4UW5A

Human galectin-7 in complex with a galactose based dendron d2-2.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
132
structure length
132
Chain Sequence
b'PHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN GALECTIN-7
publication title Structural Basis of Multivalent Galactose-Based Dendrimer Recognition by Human Galectin-7.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 30
structure length 132
sequence length 132
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4uw5A00
5DG1A 1AXKA 2EXHA 2VH9A 3ZXLA 4AVVA 3UJOA 1LTEA 2UWCA 1VALA 3BIWE 1IKQA 3LSEA 4PQ9A 5T5LA 4JCKA 2V73A 4SLIA 2NYYA 2PHTA 1AX1A 4Y24A 1LHOA 4HANA 1S0BA 4M01A 3WNXA 4OZXA 1V6JA 1OKQA 4AVTA 1GNHA 2CTVA 1WW7A 1N1YA 5JOYA 1UKGA 4WVWA 1AXYA 1KITA 1QF3A 2GMPA 3BODA 4Y1ZA 1CPMA 5DZGA 5EWSA 4M00A 3AXDA 2EIGA 4ATEA 1GZWB 2UURA 2NP0A 2A71A 2GNBA 3AZZA 4YM0A 1SACA 1YXWA 1ENSA 2CY6A 3SNMA 4K1YA 4PCRA 3IKWA 4BMBA 4JRAA 1DBNA 2YY1A 3OYWB 5DUUA 2OVUA 4YM2A 3SH3A 5T50A 2ZHMA 4BLJA 4GKYA 2AENA 1DQ4A 4FPLA 4YZ5A 1S0JA 1R1ZA 1RITA 1JBCA 2D6MA 1JOJA 2SLIA 3FUOA 3VKMA 1D2SA 2KM2A 1BJQA 4ZXKA 1UN1A 3AYDA 4Y20B 2GMEA 4KBBA 4CZSA 2P3JA 1CESA 1FYUA 2D3RA 1CONA 2A3XA 4M3CF 1LOBA 1QOTA 4XXPA 4WZFA 2ZGRA 4GWMA 1BXHA 2ES3A 4GKXA 2W39A 1V6IA 2JKBA 3MW3A 4LBQB 1WW4A 1LU1A 1SBFA 3ZXEA 1C57A 1S1AA 3VKLA 1MS4A 2OW4A 1BZWA 1GV9A 2DU1A 1H30A 1LOCA 2GMMA 3WHTA 3HMYA 1MS3A 2DVDA 1YYNA 2UU8A 1AJOA 3M1HA 2ZGOA 3WUCA 2C9AA 3ZYRA 1GZCA 1KDMA 1CPNA 3B3QE 4GWNA 2A5ZA 3M3OA 3N7LA 4DFSA 3VKNA 4FPKA 3RRDA 1AX2A 5DZEA 1GYKA 1V6MA 3NV4A 3WDYA 1YRZA 5JOXA 5JLVA 3M3CA 1BKZA 1CQ9A 2Q5TA 4TYSA 4YG3A 3TB0A 2P37A 3AZWA 1LEDA 3I4IA 2WQZC 1Q8SA 1W6OA 2EF6A 2JJ6A 3ZSLA 4UW4A 3AJYA 3IN9A 3PVNA 1FATA 1LEMA 4XJAA 1EPWA 3DUIA 1WD4A 2ZGPA 2ZHLA 5GLVA 4P14A 1W0PA 3PJQA 4XBLA 5AVAA 5T54A 4FQ4A 3WG3A 5KXBA 1QGLA 1SFYA 3D5OA 2A6YA 1G8WA 4BQ1A 4FPCA 3WG1A 5F5QA 2UWBA 4UW3A 2JD4A 1IKPA 3U4XA 3FLTA 3D4KA 1A3KA 2A6XA 4FOYA 4XIOA 1V6KA 1APNA 1W6QB 3V64A 2ZAAA 2EALA 3OBRA 4Y22B 4FPEA 3WCRA 3HN1A 2R49A 1V00A 2D43A 2VW0A 3IM0A 3OGGA 1QU0A 1N1TA 4YZ4A 2DU0A 4DPNA 2E53A 2SBAA 5GLUA 4MYEA 2ZGMA 3UK9A 4FPJA 1LHNA 1JYCA 2D3PA 4Y22A 1A8DA 4YM3A 1IOAA 1V6LA 2GDFA 1CR7A 1LHUA 4CTEA 3TAYA 2P34A 3OPZA 3KQRA 2DVAA 2YV8A 5GZGA 2PHUA 1ULEA 1BQPA 2YXSA 3JU9A 4Q1PA 1PZ9A 4U2AA 4Y1YA 1CIWA 1LODA 1AF9A 1FAYA 4XBQA 4YG0A 2P3KA 5FRAA 1I1EA 3PVOA 3O0XA 4K20A 4YW1A 3ATGA 4R9DA 3POWA 1GZ9A 2PHXA 1DLLA 4ITCA 5KXDA 5IK4A 1GANA 1LOEA 4M3CE 1OFSA 2OUHA 3WG4A 2WJSA 4LBNA 5CA6A 4LBOA 1SLAA 5JMCA 2ZMLA 2V5YA 4JC1A 1KJLA 1SLBA 2C5DA 5GZFA 3SH4A 1JW6A 2WT2A 2W52A 1GBGA 3WDUA 3GALA 2I2SA 4RL7A 3WZ1A 3AX4A 4Y1UA 4XJWA 1MZ6A 4FPHA 1S0DA 2GN3A 1WLDA 3OJBA 1N3PA 4XJZA 5JOZA 1G9FA 2WKKA 4ATFA 3R4UA 2A7AA 4XYXA 3ZXJA 2BQPA 3SITA 1GSLA 3T1MA 1BYHA 2GNDA 1QKQA 3T1LA 1IS5A 4BLIA 1QDCA 2JECA 3LCPA 4AGVA 4XMIA 3WLUA 1D0HA 4Y1VA 2DTWA 4XJ9A 4YLZA 2G4IA 4PBPA 3H0OA 5H9RA 4WVVA 4LBQD 3JUUA 5CNAA 1Q8VA 4AGRA 1RIRA 4DRVA 1GZWA 5CBLA 4ISQA 1DGLA 3FUQA 4XZPA 5LK5A 1FNZA 1JN2P 3ZXKA 2DWRA 4YW2A 1Q8PA 2LTNA 4LBMA 1ULCA 3OYWA 3Q9OA 1IS4A 2CWSA 2CWMA 3HR9A 4GALA 5H9QA 3W59A 3O0WA 3QCWA 1UL9A 1JUIA 1N47A 2ARXA 2FHRA 1WBLA 4LBJA 2PHWA 2D3SA 2ZGTA 3ZSMA 3FBYA 1MS0A 3RS6A 1FV2A 2WSUA 1KDKA 2EXKA 2ZMKA 3ZYPA 5IK8A 4Y20A 5HCFA 1CJPA 2VUAA 2GN7A 1VLNA 3INAA 2HYKA 4XTPA 2A6VA 1F9KA 2EAKA 3QLQA 3PMEA 3SH5A 3VUOA 3WDWA 1QNWA 1O4ZA 4R9BA 4LBQA 2YZ4A 1IS3A 3OBTA 4IQPA 3N3HA 3OY8B 1MR5A 4BM8A 1F5FA 1LU2A 1I3HA 1Q8OA 2PELA 4FQZA 5T5OA 1IS6A 2ZGUA 2XB6C 3ZPYA 4XTMA 1GLHA 4XHBA 5EYYA 1N3OA 3FLRA 3O12A 4PBOA 2AGSA 1LHVA 2DVBA 3I8TA 2P2KA 5CAZA 1MVEA 4FPFA 2TEPA 5HCBA 4FOVA 4AWDA 5IUQA 3WOGA 4R9CA 1HKDA 2XG3A 3ZSKA 1G7YA 3UL2A 3AZYA 2Z42A 2ZHNA 4YW4A 1S0IA 3M3QA 5DUVA 1H9WA 1GICA 1AXZA 2CL2A 4XJUA 3RMYA 1H9PA 2WT0A 2ZHKA 2ZMNA 1F31A 3IMNA 1GNZA 4XOGA 1S0FA 2NMOA 3A4UA 3LSDA 5GLZA 3T2TA 3MEPA 3N35A 1DQ5A 2WNEA 2GALA 4NO4A 5JDBA 1MS8A 5HCAA 1MS1A 4FOQA 1FV3A 1O4YA 5GZCA 4M3CB 2H0BA 5E8AA 4P9WA 1MZ5A 2ZGKA 3A0NA 4H55A 1SLIA 1URXA 5SV8A 4NOTA 1ENRA 1RINA 1VAVA 3AP9A 3AYAA 1CN1A 5GM0A 1W6QA 2AYHA 1UAIA 4YW5A 3SLIA 2DUOA 5GLWA 5IK7A 1LULA 1YIFA 4M3CA 2A75A 4XMAA 2D6KA 4L8QA 2E7TA 2WLQA 3MW4A 1HQLA 5DUXA 4D69A 2JE9A 3APBA 1ONAA 5DZFA 1J1TA 2WT1A 5GLTA 2WSVA 2OUJA 1SBEA 1HLCA 2B7YA 3AK0A 1LGNA 1C4RA 2ZGSA 1QDOA 1DFQA 1FNYA 2ARBA 2ZZJA 5IT6A 4XJ8A 2EXIA 4XBNA 1WW5A 4DQAA 4FPOB 1WW6A 2DUPA 2VW1A 4LBKA 4P9YA 4ASMB 5KXEA 1OQ1A 1ULFA 4FVVA 1QOOA 1W6MB 2DURA 1LHWA 1VIWB 3R4SA 4C1WA 1N1VA 4Q8LA 3ZSJA 5GZDA 3DGTA 1MACA 1DYPA 1ULGA 1HQWA 5DG2A 3O0VA 1LESA 1DQ2A 2JE7A 3NV1A 4XHXA 4HL0A 3V65A 2A6ZA 3WDVA 1LCLA 1NLSA 4ZKTB 1W6MA 1W6NB 2R1BA 2AUYA 3FLPA 2FMDA 3ENRA 4BPZA 1VAMA 2DYCA 1C1FA 3WDXA 4K1ZA 3NWKA 4Y26A 3AP7A 4YGDA 1KRIA 1JHNA 2DUQA 4Q26A 4YGBA 5T5JA 2AH2A 3V0BB 1AJKA 5DUWA 1DZQA 1Z78A 1QOSA 3MPPG 4GA9A 5L73A 5JVVA 1W6NA 2PHFA 2AR6A 2NMNA 5E88A 3UJQA 2ZACA 3AZVA 4DRRA 1UZZA 3N7KA 2NZ9A 4UW6A 2R16A 4YZ3A 4Q2FA 1LOAA 1WBFA 3PVEA 4YFWA 1WCSA 2DV9A 3V0BA 4BMEA 1UPSA 1UMZA 2ZKNA 3B9CA 4AVSA 3O5SA 1NXD1 1KJRA 2A6WA 2DVFA 5T55A 1G86A 4W65A 3D6EA 3ILFA 3R05A 2ENRA 2NN8A 2W08A 1N3QA 2CYFA 2VU9A 4YZ1A 1TEIA 4Y1XA 4YGEA 1SCRA 2D6PA 1MVQA 3VKOA 4WV8A 1G9BA 1LECA 4Z8BA 1G9CA 1PZ7A 3AP4A 2JDZA 1DQ1A 2D6OX 1AX0A 1XQNA 3ASIA 3B01A 1S0GA 4BOWA 2RHPA 3POSA 1MS9A 3BTAA 3AP6A 3WVJA 4K21A 3FFZA 1SLTA 3IPVB 1WLCA 4GXLA 3B00A 1YO8A 3ILRA 2D6LX 3CNAA 3V0AB 4F83A 1W0OA 2A70A 2AREA 5DXDA 1U0AA 2ZA9A 3M3EA 1GKBA 4XE9A 4Q8KA 1V6NA 1V6OA 2NM1A 2GNMA 4DS0A 1SLCA 5IK5A 5T52A 2ZGQA 1C1LA 3MW2A 4U36A 4XXAA 3RG0A 3RMXA 3ZVXA 3IPVA 1X50A 3POYA 1KQRA 3OY8A 2PHRA 3C2UA 1UX6A 2ZGLA 4Q1RA 1W6PB 1SBDA 4YG6A 1ENQA 3V0AA 2ZGNA 1ULDA 3AZXA 5CB7A 1LOFA 1MS5A 2LALA 1A78A 2CNAA 3A0KA 4XIKA 3SISA 3ZXFA 5H9SA 3AYEA 4YZ2A 2VW2A 4ISRA 1W6OB 2DVGA 3BOPA 1YI7A 4YM1A 3WV6A 1CVNA 4UW5A 1W6PA 1Q56A 3M2MA 1B09A 1Z0HA 2VY0A 2A3WA 1SCSA 2DTYA 1WLWA 5JOWA 3RSJA 3N7MA 1DQ6A 4Q27A 3NV2A 2ZABA 3W58A 3WHUA 3AP5A 5F9TA 3AXEA 1DYKA 1Y7BA 5FREA 1DIWA 4P9XA 3L2YA 1WD3A 5T5PA 3KM5A 1DHKB 4XDQA 5E89A 2A3YA 4YGCA 4FPYA 2E6VA 2W68A 5BYNA 3RQ0A 4XILA 1LGBA 2D6NA 2R1DA 5GJ6A 1QNYA 1G9DA 1PZ8A 1LENA 4AGGA 1LOFC 1ZA4A 5H9PA 1Q8QA 1LOGA 1S0EA 2P3IA 3VV1A 3ILNA 1JXNA 3WUDA 3VKFC 3USUB 2E7QA 1HDKA 2YMZA 2ZBJA 5KXCA 1G9AA 5EXOA 3NV3A 1WUVA 4TZDA 5GZEA 1ZM1A 2GNTA 1UZYA 2EXJA 3WG2A 1LGCA 2ERFA 4R9AA 3WCSA 3AJZA 1FX5A 3USUA 1LJ7A 2YROA 3AFKA 4I30A 2UWAA 4FP2A 4LBLA 3AYCA 4PF5A 5EYXA 5GALA 4CRQA 1AVBA 1JYIA 1SLLA 1DQ0A 1AZDA 3GNEA 4AYUA 4YFZA 1S0CA 2D44A 3WDTA 4YW3A 3N7JA 2VXRA 4FP3A 4FPGA 1QMJA 2R0HA 2R0FA 4FOWA 3B69A 2E51A 4C1XA 4RA0A 2D7FA 1N1SA 3N36A
chains in the Genus database with same CATH superfamily
1AXKA 5C4WB 5FPXA 2QZ3A 5FUPA 4GMP0 4AVVA 3UJOA 2QTWB 5FP9A 3NAPC 1TVGA 3LSEA 3O1VA 1YQCA 2LROA 2WYFA 4PLMA 1BMV1 5T5LA 1WMEA 3MHZA 4AG4A 2ZCWA 2V73A 2WZR3 3FFQA 3WNXA 3I59B 4Y24A 1DG6A 4M01A 3WNMA 3ZO0B 4OZXA 2IXHA 3J7HA 3GBFA 4IEWA 4AEDC 5F37A 5IVVA 5JOYA 2BUKA 1AXYA 1QF3A 2JE8A 4WVWA 3OCPA 5DZGA 3RS6A 3WF2A 5EWSA 3WNPA 4BQ5A 2PFWA 4ATEA 1GZWB 2RVAA 2GNBA 3AZZA 2B39A 5L7OA 2KD7A 1OOPA 3D82A 1MQTB 1O6UA 1RUH1 3WP5A 1Z7S2 2Y64A 4CP1A 1W8ZA 2GZWA 2A73B 4BMBA 3VBHB 1POV3 5IATA 3LIGA 5DUUA 5BNOC 5JMOA 2R061 4QQLA 2OVUA 3VBRC 4LJHA 4Y5Z0 1AR62 5ANQA 5KC6A 1FI2A 3G7DA 4BLJA 2AENA 1DQ4A 2VD7A 2QDRA 1R1ZA 3W20A 1JBCA 1HXS1 3VBSC 1KGYA 4LXLA 3VKMA 1D2SA 2HWF3 2KM2A 5FLIA 1GMMA 4Y20B 5JR7B 4AI1A 4LOTA 2P3JA 4MHRA 4PQQA 4BDVB 1MEC3 4IV1C 1JZ3A 5B4NA 2ZGRA 4CDUC 3ES4A 4GKXA 2W39A 3VHPA 4MGYE 1VBD3 1F15A 3BKZA 3B5LB 1REFA 3VKLA 1MS4A 3PU8A 4NPRA 2K46A 5D21A 1H30A 4ZONA 4CP2A 3WHTA 3DYMA 3HMYA 1HX6A 5M0TA 3D3AA 5C71A 4I0AA 5BNQA 2HLEA 2W9XA 5F5CA 4D6SA 1MEC2 4LULA 2XBO1 5L9VA 2UYAA 2RR12 1XU2A 1MQTC 1KDMA 4NRPA 1VBD2 5FAXA 2QCSB 1SFPA 1TE1B 4IEPA 4KWUA 3VBHC 4Q4V2 2MHFA 5C8CC 1GYKA 1V6MA 4DXRA 2WAOA 5JOXA 4DEVA 4NVPA 4C90A 3KVAA 4PIZA 1AYM1 3U0ZA 1K45A 3AZWA 2VG9A 3I4IA 2RMU2 2WQZC 1COV2 1UU4A 2IXCA 4COWA 2WQ4A 2ZEYA 1YFWA 3EHKA 4OI1A 4RFT0 1SDDB 4FFGA 4QHZA 3IDAA 4CCCA 1GQGA 4DMIA 1ALYA 5AVAA 4GH4B 1WZXA 4BQ1A 3LDKA 4FBFA 3BU0A 1QH7A 2XKOA 3K51A 4FPCA 5F5QA 3T08A 1R64A 4UFHA 4ET7A 1IKPA 1WGPA 5HI0A 1XXNA 4XIOA 1APNA 5F3EA 5EJ3A 1QIQA 3I54A 2QQMA 1HRV2 3HN1A 3Q8FA 4FPEA 5E6HA 4KL1A 2OYZA 3ZIXA 3TN92 1FOD3 2JENA 3OPWA 1N1TA 3PJYA 2DU0A 4RFRB 5C3QA 1UX7A 2E53A 3NAPA 1T2XA 4MYEA 1AHSA 3FMGA 4TLFA 2XL9A 3WNNA 1V0AA 2YYOA 2V72A 4YM3A 2FBEA 5A7SA 3B7MA 3T0AA 1CAUA 3VHOA 5EP9A 2P34A 4AEDA 2ORZA 1ZRCA 4IE4A 2YV8A 1VBA3 2VGDA 2ZTNA 5GZGA 1ZNPA 1VAKA 1ZZ8A 3AL6A 5L9BA 4C0BA 4Q1PA 4BYYA 1A6CA 1TME2 5J1XA 1CIWA 3KT1A 1AF9A 4XBQA 3I2KA 3ZR6A 1RB8G 4RGGA 4LORA 5A6ZA 2WA3A 1K5MA 2WFF2 4YG0A 4NIGA 4GH4C 5I8SA 5FMOL 2BGPA 3ATGA 4R9DA 2PHXA 5BNOA 1YFYA 4ITCA 5KXDA 3KSCA 3VBRA 1IPJA 1XSQA 3H3LA 3ZYJB 1OFSA 5IK4A 5BYNA 1VBA2 1PGW1 2E26A 4LBOA 2ZMLA 4NHXA 1RUG2 1XNAA 5FKBA 2RJKA 4JC1A 4CDWC 4D3WA 4DNYA 4E27A 1BEV2 1BBT3 1UYXA 2VMIA 2W47A 3KHBA 5FZMA 4QKDA 5GZFA 3VBSA 4XQDA 1OA3A 3PUQA 1ASJ1 3TOJA 3GALA 2I2SA 1F4HA 2FZ2A 1PX4A 4XJWA 2WWJA 4QT6A 5JCTA 1S0DA 2GN3A 3KCCA 3OJBA 3N9OA 4IV1A 4XJZA 4X8PA 4ATFA 3OBAA 4CDUA 3I2FA 5EZWA 3OF1A 5F6KA 3VGIA 2LM3A 3SITA 1GSLA 2IVJA 3I59A 1NE4A 2MEV1 4I09A 3BB6A 3LGRA 2WZPP 1BBT2 4LHNA 2WL1A 4D6QA 3LCPA 4MO3M 3MIDA 2HWD1 4IGQA 3WLUA 4Y1VA 2DTWA 4YLZA 4KGGA 2D93A 1MZEA 1PVC1 3MV11 4GQ7A 1PO21 3CMGA 2YC2A 1O91A 2BNNA 2XR4A 1NQJA 1GZWA 2JDYA 4CCDA 4ZZ5A 3LEMA 4MZUA 3D0JA 4G4FA 4L11A 5HXVA 1AYN3 1MQTA 2DWRA 1LR5A 4YW2A 3T4HB 4ASLA 4BQYA 5JI7A 4LBMA 2XLFA 3VBUB 4DIQA 2HKXA 5C8CA 1UZWA 2CWMA 3LA2A 3RDIA 1QJFA 5A7NA 1JUIA 3M7AA 4IEYA 4LE4A 4NPMA 1AR72 1AL0G 4IGOA 2BOIA 3JCIA 5CZKA 2ZGTA 2YB7A 4B1LA 1JZ2A 1XYNA 3HNMA 1H0BA 1MS0A 4B3NA 2ZEWA 1JZ7A 4Y20A 4CP0A 3W21A 2VOXA 1ZA7A 4FO9A 1EP0A 4QM8A 1X7NA 2Q8OA 2EAKA 4CXXA 3PMEA 4MV2A 1D2QA 5A3TA 3WDWA 4E9KA 4FTEA 4NR1A 3VB9A 2VECA 3K75B 3KZ4C 1IS3A 4AEMA 3S7EA 3FJSA 2WNUC 1ZRDA 5LZ6A 1LU2A 3NNLA 5FXWA 2Y0OA 1IS6A 2ZGUA 2XB6C 1FMD1 5J37A 1CX4A 4B29A 1QJX2 3NW4A 4XTMA 2G19A 2BBVA 2WDBA 4QDRA 2AGSA 1LHVA 3LKJA 1MVEA 4IEOA 2AEYA 2G9ZA 2JB8A 3IMMA 4YWAA 2R041 2FCTA 1V9U3 3EXUA 3FBMA 3HNBM 3LPGA 2XG3A 5K0UB 4JHZA 3WW4A 1W8OA 1AL22 2B45X 2ZHNA 3VZMA 3THPA 4MH0E 5FYCA 1AXZA 3OGJA 1K12A 1TG7A 3QACA 4CYDA 4QB1A 5LA9A 1UF2C 5KWRA 2AZ5A 2WS91 2WZR1 3IMNA 3NNJA 5CKMA 3LSDA 3OGVA 1EAH3 1U12A 1WMXA 3LB9A 3N35A 1V70A 3JXSA 2W95A 2TNFA 4RR3B 2WNEA 1B35C 1PIV3 1U5XA 1UU6A 3KV6A 3USSA 4QX2A 2GSYA 2WINB 3FL7A 4GH4A 1PNGA 5E8AA 4B7KA 4QAWA 5EQUA 4H55A 1NOVA 1W90A 3FWEA 2IFRA 2RS11 4HT1T 1EAH2 1VB2A 3PMSA 4CDWA 5A3LA 2E63A 4ARXA 2PAKA 3C8XA 2A75A 3J7LA 4K8RB 2D6KA 4MSVA 2F4LA 1H4HA 2VQAA 3MW4A 5DUXA 1ZZ9A 4XW3A 1OVSA 5DAVA 3ALQA 5LBCA 4LEJA 5K0UC 2HWF1 2ID4A 2R073 3BPZA 5KBFA 1O3SA 5IYYA 2WT1A 4IXLA 5LATA 1W04A 1HRI2 4F7ZA 4R4XA 1LAJA 4D7SA 4JGYB 2OUJA 3P6BA 2YGMA 3AK0A 1LGNA 3N9LA 1FT9A 2ZGSA 4N9HA 4ZS3A 2ZZJA 3VBOC 4PIXA 3ZMOA 1RJ7A 2KA3A 3PUHA 1YNAA 3OEBA 4LA3A 3OTFA 4IE0A 4CSWA 1QOOA 3R4SA 1NY71 4C1WA 1US2A 1S4CA 4JAAA 4OLLA 3E5UA 5GZDA 3H8OA 3QOPA 1MACA 2VMFA 1Q3EA 4HKOA 1VR3A 4LIVA 1UOBA 5DG2A 3O0VA 5I0UA 4XETA 3WX5A 1OURA 1CZTA 3CEWA 1NCRC 2FDIA 3WW1A 1IPSA 4MADA 2ZKLA 2A6ZA 4AOCA 2JX9A 3RZMA 1LCLA 2B8MA 5DPNA 4ZKTB 1W6NB 1BHGA 2DDUA 2DYCA 4PIYA 4UFKA 4Q4W1 3BALA 1PNFA 3AP7A 5BUVA 3J8F3 3CJIC 2WIIB 2F17A 4AXOA 2HWE3 3ZXAC 3LFMA 3VHNA 3KGLA 2OT7A 3RYRA 4IE7A 2XWBB 4J1XA 3GYDA 4J1WA 3MPPG 4QPGB 3VD3A 4DINB 5JVVA 2PHFA 4AFDA 2AR6A 2NMNA 2Y8KA 1UKRA 2J22A 3LE0A 5EFUA 5FV3A 5FYHA 1EV13 3NO8A 4DRRA 1RUE1 2W92A 3IWZA 4YZ3A 2NZ9A 2WNUA 4JGYC 1QQP3 4Q2FA 4PF1A 2RDNA 3ACHA 4ZU5A 5FY4A 1CWPA 2B9UA 3V0BA 4RGAA 1UMZA 2ZKNA 5FZBA 4AVSA 5FPUA 1KJRA 3MV01 4R8HA 4QXKA 4W65A 4DOUA 4GB32 1RMU2 3ILFA 5DAQA 2ENRA 4ONUA 1H8TB 1TEIA 3HAGA 3O14A 4CDXC 2IXJA 1T6BX 4V1PA 1W2AX 1FOD1 3AP4A 1DQ1A 1XQNA 2XVLA 1HB1A 2VBBA 3B01A 3NSTA 3T4VA 4I0WB 4DUXA 3NJZA 4K8FA 3ZXGA 1O3RA 4P00B 5BNPB 4DXTA 2W1WA 3H7JA 5FZFA 1UO9A 2IXKA 4QX1A 3BGAA 3FFZA 3B02A 3IPVB 3FHQA 4BZ4A 1H8VA 3FC0A 1HW5A 5JXGA 1W8WA 1B35A 1XYPA 4F83A 4S2DA 2AREA 2ZEXA 1V6NA 1ZVFA 2NM1A 5IK5A 3H3ZA 1GZTA 5JXHA 3VDCA 3OUHA 3T2PA 1SPPB 4DEQA 1C8M1 1H2LA 1UX6A 4YG6A 3V0AA 2ZGNA 4EWDA 1ZYBA 4HKLA 4L2NA 4QGNA 4CXWA 1MS5A 4AFCA 5LWBA 4QPIB 1X9TA 3MIBA 5IVEA 2BNOA 3ZN4A 4M0NA 4ISRA 1J3QA 2DVGA 3HOBA 1H8TC 1YI7A 4Q0SA 3WV6A 1CVNA 1W06A 2YBSA 1ZREA 1BMV2 1Q56A 4CU9A 5K0UA 1YQ8A 3ROUA 2VNRA 3WW2A 3TWIA 2R32A 2BZDA 1W3XA 1W9WA 4Q5OA 1WLWA 4QQ2A 5JOWA 3RSJA 3N7MA 5FUNA 2P6HA 4UF0B 5BNPC 2R063 5CISA 3W58A 5ABJB 1DYKA 1VRH1 2G1MA 3VBOA 1UIJA 3OG2A 4HN1A 3AKPA 5E89A 4YGCA 1TNRA 1ZX5A 3K4ZA 4Q0PA 3AVRA 1LGBA 2XKPA 4LUMA 1RUH2 4L97A 1G9DA 1PZ8A 4QPWA 3VDDB 1Q8QA 4A2UA 1ODMA 1LOGA 5C6CA 1JYWA 3U4SA 3MIFA 4Z2AA 4FI9A 1XSRA 1AYN1 1NCRA 3ILNA 5J36A 3M4FA 5F39A 3VKFC 1OVPA 3USUB 4CA9A 1HDKA 5DN2A 3GDBA 3DPRB 3NV3A 1WUVA 1ZM1A 1HXS2 2GNTA 4QKFA 5A6QA 2EXJA 3CLPA 4XC9A 4QPIC 3IB3A 1LGCA 1GWKA 3CJIA 1RUI3 3OPTA 1GUIA 4MUVA 3WCSA 4NIHA 3EQEA 4BWOA 3RNSA 3LEGA 2VQUA 4QMAA 2I74A 4JGZB 4ES9A 5LCWL 4XABA 3THCA 2ADDA 1F2NA 4PF5A 5EYXA 1RUNA 4CCLA 2BPA2 5GALA 2RM21 3TNQA 1VBB3 1VP6A 4JGYA 4AI3A 5I8TA 4DUWA 2CGOA 4D94A 5ABJC 4CCMA 3WDTA 1AYM3 1ZRFA 2ZX2A 3MLJA 1VMJA 1IZ3A 2WNVB 1EPZA 1TNFA 3HN3A 1UQXA 2XBO2 4HN0A 4RA0A 4HZFA 1Y9QA 2D7FA 2PAMA 2VTXJ 4L92A 1N1SA 5FJKA 1XNTA 2X8KA 3VDDC 3CKHA 1W9FA 4W6XA 1JUHA 5IAVA 4CDXA 2UWCA 1NKGA 3BIWE 4KWJA 1IKQA 3H42B 1ND2C 2C9KA 1W99A 2QKDA 4BA6A 3NJXA 1IG3A 1FPN1 3AVSA 1AYM2 4SLIA 3B9IA 3RJ2X 3S6PA 1OXCA 5L7OB 2EVXA 2Z79A 3DPRC 4HANA 4MX3A 1OOPB 5CG9A 3AKQA 1C5IA 1OKQA 3TYJA 4RS5B 5KHIA 2CTVA 4BQWA 4HBNA 2YC0A 4AE2A 1N1YA 1UKGA 4Y1ZA 3F2ZA 1Q43A 2PLV1 1CPMA 2JDHA 4N7UA 2PQSA 2YDEA 2MPFA 2UURA 4JGZC 4OI4A 4N90A 1W8TA 2NP0A 2J1UA 1YXWA 1YIPA 2CY6A 3GBWA 2E31A 4Z82A 4PCRA 2R30A 5FZ9A 3E6CC 4QB6A 1VB4A 4CCNA 2YY1A 3OYWB 2JG8B 3WQ7A 2BFUS 2XJUA 4YM2A 5A7OA 5K4LA 4UFIA 1GU3A 4GKYA 2WNVC 4YZ5A 1ND3C 1S0JA 4GJZA 4XCBA 1RGSA 2IXLA 5F7UA 2FDKA 5FP3A 1H8TA 2X09A 1E57A 3ZYBA 2HBUA 1W9SA 1IGOA 1MZFA 4E4SA 3AYDA 4COVA 2GMEA 3ZIWA 3Q8BA 1CESA 4M3CF 4NAOA 4HONA 1LOBA 3MLLA 4XXPA 5DABA 4Q4Y1 1GR3A 1ZRIA 4IEUA 4QDSA 1JZ6A 1V6IA 1PHMA 1L7QA 5HPOA 1KS5A 4LBQB 5BNPA 3ZXEA 3E6BA 3O1OA 4RS5C 4JX0A 1KD7A 2OW4A 4N43C 1BZWA 1W28A 4S2GA 1GV9A 2DU1A 2GMMA 2XQXA 3ZLIA 3RPQA 1PGSA 4UAPA 2VR4A 1YYNA 3J26N 2RDRA 4TLGA 3SQOA 1ASJ3 3AMNA 3ZYRA 1GZCA 1YI9A 1CPNA 4GWNA 3ZXDA 4DFSA 3AKRA 1VMFA 1NE6A 4B7EA 1RC6A 5DZEA 2VMCA 3E97A 2JG8C 1PGW2 3N9QA 1YRZA 5FWJA 4HKWA 1CX1A 2VQTA 2MEV3 2Q5TA 4TYSA 1LNSA 4YG3A 3WF0A 2HWD3 4LKDA 5F2WA 4Q29A 2P37A 4QPIA 3NKTA 3AC0A 5A6XA 1AR83 1PO23 1PGL1 2YU2A 4FAHA 3IN9A 3K46A 3PVNA 5I0RA 3KCYA 2XVGA 3DUIA 3J8F1 2ZGPA 3U75A 2HWE1 4AHZA 3WG3A 4A4AA 2P17A 4FQ4A 5T54A 1JTZX 3MIHA 2WO1A 3CDZB 4QQHA 4ZHNA 2A6YA 3T30A 2HWD2 5ABJA 2QQNA 4UW3A 3D0SA 2XVKA 1PVC2 3NAPB 3D4KA 1A3KA 5FY7A 3KB5A 4LKFA 1OUXA 3H7YA 1OD5A 4FTSA 2BW8A 1RUD3 4MGQA 4HETA 3WCRA 5IVFA 2R49A 2X29A 3DKQA 4MGIE 4IDZA 1CAUB 3VDDA 5JR2A 3KVBA 4YZ4A 4AEDB 4DPNA 3HWJA 4MG2A 1ND2A 2SBAA 4JDOA 1AUYA 5I0TA 4FPJA 3VL8A 2VL4A 2D3PA 4UYBA 1A8DA 3DPRA 1IOAA 1UY0A 2GC1A 3POIA 1LHUA 4CTEA 1K5MB 1ZZBA 3C7HA 3MBWA 3VZKA 1OC1A 2GP3A 3KQRA 1W39A 1FMD3 4UI9L 3PUIA 4LLOA 3MYXA 4FXKB 1SZBA 1BQPA 3VBRB 4AEKA 4JGZA 4XUOA 1FAYA 4HLTA 2JKXA 1OFNA 2R043 2YFZA 3OB8A 5DAXA 5FRAA 1VBC3 4CP9B 3PVOA 3VBSB 5BNNC 1I1EA 3BTXA 2VZTA 5DAWA 1UOJA 2X53S 1DLLA 4X6QB 2PQQA 4M3CE 4HFSA 5CA6A 1VJ2A 4IV1B 3GBGA 2W87A 2WNVA 4BK4A 4CDUB 1GP5A 1ND3A 2TBVA 1XYOA 3H1YA 2WS93 4C0HA 1SLBA 3H50A 2XLGA 1UXZA 1JW6A 2O8OA 1O3TA 1XNBA 2WT2A 4XUPA 4YVWC 4QHOA 2TUNA 1U5ZA 3WDUA 2BJSA 3MFCA 2J1TA 1MZ6A 4EN9B 3TEWA 2X5IC 5JOZA 5JSOA 3I3BA 4UXAA 2LW8A 3R4UA 4LK7A 2BQPA 4XACA 3T1MA 1BYHA 2GNDA 2WZR2 2WS92 5FZHA 1K5MC 1IS5A 4JZRA 3IAQA 4N43A 4RS5A 2RS13 2VOTA 3OSDA 4QXBA 5C8CB 2DCKA 4FTBA 1LKNA 3ES1A 3HPNA 3JUUA 4LBQD 4DRVA 1OA4A 1RIRA 4QX5A 4I2OA 5CBLA 4ISQA 4QKNA 3O1MA 4CCKA 4CU6A 4IEZA 1Q8PA 1DLCA 3JZVA 1UPIA 3T0DA 3OYWA 1SHWB 2JG8A 2CWSA 1CJDA 2RS12 3B94A 5HBAA 3O0WA 2EA7A 1WLTA 2VZVA 3UGHA 1YEWA 5FR3A 5LA0A 3P3NA 5CFCB 2X10A 2ARXA 1WBLA 4LBJA 5L36A 3NNFA 4RHV3 3ZSMA 2KXLA 5LEJA 2WSUA 3ZYPA 4P9LA 2HWF2 1CJPA 4A42A 3HBZA 3WP3A 4A6SA 3INAA 4K7JA 1RUI1 1SMVA 4NRQA 1XE7A 1BCXA 4MGSA 3IT8A 5FDBA 3CL1A 2V4VA 5FO8B 1O4ZA 1Q5OA 1DGRA 4R9BA 4LBQA 3JBG1 4XZUG 3WQ0A 4OI0A 3OBTA 4EROA 3POJA 3OY8B 1UNBA 2F6BA 5IVYA 1Q8OA 1I3HA 1O5LA 2PELA 1VBB1 5T5OA 3THDA 4CEWC 3ZPYA 1BLZA 2MNGA 1GLHA 4XHBA 3FHIB 2ET1A 2JWPA 3W5MA 3O12A 4Q4W3 4E4ZA 3RZJA 2UYBA 3J4UH 2P2KA 5FKCA 4E2QA 5CAZA 3DEMA 2BBAA 2Y60A 4I3GA 3RI8A 2FDFA 1JHJA 5HCBA 1F8VA 1DGWA 5B4XA 1NCQC 1ZZ7A 5FYIA 4QXHA 4TTGA 4R9CA 2DBNA 2R7EB 3AZYA 2CAUA 2W2IA 4FFHA 1RUE3 3AMQA 5K9YA 3ZN6A 1RUC3 4BIFA 1NYWA 1L7LA 3E1F1 4BK5A 4XJUA 5CFCC 2CL2A 2WQ8A 2UY9A 2WT0A 2ZMNA 5A3WA 1W8FA 2W0XA 2Q0AA 3FHAA 3DN7A 4XOGA 1S0FA 3ZDSA 3ZN5A 2VUCA 2OS2A 5A70A 2VOWA 3T3YA 2PN5A 3FE5A 2IWGB 4NO4A 1MS8A 4FOQA 5KR7A 4CDWB 1FV3A 4EWEA 5KHJA 4XF4A 4E2SA 5BNNA 3RWNA 1OLRA 2H0BA 3GXUA 3RYPA 2CV6A 1AR93 4LA2A 4PLOA 3A0NA 3OGRA 1SLIA 1URXA 5FYUA 2JB4A 3CIHA 4QX0A 2A1XA 1ENRA 2VZSA 5DMYA 4NE9A 4O61A 4D6RA 4YW5A 2VVEA 4B8EA 2E7AA 5ISLA 4YVWA 3MFAA 4L8QA 4W8JA 4CE8A 1HQLA 1OH3A 1FOD2 2X5IA 3WF1A 3APBA 3NMBA 3S57A 4CCEA 5A3NA 5FBJA 5AC93 2WSVA 1GWMA 1C8M3 2B7YA 1HLCA 5FY0A 4CDQB 1RVF3 3KCXA 4LO5B 1QDOA 3IBMA 1DFQA 5FQ0B 4DXZA 5IT6A 4OCTA 4XBNA 2FQPA 2VCCA 1QWRA 1WW6A 3NJYA 4P9YA 4FFIA 2WN3A 5ACA3 2V09A 1ULFA 4FVVA 5F5IA 2BOJA 1LHWA 3JB8A 3Q8CA 3PU3A 4LKEA 1JI6A 4P9GA 3ZYGA 1N1VA 4Q8LA 4RQPC 3GGLA 4IEQA 3ZSJA 4CP9A 4LNVA 4N8MA 1K42A 1C8M2 1DYPA 1ULGA 2W3JA 2H6BA 3MUZ1 3RZGA 1D4M1 1LESA 1DQ2A 3LFIA 3NV1A 4XHXA 1WWYA 5F3IA 4GIQA 1GQPA 3WW3A 3ZFGB 1R1A3 3N9MA 2VTXA 1R093 3ENRA 3IDEA 1C1FA 1VRH3 3MDPA 3I49A 4PT6A 3PURA 2WNUB 1UY2A 2VJXA 3KV5A 5T5JA 3ZYIB 5DUWA 4Z1VA 3V0BB 1AR81 2L9LA 1QOSA 5FZKA 5L73A 3WR0A 4V2WA 1YCIA 2VZPA 3UJQA 2OQ6A 2ZACA 4PLNA 5DDJ3 1OBNA 4LLFA 5CIRA 5CEHA 4UW6A 4AR2A 1VRH2 1WBFA 3PVEA 2QE3A 4CDQC 4CEWA 1WCSA 4MGZE 4OULA 2FZ1A 4WVMA 5L19A 2O0OA 1H1MA 4LITA 3O5SA 1UY4A 4H3WA 1NXD1 2OPKA 1X9PA 4HVRA 2A6WA 5T55A 1G86A 4NHMA 4XF3A 3D6EA 5TSWA 4UBGA 1N3QA 1LB2A 4BISA 1NCQA 1RUD1 4Y1XA 1AYN2 1SCRA 3DECA 2QUOA 2VVFA 4WV8A 1G9BA 1UYZA 5JIUA 3KHCA 2RM23 1B35B 3ASIA 2WR9A 3DXTA 3SCFA 5CFCA 1S0GA 3ZFGC 4AHWA 4BOWA 2RHPA 4HG6B 5LBFA 5K8SA 1OPOA 3PUAA 4LT5A 1SLTA 1DZRA 1WLCA 1WMFA 2JXAA 4KG8A 3ILRA 3VD9A 2J1EA 4HSJA 3GJBA 3RZKA 3V0AB 4M4PA 1TZOA 1ST8A 4AFMA 5DXDA 4AF9A 1U0AA 2ZA9A 2WABA 3J7MA 1V6OA 1UYYA 2RM22 1J83A 2GNMA 1SLCA 3MIGA 5FP7A 2ZGQA 1C1LA 2O14A 5FYSA 3HIFA 3UT0A 3VBFC 1Y4WA 4META 5EPAA 4XFCA 1X50A 4AFBA 3OY8A 1FPN3 5FYYA 3ZYFA 1F5JA 1WCQA 1VBC1 1ZZ6A 2WFPA 1SBDA 3EJKA 1UCXA 4JKKA 4Q1RA 1D0GA 3AZXA 1CAXA 3S30A 1YQ6A 2XXZA 4NAMA 1E5SA 3ZXFA 5LA2A 1QJU3 4N7IA 2D98A 3AYEA 5H9SA 2PLV3 2VW2A 1W6OB 3TEYA 1C28A 1XE0A 4YM1A 2EAAA 4XF9A 4DZGA 3J9SA 3VBOB 1W6PA 1KEXA 1XE8A 1V9U2 3ACFA 3RI9A 3ZR5A 1Z0HA 2VY0A 1SCSA 3G6JB 4Z07A 3PIJA 2BGOA 2C6SA 4LHLA 5FTTC 1YC61 1DQ6A 4Q27A 2WWUA 1OKOA 2ZZQA 3KD4A 2UY8A 3AXEA 2PLV2 4GMP3 5C70A 4A3XA 5HXMA 3GM8A 2CGPA 4AI8A 1NCRB 3KM5A 1DHKB 1U5YA 1YHFA 2A3YA 2ZAHA 4H14A 5FYBA 2E6VA 3KF3A 5CG8A 2QNKA 2JG9C 3ZX7A 4AAPA 4CCOA 2VMGA 2C26A 2R1DA 5GJ6A 1QNYA 3KGZA 4RQPA 1J3PA 3WY6A 1PIV2 4AGGA 4ASKA 1ZA4A 1YFUA 1S0EA 3CJIB 2JDNA 2P3IA 4MLOA 5FCCA 2RDSA 4Q4Y3 2ARAA 4WZCA 2E7QA 1AR61 2ZBJA 1L7RA 4TZDA 5GZEA 2HBTA 3AKTA 5JPMB 5JXJA 4XFBA 2IC1A 2ERFA 2BRTA 4R9AA 5FO9B 2Q1MA 4F8AA 4ZU4A 1LJ7A 3AFKA 4RHV1 4I30A 2UWAA 5J3UA 3AYCA 2F4PA 2CDOA 4JDMA 1OF3A 2FDGA 5IVCA 3POBA 1SFNA 2R072 3GHMA 5A32B 1JYIA 2J1SA 4BIOA 2JIJA 1DQ0A 1OHFA 3GNEA 4OYUA 5LASA 3WD5A 4AYUA 4CDQA 3H9AA 4LO4B 1S0CA 4JKLA 4A41A 2D44A 3HT2A 4XURA 3QH7A 4K40A 4CDXB 4OVEA 4YW3A 3VD7A 5JXIA 3QD6A 2WO2A 3B69A 4C1XA 2OXBA 3TEZA 2RR11 4H7MA 3J7NA 2Y33A 1STMA 1EY2A 2EXHA 2RS31 3ZFEC 4QX7A 3ZXLA 3RZZA 4K6BA 2HWB1 2VZ3A 4Q4V1 1VALA 5FYVA 4R52A 3SEEA 2ORXA 2CGNA 3E5QA 3W5NA 1Y43B 5BY5A 4Y4RA 1OQEA 4PQ9A 5APAA 4JCKA 1VMHA 5FZEA 4XIKA 2NYYA 3ZFGA 2HWC1 1PX3A 1V6JA 3JD73 4AVTA 5F2SA 2XJSA 5FPZA 3I3EA 1PGL2 1RUC1 3L2HA 1R081 5F9TA 1KITA 2Y6HA 2IXIA 3BODA 4B4RA 4M00A 3AXDA 4NUBA 1UXXX 3J8F2 3KF5A 4MXVA 1W2NA 2HWE2 3N9PA 4YVSB 3NNGA 2DFBA 4B4QA 5KHKA 4K1YA 3VBFA 1E5IA 5CU1A 3GZTB 2P3YA 1A34A 3TEXA 4AQSA 3SHRA 4JRAA 1EV12 2Q1FA 1ULOA 1YFXA 2XH6A 3CJXA 4I01A 5FWEA 5FZLA 1W0NA 5FPBA 1QQP2 1AR91 3I2OA 5T50A 5I0DA 1OI6A 4W6WA 1TQ5A 2VMHA 2BVVA 3DL3A 2D6MA 2IUWA 1JOJA 3FUOA 1WMDA 2HEVF 4E4DX 1OH4A 2VMDA 1UN1A 3KV9A 4IGPA 1UY3A 4CU8A 1FYUA 2D3RA 1NAEA 1YLLA 2XONA 1QOTA 5LY2A 4WZFA 2WAAA 4ZXEA 4GWMA 2ES3A 2XHNA 2JKBA 2XMLA 3T09A 3MW3A 1IHMA 1QXPA 1LU1A 1SBFA 1H2MA 5LB6A 1C57A 1S1AA 5G05L 5KHHA 2OKXA 3BI3A 1SDWA 5AC91 3UNPA 2LS6A 2Y6FA 4GJYA 1YQ5A 1RVF1 1MS3A 2QFEA 1GP4A 2JG9A 5JWPA 1OQDA 2UU8A 4RN5A 1AJOA 3P5BA 3M1HA 4YVSC 4YW6A 2ZGOA 1A8MA 1S2EA 2VZUA 2C9AA 3AFGA 3PVBB 1NX9A 4H7LA 3B3QE 2N7GA 5ACA1 1O3QA 3N7LA 1M06G 4CPBA 1I6XA 3MI8A 1GQHA 4FPKA 1J58A 4BJ0A 5JLVA 2YHJA 1BKZA 1MPXA 1D4VB 3O1UA 3GJAA 1C8NA 2OIIA 3TB0A 2WZ8A 5JZGB 5FLHA 1LEDA 1POV0 3CQOA 1ZRRA 1W6OA 2J1AA 1R1A1 2JJ6A 3WEZA 1R091 4UW4A 2Z4FA 3AJYA 4GAZA 1FATA 1LEMA 1XJAA 1EPWA 1XRUA 3EO6A 3K77A 4XJAA 1WD4A 3L9JT 2XOMA 2ZHLA 5GLVA 3UGGA 3S0MA 4P14A 1W0PA 3PJQA 3VN4A 4LO7A 5KXBA 2B9VA 1WCUA 1SFYA 3D5OA 2XGXA 3OD0A 1PO13 3WG1A 4A3ZA 3UV9A 1UOGA 4UFMA 1X36A 2QQJA 5DDJ1 1ND2B 2R062 4ORFA 1HQNA 3LEIA 3V64A 3PLQA 4M0HA 2EALA 1OUSA 3AKSA 4UFJA 1DYOA 4CEYC 1YJLA 5SV5A 1J3RA 1W2TA 3K3OA 3ZFEA 5IFTA 3OGGA 1QU0A 5FY1A 3ZKYA 1H6YA 5GLUA 4QB2A 5IVBA 2VZOA 2ZX4A 1PK6B 2ZGMA 3UK9A 2J42A 3RFRA 4XQ4A 3JBG3 3DYOA 1YQ2A 2C4XA 4XVHA 4Y22A 5LRRA 1BK1A 1CR7A 4EYUA 3TAYA 3UKVA 5JPNB 4XDOA 3OPZA 2BVBA 5JZGC 1KS4A 2WA4A 1UWWA 2WUHA 1PMHX 5A3PA 3LDRA 1JU3A 1ZBE3 5J7MA 1PZ9A 1RUI2 1LODA 1C3HA 4GWIA 4AI9A 1ND3B 3JBG2 1OLMA 2VTFA 4IV3C 2P3KA 4LOSA 2P6CA 3A23A 3OUIA 4OUMA 4K20A 4YW1A 3ZFFC 5A32A 3GHNA 3SKVA 1RUF1 5A6YA 1RL3A 1VBB2 3OUJA 4JTNA 1HV0A 1LOEA 3BYWA 2WJSA 4LBNA 3U1XA 5A33B 5JMCA 2V5YA 1DCSA 3VHRA 1KJLA 3U07A 2C5DA 1I5PA 1XC6A 2AC1A 2GU9A 2W52A 4NWVA 1GBGA 5F32A 4N43B 3WZ1A 3AX4A 4Y1UA 4BQ2A 1QJU1 3JQWA 4FPHA 1X8EA 3HT1A 4V2VA 4WM7A 1WCDJ 4NJ4A 5F8PA 1G9FA 2WKKA 4Y5SA 1PK6C 3HD8B 3HJRA 5F6LB 4EN0A 1VRBA 4QM9A 2BEOA 2IZWA 1QKQA 3SMHA 4XAAA 2C1FA 2EICA 2WBKA 2JECA 2ZX0A 1F4AA 2YG0A 4AGVA 4BU2A 5FXVA 1D0HA 1UMHA 4DY5A 3U14A 4DY3A 2DCYA 5H9RA 4WVVA 4AGRA 1Q8VA 4JHTA 2QQWA 4GMP1 4AVBA 4YVSA 5EIYB 4XZPA 4CUBA 1IPKA 4XFGA 5LK5A 4BCUA 4FT8A 1JN2P 3ZXKA 2LTNA 2XJVA 5FO7B 2WZEA 1ULCA 1NG0A 2EIDA 3IZOA 2E33A 4WM8B 3HR9A 5C3PA 5C5TA 3W59A 2BERA 3KT4A 2BNMA 3QCWA 3VLBB 1LRHA 4FFFA 4DXSA 1X8MA 3SCGA 1IQDC 2WO7A 5K7PA 4YNIA 1T6GC 2WNOA 4EV0A 3MUY1 1OD3A 2PHWA 2D3SA 1VBE3 5A3MA 2QQKA 1FV2A 2W1UA 2ZMKA 1KDKA 2EXKA 3K48A 4FSJA 2GN7A 1VLNA 4LK6A 4COUA 1DGWX 2A6VA 5JIAA 4AQ2A 4JTOA 3LF7A 3QLQA 1HRI1 3VUOA 2CHHA 2QQVA 1PM7A 2XQRA 4HSLA 4P5YA 1W8UA 4P02B 1D4M3 3BUCA 4IQPA 2VBPA 4N53B 1X33A 2DCJA 1MR5A 3O1SA 1F5FA 4FQZA 1GP6A 4L99A 3O7OA 4CEYA 3KS7A 3ZN6B 4XF1A 4PBOA 4GULA 3R4DB 1NLQA 2DVBA 2JEMA 3I8TA 4FPFA 3VZLA 1ASJ2 2TEPA 2WO3A 1QJZA 2VNVA 4AWDA 1D4M2 1NA1C 1Y9GA 5IUQA 3WOGA 1HB2A 4WM8C 3ZSKA 3VDBA 1G7YA 2HJIA 4TXWA 4A45A 2Z42A 4YW4A 1S2KA 4D0QA 5AFBA 4B1MA 4KQ7A 1S0IA 3M3QA 4PI0A 1SG3A 2XJPA 1H9WA 1GICA 2ET7A 5JZGA 2MEV2 1H9PA 3QBQA 5FIXA 2ZHKA 3RMYA 5FY9A 1EUUA 5A1FA 5BNNB 5JI9A 1L3JA 3VZJA 2NMOA 2VULA 3A4UA 3MEPA 3JD71 4M4RA 1AR82 1PO22 2HEYF 1DQ5A 4QU1A 3SCHA 2GALA 5JDBA 5HCAA 3HVDA 4OHXA 1O4YA 4IV3A 2D5HA 3SC7X 4OHWA 3ZFFA 5FOJB 3RZLA 3LZZA 3U10A 1MZ5A 4YVWB 2BV4A 4N53C 5FZ8A 1ACCA 3MGUA 5C3SA 3OBZA 1TMF3 5SV8A 1RINA 1VAVA 2X5IB 3AP9A 1CN1A 2HYXA 2PAEA 3ME2A 3HEIA 5FZ6A 1UW8A 2WN2A 5GM0A 2FDHA 2AYHA 1UAIA 3SLIA 2DUOA 4J25A 1KXGA 5GLWA 1LULA 5IK7A 2GC0A 1RMU1 4GB31 4M3CA 5L9RA 1UZVA 1U5IA 1RUD2 4XMAA 1JYVA 4XFHA 1QJY3 2E7TA 5IFPA 1D7PM 2PHDA 2JE9A 5D2AA 3POFA 1XU1A 4AHXA 1PK6A 4YPJA 5GLTA 1OSGA 1ZBA3 3T2QA 1XNCA 4UT5A 2BYVE 1DGRN 1XB9A 5DAPA 3ZKUA 1QEXA 2QQOA 4OMDA 4D8MA 2W1SA 2ARBA 3K4DA 2PXJA 2ATFA 4FPOB 1FMD2 2DUPA 2VW1A 4ASMB 5KXEA 4I3PA 2Q4SA 1OQ1A 1S2BA 4Q4X1 4DUVA 2DURA 2K2SA 1VIWB 3Q8AA 4P08A 2J7MA 2GH8A 2VO5A 3DGTA 2OZJA 2R042 4LTAA 1HQWA 1VBC2 2XUMA 2JE7A 3N9NA 4HL0A 3V65A 4O9GA 3WDVA 1NLSA 1JYNA 2FCVA 5A33A 2VBDA 1W6MA 2J1VA 4BPZA 4QKBA 3FLPA 5FZDA 4OQ9A 1VAMA 4JKMA 3IDBB 3VDAA 1DDLA 5I91A 3NWKA 4CU7A 4YGDA 1KRIA 4UWDA 4CEWB 5LA1A 4AFAA 3CO2A 2NPIA 4YGBA 2AH2A 4WVMB 4MVTA 1DZQA 4NROA 3FN9A 1Z7S3 5E16A 1O8PA 3E6DA 5T3NA 3ZSEA 2PHLA 1UZZA 4QWNA 3N7KA 2R16A 3I3DA 4JVAA 1NCQB 1AR63 5EJ1B 2DV9A 4BMEA 3HQRA 3B9CA 1PO11 2OQ7A 2VAUA 2D97A 3EMRA 4XEZA 3VD5A 4AVAA 5C33A 4HK9A 3C7FA 3BOWA 5FZAA 4PHZA 4QXCA 3R05A 2W08A 1CAWA 2VU9A 3ORJA 2Q8CA 2VVDA 1NA1A 2D6PA 1MVQA 1NUKA 4WM8A 5IJRA 2RV9A 3LAGA 2ZS6B 3WF3A 4Z8BA 2DCTA 4AW7A 1PZ7A 1G9CA 2JDZA 2D6OX 2RS51 1AX0A 2BTVC 4LMFA 3POGA 5LK7B 3POSA 5FXZA 2JDUA 1MS9A 5C4WC 3OOXA 4QQOA 3B00A 1YO8A 1RYYA 3ACIA 1JOBA 2D6LX 4RHV2 4NWWA 4FAGA 1W0OA 3PIGA 2RR13 4H2AA 3FZ3A 2E32A 5LY1A 1GKBA 2GP5A 2RS33 3I3QA 1CAXB 4G9SB 2OPWA 1ZBE1 2VZ1A 1NY72 2HWB3 3MW2A 4Q4V3 4U36A 4XXAA 3ITQA 5T52A 2AACA 3RG0A 5LW9A 2VUDA 2VPVA 3IIIA 3POYA 4N53A 2ADEA 4N9IA 2PHRA 3C2UA 5BPXA 4AL9A 4D7TA 2ZGLA 4D7YA 1W6PB 3EBRA 1ENQA 5A7QA 4A7YA 1BVVA 2HWC3 1ULDA 1HJGA 5CB7A 1RUJ1 3URFA 1LOFA 2RMU3 2FCUA 1A78A 1COV3 2LALA 1R083 2R6QA 2ETEA 1JOPA 2RS32 3C3VA 4IETA 5FFOC 4EN7B 4E8CA 4Q4W2 2HWB2 3BOPA 1OMIA 3VD4A 1QXRA 2YPJA 3H1MA 4X6RB 4UW5A 2ILMA 2RJLA 4XAEA 2VQ0A 2DF7A 2YGLA 1O5UA 4Q0QA 2QQIA 2CU5A 2A3WA 4MGKE 2ZJCA 4ZZ8A 2HWC2 5FPVA 4RQPB 1RUE2 5FK8A 2B46X 4COYA 1RUC2 1R082 4IE6A 1Y7BA 3ZOIA 1DIWA 3LA3A 1WD3A 4K9SA 1W2UA 3Q8EA 1HRV3 1PM4A 1W05A 4FPYA 3WSOA 4A7KA 3E5XA 4GWJA 2VCMA 4XILA 1REDA 3DF0A 3TN93 3C7GA 1CZVA 3KT7A 4X8NA 1LENA 5H9PA 3I2JA 2VUJA 4COZA 3BCWA 3PTRB 4XFFA 4KU7A 3VV1A 5D8AB 1JXNA 1AR92 2RJ2A 3WUDA 2Q1ZB 3M8LA 3P3PA 2YMZA 4Q0VA 1JZ4A 1G9AA 5EXOA 1CAVA 1RHI1 1UZYA 5A3OA 3DV8A 3WG2A 4P9IA 3THTA 4WBBA 1TME3 2YBKA 4MXWB 1HIXA 3RWKX 2XJRA 2YUEA 3WXPA 4XUTA 1FX5A 4SBVA 4HPKB 5C3RA 1VBE1 4C8DA 2KR2A 2WFF3 3K3NA 2H6CA 4FP2A 4LBLA 3WNKA 4OQ8A 4IL7A 3EB7A 3F95A 3CHXA 3HQUA 3I2DA 1SLLA 2BP6A 4HOOA 1W03A 5AC92 4A6OA 2HH9A 3WP6A 1RVF2 1RUG3 3N7JA 2VXRA 4FP3A 4FPGA 3U11A 1BEV3 3I2GA 5G04L 1NT0A 4FOWA 2E51A 3U37A 4OHZA 3BTYA 5ACA2 3NKGA 3OEAA 1UMIA 5DG1A 1NXMA 2VH9A 3DXUA 4QQPA 4EJRA 1JYXA 1VPHA 1LTEA 2WYSA 2PA7A 1DF0A 1XOYA 3HBKA 2YPDA 5D8AC 5IHRA 2BDRA 5F1RA 3WQ1A 4P9JA 1QJEA 2FMYA 2PHTA 2H0VA 1AX1A 1LHOA 2RG4A 1S0BA 1Y3TA 1JU4A 3VBFB 5C4WA 4NN0A 1GNHA 1R1A2 2Y6JA 4CUAA 1R092 1H1AA 1WW7A 2GMPA 3T2TA 1C5HA 2YBPA 4BHPA 4K3UA 1H6XA 2EIGA 1K5JA 1JZ5A 2XL7A 2A71A 3AL5A 3H8UA 4YM0A 1SACA 4HMZA 1ENSA 3SNMA 5KHGA 5EV7A 1F35A 1RXGA 3IKWA 3ACGA 4ZS2A 2ZXQA 3UYJA 3K2OA 4A7ZA 1DBNA 5DDJ2 5J96B 1YWKA 1NZIA 3KQ4B 4EZHA 4QGMA 3GZEA 3SH3A 1AR73 4XFAA 2ZHMA 4LO6B 4NRMA 4BXSV 3IAPA 1TMF1 2Y26A 4FPLA 3ETPA 4L9BA 1RITA 4LKSA 4LR4A 4QU2A 3VBHA 2VZRA 2SLIA 1POQA 5LBEA 1BJQA 3LA7A 4ZXKA 2JIGA 3NRUA 4AAXA 4KMQA 4KBBA 4UOJA 4CZSA 1JODA 1KFXL 1CONA 2A3XA 1XNKA 1QJY1 2JG9B 3WP4A 5JSPA 3PUSA 3ACLA 1BXHA 2XJTA 3M70A 1NZCA 5E1RA 1RUF3 5FJHA 1UIKA 2VCAA 1WW4A 3RGBA 4EN8B 2VXJA 5EHDA 3C7EA 3K4AA 1QJX3 4FCAA 1ZBA1 1LOCA 2OX0A 3NQHA 2DVDA 3H8XA 1JH5A 3SKJE 3CU7A 3GF6A 3BPSA 4JQRA 4TN7A 2K9ZA 5ANNA 3WUCA 5FZIA 1RUF2 3R6SA 2A5ZA 3M3OA 5JAXA 4CXYA 3VKNA 2ZX3A 2K0GA 2OA2A 3RRDA 1AL23 1AX2A 1M4WA 3NV4A 3WDYA 4QX3A 5FYTA 3M3CA 1FPN2 1CQ9A 4BH9A 1UY1A 4AQTA 4QX8A 5FYZA 3CBNA 2Z69A 1UZ0A 2VNGA 1H1IA 5FMCA 3VBUC 2RDQA 4JQTA 5F5AA 1Q8SA 3T2OA 2EF6A 1QJU2 4Z92B 3ZSLA 5FQ0A 1QY4A 1REEA 3BN6A 3MZHA 1OF4A 5HV4A 4G3YC 4GZ9A 3MIEA 4IESA 4YSFA 3GZUC 3I2IA 4IW3A 4EN6B 5FYMA 4XQWA 1O59A 4XBLA 4EZ4A 4CVUA 3RZHA 3AMHA 4OHVA 1UYPA 1WA6X 1QGLA 1Z7S1 1G8WA 3ZFEB 2UWBA 1J59A 1OLQA 2JD4A 2DCZA 3I97A 3FLTA 3POEA 3U4XA 2A6XA 4FOYA 2VOKA 4JDNA 2Y38A 1V6KA 1W6QB 4XF0A 2X05A 5AFEA 5C5UA 2ZAAA 4PDWB 1EYBA 3OBRA 5CYYA 4DB5A 4Y22B 2Y34A 3OD4A 1JYTA 1V00A 4UBHA 1KFUL 1CIYA 2D43A 2VW0A 5CKQA 3ZPOA 1DU3D 3IM0A 2WRAA 5FZOB 3UESA 4OUSA 5FZCA 1I9RA 4B4PA 5D8AA 3A21A 4AQ6A 3O1TA 3I3MA 1HRI3 1POV1 2NLRA 2QQLA 3ST7A 2VM9A 1LHNA 1FXZA 1JYCA 4Q4Y2 5FP4A 4PJYA 1V6LA 2GDFA 4KU8A 5CKNA 4IE5A 2B5HA 5IAXA 2DVAA 2PHUA 3CZJA 1ULEA 4BQ3A 4MXWA 2YXSA 3JU9A 4U2AA 4Y1YA 4HPKA 4YW7A 3S7IA 1JZ8A 3CZUA 1US3A 1SEFA 2B42B 3A7QA 1MEC1 3LEKA 3O0XA 4OHYA 1W9YA 3GCWA 1H4GA 2YU1A 3POWA 1W9TA 1GZ9A 1VBD1 3I2HA 5FMOS 3BTZA 3PL0A 5IW0A 3HNYM 1GANA 2OUHA 2Q30A 4WM7B 1W8NA 3WG4A 4RR3C 1E5HA 2Y6KA 1SLAA 4W50A 4RSUA 4NPLA 2ZOEB 4PDWC 4DS0A 1QHDA 3SH4A 4O65A 4Y33A 1YUDA 4RL7A 2RMU1 5J48A 4QPYA 3H8RA 1COV1 5FZ4A 2W1QA 2C0ZA 3LWCA 2QDNA 1WLDA 5CFDB 1N3PA 3MO4A 2XUEA 4I0BA 5B2GB 1J1LA 1P8JA 2A7AA 4XYXA 3ZXJA 2YC4A 1EUTA 4NIAA 1PMJX 4AI2A 4O9EA 5FZ7A 3T1LA 4BLIA 2Z5WA 1QDCA 4XMIA 2CSGA 5FMDA 3JD72 1X82A 4XJ9A 3PDQA 4ES8A 5CADA 1DP0A 2G4IA 4PBPA 3H0OA 2BFUL 4ARYA 4HK8A 4CUCA 3U78A 4GB33 1RMU3 1WA4A 5CNAA 4IEXA 1DGLA 2W46A 3FUQA 2QBXA 1FNZA 1HRV1 1OPMA 4CPBD 5BV6A 2WLPA 2YFUA 3BIEA 4LIUA 1UD1A 2GC3A 2O8QA 3TN91 5I8YA 1O8SA 3IDCB 3Q9OA 1IS4A 3LD8A 4GALA 3WNLA 2OZ6A 1XNDA 5H9QA 5LRSA 4WM7C 2BWAA 1PMIA 1UL9A 1N47A 2QQUA 4AHYA 2FHRA 3VBUA 5FY5A 3LDBA 2ZPXA 4NHKA 2P1BA 3FBYA 4INDA 3ON7A 4XDPA 5IWFA 3SEPA 4O7XA 5GKAC 3UGFA 3ZYHA 4IERA 4Q4X3 3LPFA 5HCFA 5IK8A 2VUAA 4RYDA 1HB4A 1HB3A 2HYKA 1TME1 4Q0UA 4XTPA 5CFDC 4URTA 5FZ0A 1F9KA 4CEYB 1IQAA 3SH5A 1ZZCA 1QNWA 2FD8A 5FOBB 1Y9MA 4LHSA 5HCHA 2WFF1 2LRPA 2YZ4A 3N3HA 4BM8A 4XUQA 2O1QA 4AVCA 4R4ZA 3R0RA 1VBA1 2RE9A 4QPGC 4Q4X2 5EYYA 1N3OA 4QHBA 2ZEZA 3FLRA 4IUGA 1RXFA 1RUG1 4AI0A 1JS9A 3NL1A 3X29B 1BEV1 4S2FA 2E9QA 5FK7A 5J09A 4FOVA 4E2GA 3M3IA 3VL9A 2CDPA 1G6NA 1HKDA 3UL2A 4LHKA 3SISA 4OI2A 3ZM8A 5DQ0A 5DUVA 1ENXA 4IV3B 3ZFFB 2VE1A 2XHKA 1F31A 4OFGA 1BBT1 1GNZA 2ZX1A 5GLZA 2VCBA 1E5RA 2Y0IA 3RYKA 2WWSA 5A3UA 3DCQA 2FDJA 1RUH3 3QH6A 4LE3A 2PMWB 4IEVA 4GD4A 5FLJA 1MS1A 3NJVA 2BWCA 5GZCA 1PVXA 2DBIA 3ELNA 4HXCA 4M3CB 2Q8DA 5A7WB 3KV4A 4P9WA 4OUEA 2ZGKA 2IVIB 2VNOA 2RS53 4F3JA 3HQXA 4NOTA 1PO12 3MICA 3AYAA 4RR3A 5A1AA 1HXS3 3RJRA 1W6QA 3WQBA 4PDWA 2VZQA 4RGKA 1CZSA 2W91A 3WF4A 4BE3A 5HV0A 4NIIA 1YIFA 1AR71 3AMMA 5FPLA 5FY8A 2QZ2A 3KLSA 1HN1A 1IG0A 3KMHA 2QQPA 2WLQA 4D69A 3N4MA 5FZOA 1XPWA 4EE2A 2EIEA 2B4KA 2Y6GA 1RUOA 3UKTA 1WKYA 1ONAA 2RS52 4JRLA 5DZFA 2JDMA 1J1TA 5LBBA 5IVJA 3B93A 1H2KA 2AEZA 4PI2A 5C9AB 4KGQA 1SBEA 2PTMA 4QD2A 3UKNA 1H2NA 1C4RA 3ETQA 1FNYA 4XJ8A 2EXIA 1GNYA 1RUJ3 4XFIA 5FZ1A 2J1RA 1WW5A 2XBO3 4DQAA 3FX3A 4LBKA 4NHYA 4Y4YA 2HEWF 1BK0A 2Q8EA 3SXWA 5I0SA 2GC2A 4C91A 1QJX1 1ZBE2 2JDKA 4OMCA 1W6MB 3W9AA 2WC2A 4YARA 3CF6E 4LUKA 5EJZB 3AB0A 5ERLA 5FZ3A 3BVCA 1ULPA 4MHUA 2JDPA 1QXJA 5F3GA 4DO0A 3JB4C 3H1WA 1RUJ2 1RTVA 1UOFA 2GAUA 4EWAA 3TNPB 1AL21 2R1BA 1CD3G 1JMUB 1W8HA 2AUYA 2FMDA 4OZOA 3WDXA 5AVPA 2I07B 4K1ZA 4L0PA 4Y26A 5C8WA 1JHNA 5A7PA 2D40A 4AK3A 4KI5M 5A1LA 2DUQA 4MGTA 2Y6LA 4Q26A 4ZY9A 2V4AA 4CCJA 1AJKA 5KC5A 5CFDA 1Z78A 1V9U1 4LQRA 4QDQA 2QJVA 4GA9A 1W6NA 4YRDA 2JD9A 1W2OA 4LO8A 5E88A 2G9GA 1GFF2 5BXXA 3AZVA 3ZDVA 1HN0A 3PHMA 5C9AC 4QGLA 2VC9A 5FXXA 1CAWB 1LOAA 1BVP1 3LIHA 1OLME 1NA1B 4ZU7A 4YFWA 3GZAA 3ECQA 1UPSA 3KWVA 4QPGA 1RHI3 2BU9A 1WCKA 1EAH1 2DVFA 3UETA 4NIDA 3VZOA 1PIV1 5FBZA 4HVQA 2NN8A 5C7GA 2CYFA 4NHLA 4W6YA 2V5DA 4YZ1A 1I5ZA 4YGEA 1S55A 5JSRA 4TSVA 3VKOA 4XPVA 2D5FA 4XCAA 1LECA 4CUGA 2P4EA 5FP8A 1RHI2 1YJKA 5JUVA 1ODNA 3BTAA 3WVJA 3AP6A 4KNCA 4HVOA 4K21A 1NQDA 4GXLA 3O1RA 4AZZA 5C3OA 3GCXA 1VBE2 3DYPA 3CNAA 4FXGB 2A70A 2W94A 3WNOA 3JQXA 2G9FA 4BB3A 3M3EA 4XE9A 3WT3A 4WVZA 5L7OC 5J98B 2R071 1OOPC 3RMXA 2NQYA 3ZVXA 4URAA 1GOGA 3IPVA 5FPAA 1UU5A 1KQRA 4BQ4A 3AMPA 3C7OA 4ZPIA 4Q8KA 3O1PA 4LPLA 1O7FA 5I93A 3PNAA 2W5FA 3A0KA 2CNAA 1NLRA 4KWKA 4W4ZA 4YZ2A 2XDVA 2Z2SB 4Y5TA 1SPPA 3MF9A 1HJFA 4Y3OA 2ARCA 3LOBA 3M2MA 1B09A 3V56A 2CAVA 1DZTA 2DTYA 3MPBA 2JICA 1OT5A 1PVC3 3S5QA 3NV2A 2ZABA 4UFLA 3WHUA 3AP5A 5CVRA 3T0BA 3DKWA 5FREA 4P9XA 2GH2A 3L2YA 1J84A 5T5PA 4XDQA 3LQCA 4JV4A 1SQ4A 2W68A 4KG0A 3PTYA 4P5HA 3D8CA 5FUIA 4KH9A 1OA2A 4S2HA 3RQ0A 3ZMNA 5F3CA 1CAVB 2D6NA 3NNMA 1W3VA 4MOAA 4E8DA 1O4TA 1LOFC 4UF0A 3NVCA 2VMEA 5A7WA 2XPJA 3I7DA 2IFWA 2LUWA 1EV11 4AEJA 4BQXA 1XBFA 5D1IA 3IIAA 1QQP1 2C24A 3MLKA 1K3IA 5KXCA 1CGPA 5A80A 1TMF2 2PYTA 2DFCA 5FMBA 3VZNA 1QH6A 2P5BA 3BU7A 2XLAA 1GOHA 1GOFA 3AM2A 1VE0A 3AJZA 3P1IA 4A44A 4E4HA 1HV1A 3EYPA 3USUA 1QJY2 2YROA 3MF6A 3H3UA 4EQVA 3OGSA 4RD7A 1RJ8A 4TWTA 1GWLA 3LOIA 4BXFA 1AVBA 2BGCA 4CRQA 4XUNA 5C9AA 4NMIA 2I45A 1AZDA 3TRSB 3A22A 5BNOB 3RVHA 1ZBA2 2VOVA 2XWJB 4YFZA 2XJQA 2QVSB 3TBDA 1QMJA 5LEKA 5FZGA 4YYOA 2R0HA 2R0FA 4KBZA 3WINE 4KWLA 2JDAA 4Z2WA 4I02A 3S5AA 4J6GA 3ABZA 2EIBA 3N36A
chains in the Genus database with same CATH topology
1AXKA 5C4WB 5FPXA 2QZ3A 4AVVA 4GMP0 3UJOA 3NAPC 3LSEA 1BMV1 4PLMA 5T5LA 1WMEA 4AG4A 2ZCWA 2V73A 2WZR3 3FFQA 3WNXA 3I59B 4Y24A 1DG6A 4M01A 3ZO0B 4OZXA 2IXHA 3GBFA 4IEWA 4AEDC 5JOYA 2BUKA 1AXYA 1QF3A 4WVWA 5DZGA 3OCPA 3RS6A 5EWSA 2PFWA 4ATEA 1GZWB 2GNBA 3AZZA 2B39A 5L7OA 1OOPA 3D82A 1MQTB 1RUH1 3WP5A 1Z7S2 4CP1A 2GZWA 2A73B 4BMBA 3VBHB 1POV3 5DUUA 5BNOC 2R061 4QQLA 2OVUA 3VBRC 4Y5Z0 1AR62 5KC6A 1FI2A 3G7DA 4BLJA 2AENA 1DQ4A 2QDRA 1R1ZA 1JBCA 1HXS1 3VBSC 3VKMA 1D2SA 2HWF3 2KM2A 5FLIA 4Y20B 5JR7B 4AI1A 2P3JA 1MEC3 4IV1C 2ZGRA 4CDUC 3ES4A 4GKXA 2W39A 3VHPA 4MGYE 1VBD3 3B5LB 1REFA 3VKLA 1MS4A 4NPRA 1H30A 4CP2A 3WHTA 3HMYA 1HX6A 4I0AA 5BNQA 1MEC2 4LULA 2XBO1 2UYAA 2RR12 1XU2A 1MQTC 1KDMA 1VBD2 5FAXA 2QCSB 4IEPA 1TE1B 3VBHC 4Q4V2 2MHFA 5C8CC 1GYKA 1V6MA 5JOXA 4NVPA 4C90A 4PIZA 1AYM1 3U0ZA 3AZWA 2VG9A 3I4IA 2RMU2 2WQZC 1COV2 1UU4A 2IXCA 4COWA 2WQ4A 1YFWA 3EHKA 4OI1A 4RFT0 1GQGA 4DMIA 1ALYA 5AVAA 4GH4B 4BQ1A 4FBFA 1QH7A 2XKOA 3K51A 4FPCA 5F5QA 5HI0A 1IKPA 1WGPA 1XXNA 4XIOA 1APNA 5EJ3A 3I54A 4FPEA 1HRV2 3HN1A 4KL1A 2OYZA 3ZIXA 3TN92 1FOD3 2JENA 3PJYA 1N1TA 2DU0A 2E53A 3NAPA 4MYEA 1AHSA 3FMGA 4TLFA 2XL9A 2YYOA 4YM3A 2FBEA 3B7MA 1CAUA 3VHOA 2P34A 4AEDA 1ZRCA 2YV8A 1VBA3 2VGDA 2ZTNA 5GZGA 1ZNPA 1VAKA 1ZZ8A 4C0BA 4Q1PA 4BYYA 1A6CA 1TME2 1CIWA 3KT1A 1AF9A 4XBQA 1RB8G 4RGGA 2WA3A 1K5MA 2WFF2 4YG0A 4GH4C 5I8SA 5FMOL 3ATGA 4R9DA 2PHXA 5BNOA 1YFYA 4ITCA 5KXDA 3KSCA 3VBRA 1IPJA 3ZYJB 5IK4A 1OFSA 5BYNA 1VBA2 1PGW1 4LBOA 2ZMLA 1RUG2 4E27A 2RJKA 4JC1A 4CDWC 4D3WA 4DNYA 1BEV2 1BBT3 2VMIA 5GZFA 3VBSA 4XQDA 1OA3A 3TOJA 1ASJ1 3GALA 2I2SA 2FZ2A 4XJWA 4QT6A 5JCTA 1S0DA 2GN3A 3KCCA 3OJBA 4XJZA 4IV1A 4X8PA 4ATFA 4CDUA 5EZWA 5F6KA 3OF1A 3VGIA 2LM3A 3SITA 1GSLA 3I59A 1NE4A 2MEV1 4I09A 3BB6A 3LGRA 2WZPP 1BBT2 4LHNA 2WL1A 3LCPA 3MIDA 2HWD1 3WLUA 4Y1VA 2DTWA 4YLZA 4KGGA 2D93A 1MZEA 1PVC1 4GQ7A 1PO21 1O91A 2BNNA 1NQJA 1GZWA 4MZUA 3D0JA 4G4FA 4L11A 5HXVA 1AYN3 1MQTA 2DWRA 1LR5A 4YW2A 4ASLA 5JI7A 4LBMA 2XLFA 3VBUB 2HKXA 5C8CA 2CWMA 3LA2A 3RDIA 1JUIA 3M7AA 4IEYA 4LE4A 1AR72 1AL0G 3JCIA 2ZGTA 1XYNA 1H0BA 1MS0A 4B3NA 4Y20A 4CP0A 2VOXA 4FO9A 2Q8OA 1EP0A 4QM8A 1X7NA 2EAKA 3PMEA 4MV2A 1D2QA 3WDWA 4E9KA 4FTEA 4NR1A 2VECA 3KZ4C 1IS3A 4AEMA 3S7EA 3FJSA 2WNUC 1ZRDA 1LU2A 2Y0OA 1IS6A 2ZGUA 2XB6C 1FMD1 5J37A 1CX4A 4B29A 1QJX2 3NW4A 4XTMA 2BBVA 2AGSA 1LHVA 3LKJA 1MVEA 4IEOA 2R041 1V9U3 3EXUA 3FBMA 2XG3A 5K0UB 3WW4A 2B45X 1AL22 2ZHNA 3VZMA 3THPA 4MH0E 1AXZA 3OGJA 4CYDA 3QACA 1UF2C 5KWRA 2AZ5A 2WS91 2WZR1 3IMNA 3LSDA 1EAH3 1U12A 3LB9A 3N35A 1V70A 2TNFA 4RR3B 2WNEA 1B35C 1PIV3 1U5XA 1UU6A 3USSA 2GSYA 2WINB 4GH4A 1PNGA 5E8AA 4B7KA 4H55A 1NOVA 3FWEA 2IFRA 2RS11 4HT1T 1EAH2 1VB2A 3PMSA 4CDWA 5A3LA 2E63A 2PAKA 2A75A 2D6KA 4MSVA 1H4HA 2VQAA 3MW4A 5DUXA 1ZZ9A 4XW3A 3ALQA 4LEJA 5K0UC 2HWF1 2R073 3BPZA 5KBFA 1O3SA 2WT1A 4IXLA 1HRI2 4F7ZA 4R4XA 4D7SA 4JGYB 2OUJA 2YGMA 3AK0A 1LGNA 1FT9A 2ZGSA 4N9HA 2ZZJA 3VBOC 4PIXA 3ZMOA 1RJ7A 2KA3A 1YNAA 4LA3A 3OTFA 1QOOA 3R4SA 1NY71 4C1WA 4OLLA 4JAAA 5GZDA 3E5UA 3QOPA 1MACA 1Q3EA 4HKOA 1VR3A 3WX5A 5DG2A 3O0VA 5I0UA 4XETA 3CEWA 1NCRC 3WW1A 2ZKLA 2A6ZA 2JX9A 1LCLA 2B8MA 4ZKTB 1W6NB 2DYCA 4PIYA 4Q4W1 3BALA 1PNFA 3AP7A 5BUVA 3J8F3 3CJIC 2WIIB 4AXOA 2HWE3 3ZXAC 3VHNA 3KGLA 3RYRA 4J1XA 2XWBB 3GYDA 4J1WA 3MPPG 4QPGB 4DINB 5JVVA 2PHFA 4AFDA 2AR6A 2NMNA 1UKRA 5EFUA 1EV13 3NO8A 4DRRA 1RUE1 3IWZA 4YZ3A 2NZ9A 2WNUA 4JGYC 1QQP3 4Q2FA 4ZU5A 2B9UA 3V0BA 4RGAA 1UMZA 2ZKNA 4AVSA 1KJRA 4R8HA 4QXKA 4W65A 4DOUA 4GB32 1RMU2 3ILFA 2ENRA 4ONUA 1H8TB 1TEIA 3HAGA 3O14A 4CDXC 2IXJA 4V1PA 1FOD1 3AP4A 1DQ1A 1XQNA 2XVLA 3B01A 3NSTA 4I0WB 3NJZA 4K8FA 3ZXGA 1O3RA 5BNPB 3H7JA 2IXKA 4BZ4A 3FFZA 3B02A 3IPVB 1H8VA 3FC0A 1HW5A 1B35A 1XYPA 4F83A 4S2DA 2AREA 1V6NA 1ZVFA 2NM1A 5IK5A 3H3ZA 1C8M1 1H2LA 1UX6A 4YG6A 3V0AA 2ZGNA 4EWDA 1ZYBA 4HKLA 4L2NA 4QGNA 1MS5A 4AFCA 4QPIB 3MIBA 2BNOA 3ZN4A 4M0NA 4ISRA 1J3QA 2DVGA 1H8TC 1YI7A 4Q0SA 3WV6A 1CVNA 1ZREA 1BMV2 1Q56A 5K0UA 3ROUA 2VNRA 3WW2A 3TWIA 2R32A 4QQ2A 1WLWA 5JOWA 3RSJA 3N7MA 5BNPC 2R063 5ABJB 3W58A 1DYKA 1VRH1 3VBOA 1UIJA 4HN1A 3AKPA 5E89A 4YGCA 1TNRA 1ZX5A 4Q0PA 1LGBA 2XKPA 4LUMA 1RUH2 4L97A 1G9DA 1PZ8A 3VDDB 1Q8QA 4A2UA 1LOGA 5C6CA 3MIFA 1AYN1 1NCRA 3ILNA 5J36A 3M4FA 3VKFC 3USUB 1HDKA 3DPRB 3NV3A 1WUVA 1ZM1A 1HXS2 2GNTA 2EXJA 3CLPA 4QPIC 1LGCA 3CJIA 1RUI3 3WCSA 4MUVA 3EQEA 4BWOA 3RNSA 4QMAA 2I74A 4JGZB 4ES9A 1F2NA 4PF5A 5EYXA 1RUNA 2BPA2 5GALA 2RM21 3TNQA 1VBB3 1VP6A 4JGYA 4AI3A 5I8TA 2CGOA 4D94A 5ABJC 3WDTA 1AYM3 1ZRFA 2ZX2A 3MLJA 1IZ3A 2WNVB 1EPZA 1TNFA 2XBO2 4HN0A 4RA0A 4HZFA 1Y9QA 2D7FA 2PAMA 4L92A 1N1SA 2X8KA 3VDDC 4W6XA 1JUHA 4CDXA 2UWCA 3BIWE 4KWJA 1IKQA 1ND2C 2QKDA 4BA6A 1FPN1 1AYM2 4SLIA 3B9IA 3RJ2X 3S6PA 5L7OB 2EVXA 2Z79A 3DPRC 4HANA 4MX3A 1OOPB 5CG9A 3AKQA 1C5IA 1OKQA 3TYJA 4RS5B 5KHIA 2CTVA 4HBNA 2YC0A 4AE2A 1N1YA 1UKGA 4Y1ZA 1Q43A 2PLV1 1CPMA 4N7UA 2YDEA 2MPFA 2UURA 4JGZC 4OI4A 4N90A 2NP0A 1YXWA 1YIPA 2CY6A 3GBWA 4Z82A 4PCRA 2R30A 3E6CC 1VB4A 2YY1A 3OYWB 2JG8B 3WQ7A 2BFUS 2XJUA 4YM2A 4GKYA 2WNVC 4YZ5A 1ND3C 1S0JA 1RGSA 2IXLA 1H8TA 1E57A 4E4SA 1IGOA 1MZFA 3AYDA 4COVA 2GMEA 3ZIWA 1CESA 4M3CF 1LOBA 3MLLA 4XXPA 4Q4Y1 1GR3A 4IEUA 1V6IA 1PHMA 1KS5A 4LBQB 5BNPA 3ZXEA 3E6BA 4RS5C 4N43C 1KD7A 2OW4A 1BZWA 4S2GA 1GV9A 2DU1A 2GMMA 3RPQA 1PGSA 1YYNA 3J26N 1ASJ3 3AMNA 3ZYRA 1GZCA 1YI9A 1CPNA 4GWNA 3ZXDA 4DFSA 3AKRA 1NE6A 4B7EA 1RC6A 5DZEA 3E97A 2JG8C 1PGW2 1YRZA 4HKWA 2MEV3 2Q5TA 4TYSA 4YG3A 2HWD3 4Q29A 2P37A 4QPIA 3NKTA 1AR83 1PO23 1PGL1 4FAHA 3IN9A 3PVNA 5I0RA 3KCYA 2XVGA 3DUIA 3J8F1 2ZGPA 2HWE1 4AHZA 3WG3A 2P17A 4FQ4A 5T54A 1JTZX 3MIHA 4QQHA 2A6YA 2HWD2 5ABJA 4UW3A 3D0SA 2XVKA 1PVC2 3NAPB 3D4KA 1A3KA 3KB5A 3H7YA 1OD5A 4FTSA 2BW8A 1RUD3 4HETA 3WCRA 2R49A 2X29A 4MGIE 1CAUB 3VDDA 4YZ4A 4AEDB 4DPNA 3HWJA 1ND2A 2SBAA 4JDOA 1AUYA 5I0TA 4FPJA 3VL8A 2D3PA 1A8DA 3DPRA 1IOAA 2GC1A 1LHUA 4CTEA 1K5MB 1ZZBA 3VZKA 3KQRA 1W39A 1FMD3 4LLOA 3MYXA 4FXKB 1BQPA 3VBRB 4AEKA 4JGZA 1FAYA 4HLTA 1OFNA 2R043 5FRAA 1I1EA 1VBC3 5BNNC 3PVOA 3VBSB 2X53S 4X6QB 1DLLA 2PQQA 4M3CE 4HFSA 5CA6A 1VJ2A 4IV1B 3GBGA 2WNVA 4CDUB 1ND3A 2TBVA 1XYOA 3H1YA 2WS93 4C0HA 1SLBA 3H50A 2XLGA 1JW6A 2O8OA 1O3TA 1XNBA 2WT2A 4YVWC 3WDUA 2TUNA 1U5ZA 3MFCA 1MZ6A 4EN9B 2X5IC 5JOZA 5JSOA 4UXAA 3R4UA 2BQPA 3T1MA 1BYHA 2GNDA 2WZR2 2WS92 1K5MC 1IS5A 4N43A 4RS5A 2RS13 5C8CB 2DCKA 4FTBA 1LKNA 3ES1A 4LBQD 3JUUA 4DRVA 1OA4A 1RIRA 4QX5A 4I2OA 5CBLA 4ISQA 4IEZA 1Q8PA 3JZVA 1UPIA 3OYWA 2JG8A 2CWSA 1CJDA 2RS12 3B94A 5HBAA 3O0WA 2EA7A 1WLTA 3P3NA 5CFCB 2ARXA 1WBLA 4LBJA 5L36A 4RHV3 3ZSMA 2KXLA 5LEJA 2WSUA 3ZYPA 4P9LA 2HWF2 1CJPA 3HBZA 3WP3A 3INAA 4K7JA 1RUI1 1SMVA 5FDBA 1XE7A 1BCXA 3IT8A 3CL1A 5FO8B 1O4ZA 1Q5OA 1DGRA 4R9BA 4LBQA 3JBG1 3WQ0A 4OI0A 3OBTA 4EROA 3OY8B 2F6BA 1Q8OA 1I3HA 1O5LA 2PELA 1VBB1 5T5OA 4CEWC 3ZPYA 2MNGA 1GLHA 4XHBA 3FHIB 2ET1A 3O12A 4Q4W3 4E4ZA 2UYBA 3J4UH 2P2KA 4E2QA 5CAZA 4I3GA 3RI8A 5HCBA 1F8VA 1DGWA 1NCQC 1ZZ7A 4R9CA 3AZYA 2CAUA 5K9YA 1RUE3 3AMQA 3ZN6A 1RUC3 4BIFA 1NYWA 4XJUA 5CFCC 2CL2A 2UY9A 2WT0A 2ZMNA 2W0XA 2Q0AA 3DN7A 4XOGA 1S0FA 3ZDSA 3ZN5A 2VOWA 2PN5A 3FE5A 2IWGB 4NO4A 1MS8A 4FOQA 4CDWB 1FV3A 4EWEA 5KHJA 4XF4A 4E2SA 5BNNA 3RWNA 1OLRA 2H0BA 3RYPA 2CV6A 1AR93 4LA2A 4PLOA 3A0NA 1SLIA 1URXA 1ENRA 4YW5A 2VVEA 4B8EA 2E7AA 4YVWA 3MFAA 4L8QA 1HQLA 1FOD2 2X5IA 3APBA 5AC93 2WSVA 1C8M3 2B7YA 1HLCA 4CDQB 1RVF3 3KCXA 4LO5B 1QDOA 3IBMA 1DFQA 5FQ0B 4DXZA 5IT6A 4XBNA 2FQPA 1QWRA 1WW6A 4P9YA 5ACA3 2V09A 1ULFA 4FVVA 1LHWA 3JB8A 3ZYGA 4P9GA 1N1VA 4Q8LA 4RQPC 4IEQA 3ZSJA 4LNVA 1C8M2 1DYPA 1ULGA 2H6BA 1D4M1 1LESA 1DQ2A 3NV1A 4XHXA 4GIQA 3WW3A 3ZFGB 1R1A3 1R093 3ENRA 3IDEA 1C1FA 1VRH3 3MDPA 2WNUB 4Z1VA 5T5JA 3V0BB 3ZYIB 5DUWA 1AR81 1QOSA