3PNAA

Crystal structure of camp bound (91-244)ria subunit of camp-dependent protein kinase
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
129
structure length
129
Chain Sequence
VRKVIPKDYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFPVSFIAGETVIQQGDEGDNFYVIDQGEMDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords cAMP-dependent protein kinase type I-alpha regulatory subuni
publication title Cyclic AMP Analog Blocks Kinase Activation by Stabilizing Inactive Conformation: Conformational Selection Highlights a New Concept in Allosteric Inhibitor Design.
pubmed doi rcsb
source organism Bos taurus
total genus 32
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature ec 2.7.1.37: Transferred entry: 2.7.11.1, 2.7.11.8, 2.7.11.9, 2.7.11.10, 2.7.11.11,
pdb deposition date 2010-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3pnaA01
5JSPA 1WGPA 3LA3A 3EBRA 3FWEA 3CLPA 4F8AA 3B02A 2EAAA 4FAHA 4Q0UA 1PMIA 1I5ZA 2XLGA 3QACA 3R6SA 2D93A 2EVXA 2HKXA 4MGYE 3FZ3A 2BYVE 1EY2A 4D7SA 1ZZ6A 2XKOA 3ES1A 5J48A 1CAUA 2PAEA 5AVPA 2ET7A 3EQEA 1LKNA 2UYAA 3SCGA 1Y9QA 2CAUA 4BHPA 1L3JA 3I7DA 4YNIA 1ZZ9A 4LA3A 1VP6A 5FQ0B 4O9EA 3NVCA 2D40A 4ZU5A 1ZX5A 5BXXA 1FT9A 3EO6A 4XFBA 5I0TA 4OLLA 2E9QA 5I8YA 3FX3A 3FE5A 3UKTA 1UIKA 5I8SA 2WC2A 2GC2A 4XF3A 4YYOA 5FPZA 5BY5A 1YFXA 3CF6E 1WLTA 5JSOA 3IDBB 1NZCA 1CAWA 2MPFA 1ZZ8A 5CVRA 3N4MA 4LA2A 1RUOA 3H1WA 3IWZA 3OTFA 3M70A 4Q0QA 3SHRA 4IEPA 4NVPA 4FBFA 5KHHA 4UBHA 4GULA 4I3PA 3MZHA 3H9AA 4Q0SA 2O1QA 1Q3EA 3DN7A 1NE6A 5LEKA 3I59B 3H3ZA 4IEOA 2Z69A 5CADA 2CV6A 4LULA 4KWLA 2UY9A 2QNKA 4J1XA 4EWAA 1OD5A 2P17A 3WW2A 4XFIA 5I91A 2KXLA 2BNNA 4MZUA 1EYBA 4LEJA 4N9IA 4HN0A 2H6BA 2QCSB 4AQ2A 3KCCA 2IXLA 4Q29A 4XFAA 2Q4SA 4HBNA 4LLOA 1O7FA 4QGMA 3RDIA 4R52A 4XF4A 2PAMA 4R8HA 5KHIA 4MGKE 1O4TA 3HQXA 2PYTA 3USSA 1NXMA 3S7EA 1RC6A 1YFWA 3BPZA 2PQQA 5FLIA 4MGZE 1UIJA 5I93A 4QX5A 3EHKA 3E5XA 3E6BA 4IEXA 4B29A 3NW4A 1YLLA 2PA7A 4Q0PA 5FPXA 4DINB 4QMAA 3LAGA 3KSCA 4JV4A 1SEFA 2QVSB 1ZRCA 3BCWA 4HMZA 1RGSA 3IBMA 4XFHA 3IDCB 2ET1A 4WVZA 5HI0A 1J59A 3ETQA 2FQPA 1Q43A 3RZZA 4HN1A 3KMHA 1QWRA 4PIYA 3LA7A 4Z82A 1DZRA 3FHIB 1J58A 4Q0VA 2EA7A 3E6CC 2PHLA 1HW5A 4X6QB 4CYDA 2CGPA 3EJKA 2GC0A 1DZTA 1YUDA 3E97A 4E2QA 3S0MA 5LEJA 5LRSA 3BB6A 1XE8A 2GU9A 1SFNA 1X82A 1ZVFA 4ZU4A 1EPZA 4TLFA 5I0UA 4YARA 1YWKA 1XE7A 1OI6A 4XFCA 3FFQA 2F4PA 4L11A 1CAUB 4YSFA 1JUHA 3RYRA 1CAVA 4HVQA 3MDPA 3ST7A 2IXKA 4MGIE 3E6DA 1ZREA 4KU7A 5K8SA 1CX4A 4I0AA 3PVBB 3U0ZA 1U12A 2OPKA 1LR5A 1UPIA 4MUVA 2WFPA 4HVRA 2XL9A 2MHFA 4J1WA 3SMHA 4XFGA 3WW3A 4HSLA 2PTMA 1G6NA 2ZKLA 1X8EA 4IEVA 1TQ5A 4HLTA 3GYDA 3QOPA 1NE4A 2XHKA 4X6RB 3NKTA 4XEZA 3VHRA 3LZZA 5BV6A 2CAVA 2I45A 1IPKA 1ZZ7A 3H50A 5JSRA 3H1MA 4IESA 1J3PA 3HT1A 3C3VA 1CAWB 4IEUA 1ZRRA 2N7GA 2O8QA 4LUKA 4ORFA 4AXOA 4XF0A 3SCFA 2ATFA 2GH2A 3H7YA 4META 1OMIA 1Y3TA 2OZ6A 3KGZA 2B8MA 1V70A 2UYBA 2Y0OA 1UW8A 4BH9A 4AQ6A 4BIFA 1FI2A 2XGXA 1LB2A 1UD1A 5CU1A 2PAKA 2UY8A 4KWKA 3G7DA 1UCXA 4JTNA 2H6CA 1EP0A 3H1YA 1O5LA 4QGLA 1O3RA 1XRUA 3HT2A 3ACLA 3RNSA 3UKNA 3ELNA 2OA2A 4RD7A 1IPJA 2VPVA 2DCTA 1YHFA 4I0BA 4IEZA 4O9GA 4UBGA 3DKWA 5LRRA 3LOIA 4K8FA 2BGCA 4JVAA 2GZWA 3H8UA 3I54A 4XETA 3CO2A 4LUMA 1J3QA 1YFUA 1RTVA 3LA2A 1LRHA 2B5HA 1O5UA 3UKVA 1CAXA 3ES4A 2OZJA 1RUNA 1DGWA 2H0VA 4QM9A 2XL7A 2V09A 5BPXA 4QGNA 2GAUA 5I8TA 5JAXA 2PFWA 3WW1A 4I02A 1I6XA 4KU8A 5I0RA 3ZDSA 3NL1A 5EFUA 1H1IA 1ZNPA 2IXHA 4Z07A 5EZWA 1RL3A 2K9ZA 5J3UA 1CAXB 4PIXA 4FT8A 3PNAA 4KL1A 4LTAA 5D1IA 1ZZBA 5FDBA 4MX3A 5JCTA 3GBFA 5FLHA 3E5UA 2IXJA 4UXAA 3OGJA 1GQGA 5JR7B 2ETEA 4EROA 4JTOA 2OYZA 3LWCA 4MH0E 4WZCA 3TNQA 3D0SA 3L2HA 1DGRA 4L2NA 2PHDA 4IETA 5FQ0A 1FXZA 2BEOA 1SQ4A 3D82A 3U10A 5KHKA 2D5HA 1QY4A 5I0SA 2MNGA 4N9HA 1X8MA 2IXIA 2IXCA 4PJYA 2FMYA 4MV2A 4WBBA 3U11A 2Q30A 3RPQA 3NSTA 4BYYA 3RYPA 5T3NA 3BU7A 3D0JA 2QDRA 3TNPB 3H7JA 1QXRA 2VQAA 2ZCWA 4I09A 4F7ZA 3SCHA 5F1RA 5KHJA 1CAVB 1OFNA 4HVOA 3ROUA 4YRDA 4AVBA 1J3RA 5J7MA 3HIFA 2D5FA 1ZRFA 3OCPA 4EWEA 5FCCA 3I59A 1CGPA 1PM7A 3RYKA 1H1MA 2GC1A 3NJZA 4HZFA 1O3TA 2K0GA 3DV8A 1Q5OA 2VECA 4D7TA 1NYWA 5BUVA 5C6CA 1YFYA 2Q0AA 4H7LA 4OFGA 4XF1A 3BALA 5E1RA 3KGLA 4KWJA 2Q1ZB 4QM8A 2QJVA 3OD0A 4AVAA 1ZRDA 1VJ2A 2GC3A 3FJSA 4IERA 2HJIA 1O3QA 4IEWA 4FAGA 4HSJA 3E5QA 1O3SA 4EWDA 2IC1A 2BNOA 4I01A 2Z2SB 3MYXA 5E16A 1WA4A 4E2SA 3CEWA 4I2OA 1J1LA 3WW4A 3PLQA 4E2GA 3IIAA 2XLAA 3OF1A 3JZVA 4IEYA 4PIZA 5FLJA 3MPBA 2B9UA 4AVCA 2C0ZA 5KBFA 1QXJA 4IEQA 4XF9A 3S7IA 5KHGA 4P9GA 2XLFA 3CJXA 3DL3A 2BNMA 4XFFA 2XKPA 4QXKA 3CL1A 4ONUA 4A2UA 3M3IA 4EV0A 1GQHA 1VR3A 4ZU7A 3O14A 3H3UA 1X7NA 3SXWA 1ZZCA 5C8WA
chains in the Genus database with same CATH superfamily
1WGPA 4B1LA 1E5RA 1DFQA 3FWEA 4LBNA 3WQ1A 3GDBA 3K48A 3AVRA 4XQ4A 3UETA 1YQ8A 4FPGA 5C9AC 5FY5A 4BDVB 4C1WA 3ZXGA 4PCRA 4XMIA 3MI8A 4HPKB 1GP5A 1HRI2 4ATFA 1PMIA 3WQBA 1GZWA 2WS92 3NNGA 3T2TA 3BTYA 1YQ2A 3R6SA 2ZX4A 2ZBJA 5DDJ1 3VZLA 3P6BA 1UZ0A 4AI1A 2BPA2 2WNVB 2HWF1 5JXGA 4Q4X3 1W9TA 3OBRA 3VKNA 3RZLA 1EY2A 1G86A 4ZS2A 1LOEA 3ES1A 4YM0A 1WUVA 1NKGA 3MW3A 1Y4WA 4P02B 4WVWA 2E33A 3H8OA 2LRPA 1YJKA 1PVXA 1A6CA 1UWWA 2AEYA 1S0DA 2D3RA 3H3LA 5FYMA 3UL2A 5K9YA 5C9AA 4OZXA 2XB6C 4QDSA 4B8EA 3H8RA 4UI9L 1PVC3 3PHMA 2VVDA 1V9U2 1PNFA 5DXDA 2OQ6A 4QX8A 4D7YA 4H14A 2C4XA 2K46A 3LF7A 1DYPA 1C8M2 2Y33A 4AFDA 4BHPA 3P3NA 3J8F3 1L3JA 2UWAA 4FTSA 1ZZ9A 5ANNA 3POWA 4CRQA 2W92A 4Y20A 2DUOA 3ETPA 4XJAA 4XXAA 3PIJA 1OH3A 2XH6A 1NQJA 3GZEA 4ZU5A 5FYSA 4BQ3A 2ZABA 4COVA 1FT9A 5F39A 1OKQA 2ID4A 3MV01 2VMCA 5I0TA 1Y43B 4N53B 4HETA 3LB9A 2R072 3FLTA 4L97A 4YYOA 1K3IA 5EP9A 1SBEA 1WCQA 3VL9A 3PVEA 1YFXA 5F8PA 3RMXA 3CF6E 5KXCA 3WF3A 3O1PA 5J98B 4M01A 4EN6B 5LWBA 3DPRB 1KJRA 2VG9A 1Y9MA 5CVRA 2DTYA 4YG0A 2J1SA 2DBNA 5JMCA 1VAMA 1OPOA 4XMAA 3M70A 3WF4A 3I2HA 3OUHA 4EQVA 3NNLA 1QQP1 2F6BA 5F3IA 1RUC2 1SBFA 3A4UA 4Y22A 1URXA 3MZHA 2WQ8A 4FFHA 1UU6A 5FBJA 2YU1A 4YFWA 2Q8EA 2CGNA 4SLIA 3N7JA 1RHI1 1SCRA 3I59B 4IEOA 1CONA 4M3CF 4Q1PA 4B7KA 5FP7A 5KXEA 1FPN1 1BQPA 3OGSA 1QF3A 2CV6A 1VBD1 2UY9A 3FUQA 3OG2A 4GH4B 4EWAA 2CU5A 5E8AA 4RR3C 5JUVA 1KFUL 2XVLA 4NIAA 2VCMA 1LOGA 2CY6A 5GKAC 2VCCA 2WT0A 4Q8LA 1ULGA 2UURA 3UJQA 4BB3A 2KXLA 2BNNA 1UOBA 4MGQA 3SEEA 5ACA3 1GZCA 4OUSA 5DN2A 4JGYC 4N9IA 4HN0A 3MFAA 2QCSB 4AQ2A 5FO8B 2FDKA 4BPZA 3KCCA 2CHHA 2DVBA 3WNKA 2D98A 5F2WA 4YW1A 4XAAA 4HBNA 4NPMA 1O7FA 4FTEA 2PLV1 1CPNA 3ZSJA 2JE9A 4FPEA 1K5MA 1JW6A 2PYTA 5FZFA 3S7EA 2VW2A 3R4SA 4RR3A 5F7UA 4YZ2A 1Q8QA 3U1XA 5A1LA 4DXTA 1NG0A 2WNUB 1H8VA 3KVAA 3EHKA 3E6BA 4JDMA 1IQAA 1YLLA 3CJIB 1OLRA 2PA7A 4K1YA 1MQTA 3OUJA 3VBRB 1V6OA 1FMD1 3RMYA 4XAEA 4Q0PA 3JD73 4W6WA 5FPXA 2E26A 4KGGA 4BQ2A 1D0HA 1QJU3 3KSCA 4NHMA 3PL0A 5FYHA 1SEFA 1E57A 1TME1 3BCWA 1H2KA 5A3MA 2CWSA 1AYN1 3KF3A 2DFCA 4XFHA 4EN8B 4IV1C 2WZ8A 2BTVC 2VBDA 3WNLA 4AI2A 1GFF2 1YIFA 3ETQA 3LKJA 5F5CA 5FMCA 4E4HA 4LO4B 4G3YC 3DUIA 4QPIC 5LY2A 1Q43A 1BZWA 3HN3A 3MW4A 1JZ8A 2BBVA 3ZKUA 5EJ3A 3K2OA 4DXRA 2Y6GA 3ZXAC 3DXUA 3POEA 3KCXA 4AVTA 3FHIB 1W04A 2WN2A 5ABJB 1TMF1 5FPAA 1CQ9A 3LDRA 2NMNA 3WQ7A 1SLBA 3VZJA 1T6BX 3GCWA 3IN9A 1SACA 3RG0A 2AH2A 2PHLA 3OB8A 3C7HA 5H9QA 3USUB 1HV1A 3FHAA 1BBT1 2WBKA 1F31A 2ZGNA 1BEV1 3I4IA 4FVVA 5C3QA 5FZLA 2CGPA 1QDOA 4UFIA 1YUDA 5J36A 3C8XA 3S0MA 3B93A 1DCSA 2GU9A 1PMJX 3OGVA 1SFNA 2A70A 4QU1A 1LAJA 4PI2A 3JCIA 1W28A 2WUHA 4TLFA 5BNOC 2WZR3 2GNTA 3JQXA 1GNZA 1W99A 2JIGA 1QJY2 1H6XA 5KR7A 4QHZA 3VD9A 2WO3A 4JX0A 1FOD3 2RS53 1XNBA 1JUIA 5JZGB 3ZYGA 3ZFFB 1JUHA 2WWJA 3OPZA 4YVWA 4CU9A 1NCQC 4HVQA 3NAPC 3ST7A 2IXKA 2XR4A 1AR73 4GAZA 3SNMA 2ZX1A 4AEKA 4Y26A 1H8TA 5AC92 1ZREA 2VNRA 1BVP1 4W65A 2RS31 3UGHA 5FZMA 3PVBB 5JI9A 1HRI3 4HXCA 1OBNA 4BQXA 5FPVA 2JDUA 2WS93 1LHUA 3ZFEA 4GWJA 2AC1A 3C7EA 1LR5A 1UPIA 2RHPA 5A7WB 3MICA 3IDEA 2XL9A 3H42B 2VOTA 2VQUA 5IYYA 1PK6B 1WA6X 3SMHA 4HKLA 3N7KA 1X8EA 1TQ5A 3QCWA 3S6PA 2AGSA 5AFBA 1HQWA 3QOPA 5J96B 3GNEA 3AK0A 1AX0A 4H2AA 4IDZA 2E32A 4W4ZA 4XEZA 5A80A 4COUA 2ZMLA 4YPJA 3LZZA 3WXPA 2RS11 4S2GA 3H50A 1RUD1 3ILRA 1NAEA 3WV6A 2SLIA 1J3PA 1NOVA 1CAWB 4I30A 2ZHNA 1C8M3 2ZMNA 3BOWA 4PI0A 2R063 1UAIA 2O8QA 4NROA 2JG8B 5CFDC 4XF0A 4YM1A 1B35C 1XJAA 2ATFA 2HWC2 3T09A 1UQXA 4HKWA 2J1RA 4CDXA 2YROA 1H2NA 1WW5A 1Y3TA 3GJBA 1W8NA 2B8MA 2BQPA 3QLQA 2UYBA 3FMGA 4TSVA 4BH9A 5BNOB 1POV0 4YW7A 5FYVA 1LCLA 4LQRA 3VBSC 3UT0A 4AFBA 2NP0A 2R073 2W68A 2XGXA 3J7NA 1ZBE2 5FY1A 5IAXA 2UY8A 5FYCA 1N1TA 5DAWA 4MVTA 1W8TA 4NIDA 1LESA 1V6MA 1RJ7A 2IVIB 4HK8A 3URFA 3H1YA 5FJKA 2Y60A 3WNPA 1VBB3 3OSDA 2JDAA 4AEDB 1O3RA 3MIEA 3LEMA 1Z7S1 2CGOA 3HT2A 1RXFA 2A1XA 3ELNA 4BWOA 2AACA 4U36A 3ON7A 1AL22 2WNEA 3K4DA 3PJQA 4LOSA 5FZHA 5T50A 1RUC3 2VPVA 4LHSA 3PVNA 3J9SA 3DKWA 4CPBA 3OGGA 3C2UA 2WNOA 1PMHX 2WWSA 2WNVC 3HVDA 4MSVA 4BQYA 2JB4A 4QXHA 3LOIA 2P1BA 2BGCA 4K8FA 5EIYB 1R1A2 1VBE2 3H8UA 1OA2A 1W9SA 1QOOA 5FYUA 2JE7A 4FXGB 4IV3A 4XETA 4LUMA 1ZA7A 4YW2A 1R081 1YFUA 1XSRA 2P3JA 1QOTA 3N9OA 3UNPA 2B5HA 1O5UA 5JI7A 3UK9A 5T5OA 1QJFA 3UKVA 3ES4A 4OZOA 1CJPA 2B45X 1MVEA 2IUWA 5DUUA 2ZA9A 2H0VA 2Y6JA 4QM9A 3Q8AA 4GMP0 1OHFA 3AM2A 1H6YA 2XL7A 3AXEA 3N9QA 3HNMA 4HPKA 1UNBA 2ZEWA 3UESA 3S5QA 3WP6A 2FDIA 2EIDA 2ZPXA 3PUSA 1W2OA 5FBZA 2W08A 5JXHA 3DXTA 3JBG1 2DCYA 1J84A 5JPMB 2E7TA 2WFF1 3AJYA 2J1TA 1HB2A 2RJ2A 3K4ZA 4I02A 4NHXA 4DEVA 3CIHA 3NL1A 1UY0A 4EE2A 5EFUA 2MEV2 1PHMA 1OA4A 1ZNPA 5D8AB 2J1AA 3BVCA 2BVVA 2K9ZA 5CKQA 3T2PA 2ZEYA 4PIXA 4NIGA 4N53C 1ENRA 2CTVA 3VKFC 3CNAA 1F35A 2DVDA 2EF6A 5D1IA 4E27A 5L73A 2R49A 3LDBA 4CCLA 4LIUA 1O4YA 1MEC1 3TB0A 1LHVA 2XJQA 2ZGSA 3E5UA 2IXJA 3IT8A 2XBO1 1DHKB 1UZWA 3HD8B 5FP4A 4E8CA 5FMOS 4BXFA 4ASMB 3AMPA 5JPNB 3J7LA 3PUAA 2OYZA 4ATEA 2WR9A 3ASIA 4IGOA 4XBLA 5EYYA 1DQ6A 1ULFA 2PHDA 2WAAA 1S0EA 2Q5TA 3MBWA 3N35A 4L99A 4MXWB 1AR62 1RUH2 1SZBA 3B94A 2DU0A 2DCZA 1RUE2 2X29A 4N9HA 2VCBA 4D0QA 1ALYA 1X8MA 4N53A 3O1SA 1AR83 5CZKA 4PJYA 1LOBA 2R30A 3D5OA 1JMUB 1LJ7A 2DVGA 2QBXA 1IPSA 2VNOA 3LEGA 4W8JA 3U11A 3PTRB 4BMBA 2Q30A 2PMWB 3M3QA 1IQDC 1C3HA 3NSTA 4BYYA 2VZTA 3DPRA 1NT0A 1JU4A 2QDRA 2R16A 4GH4C 1QXRA 1G9FA 2D44A 4V2VA 4Q4X1 1M06G 3RZMA 4S2FA 1WLDA 3U37A 4ISRA 3NO8A 4Q4W2 1KJLA 3R0RA 3ROUA 3M3CA 2KD7A 1SDDB 2XJVA 2HLEA 1ZRFA 1CZVA 1Q56A 4N7UA 3VBFA 2P4EA 4N8MA 2DURA 5EPAA 5APAA 4AHXA 3I59A 1PVC1 2ERFA 1T6GC 1DGLA 3ORJA 3RGBA 2ZX0A 4LE3A 1SMVA 1H1MA 1W2UA 2B42B 1W0NA 2W2IA 2CYFA 4EYUA 2K0GA 3S30A 4LOTA 3T1LA 4IE0A 3J8F1 5BYNA 1AR92 1CX1A 5BUVA 3J4UH 5F5IA 3K51A 1GZTA 1S0IA 4CE8A 1DLCA 1ZBA1 4H7LA 4E4SA 5KWRA 2FZ2A 1RIRA 2XONA 3KGLA 4IE5A 4Q4Y3 2GSYA 4QKNA 1S55A 1T2XA 2DDUA 2WNUC 1W6NB 4Q5OA 1H4GA 2A6WA 4CEWA 4AZZA 2RVAA 5CISA 5FO9B 3IPVB 3BIWE 5AC93 2B4KA 3B9CA 3IAPA 4Q26A 1VJ2A 2VZ1A 4Z2AA 3LE0A 3FJSA 1HRV3 2Z4FA 2HJIA 2CNAA 2QQWA 4IEWA 4L8QA 4ISQA 3LFMA 3WDVA 4B3NA 4P9YA 1RB8G 1W05A 1ND3C 4WM7B 4XZUG 3ZSKA 2IC1A 5FYIA 2BW8A 3VBUC 2BNOA 2PHFA 5DG2A 5EXOA 4DMIA 4NN0A 3GM8A 1GV9A 1VRH3 5DZFA 4QKFA 3MYXA 1OVSA 4GALA 5D21A 1W8ZA 4YG6A 4E2SA 1HQNA 1OPMA 4I2OA 4NPRA 3WW4A 2HEYF 4E2GA 3IIAA 2VNVA 2XLAA 1OF4A 1U5IA 2IVJA 3CJIA 4XBQA 4Y5SA 3TEXA 4UFLA 4YW6A 5C33A 3K3OA 4LMFA 4LBLA 1W2AX 1W6MB 5FLJA 1GUIA 1UXXX 4J25A 3VBRA 5ABJC 1D4M2 2GNBA 2VGDA 4K1ZA 1JYNA 5CYYA 4XHBA 2B9UA 4PLOA 2BWCA 2L9LA 4KGQA 3WD5A 1YI7A 4QD2A 5F3CA 1KD7A 4LK6A 4BLJA 2BZDA 1YEWA 3GF6A 4IEQA 1DP0A 5F6LB 5GLTA 4Q4V1 5HBAA 1K45A 2ZGOA 4BM8A 4G4FA 4AFCA 2VH9A 5JOZA 1S0BA 1GSLA 5C3RA 2ZHMA 3WNNA 1RUJ2 5DUVA 1BXHA 2BGOA 1JTZX 4PQQA 2V4VA 4IXLA 3IAQA 4LO5B 3V56A 5ACA1 3VZOA 1RMU2 2CDPA 5ABJA 1COV2 3ZVXA 1SFYA 3O1MA 1ZZCA 3NRUA 4P9JA 4K3UA 4RN5A 5FZ6A 2HWE2 5C8WA 5JZGC 3TRSB 2W94A 3ZFFC 3EBRA 4XE9A 1JH5A 5LBCA 3USUA 1WCUA 2RJKA 1CWPA 4WM8C 4HT1T 4AHWA 3OOXA 2EAAA 2VTXA 5EWSA 4ZPIA 2A75A 4UFJA 1UMHA 1Z0HA 3KHBA 1HXS3 1I5ZA 3MV11 3C7OA 1S1AA 2DU1A 1AL23 1UYYA 4KMQA 2D93A 3WG1A 5KC5A 2AUYA 2HKXA 3D8CA 3RSJA 1FV2A 3WVJA 4XJWA 5GLUA 1OSGA 3FBYA 5EHDA 4BXSV 3H8XA 1PGL2 4E4ZA 4D7SA 3H0OA 2R1BA 1VBE3 3JD71 3I2OA 5J48A 3BU0A 3FUOA 2YG0A 1O8PA 1JS9A 1QJU1 3ZFFA 1JYCA 3M2MA 5EV7A 3Q8CA 5FP3A 1DGRN 4LXLA 4XDPA 3WG2A 1RJ8A 4IV1B 4J6GA 3JU9A 1UY3A 2WT2A 3ZDVA 1FV3A 3VGIA 2WJSA 1N3OA 1LKNA 1WW4A 4K40A 2UYAA 1JHJA 2G1MA 4GJYA 2R042 4XIKA 3UGFA 1IS4A 2ZGMA 1R64A 4CUCA 1E5SA 1CN1A 1RITA 2V72A 1IKPA 5A7WA 2HEWF 4AYUA 3O5SA 4YNIA 4AGGA 4AI8A 2HBUA 4R9BA 3TYJA 4CP9B 2ADEA 1PK6A 2KA3A 2QQJA 1VP6A 3HBKA 2YHJA 4FI9A 1MS0A 3NJXA 3S5AA 3NVCA 3ZYBA 1GWMA 2D40A 3HOBA 2XHNA 1CVNA 1W8HA 4XFBA 5IK4A 4OLLA 5I8YA 1QJX2 1LENA 2D43A 4K21A 4QB6A 3FL7A 3FE5A 4COWA 1B09A 4XCAA 1UKGA 4MOAA 4K20A 4XF3A 4TWTA 2BERA 1KQRA 3ACFA 4FPJA 5FPZA 2PN5A 3IDBB 3ZXLA 3NJVA 4CU7A 1CAWA 5JWPA 2MPFA 4BK5A 2WIIB 2WZR1 1RUOA 4AEDC 3IWZA 1IZ3A 2I74A 2JG8A 3AFKA 4M3CB 1REFA 3KZ4C 2TUNA 4XZPA 4CXYA 1FOD1 2C6SA 4ZY9A 1BLZA 2RS51 3SH4A 2W3JA 3Q8FA 2H0BA 3U75A 3O1VA 2Q8CA 3M8LA 3RWNA 5T54A 1NCQB 4BMEA 3NAPB 5BNOA 3THCA 5KXBA 4MADA 4Q0SA 1OUSA 1AR71 1QXPA 3DN7A 4YGEA 4PF5A 5LEKA 1UY1A 2XMLA 4IQPA 4EN7B 1GMMA 5TSWA 5SV5A 1H1AA 5CADA 1HRI1 3AB0A 2XJTA 1JHNA 1PO22 3HQUA 4KWLA 2VU9A 3T0AA 2Z79A 2R7EB 4DIQA 5LCWL 1TVGA 1OD5A 3HAGA 4AEDA 3KV6A 4NRMA 4JRAA 4XABA 4KG8A 2WO2A 4DOUA 3W5NA 4ZZ8A 3M4FA 2E51A 4CUGA 4YG3A 4MZUA 4DQAA 1K12A 1N1YA 4LEJA 1BCXA 1VBC2 3VKOA 3CMGA 2H6BA 4RGGA 1GBGA 2VC9A 3NMBA 4BE3A 5FYBA 2DUPA 2IXLA 2IZWA 4YLZA 4XJ9A 1RINA 3JB8A 4LLOA 5DMYA 3RDIA 1VB4A 1HJGA 4R52A 4XF4A 4CU8A 5BNNB 5KHIA 4UW4A 1KDMA 4LHKA 4MGKE 2GP5A 2YGMA 2HWD2 3DYOA 3HQXA 3MW2A 5A7NA 2R061 1LOFC 2W39A 4IUGA 3RS6A 1AR93 1B35B 3SISA 4CCDA 5GZCA 1YFWA 3BPZA 5T55A 5A7QA 1REDA 2WO7A 1UIJA 3PMSA 4P9LA 4QX5A 4DUVA 4LBJA 4B29A 3NW4A 3K4AA 3LDKA 4A7KA 3WDTA 4C8DA 2YGLA 2R071 5CBLA 5IVFA 2C9KA 5FK7A 2X5IC 5FR3A 2VJXA 5D8AA 1U5XA 4NR1A 5L7OC 2R1DA 1ZRCA 4HMZA 3MLKA 4EZ4A 2JIJA 3IBMA 3AMNA 4XYXA 3IDCB 3OPTA 2ET1A 2RDNA 4WVZA 5HI0A 1J59A 1VBB1 1IS3A 4AR2A 1G9AA 3AP5A 2FQPA 4B1MA 1PM4A 3KQRA 3WEZA 3M7AA 2DVFA 4LBOA 4CVUA 1QH7A 1WW6A 3KMHA 3KT4A 1RUC1 3LA7A 4PIYA 5LASA 5DUWA 1DZRA 2EXIA 2VQTA 4B4QA 4CP0A 1U5YA 5IT6A 1J58A 4Q0VA 4YVSA 2WL1A 1LHNA 1MS9A 4V1PA 1YQ5A 2ZAAA 2EA7A 3ZFGA 2YBPA 3D3AA 1WMXA 2JDKA 4MXWA 4DO0A 2BUKA 2JDYA 3EJKA 1DZTA 2HEVF 1JBCA 4A41A 4D6QA 2RV9A 4LO6B 3TN91 4FXKB 4CDQB 1WW7A 1XE8A 2WZEA 2IFRA 2RG4A 1W8WA 1X82A 1ZVFA 1WBLA 2WAOA 5CA6A 5CG8A 3L2YA 2QQLA 1YWKA 4BLIA 1ODMA 1XE7A 4DRRA 1C5IA 1DIWA 1OI6A 1RMU3 3FFQA 1PO13 2W1WA 1OOPB 1KDKA 4CCKA 1QHDA 5A1FA 1CAUB 4KG0A 4QPGB 4YSFA 1F5FA 1JU3A 4AQTA 1GYKA 3CZUA 4KI5M 3MDPA 5IVEA 2E7QA 1PIV3 3OY8B 4QDQA 4B7EA 3N7LA 3E6DA 2EXKA 1NCRB 1CX4A 2VZRA 3OGRA 4QX2A 2A3WA 3NV4A 3VB9A 1RVF3 3FBMA 3TEYA 2WKKA 1ACCA 3V65A 3MHZA 4MUVA 5FWJA 5I0DA 3AZVA 4N43B 2WFPA 4QX1A 4BK4A 1YNAA 1OD3A 4FPLA 3AKQA 4J1WA 4RFRB 4WM7C 5H9PA 3VBOC 2QQUA 4HSLA 4CU6A 3B3QE 3KV5A 2GMMA 3T2OA 4QPYA 2QQNA 4GB32 5ERLA 2G9GA 4RHV1 1CJDA 4GWNA 3VHRA 1W6NA 5FUPA 3W5MA 2K2SA 1VAKA 4XCBA 5BV6A 1GP6A 2D6OX 3IPVA 3U07A 1AR81 5JSRA 2DCJA 2RMU3 3B69A 2D3SA 4IESA 2WLPA 2I07B 2R043 1NLRA 3HT1A 3SKJE 1UXZA 4C0HA 1NA1B 4LUKA 3RZKA 4UAPA 1YO8A 2VTFA 4WM7A 1G7YA 3V64A 4A3ZA 1UZVA 2WWUA 1OMIA 2OZ6A 4OCTA 3LIHA 1LEDA 2G19A 2HWF2 2Y0OA 1OLMA 1APNA 2YYOA 1QJX3 2A6ZA 4BIFA 2VUDA 3TAYA 1BYHA 1FI2A 3VBHC 4JDNA 5CU1A 4OUMA 3V0BB 2W46A 3IKWA 3POGA 3G7DA 4JRLA 1OFSA 1UCXA 1Q8VA 4AHYA 2GDFA 1JYVA 2WN3A 3LSDA 1IHMA 2VZUA 1EP0A 2AENA 4OQ9A 1O5LA 4D6RA 4Y1XA 4QGLA 3UGGA 1HV0A 1XRUA 2DFBA 4AAPA 2HBTA 4GWIA 4LBQD 3T1MA 1OF3A 1FX5A 2NN8A 1EAH3 1S0CA 4GQ7A 4QX0A 3T0BA 3NV2A 3TOJA 3TWIA 4B4RA 4XJ8A 4Y1UA 3O1OA 3LQCA 2ILMA 2JEMA 4Q4Y1 3FN9A 1F2NA 4IEZA 4P14A 1YHFA 1AXYA 5FREA 4JGYA 1GR3A 5C3OA 4CXWA 5CEHA 2OQ7A 3EB7A 3T4HB 1DG6A 5FPBA 2W1SA 3MIBA 1JODA 1ENXA 2FBEA 4A42A 1RUG1 1HRV1 4LBQA 2XJPA 4M0NA 1RTVA 1F4HA 3LA2A 4KBZA 5L9VA 1ND3B 4ITCA 2J7MA 1CAXA 3VBUB 4F7ZA 1BMV1 5LY1A 2DWRA 4Q8KA 4L9BA 3ZXKA 1VIWB 2C26A 5FKBA 5BPXA 5HXVA 1VRH1 3U14A 1S2EA 2VZVA 3VDDC 3NNJA 2PHUA 5ANQA 4FP3A 2VOVA 5F32A 1YXWA 3ZIXA 2YPDA 4QXBA 5L36A 3MIDA 1LODA 4CXXA 3WNMA 3B00A 1CD3G 1QQP2 3KQ4B 4OYUA 5A7SA 4LBKA 1GNHA 1XE0A 2VTXJ 4YFZA 4Z07A 3POFA 1MACA 1RL3A 2X05A 2ZKNA 1KS4A 2A6VA 4GXLA 3GHNA 4W50A 3VD5A 3SH3A 1W8UA 2LTNA 2HWD3 1W90A 4FT8A 1MS8A 4FPKA 3WP4A 1SLIA 3I3EA 2NLRA 3I2GA 4IV1A 1FPN2 4NMIA 2VY0A 4MX3A 5FPLA 3WDWA 5FTTC 4QPIA 5A7PA 1ASJ3 1CIYA 5T5PA 3A0NA 3GALA 3ALQA 1SCSA 2ZX3A 1R093 1LNSA 1N47A 1TNFA 3OGJA 4UF0B 3WOGA 5A6XA 3J26N 1LOCA 2OW4A 3BKZA 2BP6A 5A6QA 4AFAA 4EROA 1ST8A 4CP9A 4MH0E 3AKTA 3TNQA 4L2NA 4AL9A 3V0AB 3NJYA 2G9ZA 1DYKA 1SQ4A 3D82A 5FY4A 4DB5A 2D5HA 4R4ZA 5IFPA 3AL6A 4Z1VA 1XU2A 4WM8B 1O6UA 2IXIA 4ARXA 3FFZA 1NLQA 3MFCA 3MGUA 2PLV2 4MV2A 3BTAA 2VL4A 3UJOA 2ORXA 2JWPA 4R9CA 1ND2B 2VOWA 2V73A 3WUDA 5FZ3A 3WDXA 1HXS1 2JG9C 4WZFA 1OQ1A 1VB2A 3BU7A 4COZA 1AL21 2VXRA 3H7JA 5JVVA 1OUXA 3B5LB 3J7HA 5CNAA 4LLFA 1XYPA 2E63A 2LS6A 2VZQA 3K77A 3MPPG 4M3CA 4RS5C 5FUIA 5IVYA 3SCHA 2GMPA 3ZIWA 4LKDA 1QJEA 4E4DX 5F1RA 3M3EA 1CAVB 1VBE1 4XILA 1OURA 4HVOA 2ZOEB 3UV9A 3OUIA 4OHWA 5A1AA 5J7MA 1NCQA 4XQDA 3NAPA 4IGQA 5FO7B 2LUWA 4H55A 4RA0A 3D4KA 2C1FA 1WWYA 2VOXA 3OCPA 2ZGKA 4A44A 1V9U3 1TME2 1CGPA 1QU0A 2QQIA 4L0PA 4NWWA 4DFSA 4CCOA 1H2LA 5BNNC 4Q2FA 4NWVA 1WD3A 2OT7A 4HZFA 1O3TA 5H9SA 1QJZA 1Q5OA 2XWBB 1NYWA 4URAA 5GZGA 5F5AA 1MS5A 4CDUB 2Q0AA 1RUI1 4XF1A 2VZ3A 5F37A 1HB4A 4KWJA 3N9PA 4QM8A 1TMF2 2QJVA 2QFEA 3KWVA 3OD0A 2P2KA 5FZ9A 2ZAHA 3OBZA 3WG3A 1GWLA 1L7LA 3ZLIA 2JXAA 4LJHA 5FZ7A 2P37A 1KXGA 4CPBD 1BEV2 2ADDA 2J1UA 4FOYA 4HSJA 4WVMA 3E5QA 5BNNA 1O3SA 2BRTA 4FPFA 4C0BA 4Y4YA 4C90A 1H2MA 1W0PA 4CP1A 4HG6B 1JZ3A 1UOFA 1KGYA 1X9PA 2BGPA 4Y1YA 5CFDA 5E88A 5JXJA 4JAAA 1B35A 3JXSA 2D7FA 2PHRA 1OA3A 1WA4A 3POIA 4JHZA 1J1LA 3ZN6B 4QB1A 1JZ7A 4HOOA 3DYPA 4UFHA 1YYNA 4XIOA 3VBSA 3ZM8A 4Q27A 3OD4A 4URTA 1C28A 4PIZA 2SBAA 5IFTA 2TBVA 1WKYA 2YV8A 2YBSA 3WX5A 3KT7A 2NZ9A 2LROA 2BJSA 5B2GB 1QNWA 1C8NA 2C0ZA 3NNMA 2NYYA 4OI1A 2B9VA 1W8OA 3WNXA 2RS32 3TBDA 4XF9A 2BDRA 3A21A 4P9GA 5DQ0A 5JR2A 4PLNA 3SH5A 3SKVA 3CJXA 3I2FA 3I2KA 2DV9A 4JGZC 4CDQC 3PJYA 2BNMA 2RE9A 2XKPA 4XFFA 5HCFA 4ZZ5A 3KV4A 4FOVA 5A3TA 3M3IA 3ZOIA 4P08A 3PUQA 1Y7BA 4LKSA 5GZEA 4ES9A 4CCCA 2X09A 1X7NA 2LM3A 2WNVA 2RJLA 4DRVA 3CHXA 1OOPC 3HNYM 4XVHA 4CSWA 2Y38A 3POSA 3LA3A 4QPGC 3CKHA 4LKFA 3CLPA 3LD8A 4XUQA 2RS12 1H9PA 2VMHA 1RUD2 4F8AA 4DY3A 3B02A 3CZJA 5F6KA 2D6NA 1JYTA 1NCRC 2D97A 3QACA 1XNKA 4MXVA 5FIXA 1AYM2 3HMYA 3VV1A 2RM22 4N43C 3WR0A 2QTWB 3DYMA 1UL9A 2QQKA 2BYVE 5LA1A 4NHLA 1QDCA 1WBFA 2YDEA 5HCHA 1GOFA 1ZZ6A 2X5IB 4BQWA 4BOWA 1JN2P 2XWJB 4AGVA 2WZPP 1CAUA 2I2SA 4A45A 4QPGA 3WLUA 5L7OB 5AVPA 3ITQA 3ZR5A 1X36A 2VMEA 2YC0A 2YUEA 2D3PA 2WO1A 3OY8A 3GZTB 1AX2A 1IG0A 3EQEA 2B46X 1MS1A 1W6PB 1OLQA 4D94A 2YC4A 1Y9QA 4M4PA 5FZDA 3GHMA 2QDNA 2Y6KA 1Z7S2 1NA1C 2A5ZA 3I7DA 2EIEA 2Y26A 2YB7A 4XACA 4RL7A 3O7OA 1I5PA 2KM2A 2FDFA 2AZ5A 3VZKA 5BXXA 2VAUA 1FNZA 4YGDA 1NY71 4YW5A 2CSGA 3P1IA 3FX3A 1W2TA 1EV12 5IW0A 5I8SA 5LB6A 3UKTA 1KRIA 1C1FA 3I97A 4INDA 5LATA 2VMGA 1J83A 5BY5A 1R082 3S57A 2HH9A 4AG4A 3A22A 1FYUA 1W03A 4QB2A 2ZZJA 1NZCA 2JECA 2BV4A 3MUY1 1OH4A 3AZYA 1ZZ8A 1NA1A 3N4MA 4AF9A 4A6SA 1QJY3 3B01A 1HB1A 1KFXL 2R6QA 2ZXQA 3H1WA 3N9NA 3P5BA 4GH4A 4QDRA 1PX4A 2GN7A 1RUF2 1WMFA 1UMZA 5B4NA 1PO11 1XPWA 4NVPA 1RXGA 5CIRA 2DVAA 4QQ2A 4YZ1A 2QQPA 1QNYA 2WFF2 5FFOC 1AHSA 1DYOA 5A6ZA 3AFGA 4MLOA 3BPSA 3H9AA 5T52A 2AYHA 1STMA 2O1QA 3M1HA 1VBA2 1PIV1 3AZZA 2PLV3 3LGRA 4O65A 3ZYRA 3ACIA 3V0BA 2Z69A 5B4XA 5A3LA 3GJAA 1RVF1 1JZ6A 4JKLA 4XJZA 4AEJA 3IMNA 1VMJA 2QNKA 4BA6A 2EAKA 4J1XA 2J1EA 1ULOA 3VBOB 2P17A 2OX0A 5FZEA 3WW2A 1XOYA 2OS2A 1NLSA 4YW3A 2VZOA 3WCRA 4P9WA 4TTGA 2WNUA 1EYBA 3AP6A 4HKOA 1LGNA 3RQ0A 1ZYBA 3RWKX 4AW7A 2ARXA 1JOBA 2JE8A 4XFAA 4CEYB 2Q4SA 2XXZA 4QGMA 3ZX7A 1SLAA 2RMU1 1S0JA 1F9KA 2PAMA 3HWJA 4Z2WA 2R041 1HN0A 1TNRA 3MIGA 3GZAA 1OVPA 1ND3A 1NXMA 1RC6A 1DDLA 1YC61 3VBUA 2WA4A 3DECA 3PMEA 2W52A 1SDWA 2HWC3 2IFWA 1LHOA 2A71A 2WDBA 1O91A 2ZEZA 5FLIA 4XJUA 5FZ4A 3JQWA 5I93A 1IG3A 1A8DA 2LW8A 4P9XA 2ZMKA 1AX1A 3DKQA 1LEMA 3VBHB 1QJX1 4DUWA 1N1VA 3GBGA 4DINB 1BJQA 1ZBE3 2Y6LA 4GD4A 1H9WA 4QMAA 1REEA 4IGPA 3VD4A 1W9WA 5K0UB 2ZHLA 3N3HA 2XJSA 3ACHA 2P3IA 5LA0A 2QVSB 4M4RA 3CBNA 2ZGQA 2ZHKA 4XPVA 1CIWA 4ZONA 1AVBA 2A3XA 3NNFA 1PVC2 1XC6A 4F3JA 4C91A 5J37A 4JDOA 5A3UA 3J7MA 2O8OA 4HL0A 5DAPA 5F2SA 2CL2A 1EAH1 2EXHA 4PLMA 2VUAA 4UF0A 1ND2C 3J8F2 2B39A 1C4RA 3KD4A 5FZ8A 4DXZA 1BKZA 1CZSA 4Z82A 1ZBA2 1BHGA 3AZWA 2JKBA 2QKDA 1J1TA 1R1A3 2BFUL 3I3BA 3V0AA 3MLLA 4JZRA 1HW5A 5JZGA 1XNDA 4ZS3A 4CA9A 4CYDA 4CP2A 4X8PA 2F17A 4WM8A 5CFCC 2ZS6B 3L9JT 2W5FA 5F9TA 3OYWB 1IKQA 1ZM1A 2AREA 4CTEA 4H3WA 4G9SB 1DQ1A 4OHZA 3VDDB 4BIOA 2EALA 5I0UA 4UYBA 2RR12 2YFUA 2YC2A 4OVEA 5EQUA 2F4PA 4AQSA 5A70A 5BNPC 4CDUC 2A73B 4L11A 2Q8DA 2MEV3 1O4ZA 3PIGA 3X29B 4KBBA 3RYRA 1CAVA 1XBFA 2VW1A 3AKRA 1POV3 4DEQA 4Y5Z0 1UF2C 2GH8A 2VQ0A 3AYCA 1RUD3 2Q8OA 1Q8SA 2HWD1 1GANA 3C7FA 4MO3M 1CR7A 4KU7A 4MGIE 3WP3A 5K8SA 2V4AA 5ISLA 5LBEA 1XNTA 3U0ZA 1ASJ1 1U12A 1OC1A 2OPKA 2TEPA 2VW0A 4QAWA 4LPLA 1AYM3 1R091 3AMMA 4Q4V2 1W06A 2RM23 4LE4A 1SHWB 3ILNA 1MZ5A 3WW3A 3TEZA 3IB3A 1G6NA 2ZKLA 3VZNA 4CDUA 2UWCA 1TZOA 1NE4A 3PUHA 4PDWC 2FMDA 5ACA2 1AR63 2WA3A 1RUH3 4X6RB 5L9RA 1CPMA 3AVSA 4QHBA 4TYSA 1H8TB 4UWDA 1RUE3 2E53A 4HONA 4WVVA 1H30A 2CAVA 2CDOA 1SPPB 2I45A 3ZYPA 3EYPA 3ZR6A 2BBAA 2VZPA 4ARYA 4HK9A 3ZFEB 2XG3A 3DEMA 4Y33A 4ES8A 2JG9B 4XW3A 5AFEA 4IEUA 4XDOA 2WS91 2N7GA 2ZX2A 5DAVA 5D2AA 4JKMA 2W95A 4NO4A 4RSUA 3SCFA 5C7GA 1G8WA 4GMP3 2GH2A 3H7YA 4RS5B 5FZIA 5A3WA 3GBWA 4A6OA 2GNMA 2WQZC 5H9RA 4Q4W3 3ECQA 3ZN6A 1M4WA 1UW8A 3MF9A 4MGSA 1S0GA 1XYOA 3IMMA 5L19A 1EV13 4NHKA 5DZEA 4Y1ZA 5C8CB 4XTPA 1LB2A 1UD1A 1GU3A 2PAKA 4DXSA 1QJU2 3KT1A 3LEIA 4A7YA 4JTNA 1LECA 1V9U1 5LW9A 2QQVA 5F3GA 1DGWX 1A8MA 1PGW2 4FFGA 4NHYA 2V5DA 1C8M1 4CDWB 5JOWA 1ENSA 1XNAA 3RNSA 3ACLA 3I2JA 4CCNA 3UKNA 1RUF3 4TN7A 1FATA 1K42A 1HB3A 3APBA 5FZOB 3VDAA 4RD7A 1IPJA 4O9GA 2DCTA 4I0BA 1YI9A 3SEPA 3TEWA 2ORZA 1BK0A 1SBDA 4GKYA 4IE6A 5FZ1A 3ZN5A 2NM1A 1VBA3 4AFMA 1BVVA 2QQOA 4JVAA 1ZA4A 1N3QA 5IVJA 4GIQA 4R9DA 2ENRA 2ZACA 3KB5A 4NRPA 1WD4A 3DF0A 2YY1A 3VD3A 4H7MA 2FHRA 2WYSA 1ULEA 4D8MA 3ZO0B 1LOFA 2OZJA 2W91A 1RUNA 3K75B 1V6JA 1JI6A 3D6EA 5LBFA 2V09A 4XHXA 5FXZA 4QGNA 2GMEA 1ODNA 1E5HA 2GAUA 5I8TA 5JAXA 1BK1A 2PFWA 2WRAA 2WZR2 4W6XA 3ZSLA 1I6XA 1W9FA 4JQTA 4KU8A 3VHNA 3P3PA 2RS52 1UY4A 4JCKA 3ZDSA 5I0RA 1A78A 4OHVA 1O59A 4IV3B 1WMDA 1F4AA 1D4M3 2X5IA 1I3HA 1H1IA 1LHWA 2VBPA 3U4XA 5IAVA 2W47A 3AX4A 1W6OB 3SITA 3AMQA 5JIAA 5L7OA 4OMDA 2VBBA 3WY6A 1AR72 2WQ4A 4AE2A 2FD8A 2NPIA 3IZOA 4QKDA 4KL1A 1ZZBA 1HDKA 5FDBA 1G9BA 5JCTA 3ZKYA 3C7GA 4TXWA 4JGZB 5FLHA 3VN4A 4FP2A 1Q8PA 3WDYA 1W6PA 4EN9B 1JYWA 4MGTA 4ASLA 1GQGA 4XXPA 4KNCA 4YM2A 5FXVA 1RUJ3 5JR7B 4TZDA 3I2DA 5JXIA 3Q9OA 4ET7A 3LWCA 4WZCA 1UKRA 3SQOA 3L2HA 1HQLA 1COV3 4AVSA 1FXZA 2BEOA 5KHKA 2HWE3 3U10A 1QY4A 1HKDA 1NXD1 4LHNA 2GP3A 1DU3D 4ASKA 1AF9A 4M0HA 2P34A 3AZXA 2BU9A 2PHWA 1X50A 4JKKA 2Y8KA 1FNYA 2FMYA 4WBBA 1WCDJ 1H0BA 4AVVA 2HWB2 2J22A 2XDVA 1GZ9A 2R062 5T3NA 3IIIA 3VL8A 1ZBA3 2VQAA 1D2SA 2ZCWA 4GA9A 5K7PA 1MPXA 2DF7A 5CKMA 4CCMA 3O1UA 5K4LA 4YZ4A 3B9IA 4D69A 5KHJA 5C4WB 1LULA 5IVVA 3K46A 5FY9A 3E1F1 3HIFA 3OEAA 2D5FA 4FO9A 3OEBA 4EZHA 3DCQA 4RGKA 5FWEA 1VALA 3OPWA 3AKSA 2WSVA 4EWEA 4CEYC 3G6JB 1QMJA 3GZUC 4XDQA 5LBBA 3RYKA 5FRAA 4AI9A 5HCAA 1S2KA 3HEIA 3AC0A 1VBB2 4Y5TA 2P3KA 5HPOA 3A23A 3DV8A 1VE0A 4W6YA 3VDBA 2VVEA 4ZHNA 2RR13 2JKXA 3VBOA 4YGBA 1YFYA 3VZMA 3O1TA 5E1RA 5DDJ2 2A3YA 4LORA 2R32A 1F8VA 2Q1ZB 3CU7A 3O0VA 4QXCA 1KITA 1GKBA 5LK7B 1XYNA 1UY2A 2OXBA 4XBNA 3VBFB 4AVAA 2FDHA 3WNOA 4RQPB 3POBA 1W6MA 3QH7A 3ZSMA 4IERA 1UU4A 4CEYA 4UFMA 5K0UC 4FAGA 2D6MA 3PU8A 1K5MC 2RDRA 4SBVA 3T30A 2PHTA 3HNBM 4Q4V3 3T3YA 3F95A 4DUXA 1MS3A 4LNVA 5FMDA 3TN92 2Q1MA 1QJY1 1TE1B 2FCTA 1W8FA 4OHXA 1UOJA 4NPLA 3CEWA 3U78A 4XUTA 4FFFA 4CEWB 3ZXFA 3PLQA 1DBNA 3I3MA 1MQTC 2VMFA 3ZMOA 2ZGUA 3BGAA 3AYEA 3VBHA 4IEYA 2XJUA 3LPFA 3WUCA 5AC91 2VE1A 3KLSA 4FPOB 2QZ3A 2YU2A 5DZGA 5K0UA 4AVCA 3ZN4A 1NQDA 3HJRA 1JXNA 3A7QA 1PO23 2XQRA 1HX6A 1A3KA 4NAMA 4BZ4A 3S7IA 5KHGA 1AZDA 2C5DA 3GGLA 1D4VB 2JJ6A 5G04L 2QUOA 4QXKA 2VR4A 5G05L 4ONUA 3VKMA 1QKQA 1MZ6A 1UU5A 1VR3A 1VBC3 3O14A 1A34A 2JENA 5CKNA 2WYFA 2ZEXA 1D7PM 2XJRA 3SXWA 3BI3A 2YFZA 4RHV2 5FZCA 1W2NA 2VOKA 3AYAA 4N90A 5FY8A 1L7QA 5JSPA 1ZRIA 1D0GA 2VVFA 1AR82 2VUJA 2ZZQA 3KV9A 1RHI2 3RVHA 1EUUA 3FLPA 1AUYA 3PU3A 2JDHA 5A7OA 4FAHA 1JYIA 1KS5A 3OYWA 1US3A 4Q0UA 2OKXA 5FZBA 1VBD2 2HWC1 4NE9A 3WT3A 2XLGA 3ILFA 3GCXA 3ENRA 3HN1A 3VDDA 1YCIA 2EVXA 3Q8EA 1US2A 2VUCA 4MGYE 4PF1A 1JZ5A 1LU1A 3FZ3A 3IDAA 4R4XA 4AK3A 1W6QB 1IS6A 3NWKA 4LO8A 4EJRA 5A3NA 2F4LA 4YM3A 2XKOA 1VMHA 1ZBE1 1LGBA 4BCUA 4FOWA 3QD6A 4YVWC 2E7AA 3HPNA 3WSOA 4AWDA 1EUTA 2PAEA 4XC9A 1I1EA 1V6LA 4AGRA 3ZSEA 3HBZA 1H8TC 2ET7A 1OT5A 4Y4RA 2ARAA 3KHCA 5FOJB 1UOGA 3IM0A 1N3PA 4P5HA 1SLCA 2NQYA 3NV3A 4S2HA 2E6VA 3ZFEC 3SCGA 2JD4A 4P5YA 2CAUA 1F15A 4XQWA 1AJKA 4OUEA 1X9TA 5CAZA 4LA3A 3RZGA 4YGCA 1SFPA 2YZ4A 5FQ0B 4Q4Y2 4XUPA 4O9EA 2EXJA 3BTXA 1ZX5A 4K8RB 5LA9A 1R1A1 5HXMA 2UU8A 4NIHA 3EO6A 2E9QA 1FMD2 4X8NA 1OQEA 4TLGA 5CFCB 1UIKA 2P6CA 3RZHA 1MZFA 2DTWA 1XXNA 2RDQA 2GC2A 2WC2A 3VD7A 5C8CC 1SPPA 4FQ4A 1RUG2 1HRV2 4BJ0A 5A6YA 4OI2A 1WLTA 5JSOA 2JICA 4HANA 1AYN2 1BMV2 2VM9A 2JG9A 1PZ8A 5C70A 1ULCA 1PX3A 3LCPA 3MEPA 3KCYA 3PDQA 4LA2A 4WV8A 4QT6A 4QX7A 5IWFA 3OBTA 4CDWC 1VRH2 3I2IA 2HYKA 4ZXKA 3OTFA 2GN3A 5BNPB 4CDXC 3LSEA 2UWBA 5M0TA 4Q0QA 4NUBA 3SHRA 4RS5A 4IEPA 2EICA 4QKBA 4FBFA 4OHYA 2ARCA 5KHHA 4D6SA 2XOMA 1MVQA 2MEV1 2YXSA 4GULA 2XVKA 4I3PA 4UBHA 4P00B 4A7ZA 5A33B 2O0OA 3Q8BA 5HV4A 1XNCA 4Z92B 1POV1 1POQA 5C8CA 1Q3EA 4CUBA 1NE6A 4FPCA 4Y24A 1K5JA 3H3ZA 5IK7A 1G9DA 3KF5A 4A3XA 2ARBA 1BBT2 3VLBB 2A6YA 3WHTA 1DQ0A 2HWB3 4LULA 3WCSA 2VO5A 4XURA 1AYM1 3T4VA 2W9XA 4UOJA 5C5UA 2RM21 1E5IA 3AKPA 4CDWA 4RGAA 1KEXA 4XFIA 4XUOA 1GICA 3W59A 5I91A 5FP8A 3MO4A 4GB33 4PDWB 5IUQA 1WLCA 5LA2A 5FZOA 2GNDA 2R0FA 4NRQA 3O12A 2FDGA 2FZ1A 1AR61 3QBQA 1RUH1 5J1XA 1C1LA 3W20A 1RUE1 3W58A 1JZ4A 5IVBA 2FCVA 4Q29A 5CB7A 4IV3C 3BIEA 1W3VA 3SC7X 3A0KA 4R8HA 1O4TA 4ZKTB 3JUUA 2EIBA 3USSA 3WF0A 4AHZA 3AL5A 1R1ZA 5HV0A 1AXZA 3O0WA 4YWAA 2PQQA 3WG4A 1HXS2 3MIHA 5FMOL 5KXDA 1PGSA 2Q1FA 4GMP1 1GOHA 4MGZE 5DDJ3 4UT5A 2PELA 5FKCA 3VHPA 1QGLA 1SLLA 1IS5A 2CWMA 3E5XA 4CCJA 1LOAA 4IEXA 3BTZA 2HWF3 4I0WB 2Y64A 4Q4W1 1QIQA 3RZJA 1UPSA 3RJ2X 3MLJA 4HFSA 5FYZA 2XVGA 3AMHA 2OVUA 4GJZA 1EV11 1IGOA 5GLWA 3BOPA 2WINB 2D6KA 2XPJA 3QH6A 1MS4A 4COYA 3LAGA 1UYZA 5JMOA 3WZ1A 3T08A 4JV4A 3AP9A 5A32B 1W6OA 3M3OA 1RGSA 1YJLA 4A4AA 2OUHA 2XQXA 3VKLA 2DBIA 4DY5A 5GALA 1ULPA 4OMCA 4JQRA 1VMFA 1LGCA 5C3SA 2R0HA 1AR91 3N9MA 5A3OA 2BOIA 1OQDA 1GLHA 4JGZA 1RUF1 4HN1A 3RZZA 4CDQA 2WLQA 4N7IA 5JOYA 3POJA 1QH6A 3KM5A 1QWRA 1W9YA 4IE4A 1RUI2 3ABZA 5DAXA 3WF2A 4QU2A 5DABA 1OOPA 4BU2A 1VBA1 3E6CC 1Y9GA 1OLME 4X6QB 1OXCA 1HJFA 1NZIA 5C4WC 2IWGB 2QZ2A 1UMIA 4GWMA 2GC0A 2E31A 3THDA 4YZ5A 4K9SA 5IHRA 3E97A 1LTEA 4O7XA 5FZKA 4E2QA 5LEJA 5LRSA 3BB6A 1GZWB 1NCRA 5BNQA 4YZ3A 5C3PA 1XSQA 3JB4C 4ZU4A 3DPRC 1EPZA 4YARA 4JHTA 4N43A 3BUCA 1EPWA 4XFCA 4YVSB 4R9AA 1V6IA 3SLIA 3ZXEA 3ZPOA 3ZFGB 4FCAA 2DCKA 1UZYA 4RHV3 1QQP3 2D6PA 1UYXA 4NIIA 3WHUA 1D4M1 5C4WA 4ZXEA 4FFIA 5C5TA 2WSUA 5C9AB 3AXDA 5T5LA 5FMBA 1RHI3 3VBFC 1U0AA 3INAA 3LIGA 5FYTA 4QQLA 1FPN3 4RQPC 4I0AA 1WLWA 1VBD3 3CDZB 5JLVA 3PURA 5GZFA 4HVRA 5FOBB 2MHFA 2WABA 1RUJ1 3OJBA 2J1VA 4JC1A 4XFGA 4Y20B 5FZ0A 2PTMA 3WINE 1AJOA 4FOQA 3AYDA 4IEVA 3I49A 4HLTA 3N36A 2FDJA 3MF6A 2JX9A 1RMU1 3FLRA 3GYDA 4OI0A 3JBG2 1COV1 3R05A 4D3WA 1DZQA 1F5JA 2XHKA 2OIIA 4LKEA 3NKTA 4CEWC 2HWE1 3ME2A 3N9LA 3TN93 4AEMA 3GXUA 3RI9A 3BYWA 4PBOA 5CG9A 1AL0G 4FPHA 4IE7A 2OUJA 3AJZA 1IPKA 1ZZ7A 4AAXA 4RQPA 3H1MA 3AP7A 4QWNA 1RYYA 2DUQA 1DQ5A 2W0XA 3C3VA 4QQOA 5IK5A 1UN1A 3MUZ1 2W1UA 2XUEA 1ZRRA 4ORFA 1UX6A 3I8TA 5GLVA 4L92A 4LHLA 4AXOA 1MEC2 1PGL1 2XBO2 2G9FA 4META 2A7AA 4PHZA 3KGZA 1S2BA 1V70A 1CZTA 4Y22B 3VDCA 2QQMA 2PQSA 4KH9A 3ZXJA 4AQ6A 1FMD3 1GP4A 2PHXA 3CJIC 5DAQA 1XU1A 3VBRC 5FZGA 1LU2A 5FV3A 4KWKA 1GNYA 1RUG3 4XUNA 5LZ6A 3WP5A 3LOBA 4FTBA 1TME3 2YMZA 5F3EA 1AYN3 2H6CA 3KS7A 3BODA 2VCAA 5SV8A 5FPUA 3ZYIB 1N1SA 2RR11 1PZ7A 4IW3A 5FY7A 1JYXA 4AOCA 3LFIA 1VPHA 2OA2A 2ZJCA 1X33A 2VZSA 1SG3A 4UBGA 5KC6A 5LRRA 1TMF3 4UW3A 1DQ2A 4Q4X2 3UYJA 2Y0IA 4F83A 2ZTNA 2RDSA 2Z42A 4M3CE 4C1XA 4KQ7A 5IK8A 1XQNA 4E8DA 2GZWA 1NY72 5J09A 3I54A 3CO2A 1BBT3 1Q8OA 1J3QA 1BEV3 2V5YA 1K5MB 2ES3A 2Z5WA 1YQCA 1LRHA 3NQHA 3BN6A 5FP9A 1JZ2A 1VRBA 4RR3B 4OI4A 5GM0A 5IVCA 1L7RA 1DGWA 2P5BA 1MZEA 1FAYA 2VXJA 4Q1RA 1HLCA 1U5ZA 4LR4A 1UZZA 4V2WA 4BISA 3ZYFA 4JGYB 1MQTB 3ZYJB 4OULA 3WW1A 1PO12 2HYXA 1W6QA 4FQZA 4CZSA 5IATA 1YQ6A 5FY0A 2Y6FA 4MYEA 5EYXA 1XB9A 5A3PA 3WF1A 4LBQB 2IXHA 1IOAA 4UW6A 5JOXA 5EZWA 5FAXA 3T2QA 3WDUA 2G4IA 3VHOA 5J3UA 1CAXB 1PIV2 3I3QA 1W39A 4OQ8A 3PNAA 3R4UA 4LTAA 1PO21 2RS33 4S2DA 4NOTA 4DPNA 3HQRA 1UO9A 1RVF2 4PBPA 3GBFA 5HCBA 4QHOA 2J42A 4UXAA 5FUNA 3T0DA 2D6LX 3RJRA 1ND2A 4B4PA 3HR9A 2AR6A 2LALA 2ETEA 1WCKA 5FXXA 3WQ0A 2WT1A 1PK6C 1DLLA 2X8KA 4JTOA 1VBC1 2JD9A 4UW5A 3D0SA 1O8SA 1DGRA 4FPYA 1JOPA 1VLNA 4IETA 5FQ0A 4XOGA 2B7YA 4QX3A 1S0FA 1DF0A 1Z78A 5I0SA 2MNGA 2BWAA 2RS13 3RFRA 4DZGA 2IXCA 5CFCA 1PGW1 4QPIB 2FCUA 2JDMA 2P6HA 2RMU2 3ZXDA 5EJZB 2BOJA 2OPWA 3RPQA 2P3YA 1VAVA 3RYPA 3RI8A 4AI3A 3D0JA 3TNPB 4Z8BA 4BQ5A 4FSJA 2Y34A 1YRZA 2JG8C 4LO7A 1RUI3 4CUAA 3FC0A 1SLTA 4I09A 2W1QA 5FK8A 3THPA 5BNPA 5IJRA 4YVWB 1NX9A 1OFNA 3THTA 1C5HA 3ATGA 4YRDA 2BFUS 4AVBA 1J3RA 3LPGA 5FZAA 2X10A 2EIGA 3I3DA 4IL7A 3N7MA 4PT6A 5DG1A 5A33A 1AXKA 4E9KA 2PXJA 4U2AA 5DUXA 1YIPA 3K3NA 1ULDA 1GWKA 1V0AA 1G9CA 4LBMA 5E89A 4CCEA 5FCCA 5GLZA 1W3XA 2VULA 3POYA 4I3GA 1PM7A 4K6BA 5L9BA 4P9IA 2ZGTA 4K7JA 5JDBA 1ENQA 4BQ1A 1JOJA 2GC1A 2ZGLA 3NJZA 4MHUA 3O0XA 3NKGA 1Z7S3 2VECA 2TNFA 4D7TA 5FJHA 5C6CA 1EAH2 2JDNA 1PZ9A 3ZYHA 4OFGA 3NV1A 4BQ4A 3BALA 3B7MA 2Y6HA 3VUOA 4LK7A 4PQ9A 3O1RA 5DPNA 2VMDA 1QEXA 2XUMA 1GOGA 4O61A 4PDWA 3W21A 1GQPA 1P8JA 5T5JA 4NAOA 4Y3OA 4QQHA 4LIVA 3JD72 2JDZA 1ZRDA 1TEIA 2GC3A 3EXUA 3CQOA 4RYDA 1R083 3RRDA 1O3QA 2W87A 4AI0A 2ZGPA 4DNYA 4DS0A 5E6HA 1WZXA 1C57A 5FYYA 4EWDA 3DGTA 4LT5A 4KWUA 1I9RA 4GZ9A 4I01A 2Z2SB 4UFKA 4LITA 4Y1VA 4CDXB 5E16A 2AEZA 3JBG3 1NUKA 1W0OA 3MIFA 1D2QA 4M00A 1WCSA 3KVBA 2WFF3 4MHRA 2YPJA 4NJ4A 3PVOA 5C71A 5JIUA 2QE3A 3OF1A 1UYPA 1UX7A 3JZVA 1V6KA 3EMRA 1DQ4A 1MR5A 1V00A 5LK5A 1TG7A 1CESA 3MPBA 4WVMB 5D8AC 3U4SA 2VMIA 3LEKA 3R4DB 5EJ1B 1WMEA 1QOSA 5A32A 2HWB1 5GJ6A 4QPWA 5KBFA 1QXJA 4QQPA 5F5QA 3F2ZA 4XTMA 2JDPA 4YW4A 5CFDB 2JB8A 5GZDA 2C24A 1MEC3 2YBKA 3ACGA 2DYCA 2VNGA 1ASJ2 4EN0A 1HN1A 2XLFA 2XBO3 3DL3A 2GALA 4GKXA 1R092 3OBAA 3PTYA 3PUIA 2A6XA 3CL1A 5FXWA 3ZMNA 4A2UA 4GB31 5AVAA 3AP4A 2O14A 2NMOA 1S4CA 3FHQA 3VBSB 1GQHA 4EV0A 4MG2A 1ONAA 1OKOA 1V6NA 4ZU7A 1FOD2 1PNGA 3H3UA 4YVSC 2VD7A 1HIXA 2X53S 2BVBA 4RFT0 3W9AA 3ZPYA 3ZFGC 2KR2A 2C9AA 2ZGRA 1H4HA
chains in the Genus database with same CATH topology
1WGPA 1DFQA 3FWEA 4LBNA 3WQ1A 4XQ4A 3K48A 5C9AC 4FPGA 4C1WA 3ZXGA 4PCRA 4XMIA 3MI8A 4HPKB 1HRI2 4ATFA 1PMIA 1GZWA 2WS92 3T2TA 3R6SA 2ZX4A 2ZBJA 5DDJ1 3VZLA 4AI1A 2BPA2 2WNVB 2HWF1 4Q4X3 3OBRA 3VKNA 1EY2A 1G86A 1LOEA 3ES1A 4YM0A 1WUVA 3MW3A 4WVWA 1YJKA 1PVXA 1A6CA 3UL2A 1S0DA 2D3RA 5K9YA 5C9AA 4OZXA 2XB6C 4B8EA 1PVC3 3PHMA 2VVDA 1V9U2 1PNFA 5DXDA 4D7YA 4H14A 1DYPA 1C8M2 4AFDA 4BHPA 3P3NA 3J8F3 1L3JA 2UWAA 4FTSA 1ZZ9A 3POWA 4CRQA 4Y20A 2DUOA 4XJAA 4XXAA 2XH6A 1NQJA 4ZU5A 4COVA 2ZABA 1FT9A 1OKQA 5I0TA 1Y43B 4N53B 4HETA 3LB9A 2R072 3FLTA 4L97A 4YYOA 1SBEA 3VL9A 3PVEA 1YFXA 3RMXA 5KXCA 3CF6E 5J98B 4M01A 4EN6B 3DPRB 1KJRA 2VG9A 5CVRA 2DTYA 4YG0A 5JMCA 1VAMA 1OPOA 4XMAA 3M70A 1QQP1 2F6BA 1RUC2 1SBFA 3A4UA 4Y22A 1URXA 3MZHA 1UU6A 4YFWA 2CGNA 4SLIA 3N7JA 1RHI1 1SCRA 3I59B 4IEOA 1CONA 4M3CF 4Q1PA 4B7KA 5KXEA 1FPN1 1BQPA 1QF3A 2CV6A 1VBD1 2UY9A 3FUQA 4GH4B 4EWAA 5E8AA 4RR3C 1KFUL 2XVLA 1LOGA 2CY6A 5GKAC 3UJQA 2WT0A 4Q8LA 1ULGA 2UURA 2KXLA 2BNNA 5ACA3 1GZCA 4OUSA 4JGYC 4N9IA 4HN0A 3MFAA 2QCSB 4AQ2A 5FO8B 4BPZA 3KCCA 2DVBA 2D98A 4YW1A 4HBNA 1O7FA 4FTEA 2PLV1 1CPNA 3ZSJA 2JE9A 4FPEA 1K5MA 1JW6A 2PYTA 3S7EA 2VW2A 3R4SA 4RR3A 4YZ2A 1Q8QA 1NG0A 2WNUB 1H8VA 3EHKA 3E6BA 4JDMA 1IQAA 1YLLA 3CJIB 1OLRA 2PA7A 4K1YA 1MQTA 3VBRB 1V6OA 1FMD1 3RMYA 4Q0PA 3JD73 4W6WA 5FPXA 4KGGA 1D0HA 1QJU3 3KSCA 4NHMA 1SEFA 1E57A 1TME1 3BCWA 1H2KA 5A3MA 2CWSA 1AYN1 4XFHA 2DFCA 4EN8B 4IV1C 2BTVC 4AI2A 1GFF2 1YIFA 3ETQA 3LKJA 4LO4B 4G3YC 3DUIA 4QPIC 1Q43A 1BZWA 3MW4A 2BBVA 5EJ3A 3ZXAC 4AVTA 3KCXA 3FHIB 5ABJB 1TMF1 1CQ9A 2NMNA 3WQ7A 1SLBA 3VZJA 3IN9A 1SACA 3RG0A 2AH2A 2PHLA 5H9QA 3USUB 1HV1A 1BBT1 2ZGNA 1F31A 3I4IA 1BEV1 4FVVA 2CGPA 1QDOA 5J36A 1YUDA 3S0MA 3B93A 2GU9A 1SFNA 2A70A 3JCIA 4TLFA 2WZR3 2GNTA 3JQXA 1GNZA 1QJY2 1FOD3 2RS53 1XNBA 1JUIA 5JZGB 3ZYGA 3ZFFB 1JUHA 3OPZA 4YVWA 1NCQC 4HVQA 3NAPC 3ST7A 2IXKA 1AR73 3SNMA 4AEKA 2ZX1A 5AC92 4Y26A 1H8TA 1ZREA 2VNRA 1BVP1 4W65A 2RS31 3PVBB 5JI9A 1HRI3 2WS93 1LHUA 3ZFEA 1LR5A 1UPIA 2RHPA 3MICA 3IDEA 2XL9A 1PK6B 3SMHA 4HKLA 3N7KA 1X8EA 1TQ5A 3QCWA 3S6PA 2AGSA 5AFBA 1HQWA 3QOPA 5J96B 3GNEA 3AK0A 1AX0A 4XEZA 4COUA 2ZMLA 3LZZA 3WXPA 2RS11 4S2GA 3H50A 1RUD1 3ILRA 3WV6A 2SLIA 1J3PA 1NOVA 1CAWB 4I30A 2ZHNA 1C8M3 2ZMNA 3BOWA 2R063 1UAIA 2O8QA 2JG8B 5CFDC 4XF0A 4YM1A 1B35C 2HWC2 2ATFA 4HKWA 4CDXA 2YROA 1H2NA 1WW5A 1Y3TA 2B8MA 2BQPA 3QLQA 2UYBA 3FMGA 4TSVA 4BH9A 5BNOB 1POV0 1LCLA 3VBSC 4AFBA 2NP0A 2R073 2W68A 2XGXA 1ZBE2 2UY8A 1N1TA 4MVTA 1LESA 1V6MA 1RJ7A 4HK8A 3URFA 3H1YA 1VBB3 4AEDB 1O3RA 3MIEA 1Z7S1 2CGOA 3HT2A 3ELNA 4BWOA 4U36A 5T50A 1AL22 2WNEA 3PJQA 1RUC3 2VPVA 3PVNA 3J9SA 3DKWA 3OGGA 3C2UA 2WWSA 2WNVC 4MSVA 3LOIA 4K8FA 2BGCA 1R1A2 1VBE2 3H8UA 1OA2A 1QOOA 2JE7A 4FXGB 4IV3A 4XETA 4LUMA 4YW2A 1R081 1YFUA 2P3JA 1QOTA 2B5HA 1O5UA 5JI7A 3UK9A 5T5OA 3UKVA 3ES4A 3TN93 1CJPA 2B45X 1MVEA 5DUUA 2ZA9A 2H0VA 4QM9A 4GMP0 1OHFA 3AM2A 2XL7A 3AXEA 3WP6A 4HPKA 2ZPXA 5FBZA 2W08A 3JBG1 2DCYA 5JPMB 2E7TA 2WFF1 3AJYA 4I02A 3NL1A 5EFUA 2MEV2 1PHMA 1OA4A 1ZNPA 5D8AB 2BVVA 2K9ZA 4PIXA 4N53C 1ENRA 2CTVA 3VKFC 3CNAA 2DVDA 2EF6A 5D1IA 4E27A 5L73A 2R49A 1O4YA 1MEC1 3TB0A 1LHVA 2XJQA 2ZGSA 3E5UA 2IXJA 3IT8A 2XBO1 1DHKB 3HD8B 5FMOS 4ASMB 3AMPA 5JPNB 2OYZA 4ATEA 3ASIA 4XBLA 5EYYA 1DQ6A 1ULFA 2PHDA 3N35A 1S0EA 2Q5TA 4L99A 4MXWB 1AR62 1RUH2 3B94A 2DU0A 2DCZA 1RUE2 2X29A 4N9HA 1ALYA 1X8MA 4N53A 1AR83 4PJYA 1LOBA 2R30A 3D5OA 1LJ7A 2DVGA 2VNOA 4BMBA 3U11A 2Q30A 3M3QA 1C3HA 3NSTA 4BYYA 3DPRA 2R16A 2QDRA 4GH4C 1QXRA 1G9FA 2D44A 4Q4X1 1M06G 4S2FA 1WLDA 4ISRA 3NO8A 4Q4W2 1KJLA 3R0RA 3ROUA 3M3CA 2XJVA 1ZRFA 4N7UA 1Q56A 3VBFA 4AHXA 2DURA 3I59A 1PVC1 2ERFA 1T6GC 1DGLA 2ZX0A 4LE3A 1SMVA 1H1MA 1W2UA 2B42B 2CYFA 2K0GA 3S30A 3T1LA 3J8F1 5BYNA 1AR92 5BUVA 3J4UH 3K51A 1S0IA 5KWRA 1ZBA1 4H7LA 4E4SA 2FZ2A 1RIRA 3KGLA 4Q4Y3 2GSYA 1S55A 2WNUC 1W6NB 1H4GA 2A6WA 4CEWA 5FO9B 3IPVB 3BIWE 5AC93 3B9CA 4Q26A 1VJ2A 3FJSA 1HRV3 2HJIA 2CNAA 4IEWA 4L8QA 4ISQA 3WDVA 4B3NA 4P9YA 1RB8G 1ND3C 4WM7B 3ZSKA 2IC1A 3VBUC 2BW8A 2BNOA 2PHFA 5DG2A 5EXOA 4NN0A 1GV9A 1VRH3 5DZFA 3MYXA 4GALA 4YG6A 4E2SA 1HQNA 1OPMA 4I2OA 4NPRA 3WW4A 2HEYF 4E2GA 3IIAA 2XLAA 4XBQA 1U5IA 3CJIA 5C33A 4LBLA 1W6MB 3VBRA 5FLJA 5ABJC 1D4M2 2GNBA 2VGDA 4K1ZA 4XHBA 2B9UA 4PLOA 2BWCA 4KGQA 3WD5A 1YI7A 4QD2A 1KD7A 4BLJA 3GF6A 4IEQA 5F6LB 5GLTA 4Q4V1 5HBAA 4BM8A 2ZGOA 5JOZA 4G4FA 4AFCA 2VH9A 1S0BA 1GSLA 2ZHMA 1RUJ2 5DUVA 1BXHA 1JTZX 4IXLA 4LO5B 3V56A 5ACA1 3VZOA 1RMU2 5ABJA 1COV2 3ZVXA 1SFYA 1ZZCA 4P9JA 4K3UA 2HWE2 5C8WA 5JZGC 3TRSB 3ZFFC 3EBRA 4XE9A 1JH5A 3USUA 2RJKA 4WM8C 4HT1T 4AHWA 2EAAA 5EWSA 2A75A 1Z0HA 1HXS3 1I5ZA 1S1AA 2DU1A 1AL23 3WG1A 5KC5A 2D93A 2AUYA 2HKXA 3D8CA 3RSJA 1FV2A 3WVJA 4XJWA 5GLUA 1OSGA 3FBYA 1PGL2 4E4ZA 4D7SA 3H0OA 2R1BA 1VBE3 3JD71 5J48A 3FUOA 1QJU1 3ZFFA 1JYCA 3M2MA 5EV7A 1DGRN 3WG2A 1RJ8A 4IV1B 4J6GA 3JU9A 2WT2A 1FV3A 3VGIA 2WJSA 1N3OA 1LKNA 1WW4A 4K40A 2UYAA 2R042 4XIKA 1IS4A 2ZGMA 1RITA 1CN1A 1IKPA 2HEWF 4AYUA 3O5SA 4YNIA 4AGGA 4AI8A 4R9BA 3TYJA 1PK6A 2KA3A 1VP6A 2YHJA 1MS0A 3NVCA 2D40A 1CVNA 4XFBA 5IK4A 4OLLA 5I8YA 1QJX2 1LENA 2D43A 4K21A 4COWA 3FE5A 1B09A 1UKGA 4K20A 4XF3A 4TWTA 1KQRA 4FPJA 5FPZA 2PN5A 3IDBB 3ZXLA 1CAWA 5JWPA 2MPFA 2WIIB 2WZR1 1RUOA 4AEDC 3IWZA 1IZ3A 2I74A 2JG8A 3AFKA 4M3CB 1REFA 3KZ4C 2TUNA 4XZPA 1FOD1 2RS51 3SH4A 2H0BA 3M8LA 3RWNA 5T54A 1NCQB 4BMEA 3NAPB 5BNOA 5KXBA 4Q0SA 1AR71 1QXPA 3DN7A 4YGEA 4PF5A 5LEKA 4IQPA 4EN7B 5TSWA 5SV5A 1H1AA 5CADA 1HRI1 3AB0A 2XJTA 1JHNA 1PO22 4KWLA 2VU9A 2Z79A 1OD5A 3HAGA 4AEDA 4JRAA 4KG8A 4DOUA 3M4FA 2E51A 4YG3A 4MZUA 4DQAA 1N1YA 4LEJA 1BCXA 1VBC2 3VKOA 2H6BA 4RGGA 1GBGA 4BE3A 2DUPA 2IXLA 2IZWA 4YLZA 4XJ9A 1RINA 3JB8A 4LLOA 3RDIA 1VB4A 4R52A 4XF4A 5BNNB 5KHIA 4UW4A 1KDMA 4LHKA 4MGKE 2YGMA 3MW2A 2HWD2 3HQXA 2R061 1LOFC 2W39A 3RS6A 3SISA 1AR93 1B35B 5GZCA 1YFWA 3BPZA 5T55A 1REDA 1UIJA 3PMSA 4P9LA 4QX5A 4LBJA 4B29A 3NW4A 4A7KA 3WDTA 2YGLA 2R071 5CBLA 2X5IC 5D8AA 1U5XA 4NR1A 5L7OC 2R1DA 1ZRCA 4HMZA 3MLKA 3IBMA 3AMNA 4XYXA 3IDCB 2ET1A 4WVZA 5HI0A 1J59A 1VBB1 1IS3A 1G9AA 3AP5A 2FQPA 3KQRA 3M7AA 2DVFA 4LBOA 1QH7A 1WW6A 3KMHA 3KT4A 1RUC1 3LA7A 4PIYA 4B4QA 5DUWA 1DZRA 2EXIA 4CP0A 5IT6A 1U5YA 1J58A 4Q0VA 4YVSA 2WL1A 1LHNA 1MS9A 4V1PA 2ZAAA 2EA7A 3ZFGA 4MXWA 2BUKA 3EJKA 1DZTA 2HEVF 1JBCA 4LO6B 3TN91 4FXKB 4CDQB 1WW7A 1XE8A 2IFRA 5CG8A 1X82A 1ZVFA 1WBLA 5CA6A 3L2YA 1YWKA 4BLIA 1XE7A 4DRRA 1C5IA 1DIWA 1OI6A 1RMU3 3FFQA 1PO13 1OOPB 1KDKA 1QHDA 1CAUB 4KG0A 4QPGB 4YSFA 1F5FA 4AQTA 1GYKA 3MDPA 2E7QA 1PIV3 3OY8B 4B7EA 3N7LA 3E6DA 2EXKA 1NCRB 1CX4A 2A3WA 3NV4A 1RVF3 3FBMA 2WKKA 3V65A 4MUVA 3AZVA 4N43B 2WFPA 1YNAA 4FPLA 3AKQA 4J1WA 4WM7C 5H9PA 3VBOC 4HSLA 3B3QE 2GMMA 4QPYA 4GB32 2G9GA 4RHV1 1CJDA 4GWNA 3VHRA 1W6NA 2K2SA 1VAKA 5BV6A 2D6OX 3IPVA 3U07A 1AR81 5JSRA 2DCJA 2RMU3 3B69A 2D3SA 4IESA 2WLPA 2I07B 2R043 1NLRA 3HT1A 4C0HA 1NA1B 4LUKA 4WM7A 1YO8A 3V64A 1G7YA 1OMIA 2OZ6A 1LEDA 2Y0OA 2HWF2 1APNA 2YYOA 1QJX3 2A6ZA 4BIFA 3TAYA 1BYHA 1FI2A 3VBHC 4JDNA 5CU1A 4OUMA 3V0BB 3IKWA 3G7DA 4JRLA 1OFSA 1UCXA 1Q8VA 4AHYA 2GDFA 3LSDA 1IHMA 1EP0A 2AENA 1O5LA 4Y1XA 4QGLA 1HV0A 1XRUA 2DFBA 3T1MA 4LBQD 1FX5A 2NN8A 1EAH3 1S0CA 4GQ7A 4B4RA 3TWIA 3NV2A 3TOJA 4XJ8A 4Y1UA 2ILMA 2JEMA 4Q4Y1 1F2NA 4IEZA 4P14A 1YHFA 1AXYA 5FREA 4JGYA 1GR3A 1DG6A 3MIBA 1ENXA 2FBEA 1RUG1 1HRV1 4LBQA 2XJPA 4M0NA 1RTVA 3LA2A 1ND3B 4ITCA 1CAXA 3VBUB 1BMV1 2DWRA 4Q8KA 4L9BA 3ZXKA 1VIWB 5BPXA 5HXVA 1VRH1 3VDDC 2PHUA 4FP3A 2VOVA 1YXWA 3ZIXA 5L36A 3MIDA 1LODA 3B00A 1CD3G 1QQP2 4YFZA 4LBKA 1GNHA 4Z07A 1MACA 1RL3A 2ZKNA 1KS4A 2A6VA 4GXLA 3GHNA 3SH3A 2LTNA 2HWD3 3WP4A 4FT8A 1MS8A 4FPKA 1SLIA 2NLRA 4IV1A 1FPN2 2VY0A 4MX3A 3WDWA 5FTTC 4QPIA 1ASJ3 5T5PA 3A0NA 3GALA 3ALQA 1SCSA 2ZX3A 1R093 1N47A 3OGJA 1TNFA 3WOGA 3J26N 1LOCA 2OW4A 4AFAA 4EROA 4MH0E 3AKTA 3TNQA 4L2NA 3V0AB 1DYKA 1SQ4A 3D82A 4DB5A 2D5HA 4R4ZA 4Z1VA 1XU2A 4WM8B 2IXIA 3FFZA 3MFCA 3MGUA 2PLV2 4MV2A 3BTAA 3UJOA 4R9CA 1ND2B 2VOWA 2V73A 3WUDA 3WDXA 1HXS1 2JG9C 4WZFA 1OQ1A 1VB2A 3BU7A 4COZA 1AL21 2VXRA 3H7JA 5JVVA 3B5LB 5CNAA 4LLFA 1XYPA 2E63A 3MPPG 4M3CA 4F7ZA 4RS5C 3SCHA 4E4DX 2GMPA 3ZIWA 5F1RA 3M3EA 1CAVB 1VBE1 4XILA 4HVOA 2ZOEB 3UV9A 5J7MA 4OHWA 1NCQA 4XQDA 3NAPA 5FO7B 2LUWA 4H55A 4RA0A 3D4KA 2C1FA 2VOXA 3OCPA 2ZGKA 1V9U3 1TME2 1CGPA 1QU0A 4NWWA 4DFSA 1H2LA 5BNNC 4Q2FA 4NWVA 1WD3A 4HZFA 1O3TA 5H9SA 1QJZA 1Q5OA 2XWBB 1NYWA 5GZGA 1MS5A 4CDUB 2Q0AA 1RUI1 4XF1A 4KWJA 4QM8A 1TMF2 2QJVA 2QFEA 3OD0A 2P2KA 2ZAHA 3WG3A 2JXAA 2P37A 1KXGA 1BEV2 4FOYA 4WVMA 4HSJA 3E5QA 5BNNA 1O3SA 4FPFA 4C0BA 4Y4YA 4C90A 1H2MA 1W0PA 4CP1A 4Y1YA 5CFDA 5E88A 4JAAA 1B35A 2D7FA 2PHRA 1OA3A 1WA4A 1J1LA 3ZN6B 1YYNA 4XIOA 3VBSA 4Q27A 3OD4A 4URTA 1C28A 4PIZA 2SBAA 2TBVA 2YV8A 3WX5A 3KT7A 2NZ9A 5B2GB 1QNWA 1C8NA 2C0ZA 4OI1A 2NYYA 3WNXA 2RS32 3TBDA 4XF9A 4P9GA 4PLNA 3SH5A 3CJXA 4JGZC 2DV9A 4CDQC 3PJYA 2BNMA 2RE9A 2XKPA 4XFFA 5HCFA 4FOVA 3M3IA 1Y7BA 5GZEA 4ES9A 4DRVA 1X7NA 2LM3A 2WNVA 2RJLA 1OOPC 2Y38A 3POSA 3LA3A 4QPGC 3CLPA 2RS12 1H9PA 2VMHA 1RUD2 4F8AA 4DY3A 3B02A 5F6KA 2D6NA 1NCRC 2D97A 3QACA 1XNKA 4MXVA 1AYM2 3HMYA 3VV1A 2RM22 4N43C 3WR0A 1UL9A 2BYVE 4NHLA 1QDCA 1WBFA 2YDEA 1ZZ6A 2X5IB 4BOWA 1JN2P 2XWJB 4AGVA 2WZPP 1CAUA 2I2SA 4QPGA 3WLUA 5L7OB 5AVPA 1X36A 2YC0A 2YUEA 2D3PA 3OY8A 3GZTB 1AX2A 3EQEA 2B46X 1MS1A 1W6PB 1OLQA 4D94A 1Y9QA 3GHMA 2QDNA 1Z7S2 1NA1C 2A5ZA 3I7DA 2Y26A 4RL7A 3O7OA 2KM2A 2AZ5A 3VZKA 5BXXA 1FNZA 4YGDA 1NY71 4YW5A 3FX3A 3UKTA 1EV12 1KRIA 5I8SA 1C1FA 4INDA 2VMGA 5BY5A 1R082 4AG4A 1FYUA 2ZZJA 1NZCA 2JECA 3AZYA 1ZZ8A 1NA1A 3N4MA 4AF9A 1QJY3 3B01A 1KFXL 2R6QA 3H1WA 4GH4A 3WQ0A 2GN7A 1RUF2 1WMFA 1UMZA 1PO11 4NVPA 5CIRA 2QQPA 2DVAA 4QQ2A 4YZ1A 1QNYA 2WFF2 5FFOC 1AHSA 3AFGA 4MLOA 5T52A 3H9AA 2AYHA 2O1QA 3M1HA 1VBA2 1PIV1 3AZZA 2PLV3 3LGRA 3ZYRA 3V0BA 2Z69A 5A3LA 1RVF1 4XJZA 4AEJA 3IMNA 2QNKA 4BA6A 2EAKA 4J1XA 3VBOB 2P17A 3WW2A 1NLSA 4YW3A 3WCRA 4P9WA 2WNUA 1EYBA 3AP6A 4HKOA 1LGNA 3RQ0A 1ZYBA 4AW7A 2ARXA 4CEYB 4XFAA 2Q4SA 4QGMA 3ZX7A 1SLAA 2RMU1 1S0JA 1F9KA 2PAMA 3HWJA 4Z2WA 2R041 1TNRA 3MIGA 3GZAA 1ND3A 1NXMA 1RC6A 1DDLA 3VBUA 2WA4A 3PMEA 2W52A 1SDWA