 3WX5A 2XGXA 3VGIA 2RS53 3L9JT 5J09A 1FMD1 1S4CA 1W3XA 2FCVA 1G9FA 1H8TB 2RR13 5IUQA 4CDWB 3POIA 2X53S 1EAH2 3CO2A 5D8AB 4AI9A 2HWB2 3WSOA 1VBD2 2ZA9A 4BK5A 1UZYA 2YHJA 3J7LA 2UWCA 1SBEA 4B7KA 4CCOA 1R092 4CUAA 5F5CA 2X29A 2ZABA 2EIGA 4UW3A 3GBGA 4DO0A 2Q1FA 3CF6E 1MZEA 1AL0G 1IOAA 4OLLA 4P9IA 1JHJA 2BOIA 4P9GA 2VGDA 4ZKTB 1OUSA 4Q4V2 2WAOA 4RYDA 1CVNA 4LNVA 4DXSA 1REEA 2WZEA 2VQUA 3DN7A 2ZGTA 1FNZA 3HNYM 4JQTA 5FMBA 2D6KA 4BQ4A 1UOFA 4CEWC 5FPZA 5CFCB 1P8JA 1WLWA 4BQWA 4Z82A 2HJIA 3LIHA 1N3OA 4D6RA 3ZR6A 1U0AA 4M00A 1MR5A 3B9CA 3FN9A 5CISA 1OLME 4RGKA 1E5RA 3FUOA 1A34A 1H6YA 5L9BA 5FO8B 4K7JA 4MGZE 2HEYF 1DG6A 5DG1A 2VECA 3MUY1 3H3ZA 2WFF2 4KGQA 3IM0A 1VBE2 4YZ1A 1XNCA 5FPAA 3WQBA 2VOXA 2VUJA 2XB6C 4GJYA 4OCTA 2HWE1 5ACA3 1C5IA 4Q26A 2ES3A 4KI5M 5GZDA 3LEGA 2W47A 3NWKA 4BLIA 5LEKA 1ZRDA 3WG4A 4LE4A 3ZN6B 1X50A 4L2NA 3ZIWA 5C4WC 2NQYA 2Q1ZB 1N3QA 3OD0A 4HPKB 4YZ2A 3T0AA 1RUD1 2WWSA 1RUG2 2XQXA 3RRDA 2ZGLA 4FPCA 1RTVA 1HQNA 1EUTA 4Y1ZA 1AR71 2YC0A 5F6LB 4RHV2 5FZ3A 4S2FA 3VHRA 4YM3A 1AF9A 5F5QA 1JZ4A 1GFF2 2PMWB 2UYAA 4P9XA 2RMU1 3RQ0A 4BMEA 3O1VA 2JDKA 1O3TA 1H1IA 1W6OA 3POJA 2BZDA 5A1AA 1CAUA 4P08A 3VDDA 1Q5OA 1WD3A 5F5IA 1CAXB 3VHNA 3BTAA 1AR83 1RITA 2D44A 5DDJ3 2C1FA 5AC92 3ZYJB 4Q0SA 1JXNA 3EXUA 3I2FA 4UYBA 5FZ1A 5GKAC 1G9AA 2R49A 3H8RA 4CDUA 4F3JA 1VRH1 1HIXA 4ZU4A 1FPN3 1K3IA 4OUEA 5IK7A 1G9CA 2DVGA 3TWIA 1PZ8A 1OLMA 1Q43A 2P6CA 5LBCA 1GUIA 1S55A 4JCKA 4CDWA 3VZMA 2PHUA 2SBAA 3OGJA 2BNNA 5IYYA 1YXWA 4K8RB 5D8AA 5EJ1B 1T2XA 2VJXA 4P00B 4QQLA 1F5JA 1OKQA 5F37A 1U5YA 2GMEA 3MF6A 4CPBA 5IK4A 5FP4A 3E6BA 2DU0A 2Q1MA 3DL3A 4QXBA 2JKXA 5FXVA 5BNPB 3KZ4C 5F6KA 2DDUA 1NCQC 5BNQA 2IXIA 3LSEA 4XFAA 1GZWB 3JD71 4B4RA 3OY8B
chains in the Genus database with same CATH topology
1BK1A 3MYXA 3BU7A 4F83A 4GQ7A 4ES8A 4JVAA 3SNMA 4QM9A 2JXAA 1XQNA 4D7TA 1HDKA 4BYYA 1NE6A 4AFMA 3M3OA 1LJ7A 4NN0A 5KC5A 3PMSA 3NL1A 4QPIC 1PGL2 4YGEA 1CN1A 1JH5A 1KDKA 5DUUA 3SHRA 4XJWA 4MYEA 4A7KA 4I30A 5FOJB 1FI2A 4O9EA 4AFBA 5HXVA 1QJX3 3RI9A 3RMXA 4LO4B 1N1TA 4AHWA 3NV2A 4X8PA 4HN0A 5DXDA 1D0HA 1NYWA 4G3YC 5L7OC 1POV1 3FBYA 3CEWA 2DUQA 2P3KA 2CTVA 3KT4A 4XYXA 4JDMA 1RUH3 2EXKA 2OPKA 4IV3C 4Y22A 2ZCWA 1XYPA 4HPKA 4IEUA 4XFIA 1LEMA 4DXZA 1RUG1 3VBFB 2PYTA 3D6EA 2DFBA 1B35C 4QPYA 3PVBB 5FLIA 1ND3A 3GNEA 1GZ9A 3UL2A 1CAXA 3NKTA 1VBC1 3ATGA 2JG9C 1FXZA 1AYN3 1G8WA 3HN1A 4AVVA 4AQ2A 4COWA 2E63A 5AC91 2BW8A 4HSLA 1GYKA 1YHFA 3H3UA 4IXLA 5JI7A 1KQRA 3ZXDA 2BWCA 2PAEA 3VZKA 2HYKA 2AENA 3E5QA 4D69A 1QXPA 1YRZA 2Y0IA 3K48A 3VBRB 1BCXA 4OHXA 3AYAA 1K5MB 4KWKA 1BEV3 1ND2A 2WSVA 4Z92B 2MEV2 1QJU1 2XL7A 4JAAA 2HEVF 3BODA 1FATA 2RR12 1IKPA 1S0JA 2PAMA 4IV1C 1PVC1 5BNPA 4HZFA 3TN93 5DUWA 3SLIA 3FHIB 3WP6A 1YNAA 3FLTA 2DTYA 3WDUA 4AHZA 1GZWA 1R083 4ZU5A 2RM22 1SACA 3AP4A 3U11A 2ATFA 1O91A 2DVBA 2VNRA 4LO6B 4XFGA 3RWNA 2X5IC 2QDRA 2CWMA 5CFDB 1A8DA 2NMNA 2IWGB 4Q4Y3 5T3NA 3ES4A 4H7LA 3WDYA 1PGL1 1D2QA 4OI1A 1OLRA 2ZGKA 3J26N 2YYOA 3SH3A 1VIWB 2QJVA 3WQ7A 3AFKA 3PTYA 1C28A 1NCRB 5LEJA 4RL7A 2WC2A 2OUHA 2OZJA 2VQAA 3M2MA 3K51A 3PVNA 4OFGA 3DKWA 2B46X 4G9SB 1JW6A 1RMU1 3ZFFC 2G9GA 2WNVC 2VULA 4UBGA 4EN0A 2KA3A 2KM2A 4YYOA 1POV0 3MIHA 5GM0A 5A3MA 1WCDJ 1S0GA 3BPZA 4N53B 4RQPC 2FMYA 3L2HA 3PHMA 2LALA 5DZEA 3ES1A 3N7KA 2LTNA 2DWRA 3SMHA 4BQ1A 1V6LA 4GWMA 4IESA 1ZZ9A 2WSUA 3E6CC 4N9IA 1W6MA 2DCKA 2VXRA 2A70A 4LO5B 3NAPB 4HMZA 1DU3D 3AP9A 3JU9A 4Y1XA 1V6NA 1V00A 5FMOS 4PDWC 1UU5A 1DYPA 3M8LA 3MI8A 4Q27A 2ZAAA 1BMV2 1FPN2 1WBLA 3VHOA 1H8VA 1AR62 1K5MA 3QH6A 1JBCA 4NHMA 1JTZX 2RS51 3VKLA 3SH4A 3SCFA 5IT6A 1H8TC 1F2NA 3IKWA 2RR11 3EQEA 1PVXA 3AFGA 2B42B 4AI2A 3HMYA 2BTVC 4QQ2A 2W52A 1AJOA 2CWSA 2QZ3A 3C2UA 3LA2A 2D6OX 4M0HA 2R16A 4COUA 4R4ZA 1H2MA 1ZRRA 4FOYA 2EALA 3ZN5A 4Z07A 4OHYA 1KJLA 2MPFA 2EVXA 5SV5A 5CFDA 4OUSA 4YVSB 2PELA 1ZM1A 2D98A 3E6DA 5BPXA 1V6IA 3VKMA 3AMNA 4LLFA 4URTA 5CFCC 3TNPB 5I0TA 3M4FA 3MW3A 2W08A 4FPLA 2WZR3 4YARA 5B2GB 1U5IA 1E57A 1WLCA 1IZ3A 3KGLA 4AHXA 3N36A 3D82A 1W6NB 1PO23 1KRIA 1WW7A 4LT5A 1JYCA 1F9KA 3FC0A 3FBMA 4JGZB 4Q4X3 5ACA1 2NPIA 1RUJ3 1TNFA 5A33B 1WLTA 2CGPA 4N53A 1WGPA 4XJAA 4OHWA 3VBUC 5C4WB 3SITA 1DGWX 2PFWA 2ZHKA 3KSCA 3J9SA 1QOOA 3WINE 1HQLA 2GNTA 1MS0A 2MNGA 4MXVA 2AUYA 5CA6A 4XF1A 2VUAA 2O0OA 1V6MA 3ZMNA 4PLNA 5GZEA 1LHVA 1YJKA 4DY5A 4C0BA 3NAPA 1XRUA 1H2KA 1AR81 1SLIA 5BY5A 1Q8SA 3AMHA 1O3RA 1LHNA 3MIFA 1VAKA 5DDJ1 1X7NA 1MZ6A 4R4XA 4ISQA 4IEPA 4QPGC 1SLLA 1DGRA 1QOTA 3PVOA 3W58A 5I0UA 2QVSB 1HQWA 1FPN1 4DMIA 3NV4A 1W6PB 1WBFA 4HVRA 3WQ1A 3O0VA 2GALA 3BB6A 4AK3A 5L36A 4XFFA 4Q0QA 2LUWA 4RGGA 3ZX7A 1EAH3 2HWB3 2W39A 1VBD3 1AX1A 3G6JB 3SCGA 4Q4W2 3PVEA 4CP1A 2I45A 2IZWA 3WY6A 5SV8A 1LU2A 1R093 4PCRA 1ASJ2 2GNMA 3VKOA 3FWEA 4LUKA 3OD4A 1NCQB 4QQPA 1IS6A 1ULFA 2UWAA 1UIJA 4XJUA 4LR4A 2A3WA 4K21A 4Q4V3 2OYZA 4GH4C 1RVF1 4Q4Y2 2Z79A 2ERFA 3MLJA 2JX9A 1GQHA 1AUYA 1V70A 1VAVA 4XIOA 4CEWA 3ETQA 3VBHC 3ZYPA 4COVA 4QPIB 2VVEA 2XHKA 4QMAA 4AEMA 3UJQA 1QJX1 3KS7A 4MGKE 3WG2A 1S1AA 5H9SA 2WL1A 4IL7A 1SFNA 4BOWA 2WFF3 1VBE3 4LHLA 4EWDA 1O4ZA 4PBPA 2WLPA 4I02A 3UKVA 1RUH1 1B09A 1HXS2 2FZ1A 3ZMOA 4B3NA 5JOXA 1RUF3 2ZS6B 5CU1A 3VBFC 3AP5A 2R0FA 4LBKA 5C4WA 5J96B 2JG8C 4YW5A 1KJRA 3LOBA 1OD5A 4RHV3 5BNNC 2Q4SA 2C0ZA 4BA6A 5J3UA 1YO8A 3JB4C 2NM1A 1UX6A 5CIRA 4FT8A 2TEPA 4XPVA 1AYN1 2XLAA 2I74A 4E4SA 2JG9B 5CG8A 1CAVB 4LBNA 2VU9A 2BUKA 2QQPA 4IEQA 1NG0A 5JMCA 1ZZCA 2ZX3A 3RJRA 5K0UB 5CVRA 1W6PA 4N9HA 2HEWF 4OVEA 3VBRC 1H9PA 3KQRA 4KH9A 2VMGA 1SCRA 1BEV1 4K40A 5KWRA 4LBLA 2D6MA 1YFWA 2ZGNA 1S0CA 1QMJA 4XIKA 4LBMA 3TN91 2QCSB 4M3CE 4M3CF 5C8CC 2P3JA 2AZ5A 2CAVA 1YLLA 1NCQA 1R081 3ZYGA 1J1LA 5FLJA 1OA3A 3O5SA 1CONA 3O12A 1IPKA 1V6KA 2UURA 1GNZA 3LGRA 2X5IB 4MV2A 4Q4Y1 1H4GA 3M7AA 3B02A 4QHBA 5CADA 2XJSA 3B01A 3HD8B 4EWEA 1X8EA 2B9UA 5H9PA 4QPIA 3AXEA 5FTTC 3R6SA 5CB7A 3B9IA 1QNYA 1V9U3 2DCYA 3VKFC 1NCRC 2WZR2 5EV7A 2IFWA 1HX6A 4WVZA 4IETA 3MIBA 2RJLA 4XZPA 5T5LA 4YW4A 4AVTA 1DQ1A 5L7OA 1UZZA 1CR7A 2WA4A 4S2DA 2R073 3ZFFB 4AQTA 4OHVA 3T1MA 5GLVA 2WNVB 3B93A 2NN8A 3AYDA 4IV3A 2VY0A 1AXZA 1YJLA 2D6LX 4XXAA 2I07B 4AHYA 2XWBB 5GJ6A 2RE9A 4QQHA 1W6QB 1COV3 4K1YA 4LULA 4FPGA 5HCFA 1PNFA 1B35A 5T52A 3VBOC 3O0XA 3CU7A 4OZXA 3IPVA 1UN1A 1O4YA 2ZMNA 4YGBA 4YVWC 4OI2A 1WW6A 3D0SA 4WVVA 2JG9A 1CAVA 4XHBA 4FOVA 1MZFA 1DGRN 5KXCA 3CJIC 5T5PA 4Z1VA 4UW5A 5LRRA 2WKKA 3AZYA 4PDWB 3HIFA 1Q8VA 5GZFA 4I09A 1S0IA 4R8HA 1LGBA 2IXCA 1EV12 2MEV3 4EROA 5I8YA 1IPJA 4YW1A 1DQ6A 3V64A 2D97A 4LA3A 2ZHNA 2MHFA 1VBA3 3VLBB 4XQDA 2YPJA 4IV1A 3ME2A 3GF6A 4AFDA 2Z42A 2UU8A 2PHRA 2YY1A 4LUMA 3H1WA 4HL0A 5KXDA 2RM23 4KU7A 2R6QA 4YVSC 3TYJA 1VB4A 3P3PA 4MLOA 4XQ4A 5K9YA 3QLQA 2X5IA 2ZMLA 1QU0A 4K1ZA 5C9AB 4PJYA 1I1EA 2QZ2A 4KG0A 3WP4A 5HCBA 4A7ZA 4AWDA 1O7FA 1DIWA 1O5LA 1ZA4A 2VNOA 2WZR1 1D2SA 1NA1C 2QDNA 2Y38A 4IEYA 1DGLA 2VOWA 4HLTA 4XF4A 2YMZA 4XBLA 1WD4A 5JR7B 1PO21 3WW1A 3ZSLA 2ZKNA 3NV3A 3ZFFA 4JGZC 4C91A 1PZ7A 2WNVA 4WM8B 5LK5A 3ZYRA 3JQXA 4Q4X1 4N90A 2EF6A 1ZZ6A 1RUJ1 4Y4YA 4BLJA 1UL9A 3TRSB 3N7LA 1RUF2 1CJPA 4E2QA 5JSPA 4RQPA 2ZGPA 5JZGC 1SQ4A 3VBUB 4YFZA 1J3PA 2HKXA 2OUJA 3V56A 2OA2A 1SLAA 1YFYA 2XWJB 2FZ2A 4AFAA 3VZLA 4I3PA 3ZIXA 4AEJA 1Y7BA 4IEZA 1ZZBA 1WW5A 4AGGA 2PHWA 4UXAA 4YFWA 4AGVA 4XJ9A 3ZFGB 1QDOA 3IMNA 2P34A 4PF5A 2E9QA 1LRHA 4PDWA 4QPGB 1NY72 1OQDA 3N7MA 1AR92 2SLIA 2ZAHA 1AR63 3QD6A 4WVMB 5AVAA 2B5HA 3WP5A 5JAXA 1H8TA 3J8F3 1W39A 2WJSA 1EAH1 1J1TA 2HWB1 1Y3TA 1VBD1 1TME2 3WW2A 3JBG2 1LECA 2DVDA 1H0BA 1LODA 4FPEA 4LBJA 4QX5A 1R091 2KXLA 4GKXA 4JGYB 4XMIA 1LENA 3ZN4A 4XXPA 3OJBA 1TQ5A 4P9JA 4EN6B 1DZRA 4KNCA 1UMZA 4Q4V1 3D5OA 2ZX1A 3R05A 1QJZA 1U5ZA 4W6XA 4GH4B 1YUDA 4AG4A 2H0VA 1QKQA 1RUC3 4HVOA 2P37A 3OBTA 3URFA 5CFCA 4GWNA 3PJYA 1MQTB 3M3QA 2PAKA 5GLTA 4K20A 4YW3A 1V9U2 3VBHB 2AR6A 4XJ8A 2Z2SB 5I93A 1CD3G 3T2TA 5FAXA 2VH9A 3AKQA 4LO7A 2ENRA 1XNBA 1IS5A 4PBOA 3WNXA 3FLRA 2WFF1 3D4KA 4YM0A 2ETEA 1GICA 1VBE1 4R9AA 3USUB 4UW4A 3BALA 2K0GA 2ZGUA 5ABJB 2R072 4AVCA 2V73A 4FXKB 3C3VA 3ZN6A 2GNDA 1RUF1 3R4SA 2A73B 2EAAA 4DOUA 4E2SA 1XXNA 1U12A 2PA7A 3PJQA 3VBUA 5JCTA 3AKSA 2XJRA 4RHV1 2JG8B 1Q8PA 1COV2 5TSWA 2NLRA 5BNNB 5EWSA 2XLGA 5EJ3A 1PGW2 2JE9A 4DRVA 2XG3A 1DQ2A 1H4HA 1A3KA 2WNUC 1UCXA 3ZXGA 2DUPA 2HWD3 4XETA 2DF7A 1A78A 3RG0A 1F31A 2ZX2A 5K0UC 4QPGA 4XHXA 3E5UA 1ZX5A 1EYBA 2OW4A 1RUI3 4P9LA 4WVMA 4WZFA 3WP3A 4B4PA 5I0SA 3B69A 1C3HA 1SLTA 3JB8A 4MUVA 4QD2A 4X6QB 1OOPB 1C5HA 1D4VB 5EZWA 1QXJA 3GHNA 3DF0A 1VBA2 2CGNA 4Q4W3 4LE3A 1SDWA 1ASJ3 2WS92 1X82A 4TLFA 4P14A 5C8CB 2B45X 3OY8A 2WQZC 5KHIA 2GNBA 2R042 3WLUA 3IDEA 1ALYA 1XE8A 3ZSJA 3B7MA 3P3NA 2VQ0A 2O8QA 4GH4A 5JPNB 2BVBA 3MPPG 1OA2A 4A3XA 2A3XA 4WVWA 1BZWA 1XU1A 2CY6A 2OZ6A 3GHMA 4JV4A 2CAUA 3WT3A 2GU9A 3VBHA 1V9U1 2E53A 1N3PA 2Z5WA 2XJPA 3RZZA 2Q8OA 1O3QA 2A75A 4YNIA 3ZFEC 1HRV2 4WM7B 4YM2A 1GLHA 4KBBA 4EN8B 1G6NA 3QCWA 5JOWA 1TMF3 3EHKA 2R071 2DVFA 4HKLA 2CYFA 2F4PA 5IK5A 4TZDA 4QGLA 1HXS3 1CESA 1PIV2 3V0BB 4HFSA 5FPXA 2HWC3 1Y9QA 4W65A 3VBFA 3H50A 2JJ6A 5J7MA 1EP0A 3WDVA 4E4ZA 2JG8A 4FQ4A 3O0WA 1COV1 3MIGA 5BNNA 3RYKA 3MDPA 3M70A 3ZSEA 4AFCA 1DF0A 5DZGA 3W59A 2C5DA 3VBOB 3OF1A 1AXYA 3TAYA 4XEZA 4DPNA 4YVWB 1PO12 1ZBA2 4H7MA 1JUHA 4I01A 3ROUA 3AJZA 1WA4A 4YZ5A 5E16A 1QOSA 2XJUA 1GR3A 2ZZJA 1G9DA 2PHTA 3CJIB 3RSJA 1G86A 3WCSA 1JYIA 1LCLA 1J3RA 1ENQA 2E7TA 2EXJA 1RIRA 5T5OA 3VBRA 1YIPA 4MVTA 4AW7A 5C6CA 5LK7B 2TNFA 4PIYA 1RJ8A 2MEV1 3WW4A 1ZYBA 3ALQA 3J8F2 4KL1A 1ZRCA 1ZNPA 3MF9A 3SISA 1VBA1 2B7YA 1XE7A 2K9ZA 5HI0A 1HRI3 3IWZA 4LBQB 2DV9A 3KCYA 5T54A 4EN7B 1TE1B 5J48A 5KBFA 5C8CA 5GLZA 1OHFA 3GZTB 1AVBA 1RUOA 2RM21 4RS5C 5FLHA 5FRAA 2BQPA 3A0NA 4CP2A 3WG1A 1LHWA 5FDBA 4RFT0 1IS3A 2JKBA 5C9AC 4FPOB 3INAA 3T1LA 1Q8QA 2YROA 1RUC2 1TNRA 4RR3B 1WMDA 3OYWB 3VBSB 2BWAA 1LGCA 2WFPA 5C33A 1RUNA 1H2LA 4UBHA 4AEKA 3U4XA 2ZBJA 1NCRA 2JENA 3MPBA 1NA1B 1S2BA 3NV1A 4AI1A 1AL22 2H0BA 2ARXA 3ACLA 3QH7A 4QGNA 1NLSA 4META 4WM8C 4D7YA 4HETA 1J59A 5EXOA 4MX3A 1ULEA 4TSVA 4HK8A 2ZGMA 2D3SA 1V6JA 1WCSA 4IEXA 3QOPA 4CYDA 2VMIA 5FFOC 5GZGA 1SEFA 4LA2A 4B7EA 1RUE3 4GIQA 1EPZA 5JSOA 1PZ9A 5JZGB 4QQOA 2C9AA 2DCJA 4EWAA 4Q1PA 2QUOA 4LBQD 1I9RA 4FP2A 2BFUL 4OULA 3VBOA 2PHLA 2BYVE 4YVWA 4NHLA 3JZVA 3RMYA 3ZFGC 3AXDA 2DURA 5KHGA 2HWD2 2GH2A 4YG6A 1KITA 1WCKA 2DUOA 3B94A 1KFXL 3CJIA 1KD7A 3HBZA 1BMV1 2EXHA 4FVVA 1AR61 2XUMA 1RUI2 3NJZA 2ZHLA 5GALA 3OBRA 4LHNA 4XBNA 4XF3A 1EV13 2VVDA 2XKOA 1J58A 1DYKA 2XVLA 3J8F1 2PLV2 2QE3A 1ZBE2 1FV2A 4N43C 1OLQA 1CX4A 1N1SA 2EXIA 1RINA 4MGYE 5KXEA 1N47A 4LBQA 2RJKA 4TYSA 3AX4A 1Y43B 4JGYC 1CQ9A 2DCTA 5EYYA 5T50A 5T55A 3RYPA 3JQWA 1O4TA 4Q0UA 1D4M3 4FCAA 4YVSA 3S6PA 2D43A 2YXSA 3EO6A 5L73A 1TEIA 2GMPA 2XKPA 5AVPA 3N3HA 3ZVXA 4MGIE 2CV6A 4ASLA 2D6NA 1RUC1 1MQTC 1VP6A 3OYWA 4FAGA 3WDWA 1LOBA 1UF2C 1FOD2 1S0FA 2JD4A 1MS1A 4QXKA 4PLOA 2OIIA 3PMEA 1NA1A 2ET1A 2PTMA 4OI0A 2GAUA 1QQP3 1KS5A 2JE7A 2VG9A 4EN9B 2GC3A 4L9BA 3IN9A 1W6NA 4GA9A 2UYBA 3AZVA 4J1WA 4PLMA 4GALA 4FSJA 5ABJC 3KT7A 3UKTA 4QGMA 4XILA 3SXWA 1TMF2 1VBB2 4JGZA 4EJRA 5A33A 3MFCA 3FX3A 2D6PA 1HV0A 1XYOA 2ZMKA 4K3UA 2UWBA 3BCWA 5E1RA 4L99A 2HWC2 3CNAA 2BEOA 3KCCA 4HN1A 1UKGA 4CP0A 4E9KA 2ZACA 4MSVA 5JZGA 4A7YA 4Q2FA 5FOBB 1C8M3 2A6YA 3B00A 1BBT2 2YV8A 5KXBA 4AEDC 2IXHA 4S2HA 1RC6A 2DTWA 3I8TA 2Q30A 3ZSMA 1L3JA 2ZTNA 3VN4A 4ATFA 2A7AA 2ZGSA 4BWOA 3POWA 4YZ4A 5I8TA 2WNUB 3S7EA 2HWD1 4Y20B 4Q0PA 1BVP1 2PHFA 1BKZA 1DQ5A 4Z8BA 2UY8A 4F8AA 4AVSA 1LOCA 3VUOA 1AR93 1RUI1 2GZWA 5JOYA 3AYCA 4JDOA 4H3WA 1DBNA 2N7GA 3THTA 1IGOA 2JEMA 1F5FA 1OOPC 1MS3A 1PK6B 4FPYA 5I91A 4AQSA 1QXRA 4GMP0 4GULA 1OFNA 2Q5TA 4Q4W1 5EYXA 1BXHA 1TME3 1HRI2 1ULCA 3JBG3 1IKQA 2UY9A 1S0EA 1YI9A 3FE5A 3WD5A 1ASJ1 4KGGA 2R0HA 3AP6A 4LEJA 1WW4A 4Q8KA 5KHKA 4FPFA 1MVQA 1XNKA 4L92A 1LOFC 1N1YA 4HBNA 4B8EA 5JIUA 1FMD2 3M3CA 2R1DA 2RS13 4KWJA 3MFAA 4X6RB 4EV0A 1YFUA 3VL8A 4ATEA 4YRDA 1X36A 2EAKA 2A5ZA 3GYDA 5JVVA 3O14A 2GN3A 3ILFA 1NE4A 1AYM3 4WM7C 4C90A 3X29B 4K6BA 3ZFEB 3ELNA 3MW4A 5FO7B 2WT2A 5E8AA 2DCZA 1RJ7A 4L97A 1TMF1 1H1AA 5K7PA 2VW2A 2NYYA 1UAIA 1HXS1 1PGSA 3UJOA 4KQ7A 2HWC1 1LGNA 3R0RA 1KFUL 1JN2P 2R063 1IQAA 1M06G 1OSGA 3KCXA 1UU4A 4NVPA 1RUE2 2D93A 3H9AA 5J98B 4GKYA 4OI4A 3AB0A 1FNYA 4P9YA 5DUXA 3IT8A 4XFBA 4CEYC 4DQAA 3W9AA 1PHMA