5CFCB

Crystal structure of human cardiovirus safv-3
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
232
structure length
232
Chain Sequence
SPFPVTVREHAGTFFSTTPDTTVPVYGNTISTPFDYMCGEFTDLLSLCKIPTFLGNLDSNKKRIPYFSATNSTPATPLVTYQVTLSCSCMANSMLAAVARNFNQYRGSLNYLFVFTGSAMTKGKFLISYTPPGAGEPKTLDQAMQATYAIWDLGLNSSYNFTVPFISPTHYRQTSYNTPTITSVDGWLTVWQLTPLTYPLGVPNDSHILTLVSGGDDFTLRMPVTFTKYVPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP1
publication title Structure and Genome Release Mechanism of the Human Cardiovirus Saffold Virus 3.
pubmed doi rcsb
molecule tags Virus
total genus 36
structure length 232
sequence length 232
ec nomenclature
pdb deposition date 2015-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5cfcB00
5BNOB 1RHI3 1TMF3 1VRH3 4Q4V1 1R093 4IV1B 1EAH1 1CJDA 1V9U3 5L7OA 3ZFGB 1EV13 1AYN1 4YVSA 3VBUB 4JGZB 3ZFEC 1ZBE1 3JBG2 4GMP1 1IHMA 1ASJ3 1POV3 1A6CA 1VBB1 3VDDB 3VBFA 5CFDC 1RUI2 3VBOB 1C8M3 2BFUL 2RMU2 2MEV1 1ND3A 2X5IB 1K5MC 5ABJC 1E57A 1MQTA 1NCRB 1QQP3 2HWF2 5DDJ2 5CFCA 1RUI1 4BCUA 1RUH3 4GB33 4AEDA 3VBRA 1H8TC 3CJIB 1COV1 1FPN2 2HWF1 5DDJ1 1RHI2 1QJY2 1NA1B 4RHV2 4Q4Y3 4WM8B 1PO13 1QJU3 5BNNB 2XBO3 1PO22 4RQPA 2VQ0A 3LOBA 1RUD3 1HXS3 1EV12 2WZR1 1QJY1 4N53A 4RHV1 2FZ2A 5AC92 1GFF2 2HWC1 2PLV1 5FMOS 2R061 5A32A 5K0UC 1VBE2 1BMV2 1EAH3 1TME2 4LLFA 4EJRA 4IV3C 2ZZQA 3ZFEB 1RUE3 5AC91 1OOPC 3ZFFA 4CDWC 1AYN3 1NCQC 1VBE1 1FOD1 1TME1 1BMV1 3DPRC 1QQP2 1RUJ1 3TN91 4WM7C 5CFDB 5D8AB 4GMP3 1RUC2 4GB32 4Q4X1 1RVF1 5C4WA 1K5MB 5ABJB 1VBB3 4GMP0 2HWE2 2RM22 3VBHC 1W39A 3JBG3 1RUC1 4GH4A 1PO12 1QJU2 4RR3C 4CEYC 1H8TB 1HXS2 4JGYC 4PDWA 1VBD2 2HWE1 2RM21 1RUI3 1AYM2 1AR92 3IDEA 1HRI1 3CJIC 1COV3 4Y4YA 2HWF3 5DDJ3 2BUKA 1HX6A 4Q4V2 4CEWC 1AYM1 1EAH2 5BNNC 1RMU1 5JZGA 3JD71 1FPN3 4N43A 2WZR3 3S6PA 1AL0G 1QJY3 1AYN2 3FBMA 5K0UB 4CDXC 4Z92B 1M06G 4RHV3 1MEC1 1BBT2 1VB4A 4CDQA 4IV3B 1PO23 2WS91 1ZBE2 2HWD2 1OOPB 5BNPC 5FMOL 2PLV3 2HWC3 3NAPA 4CDWB 1AR71 1NCQB 2R063 5C8CA 1BBT1 1CD3G 3DPRB 1QJZA 1VBB2 1QJX1 4WM7B 2GH8A 2HWD1 2TBVA 5AC93 5L7OC 2MEV2 1R081 1VBE3 1FOD3 1TME3 4Y5Z0 1X33A 4YVSC 1RUJ3 1POV0 1AR82 3VBHB 5C9AC 5D8AC 4Q4X3 1ND2A 1RVF3 4RR3B 4YVWA 4CEYB 2HWB2 2Y26A 4JGYB 4QPGC 5CFDA 1COV2 1DDLA 1AR81 3VBFC 1BEV1 1RUC3 2ZAHA 2QQPA 2HWB1 1AUYA 1ND3C 5A33B 2HWE3 2RM23 2WZR2 1MQTC 4CEWB 2R042 5CFCC 4FTBA 1FMD2 4QPIA 3VBSA 1VBD3 5ACA1 2PLV2 2HWC2 2R041 2R062 4CDXB 1AYM3 1AR93 1FMD1 2RS12 3J8F1 2R072 5BNPB 4RQPC 4RS5A 4Q4V3 4RFT0 1FOD2 2RS11 1B35A 1RUJ2 4N53C 3TN92 3M8LA 2R071 2WS93 5BNOA 2FZ1A 4SBVA 4IV1A 4NWVA 4Q4X2 5L7OB 1RVF2 1BBT3 4YVSB 1Z7S2 1X36A 1QJX3 3ZFGA 1R1A1 5C9AB 1ZBE3 2HWD3 2DF7A 1OPOA 1RB8G 1R083 1PGL2 1Z7S1 4QPGB 4JGZA 1HRV1 3VBUA 1VBA1 3VBFB 1NY72 2WWSA 2MEV3 3VDDA 1HRI2 1PGL1 1ND3B 5C4WC 1MQTB 3VBOA 1AR83 2ZTNA 1NY71 1BEV3 5CFCB 2X5IA 2RR12 1NCRA 1RMU2 3JD72 4GH4C 1RUF1 1PGW1 2HWB3 4PDWC 2RR11 1MEC2 1RUH1 3CJIA 1AR62 1C8NA 2WS92 1AL21 2RS32 4RQPB 5ACA3 1NA1A 1SMVA 2XPJA 1AR72 4WM8A 2R043 5BNNA 4Q4Y1 1FMD3 3J8F3 2XBO1 4N53B 1AR61 1QJX2 5J98B 2RS31 1RUD1 1ZBA2 5JZGC 4CDUC 4CDXA 1D4M1 4N43C 1R082 2RS13 5A32B 4CDQC 1ZBA1 2R073 2BPA2 4FSJA 1NG0A 3JB8A 3ZFFB 3NAPC 1VAKA 3ZFEA 5C8CC 3TN93 5FOJB 1RUE1 1R1A3 1BEV2 4Q4W2 1F2NA 1HQNA 1Z7S3 5C4WB 1HRV3 5C9AA 5D8AA 1VBA3 2GSYA 2RS52 1K5MA 5ABJA 4Q4W1 1RUG2 4QPGA 4GH4B 1ND2C 4YVWC 5ACA2 4PDWB 3JBG1 2RS51 1PVC2 1H8TA 1RUG1 3J8F2 2WFF2 1HRI3 1RUF3 4AEDC 3VBRC 1VBC2 1NOVA 1PVC1 2RR13 1PIV2 2RMU1 1RMU3 4FTSA 2WFF1 3JD73 1AL23 4QPIC 5JZGB 1VBC1 4CDUB 4NWWA 3VBSC 1VRH2 1TMF2 4N43B 1R092 1MEC3 1PIV1 1AR63 1V9U2 4CDQB 2RS33 1R1A2 1FPN1 5K0UA 1D4M3 1RHI1 1TMF1 1VRH1 1AR73 1R091 4RS5C 3NAPB 4IV3A 5C8CB 1HRV2 1PO21 2BBVA 1V9U1 1OOPA 1B35C 4CDWA 1VBA2 1ZBA3 3ZXAC 1OHFA 1EV11 1NCQA 5BNOC 3DPRA 1ASJ2 1VB2A 4IV1C 3ZFFC 4WM7A 5LK7B 2WLPA 2IZWA 3ZFGC 1C8M2 1ASJ1 1POV1 1RUF2 1PGW2 1ND2B 1F8VA 4YVWB 3VBHA 3VBUC 4JGZC 4FTEA 5GKAC 1C8M1 4RR3A 1RUH2 4CEYA 4Q4W3 4JGYA 2BFUS 4AEDB 3VBRB 1AL22 1QQP1 3VDDC 2RS53 3VBOC 4Q4Y2 4GB31 1RUG3 2XBO2 2X5IC 5A33A 1RUD2 4QPIB 1NCRC 4CEWA 1D4M2 3VBSB 1PVC3 1WCDJ 1PO11 1QJU1 2RMU3 2WFF3 3HAGA 1HXS1 1VBC3 1VBD1 5J96B 4RS5B 1NA1C 1AR91 1PIV3 4WM8C 3JB4C 4CDUA 1B35B 5BNPA 1RUE2
chains in the Genus database with same CATH superfamily
4XJZA 3WG1A 3ACHA 4FI9A 2QJVA 2YB7A 3T2OA 1XQNA 1EAH1 2ET7A 5FZEA 4AAXA 1OUXA 3BTAA 3PHMA 4L99A 3H3ZA 1XNAA 2JDKA 3MGUA 5DAXA 2YROA 3ZFGB 4QPWA 4OHZA 3WNOA 1W2TA 4XIOA 3LDRA 3JCIA 1KRIA 2ID4A 5J37A 4O7XA 3ZOIA 1T6BX 4GA9A 4URTA 4YG0A 4P9WA 2C24A 1N3PA 4HL0A 5DUWA 4S2GA 1TG7A 2XHKA 2YXSA 4CTEA 3MEPA 2D97A 2XGXA 3NSTA 5I0DA 3VHNA 3VDDB 3WDTA 1FXZA 2P3JA 2YPJA 3KSCA 3ITQA 5FZ3A 1QU0A 3RZJA 1D2SA 2W1QA 1E5IA 1PM7A 3M2MA 5FZDA 3VBOB 4B7EA 4XFHA 4DQAA 4YFZA 1LOBA 2RMU2 3WNXA 1ND3A 5I91A 3CZJA 2X5IB 5IAXA 1UPSA 2RV9A 1UX6A 2JENA 1MQTA 1XE7A 3WD5A 1YIPA 1ST8A 2HWF2 2E53A 3AXEA 2JG8B 5CFCA 1N1TA 2A73B 2GP5A 2UYBA 2E9QA 4P9YA 1JU4A 4DINB 4XC9A 2EIEA 5JIUA 2ETEA 1H8TC 2YU1A 5F5QA 2LM3A 1W8NA 2HWF1 2XLGA 3C7GA 3VKNA 1RHI2 1SG3A 1QJY2 3OJBA 3HNMA 4MXWB 3THCA 5K8SA 2NN8A 3POBA 1XB9A 3Q8FA 1I1EA 5BNNB 5FKBA 3WVJA 2PAKA 3AC0A 4BLIA 1CONA 2VUJA 1CIYA 4CU7A 3FLPA 5I0TA 4LKDA 2WKKA 2VR4A 5LBEA 1QJY1 1W99A 3B5LB 3DF0A 3RGBA 1D0GA 3B94A 5LK5A 2OZ6A 4XQWA 4JV4A 4QB6A 1RIRA 2HYKA 2O8OA 1NLQA 3PUAA 4K40A 4DZGA 1J1LA 2QQVA 1OVSA 3NNGA 3BPZA 4BH9A 1WA6X 3GXUA 1F31A 4FOQA 1AXKA 4AI2A 4UFKA 4JDOA 2XLAA 3UKNA 1EAH3 2XJPA 3H50A 1GNHA 1KQRA 1PX4A 5T5PA 1F4AA 1N3QA 3OBAA 4QDRA 4TYSA 3ZKYA 4F7ZA 4XW3A 4JHTA 2WNVA 2CDOA 4XILA 4CDWC 4OLLA 1ULCA 2WN2A 2QCSB 1QQP2 4I30A 3PL0A 5DG2A 4OZXA 2P34A 2W68A 4N9HA 1WCQA 4R9AA 1ZZ6A 3FUQA 3ALQA 4JQTA 1WZXA 1PM4A 2A6WA 2ZMNA 5D8AB 4GB32 4DUWA 1CGPA 1QIQA 4HPKA 1RVF1 4L11A 1D0HA 4QMAA 5J7MA 2YGLA 3USUA 2B5HA 4GMP0 2AC1A 2QQOA 1KITA 2RM22 5GLZA 3ZXFA 3VBHC 2O8QA 3ILRA 4CRQA 1A8MA 3U10A 1QJU2 1G6NA 3S57A 1YJLA 4RR3C 4CEYC 2E7AA 1H8TB 3U14A 2BOIA 1HXS2 3RI9A 1VBD2 3WW2A 2RM21 1GP6A 2XWJB 1OFNA 4XVHA 2VMEA 3ZXKA 2VUDA 4BM8A 1GOHA 3ILFA 3OYWB 4AFAA 3IKWA 4AZZA 3E6CC 4YARA 5FY9A 1MS8A 5EYXA 3WNNA 2KR2A 2HWF3 4XFCA 4Y4YA 1OKOA 3ZSLA 4CCKA 4UBHA 4NJ4A 2ORXA 5LBFA 5JXJA 1YLLA 1UKRA 3POWA 5DZEA 5IVVA 1GWLA 3U11A 2JDAA 3JD71 4DXRA 3D4KA 4ES9A 1O3RA 5J36A 2WLQA 3VZOA 4N43A 3PDQA 2A7AA 5FK8A 3BVCA 3LGRA 3ZYGA 4YW3A 3VKFC 2E33A 1QJY3 3VN4A 3FHIB 4IEPA 4W6YA 4Z92B 1BXHA 3TEXA 1MEC1 5CNAA 3WEZA 1XSQA 4AG4A 5CG8A 2R1DA 2DU1A 2XMLA 1GR3A 1G9CA 2HWD2 4JTOA 5FMCA 4CDWB 3NAPA 1JODA 1H9PA 1ODNA 1W6PA 1ZZ9A 5DAPA 5A7SA 3UKVA 4E27A 4QQHA 1SBEA 1CAVA 3WG4A 3V65A 1CX1A 1QJZA 1VBB2 1UYXA 1QJX1 2ZGNA 2GN7A 3D3AA 1HB4A 3ABZA 1BLZA 1OC1A 4K1YA 5FZ9A 2GH8A 3LEKA 2HWD1 4F3JA 5IVBA 2GN3A 3WINE 2BP6A 4ZU4A 1MZFA 5L7OC 2MEV2 1ALYA 3GHNA 1R081 2A70A 1XU2A 4Y5Z0 5FYYA 3M3QA 1S0DA 1GANA 2V73A 2Z69A 2BVBA 2D98A 3N35A 5C5UA 3VBHB 4BZ4A 5C9AC 1US3A 3FUOA 5IAVA 1OVPA 3OBZA 4DXTA 2PHXA 1F4HA 2JG9C 3H1MA 3ZYPA 1RVF3 5I0UA 2YZ4A 4RR3B 1IPKA 5FYBA 2HWB2 4CEYB 1DCSA 2HYXA 4ZPIA 1COV2 3CO2A 3RMXA 1AF9A 3VBFC 5JOZA 4BU2A 1XNCA 2VOWA 2LUWA 2ZAHA 2QQPA 3EYPA 2HWB1 2ZX1A 4I09A 5IATA 5BV6A 1VALA 3P3NA 2RM23 2VQAA 2WZR2 2JIJA 2VBDA 4N7IA 3V0AA 2ZEYA 1ZRCA 2GZWA 2QQUA 4MSVA 4Q27A 4BYYA 3HNBM 5FZ6A 2ZS6B 4NHKA 3MICA 4W65A 3SXWA 5C71A 4Q0UA 4JZRA 5F8PA 1A8DA 1IQAA 1EUUA 3WUCA 3NKTA 3A21A 2FD8A 3VBSA 4I3GA 1VBD3 5ACA1 3LEMA 1G9AA 2JB8A 3SH3A 3VDAA 2R062 5IHRA 2VCAA 3OD4A 2J1SA 2YG0A 1JOJA 4MADA 5IK4A 5BPXA 4XF1A 3J8F1 3KQ4B 3N9PA 4AQ6A 4KI5M 3EQEA 5K4LA 1Q8VA 2ARXA 1DBNA 3N7MA 4RS5A 1B09A 3A23A 2G4IA 4RFT0 4Y33A 1FOD2 4R52A 5IFPA 4AGRA 4Z2AA 1B35A 3RYRA 3DXTA 4RYDA 4ASKA 2EIBA 4QXKA 3TN92 3T09A 1QXJA 3ZXLA 2PYTA 4SBVA 4AI1A 2VBPA 1Y4WA 4CXYA 2B7YA 5JXHA 2JICA 3Q8CA 5L7OB 1EYBA 3AYAA 4GZ9A 1WD4A 3KLSA 2MNGA 5EZWA 3OEAA 2WZPP 4Q26A 5L9BA 2G9GA 1QJX3 3ZFGA 1STMA 5F5AA 1R1A1 5C9AB 4OI4A 3KMHA 2EXJA 2HWD3 5LBCA 5KC5A 2AENA 2XLFA 4E2SA 2JG9B 4FPFA 5F6LB 1R083 4D6SA 2X8KA 3K77A 3H8RA 3NWKA 3RZLA 2DVDA 3Q8BA 3W58A 2H0VA 1BKZA 3ETQA 4HKOA 3LSEA 2VNGA 3LPFA 2BTVC 2OX0A 1DHKB 3N3HA 3VBFB 4AOCA 1S55A 5FR3A 3RZHA 1VP6A 3KGZA 2WWSA 3T1LA 2MEV3 2K46A 3ZSKA 3VDDA 1HRI2 3WP3A 3CZUA 3OPZA 2A6ZA 5LCWL 1IS6A 2FQPA 3ZXDA 3BIWE 1YYNA 2ZXQA 1SBDA 3AZWA 3RJ2X 3VBOA 3PUSA 1LU1A 2X5IA 5EJ1B 3HR9A 1RGSA 3T3YA 2G9FA 4DMIA 4NRPA 2D3PA 5IWFA 3SCGA 1W9FA 1PGW1 2FCUA 2HWB3 4ITCA 2JG8A 3JQXA 4PT6A 5L36A 1LOGA 4IW3A 1CWPA 4HLTA 3HJRA 4QX5A 2P6HA 2VZTA 4P00B 3RG0A 4ZKTB 1RUH1 2PQSA 1DGRA 3I2JA 2DV9A 1WMFA 1JYVA 2Y6FA 3M3EA 2X09A 3L2YA 3PUIA 2RS32 4MXWA 2VBBA 5ACA3 3VKMA 4BB3A 4FPLA 5BNNA 2WUHA 2XQRA 4D0QA 4YNIA 3J8F3 2QQWA 2XBO1 4IEZA 2CAUA 2RS31 1RUD1 1ZBA2 5IK8A 4GQ7A 1SLIA 4DIQA 5FDBA 1UZVA 4L0PA 3DYOA 5A32B 1MS1A 5JSOA 3U07A 1ZBA1 3MIHA 4MOAA 4AEKA 1OFSA 2CL2A 3NVCA 3QBQA 3JB8A 5JR7B 3HQXA 4OUEA 3DCQA 3IAPA 4ISQA 4ZONA 4O9EA 2J1TA 4N8MA 4Q1RA 3JQWA 4DY5A 4GWIA 3TN93 5A3WA 2E63A 4BQXA 2BYVE 1R1A3 1JI6A 2Y33A 4XDOA 3ACFA 4QD2A 4QM9A 3R4UA 4NN0A 4W6WA 2DCZA 3UL2A 1MZ6A 1SLTA 3BIEA 2ARAA 3LAGA 5D8AA 1Q8SA 5FUPA 1J58A 2AR6A 2RS52 2ZHMA 5GZEA 4AWDA 3HQUA 2XXZA 4M4RA 2FDFA 3HN3A 3NW4A 2I45A 1HB2A 4CUCA 4KMQA 2DUOA 1HQLA 2XONA 2DUPA 3HD8B 1H8VA 2V4AA 3I7DA 1UMHA 3POGA 5LRSA 4HKWA 3BTZA 2RS51 4CP9B 2IC1A 5DUXA 1H8TA 4LK6A 1UXZA 1APNA 4IE7A 5A3PA 1HRI3 1L7RA 1AX0A 3OY8B 2ZX4A 1ZZCA 3O1VA 3J7HA 1NXD1 1X82A 4NR1A 4UFIA 2XL7A 4CUGA 3OYWA 4P02B 4AEMA 1Y9QA 4ZZ8A 4Q1PA 5CZKA 3KM5A 3J9SA 4XUNA 4COZA 3LF7A 4IEYA 2X53S 4MGYE 3Q8AA 4U36A 3I3EA 2QZ2A 3TYJA 4CUAA 3AYEA 5KBFA 1CR7A 2W39A 2Q0AA 4NWWA 1TMF2 4TXWA 1OD3A 2WAAA 5F3EA 3KWVA 1WCSA 2W5FA 2UWCA 3MW4A 4OQ9A 3NQHA 1A78A 3VKLA 1DP0A 3MF9A 5FY7A 1E5RA 2RS33 3PIJA 2YC4A 4NE9A 2WAOA 2TUNA 2ZEZA 1TMF1 5FZOB 2ZEXA 3TEYA 2JB4A 2ZKLA 1WUVA 3SKJE 3T0BA 3I3QA 3ZDSA 4LUKA 1HRV2 1US2A 4AGVA 5IVJA 4C91A 3LB9A 4CDWA 1VBA2 1ZBA3 4QX8A 4DRRA 5DN2A 1VE0A 3I2OA 2WNVC 4IGPA 5BNOC 1QNYA 3AKSA 3KT4A 1LCLA 5LB6A 4UFLA 1IS3A 1XYPA 3NO8A 4COYA 1OH4A 3JUUA 3ZN6B 5LK7B 2BNOA 3THDA 3PVEA 4XHXA 4HONA 3PMSA 4EN7B 4EN0A 2N7GA 1GZTA 4BMEA 4AI8A 1UPIA 2X29A 2XH6A 1UOJA 5A3TA 1ENSA 4FPEA 5JPNB 1F8VA 5BXXA 3GJAA 3RPQA 3VBHA 5KHJA 3LQCA 3VBUC 4FTEA 2WBKA 2MHFA 4RR3A 2OUJA 3ZR5A 1W3VA 4CEYA 5KHIA 2EXHA 1QEXA 5FZFA 3PJYA 1C4RA 2DCTA 1H1IA 1AL22 4QX2A 4Y4RA 3WR0A 1BZWA 4YM1A 1TQ5A 5H9RA 4Q5OA 5SV8A 2AZ5A 4OI1A 3TAYA 5GZCA 3IM0A 4M4PA 2RS53 4Q4Y2 1S0EA 4MGQA 1OLQA 4LBLA 1MS3A 4D6RA 5JDBA 4Y24A 2WA3A 4X8PA 4AQ2A 4RSUA 2VO5A 1GKBA 1G9BA 2UU8A 2EIDA 3NKGA 2JDNA 1PNGA 4DB5A 2JDZA 1UWWA 4DXZA 4NIHA 1PO11 1N1SA 3GZEA 2J1VA 4Y22A 2QQNA 2OKXA 5FAXA 2GP3A 4IL7A 1NYWA 1NUKA 3S0MA 5FBJA 1DQ2A 2VG9A 5HV4A 1UD1A 5EJ3A 2W95A 5FCCA 1AR91 5KR7A 5M0TA 4WM8C 4D69A 4PBOA 3WF2A 5JXGA 2J1EA 1W2AX 4CDUA 1MR5A 4XDQA 5A3OA 4AVBA 5ISLA 1UN1A 2IFRA 2R49A 2WNVB 5BNOB 4IEQA 1RUOA 1TMF3 1ZRDA 4Q4V1 3HBKA 2C9AA 3OUHA 3I49A 4P9IA 3CF6E 3RZMA 4P5YA 1CJDA 2DVFA 4QGNA 1CAWB 3PIGA 4EZ4A 5L7OA 1ACCA 3G6JB 4ONUA 2IVIB 5F3GA 3RMYA 4DXSA 3VUOA 1UY4A 4BWOA 4HKLA 3IB3A 4HVQA 1DFQA 3P3PA 1TVGA 4IGOA 4KWLA 4YGEA 3USUB 3VBUB 2JG9A 2ZGPA 5LA1A 1REEA 3DKWA 3BUCA 3JBG2 3TBDA 2R16A 4YW1A 1A6CA 5LA0A 1DIWA 1JUIA 1QHDA 1WCKA 2J1RA 3VBFA 1S0FA 3AFKA 3DXUA 1FT9A 5AFEA 2ENRA 2Y6KA 4JQRA 2GC3A 1X9PA 1LU2A 3E97A 2P1BA 3OG2A 1MVEA 2Y38A 4UYBA 3O1SA 3VHOA 5J09A 2G1MA 3O14A 1D4VB 3AMPA 2E6VA 4BCUA 5B2GB 4AEDA 1H2MA 5FYZA 5CBLA 3AJZA 2XR4A 3IWZA 2G19A 2R0FA 3CJIB 4NIAA 2Q8CA 5E89A 1CAUB 2B46X 4NIIA 4Q4Y3 4WM8B 1UQXA 3ZSEA 1PO13 4UBGA 1JZ7A 1IG0A 1PO22 4QKFA 4JDNA 2VQ0A 1Y3TA 2GALA 5JOWA 5JPMB 1IPJA 3WW1A 4GD4A 2R7EB 3SITA 2G9ZA 1SLBA 3ZYJB 5AVAA 5FY1A 1LRHA 3J7MA 2EA7A 3B69A 1URXA 3I2DA 2UY9A 1JZ4A 2FHRA 3RYPA 1V6KA 2DCYA 3E5QA 4XQDA 5FYHA 1GFF2 1KD7A 2PLV1 2AH2A 4FFIA 2ZGLA 3SH4A 2O14A 3O0WA 3QH7A 5GLVA 3FN9A 5A32A 5K0UC 4LHSA 4XJ9A 4BQ3A 4LLFA 5I93A 4EJRA 4Q0VA 2Z42A 4BA6A 5EQUA 2HJIA 5LEJA 2JJ6A 1OOPC 3BKZA 2YC2A 5FK7A 3H42B 1NCQC 1UIKA 1YFYA 2EIGA 1CZTA 2B9VA 1GOFA 1PMJX 2VQTA 3DPRC 4LKEA 4XYXA 4ET7A 4YG3A 4EWDA 2JD4A 3ES1A 1ZVFA 3NJVA 1LHVA 3N9LA 4WM7C 1O3TA 2RDSA 2EICA 1VR3A 3LKJA 3J26N 1GMMA 2JDPA 4EN8B 1JZ6A 1LOEA 3NV1A 3I3DA 3MIGA 4AW7A 1JHJA 2HWE2 4E4DX 2IXJA 3BYWA 3PTRB 4LNVA 3S7EA 1DQ1A 3JBG3 4C0HA 1QH6A 2JEMA 2WQ4A 2CYFA 3D6EA 3DGTA 4QU1A 2P5BA 2HWE1 1R1ZA 1GP5A 4CP9A 1EPZA 1VAMA 1XE0A 1DYPA 4MG2A 1AYM2 4M00A 4I0WB 5FZ0A 3OY8A 3RWNA 3U4SA 2BNMA 3POJA 3KT7A 2ZA9A 1AX1A 1W8FA 2XVKA 2OPWA 4IGQA 1RJ8A 1D2QA 5FJKA 5AFBA 1AZDA 5KHHA 5FLIA 4YM3A 4BHPA 4CEWC 1AYM1 4J6GA 1EAH2 2D6NA 3U75A 3N9QA 3BN6A 1RMU1 1KFXL 5BNNC 3I2KA 1UMIA 2O1QA 1GLHA 4ZU5A 1WMEA 4HETA 4M3CF 3S6PA 5LY2A 4EZHA 5K0UB 5T54A 4TN7A 2Y6JA 4META 5FZAA 1OSGA 1W6OB 4Y5SA 4RGAA 5FZ4A 3ZPYA 4LBJA 5C70A 1PO23 1WW4A 3GJBA 3VZLA 3ZXGA 4B1MA 5FZOA 2VCBA 1QWRA 1OOPB 3D5OA 5BNPC 2PLV3 2XQXA 3LA3A 3AKQA 1NCQB 2W1SA 3MF6A 3RDIA 2FDKA 4A6OA 1UU4A 3DPRB 4YW2A 2R1BA 1F5FA 4FP2A 2HEYF 2WNOA 3GBFA 4Q0QA 4WVWA 4WM7B 2NP0A 2DFBA 5JI9A 1W3XA 3RI8A 1RITA 2DUQA 4M3CB 2YBSA 3B93A 3T2QA 1KJLA 3CKHA 4DRVA 3ZN6A 4ARYA 4YVSC 4AHXA 1WLTA 4A2UA 2P17A 4AVAA 4IESA 1PZ9A 3WNKA 1XE8A 1UYZA 4Z2WA 2CGOA 5D8AC 4QKBA 3L9JT 5A7PA 3NV3A 4SLIA 3KCYA 4OVEA 3WSOA 4MH0E 1QY4A 3WT3A 1YXWA 1QOTA 1WBFA 1GSLA 2GC1A 2VJXA 5CFDA 3AMQA 1SFNA 2DWRA 5LATA 3OEBA 3HPNA 5FXWA 1AXYA 3OSDA 4JKMA 4CXWA 5C33A 4P9LA 1Y9MA 2ARBA 2CHHA 4KBBA 2Z2SB 4OMCA 4DFSA 1G86A 3NJYA 1LHUA 3PU3A 3OGSA 5EPAA 4BQYA 1DGRN 3VD5A 4JKKA 1FATA 2HWE3 4HSLA 3JXSA 1GICA 3T30A 1JH5A 1JYWA 1GZWB 3O7OA 4CEWB 2R042 3DN7A 1DGWA 2J22A 4O65A 1IZ3A 1ENQA 4RFRB 4XFFA 1FMD2 3TEZA 4KGQA 2A6VA 3DECA 2WWJA 2TNFA 5IUQA 3CHXA 4FPKA 5FLJA 4CSWA 4NMIA 1POQA 2FDIA 2R041 4YZ4A 4FPCA 1AYM3 4PJYA 2E7TA 1FMD1 4OHVA 3WCRA 1IG3A 3KCCA 1NT0A 3D8CA 2VMFA 2A71A 2BERA 3H1WA 4LORA 3LSDA 3S7IA 3AXDA 4TSVA 2VULA 5BNPB 4HK8A 2ATFA 4XQ4A 4RQPC 3WF1A 1H6YA 4LO8A 2XJQA 4DUVA 5DPNA 1E5HA 4YW6A 3A7QA 5JOYA 3TEWA 3BB6A 4B4QA 3BU7A 1N1YA 4YGDA 5FXXA 3W5NA 5BNOA 1RJ7A 4LO5B 4O9GA 2FZ1A 4FBFA 2D7FA 5FPUA 4BE3A 1OD5A 3LDKA 3OGVA 2PHTA 3WF3A 2WT1A 4UFJA 1RVF2 4E8CA 4YZ5A 1CAWA 3UETA 4YVSB 4Z07A 2VZVA 1H1AA 1X36A 2H0BA 2VUCA 1ULPA 2B42B 2XUEA 2YHJA 3CLPA 2JDUA 4G4FA 4R9CA 3O0XA 4OYUA 4UOJA 2VM9A 2XUMA 3V0BB 3ZX7A 4JRAA 3VBUA 5LY1A 4CCMA 1TZOA 4DUXA 2B4KA 4F83A 3UJQA 1IQDC 1NY72 4CCLA 4I0BA 3EJKA 3BTYA 1O3QA 2D6PA 2VZQA 1Q43A 3MLLA 1GQPA 3K2OA 1JYTA 2Y60A 4LIUA 3AFGA 3WDVA 3LOIA 3AM2A 2IXIA 4BK4A 5FBZA 4BLJA 2VZUA 5FQ0B 3KGLA 3EMRA 1NAEA 3SCFA 1DZTA 1NY71 4EQVA 4TLFA 2WQ8A 1IKQA 1I9RA 1TNRA 2WNEA 3JD72 1UL9A 5C8WA 2XVLA 3C7EA 4K3UA 4MVTA 5FYIA 2D6KA 5C3OA 5CYYA 2VNRA 4PDWC 1O3SA 1K42A 2WT2A 3SC7X 1Y43B 2R0HA 3GZAA 3LD8A 3M1HA 4XCAA 1MEC2 3E6BA 5TSWA 3VZMA 2X05A 3CJIA 4EE2A 3F2ZA 4LJHA 2QQIA 4U2AA 2YY1A 1CAUA 4IE4A 1UOBA 4Q8LA 3AP4A 5IK5A 2F4PA 4RQPB 1VIWB 1SMVA 4XETA 3ATGA 3SEEA 1KDKA 1F15A 2R043 3GCWA 4HVOA 4WM8A 2ERFA 4XMIA 4C90A 2PAEA 4ES8A 5A3NA 5FO8B 5EV7A 3CL1A 1FMD3 3AKRA 3MI8A 3USSA 4EWAA 1QJX2 3DEMA 2VY0A 3KS7A 2VECA 4NO4A 3QCWA 4NHXA 4W8JA 1NLSA 5L9RA 1ULGA 4AQTA 4XF4A 4LOSA 4XEZA 1OLRA 4CDUC 5LA2A 4Y1UA 4PIXA 1JYNA 1H9WA 1R082 4LBQB 2QDNA 4GKYA 5GZGA 2P3YA 3RVHA 3MW2A 1W8WA 5FPXA 1S2BA 5FYVA 3P6BA 4FSJA 2GC2A 2WINB 4CCDA 4V2VA 1H1MA 1UXXX 1H4GA 4INDA 4QQPA 4A42A 3INAA 4E4SA 3RJRA 3ZFFB 3ZYHA 4XXPA 5A70A 1VAKA 1RC6A 2DURA 2LROA 1YNAA 1RUE1 3D82A 4AI3A 3ZDVA 5FZKA 3FC0A 2E51A 4HN0A 2QZ3A 4R8HA 4DS0A 2VUAA 1PHMA 1SQ4A 1YO8A 2NYYA 2WL1A 3FX3A 3MYXA 4KWJA 1YFWA 3WW3A 1YC61 2R30A 4BQ5A 4QT6A 2VVEA 2NPIA 3POEA 2JD9A 3G7DA 4RD7A 4Y1XA 1MS9A 4HMZA 2J1UA 1ND2C 5CVRA 3HEIA 2ZKNA 4YVWC 4OHXA 1H2LA 3ZYFA 5ACA2 1VPHA 4PDWB 2W91A 3WHTA 4COWA 3R6SA 1C5IA 1V6MA 2VTFA 3KVBA 2HBTA 1DQ0A 4FPYA 4QQOA 3AZYA 3J8F2 2NM1A 2LRPA 3ELNA 2PHDA 4AEDC 1GBGA 2WYFA 4Y22B 3T0AA 5IVFA 1BK0A 2C26A 2W94A 1GOGA 5D2AA 2VMDA 3FJSA 4OZOA 5JSRA 1QXRA 5FZ7A 5FZIA 1SFYA 5K7PA 3JD73 5KWRA 3I2HA 3E6DA 5A7NA 4B4PA 3EXUA 3I3BA 5JZGB 2WO3A 1GNZA 2GMMA 4CDUB 2QQKA 1PZ8A 1VRH2 3M3CA 1H2KA 3UK9A 1R092 3FLRA 1H30A 1XRUA 3VB9A 1MEC3 4FPOB 1V6OA 1V9U2 5F9TA 5JXIA 1HJFA 3WHUA 4C1WA 4LK7A 1R1A2 1IPSA 1FPN1 1Z78A 2JKBA 5K0UA 1UNBA 1VMJA 1VRH1 4CXXA 2ZGOA 3LIGA 1LULA 5L9VA 4LITA 1R091 1W6OA 2C9KA 3O1OA 2ILMA 4MGKE 4YYOA 1OKQA 3B7MA 4E8DA 1XPWA 4XZPA 3UYJA 3S5QA 3WLUA 4AFMA 2HBUA 2BBVA 1V9U1 2AACA 1OOPA 3VD4A 1XJAA 2XJUA 2P3KA 3NJZA 3RFRA 1RXGA 1EV11 1NCQA 4FOVA 4GXLA 1Y7BA 5F3CA 3DPRA 1XU1A 2I74A 1DYKA 3AL5A 2A3XA 5JWPA 4WM7A 3WW4A 3MBWA 4MLOA 5FP9A 5GJ6A 4AHZA 2NQYA 2CNAA 4M3CA 1REDA 4PBPA 3HT1A 2CY6A 1C8M2 2CDPA 5CB7A 3ZSMA 1MS0A 5IFTA 1C57A 1PGW2 3CNAA 1MZ5A 1ND2B 5K9YA 4YVWB 1UZWA 1TE1B 2W08A 4I01A 3IN9A 4PQQA 1J83A 1CAXB 2NZ9A 1C8M1 2RJKA 1RUH2 3LDBA 2OVUA 4MV2A 4AK3A 4LT5A 4EYUA 2BFUS 2ZHNA 1DQ6A 4MX3A 2VOKA 4CP2A 4AEDB 2QQJA 1V00A 4UFMA 3GM8A 4AFDA 1CQ9A 4YGCA 1UZ0A 1AJKA 2IFWA 4FFHA 3NV4A 2XBO2 3HQRA 4H3WA 2AREA 1RUD2 4IEWA 1GZWA 4LOTA 3ZYBA 2VXRA 4CEWA 4JX0A 2BGPA 2W0XA 1QXPA 5HXMA 1J59A 3JU9A 5HCFA 1WCDJ 1W8HA 1JTZX 4H7LA 4QX1A 4A3XA 1W0OA 2RHPA 2VMHA 5C6CA 2OQ7A 2XJVA 4GULA 3MUZ1 4P9XA 2LS6A 4OUMA 4QB1A 4JVAA 5J96B 3O1PA 3B02A 2A3WA 4IEUA 1W9WA 3O5SA 3WXPA 3SQOA 1GUIA 3KVAA 5BNPA 1JW6A 5F2SA 3OBTA 1HW5A 5C3RA 1LOCA 1VJ2A 4X6RB 1VRH3 4OULA 3URFA 4LBOA 2D6OX 3MLJA 1R093 2VPVA 1NE4A 1O91A 2ZGSA 1NQJA 2D40A 1Y9GA 3GGLA 1QMJA 3C8XA 4GWNA 1V9U3 5JVVA 3NJXA 2KA3A 3BOPA 1EV13 1LODA 4NVPA 5FY5A 3WG3A 2ZGMA 4LO4B 1AYN1 4YVSA 1UOFA 3ON7A 2VW2A 1NQDA 2GC0A 5GLWA 4AI9A 1W28A 1NLRA 5HBAA 2OYZA 1W9TA 4OI0A 3K4DA 1ZBE1 3RZZA 2ZX3A 1U12A 3V0BA 4GMP1 4UW4A 2V4VA 4X8NA 2WNUC 5E88A 2ZHLA 4NIGA 5BNQA 1KXGA 3AZVA 4GWMA 3T2TA 4RA0A 3ORJA 3ZN4A 3WDXA 4DEQA 1RUI2 2GAUA 4HG6B 5CFDC 3AZXA 5F7UA 2VMCA 1KGYA 1C8M3 3K48A 2BFUL 3OB8A 2GH2A 2UURA 5FIXA 1PVXA 5ABJC 1NZIA 2HEVF 1E57A 5FQ0A 2ZPXA 4TTGA 1LEMA 5DDJ2 3O1RA 1NKGA 1UW8A 4LO7A 1RUI1 1F35A 2R32A 3WDUA 2JECA 1FNYA 1RUH3 3VBRA 2ZHKA 4QX3A 4FQZA 4LBKA 2A1XA 4LBMA 2Q8DA 1DZRA 2QBXA 4BJ0A 1UYPA 3MV01 3AP9A 3N7KA 4L92A 5DDJ1 3W9AA 4CCOA 2LW8A 3ZYRA 1V6LA 4K20A 1ODMA 3AMHA 4XXAA 1C3HA 2XBO3 1KFUL 1WLWA 3J7LA 4RQPA 3LOBA 4E9KA 1RUD3 2QUOA 3PURA 4W6XA 1WD3A 3WNPA 4BOWA 4XF0A 2H6BA 2VZSA 4S2HA 1CVNA 1MZEA 2L9LA 5ANNA 3IMNA 3I97A 4QKNA 1YFXA 1DZQA 4AXOA 5FYCA 1JZ3A 1C28A 2VCMA 4PI2A 1HN1A 2HWC1 4LBQA 5FMOS 4XAEA 3WV6A 5J1XA 1JZ5A 2XL9A 1BMV2 5I8TA 1H0BA 2VW0A 1MACA 1W8ZA 3N36A 4IV3C 2CWMA 2YBPA 2FBEA 3D0JA 1JUHA 5FXZA 3ZFFA 4QHZA 4RN5A 3RRDA 3P1IA 2WNUB 1UU5A 1AYN3 2K0GA 2W2IA 2DYCA 2WSVA 3PLQA 4XFGA 3HVDA 3VD7A 3ACGA 1JMUB 4XUOA 5FZ1A 1BMV1 1OI6A 4UXAA 2JX9A 3AMNA 1RUJ1 5IK7A 3O1UA 2P4EA 1L7LA 4FOYA 2Q1ZB 5CFDB 2PQQA 3ACLA 4LIVA 5FFOC 4GMP3 1RUC2 1O4TA 2PA7A 2D3SA 2PHRA 3KF3A 4Q4X1 4Y5TA 2JE7A 2VZ1A 3MIDA 5ABJB 5IYYA 1YEWA 5I8YA 2Z79A 3M3IA 1ENRA 4I0AA 4JAAA 4YM2A 3PVNA 3FFQA 4PQ9A 3LA2A 4UW3A 3VL9A 2D3RA 4D7TA 1C1LA 3WQ0A 3IIAA 3W59A 1Z0HA 1RUC1 1PO12 4BIFA 4NHLA 1W6MB 3NNMA 3THTA 4JGYC 4PDWA 1IKPA 2VC9A 3UKTA 3EO6A 4AL9A 3M70A 3CU7A 3ZLIA 3WY6A 1RUI3 2XJRA 3AKPA 4FFFA 4GWJA 3GBWA 3FWEA 4N7UA 4XACA 4JRLA 1AR92 1KJRA 3M7AA 1OBNA 1GQGA 2IXLA 3IDEA 4XPVA 5DAVA 4DNYA 3AJYA 1FV3A 2VZRA 3CJIC 3I2FA 1SLCA 1OF3A 2YU2A 4CE8A 5DDJ3 1FX5A 3VD9A 4Q4V2 1CN1A 4OFGA 1F5JA 3POFA 4CPBA 1DF0A 5A7OA 4D7YA 2YGMA 4S2DA 5JZGA 3U0ZA 4W50A 1YHFA 5DXDA 5A3UA 3BU0A 3I2IA 2GNMA 2YFZA 4NIDA 1AL0G 2W87A 4FOWA 3FBMA 4ZXKA 4XURA 5FUIA 4WZCA 3NV2A 3WNLA 1GU3A 1O7FA 1Q8QA 1VB4A 3L2HA 4LR4A 4P9GA 5E6HA 3VDCA 2A5ZA 4IV3B 4NHYA 4CA9A 3U37A 2WS91 3UT0A 1GZCA 4LE4A 1A34A 2YC0A 5FMOL 1UZYA 2HWC3 1W05A 4FT8A 1J3PA 1PNFA 1AR71 4PLNA 4XDPA 2K2SA 1ZRRA 3FHAA 5FZMA 3FE5A 3LA7A 3RSJA 4FAGA 1CD3G 4HSJA 3MDPA 3GF6A 2NMNA 3OCPA 2VXJA 3UV9A 3H9AA 4LLOA 4MGTA 3K3OA 5C3QA 2BQPA 2OT7A 1QDOA 1F9KA 5FPZA 3H8XA 1G7YA 2YV8A 1X33A 1WW6A 3PVOA 1RUJ3 4AGGA 5I0SA 1X8EA 3WCSA 1POV0 1AR82 2A3YA 1UO9A 2A6XA 1XNKA 4AEJA 5IT6A 2W46A 3SHRA 3O1TA 4Q4X3 2C1FA 1ND2A 2J7MA 3N7JA 1MVQA 4YVWA 2IXHA 4JGYB 3AVSA 4XF9A 4Y20B 3UJOA 1LESA 4HN1A 1AR81 1CAXA 4FFGA 2YMZA 2BRTA 1BEV1 2VAUA 5JOXA 4YZ1A 2D93A 4LUMA 1RUC3 3TWIA 1RXFA 5FZGA 2VMGA 4RL7A 2Y8KA 1CZVA 2YFUA 3POSA 4BDVB 5HI0A 4YW7A 3RQ0A 1AUYA 3ZN5A 3FL7A 2WABA 4KH9A 2QQMA 5A33B 5FO9B 1O5UA 2R6QA 5A6QA 2QKDA 4XUQA 5FY4A 4D7SA 5KHGA 4H2AA 4HANA 3BTXA 3KV4A 3U78A 1I3HA 4BQ1A 3K4ZA 2GMEA 2FMYA 3T0DA 2GNBA 2VOXA 1ZZ8A 2CV6A 4KU7A 2OS2A 1UCXA 4AVSA 2AYHA 2PLV2 1HV1A 1S0GA 3ZYIB 2YPDA 2BBAA 4HZFA 4NOTA 1AR93 4A7KA 1H2NA 2RS12 3ST7A 2ES3A 3EBRA 5F5CA 2BZDA 2DBIA 2R072 1ZRFA 2ZX2A 3KQRA 1S2EA 4TZDA 2ZX0A 5A7WA 4Q4V3 1XOYA 2JXAA 5BY5A 2HH9A 4J25A 2RS11 3KHCA 3SKVA 4AHWA 4N53C 1LKNA 1MS4A 2R071 2WS93 1R64A 3VL8A 1J3RA 4XE9A 3ASIA 4NWVA 2DVBA 4IUGA 3VV1A 4BK5A 1LTEA 4OQ8A 1O8PA 5KXCA 3GDBA 4KU8A 5CKMA 1JZ2A 1YQCA 3CQOA 4AE2A 2B8MA 4BMBA 3E5XA 4YW4A 3SNMA 2DF7A 4MUVA 4XHBA 1OPOA 4IE0A 5CU1A 1RB8G 1Q8OA 4Y1ZA 1HLCA 1OQEA 1D7PM 4ZS2A 4XZUG 4COUA 4GJZA 1LR5A 4YPJA 2YYOA 3ZSJA 1W90A 4QQLA 2JDMA 4JC1A 4LE3A 3KZ4C 1AHSA 5JLVA 3PJQA 2WO1A 4DOUA 3VZKA 4C1XA 2HKXA 1LGNA 3LWCA 1OMIA 3EHKA 4Q0PA 5FJHA 5C4WC 2Y0IA 4P5HA 4FPJA 1AJOA 1AR83 1LECA 2ZTNA 4J1XA 3AYDA 2DVAA 1BEV3 1UY3A 4XIKA 4LO6B 2ET1A 1O5LA 1ZNPA 4FVVA 1MS5A 3D0SA 1UX7A 1RMU2 5KXEA 4GH4C 1RUF1 2JE9A 4NAOA 5G05L 4A4AA 3J4UH 4OHYA 4PF1A 2BV4A 5ANQA 5FKCA 1LOFC 2VW1A 4LXLA 1YFUA 1J84A 5HCAA 1W06A 1OH3A 4GALA 4A7YA 5D21A 4G9SB 3WX5A 1WLDA 1C8NA 4F8AA 2RDNA 2Q4SA 4OCTA 5DZFA 1W2UA 4AHYA 4LQRA 3WOGA 5IVCA 3KF5A 1JN2P 4H14A 1AXZA 1GWMA 2KXLA 4YLZA 5EJZB 4N53B 4NPRA 2ZGQA 4DPNA 5KXDA 3U4XA 1Q3EA 1X50A 4N9IA 5FPVA 2ZACA 4C0BA 3B3QE 2DBNA 1D4M1 4S2FA 5DQ0A 2V72A 4K9SA 4CDXA 5DAQA 4A7ZA 3AZZA 3K75B 1LHWA 4H55A 2WN3A 2RS13 2IXCA 4Y1YA 4O61A 4HBNA 2R073 4YW5A 4CDQC 1I5ZA 3W20A 4QU2A 2BDRA 4ZZ5A 1ULDA 3O1MA 4IDZA 4K8RB 2ZCWA 4JDMA 3Q9OA 4EN6B 4UW6A 4XOGA 3OGGA 5DMYA 5HCHA 2C4XA 5C8CC 1LEDA 5DUUA 5H9SA 2PELA 3I8TA 2ZBJA 3ZIXA 1ZZ7A 3OTFA 1SEFA 2P37A 2WNUA 4OUSA 3J7NA 4XAAA 1F2NA 4IQPA 4RGKA 1HQNA 4OI2A 2E31A 3ZMNA 1K45A 1VLNA 5FMDA 5C4WB 4W4ZA 1SDWA 1YWKA 1S0CA 3KB5A 3N9NA 4A6SA 1CPMA 3QACA 2GSYA 4NRMA 5A1FA 4ZXEA 5ABJA 1YI9A 1RUG2 1X9TA 1WMXA 4QPGA 4GH4B 4QXCA 1SDDB 3AYCA 4IEXA 4KG8A 4L9BA 3W21A 1QOOA 4N90A 1ULOA 3HIFA 1LOAA 2XVGA 4AVTA 1GNYA 2F6BA 1BYHA 5FPLA 3AP6A 3VGIA 4XJWA 5FXVA 5GALA 1W6MA 1RUG1 2BNNA 5T3NA 2VOVA 3F95A 3WNMA 4D94A 2PMWB 1RUF3 1RTVA 1HN0A 2VQUA 3VBRC 4XCBA 1VBC2 2RJ2A 4Z82A 4BXFA 2W92A 4ASLA 1CIWA 1W2NA 2JDYA 3BOWA 1NOVA 2JKXA 3AP7A 3I4IA 3MLKA 3P5BA 4KBZA 5CISA 1NX9A 3LFMA 4NAMA 1PIV2 2RMU1 3NMBA 2DDUA 1RMU3 4K8FA 4FTSA 4DY3A 5GZDA 2RVAA 3W5MA 4I2OA 4QPIC 1VBC1 3T4HB 5A3LA 2CSGA 3KV6A 1KDMA 3TNQA 5FZ8A 5FMBA 1PIV1 3IAQA 1WBLA 4AQSA 2BWAA 1UKGA 2BW8A 2WSUA 4LULA 4UFHA 4EN9B 4CDQB 1W9SA 2WDBA 3VLBB 2ZAAA 5C3PA 2NLRA 3OUJA 4KWKA 1D4M3 1ZRIA 3FBYA 2BVVA 1RHI1 2A6YA 1EY2A 4RGGA 2QDRA 4IV3A 1UOGA 5C8CB 1X8MA 3AL6A 3IDCB 3PU8A 5CKNA 3I59B 3ZXAC 1QJFA 1JS9A 5FTTC 3TOJA 2WC2A 3E1F1 1P8JA 4QAWA 1JOBA 2OW4A 1ASJ2 4EWEA 5DG1A 4IV1C 3ZFFC 1WMDA 1CESA 3VHPA 2E7QA 4D6QA 4E2QA 2VTXJ 4Q2FA 5DZGA 1VAVA 3IBMA 1U5YA 4UWDA 4Y1VA 2WR9A 2SLIA 2EF6A 5GZFA 1ASJ1 2VVFA 1POV1 1W6QB 2WYSA 3ZKUA 5J48A 1JOPA 4XBQA 3HOBA 4WVMB 4H7MA 1AVBA 3CJXA 1W6NB 1HDKA 2EAAA 4AAPA 4K21A 4OHWA 3H8UA 4JGZC 4PLOA 4A41A 2RJLA 3B01A 5GKAC 2DVGA 3FZ3A 2ZEWA 4WZFA 1Q56A 3OPTA 4JGYA 4CCJA 4LHLA 4Y20A 3GBGA 4YZ2A 3VBRB 4CVUA 1QQP1 1M4WA 1HKDA 4MYEA 5LRRA 1PMIA 3IIIA 4FO9A 1MPXA 2EVXA 4ZU7A 4GB31 1J3QA 1RUG3 4LBQD 1EUTA 5C7GA 5A33A 3NL1A 4YFWA 4UI9L 4QPIB 2JE8A 2RDRA 1NCRC 5F39A 3SLIA 4UAPA 1V6JA 4LA2A 3WP6A 2JDHA 3S30A 2EXKA 3NRUA 1NZCA 2GMPA 2WJSA 2Q8EA 4UT5A 1QJU1 2RMU3 4YSFA 3HN1A 3V64A 5D1IA 1XYNA 3HAGA 1HXS1 1RL3A 3K3NA 2K9ZA 4M01A 2FDJA 1VBC3 1VBD1 1VRBA 3IDBB 1IS5A 3I2GA 3WZ1A 1OXCA 2V09A 1NA1C 1GYKA 5EHDA 1PIV3 4QWNA 1UIJA 2AEYA 1REFA 4AF9A 3THPA 1RUE2 5C5TA 4ZS3A 5FY8A 4LHKA 1XNTA 1RHI3 1WWYA 1BVVA 2W47A 4E4HA 4IV1B 1HIXA 4NPLA 5F2WA 2P2KA 2QNKA 1K3IA 3LCPA 2F17A 5LZ6A 1FV2A 3B9IA 1UAIA 3LPGA 5LBBA 1TEIA 4XTPA 4UF0B 4QM8A 4I02A 4XJ8A 4XJAA 3POIA 3VD3A 2PTMA 1OA2A 5CKQA 4NROA 4PI0A 1W0NA 5FYUA 3RZGA 1O6UA 2XJTA 5F1RA 5EFUA 4OMDA 4JGZB 2Q1FA 3ZFEC 2Q1MA 3QH6A 1IHMA 1ASJ3 3C7HA 1POV3 4UW5A 1XBFA 5A6ZA 4KQ7A 2Y0OA 1OPMA 1VBB1 1IGOA 2UWBA 4CPBD 2CGPA 1KS5A 5A1LA 4BPZA 4EROA 3OD0A 5EYYA 1DLCA 2JWPA 2MEV1 1K5MC 1NCRB 1G8WA 1QQP3 2AUYA 2DTWA 2OPKA 3IDAA 4GIQA 4QXBA 1LAJA 3T1MA 2WRAA 1C1FA 2WZ8A 2D6LX 3N9OA 3MV11 2IVJA 3OGJA 3PUHA 3DYPA 4L97A 4LKFA 1QOSA 2PFWA 3N4MA 2UWAA 4GB33 5CG9A 3LEIA 4PCRA 2BOJA 4Q29A 3CBNA 3K46A 2QVSB 5IW0A 3S5AA 1LHOA 1COV1 1FPN2 1SLAA 5LW9A 1M06G 2QQLA 3A4UA 1BCXA 5A7QA 3GCXA 1GZ9A 3UGFA 1NA1B 1SBFA 4HOOA 5FWEA 1GWKA 4RHV2 3H3LA 1QJU3 3ZR6A 1DLLA 4K7JA 4J1WA 4IETA 3T2PA 4CU8A 4P9JA 4BQWA 1HXS3 1XNDA 2Z5WA 5FPAA 1EV12 3SCHA 2WZR1 1LHNA 2ARCA 5JAXA 2V5YA 1ONAA 4N53A 3WP5A 4RHV1 1QDCA 2F4LA 4XBNA 5L19A 3O12A 3IMMA 5IVEA 1UY2A 2FMDA 3UNPA 2FZ2A 1UMZA 1S0JA 1T6GC 4E2GA 5AC92 1K5JA 3OBRA 5B4XA 2R061 4DO0A 1VBE2 1TME2 2GU9A 5IVYA 2FDHA 3QLQA 1CJPA 3UGGA 2UY8A 4XFBA 2XDVA 2Y6GA 3RZKA 2VNOA 1PK6C 2ZZQA 1RUE3 2ZJCA 3WQ1A 5FZHA 5AVPA 3ZFEB 4AI0A 5AC91 5FZLA 1WGPA 3MZHA 1J1TA 4WVVA 4PHZA 1VBE1 1FOD1 1TME1 1WW5A 4BISA 1VMFA 2Q8OA 3CIHA 3R4SA 4G3YC 2B9UA 1G9FA 3TN91 2IUWA 1X7NA 2VZ3A 1XXNA 4D8MA 4BXSV 3IZOA 4XTMA 4XF3A 3U1XA 5C4WA 4CP0A 1K5MB 3MFAA 1SACA 4YZ3A 2FCTA 3ES4A 5T52A 1VBB3 1HB3A 5FREA 3RNSA 3A22A 3H7JA 4CCEA 3QOPA 1EPWA 4BQ4A 5BUVA 3WF4A 5I8SA 1W39A 4GH4A 5HXVA 4FXKB 5A1AA 2VH9A 1WA4A 2Z4FA 1LOFA 2ZGTA 1RINA 4HK9A 1QH7A 4YM0A 4M0NA 2XOMA 1CZSA 2SBAA 5LA9A 4GJYA 2ZMKA 4A45A 2TEPA 2Y6HA 5DAWA 3WG2A 1YI7A 1HRI1 2GNDA 2ADDA 4TLGA 2OZJA 3R0RA 1COV3 3HBZA 4XJUA 3OPWA 5FYSA 2BUKA 1HX6A 4Z1VA 4MO3M 4LHNA 1GQHA 3WP4A 1YQ2A 3ROUA 3BPSA 3MIFA 5FP8A 1YRZA 4IEVA 3SMHA 5A6XA 3PTYA 4NPMA 4XABA 4B1LA 4X6QB 1FPN3 1W9YA 1SPPB 2VZPA 4MGZE 4Z8BA 2WZR3 1N3OA 1Q5OA 1AYN2 1O4YA 4IE6A 4CDXC 3NNFA 3AB0A 3WUDA 2DCJA 3H0OA 3FLTA 3O0VA 4RHV3 1BBT2 3T4VA 2VVDA 1HB1A 1SHWB 1LJ7A 3ZXJA 4BIOA 4CDQA 5JMCA 4A3ZA 3I3MA 1XYOA 2CU5A 4R4XA 3GALA 1OT5A 1PK6B 5GLUA 4COVA 5LWBA 1ZBE2 3ACIA 2W52A 3AMMA 2WO2A 5JUVA 1JYCA 2VU9A 3MHZA 2R063 5C8CA 2ZZJA 2XJSA 1BBT1 4CCCA 1G9DA 4ATFA 3I59A 2BEOA 4MGSA 2Y6LA 4PF5A 2W3JA 4B29A 2J42A 4I3PA 3N9MA 4XBLA 3DUIA 3B00A 3MPBA 1IOAA 2D6MA 1ULEA 2TBVA 5AC93 1LENA 2EAKA 4MXVA 1LB2A 2QFEA 2OIIA 4C8DA 1JZ8A 1LNSA 4M3CE 4WVZA 1V6IA 3ZIWA 1VBE3 2E32A 1FOD3 1TME3 3MPPG 4FXGB 4D3WA 3N7LA 2YBKA 4KNCA 4CUBA 3MIBA 1JYIA 2PAMA 3H8OA 1QNWA 1W6QA 4WVMA 2JIGA 5KXBA 2PN5A 1W6NA 4URAA 2BU9A 1I6XA 1EP0A 2P6CA 2WIIB 5FY0A 2Y26A 5T50A 4M0HA 4CU6A 4QPGC 1YIFA 5F3IA 5KHKA 3VZNA 5KC6A 1PZ7A 2AEZA 1DDLA 4R9DA 1SFPA 5E1RA 1U5IA 3Q8EA 3ZMOA 2PHWA 2XB6C 5FZBA 1FI2A 5HCBA 4KGGA 5A3MA 3IPVB 1ND3C 4JCKA 4XUPA 2XKOA 2D5HA 1C5HA 5A6YA 1MQTC 4ATEA 1DG6A 2ZGKA 4AR2A 5CFCC 4FTBA 2IXKA 4MGIE 1S4CA 3WQBA 2H6CA 5I0RA 4QPIA 1ZA4A 2VZOA 1OUSA 1PMHX 4K1ZA 2YUEA 2B45X 1QKQA 3ZPOA 1V0AA 4B4RA 3K51A 2HWC2 1NE6A 2OUHA 3KV9A 4QDSA 3ENRA 4XMAA 4QDQA 1S1AA 4CDXB 5SV5A 5JZGC 5FV3A 1UY1A 1O59A 3JZVA 3A0KA 4IE5A 1CX4A 1FNZA 2CWSA 3MFCA 4ASMB 3LEGA 5A7WB 4LA3A 4YGBA 5EP9A 2UYAA 3BALA 3B9CA 1S0IA 5ERLA 3RWKX 1UYYA 1RUJ2 2VNVA 3AKTA 4HXCA 3SH5A 3M8LA 3BGAA 3LZZA 4B7KA 3E5UA 4YRDA 4IV1A 1XC6A 3UESA 4Q4X2 1BVP1 2Y64A 3FHQA 4FPGA 5FP3A 3ILNA 4ZHNA 2W9XA 1BBT3 1K12A 5FRAA 5L73A 1VMHA 1Z7S2 3ZO0B 1V6NA 1WLCA 1O8SA 1BHGA 2BGCA 4NRQA 5FPBA 5C3SA 3GNEA 3HWJA 4CYDA 4UF0A 4HVRA 1ENXA 1ZBE3 1LGCA 1YQ6A 2PHLA 4IERA 2XHNA 2XWBB 2C6SA 2BJSA 1S0BA 1ZZBA 1N1VA 2P3IA 3PUQA 1PGL2 4FPHA 4AFBA 1Z7S1 4JTNA 4JGZA 1HRV1 4QPGB 5FLHA 2FCVA 3APBA 1VBA1 2VGDA 1WW7A 1HQWA 5E16A 4ARXA 1ZX5A 1RYYA 3GZTB 3GHMA 3VKOA 1PX3A 5H9PA 2VTXA 3PMEA 2QTWB 1PGL1 1ND3B 5F5IA 2RG4A 4KG0A 1MQTB 1W04A 2XKPA 5FP7A 4QGLA 5CFCB 5EIYB 2RR12 1NCRA 3AP5A 2MPFA 1I5PA 4CU9A 5FO7B 3HNYM 2AGSA 3KD4A 1CPNA 3R4DB 3ZXEA 1BQPA 1W8OA 1YCIA 2CGNA 4PIZA 1SCSA 2ZGRA 2KD7A 3ECQA 5B4NA 1PGSA 2RR11 4V2WA 4Y26A 1JHNA 3WDWA 2KM2A 1AR62 3GZUC 3KT1A 2WS92 2X10A 1AL21 1U0AA 3MIEA 4TWTA 1XNBA 1O4ZA 1KEXA 5FWJA 3ME2A 1NA1A 4XFAA 1L7QA 1DGLA 4IEOA 5EWSA 1AR72 4B8EA 2XPJA 3BCWA 2ZOEB 2ZABA 4Q4Y1 2D43A 2OA2A 1AR61 1DYOA 5J98B 2VOTA 2CTVA 5JIAA 5BYNA 3RYKA 3PNAA 1Q8PA 1U5XA 2NMOA 3KV5A 4MZUA 4FCAA 5EXOA 2HLEA 4N43C 5LASA 5JCTA 1OQDA 3MW3A 3H3UA 2V5DA 1BK1A 4IXLA 1OA3A 3CMGA 5FOBB 1ZYBA 2EALA 2O0OA 3BODA 1DGWX 2RDQA 1AX2A 4LEJA 2DFCA 3VZJA 4PLMA 2BPA2 1UY0A 4FQ4A 3LIHA 1GV9A 1ULFA 3LE0A 1NG0A 2LALA 5JMOA 4A44A 3NAPC 3AX4A 1OLMA 5CIRA 3OF1A 1A3KA 2QE3A 4L8QA 3OOXA 1QGLA 4ISRA 3ZFEA 5FOJB 1RUNA 3TB0A 5CADA 4LKSA 4LPLA 3VDBA 2VCCA 3DV8A 1BEV2 1GP4A 2PHUA 3OGRA 4Q4W2 4FP3A 3BI3A 1OF4A 2IWGB 4QPYA 5CA6A 1L3JA 4HPKB 4P14A 5LEKA 1Z7S3 5HV0A 4P08A 1HRV3 5C9AA 1WCUA 1HV0A 2OQ6A 4AVVA 1E5SA 3NNJA 1VBA3 5F6KA 2VMIA 3C7FA 3CDZB 3IT8A 1W8UA 4DEVA 1K5MA 1FAYA 3R05A 4Q4W1 2C0ZA 3DL3A 4BQ2A 4QHOA 4YG6A 2W1WA 1QJEA 3H1YA 4B3NA 3GYDA 3LFIA 5DABA 5A80A 2BWCA 3JBG1 1UZZA 1YQ5A 2WO7A 1PVC2 1ZREA 2HEWF 1JXNA 5T5JA 1N47A 2XG3A 4FAHA 4NUBA 1H4HA 2WFF2 4XUTA 5JR2A 3POYA 4ORFA 5GM0A 2DCKA 1OURA 4L2NA 1ZA7A 1W8TA 3FMGA 5DUVA 4QX0A 5APAA 5IJRA 4KWUA 4HT1T 2PXJA 4LMFA 2GDFA 1W03A 3MO4A 3RS6A 5HPOA 1PVC1 3C2UA 2RR13 4Y3OA 3M4FA 5F32A 4MHUA 1IS4A 4V1PA 1JU3A 2WFF1 4XFIA 3H7YA 1UU6A 4YWAA 5FP4A 1AL23 4QHBA 3EB7A 4GAZA 1JBCA 1H6XA 2WA4A 3VBSC 3A0NA 2WZEA 4N43B 4R4ZA 3DKQA 5T5OA 2PHFA 1AR63 1SPPA 2E26A 5CEHA 3DYMA 3ZM8A 3VHRA 2WWUA 1AR73 4RS5C 3NAPB 5FYTA 3ZVXA 2VD7A 2W1UA 3M3OA 1YQ8A 5CAZA 1PK6A 1W6PB 1PO21 4MHRA 5GLTA 3T08A 1B35C 1CAVB 2Q5TA 1YJKA 3FFZA 1LGBA 1OHFA 4QGMA 4CZSA 4Q0SA 5FUNA 1WKYA 1DQ4A 1VB2A 1DU3D 2I2SA 1QF3A 3C3VA 3KCXA 3K4AA 5JI7A 2RE9A 5T5LA 5FZCA 5T55A 3X29B 3HMYA 5FYMA 2DTYA 4NHMA 2WLPA 3I54A 3QD6A 1UF2C 2D44A 1OLME 2EXIA 2IZWA 2ZMLA 4ZY9A 4Q8KA 2GNTA 3ZFGC 1KS4A 3C7OA 3V56A 1RUF2 3HT2A 2FDGA 4EV0A 3TRSB 1FYUA 2Q30A 1SZBA 5H9QA 4K6BA 3SEPA 3WDYA 4CP1A 4Q4W3 2DU0A 4AFCA 4CCNA 1OQ1A 2VL4A 4QX7A 3UGHA 4QKDA 3VDDC 3WF0A 1ZM1A 2ADEA 4PIYA 3WQ7A 4AVCA 1YUDA 2A75A 1XSRA 3KHBA 4QXHA 1NXMA 5F37A 1TNFA 3VBOC 2WT0A 1W0PA 5G04L 3V0AB 1T2XA 4JKLA 1W2OA 2VE1A 1OA4A 3IPVA 5J3UA 1U5ZA 2X5IC 1SLLA 1JYXA 2C5DA 1HJGA 4GKXA 1D4M2 4QB2A 1SCRA 5E8AA 3VBSB 2JG8C 2J1AA 3MUY1 3AK0A 4HFSA 2Y34A 1PVC3 2D5FA 3NNLA 2YDEA 1S2KA 3TNPB 3ETPA 4LBNA 4KL1A 4R9BA 2WFF3 5JSPA 2CAVA 1V70A 4JHZA 2WFPA 4E4ZA 2I07B 1BJQA 2LTNA 2WQZC 2ORZA 3SISA 4QQ2A 2ZGUA 4RS5B 2OXBA 3CEWA 3PVBB 4WV8A 4LTAA 2B39A 2BGOA 3JB4C 4AYUA 1B35B 1DQ5A 4WBBA 3OUIA 3AVRA
chains in the Genus database with same CATH topology
4XJZA 3WG1A 2QJVA 1XQNA 1EAH1 2ET7A 3BTAA 3PHMA 4L99A 3H3ZA 3MGUA 2YROA 3ZFGB 4OHZA 4XIOA 3JCIA 1KRIA 5J37A 4GA9A 4URTA 4YG0A 4P9WA 1N3PA 4HL0A 5DUWA 4S2GA 2XHKA 2YXSA 4CTEA 3MEPA 2D97A 2XGXA 3NSTA 3VHNA 3VDDB 3WDTA 1FXZA 2P3JA 2YPJA 3KSCA 1QU0A 1D2SA 1PM7A 4DQAA 3M2MA 3VBOB 4B7EA 4XFHA 4YFZA 1LOBA 2RMU2 3WNXA 1ND3A 2X5IB 1UPSA 1UX6A 2JENA 1MQTA 1XE7A 3WD5A 1YIPA 2HWF2 3AXEA 2E53A 2JG8B 5CFCA 1N1TA 2A73B 2UYBA 2E9QA 4P9YA 4DINB 5JIUA 2ETEA 1H8TC 5F5QA 2LM3A 2HWF1 2XLGA 3VKNA 1RHI2 1QJY2 3OJBA 4MXWB 5K8SA 2NN8A 1I1EA 5BNNB 3WVJA 2PAKA 4BLIA 1CONA 2VUJA 3FLPA 5I0TA 2WKKA 1QJY1 3B5LB 3DF0A 1D0GA 3B94A 5LK5A 2OZ6A 4XQWA 4JV4A 1RIRA 2HYKA 2O8OA 4K40A 4DZGA 1J1LA 3BPZA 4BH9A 1F31A 4FOQA 1AXKA 4AI2A 4JDOA 2XLAA 3UKNA 1EAH3 2XJPA 3H50A 1GNHA 1KQRA 5T5PA 1N3QA 4TYSA 4F7ZA 4XW3A 2WNVA 4XILA 4CDWC 4OLLA 1ULCA 2QCSB 1QQP2 4I30A 5DG2A 4OZXA 2P34A 2W68A 4N9HA 4R9AA 1ZZ6A 3FUQA 3ALQA 5D8AB 2A6WA 2ZMNA 3W59A 4GB32 1CGPA 4HPKA 4L11A 1RVF1 1D0HA 4QMAA 5J7MA 2YGLA 3USUA 2B5HA 4GMP0 3ZXFA 1KITA 2RM22 5GLZA 3VBHC 2O8QA 3ILRA 4CRQA 1A8MA 3U10A 1QJU2 1G6NA 1YJLA 4RR3C 4CEYC 2E7AA 1H8TB 1HXS2 3RI9A 1VBD2 3WW2A 2RM21 2XWJB 3ZXKA 1OFNA 4BM8A 3ILFA 3OYWB 4AFAA 3IKWA 3E6CC 4YARA 1MS8A 5EYXA 4XFCA 2HWF3 4Y4YA 3ZSLA 4UBHA 1YLLA 1UKRA 3POWA 5DZEA 3U11A 3JD71 4ES9A 3D4KA 1O3RA 5J36A 2WLQA 3VZOA 4N43A 3ZYGA 2A7AA 3LGRA 4YW3A 3VKFC 3VN4A 1QJY3 4Z92B 3FHIB 4IEPA 4W6YA 1BXHA 1MEC1 5CNAA 4AG4A 5CG8A 2R1DA 2DU1A 1GR3A 1G9CA 2HWD2 4JTOA 4CDWB 3NAPA 1H9PA 1W6PA 1ZZ9A 3UKVA 4E27A 4QQHA 1SBEA 1CAVA 3WG4A 3V65A 1QJZA 1VBB2 2ZGNA 1QJX1 2GN7A 4K1YA 2GH8A 2HWD1 4F3JA 2GN3A 3WINE 4ZU4A 1MZFA 5L7OC 2MEV2 1ALYA 3GHNA 1R081 2A70A 1XU2A 4Y5Z0 3M3QA 1S0DA 1GANA 2V73A 2Z69A 2BVBA 2D98A 3N35A 3VBHB 4BZ4A 5C9AC 3FUOA 2PHXA 2JG9C 3H1MA 3ZYPA 1RVF3 5I0UA 2YZ4A 4RR3B 1IPKA 4CEYB 2HWB2 1COV2 3CO2A 3RMXA 1AF9A 3VBFC 5JOZA 1XNCA 2VOWA 2LUWA 2ZAHA 2QQPA 2HWB1 2ZX1A 4I09A 5BV6A 1VALA 3P3NA 2VQAA 2WZR2 2RM23 4N7IA 3V0AA 1ZRCA 2GZWA 4MSVA 4Q27A 4BYYA 2ZS6B 4NHKA 3MICA 4W65A 3SXWA 4Q0UA 1A8DA 1IQAA 3WUCA 3NKTA 3VBSA 4I3GA 1VBD3 5ACA1 3SH3A 2R062 3OD4A 5IK4A 1JOJA 5BPXA 4XF1A 3J8F1 4AQ6A 3EQEA 1Q8VA 2ARXA 1DBNA 3N7MA 4RS5A 1B09A 4RFT0 2G4IA 1FOD2 4R52A 4AGRA 1B35A 3RYRA 4QXKA 3TN92 3ZXLA 1QXJA 2PYTA 4SBVA 4AI1A 2B7YA 2JICA 5L7OB 1EYBA 3AYAA 1WD4A 3KLSA 2MNGA 5EZWA 2WZPP 4Q26A 2G9GA 1QJX3 3ZFGA 1R1A1 5C9AB 4OI4A 3KMHA 2EXJA 2HWD3 5KC5A 2AENA 2XLFA 4E2SA 2JG9B 4FPFA 5F6LB 1R083 2X8KA 3NWKA 2DVDA 3W58A 2H0VA 1BKZA 3ETQA 4HKOA 3LSEA 2VNGA 2BTVC 1DHKB 3N3HA 3VBFB 1S55A 1VP6A 3KGZA 2WWSA 3T1LA 2MEV3 3ZSKA 3VDDA 1HRI2 3OPZA 2A6ZA 1IS6A 2FQPA 3ZXDA 3BIWE 1YYNA 1SBDA 3AZWA 3RJ2X 3VBOA 1LU1A 2X5IA 3HR9A 1RGSA 4DMIA 2G9FA 2D3PA 3SCGA 1PGW1 2HWB3 4ITCA 2JG8A 3JQXA 5L36A 1LOGA 4HLTA 4QX5A 3RG0A 4ZKTB 1RUH1 1DGRA 2DV9A 1WMFA 3M3EA 3L2YA 2RS32 4MXWA 5ACA3 3VKMA 4FPLA 5BNNA 4YNIA 3J8F3 2XBO1 4IEZA 2CAUA 2RS31 1RUD1 1ZBA2 5IK8A 4GQ7A 1SLIA 5FDBA 5A32B 1MS1A 5JSOA 3U07A 1ZBA1 3MIHA 4AEKA 1OFSA 2CL2A 3NVCA 3QBQA 3JB8A 5JR7B 3HQXA 4ISQA 4O9EA 4Q1RA 3JQWA 4DY5A 3TN93 2E63A 2BYVE 1R1A3 4QD2A 4QM9A 3R4UA 4NN0A 4W6WA 2DCZA 3UL2A 1MZ6A 1SLTA 3LAGA 5D8AA 1Q8SA 1J58A 2AR6A 2RS52 2ZHMA 5GZEA 4AWDA 3NW4A 2I45A 2DUOA 1HQLA 2DUPA 3HD8B 1H8VA 3I7DA 5LRSA 4HKWA 2RS51 2IC1A 5DUXA 1H8TA 1APNA 1HRI3 1AX0A 3OY8B 2ZX4A 1ZZCA 1NXD1 1X82A 4NR1A 2XL7A 3OYWA 4AEMA 1Y9QA 4Q1PA 3KM5A 3J9SA 4COZA 4IEYA 4MGYE 2X53S 4U36A 2QZ2A 3TYJA 3AYEA 5KBFA 1CR7A 2W39A 2Q0AA 4NWWA 1TMF2 1WCSA 3MW4A 2UWCA 1A78A 3VKLA 3MF9A 2RS33 2TUNA 1TMF1 2ZKLA 1WUVA 3ZDSA 4LUKA 1HRV2 4AGVA 4C91A 3LB9A 4CDWA 1VBA2 1ZBA3 4DRRA 2WNVC 5BNOC 1QNYA 3AKSA 3KT4A 1LCLA 1IS3A 1XYPA 3NO8A 4COYA 3JUUA 3ZN6B 5LK7B 2BNOA 3PVEA 4XHXA 3PMSA 4EN7B 4EN0A 2N7GA 4BMEA 4AI8A 1UPIA 2X29A 2XH6A 1ENSA 4FPEA 5JPNB 1F8VA 5BXXA 3RPQA 3VBHA 5KHJA 3VBUC 4FTEA 2MHFA 4RR3A 2OUJA 4CEYA 5KHIA 2EXHA 3PJYA 1C4RA 2DCTA 1H1IA 1AL22 3WR0A 1BZWA 4YM1A 1TQ5A 5H9RA 3TAYA 5SV8A 2AZ5A 4OI1A 5GZCA 3IM0A 2RS53 4Q4Y2 1S0EA 1OLQA 4LBLA 1MS3A 5JDBA 4Y24A 2WA3A 4X8PA 4AQ2A 4RSUA 1GKBA 1G9BA 2UU8A 3NKGA 1PNGA 4DB5A 2JDZA 4DXZA 1PO11 1N1SA 4Y22A 5FAXA 4IL7A 1NYWA 1DQ2A 2VG9A 1UD1A 5EJ3A 5FCCA 1AR91 4WM8C 4D69A 4PBOA 4CDUA 1MR5A 4XDQA 4AVBA 1UN1A 2IFRA 2R49A 2WNVB 5BNOB 4IEQA 1RUOA 1TMF3 1ZRDA 4Q4V1 2C9AA 4P9IA 3CF6E 1CJDA 2DVFA 4QGNA 1CAWB 5L7OA 3G6JB 4ONUA 3RMYA 3VUOA 4BWOA 4HKLA 4HVQA 1DFQA 3P3PA 4KWLA 4YGEA 3USUB 3VBUB 2JG9A 2ZGPA 1REEA 3DKWA 3JBG2 3TBDA 2R16A 4YW1A 1A6CA 1DIWA 1JUIA 1QHDA 1WCKA 3VBFA 1S0FA 3AFKA 1FT9A 5AFEA 2ENRA 4JQRA 2GC3A 1LU2A 3E97A 1MVEA 2Y38A 3VHOA 5J09A 3O14A 1D4VB 3AMPA 2E6VA 4BCUA 5B2GB 4AEDA 1H2MA 5CBLA 3AJZA 3IWZA 2R0FA 3CJIB 5E89A 1CAUB 2B46X 4Q4Y3 4WM8B 3ZSEA 1PO13 4UBGA 1PO22 4JDNA 2VQ0A 1Y3TA 2GALA 5JOWA 5JPMB 1IPJA 3WW1A 3SITA 1SLBA 3ZYJB 5AVAA 1LRHA 2EA7A 3B69A 1URXA 3I2DA 2UY9A 2FHRA 3RYPA 1V6KA 2DCYA 3E5QA 4XQDA 1GFF2 1KD7A 2PLV1 2AH2A 2ZGLA 3SH4A 3O0WA 3QH7A 5GLVA 5A32A 5K0UC 4XJ9A 4LLFA 5I93A 4EJRA 4Q0VA 2Z42A 4BA6A 2HJIA 5LEJA 2JJ6A 1OOPC 1NCQC 1UIKA 1YFYA 2EIGA 4XYXA 4EWDA 3DPRC 4YG3A 2JD4A 3ES1A 1ZVFA 1LHVA 4WM7C 1O3TA 3LKJA 1VR3A 3J26N 4EN8B 1LOEA 3NV1A 3MIGA 4AW7A 2HWE2 4E4DX 2IXJA 3S7EA 4LNVA 1DQ1A 3JBG3 4C0HA 1QH6A 2JEMA 2WQ4A 2CYFA 3D6EA 3DGTA 2HWE1 1R1ZA 1EPZA 1VAMA 1DYPA 1AYM2 4M00A 4I0WB 3OY8A 3RWNA 2BNMA 3KT7A 2ZA9A 1AX1A 2XVKA 1RJ8A 1D2QA 5AFBA 1AZDA 5KHHA 5FLIA 4YM3A 4BHPA 4CEWC 1AYM1 4J6GA 1EAH2 2D6NA 5BNNC 1RMU1 1KFXL 2O1QA 1GLHA 4ZU5A 1WMEA 4HETA 4M3CF 3S6PA 5K0UB 5T54A 4META 1OSGA 1W6OB 3ZPYA 4RGAA 4LBJA 1PO23 1WW4A 3ZXGA 3VZLA 1QWRA 1OOPB 3D5OA 5BNPC 2PLV3 3LA3A 3AKQA 1NCQB 3RDIA 3MF6A 1UU4A 3DPRB 4YW2A 2R1BA 1F5FA 4FP2A 2HEYF 4WVWA 3GBFA 4Q0QA 4WM7B 2NP0A 2DFBA 5JI9A 3RI8A 1RITA 2DUQA 4M3CB 3B93A 1KJLA 4DRVA 3ZN6A 4YVSC 4AHXA 1WLTA 4A2UA 2P17A 4AVAA 4IESA 1PZ9A 1XE8A 4Z2WA 2CGOA 5D8AC 3L9JT 3NV3A 4SLIA 3KCYA 4OVEA 4MH0E 1QY4A 3WT3A 1YXWA 1QOTA 1WBFA 1GSLA 2GC1A 5CFDA 3AMQA 1SFNA 2DWRA 1AXYA 5C33A 4P9LA 2ARBA 4KBBA 2Z2SB 4DFSA 1G86A 1LHUA 1DGRN 1FATA 2HWE3 4HSLA 1GICA 1JH5A 1GZWB 3O7OA 4CEWB 2R042 3DN7A 1DGWA 1IZ3A 1ENQA 4XFFA 1FMD2 4KGQA 2A6VA 2TNFA 5IUQA 4FPKA 5FLJA 2R041 4YZ4A 4FPCA 1AYM3 4PJYA 2E7TA 1FMD1 4OHVA 3WCRA 3KCCA 3D8CA 2A71A 3H1WA 3LSDA 3S7IA 3AXDA 4TSVA 2VULA 5BNPB 4HK8A 2ATFA 4XQ4A 4RQPC 4LO8A 2XJQA 5JOYA 3BB6A 4B4QA 3BU7A 1N1YA 4YGDA 5BNOA 1RJ7A 4LO5B 4O9GA 2FZ1A 4FBFA 2D7FA 4BE3A 1OD5A 2PHTA 2WT1A 1RVF2 4YZ5A 1CAWA 4YVSB 4Z07A 1H1AA 1X36A 2H0BA 2B42B 2YHJA 3CLPA 4G4FA 4R9CA 3O0XA 2XUMA 3V0BB 3ZX7A 4JRAA 3VBUA 4F83A 3UJQA 1NY72 4I0BA 3EJKA 1O3QA 2D6PA 3MLLA 1Q43A 3AFGA 3WDVA 3LOIA 3AM2A 2IXIA 5FBZA 4BLJA 5FQ0B 3KGLA 3SCFA 1DZTA 1NY71 4TLFA 1IKQA 1I9RA 1TNRA 2WNEA 3JD72 1UL9A 5C8WA 2XVLA 4K3UA 4MVTA 2D6KA 2VNRA 4PDWC 1O3SA 2WT2A 1Y43B 2R0HA 3GZAA 3M1HA 5TSWA 3VZMA 1MEC2 3E6BA 3CJIA 4U2AA 2YY1A 1CAUA 4Q8LA 5IK5A 3AP4A 2F4PA 4RQPB 1VIWB 1SMVA 4XETA 3ATGA 1KDKA 4WM8A 2R043 4HVOA 4ES8A 4C90A 2ERFA 4XMIA 5FO8B 2PAEA 5EV7A 3CL1A 1FMD3 3AKRA 3MI8A 3USSA 4EWAA 1QJX2 3KS7A 2VY0A 2VECA 4NO4A 3QCWA 5I91A 5JZGC 1NLSA 4AQTA 1ULGA 4CDUC 4XF4A 4XEZA 1OLRA 4Y1UA 4PIXA 1H9WA 1R082 4LBQB 2QDNA 4GKYA 5GZGA 3MW2A 5FPXA 1S2BA 4FSJA 2GC2A 2WINB 1H1MA 4INDA 1H4GA 4QQPA 4E4SA 3INAA 3RJRA 3ZFFB 4XXPA 1VAKA 1RC6A 2DURA 1YNAA 1RUE1 3D82A 4AI3A 3FC0A 2E51A 4HN0A 2QZ3A 4R8HA 4DS0A 2VUAA 1PHMA 1SQ4A 1YO8A 2NYYA 2WL1A 3FX3A 3MYXA 4KWJA 1YFWA 3WW3A 2R30A 4QT6A 2VVEA 2NPIA 3G7DA 4RD7A 4Y1XA 1MS9A 4HMZA 1ND2C 5CVRA 2ZKNA 4YVWC 4OHXA 1H2LA 5ACA2 4PDWB 3WHTA 4COWA 3R6SA 1C5IA 1V6MA 1DQ0A 4FPYA 4QQOA 3AZYA 3J8F2 2NM1A 3ELNA 2PHDA 4AEDC 1GBGA 4Y22B 3FJSA 5JSRA 1QXRA 1SFYA 5K7PA 3JD73 5KWRA 3E6DA 4B4PA 3EXUA 5JZGB 4CDUB 1GNZA 2GMMA 1PZ8A 1VRH2 3M3CA 1H2KA 3UK9A 1R092 3FLRA 1H30A 1XRUA 1MEC3 4FPOB 1V6OA 1V9U2 5F9TA 3WHUA 4C1WA 1R1A2 1FPN1 1Z78A 2JKBA 5K0UA 1VRH1 2ZGOA 1LULA 1R091 1W6OA 2ILMA 4MGKE 4YYOA 1OKQA 3B7MA 4XZPA 3WLUA 4AFMA 2BBVA 1V9U1 1OOPA 2XJUA 2P3KA 3NJZA 1EV11 1NCQA 4FOVA 4GXLA 1Y7BA 3DPRA 1XU1A 2I74A 1DYKA 2A3XA 5JWPA 4WM7A 3WW4A 4MLOA 5GJ6A 4AHZA 2NQYA 2CNAA 4M3CA 1REDA 4PBPA 3HT1A 2CY6A 1C8M2 5CB7A 3ZSMA 1MS0A 1C57A 1PGW2 3CNAA 1MZ5A 1ND2B 5K9YA 4YVWB 1TE1B 2W08A 4I01A 3IN9A 3S0MA 2NZ9A 1CAXB 4LT5A 1C8M1 2RJKA 1RUH2 4MV2A 2OVUA 4AK3A 2BFUS 2ZHNA 1DQ6A 4MX3A 2VOKA 4CP2A 4AEDB 1V00A 4AFDA 1CQ9A 4YGCA 1AJKA 2IFWA 3NV4A 2XBO2 4H3WA 2AREA 1RUD2 4IEWA 1GZWA 2VXRA 4CEWA 2W0XA 1QXPA 1J59A 3JU9A 5HCFA 1WCDJ 1JTZX 4H7LA 4A3XA 1W0OA 2RHPA 2VMHA 5C6CA 2XJVA 4GULA 4P9XA 4OUMA 4JVAA 5J96B 3B02A 2A3WA 4IEUA 3O5SA 3WXPA 5BNPA 1JW6A 3OBTA 1HW5A 1LOCA 1VJ2A 4X6RB 1VRH3 4OULA 3URFA 4LBOA 2D6OX 3MLJA 1R093 2VPVA 1NE4A 1O91A 2ZGSA 1NQJA 2D40A 1QMJA 4GWNA 1V9U3 5JVVA 2KA3A 3BOPA 1EV13 1LODA 4NVPA 3WG3A 2ZGMA 4LO4B 1AYN1 4YVSA 2VW2A 1NQDA 2GC0A 5GLWA 1NLRA 5HBAA 2OYZA 4OI0A 1ZBE1 3RZZA 2ZX3A 1U12A 3V0BA 4GMP1 4UW4A 4X8NA 2WNUC 5E88A 2ZHLA 5BNQA 1KXGA 3AZVA 4GWMA 3T2TA 4RA0A 3ZN4A 3WDXA 5CFDC 1RUI2 2GAUA 3AZXA 1C8M3 3K48A 2BFUL 2GH2A 2UURA 1PVXA 5ABJC 2HEVF 1E57A 5FQ0A 2ZPXA 1LEMA 5DDJ2 1UW8A 4LO7A 1RUI1 2R32A 3WDUA 2JECA 1FNYA 1RUH3 3VBRA 2ZHKA 4FQZA 4LBKA 4LBMA 1DZRA 4L92A 3AP9A 3N7KA 5DDJ1 3W9AA 3ZYRA 1V6LA 4K20A 4XXAA 3AMHA 1C3HA 2XBO3 1KFUL 1WLWA 4RQPA 3LOBA 4E9KA 1RUD3 2QUOA 4W6XA 1WD3A 4BOWA 4XF0A 2H6BA 4S2HA 1CVNA 1MZEA 3IMNA 1YFXA 1DZQA 4AXOA 1C28A 2HWC1 4LBQA 5FMOS 3WV6A 1BMV2 2XL9A 5I8TA 1H0BA 2VW0A 1MACA 3N36A 4IV3C 2CWMA 2FBEA 3D0JA 1JUHA 3ZFFA 3WP3A 3RRDA 2WNUB 1UU5A 1AYN3 2K0GA 2WSVA 2DYCA 3PLQA 4XFGA 1BMV1 1OI6A 4UXAA 2JX9A 3AMNA 1RUJ1 5IK7A 4FOYA 2Q1ZB 5CFDB 2PQQA 3ACLA 5FFOC 4GMP3 1RUC2 1O4TA 2PA7A 2D3SA 2PHRA 4Q4X1 2JE7A 3MIDA 5ABJB 5I8YA 2Z79A 3M3IA 1ENRA 4I0AA 4JAAA 4YM2A 3PVNA 3FFQA 4PQ9A 3LA2A 4UW3A 3VL9A 2D3RA 4D7TA 1C1LA 3WQ0A 3IIAA 1Z0HA 1RUC1 1PO12 4BIFA 4NHLA 1W6MB 3THTA 4JGYC 4PDWA 1IKPA 3UKTA 3EO6A 3M70A 3CU7A 3WY6A 1RUI3 2XJRA 3AKPA 4N7UA 3GBWA 3FWEA 4JRLA 1AR92 1KJRA 3M7AA 1GQGA 2IXLA 3IDEA 4XPVA 4DNYA 3AJYA 1FV3A 3CJIC 1SLCA 5DDJ3 1FX5A 4Q4V2 1CN1A 4OFGA 1F5JA 1DF0A 4D7YA 2YGMA 4S2DA 5JZGA 3U0ZA 1YHFA 5DXDA 2GNMA 1AL0G 4FOWA 4ZXKA 3FBMA 4WZCA 3NV2A 1O7FA 3L2HA 1Q8QA 1VB4A 4LR4A 4P9GA 2A5ZA 4IV3B 2WS91 1GZCA 4LE4A 2YC0A 5FMOL 1UZYA 2HWC3 4FT8A 1J3PA 1PNFA 1AR71 4PLNA 2K2SA 1ZRRA 3FE5A 3LA7A 3RSJA 4FAGA 1CD3G 4HSJA 3MDPA 3GF6A 2NMNA 3OCPA 3UV9A 3H9AA 4LLOA 2BQPA 1QDOA 1F9KA 5FPZA 1G7YA 2YV8A 1X33A 1WW6A 3PVOA 1RUJ3