1WW6A

Agrocybe cylindracea galectin complexed with lactose
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
160
structure length
160
Chain Sequence
TTSAVNIYNISAGASVDLAAPVTTGDIVTFFSSALNLSAGAGSPNNTALNLLSENGAYLLHIAFRLQENVIVFNSRQPNAPWLVEQRVSNVANQFIGSGGKAMVTVFDHGDKYQVVINEKTVIQYTKQISGTTSSLSYNSTEGTSIFSTVVEAVTYTGLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords galectin
publication title Structural Basis of a Fungal Galectin from Agrocybe cylindracea for Recognizing Sialoconjugate
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 38
structure length 160
sequence length 160
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ww6A00
2WSUA 5JOYA 4FPKA 2P3IA 1UL9A 4NO4A 4FOYA 4Q27A 1W0PA 2BQPA 4W65A 5EWSA 5T5PA 5CAZA 1BQPA 3ZSJA 3ZXJA 3GNEA 3TB0A 4GKYA 1CPMA 1GBGA 1DQ4A 1WUVA 4XJAA 1LTEA 2EF6A 3AX4A 1AXYA 1ZA4A 4UW5A 1ULFA 2D43A 4K21A 2JE9A 1AJKA 5CNAA 2OUHA 2A6VA 3WDWA 1UZZA 1N3PA 4PQ9A 4BQ1A 1MACA 1YI7A 1FAYA 4GWMA 3VKNA 1S0EA 1AX2A 3INAA 3AJYA 1DGLA 2ZMLA 2PHUA 2DVFA 4YW4A 4XBNA 3ZSMA 3AFKA 1W6OB 2A6XA 3V0BB 1IS4A 2VXRA 3OBRA 5IK4A 2CYFA 3VUOA 2WT0A 2CNAA 4GXLA 1HQLA 3ZXLA 2ZGMA 4UW3A 3AJZA 1LJ7A 4LBOA 1MZ5A 3UK9A 1DLLA 3WCRA 2AUYA 1NXD1 2JJ6A 4M01A 5JLVA 5L73A 1WD4A 2JE7A 4FPEA 5KXBA 2PHRA 1LGNA 1MS9A 1N1VA 2ZHMA 4WVVA 1SFYA 3UJQA 2SBAA 5DZEA 1GZWB 1W6OA 4FVVA 2E53A 4LBNA 1URXA 2E7TA 3ZVXA 1MS1A 3B3QE 1GNZA 3B01A 4WV8A 3AZWA 4R9BA 1C1LA 1LEDA 1LESA 1Q56A 1SLAA 2WKKA 4DPNA 2AREA 4Q8KA 1YYNA 1CESA 4K20A 4LBQD 4XMAA 1UKGA 4BLIA 1UAIA 4TZDA 1KRIA 1CPNA 2P2KA 2A6YA 2ES3A 2ZZJA 4YFZA 1LU1A 2GMPA 4XIOA 2GNDA 2ZACA 4Y1YA 4CRQA 1MZ6A 4FPCA 1QOSA 5GLVA 1IS5A 4AGVA 5GZFA 5H9QA 1GYKA 3WLUA 1JXNA 2AYHA 1S0FA 1Q8QA 2PHFA 1LULA 4XJ9A 4ZXKA 1C4RA 4FPGA 2UWCA 3A0KA 3RSJA 1V00A 3N7MA 4YM0A 2PHXA 5GLUA 4AYUA 1JHNA 5GZCA 3GALA 1A3KA 1KQRA 3OGGA 3USUA 3R4UA 2GMMA 4ATFA 2HYKA 1G7YA 3M3CA 1Q8VA 4FPFA 5CA6A 1AX0A 2ZGPA 1CIWA 4YG3A 5IK7A 4FPJA 5SV8A 2YROA 3WG2A 1ULGA 4R9AA 5GZEA 1KDKA 4AGRA 1WBFA 3W59A 1UMZA 1V6NA 3WCSA 3AP4A 4PF5A 1LOAA 2DV9A 1LOCA 4YZ2A 3BIWE 1DQ5A 1LHWA 1OQ1A 1H9WA 2ZGNA 3WDUA 5JDBA 1WLWA 2DUPA 3IKWA 1UZYA 4BOWA 1ULEA 5EYYA 2EXKA 1DBNA 3AZXA 3B69A 5F9TA 4H55A 1W6NA 1VAVA 3LSEA 4Y22B 1LGCA 1W6PB 5IUQA 4YZ3A 3VV1A 4ATEA 2DU0A 1N3QA 3MEPA 2EIGA 4YW1A 3OY8A 4YW2A 1MS8A 2JECA 5GM0A 4XE9A 3RMYA 2DVBA 1SCSA 3O12A 3O0XA 1IKQA 2LALA 4DRVA 1WW4A 4YM2A 2GNBA 1N1YA 1YO8A 1DYKA 5H9RA 3Q9OA 3SH5A 2ZGOA 3R4SA 1MS4A 1OFSA 3AXDA 4Q1RA 1SLLA 4FPYA 2ZGKA 3AYEA 1TEIA 2UURA 2UWBA 3ILFA 1WD3A 3WV6A 3SH3A 4R9DA 4FOWA 1AJOA 3PVNA 4AVSA 1G9DA 3FUOA 1G9CA 2ZBJA 4SLIA 4IQPA 3IPVB 1GICA 1HQWA 4XBLA 3UJOA 1SLTA 1SACA 2OVUA 1LHUA 4P9YA 4XMIA 1PZ9A 2D3SA 3AP9A 2EXJA 1JOJA 4XJ8A 1QOOA 1CR7A 3CNAA 3MW4A 1MS5A 1V6OA 3ATGA 3VKOA 4YFWA 1W0OA 4GWNA 2EALA 4AWDA 5GLWA 4WZFA 3SH4A 2GMEA 2NZ9A 3AP6A 2ERFA 2DVDA 1S0IA 2G4IA 2W08A 1MR5A 4JC1A 4HL0A 4XXPA 4D69A 1A8DA 3AZYA 4XZPA 5HCAA 4XJZA 2VUAA 3BODA 1LODA 1DFQA 2VU9A 1S1AA 2D6PA 2A3XA 1QDCA 2VW1A 3W58A 2DVAA 2FHRA 3IMNA 3ZYRA 3TAYA 1Y7BA 2E7QA 5GJ6A 3RS6A 2I2SA 1GLHA 2A75A 4DRRA 1FX5A 5GZGA 1G9FA 2E6VA 4U2AA 3QLQA 2W39A 4FQ4A 1S0CA 1JW6A 3WDYA 4FOVA 2AH2A 5FREA 3WHTA 3T2TA 4XXAA 2R0HA 3C2UA 2C9AA 2B7YA 3NV2A 4XBQA 4U36A 3QCWA 2D3RA 5DXDA 1BYHA 2YV8A 2YMZA 2ZGTA 1ULDA 1CJPA 3V0BA 2ZABA 1GKBA 1KJLA 2XB6C 2NYYA 1APNA 4ASMB 2CTVA 5IT6A 3ZXEA 4XYXA 3POSA 3VKFC 2W68A 4FPHA 1GSLA 1V6KA 3POYA 4GKXA 4XHXA 1AXZA 3WG1A 1DHKB 4FP3A 4XIKA 3V65A 3V64A 2OUJA 2OW4A 4Y1UA 4M00A 1U0AA 2R1BA 1V6LA 5DZFA 4P9XA 1YRZA 1GZWA 1LU2A 1JYCA 3A0NA 3ENRA 3M1HA 1RITA 1FV2A 3FUQA 4NOTA 4P9WA 2ZGUA 5E88A 1VIWB 3BTAA 1G9AA 1SLIA 4YGBA 4FQZA 3ZSLA 4M3CB 5DUVA 3MW2A 5GLZA 3M3QA 2A7AA 4Q26A 5F5QA 3N7JA 1QDOA 1S0BA 1DYPA 2EXIA 1V6JA 1LHOA 4XJUA 3WOGA 3WUDA 3I4IA 1FV3A 4M3CE 1WLCA 4XTPA 5DUUA 4BLJA 5GLTA 1BJQA 2H0BA 1G86A 2ARBA 3WDVA 2D6NA 4P14A 1WW6A 1JYIA 5T5OA 1DQ6A 3OPZA 4YM3A 1F5FA 3R05A 4FPLA 1SBEA 3AK0A 1SBDA 1W6MB 2WJSA 3VKMA 1VAMA 3DGTA 2DVGA 3V0AB 1AZDA 1PZ8A 3OYWB 4K1ZA 2NN8A 2CY6A 2EXHA 2ZGQA 2PELA 4YGCA 4YW5A 3BOPA 1GZCA 5HCFA 5T54A 2ZMNA 1GZ9A 2R49A 4JRAA 2JKBA 3PMEA 4OZXA 2GNTA 2ZGLA 4BPZA 1S0JA 1FNYA 4LBMA 1CONA 3SLIA 2WQZC 3WG3A 2CWMA 4AGGA 4DFSA 4YZ5A 1FATA 4PCRA 3PVOA 4JCKA 3ZXFA 5GZDA 2ENRA 4LBQB 3N35A 3ILNA 4WVWA 1SLCA 1QOTA 3L2YA 3N7KA 1CN1A 4ITCA 4Z8BA 5KXEA 1OKQA 4YG0A 2DWRA 2WNEA 1IKPA 1LHVA 1LGBA 3JU9A 4Q1PA 4UW6A 1F9KA 2UWAA 5JOZA 1Q8SA 4YZ4A 1AXKA 1JN2P 2V73A 2GN7A 5FRAA 3O5SA 2A3YA 3FFZA 1ENQA 2VY0A 1X50A 5KXCA 1S0DA 2PHWA 1CVNA 4Y22A 5CBLA 1XQNA 1W6PA 4ISRA 1D0HA 2A6ZA 4AVVA 3IN9A 4YM1A 5DG1A 1DQ0A 2R16A 2D6MA 2DU1A 3AP7A 3FLTA 2TEPA 4CTEA 1DQ2A 3RG0A 5BYNA 4BMBA 1QGLA 1WBLA 2VW0A 1QNWA 1VALA 3WNXA 1GV9A 1HDKA 1LOGA 1ONAA 1BKZA 1MVQA 1Z0HA 2AR6A 2CWSA 2ZGRA 3N3HA 4YZ1A 3M3OA 5EYXA 4RL7A 3HN1A 2Z42A 2ZHLA 3N36A 2NMOA 2V5YA 3POWA 2AGSA 3FLPA 1MS0A 5JOWA 5IK5A 4YLZA 1Z78A 3KM5A 3WHUA 2EAKA 1G8WA 1AF9A 5T5LA 1RIRA 1KJRA 4FPOB 4I30A 4Y1XA 5GALA 2YY1A 2ZHNA 4BMEA 4DQAA 3IPVA 3M2MA 1N47A 2DUQA 5AVAA 1V6IA 3N7LA 3O0VA 4BM8A 3NV1A 4YGEA 2NP0A 3ZXKA 2A6WA 1O4YA 1LOFC 2VH9A 3APBA 3PVEA 2P34A 1O4ZA 1ULCA 3LCPA 1BZWA 2ZKNA 4Q8LA 1ENSA 3I8TA 1HKDA 3UL2A 2A5ZA 5H9PA 5EXOA 2KM2A 2R0FA 1B09A 3MW3A 2JD4A 4LBKA 5CB7A 4LBLA 2E51A 1Q8OA 1UPSA 2DTYA 4M3CF 3ZSKA 1N1SA 3ASIA 1W6QB 5DG2A 5T55A 2GN3A 2P3KA 1ZM1A 2WT1A 3PJQA 1HLCA 4Q2FA 5E8AA 3U4XA 4FP2A 4FOQA 4YGDA 1I3HA 2DUOA 2A71A 2YZ4A 4GALA 5JMCA 1KDMA 2WT2A 2ZA9A 5IK8A 2D6KA 4MYEA 3SNMA 1WW7A 3ZPYA 3OJBA 1V6MA 3FBYA 4UW4A 4XHBA 3HR9A 3RQ0A 3VKLA 4DS0A 2D3PA 1DZQA 1YIFA 2DURA 3A4UA 4F83A 1IS3A 1QKQA 1N3OA 1WW5A 1N1TA 2P37A 1LCLA 2PHTA 2UU8A 1WLDA 2VW2A 1W6QA 2FMDA 4R9CA 3MPPG 1LOEA 1YXWA 1LENA 1ENRA 5T50A 2GNMA 3AZZA 1IOAA 3SISA 3AYCA 1NLSA 2ZAAA 3JUUA 4Y20B 1R1ZA 1QMJA 2A3WA 3USUB 1UX6A 1MVEA 1AX1A 2W52A 4Y24A 3H0OA 1UN1A 5LK5A 1F31A 1QF3A 3NV3A 3B9CA 1SLBA 2DYCA 4XTMA 1GANA 3SITA 1VLNA 3LSDA 4C1WA 4ISQA 3WUCA 1WCSA 3D4KA 3ILRA 2D44A 3FLRA 1SCRA 3IM0A 3NV4A 1D2SA 4M3CA 4YW3A 1KITA 1C57A 1AVBA 5DUWA 2P3JA 2WLQA 2R1DA 4XJWA 4Y20A 3WG4A 1RINA 2GDFA 1BXHA 1EPWA 1LOFA 1QU0A 3T1LA 3WZ1A 1QNYA 1LEMA 1W6NB 2ZMKA 3KQRA 4XDQA 3WDXA 2D7FA 4CZSA 1J1TA 1JUIA 1PZ7A 3HMYA 1SBFA 2C5DA 5DZGA 1Q8PA 3OBTA 2DTWA 2GALA 4K1YA 1DQ1A 4C1XA 1W6MA 1DIWA 5HCBA 3RMXA 1LHNA 3OY8B 3T1MA 3RRDA 3V0AA 4LBJA 4XILA 3AYAA 3OYWA 2WSVA 2AENA 4HANA 2XG3A 2A70A 5JVVA 4Y1ZA 1FYUA 1A78A 1LOBA 1H30A 1G9BA 1GNHA 1H9PA 1I1EA 3O0WA 4Y1VA 3DUIA 5KXDA 5H9SA 1JBCA 1C1FA 3ZYPA 3B00A 3D5OA 4PBOA 3NWKA 1FNZA 2ARXA 1LECA 2D6OX 4LBQA 4Y26A 3WDTA 3D6EA 3WVJA 2CL2A 2YXSA 3AYDA 3AXEA 3AP5A 2NMNA 2NM1A 4KBBA 2ZHKA 2JDZA 4YG6A 1S0GA 4GA9A 3M3EA 4XOGA 3AZVA 2LTNA 1IS6A 4PBPA 2ZGSA 2D6LX 4TYSA 2RHPA 4RA0A 4ZKTB 4L8QA 5E89A 4AVTA 1CQ9A 5JOXA 5T5JA 1MS3A 5T52A 2Q5TA 2SLIA 5DUXA
chains in the Genus database with same CATH superfamily
3DPRA 3HAGA 1BEV1 4JVAA 3D82A 5KR7A 4H7LA 1UOBA 5CISA 1T6BX 2VUJA 5EWSA 4QKDA 4LO6B 4OMCA 5IVYA 3ZSJA 5FPLA 4BHPA 3TB0A 5BNNC 2Q1FA 2C6SA 1DQ4A 4I0BA 1W05A 1ENXA 2PA7A 1M4WA 2WNVC 4J25A 5K0UC 4HFSA 1ZA4A 1PX4A 1OA2A 2AACA 1VMFA 2D43A 2MEV2 3GZAA 3NNFA 2O1QA 1W9FA 2WWUA 4GWMA 1KS5A 3RDIA 5KHKA 4O7XA 3INAA 1AX2A 3VKNA 2CHHA 4IEUA 3C7GA 3A21A 2FDIA 2YU2A 2PHUA 5BY5A 3THTA 4N8MA 2KXLA 2R061 3ZSMA 1ZA7A 2WBKA 5JPNB 5JSOA 1ZRFA 1OLMA 2CYFA 3MF9A 4JDNA 4CCKA 4PQQA 2XHNA 4CUGA 1XOYA 1H2KA 3RYKA 4QGNA 2VQUA 4A7YA 5FIXA 1NXD1 2JJ6A 2DBNA 5IATA 5JLVA 1EV12 4HN0A 1WD4A 2WFF3 3WP5A 1RVF2 5JXGA 5KXBA 4JGZC 1MS9A 3FC0A 3IAPA 5LWBA 4LKFA 2XGXA 1SFYA 4DXZA 3VL9A 1KFUL 4OHWA 4ZHNA 2IUWA 1W2AX 4MUVA 2J42A 4FVVA 2E53A 4PLOA 1URXA 3ZVXA 5JCTA 1MS1A 2TBVA 1GNZA 4KI5M 3T0DA 2YHJA 1AR82 1UOFA 3AZWA 1C1LA 1Q56A 4N43B 1RUH3 5CFDB 2R6QA 2VZUA 3ZIXA 3OPWA 1CESA 4K20A 4XMAA 4BLIA 1UAIA 1UY0A 4E4SA 4NR1A 1CPNA 3HIFA 4GB32 2P2KA 2ES3A 4YFZA 1REFA 2GMPA 2GZWA 5ISLA 1UYYA 3GZTB 4CEYC 1GFF2 4KQ7A 3J4UH 1QOSA 2FBEA 5H9QA 1AR61 1JXNA 1OOPB 1Q8QA 4JAAA 1LULA 4QPGC 4XJ9A 4N43A 2UWCA 4Q4X2 2OQ6A 1RUC3 4AYUA 2GH8A 2ZXQA 4IGOA 5L7OB 1HX6A 1PO22 1KQRA 4FT8A 4BQXA 3R4UA 4ATFA 4EWDA 4COUA 2HYKA 2Y6KA 3IZOA 4GJZA 1Q8VA 4AR2A 2W1UA 3CZUA 3N9MA 5ERLA 2HYXA 1SQ4A 4FPJA 4K8RB 4W50A 5SV8A 3VBFC 5JI9A 1ND2C 3E1F1 4AI3A 4AGRA 1WBFA 3AKRA 3HBZA 5DDJ3 4URAA 4JKKA 1UMZA 3WCSA 3ZKYA 4DINB 3HPNA 3T08A 4AI2A 3LFMA 4Q0PA 2ZKLA 4CUAA 1LHWA 1OQ1A 2Y6JA 4C91A 5L7OA 1H9WA 1ACCA 2QQVA 2BW8A 4IEWA 3WDUA 4QDQA 5HV0A 2K9ZA 2DUPA 3IKWA 3VBOC 5FPUA 5EYYA 2EXKA 4OMDA 1PK6B 3K4ZA 2KD7A 5LCWL 3AZXA 3B69A 4ONUA 5F9TA 5LK7B 4LKSA 2R7EB 5LW9A 1VAVA 1BVP1 4J6GA 4Y22B 4RQPB 5A3MA 4QQ2A 2XJUA 4YZ3A 3MICA 3VV1A 3VHRA 3OPTA 2PHDA 2EIGA 4X8PA 4XCBA 3MYXA 5IJRA 1TNFA 1VRH1 3ZXDA 2QTWB 5ANNA 5DAVA 3DKWA 4PDWB 2JDKA 2QZ2A 1HRI2 5AVPA 4GH4B 5FP4A 1H6XA 4LHLA 5D8AC 4XFCA 5H9RA 1PK6A 3D0JA 2B5HA 3OGSA 3T4HB 1OFSA 4TTGA 2D5HA 4HSJA 5FV3A 3IDAA 4HVRA 3AYEA 1QJX3 2UWBA 4RQPA 2WO3A 1V0AA 5EFUA 1C8M2 1AYM1 1HB3A 1H8TB 3SH3A 3KD4A 3UKTA 3PVNA 3ZXGA 1G9DA 2ZBJA 2CDOA 2E33A 1GICA 3J8F1 4YVSC 3UJOA 4EN0A 3BALA 2OVUA 3OD4A 4C8DA 5C8CA 3KV9A 2BGCA 3LKJA 2YPJA 5HPOA 3AP9A 5A3LA 2JDPA 2WN3A 3MW4A 3RGBA 1HB2A 1V6OA 4GWIA 4N7IA 2D40A 3VKOA 3ZPOA 4LO8A 4CDWB 2C26A 3GDBA 4YFWA 3LB9A 2R041 3PIGA 4AWDA 5GLWA 4WZFA 4DEVA 1ZZ9A 4FO9A 4HBNA 3WX5A 2BJSA 2IXJA 1L3JA 2BFUL 2DVDA 5L9RA 4LA2A 4MVTA 1RUD3 2RE9A 2W08A 4XXPA 4JC1A 4M4RA 5DN2A 4D69A 3P5BA 2RDRA 5HCAA 2Y34A 3WNMA 2VNVA 1QXRA 3CJIC 2WS91 3POJA 5CU1A 2VU9A 1H2NA 5FMOS 1J1LA 4KU8A 2G9GA 1PVC1 2YPDA 4Q4V3 1DYOA 4AEDA 1WMXA 3IWZA 3W58A 4CDWA 3IMNA 5F1RA 4Z92B 5AC93 3WQBA 4ZU7A 3BTXA 1DGWX 3OD0A 2I2SA 3RS6A 2LROA 4UAPA 3ZLIA 2AC1A 4OHXA 1K3IA 4Z07A 1JW6A 3NW4A 3WHTA 2E26A 2DF7A 4XXAA 3C2UA 3I3QA 5C3RA 4U36A 4IV3C 1X9TA 1PO12 4G4FA 3ZN4A 1BYHA 1VBD1 2X8KA 3BIEA 2IXHA 4AFCA 4AVCA 1QJU2 2W87A 4PHZA 4OQ9A 1APNA 4ASMB 1H1IA 4JV4A 1IQAA 5FZFA 3VBUA 2W68A 5LA2A 1UY2A 1GSLA 3IDCB 4Y5SA 4IETA 2BNOA 1VP6A 1IG3A 1TG7A 4WBBA 5LY1A 3POGA 2HBUA 4I02A 4QD2A 4XFGA 2Q4SA 4XIKA 3V65A 3I7DA 3V64A 3LE0A 2JG8C 4M00A 5HBAA 2R1BA 2DBIA 4FCAA 2FZ1A 5A33A 2GH2A 3RZJA 4C0HA 5IVEA 3KS7A 4NOTA 5E88A 1T6GC 4QDRA 2ZGUA 1VIWB 3CU7A 1PIV1 1G9AA 4YGBA 2PMWB 5DUVA 3S30A 2ZTNA 5CKMA 1QJFA 4MHRA 4AL9A 1DYPA 4XJUA 4B4QA 2DCKA 4R52A 4BLJA 2G1MA 1YWKA 4NHLA 5GLTA 1BJQA 2BBAA 2H0BA 2JDYA 4PLNA 3I3MA 3WDVA 4MGYE 2JDHA 1RB8G 4W6XA 4P14A 3T2PA 5E16A 3H8UA 3RPQA 1DQ6A 4NIGA 1DCSA 1C3HA 1F5FA 4AG4A 5LRSA 3O1OA 4XUNA 3ZM8A 3AK0A 1OUSA 1GP5A 5F3EA 5IVBA 1W6MB 1TMF1 1L7RA 2QDRA 3K4AA 4QQOA 3VKMA 3ZYJB 2DVGA 3O1PA 4EJRA 1J59A 1WMDA 4BQ5A 3OYWB 4K1ZA 2WA3A 2ZGQA 2EXHA 5DAWA 4WZCA 2RS13 3ZN6A 2X5IB 1QJY1 5FZIA 2HBTA 1S0JA 3WG3A 1CONA 1W28A 5ABJC 4E4HA 4YARA 2JG9C 5KWRA 4JGZA 2Z5WA 3FHAA 3THDA 4NHXA 1O7FA 1FOD3 1P8JA 1DGRN 3LOIA 3W20A 4ITCA 2PFWA 4CPBA 3CKHA 3JBG2 3AC0A 3VZLA 5JOZA 3ZFEB 1ND3C 3PU8A 3LD8A 5BXXA 1AYM3 4JQRA 3MIHA 1JN2P 3PJYA 1RUJ1 2GN7A 4ORFA 4OQ8A 4ZS2A 5FO8B 1OVPA 5IVCA 2IFWA 2PHLA 3NO8A 3FFZA 3LAGA 3U4SA 3ZSEA 3NVCA 1VB4A 4TXWA 1PMJX 3IIIA 3OG2A 4R4ZA 3P3NA 4KMQA 4ISRA 2JB8A 2WZR2 4F3JA 1RTVA 4GD4A 4CEYA 1UY4A 2D5FA 2XR4A 4YM1A 5DG1A 1UXXX 2D6MA 4CTEA 1RUE1 1NA1B 1WGPA 4GWJA 1QGLA 2Y64A 4RHV2 1HDKA 1LKNA 1LOGA 1ONAA 1MVQA 3J7MA 2AR6A 2HWC1 3N3HA 3M3OA 4IE5A 4NAMA 1OA3A 1W8UA 1YNAA 4GIQA 4XFFA 2RR12 5JOWA 3CLPA 2WS93 5FWEA 3K3NA 1PVC3 2V4AA 1Z78A 3FN9A 4C90A 1OMIA 1SEFA 1RIRA 1XSQA 4JX0A 4BK5A 4Y1XA 4BWOA 1K5MB 3DCQA 1XRUA 2IXCA 3CMGA 4LHNA 1NA1A 2WO2A 3TWIA 3VL8A 3BI3A 2DUQA 4QMAA 1NCQB 3P1IA 3N7LA 4LKEA 1ALYA 5JMOA 1RJ8A 2J1TA 2WN2A 3IAQA 2PTMA 3ZXKA 2VH9A 4QX8A 3PVEA 3W21A 5C4WA 1QWRA 1ULCA 5FZDA 3RJRA 1VBD3 1BLZA 4QWNA 4CDQC 4Q8LA 3KHBA 1ENSA 3M8LA 3I49A 3LPGA 1HKDA 3TYJA 2A5ZA 5EXOA 2H6CA 2KM2A 4KGQA 4LUMA 4ET7A 1BBT2 3DECA 3MW3A 4E8CA 3KMHA 5CB7A 3JD71 4HN1A 3B9IA 4HVOA 2E51A 4K3UA 4Q0QA 1TNRA 2WAOA 2WT1A 4MLOA 1NKGA 2QQWA 3GJAA 4I0AA 4Q2FA 4QU1A 4QX2A 4COVA 5FO9B 4COWA 1I3HA 1OD3A 3VHNA 1COV3 4GALA 3E6CC 5F3CA 4MGIE 2XBO2 3TBDA 1AR91 5FZHA 3UYJA 3P6BA 2WT2A 3VBRC 4LJHA 2W0XA 3C7EA 1WZXA 4MYEA 5J37A 4UW4A 2WFPA 4XHBA 3RQ0A 1E5IA 3E5QA 3Q8EA 1DZQA 3ZFFC 5C9AA 4IEXA 4HK8A 3GBFA 1YCIA 2DURA 4TSVA 4F83A 2E7AA 4CDXB 2XLFA 1YFWA 4LORA 1N1TA 3TAYA 1CWPA 1WLDA 4QPWA 4WM7A 2B4KA 4PT6A 3WQ0A 5C6CA 2MEV1 2VUCA 2XLGA 4P9GA 1R1A2 2BWAA 2P5BA 3I59B 3P3PA 4IERA 4NWVA 3LFIA 5A7QA 4YPJA 4FAHA 5C33A 1IOAA 3SISA 3AYCA 3JUUA 4AFAA 3VDCA 4BQ3A 1QMJA 2Y0IA 5FXVA 3USUB 2VR4A 1HW5A 1PNGA 3BU0A 3U11A 1AX1A 1VPHA 2W52A 4Y24A 3H0OA 5LK5A 1F31A 1QF3A 3DPRC 4QQHA 4UI9L 2A1XA 2C4XA 3AMHA 1SLBA 3SITA 4QDSA 3LSDA 3RZHA 2VCMA 5I0RA 4L92A 4HLTA 5ACA2 3FX3A 3MIDA 5DAXA 1QJY3 4UFJA 1K45A 1SCRA 3H3LA 1VBB3 1IPJA 2BVBA 2YC0A 1C57A 1AVBA 1O8SA 2EA7A 1EV11 1UU4A 4JGYA 2XDVA 4QU2A 2P3JA 5DUWA 4FTBA 1NOVA 1RVF1 4A6SA 4BA6A 4CCLA 4I2OA 2GDFA 1GOHA 1LOFA 2QDNA 4LNVA 3T1LA 4AHYA 2BYVE 2HWD2 3OF1A 4FI9A 3VZNA 3THCA 1US2A 1W6NB 3RZLA 4AI8A 4OI2A 3C7HA 1AR81 3O7OA 4AEMA 4XUOA 3CZJA 4ZONA 3VZMA 3OBTA 5BNPB 1UW8A 1RUJ3 1ZYBA 2H6BA 4C1XA 1JH5A 5HCBA 4LR4A 2E32A 3MDPA 3LA3A 3WW1A 3RRDA 2PQQA 1OD5A 2ZX1A 4XILA 3WW4A 2WSVA 3H9AA 4GB31 1XJAA 1HN0A 2HEWF 3CDZB 2GC0A 2HWB1 1A78A 1DZRA 1LOBA 1H9PA 2W47A 4IXLA 4A42A 4KBZA 3NAPB 5L9BA 1H4HA 1C1FA 3POBA 2IWGB 4EZ4A 1NQDA 1PGW2 5FY8A 1JYTA 1E5RA 3D5OA 4TLGA 2E31A 2HWC3 2PQSA 2YBSA 3MLJA 5LB6A 2ARXA 4W8JA 4Y3OA 1RUF2 2VMIA 2W94A 4AFMA 1Z7S3 2G9ZA 1UXZA 5DQ0A 1HV1A 1RXFA 4UFHA 1A6CA 4F7ZA 2OPKA 4NHYA 5FZLA 4QPYA 1DU3D 4COZA 2ET1A 2VO5A 3M3EA 2KR2A 4IV1B 4IEZA 3TNPB 3WNKA 4ASKA 2W46A 1AL0G 2ZGSA 4PBPA 3GHMA 4H3WA 3LA2A 4MOAA 4XUPA 4ZKTB 5JZGA 3VHPA 5T52A 4FFFA 4JDMA 1UOJA 4LE3A 3MIFA 4MX3A 4A6OA 2NLRA 2RS52 2P3IA 1H2LA 4OI1A 1UL9A 2VTFA 5LBFA 2IXIA 3U37A 4CEWB 2QQNA 1W0PA 2BQPA 3U07A 4N43C 1EAH2 3X29B 4QKNA 1ZZCA 1LRHA 1XYOA 2J1RA 3GNEA 3OUHA 1AR72 4P9LA 1GNYA 1POV1 2QCSB 5BNQA 5F5CA 1XBFA 1U5IA 1AXYA 5JAXA 5FPZA 3AFGA 4K21A 4OCTA 2G9FA 4E4ZA 1R082 2QQPA 1OPOA 5CNAA 2A6VA 1Y9GA 5FZCA 2C1FA 4IEVA 4YVWA 5KC6A 1XNCA 5FZOA 2TNFA 4JKLA 4UWDA 1HRI1 1CZVA 2JG9A 3VZKA 1AR93 4YW4A 4XBNA 2CAVA 4B8EA 2ZZQA 3OBRA 1OQDA 3I2IA 5IYYA 5L7OC 2YGMA 3N4MA 1OF3A 5FPXA 3ZXLA 2ATFA 1C8M1 3OBAA 3TEYA 4LTAA 3M4FA 1MZ5A 1Q5OA 1DLLA 1W06A 2AUYA 2QQIA 4M01A 2BRTA 5DAQA 3UK9A 3WCRA 4KWJA 2J1UA 2V09A 4UFIA 5L73A 1K12A 2JE7A 4FPEA 1US3A 5FXXA 4C0BA 3NJVA 1UIKA 4UF0A 1BK0A 4WVVA 4WVMA 3GZEA 3I2JA 4Z2AA 2SBAA 1V70A 4BQ4A 3PMSA 1GZWB 4QPIB 5CYYA 3M70A 3H7YA 1WA6X 1JYNA 3B01A 1ZBA2 2WNUA 2WKKA 1SLAA 1W0NA 3MHZA 4OZOA 4DPNA 3PUHA 1PK6C 4E8DA 4CU7A 2G19A 1UKGA 3NNGA 2XJQA 5E1RA 2VULA 4LUKA 4RQPC 2A6YA 1TVGA 4DY3A 4RR3B 4H2AA 2GNDA 2ZACA 4L9BA 1EV13 4D6QA 3TEXA 2IXKA 5C8CC 1YHFA 4QPIA 1JYVA 1IS5A 4AGVA 1U5ZA 5DMYA 4WM8B 2YDEA 3WLUA 5IW0A 5C71A 5A6YA 1F4HA 1ODNA 4ZXEA 5A32A 4XETA 2PHXA 1QXPA 2VZTA 4FSJA 1XSRA 2XUMA 4CDUB 2GMMA 3LQCA 2XHKA 1PO11 1ULPA 3MIGA 4MSVA 5CA6A 2MPFA 1GR3A 1NCRB 4IE6A 3DL3A 4XUTA 4GB33 4YG3A 1QJU1 1UQXA 1ULGA 2HWB3 3WG2A 1SHWB 4WM8A 3JXSA 1W2TA 1ZZ7A 3ES1A 2D98A 1V6NA 4AEDC 4Q5OA 3AP4A 2BFUS 3HQUA 1AHSA 3LEMA 3USSA 5A6XA 3BUCA 1LOAA 1B35A 2XKPA 3VD4A 1IG0A 1LOCA 1Y9QA 4CDWC 4AHWA 1M06G 2PYTA 2FDKA 3ACFA 2QVSB 4HG6B 1MQTA 3GJBA 5JDBA 1WLWA 4MGZE 5FZ4A 4BOWA 4UFMA 4DZGA 4NRPA 4EV0A 4MXWA 3VBRA 4MH0E 1J3PA 2Z79A 1JZ6A 3K4DA 1MZEA 5K7PA 1TQ5A 2Y6HA 5IUQA 1E57A 1W2NA 1CX1A 3GYDA 4ATEA 4LLOA 2E9QA 4JTOA 4IESA 3RMYA 1AYN3 1VBA2 4XE9A 4K7JA 2GSYA 4MV2A 5L9VA 1SCSA 1KGYA 2RMU2 3LZZA 3O0XA 5FZ0A 3VBUC 3WF2A 1WW4A 1N1YA 2ZOEB 3VDAA 3CO2A 4HETA 1XNTA 3SH5A 2GP3A 1MS4A 2ARAA 2YBKA 3FFQA 1SLLA 2BV4A 3QBQA 4QX1A 3VBSB 2ZGKA 3PU3A 1WLTA 1XU2A 2OPWA 4NPRA 2R072 2VZQA 1SZBA 4FOWA 4Q4Y2 4R9DA 4AVSA 4E2SA 3GGLA 1G9CA 4IQPA 4LIVA 2CDPA 3GM8A 1QXJA 1UPIA 4XZUG 4BB3A 5C3PA 1PZ9A 4LK6A 2VQAA 2EXJA 3EXUA 1QOOA 3CNAA 4SBVA 5FY9A 1WMEA 4B1MA 3UKNA 3H3ZA 3LDKA 5FZBA 1VJ2A 2EALA 2IXLA 3SH4A 2QQMA 2B39A 2NZ9A 2RDQA 4OI4A 4BCUA 2HEVF 3AP6A 4DUXA 3JBG1 5FOJB 4HL0A 1C8M3 1A8DA 1QHDA 4XZPA 5FYTA 4QXCA 5CG9A 5EZWA 4CUCA 1LODA 1DFQA 3SXWA 1H1AA 3KV6A 1S1AA 2R30A 3T0AA 4O9EA 3S57A 1D4M2 2HWE3 3E97A 3DYMA 4QT6A 2VW1A 4BDVB 5FR3A 1FXZA 4RS5B 3U14A 3U10A 1J3RA 1Y7BA 2WZR1 4PIYA 5GJ6A 5I8YA 3T4VA 5I0UA 1W8OA 3B94A 2FCVA 4DNYA 1OLRA 3ECQA 4XF4A 1RUG2 4PIZA 2AH2A 4RHV1 1VBC2 5FREA 3WF0A 2R0HA 4AI1A 2B7YA 3WR0A 1CGPA 3PNAA 3B5LB 3QCWA 3MFCA 4NIIA 1VE0A 5FZMA 2D3RA 5DXDA 4CE8A 2ADEA 2VOTA 4WVZA 5DAPA 5FP7A 2RR11 3UETA 3VDDB 2ZABA 1GKBA 4HVQA 1CJDA 1KJLA 4KWKA 2CGNA 1SG3A 3MBWA 2B9UA 3POSA 4CXYA 1PVXA 5FWJA 3AMPA 1MEC2 3HVDA 1UNBA 3WG1A 4N90A 3KT4A 4DXSA 5FP8A 4EZHA 2OUJA 4EN7B 4E2QA 1X36A 1GU3A 4YW6A 1V6LA 4CCDA 5DZFA 2ZEXA 4NAOA 1D4VB 2RS32 1LU2A 3FHIB 3A0NA 4INDA 4QAWA 5EJ1B 3GCXA 1PO13 1SLIA 1XE0A 4LLFA 1PM4A 5A7OA 1GP4A 4I09A 5CFDA 4M3CB 3MW2A 4IE0A 5DABA 5F37A 3M3QA 1QJU3 2WLPA 1HQNA 2RM22 2ID4A 1S0BA 2OZ6A 4QXBA 3WUDA 1RMU2 2Y38A 3TN91 3I4IA 1BBT1 1FV3A 4M3CE 3WOGA 5C5UA 5FYYA 2EIEA 4HONA 3U75A 5LA0A 3BYWA 4NIDA 1G86A 2ARBA 3SKVA 4EQVA 1XB9A 2D6NA 1REEA 5T3NA 1NA1C 1WW6A 4QM9A 4RGGA 3OPZA 3EHKA 3UT0A 5SV5A 2WDBA 3VDBA 1OOPA 1OXCA 1SBEA 1SBDA 2JEMA 2WJSA 2XBO1 4UYBA 3DGTA 4L11A 1ZRCA 5K9YA 4DY5A 3HWJA 3O1RA 2W1QA 2PELA 5C4WC 4YGCA 3BOPA 4LA3A 1GZCA 5T54A 1GZ9A 2VZ3A 2I45A 5CEHA 2QKDA 1RUI2 1Q43A 2ZGLA 1JU4A 2WZEA 5A7WB 3LIHA 1VBE3 2WQZC 4AGGA 2CWMA 1R1A1 2YUEA 1FATA 4PCRA 1QJZA 3PVOA 2YB7A 5FTTC 5BNOB 2WZ8A 4UFKA 1T2XA 1JHJA 1CAWB 3R0RA 3OEAA 5EP9A 1OKQA 4YG0A 5JSPA 4Q1PA 1IKPA 1F9KA 2UWAA 3AL6A 1Q8SA 4LHKA 4LQRA 2QUOA 3UESA 3N9LA 1BEV3 1XNBA 3NSTA 1W8WA 3SQOA 3VZJA 3MLKA 5A70A 4CCMA 2A3YA 4RFRB 5HXMA 5KXCA 4D94A 2WQ4A 3ELNA 5ACA1 1CVNA 4Y22A 5C9AC 3T09A 1W03A 3QD6A 3O1VA 5J96B 1O6UA 2Z69A 1DQ0A 4HKWA 4NVPA 2W92A 4PI0A 1KXGA 4WM7C 5IFPA 4QHZA 4OI0A 3RG0A 5BYNA 1WBLA 3DEMA 4PDWA 5A3NA 2FDFA 1GV9A 1OH3A 1I6XA 1FPN2 1BKZA 1QIQA 1Z0HA 2HWD1 3JQXA 2ZGRA 4GH4A 4HSLA 4YZ1A 2FDHA 4CCEA 4FTSA 2Z42A 3C7FA 4ES8A 2V5YA 4DXTA 2AGSA 4MHUA 3PDQA 1MS0A 3O14A 3RYRA 4BISA 5IK5A 1L7LA 3VGIA 4RGKA 5CKQA 3ZFGB 2R063 4DOUA 3CL1A 3KM5A 3B02A 3C3VA 1H8TA 3DYPA 1W9SA 3S0MA 1NYWA 3PTRB 1N47A 3HD8B 3Q8FA 2H0VA 1KFXL 4B1LA 4UBHA 3SCHA 4JGYC 4R4XA 1W90A 2OIIA 1NXMA 1NG0A 1PGW1 3KT1A 4BM8A 4RHV3 1JZ7A 2NP0A 3RZGA 1UF2C 1LOFC 1E5SA 2W95A 2DFCA 4HT1T 2BPA2 2WFF2 5F32A 2EIDA 1RUF1 4B4RA 1U12A 1VB2A 3A22A 4UXAA 2BGOA 5FZGA 4TWTA 4L0PA 4AAXA 4BK4A 2VOVA 3UL2A 4J1XA 2Y6GA 1XNAA 2XVKA 1B09A 1GWLA 3WY6A 2WNOA 4LBKA 3BKZA 1SPPB 3EJKA 1OH4A 2B8MA 2DTYA 3LA7A 4OULA 4BH9A 3ASIA 1W6QB 5DG2A 2GN3A 4J1WA 1ZM1A 3BPSA 1HLCA 2RG4A 2ZX3A 2JD9A 4YGDA 4MG2A 2OZJA 1ZREA 1O5LA 1YFYA 5KHIA 1NLQA 2VUDA 2DCYA 3IT8A 3DXUA 2RS51 3KWVA 1POV0 3AKPA 4NN0A 1AR63 2VZPA 2D6KA 1UWWA 5FFOC 3SNMA 5IK8A 1V6MA 3VKLA 2XJRA 3OBZA 3SHRA 1EAH1 3ACIA 5J98B 5DPNA 2D3PA 1YIFA 5EJZB 1AR71 1SPPA 4QGLA 4XUQA 4XF9A 3HQRA 4K6BA 3TN93 2PHTA 1BBT3 4R9CA 4S2GA 2VOXA 1W6QA 2FMDA 4FXKB 1RUC2 2W1WA 4P9IA 1A34A 1DG6A 5HV4A 3K2OA 4I01A 3ON7A 1R081 1YFXA 4XF0A 1ENRA 4XW3A 4DXRA 5FCCA 1HRV2 2GNMA 2P17A 3NAPC 5BNNB 1NLSA 3RWKX 1X9PA 5D21A 2WC2A 4HK9A 1R1ZA 4BXSV 5JZGC 4EYUA 1QQP2 1UX6A 1MVEA 2WNVB 1CD3G 4NIAA 2RDSA 1UN1A 5FZ1A 1DZTA 3K46A 4QB2A 3I97A 5B4XA 3B9CA 3MIBA 4KNCA 5DDJ2 4XTMA 1GANA 4B7KA 4ES9A 4C1WA 2ORXA 3BU7A 3T2QA 2CSGA 3WUCA 3F2ZA 3G6JB 3EBRA 3ILRA 1XNKA 3IM0A 3NV4A 5G04L 4DMIA 1WCUA 3OUJA 5FYHA 5FXZA 1FMD2 1DF0A 2WLQA 2WWSA 3HNBM 4NPMA 4I3GA 3WG4A 1RINA 1UY1A 1QU0A 4YVWC 3T30A 4MGTA 1JODA 1OFNA 1QNYA 1VRH3 1YQ8A 1AL22 1O59A 1BVVA 4XDQA 5KBFA 1ZBA1 1J1TA 5FZAA 1ZX5A 4BIFA 2C0ZA 2DTWA 4AVAA 2XJTA 3QH7A 1W6MA 3J26N 1LHNA 1NE4A 2JKXA 3OY8B 3T1MA 5FPBA 2F4LA 3OYWA 2FDJA 4HANA 2ZCWA 4PLMA 2A70A 4DUWA 4D0QA 4P02B 3B7MA 1H30A 4BJ0A 4DB5A 3SCFA 1NLRA 2X5IA 1J83A 4Y1VA 3THPA 1ZRRA 1QJX2 3DUIA 3J8F3 4KG8A 5H9SA 1JBCA 4JKMA 5LY2A 5CFCB 1QEXA 4ZY9A 3ZYPA 2HWD3 3OCPA 1YJKA 3B00A 4H7MA 4HPKB 3N9NA 3NWKA 2XKOA 1LECA 3PTYA 3S6PA 3D6EA 2CU5A 2CL2A 2ZEZA 5FKCA 2WNUC 2NM1A 2R043 1Q3EA 3ZFEA 2W91A 3KHCA 4LT5A 2ZHKA 1GOFA 1EUUA 5FZ7A 4GA9A 4QPGB 4Q4W2 1XYPA 4EN6B 1D7PM 2DCJA 2LTNA 2ZEWA 2D6LX 4HXCA 5J3UA 5CFCA 2OKXA 1W8FA 2XUEA 5LASA 1RUD2 1I5ZA 1MS3A 4HPKA 4X6QB 2X05A 3LDBA 3NL1A 1NZCA 4QPIC 4CP2A 2WSUA 1FI2A 2EICA 4Q4V2 3K51A 5FQ0B 3VBFB 3VN4A 2O14A 3ZOIA 5LEKA 4FOYA 4Q27A 1CAVB 1ND2B 5EPAA 4LO4B 5T5PA 5CAZA 3WNXA 4MADA 5LA9A 4QQLA 5LATA 5AC92 1O3TA 1CPMA 1GBGA 2J1VA 2VMEA 1WUVA 4XJAA 1XE7A 5LEJA 3AX4A 1OF4A 5FUPA 4UW5A 1ULFA 5IHRA 2JE9A 3N9OA 1AJKA 2OUHA 3CEWA 1HJGA 1UZZA 4QHOA 4PQ9A 1VBA1 2X29A 3VBOB 1MACA 1YI7A 1FAYA 1WCKA 2EAAA 1S0EA 1K5MA 2RMU1 1KS4A 3AJYA 4WM8C 2RJKA 2XL7A 5D1IA 5FQ0A 2ZMLA 2IVIB 2QQKA 2WRAA 5BUVA 1B35C 4Y5TA 1NCQA 2RS53 4HMZA 3W9AA 4AQSA 4W6YA 3MV01 2A6XA 4KWUA 3V0BB 3O1TA 1IS4A 2VMDA 1S2KA 1EAH3 1LR5A 1MQTC 2WQ8A 2YBPA 2CNAA 1HQLA 2F17A 2ZGMA 3BCWA 1AR73 2VJXA 4UW3A 4Q4Y1 4AQTA 2R071 4E4DX 2LS6A 4LBOA 4AF9A 4A3XA 5IFTA 2HKXA 4NRQA 2R32A 4XF3A 5D8AB 5M0TA 1PIV3 3DN7A 3OGRA 5G05L 2E63A 1JI6A 4NIHA 1R083 2WYFA 1NAEA 2PHRA 3FJSA 4AZZA 5FOBB 1C5HA 1N1VA 2Q1ZB 3BN6A 2JIGA 2IZWA 3CIHA 5FLJA 5KHHA 4XFHA 1SDWA 1W8ZA 3H42B 4LBNA 4LKDA 1OURA 4WV8A 4YVSB 4R9BA 5FP3A 1LEDA 1LESA 1REDA 2WR9A 4XFIA 5HI0A 2AREA 4Q8KA 1YYNA 4YNIA 3HJRA 1KRIA 4TZDA 1IPKA 4META 4CCNA 3CF6E 2BU9A 1TMF3 3T3YA 2ZZJA 5FPAA 1LU1A 5C3QA 2GC1A 1D4M1 4CRQA 1ZNPA 3BGAA 2BWCA 4CDXA 4E2GA 4P5HA 5GZFA 5F7UA 3URFA 1NY72 3JCIA 2AYHA 1FT9A 1S0FA 2Y33A 1UMHA 3I59A 1ST8A 4PJYA 4FPGA 4ZXKA 1PGL2 1SDDB 3CJIB 5J09A 5FY5A 3A0KA 1V00A 3H8RA 3PUIA 3KGZA 2RS12 5F3GA 1JHNA 1RUG1 4CP1A 5GZCA 1GQPA 4A41A 1A3KA 3OGGA 4P9JA 2YFUA 3H1MA 3USUA 5A7NA 4A44A 4CCOA 3MV11 5CZKA 5BV6A 3M3CA 2QQLA 2GC2A 4FPFA 5EQUA 5F6KA 3MUY1 2BEOA 5F5AA 3HQXA 4LHSA 5FMOL 2XVGA 5IK7A 2JB4A 4FTEA 2NQYA 1FOD2 2GC3A 4R9AA 1YQ2A 1UZ0A 4XEZA 2ET7A 3ZR5A 1MEC1 4IV3B 4PF5A 2EVXA 2DV9A 2JX9A 2PAMA 2YC2A 3WNOA 1DGWA 3HNMA 3ROUA 5A6QA 1RL3A 2ZGNA 1E5HA 1OHFA 1X8EA 1UZYA 1OQEA 5FZ6A 1ULEA 4K8FA 1CAUB 2VMHA 2W5FA 1RUE3 4Y4RA 3RNSA 1W6NA 1W8TA 2YU1A 5FY0A 3LSEA 1UX7A 1F2NA 3D0SA 4Q4X1 1OUXA 1W6PB 2N7GA 4B29A 2JG8B 5BNPA 1O8PA 4K40A 4XQWA 1N3QA 2RM21 3MEPA 5FZEA 1PO21 4YW2A 1MS8A 2JECA 3HBKA 1RMU1 2DVBA 2VQTA 4YRDA 4BE3A 3OB8A 4DRVA 1DYKA 3NAPA 3KSCA 4GMP1 1NX9A 3SC7X 4FPYA 3ZXAC 1VRBA 1TEIA 2UURA 4XAEA 3I3BA 2J22A 1WD3A 4IGQA 3ETPA 1RJ7A 1AJOA 4A3ZA 3FUOA 4B7EA 3L2HA 4Q29A 3IPVB 1HQWA 1SLTA 1MPXA 3AMNA 5KHGA 5CFDC 1EYBA 1W2OA 4P9YA 1RUI1 2XLAA 3VBHB 4IV1A 1JOJA 3BTYA 2RMU3 1CR7A 1ASJ2 1MS5A 1JZ4A 3OGVA 1ZBE2 1PM7A 3JD73 2WUHA 1W0OA 1HXS2 4AQ2A 1OI6A 3T0BA 3J7LA 5A7PA 2WA4A 3E6BA 2DFBA 1KEXA 1I5PA 2ERFA 3IDBB 2XVLA 3ZDSA 5J7MA 1MR5A 2V72A 3BPZA 2Q8EA 1OOPC 1WKYA 3AZYA 4CEWA 4Q4Y3 4XJZA 2R073 1W8NA 4BQWA 5ABJB 3BODA 4AVBA 4FXGB 2VPVA 2A3XA 3I3DA 1F8VA 3VBHA 1COV2 2XWBB 5ANQA 2DVAA 2FHRA 2LW8A 5F2SA 1EP0A 1UMIA 3ZN5A 3ZYRA 3H50A 1ND3B 2ARCA 4NMIA 4DRRA 1JZ3A 1FX5A 4O9GA 1XXNA 1G9FA 2VZOA 2FD8A 3RJ2X 2GAUA 1O91A 3EB7A 4U2AA 3S7IA 2MEV3 3AMQA 1Y3TA 1S0CA 4FQ4A 4IUGA 4EWAA 3E6DA 4F8AA 1IGOA 5AFEA 1FPN1 3IIAA 3TOJA 4EE2A 4XBQA 3GBGA 3E5XA 3POFA 5JIAA 1STMA 2ZGTA 1H8VA 1ULDA 4XQ4A 1CJPA 4CP0A 2Y8KA 2XB6C 5B2GB 1W2UA 3TEZA 2CTVA 3C8XA 3HT1A 3I54A 3ORJA 3ZXEA 4ARXA 5IT6A 3VKFC 4FPHA 3ZO0B 3U0ZA 1LNSA 4XHXA 3POYA 5I0TA 3VD5A 4FP3A 4BYYA 1PNFA 2YFZA 4V2VA 5BNOC 3G7DA 4H14A 5I8SA 2OW4A 4Y1UA 5A6ZA 4L97A 1U0AA 1OBNA 1OKOA 3O1UA 1RVF3 3NNJA 2QQOA 3M1HA 1GZWA 1W3XA 1JYCA 3ENRA 4OFGA 1RITA 1VBB2 3FUQA 5LZ6A 4PDWC 2FDGA 5E6HA 3ME2A 2LUWA 4RYDA 3BTAA 5FKBA 4GH4C 1IQDC 2WFF1 3AB0A 3WW2A 4XFAA 3ZMOA 3ZSLA 4ZPIA 3ZKUA 5GLZA 2I07B 3MIEA 2A7AA 4Q26A 4URTA 1O4TA 2UY9A 4NRMA 1AR83 2ZAHA 1QDOA 3N7JA 5EHDA 1V6JA 1LHOA 2K0GA 4QHBA 1YQCA 1WLCA 1WA4A 4N9HA 2WINB 1H8TC 4RR3A 5JR2A 1ULOA 1XPWA 4MXVA 4NPLA 5CKNA 2OT7A 2I74A 3ZR6A 4CDQB 2XH6A 4QB1A 1JYIA 5T5OA 3J9SA 3O1MA 2BTVC 3IBMA 5C3OA 3R05A 3ACGA 5F3IA 4FPLA 5F6LB 5JXHA 3EO6A 2AZ5A 1VAMA 3PHMA 3MUZ1 3V0AB 1AZDA 2NN8A 2AEZA 3W5NA 4Q4X3 4YW5A 4CDUA 4BZ4A 3H8XA 2IC1A 2DCZA 1CX4A 2ZMNA 2R49A 1BMV2 2RM23 5A3OA 4CA9A 1PO23 4JRAA 2JKBA 2HWC2 1RMU3 2B45X 4PIXA 1NCRA 2GNTA 4BPZA 1RUC1 1FNYA 3SLIA 1WCQA 1NE6A 1PMHX 1Z7S2 4DFSA 4YZ5A 3PUAA 2B46X 3ZXFA 5GZDA 3PUSA 1HRV1 2ENRA 2VC9A 4LBQB 2XMLA 1U5XA 3ILNA 3ZFFB 1SLCA 1CN1A 4MGKE 4XVHA 1X8MA 1QQP1 2DWRA 2WNEA 5FYVA 4D8MA 4YZ4A 1GUIA 2V73A 3GZUC 2P6CA 5DDJ1 3O5SA 1YQ5A 5A3PA 3VZOA 4OUSA 4NROA 1ENQA 2VY0A 1X50A 2YGLA 5K8SA 2XJVA 1RUI3 1POV3 3KF3A 4X8NA 1IHMA 2A6ZA 4L99A 2ORZA 5FUNA 3IN9A 3IB3A 4AVVA 3TEWA 1FMD1 2R16A 3FLTA 2DU1A 3AP7A 1OLQA 3FBMA 1DQ2A 2VBDA 2VW0A 2BOJA 1QNWA 1VALA 5LBEA 4Q0UA 2RJ2A 2CWSA 3ACHA 1RUNA 1AL21 3U1XA 2ZHLA 3N36A 4RN5A 2NMOA 4LITA 1HRI3 5A3UA 3FLPA 1GQHA 3VBSA 4BQ2A 1H4GA 5CG8A 3PURA 2OA2A 3HN3A 3KCCA 2EAKA 3UGFA 4NHKA 3UGHA 5T5LA 1KJRA 4I30A 1C8NA 2Z4FA 2ZHNA 1AR92 4DQAA 1L7QA 1XE8A 3D8CA 4MGSA 2Z2SB 2ZJCA 2KA3A 3Q8AA 5AVAA 1QJX1 3B93A 5FYZA 1EY2A 1IPSA 5FYSA 4YGEA 1FPN3 3APBA 3I2GA 4OHZA 4EN9B 1O4ZA 4CU6A 1OLME 2RVAA 3NQHA 2JDAA 1X82A 3NKGA 4O61A 3H3UA 5EJ3A 3KLSA 4AEJA 4XPVA 4DUVA 4LMFA 2O8QA 1RYYA 1TZOA 3EYPA 5I0SA 4OHVA 2HEYF 1G6NA 5HXVA 1OSGA 2HLEA 1W04A 2RJLA 3AMMA 4Q4W1 4LBLA 4AQ6A 1JZ2A 4OHYA 1UPSA 2Q30A 2V4VA 4ZU5A 3AVSA 1N1SA 1W39A 3AVRA 2JXAA 3AKSA 1H0BA 3PJQA 4XAAA 4AFDA 5E8AA 1UIJA 4RS5A 1RUD1 3U4XA 2VCBA 4NHMA 4FP2A 2X5IC 2DUOA 5JMCA 3I2FA 4L2NA 2UY8A 3NJYA 5IAVA 4W6WA 4XF1A 2ZA9A 3FWEA 4Q4V1 1WW7A 2C24A 3ZPYA 3FBYA 4DS0A 3HR9A 2GU9A 5AC91 4D3WA 3EMRA 3A4UA 3RFRA 4N53B 1IS3A 2UU8A 1WW5A 2P37A 3QH6A 3VDDA 2VW2A 3ZFEC 2VBBA 3UKVA 2PLV2 3R4DB 2HWF2 1YXWA 3EQEA 4PF1A 1V9U2 4RD7A 2IFRA 1UKRA 3AZZA 5T50A 4A7KA 2ZAAA 2FQPA 5CFCC 1SFNA 2QFEA 3WT3A 2P1BA 4JDOA 1VMJA 2HWB2 2WIIB 4LEJA 3RYPA 4ZS3A 1O3SA 4N53A 3M7AA 1EPZA 1NT0A 3H7JA 2LRPA 1S55A 1WCSA 3D4KA 4A45A 3ABZA 4JQTA 3K77A 4OUMA 4ZZ5A 3KCYA 1U5YA 2VMCA 4M3CA 4ZZ8A 1OVSA 1YJLA 3POIA 5EV7A 2C9KA 1R64A 1YI9A 2QBXA 4XJWA 1XYNA 1R092 2HH9A 2Y6LA 4NUBA 1TME2 4V1PA 4YWAA 3I2OA 1AUYA 1HRV3 5LBBA 2Y0OA 3L9JT 1BXHA 3WZ1A 1RHI2 4AHXA 2XONA 2VNGA 4UOJA 3H1YA 3GCWA 2VVFA 3CHXA 3LDRA 1K5MC 1QQP3 2D97A 2ZMKA 3WDXA 4CZSA 3OGJA 1YUDA 5JPMB 1AYN2 1SBFA 1ZVFA 2C5DA 1Q8PA 2CAUA 2GALA 1NCQC 4K1YA 1YQ6A 2BNNA 2CGPA 1RGSA 2VD7A 2VBPA 3IDEA 4QX0A 1D2QA 3AYAA 1H1MA 2PXJA 5JVVA 4OUEA 1FYUA 4DEQA 1G9BA 1FMD3 3LF7A 5KXDA 5FK7A 3E5UA 1NY71 5A7WA 3WF1A 4DO0A 5C70A 3C7OA 4PBOA 2O0OA 1PGL1 5BNOA 1FNZA 4FFHA 1AL23 1UYZA 3LPFA 1CAWA 3RVHA 3WDTA 2RS11 2J1SA 3WVJA 2F4PA 4CP9B 3AYDA 4D6SA 5C8CB 2NMNA 2YYOA 2JDZA 1W3VA 4YG6A 1S0GA 1XU1A 3JBG3 3AZVA 3VB9A 5CIRA 4RSUA 3UGGA 1IS6A 4AW7A 2JDMA 5A1AA 1FOD1 4TYSA 2Q8DA 1CAXB 2VZSA 5E89A 5JOXA 1BHGA 2Q5TA 5DUXA 4CDXC 5C5TA 3FHQA 4LO5B 5JOYA 4FPKA 5FY1A 4CP9A 2B9VA 5JXJA 4NO4A 2WZR3 1GP6A 5APAA 2HWE2 4E9KA 1UYXA 4JRLA 3VHOA 4W65A 2V5DA 3JQWA 2VVEA 1BQPA 3WEZA 3ZXJA 3ZYHA 4FFIA 4GKYA 3WW3A 1UY3A 4AEDB 4HZFA 5LBCA 5I8TA 5A3TA 1LTEA 3MO4A 3VD9A 2EF6A 4YYOA 3KQ4B 3CJXA 1CAXA 4Q4W3 1CZTA 2Q0AA 3ZFGA 2VQ0A 3FMGA 3FE5A 4IDZA 3WDWA 2RR13 1NUKA 1N3PA 4BQ1A 1ZZ8A 4GMP0 4BU2A 5FMDA 5J1XA 3KGLA 1DGLA 2X10A 2DVFA 4CSWA 1W9YA 3WQ1A 3RZZA 4S2DA 5HCHA 1RUOA 1RUH2 1W6OB 3AFKA 1ZZBA 2VXRA 3VUOA 5IK4A 2QE3A 2WT0A 1UZWA 4I0WB 4GXLA 3VBUB 3AJZA 1LJ7A 3MFAA 2Y26A 4OVEA 4I3PA 5A1LA 5L19A 5BNPC 4JZRA 1LGNA 2ZHMA 2VTXA 4AHZA 2FZ2A 2Y6FA 4UT5A 3K75B 5F39A 3UJQA 5A33B 1LAJA 5DZEA 1ASJ1 1W6OA 1ZBE1 4MGQA 2BZDA 2E7TA 2BNMA 3B3QE 3NRUA 1HXS1 4MZUA 3JB4C 5FUIA 3WP3A 1W8HA 2W1SA 3OOXA 5F5IA 1D0GA 5FYMA 1UU6A 4LBQD 4B3NA 4BQYA 4XDOA 2OXBA 2PAKA 1J3QA 3AM2A 5BPXA 5K0UB 1CIYA 2XBO3 1POQA 4A4AA 3DKQA 4XIOA 4Z82A 5J36A 4Y1YA 1COV1 1MZ6A 4CUBA 4FPCA 5CVRA 5GLVA 4OLLA 3IMMA 4M4PA 4AXOA 1GYKA 2VOWA 2VCCA 2PHFA 3VD3A 1C4RA 4IV1C 3LGRA 4JHTA 3RSJA 5BNNA 2VZ1A 3N7MA 4YM0A 5GLUA 4EN8B 2X09A 4R8HA 1DP0A 1R1A3 5FAXA 3ACLA 3GALA 4LO7A 3RI8A 1OT5A 2VG9A 3I2DA 2P3YA 5FYBA 5K0UA 2WNVA 1JYXA 3ZYBA 4NE9A 1G7YA 1VBE2 3ZN6B 3JZVA 3MI8A 1JOPA 1UYPA 1AX0A 2ZGPA 1CIWA 4LOSA 1Y43B 5FZKA 4KH9A 3TNQA 2YROA 2ZEYA 4CEWC 4RGAA 4ZU4A 3KV4A 5FY4A 1KDKA 5GZEA 4CCCA 4CU8A 4JGZB 3W59A 5LA1A 4G9SB 4P5YA 4IE7A 3VBHC 1HJFA 5TSWA 1W99A 5ACA3 2O8OA 3BIWE 4QX5A 4YZ2A 1BEV2 1DQ5A 4AEKA 5JI7A 3H1WA 5CADA 1HIXA 3CQOA 2F6BA 4IEPA 2VNRA 3WD5A 2BVVA 4XFBA 1X33A 4QXHA 1DBNA 2WABA 5F2WA 3SCGA 1O3RA 1UOGA 1VBB1 4H55A 1VMHA 3LEGA 3NJXA 2IVJA 1LGCA 2VZRA 2P6HA 4CEYB 2DU0A 4YW1A 5GM0A 3OY8A 1F15A 1ZRIA 2OX0A 3Q8BA 4N7UA 2J1AA 3NMBA 3CBNA 3O12A 1IKQA 2LALA 2VVDA 4QX3A 3RI9A 3O1SA 4YM2A 5JUVA 5IWFA 2GNBA 3K3OA 2DDUA 1YO8A 4IEQA 3AL5A 1S4CA 2R062 3Q9OA 2ZGOA 2BGPA 3R4SA 3AXDA 2WZPP 4Q1RA 3RWNA 3SEEA 3NNLA 4HOOA 2XWJB 4N9IA 3ZDVA 3VLBB 4XCAA 3ILFA 2VMFA 4K9SA 3WV6A 4LE4A 2QQUA 4A2UA 4UFLA 3POEA 3SMHA 4SLIA 4KU7A 4XBLA 2JWPA 3RZKA 1SACA 5FLHA 1LHUA 1RUF3 4CU9A 1BMV1 3DXTA 4XMIA 3MPBA 2D3SA 4QPGA 4AI9A 3PVBB 1O5UA 3KVAA 3WSOA 4Z2WA 1YLLA 4XJ8A 1DDLA 3NJZA 1LB2A 3ATGA 1GQGA 1SFPA 2BUKA 1Z7S1 2WWJA 4RR3C 3QACA 5C4WB 5JXIA 1WMFA 2XL9A 4GWNA 3H8OA 5I91A 1QJEA 2XQXA 4Z1VA 1PHMA 2GMEA 4YW7A 1J84A 4TN7A 3UNPA 5C7GA 5IVVA 4S2HA 1S0IA 2G4IA 4KWLA 4OYUA 3VBFA 3ZYGA 2VUAA 4UBGA 1CAVA 1ND2A 3N9QA 2MNGA 1K5JA 2D6PA 5FYIA 4S2FA 1DLCA 2JENA 1QDCA 5D2AA 4CDUC 3A7QA 5C3SA 1QY4A 5FZ8A 4BIOA 1AR62 2E7QA 1GLHA 2A75A 1ASJ3 1NCRC 5FJHA 3VBOA 2YG0A 5GZGA 1ZBE3 2E6VA 3BOWA 4W4ZA 1Y9MA 2QNKA 2W39A 1HXS3 3QLQA 2B42B 2J7MA 2ZX2A 4FOVA 5A3WA 3WDYA 4D7YA 2DCTA 4GQ7A 3T2TA 3NV2A 3WF3A 2C9AA 3TN92 5C9AB 1ZZ6A 4NJ4A 2XXZA 1GZTA 1GWKA 3U78A 2YV8A 2YMZA 4QM8A 1JMUB 5KHJA 4XC9A 5EIYB 3V0BA 1W9WA 4WM7B 4Q0SA 5FBZA 2NYYA 1PMIA 4Y5Z0 3UV9A 3OUIA 4XYXA 4IEYA 2A73B 1HV0A 5FP9A 3LWCA 3BVCA 1V6KA 4GKXA 5D8AA 1AXZA 1RC6A 1DHKB 1UD1A 3DV8A 2JDUA 2X53S 1DGRA 2WO1A 2OS2A 3ZMNA 5FZ9A 2J1EA 4P9XA 1YRZA 2K2SA 2BOIA 1FV2A 1GMMA 1OA4A 3AKQA 4LOTA 4P9WA 4EROA 4QKBA 5JWPA 4MO3M 4YVSA 1S2BA 1PX3A 4FQZA 4RFT0 2EIBA 1UCXA 4JGYB 5F5QA 1ZBA3 1PGSA 1VBC1 4FFGA 2EXIA 3VBSC 1VRH2 4XTPA 2AEYA 2WYSA 5DUUA 1C5IA 1GWMA 2Q1MA 2BERA 2NPIA 2W9XA 4P00B 1NQJA 4XACA 5A7SA 3ZYFA 2XPJA 4CXXA 4FBFA 4YM3A 3KT7A 1UZVA 3HOBA 3A23A 3KZ4C 4LPLA 5A1FA 3CJIA 4IGPA 1AYM2 2XJPA 2QZ3A 1PZ8A 4B4PA 2CY6A 3J8F2 2K46A 1HB1A 5HCFA 4EWEA 5A80A 4LULA 2FCUA 1JUHA 2RS31 4GULA 4CCJA 3TRSB 3RZMA 2WO7A 3PMEA 2WAAA 4LIUA 4OZXA 4XDPA 3T2OA 4LBMA 3S5QA 2PLV1 2HWF1 4JCKA 1V9U1 2L9LA 3ITQA 2ILMA 2YC4A 3DF0A 3N35A 2R042 3WNNA 4WVWA 4IV3A 5IAXA 3N7KA 1QOTA 3KVBA 3L2YA 5JIUA 1UU5A 4Z8BA 4RS5C 5KXEA 1LHVA 1LGBA 3JU9A 3F95A 3LIGA 2P4EA 2W3JA 4UW6A 5FO7B 3W5MA 1AXKA 3M3IA 2VGDA 2VTXJ 2WS92 1CAUA 4QGMA 3NKTA 1PVC2 5FRAA 3J7HA 5IVJA 3GF6A 1F4AA 1W9TA 1XC6A 1S0DA 2PHWA 1MZFA 3S7EA 5CBLA 3MGUA 5JZGB 3LOBA 1F5JA 4JHZA 1XQNA 1W6PA 2BDRA 2JG8A 1D0HA 3ZYIB 2HJIA 3VDDC 1RXGA 2XOMA 2Q8OA 1R091 2TEPA 3PUQA 1TME1 2D93A 3R6SA 4BMBA 1OC1A 2PAEA 1RHI1 3OSDA 1VBA3 4IE4A 4FAGA 4AOCA 1K42A 4XURA 5JR7B 5EYXA 4RL7A 1JU3A 1VBD2 1YFUA 3HN1A 4AFBA 4PI2A 2ZS6B 1JOBA 3POWA 1AYN1 3N9PA 4QXKA 4YLZA 3PL0A 1XNDA 3ZIWA 3WHUA 3PIJA 2CGOA 4YVWB 1G8WA 4N53C 1AF9A 3GHNA 3JB8A 3K48A 3MF6A 4FPOB 1H6YA 5FZOB 5GALA 2YY1A 2VXJA 4AK3A 4BMEA 3I3EA 3IPVA 4GAZA 3M2MA 3QOPA 1VAKA 1ODMA 2JG9B 2BP6A 3OEBA 1V6IA 1YIPA 3O0VA 4LK7A 4X6RB 3ST7A 4YSFA 3NV1A 5FBJA 2A6WA 1O4YA 1X7NA 2ETEA 3KF5A 4XABA 2RV9A 5AFBA 2OQ7A 2P34A 4TLFA 4D7TA 1PIV2 1OPMA 3LCPA 4Y4YA 2TUNA 4HKOA 1JZ8A 4M0HA 1BZWA 2ZKNA 3I8TA 5H9PA 4XQDA 4IL7A 2VM9A 5FDBA 2R0FA 5B4NA 4UF0B 3WINE 2JD4A 5ABJA 4WVMB 2OYZA 4GZ9A 2VE1A 4JTNA 2BBVA 1Q8OA 3ZSKA 4M3CF 3OTFA 5T55A 3J7NA 2P3KA 3AKTA 3GBWA 3HNYM 2VOKA 4QB6A 2WNUB 3MLLA 1D4M3 3FL7A 3NNMA 1ND3A 1Y4WA 4FOQA 4M0NA 2A71A 2YZ4A 4D6RA 3LEIA 1TMF2 1KDMA 4IW3A 2RDNA 4V2WA 1H2MA 2HWE1 3OJBA 1HB4A 4CYDA 5F8PA 4CPBD 1S2EA 4IEOA 2UYBA 4P08A 1RUG3 4G3YC 5FMBA 1QJY2 3WQ7A 1VBC3 3BB6A 1QKQA 2XJSA 1N3OA 3DYOA 2UYAA 5FLIA 1LCLA 1TE1B 3VD7A 1WWYA 4AAPA 3MPPG 4CXWA 1LOEA 1LENA 1NZIA 3HEIA 5IVFA 5A32B 2Q8CA 1JS9A 3V56A 2ZX4A 4Y33A 1UO9A 4Y20B 4GJYA 2A3WA 2W2IA 1EUTA 1MEC3 2CV6A 1F35A 3ALQA 4NWWA 1BCXA 3KB5A 3I2HA 1J58A 1RUH1 2FMYA 1QH7A 3NV3A 1RUJ2 2DYCA 4Q0VA 1SMVA 5I0DA 1VLNA 3D3AA 2VCAA 4ARYA 5I93A 1CZSA 4QX7A 5JSRA 4ISQA 4E27A 4CVUA 2Y60A 2RS33 3WP4A 1JYWA 2D44A 3FLRA 1D2SA 4YW3A 2PN5A 4AI0A 1C28A 1KITA 1B35B 1ZRDA 2VMGA 3PLQA 5KC5A 4LXLA 2PLV3 2HWF3 2R1DA 4A7ZA 3BTZA 1RUE2 4Y20A 5FMCA 1V9U3 3ZFGC 1MQTB 2JE8A 5LRRA 1EPWA 2ADDA 3FZ3A 1KD7A 3S5AA 5FPVA 3WNPA 1LEMA 2FCTA 3KQRA 4MXWB 5FXWA 3VBRB 2D7FA 4CDQA 2VNOA 5FJKA 3WXPA 1JUIA 1PZ7A 3HMYA 1JZ5A 5DZGA 5GKAC 4KGGA 1DQ1A 1DIWA 2WL1A 3RMXA 3MZHA 4GMP3 3ZX7A 2VAUA 2GP5A 2JICA 3KCXA 3V0AA 1BK1A 4LBJA 1I9RA 2AENA 4DIQA 2XG3A 1GOGA 3I2KA 4Y1ZA 5K4LA 5L36A 4COYA 1GNHA 1WCDJ 2LM3A 1YEWA 2QQJA 3ETQA 2JDNA 3O0WA 3SKJE 1I1EA 4O65A 1R093 1VR3A 3LEKA 1TME3 1JTZX 5FYCA 2MHFA 5FZ3A 1QH6A 1RHI3 3HT2A 4AE2A 2D6OX 3GXUA 4D7SA 5J48A 4LBQA 4Y26A 3DPRB 3WNLA 3WP6A 3ZFFA 2VL4A 2VZVA 3ES4A 2YXSA 3AXEA 4QKFA 3AP5A 4KBBA 2VECA 1VBE1 3Q8CA 1HN1A 3JD72 3SEPA 1IZ3A 4XOGA 2JIJA 4KL1A 5FK8A 4HKLA 2XQRA 3KV5A 4ASLA 4KG0A 2RHPA 4RA0A 4L8QA 2QJVA 4QQPA 4AVTA 1CQ9A 1YC61 4BXFA 5FY7A 2ZPXA 5T5JA 3WF4A 5FYUA 5C8WA 2ZX0A 2SLIA 1O3QA 1A8MA
chains in the Genus database with same CATH topology
3DPRA 3HAGA 1BEV1 4JVAA 3D82A 4H7LA 2VUJA 5EWSA 4BHPA 4LO6B 3ZSJA 5BNNC 3TB0A 1DQ4A 4I0BA 1ENXA 2PA7A 1M4WA 2WNVC 5K0UC 4HFSA 1ZA4A 1OA2A 2D43A 2MEV2 3GZAA 2O1QA 4GWMA 1KS5A 3RDIA 5KHKA 3VKNA 3INAA 1AX2A 4IEUA 2PHUA 5BY5A 3THTA 2KXLA 2R061 3ZSMA 5JPNB 1ZRFA 5JSOA 3MF9A 2CYFA 4JDNA 1H2KA 3RYKA 4QGNA 4A7YA 1NXD1 2JJ6A 5JLVA 1EV12 4HN0A 1WD4A 2WFF3 3WP5A 1RVF2 5KXBA 4JGZC 1MS9A 3FC0A 2XGXA 1SFYA 4DXZA 3VL9A 1KFUL 4OHWA 4MUVA 4PLOA 4FVVA 3ZVXA 2E53A 1URXA 5JCTA 1MS1A 2TBVA 1GNZA 2YHJA 1AR82 3AZWA 1C1LA 1Q56A 4N43B 1RUH3 5CFDB 2R6QA 3ZIXA 1CESA 4K20A 4XMAA 4BLIA 1UAIA 4E4SA 4NR1A 1CPNA 3HIFA 4GB32 2P2KA 2ES3A 4YFZA 1REFA 2GMPA 2GZWA 3GZTB 4CEYC 1GFF2 4KQ7A 3J4UH 1QOSA 2FBEA 5H9QA 1AR61 1JXNA 1OOPB 1Q8QA 4JAAA 1LULA 4QPGC 4XJ9A 4N43A 2UWCA 4Q4X2 1RUC3 4AYUA 2GH8A 5L7OB 1HX6A 1PO22 1KQRA 4FT8A 3R4UA 4ATFA 4EWDA 4COUA 2HYKA 1Q8VA 1SQ4A 4FPJA 5SV8A 3VBFC 5JI9A 1ND2C 4AI3A 4AGRA 1WBFA 3AKRA 3HBZA 5DDJ3 1UMZA 3WCSA 4DINB 4AI2A 4Q0PA 2ZKLA 1LHWA 1OQ1A 4C91A 5L7OA 1H9WA 4IEWA 2BW8A 3WDUA 2K9ZA 2DUPA 3IKWA 3VBOC 5EYYA 2EXKA 1PK6B 3AZXA 3B69A 4ONUA 5F9TA 5LK7B 1VAVA 1BVP1 4J6GA 4Y22B 4RQPB 5A3MA 4QQ2A 2XJUA 4YZ3A 3MICA 3VV1A 3VHRA 2PHDA 2EIGA 4X8PA 3MYXA 1TNFA 1VRH1 3ZXDA 3DKWA 4PDWB 2QZ2A 1HRI2 5AVPA 4GH4B 4LHLA 5D8AC 4XFCA 5H9RA 1PK6A 3D0JA 2B5HA 1OFSA 2D5HA 4HSJA 4HVRA 3AYEA 1QJX3 2UWBA 4RQPA 5EFUA 1C8M2 1AYM1 3SH3A 1H8TB 3UKTA 3KD4A 3ZXGA 3PVNA 1G9DA 2ZBJA 1GICA 3J8F1 4YVSC 3UJOA 4EN0A 3BALA 2OVUA 3OD4A 5C8CA 2BGCA 3LKJA 2YPJA 3AP9A 5A3LA 3MW4A 1V6OA 4N7IA 4CDWB 3VKOA 2D40A 4LO8A 4YFWA 3LB9A 2R041 4AWDA 5GLWA 4WZFA 1ZZ9A 4FO9A 4HBNA 3WX5A 2IXJA 1L3JA 2BFUL 2DVDA 4LA2A 4MVTA 1RUD3 2RE9A 2W08A 4XXPA 4JC1A 4D69A 5HCAA 3CJIC 1QXRA 5FMOS 2WS91 4BE3A 5CU1A 2VU9A 1H2NA 3WW4A 1J1LA 4KU8A 2G9GA 1PVC1 4Q4V3 4AEDA 3IWZA 3W58A 4CDWA 3IMNA 5F1RA 4Z92B 5AC93 4ZU7A 1DGWX 3OD0A 2I2SA 3RS6A 4OHXA 4Z07A 1JW6A 3NW4A 3WHTA 2DF7A 4XXAA 3C2UA 4U36A 4IV3C 1PO12 4G4FA 3ZN4A 1BYHA 1VBD1 2X8KA 2IXHA 4AFCA 4AVCA 1QJU2 1APNA 4ASMB 1H1IA 4JV4A 1IQAA 3VBUA 2W68A 1GSLA 3IDCB 4IETA 2BNOA 1VP6A 4WBBA 4I02A 4QD2A 4XFGA 2Q4SA 4XIKA 3V65A 3I7DA 3V64A 2JG8C 4M00A 5HBAA 2R1BA 4FCAA 2FZ1A 5A33A 2GH2A 4C0HA 3KS7A 4NOTA 5E88A 1T6GC 2ZGUA 1VIWB 3CU7A 1PIV1 1G9AA 4YGBA 5DUVA 3S30A 2ZTNA 1DYPA 4XJUA 4B4QA 2DCKA 4R52A 4BLJA 1YWKA 4NHLA 5GLTA 1BJQA 2H0BA 4PLNA 3WDVA 4MGYE 1RB8G 4W6XA 4P14A 5E16A 3H8UA 3RPQA 1DQ6A 1C3HA 1F5FA 4AG4A 5LRSA 3AK0A 1W6MB 1TMF1 3VKMA 2QDRA 4QQOA 3ZYJB 2DVGA 4EJRA 1J59A 1WMDA 3OYWB 4K1ZA 2WA3A 2ZGQA 2EXHA 4WZCA 2RS13 3ZN6A 2X5IB 1QJY1 1S0JA 3WG3A 1CONA 5ABJC 4YARA 2JG9C 5KWRA 4JGZA 2Z5WA 1O7FA 1FOD3 1DGRN 3LOIA 4ITCA 2PFWA 3JBG2 3VZLA 5JOZA 3ZFEB 1ND3C 5BXXA 1AYM3 4JQRA 3MIHA 1JN2P 3PJYA 1RUJ1 2GN7A 4ORFA 5FO8B 2IFWA 2PHLA 3NO8A 3FFZA 3LAGA 3ZSEA 3NVCA 1VB4A 4R4ZA 3P3NA 4ISRA 2WZR2 4F3JA 1RTVA 4CEYA 2D5FA 4YM1A 5DG1A 4CTEA 2D6MA 1RUE1 1NA1B 1WGPA 1QGLA 4RHV2 1HDKA 1LKNA 1LOGA 1ONAA 1MVQA 3WNXA 2AR6A 2HWC1 3N3HA 3M3OA 1OA3A 4GIQA 1YNAA 4XFFA 2RR12 5JOWA 3CLPA 2WS93 1PVC3 1Z78A 4C90A 1OMIA 1SEFA 1RIRA 4BWOA 4Y1XA 1K5MB 1XRUA 2IXCA 4LHNA 1NA1A 3TWIA 3VL8A 2DUQA 4QMAA 1NCQB 3N7LA 1ALYA 1RJ8A 2PTMA 3ZXKA 2VH9A 3PVEA 5C4WA 1QWRA 1ULCA 3RJRA 1VBD3 4CDQC 4Q8LA 1ENSA 3M8LA 1HKDA 3TYJA 2A5ZA 5EXOA 2H6CA 2KM2A 4KGQA 4LUMA 1BBT2 3MW3A 3KMHA 5CB7A 3JD71 4HN1A 3B9IA 4HVOA 2E51A 4K3UA 4Q0QA 1TNRA 2WT1A 4MLOA 4Q2FA 4I0AA 4COVA 5FO9B 4COWA 1I3HA 3VHNA 1COV3 4GALA 3E6CC 4MGIE 2XBO2 3TBDA 1AR91 2WT2A 3VBRC 5J37A 2W0XA 4MYEA 4UW4A 2WFPA 4XHBA 3RQ0A 3E5QA 1DZQA 3ZFFC 5C9AA 4IEXA 4HK8A 3GBFA 1YCIA 2DURA 4TSVA 4F83A 2E7AA 4CDXB 2XLFA 1YFWA 1N1TA 3TAYA 1WLDA 4WM7A 3WQ0A 5C6CA 2MEV1 2XLGA 4P9GA 1R1A2 2BWAA 3I59B 3P3PA 4IERA 4NWVA 4FAHA 5C33A 1IOAA 3SISA 3AYCA 3JUUA 4AFAA 1QMJA 2Y0IA 3USUB 1HW5A 1PNGA 3U11A 1AX1A 2W52A 4Y24A 3H0OA 5LK5A 1F31A 1QF3A 3DPRC 4QQHA 3AMHA 1SLBA 3SITA 3LSDA 5I0RA 4L92A 4HLTA 5ACA2 3FX3A 3MIDA 1QJY3 1SCRA 1VBB3 1IPJA 2BVBA 2YC0A 1C57A 1AVBA 1UU4A 1EV11 2EA7A 4JGYA 5DUWA 4QU2A 2P3JA 4FTBA 1NOVA 1RVF1 4BA6A 4I2OA 2GDFA 1LOFA 2QDNA 4LNVA 3T1LA 4AHYA 2BYVE 2HWD2 3OF1A 3VZNA 1W6NB 4AI8A 4OI2A 1AR81 3O7OA 4AEMA 3VZMA 3OBTA 5BNPB 1UW8A 1RUJ3 1ZYBA 2H6BA 4C1XA 1JH5A 5HCBA 4LR4A 3MDPA 3LA3A 3WW1A 3RRDA 2PQQA 1OD5A 2ZX1A 4XILA 2WSVA 3H9AA 4GB31 2HEWF 2GC0A 2HWB1 1A78A 1DZRA 1LOBA 1H9PA 4IXLA 3NAPB 1C1FA 1H4HA 2IWGB 1NQDA 1PGW2 3D5OA 2HWC3 3MLJA 2ARXA 1RUF2 2VMIA 4AFMA 1Z7S3 1HV1A 1A6CA 4F7ZA 2OPKA 4QPYA 1DU3D 4COZA 2ET1A 3M3EA 4IV1B 3TNPB 4IEZA 4PBPA 1AL0G 2ZGSA 3GHMA 4H3WA 3LA2A 4ZKTB 5JZGA 3VHPA 5T52A 4JDMA 4LE3A 3MIFA 4MX3A 2NLRA 2RS52 2P3IA 1H2LA 4OI1A 1UL9A 2IXIA 4CEWB 1W0PA 2BQPA 3U07A 4N43C 1EAH2 3X29B 1ZZCA 1LRHA 1XYOA 3GNEA 1AR72 4P9LA 1POV1 2QCSB 5BNQA 1U5IA 1AXYA 5JAXA 5FPZA 3AFGA 4K21A 2G9FA 4E4ZA 1R082 2QQPA 1OPOA 5CNAA 2A6VA 2C1FA 4IEVA 4YVWA 5KC6A 1XNCA 2TNFA 1HRI1 2JG9A 3VZKA 1AR93 4YW4A 4XBNA 2CAVA 4B8EA 2ZZQA 3OBRA 1OQDA 5L7OC 2YGMA 3N4MA 5FPXA 3ZXLA 2ATFA 1C8M1 4LTAA 3M4FA 1MZ5A 1Q5OA 1DLLA 3UK9A 2AUYA 4M01A 3WCRA 4KWJA 2V09A 5L73A 2JE7A 4FPEA 4C0BA 1UIKA 4WVVA 4WVMA 2SBAA 1V70A 3PMSA 1GZWB 4QPIB 3M70A 3H7YA 3B01A 1ZBA2 2WNUA 2WKKA 1SLAA 4DPNA 1PK6C 1UKGA 2XJQA 5E1RA 2VULA 4LUKA 4RQPC 2A6YA 4DY3A 4RR3B 2GNDA 2ZACA 4L9BA 1EV13 2IXKA 5C8CC 1YHFA 4QPIA 1IS5A 4AGVA 1U5ZA 4WM8B 2YDEA 3WLUA 5A32A 4XETA 2PHXA 1QXPA 4FSJA 2XUMA 4CDUB 2GMMA 2XHKA 1PO11 3MIGA 4MSVA 5CA6A 2MPFA 1GR3A 1NCRB 4YG3A 3DL3A 4GB33 1QJU1 3WG2A 1ULGA 2HWB3 4WM8A 1ZZ7A 3ES1A 2D98A 1V6NA 4AEDC 3AP4A 2BFUS 1AHSA 3USSA 1LOAA 2XKPA 1B35A 1LOCA 1Y9QA 4CDWC 4AHWA 1M06G 2PYTA 2QVSB 5JDBA 1MQTA 1WLWA 4MGZE 4BOWA 4DZGA 4EV0A 4MXWA 3VBRA 4MH0E 1J3PA 2Z79A 1MZEA 5K7PA 1TQ5A 5IUQA 1E57A 3GYDA 4ATEA 4LLOA 2E9QA 4JTOA 4IESA 3RMYA 1AYN3 1VBA2 4XE9A 4K7JA 2GSYA 4MV2A 1SCSA 2RMU2 3LZZA 3VBUC 3O0XA 1WW4A 1N1YA 2ZOEB 3CO2A 4HETA 3SH5A 1MS4A 3QBQA 3FFQA 1SLLA 3VBSB 2ZGKA 1WLTA 1XU2A 4NPRA 4Q4Y2 2R072 4FOWA 4R9DA 4AVSA 4E2SA 1G9CA 4IQPA 1QXJA 1UPIA 1PZ9A 2VQAA 2EXJA 3EXUA 1QOOA 3CNAA 4SBVA 1WMEA 3UKNA 3H3ZA 1VJ2A 2EALA 2IXLA 3SH4A 2B39A 2NZ9A 4OI4A 4BCUA 2HEVF 3AP6A 3JBG1 5FOJB 4HL0A 1C8M3 1A8DA 1QHDA 4XZPA 5CG9A 5EZWA 1LODA 1DFQA 3SXWA 1H1AA 1S1AA 2R30A 4O9EA 1D4M2 2HWE3 3E97A 4QT6A 2VW1A 1FXZA 4RS5B 3U10A 1J3RA 1Y7BA 2WZR1 4PIYA 5GJ6A 5I8YA 5I0UA 3B94A 4DNYA 1OLRA 3ECQA 4XF4A 1RUG2 4PIZA 2AH2A 4RHV1 1VBC2 5FREA 2R0HA 4AI1A 2B7YA 3WR0A 1CGPA 3PNAA 3B5LB 3QCWA 3MFCA 2D3RA 5DXDA 4WVZA 2RR11 3VDDB 4HVQA 2ZABA 1GKBA 1CJDA 1KJLA 4KWKA 2CGNA 2B9UA 3POSA 1PVXA 3AMPA 1MEC2 3WG1A 4N90A 3KT4A 2OUJA 4EN7B 4E2QA 1X36A 1V6LA 5DZFA 1D4VB 2RS32 1LU2A 3FHIB 3A0NA 4INDA 1PO13 1SLIA 4LLFA 4I09A 5CFDA 4M3CB 3MW2A 3M3QA 1QJU3 2WLPA 1HQNA 2RM22 1S0BA 2OZ6A 3WUDA 1RMU2 2Y38A 3TN91 3I4IA 1BBT1 1FV3A 4M3CE 3WOGA 1G86A 2ARBA 2D6NA 1REEA 5T3NA 1NA1C 1WW6A 4QM9A 4RGGA 3OPZA 3EHKA 5SV5A 1OOPA 1SBEA 2JEMA 1SBDA 2WJSA 2XBO1 3DGTA 4L11A 1ZRCA 5K9YA 4DY5A 3HWJA 5C4WC 2PELA 4YGCA 3BOPA 4LA3A 1GZCA 5T54A 1GZ9A 2I45A 2QKDA 1RUI2 1Q43A 2ZGLA 1VBE3 2WQZC 4AGGA 2CWMA 1R1A1 2YUEA 1FATA 4PCRA 1QJZA 3PVOA 5FTTC 5BNOB 1CAWB 3R0RA 1OKQA 4YG0A 5JSPA 4Q1PA 1IKPA 1F9KA 2UWAA 4LHKA 1Q8SA 2QUOA 1BEV3 1XNBA 3NSTA 3VZJA 3MLKA 2A3YA 5KXCA 4D94A 2WQ4A 3ELNA 5ACA1 1CVNA 4Y22A 5C9AC 3QD6A 5J96B 4NVPA 2Z69A 1DQ0A 4HKWA 4WM7C 1KXGA 4OI0A 3RG0A 5BYNA 1WBLA 4PDWA 1GV9A 2HWD1 1I6XA 1FPN2 1BKZA 1Z0HA 4HSLA 3WHUA 3JQXA 2ZGRA 4GH4A 4YZ1A 4FTSA 2Z42A 4ES8A 2V5YA 2AGSA 3RYRA 5IK5A 1MS0A 3O14A 3VGIA 3ZFGB 2R063 4DOUA 3CL1A 3KM5A 3B02A 3C3VA 1H8TA 3S0MA 1NYWA 1N47A 3HD8B 2H0VA 1KFXL 4UBHA 3SCHA 4JGYC 4R4XA 2OIIA 1NXMA 1NG0A 1PGW1 3KT1A 4BM8A 4RHV3 2NP0A 1UF2C 1LOFC 2DFCA 4HT1T 2BPA2 2WFF2 1RUF1 4B4RA 1U12A 1VB2A 4UXAA 4TWTA