1WW6A

Agrocybe cylindracea galectin complexed with lactose
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
160
structure length
160
Chain Sequence
TTSAVNIYNISAGASVDLAAPVTTGDIVTFFSSALNLSAGAGSPNNTALNLLSENGAYLLHIAFRLQENVIVFNSRQPNAPWLVEQRVSNVANQFIGSGGKAMVTVFDHGDKYQVVINEKTVIQYTKQISGTTSSLSYNSTEGTSIFSTVVEAVTYTGLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords galectin
publication title Structural Basis of a Fungal Galectin from Agrocybe cylindracea for Recognizing Sialoconjugate
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 38
structure length 160
sequence length 160
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ww6A00
4F83A 3WG3A 1ULGA 2DUPA 1W6OA 4AVVA 1IS6A 4KBBA 4YM0A 2NMNA 5EXOA 1SACA 1WBLA 5GLUA 2VH9A 4ZXKA 3BOPA 3SH5A 1DIWA 4XE9A 2ENRA 4BPZA 1AF9A 3MPPG 4LBQD 4XIKA 1SLTA 3RMXA 3ZSMA 1N3QA 5DUWA 5GZDA 2OUHA 3SH3A 1CONA 1W6OB 5JOWA 1ENQA 3RSJA 1VAVA 2DVFA 1QNWA 3AZYA 1VIWB 1J1TA 1IKPA 2EALA 2ZGRA 3POYA 1W6PB 1MZ6A 4XIOA 5GZEA 2DUOA 1MS5A 1PZ8A 2SLIA 3IM0A 3BTAA 4M3CE 4YG0A 1UZYA 2D3SA 1S0GA 2CY6A 1GZWA 3RG0A 1G9AA 1FATA 1LHNA 4FPFA 5IUQA 4FOQA 2VW0A 1KJLA 1URXA 1W6QA 1DQ0A 1JUIA 3DGTA 1LODA 4YG3A 3WUDA 4ATFA 1KRIA 4OZXA 1WLDA 4YZ1A 3D6EA 3B01A 1DQ1A 1YI7A 3A0NA 4K21A 1BYHA 3AP6A 1APNA 1GKBA 3VKLA 2D6LX 2BQPA 4FPJA 4Y1ZA 3PVEA 1F9KA 4YFWA 1WUVA 1S1AA 4BLIA 2W52A 3OPZA 1WLCA 5GZCA 2GMPA 4AVTA 1MS8A 3NV3A 2GNBA 2A71A 1SBDA 4YW1A 2CTVA 5FRAA 1OKQA 2JD4A 5T5LA 5JDBA 1LU1A 4Q1PA 4YW4A 3O12A 1S0IA 4NO4A 4Y20A 2E51A 5DG2A 1YXWA 2EIGA 2CWSA 3VKNA 4XHBA 4Y1XA 2JJ6A 1PZ9A 2VXRA 4FP2A 4LBLA 1DGLA 1KQRA 4LBKA 2LALA 2D6PA 2PHRA 1W6NB 5DZGA 3OYWA 3ZVXA 1WW4A 5CB7A 2CWMA 1LU2A 3OJBA 2ZGPA 5CBLA 2NN8A 1HKDA 1MS9A 1OFSA 5IK4A 2Q5TA 3UK9A 4JC1A 1C1LA 1H9WA 3WDYA 1VALA 5IK8A 1ULDA 3ZYRA 3HR9A 2LTNA 3ENRA 1HQLA 2FHRA 2ZAAA 2ZHMA 3DUIA 3VUOA 4PBPA 5DUVA 1ZM1A 3OYWB 3LSEA 4Q26A 4YZ2A 5GLVA 4XBNA 4XYXA 2A6YA 1UAIA 1S0CA 4FOWA 5DXDA 2C5DA 2D7FA 1FV3A 1LOFA 1WBFA 1DQ2A 3AZXA 3FUQA 5LK5A 4AGGA 5CAZA 2A3WA 2KM2A 2D6NA 2HYKA 3JUUA 2YY1A 1CIWA 3N7LA 3WG4A 1S0BA 3Q9OA 1FX5A 3VKOA 2EXJA 3AYEA 5T54A 5IK7A 1SBEA 1AX0A 3WDWA 2ZGNA 2R16A 4RA0A 5T52A 4FPOB 1V00A 4M01A 3I8TA 2E6VA 5GLTA 2WNEA 2P37A 1N1SA 1G86A 2R49A 1AX1A 3WHTA 3FLTA 1QNYA 2UU8A 3WCRA 3B00A 3WG1A 1MS0A 1LEDA 1WD3A 1HQWA 3ZXEA 2AR6A 1WCSA 4P9XA 3ASIA 2A3YA 2DURA 1FYUA 1IS4A 1ULFA 4W65A 4XBQA 3WG2A 1S0EA 1W6MA 2A6WA 3N35A 1UPSA 3PJQA 4YM1A 3HMYA 5T5PA 1QMJA 1SLBA 1V6OA 4TZDA 1SLLA 5GZFA 5KXEA 1LJ7A 2ZACA 1A8DA 4ITCA 3ZSKA 3ZSLA 2YMZA 3VKFC 2PELA 3FUOA 4FQZA 3ZXLA 2CL2A 2PHUA 4R9CA 4Y22B 4PBOA 1GYKA 4FPKA 1V6KA 1LOGA 3FLRA 2A7AA 1UL9A 3OGGA 1S0FA 3WDXA 5KXDA 5HCBA 1IOAA 1C57A 3V0BB 4XJZA 2ZGKA 3VV1A 3VKMA 1DHKB 4BQ1A 5H9QA 5EYXA 3WUCA 4FVVA 1HLCA 4AGRA 1AX2A 2NZ9A 1LGBA 4LBMA 4FOVA 4ASMB 1CPNA 5GM0A 1SLIA 2DVBA 4YGEA 3N7JA 4JRAA 1NXD1 4XTPA 2VW2A 3ZXJA 2W39A 3ILNA 4HANA 1AJOA 1GBGA 2GMMA 1LESA 1MS1A 3INAA 4XJ8A 4CTEA 3AJYA 4DQAA 1GSLA 1JOJA 2P2KA 2P3IA 3QCWA 4TYSA 1N3PA 4LBNA 5DZEA 1QF3A 1Z78A 4XJ9A 1WD4A 3BIWE 1D0HA 3D5OA 3AXEA 1QGLA 4L8QA 5DUUA 1NLSA 2DVAA 2ES3A 5HCFA 4C1WA 2W68A 1YRZA 1MS4A 2AREA 1GZWB 2GDFA 4HL0A 4AWDA 3AK0A 3ILFA 2ARBA 2EXKA 1TEIA 1W0OA 1LHOA 3V65A 4Z8BA 1W6QB 2ZGSA 1SCSA 4CRQA 1Q8OA 2EF6A 3D4KA 3IKWA 3WDTA 1LOBA 2E7TA 4AVSA 1DQ5A 2D3PA 3IN9A 4MYEA 4ISQA 4U36A 2EAKA 3HN1A 1SLAA 3ZXFA 1QOTA 2B7YA 1GLHA 1OQ1A 1UN1A 1Q56A 3AP7A 3ILRA 2P3JA 5E88A 3RS6A 4DFSA 1H9PA 5EYYA 1VLNA 2VW1A 4DPNA 1QDOA 2SBAA 1G8WA 1KJRA 1Q8SA 4XHXA 2ZGQA 1DZQA 1YO8A 2WSUA 3T1LA 3USUA 4WVWA 2PHWA 2CYFA 3FLPA 3WZ1A 5H9PA 2PHXA 4FP3A 4YW2A 3GALA 1CJPA 3A4UA 2DUQA 3M3OA 4IQPA 5GJ6A 3AX4A 1UX6A 4Y20B 1WW6A 1AZDA 5F5QA 5JVVA 1WW5A 4XJWA 1LGCA 5JOXA 2AYHA 3AZVA 2V73A 3B9CA 1KDMA 4GKXA 1Z0HA 4RL7A 5JOYA 2E53A 4GKYA 2P3KA 1BJQA 4LBQA 4NOTA 4PF5A 2AUYA 1V6MA 2GALA 5CNAA 4GXLA 3UL2A 4GA9A 1MS3A 5AVAA 5GALA 3SH4A 5KXBA 1U0AA 1KITA 1ENSA 1MVQA 1LOEA 4Q27A 3W58A 2WKKA 1B09A 2A70A 2GN3A 4DRRA 5H9SA 4YGCA 5H9RA 5JMCA 1F31A 1ULEA 1JHNA 2GN7A 3O0WA 1HDKA 3N3HA 5GZGA 1JBCA 4FPLA 4K1YA 1O4ZA 2ZMLA 2VUAA 5HCAA 1IS3A 4XJAA 3LCPA 3N7MA 1YYNA 4CZSA 1LOCA 1JW6A 1LHUA 5KXCA 3AP4A 4XMAA 2WLQA 1DQ6A 4FPYA 1O4YA 2AGSA 1BXHA 2DU1A 2RHPA 4BMEA 3AXDA 1Y7BA 3AYAA 1AXZA 1ZA4A 2JE7A 2ZHNA 4XXAA 1A3KA 3MW2A 3POSA 1LOAA 1GANA 4GWNA 3I4IA 4BMBA 4M3CF 1CN1A 2A6ZA 3AZWA 3R4UA 3C2UA 2I2SA 2JE9A 1JYCA 4H55A 3NV1A 3MW3A 3R05A 1G7YA 1W6MB 4UW4A 1EPWA 1R1ZA 3N36A 3W59A 1G9BA 4YM2A 5F9TA 1N47A 1ONAA 4M00A 4UW5A 1BZWA 4YGBA 1LHWA 2ARXA 1GNZA 1UKGA 2DU0A 4WV8A 1AXKA 1S0JA 1C4RA 1QOOA 2NM1A 1LULA 2Z42A 4GALA 1JYIA 4R9DA 2D43A 4AGVA 4WVVA 5GLWA 1GV9A 5T5OA 3CNAA 1RINA 4BM8A 3OY8A 2A5ZA 4P9WA 2GNDA 1ENRA 1LOFC 1YIFA 3NV4A 3O0XA 3QLQA 1N3OA 2TEPA 2WT1A 1AVBA 1AJKA 3LSDA 4I30A 2JKBA 2OVUA 2ZGOA 3B3QE 1GICA 1V6JA 2YROA 1W6PA 4FPCA 2V5YA 1UZZA 4FQ4A 4UW6A 3ZXKA 5EWSA 4K1ZA 3OY8B 3WVJA 1WLWA 3WCSA 2UURA 2R1DA 2UWBA 2VU9A 3R4SA 5E89A 3TB0A 3L2YA 3PVNA 3A0KA 2VY0A 4YW5A 2NYYA 4XILA 4Y1UA 2UWAA 5FREA 3WOGA 1RIRA 5JLVA 4XOGA 4M3CA 1VAMA 3WV6A 4XZPA 3ZSJA 2ZA9A 2WSVA 2D6KA 1DBNA 4GWMA 4LBJA 2ZGLA 2C9AA 3UJQA 1IS5A 1GZ9A 3SITA 5DUXA 1FNZA 1FNYA 2DV9A 1GZCA 2D44A 3U4XA 1QKQA 2UWCA 3OBTA 1LTEA 3AZZA 1SCRA 4M3CB 3ZPYA 4XXPA 3ATGA 4YZ3A 1LCLA 1CQ9A 4BOWA 2ZBJA 4P14A 4FPHA 4AYUA 4D69A 2WT2A 2WJSA 4XTMA 2G4IA 1DYPA 1V6LA 2WQZC 1BQPA 1MZ5A 2ZHKA 3M3EA 4Y1VA 1Q8VA 3AP9A 3PMEA 3AJZA 1I1EA 1FV2A 2A6VA 5L73A 3MEPA 3SNMA 2JECA 1N1YA 5BYNA 3WHUA 3M2MA 2R0FA 2R1BA 4R9AA 3UJOA 2D6OX 2E7QA 1DFQA 1N1TA 1QOSA 2GNTA 2A3XA 2XB6C 1X50A 2A75A 3APBA 4ISRA 3N7KA 3PVOA 1XQNA 4YFZA 3KM5A 1SLCA 3USUB 4YZ5A 2ZMNA 1KDKA 1H30A 1LHVA 4WZFA 3KQRA 1C1FA 1W6NA 1BKZA 2ZHLA 3GNEA 3BODA 4XMIA 5T55A 4ATEA 4FPEA 4YZ4A 4LBOA 3AP5A 3OBRA 2ZGUA 4R9BA 1AXYA 5GLZA 5T50A 5E8AA 4Q1RA 2D3RA 2DVDA 3WNXA 4YW3A 1V6NA 5DZFA 5CA6A 4YGDA 2DYCA 3M1HA 3V64A 3FBYA 3RRDA 1S0DA 2AENA 3SISA 4Q8LA 4LBQB 1Q8QA 1Q8PA 2GMEA 1N1VA 3ZYPA 4XBLA 2D6MA 3M3QA 2NP0A 4UW3A 1F5FA 4XDQA 4Y24A 1PZ7A 2DVGA 4FOYA 1SFYA 3NV2A 4K20A 1V6IA 2ZKNA 1WW7A 4Y26A 3T2TA 4JCKA 2EXHA 1I3HA 2FMDA 3TAYA 3WLUA 2CNAA 2ZMKA 2PHTA 5JOZA 3O5SA 4PCRA 2OUJA 4XJUA 1FAYA 1A78A 3SLIA 4Y1YA 2YXSA 4YG6A 3V0AA 1GNHA 3O0VA 3M3CA 1IKQA 1LENA 1JN2P 3AFKA 1CESA 3IPVA 5DG1A 4DRVA 2WT0A 3IMNA 2DTYA 2EXIA 1DYKA 1JXNA 4PQ9A 1MVEA 1G9DA 1MR5A 2ZABA 1RITA 2ZGMA 2AH2A 1DQ4A 4Q2FA 1D2SA 3RMYA 3V0AB 1LEMA 4SLIA 1UMZA 1QDCA 3AYCA 3B69A 1G9FA 3H0OA 3AYDA 2JDZA 3IPVB 2YV8A 2ZGTA 5SV8A 3RQ0A 3WDUA 4ZKTB 4P9YA 2DWRA 4YM3A 2GNMA 1LECA 2H0BA 3NWKA 1W0PA 4C1XA 5IK5A 2YZ4A 2R0HA 1LGNA 3FFZA 1CPMA 2PHFA 4DS0A 1G9CA 2OW4A 1SBFA 2XG3A 3MW4A 3WDVA 2A6XA 2W08A 3JU9A 1ULCA 4FPGA 5T5JA 4YLZA 3POWA 4Y22A 1DLLA 4U2AA 4BLJA 1QU0A 4Q8KA 5IT6A 3T1MA 2DTWA 2P34A 2NMOA 3V0BA 1CR7A 2ERFA 2ZZJA 1MACA 1CVNA
chains in the Genus database with same CATH superfamily
4OUEA 3WG3A 1ULGA 4MZUA 1NX9A 1UMIA 1W6OA 5DDJ3 1IS6A 4H14A 4KBBA 5J3UA 1MEC2 5EXOA 2CSGA 3UGHA 3HT1A 2P17A 2BERA 3BOPA 5DN2A 3ZXDA 4S2DA 1AUYA 2ENRA 4BPZA 3DPRA 3C8XA 2XJQA 3MPPG 2RS32 2JDPA 2WUHA 4PLNA 2Q8EA 4NUBA 5DABA 1GQHA 1GWKA 1R092 2LW8A 5GZDA 1POQA 1XPWA 1C5IA 1CONA 2IC1A 3K4DA 2FBEA 1OOPC 3RSJA 1VAVA 1AR91 1QNWA 5FYCA 1OC1A 1IKPA 4W50A 4AW7A 2F4PA 3CZUA 1F8VA 3MPBA 5DAWA 4AQTA 1PZ8A 3IM0A 5JCTA 3BTAA 4IV1B 4QX1A 4YG0A 2XMLA 5HV4A 2XBO2 2D3SA 1H8TA 4CUGA 4KNCA 5FCCA 3AFGA 3BB6A 4ZU7A 2W95A 1R1A1 3IIAA 2JEMA 1KJLA 4GAZA 4JRLA 4CU9A 3T3YA 2VNGA 4Q4W1 3ZLIA 2WNOA 2ORXA 3ECQA 1W9SA 1X82A 4LT5A 1UOFA 3OD4A 2Q1ZB 2ZX0A 5L9RA 3AKPA 5LB6A 3VD5A 2JDMA 3LEGA 5JI7A 4MGTA 4K21A 1VBC2 4XCAA 2HJIA 3ACHA 2CV6A 4WM7B 2WFF2 4Y1ZA 4K8RB 2VTXA 1BHGA 3RYRA 1HRV2 2W52A 4BXFA 2E33A 2PQQA 4HPKB 2QQWA 3KVAA 1PK6B 3GBWA 3MYXA 3RJRA 3DKWA 5GZCA 5FQ0B 4Q0VA 4LHNA 1QJFA 3DECA 1JHJA 4XF3A 1QJX3 1K5JA 4XQ4A 4YYOA 4IEWA 4TWTA 2JD4A 5CFDC 5JUVA 2YFZA 4Q1PA 1D4M3 2Y6FA 1JU4A 3A23A 5C8CC 4HN0A 4P08A 4Y20A 5DG2A 3TWIA 3R6SA 1AR62 5LK7B 3PL0A 5FUNA 3JD71 1G6NA 2CWSA 1DDLA 4XHBA 1OURA 4Y1XA 4X8NA 5DPNA 3WQ1A 3VDBA 2LALA 2D6PA 2X10A 1LU2A 2K0GA 2ZGPA 1A6CA 1ST8A 3SXWA 5IK4A 1RJ7A 1JZ2A 2ID4A 1FT9A 1ZZBA 2Q5TA 3JQWA 1C1LA 4JC1A 2LTNA 1UOGA 5L9VA 5K0UC 3K77A 2ZAAA 5A3UA 5ACA2 4PBPA 5DUVA 3ZDVA 2KD7A 5A6QA 1SFNA 4Q26A 3NJYA 2FMYA 4JGZB 5K9YA 1NAEA 1UOJA 1S0CA 2A6YA 3PJYA 4TN7A 2WZPP 3KD4A 2C5DA 2OZ6A 3KSCA 3ACFA 5JZGB 1LOFA 3VDDA 1WBFA 1DQ2A 1VP6A 3WNPA 2BU9A 4KBZA 4BQYA 3BTZA 5CAZA 2KM2A 2YGMA 5CYYA 2JG8B 4FFFA 4A2UA 4CDWA 4OI4A 2HYKA 4BQ5A 4QKFA 2PA7A 1AL21 4QXBA 1S0BA 3KCYA 1IG3A 3NNLA 1ALYA 4RR3A 2XJVA 3NAPB 2A1XA 1PO13 3WDWA 2IUWA 2JIGA 2ZEXA 2R16A 1COV1 1ND3C 3KWVA 5FZIA 2BNNA 3B93A 5E16A 1NXMA 2WA3A 5F3EA 4CP9A 1UCXA 3VHPA 4GMP3 4FI9A 3WHTA 3A21A 3OBZA 4QPGB 2EAAA 3FLTA 2PLV2 2XHNA 4GJYA 5LA9A 5J48A 4BK5A 3HNMA 1WCSA 4P9XA 1RUC3 5A7PA 4DZGA 3OOXA 2VNRA 1IS4A 3N4MA 1OKOA 4XBQA 1ZBE3 5KHGA 1AR81 1UPSA 5FDBA 1QMJA 1RGSA 1QY4A 1RUNA 4S2FA 5GZFA 1LJ7A 2ZACA 4AVAA 4ITCA 3ZSKA 5KXEA 4KG8A 5I8TA 2YMZA 5FPBA 2MNGA 5FZ4A 4G3YC 1JMUB 1HB4A 2W94A 5C7GA 1Y43B 4LO5B 2QCSB 4FQZA 1AR92 2CL2A 5ABJB 4Y22B 1VBE3 4YVSA 3X29B 2NQYA 3JBG3 1VBB1 3ZFGB 4CEWB 2A7AA 3EMRA 5C5UA 5JXHA 2VQAA 1C57A 4XJZA 2XVGA 3I2OA 4AHWA 4BIOA 5H9QA 5A1LA 2HWD1 4PDWC 1J3PA 3WUCA 4LUKA 1O8PA 5C4WA 4ZU4A 3VBSC 1HLCA 3VGIA 4CUAA 1O5LA 2W1UA 4FAGA 4YVWB 1LGBA 4ASMB 5FAXA 1CPNA 5A7WB 1R1A2 4JRAA 4B8EA 1D0GA 4FT8A 4ASLA 4Q4W2 4QGMA 1S4CA 2XLAA 5LATA 4XJ8A 3AJYA 4EZHA 3PUQA 2OX0A 1NT0A 1GSLA 5FK7A 3TOJA 2DBNA 1UW8A 3PU3A 4NHYA 1N3PA 3AVSA 3WF2A 1SMVA 5CISA 5BNNA 1X9TA 3D5OA 2B45X 5CFCB 5DUUA 4LOTA 1NLSA 2DVAA 1QEXA 1TZOA 2XUMA 2Y0IA 4RYDA 4XC9A 2W68A 4C1WA 4Z92B 2HBUA 4HL0A 1JI6A 3ILFA 4DXSA 2ARBA 1YJKA 1TEIA 1W0OA 5FZ0A 3MIHA 2HEVF 3FC0A 3RI8A 4AEJA 2WFPA 4AQ6A 3CLPA 1US3A 3IKWA 4OCTA 3VD3A 5IFTA 1RUE1 3WDTA 1RUJ2 1DP0A 1NZCA 1J3QA 3JD72 2YBKA 5A3WA 2C0ZA 1OA3A 1AHSA 3HJRA 1UMHA 1SHWB 1QOTA 4MXVA 1GLHA 2QQJA 3MIDA 2GC0A 2GZWA 5E88A 4GMP1 2WABA 1H9PA 2VW1A 4DPNA 2SBAA 1W2UA 1Q8SA 5FY5A 1ZZ8A 1H8VA 2WAAA 4XUTA 1V9U1 3UT0A 2AEYA 2JB8A 5E6HA 2XJUA 1DZQA 1SQ4A 2AZ5A 2HWF3 5JIAA 2CYFA 3I3QA 1FPN1 3I59B 1PMHX 5FZBA 2PHXA 3OB8A 3DPRC 4FP3A 3WZ1A 4YW2A 1W05A 2XQXA 3EJKA 3UNPA 3A4UA 1T2XA 1PIV1 4IV3A 5F3CA 5D8AA 1NLRA 3AX4A 3VZNA 2VQ0A 1AZDA 5F5QA 4AVCA 1BMV1 1WW5A 2BGOA 4XJWA 1EV12 2PAKA 3RZHA 2Z4FA 3B9CA 1W8FA 1AL22 4RL7A 1BJQA 1UXXX 2WWSA 2AUYA 4E8DA 2W87A 4L92A 2JWPA 2E31A 2VPVA 1E5SA 4MGQA 4XUNA 3SH4A 4AFAA 5B4NA 2EIEA 5KXBA 4P9JA 5CKNA 4QDSA 5LA0A 1SEFA 3BIEA 4QHBA 3U4SA 3S7EA 3WY6A 3SEPA 5I0SA 3PUSA 1O3SA 4Q4Y3 1KS5A 2GN3A 2R071 3LZZA 2EA7A 2OXBA 2X09A 4CDXA 2J1RA 1F31A 1OT5A 1ULEA 3UV9A 4D94A 2GN7A 1W8ZA 3UESA 1FOD3 2KXLA 2WNVB 4XEZA 5HCAA 4OHZA 4B3NA 5FY7A 5A3LA 3CL1A 5CG9A 1PGW1 1AR82 3R0RA 4Z82A 3N7MA 5L19A 1UWWA 4IE4A 4CZSA 4ZZ8A 5EIYB 2D93A 2OT7A 5FZMA 4MHUA 2ZZQA 5FZDA 3VBFB 4N53B 4K3UA 3SCGA 5I91A 1NCQC 1U12A 2GH8A 3C3VA 5JSPA 4BMEA 4UF0B 1XB9A 5IAXA 2JE7A 5A6ZA 2YC4A 3MW2A 2WYSA 4FTEA 5GKAC 3I4IA 5FR3A 1CN1A 1W9WA 3AZWA 3R4UA 4CDQA 2Q8CA 2I2SA 1JYCA 5FJHA 3NV1A 1KFXL 2O8OA 4MGKE 4CVUA 1W6MB 1E5RA 1I6XA 4UW4A 3OSDA 4YM2A 3LKJA 1H1AA 1SPPA 5A3PA 4AL9A 5F9TA 1N47A 3HOBA 3WF4A 1BZWA 3WR0A 3TBDA 3ZIXA 1UKGA 2DCYA 4WV8A 1AXKA 2CU5A 1DU3D 1YJLA 4E9KA 4TXWA 1RHI1 3DF0A 2GC2A 3I49A 5DQ0A 5I8YA 3WF1A 4EN6B 4L9BA 2D43A 4ES9A 4WVVA 2E26A 5HPOA 3LOIA 1GV9A 5GLWA 3CNAA 4BM8A 3OY8A 3AVRA 5LY1A 3TNPB 1JTZX 1ENRA 4GULA 1O3TA 1LOFC 3QLQA 4GH4A 4BU2A 5FMDA 2TEPA 3UETA 4E4ZA 4R4ZA 1EPZA 1GICA 1V6JA 2YROA 3IDBB 4RN5A 3ZXKA 1RJ8A 4A41A 1UO9A 3EO6A 3O7OA 1NZIA 4K1ZA 4KMQA 3BGAA 4QQ2A 2IFWA 4Z07A 4RR3C 3WVJA 4CP1A 5C5TA 2NPIA 5J1XA 2VTXJ 1TNRA 2UWBA 3DL3A 1F5JA 2OIIA 3QBQA 3R4SA 5E89A 4AI2A 4E4HA 1ZRFA 2DCKA 1NOVA 1ZREA 2UWAA 3H7JA 5FREA 2VNOA 1RUE2 3HQRA 2MEV3 5APAA 3WOGA 4AHXA 5JLVA 2VNVA 4XZPA 1RUOA 4S2GA 3AL5A 2WSVA 4A44A 3POGA 4N43C 3CMGA 1NUKA 3VBRA 3JZVA 3VZMA 2OQ7A 4OQ9A 3U4XA 1QKQA 2BV4A 1LTEA 1SCRA 2I74A 4XXPA 2VZ3A 3JB8A 1LCLA 1CQ9A 4IE7A 2ZBJA 4I01A 5A70A 4FXKB 4HFSA 4AYUA 1FPN2 2WQ4A 1W8WA 2ZX1A 1OXCA 5EFUA 2I07B 4ES8A 1DYPA 4OUMA 4HSJA 1PIV2 2FD8A 1R081 3J7NA 3HIFA 4UAPA 4QPIA 2BFUL 5CU1A 5F3IA 3SNMA 1BMV2 1KS4A 2FQPA 1H1IA 1OSGA 3M2MA 1K3IA 2R0FA 4XFAA 4YVSC 2VOKA 2R1BA 2VOVA 4N9HA 4R9AA 1IPKA 2VBBA 4QQOA 4ZXEA 5F5CA 1H1MA 1VBA3 4BCUA 1QOSA 2GNTA 2LM3A 3H3ZA 4HETA 1C5HA 3APBA 2X5IC 2BBVA 3N7KA 4JGYA 3KM5A 3DXUA 5IVVA 4A7YA 4YZ5A 1IG0A 1LHVA 4XQDA 5FKBA 1EAH1 4AFDA 2FDIA 3GNEA 1BKZA 2ZHLA 2JKXA 1ZBA2 2XJSA 5T55A 1Y9QA 4IEUA 2R072 4LBOA 5FKCA 4R9BA 2WZR3 5FYMA 2ORZA 5GLZA 5T50A 4AHZA 5E8AA 3L2HA 4Y5SA 1QJU1 2XQRA 2WLPA 2RMU3 4INDA 1RB8G 2P4EA 2AC1A 1GWMA 3ACIA 1OH3A 5FYZA 1AYM1 1W8OA 1RL3A 2D6MA 1YFWA 5L36A 1F5FA 4I0AA 1PZ7A 1VRH3 1NE4A 2HLEA 4LE4A 5KBFA 5C9AB 3TAYA 1J1LA 1OOPA 4JCKA 3AL6A 2ZMKA 1CAXB 3AC0A 4XJUA 4EN8B 4QAWA 4QM8A 3FJSA 2Y64A 4A42A 1A78A 2XL7A 4DB5A 1Y4WA 4YG6A 5FPZA 1OBNA 1GNHA 4QM9A 3WW4A 1HN0A 1LENA 2RS33 1GP5A 3AFKA 1XNKA 5FYBA 1R093 1O3RA 1IQDC 4FSJA 2EXIA 1PM7A 1DYKA 3FWEA 4WZCA 1T6BX 1G9DA 2K46A 1MR5A 2ZABA 4AI8A 1RITA 2Y6HA 1SDWA 3U1XA 4CDUB 1D2SA 3W20A 4AK3A 3N9QA 1T6GC 3W21A 2PTMA 3AYCA 4GD4A 3AYDA 3IPVB 3WDUA 5C3SA 5SV8A 4IEZA 1ASJ1 3MV11 4MXWB 4YM3A 1GU3A 1LECA 2XBO3 3PU8A 3T2PA 1W0PA 5IAVA 5KC6A 2YC0A 2HEWF 4IV3C 3S57A 4AZZA 2R0HA 5D8AC 1PO23 4OMDA 4J25A 4DXZA 4L99A 1XSRA 2JICA 4IE0A 2R063 1OLRA 3I2FA 1SBFA 4QB6A 3VZLA 1HRI1 4B4RA 3IBMA 4FPGA 3ZN5A 4YLZA 5EZWA 4QU1A 2QQLA 3CJIB 3A7QA 4QX7A 4UBHA 4W6YA 1DLLA 4D0QA 5M0TA 4U2AA 1JZ4A 4Q8KA 5IT6A 3T1MA 2DTWA 3H3UA 2NMOA 4IGPA 1S2EA 5FO9B 1VBC3 3V0BA 2OS2A 2ZZJA 2ARCA 4E2SA 2DUPA 3F95A 1HQNA 2WFF3 2WNUC 4BQWA 3ZFEB 1B35B 1SACA 4GMP0 4MADA 1HRV3 1Z7S2 4HKOA 5GLUA 1S55A 2B9VA 4QWNA 4XE9A 2R6QA 3SC7X 2QQNA 4D6QA 1AF9A 4WVMB 2TNFA 4LBQD 4XIKA 5JPMB 1J58A 4I3PA 4QPYA 4CDXC 3K75B 1UYYA 2QUOA 1PVC1 4XURA 5DUWA 2I45A 1JS9A 2OUHA 2WL1A 3SH3A 1J59A 4LTAA 1H0BA 1W6OB 3OG2A 5BY5A 2P1BA 1ENQA 5FPVA 3AZYA 5FZ1A 2EALA 2ZGRA 4ASKA 2BOIA 3P6BA 3VN4A 5A3MA 3GCWA 5J98B 1U5IA 1GP4A 5GZEA 3ABZA 2B39A 3I2KA 4EWEA 1M4WA 2G9ZA 1UZYA 4P00B 2IVJA 3Q8BA 3USSA 1S0GA 3KV9A 2C6SA 2CY6A 1GZWA 5J36A 1G9AA 1FATA 1LHNA 4F3JA 1W2OA 4ARYA 1GOFA 4MUVA 4N90A 3T4VA 1OLMA 1OA4A 3ZYBA 4AAPA 2GC3A 1URXA 1W6QA 5FBJA 3WUDA 4ATFA 1WMFA 2WS92 4GIQA 5ACA3 1WLDA 4QX0A 4YZ1A 5IATA 4CDQC 2Y34A 4GB31 4NJ4A 1H8TB 1U5ZA 5F5IA 3AMPA 4YW7A 3RGBA 2D5HA 3J8F2 1APNA 4QQHA 1EAH2 1VR3A 3VKLA 3I3BA 4IEPA 4FPJA 4Q0PA 4DEVA 3DYOA 3NNJA 1F9KA 4YFWA 4BLIA 1S1AA 4NPRA 1UNBA 3OPZA 1BVP1 5HXVA 4NIDA 1GNYA 5F6LB 1QJU2 5FZEA 5DMYA 1QXJA 2EICA 5B4XA 2CTVA 4CUBA 1CAUB 5FRAA 4E8CA 2JDUA 4S2HA 5T5LA 1UY4A 1LU1A 4YW4A 3O12A 4BQ2A 4NO4A 3D0SA 5T3NA 3CU7A 3VKNA 4ZS2A 1PZ9A 2VXRA 1RXGA 1YCIA 4NPMA 3TEYA 4AG4A 3O1PA 1WCDJ 2PLV3 5FZOA 4B1MA 4JX0A 4K6BA 1WW4A 2WBKA 3ZVXA 1QQP3 2RJLA 1JZ6A 3OJBA 1MS9A 1OFSA 1V70A 3CQOA 3VBUA 3ZXAC 2HWB1 1PGSA 1H9WA 2B5HA 4HKWA 3ZYRA 4XUPA 4Q4X3 1R64A 2JB4A 2O14A 3DUIA 4LHLA 4PDWA 2DCTA 1ZM1A 4BJ0A 4LKSA 4EWDA 3NO8A 1UKRA 1HN1A 3VBSA 1M06G 4P5YA 3ZMOA 4BDVB 5FZLA 4XABA 5JIUA 4XYXA 4FOWA 3NQHA 4BH9A 4CU7A 3OGJA 2L9LA 2D7FA 4Q4V2 1X7NA 1FV3A 3AM2A 3BOWA 3QH7A 4QKDA 4EQVA 3LEMA 4AGGA 2A3WA 3ZPOA 4IE6A 2JENA 3FHIB 1RYYA 3JUUA 3URFA 1HXS1 3N7LA 2VD7A 3Q9OA 1JZ8A 2PN5A 2EXJA 3AYEA 4CU6A 3O1UA 3U37A 4DXTA 1NQJA 1YNAA 5T54A 3VDDB 3BPSA 4AEMA 3QH6A 3GF6A 3MDPA 3MIBA 2VMDA 5C3RA 5LRRA 4CDWB 4G4FA 5T52A 4P9LA 1UYPA 4M01A 3I8TA 1BBT1 1KGYA 2ZEZA 3IWZA 4RD7A 4Y5Z0 3CKHA 1JODA 2WNEA 2P37A 1PX4A 5FTTC 5A7NA 2G9GA 2R49A 2UU8A 4WVZA 1LEDA 2FCUA 3IT8A 3NRUA 2AR6A 2P6HA 3ASIA 2DURA 1LRHA 4HMZA 4IXLA 1ULFA 1RUD1 1TQ5A 3NNGA 3WG2A 3WW2A 1S0EA 3PJQA 4RHV1 1VB2A 4YM1A 3THTA 3HMYA 4LORA 1SLBA 1V6OA 4TZDA 5JPNB 1SLLA 5FXZA 1CAVA 1U5XA 3B7MA 1A8DA 1TME1 1EYBA 1QXPA 5EPAA 5CVRA 1XE0A 1VMFA 1W2TA 4XACA 5KR7A 4I09A 2BFUS 4NVPA 2WN2A 3EHKA 5DAQA 3WEZA 2MHFA 4NRQA 3SCHA 1RUI2 2BTVC 2PHUA 3EYPA 4AE2A 1RUJ3 3KCCA 4B7KA 1GYKA 1C8M1 2PHLA 1OVSA 5HCBA 2ZEWA 2ZJCA 1QJY2 3DYMA 3J4UH 2ZGKA 2CAUA 4BQ1A 2XLFA 3PNAA 3H9AA 4DUWA 1OD5A 4FVVA 5AC91 2XHKA 2HWC1 4COVA 4FOVA 4UBGA 3LIGA 2DVBA 4MGYE 1X9PA 4QB1A 2YBSA 1BEV2 2ZKLA 2Q8DA 3ILNA 5HV0A 4UOJA 1LESA 4CTEA 5SV5A 4BQXA 3MIEA 1RTVA 2WO3A 4GB32 5C4WB 3E5QA 4YWAA 3U11A 3QCWA 4TYSA 5ANNA 4LBNA 4A45A 1Z78A 1W03A 1RUH2 4IL7A 5FY4A 1GQPA 1RUF2 1AR71 5L7OB 1EV13 4QB2A 3GGLA 4JZRA 4L8QA 5JXGA 2ES3A 3WNOA 4D7TA 1K5MA 1YRZA 1VJ2A 5FXWA 1GWLA 3FHAA 4FFHA 1DGRN 4IEVA 5FLJA 3T2QA 5BNNB 4Z8BA 1XNTA 4NPLA 1UYZA 3O1VA 2ZGSA 1MZFA 4CRQA 3B9IA 1W28A 5BNOC 1Q8OA 2VG9A 4YNIA 4XFCA 4ORFA 1VPHA 3LB9A 2ZX4A 4AEKA 3E1F1 3WSOA 1DQ5A 4Y4YA 4AEDC 4U36A 1VE0A 4X6QB 1VBD2 3BI3A 1NCQA 3DCQA 4ZY9A 4AHYA 2B7YA 1OUXA 3AP7A 1QH6A 1NA1B 1KJRA 2PMWB 3THCA 4NHMA 5IVJA 4MVTA 4B4QA 1YO8A 3T1LA 2Z79A 3LPFA 4WVWA 1Q43A 3Q8FA 1OH4A 1RMU3 2PAEA 2R043 5H9PA 5BNPC 2VMHA 3J26N 4A3ZA 2A73B 1CJPA 1CD3G 2O1QA 3ZDSA 1UX6A 2RS53 3ZYGA 1ZVFA 2H0VA 2RJ2A 5CADA 4D6SA 5JVVA 5FY9A 3MICA 4XF9A 1K45A 2F17A 5DDJ1 3ZFFA 5JOXA 1TMF2 1JOPA 1HXS2 1UIKA 4A3XA 3LDBA 4LBQA 4NOTA 2JD9A 1V6MA 1FMD3 5I0DA 1CIYA 1NCRC 3VHOA 3RZGA 2J42A 1F4HA 3POEA 4RS5A 3VBHC 2JDAA 3VHRA 4I0WB 1LOEA 2XDVA 2HWE2 1ZZ7A 1BBT2 1UU5A 2QJVA 1B09A 5LASA 1YQ2A 4DRRA 2RVAA 5H9RA 3V56A 2JDNA 5JMCA 1IPSA 2IXJA 3O0WA 1F35A 3E6BA 1QWRA 5LCWL 1JYNA 1W39A 5HXMA 2W46A 4CA9A 4BQ3A 3CDZB 4TTGA 4COWA 1YFUA 4AI1A 2Q1MA 4N43A 1J3RA 1JW6A 4NHXA 2MPFA 1L3JA 3KF3A 1TG7A 4YPJA 1H2NA 1RUG2 1MQTB 2VZPA 2JG9C 3D3AA 1O4YA 1VMHA 2AGSA 3GZUC 3OGSA 1BXHA 3AXDA 5LWBA 2ZHNA 3H50A 2WWUA 3D0JA 4RFRB 1C8M2 2VTFA 1C3HA 4GWNA 1JYXA 2ZEYA 3C2UA 4ZU5A 1O7FA 4BYYA 3R05A 4DINB 1JZ3A 3RZKA 2R7EB 1EPWA 1R1ZA 2HWC2 3N36A 4FCAA 1LB2A 2AACA 4B7EA 1QJX1 3WNNA 3VBUC 1CX4A 4M00A 4UW5A 4GJZA 4UXAA 5EV7A 1LHWA 2ARXA 3GJAA 2VZ1A 1D4M1 2WRAA 2X5IA 3ZM8A 5IVYA 1C4RA 3TEZA 4QDQA 1UY0A 2CHHA 4R9DA 3NJVA 1DYOA 5FJKA 1X8EA 1SPPB 5T5OA 3HQUA 2VOWA 1UQXA 2RV9A 5FZ3A 1CJDA 3OEBA 4P9WA 4DMIA 1AR72 5IVCA 1GMMA 4CE8A 1SFPA 3DYPA 2BGPA 1PMIA 4NWWA 4LLFA 4NHKA 2OVUA 3B3QE 4B29A 2W1SA 3HNYM 2BYVE 2ILMA 4HONA 4A6SA 2Y6GA 4R8HA 3KMHA 2XPJA 1QJEA 3OY8B 4CCKA 1WLWA 5IWFA 1ZRCA 4P9IA 2X05A 3WW1A 3PVNA 2LS6A 2VY0A 1FMD1 3MIFA 4GH4B 4Y1UA 4ZPIA 4YW5A 3UKVA 4URAA 5JXIA 4XOGA 4M3CA 3OUHA 5F2WA 3LEIA 3VBOC 5I0RA 3WV6A 3MZHA 1X36A 5FZ7A 1JYWA 1GOGA 2D6KA 4J6GA 4LBJA 4MG2A 2C9AA 1OPMA 3KT7A 3UJQA 2BNOA 2WZ8A 4LO8A 1XXNA 1PMJX 3ST7A 2LRPA 1FNZA 2DBIA 4R52A 1GZCA 5F6KA 2VZRA 2CGPA 4OUSA 1XNCA 2UWCA 3OBTA 4F8AA 3AZZA 4KI5M 3ZPYA 1PO11 2VUCA 2FCTA 3ATGA 5IFPA 5KWRA 4UYBA 4FPHA 4KH9A 1GR3A 5A7QA 4D69A 5C3QA 4FXGB 4XDOA 3VBRB 4WM7A 1CZTA 5CKMA 2WJSA 5DAPA 3PHMA 3BUCA 3ZMNA 4WM8C 4DUXA 2VZSA 3ORJA 4QHOA 2W1QA 1MZ5A 4HPKA 4RQPC 4Y1VA 1Q8VA 1PK6A 3AP9A 3VL9A 1I1EA 1FV2A 4HLTA 2B4KA 1N1YA 1F15A 1RUC1 3L9JT 5FY0A 1FXZA 2QBXA 4XETA 1ZBE1 2WQ8A 1XC6A 1NLQA 2JDKA 2QQIA 4PQQA 1SZBA 1E5IA 1Y9MA 5FYTA 1X50A 2RM23 4QPIB 2A75A 5F32A 3QD6A 5K7PA 4YFZA 3USUB 1H30A 1DGRA 4MO3M 3KQRA 1C1FA 4BA6A 3BU7A 4XMIA 5F7UA 5BPXA 1VBE1 4JQTA 5EHDA 2ADEA 3OBRA 3JBG1 4IEXA 4NAMA 1AXYA 2TBVA 4OHVA 1XE8A 3KHCA 4BHPA 4JGYB 3WXPA 2D3RA 1ZZ9A 1V6NA 5CA6A 2WNUA 4O7XA 1COV2 5D2AA 3FBYA 1PGL1 3N9MA 4QX8A 3SISA 4BQ4A 2VCMA 4KWLA 3MFAA 4JGZA 4MHRA 1Q8PA 2GMEA 4MGZE 1YI9A 4XF1A 3ZYPA 2E63A 4XBLA 4DY5A 2D5FA 4XW3A 1H2LA 3VD9A 4XDQA 1DF0A 3O1MA 1K5MC 2PXJA 4FOYA 4K20A 2DF7A 2JG8A 2Y26A 1YWKA 3OD0A 5FMBA 2ZKNA 4LE3A 3T2TA 3WLUA 2EXHA 1I3HA 5JOZA 4E27A 1ULPA 4PCRA 5J96B 1FAYA 1A8MA 1WCQA 2J7MA 1LKNA 3NAPA 3SLIA 1Z7S3 4Y1YA 3VD4A 3U07A 3V0AA 1TE1B 1IKQA 4JDOA 1KFUL 2Q8OA 1OOPB 4DOUA 5JR2A 4L0PA 4DRVA 2WT0A 3IMNA 2VE1A 2Y33A 2JE8A 1JXNA 4XFHA 4QPGA 4AF9A 2AH2A 1DQ4A 1VBB2 1IZ3A 4LOSA 1W04A 4SLIA 1QDCA 1D4M2 1CZVA 3NSTA 1ZNPA 1XE7A 1HJFA 2HWD2 4P9YA 2DWRA 3HQXA 1ENXA 2H0BA 2HEYF 3ITQA 1OQDA 3LFMA 3LOBA 3CO2A 2YZ4A 4V2VA 1E57A 1LGNA 4JTOA 4Z1VA 3NJZA 4JQRA 5FLHA 3KCXA 1G9CA 4OLLA 2OW4A 1UU4A 2XG3A 3HN3A 2WS93 1BLZA 4NIIA 3ZFFC 2W08A 1NY71 2YB7A 1ZA7A 2HH9A 3FN9A 3H1WA 5I0UA 5ABJA 4Y22A 4PIYA 3VZKA 1IHMA 1I5ZA 2HWF1 5JAXA 1JYVA 1AL0G 3CEWA 2UY9A 4AQ2A 4H3WA 4DEQA 4MV2A 4HG6B 5FZ6A 2WYFA 2YC2A 1CR7A 3J8F3 4LBKA 4JDNA 3S7IA 4LEJA 4RS5C 3T0AA 4CEYC 2QZ3A 2BWAA 4DIQA 4F83A 4AVVA 1FI2A 4YM0A 1WBLA 1O6UA 1CX1A 3SH5A 3NNMA 4YVWA 3POIA 3O1RA 4GWJA 1H2KA 1UX7A 4DUVA 3ZSMA 4EROA 3T08A 5CFDB 5C8CB 1O4TA 1S2KA 4LO6B 2DVFA 5FOBB 1PO12 1J1TA 2IXIA 4OMCA 3BU0A 1W6PB 2ET7A 3M4FA 1US2A 2JDYA 1UY3A 4HSLA 4XIOA 1O59A 1K12A 2ZCWA 3CJXA 4QHZA 1MS5A 3M3IA 5KHHA 4Q4Y1 1ND2C 4M3CE 4M0HA 1REFA 2VR4A 5EQUA 3ZIWA 1MPXA 2J1EA 3RG0A 1V9U2 2GAUA 4EV0A 2QDRA 4YW6A 5K0UB 3VZOA 4KWJA 1FOD1 4IGOA 4ONUA 3ZXGA 5KXCA 2OYZA 1DQ0A 1JUIA 4YG3A 1LODA 5C70A 3IMMA 2OA2A 2XWJB 2RS13 3NNFA 4NE9A 4NN0A 2FZ1A 3VZJA 1STMA 3B01A 3MUY1 3PMSA 1WA4A 2QQVA 1AYN3 1BYHA 3RPQA 3AP6A 1GKBA 2Q0AA 4Q4V3 2BQPA 3PIJA 5A1FA 4D6RA 2WC2A 2E9QA 3K3OA 3JBG2 4IEYA 3S0MA 2JDHA 2RDNA 2DDUA 5FYVA 3JCIA 1ND3B 3WF3A 2VZUA 3I59A 3Q8CA 2OPKA 3NL1A 3SMHA 2UY8A 4UT5A 1OKQA 1PGL2 1DGWX 3TN93 1XNDA 1NG0A 5JDBA 1YQ5A 4SBVA 4AR2A 2FDKA 3P5BA 4HK8A 3O1OA 1YXWA 1XYPA 2W1WA 2QE3A 3I54A 3LE0A 2JJ6A 5ANQA 1RVF3 3S5AA 2ETEA 1KQRA 4BB3A 2IXLA 2RR13 2PHRA 1W6NB 5DZGA 3OYWA 4PF1A 4HT1T 5CB7A 3WP4A 1K42A 2CWMA 1PGW2 2NN8A 3AMHA 2ZOEB 4C0BA 4IV1C 2WN3A 3KGLA 5A33B 5B2GB 2QNKA 1NE6A 1VALA 2XR4A 3O1SA 1ULDA 3HR9A 3ENRA 5FZOB 2FHRA 2V09A 5C6CA 2IWGB 1W9FA 2Y6LA 3LSEA 4CXXA 4XBNA 4YZ2A 4V1PA 3BVCA 5DXDA 1UAIA 1W2NA 1MEC3 5LBCA 2WA4A 3BN6A 1RUI3 3WQ7A 4JDMA 3FUQA 2WNVA 2D6NA 2HYXA 4PDWB 3ZOIA 1QJY3 2YHJA 2MEV1 3CIHA 3SEEA 3VBSB 3EQEA 4WM7C 3VB9A 1FX5A 3VKOA 2GU9A 1A34A 3FBMA 5L9BA 1PK6C 4PHZA 1AX0A 1SBEA 4N53A 4Q0SA 3UGFA 5HBAA 3B5LB 2C24A 1W3XA 4RA0A 4FPOB 1V00A 5EJ1B 1BEV3 4UF0A 3VDAA 3IDAA 5J7MA 3TEWA 5JR7B 1RHI2 5GLTA 3MF6A 2XH6A 3N9OA 4J1WA 4X6RB 1G86A 1AX1A 3KQ4B 1Y9GA 4URTA 1BVVA 3B00A 3MUZ1 1EUUA 3WCRA 3CBNA 1W9YA 2X53S 1WD3A 4WBBA 3ZXEA 5BNOA 1RUH3 2VMEA 1KXGA 1RUF3 1UIJA 4AEDA 3K46A 1W6MA 2BEOA 2Y60A 3N35A 5T5PA 1F4AA 4A7ZA 4COZA 2W5FA 1WGPA 3PDQA 2J1UA 2RG4A 3ZSLA 4Q5OA 4TLGA 1Q5OA 3ETQA 5E1RA 3VKFC 4IDZA 1VBA1 2PELA 3MGUA 4N7IA 1JUHA 4N8MA 3FUOA 5FP9A 5DAXA 4R9CA 3LA7A 4PBOA 4JGZC 1CAVB 2F6BA 1LOGA 2V4AA 3OGGA 1UL9A 4LKFA 4OYUA 4W6WA 5FLIA 3WDXA 1VBD3 2KR2A 2OPWA 5BNPA 4E4DX 5JZGC 4QX2A 5C33A 3HPNA 4L97A 4Q4Y2 2YGLA 3VV1A 4XFIA 3VKMA 1DHKB 2JG8C 1WA6X 2WZR1 5EYXA 5FZKA 4O61A 3HWJA 3LF7A 4AGRA 1AX2A 1YQ6A 3T09A 1AR63 4QD2A 1GZTA 3SQOA 1LR5A 2RMU1 2F4LA 3DPRB 4YGEA 3N7JA 3ZXJA 4XTPA 3NAPC 4HANA 1GBGA 1DZRA 1MS1A 1O3QA 1S2BA 1NCRA 1OD3A 1R082 2YYOA 1OFNA 1OF3A 4IESA 3VBHA 5IVEA 2QQMA 1JOJA 2P2KA 1VRH1 4FFGA 1NKGA 4UFLA 3W9AA 2C4XA 1WD4A 4QPGC 3AXEA 1GQGA 3ZKYA 4NRMA 1TMF3 2BJSA 5HCFA 1MS4A 5C3OA 2AREA 3PTRB 4AWDA 3ZN4A 1POV3 3N9PA 1ZX5A 2RS31 4TLFA 1LHOA 3V65A 1R091 3ON7A 1SCSA 2CGNA 2VGDA 1ZRRA 2EF6A 4HBNA 1QXRA 2HWE3 2E7TA 1WMEA 2J1SA 3OPTA 3IN9A 4NIAA 5BNQA 2JG9A 3FFQA 3O14A 5ABJC 3H8RA 1ULOA 5FPXA 3RS6A 2Y8KA 3ILRA 1Q56A 2DCJA 3ZFGC 2P3JA 4C8DA 4CEWC 2P3YA 3IIIA 4HVRA 1W06A 2VVDA 2VCAA 1QDOA 2VUDA 1G8WA 2XBO1 3MBWA 3HVDA 4XHXA 5F8PA 2XL9A 3VHNA 5HCHA 1AYM2 4LO7A 1PO21 4Q0QA 3ETPA 1NCQB 2WSUA 4LMFA 4YVWC 2R061 1W8NA 3H42B 2C26A 3WNMA 2WAOA 1PNGA 1RUG3 2D97A 4JTNA 4CXWA 4EJRA 1CGPA 3AKQA 3N9NA 5LA2A 2W2IA 1HV1A 3GYDA 3M3OA 3M70A 4Y20B 4ET7A 2YDEA 1WW6A 2J1VA 5ISLA 1OF4A 5LZ6A 1VBC1 5FWJA 5IYYA 1LGCA 2AYHA 3KGZA 3AZVA 2WFF1 4IGQA 3RNSA 1W8HA 1Z0HA 2IVIB 5JOYA 2E53A 4GKYA 2CDOA 4CCMA 1HRV1 2FDFA 2P5BA 4PF5A 5CFCC 5CEHA 4GXLA 3UL2A 2ZPXA 2QQUA 2PHDA 1AR93 1MS3A 1SG3A 3KV5A 4GA9A 5GALA 1W9TA 4LULA 4PIZA 4ZHNA 1KITA 1ENSA 1MVQA 4Q27A 5FYUA 1XYOA 3W58A 5KHIA 3ZYJB 2WKKA 4AVBA 3ROUA 1XSQA 1ASJ2 1AR61 1H2MA 1WWYA 4PI2A 3K51A 1VRBA 3I2JA 2G19A 5KHJA 1JHNA 3N3HA 1R1A3 5GZGA 1JBCA 3GZEA 4FPLA 3KS7A 3VLBB 3VBOA 4Q4W3 1HRI2 4XJAA 2ARAA 3PURA 3LCPA 4NIGA 4OQ8A 4LJHA 1LOCA 4RR3B 3ZR5A 4CDUA 4D3WA 1DQ6A 3G6JB 4FPYA 1YEWA 5ACA1 2DU1A 2RHPA 3HAGA 4W8JA 2QKDA 3AYAA 3ACGA 4CP9B 1ZA4A 4XXAA 4OULA 5FK8A 4N43B 3POSA 1LOAA 4PIXA 4XQWA 4W4ZA 4BMBA 2RDQA 4M3CF 4UI9L 2A6ZA 4WM8A 4AI3A 3SCFA 1PVC2 4RQPA 5LBBA 1REEA 4H55A 3ZO0B 4CCEA 3MW3A 3KT4A 3BKZA 2XOMA 1QHDA 1YFYA 4LKEA 2IXKA 5FY8A 3PUIA 3PLQA 4IETA 1XNAA 1G9BA 5J37A 1PM4A 1YQCA 3JD73 1ONAA 5JSRA 1YLLA 2VMCA 4NWVA 4YGBA 1GNZA 3C7HA 4XPVA 1S0JA 1B35A 5F2SA 5A7SA 2VECA 3G7DA 4BXSV 1QOOA 2NM1A 2Z42A 1LULA 1D4VB 1JYIA 2XJTA 5CZKA 4YVSB 4AGVA 2PLV1 2XVLA 4WVMA 1U5YA 1EP0A 3K2OA 4XFGA 5FZCA 3VL8A 4G9SB 2IXHA 3U0ZA 2G9FA 2A5ZA 2GNDA 3HT2A 1QQP1 2ZX2A 1YIFA 3O0XA 5FO7B 5A32A 1N3OA 2X5IB 2WNVC 4I30A 3LSDA 4K9SA 4XFFA 4OI0A 2JKBA 2QFEA 2ZGOA 4PJYA 5I8SA 3OPWA 4UW6A 2V5YA 1UZZA 4Q4X1 3LIHA 3OEAA 5EWSA 3WQBA 2D40A 4UFHA 5I0TA 3WCSA 3ZKUA 4C0HA 4RGKA 5A3NA 3VBFC 3L2YA 4N53C 3A0KA 4PLOA 4KGQA 2NYYA 4D7YA 1CAWA 1D2QA 1AL23 3P3NA 4RGGA 4COUA 5EJ3A 1OLME 2YUEA 1NQDA 2ZA9A 1DBNA 3HBKA 4GWMA 5FXVA 1HJGA 5IVFA 4COYA 1IS5A 1GZ9A 3SITA 1LAJA 5DUXA 2H6CA 1FNYA 3K48A 1WMXA 3NJXA 1COV3 4H7MA 4XUOA 4AFCA 1BCXA 1SDDB 2CAVA 3AKTA 3MHZA 4M3CB 3NW4A 1I9RA 1PO22 5BXXA 4YZ3A 4KWKA 3J9SA 4BOWA 4P14A 2ZAHA 4KU8A 3VDCA 3POFA 2R062 2XWBB 2WT2A 4XTMA 4BWOA 3ZR6A 2G4IA 3ZYFA 1V6LA 2WQZC 2V4VA 4HKLA 3Q8EA 2ZHKA 3PMEA 2W3JA 5D21A 2C1FA 3MEPA 1AR83 2HWB2 2JECA 4IEOA 2ZS6B 4DNYA 3WHUA 1H6YA 3C7GA 3WP3A 1CAUA 2D6OX 3LD8A 3K4AA 1N1TA 1OHFA 2A3XA 2XB6C 2QQOA 3KV4A 4LHKA 4ISRA 1UU6A 3RWKX 3VBRC 3RZJA 1SLCA 3KF5A 1KDKA 1VBB3 3HD8B 5JWPA 4WZFA 2WO1A 4K40A 4BK4A 4CSWA 1OLQA 3WINE 1UD1A 4IV3B 1RUJ1 5D8AB 3LA3A 1HV0A 2HWD3 2GSYA 2ZGUA 3H1MA 3DV8A 3NMBA 1NYWA 2BZDA 4CEYA 3WNXA 3BCWA 4YW3A 4KWUA 2QVSB 5DZFA 5JMOA 2YBPA 1L7QA 4YGDA 3M1HA 3BPZA 5IJRA 3ZN6A 5EP9A 1S0DA 2AENA 1F2NA 4EN0A 2VXJA 5LA1A 3B02A 1Q8QA 4HK9A 1N1VA 4QKNA 3P1IA 4ZZ5A 4Y24A 2DVGA 2B46X 1SFYA 3J7LA 1V6IA 2WNUB 4Y26A 3SHRA 3KT1A 3I2IA 3RI9A 3WP5A 1RUD2 4D8MA 3O5SA 4JHZA 4RHV2 4XCBA 1H4GA 4CDXB 2YXSA 4Y3OA 5FYIA 5FY1A 1DCSA 1TME2 1EV11 5ERLA 4NIHA 1ND2A 4KQ7A 3O0VA 3M3CA 3GBFA 3POJA 1CESA 1UZVA 5DG1A 2E32A 1J83A 5FYYA 2DTYA 1WKYA 1YIPA 2VZVA 2B42B 1MVEA 4A4AA 4IE5A 1RUE3 1UY1A 3JQXA 2ZGMA 1J84A 1UYXA 4IEQA 2XKPA 3IAQA 1QIQA 1YFXA 4DXRA 3M7AA 1LEMA 3V0AB 1UMZA 3H0OA 1G9FA 2VOTA 2ZGTA 4BISA 3DN7A 5AC92 2GNMA 5IK5A 1V9U3 3GZAA 3FFZA 4P02B 1XU2A 2VVFA 1YC61 1CPMA 2PHFA 1QQP2 4CDQB 4DS0A 4OI2A 1OA2A 4MH0E 1FPN3 5FBZA 1ZZ6A 3H3LA 3OUIA 4CCCA 2A6XA 5FIXA 1H6XA 1IGOA 1OVPA 1QH7A 5T5JA 3S6PA 3T30A 5KHKA 3BTXA 1PIV3 4Q4X2 1DZTA 1UXZA 4C90A 4FO9A 3OTFA 1QJZA 3TYJA 4BLJA 1QU0A 3I7DA 2BGCA 1RMU1 2P34A 2R041 4XFBA 5LEKA 3RZLA 1CZSA 3HN1A 3HBZA 1MACA 5LY2A 4QMAA 4LK7A 5JI9A 3S30A 3W5NA 2RS51 3LDRA 5C9AC 3BTYA 3I3MA 2NMNA 4ZXKA 2HKXA 2VH9A 1DIWA 1DLCA 3KB5A 3WF0A 3RMXA 3UGGA 1SLTA 4QX3A 1GUIA 1N3QA 5FP8A 2W0XA 2YU2A 4IV1A 5J09A 5JOWA 3NKGA 1HB3A 3MFCA 3POYA 1ZBA3 1VIWB 2D98A 2GH2A 4EZ4A 2R073 5FP7A 1MZ6A 4LO4B 3PTYA 2DUOA 4NHLA 5L7OA 1GFF2 2Y6JA 4CDUC 2SLIA 4H7LA 1VB4A 2TUNA 4LITA 3AMNA 1IQAA 3IAPA 2K9ZA 4FPFA 5IUQA 5C71A 1JU3A 2VMIA 4CCDA 3EXUA 5A7OA 4FOQA 2VW0A 1KRIA 3DGTA 1YHFA 2VM9A 2DFCA 5TSWA 4CYDA 5K4LA 4OZXA 3AKSA 3D6EA 1W2AX 5FQ0A 1DQ1A 2PAMA 1YI7A 3A0NA 3J7MA 3NVCA 3CJIC 4CXYA 3N9LA 4ARXA 5DDJ2 1NA1A 2D6LX 3EB7A 3ACLA 3PVEA 5LEJA 2YG0A 1WUVA 4LKDA 1JYTA 4M0NA 1WLCA 4Q0UA 5A3OA 2XLGA 2GMPA 3ES4A 1B35C 3ZFEC 4AVTA 1MS8A 1REDA 1JZ7A 2NLRA 3NV3A 2GNBA 2A71A 1SBDA 4YW1A 3GHNA 4GZ9A 3S5QA 4A6OA 5CG8A 5IW0A 1S0IA 2E51A 2WIIB 2R30A 3KZ4C 2EIGA 3PUAA 1RHI3 4MX3A 2BVBA 3GM8A 1POV0 4FP2A 4LBLA 4PT6A 1DGLA 5F3GA 4LR4A 3RZMA 5LW9A 4KG0A 1XU1A 4J1XA 1O5UA 1E5HA 2VZOA 1HKDA 3DEMA 4AFBA 5CBLA 4QU2A 3E5UA 1UZ0A 3UK9A 5IK8A 3WDYA 2CDPA 5JZGA 1IPJA 3KVBA 1HQLA 4KGGA 1W90A 2ZHMA 2WWJA 3TRSB 4D7SA 3VUOA 2RE9A 2VZTA 3AKRA 4EE2A 3OYWB 1ZRIA 4FFIA 5GLVA 4OI1A 2O0OA 2DFBA 2DCZA 3OUJA 4P5HA 4LUMA 3WNKA 3FZ3A 5JSOA 4GWIA 3IDCB 4LNVA 1H8TC 5F39A 2W9XA 3AZXA 3KHBA 3SKJE 5LK5A 2XGXA 2VZQA 3M8LA 2YY1A 4AQSA 1XOYA 4MOAA 1CIWA 1JH5A 1ZBA1 5FMOL 3WG4A 2BBAA 2BVVA 1QJX2 2C9KA 5IK7A 4CP2A 3CZJA 3MV01 4LPLA 4RSUA 1MQTA 2ZGNA 1YUDA 5AVPA 4OHXA 2W91A 3AB0A 5FWEA 3JB4C 2E6VA 5FYHA 4QDRA 4KL1A 1N1SA 2LUWA 1R083 2BWCA 5D1IA 1QNYA 3OGVA 3ZYHA 3TNQA 1RMU2 2R042 1MS0A 3FX3A 3I97A 3WG1A 1HQWA 2P6CA 4QPWA 1ODNA 4K8FA 3ZSEA 2VOXA 2A3YA 4KU7A 2W47A 1FYUA 3H7YA 2RS52 4M4RA 4W65A 3FHQA 3BYWA 3I3DA 3O1TA 2A6WA 3LDKA 2VO5A 1TVGA 3OGRA 5CKQA 1P8JA 1TNFA 1O8SA 1X8MA 2VAUA 1DG6A 3GCXA 2R32A 1KEXA 4UFJA 3ZFGA 4CEWA 1PNFA 2VMFA 3GHMA 4OVEA 5EJZB 4B1LA 2VUJA 5BNOB 1V0AA 4LIVA 3MF9A 4O9GA 4JKKA 1VMJA 4V2WA 1EAH3 5K8SA 1FMD2 2RDRA 2RM21 4AEDB 5IHRA 1CWPA 4LK6A 3ZXLA 3U14A 4FPKA 5A7WA 1V6KA 3FLRA 4AXOA 1S0FA 5C3PA 5KXDA 3THDA 1IOAA 3LFIA 3WD5A 3V0BB 2VQTA 1QJU3 1EUTA 1EY2A 3RVHA 3T0BA 2NZ9A 4LBMA 1AYM3 5GM0A 3JXSA 1SLIA 5BNPB 1UY2A 1NXD1 3I2HA 1ACCA 2VW2A 1OMIA 2W39A 4MSVA 4PLMA 1AJOA 3VDDC 4HXCA 2GMMA 3MLJA 4AI9A 2FCVA 3INAA 4CCJA 5CFCA 2ZXQA 3I2DA 4CDWC 5HI0A 2N7GA 4DQAA 4NRPA 4CPBD 3K3NA 1W99A 4OHWA 2P3IA 3TEXA 4IERA 4QKBA 5DZEA 1QF3A 5FP4A 3DXTA 1BK0A 2XKOA 1RUC2 3BIWE 4XJ9A 1D0HA 2WDBA 3PVBB 4HVQA 2VL4A 1QGLA 1ZBE2 2J1TA 1HB2A 1NCRB 4QT6A 4JAAA 4JVAA 3VD7A 1Z7S1 3VBHB 1UZWA 3WX5A 1GZWB 2GDFA 2OQ6A 2KA3A 3AK0A 3HNBM 4NAOA 4UWDA 1ZZCA 2EXKA 4LLOA 1KD7A 4Y33A 5FUIA 1W6QB 2VULA 2IZWA 3D4KA 1JOBA 3H1YA 1PHMA 2HBTA 1VBE2 1LOBA 2ZTNA 5A80A 4AVSA 5JXJA 1ASJ3 2D3PA 1L7LA 4AI0A 4MYEA 4ISQA 5IVBA 2EAKA 5FZFA 3ZXFA 1SLAA 4HN1A 1W3VA 5BV6A 1OQ1A 1UF2C 1UN1A 4DFSA 4CCLA 2X8KA 2QTWB 5EYYA 5LBEA 1VLNA 3F2ZA 3ES1A 4GQ7A 2BOJA 2BW8A 3ZYIB 2EVXA 2ZGQA 3WT3A 5F1RA 1HRI3 4I0BA 4CP0A 1XNBA 2PQSA 2YU1A 5FPLA 2JG9B 5FZ9A 3USUA 1OUSA 2FDJA 2PHWA 3FLPA 3CF6E 5A6YA 2BPA2 2WS91 4K7JA 3GALA 2DUQA 2IFRA 3NKTA 2BDRA 3KLSA 3QACA 4IQPA 5GJ6A 3THPA 3PUHA 1JZ5A 3IB3A 3SKVA 5C4WC 3J8F1 2G1MA 4RFT0 4I3GA 5CIRA 3U75A 2O8QA 2YPDA 3QOPA 4LHSA 4I2OA 2V73A 3MIGA 1KDMA 4GKXA 3WNLA 1PVC3 3LGRA 2P3KA 2Y0OA 5L7OC 1C8NA 5FP3A 5FUPA 5FV3A 1PX3A 1W8TA 2GALA 3FL7A 5CNAA 3VBUB 5AVAA 4XF4A 4CCNA 2W92A 1U0AA 3AMMA 4JKMA 4NROA 1MZEA 2GC1A 3GJBA 5BNNC 4XVHA 3W5MA 1VAKA 2A70A 3MLKA 2WR9A 3D8CA 4DO0A 3LPGA 5FZ8A 4FBFA 5H9SA 4YGCA 3RJ2X 3VBFA 1HDKA 5G05L 4K1YA 1O4ZA 2V5DA 2VUAA 2ZMLA 3CHXA 1IS3A 4QGLA 4BIFA 1NA1C 3EBRA 1NY72 1C28A 2PFWA 2QDNA 1XBFA 1YYNA 3IZOA 4C91A 1LHUA 2ADDA 2WINB 2HWF2 3AP4A 4GB33 4XMAA 2VBDA 2WLQA 2VJXA 5F5AA 4RGAA 2RS11 4L2NA 1I5PA 4OHYA 1L7RA 4A7KA 3VBOB 3RYPA 2RM22 3C7FA 4QQPA 1Y7BA 1PVXA 1AXZA 4NR1A 1OQEA 5A1AA 1OPOA 1AYN1 1A3KA 3GDBA 5FPAA 4E2GA 3OCPA 2QQPA 4Q4V1 2AEZA 2ET1A 1GANA 1Q3EA 2XJRA 2Q30A 5FZHA 5KC5A 1WLTA 2WZEA 5C8WA 2Y6KA 2JE9A 3LQCA 3LEKA 1HIXA 1G7YA 1GP6A 4XUQA 3C7OA 3W59A 1YQ8A 2V72A 3RWNA 3IDEA 2VVEA 4WM8B 2B9UA 2UYAA 4IW3A 5FFOC 4RQPB 3A22A 3FE5A 4ZONA 2DU0A 3TN91 4YRDA 5AFBA 4FTBA 4N9IA 4MLOA 4CUCA 5FZAA 2BNMA 4GALA 4XAEA 3C7EA 4CCOA 1RVF1 2OZJA 4O9EA 4FAHA 1FOD2 1RINA 2HWB3 2RR11 3OF1A 2WO2A 4QXHA 2JXAA 4XZUG 5CFDA 3LAGA 5C8CA 4IUGA 3NV4A 5FO8B 2Z2SB 2WT1A 1AVBA 1AJKA 4PI0A 2OKXA 2E7AA 3B94A 4FPCA 1W6PA 3K4ZA 4FQ4A 5LRSA 3RYKA 4XAAA 2VQUA 1XYNA 2YPJA 2Q4SA 2UURA 2R1DA 2VU9A 2K2SA 3TB0A 5A32B 1MQTC 4XILA 2CGOA 2J1AA 1HXS3 1RIRA 1MEC1 4Z2WA 2IXCA 3U78A 1VAMA 1RUI1 4HOOA 4E4SA 5K0UA 3ZSJA 4MGSA 2VBPA 1WCUA 5A3TA 2ZGLA 1QJY1 4FTSA 4UFIA 3J7HA 4HVOA 2DV9A 4E2QA 2D44A 5FOJB 1CAWB 1BBT3 1K5MB 5BUVA 3OBAA 1UPIA 4H2AA 4HZFA 4TSVA 4X8PA 3RZZA 5FMOS 1BEV1 2QQKA 1RC6A 5FZGA 4EWAA 2Y38A 1BQPA 3M3EA 1D7PM 4QGNA 5I93A 5FMCA 1RUD3 3AJZA 2A6VA 1BK1A 2PYTA 4LXLA 2GP3A 1H4HA 2JX9A 4RHV3 5FXXA 5L73A 4F7ZA 1ND3A 4XF0A 1RUH1 1HW5A 5BYNA 2FDGA 4Y5TA 2J22A 1RUF1 3WW3A 3E6DA 4CU8A 1TME3 3I2GA 3POBA 2VCCA 3UJOA 1WMDA 4EN9B 2E7QA 1DFQA 1XJAA 2XXZA 4Y4RA 3T4HB 2Z5WA 4LA2A 2RJKA 4Q29A 3RDIA 2ZX3A 3ALQA 3BALA 4QXCA 2EIDA 3AMQA 5A6XA 1X33A 3ELNA 1Y3TA 2VCBA 3PVOA 1XQNA 5G04L 4ZS3A 1W0NA 2ZMNA 1C8M3 1W8UA 2VC9A 4QQLA 4YSFA 1W6NA 3UYJA 3BODA 2MEV2 3Q8AA 3MO4A 4ATEA 3ZX7A 4FPEA 4YZ4A 3AP5A 4GH4C 5A33A 2Q1FA 2VMGA 5AC93 1VBD1 4Q1RA 2DVDA 2HWC3 5DAVA 4LQRA 5FPUA 4JHTA 4QXKA 4R4XA 3UKTA 2XVKA 4UFMA 3ZFFB 4Z2AA 5C9AA 2DYCA 3LWCA 2Z69A 3V64A 4BZ4A 2FDHA 3RRDA 1CAXA 4QX5A 4Q8LA 4LBQB 1O91A 3T0DA 4JV4A 3M3QA 4N7UA 4AFMA 2NP0A 1RXFA 4MGIE 4UW3A 4CEYB 3PIGA 4RS5B 4NMIA 4XDPA 4CPBA 3NV2A 5LBFA 5AFEA 2RS12 3D82A 2ATFA 1WW7A 4OZOA 2FMDA 3ZN6B 2LROA 2CNAA 1AR73 2JIJA 2BRTA 2PHTA 2XONA 2OUJA 3MI8A 4LA3A 4META 3WQ0A 1WZXA 1AYN2 4JKLA 2BUKA 1XRUA 4M4PA 4W6XA 2XUEA 2X29A 1HB1A 5FYSA 3T2OA 1JN2P 4EYUA 1TMF1 1VBA2 3U10A 3IPVA 3FMGA 2BP6A 4DY3A 1ZYBA 2RDSA 3HEIA 3GXUA 4MXWA 1POV1 1GOHA 4PQ9A 3E6CC 1ZRDA 2H6BA 4AAXA 2GP5A 4L11A 2WO7A 2YFUA 4O65A 4Q2FA 3KV6A 4QPIC 4P9GA 1ND2B 3RMYA 4YARA 3TN92 3GZTB 3B69A 1LNSA 1OI6A 4I02A 2HWE1 1DGWA 2JDZA 2YV8A 3GBGA 2EIBA 3RQ0A 2B8MA 3DKQA 4AOCA 4ZKTB 4B4PA 2WZR2 2FZ2A 3H8UA 1WCKA 1RVF2 3CJIA 3E97A 3NWKA 4C1XA 2XJPA 3WP6A 3LA2A 2RMU2 1UOBA 4LIUA 2RR12 3H8XA 4JGYC 3H8OA 3MLLA 3MW4A 3R4DB 3RFRA 4OFGA 3WDVA 2UYBA 3ZFEA 3I3EA 3JU9A 1ULCA 4EN7B 3ME2A 3POWA 4UFKA 1VRH2 3P3PA 3E5XA 5F37A 2QZ2A 1ODMA 1RUG1 3UKNA 1HX6A 2ERFA 4BE3A 1CVNA
chains in the Genus database with same CATH topology
3WG3A 1ULGA 4MZUA 5DDJ3 1W6OA 5J3UA 1IS6A 4H14A 4KBBA 1MEC2 5EXOA 3HT1A 2P17A 3BOPA 3ZXDA 4S2DA 1AUYA 2ENRA 4BPZA 3DPRA 2XJQA 3MPPG 2RS32 4PLNA 4OHYA 1GQHA 1R092 5GZDA 1C5IA 1CONA 2IC1A 2FBEA 1OOPC 3RSJA 1VAVA 1AR91 1QNWA 1IKPA 4AW7A 2F4PA 1F8VA 3MPBA 4AQTA 1PZ8A 3IM0A 5JCTA 3BTAA 4IV1B 4YG0A 2XBO2 2D3SA 1H8TA 4KNCA 5FCCA 3AFGA 3BB6A 4ZU7A 1R1A1 3IIAA 2JEMA 1KJLA 4JRLA 2VNGA 4Q4W1 3ECQA 1X82A 4LT5A 3OD4A 2Q1ZB 2ZX0A 3AKPA 5JI7A 4K21A 1VBC2 2HJIA 2CV6A 4WM7B 2WFF2 4Y1ZA 3RYRA 1HRV2 2W52A 4HPKB 2PQQA 1PK6B 3GBWA 3MYXA 3RJRA 3DKWA 5GZCA 5FQ0B 4Q0VA 4LHNA 4XF3A 1QJX3 4XQ4A 4YYOA 4IEWA 4TWTA 2JD4A 5CFDC 4Q1PA 1D4M3 5C8CC 1AR62 4HN0A 4Y20A 5DG2A 3TWIA 3R6SA 1DDLA 5LK7B 3JD71 1G6NA 2CWSA 4XHBA 4Y1XA 4X8NA 3WQ1A 2LALA 2D6PA 1LU2A 2K0GA 2ZGPA 1A6CA 3SXWA 5IK4A 1RJ7A 1FT9A 1ZZBA 2Q5TA 3JQWA 1C1LA 4JC1A 2LTNA 5K0UC 2ZAAA 5ACA2 4PBPA 5DUVA 1SFNA 4Q26A 2FMYA 4JGZB 5K9YA 2A6YA 1S0CA 2WZPP 3PJYA 3KD4A 2C5DA 2OZ6A 3KSCA 5JZGB 1LOFA 3VDDA 1WBFA 1DQ2A 1VP6A 4FTSA 5CAZA 2KM2A 2YGMA 4CDWA 2JG8B 4A2UA 4E2SA 2CGPA 4OI4A 2HYKA 2PA7A 1AL21 1S0BA 3KCYA 1ALYA 4RR3A 2XJVA 3NAPB 1PO13 3WDWA 2R16A 1COV1 1ND3C 2BNNA 3B93A 5E16A 1NXMA 2WA3A 1UCXA 3VHPA 4GMP3 3WHTA 4QPGB 2EAAA 3FLTA 2PLV2 5J48A 1WCSA 4P9XA 1RUC3 4DZGA 2VNRA 1IS4A 3N4MA 4XBQA 1ZBE3 5KHGA 1AR81 1UPSA 5FDBA 1QMJA 1RGSA 1QY4A 1RUNA 4S2FA 5GZFA 1LJ7A 2ZACA 4AVAA 4ITCA 3ZSKA 5KXEA 4KG8A 5I8TA 2YMZA 2MNGA 4G3YC 1Y43B 4LO5B 2QCSB 4FQZA 1AR92 2CL2A 5ABJB 4Y22B 1VBE3 4YVSA 3X29B 2NQYA 3JBG3 1VBB1 3ZFGB 4CEWB 2A7AA 2VQAA 1C57A 4XJZA 2XVGA 4AHWA 4BIOA 5H9QA 2HWD1 4PDWC 1J3PA 3WUCA 4LUKA 3VGIA 5C4WA 4ZU4A 3VBSC 1HLCA 4FAGA 1O5LA 4YVWB 1LGBA 4ASMB 5FAXA 1CPNA 1R1A2 4JRAA 4B8EA 1D0GA 4FT8A 4ASLA 4Q4W2 4QGMA 2XLAA 4XJ8A 3AJYA 1GSLA 3TOJA 1UW8A 1N3PA 1SMVA 5BNNA 3D5OA 2B45X 5CFCB 5DUUA 1NLSA 2DVAA 2XUMA 2Y0IA 4C1WA 4Z92B 2W68A 4HL0A 3ILFA 2ARBA 1YJKA 1TEIA 1W0OA 3MIHA 2HEVF 3FC0A 3RI8A 4AEJA 2WFPA 4AQ6A 3CLPA 3IKWA 1RUE1 3WDTA 1RUJ2 1NZCA 1J3QA 3JD72 2C0ZA 1OA3A 1AHSA 1QOTA 4MXVA 1GLHA 3MIDA 2GC0A 2GZWA 5E88A 4GMP1 1H9PA 2VW1A 4DPNA 2SBAA 1W2UA 1Q8SA 1ZZ8A 1H8VA 1V9U1 2XJUA 1DZQA 1SQ4A 2AZ5A 2HWF3 5JIAA 2CYFA 3I59B 1FPN1 3WZ1A 2PHXA 3DPRC 4FP3A 4YW2A 3EJKA 3A4UA 4IV3A 1PIV1 5D8AA 1NLRA 3AX4A 3VZNA 2VQ0A 1AZDA 5F5QA 4AVCA 1BMV1 1WW5A 4XJWA 1EV12 2PAKA 3B9CA 1AL22 4RL7A 1BJQA 2WWSA 2AUYA 4L92A 2VPVA 3SH4A 4AFAA 5KXBA 4P9JA 1SEFA 4QHBA 3S7EA 3WY6A 5I0SA 1O3SA 4Q4Y3 1KS5A 2GN3A 2R071 3LZZA 2EA7A 4CDXA 1F31A 3UV9A 1ULEA 4D94A 2GN7A 1FOD3 2KXLA 2WNVB 4XEZA 5HCAA 4OHZA 4B3NA 5A3LA 3CL1A 5CG9A 1PGW1 1AR82 3R0RA 4Z82A 3N7MA 5L19A 4CZSA 2D93A 2ZZQA 3VBFB 4N53B 4K3UA 3SCGA 5I91A 1NCQC 1U12A 2GH8A 3C3VA 5JSPA 4BMEA 2JE7A 3MW2A 4FTEA 5GKAC 3I4IA 1CN1A 3AZWA 3R4UA 4CDQA 2I2SA 1JYCA 3NV1A 1KFXL 2O8OA 4MGKE 1W6MB 1I6XA 4UW4A 4YM2A 3LKJA 1H1AA 5F9TA 1N47A 1BZWA 3WR0A 3TBDA 3ZIXA 1UKGA 2DCYA 4WV8A 1AXKA 1DU3D 1YJLA 4E9KA 1RHI1 3DF0A 2GC2A 5I8YA 4EN6B 4L9BA 2D43A 4ES9A 4WVVA 3LOIA 1GV9A 5GLWA 3CNAA 4BM8A 3OY8A 3TNPB 1JTZX 1ENRA 4GULA 1O3TA 1LOFC 3QLQA 4GH4A 2TEPA 4E4ZA 4R4ZA 1EPZA 1GICA 1V6JA 2YROA 3IDBB 3ZXKA 1RJ8A 3O7OA 3EO6A 4K1ZA 4Z07A 4QQ2A 2IFWA 4RR3C 3WVJA 4CP1A 2NPIA 1TNRA 2UWBA 3DL3A 1F5JA 2OIIA 3QBQA 3R4SA 5E89A 4AI2A 1ZRFA 1ZREA 2DCKA 1NOVA 2UWAA 3H7JA 5FREA 2VNOA 1RUE2 3WOGA 2MEV3 4AHXA 5JLVA 4XZPA 1RUOA 4S2GA 2WSVA 4N43C 3VBRA 3JZVA 3VZMA 3U4XA 1QKQA 1LTEA 1SCRA 2I74A 4XXPA 3JB8A 1LCLA 1CQ9A 2ZBJA 4I01A 4FXKB 4HFSA 4AYUA 1FPN2 2WQ4A 2ZX1A 5EFUA 2I07B 4ES8A 1DYPA 4OUMA 4HSJA 1PIV2 1R081 3HIFA 4QPIA 2BFUL 5CU1A 3SNMA 1BMV2 1KS4A 2FQPA 1H1IA 1OSGA 3M2MA 2R0FA 4XFAA 4YVSC 2VOKA 2R1BA 2VOVA 4N9HA 4R9AA 1IPKA 4QQOA 1H1MA 1VBA3 4BCUA 1QOSA 2GNTA 2LM3A 3H3ZA 4HETA 1C5HA 3APBA 2X5IC 2BBVA 3N7KA 4JGYA 3KM5A 4A7YA 4YZ5A 1LHVA 4XQDA 4AFDA 1EAH1 3GNEA 1BKZA 2ZHLA 1ZBA2 2XJSA 5T55A 1Y9QA 4IEUA 2R072 4LBOA 4R9BA 2WZR3 5T50A 5GLZA 4AHZA 5E8AA 3L2HA 1QJU1 4INDA 2WLPA 2RMU3 1RB8G 1AYM1 1RL3A 2D6MA 1YFWA 5L36A 1F5FA 4I0AA 1PZ7A 1VRH3 1NE4A 4LE4A 5KBFA 5C9AB 3TAYA 1J1LA 1OOPA 4JCKA 2ZMKA 1CAXB 4XJUA 4EN8B 4QM8A 3FJSA 1A78A 2XL7A 4DB5A 4YG6A 5FPZA 1GNHA 4QM9A 3WW4A 2RS33 1LENA 3AFKA 1XNKA 1R093 1O3RA 4FSJA 2EXIA 1PM7A 1DYKA 3FWEA 4WZCA 1G9DA 1MR5A 2ZABA 4AI8A 1RITA 1SDWA 4CDUB 1D2SA 4AK3A 1T6GC 2PTMA 3AYCA 3AYDA 3IPVB 3WDUA 5SV8A 4IEZA 1ASJ1 4MXWB 4YM3A 1LECA 2XBO3 5KC6A 1W0PA 2YC0A 2HEWF 4IV3C 2R0HA 5D8AC 1PO23 4DXZA 4L99A 2JICA 2R063 1OLRA 1SBFA 3VZLA 1HRI1 4B4RA 3IBMA 4FPGA 4YLZA 5EZWA 3CJIB 4W6YA 4UBHA 1DLLA 4U2AA 4Q8KA 5IT6A 3T1MA 2DTWA 3H3UA 2NMOA 5FO9B 3V0BA 1VBC3 2ZZJA 2DUPA 1HQNA 2WFF3 2WNUC 3ZFEB 1B35B 1SACA 4GMP0 5GLUA 1HRV3 1Z7S2 4HKOA 1S55A 4XE9A 2R6QA 1AF9A 4WVMB 2TNFA 4LBQD 4XIKA 5JPMB 1J58A 4I3PA 4QPYA 4CDXC 2QUOA 1PVC1 5DUWA 2I45A 2OUHA 2WL1A 1J59A 3SH3A 4LTAA 1H0BA 1W6OB 5BY5A 1ENQA 3AZYA 2EALA 2ZGRA 3VN4A 5A3MA 5J98B 1U5IA 5GZEA 2B39A 4EWEA 1M4WA 1UZYA 3USSA 1S0GA 2CY6A 1GZWA 5J36A 1G9AA 1FATA 1LHNA 4F3JA 4MUVA 4N90A 1OA4A 2GC3A 1URXA 1W6QA 3WUDA 4ATFA 1WMFA 2WS92 4GIQA 5ACA3 1WLDA 4YZ1A 4CDQC 4GB31 1H8TB 1U5ZA 3AMPA 2D5HA 3J8F2 1APNA 4QQHA 1EAH2 1VR3A 3VKLA 4IEPA 4Q0PA 4FPJA 1F9KA 4YFWA 4BLIA 1S1AA 4NPRA 3OPZA 1BVP1 5HXVA 5F6LB 1QJU2 1QXJA 2CTVA 1CAUB 5FRAA 4S2HA 5T5LA 1LU1A 4YW4A 3O12A 4NO4A 3D0SA 5T3NA 3CU7A 3VKNA 1PZ9A 2VXRA 1YCIA 4AG4A 1WCDJ 2PLV3 4K6BA 1WW4A 3ZVXA 1QQP3 2RJLA 3OJBA 1MS9A 1OFSA 1V70A 3VBUA 3ZXAC 2HWB1 1PGSA 1H9WA 2B5HA 4HKWA 3ZYRA 4Q4X3 4EWDA 3DUIA 4LHLA 4PDWA 2DCTA 1ZM1A 1M06G 3NO8A 1UKRA 3VBSA 3ZMOA 5JIUA 4XYXA 4FOWA 4BH9A 3OGJA 2D7FA 4Q4V2 1X7NA 1FV3A 3AM2A 3BOWA 3QH7A 4AGGA 2A3WA 2JENA 3FHIB 3JUUA 3URFA 1HXS1 3N7LA 3Q9OA 2PN5A 2EXJA 3AYEA 1NQJA 1YNAA 5T54A 3VDDB 4AEMA 3QH6A 3GF6A 3MDPA 3MIBA 5LRRA 4CDWB 4G4FA 5T52A 4P9LA 4M01A 3I8TA 1BBT1 3IWZA 4RD7A 4Y5Z0 2WNEA 2P37A 5FTTC 2G9GA 2R49A 2UU8A 4WVZA 1LEDA 3IT8A 2AR6A 3ASIA 2DURA 1LRHA 4HMZA 4IXLA 1ULFA 1RUD1 1TQ5A 3WG2A 3WW2A 1S0EA 3PJQA 4RHV1 1VB2A 4YM1A 3THTA 3HMYA 1SLBA 1V6OA 4TZDA 5JPNB 1SLLA 1CAVA 1U5XA 3B7MA 1A8DA 1TME1 1EYBA 1QXPA 5CVRA 4I09A 2BFUS 4NVPA 3EHKA 2MHFA 3SCHA 1RUI2 2BTVC 2PHUA 4AE2A 4B7KA 1RUJ3 3KCCA 1GYKA 1C8M1 2PHLA 5HCBA 2ZJCA 1QJY2 3J4UH 2ZGKA 2CAUA 4BQ1A 2XLFA 3PNAA 3H9AA 1OD5A 4FVVA 5AC91 2XHKA 2HWC1 4COVA 4FOVA 4UBGA 4MGYE 2DVBA 1BEV2 2ZKLA 3ILNA 1LESA 4CTEA 5SV5A 3MIEA 1RTVA 4GB32 5C4WB 3E5QA 3U11A 3QCWA 4TYSA 4LBNA 1Z78A 1RUH2 4IL7A 1RUF2 1AR71 5L7OB 1EV13 4L8QA 2ES3A 4D7TA 1K5MA 1YRZA 1VJ2A 5FLJA 1DGRN 4IEVA 5BNNB 4Z8BA 2ZGSA 1MZFA 4CRQA 3B9IA 5BNOC 1Q8OA 2VG9A 4YNIA 4XFCA 4ORFA 3LB9A 2ZX4A 4AEKA 1DQ5A 4Y4YA 4AEDC 4U36A 4X6QB 1VBD2 1NCQA 4AHYA 2B7YA 3AP7A 1QH6A 1NA1B 1KJRA 4NHMA 4MVTA 4B4QA 1YO8A 3T1LA 2Z79A 4WVWA 1Q43A 1RMU3 2PAEA 2R043 5H9PA 5BNPC 2VMHA 3J26N 2A73B 1CJPA 1CD3G 2O1QA 3ZDSA 1UX6A 2RS53 3ZYGA 1ZVFA 2H0VA 5CADA 5JVVA 3MICA 4XF9A 5DDJ1 5JOXA 3ZFFA 1TMF2 1HXS2 1UIKA 4A3XA 4LBQA 4NOTA 1V6MA 1FMD3 1NCRC 3VHOA 4RS5A 3VBHC 3VHRA 4I0WB 1LOEA 2HWE2 1ZZ7A 1BBT2 1UU5A 2QJVA 1B09A 4DRRA 5H9RA 3V56A 5JMCA 2IXJA 3O0WA 3E6BA 1QWRA 1W39A 4COWA 1YFUA 4AI1A 2Q1MA 4N43A 1J3RA 1JW6A 2MPFA 1L3JA 1H2NA 1RUG2 1MQTB 3GZUC 2JG9C 1O4YA 2AGSA 1BXHA 3AXDA 2ZHNA 3H50A 3D0JA 1C8M2 1C3HA 4GWNA 3C2UA 4ZU5A 1O7FA 4BYYA 3R05A 4DINB 1EPWA 1R1ZA 2HWC2 3N36A 4FCAA 1LB2A 4B7EA 1QJX1 3VBUC 1CX4A 4M00A 4UW5A 4UXAA 5EV7A 1LHWA 2ARXA 1D4M1 2X5IA 1C4RA 4R9DA 1X8EA 5T5OA 2VOWA 1CJDA 4P9WA 4DMIA 1AR72 1PMIA 4NWWA 4LLFA 4NHKA 2OVUA 3B3QE 4B29A 2BYVE 2ILMA 4R8HA 3KMHA 2XPJA 3OY8B 1WLWA 1ZRCA 4P9IA 3WW1A 3PVNA 2VY0A 4GH4B 1FMD1 3MIFA 4Y1UA 4YW5A 3UKVA 4XOGA 4M3CA 3VBOC 5I0RA 3WV6A 3MZHA 1X36A 2D6KA 4J6GA 4LBJA 2C9AA 1OPMA 3KT7A 3UJQA 2BNOA 4LO8A 3ST7A 1XXNA 1FNZA 4R52A 1GZCA 5F6KA 4OUSA 1XNCA 2UWCA