4UW5A

Human galectin-7 in complex with a galactose based dendron d2-2.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
132
structure length
132
Chain Sequence
PHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords HUMAN GALECTIN-7
publication title Structural Basis of Multivalent Galactose-Based Dendrimer Recognition by Human Galectin-7.
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 132
sequence length 132
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4uw5A00
4Q1PA 4C1XA 2GMPA 4DQAA 5DUXA 4PBOA 4GKXA 5EYXA 2E53A 4FVVA 1VAVA 4WVVA 1MR5A 1GV9A 2P34A 1FNZA 5JDBA 1LEDA 2A75A 1NXD1 4R9AA 4U36A 1FX5A 4U2AA 2WLQA 5GZFA 1S0CA 5L73A 1J1TA 5JOXA 1QGLA 2C5DA 3RS6A 3UJOA 2JECA 2B7YA 2DVFA 4H55A 1AJKA 1QKQA 2RHPA 1FV3A 2AUYA 4YZ1A 1ENQA 1A3KA 1G8WA 2D43A 2JDZA 2SBAA 3LCPA 3PVNA 3WG2A 5E88A 1LECA 1LOGA 1RIRA 2A3YA 4YG6A 1G9BA 2GDFA 4ASMB 1MZ6A 2GMMA 2YY1A 2PELA 5DZEA 3WG4A 3AZXA 3WDVA 1MS4A 1S0BA 1W0OA 4KBBA 2LALA 5T5JA 3VKOA 4YM2A 2D6NA 3M3EA 1SLTA 1Z78A 3ZSMA 1CJPA 3WDWA 5IK5A 3BODA 3AYEA 5LK5A 4Y20A 2ZHKA 2DUOA 2AR6A 4LBQA 3A4UA 2AYHA 4JCKA 3T1LA 4YM1A 4F83A 1QDCA 1RITA 1CQ9A 4Q8KA 3PMEA 2DURA 1SBDA 4WV8A 4P14A 1IKQA 3RMXA 1HQWA 2GNTA 1AX2A 2CY6A 1QDOA 1DYPA 3MPPG 3HMYA 2C9AA 3AYCA 1U0AA 2ARXA 4LBNA 4I30A 2D7FA 1O4YA 3N7MA 1BQPA 2VUAA 3ZXJA 4XHXA 1S0FA 2A6VA 2VY0A 1ULCA 2Q5TA 1QOTA 1KJRA 2P37A 4XXPA 4LBKA 4YZ2A 1N3PA 1LU2A 5IT6A 3HN1A 4HANA 3TAYA 2UU8A 3ILRA 1C57A 1MS3A 1WLDA 4GALA 3PJQA 4FOWA 1OFSA 4PQ9A 5JOYA 1W6NA 2WT0A 1W6PA 3WUCA 2PHTA 1EPWA 1HQLA 2DU1A 1G9DA 2EXIA 1JN2P 5HCBA 3B3QE 1WW6A 2DTWA 1Q8OA 2R1DA 2ZMLA 1FYUA 1DQ0A 3N7JA 1V6MA 4ITCA 5IUQA 1WLWA 3VKMA 1C4RA 1LHNA 2NYYA 4CTEA 1CVNA 2ZABA 4M3CE 5GLUA 4FPCA 2XB6C 1N1YA 4YFWA 4BMEA 3RRDA 4Y24A 1SLIA 1YXWA 1SACA 1V6OA 4AVVA 4YGEA 3V0BB 2ZGLA 4Q2FA 3AZZA 3AYDA 1DQ4A 3C2UA 4BM8A 3OPZA 1CESA 1LGNA 1GZWB 3ZXKA 2A7AA 1Z0HA 3OYWA 1SBFA 1CPMA 2ZZJA 1WW5A 2DYCA 3NV2A 5T55A 2PHFA 1A78A 1MS8A 2VW0A 2A6XA 1HLCA 1UX6A 3IPVA 4AGGA 4R9DA 4UW4A 2CWSA 4M3CA 1ULFA 3FLRA 3N7LA 5T5PA 1LOAA 2WSUA 3ATGA 1UZYA 1LOEA 2OW4A 5EXOA 2JE9A 4P9YA 3WHTA 5HCFA 2D3PA 4YW4A 3D4KA 3AP6A 3CNAA 2WKKA 4Q26A 2OUJA 2I2SA 2NMOA 4GKYA 2WT1A 3IMNA 1ZM1A 4Y1VA 1DQ5A 2GNMA 1YRZA 3NV1A 2ZHMA 2EF6A 4FPEA 4Y1ZA 3WDTA 3ZYPA 2CL2A 2UWAA 4FOVA 2DVAA 1GYKA 2DTYA 5DUUA 2ZHNA 1JOJA 4Y1YA 4YG3A 2JJ6A 1FV2A 1IS6A 1V6NA 2A3XA 4Y22A 2OUHA 2DU0A 1S1AA 4GWNA 5GZEA 2NN8A 2R0FA 1FAYA 5GLZA 3AZVA 1RINA 3M3CA 1DIWA 4XILA 4AWDA 5DG1A 2CWMA 1LU1A 3ENRA 4YW3A 1OQ1A 1ZA4A 1H9PA 4FPKA 5GALA 2ZGKA 4YGBA 4GXLA 3AJYA 3RG0A 1X50A 3VKNA 3PVOA 1YYNA 2NP0A 5CAZA 3FFZA 1V6KA 4AYUA 3O0WA 3MW3A 2A3WA 3AZYA 2ZGQA 2DVDA 3ZSJA 2A70A 3T1MA 4FPLA 3LSEA 2W08A 1UMZA 3SH4A 3N35A 2R16A 2WNEA 4XDQA 5GZGA 4XMIA 4Y26A 2W68A 1ENSA 1LESA 2UWCA 5GZDA 3WUDA 4Q1RA 4YGCA 3ZYRA 1LEMA 5GLTA 4JRAA 2GMEA 4IQPA 3BOPA 4Y20B 1MS9A 1F5FA 4LBQB 2W52A 3DGTA 1CN1A 1LHWA 4P9XA 1N3OA 2EXKA 2YMZA 3MEPA 1I3HA 4YW5A 1Q8PA 1BXHA 1W6QB 1UAIA 1SCSA 1CPNA 5GLVA 5GJ6A 3O0VA 5GZCA 1W6OB 5H9QA 4DS0A 4XYXA 3ZSLA 1HDKA 5EWSA 1S0IA 1LULA 3B01A 1JYCA 2PHWA 1Q56A 1QNYA 2WSVA 4FPYA 3USUA 1Q8QA 2DUPA 3AP4A 3LSDA 1SLAA 1GLHA 1S0DA 1AXKA 2PHRA 2ZA9A 1S0EA 3FLPA 3KM5A 3NV4A 3OY8A 1BZWA 1AZDA 3PVEA 1Q8SA 3ZXEA 4FPFA 3JUUA 1SCRA 5T52A 1BKZA 4XIOA 2JE7A 2ZMNA 1LHUA 1KDKA 4XIKA 4DFSA 1LOFA 2GN7A 3A0NA 4ATEA 3SNMA 4WZFA 5KXDA 1W6NB 1WCSA 1MS1A 1W6PB 3POYA 4M01A 3POSA 3N36A 4XJ9A 2ENRA 5DUWA 4YZ3A 1YI7A 4FOYA 1QOOA 1AXYA 4D69A 4XE9A 3A0KA 3W59A 2D44A 1QOSA 4BMBA 1TEIA 4XBQA 4ATFA 3FLTA 1QF3A 2ZGTA 3D5OA 2A5ZA 2UURA 4YFZA 2TEPA 3D6EA 3M1HA 1WLCA 2D6PA 2WT2A 3OBRA 1OKQA 4UW3A 1DQ2A 1PZ9A 1VIWB 3O5SA 2ZAAA 1F31A 4YW1A 5SV8A 4FOQA 1AVBA 1FATA 1WD3A 1LJ7A 5BYNA 1LCLA 1MVQA 1V6JA 1GICA 2E6VA 1V6IA 2SLIA 3OYWB 4XZPA 1AJOA 1LGBA 3RSJA 1JYIA 4PF5A 3INAA 3KQRA 4K20A 4ZXKA 2NM1A 2V5YA 5GM0A 4LBOA 3SITA 3MW2A 4BOWA 1GKBA 2WQZC 2XG3A 1SLLA 3APBA 4M3CB 2ZGOA 1W6MA 2PHUA 1UZZA 2D3RA 2FHRA 3ILNA 5KXEA 1IS5A 2EXHA 3B9CA 4BPZA 4DRVA 2EAKA 2NMNA 3AZWA 2P3KA 4UW5A 1C1FA 3I8TA 5GLWA 2ERFA 4YLZA 1GANA 2CTVA 4NO4A 2ZGNA 3M2MA 4PCRA 4R9BA 4XHBA 2ZHLA 4XTPA 5CNAA 2Z42A 3RQ0A 1N1SA 3WV6A 1AX1A 5DZGA 1GZ9A 1LENA 4R9CA 4TYSA 3POWA 1DQ1A 2DVBA 4XJZA 5T5LA 3RMYA 5T5OA 2VW1A 3UK9A 3WZ1A 5AVAA 1D2SA 3VKLA 4Y22B 4OZXA 3ZPYA 3SH5A 1LOBA 1A8DA 2EIGA 4Q8LA 4XJUA 3WDYA 4ZKTB 3QLQA 3WDUA 3WNXA 3V0AA 2GNBA 1VAMA 2GNDA 3AK0A 1SFYA 2ZGRA 4GWMA 5E89A 3ZXLA 2VU9A 1DQ6A 2P2KA 1BJQA 1V6LA 4LBQD 4YZ5A 4XJ8A 3UL2A 4BLIA 5DG2A 1I1EA 3DUIA 3AYAA 1UKGA 4K1ZA 1LHOA 1APNA 4Y1XA 2P3IA 5FREA 2DWRA 4JC1A 1SLCA 1DHKB 1IKPA 3BIWE 1XQNA 2BQPA 3WG3A 1O4ZA 5CBLA 1KITA 5IK8A 5H9SA 1DLLA 2YXSA 4UW6A 2A6ZA 5T50A 2R49A 2GALA 2DUQA 1G9FA 1DGLA 3SLIA 1ULDA 3H0OA 3O12A 2A6WA 3V64A 4AGVA 5JMCA 2JKBA 2VH9A 3HR9A 2WJSA 4PBPA 3VUOA 3SISA 4YZ4A 2AREA 4XBLA 4BLJA 4M00A 1VALA 3U4XA 1LGCA 3L2YA 1R1ZA 4K1YA 2JD4A 2W39A 2ZMKA 2ARBA 5H9PA 1S0GA 4NOTA 1GBGA 3WG1A 1DYKA 3R4UA 2A6YA 4YG0A 1H9WA 1IS4A 2ZACA 4XTMA 1JXNA 5JVVA 1N1VA 3VKFC 2KM2A 1G9AA 3O0XA 4Z8BA 1ULGA 2DVGA 5F9TA 1HKDA 3R4SA 3UJQA 2ZGSA 3USUB 2R0HA 3T2TA 3JU9A 2E7QA 1URXA 4LBLA 1KJLA 3AP7A 1ENRA 4YGDA 4CRQA 3GALA 3OY8B 1MZ5A 3ASIA 2E7TA 1LTEA 2YZ4A 3OGGA 1GNZA 1H30A 1W6QA 4MYEA 4RL7A 3GNEA 2D6MA 2PHXA 1W6OA 3FBYA 1QNWA 3M3QA 3WDXA 1UN1A 2CNAA 4Q27A 3W58A 4CZSA 3R05A 1SLBA 1MS0A 4GA9A 2ZGUA 1KQRA 1AXZA 4BQ1A 4XOGA 4YM0A 2AH2A 2ZGMA 1DFQA 5EYYA 1WBLA 4ISRA 2VW2A 3FUQA 3MW4A 1CIWA 5F5QA 5JOZA 4C1WA 5KXBA 2G4IA 1DZQA 3AFKA 3IM0A 4FQZA 5T54A 5JLVA 1Q8VA 3ZVXA 1D0HA 1ULEA 2ZKNA 4ISQA 1QU0A 1S0JA 3SH3A 1AX0A 2GN3A 3QCWA 4AVTA 2D6LX 5JOWA 4XMAA 3VV1A 4LBMA 2FMDA 1JHNA 1WUVA 4RA0A 1N1TA 2ES3A 1PZ7A 2YV8A 1WD4A 1LOFC 3M3OA 3OBTA 5CB7A 3WLUA 4YM3A 1WW7A 1LHVA 1SBEA 3V65A 1BYHA 1AF9A 1VLNA 1G7YA 3BTAA 4XBNA 4W65A 1WBFA 2AENA 1YIFA 1V00A 3IPVB 3N7KA 2EALA 3TB0A 3FUOA 2HYKA 2NZ9A 4XXAA 2YROA 4XJWA 2OVUA 5E8AA 3NWKA 3V0BA 1FNYA 4AGRA 3ILFA 1B09A 3OJBA 1N47A 1W6MB 2D6OX 4FPOB 1KRIA 3N3HA 2UWBA 5KXCA 2ZGPA 3I4IA 1GZWA 4WVWA 5FRAA 5IK4A 4HL0A 3NV3A 3WOGA 1JW6A 1N3QA 5IK7A 1ONAA 1GNHA 1Y7BA 2DV9A 1JUIA 5H9RA 3AP9A 2EXJA 3B00A 4AVSA 4TZDA 4Y1UA 3WHUA 2P3JA 3Q9OA 1CR7A 2ZBJA 5DXDA 2CYFA 2AGSA 4YW2A 1QMJA 4LBJA 1LOCA 1UPSA 1G86A 1F9KA 1LODA 3WCSA 2VXRA 1C1LA 1KDMA 1CONA 4K21A 4SLIA 3WCRA 1MACA 4FP3A 2D3SA 5DZFA 4FPHA 5CA6A 2A71A 1YO8A 3IN9A 3ZSKA 2LTNA 2E51A 3AXEA 1GZCA 4DPNA 1PZ8A 4FQ4A 3V0AB 1UL9A 3AJZA 1NLSA 4L8QA 5DUVA 1DBNA 1G9CA 3B69A 1W0PA 1MVEA 4DRRA 1IOAA 2H0BA 1GSLA 2V73A 3ZXFA 2D6KA 4FP2A 1WW4A 3AX4A 3WVJA 5HCAA 4P9WA 3AXDA 3IKWA 4XJAA 4FPJA 1IS3A 2R1BA 3AP5A 4M3CF 1JBCA 1MS5A 4FPGA
chains in the Genus database with same CATH superfamily
1ND2C 1HJGA 2HWE3 2K9ZA 4OFGA 1DZTA 2JENA 2GMPA 5DAXA 4ET7A 1NLRA 2VUDA 2E53A 1EV11 1VAVA 1YNAA 3DKWA 4EWAA 3VBUA 1WMEA 1ASJ3 2PFWA 1W03A 3RJRA 5DABA 1NXD1 4R9AA 4U36A 1VP6A 1BBT2 2WLQA 1S0CA 1AYM2 4JX0A 3OGRA 1MQTA 2DVFA 1OA4A 5FWEA 1AJKA 1QY4A 2RHPA 2VBDA 5DDJ3 1ENQA 2XBO3 2SBAA 1OLQA 3PVNA 3LCPA 4MXWB 3RZJA 5E88A 2A3YA 1MEC1 2Z5WA 4IEUA 1G9BA 2GDFA 1MZ6A 3P6BA 5DZEA 3WG4A 4QKFA 5A6QA 4BA6A 1I9RA 4B3NA 1MS4A 1FI2A 2AC1A 2LALA 4CEYA 1GU3A 2D6NA 4LO5B 3BKZA 3ZSMA 3WDWA 2GC1A 3QH7A 2HEWF 2XJRA 3AYEA 3N9OA 4LHKA 5A80A 3RZLA 4FTBA 1RHI2 3WF0A 3A4UA 4RS5C 5FLJA 3WP3A 4F83A 2W0XA 1COV2 2XJPA 4HSJA 1F4AA 2O1QA 3MUY1 3CHXA 1IKQA 3RMXA 1HQWA 5I8SA 2OX0A 5A3UA 4IEZA 1HW5A 2VTFA 4BCUA 3AVRA 2C9AA 3JD72 2YBKA 4I30A 2AEYA 2WABA 2XHKA 3ZIWA 3CBNA 3HD8B 3H7JA 3VBOA 1L7LA 1J58A 1W8FA 3EXUA 4KL1A 1YEWA 4BQXA 4IEPA 3H8XA 1ZRDA 4O9EA 4RHV2 3HJRA 2A6VA 3UGGA 4AAXA 2Q5TA 4AQ6A 1RUF3 1UZVA 1YQ6A 4ZONA 5LBFA 2R063 1PMJX 4BJ0A 4YZ2A 1N3PA 1LU2A 3ILRA 3J8F1 2JG8A 4HSLA 1RUH2 1WLDA 2CGNA 5FJKA 4FOWA 1OFSA 1PMHX 1XE0A 3VBSB 1GWLA 3PIGA 1OHFA 1W6PA 2RS31 3WUCA 1QJY2 3MGUA 2H6CA 2EXIA 1O5UA 3BYWA 5JZGC 5D8AC 4INDA 4CCMA 3AFGA 5HBAA 2X5IA 1ZZCA 3PDQA 4DIQA 3WNKA 3BI3A 1F35A 4QAWA 1OLME 1ZZ6A 2JD9A 1QJU1 4UI9L 5BNPA 3ACGA 4M3CE 3L2HA 1RUJ2 3S57A 3FE5A 1BMV2 3DKQA 3MO4A 2YGMA 4BMEA 3P1IA 4QKNA 1SLIA 4Y24A 1V6OA 3AZZA 1J59A 1QH6A 1DQ4A 2WL1A 5EZWA 5GKAC 3UGFA 3RWKX 1WMDA 3OPZA 5FUPA 4UF0B 2FDHA 1GZWB 5EFUA 1Q5OA 2Q8DA 2C9KA 4CUBA 5FUIA 3GHMA 3JZVA 5FK8A 3OYWA 1VBE2 5FPVA 1CPMA 2ZZJA 3S0MA 2DYCA 2P6CA 5T55A 5JSRA 1YQ8A 1A78A 3WINE 1FPN2 3KHBA 3BU0A 4DEVA 1UPIA 1CAXA 3IPVA 1UX6A 4UW4A 2ZZQA 1TME1 4PF1A 3POBA 2OXBA 1DYOA 1E5HA 4FSJA 4NUBA 1ULFA 4QPGB 4GB32 1LOAA 4Q4X2 3WY6A 2TBVA 3PURA 4N53A 4V2VA 5FZ8A 2XKPA 1IPJA 4XDOA 5EXOA 4RSUA 4P9YA 2W47A 2W46A 2VM9A 4XDPA 3SMHA 3WHTA 2I2SA 3HAGA 4CDWC 3IIAA 1OT5A 3MFAA 4QB1A 4QQHA 4ES9A 1DQ5A 3NV1A 3TOJA 3WDTA 2EF6A 4Y1ZA 3ZYPA 4FOVA 4XUOA 1D4M3 1ZBE3 1GYKA 3KF5A 1DCSA 5DUUA 4R4XA 4NIAA 5BXXA 4CDXC 2A3XA 1V9U2 2WINB 2JWPA 1VRH3 3LDRA 5FP3A 3VDDB 4AVCA 4KMQA 4PJYA 2WBKA 2FZ2A 5F7UA 3AKRA 5I8TA 4LMFA 1RYYA 3UGHA 2Y0OA 3MPBA 2F6BA 2XLFA 4XILA 2WA4A 1NZCA 3ENRA 1UY0A 4YW3A 3CF6E 4EZ4A 3E6DA 5GALA 4E2QA 3FMGA 4YGBA 5FLHA 1HRI2 4GXLA 2YFUA 3POFA 3BALA 5J96B 3OGSA 1X50A 3VKNA 3PVOA 1PIV2 5KBFA 2R6QA 3RFRA 3THPA 3E6BA 1L7RA 3MW3A 2WZR2 2FDKA 2A3WA 2CAUA 3AZYA 3C7EA 2ZGQA 2A70A 3T1MA 3SHRA 3SQOA 2VVFA 1WKYA 2UY9A 4XF9A 1PGW2 3BB6A 1LESA 4NAMA 5C9AA 1XYPA 3OOXA 4YW6A 1UU4A 3JBG1 3PVBB 4JTNA 3WF3A 3B5LB 2GMEA 2H6BA 2JIGA 5FMOS 1JOBA 3MDPA 3VBUC 2ZEXA 4MX3A 2YUEA 1AR91 2ZOEB 5ANNA 5FYHA 4F8AA 1I3HA 3ZFFA 3HEIA 1BXHA 5ANQA 1BK1A 4D6SA 1MQTC 5GLVA 3O0VA 4MADA 1W6OB 5H9QA 3ZSLA 2MEV1 5EWSA 1SFPA 3B01A 2PHWA 4AI1A 2GC0A 2XUMA 3LWCA 4FPYA 1OA2A 3USUA 2DUPA 2YBPA 1SLAA 1GLHA 1XJAA 3KCYA 1JZ7A 2QQWA 1C8M1 3KM5A 1Q8SA 4LXLA 2IFRA 4KNCA 5T52A 2IZWA 4QPIA 1RVF3 2JE7A 3MIDA 4LKFA 4XIOA 5C7GA 1VMFA 3UKVA 4DFSA 3HT1A 4IE6A 2GN7A 3A0NA 2HWB3 2JICA 4QKDA 4XF4A 3ZFEA 4COYA 1WCSA 3NRUA 5F8PA 2BOJA 1QJU3 1BBT1 1S2BA 1JHJA 2P4EA 3BOWA 3VZKA 1AYM1 1SDWA 1V0AA 2HJIA 3A0KA 1VMJA 4I0AA 3ALQA 1TEIA 4NPRA 4ATFA 5F37A 3MYXA 2ZGTA 3D5OA 3T0DA 2IUWA 2UURA 3IT8A 4EN7B 3MBWA 3VBOC 2PAKA 1JH5A 3D6EA 2D6PA 1ND3B 1OKQA 2J1EA 4GH4A 4YARA 1XYOA 1DQ2A 4GAZA 4CPBA 3NNJA 3O5SA 4IERA 1F31A 2RS11 4S2HA 5C3QA 1JZ3A 1HXS2 4H2AA 5L9BA 2WS92 2JG8C 1UY2A 1WD3A 4K8RB 4YRDA 5BYNA 1MVQA 1GICA 1RHI1 1TME3 3KF3A 5FQ0B 5FZ6A 3WR0A 4XZPA 1LGBA 3CDZB 3H8RA 1JYIA 3PJYA 2HWE2 3INAA 2Y6GA 4XW3A 5FP8A 3ZMNA 4RFT0 4AQTA 5C3SA 3ON7A 3NAPC 1GKBA 2X5IC 4OYUA 3LEGA 2XG3A 3APBA 4BOWA 4ZU7A 3RZKA 2J42A 2PHUA 1ASJ2 1IS5A 3B9CA 4NAOA 4DRVA 1GOGA 4UF0A 5ISLA 3H3ZA 3I8TA 3NNMA 3KLSA 2ERFA 4KH9A 1JU3A 1HB2A 4R9BA 3M2MA 4XHBA 4XTPA 5DDJ2 1AUYA 2ZHLA 4JGZC 4AVAA 4CCDA 2XBO2 1H4HA 4EZHA 1CAVA 5APAA 5FYIA 4NRPA 1H8TA 3Q8BA 1XC6A 4JGYA 4Z92B 4A41A 1RUH1 4IW3A 2VW1A 4V1PA 5AVAA 3KV4A 2MNGA 3VKLA 5FZHA 5FY1A 4Y22B 4JV4A 1ENXA 2VZTA 3SH5A 5F2WA 2Q4SA 2O8QA 3TEZA 4ONUA 3WDUA 5L7OC 1O3SA 4Z2AA 2GNBA 4AEJA 3ZXLA 1FOD1 1SFYA 5E89A 3ST7A 2QQLA 3PUIA 2VU9A 4IE0A 2KR2A 1V6LA 2VTXA 1VPHA 1I5ZA 5IHRA 3UNPA 2QNKA 4XCAA 3TN93 1BMV1 5C33A 2LS6A 1GZTA 3SEPA 4BLIA 5DG2A 4QQOA 3VDDA 5I0TA 3AYAA 5IFPA 1CWPA 4I3GA 4LR4A 3M7AA 1LHOA 4UT5A 5FREA 4EWEA 2W1WA 1CZVA 1EYBA 2QZ3A 4XCBA 4AFDA 4CVUA 1RUF2 2ORXA 2R062 4D6RA 2BDRA 3M4FA 1VBE1 1UNBA 4MZUA 3PUAA 5FDBA 4ZU4A 5LRSA 5JXIA 3O1RA 1O4ZA 1UD1A 2QQNA 1FPN1 1PO23 2PTMA 2YU2A 5IVVA 2YXSA 4XFIA 4LOSA 5T50A 2FBEA 2PN5A 2K46A 4GQ7A 1G9FA 4CDUC 5IVFA 2XVLA 1XBFA 1AR93 5J3UA 4D3WA 4QDSA 3EO6A 2IXJA 3H50A 5EV7A 3SISA 4EV0A 1VALA 5A3OA 5C8WA 3U4XA 4K1YA 4C8DA 1OOPB 4LLOA 4CA9A 3WG1A 4AR2A 4YG0A 5CISA 2ATFA 1N1VA 1W8UA 2FZ1A 3H1YA 1DGRN 4KG0A 4G3YC 2IWGB 4N8MA 3UETA 3HNBM 2JDHA 2VOXA 1C5HA 4JRLA 1YFXA 4C91A 3UJQA 5K8SA 5A3MA 2ZGSA 4H3WA 2R0HA 1C5IA 3ELNA 4QX7A 3T2TA 3DYOA 1URXA 4CRQA 5G05L 4HVQA 3IAPA 5FPXA 3OY8B 3NKTA 1S2KA 1MZ5A 4EYUA 2E7TA 4O9GA 4KGGA 4C90A 4RL7A 5AC91 2QQVA 2PHXA 3I2KA 4IEYA 1W6OA 4PLNA 2V4VA 4B8EA 5CKQA 3R05A 4DUVA 2XQXA 1MS0A 1SZBA 3FFQA 4I09A 3DV8A 5LA2A 4GA9A 2RE9A 1KQRA 2ZGUA 4MXVA 4NHXA 4OLLA 1HRI1 4PDWB 3ZFFC 3ZFGB 4BQ1A 2FCVA 4I0WB 2BRTA 2ET7A 2AH2A 1UOFA 3I2OA 4YVWB 2CV6A 2ZGMA 4BQ4A 1EPZA 5EYYA 4B1MA 4ISRA 1CAWB 2Q1FA 2RS13 1O59A 2WZR1 5JUVA 3NJVA 2DCYA 1Y9MA 3AFKA 3BN6A 3IM0A 5SV5A 3R6SA 2BU9A 2ZKNA 4A4AA 1D4M2 1ZBE2 4MO3M 3WSOA 3VV1A 1V70A 4LBMA 2Y60A 3LOBA 1U12A 1JHNA 2CAVA 1N1TA 1VRH2 2ES3A 1WD4A 3OBTA 1A6CA 1I5PA 2BPA2 1NG0A 1XU1A 5KR7A 4W65A 4YVSA 3WNOA 2AENA 3N7KA 5LBEA 3TB0A 1XNBA 2EALA 2FMYA 3GZUC 4IGQA 5CU1A 5DPNA 4E4SA 3KZ4C 4IEWA 4WVMB 4Y4RA 2XWBB 3THCA 4FTSA 1GQPA 1YQCA 4IE7A 4OUSA 3ILFA 2JG9A 2HKXA 1N47A 2VZ1A 3OJBA 1KRIA 3N3HA 5KXCA 4TN7A 5IK4A 3H8OA 1MEC2 1ZZ8A 3USSA 2WNUB 5FJHA 4XABA 4GH4C 5H9RA 4KU8A 4GIQA 1WMXA 2D5HA 2EXJA 2VULA 3UESA 4AVSA 4OI2A 3WHUA 5KHKA 2P3JA 2YC2A 5EQUA 2ZBJA 3WP6A 4BQ5A 1QH7A 1ND2A 2BGOA 5FPBA 3PL0A 3E5XA 5LB6A 1LOCA 5IAXA 2VMDA 1F9KA 1LODA 3CZJA 4HPKB 4P00B 4XETA 3WCSA 2GC3A 4ARXA 4K21A 2PHDA 4SLIA 3WCRA 4QX1A 1AR63 4A42A 4MHUA 4L92A 1FOD3 4OHZA 4UFHA 2VMIA 4AHXA 4GD4A 2VC9A 2A71A 3LEMA 1K12A 3F95A 4N7UA 3AXEA 5EP9A 3WW2A 4FQ4A 3OPTA 4FXGB 4QX0A 3V0AB 1MZFA 3OF1A 1UY3A 4CXYA 1G9CA 3B69A 5KHGA 2BVVA 2VNVA 4DRRA 1IOAA 2HYXA 3ZXFA 1G6NA 1AR73 1WW4A 5HCAA 3FHIB 3P3NA 4MG2A 5HV4A 1H8TC 4HVOA 1HXS1 1IS3A 4D0QA 3AP5A 4XQ4A 2WS91 4M3CF 4ARYA 4FAGA 1MS5A 3L9JT 4QPGC 1POV1 1C28A 1UOGA 1W9YA 4Q1PA 3I59A 1R1A1 4PBOA 4GKXA 3SCHA 1RVF2 4WVVA 5KHIA 1SPPA 5JSOA 1GV9A 3MLKA 1VRBA 4ES8A 3T0BA 2P34A 3WQ0A 5JDBA 2HWB2 5GZFA 1O7FA 4HKWA 5A7PA 1J1TA 3MF9A 5JOXA 3RS6A 3UJOA 1ASJ1 4META 4LT5A 1QKQA 2VL4A 1QJU2 2WWJA 5FXXA 3GBFA 3S5AA 1A3KA 1G8WA 1RJ7A 2D43A 2JDZA 3V56A 1RIRA 2A73B 4QHZA 3CJXA 1VMHA 4YG6A 5DDJ1 4ASMB 2VXJA 2GMMA 3KB5A 5ERLA 2PMWB 2XBO1 3MF6A 2W1UA 3VDDC 3ZKYA 4QXKA 4KWLA 4HT1T 4XUQA 3GF6A 1D2QA 2VR4A 5I0UA 1UYXA 5K4LA 2VCMA 4KBBA 3THDA 5A33B 5FYZA 5LATA 5IYYA 4LLFA 5IK5A 1PM4A 2ZHKA 3CKHA 3WF4A 1NCQB 4RGAA 4JCKA 3M70A 3T1LA 1HB4A 2W9XA 5AC93 5D8AA 1MZEA 1QDCA 4B4QA 4E9KA 1Q43A 3PMEA 1JI6A 3CJIB 2OZJA 1SBDA 1TME2 3JB8A 3O1VA 3B93A 3VBRB 3HVDA 1AX2A 2CY6A 2R073 1QDOA 1DYPA 1FMD3 3HWJA 2P1BA 3MPPG 4N43B 1UF2C 3RPQA 1U0AA 4XFGA 3KS7A 2VZQA 3AMPA 5A7QA 3T09A 1O4YA 1NA1B 2BNOA 2Z69A 1QJZA 2HH9A 2VUAA 1F8VA 4E2GA 4XHXA 2RJLA 2VY0A 2XQRA 1ULCA 1KJRA 2P37A 4XXPA 1SDDB 4K3UA 4KWKA 3E5UA 5IT6A 2VQ0A 4HANA 4NE9A 2EICA 1D4VB 1NLQA 1RUF1 1PK6B 2VJXA 3U4SA 2R061 4BYYA 4XZUG 4PQ9A 3PJQA 5JOYA 1W6NA 1CD3G 2F17A 2PAEA 2ZX4A 1HQLA 2DU1A 4LNVA 2Q0AA 2JDKA 4FI9A 4MUVA 4S2GA 5HCBA 2DTWA 2ZMLA 4QDQA 3N7JA 3ECQA 4ITCA 3X29B 2W87A 5L36A 1K42A 3PTYA 4CTEA 4DINB 1JUHA 3ACHA 4FPCA 2XB6C 1N1YA 3VHRA 3IDAA 4IESA 3MIFA 1Q3EA 1BLZA 1YXWA 2WDBA 4LA2A 4CP0A 3V0BB 4Q2FA 3TN92 4COWA 5LWBA 3OUIA 4BM8A 1CESA 1W8NA 1Z0HA 2A7AA 2RJ2A 3U11A 4RD7A 1SBFA 4NPLA 1WW5A 3NV2A 4JKKA 4HK8A 4XAAA 5FY0A 1E5RA 1W2AX 3EYPA 3GYDA 1I6XA 2VVEA 5IVYA 4O7XA 2ARAA 2WNVB 4P9GA 5LRRA 1QQP1 2CWSA 4M3CA 4WVMA 4YNIA 3I2HA 4B1LA 2OA2A 1PO22 2A1XA 3FLRA 2VZRA 5B2GB 3NMBA 2XLAA 5DN2A 3NW4A 5J7MA 5IFTA 4FTEA 4YVSC 1H6XA 3MICA 1XE8A 1JYXA 3GBGA 4ZY9A 1AR92 2D3PA 3A23A 1ND3C 2WNUA 4LUMA 4QX2A 2RDQA 2R30A 5FY4A 2NMOA 2GAUA 3WW1A 3BTXA 1R093 2G1MA 4FPEA 3HIFA 2ZS6B 5LK7B 2MEV2 2FD8A 2YDEA 4X6QB 2CGOA 2DTYA 2CSGA 5I0RA 4Y1YA 1PX3A 5FY5A 4PHZA 4YG3A 2QQJA 2JJ6A 1FV2A 2QDNA 1D4M1 1POQA 1W9FA 4NROA 1ZBE1 2OUHA 4PIXA 5G04L 4A3ZA 4TTGA 4IGPA 5FZOA 4GWNA 4CCJA 1R1A3 1AYN1 3A22A 3AC0A 5GZEA 5K0UA 1RUG3 1VRH1 2Z79A 3HQXA 5F5IA 1WGPA 3KCCA 4E8DA 3EHKA 1DIWA 5ABJB 1HN1A 4CUGA 1EAH3 3AKTA 2JDMA 1WA4A 1OQ1A 2E7AA 3ETQA 3PMSA 4MGTA 4FPKA 1DDLA 2XJQA 2RMU3 5FZ0A 3RG0A 4MGKE 1UKRA 1VR3A 2WQ4A 3U75A 2BFUS 5JIAA 3FFZA 4X8PA 4AYUA 1RXGA 1ZVFA 3O0WA 2JB8A 3TBDA 4COUA 3MIGA 1OQDA 4BIOA 1IG3A 3LSEA 1W05A 4CU7A 2RS12 2WNEA 4XDQA 4AEKA 2ZEZA 5GZGA 1JOPA 4XMIA 1IG0A 4QD2A 5T3NA 1X7NA 2DF7A 2BGPA 4QQ2A 2FCUA 3DXUA 1TNFA 1UOJA 2K2SA 5A6YA 3Q8AA 4A7YA 3KGLA 3TYJA 4Y20B 4NWWA 2EIBA 2OZ6A 5FYCA 4LBQB 2ID4A 2IXKA 2W52A 4AEMA 4P9XA 4LO7A 3ZR6A 4CCEA 4YW5A 2BBVA 2BUKA 1Q8PA 5FWJA 3MIEA 4M4PA 1UAIA 4BIFA 3AMMA 4P02B 1W9TA 2WN2A 4QXCA 3VDAA 4D6QA 4DS0A 1U5YA 1HDKA 2WC2A 5A33A 1GQGA 1LULA 2WO7A 3I2DA 1UU5A 3S5QA 4CE8A 2LUWA 1W9SA 5J36A 1NCRB 1S0DA 2PHRA 3CO2A 1S0EA 3FLPA 4W4ZA 2EAAA 3PVEA 4B29A 2BZDA 1P8JA 2QFEA 2V09A 3JUUA 4IGOA 3PLQA 5LA0A 4Z1VA 1JTZX 3K3OA 4MGIE 1LHUA 4NMIA 1H1MA 4LULA 1UYPA 5DMYA 3VBFA 1JYNA 1IPSA 2VG9A 5FZ1A 4SBVA 4B4RA 3SNMA 1O91A 4OHWA 1KD7A 1RVF1 2XH6A 3AKSA 4BISA 4G9SB 4LIUA 1JS9A 3N36A 3J7MA 1CX1A 1OOPC 1YI9A 2HWB1 5CG9A 4COZA 1YI7A 1GWMA 1OFNA 2W92A 3NAPA 2RR13 2HLEA 2C1FA 5FUNA 3W59A 4HKLA 4BMBA 1AR62 1FOD2 2UY8A 3H9AA 2Y6JA 4EQVA 4MHRA 1DG6A 2EIDA 3I3DA 1JZ6A 2TEPA 3GZAA 5IVCA 4CXXA 2VE1A 2WIIB 2QKDA 4JGZA 4UW3A 1PZ9A 4CU6A 3VLBB 2ZAAA 4CEWB 1WWYA 3M3IA 4Z07A 4ZXEA 5DAVA 3ZO0B 4W6YA 1AVBA 1YJKA 1ZRCA 1FATA 5F5AA 5A32B 4RQPA 2E6VA 2ZAHA 1V6IA 1QQP3 4W6WA 5HXMA 2P6HA 2DDUA 4X8NA 3U78A 4PF5A 3KQRA 4K20A 4ZXKA 4PDWC 2XJTA 1GWKA 3KT7A 5FYUA 1W3XA 5L7OA 3TEXA 2YFZA 2P3YA 3RI9A 4OUEA 1SLLA 3BVCA 4WZCA 4YVWC 1OBNA 1W6MA 1C8NA 2OQ7A 2D3RA 4QX8A 4XAEA 4IV1B 5EIYB 1CJDA 4BPZA 2EAKA 4CCKA 2P3KA 3PNAA 5GLWA 3DYMA 1GANA 3U1XA 4N90A 2ZGNA 3V65A 4IDZA 2Z42A 2QCSB 1ZBA3 3E1F1 4ASLA 5FPAA 3B94A 5JI7A 1GZ9A 4R9CA 2WA3A 2VZVA 5J09A 3POIA 2WNVA 5T5LA 4BXFA 4ZHNA 2PXJA 5KC5A 2I45A 3UK9A 4M4RA 1AYN3 3WZ1A 4GWIA 3I7DA 4KQ7A 1IZ3A 4OZXA 1LOBA 3KWVA 4PQQA 2RDSA 3CQOA 4Q8LA 4I02A 3VBHB 3WDYA 3WXPA 4CDUA 3R4DB 3VL8A 3T2QA 2QQMA 5IVJA 1VAKA 4IV3B 5AC92 4COVA 2G9FA 1HB3A 2VNGA 4P9LA 2GNDA 3AK0A 3HQRA 1DQ6A 2P2KA 1BJQA 5A7OA 3UKTA 4QGLA 2GH8A 3IDBB 2VOWA 4NWVA 5JXGA 2R072 1UX7A 2WNUC 1BK0A 1FMD2 2FDJA 5FXWA 4EN0A 3UL2A 3S30A 2DBNA 1UKGA 2C26A 3TN91 4K1ZA 4IEOA 4FFHA 2H0VA 2OQ6A 3QH6A 5BNNB 4LHLA 4IEVA 5FYTA 3ZN4A 1QEXA 2VQTA 1ALYA 5F2SA 5FZCA 3WQBA 3OSDA 5F1RA 1IKPA 1YWKA 3BIWE 4W50A 2R32A 5FP4A 3VGIA 3WG3A 3LA3A 3H1MA 3EB7A 5K0UC 1H2LA 3AB0A 5J1XA 2Z4FA 2GALA 4NRMA 5TSWA 1T6BX 4P9IA 3GZEA 1U5ZA 1PO21 1ULDA 3H0OA 3O12A 5I91A 1JYTA 5AFEA 2JKBA 1GMMA 1LR5A 2I07B 2WJSA 4KG8A 4PBPA 1XB9A 3KCXA 4BLJA 4MXWA 3VUOA 3ZYHA 4M00A 1LGCA 3L2YA 2C4XA 4MV2A 2JD4A 4DMIA 2J1TA 4I0BA 4YYOA 4OQ8A 5CFCB 1UXZA 4JAAA 4NHLA 1H9WA 1PVC3 4BK5A 3SEEA 4LPLA 5JVVA 3VKFC 2KM2A 3S7EA 1G9AA 3O0XA 1ULGA 5HXVA 1YIPA 2ZPXA 3EMRA 2DVGA 2MHFA 4AI9A 5F9TA 1HKDA 4LHNA 3O14A 5FO8B 5BV6A 3JU9A 2XHNA 2E7QA 3I2GA 5BNOB 2IVJA 5A1LA 2O0OA 2ILMA 3GALA 4LO6B 2XUEA 2HBUA 5FY7A 3ASIA 3IZOA 3KT4A 3VD9A 3VZLA 2D98A 2VUJA 1GNYA 3UV9A 1PGL2 4ORFA 3I2IA 5JR2A 1ACCA 5HV0A 2D5FA 5D1IA 4HK9A 1J84A 1XNKA 3RI8A 1QJX3 1X82A 3N9MA 4PIYA 1AXZA 3KV5A 3ZN6B 2UYAA 2WO2A 4TWTA 2E31A 2BV4A 5JPNB 4JVAA 1W99A 1W8ZA 3MW4A 5F5QA 4C1WA 3B7MA 3NVCA 1R092 3VBSA 4DXRA 1Q8VA 5FMBA 4AF9A 3GDBA 2CGPA 3KVBA 3ORJA 4GULA 3K4DA 4ISQA 4RGKA 2XJSA 4AFBA 3RYRA 3H1WA 2VZUA 5F6LB 5JOWA 2VNRA 3CJIC 1TZOA 3WF1A 3VBRC 3M3OA 4XACA 3RZZA 3VBFC 3PIJA 2C24A 4QGMA 3WLUA 3VD3A 4BQWA 4N43C 1SBEA 2EA7A 1R1A2 3ZX7A 1BYHA 4HG6B 3TNQA 4DXZA 1VLNA 1RUG2 5J37A 3AL6A 1DU3D 3TNPB 4AXOA 2ZTNA 1NA1C 2DFCA 4DOUA 5EPAA 2HYKA 3ES1A 2HEVF 3NWKA 1EAH2 4JHTA 3WW4A 4XUNA 2Y8KA 1TQ5A 4KGQA 4Q4W3 1VBB3 2D6OX 4QPWA 2QDRA 2B4KA 1GZWA 1NY72 2RMU2 4N9HA 5FRAA 5A3TA 2Q30A 3NV3A 1NUKA 1GR3A 2IC1A 2BWAA 2WNOA 3AMNA 3RWNA 1JW6A 1ZNPA 1Y7BA 1JUIA 1RC6A 4D7YA 3B00A 1T2XA 3K77A 2BEOA 1JZ4A 5FZKA 2JDUA 1REEA 1TNRA 2AEZA 2WYSA 4QPGA 1KXGA 1UPSA 1G86A 4RQPC 1NE4A 5F6KA 3T3YA 3VN4A 4DUWA 1KDMA 1W2TA 4BU2A 1W90A 4BE3A 5EJ3A 1MACA 3U0ZA 3U14A 4FBFA 3DL3A 1HJFA 2B42B 2D3SA 1RXFA 5CA6A 1K5MB 1XNTA 1O5LA 1S55A 2LTNA 1RUNA 2NPIA 1AR61 1GZCA 2WFF3 1PZ8A 4DPNA 5JXJA 3AM2A 1D7PM 5A70A 5I93A 5DUVA 4RR3B 1DBNA 4WM7B 1W0PA 1MVEA 4Q4Y1 3BTZA 2H0BA 4WBBA 1GSLA 2D6KA 4FP2A 4QKBA 3IDCB 4P9WA 5C4WB 1RTVA 2Q8OA 4AI2A 4GWJA 2WNVC 4W6XA 1AR71 1TMF3 2VTXJ 4IV3A 4BXSV 4DQAA 3J26N 5DUXA 3CZUA 5A7NA 5EYXA 3K51A 1MR5A 1W9WA 2BVBA 5BPXA 4RS5B 4EJRA 1FNZA 4URAA 1LEDA 4JHZA 4AFMA 2A75A 4U2AA 2ZEYA 4HKOA 5L73A 1ZREA 4YSFA 1QGLA 1L7QA 1QWRA 2PAMA 2JECA 4LE4A 2B7YA 5CFDB 1W8TA 2VCAA 1AHSA 2RR12 3N9PA 4E2SA 4YWAA 1GOHA 1HRV1 4Q0PA 3C7OA 5FXZA 2B8MA 3SKVA 2R7EB 4BQ2A 3I49A 3HQUA 1F5JA 1W0OA 1HV0A 1XXNA 5T5JA 4M0NA 1RUD3 4YM2A 1H0BA 3M3EA 2WRAA 1SLTA 1Z78A 4A3XA 4AEDB 1CJPA 2BNMA 3BODA 5FZ9A 5LK5A 3T4HB 4AHWA 5ABJC 5FZGA 4FAHA 2AYHA 4YM1A 3JCIA 1RITA 4Q8KA 4NN0A 5JZGB 1DF0A 2XOMA 1Y9QA 4P14A 4WV8A 1QQP2 1YUDA 4BQ3A 2GNTA 2KD7A 2VGDA 4XFHA 4BB3A 1VB2A 2Q8EA 3O1OA 3HMYA 2FQPA 3AYCA 4LBNA 2ARXA 4UFIA 1VBC1 3DYPA 2R071 2AZ5A 1FMD1 4HVRA 2Y6KA 5F5CA 1BQPA 3D82A 2JEMA 4AZZA 1RJ8A 1QOTA 4MLOA 5C70A 5KHJA 4BQYA 4BDVB 3MZHA 4CP9B 3HN1A 3TAYA 2UU8A 2X53S 3HT2A 4O65A 1XNDA 3IAQA 3KQ4B 3WNPA 4MH0E 3CLPA 1ODMA 1E5IA 3D0JA 3BU7A 5CVRA 2JDPA 3LEKA 5F3GA 1JN2P 1VE0A 1AYN2 2J22A 4Z82A 4K7JA 2R1DA 1FYUA 4NR1A 2PLV3 3LFMA 5IUQA 3W5MA 3ZYGA 2WAOA 4HFSA 1YHFA 1C4RA 2HBTA 1LHNA 3F2ZA 5K9YA 4QWNA 2ZABA 4LITA 1ND3A 4D7TA 2ETEA 5FYSA 2WAAA 1MPXA 1NCRC 2E63A 4YFWA 4N9IA 5FBJA 3S6PA 1KGYA 4AHYA 1SACA 4AVBA 2VVDA 1PVXA 4L11A 4AQSA 2ZGLA 2W2IA 5FP9A 5JIUA 4N7IA 1LGNA 4A7ZA 3ZXKA 5IAVA 3VBSC 3AKQA 1HN0A 5FQ0A 1TG7A 5FKBA 2VBPA 2BP6A 2Q1MA 5FR3A 3LDBA 1QXPA 4OUMA 2QQPA 3LPFA 1MS8A 4NRQA 2A6XA 4AGGA 3DCQA 3JD73 1GFF2 1PGL1 2HWD1 4QQPA 3IB3A 4LKEA 1J3QA 1W06A 3ACIA 3ZDVA 1Y4WA 2OW4A 4YPJA 4FFFA 4J6GA 5HCFA 3D4KA 2G9GA 3AP6A 3CNAA 2WKKA 4HBNA 1AL23 1NQJA 2OUJA 4Q26A 2ZX1A 4JDNA 1CAUB 4RGGA 4GKYA 1YQ5A 4Y5TA 3LFIA 5I0SA 4Q4Y3 1JYVA 2GNMA 1AL0G 1YRZA 2QZ2A 2ZHMA 5C3RA 4CEWC 2OYZA 2VCCA 5HCHA 2DVAA 1PVC2 1R091 1CX4A 1UY1A 2PYTA 1NKGA 1UZ0A 1W2NA 4H7MA 5LY1A 5CEHA 1V6NA 4Y22A 4PLMA 3HNYM 2VNOA 4LTAA 1IQAA 3H42B 5C8CB 5JAXA 2ADDA 3MI8A 2Y33A 2NN8A 2B9UA 2R043 4CYDA 2P17A 1FAYA 4URTA 4LQRA 3AZVA 2W95A 1LNSA 4LEJA 3B02A 1RUG1 2RM21 4RR3A 5DG1A 4AWDA 4ZZ8A 1O4TA 1ZA4A 3VBUB 2WO1A 5FMOL 3NJYA 2QQKA 2BBAA 2X05A 1EAH1 4MGZE 3ZSEA 4NPMA 4HZFA 4LA3A 1HRV3 1MQTB 1SQ4A 1HQNA 4ZS2A 5F3IA 2NP0A 1PO13 5CAZA 1NY71 2RMU1 2PA7A 1PHMA 1V6KA 4A44A 1RUOA 2D93A 3MHZA 2DVDA 3ZSJA 1DGWA 3VZJA 4J25A 2W08A 2TNFA 1UMZA 3N35A 3MLJA 2ZKLA 4GB33 2BOIA 2OPWA 3DF0A 3E5QA 4LO4B 4Y26A 4GZ9A 1ENSA 1NQDA 2HWC3 2UWCA 3ZYRA 4Q1RA 3LA7A 4CEYB 4OULA 2IXHA 4IV3C 5GLTA 5DQ0A 4EROA 3JXSA 4CUCA 1QJFA 3BOPA 5FIXA 1KFUL 1Z7S3 1XNAA 3ZYFA 1J3RA 1MS9A 4OHYA 3WEZA 1OOPA 2GH2A 3DGTA 3IDEA 1CN1A 5FZEA 2EXKA 2YMZA 3MEPA 3BPSA 4XFCA 1VBC3 1ULOA 1W6QB 2VCBA 3VD5A 4QX5A 2DCZA 5BUVA 1CPNA 4GMP0 5GZCA 4UBHA 3QBQA 2QQOA 3JB4C 4L0PA 2WZPP 2CDOA 3OGJA 3VD4A 2J1RA 3WP5A 1JYCA 1QNYA 3VBOB 4XFFA 1VBB2 3WDVA 1AXKA 2V5DA 3NV4A 3VHOA 3OY8A 4ZU5A 1BZWA 2Y26A 4A6OA 4CUAA 2VZOA 2ADEA 4LOTA 4WM8B 3BPZA 1DGRA 1SCRA 2KXLA 2ZMNA 3LIHA 1KDKA 1O3QA 2JG8B 4B7EA 4WZFA 5KXDA 2VO5A 1MS1A 1W6PB 1QXRA 4M01A 3POSA 1O6UA 3DN7A 4XJ9A 3T0AA 4PDWA 2XPJA 5DUWA 5FOJB 3ZFGA 2WFPA 4FOYA 5JXHA 1QOOA 2WLPA 2XJUA 3C3VA 4MOAA 4QX3A 2J1VA 4XE9A 4IETA 1KS4A 3SC7X 3WD5A 4YVWA 1QOSA 2YBSA 3GM8A 4MGYE 5DAWA 3FLTA 1CAWA 4K6BA 2E9QA 2RR11 1UOBA 1H2NA 4TLGA 4AW7A 3KGZA 4OQ9A 5BNPB 1K45A 4QHOA 5LA1A 3M1HA 1WLCA 2WFF2 2WT2A 5E16A 3QD6A 1GQHA 3KMHA 5F39A 2QBXA 4GJYA 5BNOC 1VIWB 5LY2A 5ACA3 3Q8FA 5K7PA 2RS53 5LCWL 5CG8A 4FOQA 4AL9A 1L3JA 1O8PA 3FHQA 5J98B 1LJ7A 5IJRA 4DXTA 3ZYIB 4J1WA 3WNLA 3OYWB 1OMIA 2JX9A 2HWD3 5FP7A 4K40A 4JDMA 3RSJA 3LE0A 1TMF2 2EIEA 1H2KA 4RFRB 4HOOA 1CAXB 2V5YA 3VZOA 2VECA 1BEV1 2WQZC 3K4ZA 1XRUA 2YC0A 2ZGOA 3GGLA 5A3NA 1VBD3 3K3NA 5KXEA 1OUXA 2EXHA 4N53B 5FLIA 1PX4A 5FYVA 2NMNA 3AZWA 4UW5A 2VOVA 2CTVA 4NO4A 2Y34A 4P08A 4PCRA 1X36A 5CNAA 3RQ0A 3OEAA 4S2FA 3FL7A 5KHHA 1AX1A 5DZGA 3H8UA 4LK7A 1LENA 2W3JA 2PQSA 4Q0QA 1DQ1A 2DVBA 2HWF3 3H3UA 4XJZA 1ZBA1 1VJ2A 5FXVA 3RMYA 1YFYA 2CU5A 4HPKA 1OVSA 3ZMOA 1D2SA 4Y4YA 1YC61 1WCKA 4CDQB 5FPLA 1RUD2 4JDOA 5F32A 3MIBA 5C6CA 2EIGA 5C5UA 3U10A 2RM23 3QLQA 1UIJA 3AMQA 3WNXA 2V4AA 2B46X 2F4PA 3V0AA 2BW8A 3G6JB 2VQUA 1RUC3 1YLLA 5EHDA 3UKNA 3IMMA 4LBQD 1U5IA 2XWJB 3LD8A 4XJ8A 1OD3A 3R0RA 5FZIA 2JXAA 4L9BA 5FZBA 3ZLIA 3FC0A 4C0BA 3J7NA 1RUI3 1X33A 4AFAA 2DCTA 3DUIA 2GP5A 1I1EA 1ZZ9A 3PHMA 1TVGA 3VHPA 5C8CA 3GZTB 5F3EA 1APNA 1AR83 2JDAA 2P3IA 3N9QA 4JC1A 1ZRRA 1SLCA 3GHNA 4IL7A 1DHKB 1UY4A 2W1SA 4OI0A 1O3RA 1D0GA 4FXKB 5I8YA 3VHNA 1XQNA 3BTYA 1RMU1 1XE7A 3FWEA 3OB8A 3S7IA 2LRPA 2G19A 4Q4V3 1KITA 5IK8A 1LB2A 5H9SA 1DLLA 4LE3A 4UW6A 2A6ZA 3NSTA 3RVHA 1K5MC 5JI9A 3SLIA 1DGLA 2LW8A 3K48A 3LQCA 4AGVA 5C9AB 2A6WA 3KSCA 3HR9A 2VH9A 4QHBA 4YZ4A 2AREA 2BERA 4RR3C 4WM7C 4PLOA 1R1ZA 5BY5A 2VZPA 2W39A 2ARBA 1UYYA 2B39A 1S0GA 2PLV2 4NOTA 4XQDA 5IATA 1OQEA 1DYKA 3ZFFB 1IS4A 1KEXA 2ZACA 2NLRA 5JR7B 4L99A 3O1TA 5C4WC 5AVPA 3NNFA 2J1UA 1REDA 3QACA 3GJAA 5DAQA 1PVC1 1VB4A 5JPMB 3O1UA 2LM3A 3USUB 5C71A 1NCQA 4YGDA 1KJLA 3U07A 1ENRA 4CPBD 3NO8A 1H2MA 5AFBA 5FPUA 3CJIA 1IPKA 2QTWB 4OVEA 4CCLA 5FFOC 1LTEA 2J1SA 2YZ4A 1HV1A 4J1XA 1W6QA 4MYEA 4QPIB 3VBRA 4CU9A 3GNEA 3I3QA 4N43A 3M3QA 3FBYA 2Q8CA 3W21A 1UN1A 2CNAA 4IEXA 4Q27A 5B4XA 3ZFEB 5CFDC 3RZHA 1NA1A 1SLBA 4NIDA 4ZZ5A 1UWWA 1YFUA 2FDFA 2ET1A 1QJX1 4LKDA 4DUXA 4YM0A 4NIIA 4Y3OA 5LASA 1UZWA 2VD7A 4WM8A 5L9RA 3ZXDA 1DFQA 2J7MA 1AL22 1PK6A 5KXBA 5JOZA 4AEDC 4XPVA 1DZQA 3K2OA 4Q4Y2 5JLVA 1F15A 1D0HA 4TLFA 1BHGA 4GH4B 1J83A 3N4MA 2XMLA 3RYPA 3SH3A 3T08A 1AX0A 2GN3A 3QCWA 2D6LX 2RJKA 2XJVA 1AR72 1WUVA 5CB7A 4UBGA 5D2AA 3U37A 4YM3A 1WW7A 2XLGA 4B7KA 1RUE3 1BEV3 3D3AA 2R042 4QU1A 1EP0A 1EY2A 2EVXA 1YIFA 3W9AA 3ZFGC 3FUOA 3ZXAC 2NZ9A 1LRHA 2YROA 4XJWA 2OVUA 5E8AA 3OBAA 1XOYA 3V0BA 1JYWA 4QDRA 1FNYA 4AGRA 4ASKA 1B09A 3I2JA 3BUCA 2UWBA 3FJSA 2ZGPA 3I4IA 4BWOA 2OPKA 4FFIA 2DFBA 1HRV2 1VBA1 4OZOA 4Q4W1 1VBB1 3AMHA 3WOGA 1N3QA 3AL5A 1UMIA 1ONAA 1GNHA 1PO12 3ZPOA 1KS5A 1GUIA 3H3LA 4TZDA 4EWDA 1CAVB 2IXIA 1PNFA 2XL9A 1H8TB 1KFXL 4HN0A 4JGYB 5DXDA 3N9LA 1K3IA 1HB1A 3DPRB 4YW2A 1QMJA 4LBJA 3ZR5A 4CCNA 5IVBA 2DBIA 1NE6A 2W5FA 1C1LA 3Q8CA 2HWC2 4LJHA 1R081 5CKNA 1IHMA 1LKNA 3I2FA 3VD7A 3IN9A 1YO8A 3NNLA 1XYNA 1Z7S2 1YJLA 2HEYF 1WCQA 2OT7A 3OGVA 3PU8A 4JKMA 4QM9A 3ZSKA 2O14A 5LBBA 3CL1A 2LROA 4Y5SA 1VBC2 3OUHA 1XU2A 3KVAA 5KC6A 1SFNA 2WFF1 4P5HA 3T30A 4DO0A 1W2OA 2OS2A 1WZXA 5FO7B 3GXUA 3VL9A 2C6SA 1PGSA 4CDQA 4HN1A 4MVTA 4EE2A 4JTOA 3IKWA 1POV0 3PUQA 2KA3A 5FY8A 2QJVA 2VPVA 2Y38A 4FPJA 2VMGA 1RMU3 2R1BA 1EV13 1JBCA 4CP1A 4FPGA 3URFA 3RJ2X 3D8CA 5FOBB 4C1XA 4K9SA 5ABJA 1WCUA 1GOFA 1K5JA 3FZ3A 2F4LA 3O7OA 4FVVA 2X09A 5FK7A 4BK4A 1TMF1 2BWCA 3LGRA 3G7DA 2C0ZA 2X29A 3NKGA 4Y33A 1FX5A 1PNGA 2C5DA 2Y6HA 1MEC3 2QVSB 4H55A 3OEBA 1J1LA 1FV3A 2AUYA 4YZ1A 2IXCA 1M4WA 3HN3A 3WG2A 2VOKA 3EBRA 3P3PA 1LECA 1LOGA 4R52A 3ZIXA 3LB9A 4XFBA 2YY1A 4PT6A 3ZOIA 2PELA 1OUSA 3AZXA 2WZEA 3WQ1A 4UWDA 4QPYA 3GBWA 5C8CC 3JQWA 4F7ZA 1S0BA 2IFWA 5FO9B 4HMZA 5A7SA 2TUNA 3VKOA 2B5HA 3LPGA 3ACFA 1HIXA 5ACA2 1NZIA 1ZRFA 3LOIA 2RS52 3N9NA 5FZFA 4Y20A 1H4GA 4UXAA 2QUOA 5L19A 1RUD1 2DUOA 2ORZA 2AR6A 1REFA 3PUSA 4LBQA 2FDIA 3ITQA 4QM8A 1CQ9A 5FZ3A 5A3WA 2DURA 1HX6A 1W3VA 3DEMA 4FT8A 2HWD2 3LF7A 1W8WA 3UYJA 1ZZ7A 3MIHA 4AHZA 2D7FA 1NCRA 1S2EA 1W04A 3M8LA 1W2UA 3N7MA 3Q8EA 3K46A 4GMP1 4I01A 3ZXJA 1VBD2 1S0FA 4PIZA 3E6CC 3J7LA 3J8F3 3O1MA 4DY5A 4NIGA 4LHSA 5FBZA 4LBKA 4AOCA 2RS33 4S2DA 2E32A 4CEYC 1C57A 1MS3A 4HLTA 4GALA 2JDYA 4UFKA 4XUPA 2G9ZA 3SKJE 2WT0A 1NCQC 2PHTA 1EPWA 1G9DA 2HWF2 2Y0IA 1H8VA 4NHKA 2ZEWA 5CYYA 1XNCA 5FMDA 1OSGA 3B3QE 1WW6A 1Q8OA 2JIJA 2PHLA 2YYOA 1JU4A 1DQ0A 3PU3A 1V6MA 1XSRA 1WLWA 1DP0A 3OBZA 3C8XA 3VKMA 1JZ2A 4I2OA 3T2PA 3WT3A 2NYYA 4E8CA 3NNGA 1CVNA 2RM22 3ZDSA 2PLV1 5GLUA 4YVSB 2WQ8A 5LA9A 1ZYBA 1RUC2 1YQ2A 3RRDA 5FYBA 4AVVA 4YGEA 4M0HA 4CEWA 1VBA3 2BNNA 4WM8C 4CU8A 4KU7A 3AYDA 4WVZA 4IUGA 4L2NA 1OPMA 2P5BA 2JG9B 2YPDA 3C2UA 1PK6C 4F3JA 1B35B 1RUI2 1UXXX 3WF2A 3B9IA 5A32A 5LEKA 3GCXA 4AG4A 4QQLA 1O3TA 1AR82 3OTFA 2PHFA 1ZRIA 2CDPA 1COV1 2VW0A 3FBMA 1HLCA 1NXMA 1UU6A 3ES4A 4R8HA 4R9DA 5BNQA 3H7YA 2MPFA 3AVSA 3UT0A 1ND2B 1R083 3N7LA 4Q4V2 5T5PA 2WSUA 3ATGA 2X10A 4IV1A 2XONA 1E57A 2OIIA 3JD71 4AI8A 3SCFA 1UZYA 2WZ8A 1LOEA 3HPNA 4QU2A 4KWJA 3VB9A 2GC2A 5BNPC 2JE9A 3NL1A 2VUCA 1W0NA 2GP3A 4YW4A 5FYMA 1JZ8A 3POJA 2E26A 1OA3A 4RHV1 2CHHA 3ETPA 2WT1A 3IMNA 1ZM1A 4P5YA 1GP5A 4Y1VA 5FY9A 1DLCA 4E27A 4CSWA 1QHDA 1YFWA 2CL2A 1AL21 2UWAA 3C7FA 2UYBA 2W1QA 4E4ZA 3DPRA 2BFUL 5FYYA 2ZX0A 4XFAA 2ZHNA 1JOJA 3LDKA 1SG3A 1U5XA 3LEIA 4D94A 1IS6A 1QJY1 2XVGA 1SMVA 1T6GC 3GCWA 2DU0A 4EN8B 1S1AA 4XUTA 3VBHA 3CIHA 1JODA 1WA6X 5F3CA 1OH3A 2R0FA 5IVEA 1OKOA 4XF3A 2BJSA 5GLZA 2JE8A 2B9VA 1RINA 4DY3A 3HBZA 3OPWA 3M3CA 2R041 3I59B 4DZGA 4N53C 2B45X 2CWMA 1LU1A 1SPPB 1RUJ1 3I3EA 4D7SA 2XVKA 4EN6B 1H9PA 5CKMA 3TEWA 4OCTA 2ZGKA 3DXTA 4CXWA 1BCXA 5C5TA 3AJYA 5A1FA 2OKXA 5E1RA 1S4CA 1YYNA 5BNNA 3RNSA 2WWUA 2FCTA 4I3PA 2FDGA 1W28A 1UQXA 1PO11 1CZTA 3BGAA 4CDQC 4FPLA 3MV01 3SH4A 4LUKA 5CIRA 2R16A 3JBG3 4PI2A 4GJZA 4UFMA 3T4VA 3WNNA 5HPOA 1OXCA 1ULPA 3E97A 3SXWA 2W68A 3WUDA 5GZDA 4YGCA 1LEMA 4GB31 4JRAA 4Q4X1 4IQPA 4KBZA 2E33A 5LEJA 2HWC1 1CZSA 1F5FA 5A1AA 4ZS3A 4QXBA 3WX5A 1LHWA 5CFCA 1N3OA 4R4ZA 5D8AB 1Z7S1 1OPOA 1BEV2 1RUE2 2MEV3 2YGLA 1SCSA 5GJ6A 3J9SA 4GMP3 3ZYJB 2QQIA 4XYXA 1UYZA 3IIIA 1S0IA 1C8M3 4KWUA 1GP6A 3LKJA 3RYKA 1Q56A 1OVPA 2QQUA 2WSVA 1PMIA 1Q8QA 3AP4A 3LSDA 5FZ4A 2YHJA 5BNOA 1V9U1 2YB7A 2ZA9A 1NYWA 5A7WB 3ZXEA 1AZDA 1YCIA 4OMCA 3KHCA 4FPFA 4A2UA 4A7KA 5KWRA 1RB8G 1BKZA 3HBKA 3OD4A 1ZBA2 5A6XA 4XIKA 4QB2A 5C9AC 1JMUB 4Q0VA 1LOFA 4ATEA 1BBT3 3MUZ1 4JQTA 1W6NB 1AYM3 3I3BA 2ARCA 1F4HA 1RL3A 1X8MA 2GSYA 3POYA 1E5SA 2XDVA 2ENRA 3O1SA 4TXWA 3J4UH 4YZ3A 4L97A 2XGXA 3ZN6A 2VQAA 1AXYA 2VBBA 4XC9A 4D69A 4DXSA 5JMOA 1X8EA 2D44A 2YU1A 5FV3A 4DEQA 4XBQA 4XEZA 3IWZA 1QF3A 1PIV1 2A5ZA 4OHVA 4BH9A 4JKLA 4YFZA 2W94A 4EN9B 3QOPA 4JZRA 3T2OA 3FX3A 3OBRA 4HETA 2V72A 4FO9A 3TRSB 2VMFA 1QJEA 4IE5A 4XF0A 3WP4A 4H7LA 1UMHA 4CDWB 5LW9A 4NIHA 1QIQA 4AI0A 4YW1A 4B4PA 5SV8A 4HONA 1PGW1 1RHI3 1GP4A 4QPIC 1FT9A 3HOBA 5ACA1 4C0HA 1COV3 2RS51 1LCLA 1V6JA 4JQRA 3AKPA 4CDXB 2NQYA 3KV6A 2SLIA 4DB5A 1RMU2 3ZFEC 2VMEA 3I97A 1AJOA 3MLLA 1EV12 5C3OA 5A6ZA 3BIEA 2IXLA 2NM1A 5GM0A 3SITA 4LBOA 2DCJA 4QXHA 4UYBA 3CEWA 3MW2A 4E4HA 1UO9A 3PTRB 4HXCA 4M3CB 3THTA 1ST8A 4W8JA 3K4AA 1DGWX 5LBCA 1UZZA 2RDNA 3D0SA 2FHRA 4NJ4A 4RHV3 3ILNA 3ZN5A 1B35A 3POGA 1RGSA 4CP2A 1C1FA 2IVIB 2XKOA 4YLZA 2ZX3A 3LZZA 1SEFA 1VBD1 3SCGA 2AACA 4K8FA 1N1SA 3POEA 1RUH3 3WV6A 2BYVE 1F2NA 2J1AA 3EJKA 4TYSA 4X6RB 4RN5A 1QJY3 3POWA 3HNMA 4LORA 4OI4A 1ZX5A 5T5OA 4QGNA 2I74A 4NHYA 3FHAA 3KD4A 4MGSA 2HWF1 2BTVC 1CGPA 3DECA 3ZPYA 4YW7A 4Q0UA 1A8DA 4XJUA 3A7QA 5FZOB 1K5MA 5K0UB 4ZKTB 1WCDJ 1RUJ3 3TEYA 2N7GA 1VAMA 5HI0A 4IV1C 4GWMA 5B4NA 2ZGRA 3P5BA 4WM7A 2VAUA 4A6SA 4YZ5A 3LAGA 4AFCA 4MGQA 2WO3A 2Z2SB 1RUC1 5CZKA 4PI0A 1QJX2 5C4WA 1QXJA 1NT0A 5FTTC 5I0DA 4AAPA 1VBE3 1C3HA 2YPJA 4H14A 1RUI1 2WYFA 4JGYC 2DWRA 4OHXA 4Y1XA 2JDNA 3DPRC 3WQ7A 2YC4A 1FPN3 4BZ4A 3J8F2 3ROUA 1AR81 4LO8A 1TE1B 3ZYBA 2BQPA 2Q1ZB 5IW0A 3OD0A 2WN3A 2RS32 5CBLA 1Y43B 1M06G 4AK3A 4RS5A 3NQHA 4Q4X3 5FZLA 2HWE1 3FN9A 3VBHC 1EUUA 1O8SA 2WR9A 2R49A 4O61A 4KI5M 1JZ5A 1BVVA 2DUQA 4LKSA 2PQQA 4Q4V1 3V64A 4DNYA 5JMCA 1FXZA 4XQWA 4AE2A 2VMCA 5CFDA 3JQXA 4XBLA 4FCAA 4FFGA 4CCCA 1NAEA 2ZMKA 5H9PA 2JKXA 3MV11 1GBGA 3R4UA 2A6YA 3RDIA 3LA2A 4XTMA 1JXNA 1UIKA 2YG0A 4XVHA 4UOJA 5LZ6A 4Z8BA 2L9LA 5BNNC 4Z2WA 1SHWB 1V9U3 3LIGA 1UCXA 3ME2A 4AEDA 3W20A 4Y5Z0 4QMAA 3R4SA 2K0GA 1VBA2 4IXLA 5E6HA 4Q4W2 1LAJA 5L9VA 1OF4A 3CMGA 1BVP1 4V2WA 4LBLA 3A21A 3AP7A 5EJZB 2XL7A 4QB6A 3WNMA 2DCKA 2JB4A 4QT6A 2XR4A 5JZGA 3KT1A 1IQDC 3OGGA 3I3MA 1GNZA 1H30A 2VZSA 4D8MA 3VZNA 2D6MA 1H1IA 1IGOA 3VBFB 3ZM8A 5D21A 1QNWA 1ZZBA 3GJBA 1OD5A 3WDXA 1HRI3 4CZSA 5FPZA 3W58A 3I54A 4A45A 3VDBA 3MFCA 3NJXA 2RVAA 2RDRA 5CFCC 1R082 1PIV3 2VOTA 3C7GA 4XOGA 3NAPB 2X5IB 4LIVA 5A7WA 2WZR3 4NVPA 3OUJA 4TSVA 4NHMA 5FZDA 4AI3A 4CP9A 1US3A 1WBLA 3IBMA 2VW2A 3FUQA 3WW3A 1CIWA 2G4IA 4FQZA 5T54A 1WLTA 2ZJCA 4UAPA 3ZVXA 4OI1A 1ULEA 4E4DX 4JGZB 1QU0A 1S0JA 3J7HA 4UFLA 2ZCWA 1OH4A 4RYDA 4AVTA 4Q29A 4XMAA 4CCOA 1WMFA 5CADA 3BCWA 2FMDA 4RA0A 5IWFA 5M0TA 3VZMA 1PZ7A 2X8KA 2YV8A 1LOFC 4BHPA 1LHVA 4OMDA 3RGBA 1NOVA 4RQPB 1AF9A 3ZKUA 1OLRA 1G7YA 3BTAA 3CU7A 5EJ1B 4XBNA 1WBFA 1V00A 1OF3A 3IPVB 5FMCA 3RZGA 1CIYA 1W8OA 1Y3TA 1RUE1 4XXAA 4XF1A 3OG2A 2XXZA 2W91A 2D40A 4CDWA 5A3PA 5L7OB 2GZWA 5DAPA 2WUHA 4FPOB 3W5NA 1PM7A 3O1PA 1W6MB 1DZRA 3TWIA 4WVWA 2RV9A 3ZXGA 3ABZA 4HL0A 4ZPIA 4CDXA 3ACLA 1R64A 5IK7A 2DV9A 2O8OA 3VDCA 5J48A 3AP9A 1US2A 1NX9A 2WWSA 2D97A 4Y1UA 4Q5OA 3Q9OA 3C7HA 5JSPA 1CR7A 1OC1A 4AQ2A 1OLMA 4MSVA 2CYFA 2AGSA 1X9PA 2QE3A 5A3LA 1J3PA 1ODNA 1A8MA 3JBG2 2VXRA 5FAXA 4Q0SA 1CONA 5FKCA 1XSQA 3PUHA 1EUTA 1XPWA 4G4FA 4FP3A 3RZMA 3EQEA 1W8HA 5DZFA 2ZX2A 4FPHA 1H1AA 1CAUA 3NJZA 4CDUB 5JWPA 4LK6A 2E51A 3OCPA 5JCTA 2BGCA 2Y6LA 2Y64A 1A34A 1UL9A 2RG4A 1NLSA 1W39A 3AJZA 4L8QA 1UW8A 1STMA 1OURA 2JG9C 4IE4A 1B35C 4UFJA 5C3PA 2GU9A 4IEQA 5FCCA 5FZAA 1Y9GA 1X9TA 3K75B 1HXS3 5FZ7A 2V73A 4P9JA 3KV9A 2WS93 3AX4A 3WVJA 1C8M2 3AXDA 1H6YA 1POV3 1ZA7A 4XJAA 1OI6A 2VZ3A 5FZMA 2VMHA 2Y6FA 4XURA 2ZXQA
chains in the Genus database with same CATH topology
1ND2C 2HWE3 2K9ZA 4OFGA 1DZTA 2JENA 2GMPA 1NLRA 2E53A 1EV11 1VAVA 1YNAA 3DKWA 4EWAA 3VBUA 1WMEA 1ASJ3 2PFWA 3RJRA 1NXD1 4R9AA 4U36A 1VP6A 1BBT2 2WLQA 1S0CA 1AYM2 1MQTA 2DVFA 1OA4A 1AJKA 1QY4A 2RHPA 5DDJ3 1ENQA 2XBO3 2SBAA 1OLQA 3PVNA 3LCPA 4MXWB 5E88A 2A3YA 1MEC1 2Z5WA 4IEUA 1G9BA 2GDFA 1MZ6A 5DZEA 3WG4A 4BA6A 1I9RA 4B3NA 1MS4A 1FI2A 2LALA 4CEYA 2D6NA 4LO5B 3ZSMA 3WDWA 2GC1A 3QH7A 2HEWF 2XJRA 3AYEA 4LHKA 4FTBA 1RHI2 3A4UA 4RS5C 5FLJA 3WP3A 4F83A 2W0XA 1COV2 2XJPA 4HSJA 2O1QA 1IKQA 3RMXA 1HQWA 5I8SA 4IEZA 1HW5A 4BCUA 2C9AA 3JD72 4I30A 2XHKA 3ZIWA 3HD8B 3H7JA 3VBOA 1J58A 4KL1A 3EXUA 1ZRDA 4IEPA 4O9EA 4RHV2 4AQ6A 2A6VA 2Q5TA 1RUF3 2R063 4YZ2A 1N3PA 1LU2A 3ILRA 3J8F1 2JG8A 4HSLA 1RUH2 1WLDA 2CGNA 4FOWA 1OFSA 3VBSB 2RS31 1OHFA 1W6PA 3WUCA 1QJY2 3MGUA 2H6CA 2EXIA 1O5UA 5JZGC 5D8AC 4INDA 3AFGA 5HBAA 2X5IA 1ZZCA 1ZZ6A 1QJU1 5BNPA 4M3CE 3L2HA 1RUJ2 3FE5A 1BMV2 2YGMA 4BMEA 4Y24A 1SLIA 1V6OA 3AZZA 1J59A 1QH6A 1DQ4A 2WL1A 5EZWA 5GKAC 1WMDA 3OPZA 1GZWB 5EFUA 1Q5OA 3GHMA 3JZVA 3OYWA 1VBE2 3S0MA 1CPMA 2ZZJA 2DYCA 5T55A 5JSRA 1A78A 3WINE 1FPN2 1UPIA 1CAXA 3IPVA 1UX6A 4UW4A 2ZZQA 1TME1 4FSJA 4QPGB 1ULFA 4GB32 1LOAA 4Q4X2 3WY6A 2TBVA 4N53A 2XKPA 1IPJA 5EXOA 4RSUA 4P9YA 3SMHA 3WHTA 2I2SA 3HAGA 4CDWC 3IIAA 4QQHA 3MFAA 4ES9A 1DQ5A 3NV1A 3TOJA 3WDTA 2EF6A 4Y1ZA 3ZYPA 4FOVA 1D4M3 1ZBE3 1GYKA 5DUUA 4R4XA 5BXXA 4CDXC 2A3XA 2WINB 1V9U2 3VDDB 1VRH3 4AVCA 4PJYA 2FZ2A 3AKRA 5I8TA 2Y0OA 3MPBA 2F6BA 2XLFA 4XILA 2WA4A 1NZCA 3ENRA 4YW3A 3CF6E 3E6DA 5GALA 4E2QA 3FMGA 4YGBA 5FLHA 1HRI2 4GXLA 5J96B 3BALA 1X50A 3VKNA 3PVOA 1PIV2 5KBFA 2R6QA 3THPA 3E6BA 3MW3A 2WZR2 2A3WA 2CAUA 3AZYA 2ZGQA 2A70A 3T1MA 3SHRA 2VVFA 2UY9A 4XF9A 1PGW2 3BB6A 1LESA 5C9AA 1XYPA 1UU4A 3JBG1 3PVBB 4JTNA 3B5LB 2GMEA 2H6BA 5FMOS 3MDPA 3VBUC 4MX3A 2YUEA 1AR91 2ZOEB 4F8AA 1I3HA 3ZFFA 1BXHA 1BK1A 1MQTC 5GLVA 3O0VA 1W6OB 5H9QA 3ZSLA 2MEV1 5EWSA 3B01A 2PHWA 4AI1A 2GC0A 2XUMA 3LWCA 4FPYA 1OA2A 3USUA 2DUPA 1SLAA 1GLHA 3KCYA 1C8M1 3KM5A 1Q8SA 2IFRA 4KNCA 5T52A 2IZWA 4QPIA 1RVF3 2JE7A 3MIDA 4XIOA 3UKVA 4DFSA 3HT1A 2GN7A 3A0NA 2HWB3 2JICA 4XF4A 3ZFEA 4COYA 1WCSA 1QJU3 1BBT1 1S2BA 3BOWA 3VZKA 1AYM1 1SDWA 2HJIA 3A0KA 4I0AA 3ALQA 1TEIA 4NPRA 4ATFA 3MYXA 2ZGTA 3D5OA 2UURA 4EN7B 3IT8A 3VBOC 2PAKA 1JH5A 3D6EA 2D6PA 1ND3B 1OKQA 4YARA 4GH4A 1XYOA 1DQ2A 4IERA 3O5SA 4S2HA 1F31A 2RS11 1HXS2 2WS92 2JG8C 1WD3A 4YRDA 5BYNA 1MVQA 1GICA 1RHI1 1TME3 5FQ0B 3WR0A 4XZPA 1LGBA 1JYIA 3PJYA 2HWE2 3INAA 4XW3A 3ZMNA 4RFT0 4AQTA 4BOWA 3NAPC 1GKBA 2X5IC 2XG3A 3APBA 4ZU7A 2PHUA 1ASJ2 1IS5A 3B9CA 4DRVA 3H3ZA 3I8TA 3KLSA 4KH9A 2ERFA 4R9BA 3M2MA 4XHBA 4XTPA 5DDJ2 1AUYA 2ZHLA 4JGZC 4AVAA 2XBO2 1H4HA 1CAVA 1H8TA 4JGYA 4Z92B 1RUH1 2VW1A 4V1PA 5AVAA 2MNGA 3VKLA 4Y22B 4JV4A 1ENXA 3SH5A 2Q4SA 2O8QA 4ONUA 3WDUA 5L7OC 1O3SA 2GNBA 4AEJA 3ZXLA 1FOD1 1SFYA 5E89A 3ST7A 2VU9A 1V6LA 1I5ZA 2QNKA 3TN93 1BMV1 5C33A 4BLIA 5DG2A 4QQOA 3VDDA 5I0TA 3AYAA 4I3GA 4LR4A 3M7AA 1LHOA 5FREA 4EWEA 1EYBA 2QZ3A 4AFDA 1RUF2 2R062 5FDBA 4MZUA 3M4FA 1VBE1 5LRSA 4ZU4A 1O4ZA 1UD1A 1FPN1 1PO23 2PTMA 2YXSA 4XFIA 5T50A 2FBEA 2PN5A 4GQ7A 1G9FA 4CDUC 2XVLA 1AR93 5J3UA 4D3WA 3EO6A 2IXJA 3H50A 5EV7A 3SISA 4EV0A 1VALA 5C8WA 3U4XA 4K1YA 1OOPB 4LLOA 3WG1A 4YG0A 2ATFA 1N1VA 2FZ1A 3H1YA 1DGRN 4KG0A 4G3YC 2IWGB 2VOXA 1C5HA 4JRLA 1YFXA 4C91A 3UJQA 5K8SA 5A3MA 2ZGSA 4H3WA 2R0HA 1C5IA 3ELNA 3T2TA 1URXA 4CRQA 4HVQA 5FPXA 3OY8B 3NKTA 1S2KA 1MZ5A 2E7TA 4O9GA 4KGGA 4C90A 4RL7A 5AC91 2PHXA 4IEYA 1W6OA 4PLNA 4B8EA 3R05A 1MS0A 3FFQA 4I09A 3DV8A 4GA9A 2RE9A 1KQRA 2ZGUA 4MXVA 4OLLA 4PDWB 1HRI1 3ZFFC 3ZFGB 4BQ1A 4I0WB 2ET7A 2AH2A 4YVWB 2CV6A 2ZGMA 1EPZA 5EYYA 4ISRA 1CAWB 2RS13 2WZR1 2DCYA 3AFKA 3IM0A 5SV5A 3R6SA 2ZKNA 1D4M2 1ZBE2 3VV1A 1V70A 4LBMA 3LOBA 1U12A 1JHNA 2CAVA 1N1TA 1VRH2 2ES3A 1WD4A 3OBTA 1A6CA 2BPA2 1NG0A 1XU1A 4W65A 4YVSA 2AENA 3N7KA 5HI0A 3TB0A 1XNBA 2EALA 2FMYA 3GZUC 4E4SA 5CU1A 3KZ4C 4IEWA 4WVMB 2XWBB 4FTSA 4OUSA 3ILFA 2JG9A 2HKXA 1N47A 3OJBA 1KRIA 3N3HA 5KXCA 5IK4A 1MEC2 1ZZ8A 3USSA 2WNUB 4GH4C 5H9RA 4KU8A 4GIQA 2D5HA 2EXJA 2VULA 4AVSA 4OI2A 3WHUA 5KHKA 2P3JA 2ZBJA 3WP6A 1QH7A 1ND2A 3E5XA 1LOCA 3WCSA 1F9KA 1LODA 4HPKB 4XETA 2GC3A 4K21A 2PHDA 4SLIA 3WCRA 1AR63 4L92A 1FOD3 4OHZA 2VMIA 4AHXA 2A71A 4N7UA 3AXEA 3WW2A 4FQ4A 4FXGB 3V0AB 1MZFA 3OF1A 1G9CA 3B69A 5KHGA 2BVVA 4DRRA 1IOAA 3ZXFA 1G6NA 1AR73 1WW4A 5HCAA 3FHIB 3P3NA 1H8TC 4HVOA 1HXS1 1IS3A 3AP5A 4XQ4A 2WS91 4M3CF 4FAGA 1MS5A 3L9JT 4QPGC 1POV1 1C28A 4Q1PA 3I59A 1R1A1 4PBOA 4GKXA 3SCHA 1RVF2 4WVVA 5KHIA 5JSOA 1GV9A 3MLKA 4ES8A 2P34A 3WQ0A 5JDBA 2HWB2 5GZFA 1O7FA 4HKWA 1J1TA 3MF9A 5JOXA 3RS6A 3UJOA 1ASJ1 4META 4LT5A 1QKQA 1QJU2 3GBFA 1A3KA 1G8WA 1RJ7A 2D43A 2JDZA 3V56A 1RIRA 2A73B 4YG6A 3CJXA 5DDJ1 4ASMB 2GMMA 3KB5A 2XBO1 3MF6A 3VDDC 4QXKA 4KWLA 4HT1T 3GF6A 1D2QA 5I0UA 4KBBA 5A33B 4LLFA 5IK5A 2ZHKA 1NCQB 4RGAA 4JCKA 3M70A 3T1LA 5AC93 5D8AA 1MZEA 1QDCA 4B4QA 4E9KA 1Q43A 3PMEA 3CJIB 2OZJA 1SBDA 1TME2 3JB8A 3B93A 3VBRB 1AX2A 2CY6A 2R073 1QDOA 1DYPA 1FMD3 3HWJA 3MPPG 4N43B 3RPQA 1UF2C 1U0AA 4XFGA 3KS7A 3AMPA 1O4YA 1NA1B 2BNOA 2Z69A 1QJZA 2VUAA 1F8VA 4E2GA 4XHXA 2RJLA 2VY0A 1ULCA 1KJRA 2P37A 4XXPA 4K3UA 4KWKA 3E5UA 5IT6A 2VQ0A 4HANA 1D4VB 1RUF1 1PK6B 2R061 4BYYA 4PQ9A 3PJQA 5JOYA 1W6NA 1CD3G 2PAEA 2ZX4A 1HQLA 2DU1A 4LNVA 2Q0AA 4MUVA 4S2GA 5HCBA 2DTWA 2ZMLA 3N7JA 3ECQA 4ITCA 3X29B 5L36A 3PTYA 4CTEA 4DINB 1JUHA 4FPCA 3VHRA 2XB6C 1N1YA 4IESA 3MIFA 1Q3EA 1YXWA 4LA2A 4CP0A 3V0BB 4Q2FA 3TN92 4COWA 4BM8A 1CESA 2A7AA 1Z0HA 3U11A 4RD7A 1SBFA 1WW5A 3NV2A 4HK8A 3GYDA 1I6XA 2VVEA 2WNVB 4P9GA 5LRRA 1QQP1 2CWSA 4M3CA 4WVMA 4YNIA 2OA2A 1PO22 3FLRA 5B2GB 2XLAA 3NW4A 5J7MA 4FTEA 4YVSC 3MICA 1XE8A 3GBGA 1AR92 2D3PA 4LUMA 1ND3C 2WNUA 2R30A 2NMOA 2GAUA 3WW1A 1R093 4FPEA 3HIFA 2ZS6B 5LK7B 2MEV2 2YDEA 4X6QB 2CGOA 2DTYA 5I0RA 4Y1YA 4YG3A 2JJ6A 1FV2A 2QDNA 1D4M1 4PIXA 1ZBE1 2OUHA 4GWNA 1R1A3 1AYN1 5GZEA 5K0UA 1RUG3 1VRH1 2Z79A 3HQXA 1WGPA 3KCCA 3EHKA 1DIWA 5ABJB 1EAH3 3AKTA 1WA4A 1OQ1A 2E7AA 3ETQA 3PMSA 4FPKA 1DDLA 2XJQA 2RMU3 3RG0A 4MGKE 1UKRA 1VR3A 2WQ4A 2BFUS 5JIAA 3FFZA 4X8PA 4AYUA 3O0WA 1ZVFA 4COUA 3TBDA 3MIGA 1OQDA 4BIOA 3LSEA 2RS12 2WNEA 4XDQA 4AEKA 5GZGA 4XMIA 4QD2A 5T3NA 1X7NA 2DF7A 4QQ2A 1TNFA 2K2SA 4A7YA 3KGLA 3TYJA 4Y20B 4NWWA 2OZ6A 4LBQB 2IXKA 4AEMA 2W52A 4P9XA 4LO7A 2BBVA 4YW5A 2BUKA 1Q8PA 3MIEA 1UAIA 4BIFA 3AMMA 4DS0A 1U5YA 1HDKA 2WC2A 5A33A 1GQGA 1LULA 3I2DA 1UU5A 2LUWA 5J36A 1NCRB 1S0DA 2PHRA 3CO2A 1S0EA 3FLPA 2EAAA 3PVEA 4B29A 2QFEA 2V09A 3JUUA 3PLQA 4Z1VA 1JTZX 4MGIE 1LHUA 1H1MA 4LULA 3VBFA 2VG9A 4SBVA 4B4RA 3SNMA 1O91A 4OHWA 1KD7A 1RVF1 2XH6A 3AKSA 4G9SB 3N36A 1OOPC 1YI9A 2HWB1 5CG9A 4COZA 1YI7A 1OFNA 3NAPA 2RR13 2C1FA 3W59A 4HKLA 4BMBA 1AR62 1FOD2 2UY8A 3H9AA 1DG6A 2TEPA 3GZAA 2WIIB 2QKDA 4JGZA 4UW3A 1PZ9A 3VLBB 2ZAAA 4CEWB 3M3IA 4Z07A 3ZO0B 4W6YA 1AVBA 1YJKA 1ZRCA 1FATA 5A32B 4RQPA 2E6VA 2ZAHA 1V6IA 1QQP3 4W6WA 4X8NA 4PF5A 3KQRA 4K20A 4ZXKA 4PDWC 2XJTA 3KT7A 5L7OA 3RI9A 1SLLA 4WZCA 4YVWC 1W6MA 1C8NA 2D3RA 4IV1B 1CJDA 4BPZA 2EAKA 2P3KA 3PNAA 5GLWA 1GANA 4N90A 2ZGNA 3V65A 2Z42A 2QCSB 1ZBA3 4ASLA 3B94A 5JI7A 1GZ9A 4R9CA 2WA3A 5J09A 2WNVA 5T5LA 5KC5A 2I45A 3UK9A 3WZ1A 1AYN3 3I7DA 4KQ7A 1IZ3A 4OZXA 1LOBA 4Q8LA 4I02A 3VBHB 3WDYA 3WXPA 4CDUA 3R4DB 3VL8A 1VAKA 4IV3B 5AC92 4COVA 2G9FA 2VNGA 4P9LA 2GNDA 3AK0A 1DQ6A 2P2KA 1BJQA 3UKTA 4QGLA 2GH8A 3IDBB 2VOWA 4NWVA 2R072 2WNUC 1FMD2 4EN0A 3UL2A 3S30A 1UKGA 3TN91 4K1ZA 4IEOA 5BNNB 2H0VA 3QH6A 4LHLA 4IEVA 3ZN4A 1ALYA 5F1RA 1IKPA 1YWKA 3BIWE 2R32A 3VGIA 3WG3A 3LA3A 3H1MA 5K0UC 1H2LA 3AB0A 2GALA 5TSWA 4P9IA 1U5ZA 1PO21 1ULDA 3H0OA 3O12A 5I91A 5AFEA 2JKBA 4KG8A 1LR5A 2I07B 2WJSA 4PBPA 3VUOA 3KCXA 4BLJA 4MXWA 4M00A 1LGCA 3L2YA 4MV2A 2JD4A