4UW5A

Human galectin-7 in complex with a galactose based dendron d2-2.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
132
structure length
132
Chain Sequence
PHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN GALECTIN-7
publication title Structural Basis of Multivalent Galactose-Based Dendrimer Recognition by Human Galectin-7.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 30
structure length 132
sequence length 132
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4uw5A00
2ES3A 2E53A 1LHVA 2PHXA 2V5YA 5HCBA 1QDOA 1Q8PA 2CYFA 1AX2A 3JU9A 4GKXA 1S0CA 2UURA 2JE7A 3AYDA 4BPZA 2UU8A 1CN1A 4Q26A 1AVBA 1WD3A 4Z8BA 1WW6A 1S0GA 2CTVA 1GSLA 1AXYA 1GLHA 4TYSA 1O4YA 4YZ1A 4LBQD 3OGGA 4DPNA 4TZDA 3N7KA 3FFZA 4GALA 2P3IA 2NZ9A 2PHWA 3AZWA 1V6MA 1N3PA 4WV8A 2EALA 5GZCA 4YG0A 2ZGPA 2JE9A 1Y7BA 3FBYA 2GMPA 2WT1A 2YXSA 5GLWA 2JD4A 3AP7A 5GJ6A 3SH3A 3ZXEA 2ZGKA 1CONA 1N1VA 3LSDA 1H9WA 2VW2A 1PZ9A 1CIWA 1G8WA 4XJUA 2PHFA 4JRAA 2XG3A 4HL0A 3MW4A 3WV6A 4LBQA 4WVWA 1Q8OA 5CB7A 4RA0A 3R4SA 2VW0A 5FREA 1A8DA 2Z42A 1WLCA 2RHPA 4JCKA 3AP9A 1A78A 1V00A 2ARXA 4XXAA 1SBFA 4Y22B 1CVNA 2ZHMA 1D0HA 3GNEA 5F9TA 1W0PA 3WG1A 1F31A 2D6OX 1VAMA 2ZGOA 2A3WA 2ZHLA 5E88A 4W65A 4XJ8A 2R1DA 1VLNA 1N3OA 3T1MA 1G9BA 2W39A 2EF6A 2P37A 1VALA 1C4RA 3AYCA 5IT6A 5T5PA 3A4UA 1YIFA 1AXZA 4GA9A 2E6VA 3SLIA 1LOBA 2A6YA 2D43A 2HYKA 3AK0A 1W6MB 1MZ6A 4YM2A 1G9CA 1DYKA 3D4KA 3Q9OA 2A71A 4FPEA 4DRRA 2PHRA 4LBKA 3M1HA 3ZXKA 5H9SA 5JOYA 3OBTA 5KXEA 4XJZA 1YI7A 2WKKA 4YW2A 5IK4A 2WSUA 4DFSA 2DTYA 4Y24A 1MS4A 1HLCA 1VIWB 2WJSA 3B69A 3I8TA 1RIRA 3AZXA 3CNAA 3WDXA 4AGVA 1F5FA 2ZA9A 3WDYA 4XJ9A 1I3HA 1W6NA 2R49A 2UWAA 2WQZC 1SACA 2TEPA 4Q1PA 4Y22A 1FNYA 4YZ4A 2ZHNA 3ZSLA 3D5OA 3ZSKA 1BQPA 4D69A 4M3CE 2ZGLA 4XE9A 2DVBA 1JHNA 3AYEA 4XIKA 4MYEA 3V65A 2DTWA 3AJZA 2ZGQA 5E89A 1GBGA 2DUOA 4UW6A 2GNTA 4XJAA 4R9AA 5GM0A 1UKGA 4XMAA 3IPVA 2FHRA 2YZ4A 2A6WA 2LTNA 1WLWA 1MR5A 4AGRA 1GV9A 3WVJA 2P3KA 4HANA 5CAZA 3ENRA 2ZKNA 3WCRA 1KDKA 3ATGA 2DUPA 1MS0A 1CPMA 2GMMA 3D6EA 1YRZA 3M3QA 1ENSA 1CJPA 1FV2A 4R9BA 3N35A 4XBLA 1V6JA 4SLIA 4FOQA 4FQZA 4NO4A 1OKQA 1JYCA 2YV8A 4FP2A 1LOCA 4M3CB 4YW3A 3WG4A 2V73A 4FPGA 1WW4A 1AXKA 3LCPA 4ISQA 2C5DA 1LHUA 3ZSMA 1LESA 4P14A 1C1FA 1GANA 1UN1A 3POWA 4FVVA 3VV1A 1V6IA 4LBMA 4XMIA 2DUQA 1JXNA 1QNYA 1G9AA 1CQ9A 1FNZA 4LBLA 4PQ9A 5L73A 4Y1XA 1QOOA 4FPLA 1B09A 3HR9A 1S0EA 4XHBA 2A5ZA 4Y20A 3TAYA 2AR6A 1LEMA 3AZYA 4FPHA 3W59A 1AX1A 3MPPG 5CA6A 2DU1A 5DUWA 1H30A 1UZYA 4GKYA 3ZXFA 1QMJA 3AXDA 1V6NA 5GZFA 3T2TA 3C2UA 2G4IA 1LECA 4M3CF 1JUIA 4OZXA 1LCLA 2A7AA 2OUJA 1SCRA 4GXLA 4YM1A 1OQ1A 4P9XA 4Q8LA 4M00A 3RSJA 1FX5A 4BM8A 3V0BB 1MS8A 1ULCA 2OUHA 3ZSJA 4AWDA 3TB0A 2GNBA 3ILFA 2XB6C 5T52A 2ZGSA 3W58A 1RINA 3APBA 3N7MA 4LBNA 4M3CA 3ILNA 4NOTA 5IK8A 4FPYA 2FMDA 3PJQA 1JW6A 4R9CA 1ULGA 3POSA 2ZMLA 3PVOA 1CESA 5AVAA 3BOPA 4FOYA 3AP4A 1ENRA 4P9WA 4XDQA 1AF9A 1TEIA 1S0DA 2A70A 2A3YA 1LOAA 3MW2A 3AX4A 4XXPA 1VAVA 2DVGA 2R1BA 3B3QE 3M3OA 4WZFA 1Z78A 2EAKA 5IUQA 1HQLA 1MVQA 4XJWA 5CNAA 4K20A 2PELA 1HKDA 1Q8VA 3PVEA 3ASIA 4UW4A 4LBJA 5T55A 1G7YA 4YW1A 3WOGA 3BTAA 4K1ZA 1W6NB 3RG0A 3U4XA 4C1WA 3O0WA 1QNWA 4Y1ZA 1IS6A 1DQ2A 1SBEA 1S0FA 1G9DA 3AZVA 3N3HA 2EXIA 3WDVA 1WUVA 3VUOA 1D2SA 3T1LA 4XZPA 4XTPA 1V6KA 3DGTA 5DZGA 1SLAA 4YM3A 3AFKA 1W6PB 1HDKA 1Q8SA 2AUYA 4UW3A 1NXD1 4ITCA 3V0BA 1SFYA 1MS1A 3NV4A 3BIWE 2H0BA 3V64A 2VW1A 1AJKA 1GICA 1GZCA 1LGBA 1W6OB 3OJBA 2NN8A 4FPFA 3IPVB 2VH9A 1DQ0A 2YROA 4YGCA 2AREA 1FATA 3GALA 2EXKA 1GZ9A 2D6PA 1DYPA 4AGGA 3ZPYA 1S1AA 5EWSA 1QF3A 4Q2FA 1LGCA 5SV8A 5T5LA 5GLVA 1ULFA 1AZDA 4YZ2A 2SBAA 1BYHA 1LJ7A 2JDZA 3AXEA 3WNXA 2R0HA 2UWBA 4XBQA 5IK5A 1AX0A 2VXRA 3O0XA 4BLJA 3ZYPA 2GDFA 1UPSA 2NMNA 4U2AA 4Y1UA 3RMYA 1UZZA 1YXWA 4YG6A 5EXOA 4YFZA 3WHTA 4CRQA 3MEPA 5DUUA 2ENRA 5GLUA 1N3QA 5T54A 1GNHA 4Y1VA 5DG2A 2SLIA 3NV1A 1LOFC 1W6PA 1LENA 1HQWA 3OYWB 3INAA 2DWRA 1W6QA 3IMNA 3OBRA 4Y20B 3BODA 2ZGUA 1SLTA 1JN2P 2DVAA 1N47A 2P2KA 3AJYA 1LEDA 1W6OA 2D3PA 4PF5A 4Q8KA 1SBDA 2R16A 4RL7A 2ZGMA 4ISRA 3L2YA 4PBPA 4YGEA 1N1SA 1GZWB 3R4UA 1N1YA 2ZHKA 5GZEA 2GNDA 5DXDA 4DQAA 1Z0HA 4GWMA 1FV3A 4CZSA 1QOSA 1JOJA 1I1EA 3FUOA 2Q5TA 3A0KA 3B9CA 1KDMA 1QKQA 2VUAA 1GKBA 5CBLA 4ZKTB 2UWCA 5E8AA 1PZ8A 3WCSA 3V0AB 3M3EA 1QGLA 1APNA 3A0NA 1UX6A 2AH2A 3NV2A 2D6KA 1AJOA 2JKBA 3VKLA 2YY1A 3OYWA 4ATFA 1ULDA 1UMZA 1MS5A 3B01A 2ZZJA 3N7JA 1G86A 3SNMA 3OY8A 2JECA 1Q8QA 2AENA 4F83A 1UAIA 3B00A 1XQNA 3O0VA 4XIOA 4FPJA 1OFSA 2EXJA 2VY0A 4XTMA 3WUCA 1ZM1A 1SLCA 2ZABA 1GZWA 1DBNA 2WT2A 4FPKA 2D6LX 3ZVXA 2EIGA 3I4IA 3QLQA 5GZGA 3WLUA 1W0OA 4L8QA 1KQRA 3AYAA 3N36A 3SISA 3ZYRA 1YO8A 1O4ZA 1BXHA 1MVEA 4P9YA 1IKPA 4FOWA 4K1YA 1CR7A 2D6MA 4Q1RA 2NYYA 4AVSA 2BQPA 2GN7A 3SH5A 3UJOA 4YLZA 1KJRA 2D3RA 4BMEA 3V0AA 1DFQA 1RITA 2ERFA 4XHXA 5DZFA 3USUA 1DHKB 1CPNA 1KITA 1MS9A 3DUIA 4R9DA 2OW4A 1LODA 4ATEA 5JLVA 2AGSA 1WBFA 4Y26A 5HCFA 2ZMNA 1LU1A 3MW3A 2GNMA 3AP6A 2E7QA 2OVUA 3IKWA 2ZGNA 4K21A 4CTEA 1GYKA 2ZGTA 4LBOA 1LOEA 4YW4A 2D3SA 5DG1A 5KXCA 5GALA 4IQPA 2GN3A 1IS3A 1X50A 2A6VA 1N1TA 2CL2A 1LHOA 4AVTA 3M3CA 5DZEA 3WG2A 1DZQA 1V6OA 5GLZA 3JUUA 4FPCA 2WT0A 4YZ3A 3KM5A 3WDUA 5H9QA 2P3JA 3M2MA 5JOZA 1FYUA 5DUVA 1W6QB 3IN9A 4UW5A 1LULA 5KXDA 2NMOA 3UJQA 1WCSA 5H9PA 1BZWA 1Q56A 3O5SA 4XYXA 3RQ0A 1A3KA 1U0AA 4JC1A 2I2SA 1UL9A 2ZGRA 3PMEA 4ZXKA 1URXA 4DS0A 1JBCA 1SLLA 4AVVA 1IS5A 4H55A 4U36A 2E51A 3HMYA 1ENQA 1ONAA 2ARBA 1LGNA 1DQ1A 3H0OA 2A75A 2CWSA 2LALA 4XBNA 4AYUA 1IS4A 3POYA 2E7TA 5HCAA 3IM0A 5EYXA 1QU0A 1WD4A 2B7YA 3NWKA 4XOGA 1F9KA 3RRDA 4PBOA 2DVFA 1S0IA 3NV3A 1C1LA 2A3XA 2DU0A 2CWMA 1IKQA 4WVVA 3WUDA 2P34A 2GALA 2R0FA 2W08A 3AZZA 1G9FA 1NLSA 2DURA 4FPOB 3HN1A 1S0BA 5DUXA 3UK9A 3VKOA 1KRIA 3VKMA 5JVVA 3KQRA 1MACA 1LHWA 3WG3A 4BQ1A 1LU2A 4FP3A 1WLDA 2DVDA 2ZACA 3OPZA 3OY8B 1WW5A 2WNEA 1GNZA 4YGBA 3FLPA 1LOGA 4FOVA 5JDBA 3WZ1A 2A6XA 1WW7A 1SLIA 2C9AA 1R1ZA 5EYYA 3QCWA 3ZXLA 2NM1A 1DGLA 2D6NA 3VKNA 1DQ6A 3WDTA 3WHUA 2PHUA 3ZXJA 4Y1YA 4BLIA 1KJLA 1S0JA 5T5JA 1QDCA 1IOAA 5F5QA 3WDWA 2CNAA 1V6LA 5GLTA 3R05A 3RMXA 1DIWA 1QOTA 2GMEA 1LOFA 2W52A 4YG3A 5LK5A 1LTEA 2PHTA 3FUQA 1EPWA 2ZMKA 3N7LA 3UL2A 3FLRA 2EXHA 2AYHA 1BKZA 5GZDA 1DQ4A 2ZBJA 1W6MA 2JJ6A 4C1XA 4I30A 5H9RA 3AP5A 3USUB 5FRAA 1DLLA 5KXBA 1SLBA 2DYCA 3SITA 1C57A 1J1TA 1ULEA 2A6ZA 4YGDA 1FAYA 1SCSA 1DQ5A 4FQ4A 2DV9A 3LSEA 4Q27A 1LHNA 4YZ5A 4KBBA 5JMCA 4M01A 4YM0A 1H9PA 4YFWA 2NP0A 3SH4A 5JOXA 2WLQA 4XILA 2D44A 1YYNA 4ASMB 1MZ5A 3FLTA 4GWNA 2YMZA 3ILRA 3PVNA 4YW5A 4BOWA 2VU9A 2WSVA 2W68A 5IK7A 2D7FA 1BJQA 3O12A 4PCRA 1JYIA 5JOWA 1PZ7A 2ZAAA 1MS3A 4DRVA 1ZA4A 4LBQB 5T5OA 5T50A 5BYNA 3RS6A 2CY6A 2KM2A 3VKFC 1WBLA 4BMBA
chains in the Genus database with same CATH superfamily
3E5UA 4XQWA 2KXLA 3PU8A 1TNRA 4GKXA 1VBB3 3LOBA 2LW8A 3AYDA 4IUGA 3T4VA 2PMWB 2JB4A 3ETQA 1WCQA 5DDJ3 4LUMA 1L7QA 1HV1A 3IAPA 3PVBB 5DQ0A 1BHGA 3MPBA 4ARYA 1AXYA 5A6YA 2BFUS 1ACCA 2ORZA 4DPNA 1PO21 4QXBA 5DN2A 3N7KA 5F6KA 4TZDA 4DEQA 2GC2A 1XYNA 4IETA 5FPZA 3ZFEB 1ASJ1 4BQ2A 2P3IA 4CCEA 3JD72 1PK6A 4QD2A 4XC9A 3VBRB 1SZBA 4YG0A 5J7MA 1SQ4A 2ZGPA 3KF3A 3AM2A 5IFPA 1Y7BA 3FBYA 3W21A 3WP5A 5F1RA 3Q8CA 2JD4A 3AP7A 3SH3A 4X8NA 2ZGKA 1W05A 1CONA 2J1AA 2ZEXA 3I59B 1H9WA 2VW2A 3LSDA 5G04L 3J8F1 1G8WA 3ZYHA 1DLCA 4JRAA 1AR73 5BNQA 4LBQA 5FKBA 3IDEA 4QX0A 5CB7A 4CU7A 2XBO2 4IL7A 5FJKA 1W8FA 2VW0A 2YYOA 5EPAA 5C8CA 1K5MB 1XSRA 4TN7A 4D7SA 5C3QA 1IGOA 1SBFA 3BKZA 4Y22B 2XJSA 2IC1A 2HWF2 4MGTA 1W2TA 1F31A 2ZHLA 1VAMA 2IXLA 2A3WA 3J8F2 3IZOA 4Q29A 4WZCA 3AMPA 1N3OA 3MV01 4KI5M 4AAPA 4B1LA 3WR0A 2KD7A 2EF6A 2P37A 1C4RA 2X05A 2BBAA 3VBSB 1A6CA 4QKBA 3A4UA 1YIFA 4N7IA 4EROA 1W9WA 4MGYE 2HYKA 4CEYC 3NAPA 2MPFA 1O5LA 4N7UA 1RUD1 5FYUA 4CYDA 2RS53 2A71A 4FPEA 4INDA 5FZ0A 5FOBB 2IXKA 5B2GB 3WT3A 3M1HA 2YFUA 5H9SA 1C8NA 4XJZA 4UFLA 3UYJA 5CU1A 1VBE2 2WSUA 4DFSA 2DTYA 5IYYA 2WJSA 1BK1A 3DPRC 2PQSA 1HQNA 2VBBA 3QOPA 1YI9A 4BXFA 2BNMA 5BY5A 2ZA9A 2FQPA 2WFF3 2X29A 3POFA 2R49A 1VBD2 4YZ4A 4QKDA 3D5OA 4AAXA 5FYMA 5A32A 4YPJA 4X6RB 2JE8A 2DVBA 4IE7A 1JHNA 1RUNA 3KQ4B 2W47A 3QH7A 4AK3A 5HBAA 2QNKA 1IG0A 4IV1C 5E89A 1VRH3 1GBGA 3BALA 1HRV1 4UW6A 4XF0A 4A6OA 1R091 1R1A2 1UMHA 5A3TA 1WLTA 4R9AA 5JCTA 4LHSA 3F95A 2R7EB 3ACLA 2WZR2 5KC6A 5FYVA 2RDNA 4AVAA 1XNBA 4IDZA 1WLWA 2NLRA 1K5JA 4FI9A 5JSRA 3ENRA 3LEIA 4OULA 1KDKA 1TE1B 4RGGA 3VBOB 1JHJA 5FUIA 2BWCA 3CIHA 3VL9A 1CPMA 2Q1MA 4HETA 2UY8A 1PO12 3WF4A 1HRV2 1W06A 1VB4A 2QQVA 2V5DA 3B94A 4FQZA 4QPGC 4SLIA 4E4ZA 4FP2A 1TME3 1KD7A 4CXWA 3UT0A 2V73A 4FPGA 4KWUA 3UGGA 3ZKUA 1WW4A 3LCPA 2OZJA 2R30A 2WNUA 4DNYA 2C5DA 3ZSMA 1LESA 1W8WA 4P9LA 4EN9B 1XJAA 3VV1A 3O1VA 1IG3A 4NRQA 1V6IA 5CFCA 2DUQA 2ZX0A 4Q0PA 5FPBA 1OLQA 1H2MA 1FNZA 5K0UA 1G9AA 1NA1A 1NCRB 2VVFA 5JSOA 3K77A 5A7OA 3PTYA 2A5ZA 1XXNA 2J7MA 5IW0A 1RHI1 1COV2 5EIYB 2DU1A 1X36A 4EN6B 1H30A 4LO4B 1OOPB 1REFA 3LDBA 3KWVA 5GZFA 3T2TA 3ZLIA 2E9QA 4YNIA 4P9GA 3MYXA 4MGQA 3RYKA 1CAVA 1LCLA 1XE7A 2WABA 3B9IA 4G4FA 3B5LB 1OQ1A 4Q8LA 4AF9A 1RUH1 1UYXA 4BM8A 1MS8A 1REDA 1TMF2 2OUHA 3K46A 4LHNA 1ZA7A 4QPWA 4WM7A 3TB0A 4AWDA 2VCCA 1W2UA 4RGKA 2XB6C 5T52A 2ZGSA 1BBT1 4GH4C 4CDWB 4YARA 2FMDA 2VJXA 2VZTA 4R9CA 4BIFA 5JI9A 1OA3A 2Y6FA 1BMV2 2ZMLA 2YBSA 4BA6A 3EMRA 4Y5TA 1OLRA 4FOYA 3L9JT 4NAOA 3O1UA 2HWD1 5C3PA 2VZ3A 1ZBA1 1LOAA 5EQUA 5BNNB 1VAKA 2J1SA 3AX4A 5LA9A 5DPNA 1VAVA 3B3QE 4WZFA 1O59A 4CP9A 1RUH2 3CL1A 1HQLA 3NKGA 4K20A 2PELA 5LB6A 2WYFA 1HKDA 1SMVA 2W5FA 4UW4A 5T55A 1PNFA 2PFWA 1G7YA 1VJ2A 4OQ9A 4RGAA 3VZKA 3BTAA 4C90A 4K1ZA 1ZZCA 4OUMA 1W6NB 4JGYB 4C1WA 3O0WA 4Y1ZA 1IS6A 2ZAHA 4MXWA 5JZGC 1H4HA 2EXIA 3ABZA 2HWD2 2P17A 2YC2A 3WDVA 1WUVA 4LHLA 4Q4Y3 2JKXA 2XUEA 3TN93 4MVTA 3AFKA 4J1WA 1W6PB 2VNGA 4XZUG 4QX1A 4UW3A 3MUZ1 1EYBA 2CHHA 4HONA 5F2WA 2LROA 3GHMA 3V64A 5LEKA 4PIYA 1LGBA 4E27A 3POJA 2NN8A 1H8VA 3G6JB 2OX0A 2PAMA 2VOWA 3I3EA 1UXXX 2YROA 4H14A 3N9MA 3BTZA 2AREA 1J59A 1DYPA 1TG7A 3GDBA 3ZPYA 1YLLA 1FOD1 3VD9A 3ES1A 1O6UA 4QM8A 1BYHA 1LJ7A 4COZA 4CVUA 4JGZA 4XUNA 5A3PA 5IHRA 4MH0E 4XBQA 1SFNA 2ET7A 2VXRA 4Q4X1 3ZYPA 3J4UH 3ZMNA 3RMYA 4XFBA 3CLPA 1C5IA 4IGOA 4UFIA 4BIOA 1YCIA 3C3VA 5EXOA 3E6BA 4XAEA 1CZSA 4CRQA 5FMCA 4K8RB 1U5ZA 5DUUA 5L9RA 5T54A 4DUWA 1FOD2 1K45A 3PURA 3KLSA 3P6BA 1LENA 1BCXA 2C1FA 4Z2AA 4GQ7A 3FHIB 4Y20B 3OBRA 3BODA 1FPN1 1DCSA 1SLTA 1N47A 4GAZA 1F4HA 1W6OA 2WBKA 3SC7X 4NRMA 1U5IA 4Q8KA 3PIJA 3S7IA 4LQRA 2PA7A 1ZZBA 4ISRA 4PBPA 4OHZA 3TWIA 2JWPA 1GZWB 2P4EA 1DP0A 5FR3A 1IPJA 2XPJA 2LS6A 2GNDA 4XUOA 5DXDA 4ZPIA 4DQAA 4CUCA 1QOSA 1JOJA 2BGPA 1FPN2 3FBMA 1HXS1 3VDDB 2QFEA 2FDFA 1KDMA 4KU8A 1QXJA 3NL1A 4K7JA 4C0HA 1XU1A 3MIBA 5JR2A 5L7OC 4CDXC 4Z92B 2X5IA 3BOWA 5ACA3 3V0AB 1AYM1 1YFYA 5FZLA 3A0NA 4KGGA 4XCBA 4N53A 1RUOA 1ND2C 2YPJA 1C3HA 3VKLA 3OYWA 1MEC3 3LQCA 1EAH1 3KT7A 3SNMA 2QJVA 3OY8A 1Q8QA 2AENA 4F83A 3B7MA 5CFDB 1GP6A 4BB3A 4CDQB 2BOIA 5C4WC 2VQ0A 2VZRA 3S5QA 2YU1A 1HN0A 4IEXA 2WT2A 1LNSA 4FPKA 4YW6A 5FUPA 3EHKA 1OT5A 1Y9QA 3OF1A 4OI2A 5KWRA 3H1WA 3WLUA 2RJKA 4L8QA 3VBUA 1UOFA 3ZYRA 1UYPA 1YO8A 5K4LA 1EAH2 2XKPA 4XEZA 4FTEA 2BNNA 3I2IA 3DKWA 4UFJA 1UQXA 5CISA 4CCNA 4FOWA 3HEIA 2D6MA 2W92A 5JXGA 4XFIA 1J83A 4D7TA 2GN7A 3SH5A 1VBC3 2OA2A 3FWEA 1KJRA 4YLZA 1UY0A 3UJOA 3BUCA 4HKOA 3O7OA 4BHPA 2W1SA 2BTVC 1CPNA 1ND3A 2AC1A 3GZEA 5JLVA 2AGSA 1P8JA 3HWJA 5HXVA 4RQPC 3LEGA 2J22A 3MF6A 4Y5Z0 5HCFA 3ACHA 1S55A 3VD5A 2E7QA 4EV0A 1D4M1 4DEVA 3JBG1 5CADA 1QJEA 4AEDB 5IAVA 1GYKA 1CAWA 1OKOA 1LOEA 1DYOA 5DAQA 5DG1A 4YW4A 5FMDA 2C26A 2WS91 3NQHA 4QT6A 5FZFA 2HWE1 1N1TA 2OQ7A 1H8TC 1RUJ1 2VM9A 3GM8A 5E1RA 4LE4A 4AVTA 4XCAA 4CEYB 4KH9A 3N4MA 1E5RA 3RWNA 3HT2A 1PHMA 4HPKA 1EUTA 3JUUA 3MFAA 2HWB3 4Q4W1 3TYJA 2VOKA 2IVIB 4QQ2A 4TLGA 4W6YA 2GU9A 1FYUA 1NUKA 3IN9A 3KT4A 1D4M2 3NJZA 5A6ZA 3PTRB 5KXDA 5I0SA 2QQKA 4IV3B 5AVPA 3UJQA 1BZWA 1Q56A 3DPRB 1U0AA 1FT9A 1UL9A 5DDJ2 2DF7A 5KHHA 2FZ2A 5FYYA 1OLMA 1RUJ2 5FTTC 4JAAA 3WW2A 4NHYA 4U36A 4Y5SA 4CDUC 5C6CA 4QX8A 4FFIA 1FMD1 2WO1A 3CJXA 2B46X 1RUF3 3PUQA 4I3PA 1LGNA 4Q4W2 2XOMA 1GQHA 4IEZA 3U78A 5HCAA 5I8SA 3N9NA 4NHXA 1O4TA 1GWMA 5JAXA 4IV1B 4QHBA 5AC91 1YQCA 2A3XA 3Q8BA 3UKNA 5A7QA 3BCWA 2CWMA 3GCXA 1V9U1 2C6SA 4N9IA 4P9JA 3WUDA 4CU6A 4GMP1 3RZJA 2GALA 2QTWB 4WM8C 2HWC3 4G3YC 3TNPB 4NROA 2PQQA 2P3YA 1XRUA 1FMD2 1JH5A 1AR72 3RGBA 2YBPA 1PM7A 4HN0A 4PDWA 3VKMA 1HJFA 2FBEA 1LHWA 4I09A 2BGOA 3O1OA 1LU2A 5FDBA 1H2KA 2DVDA 1VB2A 4LIUA 4NHKA 5T3NA 3P5BA 3TNQA 1RUE1 4LO5B 1LOGA 2IZWA 3HIFA 1RMU1 1ULOA 4CUGA 5I0DA 1C8M3 2ORXA 1V9U2 3N9QA 4GD4A 2IUWA 3NJXA 4QPGB 1R1ZA 5JIUA 2UYAA 2ZX2A 1W9FA 3MFCA 5EYYA 1DGLA 2WO3A 3VKNA 2MEV1 4META 5JMOA 2PHUA 5LEJA 1PGSA 4BLIA 1HX6A 5JR7B 3T3YA 1QDCA 2XJUA 1H1MA 1W9YA 2AZ5A 4YYOA 2CNAA 3WDWA 3RMXA 1QOTA 3KSCA 4Q4V1 4OYUA 4YG3A 1LTEA 2ZCWA 1QJU1 2QQUA 2AEYA 1WMXA 4LIVA 2J1TA 2EXHA 2RS52 3QBQA 1GU3A 2Y0OA 4W4ZA 1WZXA 4C1XA 1VMFA 4I30A 1KXGA 3AP5A 3ES4A 3ORJA 5KXBA 2MEV2 3WNLA 4BZ4A 4XQDA 3WEZA 2DYCA 4O65A 2HKXA 3CO2A 5FLIA 3SITA 4BQWA 2VG9A 2FDKA 3ZFFA 2A6ZA 1J3QA 4BXSV 5JMCA 2BERA 4KBBA 3PIGA 4M01A 1GP5A 1O5UA 4YFWA 2FCUA 2WFF2 5A33B 4RS5A 4D3WA 1BEV2 4CUBA 1UX7A 3K51A 4WBBA 1MZ5A 3PUIA 3FLTA 4GWNA 5JPNB 5J37A 1PMHX 4GH4B 4UFHA 3FX3A 3SCHA 2J1RA 1QXPA 2EIEA 2HEVF 3NKTA 3U1XA 3O12A 2ZAAA 1MS3A 2Y60A 4BWOA 2QQOA 1VRH2 5BYNA 5I0RA 4JRLA 4PLNA 1O7FA 5FZHA 5E6HA 1HIXA 1WWYA 2E53A 1QDOA 4CEWB 1Q8PA 2CYFA 3WNMA 1DGWA 2XMLA 5FPLA 3KS7A 2JE7A 4FFHA 4UAPA 5ANQA 3W5MA 3UETA 2UU8A 2Y34A 5EZWA 5IFTA 4QDQA 5EP9A 3T09A 5F5IA 3U14A 1WD3A 3EJKA 1WW6A 2CTVA 3ACIA 3T2QA 1GLHA 5JZGB 4TYSA 3VBOA 1Q5OA 2RDSA 4MO3M 3CBNA 1OFNA 3E5XA 3OGGA 4AQSA 3IB3A 3ZM8A 2BZDA 5F32A 4GALA 5DABA 3IDAA 4QXHA 3AZWA 1TME2 3SKVA 1V6MA 1N3PA 4XABA 2EALA 2VL4A 2Q30A 3OTFA 3WX5A 5FZ9A 4N43C 2P6CA 3PUSA 5GJ6A 5FZEA 3ZXEA 4A41A 2EAAA 2XG3A 1SDWA 4EZ4A 4D6QA 3MI8A 4AHZA 1YFXA 3ZOIA 1UZVA 1F15A 4RA0A 3E6CC 5FREA 2BOJA 1A8DA 1Y9MA 1YQ8A 1X8EA 1QJX3 1WLCA 2GAUA 3VGIA 3WINE 2V4VA 3WNOA 5FYSA 2BVBA 1H1AA 1GQPA 3LF7A 3VD4A 2VUDA 2WNVA 1OQEA 2UYBA 4KNCA 4P5HA 4AI9A 1D0HA 3GNEA 5FBZA 2W87A 5F9TA 5FUNA 2D6OX 5F5AA 5E88A 4JZRA 1QJY2 2R1DA 1VLNA 2R063 3WQ7A 5EJ1B 3WF2A 4LITA 1G9BA 3HNYM 3KHCA 3HBKA 2JG8A 4E8CA 3AYCA 5T5PA 1ZRDA 1F2NA 5C9AB 4GA9A 5A3NA 1R64A 2D43A 2CDOA 3AK0A 4CDWA 4JKMA 1RUG1 1UY2A 1CX4A 1DYKA 2HH9A 3AKQA 3Q9OA 4Q4X3 4I0AA 4RYDA 3T0AA 4LBKA 1IQDC 3VBFC 3RZKA 3ZXKA 5JOYA 1X9PA 3PJYA 4DY3A 5CG9A 3H3LA 2WKKA 2K2SA 1CAXB 2RS33 4QPIA 1VIWB 1HLCA 3B69A 1H6XA 1RIRA 3AZXA 5FZ7A 1DF0A 1UYYA 3H1MA 3VZNA 1ULPA 3GBGA 1OI6A 4AR2A 2PAEA 1I3HA 1W6NA 2PLV3 2UWAA 4JGYA 3T1MA 5CG8A 2YC4A 1HW5A 4WVMB 3QACA 3ZSKA 4AQ6A 1RUI2 2VQAA 3I2DA 3VDBA 1RJ8A 4CDXB 4AZZA 3A21A 3AYEA 1AL21 2E63A 4XDPA 2JDAA 2Y6LA 4XIKA 2DTWA 3AJZA 5FXVA 3V65A 1E5SA 3POEA 1UD1A 1ND2B 5FZOB 5I91A 1UWWA 2PYTA 4UFMA 4QQOA 4AW7A 3KHBA 4S2FA 4XMAA 3JQWA 2YZ4A 1JZ8A 3VHNA 2LTNA 5C4WB 4F8AA 5GKAC 1W2AX 1AYM3 4QX7A 2QQMA 3ATGA 4JKKA 2Q8DA 1AR92 1VBA2 3W9AA 4LORA 2DUPA 1MS0A 1YRZA 3M3QA 1FV2A 1CJPA 4XBLA 5FY5A 4FOQA 3RZZA 1J3PA 5C3RA 5FBJA 3ZN6B 2JICA 1LOCA 4KQ7A 4LK6A 4M3CB 4YW3A 5LK7B 1ZRRA 2YGLA 3MIHA 4FVVA 4LBMA 4YSFA 3TRSB 2JDMA 4UFKA 5D21A 2VVDA 4HLTA 4B8EA 4CU9A 3TEWA 2W46A 4LBLA 2GP5A 4Y1XA 1W3VA 2VGDA 2GZWA 1YQ2A 5DAXA 3R6SA 3JD71 4XHBA 4RQPB 1UXZA 4Y20A 2HEWF 2WQ8A 3AZYA 3J7MA 4FPHA 3W59A 4GB33 1O3QA 1QIQA 3ZIXA 1H1IA 5BNPA 4QXKA 4DOUA 4D7YA 2VMFA 3LPGA 4GKYA 3T2OA 3THDA 3ZXFA 3GZAA 4CCKA 2WWSA 4W50A 2G4IA 2ETEA 1UU6A 2YUEA 2VMCA 5HPOA 5FZCA 1H8TB 2OUJA 1RXFA 5FY0A 1PK6C 4P9XA 1HRI3 4M00A 2QDRA 1FX5A 4QX2A 2JIJA 1ULCA 2XBO1 5D2AA 3RSJA 3ZSJA 3MUY1 2ARAA 2GNBA 2R041 3W5NA 1CD3G 3DEMA 3N7MA 3VHPA 3KZ4C 3S0MA 3SQOA 4B4QA 4NIDA 3PJQA 4QGLA 1NX9A 1ULGA 4XUQA 2HWF1 5A1LA 4KG8A 3PVOA 4Y4RA 3BOPA 4P9WA 1W03A 2JD9A 3S5AA 5FMOS 5AFEA 2A70A 4LO8A 3O1PA 4X6QB 5B4XA 4QQPA 3UNPA 3MW2A 1MEC2 3ME2A 1NCQB 2ID4A 4CDUB 3SMHA 1Z78A 2EAKA 4NE9A 1ZBE2 2R042 3LFMA 4YW1A 3V0BB 3OGSA 5CFDA 3S6PA 4XFAA 4CDQA 1QQP3 3BPSA 5LWBA 4CPBA 3LEMA 4D0QA 1S0FA 3BU0A 4RN5A 4QU2A 4XUTA 2Y6HA 2XWBB 1KS5A 3BTXA 4WM8B 3DGTA 1SLAA 3KGLA 1VBE1 4YRDA 1SFYA 2WZEA 2Y6KA 3I2JA 4EWEA 3K4AA 3NV4A 4ZU4A 4PLOA 3NAPC 5F5CA 3CHXA 5JSPA 1NOVA 1AR81 1VBC2 3ZX7A 3ZR5A 1GOHA 2PHDA 1CAUB 1VBD1 4FPFA 2ZPXA 3IPVB 1DQ0A 3KCCA 3SCFA 2W2IA 1NYWA 3EBRA 1AR63 3LAGA 2IVJA 1UNBA 2IWGB 4ZS2A 1DDLA 3ZYJB 3USSA 4PI2A 2EXKA 1GZ9A 3VZOA 4JTNA 1S1AA 2RR11 4ZZ8A 1OD5A 5GLVA 4E2GA 4IEYA 1H2LA 4K40A 2SBAA 3BU7A 3QH6A 2XXZA 1T6GC 3GBFA 3WNXA 3U0ZA 1TZOA 4N9HA 5LY1A 5IK5A 1R1A1 2XLGA 4OUSA 3ZN5A 2BGCA 1H4GA 3O0XA 4BLJA 1AR82 2GDFA 1UPSA 2VMIA 4OZOA 4FT8A 2WZR1 1A8MA 3HQUA 3IDCB 3PLQA 4YFZA 4FTSA 1XPWA 3C7EA 1X82A 2RR12 4Y1VA 2SLIA 3NV1A 1LOFC 2VCAA 4FXGB 1PGL1 1QEXA 1HQWA 1DG6A 1PO11 2DWRA 1RUC2 3LB9A 4B7EA 2ZGUA 2BRTA 1JN2P 3M4FA 2P2KA 1XYPA 5LY2A 4HXCA 1RVF1 5D8AC 4IV3A 5K8SA 2XQRA 3P3PA 5KHKA 1SBDA 1QJU3 3RI8A 4N90A 4L0PA 2JG9B 5FZAA 4RL7A 3ZFGA 3N9PA 2IXIA 2YG0A 1N1SA 5GZEA 1N1YA 3T08A 2G9GA 4MG2A 5AFBA 2F17A 1E57A 1PGL2 1HB4A 2CAVA 4FXKB 5KHIA 2HYXA 4GWMA 5FPXA 4XFFA 5BPXA 4CZSA 1AUYA 1B35B 1PVC1 2GSYA 1O3SA 2CU5A 4GWIA 2Q5TA 4RHV3 3A0KA 1COV1 1RVF2 3B9CA 2WNUC 1R081 1Q3EA 4QDSA 4QPYA 4YWAA 4AEKA 1T6BX 2UWCA 1WCDJ 4AI1A 2HWC2 5CFCC 4IGPA 4IE5A 3WCSA 4MXVA 3K2OA 3M3EA 2DBNA 1O91A 4IERA 2WN3A 4DO0A 5K0UC 1NA1C 2AH2A 1BVVA 4IE6A 2HLEA 2JKBA 1HB2A 1H0BA 1TMF1 1PVC2 1XOYA 3D0SA 4F7ZA 1UMZA 4V2VA 2R072 1G86A 2ZJCA 3N7JA 1UU5A 5HV0A 1UAIA 1C8M2 1NG0A 1R082 2VNVA 1RC6A 3O0VA 3TOJA 3H50A 3T30A 3OSDA 4FPJA 3WUCA 3ZYGA 3VD7A 3LE0A 1OF3A 2QQWA 1BMV1 3OD4A 1ZM1A 4N43B 1AYN2 1US3A 3VL8A 1OC1A 1L7RA 4RR3A 2D6LX 2CSGA 3ZVXA 4WM7C 1K3IA 3QLQA 5GZGA 4A6SA 3DYMA 1KQRA 1JYVA 2RMU2 5FXWA 2G9FA 2FMYA 5ANNA 1RGSA 1BXHA 1UPIA 1MVEA 4BQ3A 3I7DA 4P9YA 1IKPA 4XQ4A 4A45A 1PX3A 4Q1RA 1X9TA 4IESA 4MGSA 4CPBD 4XFGA 2BQPA 5FQ0B 3ZYBA 3IIAA 4AVSA 4MV2A 4TLFA 4BMEA 1L7LA 4OI1A 1HJGA 2ERFA 2MNGA 1UU4A 4XHXA 3DUIA 1MS9A 5JI7A 4ATEA 1LODA 1KS4A 2B4KA 4Z2WA 1XNAA 4UT5A 5DAVA 5BNOC 2ZMNA 1LU1A 2VPVA 4IE4A 2GNMA 4UBGA 3AVRA 1VR3A 3U75A 5L19A 2ZGNA 3HPNA 3PDQA 4K21A 5LA2A 3J7NA 5K9YA 1NLRA 4URTA 5A3UA 5IVYA 3OBZA 1GFF2 3HBZA 2BJSA 4IQPA 4XDOA 1IS3A 4EE2A 4YVSC 4XFHA 1W8UA 5DZEA 1STMA 2AEZA 5F39A 5FZKA 5C9AA 3H8RA 3WG2A 1DZQA 1V6OA 3SHRA 4YZ3A 3AMNA 2RS13 2P3JA 2RG4A 3VBFB 1D2QA 5JOZA 5IVFA 5FP7A 1W6QB 4CCCA 2ADEA 1LULA 5CKNA 3EYPA 1D0GA 4Q0QA 2XKOA 3FN9A 1EV12 3H8UA 1A3KA 5CYYA 5FZ1A 4CEWA 2I2SA 3PMEA 1SPPB 4DS0A 2RDRA 5LASA 2XL7A 1SLLA 4AVVA 1S2BA 1MQTA 2XHKA 4H55A 3J7LA 4DZGA 2VBDA 4IEOA 2ARBA 1NE6A 4ONUA 1DQ1A 5FPAA 3H0OA 1RYYA 2XGXA 2A75A 3CJIB 1JMUB 3CZJA 3NNGA 2LALA 4JGZC 3KVBA 4L9BA 4A42A 1QU0A 2J1EA 1XE0A 4NR1A 4TSVA 4PBOA 1JS9A 2HBTA 2RM22 2E32A 3JQXA 3AL6A 5FZ3A 3WNPA 4LR4A 1IKQA 2XJQA 2DFBA 4WVVA 3AKPA 3BGAA 2W3JA 4Q5OA 2H0VA 3P1IA 1NLSA 5FYIA 3NNJA 2DURA 1NKGA 3VKOA 4HKLA 2XDVA 4FSJA 1KRIA 5TSWA 1DZTA 2XVGA 3SEPA 5FY8A 1W04A 4FP3A 1QJX2 5A3WA 3OPZA 3MZHA 3FLPA 2BUKA 3OUJA 1NLQA 3I2FA 4X8PA 3WZ1A 5F3GA 4LXLA 1UYZA 3QCWA 2D6NA 5LBEA 5IVVA 4A7KA 2R062 3EO6A 1HN1A 1W8NA 5T5JA 2VZQA 3L2HA 1PIV1 2VMHA 5SV5A 1QJZA 2WR9A 3O14A 4PF1A 2HEYF 4L97A 3OGVA 5LK5A 3IIIA 1O8SA 2BWAA 2IFWA 2ZMKA 3N7LA 4K8FA 3GCWA 2X5IC 4YVWA 4OI4A 4MOAA 3UL2A 4BQYA 3MIGA 5LBCA 1Z7S3 5F7UA 4N53C 3KVAA 4UYBA 3USUB 5FRAA 5FYZA 1ODNA 1J1TA 1RXGA 4AEJA 1FXZA 4YGDA 1FAYA 1OLME 2OT7A 4FQ4A 1PIV2 2DV9A 2XR4A 4TXWA 5C5TA 2JB8A 1BVP1 4DXSA 1PK6B 1Q43A 1YUDA 3MF9A 2EA7A 4NN0A 3SH4A 2VOVA 2PLV2 2BNOA 2D44A 1JUHA 2BEOA 3KCYA 4YW7A 1CJDA 4WVMA 1XYOA 3D82A 5FK8A 4BOWA 2X09A 1TQ5A 2W68A 5JWPA 1VE0A 2VXJA 4AEDA 1ZA4A 4LBQB 5FKCA 3I2HA 4K3UA 1W99A 2JDYA 2XQXA 1ODMA 3MIFA 1PO23 4OHWA 3VKFC 3VZLA 4XURA 5IK4A 2V5YA 2JDHA 2XBO3 1ASJ3 4I02A 4QQHA 4S2GA 3LA7A 2R6QA 1S0CA 1ND3C 4GWJA 3GHNA 4BPZA 3C8XA 2E31A 4G9SB 4NIAA 3WXPA 5IVCA 3FHQA 4NIGA 1AVBA 1ZYBA 3MICA 5C4WA 1GSLA 3KV4A 4COVA 4QHZA 2IFRA 3J8F3 4YZ1A 3VB9A 3LOIA 1OBNA 2ZEZA 4E4DX 3FFZA 3H7YA 5APAA 2PHWA 1W8ZA 1K42A 2Q8EA 3NO8A 2JE9A 3K75B 2KA3A 5FWEA 3ZN6A 5KR7A 1UKRA 3TEZA 2GMPA 5DDJ1 4LA3A 5GLWA 3LEKA 4UF0A 4AI0A 1JZ5A 5KHJA 1PZ9A 1XNCA 4XJUA 2R32A 2EVXA 1JI6A 5FK7A 4HL0A 4QB1A 2V09A 2OYZA 3EQEA 1WA6X 4IW3A 4WVWA 2ZEWA 3R4SA 1DZRA 4GB32 2ZXQA 4D94A 5LATA 1VBB2 2YC0A 3SCGA 2RHPA 4JCKA 3BI3A 3VDAA 3ON7A 1GR3A 2ARXA 4XXAA 3E97A 3Q8FA 4UOJA 1W0PA 1RUD3 3CDZB 4GMP0 5FZ4A 1AR71 4UBHA 4K6BA 4XJ8A 3K4ZA 4XETA 4K9SA 4DXRA 2RV9A 3WP4A 2V72A 1JYTA 3HN3A 1NT0A 2JENA 3ZFEA 1VALA 1X8MA 1JU3A 1VP6A 3GZUC 4NWWA 5J98B 4R52A 3VBRA 1U12A 5A70A 4W6XA 3J9SA 1J58A 3UGFA 3SLIA 1E5HA 1C5HA 1LOBA 2IXCA 2QUOA 4YM2A 3EB7A 5BV6A 3D4KA 4DXZA 2OPKA 5D8AB 4FTBA 4GIQA 3I59A 3VBHC 4EWAA 3OGJA 4PDWC 4DRRA 2WWJA 2GC0A 2XONA 2WZR3 5FOJB 4JHTA 5FLHA 2BW8A 5ERLA 3VD3A 4HVQA 4AFAA 2CDPA 5FY1A 4KBZA 4KU7A 3WF3A 1NCQA 4LKEA 1YI7A 1POV1 5D1IA 2ZX1A 2ZTNA 4Q0UA 4QB2A 1MS4A 4Y24A 1PGW1 4S2DA 3I8TA 3WDXA 3WW1A 1K5MA 5CIRA 4AGVA 1L3JA 1QQP2 1T2XA 4Q0SA 1HRV3 2RS51 4ZU5A 4R4ZA 4BK5A 2PAKA 1R093 4JV4A 4XJ9A 1W28A 4Q1PA 4OI0A 4Y22A 3ZSLA 2WNUB 1DU3D 2ZHNA 1OH4A 1MPXA 4Z82A 5B4NA 1EPZA 1HV0A 4D69A 5CFCB 1OA4A 3NVCA 4MYEA 5K0UB 1YJKA 2WO7A 1NA1B 1W90A 3VBSA 4E4HA 1PGW2 4A4AA 2WFF1 5I0TA 1BEV1 1JOPA 4XJAA 2C0ZA 4GJZA 4EN0A 1UKGA 2J42A 1CAUA 3IPVA 3ZFFC 2BVVA 5LRSA 3I49A 1MR5A 1RTVA 3WY6A 1CAVB 3WVJA 2P3KA 4HANA 5G05L 3WCRA 5JXJA 3T0DA 4HZFA 4W6WA 5CKQA 5A6QA 3ZXGA 1VRH1 3N9OA 4UI9L 2WYSA 2FZ1A 2JIGA 2GMMA 3BVCA 3D6EA 4RS5C 4WM7B 1ENSA 2P6HA 2X53S 2A1XA 1V6JA 1JYNA 4NO4A 2HBUA 4FAGA 1JYCA 2D5FA 2JXAA 4AVCA 1RHI3 1AXKA 1NAEA 4ISQA 3I97A 1LHUA 1KFUL 1UO9A 4P14A 1UN1A 3POWA 5F3CA 2E26A 3JZVA 3GYDA 4XMIA 4D6SA 2J1UA 1JXNA 2WC2A 5IATA 3P3NA 4BCUA 1IHMA 1B09A 3K48A 1QY4A 4L2NA 2PXJA 1NZCA 1S0EA 5ABJA 2WWUA 2VQTA 1TME1 3TAYA 1AHSA 1RUH3 4NMIA 1V0AA 4RSUA 5BNOB 5DAPA 1AX1A 3MPPG 5F8PA 3NRUA 4RD7A 5CA6A 2LRPA 5LA0A 4LHKA 5IAXA 1BBT3 1UZYA 1QMJA 3AXDA 1V6NA 3IMMA 3C2UA 2JG9A 2VTXA 3DF0A 2Y33A 4FO9A 4MXWB 3VBOC 2FDGA 4PIXA 4PJYA 1LECA 3NNLA 3OBAA 1JUIA 4L92A 4OZXA 4YVSB 2BYVE 4QX3A 3CQOA 1XNKA 2HWD3 4GXLA 4YM1A 1SDDB 3RYPA 1ZBA3 4CCMA 3LGRA 4OLLA 1Y4WA 3H3ZA 1B35A 2OS2A 4RHV2 2FDIA 2WINB 2QQJA 3ILFA 1XC6A 4MHUA 4XUPA 1RINA 3APBA 4LBNA 3MHZA 4PLMA 1Y9GA 3MDPA 3ILNA 1UIJA 4NOTA 1SFPA 4FPYA 5JIAA 1JW6A 3KV5A 4FCAA 4HG6B 3POSA 2RVAA 3CF6E 5FP8A 4LOSA 1CESA 5AVAA 5FZDA 4B3NA 4XDQA 1CGPA 1TEIA 1QJY1 1S0DA 2LUWA 2A3YA 5HI0A 1XSQA 3GBWA 5E16A 4QGNA 3M3OA 3D8CA 1NCRA 4CE8A 5A7SA 1CWPA 1MVQA 5CNAA 2B5HA 1TNFA 4JGZB 1Q8VA 3PMSA 3POBA 3ASIA 3PVEA 4LBJA 2F4LA 3RDIA 2WNVC 4Y3OA 3WW3A 3I2OA 5F3EA 1OOPA 3I3QA 4OFGA 1QNWA 1OH3A 2QQNA 1G9DA 1K12A 3AZVA 4IXLA 2DFCA 2W0XA 4PT6A 3VUOA 2DCTA 2YHJA 4MUVA 3RWKX 3T1LA 3LKJA 2JG8C 4L99A 3AFGA 2FCTA 1XBFA 4XF9A 4GZ9A 4XW3A 4C0BA 1HDKA 1Q8SA 2AUYA 4P5YA 1NXD1 1FOD3 3V0BA 1OPMA 3I2GA 3DN7A 5FMBA 4QMAA 3HQRA 2I07B 4MGZE 2O8OA 3AMHA 2W1WA 3F2ZA 5LRRA 4CDWC 4CP0A 5KC5A 1W6OB 1OSGA 3ZDSA 5FQ0A 4JHZA 3PUAA 4B4RA 4Q4Y1 1FATA 1RUI1 2ZX4A 2VZOA 4AGGA 2D6PA 1SG3A 5BNNA 5EWSA 1QF3A 5T5LA 1LGCA 4QPIC 1LB2A 3J7HA 3O1SA 1W8OA 1ULFA 2BP6A 1JYXA 2FDHA 4KL1A 4YZ2A 3AKRA 2JDZA 3AXEA 3LIHA 4ES8A 3LD8A 3HVDA 4DIQA 1CX1A 1TVGA 3NMBA 3NW4A 5JXIA 1FPN3 5A3MA 3U37A 5CEHA 2NMNA 3S7EA 2DCKA 4Q4Y2 1W2OA 3M70A 3TN92 5C7GA 2C24A 5L7OB 4ZY9A 2JDUA 3MEPA 4LPLA 2RS12 3E5QA 4N53B 1VRBA 3OOXA 4LLFA 5DG2A 1AR91 1VBA1 1PM4A 2G19A 1W6PA 1M4WA 3OYWB 4AHWA 1W6QA 2Y6GA 2VVEA 3TEXA 2DVAA 1OVSA 3MIDA 3MIEA 1LEDA 1XB9A 1S4CA 2EICA 1HXS3 3PL0A 4PF5A 5FZMA 3KB5A 4CCJA 3WNNA 4W8JA 2VO5A 2R16A 5LBBA 5IVEA 2BU9A 2OKXA 2ZGMA 3L2YA 5J36A 3RVHA 2LM3A 2ZHKA 4LNVA 1J84A 1DGWX 1LR5A 3CJIA 4Z07A 3HNMA 4O7XA 1Z0HA 3ZSEA 5EJZB 1FV3A 2JX9A 3I3BA 2Z69A 3KGZA 1I1EA 3HT1A 3FMGA 1JYWA 1EAH3 2VUAA 4NPRA 4ZKTB 4LEJA 2CGNA 2P5BA 2XWJB 5E8AA 4E2QA 1S2EA 1A34A 2B42B 1PZ8A 5FP4A 4D8MA 2O8QA 1YFUA 2CAUA 3H42B 2QCSB 3PNAA 2YDEA 1GP4A 1ND3B 5A3OA 2BPA2 2YBKA 2O0OA 2ZX3A 5ABJB 1UX6A 1PMJX 4A44A 4CCLA 2VZPA 4ATFA 2YY1A 4ZS3A 4ET7A 4N8MA 2QQPA 1ULDA 4H7LA 1MS5A 1WMFA 2ZZJA 5BNPC 1JZ3A 3ZPOA 4BQXA 2VQUA 3B00A 1F8VA 3WP3A 4KWLA 5ACA1 4XIOA 3A7QA 4NPLA 4XF1A 1W8TA 3M8LA 2GC1A 1KFXL 4D6RA 2ZABA 3S57A 2UY9A 5FXZA 1GZWA 4E4SA 4E2SA 1NXMA 4OHVA 3OUHA 4HPKB 5FMOL 1MEC1 2EIGA 2TNFA 3I4IA 4QHOA 1W0OA 3SISA 3N36A 1ZBE1 2F4PA 2Z79A 1O4ZA 3VDDA 2OZ6A 4NRPA 1D4M3 4HMZA 3JBG3 1UW8A 4QB6A 1CR7A 5ACA2 1Z7S2 2HJIA 4CXXA 3NJYA 2VTFA 4JVAA 2XVKA 3LPFA 1CZVA 2D3RA 2WS93 3FC0A 1DFQA 2D97A 5DZFA 3USUA 3V0AA 1DHKB 2HWE3 4QGMA 1EUUA 4R9DA 2QQLA 1RUJ3 4TWTA 3I3MA 2WQ4A 1WBFA 1OMIA 1QWRA 4Y26A 5C8CC 4AQTA 2WNOA 4LA2A 3MW3A 4Q4W3 2WL1A 3RPQA 3VN4A 2Y6JA 1QXRA 3D3AA 3FZ3A 3IKWA 4FAHA 3KCXA 4CDQC 4CTEA 4LBOA 1VBC1 3WQ1A 3VHRA 2D3SA 5C8WA 5KXCA 2XUMA 3HNBM 1SHWB 1Y43B 4DMIA 2XJRA 1H2NA 2A6VA 3TEYA 3MV11 1F4AA 2AACA 4P00B 3M3CA 1KEXA 3VBHB 1NQJA 4PDWB 1D7PM 2XJVA 3KM5A 1FMD3 4H3WA 5H9QA 3M2MA 1PO22 3DCQA 3S30A 2VUJA 5DUVA 4UW5A 2QE3A 2VE1A 1ASJ2 1GWKA 1WCSA 5H9PA 3THCA 4ARXA 1UY3A 5FIXA 5FZIA 3RQ0A 3WF1A 4EQVA 4ASKA 5AC93 1JBCA 2N7GA 1IS5A 1JZ4A 1V9U3 4JQRA 2E51A 2HWB1 4NVPA 3HQXA 4GMP3 1ENQA 5FPVA 2VMDA 4LJHA 3AB0A 3FL7A 5A1FA 1S2KA 4QKNA 2E7TA 3IM0A 5EYXA 1RUC1 1WD4A 3NWKA 4XOGA 3RRDA 4HK8A 2X8KA 2Q8CA 1ZRIA 1POV3 1W9TA 2VC9A 3K4DA 3RFRA 5I8YA 2FCVA 3NV3A 4KG0A 1C1LA 2DBIA 1RUE3 2WIIB 4HVOA 2DU0A 2TUNA 4A7YA 1RMU3 3K3OA 3ZR6A 1ZZ8A 2D98A 3MLKA 1RUF1 3GJAA 2R0FA 2W08A 3AZZA 1G9FA 2HWB2 4AI8A 4CEYA 5C3OA 5J48A 5C3SA 3WSOA 3HN1A 3KMHA 1S0BA 5DUXA 2MEV3 4XVHA 1LRHA 2QBXA 3UV9A 2JDKA 3ZFFB 3KQRA 4PHZA 4BQ1A 4DUXA 1GUIA 4QQLA 4QXCA 1WLDA 3CU7A 4IV3C 1O8PA 4BQ5A 1RL3A 3AMMA 4E8DA 1I5ZA 1WW5A 1GNZA 2WNEA 4F3JA 1ZX5A 4FOVA 1XNDA 4NHLA 4Q4V3 2OIIA 3DPRA 4RS5B 3OGRA 5BXXA 3ZFGC 4OCTA 2HWC1 2A6XA 1WW7A 1SLIA 1BEV3 1ALYA 2C9AA 1RUD2 3UESA 3H8XA 2Q8OA 1RUF2 1DQ6A 3MO4A 3WDTA 1YQ5A 2ARCA 3JB8A 3WHUA 2JDNA 3LA2A 3QD6A 4Y1YA 4QAWA 3RI9A 1KJLA 5FO9B 2WLPA 4HFSA 1UY1A 1IOAA 2QDNA 3BB6A 4HVRA 5DAWA 1YIPA 1CZTA 2GMEA 1LOFA 2R071 2W52A 4JQTA 1YHFA 2PHTA 4OHYA 2VTXJ 1C8M1 3M3IA 1UZ0A 4IV1A 1SEFA 2K0GA 2QZ2A 5K7PA 1BKZA 1UZWA 1DQ4A 3AKTA 4JDOA 2RE9A 2VOTA 2B45X 2PTMA 5D8AA 4JDMA 5H9RA 1DLLA 5KHGA 5JUVA 1AYN1 1SLBA 4COWA 1Y3TA 4IEPA 5HCHA 1C57A 4FBFA 1GOGA 3K3NA 4MZUA 3IAQA 2MHFA 1PMIA 5FFOC 4Q27A 2RMU1 4ORFA 3IT8A 4GJYA 3O1MA 2D93A 2EIBA 3LDKA 2VECA 1R092 2DDUA 1AL0G 4J25A 5JOXA 1JZ2A 1GZTA 5FLJA 4AE2A 2WLQA 2W1QA 4DINB 4QPGA 5HV4A 3LZZA 5KBFA 1HB3A 4RR3C 3ILRA 1WGPA 3PVNA 1G6NA 4J1XA 5IK7A 3CMGA 2D7FA 1BJQA 4KWJA 5JOWA 2W9XA 3DYOA 5T50A 5J1XA 2CY6A 2Y64A 2KM2A 4WVZA 1WBLA 3ZKYA 1PX4A 4BMBA 5C5UA 2ES3A 2PHXA 1LHVA 4L11A 4QM9A 5HCBA 2IXHA 4FFFA 3JU9A 1AX2A 2WRAA 5FWJA 1GWLA 2UURA 3RZMA 2WNVB 3O1TA 1CN1A 1NZIA 2VBPA 3NJVA 4Q26A 3NNFA 4Z8BA 2QVSB 4NIHA 1S0GA 4B7KA 1YC61 4MGKE 1O4YA 3JB4C 5IWFA 5A7PA 3THTA 4LBQD 1QJY3 5FZ6A 1OHFA 5CVRA 2JG8B 5ISLA 2NZ9A 3DV8A 3UGHA 4WV8A 3VDCA 5A33A 5GZCA 2YPDA 4M4PA 2XH6A 2XL9A 1JU4A 1EV11 1RHI2 1U5XA 4DB5A 1W2NA 3W20A 2WT1A 2YXSA 4GH4A 4AI2A 2RJLA 1N1VA 1OVPA 5JZGA 3VZJA 1IPSA 2V4AA 1CIWA 2GC3A 3KV9A 4AOCA 2PHFA 4CP1A 4LTAA 2VD7A 2WA3A 3MW4A 3WV6A 2I74A 3VLBB 3FJSA 1Q8OA 3LFIA 2Y38A 4QPIB 2ILMA 3OUIA 4CEWC 5FZ8A 3ST7A 2RM21 2Z42A 3D0JA 4BE3A 1YJLA 1I9RA 3LIGA 4BYYA 1YWKA 1ST8A 4B29A 5BNOA 1BBT2 3WQBA 3AP9A 5A1AA 4C91A 1A78A 1MQTC 1V00A 2E33A 2VUCA 4CCDA 1ZRFA 1CVNA 1FI2A 2ZHMA 4COYA 3JCIA 3UKVA 1RUG3 2ZEYA 3DXUA 3WG1A 2ZGOA 5A7NA 3ZO0B 4W65A 1ZBA2 4YVSA 2C9KA 2TBVA 1RUI3 2VAUA 1OPOA 2ZS6B 3DECA 2W39A 1QJX1 4DXTA 4AFCA 5IT6A 5LZ6A 2VMGA 1AXZA 2E6VA 2A6YA 4V1PA 5FY7A 3HAGA 1W6MB 1MZ6A 1QJFA 1G9CA 5FPUA 3ACFA 4O9EA 2PHRA 2R061 2WO2A 4HOOA 1BK0A 5F37A 3OBTA 4KMQA 5KXEA 5FYTA 3OB8A 1OUSA 4AQ2A 1YQ6A 4YW2A 2OQ6A 3ETPA 2IXJA 1AL23 1AR93 1VBA3 2W95A 2JEMA 2XJTA 3CNAA 1V70A 5HXMA 1F5FA 1HB1A 3ITQA 2VNOA 3POGA 5CFDC 3U10A 2VCBA 3WDYA 2WQZC 1SACA 2TEPA 3O1RA 1FNYA 4EJRA 1BQPA 2VZUA 4OMDA 2VR4A 2ZGLA 4M3CE 4XE9A 3TBDA 3GZTB 1REEA 2XJPA 3PHMA 5F6LB 2RS31 4BJ0A 3THPA 1UIKA 3GXUA 4HK9A 5A7WB 3BYWA 2ZGQA 2Z5WA 4YVWC 5C9AC 2RJ2A 2DUOA 2WUHA 3M7AA 2XLFA 2GNTA 2PLV1 4Q4X2 5BNPB 1KGYA 5GM0A 1WCUA 2FHRA 4LULA 3DL3A 2A6WA 5L36A 3OCPA 4LT5A 5JPMB 4AGRA 4CCOA 1GV9A 4JTOA 2W94A 3J26N 4O9GA 2ZKNA 4B1MA 3G7DA 5CAZA 4JDNA 3RZHA 2RS32 3I3DA 4XPVA 1XNTA 3DKQA 5FZGA 2WZ8A 1WCKA 3U11A 4M0NA 1CAXA 3OEAA 3SKJE 3H9AA 4R9BA 1GOFA 3LWCA 3N35A 4BH9A 4JKLA 1OKQA 3JD73 2YV8A 3WG4A 1O3RA 4MLOA 4R8HA 5IJRA 1C1FA 1GANA 1UF2C 3VBUC 2DCYA 4AEDC 5L7OA 4CDXA 2A73B 5IVJA 2Z4FA 3ZIWA 1QNYA 1QHDA 1CQ9A 2P1BA 3R0RA 4LKDA 4PQ9A 3MLLA 5L73A 1QOOA 4FPLA 3HR9A 5FO8B 2CGOA 2ET1A 2W1UA 1OURA 1ND2A 4GULA 5FZOA 5C8CB 2AR6A 1LEMA 1HXS2 1QH7A 1ZNPA 1ZBE3 3UKTA 5IVBA 4NUBA 2R043 1UOJA 5DUWA 1IPKA 4IEVA 3CKHA 1OA2A 3AVSA 4LO7A 1ENXA 3R4DB 1AYM2 3OEBA 4IEQA 4NHMA 2HWF3 3N9LA 4J6GA 4M3CF 5F3IA 3C7GA 3SEEA 3VHOA 4EWDA 5A6XA 2A7AA 1SCRA 4AEMA 4AFMA 4LE3A 4RFT0 4C8DA 4GB31 3IDBB 1VBB1 3RJRA 4PQQA 3W58A 4HSJA 3RJ2X 3OD0A 4M3CA 4CP2A 5IK8A 3NAPB 2VULA 3ZDVA 1JTZX 1OF4A 3NSTA 4BDVB 3AP4A 1ENRA 2ZZQA 1AF9A 1HRI1 2FDJA 4B4PA 4XXPA 2DVGA 2R1BA 3FE5A 4QKFA 5IUQA 4XJWA 4BK4A 3ELNA 4RQPA 1VBE3 4AFBA 4Y4YA 2WA4A 3MLJA 2QKDA 3WOGA 3BPZA 3RNSA 5FXXA 4JX0A 2QQIA 3RG0A 3U4XA 4I2OA 3JXSA 1AR83 4TTGA 3ZYFA 1DQ2A 1SBEA 1VBD3 4RFRB 3N3HA 3PU3A 3LDRA 5A32B 4A3XA 3RZLA 1WKYA 1D2SA 1F35A 1HRI2 1H8TA 3H7JA 4XTPA 1V6KA 4XZPA 5DZGA 3ZFEC 2ADDA 3HD8B 4YM3A 2RR13 4ITCA 3VBRC 1MS1A 4LMFA 1XE8A 1POV0 1GQGA 3JBG2 5M0TA 3BIWE 4OVEA 2ZOEB 2H0BA 1QQP1 2Y26A 3U4SA 2ATFA 1RUC3 2VW1A 4HSLA 1AJKA 1GICA 1GZCA 1VMJA 1R1A3 3OJBA 4IGQA 4XFCA 4COUA 4DY5A 1W39A 2WS92 4HT1T 1WA4A 2VH9A 4YGCA 2HWE2 3ZFGB 4ZHNA 3WW4A 1DGRN 5BUVA 5FP9A 3GALA 5A3LA 2ZKLA 1NCQC 2Y0IA 4Q2FA 5SV8A 4CDUA 5FYBA 3Q8AA 1AZDA 2E7AA 2K9ZA 1K5MC 1YNAA 5FY4A 2R0HA 2PN5A 2UWBA 4R4XA 1AX0A 1PO13 1WMEA 4NIIA 1PNGA 2XHNA 5J09A 1AR61 4U2AA 4IEWA 4Y1UA 1RVF3 3H3UA 2BV4A 1UZZA 1YXWA 1I6XA 2Y8KA 4YG6A 1W0NA 2QZ3A 5FZBA 1JOBA 1W9SA 1W8HA 4I0WB 4SBVA 3WHTA 5L9BA 2ENRA 5GLUA 1N3QA 2D5HA 1GNHA 4MHRA 4WM8A 1M06G 3VBHA 5EFUA 3VBSC 4A2UA 4CU8A 2CGPA 3OPTA 3INAA 4QWNA 4AHXA 3IMNA 4BISA 2CV6A 1PVC3 1WMDA 1J3RA 3A22A 3AJYA 4MX3A 1C28A 2R073 1ZREA 2D3PA 5AC92 1AR62 1COV3 1R083 5LBFA 5LW9A 2VZ1A 4FFGA 4PI0A 2Q1ZB 4YGEA 5JXHA 2BDRA 3IWZA 3R4UA 2VOXA 4RR3B 1ZZ9A 1OQDA 1AYN3 5CZKA 5C33A 2WAOA 3KD4A 2O14A 5J3UA 3T4HB 1JZ7A 3B02A 1TMF3 3FUOA 2RMU3 1RUE2 4QDRA 1QKQA 5CBLA 1GKBA 1ZZ7A 2B9UA 1RMU2 4LLOA 3WNKA 4XACA 3A23A 1ZZ6A 2DCJA 1X33A 1QGLA 2O1QA 1APNA 1IZ3A 1UY4A 2VZVA 2X10A 3ACGA 3H8OA 4A7ZA 4ZZ5A 3NV2A 2NQYA 1BLZA 5ABJC 2D6KA 1AJOA 1JODA 4CP9B 1JZ6A 4NPMA 4I0BA 2WAAA 4RHV1 1RB8G 3B01A 3DYPA 1EP0A 3MGUA 1U5YA 4CSWA 1UOBA 4Q4V2 4AL9A 5C71A 2JECA 2Z2SB 4ZXEA 2VCMA 1QJU2 1XQNA 4MADA 2JG9C 4H2AA 1OFSA 2EXJA 2VY0A 4HN1A 4XTMA 4OQ8A 3V56A 1SLCA 1DBNA 1ZVFA 3RYRA 4A3ZA 3LA3A 1B35C 1NE4A 1OUXA 4E9KA 1VPHA 4ASLA 2K46A 1E5IA 3AYAA 3I54A 5DMYA 3ROUA 3C7FA 3WQ0A 4Q0VA 5FYHA 4LO6B 3RZGA 3KT1A 2B8MA 2VNRA 4M0HA 1EY2A 2YU2A 3T0BA 1J1LA 4K1YA 2GP3A 2NYYA 1ZRCA 3E1F1 1PVXA 1EV13 2B39A 2VZSA 1MQTB 1RITA 1RJ7A 1UCXA 5I93A 1KITA 3OG2A 1NCRC 2OW4A 4NAMA 4IEUA 3IBMA 1X7NA 3AKSA 4XF4A 3WF0A 3ZYIB 4UXAA 3PUHA 1DGRA 2G9ZA 3CEWA 3H1YA 3AP6A 3T2PA 5I0UA 2OVUA 3FHAA 5FAXA 4EN8B 2Q1FA 2WDBA 4NJ4A 2OXBA 2Q0AA 1OOPC 1UOGA 2ZGTA 2C4XA 1I5PA 2JDPA 4NWVA 5GALA 2RM23 3CZUA 4CA9A 3KF5A 3I2KA 2GN3A 4ZONA 1F5JA 1X50A 5EJ3A 3AMQA 4AHYA 2CL2A 1LHOA 4H7MA 4UWDA 4BU2A 4N43A 3BIEA 4LOTA 2RDQA 5FJHA 3ZMOA 5GLZA 4ZU7A 4FPCA 2WT0A 4V2WA 3WDUA 3GJBA 4LKFA 1YEWA 3SXWA 3B93A 4KGQA 1IQAA 2NMOA 2YGMA 3O5SA 2EIDA 2H6BA 4XYXA 1D4VB 3ZXDA 2BBVA 4JC1A 4ZXKA 2VMEA 2ZGRA 1URXA 2I45A 5FP3A 1GMMA 4IE0A 5BNNC 3BN6A 4P9IA 3TN91 3Q8EA 4AI3A 3HMYA 1ONAA 2RS11 1VMHA 3URFA 4HKWA 4I3GA 2CWSA 4XBNA 4AYUA 1IS4A 2L9LA 3POYA 5I8TA 4MGIE 2B7YA 3U07A 2WFPA 1F9KA 4AXOA 5A80A 2Q4SA 4JGYC 3ZN4A 2DVFA 1S0IA 1XU2A 3ECQA 4YVWB 4AG4A 4KWKA 5FYCA 3WP6A 3C7OA 2P34A 2X5IB 5FO7B 4P02B 4LUKA 3EXUA 1YFWA 2H6CA 4EN7B 2G1MA 4QX5A 1LKNA 4FPOB 4LKSA 4EYUA 5FCCA 1MZFA 3UK9A 5JVVA 1MACA 3WG3A 3VBFA 2F6BA 5FV3A 4EZHA 3HJRA 2ZACA 3GGLA 3NNMA 1PIV3 3OY8B 4Y33A 4M4RA 4S2HA 4YGBA 1NY71 1GNYA 4OHXA 1MZEA 4O61A 5JDBA 1SPPA 4Z1VA 1W3XA 1RUG2 1OXCA 2J1VA 4BQ4A 3ZXLA 4QU1A 2NM1A 2KR2A 3CJIC 3DXTA 4PIZA 5CKMA 3ZXJA 2GH2A 1S0JA 5EV7A 4CUAA 3WD5A 4OUEA 4P08A 5EHDA 3VBUB 4XF3A 5F5QA 5C70A 5GLTA 1V6LA 3R05A 1DIWA 2XLAA 2YFZA 3FUQA 1EPWA 3BTYA 3X29B 1NY72 3FLRA 3HOBA 2AYHA 4DUVA 3MBWA 5GZDA 2ZBJA 1W6MA 3ALQA 2JJ6A 1UMIA 1O3TA 2XVLA 1QH6A 4I01A 3KV6A 1H6YA 1ULEA 5FY9A 3POIA 5J96B 4HBNA 4AFDA 4LK7A 1AL22 1DQ5A 1SCSA 2W91A 2WN2A 3LSEA 4AVBA 1LHNA 4YZ5A 2B9VA 4YM0A 1H9PA 2NP0A 1CAWB 4XAAA 4CXYA 1US2A 2OPWA 2WZPP 1Z7S1 2DCZA 4XILA 1YYNA 4ASMB 2GH8A 5F2SA 2NPIA 3GF6A 4URAA 2YMZA 4UF0B 3VZMA 1LAJA 4YW5A 1OD3A 4MSVA 5L9VA 2VU9A 2WSVA 3OPWA 3AC0A 1NQDA 4OMCA 2YB7A 1JYIA 2PHLA 4PCRA 1PZ7A 3FFQA 4DRVA 3VDDC 3AL5A 5LCWL 5T5OA 3ZXAC 2BFUL 2D40A 5A7WA 3RS6A 4ES9A 2FD8A 3E6DA 5LA1A 1CIYA 1POQA 3C7HA
chains in the Genus database with same CATH topology
3E5UA 4XQWA 2KXLA 1TNRA 4GKXA 1VBB3 3LOBA 3AYDA 3ETQA 5DDJ3 4LUMA 1HV1A 3PVBB 3MPBA 1AXYA 2BFUS 4DPNA 1PO21 4TZDA 5F6KA 3N7KA 5CFDC 2GC2A 1XYNA 4IETA 5FPZA 3ZFEB 1ASJ1 2P3IA 3JD72 1PK6A 4QD2A 3VBRB 4YG0A 5J7MA 1SQ4A 2ZGPA 3AM2A 1Y7BA 3FBYA 3WP5A 5F1RA 2JD4A 3AP7A 3SH3A 4X8NA 2ZGKA 3I59B 1CONA 3LSDA 1H9WA 2VW2A 3J8F1 1G8WA 4JRAA 1AR73 5BNQA 4LBQA 3IDEA 5CB7A 2XBO2 4IL7A 2VW0A 2YYOA 5C8CA 1K5MB 4D7SA 1IGOA 1SBFA 4Y22B 2XJSA 2IC1A 2HWF2 1F31A 2ZHLA 1VAMA 2IXLA 2A3WA 3J8F2 4Q29A 4WZCA 3AMPA 1N3OA 3WR0A 2EF6A 2P37A 1C4RA 3VBSB 1A6CA 3A4UA 1YIFA 4N7IA 4EROA 4MGYE 2HYKA 4CEYC 3NAPA 2MPFA 1O5LA 4N7UA 1RUD1 4CYDA 2RS53 2A71A 4FPEA 4INDA 5FOBB 2IXKA 5B2GB 3WT3A 3M1HA 5H9SA 1C8NA 4XJZA 5CU1A 1VBE2 2WSUA 4DFSA 2DTYA 2WJSA 1BK1A 3DPRC 3QOPA 1HQNA 1YI9A 2BNMA 2ZA9A 2FQPA 2WFF3 2X29A 2R49A 1VBD2 4YZ4A 3D5OA 5A32A 4X6RB 2DVBA 1JHNA 1RUNA 3QH7A 4AK3A 5HBAA 2QNKA 4IV1C 5E89A 5ABJB 1VRH3 1GBGA 3BALA 1HRV1 4UW6A 4XF0A 1R091 1R1A2 1WLTA 4R9AA 5JCTA 3ACLA 2WZR2 5KC6A 4AVAA 1XNBA 1WLWA 2NLRA 5JSRA 3ENRA 4OULA 1KDKA 1TE1B 4RGGA 3VBOB 2BWCA 3VL9A 1CPMA 2Q1MA 4HETA 2UY8A 1PO12 1HRV2 1VB4A 4SLIA 4QPGC 3B94A 4FQZA 4E4ZA 4FP2A 1TME3 1KD7A 2V73A 4FPGA 1WW4A 3LCPA 2OZJA 2R30A 2WNUA 4DNYA 2C5DA 3ZSMA 1LESA 4P9LA 4EN9B 3VV1A 5CFCA 1V6IA 2DUQA 2ZX0A 4Q0PA 1OLQA 1H2MA 1FNZA 5K0UA 1G9AA 1NA1A 1NCRB 2VVFA 5JSOA 3PTYA 2A5ZA 1XXNA 1RHI1 1COV2 2DU1A 1X36A 4EN6B 1H30A 4LO4B 1OOPB 1REFA 5GZFA 3T2TA 2E9QA 4YNIA 4P9GA 3MYXA 3RYKA 1CAVA 1LCLA 1XE7A 3B9IA 4G4FA 3B5LB 1OQ1A 4Q8LA 4AF9A 1RUH1 4BM8A 3V0BB 1MS8A 1REDA 1TMF2 2OUHA 4WM7A 4LHNA 4AWDA 3TB0A 1W2UA 2XB6C 5T52A 2ZGSA 1BBT1 4GH4C 4CDWB 4YARA 2FMDA 4R9CA 4BIFA 5JI9A 1OA3A 1BMV2 2ZMLA 4BA6A 1OLRA 4FOYA 3L9JT 2HWD1 1ZBA1 1LOAA 5BNNB 1VAKA 3AX4A 1VAVA 3B3QE 4WZFA 1RUH2 3CL1A 1HQLA 3NKGA 4K20A 2PELA 1HKDA 1SMVA 4UW4A 5T55A 1PNFA 2PFWA 1G7YA 1VJ2A 4RGAA 3VZKA 3BTAA 4C90A 4K1ZA 1ZZCA 4OUMA 1W6NB 4JGYB 4C1WA 3O0WA 4Y1ZA 1IS6A 2ZAHA 4MXWA 5JZGC 1H4HA 2EXIA 2HWD2 2P17A 3WDVA 1WUVA 4LHLA 4Q4Y3 3TN93 4MVTA 3AFKA 4J1WA 1W6PB 2VNGA 4UW3A 1EYBA 3GHMA 3V64A 5LEKA 4PIYA 1LGBA 4E27A 2NN8A 1H8VA 3G6JB 2PAMA 2VOWA 4H14A 2YROA 2AREA 1J59A 1DYPA 3ZPYA 1YLLA 1FOD1 3ES1A 4QM8A 1BYHA 1LJ7A 4COZA 4JGZA 4MH0E 4XBQA 1SFNA 2ET7A 2VXRA 4Q4X1 3ZYPA 3J4UH 3ZMNA 3RMYA 4XFBA 3CLPA 1C5IA 4BIOA 1YCIA 3C3VA 5EXOA 3E6BA 4CRQA 1U5ZA 5DUUA 5T54A 1FOD2 3KLSA 1LENA 1BCXA 2C1FA 4GQ7A 3FHIB 4Y20B 3OBRA 3BODA 1FPN1 1SLTA 1N47A 1W6OA 1U5IA 4Q8KA 3S7IA 2PA7A 1ZZBA 4ISRA 4PBPA 4OHZA 3TWIA 1GZWB 1IPJA 2XPJA 2GNDA 5DXDA 4DQAA 1QOSA 1JOJA 1FPN2 3FBMA 1HXS1 3VDDB 2QFEA 1KDMA 4KU8A 1QXJA 3NL1A 4K7JA 4C0HA 1XU1A 3MIBA 5L7OC 4Z92B 4CDXC 2X5IA 3BOWA 5ACA3 3V0AB 1AYM1 1YFYA 3A0NA 4KGGA 4N53A 1RUOA 1ND2C 2YPJA 1C3HA 3VKLA 3OYWA 1MEC3 1EAH1 3KT7A 3SNMA 2QJVA 3OY8A 1Q8QA 2AENA 4F83A 3B7MA 5CFDB 4CDQB 5C4WC 2VQ0A 4IEXA 2WT2A 4FPKA 3EHKA 4OI2A 1Y9QA 3OF1A 5KWRA 3H1WA 3WLUA 2RJKA 4L8QA 3VBUA 3ZYRA 1YO8A 1EAH2 2XKPA 4XEZA 4FTEA 2BNNA 3DKWA 4FOWA 2D6MA 4XFIA 4D7TA 2GN7A 3SH5A 1VBC3 2OA2A 3FWEA 1KJRA 4YLZA 3UJOA 4HKOA 3O7OA 4BHPA 2BTVC 1CPNA 1ND3A 5JLVA 2AGSA 3HWJA 5HXVA 4RQPC 3MF6A 4Y5Z0 5HCFA 1S55A 2E7QA 4EV0A 1D4M1 5CADA 3JBG1 1GYKA 1CAWA 1LOEA 4YW4A 5DG1A 2WS91 4QT6A 2HWE1 1N1TA 1H8TC 1RUJ1 5E1RA 4LE4A 4AVTA 4CEYB 4KH9A 3N4MA 3RWNA 3HT2A 1PHMA 4HPKA 4Q4W1 3JUUA 3MFAA 2HWB3 3TYJA 2VOKA 4QQ2A 4W6YA 2GU9A 1FYUA 3IN9A 3KT4A 1D4M2 3NJZA 5KXDA 5I0SA 4IV3B 5AVPA 3UJQA 1BZWA 1Q56A 3DPRB 1U0AA 1FT9A 1UL9A 5DDJ2 2DF7A 5KHHA 2FZ2A 1RUJ2 5FTTC 4JAAA 3WW2A 4U36A 4CDUC 5C6CA 1FMD1 4I3PA 3CJXA 2B46X 1RUF3 1LGNA 4Q4W2 4IEZA 1GQHA 5HCAA 5I8SA 1O4TA 5JAXA 4IV1B 4QHBA 5AC91 2A3XA 3UKNA 3BCWA 2CWMA 4P9JA 1V9U1 4N9IA 3WUDA 4GMP1 2GALA 4WM8C 2HWC3 4G3YC 3TNPB 2PQQA 1XRUA 1FMD2 1JH5A 1AR72 1PM7A 4HN0A 4PDWA 3VKMA 2FBEA 1LHWA 4I09A 1LU2A 5FDBA 1H2KA 2DVDA 1VB2A 4NHKA 5T3NA 3TNQA 1RUE1 4LO5B 1LOGA 2IZWA 3HIFA 1RMU1 1C8M3 4QPGB 1V9U2 5JIUA 1R1ZA 2UYAA 2ZX2A 3MFCA 5EYYA 3VKNA 1DGLA 2MEV1 4META 5LEJA 2PHUA 1PGSA 4BLIA 1HX6A 5JR7B 1QDCA 2XJUA 1H1MA 2AZ5A 4YYOA 3WDWA 2CNAA 3RMXA 1QOTA 3KSCA 4Q4V1 4YG3A 1LTEA 2ZCWA 1QJU1 2EXHA 2RS52 3QBQA 2Y0OA 4C1XA 4I30A 1KXGA 3AP5A 3ES4A 5KXBA 2MEV2 4BZ4A 4XQDA 2DYCA 5FLIA 2HKXA 3CO2A 3SITA 2VG9A 3ZFFA 2A6ZA 1J3QA 5JMCA 4KBBA 4M01A 1O5UA 4YFWA 2WFF2 5A33B 4RS5A 4D3WA 1BEV2 3K51A 4WBBA 1MZ5A 5JPNB 3FLTA 4GWNA 5J37A 4GH4B 3SCHA 3FX3A 1QXPA 2HEVF 3NKTA 3O12A 2ZAAA 1MS3A 4BWOA 5BYNA 1VRH2 5I0RA 4JRLA 4PLNA 1O7FA 1HIXA 2E53A 1QDOA 4CEWB 1Q8PA 2CYFA 1DGWA 3KS7A 2JE7A 2UU8A 5EZWA 1WD3A 3EJKA 1WW6A 2CTVA 5JZGB 1GLHA 4TYSA 3VBOA 1Q5OA 3E5XA 1OFNA 4AQSA 3OGGA 4GALA 3AZWA 1TME2 1V6MA 1N3PA 2EALA 2Q30A 3OTFA 3WX5A 4N43C 5GJ6A 3ZXEA 2EAAA 2XG3A 1SDWA 3MI8A 4AHZA 1YFXA 4RA0A 3E6CC 5FREA 1A8DA 1X8EA 1QJX3 1WLCA 2GAUA 3VGIA 3WINE 2BVBA 1H1AA 4P5HA 2WNVA 1OQEA 2UYBA 4KNCA 1D0HA 3GNEA 5FBZA 5F9TA 2D6OX 5E88A 1QJY2 2R1DA 1VLNA 2R063 3WQ7A 1G9BA 2JG8A 3AYCA 5T5PA 1ZRDA 1F2NA 5C9AB 4GA9A 2D43A 3AK0A 4CDWA 1RUG1 3AKQA 1CX4A 1DYKA 4Q4X3 3Q9OA 4I0AA 4LBKA 3VBFC 3ZXKA 5JOYA 3PJYA 4DY3A 5CG9A 2WKKA 2K2SA 1CAXB 2RS33 4QPIA 1VIWB 1HLCA 3B69A 1RIRA 3AZXA 1DF0A 3H1MA 3VZNA 3GBGA 1OI6A 2PAEA 1I3HA 1W6NA 2PLV3 2UWAA 4JGYA 3T1MA 5CG8A 1HW5A 4WVMB 3QACA 3ZSKA 4AQ6A 1RUI2 2VQAA 3I2DA 1RJ8A 4CDXB 3AYEA 4XIKA 1AL21 2E63A 3V65A 4AEDB 2DTWA 3AJZA 1UD1A 1ND2B 5I91A 2PYTA 4QQOA 4AW7A 4S2FA 4XMAA 3JQWA 2YZ4A 3VHNA 2LTNA 5C4WB 4F8AA 5GKAC 1AYM3 3ATGA 1AR92 1VBA2 3W9AA 2DUPA 1MS0A 1YRZA 3M3QA 1FV2A 1CJPA 4XBLA 4FOQA 3RZZA 1J3PA 3ZN6B 2JICA 1LOCA 4KQ7A 4M3CB 4YW3A 5LK7B 1ZRRA 2YGLA 3MIHA 4FVVA 4LBMA 4YSFA 3TRSB 4B8EA 2VVDA 4HLTA 4LBLA 4Y1XA 2VGDA 2GZWA 3R6SA 3JD71 4XHBA 4RQPB 4Y20A 2HEWF 3AZYA 4FPHA 1O3QA 3W59A 4GB33 3ZIXA 1H1IA 5BNPA 4QXKA 4DOUA 4D7YA 4GKYA 3ZXFA 3GZAA 2WWSA 2G4IA 2ETEA 1UU6A 2YUEA 1H8TB 2OUJA 1PK6C 4P9XA 1HRI3 4M00A 2QDRA 1FX5A 3RSJA 2XBO1 1ULCA 3ZSJA 2GNBA 2R041 1CD3G 3N7MA 3VHPA 3KZ4C 3S0MA 4B4QA 3PJQA 4QGLA 1ULGA 2HWF1 4KG8A 3PVOA 3BOPA 4P9WA 5FMOS 5AFEA 2A70A 4LO8A 4X6QB 4QQPA 3MW2A 1MEC2 3ME2A 1NCQB 4CDUB 3SMHA 1Z78A 2EAKA 1ZBE2 2R042 4YW1A 5CFDA 3S6PA 4XFAA 4CDQA 1QQP3 1S0FA 4QU2A 2XWBB 1KS5A 4WM8B 3DGTA 1SLAA 3KGLA 1VBE1 4YRDA 1SFYA 4EWEA 3NV4A 4ZU4A 4PLOA 3NAPC 5JSPA 1NOVA 1AR81 1VBC2 3ZX7A 2PHDA 1CAUB 1VBD1 4FPFA 2ZPXA 3IPVB 1DQ0A 3KCCA 3SCFA 3EBRA 1NYWA 3LAGA 1AR63 1DDLA 2IWGB 3ZYJB 3USSA 2EXKA 1GZ9A 3VZOA 4JTNA 1S1AA 2RR11 1OD5A 5GLVA 4E2GA 4IEYA 1H2LA 4K40A 2SBAA 3BU7A 3QH6A 3WNXA 1T6GC 3GBFA 3U0ZA 4N9HA 5IK5A 1R1A1 2XLGA 4OUSA 3ZN5A 2BGCA 1H4GA 3O0XA 4BLJA 1AR82 2GDFA 1UPSA 2VMIA 4FT8A 2WZR1 1A8MA 3IDCB 3PLQA 4YFZA 4FTSA 1X82A 2RR12 4Y1VA 2SLIA 3NV1A 1LOFC 4FXGB 1PGL1 1HQWA 1DG6A 1PO11 2DWRA 1RUC2 3LB9A 4B7EA 2ZGUA 1JN2P 3M4FA 2P2KA 1XYPA 1RVF1 5D8AC 4IV3A 5K8SA 5KHKA 3P3PA 1SBDA 1QJU3 3RI8A 4N90A 2JG9B 4RL7A 3ZFGA 2IXIA 1N1SA 5GZEA 1N1YA 2G9GA 5AFBA 1E57A 1PGL2 2CAVA 4FXKB 5KHIA 4GWMA 5FPXA 4XFFA 5BPXA 4CZSA 1AUYA 1B35B 1PVC1 2GSYA 1O3SA 2Q5TA 4RHV3 3A0KA 1COV1 1RVF2 3B9CA 2WNUC 1R081 1Q3EA 4QPYA 4AEKA 2UWCA 1WCDJ 4AI1A 2HWC2 5CFCC 3WCSA 4MXVA 3M3EA 1O91A 4IERA 5K0UC 1NA1C 2AH2A 1BVVA 2JKBA 1H0BA 1TMF1 1PVC2 3D0SA 4F7ZA 1UMZA 2R072 1G86A 2ZJCA 3N7JA 1UU5A 1UAIA 1C8M2 1NG0A 1R082 1RC6A 3O0VA 3TOJA 3H50A 4FPJA 3WUCA 3ZYGA 1BMV1 3OD4A 1ZM1A 4N43B 1AYN2 3VL8A 4RR3A 2D6LX 3ZVXA 4WM7C 3QLQA 5GZGA 1KQRA 2RMU2 2G9FA 2FMYA 1RGSA 1BXHA 1UPIA 1MVEA 3I7DA 4P9YA 1IKPA 4XQ4A 4Q1RA 4IESA 4XFGA 2BQPA 5FQ0B 4AVSA 3IIAA 4MV2A 4TLFA 4BMEA 4OI1A 2MNGA 2ERFA 4XHXA 1UU4A 3DUIA 1MS9A 5JI7A 4ATEA 1LODA 1KS4A 4Z2WA 5BNOC 2ZMNA 1LU1A 2VPVA 2GNMA 4UBGA 1VR3A 5L19A 2ZGNA 4K21A 5K9YA 1NLRA 4URTA 1GFF2 3HBZA 4IQPA 1IS3A 4YVSC 4XFHA 5DZEA 3WG2A 1DZQA 1V6O<