1OOPC

The crystal structure of swine vesicular disease virus
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
238
structure length
238
Chain Sequence
GLPTLSTPGSNQFLTSDDFQSPSAMPQFDVTPEMDIPGQVNNLMEIAEVDSVVPVNNTEGKVMSIEAYQIPVQSNPTNGSQVFGFPLTPGANSVLNRTLLGEILNYYAHWSGSIKLTFMFCGSAMATGKFLLAYSPPGAGAPTTRKEAMLGTHVIWDVGLQSSCVLCIPWISQTHYRYVVMDEYTAGGYITCWYQTNIVVPADAQSDCKILCFVSACNDFSVRMLKDTPFIKQDNFFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coat protein VP1
publication title Crystal Structure of Swine Vesicular Disease Virus and Implications for Host Adaptation
pubmed doi rcsb
molecule tags Virus
total genus 41
structure length 238
sequence length 238
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2003-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1oopC00
4GB33 1RUG2 2XBO3 1W39A 1RUF2 5LK7B 1D4M2 1HXS2 2MEV1 1RVF1 2HWC1 1VBE3 4QPGC 2WZR3 4GMP1 1EAH3 3VBFA 4IV3A 1RUC3 1QQP2 1AYM2 5ACA1 4RHV2 4IV3C 5FOJB 4YVWA 3VDDC 3VBSC 1PO21 4QPIA 3VBOA 2MEV2 1RVF2 5C8CC 2PLV1 4YVSB 1C8M1 2QQPA 1RUD1 1PGL1 1Z7S1 1PIV3 1AL21 5ACA2 1RHI1 4WM7A 4WM7C 1PO22 1NCQC 4PDWC 2FZ2A 3DPRB 5CFCB 1VB2A 1TMF3 5BNPB 2PLV2 2R071 1C8M2 1F2NA 1RUD2 3J8F1 1PGL2 3ZFEB 1Z7S2 2R061 3JD71 5AC91 5JZGA 2WLPA 1EV13 1AL22 1RUH1 2RS51 4EJRA 4CDXC 2X5IB 1ND3A 2RM23 5L7OC 2BPA2 1RUF3 3HAGA 2R072 4CEYC 4FTEA 1AR71 5A33A 3J8F2 2R062 3JD72 5AC92 5D8AA 1QJU3 1PVC1 4QPIB 5D8AC 5BNNA 3LOBA 1RUH2 5DDJ3 1VRH1 5BNNC 5CFDA 1R083 2RS52 1HRI1 1QJX1 1ZBA1 1AR61 1OOPA 4NWVA 2HWD3 2RR11 1POV3 1OOPC 4AEDB 1MEC1 5BNOC 2R043 5ABJB 1H8TB 1AR72 5C4WA 1K5MB 1QJY1 4Q4Y3 1RUJ1 1PVC2 1PO13 5ACA3 3VBRB 1AR83 1HRI2 1ZBA2 4GH4B 4N53A 1AR62 4JGYB 2RR12 4CDUA 1MEC2 1ND2A 4CEWA 1RUE2 4CEWC 3ZFGA 1MQTB 4RQPA 3ZFGC 5FMOL 1AYN3 5GKAC 1GFF2 2PLV3 1RUD3 4Q4W3 1QJY2 1Z7S3 5A32A 1RUJ2 4RS5B 1R091 1R1A3 2RS31 1ND3B 3ZFFC 4CDWA 4N43A 3S6PA 4CDWC 1NCRB 1FMD3 2RS11 4YVSC 2HWB3 1TME3 1VBA1 1X33A 4Y4YA 2XPJA 3VBHB 4IV1B 2WFF3 4FTSA 1V9U1 4QPGA 5AC93 1R092 2RS32 2HWF3 5K0UB 1RUH3 1X36A 1RB8G 2RS53 2RS12 5CFCC 1AR91 3VDDA 3VBSA 1HRV3 3NAPA 3ZFEC 5C9AB 1RMU2 1VBA2 4CDQB 3NAPC 4WM8A 1FPN3 5C8CA 4WM8C 1F8VA 1V9U2 1E57A 1FOD1 2TBVA 1COV3 2HWC2 4JGZB 3VBUB 1PVC3 1ASJ1 2HWE1 1BBT1 1HRI3 1AR63 1AR92 2RMU3 4RR3B 1MEC3 1NCQA 4PDWA 1RUE3 1B35B 3CJIA 3CJIC 4N43B 1FOD2 1QJY3 2VQ0A 3TN91 1VBC3 1VBB3 4AEDC 1ASJ2 2HWE2 1ZBE1 1BBT2 3JBG3 1RHI2 4CDXA 1K5MC 2WS93 1WCDJ 5L7OA 3VBFB 1RUG3 4IV3B 4CEYA 4GB31 1D4M3 1HXS3 4YVWB 3TN92 1R093 3VBSB 3VDDB 2RS33 1VBE1 2WZR1 1ZBE2 1EAH1 1QQP3 3ZXAC 1AYM3 1MQTC 4RHV3 3VBOB 1C8NA 1RUC1 1AUYA 2RS13 5BNOA 1NA1C 1RMU3 1VBA3 4RS5C 2Y26A 2MEV3 1RVF3 4WM7B 1NCRC 2HWC3 4GMP3 4PDWB 1VBE2 2WZR2 1EAH2 1PGW1 1RUC2 1VRH2 3VBHC 2DF7A 1QJX2 1PO23 1NY71 5JZGB 2IZWA 4CDXB 1C8M3 5J98B 4BCUA 3ZFFA 1OHFA 2HWE3 1BEV1 1PGW2 5C9AC 4CDQC 1AL23 2BUKA 1BMV1 1EV11 1RHI3 1VBD1 4YVSA 4Q4V1 3JB4C 5A33B 1NY72 5D8AB 3VBUC 1NG0A 5BNNB 2RM21 2R073 5CFDB 3J8F3 3TN93 2R063 3JD73 1OOPB 4RR3C 5BNOB 2ZZQA 1BEV2 1ZBE3 2ZAHA 1B35C 1QJU1 1BMV2 1EV12 4RFT0 3DPRA 5CFCA 1VBD2 5DDJ1 5BNPA 3DPRC 1R081 4Q4V2 3ZFEA 5BNPC 5C4WB 2HWD1 1A6CA 2RM22 2R041 5FMOS 1AR73 4N53B 2X5IA 4CDUB 4Z92B 4Q4Y1 1ND2B 2X5IC 4CEWB 1QJU2 1OPOA 4Y5Z0 3ZFGB 1VRH3 1HQNA 4RQPB 1PO11 3VBFC 2BFUL 4Q4X1 5DDJ2 1QJX3 1ZBA3 1AR81 1HX6A 1R082 2RR13 4YVWC 2HWD2 5A32B 3ZFFB 4SBVA 4QPIC 2R042 4CDWB 1POV0 3VBOC 1VAKA 1AYN1 1RUJ3 4Q4W1 4AEDA 1M06G 2ZTNA 4Q4Y2 1R1A1 1PO12 1SMVA 5ABJA 4Q4X2 4GMP0 1AR82 1H8TA 4NWWA 5ABJC 1AL0G 1RUI1 1K5MA 1H8TC 1FMD1 4QPGB 4FTBA 3FBMA 2HWB1 1TME1 3VBRA 3VBRC 2XBO1 4GH4A 1AYN2 1QJZA 2WFF1 4JGYA 4GH4C 4Q4W2 4JGYC 3NAPB 1BEV3 1R1A2 1MQTA 2HWF1 3IDEA 5JZGC 2GSYA 2BFUS 4WM8B 1VBD3 4Q4V3 1RUI2 1NA1A 5C8CB 1FMD2 2WWSA 4RS5A 3M8LA 1HRV1 2HWB2 1TME2 1ND3C 4GB32 2XBO2 1FPN1 1NCRA 1V9U3 2WFF2 1COV1 1NCQB 2FZ1A 1PIV1 2HWF2 3VBHA 4IV1A 3CJIB 4IV1C 1AR93 5J96B 5CFDC 1CJDA 1IHMA 2RMU1 1HRV2 1RUE1 5K0UA 1DDLA 1FPN2 5K0UC 1FOD3 1TMF1 1NOVA 5C9AA 1COV2 5C4WC 4CDQA 1PIV2 1ASJ3 1VBC1 1BBT3 1VBB1 4LLFA 5L7OB 4Q4X3 1VB4A 4CEYB 3JBG1 1CD3G 3JB8A 2RMU2 4JGZA 3VBUA 4N53C 4CDUC 4JGZC 2WS91 1ND2C 4FSJA 4RQPC 1RUG1 2BBVA 1RUF1 4RR3A 1TMF2 1NA1B 1D4M1 1HXS1 1B35A 1VBC2 1VBB2 1QQP1 1AYM1 3JBG2 1RUI3 4N43C 4RHV1 2GH8A 2WS92 1POV1 1RMU1
chains in the Genus database with same CATH superfamily
1ULCA 3BU7A 4XUPA 1CJPA 3TEYA 1W39A 2UWAA 2JDPA 1RUF2 1WA4A 3ZYHA 4ZU5A 1DLCA 2RVAA 3A23A 4JHTA 2QQKA 3HJRA 1EAH3 5FBJA 4ASMB 3TEZA 4OHVA 1Y7BA 4H2AA 4YZ2A 4FFGA 2WLQA 5LA0A 3KHBA 4B7EA 3WV6A 4EE2A 2VW0A 2WL1A 3APBA 4UW3A 4YVWA 1UCXA 4AFBA 4PLMA 5B4NA 2Q30A 3QACA 3ZPYA 3C7OA 4CP0A 4IE5A 3R05A 3SKJE 1PO21 2WN2A 1OD5A 3AYEA 5EQUA 4E27A 2R6QA 5KXDA 3LEIA 3OGGA 2G19A 4O65A 4K7JA 1I9RA 4LPLA 3OGSA 4QQOA 5EPAA 2QQPA 2A71A 5J7MA 2WYSA 1Z7S1 3DYMA 2OUHA 3LWCA 3PJYA 2D6MA 3F2ZA 2DU1A 3A21A 3RNSA 4GQ7A 2B5HA 4XDOA 2I2SA 2R0HA 4Z8BA 2W08A 3U75A 3HWJA 1D2SA 4PQQA 4LBNA 2RDSA 4PT6A 1NCQC 3I2HA 1WCQA 3KM5A 3NJYA 4PDWC 3S5QA 1UWWA 4EWAA 2L9LA 2I07B 3VDAA 2A5ZA 4LQRA 5DXDA 5CFCB 3A4UA 1XNCA 3AVRA 3CU7A 3MDPA 2R071 1GZ9A 1RUD2 3J8F1 1PGL2 3GZEA 4QX7A 4XJ8A 5JZGA 1Q5OA 1AXYA 1D4VB 1ZZ8A 2WLPA 1O5UA 4A6OA 1AL22 1X50A 2J1UA 5FK7A 5FZHA 2YG0A 1A3KA 3OEBA 3KCXA 5I0TA 1BZWA 1OMIA 3USUA 2JB8A 3PUHA 3VLBB 3SNMA 5A3OA 4L99A 4UFKA 1GZWA 2RM23 5H9SA 1MS8A 5FXWA 3GM8A 4LIVA 1FX5A 1UXZA 1IPKA 4QAWA 4AVBA 2P37A 4FTEA 3GHMA 5FP9A 5FYTA 1Q43A 1SBFA 4A42A 2CV6A 2Q4SA 5AC92 1HQWA 4XFAA 3NV4A 2Z2SB 1PVC1 2P6HA 3ETQA 2V5YA 3KV9A 5EFUA 3JU9A 3K4ZA 3WSOA 1RUH2 4GWJA 3LOBA 1VRH1 2VZSA 1HRI1 2J1TA 1QJX1 1ZBA1 2IVJA 4FAHA 1PX3A 1IKQA 2CAUA 2OQ7A 2HWD3 5FIXA 5JMCA 1RL3A 3W9AA 5JXJA 1MEC1 5A6YA 1VR3A 1CIYA 2ZGOA 4KWJA 4C0BA 4QKFA 1NYWA 2B9VA 4ASKA 1YXWA 2D6NA 5FYYA 1WLWA 3MIEA 3ACHA 1GQPA 4TLGA 3FHQA 1Y4WA 5C4WA 1K5MB 4YG3A 5KXCA 2JDYA 1LTEA 5HV4A 1OVPA 3ZYFA 5C70A 2DV9A 4DRVA 2A6VA 4X6QB 1PO13 2VECA 2YV8A 2K9ZA 1S2BA 4I3PA 5LY2A 1H8VA 3UJOA 2VTFA 4C0HA 2AUYA 5JI9A 2BRTA 2WT0A 3I4IA 5FV3A 4QWNA 4RA0A 5GLTA 1RUE2 1DP0A 4CCEA 3SHRA 3MLLA 1UX6A 3ZFGC 4CSWA 2UY9A 2W2IA 1UU5A 3CZJA 3RMYA 1V6NA 4KGGA 4BJ0A 2QZ3A 1Z7S3 3ZM8A 3LKJA 2VNRA 4E4HA 2WFPA 2QDNA 1K42A 1ND3B 1Y9MA 3KMHA 3ZFFC 4AI0A 5C33A 1HKDA 2OW4A 3LGRA 4CDWA 5C71A 1CZSA 2DU0A 2Y0IA 4Y5SA 3S6PA 3RZHA 3HVDA 1NCRB 1OLRA 4Q27A 3R6SA 4JRAA 5GLVA 3IIAA 3NO8A 1S0JA 4LBOA 3I3BA 4QD2A 1VBA1 4BPZA 1X33A 3POEA 1GKBA 1HV1A 1SLCA 4PIXA 4IV1B 4IE0A 4IUGA 4KBZA 3HN3A 2A73B 2F6BA 5AFEA 3MIFA 2PN5A 1LCLA 3BI3A 4AVCA 2QQVA 2RS32 4YZ3A 3AP6A 2HWF3 1XE8A 2YFZA 4CA9A 5IVEA 5L9VA 4DXZA 5KHGA 4E4ZA 2VJXA 4ATEA 1RB8G 2RS12 4N7UA 2R1DA 4XIKA 3VDDA 4NRPA 1OD3A 5HXMA 3VHNA 5DN2A 3AKSA 1UF2C 2GN7A 3NAPC 3FZ3A 1OXCA 2GH2A 4A44A 2DFBA 3K75B 1CAVB 4ONUA 3D6EA 4WM8C 1F8VA 1E57A 1ZRRA 2JG8B 3VZKA 2D3RA 1GWKA 3FFQA 4JGZB 4UYBA 1PVC3 1W99A 4LORA 4NMIA 2ZABA 1OURA 1ASJ1 4JKMA 1VJ2A 5SV5A 1HRI3 4MHUA 4BHPA 1AR92 2F17A 4I30A 2DURA 3RZLA 1MEC3 1UYYA 1DU3D 4QDSA 1ACCA 1HB1A 3AKRA 4X6RB 1PZ8A 1DZTA 1UAIA 5CISA 4XQDA 3UGFA 2X05A 4N43B 3BODA 5HI0A 4IL7A 1GP6A 3MFCA 2AEYA 1KS4A 1MR5A 2AYHA 3IB3A 3N9MA 3DEMA 4XBQA 1KQRA 3B02A 3V0BA 1UY3A 1TVGA 3K3NA 1CQ9A 1KFXL 2A6WA 4YZ5A 4YNIA 1VBB3 3I2FA 3BN6A 3SLIA 4URAA 3ZIXA 2HWE2 4LMFA 1BBT2 1DQ0A 1O8PA 3SH3A 5I0SA 2EXKA 5DAXA 4AAPA 1OFSA 1WUVA 2QFEA 2VUCA 3TYJA 4CCMA 2WIIB 3HN1A 1GSLA 2WS93 4JKKA 3M2MA 4A41A 2PAEA 1KS5A 2JKXA 2ADDA 3ZO0B 1UU4A 2NZ9A 4EZHA 4CEYA 3DYPA 1XQNA 4XFCA 4YVWB 2A3XA 3AZVA 3TN92 4CU6A 1ENQA 2P6CA 4AHXA 1OF3A 1VBE1 4JZRA 2WZR1 4LKEA 1FYUA 5IWFA 2BDRA 3PVBB 4NHLA 1YQ8A 1AYM3 5JCTA 1QKQA 4CU7A 2VUJA 4DUXA 1LENA 1CVNA 4BOWA 1VBA3 4RS5C 3K2OA 4CXYA 3T30A 1UOJA 3O1SA 3KQRA 1NLSA 3TRSB 1WCKA 3ZN4A 4LK6A 1W6QA 2JDNA 2ZGNA 1W04A 3IIIA 1RVF3 4PJYA 3PVOA 2YHJA 4LE4A 4P02B 5DZEA 1XYPA 4GMP3 5B2GB 2BV4A 5E6HA 1CWPA 2BOIA 3AZYA 4C91A 1EAH2 4N8MA 2E51A 3L9JT 3NJXA 2BGOA 3B9CA 4M3CA 4ATFA 1VP6A 4XVHA 1UIKA 3H3LA 2LROA 1JOPA 4HKOA 1PMHX 3ETPA 5FZCA 1HW5A 3WW2A 2BW8A 4LKSA 5JMOA 4Q0UA 3T2TA 5JZGB 2IZWA 1QNWA 2FDKA 3ZYIB 1EUUA 5C7GA 2XH6A 5JOWA 4L97A 3M1HA 1C8M3 2WO7A 3I3DA 4WVMA 3U4XA 2DTYA 2O1QA 4ASLA 4B8EA 4FPLA 4BZ4A 3USUB 1VALA 3QLQA 2VH9A 1BEV1 5C9AC 3AMNA 1RJ8A 5FZ7A 4BIFA 1BMV1 1GZWB 5I0UA 2GZWA 1RHI3 4FOVA 1VBD1 1HIXA 5LRSA 4JAAA 1W9SA 2XWBB 1YFXA 4FFFA 4NAOA 1TZOA 3VBUC 2PHDA 4BMBA 5FO9B 2UY8A 2VD7A 1UIJA 4BQ3A 3UT0A 1PK6B 3H3UA 4LA3A 5FZAA 5JI7A 2FCVA 4XTPA 3R0RA 3NV3A 4U2AA 5I8TA 2R063 3JD73 5FZBA 2VOTA 3J7NA 5BNOB 2ADEA 1KDMA 2ZAHA 4CUCA 1QJU1 2HYKA 1Z78A 3N9OA 4BU2A 1OH3A 3G7DA 5FWJA 1YQCA 2CY6A 4P5YA 2Y8KA 1QH7A 5D2AA 3DPRC 1R081 3POGA 3SH4A 3WNMA 4BQ5A 3ZFEA 4YW6A 5C4WB 1VE0A 2J22A 5J48A 5EWSA 1S0GA 3IKWA 5E89A 2P17A 2C1FA 4LOTA 4BH9A 5L36A 2E31A 4MXWA 4OQ9A 1UOGA 3AKQA 2RM22 3ELNA 3J7MA 4F3JA 2VMHA 1C28A 4FPGA 2QQNA 5F1RA 3RVHA 4EROA 5CG8A 2D6KA 2PHFA 2R49A 2RV9A 3I49A 5KHJA 2OQ6A 3EJKA 4XILA 4Q4Y1 5FWEA 2X5IC 4Z92B 2PQQA 1D2QA 1OPOA 1UZZA 1YFYA 3VBFC 2Y0OA 1GICA 3BCWA 1MACA 4XFFA 4JKLA 5GLWA 1HX6A 3N9PA 5BV6A 2R30A 1NXMA 1BK1A 2E7TA 2HWD2 3D4KA 4UBHA 4YM0A 4FAGA 1L7RA 2WSVA 1MVEA 2V4AA 1AX2A 1C5HA 4SBVA 3UETA 4A6SA 4QMAA 3POFA 3H1MA 3TOJA 3RZZA 4YW5A 4CDWB 1POV0 2O8QA 3PMSA 3VBOC 5F3CA 2GNBA 4FPHA 3WDVA 1AYN1 3UL2A 4R4ZA 4AEDA 4Q4W1 1FXZA 1GOFA 5C3SA 2B42B 1ST8A 4Z82A 1PO12 4YPJA 5ABJA 3SCGA 3IWZA 3WT3A 3OBTA 4AFCA 2EIBA 4NWWA 4B1MA 3POBA 3WX5A 5AVAA 1K12A 1H8TC 2CDOA 1DQ6A 2BGCA 1UKRA 3OUIA 5F39A 5FLHA 2DVBA 5H9RA 4DEVA 4C1XA 4DOUA 4FTBA 2HH9A 1AJKA 4ITCA 4F7ZA 1SLAA 2NN8A 1TME1 5FZEA 3VBRA 3J7HA 2PTMA 1UKGA 4PI0A 3WG3A 4DY3A 1J59A 3QH6A 1HB2A 3GJBA 5IVCA 4DNYA 2VZTA 3DYOA 1PM4A 2PMWB 2VCBA 2OXBA 1CONA 1T6GC 4GH4C 1V6IA 4JGYC 4XURA 4YGBA 1DGRN 2IXLA 1BEV3 3ZN6A 1PGSA 5DUWA 1ONAA 1MQTA 2YY1A 3ZDSA 5HBAA 2JDZA 1YI9A 2BFUS 1F9KA 1SLIA 1W6OA 1VBD3 4BE3A 5F5CA 5IVVA 4ZXKA 1R64A 5FYHA 4P9LA 4G9SB 2B7YA 4C90A 3W5NA 1Z0HA 1L3JA 1AHSA 3UKNA 5IVJA 1O91A 2VMCA 3HMYA 2IXIA 1XU1A 5HCBA 3N7KA 3U78A 1K45A 4GB32 3SCHA 3E6BA 4XE9A 2XBO2 4PBOA 1OKOA 5GZDA 2WNVC 3OF1A 3P3PA 4JC1A 4A7ZA 1IQDC 3CO2A 3WNLA 5EXOA 3WDXA 3J4UH 1S0FA 4NHKA 1COV1 2FZ1A 2WNUA 2HWF2 3WOGA 1EUTA 1LHWA 1V6MA 4ZXEA 2ZX4A 1V6KA 3KF5A 2AC1A 2XR4A 5SV8A 1SG3A 2CWMA 5J96B 4R52A 3N9NA 3WNOA 4DMIA 3QH7A 4K21A 3V0BB 4JDMA 3BTXA 1W0NA 5FTTC 4B4PA 2PELA 3I2JA 3JXSA 3WW4A 1RUE1 2RDRA 1O7FA 3M3CA 5K0UA 3ZKYA 1GNHA 4J1WA 5DUUA 4UOJA 1FOD3 2XWJB 2ZMNA 4WVVA 4Q5OA 1LOGA 1Y9QA 2C9AA 3KQ4B 2Q1ZB 4O61A 4CDQA 5IVBA 3E5UA 2VL4A 4LK7A 3MI8A 2V73A 1W0PA 1UMIA 2XXZA 3HR9A 1V6LA 4FPOB 1LOEA 1L7LA 4CEYB 1AF9A 3JBG1 1WLTA 2IFWA 3BALA 1Y3TA 3FLRA 3MUY1 4R8HA 5JPMB 2AENA 2CHHA 4GA9A 3ZYBA 4MGKE 1ND2C 2BVBA 5IAXA 1AJOA 3WNPA 4NOTA 1RUG1 1WMDA 2BEOA 5T5PA 3MPBA 1O4ZA 1TMF2 1NA1B 4RR3A 3FL7A 1H6XA 1OUSA 4D7YA 1SLBA 4K9SA 3PNAA 1WWYA 4CCKA 5F7UA 4YM1A 1VBB2 3KWVA 4URTA 3PIGA 3AMMA 4HL0A 4OCTA 3T2PA 5GZCA 1A34A 4A7YA 4RHV1 1W6QB 2CDPA 1G86A 4X8PA 1D0GA 1Q56A 4Y1UA 4AQ6A 2ZZJA 2WS92 2WABA 2HBUA 1POV1 2WSUA 1UY0A 2GNMA 4YLZA 1GR3A 1ZA7A 4AGRA 4TN7A 4M3CB 5E88A 2WR9A 5FYVA 1J3PA 2VVFA 1VIWB 3D5OA 2MEV1 4CPBD 4P9JA 4IEVA 5BUVA 2GC3A 2JDMA 1AX0A 1AX1A 5FYCA 4QPGC 2D44A 4R9AA 3UV9A 1AYM2 3GDBA 4YFZA 2CU5A 3CLPA 4IV3C 5FOJB 2D5HA 2AR6A 5F5QA 3I7DA 3NW4A 1GP5A 4WVMB 4BLIA 5EYXA 3CQOA 2YROA 4IGQA 3VBSC 1XSQA 5FLIA 1C4RA 1GQHA 1PM7A 1W2OA 5F9TA 5JIAA 4M3CF 1RXGA 4UFIA 5IK4A 3KCCA 2JDAA 1RVF2 4CCNA 4IEXA 2PLV1 3WF3A 5FO8B 3ZYJB 2E26A 2WO1A 5FZKA 1SFYA 2XG3A 5ACA2 5FYZA 4KQ7A 3LE0A 3R4DB 2Q5TA 3Q8CA 1OLMA 4WM7C 1DZQA 1W2NA 2Y6GA 4BXSV 5GZEA 3K77A 5E1RA 1DIWA 5CADA 4WVZA 1PMJX 1I5PA 2KM2A 3AP9A 4NAMA 3POJA 4DINB 4QX1A 2DFCA 3S57A 1W2AX 2ZGUA 1C8M2 1F2NA 2CNAA 3IZOA 3H8UA 4IW3A 3W59A 3ZFEB 2PHXA 1T2XA 1UMHA 2XKOA 5LA9A 3AP5A 3VZMA 4FOQA 5JIUA 3T09A 4JQRA 3GXUA 4MXWB 5F32A 5FCCA 1YJLA 4BXFA 4G4FA 4LO6B 3OJBA 3K46A 1D0HA 2H6BA 3ROUA 1FV3A 2RS51 3ASIA 3KGLA 3AXDA 5A7SA 3VHOA 1JU3A 4CDXC 2FMYA 1TEIA 4EYUA 1YJKA 3O1TA 5IK5A 1ND3A 2JECA 4IEPA 4A3ZA 2GAUA 1W90A 4CCLA 5L7OC 2NM1A 5CNAA 2BPA2 3HAGA 3MLKA 3OYWA 4HXCA 3SC7X 1PX4A 1AR71 1OA4A 2R062 2W39A 1G9FA 3JD72 4ARYA 4CUAA 4Q0SA 2XVLA 4QPIB 3IMNA 4XJWA 3P1IA 3B93A 2TUNA 2VUDA 2ZPXA 3EXUA 3KCYA 4HPKA 4YM2A 5IVFA 2Y6FA 2X29A 4CUGA 1AR61 3RI9A 2E33A 3SISA 2RR11 3ME2A 5JUVA 1POV3 1OOPC 1V0AA 2VXRA 4FP2A 3HBKA 2A7AA 3FN9A 4GD4A 4R9CA 3TB0A 3RZMA 1CIWA 2VVEA 2R043 5FJHA 2VCMA 3JZVA 4ES8A 5ABJB 1J84A 3VZJA 5IW0A 1YRZA 5DABA 1EPZA 4D8MA 1ZM1A 2VW1A 1RUJ1 1BCXA 3T4VA 2UURA 1LECA 1KFUL 2VMDA 3LB9A 5C3OA 1NUKA 3I3MA 2Z4FA 3VBRB 1AR83 2DVGA 1PZ9A 3AJYA 5FPBA 4M3CE 4OQ8A 2GN3A 4LBQD 5TSWA 5GZFA 4AF9A 5FLJA 5FOBB 1MZ5A 3T2QA 1XYOA 2BTVC 4LNVA 1UY4A 3ZN6B 2C26A 3LA7A 4CEWC 3ZFGA 1MQTB 3AZZA 2FDHA 3FUQA 4IEOA 2WAAA 2Y33A 3D3AA 4UI9L 4UWDA 2ZCWA 3WQ0A 1D7PM 1W6OB 4QHOA 4XETA 2A75A 5GKAC 4NIIA 1J58A 2PLV3 3NNFA 1U5IA 5KBFA 1CR7A 4MH0E 3RZGA 2ZX0A 1QJY2 3B9IA 2PHWA 4Y26A 1HB3A 2VOKA 1IQAA 2Y34A 3ABZA 1XB9A 3ZXKA 2XMLA 5FZIA 4QT6A 3WDUA 3CJXA 4Q1RA 2JD4A 2XHKA 3A0NA 4N43A 4QXBA 4E2GA 1IG0A 3ATGA 4Y1YA 3VZLA 2JIJA 3ORJA 4IEUA 1CZVA 1LRHA 1QXJA 4FBFA 1YYNA 2WNUB 3G6JB 5J3UA 5KC6A 4LHNA 2SBAA 3BYWA 2XPJA 4YW7A 2PHTA 1OSGA 3WUCA 4OUSA 5IK8A 2FDJA 1PNFA 2WFF3 3BGAA 4BQYA 5FDBA 5LASA 4FTSA 1V9U1 4EQVA 4XEZA 2BOJA 4FFIA 5FZFA 1R092 1WCUA 4QQHA 2XOMA 5FZ1A 2LTNA 3N7MA 4ZZ8A 3RI8A 3T3YA 2ZXQA 5K0UB 1UD1A 1UYXA 3DV8A 1C5IA 1UOFA 4NR1A 2RS53 3N3HA 3CBNA 1DGRA 2BNNA 4EN8B 5CFCC 3HNYM 5JOXA 5FPUA 3I2IA 1HRV3 4U36A 3NAPA 2NPIA 4CUBA 3OD0A 3Q8EA 4XFGA 4CDQB 2B9UA 2ERFA 3KGZA 3WR0A 3A7QA 1U5XA 2YUEA 4WM8A 1GV9A 2C5DA 2E32A 5F8PA 2BWAA 1WW4A 4AQTA 3VHRA 4XF4A 3I2KA 5C8CA 5EJZB 4XMAA 1T6BX 2VNOA 1JW6A 2HWC2 3AK0A 1O5LA 3O0WA 4HN1A 4RL7A 3T0BA 1UX7A 1FI2A 3LPGA 1MZ6A 3GZTB 3RQ0A 2YB7A 1PNGA 4DB5A 5D1IA 5FAXA 3PDQA 5I0DA 2VAUA 1QXPA 4XTMA 2R16A 1AR63 4JTNA 2RMU3 3ACLA 4RR3B 2DVFA 3ZMNA 5APAA 2XUEA 2VNVA 5IATA 3H8XA 3WEZA 3NJZA 3OSDA 1ULPA 1UPIA 5JR7B 1ULDA 2WQ8A 4R9BA 1FOD2 3ALQA 3OPZA 4OHXA 5JOZA 2VQ0A 4D69A 4MGQA 3MIDA 3LDBA 3ZDVA 1ZNPA 2W47A 2ZEZA 3POIA 1ZBE1 1ZZ9A 2R1BA 5A7QA 5LRRA 1WMFA 5JPNB 2OKXA 2UU8A 2DCJA 5ERLA 3FX3A 1HLCA 4W6XA 1C1FA 4YG0A 4I01A 1W2UA 1K5MC 4M00A 2EIEA 3E1F1 4D7SA 4BQWA 3EBRA 2V5DA 4HLTA 2PHRA 2QVSB 3IDAA 4GB31 1UYZA 1ULEA 4AVTA 4D6SA 1N3PA 4NPLA 1D4M3 1HXS3 2NMNA 2WT2A 2VBDA 2VC9A 3AKTA 3MZHA 4M4PA 4IESA 3PMEA 1XSRA 2YMZA 2E9QA 5LW9A 3MV01 5L9RA 3LFIA 1WW5A 4HK8A 1QQP3 1PK6A 3AC0A 4KG0A 3ZXAC 5CAZA 3VL8A 1C8NA 1RUC1 2DDUA 4YG6A 1FT9A 2CSGA 2ZKLA 2YYOA 3M3QA 1JYNA 1O4YA 1MS3A 2AH2A 4XYXA 3Q8BA 5BNOA 1PVXA 2LUWA 2V72A 2VNGA 5FZ8A 1RMU3 1RTVA 3BPZA 5FKBA 3M7AA 5LATA 4GWNA 2F4PA 4GKXA 2UWCA 3BOPA 2JWPA 4I0AA 1US2A 4EN0A 3O1UA 3MBWA 3ZSKA 2LM3A 3NVCA 1H2KA 2Y26A 1DG6A 4Y3OA 1ZRIA 2DUOA 4ORFA 1XE0A 1NCRC 3D0JA 2PQSA 4NJ4A 2W9XA 2P1BA 4MLOA 4PDWB 1XE7A 4MO3M 5LEJA 2BZDA 1PGW1 1MS1A 3OPTA 4RGGA 4UXAA 1SFPA 3LD8A 5IT6A 2R0FA 4Z1VA 3Q8AA 2W94A 3OGJA 4I02A 4BK5A 4META 3EYPA 2Y6HA 3SXWA 2ET7A 1PO23 5T3NA 1JYXA 2H6CA 4RN5A 3RRDA 4AEKA 4AE2A 1W6MA 2D3PA 5KHHA 2WQZC 1IZ3A 2RJKA 4CP2A 1WW6A 4L2NA 5F2WA 1MPXA 3ZIWA 4AQSA 5J98B 4Q8KA 2ETEA 5FZMA 3MO4A 3O12A 3MPPG 1MS5A 4E8CA 4YGCA 1ZYBA 2XJSA 2JDKA 2Z42A 1EV11 4ZU7A 2J7MA 1JZ3A 2J1VA 2VQTA 2VMIA 4HT1T 3OYWB 4FPFA 4YVSA 1JU4A 2ZEXA 4K6BA 4Q4V1 3WCSA 2EAKA 3KF3A 4LULA 1NY72 5K8SA 1OA2A 4YYOA 3BUCA 2IXHA 1YWKA 3NNLA 2CGOA 5C8WA 4GIQA 4AI8A 3UNPA 3FFZA 2R073 4QDRA 4Y20A 2WO3A 4HPKB 3J8F3 4B4RA 1IS4A 1F15A 2OZJA 4QB2A 3QCWA 2E7AA 2OA2A 3VZOA 2K46A 1WA6X 2ARBA 4D3WA 1ZBE3 4OFGA 1GOGA 1GZTA 3AP4A 3UJQA 1YQ5A 4QPYA 1J3RA 2LRPA 3DPRA 1LGNA 3KV4A 1DCSA 3BIWE 5DDJ1 4AW7A 1FAYA 4HVRA 4NIAA 1TQ5A 5BNPC 1ZZ6A 1NXD1 4RFRB 3WNNA 2Q1MA 2Q8EA 2QNKA 4XBLA 4NUBA 4E8DA 2JIGA 3KD4A 5FMOS 3UKVA 1US3A 4CCCA 3C2UA 2J1RA 3FLPA 1NT0A 5JXIA 2X5IA 4S2GA 4QXKA 5T5JA 4LO4B 1BXHA 1G7YA 2LALA 5J09A 3D82A 4D6QA 4FQZA 3ZFGB 1VRH3 1HQNA 3AZXA 2Y6JA 3AM2A 4ZKTB 4PF5A 1QJX3 1ZBA3 1ULFA 2EXIA 3TBDA 4HSLA 5A6XA 2JE7A 4KU7A 3RSJA 1ZX5A 4YVWC 5LCWL 1YNAA 4Y4RA 3ZFFB 4H7LA 3LPFA 1LU1A 5DAPA 2Y6KA 1U0AA 3KVAA 3ACFA 4GXLA 4XHBA 2BERA 2R042 3MLJA 2XJTA 1VAKA 2VOVA 5KC5A 1NKGA 2E63A 4P9YA 4YGDA 5HV0A 1W06A 1CPMA 1JUHA 3ZYPA 5IYYA 1R1A1 4XF0A 1WLCA 3RZJA 2D6PA 1SMVA 2ZGSA 4Q4X2 4EV0A 4QHBA 1AR82 1H8TA 2P3IA 2XLAA 4BDVB 2ZJCA 1AL0G 1RUI1 1FMD1 1QWRA 5LBEA 3FBMA 1OLME 4Y33A 2HWB1 3N7JA 5C3PA 2VZQA 3OTFA 1YFWA 4XIOA 5EIYB 1OF4A 4GH4A 3IAPA 3U07A 3MW4A 4HK9A 3OB8A 4JGYA 1UN1A 5F5IA 3MEPA 1QHDA 3NAPB 1CAUA 3AMPA 1H9WA 3CHXA 2CAVA 1XBFA 3IDEA 5JZGC 5CU1A 2GSYA 2YBPA 5B4XA 4CU9A 4WM8B 4OHYA 5CYYA 1ZRDA 1H2NA 4Q4V3 1NA1A 5C8CB 5A7OA 1HN0A 1YCIA 3E6DA 3L2HA 2QQIA 1J83A 3MYXA 3POYA 3SEPA 2WA4A 2BYVE 1UZYA 1IPJA 1DQ4A 2IXJA 3P3NA 3PU8A 1W9WA 4YRDA 2WNVA 4DUWA 5CZKA 1FPN1 2WFF2 1QJFA 5IFPA 5T5OA 4CZSA 2RE9A 2ZMLA 3RPQA 1PIV1 1TNRA 4A7KA 3VBHA 5CB7A 2W68A 2VPVA 2VZOA 1CN1A 4ZZ5A 4YFWA 1B09A 4AFAA 2FCTA 1CJDA 1QH6A 3O1PA 2PHLA 4B29A 4MVTA 5FZ4A 5LZ6A 1GUIA 1BYHA 1HRV2 4XF1A 1WCSA 4XF3A 2TEPA 4E2QA 1JI6A 2DUQA 5LEKA 1MZFA 4MZUA 4EN7B 4LE3A 1CAXA 1VMHA 5A6QA 3S0MA 2JG9C 5C4WC 4Q1PA 1ASJ3 1VBC1 3I59A 1LGCA 4B4QA 1ZRCA 4KNCA 1S0DA 4LLFA 3T08A 4BB3A 2WWJA 2Z79A 5A3MA 2KXLA 2D40A 1K3IA 1CD3G 4LBQB 5CIRA 1IGOA 3JB8A 2RMU2 4FT8A 3ZOIA 4DUVA 1C57A 1OLQA 1OQDA 3GNEA 4EZ4A 4FSJA 4XOGA 4NVPA 4XZPA 3ZR6A 4UFHA 1RUF1 1JYTA 2W52A 1REFA 4JCKA 1B35A 2KD7A 4E4SA 2WKKA 3KVBA 3MGUA 2R32A 2BGPA 4DQAA 5IK7A 2YU2A 3MICA 1S1AA 3X29B 2EIDA 3U11A 3O1MA 1DGWX 1WGPA 3K48A 2PFWA 1RUI3 4XZUG 1W03A 1QXRA 2DYCA 3NKTA 2WBKA 3AYAA 4XUQA 2GU9A 3FBYA 3KV6A 4XQ4A 1FNYA 3H50A 1CAWB 5ISLA 2GC2A 4AEMA 5JOYA 2B39A 4BLJA 3CF6E 5FZ6A 4MX3A 5LK7B 1D4M2 1E5IA 1HXS2 3V0AA 2HJIA 4S2DA 3H1YA 4HZFA 2HWC1 1VBE3 2ZGTA 2WZR3 3VDCA 4QXHA 5KHIA 2B8MA 1DQ5A 4S2HA 4IV3A 5K4LA 1W6MB 1QQP2 3OY8A 1H1IA 1HJFA 2EXHA 3FE5A 4IEWA 4DXTA 4FOWA 4NROA 1LHUA 2E7QA 2EICA 3MW2A 3VDDC 4QPIA 5A7WA 3I97A 3S5AA 5EP9A 2GC0A 1V6JA 2CYFA 2XJVA 1KJRA 1W3XA 2W3JA 2ZS6B 4QM9A 3LCPA 4YVSB 5FP7A 1RUD1 2NQYA 5GJ6A 1UMZA 3PUAA 1PIV3 4TZDA 1PGL1 4AHZA 1H6YA 4XFIA 2Y64A 2ZX3A 1AL21 1ZZBA 4WM7A 3T4HB 5FYBA 3FHAA 4Y20B 3UYJA 2JKBA 5A1LA 5AVPA 5JAXA 4GJZA 2ZBJA 3VD9A 4QQPA 1PO22 2VCCA 1YIFA 3O14A 5GLZA 3ZYRA 3RS6A 3H42B 5F2SA 3IMMA 3DPRB 1OT5A 3ZPOA 4Z2WA 1ZRFA 4KI5M 1XC6A 4UW4A 4BIOA 4KU8A 3VHPA 4BA6A 1Z7S2 1SFNA 4K1YA 5AC91 1RITA 3AL5A 3B7MA 3IT8A 3PHMA 2ORZA 3S30A 4J1XA 2BJSA 3GBFA 1RUH1 1LU2A 1QOOA 3WF1A 4DRRA 2VVDA 4FQ4A 4I0BA 5DQ0A 1JYIA 3WDTA 1ULOA 4MV2A 4IGPA 2X5IB 3PTRB 4LEJA 5T50A 4M4RA 4OHZA 4MGZE 1XPWA 4AGVA 5C5UA 1ALYA 4HOOA 4F83A 1H2LA 4IE4A 5A3TA 1GU3A 1RUF3 2AACA 2R072 4CEYC 1JZ4A 3J8F2 5DUXA 3TNPB 3WF4A 4V2WA 5DPNA 3GZAA 1QJU3 1BHGA 4LHLA 1P8JA 3C7HA 5D8AC 5FUPA 4XBNA 5A1FA 2FCUA 1FNZA 1OVSA 5BNNC 1U12A 5CFDA 1R083 3T1LA 1UZVA 1OFNA 4XAEA 1OOPA 2GNTA 2DCYA 4NWVA 3FHIB 4Y22A 5FKCA 5HCHA 1WMEA 2YPDA 4XDQA 1AXZA 3HIFA 4N90A 4NE9A 1JZ5A 4DY5A 4LKFA 1NE4A 2V09A 3KS7A 4JQTA 4CVUA 4ZONA 3H1WA 1H8TB 2XLGA 5FY5A 3MIHA 2DCTA 1ZZCA 4Q4Y3 3U14A 2H0VA 3ES4A 4WZFA 1PVC2 1LEDA 4LO5B 3IPVA 1DQ2A 3VD4A 2G9GA 3PTYA 4QX8A 3URFA 1O6UA 1S0EA 4LOSA 2VW2A 5FZGA 2VQUA 2D6LX 1HRI2 3AJZA 1UO9A 1ZBA2 2QE3A 2YFUA 3O0VA 4GH4B 4N53A 4XXPA 5EJ1B 5J37A 4JGYB 4CDUA 1JS9A 2QUOA 1E5RA 2NP0A 5A3WA 1MEC2 1Y9GA 4CEWA 1W6PA 1QDCA 3E5XA 1CAUB 4WVWA 2MPFA 4RQPA 4K8RB 2XJUA 3FWEA 3WDYA 2VMEA 1UPSA 2XQRA 4YWAA 4FPEA 5F3GA 2F4LA 1JBCA 1AYN3 1W8WA 5DAVA 1RUD3 2J42A 1BJQA 2NLRA 4Q4W3 5FZ3A 3THCA 1NZIA 1SBEA 3HNMA 3MIBA 1GYKA 2RS31 1Q8VA 2ZHMA 4FPKA 1XNAA 4P08A 1SDDB 3M3IA 3OG2A 2VGDA 2DUPA 2XKPA 2WNVB 3GBGA 1RUNA 4N7IA 5CKNA 1WMXA 2W5FA 2RS11 1O3SA 1ENXA 2YDEA 3JQXA 3TEXA 2XVGA 2ZGLA 3B94A 1REDA 3ZXDA 1TME3 5BXXA 3WHTA 3OPWA 2JB4A 1LR5A 2VU9A 3IDBB 3M4FA 3VBHB 3W5MA 1X9PA 1F4AA 4XUOA 2ZGQA 1XJAA 3LA2A 5JDBA 4HFSA 4NRQA 4TXWA 5AC93 5FPXA 3OGRA 1JHJA 4OHWA 1OQ1A 3WINE 2YC4A 2WQ4A 3LIGA 2G9ZA 1U5YA 2MNGA 2VZ3A 1RUH3 4AWDA 2XLFA 1NLQA 4LJHA 2UYBA 3B01A 3OCPA 1OKQA 1BQPA 1AR91 1S0CA 2ATFA 2GP3A 3GJAA 1URXA 4XQWA 4AI3A 4H7MA 1CAXB 4DXSA 3ZFEC 5LB6A 4I2OA 1VBA2 3S7IA 3PJQA 4Y1XA 3H7JA 1TNFA 2GC1A 3I59B 3NV2A 4FVVA 4OUMA 4KWUA 2X53S 3PURA 2ILMA 3ACGA 3VKMA 1JZ8A 4P14A 4QX2A 4UFMA 3AX4A 5DG1A 2GP5A 4DO0A 1COV3 2JXAA 4FPYA 1GMMA 1GANA 1W8UA 1SLTA 2HWE1 5D21A 1BBT1 4B3NA 1APNA 1WLDA 4AHWA 2Z69A 3E5QA 3WQ1A 1MS0A 3A22A 1LNSA 1LOFC 3VZNA 1NCQA 3JUUA 4PDWA 1GZCA 3T2OA 5FQ0A 1RUE3 1B35B 1EP0A 1XYNA 3DXUA 3AMHA 4IE7A 1GP4A 4CE8A 4KL1A 3CJIC 1S0BA 1IS6A 4J6GA 2OUJA 3NL1A 1QU0A 4XAAA 1KXGA 3LIHA 1M4WA 2YGMA 4LBJA 3TN91 2FD8A 1JYVA 4GWIA 1G9AA 4AEDC 1ASJ2 3O0XA 4D6RA 3NJVA 1A8MA 3WP4A 1XNBA 1JOJA 1VLNA 3FJSA 3JBG3 1RHI2 4FI9A 5JLVA 3K4AA 3OBAA 4L8QA 4RSUA 1WKYA 3DN7A 5FMBA 3V0AB 4DEQA 5FYMA 3GYDA 4W8JA 1BVP1 3KT1A 4KWLA 1JN2P 2WNEA 4NIDA 1NE6A 1RUG3 2A1XA 2G4IA 2YBSA 3OY8B 1E5HA 3NV1A 4IEZA 4IV3B 3O1RA 1BK0A 4K3UA 3O1OA 2I45A 2W1UA 3RYRA 3VBSB 2RS33 3NNGA 4NPRA 2ES3A 1ENRA 3VD5A 3POSA 3ZMOA 3DGTA 4QKNA 4Q26A 1EAH1 4YZ4A 3ILRA 5A7WB 4D94A 3RGBA 2WUHA 5A3LA 1MQTC 3B00A 3D0SA 4RHV3 4XMIA 2XDVA 2RS13 3HD8B 3LDRA 3P6BA 4LTAA 2UWBA 5JXHA 4UBGA 1X8MA 2IUWA 2VMGA 4HSJA 3VB9A 3ZSEA 3H0OA 2DBNA 2JDHA 1RC6A 5A7NA 5JR2A 2W87A 4MYEA 1CESA 3GGLA 1UXXX 2MEV3 4QHZA 2DWRA 3E97A 5A1AA 5GZGA 4WM7B 1JH5A 1DGLA 4Z2AA 2FDIA 3WD5A 3VDBA 1VBE2 1HN1A 1VAVA 2WZR2 4Y5TA 1YQ6A 2HBTA 4EN6B 2O14A 2WNUC 1WZXA 3KZ4C 2QZ2A 4PI2A 5G04L 4AAXA 3EMRA 3N9LA 4J25A 5FMDA 3IM0A 2GMPA 2YC2A 4CPBA 1HQLA 5F3IA 5LBFA 1LOAA 5F5AA 2WWUA 3AFGA 2JDUA 4Z07A 2IXCA 3LFMA 2QQJA 2QJVA 5EYYA 2AEZA 4XHXA 2TNFA 1LULA 1DHKB 5IFTA 2K2SA 4BK4A 1JXNA 3LOIA 1OBNA 3KT7A 5FZOA 4XABA 2G1MA 4MGIE 4AK3A 4CDXB 4INDA 1ULGA 4OYUA 3IN9A 3AP7A 3B69A 1J1LA 4YM3A 1RYYA 2UYAA 3O7OA 5FY0A 3ZFFA 1UZWA 1OHFA 2HWE3 4KGQA 5FY8A 4CDQC 2BUKA 3FMGA 4YARA 5E16A 5FREA 3ES1A 3T0DA 4CRQA 1NQJA 4A45A 3OBRA 3UKTA 3WP6A 2B45X 1YIPA 4W65A 3PU3A 2RM21 4COYA 4QX5A 5CFDB 3WW1A 2OZ6A 3PIJA 4AZZA 1W6NA 3TN93 2C9KA 1OOPB 4Y22B 4RR3C 2ZZQA 4KG8A 4ZHNA 3I3QA 1BEV2 3OUHA 4LKDA 1BMV2 3WDWA 3HNBM 1Q3EA 4N9IA 1SACA 1GLHA 2Q8DA 4Q0VA 1VBD2 5BNPA 2P2KA 4BISA 1OI6A 2C4XA 1ZA4A 1W2TA 4IETA 4AFDA 2HWD1 1A6CA 2XUMA 2LW8A 1H30A 3IPVB 1DLLA 2ZAAA 3CKHA 4HMZA 4LO7A 4OVEA 1RGSA 3DCQA 3UGHA 1C3HA 3KV5A 1F31A 1AR73 1H4HA 4N53B 3K3OA 5IUQA 4CDUB 1PHMA 2PXJA 3MHZA 1POQA 4CEWB 2EA7A 1QJU2 1W6PB 4O9EA 1QGLA 3H3ZA 2FMDA 1GBGA 4HETA 3P5BA 5DZGA 4RQPB 3WXPA 1PO11 3RDIA 5EHDA 3L2YA 3CDZB 1R082 3LA3A 2D97A 4B7KA 2RR13 4AVSA 2WZPP 1H9PA 4C8DA 3PVEA 1LOCA 3GZUC 2PAKA 4FXGB 4LBLA 1H2MA 1KD7A 1V6OA 1ZVFA 1SZBA 2J1SA 2OVUA 2D98A 5ANNA 2ZEYA 3HQUA 4ISRA 1RUJ3 3M70A 1O59A 4Q4Y2 4W4ZA 1M06G 3EHKA 1QY4A 3OD4A 4COZA 5FUNA 4HVQA 2YZ4A 4ZS2A 5FUIA 3DUIA 4HBNA 4GMP0 4PLNA 2VZRA 1E5SA 4QB1A 1EYBA 2RHPA 1J3QA 3ZXJA 3CNAA 4GALA 1CZTA 5BYNA 1GOHA 2IWGB 3ACIA 3PUIA 3NMBA 4OUEA 1XNDA 1W8ZA 1O3TA 2EVXA 4PIYA 2HEYF 3LEMA 2QQWA 5I8YA 2XBO1 1Q8SA 4LBQA 1AYN2 1QJZA 3SKVA 1ENSA 1WD3A 2DVAA 4Q4W2 3C7GA 4S2FA 3WG2A 1F5JA 1UY2A 2HWF1 4AG4A 3ZVXA 2WZ8A 4BM8A 4OMDA 4Y24A 4P9GA 2VBPA 1W3VA 1YUDA 2W1WA 2WWSA 2W92A 4RS5A 5T52A 5A6ZA 2W46A 4ZPIA 2JD9A 3H8RA 1TME2 1OPMA 2VTXA 2YXSA 1ND3C 2ZEWA 4LIUA 4BYYA 1V9U3 4QM8A 4TSVA 3R4UA 3LZZA 1XOYA 1L7QA 3HPNA 4MGSA 5FQ0B 1NCQB 1VRBA 4QGLA 1YEWA 3IDCB 1CAWA 3ITQA 2B4KA 4TWTA 4R9DA 4DS0A 2KA3A 4IV1C 5T54A 4R4XA 3SQOA 2IC1A 5JSRA 2WA3A 4QXCA 2FQPA 2YBKA 4L11A 3ZN5A 1IHMA 5CBLA 5KHKA 3AL6A 2A3WA 4W50A 3RWKX 4A2UA 2ZGKA 3IAQA 2OPWA 4G3YC 4DPNA 5FPLA 1X9TA 1N47A 2V4VA 3AB0A 1PMIA 5KXBA 2QCSB 4V1PA 1DDLA 5FYIA 1FATA 3ZYGA 3N9QA 3WLUA 2A3YA 2JE9A 1H1MA 2ZHKA 1UNBA 2Z5WA 3ZX7A 4ISQA 2J1AA 1DF0A 1TMF1 2JG9A 4PF1A 1ZZ7A 5C9AA 1COV2 2C24A 1V70A 4BQ2A 2RDQA 3IBMA 1VBB1 4QB6A 2WINB 3NQHA 4XUNA 5F6LB 5A3UA 4NHYA 3PL0A 2D43A 1KJLA 1VMFA 1VB4A 2ZGRA 3ZKUA 4LHKA 3N36A 1IPSA 5HPOA 1N1VA 1UU6A 4QX3A 2JG8C 3VBUA 5HCAA 4JGZC 2WS91 3HQRA 3ILNA 4MGYE 4UF0A 5EV7A 1I5ZA 3THTA 4DIQA 3WP5A 1UY1A 2VO5A 1RINA 2OIIA 4UT5A 5CKQA 4CP9A 3CIHA 1DZRA 4IE6A 2DCKA 4MADA 4C1WA 2XQXA 5FXZA 2ZMKA 4FOYA 4XFBA 4IERA 3CEWA 4AR2A 2QQMA 2CL2A 3RYPA 4XJAA 1AYM1 4OZOA 3JBG2 4LBMA 4N43C 4TLFA 3SITA 1AZDA 4MG2A 3RMXA 5FPZA 2PA7A 1SHWB 4LBKA 3BB6A 1GNYA 4A3XA 3RG0A 4BQXA 1F5FA 1JHNA 3ILFA 4GB33 3B3QE 1RUG2 2FBEA 2XBO3 4NO4A 2VR4A 3D8CA 2WAOA 4H3WA 4XC9A 1W8TA 4Y1ZA 1RVF1 1SCSA 2BNMA 3I2OA 2EALA 4GMP1 3VBFA 1KEXA 4FP3A 2XB6C 1RUC3 4MHRA 3UGGA 5ACA1 3AVSA 4RHV2 1LKNA 2YC0A 4MGTA 3WF2A 5IHRA 5FZOB 4AGGA 4QQLA 5A3NA 2QDRA 5M0TA 2EF6A 1RJ7A 2ZGMA 4CTEA 2VQAA 4UW6A 1IOAA 5F6KA 2WNOA 4AEDB 1O3QA 3VBOA 1QNYA 4LR4A 2N7GA 3C7FA 3U37A 1DYPA 3BPSA 3N35A 2MEV2 5FP3A 3WHUA 5C8CC 3JCIA 1C8M1 4LA2A 4XJ9A 1JUIA 3PLQA 3TWIA 3WG4A 3TAYA 2H0BA 4CP1A 3AXEA 1V00A 5FYSA 5FZ9A 3GCXA 1RHI1 1YO8A 3EB7A 4IXLA 1W9TA 1XNTA 4OI2A 1W6NB 2YGLA 2QTWB 5FZLA 4LITA 5FY4A 3C3VA 4EN9B 2PHUA 2VULA 5FMCA 3KHCA 5LBCA 5BY5A 5JSOA 2FZ2A 4QDQA 2XHNA 2KR2A 3ECQA 1VB2A 5FPAA 1TMF3 2ZX2A 3ZR5A 4BMEA 5BNPB 2PLV2 4COUA 2R061 1A8DA 2QQLA 3JD71 5L19A 2A6YA 2VZ1A 1F4HA 1EV13 5HXVA 3VGIA 4Y1VA 5GLUA 1WBFA 1VAMA 5LA1A 4NIGA 3I54A 2CGNA 3S7EA 3MW3A 2DTWA 2ORXA 1XRUA 4EJRA 2W1SA 3HOBA 4FO9A 2CGPA 1W8HA 2ARXA 2W1QA 4XCBA 4K8FA 5GM0A 2XVKA 2P3YA 3OGVA 1JOBA 2P5BA 2X8KA 2XJRA 1QOSA 3DKQA 4QX0A 3ON7A 3PVNA 1QMJA 5A33A 5I91A 1I6XA 5D8AA 2EAAA 4H55A 4DXRA 1W05A 5BNNA 2ARCA 2Q8OA 2WZEA 1LESA 1VMJA 5DDJ3 3ZXGA 1PK6C 3HT1A 2RS52 5T55A 3RWNA 1AVBA 5CG9A 5BNOC 4OZXA 4L92A 4XF9A 5FZDA 3AFKA 1N3QA 4ARXA 1CX1A 1JYWA 1DGWA 1S2EA 1AR72 2OPKA 3MIGA 2J1EA 1QOTA 2RDNA 3GCWA 1YHFA 1QJY1 5FK8A 5I93A 3TNQA 1F35A 4PIZA 4W6YA 3WQ7A 2Q1FA 3ZXFA 4O7XA 1DFQA 5ACA3 2A70A 4FPCA 1XXNA 3SMHA 1RIRA 4AI9A 4COWA 3SEEA 1STMA 4RGKA 2OT7A 1AR62 3U4SA 3KLSA 2RR12 1KITA 2R7EB 4LHSA 5FR3A 1ND2A 2O8OA 2JICA 2QKDA 3EO6A 2RG4A 3OOXA 4RGAA 4LO8A 5LWBA 3BTZA 3DF0A 4NPMA 1WBLA 3MF9A 3K4DA 2O0OA 3ST7A 3WCRA 5FMOL 2A6XA 1GFF2 1R1ZA 3ZLIA 4HKLA 4UAPA 4CU8A 2BVVA 4E4DX 1GWMA 4SLIA 5A32A 1RUJ2 4RS5B 1R091 1QJEA 3INAA 4ZY9A 1R1A3 3VKNA 4KBBA 1LJ7A 1UW8A 1SLLA 3RJRA 4XUTA 1W8OA 4CDWC 3BVCA 5DG2A 2DBIA 1FMD3 1QIQA 4KH9A 2A6ZA 3SCFA 1MZEA 4M0HA 4YVSC 2VE1A 5FRAA 2HWB3 4QU2A 4E9KA 3E6CC 2HKXA 2YU1A 5IJRA 5BPXA 3MV11 4Y4YA 2VUAA 4F8AA 1KRIA 1K5JA 2GDFA 5DAWA 4UFJA 4QQ2A 2OX0A 1W9FA 4AVAA 5GALA 4QPGA 4DZGA 5J1XA 3BOWA 3OUJA 4X8NA 2OYZA 1O4TA 3WW3A 3NNJA 4GAZA 5FYUA 3J26N 2D6OX 2ID4A 3T0AA 1X36A 4AVVA 1OC1A 2Y60A 4I3GA 3N7LA 2D5FA 3VBSA 1SBDA 2JG9B 3AMQA 3QBQA 4AI2A 1X7NA 5C9AB 1RMU2 5C5TA 4QGNA 4D7TA 2GMMA 3LSDA 5L73A 1BVVA 3BKZA 1CX4A 1FPN3 5FP4A 3VKLA 5LY1A 2GALA 1V9U2 3MF6A 1FOD1 1SDWA 1SPPA 2TBVA 2VOWA 3CMGA 3U10A 4CXXA 5HCFA 3VBUB 4JV4A 5H9QA 4UF0B 3H7YA 3N4MA 2WDBA 2XL9A 5ANQA 4AXOA 2ZX1A 2XJPA 3WG1A 4PBPA 4HKWA 1LOFA 2WJSA 2X10A 4CP9B 2ZACA 3EQEA 2ARAA 1O3RA 1S2KA 5DZFA 1OH4A 2QQOA 4I09A 3HT2A 1GWLA 3CJIA 4H14A 4I0WB 4OI4A 3T1MA 3JQWA 1PZ7A 3U0ZA 3VKFC 1YLLA 2JEMA 4DFSA 3NNMA 3AYDA 3V64A 1QJY3 3UESA 2ZA9A 1VPHA 1UQXA 1VBC3 2VCAA 4KMQA 2VZVA 1RXFA 4QKDA 5EZWA 3RFRA 2NMOA 1G9DA 3DKWA 3BIEA 1H0BA 2HEVF 1A78A 2VZUA 4V2VA 4CDXA 1LGBA 1NQDA 2VM9A 4AEJA 1S55A 4OULA 3KSCA 2GNDA 4OI1A 1WCDJ 1WW7A 3J9SA 5CA6A 5F3EA 5IVYA 1Y43B 3VBFB 5L7OA 5LBBA 1ODNA 4MSVA 3CL1A 3NSTA 4CXWA 2ENRA 3W21A 2DCZA 2WO2A 1G6NA 1KDKA 2P3KA 1JMUB 5DMYA 3VDDB 1R093 5FBZA 5C3RA 1SCRA 3HBZA 4QU1A 1ZBE2 3WNXA 3WVJA 1GQGA 1O8SA 3VBOB 4CCOA 1AUYA 4AQ2A 3FLTA 2HYXA 3WY6A 4HONA 4ET7A 3MFAA 4YW2A 1NA1C 4FPJA 4ES9A 4YSFA 2Y38A 1W28A 3KB5A 3RYKA 4GJYA 3LDKA 1BLZA 3QOPA 1XNKA 5A80A 5FP8A 1N1YA 4A4AA 2WYFA 5DUVA 1UL9A 3VN4A 2HWC3 4AL9A 4XDPA 4Q29A 2BBAA 5CVRA 3VKOA 4XPVA 3DL3A 5A7PA 3USSA 3Q8FA 5FJKA 3V65A 1RUC2 1U5ZA 1VRH2 3VBHC 2DF7A 3ZSJA 1FV2A 1QJX2 4GKYA 4OLLA 4YZ1A 2FDFA 3GHNA 1NAEA 1HDKA 3OEAA 4Q2FA 4CCDA 3BU0A 3H9AA 4QGMA 1NY71 4LLOA 1SEFA 5FY1A 4HANA 4CYDA 5K9YA 1EY2A 3M3OA 3POWA 1JZ7A 1G9BA 1EPWA 2VOXA 2XGXA 4JX0A 1CGPA 2Q8CA 2BQPA 2EIGA 1HV0A 5E8AA 3WQBA 1H4GA 4L0PA 3WNKA 4BCUA 2G9FA 3DXTA 3VV1A 1PGW2 1AL23 1TG7A 1GNZA 3GBWA 4IDZA 4UFLA 3I8TA 3HQXA 4YGEA 2EXJA 3HEIA 3O5SA 3JB4C 4LUMA 4LUKA 5A33B 3I2DA 4WZCA 3Q9OA 4AHYA 4D0QA 2P34A 3ENRA 2ZKNA 5D8AB 5FO7B 5JXGA 3DECA 1NG0A 1TE1B 4JDNA 4NRMA 5G05L 5BNNB 4GULA 5KR7A 5I8SA 3BTYA 2GMEA 2ZOEB 4XFHA 3BTAA 1CPNA 4MOAA 1AXKA 4EWDA 2BP6A 3M3EA 3WUDA 1B35C 4TYSA 1EV12 2WN3A 3I3EA 4Q0PA 4RFT0 4BWOA 5CFCA 1I1EA 1W9YA 1JZ2A 1UOBA 5JSPA 2MHFA 4O9GA 4Q4V2 4P5HA 4P9WA 2YPJA 4JTOA 3H8OA 1QF3A 1SQ4A 1Q8PA 4OMCA 4QPWA 2W91A 1X82A 4XW3A 4ZS3A 5KWRA 1I3HA 4LT5A 2BU9A 2R041 1ZREA 3VD7A 1X8EA 2Q0AA 2AGSA 1JODA 3THDA 1BKZA 4FXKB 4MXVA 1MS4A 1W0OA 4Q0QA 2ZHLA 4IQPA 4WV8A 4XJZA 3GF6A 1ND2B 4LXLA 2VG9A 2E53A 2Y6LA 3AYCA 4Y5Z0 4BQ1A 5I0RA 2BFUL 2RJ2A 4Q4X1 5DDJ2 2JENA 2ET1A 5K7PA 1AR81 2I74A 4JHZA 1N1SA 5C6CA 2C6SA 3F95A 5FZ0A 5DAQA 2OS2A 1OUXA 5A32B 2VTXJ 2NYYA 1YFUA 3NKGA 4JRLA 4IEYA 4WBBA 3RJ2X 4MUVA 4QPIC 4PQ9A 2CWSA 4HG6B 4N9HA 1NZCA 4K1ZA 1LHOA 4QKBA 2IVIB 2JX9A 2HEWF 2JJ6A 5AFBA 2D93A 3C7EA 4AYUA 2ZTNA 3PUSA 4Q8LA 1REEA 3R4SA 5F37A 3RZKA 3C8XA 1W8NA 3ZSMA 4BQ4A 1DYKA 4GZ9A 2PAMA 5A70A 2AREA 2SLIA 3LQCA 5FXVA 5ABJC 1K5MA 1YC61 4P9IA 1LOBA 4QPGB 1DBNA 2XONA 1QDOA 3LSEA 3W58A 3GALA 1LHNA 1YI7A 4XXAA 2JE8A 2W0XA 4W6WA 3VUOA 4ZU4A 5T5LA 1W8FA 3VBRC 2VY0A 2D7FA 1N1TA 2WFF1 3LEGA 4JVAA 4XCAA 3WZ1A 2PYTA 3ZXEA 3I2GA 5LK5A 4PCRA 4COVA 1OA3A 1R1A2 3W20A 3A0KA 3KT4A 3VD3A 1HJGA 1N3OA 4K20A 2IFRA 4M0NA 5L9BA 4E2SA 2QQUA 3AKPA 4NIHA 1RUI2 2VXJA 1FMD2 3V56A 1XU2A 1SPPB 1DQ1A 3M8LA 2BNOA 1HRV1 3K51A 4JDOA 2HWB2 2WT1A 4IEQA 5BNQA 4UW5A 3SH5A 4IGOA 3WP3A 4FCAA 2ZHNA 3LEKA 5EJ3A 3LAGA 5FY7A 2D3SA 1NCRA 4HVOA 3THPA 3CZUA 1S0IA 3B5LB 4YW1A 3UK9A 1IS3A 4M01A 1OQEA 2HLEA 2ZGPA 3WF0A 2VMFA 3ZSLA 3LF7A 5FFOC 4IV1A 3CJIB 3FUOA 5CKMA 5IAVA 5H9PA 1AR93 1G9CA 2P4EA 2C0ZA 5CFDC 2B46X 2X09A 2FDGA 2BWCA 2RMU1 4P00B 5JWPA 1H1AA 1S4CA 1J1TA 2LS6A 2QBXA 2CTVA 3VL9A 2DVDA 2IXKA 1LHVA 4YW3A 1FPN2 1IG3A 2WRAA 3FC0A 1C1LA 5K0UC 4TTGA 3NRUA 3OBZA 4GWMA 1NLRA 1JZ6A 4P9XA 1NOVA 4RYDA 3QD6A 1PIV2 4XACA 2RJLA 1YQ2A 1BBT3 5L7OB 1MS9A 4Q4X3 4NN0A 5CEHA 1CAVA 1JTZX 2XJQA 4PHZA 4AFMA 1UZ0A 3NWKA 4NHXA 4RD7A 5J36A 2JG8A 5FPVA 4PLOA 5FXXA 4JGZA 4YW4A 4HN0A 1Q8QA 4N53C 4NHMA 3PUQA 1LODA 4CDUC 1JYCA 3AZWA 2E6VA 4KWKA 1NX9A 4OI0A 3MUZ1 3U1XA 1LEMA 4AI1A 1RUOA 1DYOA 2P3JA 4L9BA 4RQPC 3TEWA 2BBVA 5C3QA 1G8WA 5KXEA 1LB2A 1Q8OA 1D4M1 1HXS1 2VBBA 4B1LA 3J7LA 4AOCA 4XJUA 2VZPA 1VBC2 1IKPA 5LA2A 1MVQA 2K0GA 1WD4A 4EWEA 2WC2A 2W95A 1KGYA 1QQP1 4K40A 4FFHA 1ODMA 2FHRA 1IS5A 1UYPA 5JVVA 3ZXLA 2GH8A 1QEXA 5A3PA 1HB4A 2XL7A 4CCJA 1LAJA 1RMU1 5FY9A 3O1VA 2AZ5A
chains in the Genus database with same CATH topology
1ULCA 3BU7A 1CJPA 1W39A 2UWAA 1RUF2 1WA4A 4ZU5A 4ASMB 1EAH3 4OHVA 1Y7BA 4YZ2A 2WLQA 4B7EA 3WV6A 2VW0A 2WL1A 3APBA 4UW3A 4YVWA 1UCXA 4AFBA 4PLMA 2Q30A 3QACA 3ZPYA 4CP0A 3R05A 1PO21 1OD5A 3AYEA 4E27A 2R6QA 5KXDA 3OGGA 4K7JA 1I9RA 4QQOA 2QQPA 2A71A 5J7MA 1Z7S1 2OUHA 3LWCA 3PJYA 2D6MA 2DU1A 3RNSA 4GQ7A 2B5HA 2I2SA 2R0HA 4Z8BA 2W08A 3HWJA 1D2SA 4LBNA 1NCQC 3KM5A 4PDWC 4EWAA 2I07B 2A5ZA 5DXDA 5CFCB 3A4UA 1XNCA 3MDPA 3CU7A 2R071 1GZ9A 1RUD2 3J8F1 1PGL2 5JZGA 4XJ8A 1Q5OA 1AXYA 1D4VB 1ZZ8A 2WLPA 1O5UA 1AL22 1X50A 1A3KA 3KCXA 5I0TA 1BZWA 1OMIA 3USUA 3VLBB 3SNMA 4L99A 1GZWA 2RM23 5H9SA 1MS8A 1FX5A 1IPKA 4AVBA 2P37A 4FTEA 3GHMA 1Q43A 1SBFA 2CV6A 2Q4SA 5AC92 1HQWA 4XFAA 3NV4A 2Z2SB 1PVC1 3ETQA 2V5YA 5EFUA 3LOBA 3JU9A 1RUH2 1VRH1 1HRI1 1QJX1 1ZBA1 4FAHA 1IKQA 2CAUA 2HWD3 5JMCA 1RL3A 3W9AA 1MEC1 1VR3A 4KWJA 2ZGOA 4C0BA 1NYWA 1YXWA 2D6NA 1WLWA 3MIEA 5C4WA 1K5MB 4YG3A 5KXCA 1LTEA 2DV9A 4DRVA 2A6VA 4X6QB 1PO13 2VECA 2YV8A 2K9ZA 1S2BA 4I3PA 1H8VA 3UJOA 4C0HA 2AUYA 5JI9A 2WT0A 3I4IA 4RA0A 5GLTA 1RUE2 3SHRA 3MLLA 1UX6A 3ZFGC 2UY9A 1UU5A 3RMYA 1V6NA 4KGGA 2QZ3A 1Z7S3 3LKJA 2VNRA 2WFPA 2QDNA 1ND3B 3KMHA 3ZFFC 4AI0A 5C33A 1HKDA 2OW4A 3LGRA 4CDWA 2Y0IA 2DU0A 3S6PA 1NCRB 1OLRA 4Q27A 3R6SA 4JRAA 5GLVA 3IIAA 3NO8A 1S0JA 4LBOA 4QD2A 1VBA1 4BPZA 1X33A 1GKBA 1HV1A 1SLCA 4PIXA 4IV1B 2A73B 2F6BA 5AFEA 3MIFA 2PN5A 1LCLA 4AVCA 2RS32 4YZ3A 3AP6A 2HWF3 1XE8A 4DXZA 5KHGA 4E4ZA 4ATEA 1RB8G 2RS12 4N7UA 2R1DA 4XIKA 3VDDA 3VHNA 3AKSA 1UF2C 2GN7A 3NAPC 3FZ3A 2GH2A 2DFBA 4ONUA 1CAVB 3D6EA 4WM8C 1F8VA 1E57A 1ZRRA 2JG8B 3VZKA 2D3RA 3FFQA 4JGZB 1PVC3 2ZABA 1ASJ1 1VJ2A 5SV5A 1HRI3 4BHPA 1AR92 4I30A 2DURA 1MEC3 1DU3D 3AKRA 4X6RB 1PZ8A 1DZTA 1UAIA 4XQDA 4N43B 3BODA 5HI0A 4IL7A 3MFCA 1KS4A 1MR5A 2AYHA 4XBQA 1KQRA 3B02A 3V0BA 4YZ5A 1CQ9A 1KFXL 2A6WA 4YNIA 1VBB3 3SLIA 3ZIXA 2HWE2 5I0SA 1BBT2 1DQ0A 3SH3A 2EXKA 1OFSA 1WUVA 2QFEA 3TYJA 2WIIB 3HN1A 1GSLA 2WS93 3M2MA 2PAEA 1KS5A 3ZO0B 1UU4A 2NZ9A 4CEYA 1XQNA 4XFCA 4YVWB 2A3XA 3AZVA 3TN92 1ENQA 4AHXA 1VBE1 2WZR1 1FYUA 3PVBB 4NHLA 1AYM3 5JCTA 1QKQA 2VUJA 1LENA 1CVNA 4BOWA 1VBA3 4RS5C 3KQRA 1NLSA 3TRSB 1WCKA 3ZN4A 1W6QA 2ZGNA 1RVF3 4PJYA 3PVOA 2YHJA 4LE4A 5DZEA 1XYPA 4GMP3 5B2GB 3AZYA 4C91A 1EAH2 2E51A 3L9JT 3B9CA 4M3CA 4ATFA 1VP6A 1UIKA 4HKOA 1HW5A 3WW2A 2BW8A 4Q0UA 3T2TA 5JZGB 2IZWA 1QNWA 3ZYIB 5JOWA 2XH6A 4L97A 3M1HA 1C8M3 4WVMA 3U4XA 2DTYA 2O1QA 4ASLA 4B8EA 4FPLA 4BZ4A 3USUB 1VALA 3QLQA 2VH9A 1BEV1 5C9AC 3AMNA 1RJ8A 4BIFA 1BMV1 1GZWB 5I0UA 2GZWA 1RHI3 4FOVA 1VBD1 1HIXA 5LRSA 4JAAA 2XWBB 1YFXA 4BMBA 5FO9B 3VBUC 2PHDA 2UY8A 1UIJA 1PK6B 3H3UA 4LA3A 5JI7A 4XTPA 3R0RA 3NV3A 4U2AA 5I8TA 2R063 3JD73 5BNOB 1KDMA 2ZAHA 1QJU1 2HYKA 1Z78A 3G7DA 2CY6A 1QH7A 3DPRC 1R081 3SH4A 3ZFEA 5C4WB 5J48A 5EWSA 1S0GA 3IKWA 5E89A 2P17A 2C1FA 4BH9A 5L36A 4MXWA 3AKQA 2RM22 3ELNA 4F3JA 2VMHA 1C28A 4FPGA 5F1RA 4EROA 5CG8A 2D6KA 2PHFA 2R49A 5KHJA 3EJKA 4Z92B 4XILA 4Q4Y1 2X5IC 2PQQA 1D2QA 1OPOA 1UZZA 1YFYA 3VBFC 2Y0OA 1GICA 3BCWA 1MACA 4XFFA 5GLWA 1HX6A 5BV6A 2R30A 1NXMA 1BK1A 2E7TA 2HWD2 3D4KA 4UBHA 4YM0A 4FAGA 2WSVA 1MVEA 1AX2A 1C5HA 4SBVA 4QMAA 3H1MA 3TOJA 3RZZA 4YW5A 4CDWB 1POV0 2O8QA 3PMSA 3VBOC 2GNBA 4FPHA 3WDVA 1AYN1 3UL2A 4R4ZA 4AEDA 4Q4W1 1FXZA 2B42B 4Z82A 1PO12 5ABJA 3SCGA 3IWZA 3WT3A 3OBTA 4AFCA 4NWWA 3WX5A 5AVAA 1H8TC 1DQ6A 2BGCA 1UKRA 5FLHA 5H9RA 2DVBA 4FTBA 4C1XA 4DOUA 1AJKA 4ITCA 4F7ZA 1SLAA 2NN8A 1TME1 3VBRA 1J59A 2PTMA 1UKGA 3WG3A 4DY3A 3QH6A 4DNYA 4GH4C 1CONA 1T6GC 1V6IA 4JGYC 4YGBA 3ZN6A 1DGRN 2IXLA 1BEV3 1PGSA 5DUWA 1ONAA 1MQTA 2YY1A 3ZDSA 5HBAA 2JDZA 1YI9A 2BFUS 1F9KA 1SLIA 1W6OA 1VBD3 4BE3A 4ZXKA 4P9LA 4G9SB 2B7YA 4C90A 1Z0HA 1L3JA 1AHSA 3UKNA 1O91A 3HMYA 2IXIA 1XU1A 5HCBA 3N7KA 4GB32 3SCHA 3E6BA 4XE9A 2XBO2 4PBOA 5GZDA 2WNVC 3OF1A 3P3PA 4JC1A 4A7ZA 3CO2A 5EXOA 3WDXA 3J4UH 1S0FA 4NHKA 1COV1 2FZ1A 2WNUA 2HWF2 3WOGA 1LHWA 1V6MA 2ZX4A 1V6KA 5SV8A 5J96B 2CWMA 4R52A 4DMIA 3QH7A 4K21A 3V0BB 4JDMA 5FTTC 5I93A 4B4PA 2PELA 3WW4A 1RUE1 3M3CA 1O7FA 5K0UA 1GNHA 4J1WA 5DUUA 1FOD3 2XWJB 2ZMNA 4WVVA 1LOGA 1Y9QA 2C9AA 4CDQA 2Q1ZB 3E5UA 3MI8A 2V73A 1W0PA 3HR9A 1V6LA 4FPOB 1LOEA 4CEYB 1AF9A 3JBG1 1WLTA 2IFWA 3BALA 1Y3TA 3FLRA 4R8HA 5JPMB 2AENA 4GA9A 4MGKE 1ND2C 2BVBA 1AJOA 4NOTA 1RUG1 1WMDA 2BEOA 5T5PA 3MPBA 1O4ZA 1TMF2 1NA1B 4RR3A 4D7YA 1SLBA 4K9SA 3PNAA 4YM1A 1VBB2 4URTA 3AMMA 4HL0A 5GZCA 4A7YA 4RHV1 1W6QB 4X8PA 1G86A 1D0GA 1Q56A 4Y1UA 4AQ6A 2ZZJA 2WS92 2WSUA 1POV1 2GNMA 4YLZA 1GR3A 4AGRA 4M3CB 5E88A 1J3PA 2VVFA 1VIWB 3D5OA 2MEV1 4P9JA 4IEVA 5BUVA 2GC3A 1AX0A 1AX1A 4QPGC 2D44A 4R9AA 3UV9A 1AYM2 4YFZA 3CLPA 4IV3C 5FOJB 2D5HA 2AR6A 5F5QA 3I7DA 3NW4A 4WVMB 4BLIA 5EYXA 2YROA 3VBSC 5FLIA 1C4RA 1GQHA 1PM7A 5F9TA 5JIAA 4M3CF 5IK4A 3KCCA 1RVF2 4IEXA 2PLV1 5FO8B 3ZYJB 1SFYA 2XG3A 5ACA2 4KQ7A 3R4DB 2Q5TA 4WM7C 1DZQA 5GZEA 5E1RA 1DIWA 5CADA 4WVZA 2KM2A 3AP9A 4DINB 2DFCA 2ZGUA 1C8M2 1F2NA 2CNAA 3H8UA 3W59A 3ZFEB 2PHXA 2XKOA 3AP5A 3VZMA 4FOQA 5JIUA 4JQRA 4MXWB 5FCCA 1YJLA 4G4FA 4LO6B 3OJBA 1D0HA 2H6BA 3ROUA 1FV3A 2RS51 3ASIA 3KGLA 3AXDA 3VHOA 4CDXC 2FMYA 1TEIA 1YJKA 5IK5A 1ND3A 2JECA 4IEPA 2GAUA 5L7OC 2NM1A 5CNAA 2BPA2 3HAGA 3MLKA 3OYWA 1AR71 1OA4A 2R062 2W39A 1G9FA 3JD72 4Q0SA 2XVLA 4QPIB 3IMNA 4XJWA 3B93A 2TUNA 2ZPXA 3KCYA 3EXUA 4HPKA 4YM2A 2X29A 1AR61 3RI9A 3SISA 2RR11 3ME2A 1POV3 1OOPC 2VXRA 4FP2A 3TB0A 4AEDB 2A7AA 4R9CA 1CIWA 2VVEA 2R043 3JZVA 4ES8A 5ABJB 3VZJA 1YRZA 1EPZA 1ZM1A 2VW1A 1RUJ1 1BCXA 2UURA 1LECA 1KFUL 3LB9A 3VBRB 1AR83 2DVGA 1PZ9A 3AJYA 4M3CE 2GN3A 4LBQD 5TSWA 5GZFA 4AF9A 5FLJA 5FOBB 1MZ5A 1XYOA 2BTVC 4LNVA 3ZN6B 3LA7A 4CEWC 3ZFGA 1MQTB 3AZZA 3FUQA 4IEOA 3WQ0A 2ZCWA 1W6OB 4XETA 2A75A 5GKAC 5KBFA 1J58A 2PLV3 1U5IA 1CR7A 4MH0E 2ZX0A 1QJY2 3B9IA 2PHWA 4Y26A 2VOKA 1IQAA 3ZXKA 4QT6A 3WDUA 3CJXA 4Q1RA 2JD4A 2XHKA 3A0NA 4N43A 4E2GA 3ATGA 4Y1YA 3VZLA 4IEUA 1LRHA 1QXJA 4FBFA 1YYNA 2WNUB 3G6JB 5J3UA 5KC6A 4LHNA 2SBAA 2XPJA 2PHTA 1OSGA 3WUCA 4OUSA 5IK8A 2WFF3 1PNFA 5FDBA 4FTSA 1V9U1 4XEZA 1R092 4QQHA 2LTNA 3N7MA 3RI8A 5K0UB 1UD1A 3DV8A 1C5IA 4NR1A 2RS53 3N3HA 4EN8B 1DGRA 2BNNA 5CFCC 5JOXA 1HRV3 4U36A 3NAPA 2NPIA 3OD0A 4CDQB 4XFGA 2B9UA 2ERFA 3KGZA 3WR0A 1U5XA 2YUEA 4WM8A 1GV9A 2C5DA 4AQTA 2BWAA 1WW4A 3VHRA 4XF4A 5C8CA 4XMAA 2VNOA 3O0WA 1JW6A 2HWC2 3AK0A 1O5LA 4HN1A 4RL7A 3RQ0A 1FI2A 4DB5A 1MZ6A 3GZTB 1PNGA 5D1IA 5FAXA 1QXPA 4XTMA 2R16A 1AR63 4JTNA 2RMU3 3ACLA 4RR3B 2DVFA 3ZMNA 3NJZA 1UPIA 5JR7B 1ULDA 4R9BA 1FOD2 3ALQA 3OPZA 4OHXA 5JOZA 2VQ0A 4D69A 3MIDA 1ZNPA 1ZBE1 1ZZ9A 2R1BA 5LRRA 1WMFA 5JPNB 2UU8A 2DCJA 3FX3A 1HLCA 4W6XA 1C1FA 4YG0A 4I01A 1W2UA 1K5MC 4M00A 4D7SA 3EBRA 4HLTA 2PHRA 2QVSB 4GB31 4AVTA 1ULEA 1N3PA 1D4M3 1HXS3 2NMNA 2WT2A 3AKTA 3MZHA 4IESA 3PMEA 2YMZA 2E9QA 1WW5A 4HK8A 1QQP3 1PK6A 4KG0A 3ZXAC 5CAZA 3VL8A 1C8NA 1RUC1 4YG6A 1FT9A 2ZKLA 2YYOA 3M3QA 1O4YA 1MS3A 2AH2A 4XYXA 5BNOA 1PVXA 2LUWA 2VNGA 1RMU3 1RTVA 3BPZA 3M7AA 4GWNA 2F4PA 4GKXA 2UWCA 3BOPA 4I0AA 4EN0A 3ZSKA 2LM3A 3NVCA 1H2KA 2Y26A 1DG6A 2DUOA 4ORFA 1NCRC 3D0JA 4MLOA 4PDWB 1XE7A 5LEJA 1PGW1 1MS1A 4RGGA 4UXAA 5IT6A 2R0FA 4Z1VA 3OGJA 4I02A 4META 3SXWA 2ET7A 1PO23 5T3NA 2H6CA 3RRDA 4AEKA 4AE2A 1W6MA 2D3PA 5KHHA 2WQZC 1IZ3A 2RJKA 4CP2A 1WW6A 4L2NA 3ZIWA 4AQSA 5J98B 4Q8KA 2ETEA 3O12A 3MPPG 1MS5A 4YGCA 1ZYBA 2XJSA 2Z42A 1EV11 4ZU7A 2VMIA 4HT1T 3OYWB 4FPFA 4YVSA 4Q4V1 3WCSA 4K6BA 2EAKA 4LULA 1NY72 5K8SA 1OA2A 4YYOA 2IXHA 1YWKA 2CGOA 5C8WA 4GIQA 4AI8A 3FFZA 2R073 4Y20A 4HPKB 3J8F3 4B4RA 1IS4A 2OZJA 3QCWA 2E7AA 2OA2A 3VZOA 2ARBA 4D3WA 1ZBE3 4OFGA 3AP4A 3UJQA 4QPYA 1J3RA 3DPRA 1LGNA 3BIWE 5DDJ1 4AW7A 1FAYA 4HVRA 1TQ5A 5BNPC 1ZZ6A 1NXD1 2Q1MA 2QNKA 4XBLA 3KD4A 5FMOS 3UKVA 3C2UA 3FLPA 2X5IA 4S2GA 4QXKA 5T5JA 4LO4B 1BXHA 2LALA 1G7YA 5J09A 3D82A 4FQZA 3ZFGB 1VRH3 1HQNA 3AZXA 3AM2A 4ZKTB 4PF5A 1QJX3 1ZBA3 1ULFA 2EXIA 3TBDA 4HSLA 2JE7A 4KU7A 3RSJA 1ZX5A 4YVWC 1YNAA 3ZFFB 4H7LA 1LU1A 1U0AA 4GXLA 4XHBA 2R042 3MLJA 2XJTA 1VAKA 2VOVA 5KC5A 2E63A 4P9YA 4YGDA 1CPMA 1JUHA 3ZYPA 1R1A1 4XF0A 1WLCA 2D6PA 1SMVA 2ZGSA 4Q4X2 4EV0A 4QHBA 1AR82 1H8TA 2P3IA 2XLAA 2ZJCA 1AL0G 1RUI1 1FMD1 1QWRA 3FBMA 2HWB1 3N7JA 3OTFA 1YFWA 4XIOA 4GH4A 3U07A 3MW4A 4HK9A 4JGYA 1UN1A 3MEPA 1QHDA 3NAPB 1CAUA 3AMPA 1H9WA 2CAVA 3IDEA 5JZGC 5CU1A 2GSYA 4WM8B 4OHYA 1ZRDA 1H2NA 4Q4V3 1NA1A 5C8CB 1YCIA 3E6DA 3L2HA 3MYXA 3POYA 2WA4A 2BYVE 1UZYA 1IPJA 1DQ4A 2IXJA 3P3NA 4YRDA 2WNVA 1FPN1 2WFF2 5T5OA 4CZSA 2RE9A 2ZMLA 3RPQA 1PIV1 1TNRA 4A7KA 3VBHA 5CB7A 2W68A 2VPVA 1CN1A 4YFWA 1B09A 4AFAA 1CJDA 1QH6A 2PHLA 4B29A 4MVTA 1BYHA 1HRV2 4XF1A 1WCSA 4XF3A 2TEPA 4E2QA 2DUQA 5LEKA 1MZFA 4MZUA 4EN7B 4LE3A 1CAXA 3S0MA 2JG9C 5C4WC 4Q1PA 1ASJ3 1VBC1 3I59A 1LGCA 4B4QA 1ZRCA 4KNCA 1S0DA 4LLFA 2Z79A 5A3MA 2KXLA 2D40A 1CD3G 4LBQB 5CIRA 1IGOA 3JB8A 2RMU2 4FT8A 1C57A 1OLQA 1OQDA 3GNEA 4FSJA 4XOGA 4NVPA 4XZPA 1RUF1 2W52A 1REFA 4JCKA 1B35A 4E4SA 2WKKA 3MGUA 2R32A 4DQAA 5IK7A 3MICA 1S1AA 3X29B 3U11A 1DGWX 1WGPA 3K48A 2PFWA 1RUI3 1QXRA 2DYCA 3NKTA 3AYAA 2GU9A 3FBYA 4XQ4A 1FNYA 3H50A 1CAWB 2GC2A 4AEMA 5JOYA 2B39A 4BLJA 3CF6E 4MX3A 5LK7B 1D4M2 1HXS2 3V0AA 2HJIA 4S2DA 3H1YA 4HZFA 2HWC1 1VBE3 2ZGTA 2WZR3 5KHIA 2B8MA 1DQ5A 4S2HA 4IV3A 1W6MB 1QQP2 3OY8A 1H1IA 2EXHA 3FE5A 4IEWA 4FOWA 1LHUA 2E7QA 3MW2A 3VDDC 4QPIA 2GC0A 1V6JA 2CYFA 2XJVA 1KJRA 2ZS6B 4QM9A 3LCPA 4YVSB 1RUD1 2NQYA 5GJ6A 1UMZA 1PGL1 1PIV3 4TZDA 4AHZA 4XFIA 2ZX3A 1AL21 1ZZBA 4WM7A 4Y20B 2JKBA 5AVPA 5JAXA 2ZBJA 4QQPA 1PO22 1YIFA 3O14A 5GLZA 3ZYRA 3RS6A 1ZRFA 4Z2WA 3DPRB 4UW4A 4BIOA 4KU8A 3VHPA 4BA6A 1Z7S2 1SFNA 4K1YA 5AC91 1RITA 3B7MA 3IT8A 3PHMA 3S30A 4J1XA 3GBFA 1RUH1 1LU2A 1QOOA 4DRRA 2VVDA 4FQ4A 4I0BA 1JYIA 3WDTA 4MV2A 2X5IB 4LEJA 5T50A 4OHZA 4MGZE 4AGVA 1ALYA 4F83A 1H2LA 1RUF3 2R072 4CEYC 3J8F2 5DUXA 3TNPB 3GZAA 1QJU3 4LHLA 5D8AC 4XBNA 1FNZA 5BNNC 1U12A 5CFDA 1R083 3T1LA 1OFNA 1OOPA 2GNTA 2DCYA 4NWVA 3FHIB 4Y22A 1WMEA 4XDQA 1AXZA 3HIFA 4N90A 4DY5A 1NE4A 2V09A 3KS7A 3H1WA 1H8TB 2XLGA 3MIHA 2DCTA 1ZZCA 4Q4Y3 2H0VA 3ES4A 4WZFA 1PVC2 1LEDA 4LO5B 3IPVA 1DQ2A 2G9GA 3PTYA 3URFA 1S0EA 2VW2A 2D6LX 1HRI2 3AJZA 3O0VA 1ZBA2 2QE3A 4GH4B 4N53A 4XXPA 5J37A 4JGYB 4CDUA 2QUOA 2NP0A 1MEC2 4CEWA 1W6PA 1QDCA 3E5XA 1CAUB 4WVWA 2MPFA 4RQPA 2XJUA 3FWEA 3WDYA 1UPSA 4FPEA 1JBCA 1AYN3 1RUD3 2NLRA 1BJQA 4Q4W3 1SBEA 3MIBA 1GYKA 2RS31 1Q8VA 2ZHMA 4FPKA 3M3IA 2VGDA 2DUPA 2XKPA 2WNVB 3GBGA 1RUNA 4N7IA 2RS11 1O3SA 1ENXA 2YDEA 3JQXA 2XVGA 2ZGLA 3B94A 1REDA 3ZXDA 1TME3 5BXXA 3WHTA 1LR5A 2VU9A 3IDBB 3M4F