3PNAA

Crystal structure of camp bound (91-244)ria subunit of camp-dependent protein kinase
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
129
structure length
129
Chain Sequence
VRKVIPKDYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFPVSFIAGETVIQQGDEGDNFYVIDQGEMDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cyclic AMP Analog Blocks Kinase Activation by Stabilizing Inactive Conformation: Conformational Selection Highlights a New Concept in Allosteric Inhibitor Design.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
molecule keywords cAMP-dependent protein kinase type I-alpha regulatory subuni
total genus 32
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature ec 2.7.1.37: Transferred entry: 2.7.11.1, 2.7.11.8, 2.7.11.9, 2.7.11.10, 2.7.11.11,
pdb deposition date 2010-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3pnaA01
3SXWA 4EROA 2GC2A 1YUDA 1Q5OA 4MZUA 4WBBA 3BU7A 1QWRA 1UIKA 4MUVA 3RZZA 2BNMA 3BCWA 3DL3A 1OD5A 3KGZA 4IERA 1PM7A 4Q0SA 1J3PA 1OFNA 1ZRCA 3FE5A 1GQGA 3RPQA 5BY5A 2PA7A 5C6CA 1FI2A 1DGWA 3FX3A 3S7EA 4LUKA 4UXAA 3TNQA 4YARA 4EWAA 5LEKA 4HN0A 1UW8A 5KHGA 1I6XA 3GYDA 2ATFA 3KGLA 1V70A 3SHRA 1LR5A 1DZTA 3RNSA 2F4PA 1L3JA 2GC3A 3CL1A 1ZZCA 4FBFA 3N4MA 4BHPA 1O5UA 3E6CC 5EZWA 4QMAA 4L2NA 2PTMA 3SCFA 4I0BA 1YHFA 5J48A 1EY2A 5CADA 3ES1A 3H1WA 2OYZA 1RC6A 2KXLA 4OLLA 1X82A 1RTVA 2Z2SB 2ETEA 1Q3EA 4WVZA 4HN1A 5BXXA 3LA2A 1I5ZA 4PIYA 1VJ2A 2MNGA 2VPVA 4XFGA 4E2GA 4IEUA 1WGPA 1VP6A 1X8EA 4XFBA 1NE4A 1SQ4A 2UYBA 1UIJA 4XF4A 1X7NA 4O9GA 5J3UA 1RGSA 4FAHA 4IEVA 1RUNA 1H1IA 2GC0A 2QCSB 4CYDA 4MGKE 2IXIA 2D5FA 1ZZ7A 4KU8A 2CV6A 3GBFA 5I91A 5AVPA 2FQPA 2IXJA 4KWLA 5I8SA 4MGYE 1YLLA 2IXCA 4AVAA 2IXHA 3RYPA 2XLAA 5I0TA 4WZCA 2Y0OA 1NE6A 5FQ0A 2GH2A 2C0ZA 4XFHA 4QM9A 1UD1A 4H7LA 1O3QA 2EVXA 3O14A 3BB6A 3CJXA 2IXKA 5FPXA 1LB2A 4J1XA 4TLFA 1ZZ9A 4Q0QA 3FHIB 4QXKA 2DCTA 5I8YA 5BPXA 3EBRA 2ZKLA 4BYYA 4QGNA 3QOPA 4I0AA 3EJKA 3SCHA 3D0SA 3H7YA 3G7DA 1NXMA 3E5QA 4UBHA 2Q0AA 5KBFA 2K0GA 4OFGA 3IDCB 4EWEA 4I02A 4BIFA 3SCGA 2UY9A 2H6CA 1X8MA 4LUMA 1CAVB 5FCCA 1GQHA 2GC1A 2XKOA 4LTAA 3KCCA 1O3SA 4AQ6A 3BPZA 3U10A 1O5LA 4F7ZA 3LA7A 1YFYA 2N7GA 2Q1ZB 2MHFA 1U12A 5FLJA 5FLIA 4IEXA 3VHRA 2B9UA 3FZ3A 5HI0A 3FJSA 4EWDA 3ES4A 4KWKA 4XETA 1QXJA 4MH0E 5JSOA 2E9QA 2OZ6A 1IPKA 1O7FA 3H7JA 5EFUA 4XFCA 2QJVA 4E2SA 3UKTA 4B29A 5LEJA 2CAVA 3H1YA 2IXLA 3HT2A 4IESA 3OGJA 4AVCA 4DINB 1JUHA 3E6BA 4R52A 1Q43A 3CEWA 5I93A 3IWZA 3UKVA 2QDRA 1Y3TA 2PHDA 4XF1A 5I0UA 1YFXA 3NVCA 1RUOA 5F1RA 4QM8A 3FWEA 2MPFA 2PFWA 4L11A 1EYBA 1ZVFA 4QGMA 3RYRA 4N9HA 2BGCA 3EHKA 4IEOA 3B02A 4A2UA 1DGRA 3I59A 4UBGA 2H0VA 1FT9A 4HLTA 3S7IA 3H3UA 4PIXA 1CX4A 2D40A 3H50A 2ET1A 2IC1A 3IIAA 4Q0PA 3KSCA 3H1MA 3DV8A 3BALA 2PYTA 3DN7A 2CAUA 5FQ0B 2P17A 5K8SA 2O8QA 4HSJA 1HW5A 3NW4A 3D0JA 2HKXA 1H1MA 2BEOA 3ELNA 2B5HA 3DKWA 1ZZBA 4YYOA 5I0RA 1NZCA 5BV6A 3E6DA 3LWCA 1YWKA 3WW2A 5JAXA 3LOIA 2GU9A 4MV2A 1O3RA 5J7MA 1ZZ8A 5KHHA 4HZFA 1VR3A 4AVBA 3PVBB 2OA2A 5JR7B 4MGIE 3ROUA 4IEQA 4ZU4A 1J3QA 3HT1A 1RL3A 2PAKA 2GZWA 3UKNA 3WW4A 2D93A 1ZREA 3PLQA 1CAUA 4E2QA 1SEFA 2CGPA 4LA3A 4XFAA 3EO6A 2FMYA 3HQXA 3EQEA 2QVSB 4F8AA 3H3ZA 3S0MA 4HSLA 5FPZA 2EAAA 3U0ZA 3MYXA 1YFUA 3IDBB 3MZHA 4XF0A 4Q0VA 2BYVE 3LZZA 4LA2A 4J1WA 4YRDA 1EPZA 1PMIA 3OCPA 2B8MA 4IETA 4IEPA 1Y9QA 1ZRDA 3R6SA 3CO2A 2WFPA 3NSTA 4QGLA 1XE8A 2Q30A 3HIFA 2GAUA 1YFWA 2BNOA 3E5UA 1ZX5A 1O4TA 1QXRA 5D1IA 2HJIA 1ZRFA 4KU7A 4PJYA 2I45A 3I54A 3I7DA 4X6QB 3WW1A 3JZVA 5CVRA 5LRSA 2QNKA 4R8HA 2XL9A 5E1RA 4Q0UA 4XFIA 4ORFA 4IEYA 2VQAA 2PAMA 5I0SA 3OF1A 4XFFA 3WW3A 1UPIA 2XLFA 2Q4SA 5KHKA 3D82A 2Z69A 4I09A 3MDPA 1O3TA 3ETQA 2D5HA 4LLOA 1CAXB 4LULA 4Z07A 5LRRA 3IBMA 1OMIA 2OPKA 3RDIA 3TNPB 4HMZA 4RD7A 4FAGA 4HVOA 3ACLA 5KHJA 4MX3A 4XEZA 1EP0A 5I8TA 4XF9A 4BH9A 3RYKA 2UYAA 5KHIA 1TQ5A 1J3RA 2PAEA 4IEWA 3M3IA 5C8WA 3KMHA 2K9ZA 4JTNA 4N9IA 3L2HA 5CU1A 3NJZA 5JSRA 3LAGA 5FDBA 3E97A 2ZCWA 4JVAA 1CAXA 4D7SA 2XHKA 2O1QA 4NVPA 3ST7A 3QACA 3SMHA 2BNNA 2V09A 4I2OA 1IPJA 3FFQA 4JTOA 1LRHA 3U11A 1DZRA 4Q29A 4ZU5A 2VECA 3NL1A 4KL1A 1CAWB 5JSPA 2EA7A 1QY4A 5FLHA 1J59A 1CAUB 4PIZA 4HVQA 3CF6E 4K8FA 4JV4A 1CAWA 1J1LA 4IEZA 3CLPA 2UY8A 2H6BA 1LKNA 1ZRRA 4I3PA 3E5XA 5T3NA 5BUVA 3MPBA 3OD0A 4Z82A 4GULA 3H9AA 4HBNA 3C3VA 4YSFA 5JCTA 4I01A 4QX5A 1SFNA 4ZU7A 1WA4A 3LA3A 3H8UA 1J58A 2PHLA 3USSA 3M70A 3ZDSA 3PNAA 2XL7A 3I59B 4P9GA 1WLTA 1XRUA 4ONUA 2XGXA 4EV0A 2ET7A 4YNIA 1FXZA 2XLGA 3NKTA 1CAVA 1OI6A 4X6RB 4D7TA 1CGPA 5E16A 1ZZ6A 1UCXA 4XF3A 2XKPA 4META 4KWJA 2OZJA 3OTFA 4HVRA 4MGZE 1NYWA 2WC2A 2PQQA 1G6NA 4AQ2A 4AXOA 1ZNPA 4O9EA 1XE7A 4LEJA 4FT8A
chains in the Genus database with same CATH superfamily
2D6KA 1XB9A 4Y20B 3SLIA 2RJKA 3BU7A 1UIKA 1COV3 5DAQA 3R05A 3RZZA 3NV3A 5EPAA 2HWF2 4MXVA 2Y60A 1GOFA 1QH6A 4YZ4A 1DQ0A 3ZMNA 5CBLA 1L7LA 3DPRB 3WF2A 3RZMA 1DG6A 3O12A 2Y33A 3J7NA 3KCYA 2A6ZA 3FE5A 3T09A 1DQ5A 2PA7A 4JZRA 1FI2A 5ERLA 2LALA 4H7MA 4UXAA 3KF5A 2GALA 4FTSA 4FPKA 1UW8A 1J1TA 1I6XA 2QTWB 4BK4A 2WKKA 4GH4C 1AUYA 4QT6A 1V70A 4XBQA 3ZXDA 3SHRA 4HANA 3DPRC 4CDQC 5LZ6A 2Y6JA 3AZXA 1HQLA 2RG4A 3C7GA 5FZ4A 1VBE2 1R081 1ZZCA 3RS6A 3BIEA 4IE4A 3KHCA 3N4MA 4QQOA 1UY1A 2BFUS 4E4ZA 3ZFEC 1DLLA 4QMAA 4L2NA 1F8VA 5K0UB 3VBOB 1MEC1 2XMLA 1AR61 1RUD2 2ZX1A 4NRPA 4V2WA 1HQNA 1JH5A 3SCFA 3GZEA 3WINE 1YHFA 3ZM8A 1FPN3 4E4DX 1AJKA 1WW5A 2P1BA 3H8XA 2OYZA 3JUUA 2XQXA 2XJQA 2QQUA 2RS32 3KQ4B 2PELA 1SLCA 4UW4A 4WVZA 3LA2A 5CFDA 1ZBE1 2HWE3 2VM9A 3Q8EA 2Z79A 1I5ZA 1W6QB 3VUOA 1S0JA 2DVDA 2ZEWA 1QJZA 3PVNA 3I4IA 2CHHA 2X29A 4J25A 4OHWA 4XF4A 4NOTA 1WLDA 2RVAA 2ZGKA 1MS1A 1ND3C 5ABJB 1UYYA 1RINA 3OGVA 1ZM1A 2LM3A 5J3UA 2QQPA 1H8TA 2HH9A 2RV9A 4N7IA 4OUMA 2HBTA 2WINB 4FAHA 4IEVA 1AR63 3ZX7A 5FK7A 4ES9A 1XNCA 2HWF3 4AAPA 1OPOA 1JYNA 1RUE3 1WUVA 4KU8A 2W91A 1DU3D 3GBFA 4Q26A 4CCDA 3HPNA 4ET7A 2IXJA 4KWLA 1HV0A 4LE3A 4QD2A 4A44A 4L0PA 2GP3A 2YC4A 2IXHA 5ACA1 3RYPA 2XLAA 5GJ6A 5E6HA 1WW4A 5I93A 4M4RA 1DFQA 2X09A 1PGW2 4BQ3A 1YJLA 5A6YA 2ZGOA 2VC9A 4QDSA 4SBVA 4QX0A 5BNPB 4AGRA 1RMU3 2BGOA 2VJXA 2WRAA 3CJXA 4ASKA 3AKPA 1TNFA 3HEIA 4BQ1A 5J37A 3PTYA 5FJKA 4QXCA 1US3A 4XAEA 3ZPYA 4RS5C 1ALYA 2P34A 1VBA2 3AL5A 3CZUA 5I8YA 1FOD3 5FY0A 1OBNA 4KGQA 2P3JA 4BYYA 4W50A 1W6MB 4XHXA 5KXDA 3KLSA 4HPKA 1QJU2 4B8EA 3NV2A 1ENRA 1W06A 3ACIA 3GZUC 3H7YA 4FVVA 2ENRA 4CU8A 2A6YA 2PHUA 4UFJA 3ACGA 4JAAA 3E5QA 5FY9A 2VW0A 3VBHC 4B1LA 1LHOA 4BXFA 2QQVA 1AL23 3NAPA 1LEDA 4P9YA 5JXIA 2XJVA 1WD3A 2GMMA 4G3YC 3WCSA 4P08A 5JOXA 1TMF1 1EUTA 2ARCA 1RYYA 3ZN5A 4LK7A 2WWSA 3IPVB 1IS5A 3MGUA 5DZFA 4P00B 1CAVB 4LHNA 2ZAHA 1GQHA 5IFPA 1ND3A 4Q1PA 5A3TA 5HXMA 5DAXA 1G9CA 2BGPA 4BZ4A 3JB8A 3QH7A 1R1A3 1VRH2 3U10A 3POSA 1W9FA 1WD4A 1PO21 1QNYA 2Q8DA 1WZXA 2OPWA 1YFYA 2JDAA 1CPNA 2ZEYA 4IQPA 2MHFA 1G7YA 4NIDA 4HL0A 4QPIB 2RDQA 3V0BB 3WP4A 2RS12 3OBTA 2VQTA 2XH6A 3VB9A 3FJSA 1DF0A 2YXSA 4RR3B 4CP9A 4MH0E 2DCYA 3DCQA 2VMEA 4I3GA 1UOGA 2FDFA 5EIYB 5FYYA 4FQZA 3IM0A 3SITA 5JLVA 4N90A 4A6OA 2PXJA 1JBCA 3I2KA 4GKXA 1AR82 1IPKA 3A21A 1O7FA 3H7JA 4RSUA 1JHNA 1OH4A 4N53B 4KQ7A 3VBUC 1UU4A 3ZSJA 4AI8A 1JZ5A 5C70A 2VTXA 1W6OB 3HT2A 4CEWB 1JYVA 2YZ4A 2D98A 2VMHA 1HJGA 1RUI3 1Q43A 3I2GA 5LBEA 2WBKA 1N1VA 3CEWA 4FPLA 4AI0A 1Z7S3 5FPAA 3IWZA 4LJHA 4Q4V2 3UKVA 1Y3TA 2KA3A 2XPJA 1VBB3 2EAKA 2ZS6B 4GMP3 3VBSA 3NVCA 2VMFA 4PLNA 4UT5A 3ZXGA 2BUKA 3KCXA 5A6ZA 2MPFA 4RQPC 4NROA 2VUAA 2JB8A 1KEXA 3PURA 4PBPA 3SQOA 3KV5A 3WHUA 3NNLA 4XJ8A 4KBBA 4RHV3 1XNAA 5CIRA 4QAWA 3SISA 1BEV1 3IDEA 4CA9A 2H0VA 1CJDA 2R072 4HLTA 5DUVA 4COZA 3D5OA 3VBOA 3THCA 1JOJA 3LCPA 1FMD3 3T0AA 1D2SA 3WV6A 1RVF2 2W52A 2ZX0A 3LEGA 3RWNA 1C8M1 2EXJA 1OLMA 5DG1A 2DUOA 1UF2C 1C57A 3UL2A 3KSCA 4UFIA 4COYA 4NHMA 3VKMA 5FQ0B 1QOSA 1RXGA 2P17A 2Y6FA 4K20A 5LA1A 1RUE1 2J1TA 4HSJA 3O1TA 1SLBA 1D4M1 2RR13 4K9SA 3K51A 4OUSA 2Y6HA 5GLUA 5FR3A 1OLRA 2VOVA 5JIUA 3GNEA 1FV2A 3ELNA 1JTZX 2DUPA 3MHZA 4FOWA 4MADA 3B69A 2GDFA 3PIGA 1VALA 3FHAA 3WSOA 1PIV2 2R30A 5EJ1B 3WW2A 1PGL1 1FYUA 1E5RA 1XOYA 2KM2A 2UURA 1Y7BA 2W3JA 3U37A 2J1UA 1H8TB 1ZA7A 2KR2A 1OQDA 5J7MA 1VR3A 2BWCA 1WKYA 1MS0A 3PTRB 3PVBB 1C8M3 2OA2A 1ZBE3 2HWE1 3DGTA 4AI2A 4ZU4A 2R041 2PAKA 4IV1A 3ZKYA 1R64A 4K8RB 4H14A 2W1QA 2X05A 3UKNA 4Z2AA 4FP2A 1T2XA 2JG9C 1UOJA 1YRZA 2WS92 4BLIA 1Q8OA 2D93A 3PLQA 2W94A 1CAUA 3O1RA 1MVQA 1UOBA 3AVSA 3PVEA 3LEMA 2WZR2 4XFAA 1LOEA 5IVFA 3POYA 3HQXA 4Y22B 3J7LA 3WG4A 5HV0A 1QHDA 2OQ6A 4XTPA 4Y24A 3WNPA 1PZ8A 3M1HA 3LE0A 4XIKA 4AOCA 1AVBA 1ND2C 4AG4A 3S0MA 4YG3A 1RUC1 3JB4C 4QKBA 5DN2A 1YQ8A 2FCTA 1R1ZA 4NHYA 5JOYA 2Q8OA 3M7AA 5HXVA 5T55A 4FPYA 3IDBB 2ZGRA 4OYUA 4DUXA 3LZZA 2WUHA 4MVTA 3FFZA 3K3OA 1UX7A 1MZEA 1EPZA 1K45A 4GB31 4RS5A 2DUQA 1ACCA 1LU1A 4S2FA 1DZQA 5FYCA 4ES8A 2I2SA 5IVEA 4QB1A 3CO2A 2ZX2A 1XE8A 5FBJA 1G8WA 3TWIA 3VKLA 2WT2A 5IATA 2FDGA 3GXUA 1GBGA 5FO9B 1ODNA 3ZYPA 3RI8A 4XBNA 1O4ZA 4JKKA 1VBB1 2VH9A 1OUXA 2ZMLA 2K46A 1S0DA 5AC92 4LORA 2YPJA 1OD3A 5IVVA 3LF7A 3IPVA 1KS5A 4MLOA 4Y3OA 4NIGA 1VMHA 2PHWA 2DYCA 4CCKA 3USUA 3ON7A 2JECA 2Q8CA 2A75A 2ZHLA 5SV8A 5F9TA 2QNKA 5A3UA 2VNVA 1F4HA 4AR2A 2J1VA 5E1RA 1PNGA 4QKFA 4Q27A 4YFWA 1PVC1 3C7FA 4E4HA 1H8TC 4R9DA 2YC2A 3CJIB 4XQDA 2PAMA 3TYJA 3HNYM 4HT1T 3FL7A 4DO0A 4DB5A 1MVEA 4NPRA 3RMXA 4AYUA 1RUI1 4S2HA 3J7HA 5KR7A 3MDPA 5F3EA 2WO7A 2WFF1 1DQ4A 2VG9A 3ITQA 2OPKA 1Z0HA 4FAGA 1H6YA 4A7YA 4HVOA 1IOAA 2FDIA 3ACLA 2ADEA 1UY0A 4JGZB 1SFPA 2VTFA 5CZKA 4QX1A 2JB4A 5GALA 3VHNA 1RUH3 3VBUB 5FZKA 4NAMA 4PQQA 3JD71 1N3OA 1R1A2 5JZGB 2XDVA 5KXCA 5J09A 3KMHA 2OX0A 5B4NA 1QJY1 5JPMB 3WQBA 3KT4A 2C5DA 3L2HA 5DDJ3 1L7RA 3W21A 5JSRA 4P5HA 1Q8SA 3LAGA 5GZFA 4AFAA 1HJFA 1PZ7A 2A70A 2RS51 4WVMB 1D7PM 1AR72 3WXPA 2WAAA 5C3QA 3VD3A 2ES3A 4PT6A 3LIHA 1W2AX 4Q4X1 3AKRA 4I2OA 1IPJA 3FFQA 4JTOA 2WQ8A 2BERA 2NZ9A 4CU7A 2W95A 1LAJA 1FATA 3RQ0A 2AZ5A 1DZRA 5FMOS 1SBFA 3JBG1 4NPMA 3FUOA 5FZAA 1VPHA 1CAWB 1PO12 3NNFA 4CXYA 1NOVA 2BVBA 5FLHA 2VULA 1LESA 2F17A 1BVVA 1PO11 4PIZA 4WM7A 3KD4A 4ZS2A 1KFUL 1DIWA 5ACA3 2B46X 1J1LA 3JU9A 4Q8LA 5F6KA 2ZTNA 4L8QA 1BXHA 4RHV1 2AENA 3E5XA 2OXBA 4YZ1A 3S5AA 4ASLA 4LLFA 1SDWA 2FMDA 3EYPA 4COVA 5BNNC 1W9YA 1EV13 4Q4X2 5GLVA 5BNOA 3R4SA 3H9AA 4XBLA 3C3VA 5FPBA 4E8DA 4BQ4A 1V6LA 1WA4A 4O61A 5FXZA 1XQNA 2WZPP 3H8UA 1HRI1 2PN5A 2IUWA 3M70A 2HWD2 4Q1RA 5DAVA 5FRAA 4B4QA 3WG1A 3DYOA 1GNHA 1BMV1 3T2TA 1WLTA 1XJAA 1V6JA 4WV8A 1FNYA 2XVKA 3GDBA 2HBUA 4AVVA 3PU3A 4W8JA 4UWDA 3M3CA 4X6RB 1NY72 4X8PA 5DAPA 5FY4A 2JDNA 2BBVA 3A4UA 4CUGA 1N1YA 3T0BA 1UCXA 5E88A 4ZZ5A 3ZSEA 2TBVA 1CZTA 1JN2P 1S1AA 3DYMA 4JC1A 4B4RA 5C8CA 2GNTA 4LBJA 1QJY3 3WHTA 1XC6A 4H2AA 2JE7A 1V9U1 1LOAA 1VMFA 4HVRA 1UZVA 5EYXA 3HOBA 4ZY9A 5FMBA 4CPBD 5DG2A 5FXWA 3CMGA 3NV1A 4N43B 5F5AA 2PQQA 1IPSA 1G6NA 1S0EA 2QQLA 2XJUA 2AEZA 4O9EA 2RMU1 2F6BA 4AZZA 1PIV3 3MLJA 4OI1A 1KITA 2W47A 2GC2A 2ZEZA 3S30A 2I74A 4MHUA 4MZUA 3GHMA 1CVNA 2J7MA 4KG8A 4RFRB 4UF0B 4FTBA 4L92A 3ZYFA 2D6NA 4MUVA 4A3ZA 1V0AA 1VBC2 1SLIA 1ND2A 2BNMA 2QE3A 3BCWA 4TN7A 3DL3A 3AMPA 1VB4A 2DCKA 1J3PA 4E9KA 4JX0A 3U4XA 1WCQA 1GOHA 4UI9L 1OA4A 1PMHX 2JDYA 2YFUA 3RPQA 4A45A 2VD7A 5J36A 1DGWA 2C9AA 2XHNA 2RM21 4LO5B 4CCOA 4BMBA 4Q4Y2 3TNQA 3ACFA 3PUSA 4EWAA 1QJX2 2VQ0A 4Q4Y1 3OPTA 2P37A 2JD9A 2RM22 4YVWC 3GYDA 3OJBA 4AHYA 1C1FA 4RGGA 1DZTA 3RNSA 1QMJA 4LO8A 2GC3A 4YVSA 5T5PA 2WNUC 4FBFA 4BHPA 4LE4A 1F5FA 2AREA 1LECA 2YC0A 4N53C 1VBC1 5LK7B 1JZ2A 1XSRA 2D3RA 4MGTA 4I0BA 2DBNA 4XCAA 1EY2A 5CADA 4IL7A 1JZ6A 2QQWA 1UMIA 3CNAA 4KNCA 4PBOA 4OLLA 2JE9A 2K2SA 4AEDC 3SEEA 1RTVA 3ILRA 2DDUA 4K1ZA 1RUF1 4RR3C 5A6QA 3RFRA 1HRV1 4HN1A 5BXXA 5F39A 1B35A 3M2MA 2EXIA 1AX0A 1PNFA 4LBOA 4XHBA 2R043 3LDKA 4GWIA 1OC1A 1VJ2A 1AYN3 4AFCA 5C5TA 4E2GA 1O6UA 2BJSA 3DYPA 4IEUA 4NRMA 2B4KA 5D21A 5FZ1A 3WDUA 1X8EA 2VZOA 4XFBA 1NE4A 1SQ4A 1F4AA 1V6MA 1LEMA 1UMHA 2P6HA 3URFA 3VBOC 4ARXA 1X7NA 5IW0A 5FO7B 3RG0A 4CDUA 1JZ7A 4N8MA 1SLTA 1NY71 4JDOA 3GHNA 3NNGA 1N3QA 5LA9A 1RUNA 2GC0A 2QCSB 1WCKA 2D6LX 3AMMA 3HBKA 3NJVA 2D5FA 3P3NA 2CV6A 4CDWA 4EN8B 4DOUA 5HV4A 1D4M3 2RR11 4RQPA 2FQPA 2VQUA 4N7UA 3IKWA 2CY6A 2IXCA 3MIEA 5FZFA 4AI9A 4AVAA 3OGSA 5CISA 1W03A 5F7UA 4SLIA 1B35B 3FLTA 2R49A 4CU6A 4D94A 5B2GB 4E27A 5F8PA 1NE6A 3PMSA 2RM23 2C0ZA 1UD1A 3MF9A 1OSGA 4RHV2 2PHXA 3BB6A 1E5HA 3HN1A 3KT7A 3OBZA 1IQDC 4IE6A 4NAOA 1ZBA3 4XUTA 4XQ4A 3W5NA 3CU7A 4J1XA 4URTA 2VBDA 1ZZ9A 5FP8A 5CEHA 1COV2 3FHIB 1RVF3 2DURA 2WABA 5DPNA 1YC61 5CB7A 3HN3A 3CJIA 2E7TA 3NV4A 2WNVC 3FBYA 3QOPA 1VB2A 1VRH3 2A5ZA 2MEV1 2GNDA 3A7QA 3DF0A 4IV3A 4LBQA 3WP3A 4LT5A 1MQTC 3AKSA 2R16A 2GP5A 3D0SA 4LBNA 1REEA 1IG0A 3C7OA 1NXMA 2E33A 4JGYC 5B4XA 3N7KA 3LFMA 1D4VB 1UYZA 3LB9A 3OG2A 2Q0AA 4R9CA 1W8ZA 2JIGA 1W8UA 3M3EA 1UO9A 5H9PA 4NIAA 4DY5A 4OFGA 2Q1MA 1PVC3 1KXGA 3IN9A 4I02A 2Z42A 1RMU2 2RJLA 2YG0A 4R9BA 1APNA 1X8MA 1WBFA 5IK4A 1RJ8A 4COWA 5C71A 1PX4A 2A7AA 4Q4V1 2GC1A 1LHNA 5L9RA 3WP6A 5LA0A 3N9NA 1O3SA 4AQ6A 3BPZA 1POQA 4FPHA 1W0PA 4YVWB 4IV3B 5ABJC 3LA7A 4RYDA 1RHI2 3NAPC 1TVGA 5T5JA 4DPNA 2Q8EA 4LHKA 1F2NA 4Q4V3 4BJ0A 2E53A 4LPLA 4YW1A 5FZGA 4OZOA 5FLIA 1TE1B 3B9CA 3KV4A 2WFF2 4C91A 4MGSA 1W05A 1M4WA 3O1UA 4KWKA 5F2WA 1GNZA 5LA2A 4HOOA 1UMZA 3SC7X 4DY3A 2EIEA 1LOFC 2E7AA 3WNLA 2RS11 4B1MA 3NJYA 3U14A 5H9RA 3ZOIA 3CIHA 1W3VA 1SCRA 1HDKA 1WLCA 2ZOEB 3AYDA 3OYWA 3CQOA 5HCBA 4UFHA 3BGAA 1ZYBA 2UU8A 4PDWB 1OOPA 4R4ZA 3NNJA 4OULA 3WNXA 2VUCA 3TB0A 4E2SA 2CGOA 1DHKB 5JUVA 4MYEA 4JDNA 1REDA 2ZMNA 1W2OA 2IXLA 5FPLA 2ZGQA 5FYBA 4NIHA 4DINB 5JMCA 1CX1A 1NA1B 4RL7A 5EV7A 1VMJA 1W6OA 2PHTA 5IVCA 5I0UA 1WMEA 5FY5A 5CG9A 3FN9A 4LIUA 5F1RA 2CSGA 3N9OA 4QM8A 1GZWB 2PFWA 2LW8A 3KT1A 2ARBA 3AYAA 4L11A 5FY7A 1TMF2 5L73A 3SKJE 2XR4A 3THDA 4CXWA 3J8F2 1MS4A 4AI1A 2VY0A 3C2UA 5JOZA 2DWRA 2BGCA 4YZ5A 5DXDA 5FZOA 1QDOA 2IWGB 3EHKA 2VU9A 1EPWA 2B7YA 2ZABA 1YEWA 3IIIA 1XNBA 2Y26A 1M06G 5FZ3A 1DGRA 1YQ6A 1W8OA 4M0NA 4D6RA 4IE7A 5F5IA 1QJU1 1SBEA 3P6BA 1ULPA 3H3UA 4OZXA 3ZLIA 2WO2A 2ZZJA 2J1SA 5GZGA 3T4VA 2OUHA 5I0DA 4XOGA 3IIAA 3QH6A 3T2QA 4PI2A 2TNFA 4Q0PA 5FOJB 2VXJA 2QZ3A 2R7EB 2PYTA 1ONAA 4QX2A 3IAQA 2UWCA 1ULFA 3M8LA 3VBFA 3KM5A 4NRQA 3VZNA 1WCSA 1HW5A 3D0JA 2HKXA 3JQWA 1DYOA 2BEOA 2J1RA 3B9IA 4Y33A 5CFCB 2DBIA 1FX5A 1RJ7A 2E26A 4Y1UA 4YYOA 4YGEA 4MO3M 5I0RA 1NZCA 5BV6A 2JG9B 4Z8BA 4GMP0 1KRIA 4BWOA 3GJAA 1X36A 4DFSA 3LOIA 1QOTA 1OLME 1UU6A 1CN1A 1W8HA 2GU9A 4MV2A 3ZFEA 4BQWA 2R061 4LITA 5JZGC 1XPWA 1FMD2 2ZX3A 1T6GC 4CDQA 3C7HA 1SPPB 1UKRA 5JR7B 4GH4A 3ZFGB 4MGIE 1GNYA 3EB7A 4XACA 3W20A 1A6CA 1RL3A 5E89A 4OQ8A 1SG3A 4DXSA 2ZHNA 3APBA 2JX9A 3AVRA 1AR93 1QGLA 2VO5A 1PIV1 3UNPA 1ZREA 1HXS3 2RDRA 4JDMA 2CGPA 5FMCA 1HB4A 4LA3A 4XDOA 2ARXA 2DVAA 2WLQA 4AFMA 5L7OA 1DCSA 2QVSB 2R1BA 2ZXQA 3LD8A 2C6SA 2GSYA 3H3ZA 4M4PA 3MO4A 1K5JA 5FZMA 1DGLA 2EAAA 2FDKA 4IGPA 3V0AB 3PVOA 5FUNA 2WSUA 1SDDB 3U0ZA 4BQ2A 2VOWA 1VBE3 1MR5A 4IW3A 1AR83 1UX6A 2WNUB 4XF0A 2JJ6A 2XUMA 4YM3A 1C8M2 4NPLA 3WDTA 2B8MA 1AZDA 2VBPA 1AYM1 3DXTA 1ZRDA 2W1WA 1H1AA 2VR4A 4EYUA 2ZGUA 1H2KA 4KBZA 5F5CA 1FPN2 4CP2A 4URAA 1ENSA 2FHRA 1BEV2 3OEBA 1NA1A 1Z7S1 3FHQA 4AEKA 2RS53 5LCWL 4UFLA 1VBE1 1PX3A 3MFAA 2EICA 1T6BX 1PVXA 1QXRA 5D1IA 2WSVA 1ENXA 1ZRFA 1G9DA 1V6OA 1ASJ3 2QDNA 4PJYA 3HNMA 3DUIA 4DRVA 2BZDA 1DP0A 5BNPA 2I45A 4YGCA 1K5MC 3I7DA 1O8SA 4X6QB 3WW1A 2R062 1NCQC 1URXA 4XUQA 5LRSA 3PJYA 4CEWA 5FZ8A 4MXWB 2D3SA 5JIAA 4KI5M 4R8HA 5H9SA 1A78A 4P9XA 3MF6A 4CDXC 4XFIA 2Z4FA 1H4HA 4AQTA 2IFRA 5A7PA 5DUXA 2BTVC 2D44A 2X5IA 4IUGA 1C8NA 1UPIA 2XLFA 4XJUA 4LBKA 1OVPA 4UW6A 2GMEA 4HK8A 3Q8CA 2Z69A 1ND2B 2VOKA 3P1IA 5FP3A 5FOBB 3MW2A 4M3CE 3T0DA 4LULA 4QPIC 4AGGA 5HCFA 3IMNA 1UY2A 1E5SA 1I9RA 3RDIA 1GR3A 3TNPB 4YM2A 1POV3 2CTVA 1NUKA 3MUY1 1SZBA 1H9PA 5FJHA 1LU2A 2ZHKA 5FY1A 4S2GA 4QB2A 4DMIA 5A3PA 4PDWA 5ANNA 1QKQA 4QPGA 4H3WA 5CNAA 1O4YA 4GWMA 4CDQB 3RYKA 1TQ5A 2D97A 2NPIA 2PAEA 3Q8BA 4YVSB 1KQRA 2VOXA 4L97A 4LBLA 2JE8A 5A3NA 3CBNA 4LIVA 4FXKB 4LBQB 2ZBJA 5C4WA 1JUIA 4JTNA 4A41A 1OQ1A 3BOPA 3I2IA 1V00A 2LROA 2HWC1 4N9IA 3NJZA 1JOPA 5HCAA 4YW5A 2WS93 5FDBA 3ME2A 3MICA 3WF3A 4J6GA 3ZYHA 1UNBA 4Q5OA 1Q56A 1BHGA 3PMEA 4X8NA 2WJSA 2WN3A 1NLQA 4D7SA 2XHKA 1Q8PA 5KC6A 4Y1XA 3QACA 3TEYA 2BVVA 3WNNA 2AGSA 4AW7A 1S2BA 4OUEA 3VGIA 3SMHA 2BNNA 4YM1A 4DXZA 2C26A 2V09A 1S2KA 1IZ3A 4PQ9A 1F35A 3AMQA 4OCTA 4D0QA 5T5OA 3GF6A 5JXHA 1IKQA 3WUDA 2HWB3 3N7LA 4XZPA 4QQLA 2YV8A 5K0UA 4KL1A 2EA7A 3I49A 3I97A 5CKMA 3VDDC 1Q8VA 4ASMB 1CAUB 1MZFA 2XVGA 2QQKA 1AX2A 2PMWB 4W6XA 5DAWA 3ASIA 4AHWA 1CAWA 2FCUA 3CLPA 2GN3A 5F3CA 3MBWA 1K3IA 4IV1B 4RA0A 5J98B 3GZTB 1GU3A 3FLRA 4BCUA 1PGW1 3MPBA 3OD0A 4LHLA 1IG3A 4Z82A 2R0HA 2Y8KA 1ASJ1 5FAXA 1XXNA 4I01A 4IE0A 4QX5A 2D43A 2P3KA 2LRPA 1JMUB 4ZU7A 4W65A 3ETPA 1NCRA 2VZ1A 3USSA 4C90A 2JKBA 5C4WC 2VGDA 3I59B 2B45X 2DV9A 4P9GA 2WNEA 3THTA 2C9KA 2VUJA 1RMU1 3RJ2X 2ET7A 5LWBA 2XLGA 3OUJA 1WW6A 1CAVA 1RUD3 3O1PA 4CUAA 1BBT3 2UWBA 5E16A 1ZZ6A 2WWUA 2DTWA 5C3SA 1TME1 1AJOA 2BOJA 4NR1A 1HRV3 3ACHA 3WNOA 4CXXA 2JDKA 3BTYA 1Z7S2 1CQ9A 1S4CA 4KWJA 1W39A 3OY8A 4RGKA 4LHSA 4WM8A 4Y1ZA 1FPN1 4GJYA 3K77A 3POGA 2WAOA 4QPIA 4XW3A 5FP4A 3HD8B 5AFEA 1AYM2 1OXCA 2WZ8A 4UOJA 4AQ2A 4JRLA 3UGHA 2D6PA 2RJ2A 3T2OA 4AXOA 1COV1 2NYYA 3ZFGC 3MIBA 1PZ9A 2OKXA 1UZ0A 3WY6A 4XC9A 1POV0 1E57A 4EROA 2Y0IA 1YUDA 1AR91 1LJ7A 4RFT0 4QPGB 1JZ4A 3VZMA 1RUD1 1AR62 1MEC2 4CDXA 2AC1A 2YBSA 3OPZA 4Q4W2 1OD5A 3KGZA 2EALA 2YPDA 1OFNA 3MW4A 1ZRCA 1KS4A 1MS5A 3VD4A 5F5QA 4QX7A 2VE1A 4AFDA 2FCVA 1JODA 3S7EA 1W2NA 4LUKA 1UY4A 1HX6A 2RR12 2ZGMA 4YARA 5LEKA 4HN0A 4AFBA 1YYNA 3WR0A 2WQZC 5A1AA 1FMD1 1OA2A 4NN0A 2WR9A 4QQ2A 3WLUA 1JZ3A 5J96B 2ATFA 2VBBA 3KGLA 4AEMA 3UETA 1REFA 4AEDB 1LR5A 2G9FA 5FP9A 1L3JA 2RDNA 3CL1A 5L9VA 4NWVA 2A6VA 3H3LA 2CU5A 5L36A 1O5UA 3D8CA 4I30A 2IFWA 5EZWA 2VCMA 1FV3A 4ATFA 4DXRA 3QCWA 3BN6A 2PTMA 1F9KA 5CA6A 2BBAA 1PO13 1H6XA 1ULDA 4WVVA 4AVSA 3ZFFC 5J48A 3AJYA 5CKNA 5LB6A 2JDZA 3ZXLA 2GNMA 3ES1A 4IE5A 5A7QA 1OFSA 2RE9A 1RC6A 2KXLA 4G9SB 4JCKA 1HRV2 1LODA 3N3HA 3I2HA 4INDA 4XPVA 5A3OA 4BXSV 5IVJA 3ZXEA 1LTEA 1JYIA 1X82A 1OKOA 2Z2SB 2P6CA 3ZIXA 2VXRA 3V0BA 3MPPG 4HKLA 1QDCA 3J26N 1W90A 5A6XA 2WFF3 3TEZA 1AL22 1OKQA 1VE0A 2MNGA 4CDUB 4XFGA 1W0OA 2PHRA 5C9AC 2X8KA 4LBQD 1W6NA 1OHFA 4GMP1 1CZSA 2UYBA 2VMCA 3ZSKA 1UIJA 1A8MA 4OQ9A 2KD7A 4XJWA 5FY8A 4P5YA 1NXD1 4C1XA 5A33A 3N9MA 4CCNA 3VBRC 1WWYA 3J8F1 2P3IA 1H4GA 4XVHA 3LGRA 4CYDA 4MGKE 1V6IA 2IXIA 4GD4A 3OGGA 4WZFA 2Y6GA 5I91A 4CVUA 3TAYA 4OMCA 2V4VA 4FPGA 4HPKB 2FBEA 1BCXA 1YLLA 5G04L 3S57A 2YYOA 3VDCA 4A42A 1GSLA 5C9AB 4KGGA 2OS2A 1KJLA 1UYPA 1PO23 2DVGA 1OLQA 3IAPA 4JQTA 4Y1YA 5EYYA 5CFDB 1XYPA 4N43C 4WZCA 3NO8A 2O8OA 4FFIA 4NJ4A 4IDZA 5GLTA 3IZOA 2GH2A 4XFHA 4QM9A 4AEJA 5TSWA 4H7LA 4HK9A 2OUJA 4A3XA 2EVXA 1O3QA 1BLZA 4MOAA 3O14A 1SPPA 4NE9A 3BU0A 4ATEA 5GZCA 5FPXA 1I1EA 5CFCA 3JXSA 4XILA 1YCIA 1HB3A 2VNRA 2BPA2 4TLFA 4XMIA 3K2OA 3ZSMA 4GWJA 2DCTA 3KQRA 5BPXA 2ZKLA 3T3YA 2EF6A 4QQHA 3ZDVA 4O7XA 1GZTA 1RUH1 4P9WA 2DU0A 2Z5WA 5F32A 2IZWA 3GALA 3I3QA 4HFSA 2Y34A 3EJKA 5T54A 2VZRA 3SCHA 3WDXA 3D3AA 4N43A 2WIIB 5LK5A 2V4AA 2BP6A 5FZCA 1RHI1 5KWRA 4UYBA 4R9AA 5L9BA 3O1VA 1GV9A 2JG8C 1S0BA 2VAUA 3OSDA 4FO9A 4QKDA 4FOYA 4UBHA 4KMQA 4Q4Y3 1OPMA 1X9PA 5A7OA 5KBFA 2K0GA 2IVJA 5BNNB 1WA6X 1MPXA 4FXGB 4BIFA 3SCGA 4E8CA 1LOBA 3K4DA 2X10A 3AK0A 5LW9A 1YQCA 5FZIA 4LUMA 1LGCA 3LPGA 4OVEA 5FCCA 4LTAA 4UW5A 1S0IA 1YI7A 3T1MA 1C3HA 4JKMA 3UJOA 5LBCA 3WVJA 3WG3A 1DQ6A 3MLKA 4HG6B 1W6MA 2VNOA 4C0HA 1O5LA 2P2KA 2R6QA 4K21A 3ZSLA 1TEIA 1W2TA 2N7GA 5DZEA 4PLOA 5F3GA 5FK8A 3WDYA 3HWJA 1U12A 5D8AC 2BRTA 4QU2A 3EXUA 5FMOL 3ZXAC 3QLQA 5FLJA 5JI9A 3WDWA 2MEV2 2FDJA 3AYEA 5AFBA 2PLV3 3U1XA 4AQSA 4DNYA 4UAPA 3U07A 1C28A 2B9UA 3FZ3A 3MIGA 2JDPA 3VHRA 5HI0A 5CKQA 4EWDA 3ES4A 4S2DA 2DFBA 4JHTA 1SACA 2XJSA 1HKDA 1QXJA 3ZFFA 1PMJX 1W6NB 1GWKA 2G19A 4D7YA 3JBG2 4PI0A 3OEAA 4NO4A 1GWLA 3VD9A 5JSOA 1H8VA 4O65A 4BMEA 3A0KA 3I3EA 2HWC3 3OUHA 4ZONA 4FFGA 4QHOA 3WF0A 4DEVA 2XUEA 5EFUA 3UT0A 4JQRA 2GNBA 2PQSA 4JGZA 3WCRA 1VBA3 2CAVA 4IESA 1UYXA 1AF9A 4F3JA 1C4RA 2C1FA 3GZAA 3O0VA 3E6BA 2BQPA 3P3PA 2D7FA 2RS52 3VZJA 2CL2A 4EJRA 4KWUA 2E7QA 1OQEA 3D6EA 5GKAC 3VBHB 2QQJA 2ZGTA 2ID4A 4KH9A 1Y43B 5FFOC 4CCLA 1RUOA 2W9XA 2XWJB 2WZR3 5JI7A 3I2OA 3NMBA 1XNTA 1EYBA 1SLLA 3ZN6A 1Y9GA 1S0FA 4JGYA 1R1A1 4OHZA 1UL9A 1US2A 2VCAA 5FREA 2CYFA 2OVUA 4N9HA 3T08A 4U2AA 4LK6A 4XCBA 4IEOA 5IHRA 2ZAAA 2HWD3 2ZGSA 4IV3C 4A2UA 3RGBA 4CSWA 2HYXA 2WNVA 2RMU3 3I59A 4UBGA 5KXEA 2HLEA 3CJIC 1FT9A 3S7IA 2QZ2A 3I2JA 2WT1A 4XYXA 4LR4A 4JGZC 1MEC3 1CX4A 3KS7A 3K75B 1IS3A 2D40A 3H50A 2ET1A 3M4FA 4OHXA 1UZYA 2IC1A 4Q4W3 1GANA 1RUF2 4XE9A 1JYTA 2VOTA 5AVAA 3AC0A 3BALA 3AMNA 1OH3A 2W2IA 5FV3A 2EIDA 3OY8B 2O8QA 4EE2A 1NG0A 3WF1A 5K7PA 1VBD1 1OF3A 4BQYA 1JYXA 3ZVXA 2ARAA 1H1MA 5FZLA 4QHBA 1DQ2A 3AFKA 3INAA 1AYN1 1TMF3 1B09A 5IK5A 1BVP1 1G9AA 2O14A 1OUSA 3B7MA 2B5HA 2HEVF 1PVC2 1ZZBA 2VMDA 2D3PA 3DKWA 4MSVA 4TSVA 3WF4A 3E6DA 2AH2A 5FYUA 1HRI3 4CCJA 3L9JT 4DZGA 3HVDA 5FZ6A 4M0HA 2AEYA 3AZVA 3PL0A 1CPMA 1ND3B 1ULOA 5KHHA 3I2FA 3RVHA 4AVBA 4E4SA 2JENA 1QJX1 1L7QA 3OPWA 2VZPA 4IEQA 1U5ZA 1J3QA 1U5YA 1YQ2A 2XJPA 2XXZA 3HT1A 3VZOA 4AAXA 3PIJA 4CDUC 4QPYA 3WW4A 4FQ4A 1C5HA 2NN8A 2EXHA 3POFA 5A32A 1UXZA 3AMHA 2WLPA 4B7EA 1VBB2 4CP0A 2HYKA 2QKDA 1SEFA 2PHFA 3IB3A 4NIIA 4E2QA 1W8NA 5F3IA 3MIFA 2FMYA 3GM8A 5C8CB 2VVFA 1B35C 1ULEA 5A1FA 3J9SA 2JG8A 4RR3A 4W6YA 4CP9B 5D8AB 2D6MA 3VDDA 1ODMA 1R083 3J7MA 4IXLA 4GB32 5GLZA 5HBAA 3LKJA 4AEDA 4C1WA 5K0UC 1I3HA 2VZUA 3AZWA 4UW3A 1VLNA 1YFUA 5EXOA 2RMU2 3AP7A 3MZHA 2BYVE 3KB5A 1MS9A 3HQUA 4XURA 3WQ0A 4J1WA 4YRDA 3OB8A 4D8MA 1PMIA 1QQP1 1W04A 1OURA 4Q2FA 3R6SA 5JDBA 3ZN4A 4WM8B 4XXPA 4A7KA 4WM7B 2CDOA 1V9U2 4QGLA 3NSTA 4CEYC 5CFCC 1W99A 3BPSA 1ZRIA 3UGFA 2VVDA 5FYSA 5IJRA 5A32B 3HIFA 3NWKA 1YFWA 4XJAA 1IGOA 2BNOA 2VCBA 3E5UA 2J1AA 5A3WA 1ZX5A 2DCJA 3P5BA 2W0XA 4QKNA 3X29B 3KVAA 2ZEXA 3JD73 4FFFA 4CRQA 1VAKA 2R042 2E6VA 1LHUA 2R0FA 1RUJ2 3AB0A 3LSEA 2PLV1 1JXNA 4EN6B 4EN0A 1BMV2 2RHPA 3I54A 1IS4A 1NX9A 2HWD1 3F95A 1HRI2 4QPWA 3JZVA 3VKOA 4QPGC 3AP9A 4RN5A 3KWVA 1PGL2 4ISQA 3UJQA 2A3XA 2XL9A 4Q0UA 3R4UA 3K4ZA 2VMGA 3OYWB 1NT0A 1HN1A 1LOCA 2VQAA 2R32A 5LY1A 3GCXA 2YUEA 3W59A 3O1MA 1D4M2 2P3YA 3I3MA 2H0BA 2A3YA 4A4AA 3GBGA 3POJA 3DKQA 3K3NA 3WEZA 4AGVA 5C9AA 5FYVA 1O3TA 3A22A 3ETQA 4Y4RA 2D5HA 4LLOA 1CAXB 1RITA 3M3OA 4JHZA 4Z07A 4ZXKA 1JS9A 3AP4A 5LRRA 5FUPA 3V56A 1SLAA 2VMIA 3VL9A 5CYYA 4GB33 1GP4A 2VW2A 5I8TA 1EAH1 2R071 4YGBA 5F37A 2ZGPA 1HN0A 4DIQA 5KHJA 1NAEA 5EHDA 1QJFA 1CR7A 1UAIA 3TN92 5EWSA 4UF0A 2HWB2 1JYCA 1AR71 1K5MA 2NMNA 5KHIA 3PUQA 5K9YA 4LO7A 1J3RA 4IEWA 5BNPC 1W9WA 3VBRB 5ISLA 3M3IA 3WUCA 5C8WA 1SBDA 4QQPA 1D2QA 1YO8A 1XYOA 2OT7A 5CG8A 3BTAA 3I3DA 1QNWA 4GQ7A 5CU1A 3LOBA 4XIOA 2GH8A 4TZDA 4UFKA 4B7KA 1QJY2 3E97A 2VCCA 3POBA 3VBSB 2V72A 1HXS2 4JVAA 2WO1A 4I0WB 1W2UA 3N9LA 1CAXA 3NAPB 2AACA 2O1QA 3JD72 4NVPA 4YG6A 3ST7A 5BNOB 1IKPA 2XVLA 2E31A 4YW2A 4XABA 4LNVA 3VZKA 3Q9OA 2Q5TA 3JBG3 3M3QA 5JXGA 1H2NA 1HIXA 2SLIA 2Y64A 2Y6LA 1AXKA 1LRHA 3FBMA 3U11A 3WP5A 1AR81 4WM7C 4PHZA 1E5IA 4ZPIA 2J42A 5FYTA 2VECA 3NL1A 3OD4A 5JSPA 4PF1A 1VBC3 1J59A 4YLZA 4DS0A 1J83A 3RZGA 5T5LA 4HVQA 1RUI2 3CF6E 4P14A 1VRBA 2JICA 3WQ7A 3HJRA 1BEV3 4P9LA 4GH4B 3ZFGA 5ANQA 5FPUA 2H6BA 1ZRRA 4I3PA 3POWA 5T3NA 3BOWA 3Q8FA 5BUVA 2W5FA 1STMA 3PUIA 3ZPOA 1TG7A 5D2AA 1MZ6A 4D6QA 1OT5A 5JCTA 3RZJA 3NJXA 2BDRA 4WM8C 5GM0A 3WD5A 3ZFFB 4CEYB 3SKVA 1GLHA 5IVYA 1KFXL 4Y5Z0 1J58A 1W6PA 2PHLA 2XG3A 3MIDA 4LOTA 3ZDSA 3PNAA 2R063 1PGSA 4BM8A 1IQAA 2R073 5IAVA 4IGQA 1FOD1 2F4LA 3W58A 2JKXA 3LPFA 5GLWA 3WX5A 4EV0A 4XAAA 3SH5A 5AC91 2FZ1A 2A73B 3NKTA 2QQOA 3RI9A 2C24A 3R0RA 1DDLA 1QQP3 1NLSA 1W8FA 4B3NA 4XF3A 3VKNA 2XKPA 1GFF2 3I3BA 1NCRC 3TN91 5BNQA 2OZJA 2VZQA 3OTFA 2JG8B 2ZHMA 3VBFC 2XWBB 1EAH2 4XZUG 1HQWA 4OI4A 2HEYF 2DF7A 3EMRA 4GAZA 4BISA 2WC2A 1XU2A 4DRRA 3BODA 3MW3A 5G05L 4CEYA 4GJZA 3T30A 3PJQA 1VBA1 4K40A 5FKBA 1ZNPA 4FPEA 3BVCA 4GA9A 1XE7A 4LEJA 5M0TA 1RUG1 2BFUL 3B93A 4FT8A 1DBNA 2YROA 4CDXB 4YW3A 3VZLA 3SXWA 3KF3A 1RUC2 2W92A 3ENRA 5A1LA 5HPOA 5IYYA 1Q5OA 1UZZA 4WBBA 5FZHA 1QWRA 3AKTA 2OW4A 4HONA 5EJ3A 5FXXA 3WNKA 3VL8A 5FO8B 3MIHA 2WZR1 2LUWA 4OI0A 1LHWA 4GZ9A 2V5YA 5F2SA 1JOBA 4IERA 4LKEA 4DEQA 1A34A 3GGLA 1PM7A 1ULGA 4Q0SA 5JPNB 5ACA2 2WS91 1PHMA 1GQGA 5BY5A 1ZA4A 5C6CA 5JMOA 3FX3A 3AXDA 3N9PA 5LBFA 5FYZA 2NMOA 2VZTA 4HETA 5LBBA 1JI6A 3VDBA 5IT6A 2YBKA 2HWE2 2ZACA 3K48A 1A8DA 3ORJA 4LKDA 5JWPA 4CZSA 2G9GA 2R1DA 4Y1VA 5APAA 5KHGA 5JOWA 3RJRA 3VHPA 3LEIA 3N36A 4XDQA 1H2MA 1OF4A 1C5IA 3OOXA 2F4PA 1VBD3 2P5BA 3HAGA 4JKLA 3VD7A 3NRUA 1N3PA 5FKCA 1G86A 3CKHA 3ILFA 3E6CC 5FZDA 5IVBA 2JXAA 3SH4A 1GYKA 1S0CA 1Y4WA 1LGBA 2AYHA 2WL1A 5FMDA 2ZGNA 1LHVA 5GZEA 1KDMA 3WNMA 1LOFA 1V9U3 1GP5A 1YIFA 1QQP2 2EIBA 3AL6A 1RUE2 3H1WA 2TUNA 1RUG2 4XQWA 1KJRA 5A7WA 2ETEA 1Q3EA 2RS31 2J22A 3TOJA 4W4ZA 2WQ4A 1FAYA 1X33A 1XNDA 2WN2A 3LDBA 5KXBA 5T52A 1RVF1 4ITCA 4PIYA 4BK5A 1WW7A 4GIQA 2VPVA 5ABJA 3VBFB 1S55A 3O0XA 1WGPA 1VP6A 3CHXA 4YW6A 1VAMA 1WCUA 3BYWA 2JG9A 2ZPXA 4GALA 4LBMA 4QU1A 4O9GA 3B5LB 3H0OA 3ZYRA 4ZS3A 4BPZA 1DGWX 1RGSA 1OOPB 1K12A 4FOVA 3ZR6A 3T4HB 1NQJA 3RZHA 1H1IA 3DXUA 3ZFEB 1NZIA 1FOD2 2E51A 1ZZ7A 1NCQA 2VNGA 1RXFA 3C8XA 2NQYA 1S2EA 4U36A 2W46A 5AVPA 2D6OX 3O7OA 1PK6B 5I8SA 3B01A 4MGYE 1P8JA 1F5JA 5C7GA 4DUVA 4MG2A 1GZ9A 3WDVA 3K46A 4FPCA 1UPSA 5I0TA 2Y0OA 3L2YA 2VTXJ 1DGRN 1U5IA 4UFMA 5FQ0A 3BIWE 5FYIA 1GICA 5SV5A 1UXXX 2DTYA 1CJPA 1NA1C 4B4PA 5C3OA 5FZ7A 4NUBA 1VBD2 3UYJA 3V64A 1CZVA 1OA3A 2IXKA 3BTZA 5GZDA 2GN7A 4P02B 1LB2A 4NHXA 4WVWA 4F83A 2E32A 5F6LB 4Q0QA 3BTXA 1IHMA 4QXKA 3ZXFA 1SMVA 3ECQA 4PLMA 3EBRA 1UU5A 4D3WA 3AP5A 4QDQA 3AJZA 3KZ4C 1UKGA 1RUF3 2A1XA 2Q1FA 1CIWA 3AKQA 4H55A 4I0AA 4QGNA 1YXWA 4CDWB 4TXWA 1QH7A 4TLGA 5DDJ2 4C8DA 1QXPA 1QIQA 1WMFA 3G7DA 4EQVA 3ZR5A 1PO22 1XE0A 3OBAA 3B94A 5D8AA 3RSJA 1VRH1 2MEV3 4ZZ8A 5L7OC 5DQ0A 5FYHA 4K7JA 3R4DB 1U5XA 4K1YA 1W6PB 4GKYA 2Y6KA 5JR2A 2DVBA 2YU1A 3JQXA 3IDCB 3VBSC 4FI9A 4EWEA 1DYKA 1BK0A 1HXS1 1LULA 3J8F3 1LENA 3LSDA 1N1SA 4XXAA 1JYWA 4L99A 3MI8A 4K6BA 4AI3A 3DECA 2UY9A 2H6CA 1LNSA 3AFGA 3IMMA 3RZKA 1S0GA 2OIIA 3CZJA 2JDHA 1QEXA 1X9TA 2XKOA 3KCCA 3VBUA 2P4EA 4FTEA 5EQUA 2HWB1 5JZGA 4XUPA 2A71A 1HLCA 1QJU3 4F7ZA 2SBAA 2YBPA 2Q1ZB 3FMGA 2DVFA 3RMYA 5CAZA 2WA3A 3PUAA 2RS33 4HKWA 4K3UA 3U4SA 1G9BA 2CGNA 1KGYA 1WMDA 3AP6A 3JCIA 4IEXA 4Q4X3 2VZ3A 3PDQA 3ZXKA 5E8AA 2L9LA 5FXVA 3LDRA 4XETA 4LQRA 1BQPA 4KG0A 1SCSA 2WWJA 4EN9B 4FFHA 1NCRB 4CUCA 2BOIA 4N53A 1JZ8A 2XJTA 1MS3A 4Y5SA 3POEA 2E9QA 1RIRA 2OZ6A 3VDAA 5DMYA 5FWEA 3IDAA 3THPA 2WNUA 3I2DA 4LMFA 4YVSC 3ABZA 4YW4A 4XFCA 2QJVA 2LTNA 3UKTA 4B29A 4DXTA 5C33A 5LEJA 3H1YA 3WG2A 4NHLA 2YB7A 4YVWA 3OGJA 4AVCA 5IK8A 1W3XA 2V5DA 1GKBA 2C4XA 1JUHA 1JW6A 4R52A 4M3CF 1QF3A 1ENQA 2YDEA 4RQPB 2YGMA 3UESA 5BYNA 3ZYIB 1W6QA 2VVEA 2VW1A 3N9QA 3CDZB 4XUNA 2QDRA 1UN1A 2A6XA 2PHDA 4LKFA 4CPBA 4XF1A 1YFXA 2I07B 2PLV2 3NNMA 4TTGA 1RUJ1 3AYCA 3J4UH 3FWEA 5H9QA 1UY3A 4XDPA 1H2LA 1N1TA 3VBHA 4YZ2A 3SEPA 3OBRA 1ZVFA 3KV6A 4GXLA 3N35A 1PM4A 2WNVB 3MV01 3QD6A 5DABA 4QGMA 1BJQA 3RYRA 4QB6A 5A7SA 4OHVA 3B02A 3UK9A 1A3KA 1NKGA 1GZCA 2XBO3 2O0OA 2VZSA 3ZN6B 3VBRA 4FSJA 3UGGA 2XOMA 3U75A 3MUZ1 1LCLA 4AHXA 1XNKA 2ZZQA 4LXLA 3SH3A 1DQ1A 1YI9A 4PIXA 4YM0A 1QU0A 2DCZA 1BK1A 2XONA 1C1LA 4HXCA 3T1LA 1OOPC 1AXYA 1D0GA 2JIJA 2RDSA 5EP9A 1ZBE2 5A33B 1JU3A 4NHKA 2YGLA 4BA6A 1YIPA 4FPOB 5FP7A 3H1MA 3DV8A 3DN7A 1RHI3 3LQCA 3UV9A 1K5MB 2CAUA 2ILMA 4OI2A 2B39A 1XBFA 3O5SA 5LASA 3VD5A 4TWTA 3SNMA 5K8SA 4Z92B 1GP6A 3OGRA 1BYHA 3NW4A 1QJEA 5C8CC 1J84A 1O91A 4QDRA 3B3QE 2ZMKA 4DQAA 1QJX3 1AYM3 2WZEA 3LEKA 4V2VA 5FIXA 3H42B 1WBLA 2JDMA 3E1F1 2QUOA 3A23A 2G1MA 4PCRA 5EJZB 3RZLA 1CWPA 1R082 3HMYA 1YWKA 3LWCA 3IT8A 4FOQA 3H8RA 5JAXA 3N7JA 2CNAA 3TN93 1O3RA 1ZZ8A 2TEPA 4HZFA 5IK7A 4M3CB 4Y5TA 2QFEA 1ULCA 2B9VA 2QBXA 3C7EA 3F2ZA 3KHBA 5JXJA 1N47A 4QHZA 2WYSA 3ROUA 2JWPA 2XQRA 1W9TA 4PF5A 1NCQB 2J1EA 2QQIA 2GZWA 1DLCA 5C4WB 1W8WA 1XU1A 1F15A 5BNOC 2VZVA 4LKSA 3FLPA 5FPVA 1CIYA 5C3PA 4JRAA 2YHJA 2CWMA 1RUG3 3NKGA 1V6KA 3TRSB 5BNNA 3TEXA 3VN4A 2FZ2A 4AWDA 1K42A 4Y26A 1BZWA 2HWF1 3EO6A 5DUUA 3ILNA 3EQEA 4P9IA 2ZA9A 1AYN2 1XYNA 4IGOA 5IWFA 5CFDC 2Y38A 3PUHA 4QXHA 5FZ0A 4YW7A 3FUQA 4F8AA 3ZO0B 1SHWB 4HSLA 3ZMOA 3ZKUA 1AL21 5FPZA 5FWJA 4XTMA 4QX8A 4D69A 1MQTA 1ZBA1 4RS5B 3MYXA 1O8PA 1ST8A 3HR9A 1KDKA 3VDDB 3GBWA 1W8TA 2V73A 4Q0VA 4DUWA 5C3RA 4LA2A 4MXWA 4HKOA 4YPJA 4IETA 3OCPA 4AL9A 4IEPA 4NMIA 1Y9QA 4M00A 4XJ9A 2WFPA 2Q30A 3DPRA 2LS6A 2ZGLA 4BLJA 1UWWA 3VHOA 1JU4A 1LGNA 2GAUA 5FZEA 1W9SA 1WMXA 2OQ7A 3I8TA 4NWWA 1O4TA 2CWSA 2XJRA 4CUBA 1UZWA 2HJIA 3AX4A 1QOOA 4V1PA 4KU7A 5IUQA 4CE8A 5FYMA 4YFZA 1O59A 1Q8QA 2G4IA 3ZXJA 2G9ZA 3RWKX 2AR6A 3VKFC 2FDHA 1AX1A 3LFIA 3Q8AA 3HQRA 1W0NA 4TYSA 4A6SA 2XBO1 1MS8A 1NQDA 3AZYA 5A80A 4CDWC 5J1XA 1R093 3NQHA 3POIA 5CVRA 1UQXA 5IAXA 4BE3A 2YMZA 3V65A 3N7MA 3OUIA 3S6PA 4M01A 4LO4B 5DUWA 1CESA 3USUB 4ZHNA 4ORFA 2ZJCA 3ZYGA 4IEYA 4Q4W1 3HBZA 4XUOA 5LY2A 3TBDA 4FP3A 5IFTA 4XJZA 1TNRA 5I0SA 3OF1A 4XFFA 1H0BA 3WW3A 2UWAA 2W1UA 3KVBA 1H30A 2Q4SA 4YZ3A 5T50A 4Z1VA 5KHKA 3WOGA 4AK3A 4ZKTB 1AR92 3VV1A 3D82A 5FUIA 3WQ1A 4JGYB 4I09A 1H9WA 3G6JB 1YQ5A 4ISRA 1BKZA 2WO3A 3MEPA 1MACA 1TZOA 1WLWA 4C0BA 4QX3A 4Y4YA 5FZ9A 3TEWA 4CU9A 1HB1A 2WDBA 2VL4A 1YJKA 2ORXA 3IBMA 4LO6B 3MV11 2CDPA 1OMIA 4BOWA 1MZ5A 3B00A 5A7NA 1OVSA 2NLRA 3GCWA 4HMZA 4RD7A 4COUA 1R091 1YNAA 1DYPA 2BW8A 4AF9A 1F31A 3KV9A 4MHRA 4BB3A 1RUC3 4D6SA 2A6WA 4MX3A 3O1SA 3A0NA 4Y20A 3PHMA 3VLBB 4BQXA 4QXBA 1SFYA 3QBQA 4XEZA 1EP0A 1TME2 2ERFA 2WYFA 4XF9A 4RGAA 3S5QA 4BH9A 1EV11 1KD7A 2UYAA 2WT0A 4OMDA 4CCMA 2NM1A 4P9JA 1G9FA 3BI3A 5A7WB 1BBT2 1V6NA 3T2PA 3K4AA 2K9ZA 4WVMA 1FNZA 2GMPA 1GZWA 2BU9A 1VAVA 4BU2A 5C5UA 1AHSA 2QQMA 4QWNA 4EZHA 1BBT1 2ZCWA 1GMMA 1Z78A 2IVIB 1PK6C 2ADDA 2NP0A 2BWAA 4EN7B 1EV12 1GOGA 3H8OA 4YG0A 5A3LA 1ASJ2 2JEMA 4Q8KA 2FD8A 3PU8A 1HV1A 5FZOB 2DFCA 2WNOA 4ARYA 3W5MA 4FPJA 2ZX4A 1Y9MA 1R092 1GQPA 2XB6C 4PDWC 4ZXEA 1RUH2 3AM2A 4AE2A 4AVTA 4LOSA 4Q29A 4ZU5A 2A3WA 1HB2A 1QY4A 1I5PA 1JHJA 4L9BA 2QQNA 2ZKNA 4R4XA 3GJBA 4K8FA 4YGDA 3W9AA 2JD4A 4JV4A 3DEMA 2B42B 3AZZA 4IEZA 4BIOA 1AXZA 2UY8A 5L19A 2X53S 1LKNA 2W1SA 3WZ1A 1POV1 2W39A 4OHYA 2E63A 4CP1A 3HNBM 1EAH3 4MGQA 1VIWB 1AR73 2RS13 4GULA 2DU1A 5K4LA 1PK6A 5FZBA 4CCCA 4HBNA 5AC93 2W08A 4YSFA 2X5IC 5FTTC 4IV1C 1LOGA 1RUJ3 3O0WA 1SFNA 1NLRA 1CD3G 1XSQA 2BV4A 2JDUA 3LA3A 3AXEA 3BKZA 1U0AA 4M3CA 4FCAA 4FPFA 3MLLA 2XBO2 4Y22A 4Z2WA 4GWNA 3BUCA 3WT3A 2XL7A 1RB8G 4W6WA 4YWAA 3MFCA 4AHZA 4CEWC 2HWC2 2HEWF 1TME3 1XRUA 4ONUA 1GWMA 2XGXA 4CTEA 4EZ4A 4YNIA 5HCHA 1FXZA 4BQ5A 1D0HA 4BDVB 1OI6A 3RRDA 4D7TA 2AUYA 2W87A 1CGPA 2X5IB 3ZIWA 4CCEA 3FC0A 2EXKA 5KC5A 2WA4A 3D4KA 2ORZA 2VUDA 4META 5L7OB 2YU2A 3O1OA 1W28A 5A3MA 1UOFA 5DDJ1 1WCDJ 3ALQA 5LATA 2W68A 4MGZE 1NYWA 4A7ZA 3ATGA 4G4FA 5DZGA 3U78A 1GUIA 2YY1A 2EIGA 5FBZA 3ZYJB 1IS6A 1X50A 1EUUA 2YFZA 4XMAA 1CONA 3V0AA 1MQTB 5A70A 5JVVA 3ZYBA 1ZBA2 1AL0G 3LIGA
chains in the Genus database with same CATH topology
2D6KA 4Y20B 3SLIA 2RJKA 3BU7A 1UIKA 1COV3 3R05A 3RZZA 3NV3A 2HWF2 4MXVA 4YZ4A 1QH6A 1DQ0A 3ZMNA 5CBLA 3DPRB 1DG6A 3O12A 3KCYA 2A6ZA 3FE5A 1DQ5A 2PA7A 1FI2A 2LALA 4H7MA 4UXAA 2GALA 4FTSA 4FPKA 1UW8A 1J1TA 1I6XA 2WKKA 4GH4C 1AUYA 4QT6A 1V70A 4XBQA 3ZXDA 3SHRA 4HANA 3DPRC 4CDQC 3AZXA 1HQLA 3RS6A 1VBE2 1R081 1ZZCA 3N4MA 4QQOA 2BFUS 4E4ZA 3ZFEC 1DLLA 4QMAA 4L2NA 1F8VA 5K0UB 3VBOB 1MEC1 2ZX1A 1AR61 1RUD2 3SCFA 1HQNA 1JH5A 3WINE 1YHFA 4E4DX 1FPN3 1AJKA 1WW5A 2OYZA 3JUUA 2XJQA 2RS32 2PELA 1SLCA 4UW4A 4WVZA 3LA2A 5CFDA 1ZBE1 2HWE3 2Z79A 1I5ZA 1W6QB 3VUOA 1S0JA 2DVDA 1QJZA 3PVNA 3I4IA 2X29A 4OHWA 4XF4A 4NOTA 1WLDA 2ZGKA 1MS1A 1ND3C 5ABJB 1RINA 1ZM1A 2LM3A 5J3UA 2QQPA 1H8TA 4N7IA 4OUMA 4FAHA 2WINB 4IEVA 1AR63 3ZX7A 4ES9A 1XNCA 2HWF3 1OPOA 1RUE3 1WUVA 4KU8A 3GBFA 1DU3D 4Q26A 2IXJA 4KWLA 1HV0A 4LE3A 4QD2A 2IXHA 5ACA1 3RYPA 2XLAA 5GJ6A 1WW4A 1DFQA 1PGW2 1YJLA 2ZGOA 4SBVA 5BNPB 4AGRA 1RMU3 3CJXA 3AKPA 1TNFA 4BQ1A 5J37A 3PTYA 3ZPYA 4RS5C 1ALYA 2P34A 1VBA2 5I8YA 1FOD3 4BYYA 4KGQA 2P3JA 1W6MB 4XHXA 5KXDA 3KLSA 4HPKA 1QJU2 4B8EA 3NV2A 1ENRA 3GZUC 5A3LA 3H7YA 4FVVA 2ENRA 2A6YA 2PHUA 4JAAA 3E5QA 2VW0A 3VBHC 1LHOA 1AL23 3NAPA 1LEDA 4P9YA 2XJVA 1WD3A 2GMMA 4G3YC 3WCSA 5JOXA 1TMF1 3ZN5A 2WWSA 3IPVB 1IS5A 3MGUA 5DZFA 1CAVB 4LHNA 2ZAHA 1GQHA 1ND3A 4Q1PA 1G9CA 4BZ4A 3JB8A 3QH7A 1R1A3 1VRH2 3U10A 3POSA 1WD4A 1PO21 1QNYA 1YFYA 1CPNA 4IQPA 2MHFA 1G7YA 4HL0A 4QPIB 3V0BB 3WP4A 2RS12 3OBTA 2XH6A 3FJSA 1DF0A 2YXSA 4RR3B 4MH0E 2DCYA 4I3GA 4FQZA 3IM0A 3SITA 5JLVA 4N90A 1JBCA 4GKXA 1AR82 1IPKA 1O7FA 3H7JA 4RSUA 1JHNA 4N53B 4KQ7A 3VBUC 1UU4A 3ZSJA 4AI8A 1W6OB 3HT2A 4CEWB 2YZ4A 2D98A 2VMHA 1RUI3 1Q43A 4FPLA 1N1VA 3CEWA 4AI0A 1Z7S3 3IWZA 3UKVA 4Q4V2 2XPJA 1Y3TA 2KA3A 1VBB3 2EAKA 2ZS6B 4GMP3 3VBSA 3NVCA 4PLNA 3ZXGA 2BUKA 3KCXA 2MPFA 4RQPC 2VUAA 4PBPA 3WHUA 4XJ8A 4KBBA 4RHV3 5CIRA 3SISA 1BEV1 3IDEA 2H0VA 1CJDA 2R072 4HLTA 5DUVA 4COZA 3D5OA 3VBOA 1JOJA 3LCPA 1FMD3 1D2SA 3WV6A 1RVF2 2ZX0A 2W52A 3RWNA 1C8M1 2EXJA 5DG1A 2DUOA 1UF2C 1C57A 3UL2A 3KSCA 4COYA 4NHMA 3VKMA 5FQ0B 1QOSA 2P17A 4K20A 1RUE1 4HSJA 1SLBA 1D4M1 2RR13 4K9SA 3K51A 4OUSA 5GLUA 1OLRA 2VOVA 5JIUA 3GNEA 1FV2A 3ELNA 1JTZX 2DUPA 4FOWA 3B69A 2GDFA 1VALA 1PIV2 2R30A 3WW2A 1PGL1 1FYUA 2KM2A 2UURA 1Y7BA 1H8TB 5J7MA 1OQDA 1VR3A 2BWCA 3PVBB 1MS0A 1C8M3 2OA2A 1ZBE3 2HWE1 3DGTA 4AI2A 4ZU4A 2R041 2PAKA 4IV1A 4H14A 3UKNA 4FP2A 2JG9C 2WS92 1YRZA 4BLIA 1Q8OA 2D93A 3PLQA 1CAUA 1MVQA 3PVEA 4XFAA 2WZR2 1LOEA 3POYA 3HQXA 4Y22B 3WG4A 1QHDA 4XTPA 4Y24A 1PZ8A 3M1HA 4XIKA 3S0MA 1AVBA 1ND2C 4AG4A 4YG3A 1RUC1 3JB4C 5JOYA 1R1ZA 2Q8OA 3M7AA 5HXVA 5T55A 4FPYA 3IDBB 2ZGRA 3LZZA 4MVTA 3FFZA 4GB31 1MZEA 1EPZA 4RS5A 2DUQA 1LU1A 4S2FA 1DZQA 4ES8A 2I2SA 3CO2A 2ZX2A 1XE8A 3VKLA 1G8WA 3TWIA 2WT2A 1GBGA 5FO9B 3ZYPA 3RI8A 4XBNA 1O4ZA 1VBB1 2VH9A 2ZMLA 1S0DA 5AC92 2YPJA 3IPVA 1KS5A 4MLOA 2PHWA 2DYCA 3USUA 2JECA 2A75A 2ZHLA 5SV8A 5F9TA 2QNKA 5E1RA 1PNGA 4YFWA 4Q27A 1PVC1 1H8TC 4R9DA 3CJIB 4XQDA 2PAMA 3TYJA 4HT1T 4DB5A 1MVEA 4NPRA 3RMXA 4AYUA 1RUI1 4S2HA 3MDPA 2WFF1 1DQ4A 2VG9A 2OPKA 1Z0HA 4FAGA 4A7YA 4HVOA 1IOAA 3ACLA 4JGZB 5GALA 3VHNA 1RUH3 3VBUB 3JD71 1N3OA 1R1A2 5JZGB 5KXCA 5J09A 3KMHA 5JPMB 1QJY1 3KT4A 2C5DA 3L2HA 5DDJ3 5JSRA 4P5HA 1Q8SA 3LAGA 5GZFA 4AFAA 1PZ7A 2A70A 2RS51 4WVMB 1AR72 3WXPA 2ES3A 4Q4X1 3AKRA 4I2OA 1IPJA 3FFQA 4JTOA 2NZ9A 1FATA 3RQ0A 2AZ5A 1DZRA 5FMOS 1SBFA 3JBG1 3FUOA 1CAWB 1PO12 1NOVA 2BVBA 5FLHA 2VULA 1LESA 1BVVA 1PO11 4PIZA 4WM7A 3KD4A 1KFUL 1DIWA 5ACA3 2B46X 1J1LA 3JU9A 4Q8LA 5F6KA 2ZTNA 4L8QA 1BXHA 4RHV1 2AENA 3E5XA 4YZ1A 4ASLA 4LLFA 1SDWA 2FMDA 4COVA 5BNNC 1EV13 4Q4X2 5GLVA 5BNOA 3R4SA 3H9AA 4XBLA 3C3VA 1V6LA 1WA4A 1XQNA 2WZPP 3H8UA 1HRI1 2PN5A 4Q1RA 3M70A 2HWD2 5FRAA 4B4QA 3WG1A 1GNHA 1BMV1 3T2TA 1WLTA 1V6JA 4WV8A 1FNYA 2XVKA 4AVVA 3M3CA 4X6RB 1NY72 4X8PA 2BBVA 3A4UA 1N1YA 1UCXA 5E88A 3ZSEA 2TBVA 1JN2P 1S1AA 4JC1A 4B4RA 5C8CA 2GNTA 4LBJA 1QJY3 3WHTA 2JE7A 1V9U1 1LOAA 4HVRA 5EYXA 5DG2A 3NV1A 4N43B 2PQQA 1G6NA 1S0EA 2XJUA 4O9EA 2RMU1 2F6BA 1PIV3 3MLJA 4OI1A 1KITA 2GC2A 3S30A 2I74A 4MZUA 3GHMA 1CVNA 4KG8A 4FTBA 4L92A 2D6NA 4MUVA 1VBC2 2BNMA 1SLIA 1ND2A 2QE3A 3BCWA 3DL3A 3AMPA 1VB4A 2DCKA 1J3PA 4E9KA 3U4XA 1OA4A 3RPQA 5J36A 1DGWA 2C9AA 2RM21 4LO5B 4BMBA 4Q4Y2 3TNQA 4EWAA 1QJX2 2VQ0A 4Q4Y1 2P37A 2RM22 4YVWC 3GYDA 3OJBA 4AHYA 1C1FA 4RGGA 1DZTA 3RNSA 1QMJA 4LO8A 2GC3A 4YVSA 5T5PA 2WNUC 4FBFA 4BHPA 4LE4A 1F5FA 2AREA 1LECA 2YC0A 4N53C 1VBC1 5LK7B 2D3RA 4I0BA 1EY2A 5CADA 4IL7A 3CNAA 4PBOA 4KNCA 4OLLA 2JE9A 2K2SA 4AEDC 1RTVA 3ILRA 4K1ZA 1RUF1 4RR3C 1HRV1 4HN1A 5BXXA 1B35A 3M2MA 2EXIA 1AX0A 1PNFA 4LBOA 4XHBA 2R043 1VJ2A 4AFCA 1AYN3 4E2GA 4IEUA 3WDUA 1X8EA 4XFBA 1NE4A 1SQ4A 1V6MA 1LEMA 3URFA 3VBOC 1X7NA 5FO7B 3RG0A 4CDUA 1SLTA 1NY71 4JDOA 3GHNA 1N3QA 1RUNA 2GC0A 2QCSB 1WCKA 2D6LX 3AMMA 2D5FA 3P3NA 2CV6A 4CDWA 4EN8B 4DOUA 1D4M3 2RR11 4RQPA 2FQPA 4N7UA 3IKWA 2CY6A 2IXCA 3MIEA 4AVAA 4SLIA 1B35B 3FLTA 2R49A 5B2GB 4D94A 4E27A 1NE6A 3PMSA 2RM23 2C0ZA 1UD1A 3MF9A 1OSGA 4RHV2 2PHXA 3BB6A 3HN1A 3KT7A 1ZBA3 4XQ4A 3CU7A 4J1XA 4URTA 1ZZ9A 1COV2 3FHIB 1RVF3 2DURA 5CB7A 3CJIA 2E7TA 3NV4A 2WNVC 3FBYA 3QOPA 1VB2A 1VRH3 2A5ZA 2MEV1 2GNDA 3DF0A 4IV3A 4LBQA 3WP3A 4LT5A 1MQTC 3AKSA 2R16A 3D0SA 4LBNA 1REEA 1NXMA 4JGYC 3N7KA 1D4VB 3LB9A 2Q0AA 4R9CA 3M3EA 5H9PA 4DY5A 4OFGA 2Q1MA 1PVC3 1KXGA 3IN9A 4I02A 2Z42A 1RMU2 2RJLA 4R9BA 1APNA 1X8MA 1WBFA 5IK4A 1RJ8A 4COWA 2A7AA 4Q4V1 2GC1A 1LHNA 3WP6A 1O3SA 4AQ6A 3BPZA 4FPHA 1W0PA 4YVWB 4IV3B 5ABJC 3LA7A 1RHI2 3NAPC 5T5JA 4DPNA 4LHKA 1F2NA 4Q4V3 2E53A 4YW1A 5FLIA 1TE1B 3B9CA 2WFF2 4C91A 1M4WA 4KWKA 1GNZA 4DY3A 1UMZA 1LOFC 2E7AA 2RS11 5H9RA 1SCRA 1HDKA 1WLCA 2ZOEB 3AYDA 3OYWA 5HCBA 3WNXA 4PDWB 1ZYBA 2UU8A 1OOPA 4R4ZA 4OULA 3TB0A 4E2SA 2CGOA 1DHKB 4MYEA 4JDNA 1REDA 2ZMNA 2IXLA 2ZGQA 4DINB 5JMCA 1NA1B 4RL7A 5EV7A 2PHTA 1W6OA 5I0UA 1WMEA 5CG9A 5F1RA 4QM8A 1GZWB 2PFWA 3KT1A 4L11A 2ARBA 3AYAA 5L73A 1TMF2 3J8F2 1MS4A 4AI1A 2VY0A 3C2UA 5JOZA 2DWRA 2BGCA 4YZ5A 5DXDA 1QDOA 2IWGB 3EHKA 2VU9A 1EPWA 2B7YA 2ZABA 1XNBA 2Y26A 1M06G 1DGRA 4M0NA 1QJU1 1SBEA 3H3UA 4OZXA 2ZZJA 5GZGA 2OUHA 4XOGA 3IIAA 3QH6A 2TNFA 4Q0PA 5FOJB 2QZ3A 2PYTA 1ONAA 2UWCA 1ULFA 3M8LA 3VBFA 3KM5A 3VZNA 1WCSA 1HW5A 3D0JA 2HKXA 3JQWA 2BEOA 3B9IA 5CFCB 1FX5A 1RJ7A 4Y1UA 4YYOA 4YGEA 5I0RA 1NZCA 5BV6A 2JG9B 4Z8BA 4GMP0 1KRIA 4BWOA 1X36A 4DFSA 3LOIA 1QOTA 1UU6A 2GU9A 1CN1A 4MV2A 3ZFEA 2R061 5JZGC 1FMD2 2ZX3A 1T6GC 4CDQA 1UKRA 5JR7B 4GH4A 3ZFGB 4MGIE 1A6CA 1RL3A 5E89A 2ZHNA 3APBA 2JX9A 1AR93 1QGLA 1PIV1 1ZREA 1HXS3 4JDMA 2CGPA 4LA3A 2ARXA 2DVAA 2WLQA 4AFMA 5L7OA 2R1BA 2QVSB 2GSYA 3H3ZA 1DGLA 2EAAA 3V0AB 3PVOA 2WSUA 3U0ZA 2VOWA 1VBE3 1MR5A 1AR83 1UX6A 2WNUB 4XF0A 2JJ6A 2XUMA 4YM3A 1C8M2 3WDTA 2B8MA 1AZDA 1AYM1 1ZRDA 1H1AA 2ZGUA 1H2KA 1FPN2 4CP2A 1ENSA 2FHRA 1BEV2 1NA1A 1Z7S1 4AEKA 2RS53 1VBE1 3MFAA 1PVXA 1QXRA 5D1IA 2WSVA 1ENXA 1ZRFA 1G9DA 1V6OA 1ASJ3 2QDNA 4PJYA 3DUIA 4DRVA 5BNPA 2I45A 4YGCA 1K5MC 3I7DA 4X6QB 3WW1A 2R062 1NCQC 1URXA 5LRSA 3PJYA 4CEWA 4MXWB 2D3SA 4R8HA 5H9SA 1A78A 4P9XA 3MF6A 4CDXC 4XFIA 1H4HA 4AQTA 2IFRA 5DUXA 2BTVC 2D44A 2X5IA 1C8NA 1UPIA 2XLFA 4XJUA 4LBKA 4UW6A 2GMEA 4HK8A 2Z69A 1ND2B 2VOKA 5FOBB 3MW2A 4M3CE 4LULA 4QPIC 4AGGA 5HCFA 3IMNA 1I9RA 3RDIA 1GR3A 3TNPB 4YM2A 1POV3 2CTVA 1H9PA 1LU2A 2ZHKA 4DMIA 4S2GA 4PDWA 1QKQA 4QPGA 4H3WA 5CNAA 1O4YA 4GWMA 4CDQB 3RYKA 1TQ5A 2D97A 2NPIA 2PAEA 4YVSB 1KQRA 2VOXA 4L97A 4LBLA 4FXKB 4LBQB 2ZBJA 5C4WA 1JUIA 4JTNA 1OQ1A 3BOPA 4N9IA 1V00A 2HWC1 3NJZA 5HCAA 4YW5A 2WS93 5FDBA 3ME2A 3MICA 4J6GA 1Q56A 3PMEA 4X8NA 2WJSA 4D7SA 5KC6A 2XHKA 1Q8PA 4Y1XA 3QACA 2BVVA 2AGSA 4AW7A 1S2BA 3VGIA 3SMHA 2BNNA 4YM1A 4DXZA 2V09A 1S2KA 1IZ3A 4PQ9A 3AMQA 5T5OA 3GF6A 1IKQA 3WUDA 2HWB3 3N7LA 4XZPA 4QQLA 2YV8A 5K0UA 4KL1A 2EA7A 3VDDC 4ASMB 1Q8VA 1CAUB 1MZFA 2XVGA 1AX2A 4W6XA 3ASIA 4AHWA 1CAWA 3CLPA 2GN3A 4IV1B 4RA0A 5J98B 3GZTB 3FLRA 4BCUA 1PGW1 3MPBA 3OD0A 4LHLA 4Z82A 2R0HA 1ASJ1 5FAXA 1XXNA 4I01A 4QX5A 2D43A 2P3KA 4ZU7A 4W65A 1NCRA 3USSA 4C90A 2JKBA 5C4WC 2VGDA 3I59B 2B45X 2DV9A 4P9GA 2WNEA 3THTA 2VUJA 1RMU1 3RJ2X 2ET7A 2XLGA 1WW6A 1CAVA 1RUD3 1BBT3 2UWBA 5E16A 1ZZ6A 2DTWA 1TME1 1AJOA 4NR1A 1HRV3 1Z7S2 1CQ9A 4KWJA 1W39A 3OY8A 4WM8A 4Y1ZA 1FPN1 4QPIA 4XW3A 3HD8B 5AFEA 1AYM2 4AQ2A 4JRLA 2D6PA 4AXOA 2NYYA 1COV1 3ZFGC 3MIBA 1PZ9A 3WY6A 1POV0 1E57A 4EROA 2Y0IA 1YUDA 1AR91 1LJ7A 4RFT0 4QPGB 3VZMA 1RUD1 1AR62 1MEC2 4CDXA 3OPZA 4Q4W2 1OD5A 3KGZA 2EALA 1OFNA 3MW4A 1ZRCA 1KS4A 1MS5A 5F5QA 4AFDA 3S7EA 4LUKA 2RR12 1HX6A 2ZGMA 4YARA 5LEKA 4HN0A 4AFBA 1YYNA 3WR0A 2WQZC 1FMD1 1OA2A 4NN0A 4QQ2A 3WLUA 5J96B 2ATFA 3KGLA 4AEMA 1REFA 4AEDB 1LR5A 2G9FA 1L3JA 3CL1A 4NWVA 2A6VA 5L36A 1O5UA 3D8CA 4I30A 2IFWA 5EZWA 4ATFA 1FV3A 3QCWA 2PTMA 1F9KA 5CA6A 1PO13 1ULDA 4WVVA 4AVSA 3ZFFC 5J48A 3AJYA 2JDZA 3ZXLA 2GNMA 3ES1A 1OFSA 2RE9A 1RC6A 2KXLA 4G9SB 4JCKA 1HRV2 1LODA 3N3HA 4INDA 4XPVA 3ZXEA 1LTEA 1JYIA 1X82A 2Z2SB 3ZIXA 2VXRA 3V0BA 3MPPG 4HKLA 1QDCA 3J26N 2WFF3 1AL22 1OKQA 2MNGA 4CDUB 4XFGA 1W0OA 2PHRA 5C9AC 2X8KA 4LBQD 1W6NA 1OHFA 4GMP1 2UYBA 3ZSKA 1UIJA 1A8MA 4XJWA 1NXD1 4C1XA 5A33A 3VBRC 3J8F1 2P3IA 1H4GA 3LGRA 4CYDA 4MGKE 1V6IA 2IXIA 3OGGA 4WZFA 5I91A 3TAYA 4HPKB 4FPGA 2FBEA 1BCXA 1YLLA 2YYOA 1GSLA 5C9AB 4KGGA 1KJLA 5CFDB 1PO23 2DVGA 1OLQA 4Y1YA 5EYYA 1XYPA 4N43C 4WZCA 3NO8A 2O8OA 5GLTA 2GH2A 4XFHA 4QM9A 4AEJA 5TSWA 4H7LA 4HK9A 2OUJA 4A3XA 2EVXA 1O3QA 3O14A 4ATEA 5GZCA 5FPXA 1I1EA 5CFCA 4XILA 1YCIA 2VNRA 2BPA2 4TLFA 4XMIA 3ZSMA 2DCTA 3KQRA 5BPXA 2ZKLA 2EF6A 4QQHA 1RUH1 4P9WA 2Z5WA 2DU0A 2IZWA 3GALA 4HFSA 3EJKA 5T54A 3SCHA 3WDXA 4N43A 5LK5A 2WIIB 5KWRA 1RHI1 4R9AA 1GV9A 2JG8C 1S0BA 4FO9A 4FOYA 4UBHA 4Q4Y3 1OPMA 5KBFA 2K0GA 5BNNB 4FXGB 4BIFA 3SCGA 1LOBA 3AK0A 4LUMA 1LGCA 4OVEA 5FCCA 4LTAA 4UW5A 1S0IA 1YI7A 3T1MA 1C3HA 3UJOA 3WVJA 3WG3A 1DQ6A 3MLKA 1W6MA 2VNOA 4C0HA 1O5LA 2P2KA 2R6QA 4K21A 3ZSLA 1TEIA 2N7GA 3WDYA 5DZEA 4PLOA 3HWJA 1U12A 5D8AC 4QU2A 5FMOL 3EXUA 3ZXAC 5JI9A 3QLQA 5FLJA 3WDWA 2MEV2 3AYEA 5AFBA 2PLV3 4AQSA 4DNYA 3U07A 1C28A 2B9UA 3FZ3A 3MIGA 3VHRA 5HI0A 4EWDA 3ES4A 4S2DA 2DFBA 1SACA 2XJSA 1HKDA 1QXJA 3ZFFA 1W6NB