1OOPC

The crystal structure of swine vesicular disease virus
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
238
structure length
238
Chain Sequence
GLPTLSTPGSNQFLTSDDFQSPSAMPQFDVTPEMDIPGQVNNLMEIAEVDSVVPVNNTEGKVMSIEAYQIPVQSNPTNGSQVFGFPLTPGANSVLNRTLLGEILNYYAHWSGSIKLTFMFCGSAMATGKFLLAYSPPGAGAPTTRKEAMLGTHVIWDVGLQSSCVLCIPWISQTHYRYVVMDEYTAGGYITCWYQTNIVVPADAQSDCKILCFVSACNDFSVRMLKDTPFIKQDNFFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords Coat protein VP1
publication title Crystal Structure of Swine Vesicular Disease Virus and Implications for Host Adaptation
pubmed doi rcsb
total genus 41
structure length 238
sequence length 238
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2003-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1oopC00
4Y5Z0 1PGL2 1BBT2 3FBMA 4N43A 4Q4W3 5CFDB 1VBB3 3HAGA 1FOD1 5JZGB 1AR71 3JD71 1VBE1 4JGYC 4WM7B 1NCRC 3J8F1 1POV1 4YVSB 1F8VA 1TME1 4GH4B 1NCQC 1RMU1 5J98B 5CFDC 1BEV1 2HWF3 1MEC1 2RS13 2Y26A 5JZGC 1FPN1 1R093 2WS91 1RVF2 1EAH3 1AYN3 4RHV1 5AC92 1M06G 1V9U1 3CJIC 5CFCA 1AR81 5C9AA 4CDXC 4GH4C 4RR3A 1RUH2 1DDLA 2RS52 3VBHA 4N43C 2RR12 1X33A 1VRH2 1PO22 4RS5A 1CD3G 1C8M1 5C9AB 4EJRA 1HRV3 4RR3B 2RS33 3VBHB 2R073 3ZFEA 1MQTA 2HWC1 1PVC3 5FOJB 5LK7B 2RS31 2BFUL 1PO12 1A6CA 4RS5B 1VBA3 5CFCC 1EV13 1D4M3 5C9AC 5BNNA 1R1A1 4RR3C 1ZBE1 1R083 3VBHC 1EV11 2RR11 3JB4C 1AL22 1MQTB 3TN91 4RS5C 2WZR1 1RUI3 2HWD1 4Q4X3 5BNNB 4Y4YA 4CDQA 2RMU2 3ZFEC 1MQTC 3JB8A 1PIV3 1RUG2 1RUD3 4FSJA 2FZ1A 1PIV1 2TBVA 2WFF2 5BNNC 1QJX2 3M8LA 1RUD1 2RM21 1Z7S3 4CDQB 1RB8G 1RUJ3 1AL21 1K5MC 4QPGA 2DF7A 2ZZQA 1QJU3 4FTBA 4CDQC 1RHI1 4GB31 1RUE2 1HRI2 1X36A 1RUC3 2HWE1 1AYM1 4QPGB 3ZFGC 1C8NA 1H8TA 2MEV1 1NA1A 3JBG1 1POV0 4AEDC 2FZ2A 3VBUA 1VBD1 2XBO2 5ACA2 1FOD3 4QPGC 1OOPC 1AR73 3JD73 1VBE3 1FMD1 2HWB2 1B35C 1PGW2 3J8F3 1H8TB 1NA1B 1POV3 1QQP1 1TME3 1RMU3 3VBUB 1HRI1 4NWWA 3CJIB 2X5IA 1BEV3 4CDXB 1MEC3 1BMV2 1FPN3 5DDJ2 2WS93 4RHV3 1QJZA 4Q4Y2 4N43B 1V9U3 1NY71 2HWF2 1AR83 1H8TC 1NA1C 2RS12 1E57A 1R092 1QJY1 3VBUC 1ND2A 1BBT3 5FMOL 1HXS1 2BFUS 5GKAC 1ASJ2 2X5IB 1NG0A 1PGL1 1BBT1 1PGW1 2VQ0A 1C8M3 1AR62 2IZWA 1ND2B 5L7OC 5CFCB 2X5IC 2HWC3 1F2NA 4PDWC 4CDUA 1TMF2 4JGZA 1AR92 2R072 4Q4Y1 4IV3C 1PVC2 1VBC2 4N53A 2R062 1R1A3 1RUH3 1RVF1 1ZBE3 5AC91 1ND2C 1COV2 3VBRC 1ASJ1 2RR13 4Q4V2 2WLPA 1RUH1 4CDUB 3TN93 1R082 2RS51 1IHMA 4JGZB 3ZFEB 1RUF2 1AR61 2WZR3 1VRH1 1PO21 2HWD3 3VBOA 1K5MA 5K0UA 4Q4X2 4CDUC 4JGZC 4QPIC 2R061 4N53C 1ZBA2 3VBOB 3S6PA 1K5MB 2RM23 5K0UB 1PO11 5C4WA 2BUKA 4NWVA 2ZAHA 1AL23 4SBVA 3ZFGA 1WCDJ 4AEDA 2R042 1OHFA 1RUF1 3VBOC 1ND3A 5K0UC 1RHI3 1OOPA 4IV1A 5C4WB 4GB33 1QJU2 1B35A 3ZFGB 1RUG3 2QQPA 2RMU1 4AEDB 2HWE3 1AYM3 4WM8C 1NOVA 3VBSA 1RUG1 1ZBA1 1RUC2 2MEV3 2PLV2 1ND3B 3JBG3 1AUYA 5C4WC 1OOPB 1VBD3 4IV1B 2WFF1 1QJX1 1B35B 3IDEA 4CDWA 1FMD3 5FMOS 1FOD2 1W39A 1AL0G 1ND3C 1QQP3 3JD72 1VBE2 4IV1C 1RUE3 4Q4W2 1HRI3 1VBB2 2BPA2 3ZFFA 3J8F2 4RQPC 1TME2 1RMU2 1RUE1 4CDWB 3VBSC 5L7OA 1BEV2 4PDWA 1SMVA 1FPN2 1QJY3 4RHV2 4CEWA 1V9U2 4IV3A 1HXS3 4GMP1 1EAH2 1AYN2 4CDWC 2XBO1 2HWB3 2GSYA 3VBRA 5ACA1 5L7OB 4PDWB 4Q4W1 1VBB1 2HWB1 1VAKA 4CEWB 4IV3B 3LOBA 3ZFFC 4YVWA 1C8M2 5A32A 5DDJ3 4Q4Y3 4RFT0 2HWC2 3VBRB 1HRV2 1BMV1 2RS32 5DDJ1 1RVF3 5AC93 4CEWC 4WM7C 4BCUA 2HWF1 4YVSC 2RS11 1ASJ3 4QPIA 4YVWB 1R1A2 1R091 3VDDA 1EAH1 1AYN1 1ZBE2 5D8AA 5A32B 2RS53 1VBA2 1EV12 1D4M2 1AR63 1VRH3 3TN92 1PO23 5C8CA 2ZTNA 2WZR2 4YVWC 2HWD2 1TMF3 4QPIB 3VDDB 4N53B 1AR93 5D8AB 5BNPA 1HRV1 1RUI2 1TMF1 1VBC3 2R063 1AR91 2R071 1COV3 1PO13 4WM8A 5C8CB 1PVC1 4CEYA 1PIV2 1VBC1 4Q4V3 3VDDC 1RUD2 2RM22 5D8AC 1COV1 3VBFA 1VBA1 3NAPA 1D4M1 5BNPB 4FTEA 4Q4V1 1RUF3 1R081 1Z7S2 1GFF2 1VB4A 4LLFA 1RUJ2 5C8CC 4WM8B 5A33A 4CEYB 1RHI2 2RMU3 3VBFB 5BNOA 5BNPC 3NAPB 4GB32 1RUI1 4Q4X1 4RQPA 2WWSA 1ZBA3 2HWE2 1AYM2 4CEYC 2WFF3 1QJX3 3ZXAC 2MEV2 3JBG2 5A33B 5J96B 2R043 3VBFC 1VBD2 3DPRA 3NAPC 5BNOB 1HQNA 1CJDA 5ABJA 1Z7S1 4RQPB 1OPOA 2R041 1RUJ1 1FMD2 3VBSB 4FTSA 4GMP0 1QQP2 1AR72 5BNOC 4JGYA 1HX6A 3DPRB 1QJU1 1NCRA 5ABJB 2BBVA 2GH8A 1NCQA 2PLV3 4Z92B 5CFDA 1NY72 1RUC1 1VB2A 2PLV1 5JZGA 1MEC2 4GMP3 1QJY2 2WS92 3DPRC 3CJIA 4WM7A 4JGYB 2XBO3 5ABJC 2XPJA 4CDXA 1HXS2 1AR82 1NCRB 4YVSA 4GH4A 5ACA3 3ZFFB 1NCQB
chains in the Genus database with same CATH superfamily
4TLFA 3WW3A 4PT6A 3FBMA 4N43A 5CFDB 1VBB3 1X7NA 2XLFA 1VJ2A 2D40A 2VCCA 2BOIA 3EXUA 4YGBA 1CAWB 1UCXA 4OYUA 1AR71 1JZ5A 3EQEA 4JGYC 1UY2A 4Q0PA 2QQVA 5A1FA 2ZPXA 1SCRA 1AF9A 1UX7A 4QHZA 3H1YA 1RMU1 2VMGA 1BXHA 3FUOA 4DXSA 4FPEA 2KXLA 5FOBB 2VOWA 3AFGA 2BERA 2Y8KA 5A3WA 1J3RA 2WNUA 2HWF3 1MEC1 4TXWA 4UF0A 5JZGC 3IZOA 1R093 2WS91 1OKOA 1RVF2 1EAH3 4EYUA 2WABA 4XTPA 1HJFA 2YFZA 4M3CB 5BNQA 3VD9A 3CU7A 3ZR5A 5FJHA 4LA3A 4MZUA 1X8EA 5D1IA 4Q1PA 5JMOA 3NNFA 2J22A 1UZZA 3MV01 4KWUA 1GBGA 1HB1A 3WF1A 1VRH2 5DAXA 4AG4A 1AZDA 5HPOA 2DCJA 1U5XA 2QQMA 1S1AA 2BGOA 2HEVF 1IG0A 2WT0A 4FPOB 4IW3A 3WR0A 3GYDA 2B4KA 1H1AA 4KL1A 3KD4A 4OMDA 4C0HA 3A22A 4LHLA 4LOSA 1PK6B 5ISLA 5BUVA 1O3RA 3ZMNA 4IE5A 4E4HA 5SV8A 3MPBA 1IPJA 2YUEA 3P3PA 4LKFA 1AX2A 2YV8A 3VD5A 4URAA 1C5IA 3I2FA 3PVEA 3VKMA 3QCWA 4AHXA 1ZNPA 4DXZA 1RGSA 1ZZ7A 3LA7A 3O1OA 2BFUL 1PO12 1A6CA 4WBBA 1VBA3 5C5TA 4UT5A 1EV13 1ENRA 3AVSA 5JPNB 4E8CA 1ZBE1 4PQ9A 5A80A 4ITCA 2ILMA 1M4WA 2RR11 2VTXJ 1PMJX 3JXSA 4XQ4A 4CYDA 2WNEA 3ZN6B 5LEJA 1XJAA 3MIEA 3ZVXA 2G9GA 5FZIA 2VY0A 3TNQA 3N9MA 1GNYA 1ZRFA 4YW3A 3RPQA 3AP5A 4PIYA 2YHJA 2PQSA 4L11A 5BNNB 1WBLA 4JRLA 4Y4YA 1PHMA 5D2AA 5FAXA 3ZSMA 5FZKA 5FUPA 4COYA 4LUMA 4XW3A 2BOJA 1MQTC 1LKNA 2WO7A 2ZMNA 4LKEA 5EFUA 5C6CA 2K2SA 4S2HA 2P34A 4UWDA 3CO2A 4UBHA 5BXXA 2W2IA 3LAGA 5FO7B 4BQWA 3V0BA 1FXZA 1XBFA 1W05A 5LATA 1DQ2A 1W6MA 4M01A 1QJX2 3EBRA 4XF9A 1Q8PA 1POQA 2DU0A 1RUD1 3M8LA 1K42A 2ZCWA 5FZLA 3APBA 3M4FA 1H8VA 5KR7A 1W2NA 3O1UA 1CAXB 4XF0A 3OGSA 5T5OA 1NQDA 1CZVA 1PM4A 1W04A 1WA4A 3VKOA 4QXBA 3W59A 1N1TA 4FAHA 2DF7A 2YB7A 2ZGPA 4IE4A 4KU8A 4XABA 3IMMA 1OVPA 4FPYA 3U1XA 2LS6A 4CDQC 1RHI1 3BALA 4C1WA 4CU9A 4UW6A 3AP9A 4K40A 1ZYBA 2CWMA 4AGVA 3NL1A 5IVEA 3BPZA 2E7TA 3MIFA 2QKDA 1V6OA 1YFYA 4XILA 3A23A 1UZVA 2B9VA 2VVFA 1UY0A 3VL8A 4LITA 4DUXA 1KDMA 1NA1A 3N7MA 1UZ0A 3H7YA 5EJ1B 4AEDC 2FZ2A 1W8UA 3KCYA 4I0BA 3HEIA 5FUNA 1Y9QA 3VKNA 1JU3A 5ACA2 1CESA 1FOD3 1LGBA 2NYYA 3D6EA 4TN7A 3NNMA 1HLCA 1XNKA 4UFJA 4GWMA 5HXVA 1BYHA 1OOPC 5CG8A 1VBE3 2W1WA 3N9PA 5HV4A 1XRUA 1ZZCA 3I49A 4PI0A 3PNAA 2Q8CA 3VKLA 1H8TB 2LUWA 1POV3 1V00A 5H9RA 5DUVA 1G9DA 2MNGA 5FPAA 3D82A 2D3SA 2R32A 1HRI1 2D6PA 3A21A 3WSOA 4XZUG 3AZZA 4EWDA 1BMV2 3UV9A 1FPN3 3E6DA 5DDJ2 3A0KA 5GZDA 5T5JA 3RRDA 4MG2A 5H9PA 1XYPA 2BWCA 4FVVA 4XTMA 1NY71 4KWLA 4Q1RA 4XUPA 1AR83 5FY8A 3NV3A 2OX0A 3FZ3A 2VR4A 3POSA 3VBUC 2PHUA 3KV4A 3WEZA 3OPWA 4NN0A 4BQ5A 3VZNA 4HSJA 4B3NA 4KNCA 2YPDA 2ZMKA 2X5IB 5JMCA 5FZ7A 3R4DB 3ACHA 1L3JA 2Y6JA 2JG8C 1BBT1 2Y34A 3IDAA 1RITA 1GUIA 2VQ0A 3N35A 5FYVA 3FL7A 4PBPA 3POBA 5CISA 2WYFA 3D3AA 3KVBA 5A6XA 2PHLA 3ETPA 3MHZA 3IMNA 3TB0A 3B94A 4HPKB 4IGQA 3RSJA 2GDFA 2OXBA 3GGLA 2X29A 2VNGA 3J7LA 4Q4Y1 1BHGA 2JG9C 3FBYA 1XB9A 2G9ZA 3WZ1A 5IK7A 1VBC2 4S2FA 1S0JA 3FLPA 2D6MA 1ND2C 1OUSA 4AFDA 4YARA 1DG6A 3AKRA 2R6QA 3GZEA 3OBAA 3VBRC 3JZVA 3WY6A 4UYBA 4P14A 4Q4V2 3UJOA 1TNFA 5F7UA 1US2A 1REFA 2ARBA 3TN93 2ZMLA 1W03A 2HYKA 2VZOA 3FLTA 3GHNA 1DF0A 4A3ZA 2WAOA 1ULOA 1RUF2 2JEMA 2WZR3 4XURA 4C90A 1E5HA 1K5MA 5K0UA 2UYAA 2EAAA 3A7QA 2I74A 4GAZA 3SEEA 1SACA 1TQ5A 2QE3A 3IKWA 4RL7A 5KXDA 1R64A 5I91A 2PTMA 2VD7A 1JYWA 2W92A 2WUHA 2ZGOA 2XQRA 4BU2A 4D94A 2ES3A 4QKDA 3HIFA 5E8AA 3FFZA 1ENSA 2ZACA 3M2MA 2BVBA 2VUAA 3LZZA 2IVIB 1P8JA 4XHXA 1G9BA 3IIIA 5F3CA 2BUKA 1ODMA 1AL23 4BK4A 4FP2A 4SBVA 3BUCA 1ZZ6A 3H50A 1BQPA 4Y26A 1Y4WA 2A6YA 3WNKA 1C1FA 2VJXA 5IVYA 4AI8A 3S7EA 5EXOA 3WG4A 4M4RA 3I2KA 4LBJA 1W6OA 1UU6A 2XHNA 2OT7A 2C6SA 5T3NA 4K1ZA 1PZ9A 3URFA 3WXPA 4GB33 3W9AA 1QJU2 3H8UA 1ACCA 1B35A 3ZSLA 3I7DA 1O7FA 1RUG3 5DUWA 3D0SA 4XC9A 4BA6A 3QH6A 1LGCA 2VW0A 1GKBA 2HWE3 1AYM3 3I2DA 4QX1A 4AEDB 1Q8OA 1W8FA 5EPAA 1RJ8A 3LIHA 4OHXA 4U2AA 2PLV2 1ND3B 1LESA 1T2XA 2D98A 3AKTA 4FOQA 1OOPB 3GCXA 3P1IA 1O5LA 5FZOA 5FP7A 4UFKA 3P5BA 1E5IA 5FLIA 2ZGMA 2J1RA 3K51A 2DUPA 2JE8A 2CU5A 2PAEA 1EUUA 4LBQD 4CDWA 4FPCA 5H9QA 3B00A 3PL0A 1W39A 3OPTA 2VGDA 1LOEA 5FWJA 3ZXFA 4Q2FA 3JD72 5DPNA 4IV1C 1LTEA 2E7QA 1W0PA 1OURA 1VBB2 1K45A 2E26A 2ZA9A 3IPVA 1UL9A 2WJSA 4E8DA 1IKPA 2BGPA 2XL7A 1UKRA 3WT3A 2K46A 1RUE1 3GBFA 1QNWA 4B1MA 4BK5A 4COWA 4Z2WA 1ENQA 5JI9A 5C3PA 2XXZA 1LHNA 1BEV2 3ROUA 3E5UA 4E27A 5A7OA 3MFAA 4F8AA 2BEOA 4HN1A 4PDWA 2WA4A 4NMIA 3J7NA 4XDOA 3RI8A 3IDBB 3JQWA 5CA6A 1QJY3 4RHV2 3MIBA 1RL3A 2XJQA 4IV3A 1C1LA 4HFSA 3ZXKA 2A6VA 4R9AA 3D4KA 4P08A 4PIZA 2RE9A 1EAH2 3ZSEA 2XBO1 1JW6A 4QPYA 5FBJA 3R6SA 5BYNA 5FQ0A 2YYOA 1LNSA 4QDRA 2VTXA 2VNRA 3ZO0B 1LOBA 3Q8FA 4QMAA 5K7PA 1J83A 1KRIA 2ZABA 2HWB1 3O0WA 3FJSA 3LOBA 4YRDA 3ZFFC 5JDBA 1C8M2 1IS3A 2YC4A 3RJ2X 4R9BA 4TYSA 4O61A 1H0BA 2W08A 3KV5A 4LBQA 4Q0UA 4WVMA 3VZLA 4IEWA 2V73A 2EIEA 4RFT0 4Y33A 2HWC2 2PELA 3VBRB 1DQ1A 2GH2A 2VULA 1LOAA 4CXXA 2JKBA 4NHXA 1RVF3 2X10A 5IAVA 5FY9A 3JU9A 1QDOA 2XDVA 3HN3A 4KU7A 2BDRA 2ZOEB 2RS11 1ASJ3 1XXNA 1SEFA 4FBFA 1R1A2 5AFBA 4AEKA 2R16A 1AYN1 1GANA 3QH7A 1C28A 4JRAA 4CU8A 4Q26A 1VBA2 1EV12 5CKMA 2GNMA 2IXCA 4YFWA 2DCTA 3O1VA 1AR63 1UOGA 1VRH3 5C71A 3OOXA 2VXJA 2JDZA 4NRMA 2RDQA 3WF3A 5C8CA 2HEWF 2ZTNA 3H1WA 2JE9A 1PX3A 3MDPA 4CUGA 4E4ZA 3VDDB 1I5ZA 1JZ4A 4JCKA 2XVGA 5D8AB 2PHDA 3ACLA 3VUOA 2X8KA 1LOGA 1HRV1 5IUQA 2WO3A 1H1IA 2XJSA 1TMF1 2WR9A 2Z79A 4J25A 4URTA 3MF9A 3U78A 2R063 1CX1A 1D7PM 1AR91 3POJA 3ZXLA 2R071 5I0DA 3SC7X 2DBIA 4DY5A 2CDOA 1PO13 3VZOA 4WM8A 4CCJA 5CNAA 1YCIA 4CEYA 2DBNA 4ES8A 1RTVA 1COV1 2P4EA 1AJOA 1RYYA 4XUQA 1W2OA 1WLTA 3HNBM 1ZZBA 1R081 1RJ7A 1WW4A 2Z42A 4IETA 4X6QB 1DGRA 4QX0A 1VB4A 4H7LA 4IEXA 2XMLA 4DOUA 4L8QA 4E4DX 3T4VA 1BLZA 3RYPA 2ZX4A 3VHOA 1DZQA 2ZEXA 5FYHA 1W8NA 3FX3A 5JOZA 2QQKA 3BN6A 4QU2A 3VHNA 2WA3A 1CAXA 5BNOA 2BVVA 2XOMA 3NAPB 1KJRA 3B69A 1WCSA 2ZJCA 4Q4X1 4ZZ8A 3ENRA 2FMYA 2WWSA 1VPHA 3AVRA 4LO6B 4FFFA 1ZRIA 2JXAA 3C2UA 4LBNA 5AVPA 1W6PA 1YHFA 3PHMA 2Y0OA 3WNOA 4QD2A 1OSGA 1XYOA 4EN8B 1QJX3 5A3NA 2DVGA 3JBG2 4AFBA 3AZVA 4M3CE 3AZYA 2VNVA 3DYOA 3VBFC 3AK0A 4U36A 4Q5OA 2QQLA 5ABJA 4CCCA 4OHZA 1U5ZA 1Z7S1 4AFMA 4O9GA 5A3PA 1OPOA 2R041 1LHWA 3OY8A 2J1EA 4IEQA 3T0AA 5BPXA 3OF1A 4OUEA 1FMD2 3PLQA 4MGKE 1KD7A 4FTSA 4FFGA 2AEZA 4XJUA 5EYYA 4AI3A 3RZZA 4XXPA 4JGYA 1HX6A 3CDZB 1GU3A 5CVRA 2BNNA 5FZDA 2JDAA 1STMA 2XLAA 2ETEA 4PF5A 3AP6A 3KF3A 4MXVA 1ULCA 4EN6B 4CXYA 1QJFA 1I5PA 1RUC1 1VB2A 1H2NA 2Z69A 3M3EA 4AW7A 5JZGA 4GMP3 4H2AA 1OKQA 4XFFA 3UT0A 2E53A 2VZRA 5LW9A 3RZGA 2FDIA 3DPRC 2VECA 1LCLA 3I2JA 4LK6A 1CZTA 1HXS2 1AR82 3LPFA 4YVSA 5ACA3 3ZFFB 5JR2A 3ZXDA 1VALA 1NCQB 3MF6A 3NJVA 5LRRA 4AFAA 4DINB 2EXKA 5F37A 1PGL2 2W46A 4Q4W3 2WN3A 3GDBA 4D6RA 1J59A 3HAGA 3OUIA 3R05A 5T55A 1DQ4A 3RDIA 3M1HA 1S4CA 2F4LA 4R4ZA 4C91A 3VHPA 4ZY9A 1GP6A 1QDCA 3KWVA 1G9FA 2JECA 2ZBJA 1W9SA 1MS0A 1NCRC 3J8F1 4LBMA 5EHDA 5BV6A 3AMNA 2V09A 1TME1 3PURA 4NVPA 2ZEZA 4XFHA 1F8VA 2BYVE 3AZXA 2A6WA 4XFAA 5CFDC 4COZA 1GV9A 2YGLA 1GZWA 1I9RA 2GU9A 1CR7A 5FYBA 3B5LB 3VD3A 4IE6A 3KV6A 2A3XA 3ST7A 5K9YA 3O1PA 1V9U1 4QKFA 3BTZA 3WP6A 1NE6A 1FX5A 1GP4A 4PLMA 2B46X 2J1AA 3HT1A 2C0ZA 4Q29A 3VZMA 4Z8BA 2RJ2A 5CAZA 3C7HA 3H1MA 1ZM1A 2WLQA 1V0AA 1UPIA 1PO22 4OHWA 5HBAA 3WV6A 5FZGA 5A3OA 4B7KA 2V72A 1N1SA 3SMHA 4ZS2A 5A6QA 2VZPA 3LA3A 1GWKA 4EJRA 5C9AB 4OI0A 1CAUA 2Y0IA 4RR3B 1MS4A 2WDBA 5D21A 2DFCA 1HW5A 4CCEA 2WNVB 3VBHB 1O6UA 4JV4A 1MQTA 1GWLA 2G4IA 2W1UA 3MGUA 4LE3A 5FOJB 5FZ1A 2WWUA 5L73A 5LK7B 4BM8A 2Q1MA 1X8MA 1SBFA 4BE3A 5DAPA 3I59B 4RS5B 5CFCC 4KWJA 2ZHLA 3CIHA 5JXHA 1YFWA 3WHTA 4RGKA 3RMXA 1IS6A 3FWEA 4YZ3A 4D69A 3WNXA 5LZ6A 3VZJA 4XQWA 4NUBA 2QDNA 5EQUA 3CQOA 1KQRA 3JB4C 1AL22 3GZUC 4BH9A 3O0XA 4CEYB 1XPWA 3E6BA 3TOJA 3NVCA 1F35A 5JAXA 2CWSA 3LIGA 3VB9A 2R1BA 4XF4A 4MV2A 4UW4A 5J7MA 1JYXA 3WQ1A 1RUI3 1Z78A 1IS4A 2HWD1 5I8SA 4HVRA 5LK5A 5LEKA 4JQTA 4CDQA 1PZ7A 2W87A 1H4GA 4LIVA 4XBLA 5G05L 4AI9A 2P5BA 2Q5TA 4AVCA 3PVBB 1HQLA 4K3UA 2WIIB 1MVQA 1RUG2 5CBLA 1RUD3 1V6NA 3P3NA 1SLBA 5LBCA 3BIWE 4XXAA 4XACA 3WINE 2YFUA 3CMGA 5BNNC 2WFF2 3UKVA 4QB1A 2YBPA 2RM21 2ERFA 2W52A 2EXJA 3SKVA 2QQOA 1RB8G 1W2TA 3K4ZA 4ARYA 1OA3A 2VC9A 3ZLIA 4AGRA 4CA9A 2GMMA 3NJXA 2EA7A 5IVJA 4Q0SA 4W6WA 5IYYA 2CL2A 1QJU3 2WO1A 3NW4A 4AZZA 4L97A 3CZUA 2ZKNA 1QKQA 1SDDB 1UOJA 4O65A 4I0WB 3U11A 2VQTA 1XC6A 3MW3A 4IEZA 4EWEA 5FY5A 5FTTC 1DGWX 2A70A 1OC1A 2GALA 4QPGB 2JDNA 2ZKLA 5FCCA 1JN2P 2XGXA 2P6CA 4CUAA 3ZFGC 1UY4A 1C8NA 1QU0A 2MEV1 3I8TA 2JICA 1SDWA 1MVEA 1JYNA 3VBUA 2OPWA 1CPMA 1VBD1 3UJQA 2NQYA 3KQRA 5FYSA 1CGPA 2H0BA 2DCKA 2WL1A 4G9SB 3I2IA 5A7WB 2IXKA 2UWAA 1PMHX 3HMYA 2JG8A 3WW2A 1TEIA 3JD73 3I97A 4IEOA 2QBXA 4IQPA 1F15A 3C8XA 4HVOA 4B8EA 1HKDA 2ARAA 3USUB 4DRRA 3IAPA 1XNCA 3I54A 4NRPA 1QQP1 4P00B 2PHRA 5DUUA 4AEJA 2ADDA 2AREA 2F17A 3OSDA 3B02A 4OMCA 1BEV3 4AF9A 4D0QA 4BJ0A 5C8WA 4RGGA 4OCTA 2Y6FA 4IESA 3JUUA 4RHV3 3CJXA 4CP9B 3IT8A 4LO4B 2JG9A 2JWPA 1H8TC 1WMXA 1QNYA 2KR2A 4PBOA 1E57A 2P3KA 2DVBA 3I3MA 2IXHA 1W8WA 4LJHA 3NKTA 1ND2A 1BBT3 4QX5A 2P37A 4ZS3A 1JYVA 1GOFA 3SQOA 1GICA 1ASJ2 1SFPA 2PHFA 3EO6A 3THCA 3WDTA 2D43A 1NG0A 2BU9A 1ULGA 1W8ZA 1WCKA 2MHFA 4N8MA 2XONA 2DVFA 3AYAA 3MIHA 4Y3OA 4E4SA 5CEHA 1WD4A 3BOWA 5LA1A 2J1TA 3O0VA 1XNTA 1WD3A 4BXFA 1C8M3 1AR62 1NE4A 1U12A 4NO4A 3A0NA 3NSTA 3HQUA 1JH5A 3VKFC 1QXPA 5L7OC 5LA2A 2QDRA 5CFCB 2X5IC 1LOCA 1SBDA 2HWC3 5FREA 3SISA 2QTWB 3HR9A 4IE7A 5FZ9A 5IWFA 4A2UA 1G9CA 3MYXA 4CP2A 1D4VB 2O14A 4A7ZA 5EP9A 4XDPA 3OJBA 3WNPA 5I0UA 4QKNA 1PVC2 3KHCA 2R062 1R1A3 5FZ8A 3RQ0A 3NNLA 2EVXA 5AC91 5HI0A 3OUHA 4FQ4A 5HV0A 1ULEA 1LRHA 4H3WA 4LBLA 1UY1A 1IPSA 1RUH1 4CDUB 4YSFA 2RS51 3VHRA 1Q3EA 2IXLA 4JGZB 1O3SA 2FCUA 2RHPA 1NZCA 1YFUA 3WUCA 1QHDA 3GM8A 1JODA 2ID4A 1UO9A 3ITQA 1SFNA 1Q8QA 2ZHMA 4H55A 4LKDA 4JKMA 2VOKA 4RFRB 4I3GA 5FK8A 1XNBA 2O1QA 3PDQA 5JIUA 2QZ2A 3AP4A 1RINA 3C7FA 2VZSA 3AMHA 2OQ6A 1F9KA 3V0AA 5LA0A 4QAWA 3IWZA 3THDA 1HB3A 4QPIC 4LO8A 4LLOA 1W6QB 3VBOB 3OD4A 3AJZA 4BLJA 4C1XA 4AI1A 3BU0A 3W20A 4NWVA 1WWYA 3W5NA 4Y1UA 4LQRA 3SITA 2BV4A 3FHAA 5KHJA 3LPGA 2XVLA 4GWNA 2Q8EA 5G04L 2V5YA 1T6BX 1OHFA 1W3VA 1RUF1 4GULA 5IVVA 3RI9A 1DQ0A 4ASMB 4Z07A 3OYWB 1O59A 4Y1ZA 2CSGA 2J42A 4IV1A 5FZAA 2Q8OA 5C4WB 4FFIA 4XPVA 5I8TA 1QOOA 5JLVA 3MUY1 2EIBA 2EAKA 2EICA 5FPLA 3ZFGB 3LSDA 2WQZC 1VMFA 4K9SA 4OLLA 4Y1VA 2RMU1 3HN1A 3SH4A 2ENRA 2D6KA 1BZWA 1AX1A 1BVVA 3K48A 4LBKA 4AI2A 4BQYA 3WQ0A 4XOGA 1LHUA 1JMUB 1U0AA 2JE7A 5GLZA 1DYOA 2BGCA 3JBG3 4MHRA 4A7YA 3K77A 1AUYA 1DP0A 2GP5A 4QXCA 2TEPA 2FDGA 1YYNA 1QH6A 2ADEA 4OI2A 4FPLA 4HMZA 2DWRA 2ZGNA 4IEYA 1WA6X 1VR3A 2FDKA 4FXGB 4PHZA 4YZ2A 1FMD3 2ZX2A 4TTGA 3OPZA 3E6CC 4Q0QA 1ND3C 4P5YA 3CZJA 5ERLA 1OT5A 3QACA 5F5QA 4K20A 5BY5A 4JQRA 1RUE3 2Z2SB 2VXRA 4Q4W2 5L9BA 5JUVA 1JYTA 1OA4A 1W6NA 1XSQA 2VO5A 3ZFFA 2C24A 2Y38A 3ZYIB 4JTOA 2D6OX 1RMU2 2W68A 3WOGA 3SCGA 1DBNA 1GQGA 3VLBB 3VBSC 2QUOA 4DUWA 5FDBA 5A1AA 3MEPA 4JZRA 4P9WA 4OZOA 1SMVA 5FYYA 4YYOA 4NHMA 4A6SA 4ATEA 2ZGKA 4N7IA 3V64A 3H8XA 1URXA 3I2OA 3AYCA 2OIIA 1YIPA 1HXS3 4BISA 3ZIXA 3B9CA 5F39A 2RJLA 4HBNA 3DEMA 4YGEA 1Y9MA 2XVKA 2HWB3 1JZ3A 2XWJB 2XWBB 5L7OB 1JOPA 3KQ4B 3CBNA 2YC0A 1PNGA 4NIGA 4QQPA 2AACA 1C57A 1VBB1 4Q8KA 2C9KA 3HVDA 4I30A 4CEWB 4YW6A 4QHOA 5T52A 2IFRA 4CUCA 1YIFA 3U4SA 2E51A 5JXGA 5FYMA 1NLSA 3MI8A 2GC0A 1S0BA 2DFBA 1QY4A 1YWKA 4FI9A 3I4IA 1IPKA 3FFQA 3HOBA 3POEA 5IK8A 5FY1A 3KMHA 4WM7C 1O8PA 4BCUA 4QX3A 3T0BA 4LA2A 2HWF1 2QFEA 1DZTA 1X9TA 4FPJA 2D6LX 4NHYA 2IFWA 1R091 4YVWB 4WVVA 4OUMA 1EAH1 2J7MA 1ZBE2 5A32B 4AAPA 3ELNA 4R9CA 2B9UA 1F31A 4XHBA 5F5CA 2Z4FA 1SCSA 2W3JA 1WCQA 2VMFA 3J4UH 1Q43A 1PO23 2PHTA 2GZWA 4ARXA 4B4QA 4CP1A 2Q1ZB 2VUCA 2FDFA 3J26N 4AVSA 1JBCA 2JDPA 5JOYA 3FLRA 2BQPA 2YBSA 1OF4A 4GD4A 1TMF3 4QPIB 2GC1A 3T2PA 5J3UA 3AXDA 1AR93 4KG0A 2BBAA 4NPRA 5IJRA 4EE2A 3NV1A 1HB4A 2WNUC 1UN1A 2RDSA 1RUI2 3DXTA 3LD8A 1Q8SA 1ZA7A 2SLIA 4R52A 2E6VA 5IVBA 4PIXA 2UU8A 2Y6LA 3DYPA 1COV3 4HOOA 5JR7B 3WQBA 5C3OA 1O4TA 5IT6A 1KXGA 4LULA 4XFGA 4YLZA 4X8NA 5FZ6A 1RUD2 3VDDC 1K3IA 1QOTA 1ULDA 2OVUA 4QXHA 5D8AC 5FXVA 3RGBA 4L99A 1VBA1 3VBFA 4MLOA 3WVJA 4CE8A 5KXEA 3VD7A 4A6OA 5BNPB 4QM9A 1HQWA 3ZXJA 4FO9A 2A6XA 1UOBA 1WW6A 5JXIA 5FRAA 3ES1A 4UXAA 2ZGQA 3PU8A 4HLTA 3LCPA 3MW2A 3UYJA 3PIGA 3KCCA 2VOVA 4I3PA 5A33A 2H6CA 5L9RA 1AXKA 1QWRA 3MO4A 4IGPA 5ANNA 4N9HA 4ZXKA 1HJGA 1LODA 1RHI2 2AR6A 2PAKA 2PN5A 3LEGA 4HKOA 4IL7A 4QQLA 3N3HA 3KHBA 4UI9L 4Y20B 5JWPA 2A3WA 2Z5WA 4AOCA 1ZRDA 1MR5A 3DXUA 2V5DA 1H9PA 2VOTA 4RQPA 3S30A 1ZBA3 3N9OA 1YQCA 3H3UA 4CCLA 4OHYA 1EPWA 2Q30A 4B7EA 1CQ9A 1Y43B 2CAVA 2Q0AA 2WFF3 3BTYA 3ZXAC 3SH5A 5C33A 2GNBA 4HKWA 3B93A 5CG9A 2R043 2ZX3A 1AXZA 3NAPC 3DPRA 1UY3A 1UF2C 1OH4A 1HQNA 1ZA4A 5I8YA 1OMIA 2ZX1A 4BIOA 1J3QA 1KS4A 2FMDA 3T1LA 2YZ4A 1ZREA 1LULA 3SHRA 1G7YA 2AEYA 2Y6HA 1UZWA 4W6XA 5I0SA 3GZAA 2IXJA 3VBSB 5FZHA 1S2BA 4MXWA 3WNNA 3IAQA 4ATFA 2P17A 4AVAA 1A8DA 4BYYA 2E32A 2WYSA 2XH6A 4O7XA 1GMMA 2PQQA 3N9QA 4MX3A 3H3LA 2LM3A 1NCRA 5A7WA 3MIGA 1HDKA 1F5FA 1CZSA 4YM3A 4NPMA 1UD1A 1N47A 5CFDA 3T08A 5J48A 1SPPB 3JCIA 4YWAA 1NY72 2JIGA 3BOPA 3HQRA 3H42B 1SHWB 1CAWA 3SNMA 3ZOIA 5AVAA 2PXJA 2WT2A 1XE7A 2CNAA 1VMHA 1XE8A 1YJKA 2ZEWA 5CZKA 2LRPA 3OGRA 4YNIA 1LJ7A 3LKJA 3S5QA 4QB6A 4LHNA 5A7SA 4OQ9A 5C3RA 5KHGA 4QM8A 2XUEA 1BBT2 4TZDA 3GBWA 5FZFA 4XFCA 3CLPA 3VL9A 1FOD1 4K6BA 1S2KA 3MIDA 4EN7B 4KQ7A 4Y22B 3ILRA 5E88A 2VZQA 1VBE1 4L92A 4MGYE 4M3CA 4WM7B 5FK7A 1JU4A 1POV1 3AYEA 4JHTA 4GH4B 1NCQC 5CYYA 3E5QA 3U0ZA 1H6XA 4NHKA 1H30A 3VN4A 5FYTA 1FPN1 1AVBA 3F95A 3KSCA 2YU1A 3RMYA 1BCXA 3RZKA 5CFCA 4JVAA 1TVGA 5K4LA 1AR81 1J1LA 3T2OA 4CDXC 2VUDA 1PK6A 1L7QA 1YQ5A 4KI5M 3N9LA 4KG8A 1DDLA 1G9AA 1OD3A 2YDEA 1UMIA 2OKXA 4BDVB 2OS2A 2RJKA 1C3HA 3ACGA 3WG3A 4CVUA 1X33A 3LDKA 2G19A 2WNUB 5A7PA 4AQ2A 5L36A 1UXXX 4UF0B 3KT1A 4D6QA 1YI7A 1DLCA 2NM1A 1LEMA 3IIAA 1FYUA 2ZGUA 4KBBA 5F2SA 3DYMA 5FZCA 2HJIA 3BKZA 1SLTA 2DU1A 3ZN6A 1KFUL 1XU2A 5B4XA 1DFQA 1PVC3 3LA2A 4MGZE 4YW5A 5DQ0A 5FP3A 4DFSA 1VAMA 3ZN4A 2RS31 3BI3A 4WV8A 2Y64A 1AX0A 4H14A 4AWDA 1OQDA 4BWOA 1K12A 4DMIA 1D4M3 3UK9A 2VZUA 5C9AC 1VRBA 3LWCA 4MOAA 4QB2A 2E63A 2B39A 4RR3C 5F32A 5BNNA 1OH3A 2BP6A 3LDRA 1UXZA 2OPKA 2WNVC 3VBHC 4COVA 3B9IA 4OHVA 4GALA 4Y5TA 1TE1B 1V6KA 4M0NA 1JZ7A 1W6QA 3ILFA 2EXHA 3TN91 5I0TA 4AVTA 4RS5C 3UGFA 4JDNA 5LBEA 4QT6A 2VNOA 3LEMA 4QX2A 2WZR1 4AHZA 2DV9A 3WF0A 1UAIA 4S2DA 3I2GA 3KB5A 3Q8EA 3AM2A 1PM7A 4B1LA 3ZFEC 2MPFA 2WQ4A 4PCRA 1IG3A 2WZEA 3JB8A 4CCKA 1DYPA 3ZR6A 4EWAA 1GZCA 4FPFA 2X05A 3IM0A 3K3OA 4FSJA 2FZ1A 3EHKA 5A3MA 3DV8A 4HONA 1PIV1 1UQXA 4XDQA 1LHOA 1SLAA 1LU1A 4MGQA 4O9EA 3PUHA 4EN9B 4GJZA 1RUJ3 4M0HA 1AL21 4XUTA 2OZJA 3ZYJB 1WZXA 1IS5A 1RUNA 1WMFA 1K5MC 4FPHA 3BGAA 1NAEA 2QZ3A 1O91A 2A6ZA 2ZZQA 2WT1A 3LQCA 5LASA 1UX6A 3IB3A 3V0BB 1AJKA 1W6MB 3O14A 4YM2A 3WQ7A 5H9SA 2JIJA 4QX8A 4XZPA 3ZSJA 4P9IA 4L2NA 4GB31 1RUE2 3RYKA 3UKNA 1H4HA 1A34A 1X36A 3NMBA 3ZDSA 2ARCA 3M3OA 1PVXA 2YBKA 5F5IA 2HWE1 1AYM1 3KLSA 2IC1A 4AQTA 5JSOA 1IZ3A 5A3TA 3WUDA 5FV3A 5T5PA 4HK9A 2E9QA 2R0HA 1H8TA 1UYZA 5DAQA 5FBZA 3RG0A 3T2QA 4HXCA 3MUZ1 1WMEA 2VBPA 2B42B 3ATGA 3E1F1 4AL9A 4P9JA 2XBO2 1YQ6A 4XJZA 4BIFA 1UIJA 2A3YA 4FPGA 1V6JA 1S2EA 4W65A 1JYIA 3O5SA 2UURA 2QQIA 4QPGC 4D7SA 1EYBA 5HXMA 5FYUA 1AR73 5IAXA 3U37A 2HWB2 5FR3A 1Y7BA 1JTZX 5DAWA 1B35C 1H9WA 1PGW2 2JD4A 2DCZA 1OLQA 3K4DA 3SCFA 1UMZA 1NA1B 1MZ5A 1LGNA 1RMU3 3GBGA 4BMBA 1V70A 5GM0A 4LT5A 3MLLA 2X5IA 2W94A 4CDXB 3Q8BA 1C4RA 1MEC3 4CP0A 2WS93 4Q8LA 1QJZA 3SH3A 2I2SA 1TNRA 4QPWA 5IFTA 1KDKA 1KS5A 2RS12 4IUGA 1QJY1 2GAUA 2W1QA 1CJPA 5J1XA 2CHHA 4WVZA 4B29A 4Z82A 3E5XA 2IVJA 4HPKA 1UWWA 2CY6A 1REDA 5DXDA 1US3A 4NOTA 3V65A 4JTNA 2CGOA 4OI4A 4P9YA 4R4XA 1XNAA 5IATA 3VV1A 4QU1A 3KT7A 3K3NA 4IEPA 3UGGA 3C7OA 5FUIA 1ALYA 2XUMA 3AJYA 4V2WA 4XCAA 1OLMA 1CIYA 3OUJA 1VAVA 4XETA 1OXCA 4PDWC 1JS9A 1SG3A 1TMF2 2JKXA 3CKHA 5FWEA 3WF2A 4QQHA 1AR92 4YZ5A 2L9LA 1IQAA 1V6LA 1W06A 2R072 3ETQA 2XG3A 1JXNA 2YC2A 1J3PA 4IV3C 4CU6A 1QOSA 4GXLA 3W5MA 3HWJA 4QHBA 4IE0A 1QMJA 1RUH3 1ZX5A 3FE5A 1RVF1 1ZBE3 2GC2A 4ZPIA 1COV2 3PUQA 1WGPA 5B2GB 4DS0A 2W47A 2CYFA 3L2YA 1JUIA 1ASJ1 2RR13 5DZFA 2W1SA 1DHKB 4QGMA 3N7JA 2KA3A 4YPJA 2CGPA 2ZGRA 1R082 4NIAA 3NO8A 3U75A 3ZMOA 2VPVA 5EJ3A 2XR4A 5JCTA 2NP0A 3ZFEB 1AR61 1VRH1 5FXXA 3T0DA 2H6BA 3T09A 3POGA 4RN5A 3LGRA 2KD7A 3O12A 4LR4A 2ZGLA 1LHVA 4Q4X2 3PU3A 4CDUC 3BODA 4MUVA 4JGZC 1XSRA 2CDPA 4K8FA 3HJRA 3ZYGA 5GZGA 2BW8A 1AXYA 4Y24A 2R061 2WZ8A 4N53C 4W4ZA 3MLKA 1ZBA2 4OVEA 5FY0A 2P3IA 5CB7A 3S6PA 4LEJA 1K5MB 4AK3A 5K0UB 3J7MA 1PO11 1ULFA 2Q8DA 3ZYRA 1MS5A 1GYKA 2W9XA 2ZAHA 4GA9A 4K21A 2FHRA 4LXLA 3KT4A 1WCDJ 4RGAA 4AEDA 5IFPA 2R042 4CRQA 4XQDA 4FOWA 2ET7A 2A5ZA 2H0VA 5FLJA 4UFMA 3VBOC 1ND3A 2AH2A 3MFCA 3AL5A 5DUXA 1RHI3 5KXCA 1OOPA 4KH9A 4D7YA 3IBMA 1H6YA 2PAMA 4DRVA 3IDCB 5CADA 2VW2A 3LE0A 4N9IA 4UFLA 2QQPA 3AKSA 2O8QA 1G8WA 4WM8C 1NOVA 3VBSA 3THPA 2ET1A 2ARXA 2EALA 4L9BA 4BOWA 4HL0A 4XFBA 1RUC2 1W6OB 1MACA 2UY9A 5C4WC 4QDQA 4NIDA 4BB3A 3O1SA 3H0OA 1A78A 1QJX1 4NR1A 4QWNA 1B35B 3IDEA 2E31A 2YMZA 3GXUA 4FFHA 1OLME 1SQ4A 1X9PA 2DCYA 5DAVA 2LALA 1O3TA 4GZ9A 3H9AA 1W0OA 4ASLA 4BZ4A 3GCWA 5FMOS 3EMRA 4YZ4A 2YROA 1SBEA 3B3QE 4Y1XA 2W5FA 3M7AA 5E1RA 5F3IA 1GWMA 5FLHA 3ABZA 2BZDA 1HRI3 2HBTA 3DCQA 3QD6A 5FZOB 3R4UA 1SLLA 2BPA2 3J8F2 3OGJA 2PYTA 3N7KA 1FNZA 1TME2 4J1WA 5CU1A 3TEZA 3G6JB 2Y33A 5F6LB 4CDWB 5KC6A 1YLLA 1D2SA 4F7ZA 2HYXA 2TUNA 2YXSA 4Y4RA 4IXLA 1KGYA 1NUKA 4OFGA 1JI6A 4S2GA 2WNOA 2WQ8A 4XYXA 1V9U2 5J36A 3IPVB 3AMQA 4E2SA 4EN0A 1VMJA 3AC0A 3LFMA 5GZEA 4GMP1 4UW3A 2OW4A 4TSVA 4JDOA 3KGZA 1QXJA 2VCMA 3VBRA 5FY4A 5ACA1 3S5AA 1DQ6A 3HQXA 1W9WA 2AGSA 1QJEA 1UU4A 2D7FA 1W90A 2NPIA 4PDWB 1S0GA 4INDA 4Q4W1 1UIKA 2IWGB 4JC1A 5LA9A 4IV3B 1ST8A 2XJRA 4A41A 2JB4A 3N4MA 3POFA 3HBKA 2XJPA 3UETA 3MW4A 4AR2A 4PI2A 2YGMA 2OUHA 4DEQA 3I3DA 4Q4Y3 4DQAA 3AB0A 5FQ0B 3VDAA 3AYDA 3AKQA 4EROA 5KC5A 5F5AA 1N3OA 1BMV1 1OUXA 2B5HA 5DDJ1 1YO8A 3BTXA 2K9ZA 2XQXA 4CEWC 3PMEA 3LF7A 1FNYA 1EPZA 4YVSC 1JZ8A 4LO7A 2ORZA 4FAGA 3VDDA 4CXWA 4UAPA 5D8AA 4C0BA 4CZSA 1X50A 5IK5A 4LBQB 4BXSV 2GC3A 4WVMB 3O1MA 1CAVB 1ZRCA 3FMGA 1D4M2 1E5SA 1UU5A 4LUKA 4QGNA 1CX4A 2UWCA 3LEIA 4WZFA 4CU7A 5JXJA 1GZ9A 1PNFA 2V4VA 1Y9GA 4C8DA 5I0RA 4YVWC 1J1TA 1HIXA 2HWD2 3U14A 1OF3A 2J1UA 4HETA 4N53B 5C3SA 4JKKA 3VGIA 3NNJA 4HANA 2W39A 3CNAA 1YQ8A 1MS9A 5F2WA 2LW8A 4DO0A 2RDRA 2XJTA 5HCHA 4XAAA 3K4AA 2BRTA 2QQWA 4HZFA 3W58A 5C8CB 1Q5OA 3WW1A 1VBC1 4ZKTB 1O4YA 5FZMA 4NAOA 2BNMA 2DTYA 1K5JA 2RM22 5JOXA 1W99A 2XKPA 2YG0A 5A1LA 2C4XA 3NAPA 4YG3A 5HCBA 1E5RA 3I2HA 3TRSB 2K0GA 4Q4V1 4FTEA 1RUOA 3S57A 2ZAAA 1YJLA 2Y60A 4MSVA 1CIWA 1GFF2 4NAMA 3POYA 4LLFA 1RUJ2 4KBZA 4XVHA 5CIRA 3ZDVA 4XE9A 3A4UA 4BQ1A 4WM8B 3UL2A 2N7GA 1BK0A 1A8MA 1EP0A 3L2HA 4X6RB 5FZEA 1FV3A 1V6MA 1WLDA 3H7JA 2DYCA 5DZGA 4AI0A 5E89A 5DG2A 5BNPC 4XUOA 2ZGTA 1NT0A 4XJAA 1RUI1 3OD0A 5DN2A 3KV9A 4P02B 5LBBA 3AFKA 3M3IA 5IVFA 3WDWA 1WLWA 3THTA 2VAUA 1FAYA 4QQ2A 4NROA 3LFIA 2PFWA 1T6GC 4OULA 5C3QA 4F3JA 1NXMA 1VLNA 1WMDA 3WDVA 1JUHA 3GNEA 1W3XA 2MEV2 4DY3A 5LY1A 1VBD2 5GLUA 5BNOB 4ZHNA 1CJDA 4FQZA 3NQHA 5F8PA 3WD5A 4D6SA 4Y1YA 2AUYA 4BPZA 3FUQA 4NRQA 2ORXA 2VBDA 2NMNA 2QQUA 2IUWA 3AXEA 5T5LA 5FKCA 4DZGA 2VMIA 2VMHA 1W6PB 4FOYA 4YZ1A 2F6BA 4I09A 4LK7A 1QQP2 2OQ7A 2PHWA 5DZEA 1AR72 4XJ9A 2KM2A 2AENA 5EYXA 1QJU1 3CHXA 4JKLA 1XU1A 5ABJB 2GMEA 1GZTA 1PX4A 4LMFA 2BBVA 2PHXA 1NCQA 1PGSA 2WKKA 2BJSA 3OY8B 4XIKA 5IHRA 3ZXGA 2A73B 2DVDA 3OG2A 1GQPA 5EIYB 2PLV1 3H8RA 5FMCA 3WG1A 1MEC2 3MV11 1A3KA 1NKGA 2JJ6A 2WS92 1GP5A 3ON7A 5F3GA 5LB6A 2C5DA 4ISRA 5F1RA 2HKXA 2XBO3 4JGYB 2XPJA 3POWA 4CDXA 2UY8A 3OCPA 4K1YA 4R8HA 1YFXA 3S7IA 2R49A 4RYDA 4I01A 4Y5Z0 3H8OA 3PVNA 3O1RA 2FD8A 2TNFA 2VCAA 1WKYA 3SEPA 2VVDA 3DN7A 2A75A 3RS6A 1OFNA 5JZGB 4ET7A 3LB9A 3JD71 5KHKA 3GHMA 4NIHA 1LOFC 4V2VA 4M3CF 3RZMA 3MZHA 4YVSB 4AVBA 1QEXA 1LU2A 3RYRA 5J98B 2OZ6A 3USSA 4AE2A 4LOTA 1HV0A 3PJYA 2RDNA 5HCAA 1BEV1 2VMEA 5A7NA 2FDHA 1GR3A 2R30A 2RS13 2Y26A 3NNGA 4Y5SA 5FP8A 4A42A 3J9SA 1BJQA 1AYN3 4RHV1 5AC92 1M06G 3CJIC 1QIQA 2DTWA 3U07A 2EF6A 4QQOA 1KEXA 5C9AA 5A3LA 4UFHA 4GH4C 1W8OA 2Y6KA 4RR3A 1NYWA 1RUH2 5DG1A 2VU9A 2RS52 2WNVA 1OD5A 3VBHA 3OEBA 2W95A 4N43C 1DGLA 5IVCA 4CPBD 2VZTA 3PUAA 1GZWB 5DABA 2RR12 5JPMB 5FO9B 5FXZA 3FN9A 3EB7A 2VH9A 2D44A 3GZTB 1XE0A 5FPUA 3I59A 1CD3G 4RS5A 3ZYBA 5LCWL 1OPMA 1DLLA 4YM1A 1H1MA 1JZ2A 1C8M1 1ZRRA 1HRV3 4JAAA 5FZ0A 2A7AA 1U5YA 5CKQA 2I45A 2RS33 4E9KA 4YW4A 3RZHA 2R073 2DDUA 1S0DA 2E33A 4HG6B 1LR5A 3CL1A 4M4PA 3ZFEA 2HWC1 1LB2A 2EIGA 3HT2A 1I1EA 2DVAA 2D3PA 2VL4A 3OB8A 2P3YA 5AFEA 2Y6GA 2O8OA 3VZKA 4ZU5A 4D8MA 1W8TA 1KJLA 1GNHA 2XLGA 5KHIA 3WP3A 4R9DA 3SXWA 4CCNA 2HEYF 4A4AA 1R1A1 5KBFA 3D0JA 1CAUB 2YPJA 1FATA 3WCRA 1R083 4W50A 2NMOA 1EV11 3WDUA 4CCOA 4B4RA 1FV2A 4LHKA 1MQTB 1DGWA 4AEMA 4GQ7A 1MS8A 1TZOA 2OUJA 4ZONA 4E2GA 4GKYA 3PJQA 4AVVA 2QNKA 4LO5B 4XJWA 2G1MA 4CSWA 1J84A 2DUQA 3ZIWA 5FPVA 4Q4X3 3MICA 4XBQA 4HT1T 4NE9A 4DXTA 2RMU2 2JDYA 2EIDA 3PMSA 3B01A 4CPBA 3OBRA 2VMCA 5FKBA 3NV2A 1PIV3 3N7LA 4OQ8A 1RXFA 4YFZA 5L19A 2VM9A 3N9NA 3OTFA 1HN1A 5F6KA 3BIEA 2VZVA 2VBBA 4K8RB 4NIIA 1APNA 3ACFA 4Z1VA 4GWJA 4MYEA 4K7JA 1LAJA 2TBVA 1W9YA 2VCBA 1GSLA 3SCHA 2VVEA 2ZEYA 1Z7S3 1LENA 3WDYA 3GALA 3WX5A 2FCTA 4CDQB 3JQXA 1MZ6A 2RVAA 3AKPA 5FMDA 5GZFA 4FPKA 1XOYA 5A6ZA 4PF1A 1SZBA 3ZM8A 4QPGA 2I07B 3NJYA 4UOJA 3S0MA 1OBNA 3I3BA 1XQNA 1RIRA 4JDMA 3VD4A 2E7AA 4FTBA 4IERA 3TWIA 2YY1A 2WWJA 3ZYFA 1DCSA 4LNVA 4BMEA 1N1YA 4GIQA 5T54A 4N90A 2GNDA 4HSLA 1HRI2 2F4PA 1DQ5A 5CKNA 1V6IA 2XJVA 3PUIA 1OA2A 1RUC3 1GQHA 3V56A 4H7MA 4TLGA 5I93A 5FP9A 4A7KA 3T30A 3USUA 4MADA 1W28A 3JBG1 2B7YA 3CF6E 3POIA 1POV0 1UNBA 4DUVA 4DNYA 3RZJA 2CGNA 4RSUA 4PQQA 3ZYPA 1CWPA 2DUOA 5LRSA 3GF6A 2WAAA 5M0TA 2WN2A 4ZU7A 5GLVA 2D5HA 3WP5A 1JOBA 1Q8VA 2FDJA 5FPZA 3Q9OA 4CUBA 3VDBA 3NKGA 4META 4CP9A 2P3JA 1OLRA 3PIJA 1FMD1 4LTAA 5TSWA 1GOHA 1W2AX 1OQ1A 2GNTA 3J8F3 4G3YC 3TBDA 1QH7A 5J09A 1TME3 2RG4A 1C5HA 3R4SA 3VBUB 2VTFA 3ZKUA 4NWWA 3L9JT 3CJIB 5SV5A 3MLJA 1YI9A 4CTEA 2VMDA 1GOGA 3BTAA 3J7HA 1L7LA 1DZRA 1YRZA 2JG8B 2C9AA 2WSVA 2X53S 4G4FA 2VOXA 4I02A 1V9U3 4N43B 1EUTA 4Q4Y2 4SLIA 2HWF2 4MO3M 3RJRA 1NA1C 2NLRA 1R092 3O1TA 1JOJA 4YG6A 2IXIA 5FMOL 2ZGSA 1IGOA 2J1SA 4ASKA 1HXS1 2BFUS 2JENA 4Z2AA 4P9XA 5GKAC 1MS3A 5A6YA 3K2OA 3KM5A 2W91A 3TYJA 2WZPP 1Y3TA 2WO2A 5GLWA 1PGL1 1WW5A 4DPNA 1B09A 1PGW1 2HLEA 1CONA 4XUNA 2JG9B 2PMWB 5J37A 4QDSA 4BHPA 2IZWA 2A71A 1CAVA 2AC1A 4IEVA 1ND2B 3Q8AA 4XFIA 5EWSA 2VZ1A 4FCAA 4FOVA 2HH9A 1F2NA 1ULPA 3C3VA 4CDUA 2ZHNA 2LROA 4JGZA 3DUIA 3TEYA 3DECA 3D8CA 5FZ4A 2WRAA 2JDUA 4N53A 3KS7A 4B4PA 3M3QA 2X09A 3DF0A 1EY2A 4AFCA 1ONAA 1ZZ8A 3EYPA 4L0PA 4XF3A 3F2ZA 2WLPA 2ZXQA 1DU3D 4MVTA 3ZPYA 5F3EA 2Q1FA 3P6BA 1IHMA 2VQAA 3PTYA 3UGHA 4IGOA 4AYUA 4GJYA 3RNSA 4YW7A 5C70A 5B4NA 1PO21 2HWD3 3VBOA 3AX4A 1LECA 4NPLA 3RWNA 3PTRB 5GJ6A 1CVNA 1ENXA 3T3YA 2V4AA 1S0CA 3WP4A 4ORFA 3M70A 1HV1A 4P5HA 4FXKB 1DGRN 1JHNA 5KXBA 1X82A 2AYHA 4P9LA 4HN0A 2D5FA 4AQSA 4MGTA 5A70A 1W8HA 3CEWA 3OYWA 4AAXA 1UKGA 2RM23 4UW5A 3ILNA 1TG7A 5C4WA 2GN3A 2BWAA 2C1FA 2WFPA 4LPLA 5A3UA 2VG9A 3ZFGA 3DKWA 3WLUA 1OFSA 1UYYA 5JSPA 1J58A 4XMAA 3V0AB 4GWIA 2CAUA 2P6HA 3LDBA 4A44A 4DB5A 4HKLA 4LHSA 3UESA 1WBFA 5FP4A 1F4AA 2ATFA 3K46A 3W21A 4JX0A 4EV0A 4KGQA 5K0UC 5FYIA 1Z0HA 4QXKA 1OI6A 1N3QA 1PZ8A 3KZ4C 3ZYHA 1OVSA 3H3ZA 3KF5A 3N36A 4ONUA 1W2UA 1W9TA 2HBUA 3HD8B 3FHIB 2B8MA 3ASIA 4QGLA 3BVCA 1ZVFA 2NN8A 1DYKA 1UYXA 4LE4A 4Q0VA 1DIWA 1RUG1 1ZBA1 1MS1A 3B7MA 3AL6A 2MEV3 1MPXA 3RZLA 1GNZA 2D97A 1D2QA 2VW1A 3RVHA 4YW2A 3LEKA 1VBD3 3ZKYA 4IV1B 3AZWA 2ZHKA 2WFF1 3ALQA 5FPXA 3EJKA 4MHUA 3UNPA 3WDXA 1YUDA 4W8JA 2G9FA 2OYZA 3AMPA 1GLHA 4NJ4A 4WVWA 4I2OA 1UOFA 1FOD2 1H2LA 1KFXL 1O4ZA 5EV7A 5JVVA 3NJZA 1AL0G 3PUSA 4PLNA 1QQP3 4TWTA 1VBE2 4XJ8A 1UYPA 3ES4A 3LSEA 3WCSA 3DGTA 3D5OA 4RQPC 4UFIA 3ZPOA 1UMHA 3OGGA 4I0AA 2FQPA 2R0FA 2NZ9A 4KGGA 1G86A 4IDZA 2A1XA 5LBFA 3U10A 2JX9A 4D7TA 1YC61 3NWKA 2ZX0A 4ZXEA 5L7OA 1FPN2 2D6NA 4BQ2A 1ODNA 1NXD1 5L9VA 3TEWA 4UBGA 2P2KA 4CEWA 4ZU4A 3AP7A 2JD9A 5JSRA 1W6NB 1VIWB 2EXIA 5EJZB 3UKTA 3X29B 3ZXEA 2WC2A 2WINB 3GJAA 1CN1A 3KGLA 4M00A 3NRUA 5APAA 1AYN2 4CDWC 2P1BA 3OBTA 1NLQA 4RA0A 3OBZA 2GSYA 4LORA 4LIUA 5JI7A 3C7GA 2LTNA 3T2TA 1QGLA 4EQVA 3ZX7A 1D0HA 1IKQA 2XKOA 4V1PA 1VAKA 5JIAA 2R7EB 1AHSA 3TNPB 1REEA 4YVWA 2W0XA 4QKBA 3SKJE 5A32A 3WNMA 5FYCA 4YG0A 5DDJ3 3WHUA 3BCWA 4BQ4A 3MPPG 1YXWA 1CPNA 5GZCA 1YNAA 1IOAA 2J1VA 2JDKA 1S55A 1HRV2 1PMIA 2RV9A 3K75B 1F4HA 2RS32 2QQNA 4XMIA 1BKZA 4LBOA 5FXWA 5AC93 4F83A 3ME2A 5HCFA 1Q56A 1QXRA 4QPIA 2BTVC 4WZCA 5FIXA 4A3XA 2RS53 2JDMA 1N3PA 4AHYA 4E2QA 3ZSKA 3BPSA 2O0OA 5LWBA 3BU7A 4MH0E 4XIOA 4N7UA 3SLIA 3TN92 4HVQA 1JZ6A 1XNDA 2WBKA 3HNYM 5GALA 4J1XA 4EZHA 2Q4SA 1SFYA 2WZR2 1XYNA 1JYCA 4OI1A 5KHHA 4ZZ5A 1RXGA 3QOPA 4YW1A 5IW0A 4LKSA 5BNPA 1SLCA 4J6GA 1S0IA 3AMMA 5E6HA 3T1MA 1D0GA 3QLQA 1WW7A 1S0FA 1IQDC 1WCUA 3NV4A 1N1VA 1VBC3 2BNOA 5FJKA 5DMYA 4DIQA 3OEAA 1VE0A 2ZS6B 4MGSA 4RD7A 4P9GA 5FYZA 3TEXA 2OA2A 1F5JA 3U4XA 3O7OA 4QX7A 1PVC1 2AZ5A 1NQJA 4GKXA 1PK6C 2QJVA 1PIV2 4Q4V3 2XHKA 4OUSA 5T50A 3DKQA 4CCMA 2CV6A 4Y20A 3ZN5A 1HB2A 2VE1A 4YGCA 4AGGA 1D4M1 1VP6A 1W9FA 1NX9A 3HNMA 2C26A 4YM0A 3HPNA 1BK1A 1RUF3 3WG2A 5K8SA 1MZEA 1U5IA 1I3HA 1G6NA 2YU2A 3KCXA 4BQXA 3G7DA 4JHZA 1Z7S2 4OZXA 2GN7A 4KWKA 5GLTA 4A45A 1UPSA 5C8CC 2D3RA 2SBAA 3BYWA 4XF1A 4BLIA 1LEDA 2RMU3 2JDHA 3VBFB 1UW8A 2PA7A 4GB32 2R1DA 4BQ3A 3MBWA 3RFRA 4EZ4A 1QF3A 1SLIA 3R0RA 1L7RA 2XJUA 4D3WA 1WLCA 3HBZA 1BVP1 1W0NA 2CTVA 2GP3A 5A7QA 1ZZ9A 1AYM2 2HWE2 4ISQA 5FPBA 5FO8B 1YEWA 4PJYA 4X8PA 2UWBA 1NLRA 3LOIA 1O3QA 4CEYC 3PVOA 4KMQA 2QCSB 2XL9A 5A33B 5C5UA 3IN9A 5J96B 1WUVA 2XB6C 2GMPA 4W6YA 3RWKX 4Q27A 5ANQA 3WF4A 4XBNA 5IK4A 2D93A 3KVAA 1O8SA 4HK8A 2VQUA 3VDCA 1JHJA 4MGIE 4RQPB 5EZWA 5FMBA 4FT8A 5FFOC 1NZIA 1RUJ1 1SPPA 4AQ6A 3TAYA 1OQEA 2UYBA 3FC0A 3ECQA 5C7GA 3BB6A 1H2MA 1O5UA 1RC6A 1S0EA 4GMP0 4XEZA 4CCDA 1HN0A 5E16A 5FY7A 3C7EA 3Q8CA 3ACIA 5BNOC 3QBQA 1LOFA 3M3CA 3DPRB 2VUJA 5LY2A 3T4HB 3I3QA 5KWRA 4PLOA 2GH8A 4NHLA 1KITA 5FZ3A 1YQ2A 4IEUA 3WW4A 2PLV3 3DL3A 4AXOA 3OGVA 4Z92B 3INAA 5JOWA 2VZ3A 2ZZJA 4AHWA 3GJBA 2QVSB 2JB8A 2QQJA 2FCVA 4FP3A 2DURA 3WNLA 4Y22A 4COUA 5F9TA 1FT9A 3E97A 3ORJA 3I3EA 5FZBA 4MXWB 2WSUA 1I6XA 1QJY2 4DXRA 4ES9A 4YGDA 2B45X 2FBEA 4DEVA 3CJIA 4WM7A 1UZYA 5ABJC 1H2KA 1NCRB 4GH4A 4XAEA 1FI2A 3FHQA 1R1ZA 1MZFA 4XCBA
chains in the Genus database with same CATH topology
4TLFA 3WW3A 3FBMA 4N43A 5CFDB 1VBB3 1X7NA 2XLFA 1VJ2A 2D40A 3EXUA 4YGBA 1CAWB 1UCXA 1AR71 3EQEA 4JGYC 4Q0PA 2ZPXA 1SCRA 1AF9A 3H1YA 1RMU1 2VMGA 1BXHA 3FUOA 5FOBB 4FPEA 2KXLA 2VOWA 3AFGA 1J3RA 2WNUA 2HWF3 1MEC1 5JZGC 1R093 2WS91 1RVF2 1EAH3 4XTPA 4M3CB 5BNQA 3CU7A 4LA3A 4MZUA 1X8EA 5D1IA 4Q1PA 1UZZA 1GBGA 1VRH2 4AG4A 1AZDA 2DCJA 1U5XA 2WT0A 1S1AA 2HEVF 4FPOB 3WR0A 5FO9B 3GYDA 1H1AA 4KL1A 3KD4A 4C0HA 4LHLA 1PK6B 5BUVA 1O3RA 3ZMNA 5SV8A 3MPBA 1IPJA 2YUEA 3P3PA 1AX2A 2YV8A 1C5IA 3PVEA 3VKMA 4AHXA 3QCWA 4DXZA 1ZNPA 1RGSA 1ZZ7A 3LA7A 2BFUL 1PO12 1A6CA 4WBBA 1VBA3 1EV13 1ENRA 5JPNB 1ZBE1 4PQ9A 4ITCA 2ILMA 1M4WA 2RR11 4XQ4A 4CYDA 2WNEA 3ZN6B 5LEJA 3MIEA 3ZVXA 2G9GA 3TNQA 2VY0A 1ZRFA 4YW3A 3RPQA 3AP5A 4PIYA 2YHJA 4L11A 5BNNB 1WBLA 4JRLA 4Y4YA 1PHMA 5FAXA 3ZSMA 4COYA 4LUMA 4XW3A 1MQTC 1LKNA 2ZMNA 5EFUA 5C6CA 2K2SA 4S2HA 2P34A 3CO2A 4UBHA 5BXXA 3LAGA 5FO7B 3V0BA 1FXZA 1DQ2A 1W6MA 4M01A 1QJX2 3EBRA 4XF9A 1Q8PA 2DU0A 1RUD1 3M8LA 2ZCWA 3APBA 3M4FA 1H8VA 1CAXB 4XF0A 5T5OA 1NQDA 3VKOA 1WA4A 3W59A 1N1TA 4FAHA 2DF7A 2ZGPA 4KU8A 4FPYA 4CDQC 1RHI1 3BALA 4C1WA 4UW6A 3AP9A 4K40A 1ZYBA 2CWMA 4AGVA 3NL1A 3BPZA 2E7TA 3MIFA 2QKDA 1V6OA 1YFYA 4XILA 2VVFA 3VL8A 1KDMA 1NA1A 3N7MA 3H7YA 4AEDC 2FZ2A 3KCYA 4I0BA 1Y9QA 3VKNA 5ACA2 1CESA 1FOD3 1LGBA 2NYYA 3D6EA 1HLCA 1XNKA 4GWMA 5HXVA 1BYHA 1OOPC 5CG8A 1VBE3 1XRUA 1ZZCA 3PNAA 3VKLA 1H8TB 2LUWA 1POV3 1V00A 5H9RA 5DUVA 1G9DA 2MNGA 3D82A 2D3SA 2R32A 1HRI1 2D6PA 3AZZA 4EWDA 1BMV2 3UV9A 1FPN3 3E6DA 5DDJ2 3A0KA 5GZDA 5T5JA 3RRDA 5H9PA 1XYPA 2BWCA 4FVVA 4XTMA 1NY71 4KWLA 4Q1RA 1AR83 3NV3A 3FZ3A 3POSA 3VBUC 2PHUA 4NN0A 3VZNA 4HSJA 4B3NA 4KNCA 2ZMKA 2X5IB 5JMCA 3R4DB 1L3JA 2JG8C 1BBT1 1RITA 2VQ0A 3N35A 4PBPA 2PHLA 3IMNA 3TB0A 3B94A 4HPKB 3RSJA 2GDFA 2X29A 2VNGA 4Q4Y1 2JG9C 3FBYA 3WZ1A 5IK7A 1VBC2 4S2FA 1S0JA 3FLPA 2D6MA 1ND2C 4AFDA 4YARA 1DG6A 3AKRA 2R6QA 3VBRC 3JZVA 3WY6A 4P14A 4Q4V2 3UJOA 1TNFA 1REFA 2ARBA 3TN93 2ZMLA 2HYKA 3FLTA 3GHNA 1DF0A 1RUF2 2JEMA 2WZR3 4C90A 1K5MA 5K0UA 2UYAA 2EAAA 2I74A 5KXDA 1SACA 1TQ5A 2QE3A 3IKWA 4RL7A 5I91A 2PTMA 2ZGOA 4D94A 2ES3A 3HIFA 5E8AA 3FFZA 1ENSA 2ZACA 3M2MA 2BVBA 2VUAA 3LZZA 4XHXA 1G9BA 2BUKA 1AL23 4FP2A 4SBVA 1ZZ6A 3H50A 1BQPA 4Y26A 2A6YA 1C1FA 4AI8A 3S7EA 5EXOA 3WG4A 4LBJA 1W6OA 1UU6A 5T3NA 4K1ZA 1PZ9A 3URFA 3WXPA 4GB33 3W9AA 1QJU2 3H8UA 1B35A 3ZSLA 3I7DA 1O7FA 1RUG3 5DUWA 3D0SA 4BA6A 3QH6A 1LGCA 2VW0A 1GKBA 2HWE3 1AYM3 3I2DA 4AEDB 1Q8OA 1RJ8A 4OHXA 4U2AA 2PLV2 1ND3B 1LESA 2D98A 3AKTA 4FOQA 1OOPB 1O5LA 5FLIA 2ZGMA 3K51A 2DUPA 4LBQD 2PAEA 4CDWA 4FPCA 5H9QA 3B00A 1W39A 2VGDA 1LOEA 3ZXFA 4Q2FA 3JD72 4IV1C 1LTEA 2E7QA 1W0PA 2ZA9A 1VBB2 3IPVA 1UL9A 2WJSA 1IKPA 2XL7A 1UKRA 3WT3A 1RUE1 3GBFA 1QNWA 4COWA 4Z2WA 5JI9A 1ENQA 1LHNA 1BEV2 3ROUA 3E5UA 4E27A 3MFAA 4F8AA 2BEOA 4HN1A 4PDWA 2WA4A 3RI8A 3IDBB 3JQWA 5CA6A 1QJY3 4RHV2 3MIBA 1RL3A 2XJQA 4IV3A 1C1LA 4HFSA 3ZXKA 2A6VA 4R9AA 3D4KA 4PIZA 2RE9A 1EAH2 3ZSEA 2XBO1 1JW6A 4QPYA 3R6SA 5BYNA 5FQ0A 2YYOA 2VNRA 3ZO0B 1LOBA 4QMAA 5K7PA 1KRIA 2ZABA 2HWB1 3O0WA 3FJSA 3LOBA 4YRDA 3ZFFC 5JDBA 1C8M2 1IS3A 3RJ2X 4R9BA 4TYSA 1H0BA 2W08A 4LBQA 4Q0UA 4WVMA 3VZLA 4IEWA 2V73A 4RFT0 2HWC2 2PELA 3VBRB 1DQ1A 2GH2A 2VULA 1LOAA 2JKBA 1RVF3 3JU9A 1QDOA 4KU7A 2ZOEB 2RS11 1ASJ3 1XXNA 1SEFA 4FBFA 1R1A2 5AFBA 4AEKA 2R16A 1AYN1 1GANA 3QH7A 1C28A 4JRAA 4Q26A 1VBA2 1EV12 4YFWA 2GNMA 2IXCA 2DCTA 1AR63 1VRH3 2JDZA 5C8CA 2HEWF 2ZTNA 3H1WA 2JE9A 3MDPA 4E4ZA 3VDDB 1I5ZA 4JCKA 2XVGA 5D8AB 2PHDA 3ACLA 3VUOA 2X8KA 1LOGA 1HRV1 5IUQA 1H1IA 2XJSA 1TMF1 2Z79A 4URTA 3MF9A 2R063 1AR91 3ZXLA 2R071 4DY5A 1PO13 3VZOA 4WM8A 5CNAA 1YCIA 4CEYA 4ES8A 1RTVA 1COV1 1AJOA 1WLTA 1ZZBA 1R081 1RJ7A 1WW4A 2Z42A 4IETA 4X6QB 1DGRA 4DOUA 1VB4A 4H7LA 4IEXA 4L8QA 4E4DX 3RYPA 2ZX4A 3VHOA 1DZQA 3FX3A 5JOZA 4QU2A 3VHNA 2WA3A 1CAXA 5BNOA 2BVVA 3NAPB 1KJRA 3B69A 1WCSA 2ZJCA 4Q4X1 3ENRA 2FMYA 2WWSA 4LO6B 2JXAA 3C2UA 4LBNA 5AVPA 1W6PA 1YHFA 3PHMA 2Y0OA 4QD2A 1OSGA 1XYOA 4EN8B 1QJX3 2DVGA 3JBG2 4AFBA 3AZVA 4M3CE 3AZYA 3VBFC 3AK0A 4U36A 5ABJA 4OHZA 1U5ZA 1Z7S1 4AFMA 4O9GA 1OPOA 2R041 1LHWA 3OY8A 4IEQA 5BPXA 3OF1A 1FMD2 3PLQA 4MGKE 1KD7A 4FTSA 4XJUA 5EYYA 4AI3A 3RZZA 4XXPA 4JGYA 1HX6A 5CVRA 2BNNA 2XLAA 2ETEA 4PF5A 3AP6A 4MXVA 1ULCA 4EN6B 3M3EA 1RUC1 1VB2A 1H2NA 2Z69A 4AW7A 5JZGA 4GMP3 4XFFA 1OKQA 2E53A 3DPRC 2VECA 1LCLA 1HXS2 1AR82 4YVSA 5ACA3 3ZFFB 3ZXDA 1VALA 1NCQB 3MF6A 4AFAA 5LRRA 4DINB 2EXKA 1PGL2 4Q4W3 1J59A 3HAGA 3R05A 5T55A 1DQ4A 3RDIA 3M1HA 4R4ZA 4C91A 3VHPA 1QDCA 1G9FA 2JECA 2ZBJA 1MS0A 1NCRC 3J8F1 4LBMA 5BV6A 3AMNA 2V09A 1TME1 1F8VA 4NVPA 4XFHA 2BYVE 3AZXA 2A6WA 4XFAA 5CFDC 4COZA 1GV9A 2YGLA 1GZWA 1I9RA 2GU9A 1CR7A 3B5LB 2A3XA 3ST7A 5K9YA 1V9U1 3WP6A 1NE6A 1FX5A 4PLMA 2B46X 3HT1A 4Q29A 2C0ZA 3VZMA 4Z8BA 5CAZA 3H1MA 1ZM1A 2WLQA 1UPIA 1PO22 4OHWA 5HBAA 3WV6A 4B7KA 1N1SA 3SMHA 3LA3A 5C9AB 4EJRA 4OI0A 1CAUA 2Y0IA 4RR3B 1MS4A 2DFCA 1HW5A 2WNVB 3VBHB 4JV4A 1MQTA 2G4IA 3MGUA 4LE3A 5FOJB 5L73A 5LK7B 4BM8A 2Q1MA 1X8MA 1SBFA 4BE3A 3I59B 4RS5B 5CFCC 4KWJA 2ZHLA 1YFWA 3WHTA 3RMXA 1IS6A 3FWEA 4YZ3A 4D69A 3WNXA 3VZJA 4XQWA 2QDNA 1KQRA 3JB4C 1AL22 3GZUC 4BH9A 3O0XA 3E6BA 3TOJA 3NVCA 5JAXA 2CWSA 2R1BA 4XF4A 4MV2A 4UW4A 5J7MA 3WQ1A 1RUI3 1Z78A 1IS4A 2HWD1 5I8SA 4HVRA 5LK5A 5LEKA 4CDQA 1PZ7A 1H4GA 4XBLA 4AVCA 2Q5TA 3PVBB 1HQLA 4K3UA 2WIIB 1MVQA 1RUG2 5CBLA 1RUD3 1V6NA 3P3NA 1SLBA 3BIWE 4XXAA 3WINE 5BNNC 2WFF2 3UKVA 2RM21 2ERFA 2W52A 2EXJA 1RB8G 1OA3A 4AGRA 2GMMA 2EA7A 4Q0SA 4W6WA 2CL2A 1QJU3 3NW4A 4L97A 2ZKNA 1QKQA 4I0WB 3U11A 3MW3A 4IEZA 4EWEA 5FTTC 1DGWX 2A70A 2GALA 4QPGB 5FCCA 2ZKLA 1JN2P 2XGXA 3ZFGC 1C8NA 1QU0A 2MEV1 3I8TA 2JICA 1SDWA 1MVEA 3VBUA 1CPMA 1VBD1 3UJQA 2NQYA 3KQRA 1CGPA 2H0BA 2DCKA 2WL1A 4G9SB 2IXKA 2UWAA 3HMYA 2JG8A 3WW2A 1TEIA 3JD73 4IEOA 4IQPA 4HVOA 4B8EA 1HKDA 3USUB 4DRRA 1XNCA 3I54A 1QQP1 2PHRA 5DUUA 4AEJA 2AREA 3B02A 1BEV3 4AF9A 5C8WA 4RGGA 4IESA 3JUUA 4RHV3 3CJXA 3IT8A 4LO4B 2JG9A 1H8TC 1QNYA 4PBOA 1E57A 2P3KA 2DVBA 2IXHA 3NKTA 1ND2A 1BBT3 4QX5A 2P37A 1GICA 1ASJ2 3WDTA 2PHFA 3EO6A 1NG0A 2D43A 1ULGA 1WCKA 2MHFA 2DVFA 3AYAA 3MIHA 4E4SA 1WD4A 3BOWA 3O0VA 1WD3A 1C8M3 1AR62 1NE4A 1U12A 4NO4A 3A0NA 3NSTA 1JH5A 3VKFC 1QXPA 5L7OC 2QDRA 5CFCB 2X5IC 1LOCA 1SBDA 2HWC3 5FREA 3SISA 4A2UA 3HR9A 1G9CA 3MYXA 4CP2A 1D4VB 4A7ZA 3OJBA 5I0UA 1PVC2 2R062 1R1A3 3RQ0A 2EVXA 5AC91 5HI0A 4FQ4A 1ULEA 1LRHA 4H3WA 4LBLA 1RUH1 4CDUB 4YSFA 2RS51 3VHRA 1Q3EA 2IXLA 4JGZB 1O3SA 2RHPA 1NZCA 1YFUA 3WUCA 1QHDA 4H55A 1SFNA 1Q8QA 2ZHMA 2VOKA 4I3GA 1XNBA 2O1QA 5JIUA 2QZ2A 3AP4A 1RINA 3AMHA 1F9KA 3V0AA 3IWZA 4QPIC 4LO8A 4LLOA 1W6QB 3VBOB 3OD4A 3AJZA 4BLJA 4C1XA 4AI1A 4NWVA 4Y1UA 3SITA 5KHJA 2XVLA 4GWNA 2V5YA 1OHFA 1RUF1 4GULA 3RI9A 1DQ0A 4ASMB 4Z07A 3OYWB 4Y1ZA 4IV1A 2Q8OA 5C4WB 4XPVA 5I8TA 1QOOA 5JLVA 2EAKA 3ZFGB 3LSDA 2WQZC 4K9SA 4OLLA 4Y1VA 2RMU1 3HN1A 3SH4A 2ENRA 2D6KA 1BZWA 1AX1A 1BVVA 3K48A 4LBKA 4AI2A 3WQ0A 4XOGA 1LHUA 1U0AA 2JE7A 5GLZA 2BGCA 3JBG3 4A7YA 1AUYA 2TEPA 1YYNA 1QH6A 4OI2A 4FPLA 4HMZA 2DWRA 2ZGNA 4IEYA 1VR3A 4FXGB 4YZ2A 1FMD3 2ZX2A 3E6CC 3OPZA 4Q0QA 1ND3C 5F5QA 3QACA 4K20A 5BY5A 4JQRA 1RUE3 2Z2SB 2VXRA 4Q4W2 1OA4A 1W6NA 3ZFFA 2Y38A 3ZYIB 4JTOA 2D6OX 1RMU2 2W68A 3WOGA 3SCGA 1DBNA 1GQGA 3VLBB 3VBSC 2QUOA 5FDBA 3MEPA 4P9WA 4YYOA 1SMVA 4NHMA 4ATEA 2ZGKA 4N7IA 3V64A 1URXA 3AYCA 2OIIA 1YIPA 1HXS3 3ZIXA 3B9CA 2RJLA 4HBNA 4YGEA 2XVKA 2HWB3 2XWJB 2XWBB 5L7OB 2YC0A 1PNGA 4QQPA 1C57A 1VBB1 4Q8KA 4CEWB 4I30A 5T52A 2IFRA 1YIFA 2E51A 1NLSA 3MI8A 2GC0A 1S0BA 2DFBA 1QY4A 1YWKA 3I4IA 1IPKA 3FFQA 5IK8A 3KMHA 4WM7C 4BCUA 4LA2A 2HWF1 2QFEA 1DZTA 4FPJA 2D6LX 4YVWB 2IFWA 1R091 4WVVA 4OUMA 1EAH1 1ZBE2 5A32B 3ELNA 4R9CA 2B9UA 1F31A 4XHBA 1SCSA 3J4UH 1Q43A 1PO23 2PHTA 2GZWA 4B4QA 4CP1A 2Q1ZB 3J26N 4AVSA 1JBCA 5JOYA 3FLRA 2BQPA 1TMF3 4QPIB 2GC1A 5J3UA 3AXDA 1AR93 4KG0A 4NPRA 3NV1A 2WNUC 1UN1A 1RUI2 1Q8SA 2SLIA 4R52A 2E6VA 4PIXA 2UU8A 1COV3 5JR7B 1O4TA 5IT6A 1KXGA 4LULA 4XFGA 4YLZA 4X8NA 3VDDC 1RUD2 1ULDA 1QOTA 2OVUA 5D8AC 3VBFA 4L99A 1VBA1 3WVJA 4MLOA 5KXEA 5BNPB 4QM9A 1HQWA 3ZXJA 4FO9A 1WW6A 2A6XA 5FRAA 3ES1A 4UXAA 2ZGQA 4HLTA 3LCPA 3MW2A 3KCCA 2VOVA 4I3PA 5A33A 2H6CA 1AXKA 1QWRA 4N9HA 4ZXKA 1LODA 1RHI2 2AR6A 2PAKA 2PN5A 4HKOA 4IL7A 4Y20B 4QQLA 5JWPA 3N3HA 2A3WA 2Z5WA 1ZRDA 1MR5A 1H9PA 4RQPA 3S30A 1ZBA3 3H3UA 4OHYA 1EPWA 2Q30A 4B7EA 1CQ9A 1Y43B 2CAVA 2Q0AA 2WFF3 3ZXAC 3SH5A 5C33A 2GNBA 4HKWA 3B93A 5CG9A 2R043 2ZX3A 1AXZA 3NAPC 3DPRA 1UF2C 1HQNA 1ZA4A 5I8YA 1OMIA 2ZX1A 4BIOA 1J3QA 1KS4A 2FMDA 3T1LA 2YZ4A 1ZREA 1LULA 3SHRA 1G7YA 5I0SA 4W6XA 3GZAA 2IXJA 3VBSB 1S2BA 4MXWA 4ATFA 4AVAA 2P17A 4BYYA 1A8DA 2XH6A 2PQQA 4MX3A 2LM3A 1NCRA 3MIGA 1HDKA 1F5FA 4YM3A 1UD1A 1N47A 5CFDA 5J48A 3JCIA 1NY72 3BOPA 3SNMA 1CAWA 5AVAA 2WT2A 1XE7A 2CNAA 1XE8A 1YJKA 4YNIA 1LJ7A 3LKJA 4LHNA 5KHGA 4QM8A 1BBT2 4TZDA 3GBWA 4XFCA 3CLPA 3VL9A 1FOD1 4K6BA 1S2KA 3MIDA 4EN7B 4KQ7A 4Y22B 3ILRA 5E88A 1VBE1 4L92A 4MGYE 4M3CA 4WM7B 1POV1 3AYEA 4GH4B 1NCQC 3E5QA 3U0ZA 4NHKA 1H30A 3VN4A 1FPN1 1AVBA 3KSCA 3RMYA 1BCXA 5CFCA 4JVAA 1AR81 1J1LA 4CDXC 1PK6A 4KG8A 1DDLA 1G9AA 2YDEA 2RJKA 1C3HA 5L36A 3WG3A 1X33A 2WNUB 4AQ2A 3KT1A 1YI7A 2NM1A 1LEMA 3IIAA 1FYUA 2ZGUA 4KBBA 2HJIA 1SLTA 2DU1A 3ZN6A 1KFUL 1XU2A 1DFQA 1PVC3 3LA2A 4MGZE 4YW5A 4DFSA 1VAMA 3ZN4A 2RS31 4WV8A 1AX0A 4H14A 4AWDA 1OQDA 4BWOA 4DMIA 1D4M3 3UK9A 5C9AC 5BNNA 3LWCA 2E63A 2B39A 4RR3C 2OPKA 2WNVC 3VBHC 4COVA 3B9IA 4OHVA 4GALA 1TE1B 1V6KA 4M0NA 1W6QA 3ILFA 2EXHA 3TN91 5I0TA 4AVTA 4RS5C 4JDNA 4QT6A 2VNOA 2WZR1 4AHZA 2DV9A 1UAIA 4S2DA 3KB5A 3AM2A 1PM7A 3ZFEC 2MPFA 2WQ4A 4PCRA 3JB8A 1DYPA 4EWAA 1GZCA 4FPFA 3IM0A 4FSJA 2FZ1A 3EHKA 5A3MA 3DV8A 1PIV1 4XDQA 1LHOA 1SLAA 1LU1A 4O9EA 4EN9B 4M0HA 1RUJ3 1AL21 2OZJA 3ZYJB 1IS5A 1RUNA 1WMFA 1K5MC 4FPHA 2QZ3A 1O91A 2A6ZA 2ZZQA 2WT1A 3V0BB 1UX6A 1AJKA 1W6MB 3O14A 4YM2A 3WQ7A 5H9SA 4XZPA 3ZSJA 4P9IA 4L2NA 4GB31 1RUE2 3RYKA 3UKNA 1H4HA 1X36A 3ZDSA 3M3OA 1PVXA 2HWE1 1AYM1 3KLSA 2IC1A 4AQTA 5JSOA 1IZ3A 3WUDA 5T5PA 4HK9A 2E9QA 2R0HA 1H8TA 5FBZA 3RG0A 1WMEA 2B42B 3ATGA 4P9JA 2XBO2 4XJZA 4BIFA 1UIJA 2A3YA 4FPGA 1V6JA 4W65A 1JYIA 3O5SA 2UURA 4D7SA 4QPGC 1EYBA 1AR73 2HWB2 1Y7BA 1JTZX 1B35C 1H9WA 1PGW2 2JD4A 2DCZA 1OLQA 3SCFA 1UMZA 1NA1B 1MZ5A 1LGNA 1RMU3 3GBGA 4BMBA 1V70A 5GM0A 4LT5A 3MLLA 2X5IA 4CDXB 1C4RA 1MEC3 4CP0A 2WS93 4Q8LA 1QJZA 3SH3A 2I2SA 1TNRA 1KDKA 1KS5A 2RS12 1QJY1 2GAUA 1CJPA 4WVZA 4B29A 4Z82A 3E5XA 4HPKA 2CY6A 1REDA 5DXDA 4NOTA 3V65A