1WW6A

Agrocybe cylindracea galectin complexed with lactose
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
160
structure length
160
Chain Sequence
TTSAVNIYNISAGASVDLAAPVTTGDIVTFFSSALNLSAGAGSPNNTALNLLSENGAYLLHIAFRLQENVIVFNSRQPNAPWLVEQRVSNVANQFIGSGGKAMVTVFDHGDKYQVVINEKTVIQYTKQISGTTSSLSYNSTEGTSIFSTVVEAVTYTGLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords galectin
publication title Structural Basis of a Fungal Galectin from Agrocybe cylindracea for Recognizing Sialoconjugate
pubmed doi rcsb
total genus 38
structure length 160
sequence length 160
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ww6A00
2E7TA 2R1DA 3DUIA 4C1XA 1SBEA 2CNAA 1G7YA 2VH9A 4R9AA 5JLVA 1DYPA 3V0BB 1LODA 3MW4A 1GKBA 3FUOA 1AX2A 1ULCA 1Q56A 2AH2A 1LEMA 4XTMA 1LECA 1I3HA 2P3KA 3SH4A 3N7MA 3D4KA 4YM1A 1W6PB 2ZHKA 5AVAA 3D6EA 3AFKA 4Y24A 1FATA 1SBFA 1LOCA 3O0XA 3WDVA 5GLTA 2NN8A 4XJAA 3HMYA 1DIWA 2W68A 3ILNA 2ARBA 5T50A 3WUDA 1D0HA 2NP0A 3ZXEA 1CPNA 2CWSA 2P2KA 1MZ6A 5T5JA 4YG6A 5CB7A 2CWMA 3M3EA 3RRDA 1DQ0A 5CBLA 1W0PA 4AGRA 1KITA 2H0BA 1QMJA 1WW6A 2AREA 5GLUA 5CAZA 3FLPA 1MS4A 3UK9A 1V6JA 4FPLA 4XMIA 5KXDA 3ASIA 2ZABA 1ULFA 2ZHMA 3BOPA 4Q1RA 4YZ3A 5IK7A 3MW3A 3SH3A 2A3YA 4XE9A 1ENSA 1G9BA 1GV9A 2R1BA 3AZZA 4ZXKA 3WVJA 1MACA 1SACA 4LBQD 1LHVA 2SBAA 1MS0A 1HDKA 3WOGA 1SCRA 2C5DA 1DQ6A 3M3QA 4FQZA 3W58A 3WZ1A 1DBNA 3RMXA 5GZEA 4K21A 1IS4A 2WKKA 3C2UA 4NO4A 2P3JA 3RS6A 3R05A 2CYFA 2ZGLA 5KXBA 5GZDA 2YZ4A 1V6MA 1LESA 1VLNA 4P9WA 2PHRA 1UAIA 3AXEA 1S0FA 1G86A 5E88A 3OY8A 3OJBA 4Q8KA 1A78A 4CTEA 1WW7A 1DYKA 5H9RA 1AJKA 3OPZA 1S0GA 4Y1ZA 3ZPYA 1W6QA 1QDOA 5IK4A 1I1EA 3ILRA 3NV1A 2D3PA 2GDFA 2V73A 2NZ9A 2ZAAA 2OW4A 5HCBA 4AWDA 2CTVA 1AZDA 1MR5A 2AUYA 1ENQA 3LSDA 3AZXA 3GALA 2ZBJA 1BQPA 1G8WA 1LCLA 1PZ8A 4TYSA 3FLRA 2A7AA 3OY8B 3T2TA 3AP7A 4LBNA 4YW1A 3SITA 3OGGA 1QU0A 2D3RA 1W6QB 4ISQA 4PBOA 3AP4A 2ZA9A 3LCPA 3R4UA 2Q5TA 2JKBA 4ISRA 2VW2A 1GSLA 4M3CE 5JOZA 4KBBA 3M2MA 2FMDA 3MEPA 1JXNA 1CJPA 1DQ4A 2YY1A 4XJ8A 1ULDA 4Y1YA 5GALA 1GNZA 1EPWA 3R4SA 3QCWA 1MZ5A 4GWNA 4XILA 4FPGA 2D6LX 2W08A 1V6OA 3N36A 4XDQA 4FPOB 4M3CA 4YZ4A 5H9PA 4GALA 1V00A 1C57A 4ZKTB 2E7QA 1FV2A 1WCSA 2P37A 3SH5A 3N35A 2A71A 1AJOA 1V6IA 1CR7A 3VV1A 2ZHNA 1LOEA 2WT1A 2UWAA 3IMNA 4LBMA 1KDKA 1W0OA 3JUUA 4FOYA 3ZSKA 3ZYPA 1S0DA 1Q8QA 1H9WA 4XIOA 4C1WA 4BOWA 2ZGMA 5BYNA 5EXOA 5IUQA 2B7YA 5KXEA 1FYUA 4JC1A 1S0BA 1GANA 4HL0A 3B69A 3BIWE 4M3CB 3UL2A 2WJSA 1ZA4A 2R49A 1WBFA 5FRAA 3AZVA 2C9AA 4ASMB 2EXKA 3ZVXA 1GLHA 1SCSA 2W52A 3NWKA 4WV8A 4YW3A 2CL2A 2VU9A 1N3PA 1QKQA 4ATFA 1CONA 3O12A 4P9YA 4YFZA 4XXAA 4TZDA 1JUIA 1YRZA 1OFSA 5EYYA 1LOFC 2WLQA 1MVEA 1LENA 3INAA 3O0WA 4P14A 1AXKA 4YGCA 4AVTA 4FPFA 1QOTA 4CZSA 2PHUA 2UWCA 3ZXFA 2D6NA 5IK5A 3W59A 1S1AA 3AP9A 1LOBA 1UX6A 3PVEA 1A3KA 2PHWA 4LBLA 1SLLA 1FNYA 4XJ9A 4MYEA 5HCAA 2XG3A 1W6NA 4GKYA 1IS6A 1GZ9A 2NMOA 1LHOA 3FFZA 4XMAA 4DS0A 1IKPA 2A5ZA 1RINA 3POWA 4YW5A 4SLIA 3GNEA 3ZXKA 1AX1A 1RIRA 5DG2A 1C1FA 5T5LA 3V64A 1ULGA 4NOTA 2ZGPA 3AYCA 5JOXA 1UPSA 3FUQA 3T1MA 3VKLA 1LULA 1ENRA 4YGDA 5DG1A 2P34A 2DUQA 4XBQA 3D5OA 5T5OA 1D2SA 3WV6A 4UW3A 2YV8A 3JU9A 1W6NB 2UU8A 1UN1A 1WUVA 1WD3A 4YZ2A 1GZWA 3AYAA 2DUOA 1OQ1A 2ZMKA 2EF6A 3U4XA 1AF9A 2JDZA 4Y1VA 4Q2FA 1LEDA 3Q9OA 1GNHA 5T52A 1JOJA 1O4ZA 1V6LA 2ZGOA 2UWBA 1WLDA 3A0KA 1LU1A 2LALA 4GWMA 3VKNA 3ZSLA 4FOWA 5GZGA 2D44A 2D6KA 1GICA 5DXDA 1CQ9A 2DTYA 2WT0A 3MPPG 1LOGA 1W6OA 3IKWA 1N3QA 2UURA 2ZGSA 3OBTA 3POSA 1IS5A 3BODA 3WDUA 1VALA 1FV3A 3NV3A 1VAMA 2A6VA 1SFYA 4YM0A 3ZXJA 1CPMA 1VIWB 1HQLA 1GZWB 3I8TA 4XHBA 2ENRA 2ES3A 1SLBA 2TEPA 2ZGKA 3HN1A 5T5PA 2GMPA 1BYHA 2GMMA 4RL7A 2V5YA 4UW6A 5JDBA 3ZYRA 1QF3A 1AXYA 2FHRA 3OBRA 4FQ4A 1WW4A 3UJQA 3USUA 1Q8SA 2ZGUA 1ZM1A 3WG2A 1W6OB 4AVVA 1N1YA 2A6ZA 1LOFA 3AK0A 4XJUA 2DUPA 4JRAA 3ILFA 1S0EA 3RG0A 1HKDA 1J1TA 3PMEA 1C1LA 4BQ1A 2PELA 4Y22A 5EYXA 2A75A 4DPNA 1G9DA 4BLIA 2E6VA 2VUAA 4YW4A 4XZPA 2CY6A 2ZKNA 2GMEA 3N3HA 1QGLA 4W65A 1LGBA 3AYEA 5LK5A 4AVSA 4FPJA 2OVUA 4YM3A 1Q8OA 3VKMA 2D6PA 1KDMA 3IPVA 5GLZA 3USUB 1MS1A 3WLUA 2NM1A 3M1HA 1IKQA 2GNDA 2A70A 3AJYA 1WD4A 1F31A 4IQPA 1BJQA 4FPHA 1Q8PA 3PVNA 5H9QA 5DUVA 1DQ5A 3SNMA 3L2YA 3WHTA 2VY0A 5H9SA 4Y22B 1DFQA 3WG1A 5CA6A 4YZ5A 1G9FA 1GBGA 5IK8A 3AP6A 3CNAA 1V6KA 3B3QE 2RHPA 1URXA 5GM0A 3AX4A 3NV4A 2ZHLA 4K1ZA 4R9CA 1W6MA 1Z0HA 5DZFA 3A0NA 2A3WA 3IPVB 1Y7BA 1DHKB 2GNBA 3PVOA 2R0FA 1QDCA 1YO8A 3IN9A 2WSVA 3ZSJA 1F9KA 4Q1PA 1FNZA 5JOWA 1LU2A 4FOVA 2D3SA 3OYWA 1N1TA 1DGLA 2ZZJA 1LHUA 1LHWA 2DVBA 5F5QA 4FPKA 3AZYA 1H30A 3N7LA 4XBLA 4FVVA 4L8QA 5T55A 2AGSA 4D69A 2DVAA 1KJRA 3M3CA 3RMYA 4DFSA 1JYIA 4RA0A 3KM5A 2EXJA 3WCSA 3B01A 4YW2A 1W6MB 2OUJA 4R9DA 2A6WA 2DTWA 3AXDA 2EALA 1SLAA 1CN1A 1V6NA 1C4RA 1LGCA 2DVGA 2EIGA 1AVBA 2BQPA 3O5SA 1QNWA 2OUHA 2JECA 2JE9A 3RQ0A 1X50A 1JHNA 1O4YA 3OYWB 5T54A 4XJZA 3SISA 4DRVA 1B09A 1DLLA 2NMNA 3DGTA 4PBPA 4UW4A 1R1ZA 3ZXLA 1ONAA 1DZQA 4K20A 4WZFA 1NXD1 2EXIA 3M3OA 1MS3A 4YLZA 4F83A 4FP3A 1TEIA 2ZMNA 3B00A 2GNMA 4LBJA 2DYCA 4XTPA 2HYKA 1APNA 3UJOA 3WG3A 1U0AA 2GN7A 4Z8BA 1F5FA 1MS9A 4XHXA 2ARXA 2GN3A 4DRRA 1JYCA 3POYA 3RSJA 1LJ7A 1AXZA 1WBLA 2AENA 4ATEA 2KM2A 2D7FA 4BPZA 1LGNA 2D6MA 2WNEA 2ZACA 1GYKA 4H55A 3AYDA 1PZ7A 4YM2A 1SLTA 3ENRA 3QLQA 2YMZA 2E53A 3VUOA 4U2AA 5GZFA 3T1LA 3BTAA 1QOSA 4FPCA 1FX5A 5GLWA 1IS3A 3ZSMA 4AGVA 4DQAA 4M01A 2P3IA 3TB0A 1WLWA 3WG4A 3AJZA 1SBDA 3AZWA 2PHXA 2WT2A 4BLJA 1IOAA 4BMEA 2R16A 1A8DA 1MS5A 1S0IA 1PZ9A 1UKGA 3TAYA 3WCRA 2W39A 1OKQA 4GA9A 4XXPA 3B9CA 2A6XA 1AX0A 1N1SA 2VXRA 2YROA 4GXLA 4LBQA 4XIKA 2GALA 4YG3A 2D6OX 1ULEA 4Q27A 2AYHA 2I2SA 5F9TA 4BMBA 2ZGTA 3WDWA 4PQ9A 2JE7A 4M00A 4XJWA 1UL9A 2G4IA 3A4UA 2ZGRA 1LHNA 2PHFA 1CIWA 5KXCA 3V65A 1QNYA 4XOGA 4YFWA 1JBCA 1YYNA 3APBA 4JCKA 4PF5A 5IT6A 1MVQA 4Y26A 1SLIA 2DURA 4YGEA 1HQWA 4LBKA 4ITCA 1BZWA 4XBNA 5DUXA 5EWSA 1G9CA 2A3XA 3HR9A 4FP2A 4Q26A 1BXHA 2DVFA 3WHUA 4LBQB 1H9PA 2VW0A 4K1YA 5SV8A 1MS8A 1KQRA 3VKFC 4Q8LA 1YXWA 2DU1A 4Y20A 4Y1XA 5HCFA 1NLSA 3H0OA 4BM8A 1UZYA 3IM0A 1YI7A 2PHTA 2WSUA 3O0VA 4AYUA 5GJ6A 1DQ2A 3WUCA 2VW1A 1VAVA 4P9XA 4WVWA 1Z78A 3ATGA 2JJ6A 4OZXA 1UZZA 4FPEA 3LSEA 5E8AA 2ZGQA 5FREA 3WDYA 3NV2A 2AR6A 5JVVA 1XQNA 4YGBA 5DZGA 3SLIA 2ZMLA 1LOAA 3PJQA 3VKOA 1KRIA 4U36A 4PCRA 1JW6A 2D43A 2E51A 4FPYA 4Y20B 4LBOA 3MW2A 4FOQA 2R0HA 5GZCA 5JMCA 4WVVA 1DQ1A 3KQRA 1BKZA 2WQZC 4GKXA 2LTNA 4I30A 1GZCA 2NYYA 1UMZA 1SLCA 2Z42A 1WLCA 5L73A 3WNXA 1KJLA 2EXHA 4CRQA 3V0AA 3N7JA 2DVDA 5JOYA 2SLIA 1FAYA 2XB6C 1QOOA 1RITA 1S0CA 3FBYA 3WDXA 3V0BA 5DUUA 1YIFA 1G9AA 4Y1UA 1HLCA 2DWRA 2ZGNA 3FLTA 4YZ1A 4XYXA 5E89A 4AGGA 2A6YA 1N3OA 1Q8VA 5CNAA 2YXSA 2ERFA 3AP5A 4R9BA 1W6PA 1WW5A 2DU0A 5DUWA 3I4IA 1N1VA 2DV9A 3N7KA 4YG0A 1CESA 4HANA 3V0AB 2JD4A 2EAKA 4M3CF 2GNTA 3WDTA 1JN2P 5GLVA 5DZEA 1N47A 1S0JA 1LTEA 1CVNA 4UW5A
chains in the Genus database with same CATH superfamily
3VBSB 1SBEA 2IXLA 1G7YA 3DECA 4Q4V1 1RHI1 4CU6A 2JENA 3T30A 1AX2A 4CP2A 3FC0A 5JZGA 2LROA 2AH2A 2PQQA 3PJYA 1NCQB 1EYBA 4IV1C 4YPJA 4D7TA 1UYZA 1I3HA 4K40A 1C28A 2G9ZA 1YFWA 3N7MA 1C8NA 4NRPA 4MGSA 5FYVA 3ZXDA 3D4KA 1CWPA 4KL1A 4MZUA 1TVGA 1NX9A 1E5SA 1ZA7A 3K75B 4LK7A 1WLTA 4Y24A 3FZ3A 1SBFA 1LOCA 3ZO0B 1RJ8A 3IDCB 4IE0A 1QH7A 5GLTA 3ZFGA 3I3QA 4A44A 1REFA 4XJAA 3U11A 1DIWA 1I9RA 1RUC2 2ARBA 3O1UA 1PGSA 2ID4A 2NP0A 5KHIA 1CPNA 1BEV1 2P2KA 2NLRA 4CDWB 3NL1A 3RRDA 2CWMA 2XONA 5J3UA 4XZUG 4LHSA 1KITA 4LK6A 2KR2A 2AC1A 2AREA 3POEA 4JDNA 2AEYA 3OGRA 2IXHA 5L9VA 4NIGA 4K8RB 2XKOA 3AMPA 1C3HA 1SMVA 1DGRA 1ULFA 5A7NA 3CZJA 4Q1RA 4YZ3A 4RSUA 1ND3A 3LOBA 2XWJB 4XE9A 4W6YA 2XJPA 3AZZA 5FZCA 5FP7A 1MACA 3M70A 3H3LA 4WM8B 1JYTA 5C9AB 4I01A 2HEVF 4AG4A 1SFPA 1EY2A 4FQZA 1IPJA 3GF6A 3M3QA 3W58A 3WZ1A 3ZFEB 1VP6A 5F6KA 3RMXA 4RD7A 5GZEA 4K21A 1IS4A 4AFAA 3A23A 5FK7A 2ZGLA 1AR72 2AZ5A 3HT2A 4COUA 2Y26A 3DKWA 3DF0A 2YZ4A 5I8YA 2RMU1 4PI2A 2PHRA 3T08A 2YBKA 3NNFA 4N7IA 2HBTA 1OVPA 1O3QA 1OLME 2BJSA 2X5IA 3NJVA 5IK4A 2PYTA 1I1EA 2CDOA 3B02A 4FSJA 1JZ8A 2WLPA 3AKQA 3NV1A 3WNLA 3FHAA 2GDFA 2V73A 1PO22 2WO2A 5CKMA 3ZFGC 1IHMA 1UX7A 2PQSA 3KSCA 3NMBA 1JZ5A 4C0BA 1HB3A 1JUHA 2WO3A 4XF0A 3I3DA 4C90A 3NO8A 3C3VA 4ZXEA 1ZZ6A 1PZ8A 2QQKA 4XCBA 3OY8B 2WFPA 2VD7A 4P00B 4LBNA 2BNNA 1NQJA 2FDHA 3SITA 4ISQA 4AI8A 1W6QB 2HWD2 3OB8A 4JHZA 1J84A 3WW2A 2YFZA 4BXFA 1ND3C 4K8FA 3PLQA 2E7AA 5FZ4A 1C5HA 2VW2A 4UFJA 3S7IA 2R043 1H6XA 1JXNA 4NHLA 3AKTA 4MG2A 2VMHA 1GP6A 4CCCA 4Y1YA 2QDRA 5FTTC 1EPWA 5KBFA 5K0UA 3VDBA 3QCWA 1NA1B 3QH7A 4FPGA 4SBVA 4HSLA 2WBKA 5LEJA 3I54A 1XE8A 4QPYA 1WCSA 4R52A 4UOJA 3ZSEA 3KHCA 1K5JA 4QQOA 2R063 1J1LA 2A71A 4EJRA 4HBNA 2OQ7A 3H8UA 4NMIA 4NIIA 5ISLA 4N90A 2IXKA 1H2NA 2UWAA 4LBMA 3JB8A 3JUUA 3ZYPA 1RUE2 1ZNPA 1NZIA 3KWVA 5DMYA 4NE9A 3VN4A 1Q8QA 2X5IC 2ZGMA 2FDIA 5EXOA 2E32A 1FYUA 1S55A 2XJUA 1LRHA 3WF2A 3B5LB 2FD8A 1S0BA 3KT1A 3B69A 3U07A 5EPAA 4X6QB 1C8M1 3ZYHA 1O6UA 1O4TA 2WJSA 5CIRA 3ZFFA 3U0ZA 1PVC3 1OH3A 3DXUA 5FRAA 2VVEA 3BU0A 1ZRFA 2DCJA 4GMP1 1GLHA 3LAGA 5A32B 4BQYA 4CSWA 4YW3A 5CISA 3I2KA 3EBRA 1YFXA 5FLHA 1CONA 3O12A 4P9YA 4LIUA 4YFZA 4HG6B 2BGPA 1CAXB 1JUIA 1OFSA 4Z2AA 1LOFC 1UQXA 2FDKA 1MVEA 3KCYA 3DEMA 4MV2A 1H6YA 4P14A 2VMCA 5LY1A 5IW0A 4K3UA 3NKGA 4RHV3 4KQ7A 2VQAA 3TEXA 4PHZA 4QPIA 4NWWA 4CZSA 2PHUA 2UWCA 2D6NA 5IK5A 4CCJA 2VL4A 3O14A 3WR0A 2PAMA 3ZYGA 2F4PA 2PHWA 5JIAA 3VGIA 1FNYA 4XJ9A 5K0UC 5HCAA 1GQHA 5DDJ3 3IAPA 2J1AA 1IPKA 4GKYA 4X6RB 3WW3A 4AW7A 1ZRRA 5L36A 3MUZ1 2RVAA 3HBKA 5A7PA 3CJIA 4YW5A 4SLIA 2B46X 1UU4A 5TSWA 1AX1A 1C1FA 1W3XA 5T5LA 4COYA 1VRH3 1W8ZA 5JOXA 2DBIA 3T1MA 4XFCA 3VKLA 2IVIB 1W8HA 2RV9A 1QQP2 2DUQA 3KCCA 3D5OA 3WSOA 1D2SA 3AMMA 1HXS2 4A7YA 5LCWL 1W6NB 1OOPB 1UZ0A 1YNAA 3DPRC 3ZFFC 2RS52 4A4AA 4YZ2A 1RMU2 3JZVA 2ZMKA 1OQ1A 1T6GC 3GGLA 4XAEA 2JDZA 1HB2A 4Y1VA 3TNQA 4L11A 4N53C 4KWUA 1OPMA 1GNHA 5K7PA 2WZEA 3A0KA 1V6LA 4GWMA 5A6XA 4PIYA 4GMP0 1EV13 1XJAA 2BNOA 3LFIA 5JAXA 2X53S 3S5AA 1LOGA 1OVSA 1W6OA 4CUBA 3A21A 3ALQA 3POSA 2D40A 3WDUA 3VBHA 4IDZA 4QX5A 1XNAA 2W2IA 2VMFA 5ABJA 1TMF1 1UY2A 1GZWB 2ENRA 1MQTC 2HWC2 3UKVA 2ZX2A 3CBNA 3GZEA 4IV3B 5FK8A 2FQPA 2GMMA 2XJRA 4AVBA 1QF3A 4FQ4A 1FPN1 2R072 5FPUA 2VZUA 3J7LA 4AFCA 1OURA 1CD3G 1I5ZA 2ZGUA 1TME1 4CEWA 3JBG2 1I6XA 1YQCA 4IEWA 2DUPA 4FFGA 4JRAA 4CCDA 3LF7A 5A3LA 5K4LA 4Y22A 1VBE3 5EYXA 4UF0B 1UF2C 1X9PA 4C8DA 5A3MA 4XZPA 2ZKNA 4NPMA 2GMEA 4P9IA 3ROUA 5C5UA 1R1A3 2K2SA 1W90A 4P9GA 1W8OA 4BK5A 4YM3A 1L7QA 2VECA 3VBUA 4R4XA 3USUB 1MS1A 2PFWA 3WLUA 4LHLA 3MO4A 1PNFA 2YPJA 2QQUA 4UFKA 5LBBA 3ST7A 5FYCA 2XVKA 4HOOA 2VNOA 2KD7A 2G19A 1KS4A 3OSDA 1BJQA 1Q8PA 3VHRA 5DUVA 1QXRA 4D8MA 2Y33A 4UBGA 3SNMA 1O7FA 3I2JA 4KG0A 5EJ3A 3RWNA 5FCCA 4HZFA 3WHTA 1LAJA 4Y5SA 3WG1A 1WWYA 5EP9A 5FZBA 4ZU7A 5CA6A 1GBGA 3D0SA 1DP0A 4NAOA 4EZHA 3CNAA 4ES9A 1B35C 1PGW2 3WNKA 1URXA 3B94A 5C4WB 3H3ZA 3E5QA 4R9CA 5DAQA 5ABJC 4AVAA 1EAH3 2XBO2 2JDMA 1JOBA 5HCHA 3ZSJA 3MLJA 5FZ0A 5JOWA 5BY5A 4TN7A 3VD4A 2Y64A 2D3SA 2RM22 4DEVA 2WZR2 3OYWA 4OZOA 4HFSA 1RUH3 1PGL1 5A7WB 1F15A 1DGLA 2D5FA 3RDIA 4QGMA 5FO8B 1RUI3 1RUD2 3WNNA 2A1XA 4D0QA 1H1AA 1QJU2 3DL3A 4L8QA 5IVCA 4H14A 2PA7A 1TNFA 1VBB3 2VMDA 2RS32 1XNTA 4JQTA 1S2EA 4YW2A 1YIPA 2R30A 3C7GA 3VBFA 3AXDA 2DCKA 2JB8A 3IDBB 4CXXA 5JPMB 2VCAA 3O5SA 1QNWA 2OUHA 4GD4A 5GKAC 2JE9A 4IXLA 4R8HA 4IW3A 2DFBA 5T54A 4CDUB 4DRVA 4URTA 3VBUC 2WNVB 3MBWA 4KWJA 1NOVA 1R1ZA 2JIJA 2W1WA 4K20A 5HV4A 1NY72 2WWSA 4AQ6A 2EXIA 1UMIA 1C5IA 5A7SA 1FOD3 5F32A 3THPA 3WNMA 5BNNA 4CCNA 4FP3A 2B4KA 3B00A 4GB33 5FZGA 4E2SA 3MGUA 4JDOA 4YVWA 3UJOA 4N9HA 2GN7A 4QD2A 4QPGB 4Z8BA 3HNMA 3ORJA 1CAVA 1RUJ3 5FR3A 1UOGA 3ACFA 1H2MA 2ARXA 4XHXA 1NCRB 1AXZA 4Q29A 3SMHA 5EJZB 4QHOA 5CFCC 2WO7A 4KU8A 2QCSB 4QB1A 3POIA 1UW8A 3WP6A 5F1RA 1W9YA 4W4ZA 4HKOA 3NAPB 2OPWA 2E53A 3VUOA 2P5BA 1TNRA 4JRLA 3BTAA 1OA4A 1QOSA 2R041 5JR7B 4EQVA 4Q0VA 1CX1A 5LWBA 1AHSA 1GR3A 1HX6A 1PK6C 4M01A 2P3IA 3QACA 4MSVA 2WAAA 1VBC3 4Q4Y3 2PHXA 3KQ4B 3BTXA 2R16A 4A42A 4AHXA 1VBA2 3DV8A 1PZ9A 3ON7A 3HOBA 3U75A 2R061 1UKGA 1XYPA 4JDMA 5BNQA 3JQWA 3U14A 4E8CA 3VBFC 1Y9MA 4CDQB 3OTFA 1NYWA 3IIAA 2GH8A 2VXRA 1N1SA 4D6QA 1AYM2 2O1QA 2BVBA 1OA3A 5G05L 4Q0PA 1ULEA 3CO2A 4LLOA 3DYOA 1OT5A 5LW9A 2ZGTA 4Z82A 5FY7A 5FZFA 5FLJA 4M00A 1VMJA 3A4UA 4B8EA 3RZLA 1OH4A 2PHFA 3K2OA 1AYN3 3EO6A 4MH0E 3APBA 1PVC1 1KFXL 4QGLA 1KGYA 2RR12 1HQWA 4ITCA 1G9CA 1GWMA 3VZJA 1UO9A 4Q26A 1BXHA 4TSVA 3E6DA 4LBQB 3I59B 4RR3A 4TWTA 4AI3A 3O1OA 2VW0A 2UY8A 4IEVA 4K1YA 2JXAA 3WQ1A 1EPZA 3HBZA 5F7UA 1VE0A 4Q8LA 3LEGA 1L7RA 1LNSA 2VOXA 4Y20A 4Y1XA 5HCFA 4RHV1 2GP5A 2P4EA 1NLSA 4BM8A 4E9KA 3IM0A 3H8RA 1YI7A 2RS13 4AEJA 3ZFEC 3J7NA 3ZN4A 3BIEA 1DQ2A 4XQDA 2VW1A 1YJKA 5A3TA 3CQOA 1D4VB 1Z78A 1XU1A 2HWB3 4LUMA 5EHDA 1VBD2 5DDJ1 4OZXA 3LEMA 4FPEA 3PMSA 2GP3A 4C0HA 2ZGQA 5FREA 1OI6A 3FN9A 1SPPB 3I3MA 1WCUA 1ODNA 3KVAA 5F5CA 2ZMLA 2VO5A 5D2AA 4QT6A 4Z07A 3E97A 1JS9A 1GWLA 4XVHA 1KRIA 1MEC2 1CAUA 4LBOA 2C26A 3IMMA 2BU9A 3BCWA 4RQPA 4B7KA 4WVMB 4WVVA 4NHMA 1DQ1A 2XJVA 1BKZA 4JAAA 2WZ8A 2BYVE 1GZCA 2NYYA 1RUG2 4I30A 4NUBA 3ZPOA 4BHPA 2J1RA 4GWIA 1BBT3 4LQRA 5FZLA 5FPBA 2W0XA 1NUKA 1WMXA 1W9SA 2EIBA 3RYPA 3ZMNA 3WF0A 3RJ2X 4EN8B 1CIYA 4META 5D21A 4AL9A 3FBYA 3TYJA 1MZFA 2EIEA 2IFRA 1W9TA 3WDXA 5CEHA 3V0BA 4IERA 1D4M2 4Y1UA 1X8EA 1YJLA 5J7MA 2QKDA 3KMHA 3PIJA 1NKGA 3K46A 4YZ1A 2QQMA 3G6JB 4KG8A 1ACCA 1OBNA 1SDDB 1WW5A 3UKTA 4IGOA 5A3WA 4NHYA 4YG0A 3V0AB 4LO4B 3UGFA 2EAKA 4M3CF 2GNTA 2V09A 1HQNA 4CE8A 2JG9A 1NA1C 1CVNA 4XFFA 4CEYC 2R1DA 2ZPXA 4C1XA 5I0SA 3VHPA 1LODA 1NG0A 2BGCA 3MW4A 2IC1A 2WL1A 2UYAA 4H2AA 4MGIE 5IFTA 1D4M1 1ULCA 2RJLA 1ZBA2 3WY6A 4XTMA 2FCVA 2UYBA 3OGJA 4LO5B 4HK8A 3M7AA 4KMQA 2JKXA 4W8JA 4NIDA 3D6EA 2W3JA 4RQPC 1GUIA 1LR5A 1FATA 2C0ZA 2NN8A 1W8FA 4AQ2A 1VMHA 2RDRA 1YWKA 3HMYA 3ILNA 1VBE1 4TLFA 2BP6A 1RUF3 3ZXEA 2CWSA 2BNMA 5K9YA 2B9UA 5CBLA 5T5JA 5CZKA 1W0PA 5EIYB 4FBFA 1DDLA 3NQHA 1HRV3 3FLPA 1MS4A 2RDSA 3CF6E 1V6JA 3T2OA 1FT9A 1KEXA 5I0DA 5ANQA 4XW3A 2ZHMA 1HRI2 3BOPA 1DCSA 4FI9A 4QXKA 5J36A 5IK7A 3QOPA 4RGKA 1RUH2 3CZUA 4QKNA 3VZLA 3RZKA 2VNVA 1GV9A 2R1BA 3D3AA 3WVJA 1SACA 3LA2A 3M4FA 5FP9A 5FP8A 3ZXGA 4CDXB 3H1MA 1MS0A 4FFIA 4FTEA 1AR62 1DQ6A 3PTRB 5J1XA 1DBNA 4LORA 1AR82 1RVF2 3CJIB 4ARYA 4O7XA 3RVHA 4Y3OA 3KT4A 4L9BA 2CYFA 1EAH1 4V2WA 4AQTA 5GZDA 3VZKA 4HETA 4P9WA 5C3QA 3AXEA 2QBXA 2VBDA 3MLLA 2D97A 1RUH1 3Q8CA 1A78A 1H4GA 3RZZA 4CTEA 1DYKA 2BUKA 1RUI1 3IT8A 1AJKA 2BDRA 3LDRA 1S4CA 2B9VA 2LRPA 2PN5A 2X10A 4DUVA 1BHGA 1YQ6A 3PUIA 2D5HA 1QIQA 1VBB1 2D3PA 2ZAAA 3MIDA 4Q4X3 4QGNA 4Q0SA 2Q1FA 1QJX3 4RYDA 1PO12 4AWDA 4EN0A 2JG8B 1ENQA 2BGOA 5CG8A 4DXZA 1OOPC 3GALA 2MPFA 1LCLA 2OIIA 5FKBA 4QQLA 4QKBA 2BWAA 1V9U3 1W9WA 3ABZA 3H42B 4PBOA 3ELNA 3VBHB 4IE7A 4IV1A 2WQ4A 3J7HA 1FOD1 3POGA 4UI9L 1W2NA 2VCCA 2JKBA 3J8F3 3EXUA 4GB31 4ISRA 5D1IA 1R093 4M3CE 2E31A 2WIIB 4KBBA 3RYKA 3MIEA 1NXMA 2WA3A 4B4PA 1ZZ8A 1RUJ1 5C3RA 2HYXA 3OGVA 1FMD3 3VZMA 1ZZBA 1NLQA 1CAWA 3AC0A 3IIIA 1H8TB 4XDQA 4M3CA 4XUTA 5H9PA 3ZKUA 4GALA 1UOFA 2GC2A 4CP9B 1C57A 5D8AB 4ZKTB 4QXCA 2E7QA 2J1TA 2Y6JA 3W21A 1FV2A 2P37A 5JXHA 1PVXA 2HWF3 3N35A 4YNIA 1GP4A 2X05A 1QWRA 1HV1A 1CR7A 4AEDB 1XNDA 4BQWA 1LOEA 1RHI2 2BW8A 5FZMA 3CDZB 1UU5A 5CG9A 1Y43B 3ZIWA 1KS5A 4L99A 2WT1A 3IMNA 4OHWA 4I0AA 3ZSKA 4E4ZA 1VBC1 1S0DA 4Q4Y1 1H9WA 4C1WA 1WKYA 4M0HA 4E2GA 2FDJA 5BYNA 5LEKA 5IUQA 2B7YA 1PX4A 1UYPA 3E1F1 5I0TA 1LB2A 1W99A 4F7ZA 3P1IA 4MADA 5JXGA 5C8CA 3USSA 2R49A 3AZVA 2C9AA 4ASMB 1W2AX 4L2NA 5IVJA 2VZSA 3C7EA 2HEWF 1SCSA 2FCTA 4WV8A 4O65A 3RYRA 4ATFA 1N3PA 2X29A 1QEXA 5FO9B 2X09A 3MI8A 4FT8A 1OKOA 4TZDA 2W1SA 3URFA 3N9MA 3U78A 5EYYA 1IGOA 2WS93 1JMUB 3EQEA 1W8UA 5FYMA 5E16A 2ZAHA 1AXKA 2GC3A 3OEAA 3VBOB 2PLV3 1QOTA 5FYBA 3IAQA 5KHHA 5BNNB 3S5QA 1IPSA 1KXGA 3RPQA 3W59A 3AP9A 5FZHA 4LUKA 1LOBA 4LBLA 1RXFA 5JI7A 5FZ3A 3ZN6B 4ZU4A 5C4WC 1UY0A 2VGDA 2XLGA 3KV6A 4FCAA 2ATFA 1AUYA 2WO1A 4HLTA 5LA9A 1K12A 4J1XA 1IS6A 1QHDA 2JDHA 2NMOA 1J3QA 5FPVA 2V72A 3POWA 1W0NA 4E27A 1K5MB 2VZOA 3UKNA 2RS11 3ZXKA 1Z7S3 1OQEA 4KNCA 2IUWA 1ULGA 4NOTA 2Q8DA 5K8SA 2RMU2 3AYCA 4PDWB 3FUQA 2HWB1 4BK4A 5JI9A 2Y6GA 1LULA 1XE7A 3PUHA 3HNBM 2YHJA 5A33A 5HXVA 4CUGA 2IXIA 2FZ1A 2ZEXA 3KF3A 4K9SA 5T5OA 3WXPA 4FAGA 5FBZA 3WV6A 1RYYA 1VPHA 4UW3A 4AI0A 2WNUA 4Q0QA 2UU8A 1ZVFA 5C8CC 2BBAA 1WD3A 4LIVA 2DUOA 2EF6A 2OX0A 4W50A 4A41A 3J26N 4QX0A 4BQ4A 4YW7A 2WNVC 1U5XA 1HN0A 1WLDA 2OZJA 2UWBA 3VKNA 1CAVB 1GU3A 1QXJA 4GULA 3S6PA 5GZGA 1F2NA 3WF3A 1GICA 2I07B 4CA9A 1BBT1 5DXDA 1XU2A 4N9IA 1IQDC 1WZXA 3MPPG 3F2ZA 2UURA 2VMGA 4BZ4A 2ZGSA 3NNLA 3OBTA 5LBEA 4AOCA 1O3RA 3MV11 1VALA 3P6BA 2YC2A 4NWVA 1VAMA 3SCGA 1BMV2 4YM0A 3E5XA 4Y4YA 1CPMA 4HPKA 3EYPA 1SQ4A 1ZYBA 1K3IA 2ES3A 2Q8EA 1JU4A 2TEPA 2ZGKA 3HN1A 3F95A 1OLMA 1YQ2A 2XJQA 4RL7A 5JCTA 1UYXA 3ZYRA 2GH2A 4LKSA 3T4HB 5FBJA 3MLKA 4CCEA 4X8NA 1WW4A 4JGZC 3TRSB 1ZM1A 5DAPA 5FZOB 3DYPA 1UXXX 4AVVA 3RZMA 4A3ZA 3HQXA 1HJFA 4IL7A 3THDA 4BYYA 1LOFA 2G9GA 3AK0A 1POV3 4L0PA 4AXOA 3EMRA 3RG0A 1UXZA 1J1TA 3PMEA 4I0BA 1C1LA 5L19A 4L92A 2A75A 4LEJA 3VLBB 1QH6A 2ET7A 3I7DA 4YW4A 5BNPB 1I5PA 4AVSA 5AC93 1XOYA 1QGLA 3N3HA 1LGBA 4W65A 4CDQC 2PAEA 2WNUC 5I93A 3S0MA 2WC2A 3LKJA 2OVUA 4WM7A 3VKMA 3KHBA 1SZBA 1KDMA 1C8M2 1XRUA 3MV01 4RFT0 5FYSA 1JYVA 3KS7A 2Q4SA 1YEWA 5JIUA 4QXHA 1Q5OA 3AJYA 4MX3A 4UYBA 1F31A 2KA3A 1RUF1 3ACIA 2EIDA 3EHKA 3AVSA 3GYDA 4XABA 5FQ0B 2J7MA 5HBAA 3BPZA 5L7OB 1UNBA 1PIV3 1HRV1 5SV5A 4CU9A 4K6BA 3B3QE 5B4XA 3T4VA 4HN0A 4K1ZA 2C6SA 2I45A 3NJYA 1WCQA 3A0NA 3IPVB 1ZRDA 3ZX7A 3L2HA 2R0FA 1YO8A 1XB9A 2WSVA 3DPRA 5A3NA 5CFDB 1FNZA 1O5LA 4FOVA 1F8VA 5AVPA 1HIXA 3VBRC 1E5IA 1X33A 4N53A 4HSJA 1N1TA 3V56A 5JUVA 2DVBA 3BN6A 3AZYA 3FMGA 4FPKA 4MLOA 4MXWB 4XBLA 2AGSA 4RS5A 2VZPA 1DLCA 4WZCA 1H2KA 5FKCA 3VD7A 1Y9GA 4DFSA 1KJRA 2GC0A 2H0VA 4N43B 1GOGA 3ETQA 3QBQA 3RMYA 1E5RA 2W92A 4AHWA 4COZA 4JVAA 1W6MB 4R9DA 2WQ8A 4JGYB 2DVGA 1PM7A 3TEYA 3Q8FA 1AVBA 5FZDA 3NNJA 1NE6A 3POBA 5C70A 3LGRA 3H1WA 3WT3A 1RJ7A 1JHNA 1O4YA 2WAOA 1K42A 1MQTA 4QB2A 2C24A 4YVSA 4WM7C 5A1FA 1BCXA 5IWFA 3TN93 4IGQA 2I74A 1DLLA 5IVVA 4PBPA 1ONAA 4WZFA 2OZ6A 4LR4A 4Q4X1 1MS3A 1QJX1 2G1MA 2JE8A 1ODMA 3TNPB 1R083 3NNMA 4XTPA 1UY4A 3WG3A 1U0AA 3VHOA 3PU8A 1UCXA 3MF9A 3RJRA 5ACA3 1JZ2A 1MS9A 1UWWA 1OA2A 2GN3A 4XF3A 1JYCA 3POYA 3RSJA 1LJ7A 1V9U1 3JQXA 1H0BA 3MPBA 2O8OA 5FY9A 3ZDSA 3LOIA 3WEZA 2WNEA 3VB9A 5A6ZA 1GYKA 4H55A 1SLTA 2JG9B 3ENRA 3J8F1 5F6LB 1H2LA 1R091 1TMF2 2HEYF 4FPCA 4ASKA 4RGGA 2E9QA 1IS3A 4Q4W3 3ZSMA 4AGVA 4EYUA 4J1WA 1FMD1 1WMDA 1WLWA 3NNGA 1O8SA 4AAXA 1FPN2 2WN2A 5FZIA 1GMMA 3AZWA 4BJ0A 2WDBA 4RS5C 1TME2 4BMEA 1A8DA 1MS5A 1UMHA 2VUDA 4IE4A 4PF1A 5IAVA 1L7LA 2XUEA 4FTBA 2HWF1 4B4RA 3FHIB 5EFUA 3TAYA 4QMAA 3KVBA 3R6SA 1B35A 1GOHA 1QY4A 3CL1A 4XFGA 4XDOA 4XXPA 2CDPA 5FY8A 1QXPA 1DYOA 1W8NA 2Y6KA 2BFUS 2GALA 3CKHA 5FYUA 3PL0A 2D6OX 4DUXA 4A7KA 3VD3A 5JSPA 2I2SA 4YVSC 5F9TA 2YBPA 4XAAA 3WDWA 4IE5A 5A1LA 2WR9A 3VDDB 5DAXA 4XJWA 1LHNA 1CIWA 3V65A 4URAA 1QNYA 4YFWA 4GZ9A 3BOWA 4PF5A 5LA2A 4QDSA 5IT6A 1MVQA 3N9PA 2E26A 1COV3 4YGEA 4DXTA 4ZONA 4QU2A 5EWSA 5DUXA 3HR9A 4B1MA 3JB4C 2P6HA 1PMHX 4PLNA 3WHUA 3HJRA 4D94A 5SV8A 3NRUA 1OSGA 4GH4B 2VZTA 3I97A 2GU9A 5CKNA 2WS91 3I2HA 1YXWA 3FJSA 4CVUA 4LNVA 4YRDA 4IEUA 2WWJA 4H3WA 5LBFA 2DCTA 1XXNA 2PLV1 2C4XA 3Q8BA 4H7LA 1S2BA 4IEXA 3O0VA 1T2XA 5DAWA 2MEV3 4ET7A 4WVWA 3KLSA 1ASJ3 4CXYA 4BDVB 1D7PM 2Y6LA 1PGL2 1UZZA 4MGYE 2B39A 4OYUA 3WDYA 1ZZ9A 4PJYA 4KWKA 1XQNA 4D3WA 3C7FA 4ASLA 1LOAA 2C1FA 3N4MA 1JW6A 3MZHA 3ZR6A 3ZYIB 1Z7S1 1ND2B 2H6CA 3BB6A 3J4UH 3MW2A 5CFCA 1XBFA 5FMCA 4Q0UA 2ZCWA 4GKXA 5FYHA 3KD4A 3PUSA 3U37A 5FUPA 4QQ2A 1IG0A 2EXHA 3I2IA 5BNOB 1PMIA 4CRQA 1F4AA 2JG8C 1OD3A 2XQRA 4PIXA 2DVDA 5JOYA 1F5JA 1PK6A 4Q5OA 4IV1B 1FAYA 2VNGA 1DGWA 4QU1A 4LO7A 5FMOL 5L9RA 1S0CA 5I0UA 2XMLA 3IDEA 1WA4A 1G9AA 4MOAA 3BU7A 2RDQA 4UFIA 3W20A 4CYDA 5EQUA 4AGGA 3QD6A 1N3OA 1Q8VA 4NPRA 5LRSA 2Z5WA 5CNAA 2YXSA 2ERFA 3LIGA 3JCIA 1Y4WA 1FI2A 3CJXA 2HKXA 3N7KA 4INDA 2JD4A 3LD8A 1N47A 1S0JA 2VUJA 3OGSA 3JD73 5B2GB 2QQNA 5ANNA 2R042 5FZEA 4E4SA 2E7TA 3DUIA 5JLVA 1H8TC 1W2TA 5HI0A 4CDWA 4QAWA 3D82A 1GKBA 3FUOA 2VR4A 1UIKA 5E1RA 1Q56A 3OD0A 1LEMA 1H1MA 2VCMA 4AEDC 2HLEA 1S2KA 5FY5A 2WUHA 1J59A 2WNOA 1W6PB 3C8XA 2VC9A 2BZDA 2R062 2R7EB 4C91A 1POV1 5DPNA 5C3OA 3O0XA 2QJVA 1GQGA 4FO9A 4LKFA 2W87A 4M4PA 4YW6A 5FZ9A 4BWOA 1QJFA 5T50A 4WM8A 1D0HA 4EWAA 5C9AA 3T0DA 2W5FA 2FZ2A 2ORZA 3GBFA 3ZFEA 5AC91 4WBBA 4YG6A 5CB7A 3M3EA 3UYJA 1DQ0A 4ZZ8A 1JYNA 5JZGB 2H0BA 1QMJA 1WW6A 5EJ1B 5CAZA 3PIGA 4XMIA 3O1TA 3GCXA 3VBSC 3ASIA 1V70A 1PVC2 5JSRA 3OPTA 4HVQA 1M06G 3MW3A 2A3YA 4ES8A 1G9BA 3ZFGB 1NCQC 4ZXKA 3VBOC 4LPLA 4LBQD 1AR93 3THTA 2SBAA 1JODA 1HDKA 1RUNA 1UU6A 3O1SA 1PIV1 4BQ5A 3ZMOA 2HJIA 4ZU5A 4RHV2 2VZ3A 2VG9A 4NO4A 1RUOA 3AKSA 3RI8A 1CJDA 4BIFA 3RS6A 2XLAA 3R05A 3DCQA 2P17A 2Z4FA 4JKKA 4L97A 1V6MA 1LESA 4CDWC 1VLNA 2ZKLA 3MFCA 1UAIA 1ND3B 4DO0A 1G86A 5A33B 5E88A 1K5MC 3H50A 1CGPA 3OY8A 5DDJ2 4PIZA 5I91A 1J3PA 4RFRB 3KF5A 3OPZA 3LDKA 3U1XA 3ZPYA 1W6QA 1QDOA 3SHRA 3ME2A 3FL7A 1YFUA 2NZ9A 2OW4A 2XJSA 1VRH2 4Q4V3 4F8AA 3SEPA 5FMDA 3BTYA 1AZDA 1XYNA 2K46A 2V4VA 3DKQA 2AUYA 2K0GA 2DBNA 1POV0 1ZBE3 2XH6A 1QJY3 3AZXA 3LSDA 3Q8AA 4WM8C 1CZVA 5C9AC 2ZBJA 2EAAA 1G8WA 2CAUA 2XOMA 1NA1A 1SFNA 4PLOA 4CEYA 5DAVA 3MFAA 1DF0A 2GSYA 4TYSA 5J48A 3FLRA 2A7AA 2XPJA 1Q3EA 3SKJE 2QNKA 4BCUA 3TN91 2JDNA 3AP7A 1JZ3A 4A6OA 5FZ8A 3OGGA 2X5IB 3WQBA 3FE5A 2ZA9A 2Q5TA 4CCMA 5FOBB 1GOFA 5IVEA 3LWCA 4MHUA 1R081 3W5NA 1GSLA 1POQA 2D98A 2Q0AA 3K3OA 3PHMA 4F3JA 2FMDA 5JOZA 3MDPA 2QTWB 3OUJA 1CJPA 4RN5A 2YY1A 1VRH1 1EV12 4XJ8A 5ACA1 5EZWA 2W95A 1GNZA 4JQRA 1PM4A 1WCKA 4XPVA 1MZ5A 4GWNA 4EWEA 4XUQA 2D6LX 2VTXA 1V6OA 2W08A 1BVVA 1E5HA 3N36A 4I0WB 4YZ4A 5J37A 1SG3A 3AKRA 2F17A 2YC4A 4OVEA 3OUIA 3AVRA 3SH5A 5A32A 1AJOA 2V4AA 3KV9A 2VCBA 5A3PA 2ZHNA 1KD7A 4I09A 4NRMA 4B29A 4DOUA 4Q4W1 1JYXA 5IYYA 1RUC3 2BWCA 4DZGA 5FY0A 4D6RA 1KDKA 1CAXA 5J98B 2RJ2A 3AMHA 2EA7A 4XIOA 1EV11 5K0UB 3B7MA 2TBVA 4JC1A 5F39A 1OXCA 3I3EA 2F6BA 3BIWE 1P8JA 5BNPC 3POJA 4XFAA 1JU3A 2EXKA 3TWIA 3ZVXA 1VBE2 1NLRA 2W52A 1KFUL 4MO3M 4MXVA 2CL2A 1M4WA 4O61A 5FYZA 3KV5A 1R1A2 2ARCA 3QH6A 4XXAA 1RTVA 4G4FA 4HMZA 1IZ3A 4MUVA 3INAA 3WNPA 5HPOA 4J6GA 2VPVA 2Z79A 1J3RA 3ZYJB 2L9LA 3A7QA 1F4HA 3NW4A 4FPFA 4YGCA 4AVTA 4ONUA 3ZXFA 2Y0IA 3C7OA 3J9SA 5L7OC 1AR73 2BRTA 2FBEA 3ZFFB 4A6SA 1RXGA 4AQSA 3PVEA 4AEMA 4P08A 1SLLA 4UBHA 4N53B 1YHFA 3PUAA 2Q30A 1WMFA 4XF1A 1OD5A 1W6NA 4XCAA 1OOPA 4ZHNA 3FFZA 4JX0A 5CFDC 4NIHA 1IKPA 2A5ZA 2W1UA 1R1A1 4XURA 3X29B 4I02A 5FXVA 5FAXA 4CXWA 1EAH2 3HIFA 1RIRA 3IB3A 3UETA 3V64A 1PO23 1D0GA 2MEV1 5C6CA 4QPIB 4YYOA 5FZ6A 1ASJ1 1UPSA 3HVDA 2WYSA 5F3CA 1NE4A 4YGDA 2AEZA 3BVCA 5DG1A 2P34A 3IZOA 1MQTB 1RUI2 2XL9A 3I2GA 4QKDA 1XNCA 4XBQA 3K4DA 1YLLA 5T3NA 3LEIA 4OQ8A 2PHDA 2YV8A 3JU9A 1F35A 2YUEA 2ILMA 2WZPP 1UOBA 2ZX3A 5KR7A 1VBB2 1WUVA 4P5HA 1GZWA 3U4XA 5AFEA 2HWD3 5A3OA 1AF9A 3M3IA 3Q9OA 4IV3A 4S2FA 5BXXA 5A70A 1JOJA 1O4ZA 5FYYA 3SH4A 3DN7A 4FOWA 2MHFA 2W47A 3VD9A 2D6KA 4NR1A 4OHZA 4QDRA 2CGOA 2DTYA 2CSGA 3IKWA 4LO6B 5KHJA 1IS5A 4QKFA 3BODA 4YSFA 1FV3A 3GZUC 3NV3A 3PURA 1FOD2 2A6VA 5A7OA 3ZYFA 2J1UA 2DF7A 4GB32 3ZXJA 3VDAA 1XSQA 1UKRA 4JZRA 1HQLA 2VBPA 3I8TA 2ZTNA 1QJEA 4XHBA 2B5HA 2IXJA 3H7YA 5A7QA 2YBSA 1UOJA 4Y33A 1RUJ2 1BYHA 3ACLA 5FZAA 5IJRA 3VZNA 4EE2A 4UW6A 1R64A 2E63A 1RUE3 2JICA 5FZ7A 2WRAA 2XHKA 3T0AA 3USUA 1JI6A 2Y6HA 5FJHA 1W6OB 2IZWA 1N1YA 4JHTA 2A6ZA 2WA4A 3GHNA 3JD71 1S0EA 4LXLA 1HKDA 5ABJB 4P02B 4BQ1A 2PELA 4OUSA 4J25A 4QHBA 4A3XA 1G9DA 5F3GA 4BLIA 2E6VA 5I8TA 1VBC2 4UFMA 4Q4Y2 5C4WA 4FPJA 1UIJA 4OHXA 1J58A 3M8LA 1GQPA 3M1HA 1RGSA 4CEWB 4OI4A 1IKQA 2GAUA 1U5IA 4IV3C 4B4QA 2A70A 2N7GA 3AL5A 3T3YA 2WFF3 1VB2A 2R6QA 5CVRA 1WD4A 3VDDC 5IHRA 3BKZA 3ETPA 3PVNA 2ETEA 5A7WA 4AAPA 3BYWA 3L2YA 3MF6A 2VY0A 5H9SA 4Y22B 1DFQA 2QQLA 2QZ3A 5C3PA 3VL9A 3DYMA 4S2DA 1G9FA 4YZ5A 5J96B 3MYXA 5IK8A 5B4NA 3RZGA 2AACA 2RHPA 1AYN2 3ACGA 3AKPA 4CCLA 3AX4A 5JPNB 3MICA 5DN2A 1JYWA 3VBUB 2VZ1A 2G9FA 2A73B 1DHKB 4UAPA 3PVOA 4OI1A 4M4RA 1QDCA 1TQ5A 1BVP1 4OFGA 5C8WA 3TEWA 1F9KA 4NAMA 1LU2A 4E2QA 5FYIA 1AR91 2RG4A 5ERLA 4IEYA 4TLGA 3N9LA 4CDUA 1JZ7A 1QJZA 3H3UA 4COVA 2WNVA 1LHUA 1LHWA 1QQP3 2ZZJA 2YC0A 2Y6FA 2ZEZA 5F5QA 3HPNA 1H30A 3CLPA 1HXS3 2H6BA 4AFMA 4MVTA 2RS12 3CHXA 3ZXAC 3M3CA 3N9OA 2RS53 4LOSA 1JYIA 1RMU3 1ZZ7A 2EXJA 2XVLA 1AYN1 3B01A 5FMOS 1YQ8A 4QPGA 4OHYA 3SCFA 2EALA 1RC6A 2HWB2 4Z1VA 1H4HA 3ZN5A 1C4RA 1ULOA 4D7SA 4DINB 3AFGA 3SC7X 5KWRA 3W5MA 4E4HA 4LMFA 3OBZA 2JECA 4GAZA 3OBAA 3RQ0A 1ZX5A 3OYWB 2R32A 3GDBA 4EN7B 1PK6B 3SISA 5HV0A 1OUSA 4UFLA 5CADA 2VTFA 3NAPA 4AZZA 3DGTA 3ZXLA 4UW4A 1GFF2 3RZJA 1DZQA 1X36A 3C7HA 4QX3A 5BNOC 4YLZA 4F83A 2ZMNA 5IATA 4JGZA 1ZBE1 5APAA 1QJY1 1PX3A 3B9IA 4HK9A 2DYCA 2VVFA 2HYKA 4Y5TA 5F2SA 4XFBA 3S7EA 3VBFB 2HWC3 5FPAA 2ZX1A 1F5FA 1UZVA 5F2WA 3U4SA 1BBT2 5LA1A 2BPA2 2CHHA 1OC1A 4LHNA 3ACHA 2AENA 2R073 4BPZA 3UV9A 2VNRA 3IWZA 3ZM8A 4KI5M 3AYDA 1PZ7A 2ZX0A 4CDQA 3NSTA 3JBG3 4XEZA 3T09A 1PMJX 3I2FA 3OEBA 1YQ5A 2JDPA 1VR3A 1X9TA 2VXJA 1FX5A 5GLWA 3U10A 4HKLA 4CDUC 2PAKA 3B93A 4XF4A 4YVWB 1SEFA 1BK0A 2W1QA 1A6CA 1SBDA 3AJZA 5FMBA 3HNYM 4QX1A 4HT1T 4UWDA 4WVZA 2VJXA 3K4ZA 1ZRIA 2J42A 3CMGA 1S0IA 5CKQA 2W39A 2XVGA 4QPGC 3D8CA 4M0NA 1XE0A 1OKQA 3LE0A 3WQ7A 1IQAA 1AX0A 1RUC1 2A6XA 3I59A 4LBQA 5FXWA 1UYYA 3HEIA 5LASA 1NCRC 3ES1A 4YG3A 4YARA 4EN9B 4NN0A 3KT7A 2O8QA 2AYHA 2IFWA 2Q1ZB 4LHKA 5AFBA 5JMOA 2XKPA 2JE7A 3NAPC 5KC5A 3VBRA 2G4IA 4CCKA 1REEA 4XOGA 1JBCA 1YYNA 2WINB 3K51A 3N9QA 5C3SA 2VVDA 2J1EA 5JZGC 4BIOA 4LBKA 2XBO3 1BZWA 1GP5A 1RUF2 4XBNA 2A3XA 4FP2A 5KHKA 4QM9A 4QM8A 2DVFA 2TUNA 3G7DA 1SPPA 2RM23 2ZEWA 2WZR3 2BEOA 5C33A 4I3PA 4OLLA 4OMDA 1MS8A 1HRV2 3VKFC 3K4AA 4KGGA 1RUD3 3H7JA 3P3NA 2XLFA 1QJU3 3H0OA 2ZEYA 4ZPIA 1EUUA 4X8PA 2DFCA 4WVMA 2LW8A 1VMFA 4DEQA 1AR71 3EB7A 2WSUA 3L9JT 1US3A 1OHFA 5GJ6A 3AB0A 2RS33 1GWKA 4FXGB 2FMYA 4P9XA 4TTGA 1GZTA 4ARXA 5FOJB 2JX9A 1WA6X 4ZS2A 5FUNA 2JJ6A 2JDAA 3LSEA 4RR3B 2AR6A 5JVVA 1NZCA 5JR2A 4YGBA 4NHXA 4COWA 3PJQA 4A2UA 4PCRA 1VAKA 4FPYA 4Y20B 1U5ZA 1PO21 1V0AA 4AE2A 4FOQA 2R0HA 5GZCA 3K3NA 5JXJA 3KQRA 2WQZC 4LOTA 2ZZQA 2LTNA 2BERA 2Z42A 5L73A 4CEYB 1WLCA 5LK7B 1KJLA 3E6CC 3V0AA 1NAEA 2B8MA 4QPWA 4KH9A 4V2VA 2XB6C 2O14A 1QOOA 1DG6A 3AL6A 1NT0A 1RITA 2HWD1 4Q4X2 2ET1A 1QJX2 3K77A 1XYOA 3LZZA 3P5BA 2F4LA 1YIFA 1CAUB 3HQRA 1W9FA 4EWDA 4RQPB 1HLCA 2ZGNA 5A6YA 2FCUA 3P3PA 5E89A 1T6BX 2LM3A 2OT7A 5LATA 1JZ6A 1MPXA 2PXJA 1V9U2 4R9BA 2DU0A 1NQDA 2QQPA 1TZOA 4DXRA 1N1VA 1CESA 4HANA 3WNOA 1EP0A 1JN2P 1W04A 2X8KA 1VBA3 2PTMA 3J8F2 3SEEA 3O1PA 1R092 2KXLA 1LTEA 2QDNA 1XSRA 2LUWA 3HT1A 4P9LA 2Y8KA 1CX4A 4UW5A 2CNAA 2VH9A 4R9AA 4XC9A 2LS6A 5G04L 1DYPA 3V0BB 4BQ2A 4D7YA 1AYM3 1FMD2 1US2A 1RUE1 3I2OA 2RDNA 1LECA 3OPWA 4ORFA 2P3KA 5A6QA 4JTOA 1OPOA 4YM1A 2WFF2 3WINE 2ZHKA 3ITQA 5AVAA 2HWF2 3AFKA 2IVJA 3CIHA 3WDVA 3H8XA 4JKMA 3CEWA 2O0OA 1X7NA 1XC6A 2RR13 2W68A 4IEOA 3T2QA 2ARAA 3WUDA 3WX5A 4CDXA 5DABA 2D93A 3KV4A 5F5IA 1MZ6A 3GCWA 4LKEA 4XFIA 3D0JA 4A7ZA 1OF3A 4JTNA 1O3TA 4AGRA 5LZ6A 4DUWA 5GLUA 2K9ZA 3AM2A 4FPLA 4I3GA 5FXXA 3UK9A 1H1IA 5KXDA 5E6HA 2ZABA 2WFF1 3SH3A 1ENSA 2TNFA 5FUIA 1LHVA 3HQUA 4CPBD 1YC61 1VBD3 2W94A 4BE3A 3WOGA 1SCRA 2C5DA 2WS92 4FAHA 4QB6A 1O8PA 4S2HA 2IWGB 4PQQA 1JH5A 2WKKA 3C2UA 4JKLA 2P3JA 2PLV2 3H1YA 2VOTA 4LO8A 4BXSV 4KGQA 2JG8A 2VQ0A 1MEC3 1CZSA 1SHWB 3W9AA 3ZDVA 5KXBA 2Q8OA 3LA3A 5F8PA 1DGWX 5JWPA 4XFHA 3LQCA 4LTAA 1S0FA 4EN6B 2VQTA 2B42B 5BUVA 1OLRA 1O5UA 3HN3A 3OJBA 1RUG3 1XNKA 2XUMA 4Q8KA 4G3YC 1WW7A 4LE3A 1QQP1 2V5DA 5H9RA 3T2PA 4BB3A 4QPIC 5JSOA 1S0GA 4Y1ZA 1HXS1 1HB1A 3AMQA 3FWEA 3ILRA 5LY2A 4B3NA 1Z7S2 2RS51 5HCBA 4Y5Z0 1RMU1 3UGHA 4LT5A 4HVRA 2CTVA 1OUXA 3VD5A 1MR5A 4CDXC 2YGLA 1D4M3 2MNGA 5JXIA 3FFQA 5F3IA 4JV4A 1BQPA 3HAGA 3WF1A 2JD9A 3CJIC 5C5TA 1H8TA 1HJGA 5FPLA 3T2TA 4CP9A 2J1VA 5D8AA 2EVXA 4YW1A 5C71A 1QU0A 2D3RA 3RGBA 2XQXA 3AP4A 4AEDA 2VZVA 3LCPA 3R4UA 1O91A 2HWE3 1HW5A 3Q8EA 4FTSA 4QX2A 3M2MA 3KZ4C 3MEPA 2FDGA 1DQ4A 2HWC1 3THCA 2BTVC 3WD5A 1W06A 1ULDA 4NRQA 5FP4A 5GALA 2VMEA 3R4SA 3TBDA 2BVVA 1PNGA 1ZBA3 4NJ4A 4XILA 2R071 2YFUA 4UFHA 3ZIXA 3SXWA 4MGTA 4FPOB 3OCPA 2BBVA 1X82A 1AL0G 1V00A 3GM8A 3JBG1 4GJZA 2W9XA 5FPXA 1E57A 3PDQA 2YPDA 1V6IA 3FHQA 3VV1A 3I3BA 3MIHA 2BV4A 3BPSA 3VBSA 4AK3A 2E33A 2EICA 4Z92B 2YU1A 2YU2A 2PMWB 1O59A 1W0OA 4GIQA 4FOYA 3WQ0A 2ZJCA 5FJKA 2P6CA 3VBHC 4E8DA 3CU7A 5I0RA 1NCQA 4XQ4A 4BOWA 2VOWA 4BISA 5KXEA 3VBOA 2VOVA 4AHYA 3EJKA 4CP0A 5A3UA 1GANA 1CAWB 2Y60A 3KB5A 4HL0A 4IE6A 4M3CB 1YFYA 2JIGA 2HBUA 3UL2A 1ZA4A 2XGXA 4PT6A 1WBFA 1HRI3 1OQDA 3ZN6A 4FXKB 4AVCA 5J09A 3NWKA 1VRBA 2XDVA 2VU9A 2WABA 1QKQA 5LBCA 3T0BA 4B1LA 2ZXQA 5FY1A 5AC92 3TEZA 4NVPA 4CEWC 3GJBA 4NROA 4LJHA 4OUMA 5D8AC 1YRZA 2QVSB 1FXZA 5I8SA 1AR63 2WLQA 1K5MA 1LENA 3O0WA 2XWBB 4HXCA 1AR83 1PGW1 1RVF3 3AMNA 1DZTA 4ZY9A 3BUCA 2XJTA 2XR4A 3UT0A 1AL23 4PDWA 4XUPA 4G9SB 5FIXA 1S1AA 2XBO1 5C8CB 5M0TA 4CUCA 1BK1A 1UX6A 4QXBA 1A3KA 4N8MA 3LB9A 3LFMA 5FZ1A 3MUY1 2RM21 2Y0OA 4Y4RA 2WZR1 3OD4A 4MYEA 2XG3A 1YCIA 2VTXJ 4AI2A 1PIV2 2QQVA 2YYOA 1GZ9A 4DS0A 4DY5A 1LHOA 1W03A 1RUD1 4XMAA 5FDBA 1RINA 5EV7A 1QJU1 5BPXA 2PHLA 3OF1A 4EROA 4OMCA 3NVCA 3GNEA 5DG2A 4Z2WA 2YB7A 2VMIA 5FWEA 1JOPA 2RS31 2ADDA 3OOXA 2ZGPA 1WMEA 1PO13 5C7GA 1RL3A 3MIFA 2VBBA 2QQIA 1ENRA 3LDBA 1O3SA 4BA6A 5DQ0A 2OKXA 1OMIA 1UN1A 2VM9A 5BNNC 4ZZ5A 1DU3D 4AEKA 1NY71 2CU5A 2J22A 3AYAA 3VL8A 4DY3A 2JWPA 4JGZB 1BMV1 4Q2FA 1LEDA 2ZX4A 4K7JA 5F3EA 3K48A 1JZ4A 5T52A 4KU7A 2ZGOA 3R4DB 1LU1A 2LALA 4B7EA 3ZSLA 4AR2A 2D44A 4HONA 4QWNA 4OULA 1H8VA 2JB4A 1CQ9A 2WT0A 1OF4A 5FZOA 3TN92 1N3QA 1W2UA 4XUOA 1W28A 5KHGA 2WNUB 3POFA 4A45A 1SFYA 4PDWC 3RWKX 5FY4A 1HB4A 1R082 1VIWB 3GBGA 2JEMA 3LEKA 1SLBA 1U12A 1TE1B 5T5PA 5ACA2 1RHI3 2GMPA 5BNPA 3O7OA 2V5YA 4H7MA 4KWLA 5JDBA 1OLQA 3FX3A 1AXYA 2FHRA 3OBRA 4N7UA 3UNPA 4IGPA 3UJQA 1Q8SA 3IBMA 4OI2A 5F5AA 3WG2A 1XNBA 4DB5A 4YVWC 1VBA1 4XJUA 4QX8A 3ILFA 3GJAA 4LITA 5BV6A 3H8OA 4Q4W2 4HPKB 5F37A 5FQ0A 1AYM1 1ZREA 4DPNA 5L7OA 4IEZA 1BEV3 3RFRA 2VUAA 3WW4A 3LPGA 2CY6A 4MHRA 4GQ7A 3AYEA 5LK5A 5FP3A 3VBRB 1WGPA 2Q1MA 1Q8OA 4OUEA 2ZOEB 3GBWA 3O1RA 2D6PA 3IPVA 5GLZA 5FWJA 2NM1A 1G6NA 5CFDA 4OI0A 2GNDA 3BALA 2VE1A 3R0RA 2DDUA 2RR11 2W46A 3MIGA 4MGQA 3ECQA 4FPHA 4IQPA 1ZZCA 4PI0A 5H9QA 1DQ5A 3S57A 1Y3TA 4IESA 1UY3A 4MXWA 3VHNA 1WCDJ 2IXCA 1W8TA 2VULA 3AP6A 3WP3A 1V6KA 2RE9A 5GM0A 4N43A 3ZOIA 3NV4A 2ZHLA 4PLMA 4WM7B 1W6MA 1Z0HA 3ES4A 5DZFA 1COV2 2A3WA 4IEPA 4E4DX 1Y7BA 4JGYA 2GNBA 3IN9A 2QQOA 1X8MA 1CZTA 5IVYA 2RMU3 4Q1PA 2ZS6B 4IUGA 1SDWA 5LB6A 1VBD1 3GZTB 3OUHA 4LA3A 4W6XA 3N7LA 2QZ2A 4QHZA 4FVVA 5T55A 4D69A 2NPIA 2OXBA 1YI9A 1BLZA 1VJ2A 4QQHA 3BGAA 1MEC1 2DVAA 5LRRA 2XL7A 4RA0A 4DNYA 3KM5A 4RR3C 2MEV2 3WCSA 2OUJA 4HN1A 2A6WA 1ASJ2 2DTWA 2UY9A 2VOKA 1SLAA 1W2OA 1CN1A 1V6NA 4D6SA 2EIGA 1COV1 1LGCA 1DZRA 1IG3A 3DPRB 2ORXA 3JXSA 1RUG1 2BQPA 2GC1A 2VUCA 3VDCA 5IAXA 1JTZX 1X50A 4TXWA 4BQ3A 1A8MA 3RZHA 4MGZE 4XJZA 1W05A 2HWE2 5HXMA 1RB8G 3S30A 1B09A 2OA2A 2QFEA 2YDEA 2NMNA 5FZKA 3OG2A 3WF4A 1TG7A 4DXSA 1NXD1 1W8WA 3M3OA 4RS5B 2VZRA 3GHMA 1TEIA 3O1VA 3PNAA 4LKDA 4QDQA 2Z69A 2GNMA 4LBJA 4CP1A 4IETA 1APNA 2OYZA 4AFBA 3FBMA 3LA7A 3MIBA 3PU3A 5IVBA 2RJKA 3SCHA 4ATEA 1WBLA 4DIQA 2KM2A 2D7FA 4N43C 4FFFA 1LGNA 2D6MA 2ZACA 4YVSB 4BQXA 4YM2A 5FO7B 1UZWA 2HWE1 3QLQA 2VZQA 2YMZA 4XF9A 5IFPA 4JGYC 4U2AA 3WP4A 3J7MA 4YWAA 4W6WA 5GZFA 1MZEA 3T1LA 2CGPA 2FDFA 3ZKYA 4HVOA 1HV0A 3PTYA 5FV3A 3UESA 3KCXA 3ZYBA 4XETA 4DQAA 3H9AA 1U5YA 3TB0A 4HKWA 3VDDA 3WG4A 1ZBA1 3HD8B 4AI1A 2WT2A 1W39A 4OQ9A 3UGGA 4BLJA 2VQUA 1IOAA 3O1MA 1EUTA 1YUDA 1LKNA 2NQYA 4GJYA 2BFUL 3JD72 1C8M3 3WCRA 1W3VA 2WWUA 4GA9A 4ZS3A 3SKVA 3B9CA 4GXLA 4UT5A 2YROA 4GMP3 4R4ZA 4CPBA 4XIKA 2WYFA 4GH4A 4O9EA 4OCTA 4XACA 1ULPA 4UF0A 2Q8CA 3RI9A 4DMIA 4Q27A 4LA2A 4BMBA 1AL22 1ST8A 2P3YA 4PQ9A 1ENXA 2DCYA 2JG9C 3GZAA 2C9KA 4KBZA 4BH9A 3I2DA 1UL9A 2CAVA 2ZGRA 5KXCA 3NJXA 5IVFA 5CU1A 4JCKA 2Y34A 4CU7A 2JDYA 1HRI1 2QQJA 3MHZA 4AHZA 4Y26A 1SLIA 2DURA 2WN3A 2XHNA 5FFOC 1J83A 1HN1A 4NHKA 3BI3A 4XDPA 2BOIA 3RNSA 2JDKA 1B35B 2ADEA 1H9PA 2DCZA 3PUQA 5L9BA 4LULA 1AR61 1KQRA 3NJZA 2J1SA 5A1AA 3IDAA 1AR81 1RVF1 2DU1A 2OQ6A 1ND2A 2CGNA 2W91A 3I49A 1UZYA 1L3JA 1AL21 4MGKE 1GNYA 2PHTA 3LIHA 2QE3A 3N9NA 4AYUA 3ZR5A 4DRRA 3WUCA 1A34A 1VAVA 2HH9A 1REDA 4UXAA 5CYYA 2OPKA 2GZWA 1AR92 5BNOA 3ATGA 4RGAA 1STMA 5FXZA 3GXUA 2Z2SB 5E8AA 4P9JA 3BTZA 1ALYA 3E5UA 3LPFA 3NV2A 3TOJA 3DXTA 5DZGA 3SLIA 4O9GA 4CU8A 3VKOA 4S2GA 4LE4A 4QQPA 4U36A 4XQWA 2D43A 2E51A 1UY1A 4LLFA 3SQOA 2YGMA 5JMCA 1PO11 3A22A 2P1BA 3PVBB 1Y9QA 4NPLA 4FFHA 4GH4C 3E6BA 4CCOA 1ZRCA 2B45X 3HWJA 3WNXA 1UMZA 1SLCA 3WW1A 4GWJA 2JDUA 4I2OA 2OS2A 3N7JA 5FPZA 4EV0A 4AFDA 2Y38A 2SLIA 4IEQA 2CV6A 5LA0A 1DGRN 4Q4V2 1JHJA 2VAUA 4CUAA 5KC6A 3NKTA 4AI9A 5DUUA 3WP5A 1Q43A 1OFNA 1ZBE2 1QJY2 1TMF3 2QQWA 1XPWA 2DWRA 2QUOA 3FLTA 5CFCB 4XYXA 4P5YA 4XUNA 2A6YA 4OHVA 1D2QA 3VZOA 3KGLA 3AP5A 5FYTA 4BU2A 5A80A 1W6PA 1UPIA 2BOJA 5DUWA 1FPN3 1NCRA 3I4IA 3ZLIA 1ND2C 2DV9A 5FLIA 4NIAA 4AF9A 1VB4A 1TME3 4QX7A 4V1PA 3WDTA 5GLVA 4EZ4A 5DZEA 2XXZA 1K45A 1PHMA 1BEV2 1UD1A 2YG0A 3KGZA
chains in the Genus database with same CATH topology
3VBSB 1SBEA 2IXLA 1G7YA 4Q4V1 1RHI1 2JENA 1AX2A 4CP2A 3FC0A 5JZGA 2AH2A 2PQQA 3PJYA 1NCQB 1EYBA 4IV1C 4D7TA 1I3HA 4K40A 1C28A 1YFWA 3N7MA 1C8NA 3ZXDA 3D4KA 4KL1A 4MZUA 4Y24A 1WLTA 3FZ3A 1SBFA 1LOCA 3ZO0B 1RJ8A 3IDCB 5GLTA 1QH7A 3ZFGA 1REFA 4XJAA 3U11A 1DIWA 1I9RA 1RUC2 2ARBA 1PGSA 2NP0A 5KHIA 1CPNA 1BEV1 2P2KA 2NLRA 4CDWB 3NL1A 3RRDA 2CWMA 5J3UA 1KITA 2AREA 4JDNA 2IXHA 2XKOA 3AMPA 1C3HA 1SMVA 1DGRA 1ULFA 4Q1RA 4YZ3A 4RSUA 1ND3A 3LOBA 2XWJB 4XE9A 4W6YA 2XJPA 3AZZA 1MACA 3M70A 4WM8B 5C9AB 4I01A 2HEVF 4AG4A 1EY2A 4FQZA 1IPJA 3GF6A 3M3QA 3W58A 3WZ1A 3ZFEB 1VP6A 5F6KA 3RMXA 4RD7A 5GZEA 4K21A 1IS4A 4AFAA 2ZGLA 1AR72 2AZ5A 3HT2A 4COUA 2Y26A 3DKWA 3DF0A 2YZ4A 5I8YA 2RMU1 2PHRA 4N7IA 1O3QA 2X5IA 5IK4A 2PYTA 1I1EA 3B02A 4FSJA 2WLPA 3AKQA 3NV1A 2GDFA 2V73A 1PO22 3ZFGC 1IHMA 3KSCA 4C0BA 1JUHA 4XF0A 4C90A 3NO8A 3C3VA 1ZZ6A 1PZ8A 3OY8B 2WFPA 4LBNA 2BNNA 1NQJA 3SITA 4ISQA 4AI8A 1W6QB 2HWD2 3WW2A 1ND3C 4K8FA 3PLQA 2E7AA 1C5HA 2VW2A 3S7IA 2R043 1JXNA 4NHLA 3AKTA 2VMHA 4Y1YA 2QDRA 5FTTC 1EPWA 5KBFA 5K0UA 3QCWA 1NA1B 3QH7A 4FPGA 4SBVA 4HSLA 5LEJA 3I54A 1XE8A 4QPYA 1WCSA 4R52A 3ZSEA 4QQOA 2R063 1J1LA 2A71A 4EJRA 4HBNA 3H8UA 4N90A 2IXKA 1H2NA 2UWAA 4LBMA 3JB8A 3JUUA 3ZYPA 1RUE2 1ZNPA 3VN4A 1Q8QA 2X5IC 2ZGMA 5EXOA 1FYUA 1S55A 2XJUA 1LRHA 3B5LB 1S0BA 3KT1A 3B69A 3U07A 4X6QB 1C8M1 1O4TA 2WJSA 5CIRA 3ZFFA 3U0ZA 1PVC3 5FRAA 1ZRFA 2VVEA 2DCJA 4GMP1 1GLHA 3LAGA 5A32B 4YW3A 3EBRA 1YFXA 5FLHA 1CONA 3O12A 4P9YA 4YFZA 1CAXB 1JUIA 1OFSA 1LOFC 1MVEA 3KCYA 4MV2A 4P14A 4K3UA 3NKGA 4RHV3 4KQ7A 2VQAA 4QPIA 4NWWA 4CZSA 2PHUA 2UWCA 2D6NA 5IK5A 3O14A 3WR0A 2PAMA 3ZYGA 2F4PA 2PHWA 5JIAA 3VGIA 1FNYA 4XJ9A 5K0UC 5HCAA 1GQHA 5DDJ3 1IPKA 4GKYA 4X6RB 3WW3A 4AW7A 1ZRRA 5L36A 3CJIA 4YW5A 4SLIA 2B46X 1UU4A 5TSWA 1AX1A 1C1FA 5T5LA 4COYA 1VRH3 5JOXA 3T1MA 4XFCA 3VKLA 1QQP2 2DUQA 3KCCA 3D5OA 1D2SA 3AMMA 1HXS2 4A7YA 1W6NB 1OOPB 1YNAA 3DPRC 3ZFFC 2RS52 4YZ2A 1RMU2 3JZVA 2ZMKA 1OQ1A 1T6GC 2JDZA 4Y1VA 3TNQA 4L11A 4N53C 1OPMA 1GNHA 5K7PA 3A0KA 1V6LA 4GWMA 4PIYA 4GMP0 1EV13 2BNOA 5JAXA 2X53S 1LOGA 1W6OA 3ALQA 3POSA 2D40A 3WDUA 3VBHA 4QX5A 5ABJA 1TMF1 1GZWB 2ENRA 1MQTC 2HWC2 3UKVA 2ZX2A 4IV3B 2FQPA 2GMMA 2XJRA 4AVBA 1QF3A 4FQ4A 1FPN1 2R072 4AFCA 1CD3G 1I5ZA 2ZGUA 1TME1 4CEWA 3JBG2 1I6XA 4IEWA 2DUPA 4JRAA 5A3LA 4Y22A 1VBE3 5EYXA 1UF2C 5A3MA 4XZPA 2ZKNA 4P9IA 2GMEA 3ROUA 1R1A3 2K2SA 4P9GA 4YM3A 2VECA 3VBUA 4R4XA 3USUB 1MS1A 2PFWA 3WLUA 4LHLA 1PNFA 2YPJA 3ST7A 2XVKA 2VNOA 1KS4A 1BJQA 1Q8PA 5DUVA 1QXRA 3SNMA 4UBGA 1O7FA 5EJ3A 4KG0A 3RWNA 3WHTA 5FCCA 4HZFA 3WG1A 5CA6A 4ZU7A 1GBGA 3D0SA 3CNAA 4ES9A 1B35C 1PGW2 1URXA 3B94A 5C4WB 3H3ZA 3E5QA 4R9CA 5ABJC 4AVAA 1EAH3 2XBO2 3ZSJA 3MLJA 5JOWA 5BY5A 2D3SA 2RM22 2WZR2 3OYWA 4HFSA 1RUH3 1PGL1 1DGLA 2D5FA 3RDIA 4QGMA 5FO8B 1RUI3 1RUD2 1H1AA 1QJU2 3DL3A 4L8QA 4H14A 2PA7A 1TNFA 1VBB3 2RS32 4YW2A 1YIPA 2R30A 3VBFA 3AXDA 2DCKA 3IDBB 5JPMB 3O5SA 1QNWA 2OUHA 5GKAC 2JE9A 4IXLA 4R8HA 2DFBA 5T54A 4CDUB 4DRVA 4URTA 3VBUC 2WNVB 4KWJA 1NOVA 1R1ZA 4K20A 1NY72 2WWSA 4AQ6A 2EXIA 1BMV2 1C5IA 3THPA 1FOD3 4FP3A 3B00A 4GB33 4E2SA 3MGUA 4JDOA 4YVWA 3UJOA 4N9HA 2GN7A 4QD2A 4QPGB 4Z8BA 1CAVA 1RUJ3 1H2MA 2ARXA 4XHXA 1NCRB 1AXZA 4Q29A 3SMHA 5CFCC 4KU8A 2QCSB 3WP6A 5F1RA 1UW8A 4HKOA 3NAPB 2E53A 3VUOA 1TNRA 4JRLA 3BTAA 1OA4A 1QOSA 2R041 5JR7B 4Q0VA 1AHSA 1HX6A 1GR3A 1PK6C 4M01A 2P3IA 3QACA 4MSVA 1VBC3 4Q4Y3 2PHXA 2R16A 4AHXA 1VBA2 3DV8A 1PZ9A 2R061 1UKGA 1XYPA 4JDMA 5BNQA 3JQWA 3VBFC 4CDQB 3OTFA 1NYWA 3IIAA 2GH8A 2VXRA 1N1SA 1AYM2 2O1QA 2BVBA 1OA3A 4Q0PA 1ULEA 3CO2A 4LLOA 2ZGTA 4Z82A 5FLJA 4M00A 3A4UA 4B8EA 2PHFA 1AYN3 3EO6A 4MH0E 3APBA 1PVC1 1KFXL 4QGLA 2RR12 1HQWA 4ITCA 1G9CA 3VZJA 4Q26A 1BXHA 4TSVA 3E6DA 4LBQB 3I59B 4RR3A 4TWTA 4AI3A 2VW0A 2UY8A 4IEVA 4K1YA 2JXAA 3WQ1A 1EPZA 3HBZA 4Q8LA 2VOXA 4Y20A 4Y1XA 5HCFA 4RHV1 1NLSA 4BM8A 4E9KA 3IM0A 1YI7A 2RS13 4AEJA 3ZFEC 3ZN4A 1DQ2A 4XQDA 2VW1A 1YJKA 1D4VB 1Z78A 1XU1A 2HWB3 4LUMA 1VBD2 5DDJ1 4OZXA 4FPEA 3PMSA 4C0HA 2ZGQA 5FREA 1OI6A 2ZMLA 4Z07A 4QT6A 1KRIA 3E97A 1MEC2 1CAUA 4LBOA 3BCWA 4RQPA 4B7KA 4WVMB 4WVVA 4NHMA 1DQ1A 2XJVA 1BKZA 4JAAA 2BYVE 1GZCA 2NYYA 1RUG2 4I30A 4BHPA 1BBT3 2W0XA 3ZMNA 3RYPA 3RJ2X 4EN8B 4META 3FBYA 3TYJA 1MZFA 3WDXA 2IFRA 3V0BA 4IERA 1D4M2 4Y1UA 1X8EA 1YJLA 5J7MA 2QKDA 3KMHA 4YZ1A 3G6JB 4KG8A 1WW5A 3UKTA 4YG0A 3V0AB 4LO4B 2EAKA 4M3CF 2GNTA 2V09A 1HQNA 2JG9A 1NA1C 1CVNA 4XFFA 4CEYC 2R1DA 2ZPXA 4C1XA 5I0SA 3VHPA 1LODA 1NG0A 2BGCA 3MW4A 2IC1A 2WL1A 2UYAA 4MGIE 1D4M1 1ULCA 2RJLA 1ZBA2 3WY6A 4XTMA 2UYBA 3OGJA 4LO5B 4HK8A 3M7AA 3D6EA 4RQPC 1LR5A 1FATA 2C0ZA 2NN8A 4AQ2A 1YWKA 3HMYA 3ILNA 1VBE1 4TLFA 1RUF3 3ZXEA 2CWSA 2BNMA 5K9YA 2B9UA 5CBLA 5T5JA 1W0PA 4FBFA 1DDLA 1HRV3 3FLPA 1MS4A 3CF6E 1V6JA 1FT9A 4XW3A 2ZHMA 1HRI2 3BOPA 4QXKA 5J36A 5IK7A 3QOPA 1RUH2 3VZLA 1GV9A 2R1BA 3WVJA 1SACA 3LA2A 3M4FA 3ZXGA 4CDXB 3H1MA 1MS0A 4FTEA 1AR62 1DQ6A 1DBNA 1AR82 1RVF2 3CJIB 3KT4A 4L9BA 2CYFA 1EAH1 4AQTA 5GZDA 3VZKA 4HETA 4P9WA 3AXEA 3MLLA 2D97A 1RUH1 1A78A 1H4GA 3RZZA 4CTEA 1DYKA 2BUKA 1RUI1 3IT8A 1AJKA 4A3XA 2PN5A 2D5HA 1VBB1 2D3PA 2ZAAA 3MIDA 4Q4X3 4QGNA 4Q0SA 4AWDA 1QJX3 1PO12 4EN0A 2JG8B 1ENQA 5CG8A 4DXZA 1OOPC 3GALA 2MPFA 1LCLA 2OIIA 4QQLA 2BWAA 1V9U3 4PBOA 3ELNA 3VBHB 4IV1A 2WQ4A 1FOD1 3J8F3 2JKBA 4GB31 3EXUA 4ISRA 5D1IA 1R093 4M3CE 2WIIB 4KBBA 3RYKA 3MIEA 1NXMA 2WA3A 4B4PA 1ZZ8A 1RUJ1 1FMD3 3VZMA 1ZZBA 1CAWA 4XDQA 1H8TB 4M3CA 5H9PA 4GALA 2GC2A 1C57A 5D8AB 4ZKTB 2E7QA 1FV2A 2P37A 1PVXA 2HWF3 3N35A 4YNIA 1QWRA 1HV1A 1CR7A 4AEDB 1XNDA 1LOEA 1RHI2 2BW8A 1UU5A 5CG9A 1Y43B 3ZIWA 1KS5A 4L99A 2WT1A 3IMNA 4OHWA 4I0AA 3ZSKA 4E4ZA 1VBC1 1S0DA 4Q4Y1 1H9WA 4C1WA 4M0HA 4E2GA 5BYNA 5LEKA 5IUQA 2B7YA 5I0TA 1LB2A 4F7ZA 5C8CA 3USSA 2R49A 3AZVA 2C9AA 4ASMB 4L2NA 2HEWF 1SCSA 4WV8A 3RYRA 4ATFA 1N3PA 2X29A 5FO9B 3MI8A 4FT8A 4TZDA 3URFA 5EYYA 1IGOA 2WS93 3EQEA 5E16A 2ZAHA 1AXKA 2GC3A 3VBOB 2PLV3 1QOTA 5KHHA 5BNNB 3W59A 1KXGA 3RPQA 3AP9A 4LUKA 1LOBA 4LBLA 5JI7A 3ZN6B 5C4WC 4ZU4A 2VGDA 4FCAA 2XLGA 2ATFA 1AUYA 4HLTA 4J1XA 1IS6A 1QHDA 2NMOA 1J3QA 3POWA 4E27A 1K5MB 3UKNA 2RS11 3ZXKA 1Z7S3 1OQEA 4KNCA 1ULGA 4NOTA 5K8SA 2RMU2 3AYCA 4PDWB 3FUQA 2HWB1 5JI9A 1LULA 1XE7A 5A33A 2YHJA 5HXVA 2IXIA 2FZ1A 4K9SA 5T5OA 3WXPA 4FAGA 5FBZA 3WV6A 4AI0A 4UW3A 2WNUA 4Q0QA 2UU8A 1ZVFA 5C8CC 1WD3A 2DUOA 2EF6A 3J26N 2WNVC 1U5XA 2UWBA 1WLDA 2OZJA 3VKNA 1CAVB 1QXJA 4GULA 5GZGA 3S6PA 1F2NA 1GICA 2I07B 1BBT1 5DXDA 1XU2A 4N9IA 3MPPG 4BZ4A 2UURA 2VMGA 1O3RA 2ZGSA 3OBTA 1VALA 4NWVA 1VAMA 3SCGA 4YM0A 3E5XA 4Y4YA 1CPMA 4HPKA 1SQ4A 1ZYBA 2ES3A 2TEPA 2ZGKA 3HN1A 4RL7A 5JCTA 2XJQA 3ZYRA 2GH2A 3MLKA 4X8NA 1WW4A 4JGZC 3TRSB 1ZM1A 4AVVA 3HQXA 4IL7A 4BYYA 1LOFA 2G9GA 3AK0A 1POV3 4AXOA 3RG0A 1J1TA 3PMEA 4I0BA 1C1LA 5L19A 4L92A 2A75A 4LEJA 3VLBB 1QH6A 2ET7A 3I7DA 4YW4A 5BNPB 5AC93 4AVSA 5I93A 3N3HA 1QGLA 4W65A 1LGBA 4CDQC 3S0MA 2PAEA 2WNUC 2WC2A 3LKJA 2OVUA 4WM7A 3VKMA 1KDMA 1C8M2 1XRUA 4RFT0 3KS7A 2Q4SA 5JIUA 1Q5OA 3AJYA 4MX3A 1F31A 2KA3A 1RUF1 3EHKA 3GYDA 5FQ0B 5HBAA 3BPZA 5L7OB 1PIV3 1HRV1 5SV5A 4K6BA 3B3QE 4HN0A 4K1ZA 2I45A 3A0NA 3IPVB 1ZRDA 3ZX7A 3L2HA 2R0FA 1YO8A 2WSVA 3DPRA 5CFDB 1FNZA 1O5LA 4FOVA 1F8VA 5AVPA 1HIXA 3VBRC 1X33A 4N53A 4HSJA 1N1TA 3V56A 2DVBA 4FPKA 3AZYA 3FMGA 4MXWB 4MLOA 4XBLA 2AGSA 4RS5A 4WZCA 1H2KA 4DFSA 1KJRA 2GC0A 2H0VA 4N43B 3ETQA 3QBQA 3RMYA 4AHWA 4COZA 4JVAA 1W6MB 4R9DA 4JGYB 2DVGA 1PM7A 1AVBA 1NE6A 3LGRA 3H1WA 3WT3A 1RJ7A 1JHNA 1O4YA 1MQTA 4YVSA 4WM7C 1BCXA 3TN93 2I74A 1DLLA 4PBPA 1ONAA 4WZFA 2OZ6A 4LR4A 4Q4X1 1MS3A 1QJX1 3TNPB 1R083 4XTPA 3WG3A 1U0AA 3VHOA 1UCXA 3MF9A 3RJRA 5ACA3 1MS9A 1OA2A 2GN3A 4XF3A 1JYCA 3POYA 3RSJA 1LJ7A 1V9U1 3JQXA 1H0BA 3MPBA 2O8OA 3ZDSA 3LOIA 2WNEA 1GYKA 4H55A 1SLTA 2JG9B 3ENRA 3J8F1 5F6LB