3PNAA

Crystal structure of camp bound (91-244)ria subunit of camp-dependent protein kinase
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
129
structure length
129
Chain Sequence
VRKVIPKDYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFPVSFIAGETVIQQGDEGDNFYVIDQGEMDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase type I-alpha regulatory subuni
publication title Cyclic AMP Analog Blocks Kinase Activation by Stabilizing Inactive Conformation: Conformational Selection Highlights a New Concept in Allosteric Inhibitor Design.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 32
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature ec 2.7.1.37: Transferred entry: 2.7.11.1, 2.7.11.8, 2.7.11.9, 2.7.11.10, 2.7.11.11,
pdb deposition date 2010-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3pnaA01
3KGLA 3RYRA 3UKNA 3CJXA 3E6DA 2QVSB 1J3PA 3IDBB 1Q5OA 4MGKE 3RYKA 5I8TA 3KCCA 2C0ZA 3E5QA 3HIFA 3EHKA 3M3IA 3H50A 5K8SA 3ELNA 3I54A 4UBHA 2GC2A 3NKTA 1UPIA 1UIJA 4XF4A 3PVBB 5D1IA 4QGNA 4KWKA 1ZRRA 3U0ZA 5AVPA 4KU7A 5JSOA 4BIFA 3BALA 2XGXA 3LA3A 4XF9A 4A2UA 2HJIA 3BU7A 4Q29A 1YWKA 2OZJA 2CV6A 4XFBA 1YHFA 4MV2A 3DKWA 5JAXA 3I59A 4IESA 1XRUA 1CAXB 1YFWA 4IEXA 3C3VA 1X8MA 1O5LA 3FZ3A 3OTFA 2GC0A 3I7DA 5KHIA 4Q0QA 1YUDA 3BCWA 4BYYA 1GQHA 4XETA 5E1RA 3EBRA 2N7GA 5FLJA 4YARA 2Q0AA 3ZDSA 2OA2A 1X82A 2QJVA 2VQAA 3L2HA 2IXHA 4I09A 4EWAA 1DZTA 5KBFA 3H3ZA 4AVCA 4HBNA 2MHFA 3RYPA 1Y9QA 4IETA 3WW2A 2H6BA 2QDRA 1CAXA 4BHPA 3H3UA 4AQ2A 4WBBA 3RNSA 2BNMA 1EY2A 2B8MA 1PMIA 2HKXA 4HN0A 1I5ZA 1UW8A 3OF1A 4IEWA 3ST7A 3E5XA 4O9EA 1QWRA 1Y3TA 2B5HA 4KU8A 2UY9A 2XLFA 4LUKA 2OPKA 4PIYA 4FAHA 4PJYA 3H7JA 5JCTA 1WLTA 3UKTA 1O3RA 3FHIB 4PIXA 2ZCWA 4O9GA 1ZZ6A 3ROUA 4FAGA 1ZRCA 1OI6A 1OMIA 1RTVA 4IEPA 3RDIA 5FLIA 4IEZA 3ES4A 3H7YA 1LR5A 3MYXA 1IPKA 2H6CA 1J58A 3H8UA 5E16A 1CAWB 5BPXA 3WW3A 3FWEA 5JSRA 1OD5A 1FT9A 5BV6A 1QXRA 5KHGA 2PTMA 1RUOA 4KWLA 2IXCA 4TLFA 4QX5A 1NXMA 1FI2A 3RZZA 1L3JA 5I8YA 1X7NA 4HZFA 5FCCA 2IXJA 4WVZA 3WW1A 1VR3A 5J7MA 4D7SA 2BYVE 4H7LA 2GAUA 5EZWA 3HT1A 4HVQA 2FQPA 3EJKA 3CEWA 4HSJA 2GU9A 2GZWA 3H1WA 3H1YA 3I59B 3PLQA 4EV0A 4MUVA 1CAWA 2WC2A 2O1QA 2CAVA 3USSA 4ORFA 5BXXA 3NSTA 3CLPA 4ZU4A 3NW4A 3SMHA 2XLGA 1CX4A 1I6XA 4NVPA 4D7TA 2BEOA 4JV4A 4AVBA 4N9HA 3OD0A 1O4TA 3KSCA 3S7EA 2PHLA 3B02A 2VPVA 3SXWA 1VJ2A 1O7FA 1J1LA 1Q43A 4FBFA 2UYAA 4OLLA 1GQGA 1PM7A 3WW4A 4F7ZA 1DGWA 5CU1A 4LLOA 1LKNA 3OCPA 4MGYE 5I8SA 3G7DA 3N4MA 4F8AA 5C8WA 4E2GA 2ET7A 4LA3A 4IEUA 4AQ6A 2DCTA 4I01A 4K8FA 3SCGA 5BY5A 2Z2SB 3DV8A 4ZU5A 4N9IA 1NYWA 1ZZ7A 3FFQA 4JVAA 4EROA 2D5HA 5HI0A 3IDCB 1O3TA 3MPBA 4WZCA 2Q4SA 1J3RA 3LOIA 1O3SA 2Z69A 1CAVB 1IPJA 2PQQA 2EVXA 5CADA 5FPXA 1SFNA 3IIAA 5I93A 1XE8A 4LA2A 4META 1CAUB 4E2SA 1O5UA 3FX3A 4IEYA 5KHKA 2ZKLA 4B29A 3JZVA 4IERA 3E6BA 3HQXA 4P9GA 4XFCA 2ATFA 4R8HA 1UCXA 1EP0A 4PIZA 1VP6A 2XKPA 4QGMA 5LRRA 4KWJA 1TQ5A 5I0SA 3BPZA 1RGSA 2PHDA 2GH2A 1ZREA 3OGJA 3KMHA 3R6SA 2MNGA 2Q30A 3D82A 3EO6A 1CAVA 2BNNA 5I0UA 5C6CA 3E6CC 1ZNPA 4XF1A 2ETEA 4HVRA 1CAUA 4UBGA 3ETQA 2XL7A 4L2NA 3BB6A 4MGZE 3U11A 2Y0OA 3NVCA 4YRDA 3ES1A 4DINB 4MZUA 2PYTA 4CYDA 1ZZBA 3GBFA 4UXAA 1LB2A 1XE7A 3TNPB 4XF3A 4XFAA 2OYZA 3D0SA 3RPQA 1FXZA 2UY8A 3GYDA 2XL9A 3FE5A 3LWCA 4LTAA 2MPFA 5FQ0B 5LEJA 4Q0VA 3H9AA 1UD1A 5I91A 1WGPA 1LRHA 1RUNA 3DL3A 5CVRA 3O14A 4MH0E 5I0TA 3ACLA 4XF0A 3FJSA 3NL1A 1CGPA 4R52A 3TNQA 3D0JA 3PNAA 1YFYA 1NZCA 2PA7A 5J48A 3MZHA 2CGPA 2CAUA 1RL3A 1SQ4A 4ZU7A 3IBMA 1EPZA 3NJZA 4GULA 4AVAA 4XFHA 1NE6A 4I3PA 5FLHA 2I45A 4X6RB 5EFUA 2BGCA 1ZZCA 4I02A 5J3UA 1OFNA 2PAEA 5FQ0A 1WA4A 2PAKA 1U12A 4QMAA 1ZX5A 4J1WA 3CL1A 5LEKA 1NE4A 3LA7A 3LA2A 4HLTA 4HMZA 4I0BA 5BUVA 5T3NA 3M70A 2FMYA 1YFXA 2Q1ZB 1ZZ8A 5FPZA 2EA7A 5KHJA 4I2OA 2VECA 4Q0SA 2H0VA 2OZ6A 5KHHA 4IEVA 4Q0UA 5JSPA 3QACA 2QCSB 3IWZA 4MX3A 4Z07A 2ET1A 2F4PA 4FT8A 4LUMA 2B9UA 5F1RA 5LRSA 1ZRFA 3EQEA 4XEZA 3S7IA 2IC1A 2QNKA 2XHKA 4EWEA 2KXLA 4ONUA 4X6QB 4EWDA 2D40A 3S0MA 1O3QA 1YFUA 2O8QA 1J3QA 3E5UA 1J59A 4YYOA 1V70A 1ZRDA 4HSLA 2D93A 4XFGA 2XLAA 4L11A 1RC6A 3UKVA 1H1MA 2IXIA 1Q3EA 1QXJA 3DN7A 1ZVFA 4IEQA 3LZZA 4BH9A 4MGIE 3SCFA 4JTNA 4E2QA 4AXOA 3QOPA 2UYBA 4Z82A 4IEOA 1QY4A 4QGLA 2EAAA 2GC3A 3LAGA 1DZRA 4LULA 2IXKA 1HW5A 3KGZA 3H1MA 4XFFA 2IXLA 1JUHA 3CO2A 4Q0PA 3E97A 2E9QA 5JR7B 1YLLA 2XKOA 1ZZ9A 4KL1A 3VHRA 4JTOA 2D5FA 3U10A 1UIKA 1EYBA 4XFIA 2P17A 5I0RA 2V09A 4J1XA 1G6NA 4QM8A 4RD7A 5FDBA 4HN1A 4HVOA 1SEFA 2PAMA 3SHRA 1X8EA 1H1IA 4YNIA 1DGRA 4LEJA 4QXKA 3CF6E 4YSFA 2GC1A 4OFGA 4QM9A 3MDPA 2WFPA 3SCHA 2BNOA 4I0AA 2K9ZA 3HT2A 2PFWA 2K0GA
chains in the Genus database with same CATH superfamily
4LK6A 3N7LA 1PVC2 3SH4A 5I8TA 5F2SA 5ABJB 2ZTNA 2Q1MA 4FTBA 2C0ZA 2ARCA 2XQRA 3PVNA 1RUI1 2F17A 4PI2A 4CEWB 4BQ5A 2ENRA 1AR83 1JOJA 4H14A 4CCNA 1Z7S1 1C57A 4Y24A 1H8VA 4QPGA 1PZ9A 1UPIA 4XJ8A 4AEMA 1ZA4A 1V9U3 4JGYA 3QCWA 4E9KA 1TE1B 1C8M3 2NM1A 4KU7A 1POV3 3AL6A 4LKSA 4FOWA 5FYIA 2VZQA 2YGMA 4A2UA 3NNGA 4XF9A 5FP7A 5C5UA 5C9AA 3FHQA 2ADEA 4Q29A 2QQUA 1OF4A 4M00A 4NR1A 1TMF3 5DAVA 1V6NA 2CV6A 1XNAA 4M0HA 4LIVA 4UW3A 5GLWA 3RVHA 4XFBA 1LGNA 3JBG2 2O8OA 2D3SA 4KWUA 3OY8B 1RUG1 2ZXQA 5F3CA 1YRZA 3DKWA 1UNBA 2VBBA 2V5DA 5LA2A 3W21A 1XRUA 2FDHA 2A6VA 5FKCA 1YFWA 3A7QA 4ZZ8A 1ODMA 2QZ3A 2YC0A 3LF7A 3D5OA 2JDAA 3V56A 2CTVA 3FZ3A 1SCSA 3AX4A 5EWSA 3LGRA 1W9TA 5EJ1B 1VE0A 3Q8BA 1SACA 4FPLA 5C33A 1JZ8A 1DQ6A 4O61A 2WO3A 4UFJA 1JZ3A 4ZKTB 5DG1A 4RHV1 5LBFA 2N7GA 5FLJA 2J1TA 4YARA 3SH3A 2HWE3 1C1LA 3TRSB 3JQWA 4AEJA 1W6MA 5KBFA 1F35A 5A3PA 3T0AA 4FSJA 4GB33 5E6HA 1MZFA 1AR72 2ARAA 1PGW2 3VZLA 2FDIA 1DGWX 5F2WA 4R4XA 1PO12 1W8FA 2FMDA 3CU7A 1AXKA 2ZHMA 3GZTB 3NV4A 4GMP1 2R041 2ZABA 4BHPA 4PDWB 1AR92 4B7KA 3H42B 4FVVA 4LBQA 2WZEA 4QXCA 4OZOA 2DCYA 1VBB2 2W2IA 1SDDB 1ASJ2 2W5FA 2BNMA 3ACFA 1MEC1 2QTWB 5DAQA 4EN6B 2VOXA 1V6OA 1I5ZA 1JXNA 1YJKA 1UW8A 3KCXA 2Q8EA 3LSDA 2VQUA 3VHNA 1WW7A 5EJZB 3WSOA 4LUKA 2ZGKA 2ZX2A 4FAHA 1HV1A 2ORXA 3HBZA 4PJYA 1GWKA 1COV1 2W46A 2F6BA 4S2FA 2QQNA 3ZFFA 4BQYA 5BYNA 5JCTA 1FMD1 2VUDA 5D8AA 3LE0A 3VBRC 4Q4X1 1FOD2 4CEYA 3RZJA 4FO9A 3FHIB 4FAGA 3KB5A 4QQ2A 3VKOA 3ACGA 4CDXA 1A8MA 5HXMA 3H8RA 2QQVA 4UFMA 4JC1A 2R073 1Q8VA 4BCUA 1E5SA 4RFT0 4IEZA 3ES4A 5LBCA 3J8F3 5HV0A 2XUMA 2JG8C 3MYXA 1IPKA 2NP0A 2AUYA 1RUJ2 3K3NA 1QJU1 1JHNA 5DMYA 5FBJA 5FYTA 2C26A 1HRV2 3MFAA 5I0DA 5A80A 5JSRA 1R081 5GLUA 4E8DA 4JX0A 1OD5A 3VBOB 5BV6A 1OSGA 3RZMA 4IV1A 1QXRA 2VXRA 4JKKA 2DUQA 4XAEA 5FZOB 2IXCA 4AF9A 3MICA 1W3XA 1WMFA 3RZZA 1DDLA 4PQQA 4NE9A 3V0AB 1VBE1 5FYCA 3GALA 4WVZA 4NIGA 3T2PA 5FZ7A 1VR3A 2C5DA 3C7GA 5J7MA 3I3QA 4FCAA 4D8MA 3BI3A 2RDQA 4JHTA 2G9ZA 1WCKA 4ASKA 4DFSA 3DECA 4DB5A 4QAWA 5EZWA 3P3PA 3UT0A 3K75B 1K3IA 5FYBA 2PLV1 4XUNA 4GZ9A 3I59B 3H1YA 1AXZA 3PLQA 4CA9A 1AHSA 4MUVA 4YGBA 2WC2A 5FPBA 3WF4A 2CAVA 4A6SA 4YWAA 1SG3A 2P3JA 1OA4A 2ZHNA 3NW4A 2VO5A 1OOPC 3WG2A 2ZJCA 3U4SA 4HXCA 2C4XA 1RUI2 1UX6A 2BEOA 5L7OA 3U75A 1ULDA 2XVGA 3GF6A 4K7JA 2Z4FA 5L9BA 5C8CB 1CJDA 2VH9A 2JD9A 4N9HA 4O7XA 4QQPA 5AVAA 2XDVA 1H9PA 1WUVA 1DQ5A 1UZZA 2AYHA 2PHLA 2VVDA 3LEKA 4M0NA 4Q4Y3 1LGCA 4YGEA 5JOYA 2DVGA 4JDMA 4NOTA 3IPVB 3INAA 3V0BA 3I2KA 4EZ4A 1VMJA 5M0TA 1YCIA 2UYAA 4OLLA 3MPPG 1GQGA 4AI0A 2YPDA 4H3WA 2DF7A 3WXPA 3U4XA 1XQNA 3WP5A 1VMFA 1CX1A 3I2JA 4BISA 5J36A 5LATA 2XVLA 1W9YA 3O5SA 3G7DA 1RUG2 2ZGUA 4LOTA 4OHWA 4NIAA 3ZYPA 4CU9A 1YEWA 2JIJA 2LS6A 4E2GA 3J4UH 2VMEA 3NWKA 2ZEZA 4LA3A 2W39A 2WAOA 2ZGNA 3JXSA 2JDUA 1YI9A 3N35A 5L9RA 2ZKNA 1K5MA 1R1A1 4AQ6A 2VMDA 4I01A 2A70A 4RGGA 1U5IA 3ZVXA 3AP6A 5F3GA 5FYZA 3BGAA 1CIWA 2QBXA 3Q8CA 5DG2A 2WS91 5C4WB 4IE7A 2J42A 1OLMA 1M4WA 5BY5A 5JMCA 4AE2A 3FC0A 4RHV2 2Z2SB 2BU9A 2FD8A 1K12A 2ZGMA 3SC7X 1WLCA 1W0PA 3DXUA 4LORA 2RJKA 4N43B 4K20A 1CZVA 5A7SA 2I2SA 3A23A 3FFQA 2AEYA 3VKLA 3UGFA 4BQXA 4W6XA 4URTA 1WW5A 4LBJA 3AKQA 2AC1A 4FFIA 5FIXA 4CUAA 3SLIA 3IDCB 2P34A 2WLPA 4WZCA 3LOIA 2RJLA 1UYZA 2WFF1 3N9OA 2WUHA 1U5ZA 1D0GA 1ND2A 1O3SA 3U07A 3VBHA 3LFIA 4RR3B 1NQJA 2R042 3AVSA 3ZN4A 4GKXA 5K0UC 4A42A 1POQA 3NJYA 4Y22B 1IG0A 3NAPC 4LA2A 4META 2W92A 3KQRA 2X5IC 2XMLA 3THPA 5JZGC 1MEC2 5KHKA 2ZKLA 3LB9A 4YVWC 5F6KA 3JZVA 3LFMA 5BNPB 1XNCA 1MACA 4TYSA 1S55A 2QQLA 3ZFEB 3HVDA 5F7UA 1LODA 1CPMA 3F2ZA 5LRRA 4QGMA 3VD7A 3PHMA 3WNOA 1COV2 4KWJA 5G05L 1NKGA 2E31A 1FMD2 1NY71 1Q8SA 1SLLA 1W04A 3BPZA 3MF6A 4GWIA 4Q4X2 5F5QA 5FO8B 1US2A 5C3OA 2GH2A 2CHHA 1GZTA 3HAGA 1Y43B 2YBPA 2UWCA 1OA3A 3DPRA 2J1VA 3MIDA 3D82A 3T4VA 1QJX3 1O4ZA 3RFRA 1GUIA 1GFF2 2WWJA 5FK7A 2VZ3A 1N3OA 5GALA 4AVTA 3OGGA 2YYOA 1DP0A 1EAH3 3NMBA 5DZFA 1CAUA 1CJPA 3ETQA 1SLBA 1S2EA 3ZYFA 1D0HA 1QJU2 2X8KA 1EUTA 1K5JA 3BB6A 3HQRA 1G9BA 1DHKB 4U2AA 1UOBA 1OVPA 5FYYA 2ZAHA 1H1AA 4BQ3A 1QJZA 1P8JA 1QQP1 2BVVA 1Y4WA 3ES1A 4JGZC 2VOVA 4MZUA 4N8MA 1XPWA 4RA0A 3NRUA 4WVMA 1DGRN 2GMPA 3E1F1 3ZYBA 5SV8A 4Q4V3 1IKPA 2IWGB 1C8NA 3POYA 3LIGA 1Z7S3 1VBE2 1XE7A 3TNPB 1HJGA 2HLEA 2OYZA 4YZ1A 3B3QE 3WP3A 3D0SA 3RPQA 4CDQA 5DAXA 1UWWA 1UX7A 2BUKA 5HBAA 1JU4A 2RS11 2A75A 2NYYA 3D6EA 3LWCA 2MPFA 5CFDA 2GMEA 3ZMOA 2PLV2 1S0JA 3I97A 3MIGA 1WGPA 5I91A 1QJY1 4NO4A 1LRHA 1HXS3 4YG0A 2YUEA 2RDRA 1RUNA 4EN9B 5IVJA 3NNLA 4Y3OA 4YFWA 5AFBA 5FP9A 3O14A 1YO8A 4NMIA 2HEYF 3POBA 4GJYA 3B93A 1LTEA 1H9WA 4ZS3A 3NL1A 2Q8CA 2VCAA 3D0JA 4K6BA 2YC4A 1YFYA 2VMFA 1HQLA 5J48A 3MZHA 2CGPA 5FJKA 5EV7A 4NJ4A 4Y1UA 2HWD2 4AGVA 5FYVA 4AVAA 5EJ3A 3WDYA 4X6RB 1Q8PA 1REFA 5EFUA 4I02A 4QPYA 3ZDVA 1O6UA 4YG3A 4N90A 5J3UA 1FNYA 2EAKA 4QKDA 4YG6A 2EXKA 5AC93 3PMEA 4LKFA 5LBEA 4P9YA 1NCQA 3SH5A 4QMAA 5FY0A 1OUXA 3ZSKA 1SCRA 5FMCA 4ZHNA 2WR9A 3O1PA 4J1WA 4IDZA 2ZACA 5CNAA 2X10A 5GKAC 5LEKA 1NE4A 4HMZA 4G4FA 4I0BA 3JQXA 4QHOA 1RMU3 4OUEA 3M70A 3ZXJA 1WBLA 1YFXA 2Q1ZB 4B1MA 1W9SA 3UK9A 3B69A 4BM8A 2A6ZA 2VECA 3J9SA 4JQRA 2VMGA 4BDVB 2OZ6A 1W6NB 1OPMA 3A21A 4Q0UA 1YIPA 3HR9A 5JSPA 1XYPA 4YVSC 5A3OA 4OUSA 1F4HA 5ERLA 3WY6A 2F4PA 4FT8A 4NIDA 3BPSA 2WS92 3URFA 2IVJA 4BB3A 3R05A 5FJHA 4RQPC 1Q56A 4E8CA 1NG0A 1MZ6A 1FMD3 2MEV1 4XC9A 1ZRFA 2IFWA 1R1ZA 1ULEA 3VN4A 1W8TA 3EQEA 4XEZA 2VTFA 2YMZA 4AGRA 4PLOA 3WF2A 4CE8A 4D6RA 4Q2FA 3OGSA 1LJ7A 2XHKA 3OY8A 1YNAA 3T1MA 2VNRA 4EWEA 5A3NA 3WR0A 3MIBA 3VBRB 4SLIA 2ZEWA 3AMMA 4FPOB 3S0MA 2YU2A 4FFFA 2WFF2 2HWF3 4P00B 1J59A 3O1MA 4CDUC 2BPA2 3VKNA 3GNEA 5LASA 4LKDA 1KEXA 4UYBA 4L11A 2GH8A 1KRIA 1OQ1A 4X8PA 2JG8B 4AAXA 3ZN6A 1XNBA 1ZVFA 1BMV1 1R083 3BYWA 5A7PA 4BH9A 1Z78A 5A6YA 4IE0A 1CZSA 3AYEA 1RUD2 4E2QA 3HNYM 4XMIA 3QOPA 1WW4A 2CWMA 3N3HA 3PURA 5FYUA 3SNMA 2WWUA 1YQ6A 2EAAA 1UPSA 1DZRA 2VULA 3JD72 4YM2A 3ZYJB 1PGL1 1NY72 1Y9MA 1W6PA 2IXKA 1LHWA 3TB0A 5FYMA 1PK6A 4WV8A 3T2QA 5CG8A 3PTRB 3I2IA 4CEWA 4PDWA 4Q0PA 3M8LA 4FTSA 4WM7A 1W6QA 1GQPA 2FDKA 3OPTA 4MXWA 4NHMA 1W2NA 3FLTA 3J26N 1OLRA 2DDUA 3FN9A 4XABA 2YBKA 4A7YA 2B39A 1I3HA 2WZR3 1WMXA 3IB3A 4IV3C 3VBUC 2QQPA 4F3JA 4GAZA 3TBDA 2RS52 4QB6A 4RD7A 2D6MA 2PMWB 4YZ5A 3TEYA 4HVOA 1GSLA 1SEFA 2RDNA 4P9WA 3WF3A 2W1WA 4YNIA 4LEJA 4UI9L 1S0DA 3MUY1 5IT6A 4CPBD 1PVC1 1QQP2 2OIIA 1WD3A 2GC1A 2XWJB 3VKMA 3C7EA 5FZ9A 5LA0A 2WNUB 3OYWB 4RGAA 3M3OA 4XBNA 4B4QA 5CKQA 3AKSA 3KGLA 1EV11 3PU8A 3T4HB 3UKNA 1GV9A 3E6DA 1JZ6A 3AXEA 4Z92B 4AQTA 3WVJA 3OSDA 4MGKE 1HB2A 1J84A 4AHWA 1TG7A 4KBBA 3E5QA 3HIFA 5ANQA 4XIKA 1GZWB 1H8TC 1BLZA 2VR4A 3RZHA 4FOYA 1APNA 5K8SA 3MIHA 3ELNA 1QJY2 1IHMA 3KS7A 4UBHA 5CA6A 3ON7A 4B7EA 4R4ZA 3BU0A 5TSWA 5CEHA 3VBSA 1UIJA 4XF4A 5T5OA 3PVBB 1KDKA 4QGNA 3WOGA 1OFSA 3UJQA 3U0ZA 1RUH1 3VHOA 4FXKB 5JSOA 3FHAA 3J7NA 3LA3A 5DABA 4DY5A 4ES9A 1R1A3 2DTWA 1WKYA 5F5CA 1PHMA 1UQXA 5C8CC 1LHVA 1YWKA 3IAQA 5A32A 2R1BA 3OG2A 3W20A 1RB8G 1KITA 1WCUA 2RR13 3MUZ1 2QE3A 5IAVA 1JHJA 4CVUA 4XQWA 4IUGA 2P2KA 5JAXA 2ZHLA 3GDBA 3HN3A 5IUQA 2VCBA 3B9IA 3I59A 4IESA 4M3CF 4MVTA 3S30A 4IEXA 4FFGA 3VL8A 5DUWA 4DO0A 3C3VA 1VBC1 2HWB2 4UOJA 4M01A 3IDEA 3ZPOA 4GALA 4CSWA 2GC0A 3I7DA 2W0XA 1C3HA 4LQRA 1OKOA 2C9AA 3BCWA 1O8PA 4BYYA 2E26A 5CISA 5C3QA 4Q8LA 1SLIA 5A7WB 1PGW1 1HLCA 1QHDA 1UKGA 4Y33A 2Q0AA 5FPUA 1JZ2A 2WT1A 3ZXKA 1UY2A 2DBIA 2ZGLA 3DCQA 1AJKA 1K45A 4HFSA 4EWAA 2VJXA 4QHZA 1DQ2A 5FP4A 2D98A 2BP6A 1VRH2 2ZX4A 5F5AA 1G86A 5FPVA 4C0HA 2IUWA 5C4WC 3WDUA 2MHFA 1PVXA 5K0UB 4ZONA 5T55A 2OVUA 1Y9QA 3NAPB 3FUQA 4IW3A 3TYJA 2X5IB 2QDRA 5FPLA 3AMHA 1CAXA 1XU1A 2G1MA 3ZKYA 4YVWB 2MEV2 3H3UA 4AQ2A 2FCTA 2RV9A 1PX3A 3MFCA 3RNSA 3G6JB 5IATA 5KC5A 4JDNA 2XJTA 4WVWA 1ZA7A 3OUHA 4L97A 1BBT3 1NLQA 2GNDA 2B8MA 2YU1A 1FOD1 4HN0A 4M3CA 2DVFA 1UMZA 5J1XA 3JCIA 1R091 3PUHA 1E5IA 3E5XA 2EALA 1JU3A 4KU8A 2XLFA 3SITA 2OPKA 4PIYA 1W2OA 1WMDA 5LK5A 2ZA9A 3H7JA 4EJRA 4BOWA 4LNVA 4UFKA 3WNMA 2E7QA 5KXDA 3KHCA 1GMMA 1RUE1 3ITQA 3ENRA 4AHZA 4XZPA 2XWBB 3C2UA 4PIXA 3LEGA 3ROUA 4BLIA 5BNPC 2DBNA 4BMBA 4CXYA 1OI6A 2DV9A 3ACIA 4JCKA 5KR7A 1BMV2 2ZEXA 3O7OA 1JYTA 4IEPA 4LR4A 5EYXA 1UKRA 2PHXA 2V72A 3I3EA 1F5FA 1S2KA 1BCXA 3A0KA 3PTYA 3H7YA 2FZ1A 1LR5A 1ND3B 2VCMA 1LHNA 3H8UA 1X9PA 5IAXA 1S0EA 4QX2A 5JIUA 1PGL2 4JGZB 1SFYA 5DXDA 3W5NA 4EE2A 1PIV3 4WM8C 5FY1A 1C5HA 1UY4A 2EIEA 2W94A 4EQVA 4XZUG 4AZZA 1ZBA1 4Q27A 2EXHA 2RS13 4AWDA 5KHGA 4BK5A 2E51A 1QNWA 3OBRA 1UY0A 4QX5A 3POEA 4HZFA 1QDOA 1BYHA 2IXJA 4P08A 5FCCA 2CDPA 1RUF3 1URXA 1X33A 3WW1A 2YY1A 1N3QA 1ODNA 2OXBA 2BYVE 4UW6A 4Q5OA 4XQDA 3VZNA 2DFCA 2LW8A 4ATEA 1GBGA 2GAUA 4QT6A 4LHNA 4YW7A 3USUB 2QDNA 3EJKA 3CEWA 4BXFA 5EHDA 5A3UA 4LO5B 1ZRIA 1S0FA 4UFLA 4QPGC 4XILA 4CCLA 4S2HA 1G7YA 1CAWA 2XBO1 1NCRA 2WNVA 4JGYC 4AOCA 1QGLA 2NLRA 4OHXA 4UF0A 4PBOA 1EV12 4OZXA 1HIXA 4FI9A 3CLPA 2JDHA 2XONA 4ZU4A 1RHI1 5C9AC 2GNTA 1VPHA 1CX4A 1AL21 3EB7A 3EMRA 4R9DA 4XUQA 3POSA 5FZ4A 4NVPA 4CDWA 1HRI3 5FFOC 4GH4A 4GWMA 4CXXA 4JV4A 4PF1A 2YBSA 2BRTA 1LHOA 1VBD3 2ZGPA 5ISLA 2Y8KA 3B02A 1DZQA 3TEXA 3POWA 5JPMB 3CBNA 3AZXA 1ULPA 5JVVA 1VJ2A 1ZBE1 3UV9A 4XE9A 4MG2A 1RUH2 4FBFA 3MV01 3WP6A 1ENXA 2V4VA 3LD8A 1JBCA 4H2AA 1PM7A 4KNCA 4BZ4A 2R49A 1IS6A 2Q1FA 1W6OA 5IK8A 5FYSA 3C7FA 4XJ9A 3WW4A 3ZR6A 1GR3A 1DGWA 5CU1A 4AFMA 1AYN1 5IWFA 4XUTA 1O8SA 1VMHA 4YVSB 3IAPA 4ITCA 3GZUC 3AL5A 3O0VA 5APAA 1T6GC 2CY6A 2WYFA 2OW4A 3L9JT 1E5HA 1AX0A 2WQZC 2JB4A 2D6PA 4JQTA 1F9KA 1VBC2 2BWCA 3ZXEA 4RQPB 1NUKA 2D6OX 4IEUA 2HWC1 5ACA3 3V64A 2DCTA 3N9QA 1MZ5A 1SPPA 4P9LA 4L0PA 4Y5TA 2P3KA 3RS6A 2RM23 2W68A 2ES3A 5JXHA 2Y0IA 2JE8A 5LZ6A 1GP6A 3DV8A 4G3YC 4AL9A 1GP4A 2GDFA 3MW3A 1IOAA 4S2DA 1U5YA 2UU8A 5JMOA 1TME3 1ZZ7A 2JDPA 1O59A 2JDZA 4JVAA 3WG1A 1YQ8A 3KVBA 4CDUB 2YC2A 4KQ7A 3B5LB 5FBZA 4XBQA 2J1EA 1JOBA 3MEPA 5FXZA 2Q4SA 2Y6JA 3ILNA 2PELA 2SLIA 3LQCA 1UZ0A 2YPJA 3MW2A 5D8AC 3UGGA 4QKBA 1CAVB 2WO2A 4XJUA 5EP9A 1IPJA 4CEYC 2PQQA 3RWKX 2EVXA 5LY2A 1NT0A 1SFNA 4W8JA 5FZMA 5FPXA 5A33B 2Q8OA 2ID4A 3IMNA 5FMBA 2VOKA 2VTXA 4A45A 4DXSA 1MVEA 1CESA 3JU9A 4XXPA 1R092 1W8OA 4QX0A 5BNNC 1LCLA 2UWAA 3TN91 3E6BA 3HQXA 3WUDA 1RVF2 4QQHA 3VD3A 2KR2A 3APBA 4FPCA 4XFCA 3UJOA 4YFZA 1UCXA 1EP0A 4PIZA 3VLBB 4H7MA 4XMAA 3KV9A 4B4RA 3K46A 2G4IA 4OI0A 4QHBA 1RUE2 1ULCA 1FYUA 4M4PA 3GGLA 5E89A 1ZREA 3R6SA 1JZ5A 3WD5A 4IV1C 3ORJA 4IV3B 1AR61 3VBUB 4COWA 2Q30A 1N1SA 1PVC3 1WW6A 2D6NA 2B9VA 2J1UA 2OS2A 2BNNA 2XVKA 3EO6A 5I0UA 1SZBA 2P1BA 4RYDA 1BEV1 3E6CC 1ZNPA 3OOXA 2A6YA 2A3WA 1MR5A 3K77A 2PQSA 2CDOA 2O14A 3KT4A 1PO22 2GN3A 3FLPA 1W8ZA 3LEIA 4FP2A 3VDBA 2XL7A 3VUOA 2L9LA 3T2TA 3R4SA 4BK4A 3WDXA 2AEZA 5BNOC 1AYM1 5D21A 5HCBA 1ZBA2 1SLAA 3O1SA 2RMU2 3ECQA 4DEQA 5C70A 1FPN1 1LEMA 1HN1A 2XB6C 5CIRA 2V5YA 2OUJA 4UXAA 3MGUA 3O1VA 1LHUA 2W9XA 1H8TB 3VDDA 3RQ0A 3JBG3 2GSYA 2ILMA 5F3EA 4RN5A 1YIFA 1FNZA 3GYDA 1DQ0A 1GNYA 4N7IA 1OKQA 5L7OC 2XG3A 5FQ0B 4LXLA 3GHMA 2WNUC 4Y1VA 4Q0VA 5LEJA 1RJ8A 2VZOA 4CP9B 3H9AA 5LA1A 5E8AA 1RUC1 2O0OA 4TLGA 3ZKUA 3ZSJA 1G9DA 1ENQA 1UOFA 1GOFA 1US3A 2XBO2 3K2OA 2HWD1 4INDA 4XUOA 3CQOA 1DYKA 2ZHKA 3DL3A 4LITA 4Y1ZA 3FBYA 5FZLA 3WDTA 4BLJA 3PJQA 1X36A 4LJHA 4XF0A 2XQXA 2XHNA 4O65A 1RHI2 5FKBA 3OEAA 4DUXA 1UMHA 1AL22 1BK0A 1QJEA 4BIOA 2DUPA 2HBTA 3QD6A 1AZDA 1RL3A 2Y60A 1OA2A 1G9FA 2WJSA 4BJ0A 1NE6A 1AR73 1WCDJ 4I3PA 5FREA 2I45A 4A41A 5K7PA 3KVAA 1PO13 1ZZCA 1PMJX 4YZ3A 3P3NA 5CYYA 5SV5A 1W8UA 3O1OA 3V65A 1AR93 1CQ9A 1K5MC 1OOPA 1ZBE2 3KV6A 4L99A 3ZO0B 1U12A 4WZFA 4D7YA 1NXD1 1VBB3 2XJVA 4Q4W1 1ASJ3 4PLMA 4B4PA 1KFXL 1N47A 1ZX5A 1H4GA 2FZ2A 3VZMA 2QQIA 3LA7A 3LA2A 4HLTA 2X05A 1W2AX 1KGYA 1HJFA 4YLZA 4BE3A 2BGPA 1AYN2 3THDA 2YROA 1POV0 5KHJA 2FBEA 1W06A 1JUIA 1D4M2 4I2OA 1NAEA 4P5YA 2Y34A 1AXYA 4XQ4A 1J83A 4TXWA 2H0VA 1FOD3 4W6WA 3AZVA 3PUIA 2VUAA 2HWC2 3Q8FA 5FPAA 1TEIA 4MX3A 3GXUA 2ET1A 4Z07A 2TUNA 5G04L 4GWNA 4DRRA 2R061 1QOTA 3I2FA 4V1PA 4LUMA 4Y5SA 2JENA 4ISRA 5LRSA 3KCYA 4OCTA 4N53A 4E4HA 2W87A 5A3WA 1RUJ3 3CJIA 4OMCA 4NHYA 3VDAA 4X6QB 1XBFA 4XCAA 1CZTA 1NOVA 1HRV3 4X8NA 2WNEA 4KMQA 5FZ1A 1DGLA 1IZ3A 4LBLA 4U36A 1RUD1 2Z5WA 3E5UA 3DGTA 5A3MA 5FUPA 5C71A 3ZSMA 1V70A 2A71A 1SMVA 4XDQA 1GNHA 2XJSA 2AREA 4OYUA 4HSLA 4PT6A 2BQPA 3ATGA 1XB9A 4XFGA 3R0RA 1AJOA 3DPRC 3JD71 1H1MA 1W3VA 2VG9A 5FRAA 4MOAA 1QXJA 3DN7A 3A22A 1KS5A 3TWIA 4DMIA 4AEDA 4Y1XA 3I4IA 4MGIE 3SCFA 4YM0A 1B35A 1GLHA 3TN92 5IVCA 1IGOA 4WM8B 1LOGA 2RE9A 1UXZA 2W1QA 3LCPA 4J6GA 5JDBA 2GC3A 2WSUA 4P9IA 3AZZA 2P6CA 1RINA 5HCFA 4QDSA 2JEMA 2A1XA 4R9AA 1UYYA 5IVFA 1HW5A 4K21A 2JE9A 3AJZA 3IT8A 5CZKA 5JZGA 4D6SA 1V6MA 2RS51 2ZGQA 4OHYA 3ZXGA 4CUGA 2FDGA 2R30A 3OBTA 1AR62 2DU0A 5C3SA 3HN1A 1ND3C 1YLLA 5JR7B 3ZIXA 1W05A 5C3PA 2HH9A 1BEV2 3RZGA 2VY0A 4QPIA 4B8EA 4C1XA 3QLQA 2DCJA 5A3TA 1RUI3 1XYOA 2GN7A 2W47A 3WUCA 5I0RA 2WQ4A 4AFDA 3VD9A 4Y4RA 4CDQC 1G6NA 2UURA 3HBKA 3LDBA 2BBAA 1OC1A 2D7FA 5B4XA 2HEWF 3TEWA 4QPGB 1AYM2 1VB2A 2X29A 4QXKA 4XJZA 3MW4A 4LPLA 3ZFGC 1UY1A 4AI2A 1DCSA 3TEZA 1JI6A 4JGYB 2W1SA 1SBEA 4OFGA 3MDPA 1KD7A 2WFPA 3SCHA 1FPN2 3LDKA 1O4YA 5HPOA 3WQ0A 4I0AA 3THCA 3NNJA 4R9BA 1F2NA 2H0BA 2K9ZA 3GJBA 4HPKA 5C9AB 3M2MA 3WG3A 2EXIA 3NV3A 1CONA 2WAAA 3OUIA 3SEEA 2Y6HA 2QVSB 3T09A 2WABA 5DZEA 1J3PA 1RUG3 4PF5A 1N1YA 5C3RA 2VM9A 5C5TA 3KCCA 4RS5A 1VIWB 3ME2A 4CPBA 3KT1A 2HYXA 5FY8A 2RJ2A 4L92A 3H50A 2XXZA 1LULA 2JG9A 4Q8KA 2VZTA 1RUC2 1D2QA 1MS0A 3I54A 3MLLA 1OT5A 3NKTA 1YYNA 2ZEYA 1M06G 4AFBA 3D8CA 4UWDA 2VBDA 4RHV3 1NCQC 5FXXA 1LNSA 2XJRA 3AC0A 1ZRRA 3AP9A 5LB6A 3VBFC 5AVPA 2WZPP 4IGOA 5FO9B 3J7LA 3BALA 5A7QA 1IKQA 3AZYA 3OEBA 1D7PM 3WHTA 2HJIA 1UN1A 3MHZA 4Y20A 2HWB1 4QD2A 4ARXA 1XSRA 2WN3A 4XAAA 1A34A 2R0FA 3USUA 1ST8A 3M1HA 1STMA 5ABJA 2ZAAA 4YPJA 4GMP3 2R043 2VZSA 1L7LA 1OLQA 1A3KA 1NLRA 3KZ4C 3A0NA 1X8MA 4I0WB 4LBQB 3PJYA 1OD3A 4LO6B 4C1WA 5T5PA 4Q4W2 1AR81 2AR6A 2AH2A 1WWYA 3S6PA 1MEC3 2J7MA 4Q0QA 1VRH1 4AR2A 1CWPA 1YUDA 3U78A 4G9SB 3PIJA 4FPJA 4UW5A 1GQHA 2GMMA 4XETA 5E1RA 1V9U1 5FZIA 2CL2A 3WZ1A 1C8M1 3ZDSA 1POV1 2OA2A 2VC9A 3AP7A 1X82A 2QJVA 1COV3 2VQAA 2IXHA 1IQDC 3L2HA 4LO7A 2Y6LA 3DYOA 3OBZA 5D8AB 4IGQA 4Q4X3 3H3ZA 3AK0A 4JDOA 4NIHA 1TMF1 4AVCA 5JWPA 3T3YA 4CEYB 4COZA 3PUQA 2E63A 2TEPA 5FO7B 4Z8BA 5IK4A 3I3MA 5B4NA 4XBLA 4BPZA 5JIAA 3W58A 4CCMA 2YZ4A 4AEKA 4CXWA 3O1TA 3WW2A 1W8HA 4CDXB 1U5XA 3QH6A 2R062 4UFIA 1F8VA 1RYYA 2VOTA 2A7AA 2GNBA 4OMDA 4FQ4A 1BQPA 1S0CA 1YI7A 2G19A 1OH4A 1WD4A 2VMHA 4NHXA 2Q8DA 5BNNB 1SLCA 4WBBA 5FZBA 2B4KA 4A3ZA 1GKBA 4YW6A 3MV11 1W03A 1EY2A 1UXXX 5A3LA 1NX9A 1Y7BA 1QJU3 2VZRA 2HKXA 2R16A 1V6JA 2WKKA 4TSVA 3OF1A 5IVVA 1BZWA 3BOPA 3FMGA 2VL4A 2GALA 4XHBA 2UY9A 2HWE1 3M3QA 4NHLA 1LESA 4OI2A 4XDPA 4IV1B 1PK6C 1WLTA 2WT0A 1T6BX 1O3RA 4FOVA 3BUCA 1VBE3 2Z79A 3PUSA 1ZZ6A 3I3DA 4DIQA 4GB31 2DYCA 1NA1C 4WM7C 4C90A 2ZZQA 3WHUA 2W95A 2QQWA 4AHYA 1DQ4A 5DDJ2 2ZMNA 2XUEA 3WDWA 1NZIA 1W2TA 1DYOA 4LHSA 5BNOB 4QKNA 3BIEA 2PLV3 2ZX1A 1BK1A 4K1YA 3RMXA 4Q1PA 5E16A 3N9PA 5DQ0A 1JYVA 4QDRA 1PX4A 5FY7A 5BPXA 2BZDA 3FWEA 3AMNA 1OF3A 5FZDA 1X9TA 4GWJA 5A7OA 4QX1A 1WLWA 1FT9A 4XUPA 2VNOA 3C7HA 4BQ4A 3W9AA 5IVEA 4KWLA 1RUOA 2VVEA 1JH5A 1H4HA 2BDRA 4TLFA 2FDFA 1L3JA 1X7NA 5L7OB 2DCKA 2HWD3 1B09A 4CZSA 4YGCA 1LU1A 3IN9A 2DWRA 5IVBA 5GZDA 3K4DA 2R071 2YHJA 4UFHA 1YQ5A 3J8F1 3FBMA 2WA4A 2KM2A 2FQPA 2OQ6A 3ILFA 3V0BB 4HSJA 3NV2A 1PM4A 2BTVC 1I5PA 2DCZA 2GZWA 3H1WA 4IE6A 4EV0A 3WEZA 1IQAA 3VBSC 3H8XA 4D0QA 3K4AA 2J1AA 5JI7A 2DUOA 2IFRA 1YQ2A 2JDKA 4QX7A 2ZZJA 4ORFA 1HX6A 4MXVA 2RVAA 4NPRA 3VBOA 1SHWB 5FZOA 4KBZA 3Q9OA 3UETA 5HV4A 3BODA 4RFRB 4Q4W3 2BFUL 5IJRA 4QXHA 3AFKA 4D7TA 4CUCA 2E7TA 3V0AA 1W8WA 1LOAA 1VBA2 1H6YA 1K5MB 1S0GA 1ULGA 4AVBA 1MPXA 4OQ9A 2E53A 3S7EA 2XJUA 5CBLA 2WS93 2VPVA 4GKYA 5JXIA 1O7FA 2EICA 1JOPA 3WINE 1Q43A 4IGPA 3D4KA 3L2YA 3B94A 1MS8A 2WO7A 4QKFA 1H8TA 5JOWA 1UO9A 1LOFC 4LHLA 4NRQA 1LAJA 2PXJA 1FAYA 1V6KA 1LKNA 1WLDA 2P4EA 1UAIA 1DLLA 3VZOA 3NJVA 3HNBM 3WCSA 2WFF3 3N4MA 1R64A 5HCAA 3N7KA 1SDWA 2VBPA 3P5BA 2WINB 3WQ1A 4LHKA 3CDZB 2SBAA 5F6LB 1MZEA 5H9RA 4AI9A 3T08A 4XHXA 3WQ7A 2J1RA 5B2GB 1RJ7A 1K42A 2A3YA 5C8CA 1AR82 3RZLA 4LBKA 4NPMA 3R4DB 1OLME 2Z42A 4K8FA 4V2WA 3SCGA 1OUSA 4URAA 4Q4Y1 1RUD3 4BXSV 2W3JA 3IPVA 4OUMA 2QZ2A 3ZXDA 4QB2A 1V9U2 1XC6A 4LK7A 5CFCC 2JICA 3KD4A 1DG6A 4P9JA 1C8M2 4XPVA 4CRQA 1G9AA 4ZU5A 1GOGA 3X29B 3JD73 3WNLA 4DEVA 1HB3A 1AL0G 1MQTC 3S5AA 3NKGA 4FPKA 1TMF2 4YW3A 4MGTA 1F5JA 2D5HA 1DLCA 3KF5A 3W5MA 3MPBA 3DPRB 5JI9A 1RVF1 4COVA 3O0WA 1OQEA 2Y6FA 3ZM8A 2Y26A 1Q8QA 2DVAA 3I2GA 5CADA 5I93A 5LBBA 3RGBA 1XE8A 1CAUB 3CKHA 4UT5A 3OJBA 3ZYHA 1O5UA 2RS53 1KJRA 3I3BA 3I2HA 3ZSLA 1CPNA 1GZCA 2VZVA 2A3XA 3JB4C 4HOOA 2BFUS 5C4WA 3ZOIA 2C1FA 4IERA 1D4VB 2BWAA 4KGGA 4P9GA 3VL9A 1IS5A 2JDNA 1OQDA 4AW7A 1QQP3 2R6QA 2HWE2 3WNKA 4N43A 4AFAA 3K48A 1TQ5A 4WVMB 4AQSA 1WCSA 1H2MA 2ZMLA 3JUUA 5GLZA 5I0SA 1RGSA 2PHDA 1PO21 4AAPA 1JYCA 3DYPA 1JMUB 3OGJA 4GB32 1XJAA 3POIA 3WP4A 2D6LX 2RHPA 4FTEA 2JWPA 2MNGA 4PLNA 1BHGA 2VZPA 4HT1T 4CDQB 3VD4A 2JDYA 4RR3A 1H6XA 3ZLIA 3I2DA 4XF1A 4DXTA 2RMU1 3FFZA 4MHUA 2ZOEB 4Y22A 5CFDB 3ZFGB 3N7JA 5D2AA 1OBNA 4AI1A 5IFTA 4EZHA 4L2NA 1JYNA 3HOBA 1QJY3 3FUOA 2A6WA 4S2GA 5KXCA 5FZKA 5BNPA 3U11A 2Y0OA 3O1RA 4IE5A 2IZWA 1S0BA 3NVCA 4ZXKA 3ZFEA 4DNYA 3H3LA 4MHRA 4MGQA 2ZGRA 3GBFA 3LSEA 1H0BA 1NCRC 2WNVC 4DZGA 1GICA 3Q8EA 3GM8A 1C28A 2YXSA 3B00A 4QQLA 5KXEA 2DU1A 2YB7A 4HETA 3PL0A 4BQ1A 1HQNA 2ORZA 3BTXA 5DUVA 2VW2A 3AB0A 4WM8A 4XFAA 3SKVA 1L7QA 2C24A 2YGLA 1QJX1 1FXZA 2UY8A 2NZ9A 3RI8A 3UYJA 4CDWC 3ZXFA 2R072 4WVVA 2XL9A 1W9WA 1DFQA 3FE5A 3J8F2 4GH4C 3H8OA 4LTAA 3SISA 2A5ZA 2AGSA 4ATFA 1F15A 1NCQB 2HWB3 1BJQA 4A44A 2TNFA 3MO4A 3VBFB 5JOZA 1JZ7A 5DUXA 1S0IA 5BNQA 4NIIA 1AUYA 2A6XA 4LIUA 2RDSA 4MH0E 5I0TA 3ACLA 3RG0A 4MADA 1XNDA 1HN0A 4NHKA 3QH7A 1BKZA 1LOEA 4Q4V1 1NZCA 1LENA 2CAUA 2W52A 3O12A 4OVEA 3M4FA 3DUIA 4DOUA 1N3PA 1SQ4A 1VRH3 3GCXA 3IBMA 4ISQA 5FZ0A 3A4UA 4GULA 4GQ7A 3THTA 5F3IA 4XFHA 5FZ8A 4V2VA 1VALA 1RXFA 2DTYA 2BGCA 2QUOA 2ZGTA 1UMIA 1OFNA 3MBWA 2CSGA 5T5LA 3S5QA 4A4AA 4YW4A 2C9KA 1CR7A 3IIIA 1WA4A 4YZ4A 2MEV3 2PAKA 3GCWA 3UGHA 2WT2A 2E6VA 3U1XA 4RL7A 3EYPA 1D4M1 2Y38A 4DY3A 3OGRA 2XR4A 3ZXAC 3AYCA 1MS5A 1HXS1 3ASIA 3AYDA 3IZOA 5BUVA 4TTGA 1PZ8A 2LUWA 1QIQA 2ADDA 2FMYA 4HG6B 5FXVA 1W99A 2QQJA 5L9VA 4JKMA 4AFCA 4MLOA 4NRMA 3IM0A 1NQDA 2ARXA 2WO1A 5KHHA 2VNVA 4IEVA 5CB7A 4CP2A 5A1AA 4NUBA 2LRPA 3QACA 2YDEA 5EYYA 3ZPYA 1I9RA 2QCSB 4YM3A 3IWZA 1CN1A 2ZGOA 4XURA 3ZN6B 1GWMA 4A7ZA 4K3UA 4Q4Y2 4Q1RA 3BTAA 5A1FA 5I8YA 3GZEA 3ZFFC 3POFA 3TOJA 3AMPA 5AC91 5F1RA 1AF9A 3SQOA 5K4LA 3GBGA 3S7IA 3KLSA 4RSUA 2IC1A 1QMJA 3LOBA 1HV0A 1REEA 2QNKA 2ZPXA 1N1TA 3NQHA 2BV4A 1W6PB 4P14A 1QKQA 4XIOA 3ZIWA 1QOSA 2R1DA 5CKNA 3ILRA 1RXGA 1PK6B 4ONUA 4CDXC 1OXCA 3DF0A 1E57A 1RMU1 3OPWA 4CU6A 2D40A 5FZCA 5ANNA 1YFUA 1E5RA 1VAVA 4BU2A 4YZ2A 1W2UA 1NA1B 3PU3A 4WM7B 1W6QB 3CNAA 5FZ3A 3BOWA 2XPJA 4MXWB 5KC6A 5FZ6A 5A6ZA 1ZRDA 1W6NA 4PBPA 2D93A 2XLAA 3JB8A 3LPGA 4FFHA 1GYKA 1RC6A 1UOGA 1HB1A 4ZY9A 2VUCA 2JIGA 1MS4A 5T52A 3VKFC 4QWNA 4ZZ5A 1WCQA 4LBNA 3SKJE 3DEMA 2K2SA 2UYBA 1H2LA 1PGSA 1QH6A 4NWWA 5J98B 1LOCA 4DUVA 1JYWA 1H2NA 3GJAA 4QU2A 3LAGA 4I30A 4OHVA 1X50A 1JZ4A 4LE4A 2K46A 1V6LA 2PHFA 5T50A 4IE4A 3I2OA 3I49A 3KGZA 1FATA 2R32A 3O1UA 1A6CA 4P02B 4XFFA 5F8PA 3VBRA 3B7MA 4KI5M 2R0HA 2NMOA 3PMSA 2VMCA 4FPGA 1EV13 2BERA 5BNNA 4QX3A 2E9QA 2XOMA 1TNFA 2HWF1 4MYEA 2CU5A 2E7AA 3AKTA 4RGKA 3WNXA 1PNFA 1ZZ9A 2XKOA 1Q8OA 2BBVA 4KL1A 4CCDA 3VHRA 4Z2WA 3U10A 3RJ2X 1EYBA 3VDDC 2P17A 2JG8A 3LDRA 4J1XA 3LIHA 4LMFA 4QM8A 3ZN5A 1A8DA 2RS31 5FDBA 2JX9A 1C1FA 2PAMA 3SHRA 2I74A 3ZX7A 1X8EA 1H1IA 1DGRA 2A73B 3ZYGA 3UNPA 3VBSB 1UZWA 1W0NA 1RUH3 1Y9GA 4F83A 2BNOA 2WDBA 4SBVA 3RWNA 3U37A 3AZWA 3CZUA 4K1ZA 4DPNA 1C5IA 2JD4A 3VGIA 4DS0A 5JR2A 2PFWA 5A32B 2K0GA 3NJXA 3RYRA 3CJXA 2VNGA 2P6HA 4FOQA 2PHTA 5BNOA 1QJX2 4I3GA 4NWVA 2FCVA 3IDBB 4XTPA 1Q5OA 2D44A 3RYKA 4BWOA 2JKXA 4LOSA 4LBMA 3EHKA 1EAH2 2VAUA 3M3IA 1QH7A 1UYXA 1VBC3 2WZR1 4A6OA 4CU7A 3VV1A 2G9FA 2QFEA 2F4LA 4JRAA 1LGBA 1MVQA 2NMNA 2GC2A 2W1UA 2FDJA 3ALQA 3M7AA 1JW6A 2P37A 5EXOA 5D1IA 5F32A 4KWKA 4FPHA 5LY1A 1FV3A 4QB1A 5DUUA 5FXWA 1DYPA 4BIFA 1QOOA 3AJYA 2XGXA 4Q4V2 1L7RA 2OX0A 2DVBA 2WNUA 3DKQA 4GIQA 4PHZA 3K4ZA 3OYWA 3BU7A 3S57A 1Z7S2 2OZJA 1LU2A 4KG8A 5IVYA 4YW1A 1CD3G 2CYFA 1YHFA 1EPWA 5GJ6A 2D6KA 1G8WA 4MV2A 1FV2A 2EIGA 4CP0A 4ES8A 2B46X 1CAXB 5DPNA 1PZ7A 4COUA 1XXNA 1GZWA 2WSVA 3LEMA 1W39A 4QU1A 5CKMA 4K40A 1H2KA 5CFCB 3C8XA 1O5LA 5GLTA 3OTFA 2ZX0A 1ONAA 3AM2A 1SLTA 1OPOA 1HXS2 4M3CB 4XXAA 5KHIA 3T0BA 1R093 1YC61 3HD8B 4E27A 3P1IA 4OULA 1LECA 5KWRA 2BVBA 1RVF3 1MQTB 1ND2C 3EBRA 3VBHC 4AVVA 3HMYA 4LBQD 4GA9A 4N53C 4CCKA 1LEDA 3CJIC 1O91A 4GJZA 5FAXA 4I09A 2B45X 1DZTA 4EN8B 1XOYA 2YFUA 1W9FA 5L36A 1RUE3 1UZVA 2BGOA 4D3WA 4BMEA 4HBNA 3RYPA 1F4AA 5FMOL 2RR11 4IETA 3FL7A 2H6BA 2WL1A 2BOIA 5IYYA 2E33A 2D97A 5FTTC 5AC92 4COYA 5FWJA 4M3CE 5FV3A 1PO23 4AEDC 2J22A 2VE1A 1PMIA 4XVHA 1B35C 5FZEA 1VLNA 2CWSA 3ST7A 4IEWA 4ET7A 4O9EA 1QWRA 1Y3TA 1RMU2 2B5HA 5A7WA 2WQ8A 1ZBA3 1IG3A 1XU2A 3FLRA 1ZYBA 2RMU3 4D6QA 5LK7B 3MLKA 5DDJ1 1LOBA 5LA9A 3UKTA 1HQWA 2XH6A 5F5IA 3T30A 3UESA 2ZCWA 3HQUA 4O9GA 3ACHA 5K0UA 4EN7B 1ZRCA 3NAPA 2YG0A 2X5IA 1YQCA 1OMIA 2X09A 1RTVA 4GD4A 4QPIC 3RDIA 1QDCA 4FXGB 4QQOA 5FLIA 4YVWA 1Z0HA 1UF2C 2VTXJ 1HKDA 4K9SA 1XNTA 5L73A 3B01A 4LO8A 4L8QA 3N9LA 2H6CA 3B9CA 1J58A 5JUVA 5A70A 1KXGA 1JTZX 1BBT1 5GZGA 2ZGSA 3IMMA 5FMDA 3RRDA 4AVSA 3M3CA 4XCBA 2XBO3 1CAWB 4YW5A 5J37A 1NCRB 2WNVB 3WW3A 1J1TA 4OI1A 4UF0B 1DF0A 3SEPA 2AZ5A 2HWF2 3AP5A 5CFDC 3AFGA 1RHI3 4E4DX 2PTMA 5K9YA 3OUJA 2KA3A 4MO3M 1AL23 4CU8A 3N7MA 1OURA 3W59A 2V4AA 1NXMA 1FI2A 1REDA 2LTNA 3OB8A 4CDWB 3PVEA 3QBQA 5H9PA 1ALYA 1QF3A 2JB8A 2VVFA 2X53S 2NPIA 3HJRA 4GH4B 3RSJA 1QXPA 3P6BA 5IK5A 4XOGA 1R082 4CCOA 1FX5A 2RS32 4D7SA 4RS5C 4ARYA 4ASMB 3T0DA 2CNAA 4H7LA 5FWEA 1TZOA 1EUUA 4CTEA 2RG4A 1ACCA 1ND3A 4TWTA 3HT1A 4XW3A 4HVQA 1GU3A 1ZBE3 5FMOS 2JG9C 4DQAA 5JOXA 1CIYA 2GU9A 4JGZA 2HYKA 2VOWA 4K8RB 4AK3A 1PIV1 3T2OA 3NV1A 4DUWA 4IXLA 5AFEA 1W6OB 1VBA1 2O1QA 3PDQA 4AG4A 1HDKA 3USSA 4MGSA 1DU3D 1AYN3 3H0OA 2WNOA 2B42B 3NSTA 4NAOA 5F39A 5BXXA 4AGGA 5DAWA 3ZFGA 2C6SA 3PIGA 3SMHA 5EPAA 2FCUA 1IS3A 1D4M3 1W8NA 2XLGA 2KD7A 1I6XA 2AACA 3KQ4B 3MLJA 4YW2A 1OH3A 2WZR2 5FR3A 2VZUA 2VQ0A 1RUF1 2HWC3 1W6MB 3OD0A 5ABJC 1O4TA 4XJAA 3KSCA 4CP1A 1SFPA 1SPPB 2JJ6A 2QQMA 1JYIA 4CEWC 3GHNA 2J1SA 3SXWA 1U0AA 2BW8A 1GANA 2OT7A 2VD7A 1J1LA 3WNPA 1G9CA 2LROA 5J09A 4YM1A 3UL2A 2ERFA 5FY5A 1AVBA 1OVSA 2EIBA 4F7ZA 1UU6A 2NN8A 4HK8A 4CUBA 3BTYA 4LLOA 3OCPA 4MGYE 2QQKA 4P9XA 4XYXA 5I8SA 3BIWE 3NO8A 2YV8A 5T5JA 1WA6X 4F8AA 1YJLA 3GBWA 5C8WA 3HPNA 3BTZA 2ET7A 3VBFA 1HRI1 2BOJA 4LKEA 1AX2A 1VAMA 1QJFA 2OPWA 5C7GA 3ZFFB 5FOBB 2CGNA 3AKPA 4HKOA 4JKLA 3WLUA 1ENSA 2Y6KA 1T2XA 1VBD1 1S1AA 2W91A 5FYHA 3WG4A 4R9CA 3TN93 3KT7A 3OBAA 2VU9A 4C0BA 4HL0A 3WQBA 3IKWA 3KF3A 4N9IA 5EIYB 1NYWA 4HKLA 1R1A2 3CMGA 2Y64A 3AMQA 3GZAA 3AVRA 1V00A 4EROA 5LCWL 5DAPA 5HI0A 1ENRA 2VW0A 5IHRA 1O3TA 2RR12 4YVSA 4IQPA 1H30A 1HB4A 1J3RA 1AR63 2I07B 2Z69A 2G9GA 4CCEA 3CIHA 3DXTA 1BEV3 2WZ8A 1XE0A 3J7HA 3MIFA 2VMIA 3IIAA 3AYAA 2JXAA 4RQPA 2WN2A 1GOHA 5ACA1 2D3PA 4E2SA 4PQ9A 4A7KA 5A1LA 1GWLA 3FX3A 4IEYA 4ASLA 1PNGA 4B29A 4P5HA 3K51A 4PDWC 4DXZA 1UY3A 1AYM3 2RM21 5FY9A 2ATFA 4R8HA 1IPSA 4D69A 4FQZA 5J96B 3KWVA 1VP6A 2XKPA 5F37A 1TME1 1FPN3 4OI4A 4PI0A 2PN5A 5HCHA 3N9MA 4JHZA 3RI9A 4CDUA 1W28A 2RS33 2ZX3A 5KXBA 2EXJA 4DRVA 1UL9A 5FUNA 4KH9A 3N36A 3KMHA 5FK8A 1S4CA 3WT3A 2PHUA 4C8DA 3VDDB 1QNYA 4Y26A 1CAVA 5C6CA 2NQYA 3U14A 1N1VA 2EF6A 1SBDA 2ETEA 2HEVF 5A33A 4BQ2A 4HVRA 4LT5A 4NAMA 1JODA 1MS3A 4UBGA 4QXBA 1BBT2 5FUIA 1RUC3 3HNMA 1NLSA 1UOJA 4MGZE 4PCRA 4BA6A 4HONA 1NA1A 1VRBA 4YRDA 2B7YA 3OGVA 4OHZA 5JLVA 5JXJA 2QQOA 2VXJA 4AHXA 4AI8A 4DINB 1D2SA 2PYTA 2WWSA 2OQ7A 4HKWA 1SBFA 5DN2A 4ZS2A 5HXVA 3TAYA 4CYDA 4E4ZA 1ZZBA 3CHXA 1VB4A 3AKRA 2Y33A 3EXUA 1W0OA 1XYNA 3VHPA 3WCRA 1LB2A 2WYSA 3VBOC 4XF3A 2VCCA 5A6XA 2DURA 3VBUA 4IV3A 3VDCA 3IDAA 4QDQA 3POGA 5E88A 2P3IA 3AXDA 3RMYA 5FZGA 4FP3A 4QPWA 5GZCA 3R4UA 1KDMA 2PHRA 4JRLA 2WBKA 4LO4B 1RITA 1OOPB 5JXGA 3ZXLA 1GZ9A 5IFPA 5LWBA 4NN0A 1UD1A 1PIV2 2P5BA 3DYMA 1WMEA 2VQTA 2D43A 2D3RA 5CVRA 3WNNA 5L19A 1DIWA 1MS1A 1S2BA 2UWBA 2RS12 2BJSA 1ULFA 3FJSA 4ZXEA 1CGPA 4R52A 3LPFA 3TNQA 3PNAA 1PMHX 2PA7A 5GLVA 2GP5A 4FPYA 4LLFA 1GNZA 5IK7A 5CG9A 4OQ8A 3OD4A 4ZU7A 1EPZA 1WZXA 1RUF2 3J7MA 3NJZA 1JYXA 3VD5A 4NPLA 1V6IA 2CGOA 3JBG1 5DZGA 5FLHA 5FOJB 2R063 1QU0A 1IS4A 1DBNA 2EIDA 2PAEA 2ARBA 2ZS6B 2WLQA 5FQ0A 4UW4A 4CP9A 5IW0A 4B3NA 2LALA 1ND2B 3VBHB 1TVGA 1OHFA 4IL7A 4N53B 1BVVA 5FZHA 5GM0A 3CJIB 3POJA 4TZDA 3CL1A 3WDVA 3OPZA 2ZBJA 5T3NA 3RZKA 1KJLA 2VW1A 2R7EB 2VGDA 2ZMKA 1ZZ8A 3RJRA 1QEXA 5FPZA 2EA7A 2OUHA 5GZFA 4EYUA 5FP8A 2XJPA 4Q0SA 2WIIB 4NRPA 4YGDA 1HRI2 1RIRA 2V73A 4Y1YA 3BKZA 3AP4A 4LBOA 3WF0A 1AR71 1VBD2 2DFBA 1LOFA 4AEDB 1PO11 3MIEA 3KM5A 3HEIA 2GP3A 1B35B 1BVP1 1MS9A 4GMP0 4M4RA 5DDJ3 1AR91 3O0XA 3VZKA 1KQRA 2B9UA 1V0AA 5A6QA 4FPFA 4W65A 1CVNA 1VBB1 4Y5Z0 4AI3A 1ASJ1 1DQ1A 3ETPA 3Q8AA 3C7OA 2OKXA 5FZFA 4E4SA 4Z1VA 5LW9A 5H9SA 2KXLA 4H55A 3M3EA 4CCCA 3HWJA 5EQUA 4BQWA 4EWDA 5JZGB 5FY4A 4TN7A 3CZJA 4N7UA 4N43C 2AENA 1KFUL 3MF9A 3WX5A 3ZYIB 1JS9A 1JN2P 2O8QA 1O3QA 1J3QA 3ZSEA 3NNFA 1GP5A 2P3YA 5CFCA 3NNMA 4YYOA 1UYPA 3KHBA 5T54A 4CCJA 2LM3A 5GZEA 4HANA 4QPIB 4XTMA 3WV6A 4ZPIA 3UKVA 5ACA2 1AX1A 2IXIA 1MQTA 1UZYA 1Q3EA 4XDOA 4IEQA 3LZZA 4KG0A 4RR3C 4LE3A 1VAKA 1WBFA 3MI8A 3KV4A 4W50A 4JTNA 4JZRA 1XNKA 2XJQA 4Z2AA 1I1EA 2RM22 4AXOA 1A78A 3WF1A 2W08A 2HBUA 4Z82A 1BXHA 5JPNB 5H9QA 4IEOA 2IVIB 3ABZA 1QY4A 3I8TA 4QGLA 1TME2 4XJWA 4LULA 1RUJ1 1UU5A 3ZMNA 4C91A 2DVDA 4Q26A 3PUAA 3ZFEC 4HPKB 3H1MA 2YFZA 1HRV1 2IXLA 4AYUA 4EN0A 1JUHA 3CO2A 3VZJA 2Q5TA 2JE7A 3E97A 2QKDA 3F95A 3ZYRA 2JKBA 4HK9A 4QX8A 5A7NA 4A3XA 3T1LA 4JTOA 2D5FA 4RS5B 4XACA 1UIKA 4KGQA 4MSVA 4D94A 5CAZA 4UAPA 4W4ZA 1W90A 4XFIA 3VB9A 4Y4YA 1TNRA 1VBA3 2V09A 1YXWA 2JG9B 1KS4A 4HN1A 4JAAA 1F31A 1UU4A 2GNMA 4DXRA 2E32A 3KV5A 5FZAA 2VUJA 1ULOA 3BN6A 5F9TA 2PHWA 1ZM1A 2FHRA 3CF6E 4YSFA 4NROA 2JECA 2WA3A 3D3AA 4QM9A 2JDMA 3BVCA 3ZR5A 3N9NA 2TBVA 4FPEA 3K3OA 1EAH1 5FP3A 2VZ1A 3PVOA 4J25A 4GXLA 1XSQA 3HT2A 4L9BA 3LKJA 4W6YA 4Y20B 1C4RA 4B1LA 2WRAA 2Y6GA
chains in the Genus database with same CATH topology
3N7LA 1PVC2 3SH4A 5I8TA 5ABJB 4FTBA 2ZTNA 2Q1MA 2C0ZA 3PVNA 1RUI1 4CEWB 2ENRA 1AR83 1JOJA 4H14A 1Z7S1 1C57A 4Y24A 1H8VA 4QPGA 1PZ9A 1UPIA 4XJ8A 4AEMA 1ZA4A 1V9U3 4JGYA 3QCWA 4E9KA 1TE1B 1C8M3 2NM1A 4KU7A 1POV3 4FOWA 2YGMA 4A2UA 4XF9A 5C9AA 4Q29A 4M00A 4NR1A 1TMF3 1V6NA 2CV6A 4M0HA 4UW3A 5GLWA 4XFBA 1LGNA 3JBG2 2O8OA 2D3SA 3OY8B 1RUG1 1YRZA 3DKWA 1XRUA 2A6VA 1YFWA 2QZ3A 2YC0A 3D5OA 3V56A 2CTVA 3FZ3A 1SCSA 3AX4A 5EWSA 3LGRA 1SACA 4FPLA 5C33A 1DQ6A 4ZKTB 5DG1A 4RHV1 2N7GA 5FLJA 4YARA 3SH3A 2HWE3 1C1LA 3TRSB 3JQWA 4AEJA 1W6MA 5KBFA 4FSJA 4GB33 1MZFA 1AR72 1PGW2 3VZLA 1DGWX 4R4XA 1PO12 2FMDA 3CU7A 1AXKA 2ZHMA 3GZTB 3NV4A 4GMP1 2R041 2ZABA 4BHPA 4PDWB 1AR92 4B7KA 4LBQA 4FVVA 2DCYA 1VBB2 1ASJ2 2BNMA 1MEC1 4EN6B 2VOXA 1V6OA 1I5ZA 1JXNA 1YJKA 1UW8A 3KCXA 3LSDA 3VHNA 1WW7A 4LUKA 2ZGKA 2ZX2A 4FAHA 1HV1A 3HBZA 4PJYA 4S2FA 1COV1 5BYNA 2F6BA 3ZFFA 5JCTA 1FMD1 5D8AA 3VBRC 4Q4X1 1FOD2 4CEYA 4FO9A 3FHIB 4FAGA 3KB5A 4QQ2A 3VKOA 4CDXA 1A8MA 4JC1A 2R073 1Q8VA 4BCUA 4RFT0 4IEZA 3ES4A 3J8F3 2XUMA 2JG8C 3MYXA 1IPKA 2NP0A 2AUYA 1RUJ2 1QJU1 1JHNA 1HRV2 3MFAA 5JSRA 1R081 5GLUA 1OD5A 3VBOB 5BV6A 1OSGA 4IV1A 1QXRA 2VXRA 2DUQA 2IXCA 4AF9A 3MICA 1WMFA 3RZZA 1DDLA 3V0AB 1VBE1 3GALA 4WVZA 1VR3A 2C5DA 5J7MA 4FCAA 1WCKA 4DFSA 4DB5A 5EZWA 3P3PA 2PLV1 3I59B 3H1YA 1AXZA 3PLQA 1AHSA 4MUVA 4YGBA 2WC2A 2CAVA 2P3JA 1OA4A 2ZHNA 3NW4A 1OOPC 3WG2A 2ZJCA 1RUI2 1UX6A 2BEOA 5L7OA 1ULDA 2XVGA 3GF6A 4K7JA 5C8CB 1CJDA 2VH9A 4N9HA 4QQPA 5AVAA 1H9PA 1WUVA 1DQ5A 1UZZA 2AYHA 2PHLA 2VVDA 4M0NA 5JOYA 4Q4Y3 1LGCA 4YGEA 2DVGA 4JDMA 4NOTA 3IPVB 3INAA 3V0BA 1YCIA 2UYAA 4OLLA 3MPPG 1GQGA 4AI0A 4H3WA 2DF7A 3WXPA 3U4XA 1XQNA 3WP5A 5J36A 2XVLA 3O5SA 3G7DA 1RUG2 2ZGUA 4OHWA 3ZYPA 4E2GA 3J4UH 3NWKA 4LA3A 2W39A 2ZGNA 3N35A 1YI9A 2ZKNA 1K5MA 1R1A1 4AQ6A 4I01A 2A70A 4RGGA 1U5IA 3ZVXA 3AP6A 1CIWA 5DG2A 2WS91 5C4WB 1M4WA 5BY5A 5JMCA 4AE2A 3FC0A 4RHV2 2Z2SB 2ZGMA 1WLCA 1W0PA 4N43B 2RJKA 4K20A 3VKLA 2I2SA 3FFQA 4W6XA 4URTA 1WW5A 4LBJA 3AKQA 3SLIA 3IDCB 2P34A 2WLPA 4WZCA 3LOIA 2RJLA 2WFF1 1O3SA 1U5ZA 1D0GA 1ND2A 3U07A 3VBHA 4RR3B 1NQJA 2R042 3ZN4A 4GKXA 5K0UC 4Y22B 3NAPC 4LA2A 4META 3KQRA 2X5IC 3THPA 5JZGC 1MEC2 5KHKA 2ZKLA 3LB9A 4YVWC 5F6KA 3JZVA 5BNPB 1XNCA 1MACA 4TYSA 1S55A 3ZFEB 1LODA 1CPMA 5LRRA 4QGMA 3PHMA 1COV2 4KWJA 1FMD2 1NY71 1Q8SA 1SLLA 4Q4X2 3BPZA 3MF6A 5F5QA 5FO8B 2GH2A 3HAGA 1Y43B 2UWCA 1OA3A 3DPRA 3MIDA 3D82A 1QJX3 1O4ZA 1GFF2 1N3OA 5GALA 4AVTA 3OGGA 2YYOA 1EAH3 5DZFA 1CAUA 1CJPA 3ETQA 1SLBA 1D0HA 1QJU2 2X8KA 3BB6A 1G9BA 1DHKB 4U2AA 2ZAHA 1H1AA 1QJZA 1QQP1 2BVVA 3ES1A 4JGZC 2VOVA 4MZUA 4RA0A 4WVMA 1DGRN 2GMPA 5SV8A 4Q4V3 1IKPA 2IWGB 1C8NA 3POYA 1Z7S3 1VBE2 1XE7A 3TNPB 2OYZA 4YZ1A 3B3QE 3WP3A 3D0SA 3RPQA 4CDQA 2BUKA 5HBAA 2RS11 3D6EA 2A75A 2NYYA 3LWCA 5CFDA 2MPFA 2GMEA 3ZMOA 2PLV2 1S0JA 3MIGA 1WGPA 5I91A 1QJY1 4NO4A 1LRHA 1HXS3 4YG0A 2YUEA 1RUNA 4EN9B 4YFWA 5AFBA 3O14A 1YO8A 2HEYF 3B93A 1LTEA 1H9WA 3NL1A 3D0JA 4K6BA 1YFYA 1HQLA 5J48A 3MZHA 2CGPA 5EV7A 4Y1UA 2HWD2 4AGVA 4AVAA 5EJ3A 3WDYA 4X6RB 1Q8PA 1REFA 5EFUA 4I02A 4QPYA 4YG3A 4N90A 5J3UA 1FNYA 2EAKA 4YG6A 2EXKA 5AC93 3PMEA 3SH5A 4P9YA 1NCQA 4QMAA 3ZSKA 1SCRA 4J1WA 2ZACA 5CNAA 5GKAC 5LEKA 1NE4A 4HMZA 4G4FA 4I0BA 3JQXA 1RMU3 3M70A 3ZXJA 1WBLA 1YFXA 2Q1ZB 3UK9A 3B69A 4BM8A 2A6ZA 2VECA 3J9SA 4JQRA 2VMGA 2OZ6A 1W6NB 1OPMA 4Q0UA 1YIPA 3HR9A 5JSPA 1XYPA 4YVSC 4OUSA 3WY6A 2F4PA 4FT8A 2WS92 3URFA 3R05A 4RQPC 1Q56A 1NG0A 1MZ6A 1FMD3 2MEV1 1ZRFA 2IFWA 1R1ZA 1ULEA 3VN4A 3EQEA 4XEZA 2YMZA 4AGRA 4PLOA 4Q2FA 1LJ7A 2XHKA 3OY8A 1YNAA 3T1MA 2VNRA 4EWEA 3WR0A 3MIBA 3VBRB 4SLIA 3AMMA 4FPOB 3S0MA 2WFF2 2HWF3 1J59A 4CDUC 2BPA2 3VKNA 3GNEA 4L11A 2GH8A 1KRIA 1OQ1A 4X8PA 2JG8B 3ZN6A 1XNBA 1ZVFA 1BMV1 1R083 4BH9A 1Z78A 3AYEA 1RUD2 4E2QA 4XMIA 3QOPA 1WW4A 2CWMA 3N3HA 3SNMA 2EAAA 1UPSA 1DZRA 2VULA 3JD72 4YM2A 3ZYJB 1PGL1 1NY72 2IXKA 1W6PA 1LHWA 3TB0A 1PK6A 4WV8A 5CG8A 4CEWA 4PDWA 4Q0PA 3M8LA 4FTSA 4WM7A 1W6QA 4MXWA 4NHMA 3FLTA 3J26N 1OLRA 4A7YA 2B39A 1I3HA 2WZR3 4IV3C 3VBUC 2QQPA 4F3JA 3TBDA 2RS52 4RD7A 2D6MA 4YZ5A 4HVOA 1GSLA 1SEFA 4P9WA 4YNIA 4LEJA 1S0DA 5IT6A 1PVC1 1QQP2 2OIIA 1WD3A 2GC1A 2XWJB 3VKMA 2WNUB 3OYWB 4RGAA 3M3OA 4XBNA 4B4QA 3AKSA 3KGLA 1EV11 3UKNA 1GV9A 3E6DA 3AXEA 4Z92B 4AQTA 3WVJA 4MGKE 4AHWA 4KBBA 3E5QA 3HIFA 4XIKA 1GZWB 1H8TC 4FOYA 1APNA 5K8SA 3MIHA 3ELNA 1QJY2 1IHMA 3KS7A 4UBHA 5CA6A 4B7EA 4R4ZA 5TSWA 3VBSA 1UIJA 4XF4A 5T5OA 3PVBB 1KDKA 4QGNA 3WOGA 1OFSA 3UJQA 3U0ZA 1RUH1 3VHOA 4FXKB 5JSOA 3LA3A 4DY5A 4ES9A 1R1A3 2DTWA 5C8CC 1PHMA 1LHVA 1YWKA 5A32A 2R1BA 1RB8G 1KITA 2RR13 2QE3A 4XQWA 2P2KA 5JAXA 2ZHLA 5IUQA 3WQ0A 3I59A 3B9IA 4IESA 4MVTA 4M3CF 3S30A 3VL8A 4IEXA 5DUWA 3C3VA 1VBC1 2HWB2 4M01A 3IDEA 4GALA 2GC0A 3I7DA 2W0XA 1C3HA 2C9AA 3BCWA 4BYYA 4Q8LA 1SLIA 1PGW1 1HLCA 1QHDA 1UKGA 2Q0AA 2WT1A 3ZXKA 2ZGLA 4HFSA 1AJKA 4EWAA 1DQ2A 2D98A 1VRH2 2ZX4A 1G86A 4C0HA 5C4WC 3WDUA 2MHFA 1PVXA 5K0UB 5T55A 2OVUA 1Y9QA 3NAPB 3FUQA 3TYJA 2X5IB 2QDRA 3AMHA 1CAXA 1XU1A 4YVWB 2MEV2 3H3UA 4AQ2A 3MFCA 3RNSA 3G6JB 5KC5A 4JDNA 2XJTA 4WVWA 4L97A 1BBT3 2B8MA 2GNDA 4M3CA 1FOD1 4HN0A 2DVFA 1UMZA 3JCIA 1R091 3E5XA 2EALA 4KU8A 2XLFA 3SITA 2OPKA 4PIYA 1WMDA 5LK5A 2ZA9A 3H7JA 4EJRA 4BOWA 4LNVA 2E7QA 5KXDA 1RUE1 3ENRA 4AHZA 4XZPA 2XWBB 3C2UA 4PIXA 4BLIA 3ROUA 5BNPC 4BMBA 1OI6A 2DV9A 4JCKA 1BMV2 3O7OA 4IEPA 4LR4A 5EYXA 1UKRA 2PHXA 3PTYA 1F5FA 1S2KA 1BCXA 3A0KA 3H7YA 2FZ1A 1LR5A 1ND3B 1LHNA 3H8UA 1S0EA 5JIUA 1PGL2 4JGZB 1SFYA 5DXDA 1PIV3 4WM8C 1C5HA 1ZBA1 4Q27A 2EXHA 2RS13 4AWDA 5KHGA 2E51A 1QNWA 3OBRA 4QX5A 4HZFA 1QDOA 1BYHA 2IXJA 5FCCA 1RUF3 1URXA 1X33A 3WW1A 2YY1A 1N3QA 4XQDA 2BYVE 4UW6A 3VZNA 2DFCA 4ATEA 1GBGA 2GAUA 4QT6A 4LHNA 3USUB 2QDNA 3EJKA 3CEWA 4LO5B 1S0FA 4QPGC 4XILA 4S2HA 1G7YA 1CAWA 2XBO1 1NCRA 2WNVA 4JGYC 1QGLA 2NLRA 4OHXA 4PBOA 1EV12 4OZXA 1HIXA 3CLPA 4ZU4A 1RHI1 5C9AC 2GNTA 4R9DA 1CX4A 1AL21 4CDWA 3POSA 4NVPA 1HRI3 5FFOC 4GH4A 4GWMA 4JV4A 1LHOA 1VBD3 2ZGPA 3B02A 1DZQA 5JPMB 3POWA 3AZXA 5JVVA 1VJ2A 1ZBE1 3UV9A 4XE9A 1RUH2 4FBFA 3WP6A 1ENXA 1JBCA 1PM7A 4KNCA 4BZ4A 2R49A 1IS6A 1W6OA 5IK8A 4XJ9A 3WW4A 1GR3A 1DGWA 5CU1A 4AFMA 1AYN1 4YVSB 4ITCA 3GZUC 3O0VA 1T6GC 2CY6A 2OW4A 3L9JT 1AX0A 2WQZC 2D6PA 1F9KA 1VBC2 2BWCA 3ZXEA 4RQPB 2D6OX 4IEUA 5ACA3 2HWC1 3V64A 2DCTA 1MZ5A 4P9LA 2P3KA 3RS6A 2RM23 2W68A 2ES3A 2Y0IA 3DV8A 4G3YC 2GDFA 3MW3A 1IOAA 4S2DA 1U5YA 2UU8A 1TME3 1ZZ7A 2JDZA 4JVAA 3WG1A 4CDUB 4KQ7A 3B5LB 5FBZA 4XBQA 3MEPA 2Q4SA 3ILNA 2PELA 2SLIA 3MW2A 2YPJA 5D8AC 1CAVB 4XJUA 4CEYC 1IPJA 2PQQA 2EVXA 5FPXA 1SFNA 5A33B 2Q8OA 3IMNA 2VOKA 1MVEA 1CESA 3JU9A 4XXPA 1R092 5BNNC 1LCLA 2UWAA 3TN91 3E6BA 3HQXA 3WUDA 1RVF2 4QQHA 3APBA 4FPCA 4XFCA 3UJOA 4YFZA 1UCXA 1EP0A 4PIZA 3VLBB 4H7MA 4XMAA 4B4RA 2G4IA 4OI0A 4QHBA 1RUE2 1ULCA 1FYUA 5E89A 1ZREA 3R6SA 3WD5A 4IV1C 3VBUB 4IV3B 1AR61 4COWA 2Q30A 1N1SA 1PVC3 1WW6A 2D6NA 3EO6A 5GLVA 2BNNA 2XVKA 5I0UA 3E6CC 1BEV1 1ZNPA 2A6YA 2A3WA 1MR5A 3KT4A 1PO22 2GN3A 3FLPA 4FP2A 2XL7A 3VUOA 3T2TA 3R4SA 5BNOC 1AYM1 5HCBA 1ZBA2 1SLAA 2RMU2 3ECQA 1FPN1 1LEMA 2XB6C 5CIRA 2V5YA 2OUJA 4UXAA 3MGUA 1LHUA 1H8TB 3VDDA 3RQ0A 3JBG3 2GSYA 2ILMA 1YIFA 1FNZA 3GYDA 1DQ0A 4N7IA 1OKQA 5L7OC 2XG3A 5FQ0B 5LEJA 3GHMA 2WNUC 4Y1VA 4Q0VA 1RJ8A 3H9AA 5E8AA 1RUC1 2O0OA 3ZSJA 1G9DA 1ENQA 2XBO2 2HWD1 4INDA 1DYKA 2ZHKA 3DL3A 4Y1ZA 3FBYA 3WDTA 4BLJA 3PJQA 1X36A 4XF0A 1RHI2 1AL22 4BIOA 2DUPA 3QD6A 1AZDA 1RL3A 1OA2A 1G9FA 2WJSA 1NE6A 1AR73 1WCDJ 4I3PA 5FREA 2I45A 5K7PA 1PO13 1ZZCA 5SV5A 4YZ3A 3P3NA 3V65A 1AR93 1CQ9A 1K5MC 1OOPA 1ZBE2 4L99A 3ZO0B 1U12A 4WZFA 4D7YA 1NXD1 1VBB3 2XJVA 4Q4W1 1ASJ3 4PLMA 4B4PA 1KFXL 1N47A 1ZX5A 1H4GA 2FZ2A 3VZMA 3LA2A 3LA7A 4HLTA 4YLZA 4BE3A 1AYN2 2YROA 1POV0 5KHJA 2FBEA 1JUIA 1D4M2 4I2OA 4XQ4A 1AXYA 2H0VA 1FOD3 4W6WA 3AZVA 2VUAA 2HWC2 1TEIA 4MX3A 4Z07A 2ET1A 2TUNA 4GWNA 4DRRA 2R061 1QOTA 4V1PA 4LUMA 2JENA 4ISRA 5LRSA 3KCYA 4N53A 1RUJ3 3CJIA 4X6QB 1NOVA 1HRV3 4X8NA 2WNEA 1DGLA 1IZ3A 4LBLA 4U36A 1RUD1 2Z5WA 3E5UA 3DGTA 5A3MA 3ZSMA 1V70A 2A71A 1SMVA 4XDQA 1GNHA 2XJSA 2AREA 4HSLA 2BQPA 3ATGA 4XFGA 3R0RA 1AJOA 3DPRC 3JD71 1H1MA 2VG9A 5FRAA 1QXJA 3DN7A 1KS5A 3TWIA 4DMIA 4AEDA 4Y1XA 3I4IA 4MGIE 3SCFA 4YM0A 1B35A 1GLHA 3TN92 1IGOA 4WM8B 1LOGA 2RE9A 3LCPA 4J6GA 5JDBA 2WSUA 2GC3A 4P9IA 3AZZA 1RINA 5HCFA 2JEMA 4R9AA 1HW5A 4K21A 2JE9A 3AJZA 3IT8A 5JZGA 1V6MA 2RS51 2ZGQA 4OHYA 3ZXGA 2R30A 3OBTA 1AR62 2DU0A 3HN1A 1ND3C 1YLLA 5JR7B 3ZIXA 1BEV2 2VY0A 4QPIA 4B8EA 4C1XA 3QLQA 2DCJA 1RUI3 1XYOA 2GN7A 3WUCA 5I0RA 2WQ4A 4AFDA 4CDQC 1G6NA 2UURA 2D7FA 2HEWF 4QPGB 1AYM2 1VB2A 2X29A 4QXKA 4XJZA 3MW4A 3ZFGC 4AI2A 4JGYB 1SBEA 4OFGA 3MDPA 1KD7A 2WFPA 3SCHA 1FPN2 1O4YA 4I0AA 4R9BA 1F2NA 2H0BA 2K9ZA 4HPKA 5C9AB 3M2MA 3WG3A 2EXIA 3NV3A 1CONA 2QVSB 5DZEA 1J3PA 1RUG3 4PF5A 1N1YA 3KCCA 4RS5A 1VIWB 3ME2A 3KT1A 4L92A 3H50A 1LULA 2JG9A 4Q8KA 1RUC2 1D2QA 1MS0A 3I54A 3MLLA 3NKTA 1YYNA 1M06G 4AFBA 3D8CA 4RHV3 1NCQC 2XJRA 1ZRRA 3AP9A 3VBFC 5AVPA 2WZPP 5FO9B 3BALA 1IKQA 3AZYA 3WHTA 2HJIA 1UN1A 4Y20A 2HWB1 4QD2A 2R0FA 3USUA 3M1HA 5ABJA 2ZAAA 4GMP3 2R043 1OLQA 1A3KA 1NLRA 3KZ4C 3A0NA 1X8MA 4I0WB 4LBQB 3PJYA 4LO6B 4C1WA 5T5PA 4Q4W2 1AR81 2AR6A 2AH2A 3S6PA 1MEC3 4Q0QA 1VRH1 1YUDA 4G9SB 4FPJA 4UW5A 1GQHA 2GMMA 4XETA 5E1RA 1V9U1 2CL2A 3WZ1A 1C8M1 3ZDSA 1POV1 2OA2A 3AP7A 1X82A 2QJVA 1COV3 2VQAA 2IXHA 3L2HA 4LO7A 5D8AB 4Q4X3 3H3ZA 3AK0A 4JDOA 1TMF1 4AVCA 5JWPA 4CEYB 4COZA 2E63A 2TEPA 5FO7B 4Z8BA 5IK4A 4XBLA 4BPZA 5JIAA 3W58A 2YZ4A 4AEKA 3WW2A 1F8VA 4CDXB 1U5XA 3QH6A 2R062 2A7AA 2GNBA 4FQ4A 1BQPA 1S0CA 1YI7A 1WD4A 2VMHA 5BNNB 1SLCA 4WBBA 1GKBA 1EY2A 5A3LA 1Y7BA 2WKKA 1QJU3 4TSVA 2HKXA 2R16A 1V6JA 3OF1A 1BZWA 3BOPA 3FMGA 2GALA 4XHBA 2UY9A 2HWE1 3M3QA 4NHLA 1LESA 4OI2A 4IV1B 1PK6C 1WLTA 2WT0A 1O3RA 4FOVA 1VBE3 2Z79A 1ZZ6A 4GB31 2DYCA 1NA1C 4WM7C 4C90A 2ZZQA 3WHUA 4AHYA 1DQ4A 5DDJ2 2ZMNA 3WDWA 5BNOB 2PLV3 2ZX1A 1BK1A 4K1YA 3RMXA 4Q1PA 5E16A 5BPXA 3FWEA 3AMNA 1WLWA 1FT9A 2VNOA 3W9AA 1RUOA 4KWLA 2VVEA 1JH5A 1H4HA 4TLFA 1L3JA 1X7NA 5L7OB 2DCKA 2HWD3 1B09A 4CZSA 4YGCA 1LU1A 3IN9A 2DWRA 5GZDA 2R071 2YHJA 3J8F1 3FBMA 2WA4A 2KM2A 2FQPA 3ILFA 3V0BB 4HSJA 3NV2A 2BTVC 2