4UW5A

Human galectin-7 in complex with a galactose based dendron d2-2.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
132
structure length
132
Chain Sequence
PHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN GALECTIN-7
publication title Structural Basis of Multivalent Galactose-Based Dendrimer Recognition by Human Galectin-7.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 30
structure length 132
sequence length 132
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4uw5A00
4AVSA 1LOAA 1KITA 4U2AA 4MYEA 5EYYA 2DU1A 1LEMA 4C1WA 2A6ZA 1QNWA 5F5QA 5SV8A 5F9TA 1DHKB 1X50A 1CR7A 4XMAA 2JJ6A 4UW3A 5E89A 1V6NA 1W6NA 2GMMA 1Q56A 4YGDA 4YG0A 1UX6A 4FPKA 4FPLA 5JMCA 3UJOA 3W58A 2VUAA 3WHUA 3B01A 4JCKA 3N36A 4YW2A 2A6XA 1GBGA 2ES3A 2W39A 1HLCA 5DZFA 2R0FA 4I30A 4YW1A 2PHTA 3IM0A 1LODA 2DTYA 1FX5A 2CL2A 3MPPG 1CJPA 2XG3A 3T1LA 1S0BA 4XDQA 3AXDA 4YGEA 3RQ0A 3MW4A 4Y1YA 2D6KA 3ILRA 5AVAA 1UZZA 1LHOA 2VW1A 3IMNA 4BMEA 1LOEA 2WT2A 2ZGSA 3OY8A 4UW4A 4YG6A 2EIGA 2ZGNA 3VV1A 1Q8VA 1UN1A 2YMZA 5GLTA 5IK5A 3C2UA 3N7JA 3OYWB 4Y1XA 1W6MA 2EXIA 4LBOA 3ZXFA 4NO4A 3AJZA 1G9CA 3AP4A 3B69A 5GZCA 1GZ9A 5HCAA 5DUVA 1VALA 1CVNA 3WG4A 3FLPA 5H9RA 2W52A 1QDCA 1O4YA 3AP7A 1H9PA 2D6MA 1N1SA 3ZYPA 4XHBA 3V0AA 1BKZA 2AYHA 1BZWA 2R0HA 3RRDA 2CNAA 5GZGA 2LALA 1LESA 2D6NA 4PBOA 5T5OA 3RG0A 4DFSA 1Q8QA 5H9QA 1S0FA 3ZSJA 1LOFA 3NWKA 1B09A 1CPNA 1JOJA 2ZHKA 1LCLA 1MZ6A 3AP9A 3N3HA 4Y26A 1C1FA 1DQ0A 5DXDA 1D2SA 1ENQA 1WCSA 2DWRA 3AYCA 3POWA 1WW4A 1GZWA 4Q8LA 3WUCA 5T54A 4R9BA 4BPZA 1LGCA 2DU0A 2ZGTA 1N3QA 2GMEA 3QCWA 4HANA 3RS6A 4AGRA 3WDUA 3AX4A 2A6VA 1HKDA 1MS1A 3NV2A 1S0EA 2ZGQA 5GM0A 4XE9A 2ZGPA 1Q8PA 1H9WA 2E51A 4P9XA 1C57A 1QOSA 5JOWA 2AR6A 1ULCA 3R4SA 2UWBA 4M00A 2UWCA 1IOAA 1YI7A 3FBYA 1QMJA 3R05A 3M2MA 2A3WA 4C1XA 1UL9A 2YV8A 5E88A 1W0PA 1JW6A 3M3CA 3V65A 2GALA 4YLZA 2VXRA 1W6QB 1G9DA 1LHNA 1LOBA 2CYFA 2GNDA 4AVTA 5HCBA 1A3KA 2W08A 3AYEA 4YM2A 3ZXJA 3PVNA 3LSEA 2ARXA 4LBJA 2WT0A 4XTMA 4YFWA 4AYUA 2ZGMA 5LK5A 4YGBA 1MACA 3POYA 4WVWA 5GZDA 1ENSA 1JYCA 5IT6A 1DZQA 2Z42A 2P2KA 1CN1A 5DUXA 1YXWA 2P34A 4YZ1A 1G8WA 1GANA 1F5FA 1LOCA 3WDVA 4XJ9A 4YZ2A 1SLBA 5T5JA 4CZSA 3V64A 1LHWA 2ZAAA 4ATFA 1KJRA 4ZXKA 1HQLA 1KJLA 1MS9A 2P3JA 1XQNA 2CWMA 3HR9A 3ILFA 4Y22B 4YW4A 4YFZA 1V6MA 2ZHLA 2UURA 3O5SA 4XBLA 4GALA 4FPYA 4XXAA 3O12A 1Q8OA 5DG2A 3AZYA 3BOPA 3N7LA 2DYCA 3QLQA 1WUVA 1FNYA 1TEIA 1YIFA 2VW0A 3NV4A 3ZPYA 2AGSA 3MW3A 3LSDA 2P3KA 3AP5A 3APBA 1QGLA 4R9AA 5GLVA 2R1BA 2GMPA 2A75A 2AUYA 2DUPA 2WKKA 3WHTA 1CQ9A 3N35A 3OYWA 2DVAA 2NMOA 4ISQA 2A70A 2JE7A 2GNMA 4AGGA 4FPFA 4M01A 1DQ6A 4AWDA 2UWAA 2ZMKA 2OW4A 2PHUA 3AFKA 3NV1A 4DPNA 1DFQA 1AJOA 5L73A 3UJQA 1LHVA 2DV9A 4XMIA 1BXHA 3ATGA 3OBTA 4XHXA 4DS0A 2R16A 5CBLA 1AVBA 2OVUA 1WW6A 2ZMLA 1MS0A 4XIOA 3I4IA 2LTNA 4GA9A 5JOXA 3W59A 1I3HA 5DG1A 2FHRA 2EXHA 3ZSKA 1QF3A 2D6LX 1V6KA 2P3IA 4WV8A 3VKMA 3M3OA 2WSVA 2E6VA 4LBLA 4H55A 2V73A 1JBCA 1H30A 1YRZA 4BOWA 1KRIA 1UZYA 1Z0HA 4FOQA 1WBLA 1NLSA 1A8DA 3AXEA 5DZEA 5GJ6A 3O0XA 3ZYRA 2SLIA 1FV2A 5EYXA 1LEDA 4SLIA 3RMYA 3BTAA 2NMNA 4OZXA 2CWSA 1UPSA 5BYNA 4XIKA 5GLZA 2D44A 1G9BA 1GYKA 3SLIA 1AX1A 1LTEA 1G9AA 4XJZA 2A5ZA 3B00A 5T5LA 4L8QA 4CTEA 5KXCA 1FATA 4XBQA 4LBQB 1Y7BA 3H0OA 2PHWA 3M3EA 1SBDA 4DQAA 4D69A 1U0AA 1LOFC 1VAVA 1W6QA 1CONA 2C9AA 4Q27A 1N47A 3GNEA 4YZ3A 3WDWA 4M3CE 1SLCA 3WUDA 1MS8A 3ZVXA 1UKGA 4P14A 3KQRA 4M3CB 1SBFA 2JKBA 3A0NA 3ZXKA 4LBMA 1WD4A 4Y1ZA 2JDZA 3Q9OA 4P9WA 4RL7A 1DYPA 3A0KA 4XYXA 3TB0A 3TAYA 1LECA 5DUUA 4TZDA 2YXSA 3ILNA 3I8TA 4FPJA 4WZFA 4Y20B 1V6IA 1SFYA 2EALA 3ENRA 3UK9A 3CNAA 4Y22A 3KM5A 1SCSA 2D3PA 4K20A 1WBFA 4GKXA 5JVVA 4P9YA 3LCPA 5KXDA 3AZVA 5KXEA 4XTPA 1N3OA 2DUOA 1WD3A 2ZGUA 3PMEA 4GWMA 3WG1A 5KXBA 1N1YA 3SITA 1DGLA 1D0HA 2ENRA 1IKQA 2EF6A 2RHPA 3O0WA 3PJQA 3V0BB 1DIWA 1DQ1A 1WLWA 2D7FA 4PQ9A 1MVQA 1GLHA 4FVVA 1KQRA 1AZDA 4ITCA 2EXJA 1AX0A 1AXZA 4YW3A 3MW2A 2YZ4A 5GZFA 3AZXA 2A3XA 3VUOA 3WCSA 4BLJA 2YY1A 2DVFA 1N1TA 1FAYA 2SBAA 4YG3A 1OKQA 2A3YA 4NOTA 4LBNA 2D3RA 4FOYA 3ASIA 3HMYA 1G7YA 1GNHA 4YZ5A 1QKQA 1PZ8A 3WG2A 5CA6A 4Z8BA 1W6OB 2KM2A 2GN3A 2NP0A 5IUQA 3VKLA 1Z78A 5T50A 1RIRA 4FPGA 3WCRA 2FMDA 1N3PA 4ISRA 3D5OA 2AH2A 4UW5A 3SNMA 1IKPA 2VH9A 1MS5A 3WZ1A 1G86A 2PHXA 2ZHMA 1URXA 3INAA 1GICA 2P37A 4K1YA 1MR5A 4R9CA 3SH5A 4Q8KA 1J1TA 2EXKA 2Q5TA 1W6PB 1ULGA 2H0BA 3JUUA 1ULDA 1CPMA 2R1DA 1KDMA 2VY0A 2ERFA 1YYNA 2NN8A 1WLDA 3DUIA 2WNEA 1AXYA 4XBNA 1DYKA 1KDKA 1S0DA 1IS4A 2JECA 2CY6A 2WSUA 1I1EA 1SLLA 3FLTA 4YM1A 1AF9A 2GN7A 1WLCA 1LU1A 4M3CA 3FUOA 3WVJA 4IQPA 2D3SA 1LHUA 3ZSMA 2PHRA 3SISA 1MS3A 4K21A 1AJKA 5IK8A 1NXD1 4XOGA 3R4UA 1LGBA 5CAZA 3HN1A 5DZGA 4Y20A 2PHFA 4FP3A 4GWNA 4YW5A 4AGVA 2ZGKA 3VKFC 2E7TA 3WV6A 1FYUA 1ULFA 5FRAA 1GZCA 4YGCA 2VW2A 1V00A 1JHNA 1MVEA 2JE9A 2A7AA 1IS6A 4XZPA 3BODA 3WNXA 2CTVA 2E7QA 1ENRA 1V6LA 2GNBA 1MS4A 3IPVB 5GALA 3USUB 4XXPA 3V0BA 1RINA 1ZA4A 1QOTA 2DVDA 1DQ4A 1G9FA 4XJ8A 2D6OX 3UL2A 3A4UA 2DURA 2ZABA 1CESA 4FOVA 1R1ZA 1UMZA 3VKNA 4BQ1A 1Q8SA 4DRVA 5GZEA 1IS3A 1YO8A 3FLRA 2OUHA 4Q1PA 1BQPA 4TYSA 4LBKA 5JDBA 3M3QA 3FFZA 1GKBA 3WDTA 1VLNA 3ZXLA 1CIWA 4ATEA 3AZWA 4LBQD 3U4XA 5EWSA 3AK0A 3OGGA 1LGNA 1C4RA 2A6YA 2WT1A 1JN2P 4BMBA 1VAMA 4W65A 1S0GA 3L2YA 3WDXA 1PZ7A 1S0IA 1QDOA 4XJAA 3WLUA 4Y1UA 3BIWE 1LULA 2C5DA 4HL0A 1JXNA 1EPWA 2R49A 4RA0A 4WVVA 1W6OA 2A6WA 2ZGOA 1F31A 1SLIA 3NV3A 2E53A 1QU0A 5T52A 2DVGA 5IK4A 2HYKA 2DTWA 4U36A 1AX2A 1V6OA 5CB7A 1S1AA 3B3QE 3PVOA 2ZA9A 1W6NB 3WG3A 1JYIA 1JUIA 1WW5A 1QNYA 5H9SA 3RSJA 1SCRA 2BQPA 2NZ9A 4K1ZA 1ONAA 1W6PA 5E8AA 1BYHA 4FP2A 1F9KA 2WQZC 1V6JA 3D6EA 1ZM1A 1W0OA 3AYAA 4M3CF 1IS5A 4R9DA 4JRAA 3T2TA 2NM1A 5H9PA 5EXOA 4XILA 3MEPA 5JOYA 4YM0A 2AREA 1DQ2A 1WW7A 4KBBA 2ZMNA 1QOOA 2B7YA 2V5YA 5JLVA 1S0CA 4Q1RA 2NYYA 2XB6C 1AXKA 3IN9A 3SH3A 2UU8A 1SLAA 2D6PA 4ASMB 2ZBJA 2I2SA 3PVEA 1S0JA 2ZGRA 2AENA 3DGTA 3JU9A 3D4KA 4XJWA 1PZ9A 3OY8B 2W68A 3ZSLA 4FQ4A 2VU9A 4YM3A 2D43A 1APNA 4FOWA 4CRQA 1LJ7A 4BLIA 1ULEA 3WOGA 1MZ5A 3WDYA 1SBEA 1W6MB 1O4ZA 4PBPA 2OUJA 4PCRA 3VKOA 5CNAA 3O0VA 1OQ1A 4YZ4A 1LU2A 5IK7A 3OBRA 4FQZA 1HQWA 2DVBA 1UAIA 1LOGA 5DUWA 1DQ5A 4AVVA 3N7MA 3V0AB 3AZZA 1GNZA 4FPHA 3IPVA 4Y1VA 2ZHNA 3USUA 5JOZA 4FPCA 4XJUA 5FREA 1A78A 3SH4A 2DUQA 1LENA 2PELA 3GALA 4Q26A 2WLQA 4UW6A 5T55A 2ZZJA 1SLTA 3B9CA 3AP6A 4LBQA 1SACA 1FV3A 1OFSA 3OPZA 5GLUA 2ZGLA 3AYDA 4Y24A 1GZWB 2GNTA 2GDFA 3M1HA 5HCFA 1VIWB 2WJSA 3AJYA 4FPOB 5GLWA 1DLLA 3RMXA 4PF5A 3IKWA 2ARBA 2JD4A 2TEPA 5T5PA 1DBNA 1GV9A 2ZACA 3OJBA 2ZKNA 4F83A 2G4IA 2YROA 1GSLA 1RITA 2EAKA 4GKYA 4ZKTB 4BM8A 1HDKA 1FNZA 1C1LA 4JC1A 3N7KA 4Q2FA 4GXLA 4FPEA 3T1MA 1BJQA 3ZXEA 4DRRA 2A71A 1N1VA 3FUQA 3POSA
chains in the Genus database with same CATH superfamily
1DU3D 2HWE3 3ON7A 4C8DA 3H8OA 1D4M1 3W5MA 2DU1A 2RR11 3LZZA 3U78A 1X50A 4NAOA 1L7RA 1W6NA 3VBOB 1Q56A 4FPKA 4JRLA 3B93A 3FFQA 4OMDA 3UJOA 4IEWA 4Q0QA 3B01A 4CDWA 3OBAA 5F7UA 2A6XA 4WVZA 1HLCA 5DZFA 4PQQA 5IVBA 4XFIA 1RUNA 2VTXA 2ZX0A 2Z5WA 5KHKA 3LB9A 3O1UA 1FX5A 5EP9A 3DPRA 2CL2A 1CJPA 5CYYA 4BH9A 2ET1A 4QQHA 4YGEA 1QQP2 3KWVA 3MW4A 3RQ0A 5AVAA 3VD7A 5K7PA 4MGKE 4L9BA 5M0TA 1UZZA 1LHOA 1YFWA 2BOIA 3IMNA 3K2OA 2FCTA 4ZXEA 4BMEA 3OG2A 5FAXA 4EJRA 5C5TA 4P5HA 3U11A 1FXZA 5C3OA 2VMDA 2CHHA 1Q8VA 1UN1A 4O9EA 3BIEA 3JQWA 1HRI2 1DG6A 4MHRA 4Y1XA 4XFAA 2XJPA 3MIBA 1QXJA 1VRH2 4I0WB 3AP4A 3B69A 2VUJA 4AR2A 4K9SA 1VBE3 2A1XA 4AFBA 3U0ZA 1CVNA 3CO2A 3MIEA 1V0AA 1WZXA 4RQPC 5H9RA 2W52A 2CGOA 3VZJA 4AFAA 1VMHA 1O8SA 1H9PA 2WAOA 3AP7A 3AC0A 3CJIC 3D0SA 2HWF3 3ZYPA 1JYVA 1BKZA 2RS12 4EV0A 3GBWA 2CNAA 2LALA 4HOOA 2D6NA 3B94A 4WVMA 1E5HA 5BY5A 5H9QA 4OQ9A 4QU2A 1ASJ1 1CPNA 1JZ6A 3VLBB 1PMIA 1AR73 3OB8A 3J7HA 1M4WA 3AL6A 3LWCA 4Y26A 5DXDA 4OHYA 4GMP1 5FO9B 1ENQA 1WCSA 2DWRA 3HQUA 4OULA 4Q8LA 3TEXA 3I3MA 1QJU1 1VAKA 1UMHA 3ZYHA 2DU0A 2Q4SA 3HQRA 4HANA 3I2GA 5BNPC 5A1LA 2A6VA 1HKDA 2WRAA 3CF6E 3WP4A 5L36A 1F5JA 1FPN3 3NV2A 5C3QA 4FAGA 2ZGPA 3ACLA 2W5FA 4N8MA 1C57A 1K5JA 1QOSA 2MNGA 3R4SA 4Q4X2 5L7OA 2W95A 4AI8A 3UGGA 3OF1A 1A34A 1CZTA 2JG8A 2RS51 1O3RA 1QMJA 5CFCA 2Q8OA 3KGZA 1RUJ3 5JSOA 3VBFC 1JW6A 4ASLA 3NAPA 2WUHA 3V65A 2GALA 1LAJA 2R071 2VXRA 4YLZA 2XHNA 1WLTA 3GCWA 1LOBA 5FY0A 4QT6A 3RJRA 3WINE 4XUTA 2J1AA 2P1BA 1PNGA 2W08A 3O1PA 3AYEA 4YM2A 4DXTA 4ZY9A 1WMXA 4HK9A 2VZUA 1PO23 4UBGA 3VBOA 5LB6A 5LK5A 1ZRFA 4YGBA 5DAXA 5F37A 1UOJA 2XQXA 1EV11 3POYA 2RM23 5IT6A 1J59A 1YC61 2IXLA 2Z42A 4J1WA 1UOGA 5DUXA 3J8F1 3FL7A 1W05A 4DZGA 1G8WA 5C9AC 4DXSA 1F5FA 1ULPA 3WDVA 5CFDC 1W99A 1PNFA 1YQCA 3CEWA 4YZ2A 1NE4A 1KJRA 4TLGA 4ATFA 4PIZA 4ZXKA 3ILFA 4YW4A 1XQNA 2QQNA 1NA1B 1W90A 1UIKA 3O5SA 3VDBA 5F1RA 2OPWA 3KT1A 4XXAA 1KFXL 3FMGA 1Q8OA 2BVBA 3AZYA 4WBBA 3U4SA 2DYCA 3QLQA 1RUF2 1WUVA 3BN6A 1OA4A 3NV4A 4QX7A 4H7LA 1OXCA 3MW3A 3WP3A 3M8LA 2D5HA 4YVSB 3AP5A 4R9AA 1ZZ8A 4XABA 1R1A2 2ZAHA 3AMHA 1HV0A 2NLRA 2DUPA 4COWA 3T0BA 3BTZA 2DVAA 5JPMB 1IZ3A 4ISQA 2IZWA 4FPFA 1DQ6A 1K12A 1W8FA 4LPLA 3CZUA 3ZM8A 4ZZ5A 2JENA 1RL3A 3NV1A 2BOJA 1DFQA 4OI1A 4QKBA 4NROA 2JD9A 4XHXA 2WO2A 4BK5A 1V9U1 4E4DX 1WKYA 5FZFA 4MGSA 2Q30A 4W4ZA 3ZOIA 4CDUB 2FDKA 4CUBA 5FLHA 2FHRA 2EXHA 5JSPA 4AEDC 1ALYA 5FDBA 3ZSKA 1OHFA 1JYXA 1AYM3 2D6LX 2ID4A 4WV8A 1VB4A 3VKMA 1WCUA 3T2QA 1EP0A 4H55A 4CVUA 1H30A 4BOWA 4FOQA 1WBLA 3GDBA 5DZEA 3ZYRA 3NQHA 4QB2A 2EIEA 1QJY3 1MZEA 5C4WB 3AKTA 4SLIA 3M3IA 3RMYA 3IT8A 3KD4A 2NMNA 2VNOA 1UPSA 1PK6C 4XIKA 5GLZA 5BYNA 2D44A 1J3PA 1ODMA 4Y4YA 3K75B 2JDKA 1LTEA 4GMP0 4GB32 4QPWA 1YFYA 1MZFA 2A5ZA 2W87A 2GU9A 5KXCA 3I97A 4NRPA 4D6QA 3O1RA 2X5IC 5FUPA 2W91A 1AL23 5A3LA 1XNAA 1Y7BA 3M3EA 4YVWC 4DQAA 3HBKA 1GQHA 4D69A 5FUIA 3RYRA 4EN8B 4NN0A 1CONA 4YZ3A 5FBZA 1STMA 3JD71 4M3CE 1MS8A 5FZCA 2HEYF 1AR62 5IAXA 2VNGA 3OOXA 4M3CB 2WL1A 1YNAA 1Q43A 1IG0A 2ORXA 3I3EA 1UYYA 1I9RA 1VE0A 2XLFA 5FPXA 2VNVA 1LECA 5DUUA 4QHBA 3WT3A 4FTBA 3SC7X 1ULOA 3I8TA 4CUCA 1YQ2A 4P02B 4HVQA 3ACGA 3ZDVA 5J09A 3KT4A 2Y6KA 1QJZA 1AYN1 2XBO3 3POFA 3KM5A 1NA1A 1RMU1 1SCSA 1UY1A 1JZ3A 3G7DA 5JR7B 3T0DA 5FZDA 5L9BA 5LATA 1ZX5A 4JGYC 4FFGA 4QKFA 4COZA 3T0AA 4F8AA 3P5BA 1UYXA 4URAA 2ENRA 1MQTB 2PLV1 4YVSA 4YYOA 2RHPA 4BZ4A 3V0BB 4HVRA 3ELNA 2WFF1 1A6CA 3T3YA 3VZKA 1UMIA 3F95A 3JXSA 3OD0A 4RD7A 1GWLA 3WW2A 1ODNA 2RR12 3VHRA 4FVVA 5FZ6A 1AZDA 5FP3A 3T4HB 3GJBA 2E26A 4A3XA 4YW3A 5A7QA 1QJX3 1KS4A 3VD5A 3VUOA 1YQ5A 1I6XA 5FJKA 4IV3C 1LR5A 4D3WA 2XLGA 3WNLA 2B8MA 2DVFA 3KQ4B 4CDUA 1FAYA 3VDDB 2SBAA 4NOTA 2E33A 1C8M3 2P6HA 2R061 1R64A 1ZRRA 4QPYA 4YSFA 3ASIA 3E97A 4DXRA 3LIHA 4L0PA 2IVJA 3VB9A 2WS91 1PZ8A 1RUE2 2R7EB 3TNPB 5C33A 1VBA1 5CA6A 1UXZA 2YC2A 1JU4A 4PIXA 4IEZA 1W6OB 2WYSA 4MX3A 4OUMA 4WM7C 4Z8BA 1W9YA 2NP0A 5IUQA 4OLLA 1RUG3 5F6KA 1SG3A 5FYMA 5LA9A 1HB4A 5C4WA 1RVF3 3OPWA 4JV4A 4UW5A 5ISLA 1OD5A 1IKPA 2VH9A 5BNOB 1F15A 2QQLA 4FSJA 4QB6A 3PJYA 3W5NA 4E9KA 2GC2A 2PYTA 5APAA 1GICA 2JICA 4K1YA 5EJZB 4Q8KA 3S57A 1W6PB 1ULGA 2H0BA 2UY9A 3JUUA 2XVGA 4HT1T 3ZFGB 2VZSA 4RQPB 5FK8A 2XKPA 1CPMA 2OX0A 2PHLA 4FI9A 3JCIA 1TNRA 3DUIA 4L99A 3RPQA 4CP2A 4JTNA 4XBNA 4N43B 3GGLA 4JQTA 2CY6A 2VBBA 1HRV1 1AUYA 2XJSA 3H3LA 4YM1A 2VMGA 1WLCA 2CGNA 4XF1A 3HNBM 5D1IA 4M3CA 3FUOA 3GBFA 1JODA 3IWZA 5FZLA 3ZSMA 3SISA 4FTSA 4COYA 3DYOA 4J6GA 1MS3A 3MZHA 1QJU2 3LEGA 2DCKA 3MBWA 5IK8A 2NQYA 2RG4A 5CAZA 2XDVA 3HN1A 5DZGA 5BNPB 5K0UB 5K9YA 1VMFA 2E7TA 2HYXA 2VOXA 4QX1A 5FYVA 3KCCA 5FRAA 2EIBA 1GZCA 1QEXA 3DYMA 2Y0IA 1C8NA 1UU6A 5CADA 2JE9A 3VBHB 1JI6A 2WZR1 2HLEA 2RS52 4BQ4A 2CTVA 1V6LA 3QBQA 4N90A 5GALA 4E2GA 1IPJA 4XXPA 3VBRC 1MQTA 1OKOA 2FDIA 3V0BA 4CEYC 2QQMA 2H6CA 2WFPA 4JKLA 3NJVA 1CESA 2GC3A 2ZEYA 1R1ZA 3SCHA 4NWWA 4NRQA 4CP9B 2FDGA 1CAXB 1OD3A 4Q1PA 3UGHA 3OUJA 5JDBA 2VQAA 2WNUB 5FK7A 2PXJA 3FFZA 1YFUA 1GKBA 1EV12 2JIJA 3IB3A 4QDSA 4CCKA 2QQOA 2DBNA 2JEMA 3K4DA 2DFBA 4IV1C 3J8F2 1LGNA 2WT1A 4OUSA 5C9AB 1S2KA 2QNKA 1RJ8A 3VDDA 5EQUA 1S0GA 3MGUA 4OMCA 4AEJA 5CFDB 4AI0A 4AVCA 3ZXAC 5IYYA 5BV6A 1TMF1 1OI6A 3WLUA 5DDJ3 5FJHA 4CU6A 2XHKA 5G04L 3WF3A 1EPWA 4AK3A 5LBBA 1W6OA 2ZX2A 4HKLA 2ZGOA 3VBUB 4Y5Z0 2FDFA 3ZXDA 2E53A 4UFJA 4IGPA 1XRUA 5DAVA 5T52A 3BTXA 5IK4A 4MSVA 1OH4A 4IW3A 5FMOL 2DTWA 1AX2A 1S1AA 5FP7A 3VHNA 3PVOA 5BNOA 1VBC2 2XONA 4XCBA 4N7IA 2W1SA 3KB5A 1WW5A 5H9SA 2BGCA 3MUZ1 4N53B 5FYHA 2AACA 2FBEA 1W6PA 3ME2A 4JDNA 1JYWA 3ZFGA 4RHV3 1QIQA 3BU7A 4RQPA 3AYAA 2VCAA 1IS5A 2XR4A 4JRAA 1ZBE2 5FYZA 4ASKA 5H9PA 4D8MA 4E4HA 2WA4A 5JOYA 3P3PA 4YM0A 4ZU7A 3LFMA 4N43A 1V9U2 2AREA 5D2AA 1S0CA 4DUXA 2VBDA 2NYYA 3I54A 3IN9A 4LT5A 3LOIA 4ASMB 2C6SA 5KHJA 3PVEA 2ZGRA 4Q5OA 2E32A 4Z82A 3UNPA 4DO0A 2QQUA 3ZFEB 2Y6HA 4XJWA 3RZKA 3OY8B 3ZSLA 1RC6A 4CDQC 3NNMA 1K42A 2Q8EA 4L92A 1VRBA 4DUWA 4FAHA 2D43A 1W04A 1RXFA 4CRQA 1ULEA 5I91A 1LNSA 1MZ5A 3PUIA 3LDBA 2XJRA 1W6MB 1O4ZA 1YFXA 1QJFA 1PO13 1XNBA 4IEPA 4RS5C 3S30A 4PCRA 2WO3A 4D94A 1W2AX 1TZOA 3I3BA 2VXJA 1SEFA 3O0VA 5FZ0A 3VKOA 3WX5A 1LU2A 2QQIA 4C90A 3OBRA 1VRH1 2DVBA 3O7OA 1GP4A 1H2LA 5FZEA 4RGAA 3KLSA 4PT6A 1DQ5A 3VBHA 4QGLA 2BTVC 3NVCA 4AVVA 3AZZA 3KZ4C 3LGRA 1NCQB 4LHSA 4QQOA 1S4CA 2X5IB 5FKBA 5FMOS 4V2VA 5FREA 1GUIA 1NYWA 3SKVA 5FMCA 1LENA 2VTFA 2BGOA 1XNDA 2RS11 4XDPA 3PMSA 5FZ3A 3AP6A 3OCPA 2AZ5A 1SACA 4E4SA 3OPZA 2ZGLA 4CP9A 1BBT3 1CAXA 2GNTA 3JD72 1VIWB 2WNUA 3RMXA 4AQ2A 4C0BA 1DLLA 5FPUA 5FLIA 2ARBA 4GAZA 1D0GA 2JD4A 4GWJA 4JKMA 2BV4A 2VE1A 3OJBA 3KSCA 3CZJA 4F83A 5C9AA 3HPNA 5A7NA 1RITA 2O14A 5CFDA 1C1LA 2G9GA 4Q2FA 4EROA 2EA7A 4TXWA 5DAQA 3ZDSA 1DGWX 3AB0A 5LBFA 1DDLA 2A71A 1N1VA 1R081 5AC93 2FDHA 2YFZA 1AYN2 3FUQA 5FKCA 2LUWA 3AMQA 1RMU2 4QDRA 3VBUA 4BQXA 2PN5A 3PIGA 4HVOA 2PAKA 1ZBA1 3OEAA 4MYEA 2IFWA 2O1QA 2HWE1 4C1WA 5I8YA 5SV8A 5F5QA 5ERLA 5F9TA 1DHKB 5BXXA 2B39A 3KCYA 2PLV2 2Y0OA 2Y6GA 4YG0A 4FPLA 3DXUA 3ZYFA 1CD3G 2WFF2 2VUAA 4N53A 4CUGA 2HWD2 2ET7A 1H2MA 3C7OA 1SHWB 3I3QA 2ES3A 2I74A 2W39A 4LO4B 1GWMA 5BNQA 4YW1A 1WMDA 4IV3B 2VJXA 4ZONA 4JAAA 2IXKA 4D7TA 3H8RA 3N9MA 2F4PA 3VZOA 4CCMA 4K40A 3RZGA 4K6BA 3MF9A 5HXMA 2D6KA 3PTYA 2R062 4FBFA 3ZFEA 3W20A 2ZGSA 3OY8A 3E5UA 3J26N 4WM7B 4LHLA 1VBA2 2HWB3 3VV1A 3OTFA 2B4KA 2FD8A 4MOAA 5JXJA 1HN0A 5ABJB 3JBG2 5IK5A 3ZPOA 1O5UA 1RUH3 1VP6A 1W6MA 1ND2C 4D7SA 3ZXFA 3BPZA 4NO4A 4QPGC 1G9CA 2QQKA 3N4MA 1R1A1 5FYCA 5GZCA 3FX3A 4Q4V3 1VALA 5HXVA 5C70A 5LBEA 1AR92 1VBE1 3I2JA 4O7XA 4RR3C 4LK6A 1RUC3 3RYKA 2B5HA 3WW4A 2BBVA 3ZIWA 4CCJA 4I2OA 1N1SA 4PDWB 4CCEA 4B1MA 1NCQA 1R093 2R0HA 1X8EA 2BZDA 2HWF1 2X5IA 3GXUA 3UYJA 5GZGA 1CJDA 4PBOA 5T5OA 3ZFFC 1S0FA 1B09A 2XJUA 3WEZA 1ZZCA 2ZHKA 1LCLA 5FYBA 1Z7S3 3AP9A 4QX8A 4B7KA 4N7UA 5C8CC 2VG9A 3HVDA 5A6XA 5HCHA 1FOD2 1HRV2 2VZQA 3AYCA 2D97A 1WW4A 5FY7A 2W47A 3D82A 4NPMA 5T54A 5A3MA 1Y4WA 2O8QA 5LRRA 1LGCA 1N3QA 3RS6A 5LZ6A 4PLMA 4AGRA 1XXNA 3I49A 3AX4A 3RNSA 3ACFA 5A3TA 5LCWL 1S0EA 2E63A 3HQXA 2Y64A 4XE9A 5GM0A 1NZIA 2RMU3 5JOWA 3BYWA 5SV5A 2AR6A 2UWBA 2XVLA 1F4HA 4YW6A 1YI7A 3AFGA 4IEOA 2XOMA 3DXTA 2XWJB 2A3WA 1X7NA 2WNOA 4C1XA 3LDKA 2YV8A 2WNVB 5E88A 3H9AA 4LIUA 2H6BA 5IVYA 2JE8A 1W6QB 2WZR2 1NY71 4AHWA 2GNDA 3WP5A 5HCBA 1A3KA 1QWRA 1K5MC 5BNPA 2ZOEB 5JIUA 2DCJA 2KD7A 3ZXJA 2Y60A 3LSEA 4NIAA 1PVC2 1JZ7A 2PMWB 4HKOA 4HZFA 2JKXA 1XSRA 2ZGMA 4AYUA 1RGSA 1E5IA 1MACA 2ZEXA 2VL4A 2VO5A 2WYFA 3HBZA 4XUQA 1BHGA 3CJXA 1AR61 1VBB3 4YZ1A 2HWC3 2OPKA 3RGBA 1POQA 2LM3A 4XJ9A 2JIGA 4XQ4A 1DGRN 3WW1A 4IV3A 1F8VA 4K7JA 4KMQA 4IV1B 5FO7B 4LITA 2ZAAA 1FMD3 4KWKA 2GP5A 4QPIC 1SDWA 1HQLA 1KJLA 3EO6A 3HR9A 1UZVA 4IXLA 4QAWA 1J3RA 1V6MA 2ZHLA 4IDZA 3BVCA 2Q8CA 4AAPA 4GALA 4QM9A 3D8CA 3O12A 2VCMA 2W94A 3N7LA 4NJ4A 1YIFA 2VW0A 5F8PA 4WM7A 4C91A 1DCSA 2YYOA 3VDCA 2AGSA 2RS32 2YBPA 3VHOA 2P3KA 1H8TB 2R1BA 4OCTA 2AUYA 2VZVA 3WHTA 3Q8FA 1CQ9A 5ABJA 3LF7A 2A70A 5D8AB 2GNMA 2OW4A 2PHUA 3AFKA 1PM4A 4DPNA 1OC1A 3UJQA 1RYYA 2DV9A 2WO1A 3ATGA 4XMIA 3VL9A 4BCUA 5CKNA 2R16A 1ZZ7A 4PDWA 5BNNB 2OVUA 1WW6A 1MS0A 2ZEWA 5IFPA 3PLQA 2Z4FA 2PQSA 1I3HA 1YQ6A 1D4VB 1OQDA 3DCQA 4B3NA 5LEKA 1V6KA 2VVEA 4Q4X3 2VQUA 1V70A 4FXKB 1ND3B 1AYM1 2WSVA 2E6VA 4CCCA 5IVJA 5A7SA 4BU2A 2GH2A 1UZYA 1Z0HA 4AHYA 1KRIA 2BERA 3PUHA 4UFHA 1RUE1 1Y9MA 3URFA 3DKWA 1OH3A 4B4RA 3S5QA 1QJY1 1CWPA 3BTAA 3M70A 3BUCA 3FE5A 1HXS3 1US2A 2WWSA 3ZYGA 2Z79A 1W28A 1GYKA 5J48A 5JR2A 1ENXA 1TME3 4LORA 4XJZA 5FPZA 4RS5B 3B00A 1SFNA 2ZKLA 3IIIA 1KS5A 2WNVA 3DN7A 3RWNA 2JG9C 1SPPB 3P3NA 1AL21 1LOFC 1W6QA 4Q4W3 4P9GA 3U14A 3OSDA 4XUOA 2QVSB 3ZN6B 1EAH3 1O6UA 2WABA 5C6CA 1M06G 2CGPA 3WUDA 2IWGB 3DF0A 3E5QA 3MHZA 3T09A 5FY1A 3GCXA 3ZVXA 5J3UA 4XF4A 3KQRA 4KG0A 5FBJA 1POV3 2ZX3A 3ZXKA 4ZS2A 4NAMA 3KT7A 4ZPIA 1IQDC 1WD4A 2JDZA 1OBNA 3H1WA 4P9WA 3TAYA 5FR3A 1B35A 1RUD3 3VHPA 5FZIA 5JCTA 1COV2 4RGGA 1O7FA 3HN3A 4KH9A 4IV1A 3TNQA 2EALA 3ENRA 5FPVA 3I2IA 2GC0A 2VZ3A 4OZOA 4QGMA 2OKXA 4K20A 2D3PA 2X29A 4XEZA 5CG8A 4GKXA 5JVVA 3WR0A 3HOBA 3WF4A 3AZVA 3H8UA 5IW0A 3WQ0A 1N3OA 4KG8A 2Q0AA 1WD3A 3PMEA 5HI0A 1IHMA 1N1YA 1VR3A 1R082 1IKQA 1YI9A 4BISA 2OQ7A 1H8TA 2ETEA 1OLMA 4XUNA 3SEEA 1ZBA2 1X9PA 2YFUA 4QHZA 2HWE2 5D8AA 4PQ9A 2AEZA 4PF1A 1T2XA 3ACIA 1KQRA 3OUHA 3FC0A 1AX0A 2B45X 2YBKA 2YZ4A 3C7FA 3NNJA 5F6LB 1Y9QA 5FY9A 4AFCA 5BNNA 1JZ2A 3ES1A 4BLJA 2MEV3 3S0MA 2ADDA 1G6NA 3LKJA 4BQWA 1OKQA 4CCOA 5FYYA 3CDZB 4LBNA 2D3RA 4FOYA 5A3WA 3NO8A 1ND3A 1C8M1 1G7YA 1W03A 1XNCA 2OQ6A 2VOWA 3HMYA 3P1IA 4BDVB 3MFCA 3KVAA 1OF3A 4HPKB 5DPNA 5L19A 1NXMA 1GP5A 4CA9A 1JUHA 3HT2A 2W92A 3TN93 4KGGA 5JIAA 5T50A 4FPGA 3WCRA 2FMDA 1N3PA 1UKRA 2TUNA 3GHMA 4ISRA 3ZR5A 1RUG1 2DDUA 1MS5A 3MF6A 1RVF1 1RJ7A 2WC2A 4BK4A 2PHXA 2BWAA 3C7EA 4OYUA 1UD1A 4QKDA 4AW7A 5FOJB 5K8SA 3B5LB 1ND2B 4RS5A 4ORFA 2P37A 3SH5A 1MR5A 4BYYA 1VBC1 3RI9A 1J1TA 2B46X 2Q5TA 5JMOA 2VAUA 4QDQA 1HIXA 1W39A 3PNAA 1KDMA 4BM8A 2Z69A 5KC5A 1SPPA 1VBE2 3UKVA 4LOTA 2NN8A 4KWUA 3N9NA 5A7OA 3W21A 3ZN6A 1ZRCA 1XOYA 2JECA 1KDKA 1S0DA 2DF7A 1ZBE1 2DCYA 3GBGA 4LOSA 1UCXA 2HWF2 3FLTA 4H2AA 1AR83 3RJ2X 5A70A 1I1EA 3ZFFB 2BRTA 2VZPA 4BQ5A 4ET7A 2D5FA 3HT1A 3GJAA 1W8WA 4DINB 1RHI3 1LU1A 2VQ0A 2WLPA 2PHRA 4LUMA 1AR72 4Y4RA 3DKQA 2XUEA 3MLJA 4XOGA 1H4HA 4AGVA 1BEV1 2W1WA 4FP3A 4GWNA 4OFGA 2JXAA 1FYUA 1D4M3 3H3UA 3IZOA 4XVHA 5F39A 1ULFA 4W6WA 4PLOA 3S6PA 5B4NA 2VMEA 4YGCA 4XFGA 1V00A 1FPN2 4BJ0A 2VBPA 3CQOA 5IVCA 2A7AA 5DABA 1IS6A 4Z2WA 2IXHA 4XZPA 5FP8A 3PL0A 5JZGB 2XJTA 4ES8A 3IPVB 2E7QA 3POBA 4I02A 2GNBA 4Q4Y3 4HONA 1PIV1 1UY2A 1RUJ2 1C5IA 1ZA4A 1QOTA 1DQ4A 4XUPA 2D6OX 4QX3A 3O1OA 1YJKA 2IUWA 1NY72 2ZABA 1FI2A 1NUKA 5E6HA 4CEWB 4TYSA 3NL1A 3FN9A 3MFAA 3MIDA 2GAUA 2VECA 2QQWA 1WCDJ 4UAPA 3ZKUA 1CIWA 3R4DB 4ATEA 3AZWA 2RM22 2WWJA 4JX0A 1Q5OA 5FLJA 4BMBA 3L2YA 3O1VA 5F2WA 3WDXA 1PZ7A 1JZ8A 4JHZA 1QDOA 2BNNA 2J42A 5HBAA 3BIWE 2C5DA 4QPIB 2L9LA 5DDJ1 2QDNA 5CZKA 5I93A 1F31A 1REDA 1SLIA 4HPKA 4M0NA 3AVSA 5A1AA 1QJEA 1QU0A 2ORZA 4KL1A 4IUGA 2RV9A 2VM9A 3U1XA 4CUAA 4AQTA 4JDOA 5AVPA 1ZREA 3WG3A 2R30A 1JUIA 3OPTA 1QNYA 3POJA 4WM8C 4AEMA 1ND2A 1JYTA 1ASJ3 3E6CC 3AM2A 3RZMA 1ST8A 1ONAA 4X8PA 3NJZA 4IL7A 3D6EA 1ZM1A 3MLKA 5I0TA 4A2UA 4R9DA 4MGTA 1AL0G 4RHV1 3T2TA 4MZUA 2HWD1 1OA2A 5EXOA 4XILA 5ACA3 4G4FA 5JXIA 3AKSA 3SXWA 3RZLA 3H7JA 1WW7A 4QQ2A 3UT0A 2QDRA 3EXUA 1AXKA 2PAEA 3FJSA 3ZFFA 2UU8A 3ACHA 4XURA 1SLAA 2D6PA 1XYOA 2YU1A 4XF0A 2WR9A 5F5CA 3R6SA 2CDPA 3ZYBA 4EWEA 2AENA 3DGTA 4IETA 4BWOA 1AYM2 1PZ9A 1QHDA 1TNFA 1XNKA 1JTZX 4X6RB 5FUNA 3SMHA 5J37A 4FQ4A 2VCCA 3P6BA 1NT0A 4UF0B 4YM3A 5I0UA 1JZ4A 2KXLA 4FOWA 1LJ7A 4IE4A 3VL8A 3WOGA 2OS2A 2J7MA 4J1XA 5L9VA 1YWKA 2R073 3S7EA 4BXFA 1QJY2 1PO11 4KGQA 3JBG1 1OQ1A 5IK7A 2VVFA 2AEYA 4FQZA 4K8RB 1O3SA 3N9OA 1TE1B 3EMRA 1WCKA 5JZGA 3F2ZA 1EV13 1GOHA 4B29A 5CISA 1AR91 1GNZA 1ZZ6A 2IVIB 2JDYA 3IPVA 4INDA 4I3PA 2ZHNA 5I8TA 2IXCA 3I3DA 3QOPA 3SH4A 4OHVA 3GALA 2UY8A 3RVHA 4LXLA 4DEVA 1AL22 3A7QA 3K3OA 1PHMA 4IEVA 1OT5A 3KV6A 4XAEA 5T55A 1H2NA 4NIIA 4S2HA 3WQ1A 1FV3A 3BU0A 2V4VA 3HNMA 2WZ8A 3PIJA 2FZ1A 2P3YA 4HMZA 4OI4A 1Y3TA 3B9IA 3CJIB 2ZTNA 2YBSA 2GDFA 4CEWA 2OT7A 2VULA 4HXCA 4QU1A 5GLWA 4BQYA 3WNMA 4H7MA 4XFHA 4CDXC 4DUVA 1FOD1 3IKWA 3K77A 2ARAA 3ZIXA 5T5PA 4AE2A 4COVA 5FWJA 1DP0A 1GV9A 4FT8A 2ZACA 1MEC3 2ZKNA 3WSOA 2W1UA 4COUA 1YHFA 4I09A 1XBFA 2EAKA 4JQRA 2W2IA 4FFIA 2IC1A 5FQ0B 1FNZA 3N7KA 4LMFA 3Q8BA 3MIHA 4NHLA 1ZYBA 4MGYE 4QPIA 1BJQA 5DN2A 1H1MA 3POSA 4I0BA 4OUEA 4CDWC 5AC91 2XBO2 3QD6A 2Y34A 5FP9A 4U2AA 5CKQA 4DNYA 4MXWB 5EYYA 2FCUA 1LEMA 1NQDA 1OLQA 1QNWA 2A6ZA 1CR7A 4XMAA 2V72A 1Q3EA 2JJ6A 4W50A 2XMLA 1V6NA 4BHPA 2GMMA 3EYPA 3FBMA 1GQGA 1WCQA 5A32B 3KHCA 3C3VA 3DPRC 2RJLA 3W58A 4E8DA 1YEWA 3VBFB 1PVC1 4CPBD 2RDRA 4JCKA 3WHUA 5FIXA 1UX7A 1E57A 4XF9A 3MLLA 1AHSA 2ARCA 3H1YA 4K3UA 4YPJA 4I30A 5KBFA 2VTXJ 2PHTA 4Q29A 3IAQA 3AMPA 1QJX2 5C3RA 5IVVA 5JI7A 2DBIA 3MPPG 4ZU5A 3WP6A 3LA7A 1S0BA 3CHXA 4RYDA 3AXDA 2XH6A 1ZNPA 4LO6B 4G3YC 3B02A 5A3UA 3FWEA 2X05A 1LOEA 1WA6X 4G9SB 1C8M2 3RZHA 4LE4A 2E31A 4UW4A 4YG6A 2EIGA 3GM8A 4UF0A 3MV01 4IEYA 2OIIA 3IBMA 2HWB1 3EB7A 3T30A 5GLTA 2VUCA 3C2UA 2RS31 2WIIB 4LJHA 2EXIA 4Q0PA 3AJZA 1RUH1 5HCAA 1GZ9A 1RUG2 5DUVA 3N9LA 4ZS3A 3WG4A 1RVF2 1XE0A 4JHTA 3NNFA 2EICA 1J58A 2WQ8A 2JWPA 4LR4A 3I2FA 5G05L 4XACA 4XFCA 1DGRA 2CAUA 2AYHA 4FCAA 1BZWA 3ZYIB 3RRDA 2G1MA 2XUMA 2WAAA 4OI2A 1R091 3J7LA 4HK8A 2J22A 4DFSA 5JXGA 2XJQA 1LOFA 2LRPA 3NWKA 4RN5A 3N3HA 3A22A 3T2PA 4UYBA 1D2SA 4R4XA 3POWA 3UV9A 5HPOA 3CJIA 3WUCA 2JG8C 1YUDA 5LEJA 4XZUG 3K4ZA 2VCBA 3QCWA 1EPZA 2GMEA 3UETA 1NAEA 3UKTA 4D6SA 3WDUA 4AEDB 3NAPC 1MS1A 4I3GA 1XB9A 4S2GA 1O59A 1UXXX 2ZGQA 3ITQA 4EN6B 3G6JB 1Q8PA 1H9WA 2PLV3 3U07A 5FQ0A 4AI9A 1UWWA 3ES4A 4M00A 3BOWA 1OPOA 1U5ZA 1WMEA 1IOAA 1BEV2 3NJYA 1UF2C 2OZJA 3NRUA 4GD4A 5FZ9A 5KHHA 3WQBA 1ZA7A 3POIA 4EZHA 1UL9A 5ANNA 2Y33A 1RUI3 4A7YA 3J7MA 4X8NA 3FHIB 3TEZA 1PK6B 1G9DA 4BIFA 3DL3A 1LHNA 4MXWA 5FXVA 4AVTA 2VMIA 2VZTA 1VBD3 2CU5A 2I07B 4BQ3A 3GYDA 4LHKA 4LO7A 3KGLA 1PIV2 1REEA 2ARXA 4LBJA 3RZZA 2WT0A 4XTMA 2RE9A 2IXJA 4YFWA 4AFDA 5A32A 2XL9A 4LA3A 4WVWA 3VBFA 3WD5A 4YVWB 4KBZA 1JYCA 1CN1A 2WS93 3OGJA 2QCSB 1LOCA 2K2SA 3ECQA 3CIHA 2VOVA 4LE3A 2Y6LA 4RFRB 1COV1 2P3JA 1UQXA 2CWMA 1FMD1 2RJ2A 3KV4A 1UW8A 4O9GA 3ZN5A 4XBLA 4A7KA 4NVPA 4CXWA 2VVDA 4MH0E 3BOPA 1UOFA 3KVBA 3A23A 4GQ7A 3ZPYA 2YPJA 4LQRA 5DDJ2 3LSDA 4URTA 5EV7A 3ST7A 3TYJA 4BQ2A 1QGLA 5GLVA 4Y3OA 1W9FA 2A75A 3LPGA 1DF0A 2NMOA 1DLCA 1ZVFA 2BGPA 1XNTA 3ZO0B 4AGGA 4M01A 2UWAA 4JGYB 5A1FA 4XCAA 1I5ZA 3BALA 1PGW1 4LO8A 1AJOA 2WN3A 4QQPA 4WM8B 5L73A 3AKRA 5CBLA 2ZMLA 5LA1A 3BKZA 4XIOA 1W3XA 3T2OA 4QHOA 5K4LA 4GA9A 3ZSEA 1GOGA 4P9IA 5LBCA 3OUIA 4LULA 4Z07A 4RHV2 1PVXA 5F3CA 1GOFA 1QXPA 2P3IA 3SHRA 2JDAA 4EZ4A 1BK1A 2G9ZA 2V5DA 1BLZA 2MHFA 4UOJA 5FYTA 2V73A 5A7WB 5DQ0A 3NSTA 4A44A 4CU8A 4LLFA 1A8DA 1D7PM 3KMHA 1SZBA 5GJ6A 5KHIA 2SLIA 4MXVA 1FV2A 1TVGA 5EYXA 3PVBB 4QGNA 4AEDA 3POEA 3T4VA 5JI9A 1GWKA 1SDDB 2YPDA 3GHNA 3NW4A 1G9BA 4A6OA 1HXS1 4Y5SA 4NPLA 1EYBA 2QUOA 4CTEA 4RFT0 5B4XA 5FZ7A 2C0ZA 2ZXQA 1UZ0A 2TNFA 2WZEA 3OGSA 1WGPA 2W0XA 1PO12 3RYPA 4F7ZA 1CAWB 2C1FA 2BYVE 4JDMA 4LBQB 3H0OA 2G19A 5KR7A 1SBDA 3GZTB 2UYBA 4Q0VA 1U0AA 2J1SA 1PK6A 3WF0A 4TLFA 3NJXA 2C9AA 1EUTA 4Q4W1 1UZWA 1EAH1 1N47A 3GNEA 3WDWA 1SLCA 4A42A 1JU3A 3LQCA 2R043 2ZX4A 3DEMA 1LRHA 4SBVA 3I2DA 4YVWA 3A0NA 4WZCA 3TOJA 1NA1C 4LBMA 5E1RA 1TMF3 4GJYA 3I2OA 4RL7A 3A0KA 3K51A 4XYXA 4E4ZA 4W8JA 1BBT2 2BNMA 2YXSA 3N9PA 2VMHA 3FHQA 1UY4A 4XC9A 1RUD1 2RVAA 1AR71 1OVSA 2Q1ZB 3ILNA 5FY8A 1W3VA 3USSA 3WW3A 4ARXA 4HLTA 5ANQA 3VD4A 1JMUB 1SFYA 3PUQA 3UK9A 3KV5A 2VR4A 5F3IA 4EYUA 4JVAA 3OGVA 4A7ZA 2VC9A 4PHZA 1WBFA 5KXDA 1HW5A 4P9YA 5FYSA 4XTPA 5FZAA 1Y43B 2GC1A 2DUOA 2ZGUA 4GWMA 1IQAA 1FPN1 2WINB 1XE7A 1W8NA 2C4XA 2WBKA 5EJ3A 3PJQA 3O0WA 4Q0SA 1OF4A 2GH8A 4X6QB 5AC92 3BI3A 1SQ4A 1DIWA 4CDUC 2Y6FA 5F3EA 1RUJ1 1MVQA 2H0VA 4UXAA 4JGYA 1UU5A 2EXJA 3W9AA 3HEIA 5A33B 4Q0UA 1JYNA 3DPRB 4WM8A 5C71A 1AXZA 3IMMA 3PTRB 5GZFA 3VBRB 3LDRA 3AZXA 2A3XA 4FXGB 4C0HA 1X9TA 4D6RA 4E2SA 3WCSA 2HBUA 4CEYB 2LS6A 5EIYB 2YY1A 1QQP3 2CAVA 1PO21 2J1VA 4PLNA 1N1TA 2MEV1 3UGFA 1J84A 4PI0A 4YG3A 4EQVA 1UIJA 2A3YA 4IE7A 4QQLA 5C4WC 3MYXA 5CU1A 2RM21 1S55A 4CU9A 2N7GA 2XVKA 5C3SA 1GNHA 1S2EA 4YZ5A 5A7WA 4HG6B 1HRI3 3OBZA 2GN3A 2W46A 3JQXA 4W6YA 5FZKA 1VRH3 3VKLA 1Z78A 4KWJA 1RIRA 3NMBA 2O0OA 5A3NA 3E6DA 3MIFA 4I0AA 3D5OA 3TN91 2JDNA 3R0RA 4UWDA 5IVFA 1XSQA 3AMNA 1G86A 2YGMA 2HWB2 1GFF2 2BUKA 1URXA 1BK0A 3WQ7A 1KD7A 2RS13 2YDEA 3K3NA 4H3WA 1U5XA 5IVEA 1UPIA 1RUH2 4B4QA 4IEQA 5FMDA 1CAWA 4AAXA 4HBNA 2VY0A 5DAWA 4AVBA 4JKKA 5LWBA 3SCFA 4XFBA 2AC1A 3S5AA 4E27A 1AXYA 1RUC2 1DYKA 1NCRC 5KC6A 1K3IA 2HEWF 4Z92B 2VOTA 1PMHX 2R32A 1R092 1AF9A 1AR81 2FDJA 2FCVA 4IQPA 4LNVA 2D3SA 3MIGA 3ZX7A 4IEXA 2XL7A 3LEIA 5LA0A 4NMIA 1Z7S2 1BVVA 4DXZA 4EWAA 2FMYA 3LAGA 4OI0A 1CZSA 1UY0A 4K21A 4YARA 1AJKA 1IGOA 1KGYA 1NXD1 4IEUA 1LGBA 2XJVA 4UI9L 2PHFA 2HKXA 1MQTC 3MO4A 3VKFC 1UY3A 3WV6A 2QE3A 3CLPA 4PI2A 5EHDA 1PX4A 2J1UA 2VW2A 3AMMA 1POV0 4CDQB 2QKDA 2RMU2 3BODA 4LLOA 2D98A 3WNXA 1GZTA 1ENRA 1OFNA 1PX3A 1MS4A 2BNOA 2YG0A 3PU8A 5BUVA 2ILMA 4HETA 4Q4Y1 4NE9A 2XLAA 3WXPA 2DVDA 3POGA 4HSJA 4S2FA 4V2WA 2DURA 3VDDC 4FOVA 2CSGA 3VKNA 1O3QA 1IS3A 3BTYA 2OUHA 1BQPA 1OA3A 2BU9A 5A33A 3M3QA 2CDOA 1UU4A 3J4UH 1NX9A 4UFLA 2PHDA 3VBRA 3WDTA 3TRSB 2OA2A 2VUDA 3LD8A 3ZXLA 1YCIA 4CEYA 4FTEA 4LBQD 3U4XA 5EWSA 3AK0A 1GNYA 2WZPP 1C4RA 3NKTA 4TSVA 4A41A 4XETA 3PHMA 1VBB2 4BIOA 3J7NA 3BCWA 1RUF3 2HWC2 3E5XA 5BNOC 1S0IA 2D40A 5FCCA 3ZMOA 5J96B 4IE0A 4LA2A 1JXNA 5A6ZA 2R49A 4RA0A 4QWNA 4P9LA 1R1A3 4P9JA 2A6WA 3THDA 5A6YA 2F6BA 1FMD2 1O8PA 5EFUA 5FPBA 2QZ2A 3EJKA 3NV3A 3THPA 3ZFGC 3D3AA 4KWLA 4LKDA 2DVGA 1HJFA 1TG7A 4NIGA 2W3JA 2HYKA 2RJKA 5CB7A 2XBO1 1V6OA 1DZRA 5B2GB 1UO9A 1NLQA 3HD8B 3Q8AA 4MGQA 4N43C 5IWFA 4MHUA 2BBAA 1SCRA 2BQPA 3IDEA 1OOPC 1WA4A 3CU7A 1W06A 1BYHA 1F9KA 2WQZC 1W0OA 1VMJA 1YJLA 4M3CF 1PGW2 5IFTA 3ZLIA 1VJ2A 2IFRA 2ADEA 5ACA1 1VB2A 2QQJA 1SFPA 5IJRA 1QOOA 5JLVA 4CU7A 3TEWA 4Q1RA 2QTWB 5K0UC 4MUVA 5E16A 3SH3A 2JB4A 3S7IA 2QBXA 2I2SA 2ZBJA 1QJX1 2X09A 4GZ9A 4MGZE 1JZ5A 2XPJA 3JU9A 4F3JA 4R52A 4GWIA 3D4KA 2YHJA 2W68A 3JB8A 2TBVA 2VQTA 3EHKA 2VU9A 2A73B 3VBHC 2DCZA 4GB33 1APNA 4BLIA 5DAPA 3WDYA 1SBEA 2VNRA 3D0JA 5HV4A 5CEHA 4LTAA 2XWBB 4DY5A 3HIFA 2Q8DA 4YZ4A 1W2NA 2F4LA 4CCLA 1HXS2 1UAIA 4CDQA 1LOGA 3RDIA 5DUWA 4H14A 3N7MA 3V0AB 1TME2 3C7GA 4LEJA 2WNUC 4FPHA 4E2QA 4Y1VA 5LY1A 5JOZA 4FPCA 1AR63 4XJUA 4QPGB 2DUQA 4CCNA 2PELA 4Q26A 2WLQA 5IATA 4UW6A 3O14A 5LA2A 1SLTA 2BJSA 2WDBA 3B9CA 4RR3B 4Q4W2 1OFSA 3NKGA 5GLUA 1EAH2 4Y24A 4MGIE 1GZWB 4DMIA 3M1HA 5HCFA 3AJYA 2VOKA 4FPOB 4PF5A 4Y33A 2TEPA 4I01A 1UOBA 2IXIA 3RWKX 3THCA 3VBUC 5AFBA 5FOBB 4DIQA 2G4IA 2YROA 4NPRA 5C8CB 4ZKTB 1MEC1 4JTOA 1HDKA 4MO3M 4MG2A 4L11A 4ARYA 3LIGA 3MI8A 3VDAA 1RUD2 3HNYM 4AG4A 2P6CA 4FPEA 1W2TA 3T1MA 1H1IA 1RUOA 3ZXEA 3BGAA 1O5LA 4KU8A 4N53C 2WWUA 1C5HA 4M4PA 1YQ8A 1LOAA 4KI5M 4O61A 1KITA 2E7AA 4QXCA 4AVSA 2RR13 4W6XA 3NNGA 3HJRA 2W9XA 1F35A 5FP4A 5A3PA 2EIDA 4O65A 3VD9A 2C9KA 2J1RA 4UW3A 5E89A 2GP3A 2P17A 4YGDA 1UX6A 3H1MA 4IGOA 5FZ4A 5I8SA 5JMCA 3VBSC 4OQ8A 1OQEA 4AQ6A 1X82A 1IPKA 3N36A 4YW2A 3C7HA 1GBGA 2K0GA 4JZRA 3ZFEC 5LASA 1K5MB 5FWEA 5FZHA 2R0FA 4AXOA 1RUE3 4IE5A 4UT5A 1XU1A 3IM0A 1LODA 2DTYA 3THTA 4EN9B 3O1MA 3ETPA 3WF2A 4NHXA 2XG3A 1H8VA 1PO22 1FT9A 5EZWA 3T1LA 4XDQA 2MEV2 1L3JA 1XU2A 4CP1A 2CV6A 4Y1YA 3ILRA 3U10A 2VW1A 5C5UA 1W8HA 2MPFA 2WT2A 3SEPA 2XQRA 1X33A 2ZGNA 2P5BA 5A3OA 2YMZA 3CKHA 3U75A 2JDPA 3ETQA 2VPVA 4AVAA 1NCQC 1QXRA 1CAVB 2X8KA 1OMIA 3N7JA 3OYWB 1H4GA 3UESA 4LBOA 4A45A 3TN92 3MPBA 2JDHA 5LW9A 2DFCA 2K46A 1JHJA 5AFEA 3FLPA 3K48A 1QDCA 5J1XA 1O4YA 2D6MA 1I5PA 2R6QA 2ZX1A 3C8XA 4GH4C 4XHBA 5CIRA 4A6SA 3V0AA 4QXKA 2B42B 2BFUL 1LESA 3RG0A 4TTGA 4QPGA 1LKNA 1Q8QA 3ZSJA 2K9ZA 1JOJA 4LKFA 2KR2A 1NCRB 3RFRA 4GMP3 1MZ6A 4GULA 4RR3A 3KHBA 1C1FA 1DQ0A 2PFWA 3RI8A 3AKQA 1RB8G 1QJU3 1TQ5A 1GZWA 1HB1A 4R9BA 4BPZA 1AR82 5I0RA 2ZGTA 5CG9A 1RHI2 3DECA 1S2BA 4IESA 3BB6A 3H8XA 3IDBB 5C8CA 4P00B 3U37A 2E51A 4P9XA 1ULCA 2RS53 5T3NA 3GF6A 2GZWA 5FZ8A 2VMCA 2UWCA 4XAAA 3FBYA 1XPWA 3R05A 2Z2SB 2QFEA 4KNCA 2P4EA 1ZRIA 1W8ZA 1QH6A 1L7LA 1XC6A 2HEVF 2GSYA 1D4M2 2Y26A 3M2MA 2VZ1A 1W0PA 4QX2A 3M3CA 2KA3A 1BMV1 1RUI1 4CPBA 1H6XA 2CYFA 1PMJX 2WN2A 4M0HA 3PVNA 1VBD1 2ZJCA 4EE2A 4XQDA 4Q4Y2 1XYNA 2XGXA 1WWYA 4J25A 3WNNA 5F32A 5GZDA 1U12A 2FQPA 4JGZC 2F17A 2JG9B 1ENSA 3J8F3 1A8MA 1DZQA 5D21A 3ZMNA 5JAXA 4EWDA 2P2KA 1UNBA 1YXWA 2Q1MA 5EJ1B 2P34A 4ONUA 1GANA 1P8JA 4BXSV 1K5MA 1SMVA 2BFUS 5FPAA 3KS7A 1NG0A 4QX5A 5FFOC 3IIAA 1CAUB 2VMFA 1SLBA 4FFHA 5FMBA 1K45A 5T5JA 3V64A 4CZSA 1BBT1 1LHWA 3VZLA 3DV8A 3QH7A 4KU7A 4RSUA 5ABJC 4LHNA 1MS9A 4UBHA 4Y22B 4YFZA 1WMFA 3N9QA 2VZOA 2UURA 3PDQA 3X29B 4FPYA 2Y8KA 3CL1A 5DG2A 2B9VA 4OVEA 1FNYA 1E5RA 1TEIA 1VBC3 1W9WA 3AKPA 1CGPA 3APBA 4PDWC 5A7PA 2GMPA 5TSWA 2WKKA 1CAVA 3N35A 3OYWA 4HFSA 2J1EA 2WO7A 5FXXA 2JE7A 4UFIA 5F3GA 4AHZA 2YB7A 4AWDA 1HN1A 1ZBE3 2ZMKA 5J36A 3EBRA 3OGRA 4FO9A 3V56A 3LA3A 1LHVA 3H42B 1BXHA 1V9U3 3OBTA 3PURA 4DS0A 1OOPB 1AVBA 3H3ZA 4MV2A 4CXXA 5FZOB 1ASJ2 2LTNA 3I4IA 5JOXA 4FFFA 3ABZA 3W59A 5DG1A 2PA7A 1QF3A 1H0BA 1NCRA 3M3OA 4XFFA 2LW8A 1BEV3 4LBLA 5F2SA 5ACA2 4QM8A 1JBCA 1YRZA 3BPSA 3AVRA 1NLSA 3AXEA 1W8UA 4AZZA 3O0XA 4RGKA 4XF3A 4CE8A 5J7MA 2VGDA 2BP6A 2WNVC 1PGL1 1LEDA 5I0SA 4OZXA 2OXBA 2CWSA 3H50A 5LY2A 4D0QA 5JWPA 1HJGA 1PIV3 3SLIA 1AX1A 2JDMA 1GR3A 4QMAA 1G9AA 2FZ2A 3KCXA 5T5LA 4L8QA 4AHXA 3T08A 2JX9A 1FATA 2R072 1CX4A 3I2KA 4XBQA 5JSRA 3LFIA 1T6GC 1W9SA 3A21A 4OHWA 2OYZA 2PHWA 1XJAA 2V09A 4LKEA 3DYPA 1VAVA 4Q27A 1B35C 3AL5A 3JD73 4Q4V1 3SCGA 3LPFA 1H2KA 4UFMA 3WF1A 1RUC1 1W2OA 1UKGA 2V4AA 1C3HA 5L9RA 4P14A 3TBDA 2BDRA 4ZU4A 4D7YA 3IAPA 2R041 1SBFA 2JG9A 2JKBA 3WNKA 4LUKA 1D2QA 4BE3A 4Y1ZA 4BA6A 3KV9A 3Q9OA 3Q8EA 3TB0A 1DYPA 1O3TA 4YRDA 3MUY1 4TZDA 3CMGA 1RXGA 1J83A 2D93A 5L7OC 1Z7S1 4CCDA 3OEBA 4FPJA 1W2UA 4WZFA 1V6IA 1CAUA 4Y20B 5EPAA 4AFMA 3GZAA 1AYN3 1H8TC 4B7EA 3CNAA 4LK7A 1RMU3 4B8EA 5CFCC 4Y22A 3PUAA 1MEC2 5LRSA 2ZZQA 5D8AC 3LOBA 1E5SA 4HKWA 3LCPA 1CIYA 5KXEA 4R8HA 5FYIA 1HB3A 3NAPB 1NQJA 3WG1A 1NKGA 1ZZ9A 3QACA 5KXBA 3SITA 1J3QA 1DGLA 1D0HA 4NIHA 2EF6A 2G9FA 1REFA 2RMU1 1QY4A 5BNNC 2WFF3 3FZ3A 3VBOC 3EQEA 2C24A 1JH5A 2HWD3 2EAAA 1BVP1 1DQ1A 5FZMA 2ZPXA 1WLWA 2D7FA 3WNOA 3TEYA 5BPXA 1O4TA 1GLHA 5FV3A 3E1F1 3KF5A 4ITCA 4E8CA 1ND3C 1ZRDA 4NHYA 3VBSB 3MW2A 1EUUA 3MV11 3VN4A 1OOPA 4AOCA 5FZOA 3ZN4A 4AI1A 1U5IA 3K46A 1KXGA 1MPXA 5FZ1A 2R063 4AI2A 1QQP1 2ATFA 4N9HA 1EY2A 2RDSA 2YC4A 1VBA3 1QKQA 1VBB1 3WG2A 1JS9A 4AQSA 1IPSA 4GJZA 2HWC1 2C26A 1H1AA 2KM2A 4B1LA 3GZEA 3JBG3 1NE6A 4MLOA 3ZYJB 4XQWA 1CZVA 1HRI1 2ZCWA 2WA3A 2PAMA 1HB2A 4LIVA 4EN7B 2AH2A 1NLRA 1F2NA 4Z2AA 1AR93 1OSGA 3SNMA 1XE8A 3GZUC 4HN0A 3WZ1A 2ZHMA 3M7AA 1JOPA 2HBTA 4OHXA 5FXWA 5C7GA 3INAA 4R9CA 3L9JT 4AI3A 2EXKA 4LKSA 1W8TA 1LB2A 4CXYA 1OVPA 5J98B 5IAVA 1RTVA 1ULDA 4DEQA 3LEKA 2R1DA 4ES9A 4M4RA 3LE0A 5FY5A 2ERFA 1YYNA 1T6BX 2BPA2 1WLDA 4GH4B 1F4AA 1FOD3 1HV1A 2RDNA 2X10A 2WNEA 1HRV3 3M4FA 4DY3A 1IS4A 5FZGA 1U5YA 3VZMA 2WSUA 1SLLA 4HSLA 2GN7A 4A3ZA 2YUEA 3LEMA 1ZZBA 4AF9A 3WVJA 4CP0A 2XKOA 1OPMA 3OD4A 4NUBA 4QXBA 5C8WA 1W0NA 1LHUA 3SQOA 4IGQA 2BEOA 2X53S 3I59B 1L7QA 1GU3A 4Y5TA 2WQ4A 5F5IA 4Q4X1 3R4UA 5FO8B 4Y20A 4YW5A 2ZGKA 3VGIA 4META 1NZCA 1W8OA 1DZTA 4N9IA 2B9UA 1JHNA 1MVEA 2WZR3 5F5AA 4QX0A 5A80A 2O8OA 5KHGA 1NOVA 1PVC3 1YLLA 3USUB 1CX1A 5I0DA 1UYPA 4Z1VA 1TME1 1RINA 2XXZA 3NNLA 4TN7A 5FYUA 1BMV2 3ORJA 1G9FA 1RUI2 3K4AA 4IERA 4XJ8A 3UL2A 3JZVA 4CYDA 2QQVA 3A4UA 4NRMA 4OHZA 1OUSA 4YWAA 1UMZA 4BQ1A 1Q8SA 4DRVA 5GZEA 4EN0A 1HX6A 1YO8A 3FLRA 1VBD2 4LBKA 3RZJA 2YC0A 3L2HA 5FTTC 4JGZB 5FZBA 3VBSA 2VZRA 1VLNA 3OGGA 2A6YA 1JN2P 4GIQA 2PQQA 3ZXGA 1VAMA 2WS92 4W65A 2W1QA 3H7YA 1POV1 2HH9A 4MADA 1H6YA 3QH6A 2RS33 4CDXB 1RUF1 4XJAA 2Y6JA 4HL0A 1LULA 4Y1UA 4WVVA 3FHAA 4YVSC 2PTMA 4K8FA 1KFUL 1DGWA 4U36A 3IDAA 3B3QE 2ZA9A 1W6NB 3KF3A 1JYIA 1GQPA 4DB5A 3RSJA 2Q1FA 5A6QA 5CVRA 2BVVA 2NZ9A 2Y38A 4K1ZA 4NHMA 4QD2A 4CDWB 4LO5B 4ZZ8A 1US3A 2BW8A 5E8AA 1OURA 4FP2A 4YW7A 2QQPA 1V6JA 2YGLA 5LK7B 4PIYA 1VPHA 4NR1A 2NM1A 2OZ6A 1OLRA 3MEPA 4GH4A 4XPVA 2ZS6B 2QJVA 3O1TA 1DQ2A 2YU2A 2ZMNA 2I45A 2B7YA 2V5YA 4KBBA 2XB6C 3SKJE 1C28A 4L2NA 4NHKA 4P08A 3VD3A 4PJYA 1HQNA 3IDCB 4TWTA 3HAGA 1S0JA 1O91A 1PM7A 3CBNA 3TWIA 3LA2A 1DYOA 2HJIA 1GMMA 3WNPA 3I59A 4UFKA 4HN1A 4A4AA 1YIPA 5JZGC 1XYPA 2QZ3A 4S2DA 2LROA 1OUXA 4GB31 4AEKA 1ACCA 5DMYA 5CKMA 4PBPA 5GKAC 2OUJA 5FY4A 2DCTA 3VZNA 1PGL2 5CNAA 2RDQA 4DOUA 4XDOA 1J1LA 1GP6A 1HQWA 3O1SA 4B4PA 3B7MA 4V1PA 4CEWC 1IG3A 3I7DA 3UKNA 4BB3A 5JPNB 1UYZA 3MDPA 3E6BA 4P5YA 5C3PA 5HV0A 4XW3A 2JB8A 3Q8CA 4WVMB 3USUA 3ZKYA 3ZR6A 1A78A 1X8MA 4AL9A 3J9SA 1Y9GA 4QXHA 2ZEZA 1B35B 2ZZJA 3HWJA 4R4ZA 4LBQA 5FXZA 2JDUA 4Q4V2 1QH7A 3AYDA 4QB1A 4QKNA 1COV3 1PGSA 2EVXA 3MICA 1JOBA 2WJSA 4CSWA 3I2HA 3PUSA 4JGZA 1DBNA 2R042 5KWRA 5IHRA 1BCXA 4MVTA 4KQ7A 3ALQA 4NWVA 2BWCA 5JXHA 1GSLA 4ZHNA 4NIDA 4GKYA 1TMF2 1X36A 3JB4C 2NPIA 1RHI1 2J1TA 1KEXA 5FPLA 4YNIA 4IE6A 4JC1A 5K0UA 1OLME 5L7OB 4GXLA 4L97A 2JG8B 2VD7A 4CDXA 1R083 5CFCB 4DRRA 3PU3A 1W9TA 3WY6A 2UYAA 2E9QA 5JUVA 3ROUA 1ZBA3
chains in the Genus database with same CATH topology
1DU3D 2HWE3 1D4M1 2DU1A 2RR11 3LZZA 1X50A 1W6NA 3VBOB 1Q56A 4FPKA 4JRLA 3B93A 3FFQA 3UJOA 4IEWA 4Q0QA 3B01A 4CDWA 2A6XA 4WVZA 1HLCA 5DZFA 4XFIA 1RUNA 2ZX0A 2Z5WA 5KHKA 3LB9A 1FX5A 3DPRA 2CL2A 1CJPA 4BH9A 2ET1A 4QQHA 4YGEA 1QQP2 3MW4A 3RQ0A 5K7PA 5AVAA 4MGKE 4L9BA 1UZZA 1LHOA 1YFWA 3IMNA 4BMEA 5FAXA 4EJRA 4P5HA 3U11A 1FXZA 1Q8VA 1UN1A 4O9EA 3JQWA 1HRI2 1DG6A 4Y1XA 4XFAA 2XJPA 3MIBA 1QXJA 1VRH2 4I0WB 3AP4A 3B69A 2VUJA 4K9SA 1VBE3 4AFBA 3U0ZA 1CVNA 3CO2A 3MIEA 4RQPC 5H9RA 2W52A 2CGOA 3VZJA 4AFAA 3AP7A 1H9PA 3D0SA 3CJIC 3ZYPA 2HWF3 1BKZA 2RS12 4EV0A 3GBWA 2CNAA 2LALA 4WVMA 2D6NA 3B94A 5BY5A 5H9QA 4QU2A 1ASJ1 1CPNA 3VLBB 1PMIA 1AR73 1M4WA 4Y26A 3LWCA 4OHYA 5DXDA 4GMP1 5FO9B 1ENQA 1WCSA 2DWRA 4OULA 4Q8LA 1QJU1 1VAKA 2DU0A 2Q4SA 4HANA 5BNPC 2A6VA 1HKDA 3CF6E 3WP4A 5L36A 1F5JA 1FPN3 3NV2A 2ZGPA 3ACLA 5L7OA 1C57A 1QOSA 2MNGA 3R4SA 4Q4X2 4AI8A 3OF1A 2RS51 2JG8A 1O3RA 1QMJA 5CFCA 2Q8OA 3KGZA 1RUJ3 5JSOA 3VBFC 1JW6A 4ASLA 3NAPA 3V65A 2GALA 2R071 2VXRA 4YLZA 1WLTA 1LOBA 4QT6A 3RJRA 3WINE 2W08A 1PNGA 3AYEA 4YM2A 4HK9A 3VBOA 1PO23 4UBGA 5LK5A 1ZRFA 4YGBA 1EV11 3POYA 2RM23 5IT6A 1J59A 2IXLA 2Z42A 4J1WA 5DUXA 3J8F1 4DZGA 1G8WA 5C9AC 1F5FA 3WDVA 5CFDC 1PNFA 3CEWA 4YZ2A 1NE4A 1KJRA 4ATFA 4PIZA 4ZXKA 3ILFA 4YW4A 1XQNA 1NA1B 1UIKA 3O5SA 5F1RA 3KT1A 4XXAA 1KFXL 3FMGA 1Q8OA 2BVBA 3AZYA 4WBBA 5J3UA 2DYCA 3QLQA 1RUF2 1WUVA 1OA4A 3NV4A 4H7LA 3MW3A 3WP3A 3M8LA 2D5HA 4YVSB 3AP5A 4R9AA 1ZZ8A 1R1A2 2ZAHA 3AMHA 1HV0A 2NLRA 2DUPA 4COWA 2DVAA 5JPMB 1IZ3A 4ISQA 2IZWA 4FPFA 1DQ6A 2JENA 1RL3A 3NV1A 1DFQA 4OI1A 4XHXA 1V9U1 4E4DX 2Q30A 4CDUB 5FLHA 2FHRA 2EXHA 5JSPA 4AEDC 1ALYA 5FDBA 3ZSKA 1OHFA 1AYM3 2D6LX 4WV8A 1VB4A 3VKMA 1EP0A 4H55A 1H30A 4BOWA 4FOQA 1WBLA 5DZEA 3ZYRA 1QJY3 1MZEA 5C4WB 3AKTA 4SLIA 3M3IA 3RMYA 3IT8A 3KD4A 2NMNA 2VNOA 1UPSA 1PK6C 4XIKA 5GLZA 5BYNA 2D44A 1J3PA 4Y4YA 4GMP0 1LTEA 4GB32 1YFYA 1MZFA 2A5ZA 5KXCA 2GU9A 2X5IC 1AL23 5A3LA 1Y7BA 4YVWC 3M3EA 4DQAA 1GQHA 4D69A 3RYRA 4EN8B 4NN0A 1CONA 4YZ3A 5FBZA 4M3CE 3JD71 1MS8A 2HEYF 1AR62 2VNGA 4M3CB 2WL1A 1YNAA 1Q43A 1I9RA 2XLFA 5FPXA 1LECA 5DUUA 4QHBA 3WT3A 4FTBA 3I8TA 5J09A 3KT4A 1QJZA 1AYN1 2XBO3 3KM5A 1NA1A 1RMU1 1SCSA 3G7DA 5JR7B 1ZX5A 4JGYC 4COZA 4F8AA 2ENRA 1MQTB 2PLV1 4YVSA 4YYOA 2RHPA 4BZ4A 3V0BB 4HVRA 3ELNA 2WFF1 1A6CA 3VZKA 3WW2A 3OD0A 4RD7A 2RR12 3VHRA 4FVVA 1AZDA 4A3XA 4YW3A 1QJX3 1KS4A 3VUOA 1I6XA 4IV3C 1LR5A 4D3WA 2XLGA 2B8MA 2DVFA 4CDUA 1FAYA 3VDDB 2SBAA 4NOTA 1C8M3 2R061 4YSFA 1ZRRA 4QPYA 3ASIA 3E97A 2WS91 1PZ8A 1RUE2 3TNPB 5C33A 1VBA1 5CA6A 4WM7C 4PIXA 4Z8BA 4IEZA 1W6OB 4MX3A 4OUMA 2NP0A 5IUQA 4OLLA 1RUG3 5F6KA 5C4WA 1RVF3 4JV4A 4UW5A 1OD5A 1IKPA 2VH9A 5BNOB 4FSJA 3PJYA 4E9KA 2GC2A 2PYTA 1GICA 2JICA 4K1YA 4Q8KA 1W6PB 1ULGA 2H0BA 2UY9A 3JUUA 2XVGA 4HT1T 3ZFGB 4RQPB 2XKPA 1CPMA 2PHLA 3JCIA 1TNRA 3DUIA 4L99A 3RPQA 4CP2A 4JTNA 4XBNA 4N43B 2CY6A 1HRV1 1AUYA 2XJSA 4YM1A 2VMGA 1WLCA 2CGNA 4XF1A 5D1IA 4M3CA 3FUOA 3GBFA 3IWZA 3ZSMA 4FTSA 3SISA 4COYA 4J6GA 1MS3A 3MZHA 1QJU2 2DCKA 5IK8A 2NQYA 5CAZA 5BNPB 3HN1A 5DZGA 5K0UB 5K9YA 2E7TA 2VOXA 3KCCA 5FRAA 1GZCA 2Y0IA 1C8NA 1UU6A 5CADA 2JE9A 3VBHB 2WZR1 2RS52 2CTVA 1V6LA 3QBQA 4N90A 5GALA 4E2GA 1IPJA 4XXPA 3VBRC 1MQTA 3V0BA 4CEYC 2H6CA 2WFPA 1CESA 2GC3A 3SCHA 1R1ZA 4NWWA 1CAXB 5JDBA 4Q1PA 2VQAA 2WNUB 3FFZA 1YFUA 1GKBA 1EV12 2JEMA 2DFBA 4IV1C 3J8F2 1LGNA 2WT1A 4OUSA 5C9AB 1S2KA 2QNKA 1RJ8A 3VDDA 1S0GA 3MGUA 5CFDB 4AEJA 4AI0A 4AVCA 3ZXAC 5BV6A 1TMF1 1OI6A 3WLUA 5DDJ3 2XHKA 1EPWA 4AK3A 1W6OA 2ZX2A 4HKLA 2ZGOA 3VBUB 4Y5Z0 3ZXDA 2E53A 1XRUA 5T52A 5IK4A 4MSVA 5FMOL 2DTWA 1AX2A 1S1AA 3VHNA 5BNOA 3PVOA 1VBC2 4N7IA 3KB5A 1WW5A 5H9SA 2BGCA 4N53B 4JDNA 2FBEA 1W6PA 3ME2A 3ZFGA 4RHV3 3BU7A 4RQPA 3AYAA 1IS5A 4JRAA 1ZBE2 5H9PA 2WA4A 5JOYA 3P3PA 4YM0A 4ZU7A 4N43A 1V9U2 2AREA 1S0CA 2NYYA 3I54A 3IN9A 4LT5A 3LOIA 4ASMB 5KHJA 3PVEA 2ZGRA 4Z82A 3ZFEB 4XJWA 3OY8B 3ZSLA 1RC6A 4CDQC 4L92A 4FAHA 2D43A 4CRQA 1ULEA 5I91A 1MZ5A 4JTOA 4IEPA 2XJRA 1W6MB 1O4ZA 1YFXA 4RS5C 1PO13 1XNBA 5K0UA 3S30A 4D94A 4PCRA 3VKOA 3WX5A 1SEFA 3O0VA 1LU2A 4C90A 3OBRA 1VRH1 2DVBA 3O7OA 1H2LA 3VBHA 4RGAA 3KLSA 1DQ5A 4AVVA 4QGLA 2BTVC 3NVCA 3AZZA 3KZ4C 3LGRA 1NCQB 4QQOA 2X5IB 5FMOS 5FREA 1NYWA 1LENA 1XNDA 2RS11 3PMSA 3AP6A 3OCPA 2AZ5A 1SACA 4E4SA 3OPZA 2ZGLA 1BBT3 1CAXA 2GNTA 3JD72 1VIWB 2WNUA 3RMXA 4AQ2A 4C0BA 1DLLA 5FLIA 2ARBA 1D0GA 2JD4A 3OJBA 3KSCA 4F83A 5C9AA 1RITA 5CFDA 1C1LA 2G9GA 4Q2FA 4EROA 2EA7A 3ZDSA 1DGWX 3AB0A 1DDLA 2A71A 1N1VA 1R081 5AC93 3FUQA 1AYN2 3VBUA 2LUWA 3AMQA 1RMU2 2PN5A 4HVOA 2PAKA 1ZBA1 4MYEA 2IFWA 2O1QA 2HWE1 4C1WA 5I8YA 5SV8A 5F5QA 5F9TA 1DHKB 5BXXA 2B39A 3KCYA 2PLV2 2Y0OA 4YG0A 4FPLA 1CD3G 2WFF2 2VUAA 4N53A 2HWD2 2ET7A 1H2MA 2ES3A 2I74A 2W39A 4LO4B 5BNQA 4YW1A 1WMDA 4IV3B 4D7TA 4JAAA 2IXKA 3VZOA 2F4PA 4K40A 4K6BA 3MF9A 2D6KA 3PTYA 2R062 4FBFA 3ZFEA 2ZGSA 3OY8A 3E5UA 3J26N 4WM7B 4LHLA 1VBA2 2HWB3 3VV1A 3OTFA 5ABJB 3JBG2 5IK5A 1O5UA 1RUH3 1VP6A 1W6MA 1ND2C 4D7SA 3ZXFA 3BPZA 4NO4A 4QPGC 1G9CA 3N4MA 1R1A1 5GZCA 3FX3A 4Q4V3 1VALA 5HXVA 4BYYA 1AR92 1VBE1 4RR3C 3RYKA 3WW4A 1RUC3 2B5HA 2BBVA 3ZIWA 4I2OA 1N1SA 4PDWB 1NCQA 1R093 2R0HA 1X8EA 2X5IA 2HWF1 5GZGA 1CJDA 4PBOA 5T5OA 3ZFFC 1S0FA 1B09A 2XJUA 1ZZCA 2ZHKA 1LCLA 1Z7S3 3AP9A 4B7KA 5C8CC 4N7UA 2VG9A 1FOD2 1HRV2 3AYCA 2D97A 1WW4A 3D82A 5T54A 5A3MA 2O8QA 5LRRA 1LGCA 1N3QA 3RS6A 4PLMA 4AGRA 1XXNA 3AX4A 3RNSA 1S0EA 2E63A 3HQXA 4XE9A 5GM0A 5JOWA 2RMU3 5SV5A 2AR6A 2UWBA 2XVLA 1YI7A 3AFGA 4IEOA 2XWJB 2A3WA 1X7NA 4C1XA 2YV8A 2WNVB 5E88A 3H9AA 2H6BA 1W6QB 2WZR2 1NY71 4AHWA 2GNDA 3WP5A 5HCBA 1A3KA 1QWRA 1K5MC 5BNPA 2ZOEB 5JIUA 2DCJA 3ZXJA 3LSEA 1PVC2 4HKOA 4HZFA 2ZGMA 4AYUA 1RGSA 1MACA 3HBZA 3CJXA 1AR61 1VBB3 4YZ1A 2HWC3 2OPKA 2LM3A 4XJ9A 4XQ4A 1DGRN 3WW1A 4IV3A 1F8VA 4K7JA 4IV1B 5FO7B 2ZAAA 1FMD3 4KWKA 4QPIC 1SDWA 1HQLA 1KJLA 3EO6A 3HR9A 4IXLA 1J3RA 1V6MA 2ZHLA 4GALA 4QM9A 3D8CA 3O12A 3N7LA 1YIFA 2VW0A 4C91A 4WM7A 2YYOA 2AGSA 2RS32 3VHOA 2P3KA 1H8TB 2R1BA 5ABJA 2AUYA 3WHTA 1CQ9A 2A70A 5D8AB 2GNMA 2OW4A 2PHUA 3AFKA 4DPNA 3UJQA 2DV9A 4XMIA 3ATGA 4BCUA 3VL9A 2R16A 1ZZ7A 4PDWA 5BNNB 2OVUA 1WW6A 1MS0A 3PLQA 1I3HA 1D4VB 1OQDA 4B3NA 5LEKA 1V6KA 2VVEA 4Q4X3 4FXKB 1V70A 1ND3B 1AYM1 2WSVA 2E6VA 1KRIA 2GH2A 1UZYA 1Z0HA 4AHYA 1RUE1 3URFA 3DKWA 4B4RA 1QJY1 3BTAA 3M70A 3FE5A 1HXS3 2WWSA 3ZYGA 2Z79A 1GYKA 5J48A 1ENXA 1TME3 5FPZA 4XJZA 4RS5B 3B00A 1SFNA 2ZKLA 1KS5A 2WNVA 3DN7A 3RWNA 2JG9C 3P3NA 1AL21 1LOFC 1W6QA 4Q4W3 4P9GA 3ZN6B 2QVSB 1EAH3 5C6CA 1M06G 2CGPA 3WUDA 2IWGB 3DF0A 3E5QA 3ZVXA 4XF4A 3KQRA 4KG0A 1POV3 2ZX3A 3ZXKA 3KT7A 1WD4A 2JDZA 3H1WA 4P9WA 3TAYA 1B35A 1RUD3 3VHPA 5JCTA 1COV2 4RGGA 1O7FA 4KH9A 4IV1A 3TNQA 2EALA 3ENRA 2GC0A 4QGMA 4K20A 2D3PA 2X29A 4XEZA 5CG8A 4GKXA 5JVVA 3WR0A 3AZVA 3H8UA 3WQ0A 1N3OA 4KG8A 2Q0AA 1WD3A 3PMEA 5HI0A 1IHMA 1N1YA 1VR3A 1R082 1IKQA 1YI9A 1H8TA 2ETEA 1ZBA2 2HWE2 5D8AA 4PQ9A 1KQRA 3FC0A 1AX0A 2B45X 2YZ4A 5F6LB 1Y9QA 4AFCA 5BNNA 3ES1A 4BLJA 2MEV3 3S0MA 1G6NA 3LKJA 1OKQA 4LBNA 2D3RA 4FOYA 3NO8A 1ND3A 1C8M1 1G7YA 3HMYA 1XNCA 2VOWA 3MFCA 4HPKB 5L19A 1NXMA 1JUHA 3HT2A 3TN93 4KGGA 5T50A 4FPGA 3WCRA 2FMDA 1N3PA 1UKRA 2TUNA 3GHMA 4ISRA 1RUG1 1MS5A 3MF6A 1RVF1 1RJ7A 2WC2A 5FOJB 2PHXA 2BWAA 4AW7A 1UD1A 5K8SA 3B5LB 1ND2B 4RS5A 4ORFA 2P37A 3SH5A 1MR5A 4HVQA 1VBC1 3RI9A 1J1TA 2B46X 2Q5TA 1HIXA 1W39A 3PNAA 1KDMA 2Z69A 5KC5A 1VBE2 3UKVA 2NN8A 1ZRCA 3ZN6A 2JECA 1KDKA 1S0DA 2DF7A 1ZBE1 2DCYA 3GBGA 1UCXA 2HWF2 3FLTA 1I1EA 1AR83 3RJ2X 3ZFFB 2D5FA 3HT1A 4DINB 1RHI3 1LU1A 2VQ0A 2WLPA 2PHRA 4LUMA 1AR72 3MLJA 4XOGA 1H4HA 4AGVA 1BEV1 4FP3A 4GWNA 4OFGA 2JXAA 1FYUA 1D4M3 3H3UA 1ULFA 4W6WA 4PLOA 3S6PA 4YGCA 4XFGA 1V00A 1FPN2 2A7AA 1IS6A 4Z2WA 2IXHA 4XZPA 5JZGB 2XJTA 4ES8A 3IPVB 2E7QA 4I02<