3MIBA

Oxidized (cu2+) peptidylglycine alpha-hydroxylating monooxygenase (phm) with bound nitrite
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
310
structure length
308
Chain Sequence
NECLGTIGPVTPLDASDFALDIRMPGVTPKESDTYFCMSMRLPVDEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYWFCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFNHKDCSGVSVHLTRVPQPLIAGMYLMMSVDTVIPPGEKVVNADISCQYKMYPMHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQNPQLPQAFYPVEHPVDVTFGDILAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYMEAKYALSFMTCTKNVAPDMFRTIPAEANIPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-glycine alpha-amidating monooxygenase
publication title Differential Reactivity Between the Two Copper Sites of Peptidylglycine alpha-Hydroxylating Monooxygenase (PHM)
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 64
structure length 308
sequence length 310
ec nomenclature ec 1.14.17.3: Peptidylglycine monooxygenase.
pdb deposition date 2010-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01082 Cu2_monooxygen Copper type II ascorbate-dependent monooxygenase, N-terminal domain
A PF03712 Cu2_monoox_C Copper type II ascorbate-dependent monooxygenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.230 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3mibA02
2.60.120.310 Mainly Beta Sandwich Jelly Rolls Copper type II, ascorbate-dependent monooxygenase, N-terminal domain 3mibA01
3MLKA 3MIBA 3MIHA 4QHBA 4E4ZA 3PMSA 3MICA 4R4ZA 4R4XA 1PNFA 3MIEA 3MLLA 1SDWA 1PHMA 1PNGA 3PHMA 3MIDA 1PGSA 3MIGA 1OPMA 1YJLA 3MLJA 1YIPA 1YI9A 1YJKA 3MIFA 3KS7A
chains in the Genus database with same CATH superfamily
4CTEA 2ZX1A 3FUQA 1TZOA 1D0GA 4M01A 4NHLA 1GR3A 2PA7A 1IKQA 4AGGA 2ERFA 2WLQA 4X6RB 2R1DA 4JGZC 2JEMA 2MEV1 2WFPA 4CDQC 5KHIA 5IK7A 1MPXA 1W0PA 2BWAA 4I30A 3P3NA 3RI9A 3ZN4A 4C8DA 3O1RA 1R1A2 4Z92B 3D0SA 4CU9A 1U5XA 3RRDA 4GQ7A 4CUGA 1FPN1 4EZHA 1W9YA 2X8KA 1HRI1 2L9LA 4PQQA 1VMHA 2BOJA 5DG1A 2HWC1 1NZIA 2V09A 4E2QA 1DYPA 1LGCA 2VCCA 2VQTA 3CJXA 1QDOA 1K3IA 2D98A 3KT1A 3LPFA 4QDRA 4Y22B 4OHYA 3ZFGB 1NCQA 5FZFA 4RGAA 5BNOB 2D5HA 3CDZB 1X9TA 2ATFA 2WWUA 5DAXA 2W1QA 3THPA 1SFPA 4TN7A 2RDNA 4YW5A 3SCHA 4Y24A 1PZ9A 3FN9A 3VKMA 4FXGB 4E8DA 1PO22 4L0PA 3WP5A 4AYUA 4DOUA 2JD9A 3AP9A 5EYYA 4BQYA 1LJ7A 1ZVFA 4LUMA 4YG0A 2GC0A 2JG9B 2WT0A 4QX0A 4UFKA 4NWVA 5T52A 3T08A 4CU7A 5J37A 2Q1FA 3VHRA 3QACA 4GALA 3J8F1 1PHMA 4AFBA 1UOJA 5FUPA 1FV3A 2PHUA 1RUI3 4GB31 4XCAA 2DVBA 4XUPA 2WN3A 3OPZA 4Z07A 2BQPA 2C4XA 2BU9A 5ABJA 5IK8A 3J7LA 5DUVA 2KA3A 2VOVA 4XF0A 3URFA 3LAGA 1OLRA 2DVDA 2IXCA 1DZTA 2AZ5A 2D40A 3AZZA 3NJZA 4GMP1 4P5YA 2W47A 4YVSA 1YC61 1JZ8A 4AHXA 1V70A 1D4M3 1QJFA 2XOMA 1GICA 3PTYA 4KNCA 4R4XA 2WIIB 4YW6A 3NV3A 4XABA 1K45A 1NA1B 1RC6A 3UKNA 3U37A 3MYXA 2E33A 1A3KA 4PBPA 4HK9A 2VTXJ 5BNOA 5FJHA 4C91A 2ORZA 4Q26A 2PAKA 3O12A 4RA0A 4K8RB 3VL9A 2LTNA 3BOPA 1X82A 4IV3C 1LTEA 3AKQA 1V9U1 1DQ1A 4N9HA 4R8HA 3TNQA 4LO5B 5EHDA 1O3SA 3PIGA 1MS8A 2BGCA 1W8WA 1GZ9A 3ACIA 1C5HA 2TNFA 4LEJA 4PDWC 2HWE1 3BU7A 4HPKB 3MICA 2Q30A 3JZVA 1RUD2 4AVVA 1LHUA 3CJIA 4HSJA 5JOZA 2Y33A 3S7EA 4IW3A 3VDAA 2Y6GA 2LROA 3TEXA 5I91A 4A3XA 4L97A 1PGL2 1QXPA 2W95A 2VBPA 2P3IA 4Q0UA 4N43A 2JG8A 1W8UA 2IZWA 5FZBA 1H6XA 1RXGA 1GANA 2CDPA 1G6NA 2VCBA 2XONA 3UGFA 2FDFA 3AMHA 2W5FA 1F8VA 2WNVB 4Q1PA 3OPWA 1YFWA 1KXGA 1UY0A 2Y8KA 3KGZA 4IEXA 1IHMA 3FLRA 2XG3A 3VHOA 3TEZA 2B8MA 2VNRA 3ON7A 4AWDA 1J84A 2R49A 2UYBA 2Y26A 4I0AA 4OMDA 5FUIA 1SBEA 3HQUA 1DQ2A 3J7HA 2ET1A 4LOTA 5BXXA 3M4FA 4JRAA 1NY71 2GC2A 1AR93 4GA9A 1VMFA 4EN9B 1AR71 2E9QA 4R9CA 4IEVA 4LKEA 1H4HA 4IV1B 3ZXAC 2JDYA 1KRIA 2VO5A 1VRH1 2ET7A 4GWIA 3ORJA 5BV6A 3S57A 5FZ6A 1LGBA 3OJBA 2Z5WA 4XYXA 4BQ2A 3MV11 1HB3A 2JKBA 1Y7BA 1VAMA 4D6SA 4EROA 3TAYA 1MEC2 4AQ2A 3J26N 4CDWB 4FSJA 1HLCA 4MV2A 4Z2WA 3O1OA 1SDWA 3SH4A 5EP9A 3H7JA 1ALYA 2W52A 4FVVA 2ZZQA 3GJAA 3CMGA 1LGNA 2VTFA 1TME2 3PUHA 1KS5A 1UWWA 1ZYBA 1G9FA 4BB3A 5CFCB 1ULEA 2WO1A 2P3KA 3ILFA 2HH9A 5LRRA 3L2HA 1YJKA 3RJRA 2PLV2 1EY2A 4MXWB 3NSTA 4L2NA 1XE7A 3GBGA 2C0ZA 2ZGTA 2EIDA 5FYHA 1QJX3 3I2DA 2GN3A 4MOAA 3JXSA 3GBWA 2WNUA 1ND3C 3RI8A 1IG0A 1TE1B 5JWPA 2W1WA 2YXSA 1R082 3ZDVA 3IMNA 2PXJA 4K1YA 2Y0OA 4IEOA 2EIEA 3ZXEA 2RM22 1OT5A 1Z78A 2YV8A 2PHLA 4O61A 2QQWA 4CE8A 2WZ8A 2A3YA 3ACFA 3PVOA 4IV1A 1BVVA 2VW2A 3KB5A 1H9PA 4IXLA 3H0OA 5FY0A 3VV1A 2W94A 4UBHA 1SG3A 1L3JA 3ZFGC 4XDPA 1ZBE3 1AJOA 3WVJA 3CNAA 5BNNB 5AFBA 4QX8A 4YG6A 3VKFC 3KHCA 3IPVB 2P3YA 2LS6A 4ZU7A 1W99A 1UOGA 2QNKA 5HV4A 1HV1A 1VLNA 2IXKA 5HCBA 1NLQA 1A34A 3VKNA 2JG9C 4CEYA 5AVAA 5FZOA 5F6LB 5FZ0A 3BI3A 1UZ0A 1FMD2 1ACCA 3NNLA 4HN0A 3WDTA 3ZXGA 1NXD1 3FBMA 5IJRA 1YHFA 5FZMA 1SLTA 5IVVA 2YBPA 4QM8A 2EALA 5A7PA 2BYVE 3NWKA 4MXWA 1W90A 1AXKA 1RHI2 4CXYA 1JS9A 1SCRA 4QU2A 3WD5A 5LEKA 1QJY3 4XQDA 3VBHB 3AVRA 2CWSA 2VXRA 4MGSA 2WUHA 3DYOA 2VR4A 3PMEA 4EE2A 5ANNA 3H42B 1NXMA 2ZTNA 1LOGA 1SLLA 1EAH3 1V6IA 2WN2A 3D0JA 4QQPA 5A7WA 1YO8A 1F15A 1NA1C 1T6BX 1WLTA 4QXHA 4LTAA 3MEPA 2J1VA 3LDKA 3T4HB 2BVBA 1JOPA 3ZYGA 5JOXA 4URAA 4CRQA 4ZZ8A 1OXCA 5ANQA 3AYDA 2GNDA 2WFF1 5FXVA 4XFAA 3N4MA 4ONUA 4IGOA 3IPVA 5C7GA 4AEDC 3NNFA 1U5IA 4Q4X2 3CO2A 4HANA 3WW1A 1A78A 5H9RA 2FHRA 2QBXA 4FPGA 2KM2A 4S2GA 3B94A 4I3PA 2A73B 3N7LA 3OCPA 4MGIE 5FZ1A 5K4LA 1HXS3 2MPFA 1GWMA 1K12A 4G3YC 2DUOA 3ZSMA 4UFHA 4K21A 4L8QA 5E88A 1VBC1 1AR81 2B9UA 2FZ1A 1JU3A 2QQKA 1BEV1 4ASLA 3B02A 5IVYA 2K9ZA 4ES8A 2CAVA 3OF1A 1GQGA 1PNGA 3PL0A 3VBHA 4YW1A 4A42A 2AEYA 1M4WA 1MQTB 1NLSA 3QOPA 3RYPA 5JXIA 1XYNA 1OI6A 2ENRA 2VMDA 2YGLA 4KL1A 4Y1UA 4GH4A 2VW1A 1G7YA 1GZWB 2WNVC 3GHNA 3HWJA 4I3GA 4NIAA 4FBFA 5BNQA 2Q8OA 3NAPC 4BXSV 4W6YA 4COWA 2VVFA 4PBOA 1NT0A 4CP1A 4FTBA 3RWKX 2HWF2 1KD7A 3H3ZA 4Y5Z0 5FYBA 1ZRIA 1D4VB 2XVLA 1V6KA 4NRMA 5IVJA 2WKKA 5D8AA 5FP4A 3QH7A 5EJ1B 3LB9A 2OXBA 1ULOA 5GZDA 1ULPA 2CU5A 1NAEA 4EQVA 4FCAA 4YWAA 1VBA2 2FDJA 1UMIA 3I3BA 2XXZA 4LE4A 2Q1MA 1CAWB 1PK6B 1VBD1 1W2TA 2BUKA 2QQIA 5KHHA 2NMNA 2CGOA 1POV1 4HL0A 4XVHA 3ZMNA 2VZRA 4LMFA 4HBNA 1MS4A 4QQHA 4ZPIA 5FZDA 2K46A 2AYHA 1W8TA 4RHV2 2E51A 2IXJA 4R9DA 2O0OA 4DO0A 2VBDA 2G9FA 5C8CA 5CAZA 2HBUA 5FRAA 2DVFA 3LEMA 3KMHA 4QX1A 3ZYIB 5DABA 3IDEA 3KM5A 5I0TA 3I49A 1XNCA 1BBT2 3DEMA 4LO4B 3MGUA 4LBQD 2VMEA 3WNMA 2HWB3 2E7TA 3F2ZA 2YGMA 1MQTA 2DYCA 2Q1ZB 2OT7A 2HEWF 2VOWA 3W9AA 5CFCC 2GSYA 3KT4A 4HKWA 1PX4A 4AQ6A 2MHFA 1EV12 4AVCA 4AL9A 1HJGA 4LUKA 3ZXLA 4B4QA 3B9IA 2OZ6A 3MDPA 4JAAA 4URTA 5EPAA 5BNPB 4LBJA 5FZAA 4YGBA 3HBZA 3KHBA 1AL23 3ELNA 1CPMA 3X29B 3FZ3A 2G4IA 1IZ3A 3L9JT 5FMOS 1VB4A 1YI7A 4Q5OA 2Q8DA 5DDJ2 2I07B 1PO11 3VD7A 2QDNA 4Q4V2 2ZABA 1WLDA 4FOVA 5JXJA 4DRRA 1IOAA 1OA2A 4FOQA 3DPRC 1DZRA 1YQ2A 2HWD2 4UF0A 1YRZA 1ULDA 3PHMA 4CCMA 4XF9A 2PN5A 5JSPA 1OF3A 1UU4A 4L9BA 1CX4A 1DG6A 1YFYA 2GC3A 4Q8LA 2CV6A 5FR3A 4XHBA 3RZGA 4BMBA 2VZQA 2YFUA 4YW7A 1LOFC 2NN8A 4HZFA 1VBB3 4QAWA 1QXRA 2CNAA 3WG3A 3JD73 3ZO0B 5L7OC 3VBFC 4KGGA 2ZXQA 1ASJ3 3BVCA 3JBG1 1YFUA 5BUVA 3ZYJB 4YM0A 2OPWA 4JKKA 1XNKA 1VRBA 1BLZA 2VQ0A 1O3TA 5IK4A 5BNPA 5FPVA 5JXGA 4QX7A 3WV6A 1YI9A 2VUCA 3WF2A 4NOTA 2ARXA 1PGW1 4K9SA 4UFJA 3HAGA 1V6JA 3UK9A 1BVP1 3RNSA 2FD8A 3AZXA 4AI2A 1RB8G 3LFMA 4Z82A 1CQ9A 4HOOA 2R041 3NNMA 4PIXA 5LA0A 4HVOA 5FYCA 4EWAA 4LXLA 2W2IA 3R4DB 4R4ZA 1IS4A 2J1TA 2VMGA 4DEQA 1LNSA 3KCCA 4CVUA 2VZUA 4ORFA 5E6HA 5LA9A 2Y6LA 5FYYA 4K8FA 5GKAC 5FXXA 1PVC2 2VM9A 2R073 2VGDA 2WZR3 3WDYA 2YPDA 1ZRDA 1AYN1 1W6PB 3M3CA 1AYM2 1W8OA 2WNEA 5KXDA 3B3QE 2O1QA 2WWJA 3HOBA 4I0BA 4D0QA 4YLZA 1LU1A 3J7NA 4LT5A 4GXLA 1UU6A 5IFTA 3A22A 1UIJA 4B1LA 4Q2FA 1UZVA 3NO8A 3I2IA 2ZAAA 3OUIA 4TLFA 3WHUA 3ZM8A 5KHGA 4Q0QA 2XJTA 1W06A 4QHBA 4AQSA 4AZZA 1CJPA 1PVXA 3ZMOA 2BPA2 3M3EA 4CDXC 3AK0A 4JGZB 2EAAA 2GDFA 3KVBA 3MI8A 4H2AA 1UW8A 4MSVA 4CDQB 1UN1A 4V1PA 1X33A 3I4IA 5LBCA 3N9OA 1LKNA 3BTXA 2B5HA 1CONA 3I54A 4AEMA 1DF0A 2IC1A 4B29A 5HBAA 3K3OA 1Q5OA 2VCMA 1YJLA 1PMJX 1ZBA1 4JX0A 1CZTA 2IFRA 1BMV1 1XOYA 1CAXB 1I5ZA 4LLOA 2G9ZA 2XJRA 3N36A 5LA2A 4CEWB 3VDDA 1Z7S3 2BGPA 3SCGA 3VLBB 3AKTA 1R1ZA 1RUOA 2ZGRA 3ASIA 4CZSA 1QHDA 2WZPP 3CLPA 1DQ5A 3OY8B 1WA4A 4RR3C 1HQNA 5C8WA 4AGVA 2WS92 1RUE1 1CPNA 1QJU3 1RUC3 2XB6C 1AHSA 1F31A 4NJ4A 4CU8A 5C9AA 4YVWC 1AYN3 4A6SA 1W9WA 2RS31 1PK6C 2CGNA 1VR3A 2EA7A 2RS52 2W92A 4LK7A 5T5JA 3WP6A 4ZZ5A 5L9VA 3LE0A 3HNBM 1WKYA 5A3UA 4YW4A 4F83A 2UU8A 3HIFA 4XAEA 2P2KA 1PIV1 1COV2 2VQAA 4XACA 3ZR5A 3I8TA 1QY4A 1ULGA 1CAVB 1XSRA 1C5IA 1RVF3 4JGZA 5FLHA 1R093 4W6WA 2VNOA 4GWNA 4HN1A 3RMXA 2RS11 2Y6HA 4DZGA 1CD3G 1QIQA 3UJQA 1WWYA 1QXJA 3E5QA 4JTNA 5IW0A 4D8MA 1HRV2 1N3OA 1S2KA 4M00A 1ZZ7A 2G1MA 1OMIA 2RR13 1X8MA 2W1UA 4XJUA 5CFDC 3OBAA 1JHNA 2YDEA 4FOWA 4LO7A 1SPPA 2GNTA 2HBTA 3VBUB 5CZKA 3SISA 1DHKB 2WRAA 4DIQA 2JWPA 1AF9A 5T3NA 5AC92 1QQP2 2X29A 1UMHA 2FZ2A 3N7MA 4WM8B 4Y1VA 1BJQA 4XUQA 1YFXA 2PHTA 4Q4W2 1MVQA 4DXTA 1OF4A 5CG8A 3MIFA 3RZMA 4NHXA 4G9SB 4S2DA 3TBDA 1RUG3 1W2OA 5G04L 4OHWA 3J7MA 1CGPA 3FLTA 1BYHA 3KV6A 5KBFA 2VC9A 5F9TA 1LAJA 2D6KA 2A3WA 3USUB 2B4KA 5FZ3A 1QNYA 2CGPA 3SH5A 5DUXA 3BCWA 4MXVA 4HMZA 2WO7A 4YM2A 3WQBA 4K40A 1XNDA 2W3JA 2Y0IA 4NWWA 1WMEA 2D7FA 4CCOA 5A1AA 1C8M3 5IVEA 4XF4A 3H3UA 4WVMB 3WCSA 3MIGA 1O3RA 3EQEA 4UW3A 2Y6KA 2A7AA 5ACA3 1WA6X 4BMEA 1RUH2 4A44A 4IEWA 1FI2A 1FOD1 4BQ5A 3VGIA 3N7JA 4ARXA 4B3NA 1UIKA 3VBOC 2WABA 2XJVA 1LCLA 1TMF1 4J1WA 4N53A 5FFOC 4NE9A 4ATFA 1ND2C 1DFQA 3GCWA 1QU0A 1AUYA 5F2WA 5JIUA 3ZSEA 2XBO3 3RQ0A 1VPHA 1MZFA 2OIIA 3OEAA 2ZS6B 5ACA2 2WDBA 5FZHA 2TBVA 1MZ5A 4GJZA 5KXCA 3VDCA 3M3IA 1WCSA 3HN1A 1R1A1 2BZDA 3OGJA 4ZXEA 3CZJA 4E4HA 1AR63 1NLRA 4U36A 4BA6A 3BGAA 4IV3A 4WVWA 1GYKA 1XU1A 3AXEA 4Q27A 3JU9A 2D6LX 1OFSA 1JYCA 1SLIA 5FPAA 1H4GA 3WNOA 5FO8B 3OOXA 2EXHA 3BIEA 3POFA 4PDWA 4LR4A 4CCDA 4Q4Y2 3IIIA 3WT3A 1DBNA 1W6MA 1XBFA 2ZMLA 1B35B 3THTA 3KF3A 5K0UA 1JYXA 5F6KA 1ENRA 1PO21 2I45A 4P9IA 2ZGQA 1LOBA 4L99A 3GJBA 4XILA 5DXDA 4OZXA 1DQ6A 3I2HA 3N9PA 4E8CA 1JYIA 4EN6B 1VBE2 5CBLA 1LB2A 4Q8KA 4FAHA 1JOJA 2ZEYA 1J1LA 1CZSA 3HNYM 4C1XA 1H6YA 3TN93 1W3VA 2CHHA 3I3EA 2WT2A 1SMVA 4XHXA 1JUHA 2YY1A 1HN1A 3KCXA 4ZONA 4LKFA 4WM7B 4AVBA 1JZ7A 1RITA 4OI4A 4KBZA 3KV4A 4R9BA 1ZRRA 2C9KA 4GULA 3HN3A 4A7ZA 2V72A 3VD9A 4ARYA 1K5JA 3ZN5A 4OUMA 1ND3B 2ZA9A 3V56A 3V0AB 5FPUA 1UYXA 5FPLA 4JDOA 2RE9A 5HXMA 3VD4A 5I0RA 2JDAA 3RVHA 4P9WA 2BGOA 4FPKA 1EUUA 1YQ6A 2RHPA 4KU8A 5FWEA 4D69A 2A6XA 4CDUA 2VMCA 3TB0A 1REDA 4MZUA 1UQXA 2Q8EA 5LB6A 4BXFA 3R0RA 4CEWC 2XQRA 4XFBA 3W5MA 2IVJA 1OKQA 1RMU3 3FBYA 2DF7A 4XXAA 2X53S 3E5XA 4M3CB 4O9EA 5A3NA 3C2UA 3ZFFC 4CXXA 4HSLA 2XVGA 1ZRCA 3LWCA 4LHLA 4KI5M 1Y3TA 4NPRA 4XIKA 5F5IA 3AJYA 3D3AA 3C7GA 1QOTA 3T0BA 3VKLA 3THDA 1J3RA 3GF6A 3VDBA 3POIA 3WEZA 3AB0A 1NUKA 2ZHNA 1XYOA 1RUD1 4YSFA 3MZHA 2HEVF 3JQXA 4AK3A 3VZMA 1W9SA 1XYPA 2R063 3AL6A 5DAQA 2XQXA 1R64A 2NM1A 4QQ2A 4B4RA 2VZOA 4QXCA 5C3OA 1PGL1 2D97A 4PI0A 4AI1A 4XDQA 1H8TB 2GAUA 3WDXA 2MEV3 1C28A 2DU0A 3SC7X 2DTWA 2JICA 1ND3A 3HJRA 2SLIA 2DCZA 3NKGA 3RDIA 1C8NA 4XJ8A 1YIFA 2CDOA 2W08A 1PM4A 1JI6A 1O4TA 1RUI2 3HVDA 5CVRA 5FPZA 5IAVA 3VBUC 1ODMA 2ZMNA 1FPN3 1JZ2A 1UKGA 2FCUA 1DYKA 4CUBA 1HRI3 1UYYA 2AGSA 2K0GA 2ZHLA 3OUHA 4JKMA 4YZ4A 4TLGA 1VAVA 2HWC3 4WM8C 2KXLA 4Y22A 3HR9A 3C7OA 2A70A 1CESA 3ZFGA 4C0BA 5C33A 3U1XA 1YWKA 3UNPA 1YEWA 2NYYA 1D4M2 4OLLA 1JODA 2P1BA 4O7XA 2DV9A 4M3CA 1IS3A 3POSA 4PF5A 4AEDB 1UY2A 4F8AA 2BV4A 4Z2AA 1UF2C 3P6BA 5A3MA 2EICA 2JG9A 4QX5A 3V65A 3WZ1A 1UZWA 2V4VA 2I2SA 2G9GA 3Q9OA 4EWEA 1S0IA 2XGXA 1FYUA 1CJDA 4OI0A 4XMAA 1F2NA 1Q8QA 2ZGUA 2Y34A 3J8F3 5FMOL 1QF3A 3AL5A 4XUTA 5FTTC 5J98B 4GB33 2AEZA 4Y33A 4E2SA 1E5HA 2YROA 4KG0A 4O65A 1OD5A 2J42A 1MEC1 2VE1A 1G9AA 5FZKA 2XLGA 3ZYHA 3VZNA 3K4DA 3AYCA 4N7UA 5FPXA 2D6MA 2FDIA 1QDCA 4P02B 2QVSB 4TZDA 1TME1 4GMP3 1NG0A 4HLTA 3TRSB 1PX3A 1OH3A 4KGQA 4PI2A 1GNHA 1LOCA 3NAPB 1DQ0A 2PLV1 2X10A 4E4ZA 1NA1A 1LULA 2B7YA 2R0FA 3ZOIA 4H14A 3PIJA 1O8PA 4JGYC 3HNMA 1YYNA 1VAKA 4XMIA 3DYPA 3PUIA 3MIDA 2DBNA 3VZOA 3LEIA 1WD4A 1R081 4CCNA 3IT8A 2XVKA 5FK7A 5FY9A 4AEDA 1EYBA 3VD3A 1X36A 2RM21 5FQ0B 3WP4A 1V9U3 1H2NA 2YFZA 2KR2A 5FZ9A 1QOOA 1GZTA 4M3CF 3AFKA 4HPKA 1JUIA 3V0BB 3GZAA 4ASKA 2HWE3 2VNVA 2XHNA 1G8WA 4AFDA 1IQDC 2VMIA 2BNNA 3NKTA 2HEYF 5DAPA 1B35C 5A33B 5C3RA 2ZX0A 3ZYFA 4D7TA 1O59A 1AR92 2WZEA 5A32B 2VZPA 5IHRA 2ADDA 3MW2A 4B7EA 5A1LA 4WVVA 2EIGA 5JI9A 2Y38A 2BEOA 1J3PA 4BWOA 1DLLA 2A1XA 5LBFA 1FMD1 2VD7A 5A3OA 2OX0A 2A6WA 3NV2A 1F5JA 4DXZA 3A23A 2WNVA 4UW6A 5DMYA 1XNBA 1HW5A 4BPZA 4CPBD 4G4FA 1NCQC 3NAPA 3SH3A 3U75A 5CNAA 3WG4A 4NIGA 2P37A 2EF6A 4IE4A 4WM7C 1RHI1 3SKJE 2J1AA 2ZHMA 2QQMA 3AX4A 2XKPA 3MPBA 5M0TA 5DUWA 3ABZA 5C5TA 2ZEZA 3R4UA 1UKRA 1KFUL 1W3XA 5GZEA 4J1XA 3SNMA 1ULCA 3UGHA 2XLAA 1DCSA 4ITCA 4QPIB 1H1MA 3ZXDA 4BM8A 1SQ4A 3VB9A 1JZ4A 2GU9A 1AR73 2OQ6A 1GQHA 1LHOA 1S0CA 3ATGA 4GMP0 5A6YA 2GNBA 3DPRB 3POGA 5C71A 3K46A 5ABJC 5FOBB 4OZOA 1QJX2 5FUNA 5G05L 5JZGB 5A7NA 1VRH3 4BQXA 4CCKA 4S2HA 2XJSA 1QWRA 4YVSC 3ACLA 5EJZB 4HK8A 2FMYA 4CDWA 1NY72 2C5DA 1X8EA 3VKOA 4NHYA 4Q4X1 1TNRA 1SLBA 5GM0A 5L7OB 2ZACA 3VBFB 2OVUA 3WHTA 3E6BA 3HQRA 1O3QA 3M3QA 3IZOA 4LKDA 5JR7B 4Z8BA 3D8CA 4XTMA 2G19A 5LK5A 4J6GA 4NRQA 4BIFA 3DECA 5FYIA 2YC0A 1QH6A 2DURA 4A4AA 5CFCA 5K7PA 3H8RA 1ZBE2 2QUOA 1HQWA 3K3NA 2XKOA 1ZZBA 2W68A 1US2A 2CWMA 2UWBA 3DL3A 5APAA 3LA7A 3T09A 1XE8A 1S55A 4HETA 3TNPB 2QQUA 5EFUA 1KFXL 1UY4A 2O8QA 4Y1YA 5FYVA 1W6NB 4QWNA 1DZQA 2D3PA 1H8TC 4Q29A 1VMJA 1XU2A 2Y64A 4AOCA 1UX7A 1UXZA 4JV4A 1QJEA 2D6NA 4RS5B 1US3A 1N1SA 4ZXKA 4BOWA 3GHMA 3N9MA 1AX1A 4I02A 4M3CE 3RFRA 2PQQA 4LIUA 2BWCA 4W6XA 4E4SA 3LD8A 1DGLA 2IXLA 3ECQA 1WBLA 2HWF1 4YM3A 1JYWA 4QKFA 5K8SA 2QQPA 1LODA 1QJY2 1C1LA 3ST7A 2OA2A 3WNKA 3NQHA 5A7SA 3HBKA 3IN9A 4MGYE 2D3SA 4XAAA 3WOGA 1L7LA 4QXKA 1SBFA 4QX3A 3U11A 5DAWA 3B00A 4K20A 2XJUA 5DAVA 5JVVA 4BZ4A 4A41A 5BNNA 3GBFA 1LOFA 2VVEA 5LY2A 1W0OA 1F4HA 1EAH2 1UZZA 2CAUA 3LF7A 2V73A 2XLFA 4JCKA 3HT1A 4KQ7A 1VBA1 4PT6A 4BK5A 3QH6A 1V6LA 3N9QA 3SHRA 5IFPA 4AG4A 3I3MA 3RZKA 2ARCA 1HB1A 2NP0A 5IWFA 1B09A 4CP9B 1F4AA 2JDMA 2NQYA 1WZXA 2ZGKA 3WW2A 2XPJA 3ES4A 3ITQA 4YW3A 4RHV1 4W8JA 4DY3A 1E5SA 4GKYA 4PJYA 4XQ4A 1UXXX 3VL8A 5JCTA 3AMQA 2JDHA 5KXEA 4E9KA 4XXPA 1W6NA 3BOWA 1BBT1 4QDSA 4JHZA 5I8SA 1ZNPA 3DN7A 2RDSA 3S6PA 4FOYA 4LBLA 2F4PA 4B7KA 1S0GA 2RJLA 1HXS2 4RGKA 1OOPB 2EVXA 3VHPA 1AX0A 1NX9A 2P4EA 4BQWA 3CIHA 1WW4A 3B7MA 4PLNA 3RZHA 4JQTA 1EV11 2YMZA 1W8FA 5EQUA 4NIIA 1CAUB 5LBEA 4NROA 2GC1A 2VNGA 1MR5A 1RUJ1 3B93A 5F3EA 2JDKA 3ZLIA 4CPBA 4DFSA 5GALA 1JZ6A 2PAMA 4XBNA 3H8UA 1HKDA 1Q43A 4NVPA 4RR3B 3PVNA 3POJA 5FYTA 2GH8A 5FBJA 1G86A 2VZ3A 2WFF3 5DDJ1 4CA9A 4YVWB 4FFGA 4XIOA 4Q4V1 2DDUA 1ENXA 1QNWA 5A7OA 2WA4A 4JQRA 2HWD1 4W4ZA 3VD5A 4C1WA 2OUHA 5IUQA 4COVA 5F3GA 3SKVA 2IVIB 5LK7B 3AZVA 4YGDA 1WD3A 3I97A 2XJQA 3ZDSA 5A1FA 5FO7B 4CDXA 3C8XA 4HFSA 2DUQA 1VBC3 1AR83 2RDRA 1BEV3 2UY8A 2VZVA 2WINB 1GNYA 1GOGA 3H1WA 5SV8A 3BPSA 3VBRB 3K2OA 5CFDB 1JOBA 1RUF1 2FDHA 2RJ2A 3NV4A 1GZWA 5CU1A 4HG6B 1LOEA 4NO4A 4A6OA 2UYAA 3QD6A 4XFFA 2DWRA 4UAPA 5JI7A 4DB5A 5JSOA 2VZTA 5FJKA 4IESA 3PLQA 1QH7A 4OHVA 5KC5A 2VPVA 4XFHA 2HWB2 3K51A 4NUBA 4QB2A 5F7UA 2A3XA 4KG8A 1HN0A 3M3OA 5FY8A 4D6RA 4QX2A 4RR3A 3ZPOA 1GSLA 3S5QA 4QPIC 1W6OB 2YZ4A 3ZPYA 1WMXA 1CAWA 1PK6A 2DCJA 1GNZA 3H1YA 1OFNA 1VBD3 5J3UA 2E63A 1RJ7A 2LALA 5JZGC 3H1MA 1JXNA 1POV3 1AL22 2EXIA 3BIWE 1PVC1 2VOXA 1AYM1 3U14A 2VTXA 4P9YA 1GOHA 1N1TA 4ZU4A 2CTVA 4QXBA 4YZ5A 3VBOB 1WMDA 2CSGA 2X09A 4LITA 4NPMA 2AACA 5CFDA 1KEXA 4FI9A 4LHKA 4AHYA 1ND2B 4ISQA 2YYOA 3R6SA 1RUF3 4GJYA 5KR7A 5H9PA 4CU6A 4FTEA 1ODNA 4XBLA 4YZ3A 3D82A 5L9BA 3O1VA 3USSA 1HJFA 1VBB2 1J83A 4C90A 3BB6A 3AFGA 3JD72 4TWTA 3RYRA 2J1UA 2RV9A 3OGGA 1NE6A 2B39A 3WUDA 1SCSA 2W9XA 3O0VA 1ASJ2 3U78A 1K42A 1S0DA 1O5LA 1PMIA 2PMWB 3RJ2X 3SEEA 1JW6A 2WJSA 3T2PA 4RS5C 1SACA 1WCUA 3ILRA 4ZS3A 4XQWA 1W6OA 3ILNA 3CHXA 5GZFA 5DZFA 1OH4A 1PO13 3SCFA 2YBKA 2BDRA 5F3CA 1I5PA 4DMIA 1UOFA 1O8SA 4E27A 3MF6A 3IAPA 1UPIA 2ARAA 3N9LA 3NJVA 4H55A 2JDNA 4MHUA 5FLJA 2XHKA 3WINE 2J1RA 1WW5A 1ENQA 2JE8A 2WSUA 1EPWA 5BY5A 3FE5A 2BVVA 1VIWB 5I8TA 4MYEA 1LEMA 2VZSA 2B9VA 2RS51 4BJ0A 4QB1A 2YPJA 1XNTA 4QPGB 1H9WA 5FZGA 3I2OA 2QZ3A 3H50A 4QQLA 4MX3A 3T3YA 3FFQA 4K6BA 3JBG3 1ST8A 1NE4A 5D8AC 2R072 1ZRFA 2WZR2 1COV1 2Q0AA 1Y9MA 4OFGA 1S1AA 5A3TA 1GUIA 1MS1A 1NZCA 3LEGA 1POV0 4A45A 1L7RA 1OVPA 4EYUA 2FBEA 2X5IB 1RGSA 3FHAA 2E26A 2W46A 3AJZA 4QU1A 2AR6A 4XBQA 4BIOA 1HRV1 4LJHA 1W2UA 5LATA 3KQ4B 4GAZA 2D6PA 5DZGA 5FMDA 1J3QA 2NMOA 5HI0A 1SZBA 4RSUA 5SV5A 3VBSB 1JTZX 1X9PA 1OOPC 5FREA 2CL2A 3KV5A 5AC91 2PTMA 4PIZA 1Y43B 5F2SA 2A75A 3PUSA 3DYMA 4AI8A 2R043 3R05A 1FXZA 1XRUA 4HXCA 3PTRB 4CXWA 4PLMA 4Q4W1 5JAXA 2E6VA 1W6QB 5T5LA 5L19A 3ZR6A 1C4RA 3FWEA 2ZPXA 3RYKA 3ZX7A 1BZWA 2ZKLA 3KF5A 1WBFA 3ZSLA 1QKQA 3ZFFB 4EN7B 4YYOA 4AVAA 1YCIA 3LPGA 1W6PA 4IL7A 5EXOA 4IE5A 3ZIWA 4AFMA 3MHZA 4KWKA 4MGKE 2F17A 3ZXJA 2PHDA 3WY6A 2ARBA 1OQEA 1W0NA 3AVSA 1Z7S2 5GLWA 1GBGA 2VAUA 2ETEA 1Q8VA 3A0NA 3P3PA 2BERA 4J25A 5FP3A 2JECA 5JXHA 1RL3A 4KMQA 3Q8CA 3C7HA 2WQZC 4CDQA 5LWBA 3S0MA 1QJU2 1RUC2 1EUTA 5LRSA 3PMSA 4I2OA 2PHXA 5A7QA 1AYN2 4A3ZA 4Y1XA 1F5FA 3VBRC 4CCCA 1AX2A 2JE7A 4FPLA 1H0BA 5F5CA 4XDOA 1NCRC 2QZ2A 5CISA 4MG2A 2V5YA 3EHKA 4XFCA 3K77A 1UL9A 2GNMA 1OKOA 1XQNA 1ZBA3 2D6OX 2DTYA 2Z42A 1CR7A 1CAXA 1W03A 2PHRA 1BHGA 3AKPA 1BK1A 3WNXA 3O14A 5A3PA 1RVF2 3INAA 4XJAA 1R092 5CYYA 4CEWA 4D7YA 1WUVA 3WQ7A 4IEPA 4P00B 1H1IA 4COYA 3ETPA 4WZCA 2VZ1A 3P5BA 2YC2A 1V6MA 1M06G 5FP9A 4NR1A 1U5ZA 2PHWA 3FHQA 4OUSA 2RR12 2WAAA 1WW7A 4E2GA 5LASA 2OZJA 4ZY9A 3OY8A 3U07A 2RMU1 1LESA 1NYWA 1HIXA 4Y20B 2HKXA 4YARA 3J9SA 3ZKUA 3W5NA 4Y3OA 5CA6A 1CX1A 1RUE3 3WW3A 3MLLA 1KJRA 2DCYA 2ES3A 3APBA 5DN2A 4LA3A 3WX5A 5BPXA 4K7JA 2RS33 4NIHA 3EBRA 4Q4Y1 3MFAA 5FLIA 5JPMB 4QHZA 1MZ6A 1DYOA 2B45X 4R9AA 2IXIA 1RUG2 3NRUA 2E32A 2JB4A 4W50A 3OD0A 5J1XA 2ZKNA 3HT2A 1CAVA 1PIV3 3QCWA 3T30A 3WLUA 4BU2A 4Y1ZA 5GLZA 1WLCA 2D44A 2GP3A 4CYDA 2OQ7A 2YU2A 1UX6A 1VBE1 2JIJA 2RS13 5KC6A 5H9SA 2XR4A 3IDAA 4AVTA 1H8VA 1LR5A 2JB8A 3PJQA 2QKDA 4EV0A 1O5UA 3OUJA 2OUJA 1FATA 3VBUA 1C8M2 2TEPA 3OBZA 4LBOA 4LHSA 5FAXA 3Q8BA 3BODA 4L11A 4ZS2A 1L7QA 4RQPC 3ZFEB 4ES9A 4PIYA 4XJ9A 5A80A 3K4AA 4WM8A 5FP7A 3VZKA 5F1RA 2VUDA 2QTWB 4IE6A 1YLLA 4IE7A 4JGYB 1OVSA 5FYSA 1C1FA 5FKCA 3ETQA 3E97A 2VOKA 2WQ4A 4QDQA 3S7IA 2ZAHA 1VE0A 3KD4A 3PUAA 2WT1A 1JMUB 3KZ4C 2E7QA 2XBO2 2ZGNA 5FZEA 3UL2A 1SHWB 2JX9A 2VCAA 2RVAA 2Y60A 2RMU3 3USUA 1NQDA 1CIYA 3GM8A 3GGLA 3MLKA 2C9AA 4LA2A 3NL1A 3G7DA 4QKDA 1ZZCA 1UO9A 4RFT0 5FWJA 3WF0A 2LM3A 1S0JA 5FXWA 4KWJA 4IEYA 1Q3EA 4UT5A 1Q8PA 3LQCA 3GDBA 4WVMA 1QEXA 3ZSJA 2GZWA 3DGTA 4NHMA 4BH9A 1AR62 1DDLA 1GLHA 4AXOA 3RZZA 4BYYA 5I93A 4CP2A 5GJ6A 3WSOA 2Z4FA 4JKLA 4ISRA 3K48A 2GP5A 2ZX4A 3HPNA 3NNJA 2ZGSA 4TYSA 4D3WA 3TWIA 2H0VA 3TYJA 1FOD3 1OBNA 3HQXA 2PYTA 1JH5A 3J4UH 2WO3A 4QPGC 2VUAA 5JMCA 2YUEA 2RJKA 4EN8B 3WQ0A 2AUYA 3IIAA 1QMJA 1NCQB 1TMF3 3O0XA 2JJ6A 4AVSA 4XTPA 2OPKA 4Y4RA 3SITA 2OYZA 5JDBA 4B1MA 2Q4SA 1PNFA 3A7QA 3OYWB 3PJYA 2O14A 1Y9GA 4UW4A 5IAXA 4AHZA 1IQAA 1HQLA 2X5IC 5FZCA 3IMMA 5J36A 2VBBA 4FPOB 4WBBA 1JZ5A 5C9AC 4MGTA 3TN92 3ME2A 4OMCA 3I59B 1H2MA 1KDMA 1R1A3 4P9GA 1DGWA 5EWSA 1O7FA 1K5MC 1REEA 1RUI1 2OW4A 5FCCA 1UMZA 5GLUA 2JDPA 4MLOA 3VBSC 2P17A 3UT0A 5GZGA 4DRVA 4HKLA 4PHZA 4OVEA 1HX6A 3OBRA 2K2SA 3E5UA 3DV8A 3OPTA 4NHKA 4YFWA 3WDVA 5ABJB 4A7KA 3BTZA 2QQJA 5T50A 3UKTA 4YZ1A 2P6CA 2UY9A 3SEPA 1HDKA 5F3IA 5LBBA 3ZYPA 1B35A 4QKNA 3B9CA 3CU7A 4YVSB 1GP6A 3JB4C 1D4M1 5A3WA 3FC0A 1UY1A 3WNNA 4DINB 3TEYA 2NZ9A 5CKMA 5C5UA 1PO23 1RYYA 1N3QA 2BFUS 2Y6JA 3PU3A 1CZVA 2H6CA 1KITA 4EJRA 3CEWA 2R7EB 3N3HA 1E5RA 2LRPA 2BNOA 3NVCA 4LK6A 3NMBA 5IYYA 2A6ZA 4DQAA 1AJKA 1RINA 1RMU2 2JKXA 2YB7A 4FPEA 2P5BA 4DEVA 4TTGA 3VN4A 2WA3A 3LGRA 4WM7A 2QJVA 4P5HA 3FUOA 2Y6FA 1HB2A 3QLQA 4MH0E 1YNAA 3OYWA 3E6DA 4P9JA 2NLRA 2ZCWA 3S30A 1TQ5A 5LW9A 3LA3A 3I3QA 4K1ZA 4F7ZA 3V0AA 5T5PA 2WNOA 2WO2A 2ZX3A 1HB4A 3I59A 3AKRA 3LFIA 4B8EA 2WBKA 4A2UA 4OCTA 4FP3A 1NOVA 5GZCA 2VU9A 1MS3A 2R062 3FL7A 3CJIB 4BQ3A 5DQ0A 3P1IA 1PGSA 2AENA 4OQ9A 3AMMA 4GWMA 5HPOA 3ZXKA 2FDGA 4EWDA 3MUY1 3BKZA 2MEV2 1OPOA 3EXUA 3MPPG 2PFWA 3KGLA 3OSDA 4QMAA 3U4XA 1MVEA 4N43B 2JG8B 3ZSKA 1IS6A 1Y9QA 1LHWA 4IE0A 1OA4A 3I2KA 1LOAA 4UFMA 2A5ZA 4DS0A 4MADA 2Q5TA 5L73A 1FPN2 4JDNA 4D7SA 3AMNA 4N53C 5C4WC 4CP0A 1HRI2 2WAOA 4CUAA 2HWC2 3E6CC 4GKXA 1UAIA 2B42B 2PHFA 2F4LA 3TEWA 5DZEA 4CCJA 3IB3A 4ZKTB 3MF9A 3I7DA 1RUD3 1AR91 2D3RA 1ONAA 4N7IA 1NKGA 3PVEA 4IQPA 5C3QA 4AAXA 5E8AA 1IPSA 4UYBA 4OUEA 3WDWA 4F3JA 1H8TA 3KWVA 4AF9A 4KWUA 2TUNA 4Q1RA 1V6OA 1SLAA 5HXVA 3J8F2 3MIHA 1DP0A 3SQOA 2VG9A 1C3HA 1H1AA 2VOTA 3JB8A 5CADA 4W65A 4GB32 2ORXA 1KGYA 1T2XA 4NAMA 2W39A 2J1EA 4P08A 1W05A 1OLME 3ZFEC 3KT7A 5FZ7A 1UZYA 2C1FA 3PURA 5K0UC 5EYXA 1OHFA 2EXKA 2H0BA 1U0AA 4FFHA 5H9QA 4FPJA 4X6QB 5I8YA 4Z1VA 3T2QA 4WV8A 1PMHX 3B01A 4P14A 2A6VA 1OLQA 2C26A 3PU8A 5FYZA 1G9BA 1GV9A 3FFZA 2A71A 3PUQA 2CYFA 2RDQA 3RG0A 5B4XA 4MVTA 4JRLA 2MNGA 3R4SA 5EIYB 1QJX1 3WG1A 2HYXA 1GMMA 3AC0A 3SLIA 4ZU5A 4UI9L 4YNIA 3DCQA 4M0NA 4LKSA 3N7KA 2D5FA 4IETA 1N1YA 2WNUB 1C57A 2BW8A 3RZLA 1REFA 1WCQA 4RD7A 3UKVA 2V5DA 2BNMA 1WCKA 1MEC3 2WSVA 2PQSA 1FX5A 1V9U2 2ZZJA 3ALQA 3GZEA 5FPBA 5C3SA 5HCHA 2VH9A 4COZA 3JQWA 1H2LA 5C70A 3E1F1 1ZREA 4CDUC 3KLSA 3VZJA 2GH2A 2HWE2 3BYWA 5F5AA 1TME3 2DUPA 5JPNB 4MHRA 3FHIB 4Y5SA 4XFIA 1ZBE1 3MFCA 2JENA 1KS4A 2JIGA 3ACHA 3K4ZA 2Z79A 3DXUA 2PLV3 3Q8EA 1RTVA 2B46X 1RUNA 4AAPA 3DKQA 5FOJB 3T0DA 3CQOA 2IWGB 5D21A 4OHXA 5GLVA 4CEYB 5JIAA 5FZOB 2W1SA 5F37A 1AZDA 4QPYA 5FV3A 2DBIA 1F35A 1E5IA 3ZXFA 3M1HA 1S0FA 4ASMB 4DXSA 1Z0HA 1R083 1ZA7A 3AMPA 5FQ0A 1FV2A 3MUZ1 1YUDA 2R6QA 1POQA 2RM23 3HMYA 5A6ZA 3LZZA 1YXWA 1QJY1 3L2YA 1W28A 3BU0A 5FIXA 3V0BA 2XWJB 1SFYA 5DG2A 1OD3A 3O1UA 5J09A 4AI3A 4AGRA 3MV01 1Q56A 5A33A 3T4VA 5IVFA 4QGLA 4ATEA 2IUWA 3BN6A 5A32A 5F8PA 1EAH1 1AVBA 1AR72 5J7MA 4LHNA 5A7WB 1YQ5A 2PELA 4NAOA 3UESA 1XE0A 3LOBA 5K9YA 4MO3M 2SBAA 2OKXA 1FMD3 2AREA 2WWSA 3ACGA 5FKBA 5JLVA 1VRH2 4PCRA 2UWCA 4JTOA 5FY4A 4LLFA 4YPJA 3D6EA 2RG4A 3OEBA 3HD8B 5BNOC 1JYVA 4SLIA 4OI1A 3RWNA 3ZN6B 4YGCA 4FPYA 1NQJA 3KS7A 4DUVA 3CL1A 1RHI3 4LPLA 2GMEA 3A4UA 4QB6A 1UYPA 4META 1GKBA 3JUUA 3PNAA 1I6XA 3EYPA 1S0BA 4UWDA 1RIRA 1S4CA 3RMYA 1BK0A 1XB9A 5DUUA 1HXS1 4IDZA 3NV1A 4QPIA 3UJOA 1JYTA 2FCVA 4QT6A 3W21A 2HYKA 1GP5A 1LHNA 1W8HA 1U12A 3AZWA 4H7MA 3GXUA 3CJIC 3DPRA 1AXZA 3WDUA 5JZGA 4FFIA 5L36A 5I0SA 5F5QA 5IVBA 1GWLA 5EJ3A 1O6UA 2YU1A 2AH2A 2JG8C 2R1BA 1WGPA 3I3DA 4FXKB 4N43C 3UGGA 3WW4A 5JSRA 5KHJA 2QDRA 1OC1A 2BBAA 2E53A 5FBZA 4GH4B 4OQ8A 5L7OA 2DFBA 3VBFA 2GMMA 1JZ3A 1XPWA 4LORA 4AEKA 4Q4X3 4X8PA 2IFWA 1J58A 3AZYA 4K3UA 4JC1A 4AE2A 2HJIA 3AYAA 3BUCA 2WR9A 1W8ZA 4RYDA 3KV9A 3DF0A 1GZCA 2VL4A 1URXA 3FMGA 2ZEWA 3FX3A 4I0WB 5D8AB 4BDVB 2UWAA 2JE9A 3KCYA 3OTFA 3ZYBA 5J48A 2VECA 3ZN6A 5E89A 5JUVA 2ZX2A 1OA3A 1TEIA 2XUEA 5LZ6A 3I2JA 4IGPA 3VZLA 1LRHA 2GN7A 4NN0A 1UOBA 4A7YA 1U5YA 1H2KA 1Q8OA 5FY7A 2XL9A 5CKQA 4RS5A 3D5OA 3RPQA 2V4AA 1GFF2 1OQ1A 5JMOA 4ET7A 2VXJA 2FCTA 1ZM1A 5C8CB 4HVRA 3RS6A 2HWF3 2DVAA 2ZGOA 3WNLA 2ZGMA 3H7YA 1BQPA 3LSEA 3M8LA 4M4PA 1OSGA 2YC4A 2HWB1 3WCRA 5KWRA 4YZ2A 2AC1A 2X05A 1GOFA 4JZRA 4XFGA 2BRTA 1OUXA 3POEA 4QGMA 4AHWA 2FMDA 4YFZA 4H7LA 3MBWA 1VBA3 3CZUA 3LDRA 4CP9A 1WCDJ 4IEUA 1LENA 5CB7A 4HONA 4RFRB 4N9IA 2J7MA 4NIDA 1IPJA 1UU5A 1AL21 4X8NA 1MS0A 1W2NA 4C0HA 1HV0A 3RSJA 5IVCA 4FQZA 3POYA 4RHV3 1AL0G 2WNUC 2BP6A 3IKWA 2WFF2 4AI0A 2VMHA 3U0ZA 3SMHA 5KXBA 2DFCA 4IEQA 5I0DA 3VHNA 2DVGA 2GMPA 4D94A 1BBT3 1KJLA 5T5OA 2VY0A 4CCLA 3KSCA 1NCRB 2C6SA 4IGQA 1IPKA 4IV1C 3UV9A 4D6QA 3CBNA 4JVAA 4UF0B 1KQRA 1OOPA 2ZMKA 4XPVA 2D93A 1KDKA 2GALA 2ZHKA 3AXDA 4LIVA 1VBB1 1CAUA 1EV13 2XJPA 3NJYA 1VBC2 1AR82 3C3VA 3F95A 5C6CA 3MIBA 1BEV2 3JD71 3POWA 2BJSA 5FY5A 5I0UA 1N47A 1FAYA 4CDWC 5CG9A 4S2FA 4CEYC 3BTYA 1RUJ3 4LBNA 1V6NA 3POBA 4OI2A 1ASJ1 1A6CA 1SLCA 4XZPA 3VUOA 3GALA 4FTSA 1LECA 2F6BA 1WW6A 4IEZA 1G9CA 4YVWA 4M0HA 5DDJ3 3W58A 4AR2A 3UETA 2R0HA 2O8OA 3AKSA 1UPSA 3OGSA 2ZGPA 4Q4V3 1CIWA 2W91A 2ZJCA 4XW3A 4ZHNA 1A8DA 1DIWA 4CUCA 3CF6E 4UFIA 1VALA 3WNPA 2HWD3 4UFLA 3GZUC 4LQRA 2UURA 1RUJ2 4GD4A 4BCUA 4N8MA 3GNEA 1VP6A 1ZA4A 4LNVA 1MS5A 4KH9A 3KVAA 5FK8A 2EIBA 4EZ4A 4SBVA 4YW2A 3O1SA 5FXZA 1DGWX 2QQOA 1Y4WA 1ULFA 4UOJA 5DPNA 2P34A 3IM0A 5FZIA 5EZWA 3B69A 3VBRA 1VBD2 3WP3A 5D1IA 2JDZA 5IK5A 1NCRA 1UD1A 3A0KA 2QE3A 3TOJA 4RQPB 3T2TA 2ID4A 2R071 2WZR1 2LUWA 4JHTA 1S2EA 3Q8AA 4FQ4A 4XCBA 4XE9A 5BNNC 2BFUL 2P3JA 2KD7A 2OS2A 3C7FA 4M4RA 4QKBA 4OULA 1I3HA 1LEDA 4R52A 5BYNA 3B5LB 4FPFA 4E4DX 5HV0A 3WF3A 1RUF2 3OD4A 1ZX5A 3RGBA 4DXRA 5L9RA 2BOIA 3LKJA 1E57A 1IG3A 4BK4A 5FYMA 1LU2A 2W87A 1SDDB 4DNYA 5AVPA 3LIGA 1D7PM 4BLJA 1DGRN 5FZLA 2WYFA 1TG7A 2ZEXA 2VW0A 4WZFA 5LA1A 3VBHC 3S5AA 2QQVA 2HLEA 3LA2A 5CKNA 1A8MA 3MLJA 1D0HA 1PVC3 2WS91 1TVGA 3IDBB 2DU1A 3O5SA 4GH4C 2BBVA 4CSWA 1W9TA 5A3LA 5FZ8A 1AYM3 1OUSA 4Y5TA 1N1VA 1PO12 4AI9A 3VBOA 3O1PA 4LBQB 3GYDA 5FP8A 3EB7A 5E1RA 1S2BA 3BTAA 1I9RA 3SXWA 1AXYA 1Z7S1 5IATA 4FP2A 3T2OA 4GIQA 1O4YA 3O0WA 1ND2A 3VDDB 5KHKA 3ZIXA 5CEHA 1V0AA 3T1LA 1I1EA 4FT8A 1QJZA 4RQPA 5F39A 5FMBA 4XJZA 1UNBA 3WUCA 1EPZA 4COUA 2VULA 3U4SA 1QJU1 1EP0A 1RUC1 5LY1A 1JYNA 4PLOA 5FDBA 4QD2A 3ZVXA 1PZ8A 4HKOA 5C9AB 2YBSA 3DKWA 1K5MB 1OQDA 3PVBB 1CWPA 3NNGA 2W0XA 5HCFA 2JDUA 1QQP1 3I2GA 2Z2SB 3JBG2 4XURA 1T6GC 3DUIA 3O1MA 4I01A 3IDCB 1RVF1 1R091 3RZJA 1GWKA 5C8CC 1JHJA 2J22A 4YG3A 4YM1A 1GU3A 4V2VA 5B2GB 5B4NA 2J1SA 4OHZA 1FT9A 1XJAA 4O9GA 4PQ9A 4Y4YA 4DPNA 3M7AA 4Q0PA 1VB2A 5A6XA 4XUNA 3O7OA 2RR11 3EO6A 5J96B 2EXJA 3LCPA 1S0EA 1PGW2 1MQTC 4V2WA 3UYJA 2H6BA 2ZOEB 4QM9A 1SPPB 2WYSA 1APNA 4Y26A 2Q8CA 4MUVA 4YRDA 4EN0A 2WS93 5LCWL 1OPMA 4AQTA 2R30A 2R042 5JR2A 4PF1A 4FAGA 4DUWA 5T54A 2XH6A 4LBQA 2ADEA 2RS53 4QPGA 4XZUG 4AW7A 3EMRA 4XOGA 4Q0VA 3WF1A 5T55A 1RUG1 5IT6A 5F32A 2WQ8A 1YQ8A 2C24A 2XL7A 5D2AA 4LBKA 2QFEA 3MW4A 1RJ8A 4U2AA 1H30A 1COV3 1RUH1 2LW8A 4AFCA 1D2SA 4P9LA 4WVZA 1GQPA 3ZKYA 1MS9A 4DY5A 5LEJA 2X5IA 3OGRA 3FLPA 5ERLA 1W8NA 3MO4A 3PDQA 1O91A 2D43A 3C7EA 3BPZA 3I2FA 3O1TA 1HRV3 4XC9A 1K5MA 3WG2A 4BLIA 2ILMA 5A70A 1C8M1 3K75B 2WLPA 2VMFA 3DXTA 2N7GA 2DCKA 3VBSA 4BISA 2YG0A 5C3PA 3H9AA 2IXHA 1J1TA 1CN1A 5ACA1 4DUXA 5AC93 1QQP3 5ISLA 2VUJA 3LEKA 3OG2A 4UW5A 1GP4A 1LHVA 1OURA 1W6QA 4RN5A 3V64A 4XEZA 3LIHA 3NW4A 4Q4W3 3H8OA 4LO8A 1X50A 2R16A 4CCEA 1F9KA 3WXPA 5AFEA 4LBMA 3ZFFA 2XBO1 2QCSB 4N53B 5C4WB 1ZBA2 4IUGA 4UXAA 5EV7A 1VJ2A 1BMV2 2DCTA 1UYZA 5TSWA 3M2MA 4BQ1A 1Q8SA 4XF1A 1V00A 2VJXA 2VQUA 3AM2A 3GCXA 2WC2A 4QPWA 4XJWA 5BNPC 4RGGA 2ZBJA 1YIPA 1WLWA 1AR61 1IS5A 1N3PA 3WR0A 5CIRA 1ZZ6A 4TXWA 5FZ4A 1UCXA 2I74A 2FDKA 3JCIA 4IV3B 1G9DA 3WQ1A 4TSVA 4BQ4A 4QQOA 3H8XA 4RL7A 1QOSA 1RUE2 3M70A 4H3WA 4FO9A 1RUH3 1O4ZA 1FNZA 1ZZ8A 4L92A 1IGOA 5FYUA 2RS32 2EAKA 2VVDA 1JU4A 1DQ4A 4NPLA 4PDWB 3CKHA 3MIEA 2QQLA 3ES1A 4QHOA 1W6MB 5GLTA 3NJXA 1PM7A 3T1MA 4OYUA 2QQNA 1JN2P 4CDXB 1PIV2 5K0UB 2XMLA 2ZGLA 5A6QA 1RXFA 1P8JA 3W20A 1FNYA 1W2AX 4KBBA 3AP7A 2RS12 1W04A 2E7AA 2XUMA 4BHPA 1J59A 2JD4A 3TN91 4I09A 5JOYA 3IAQA 1ZZ9A 4UBGA 3G6JB 1SFNA 3LSDA 4Y20A 1OLMA 3T0AA 5HCAA 1W9FA 1MACA 3ENRA 5C4WA 3U10A 3WF4A 2P6HA 5FO9B 5E16A 3THCA 4LE3A 4FPHA 3OGVA 4N90A 3AP5A 1XSQA 4KU7A 4GWJA 3AP6A 4LOSA 3W59A 4BE3A 1X7NA 4HVQA 3QBQA 4MGZE 3IWZA 4XF3A 4P9XA 5FMCA 1DGRA 4FPCA 4INDA 4Q4Y3 1XXNA 2CY6A 3N35A 1IKPA 3GZTB 3LOIA 4IERA 4NMIA 2NPIA 4XUOA 3AYEA 4YGEA 4AEJA 1UY3A 1W39A 2PAEA 2RMU2 3Q8FA 1DU3D 2YHJA 3OBTA 1STMA 4LULA 3H3LA 1BCXA 5FY1A 4CDUB 1JBCA 1VBE3 1QGLA 4Q0SA 2XDVA 3ZYRA 1DLCA 3HEIA 4FFFA 2BTVC 3VDDC 1BKZA 4LO6B 1RMU1 3AP4A 1D2QA 1TNFA 1XNAA 2Z69A 3A21A 1PZ7A 2R32A 2FQPA 2JXAA 2XWBB 4GZ9A 3N9NA 3ZFEA 1SEFA 4KWLA 3BALA 3FJSA 4JGYA 2WL1A 2A6YA 3ROUA 4AFAA 1ENSA 5JOWA 1BXHA 1SBDA 1XC6A 3EJKA 1FOD2 3IBMA 4NRPA 1WMFA 3OB8A 4QGNA 1MZEA 3KQRA 3MW3A 1CVNA 1TMF2 3D4KA 2E31A 3LDBA 4B4PA 1YQCA 4HT1T 4MGQA 4XETA 4JDMA 2R061
chains in the Genus database with same CATH topology
4CTEA 2ZX1A 3FUQA 4NHLA 1D0GA 4M01A 1GR3A 2PA7A 1IKQA 4AGGA 2ERFA 2WLQA 4X6RB 2R1DA 4JGZC 2JEMA 2MEV1 2WFPA 4CDQC 5KHIA 5IK7A 1W0PA 2BWAA 4I30A 3P3NA 3RI9A 3ZN4A 1R1A2 4Z92B 3D0SA 1U5XA 3RRDA 4GQ7A 1FPN1 2X8KA 1HRI1 5DG1A 2HWC1 2V09A 4E2QA 1DYPA 1LGCA 3CJXA 1QDOA 2D98A 4Y22B 3KT1A 4OHYA 3ZFGB 1NCQA 4RGAA 5BNOB 2D5HA 2ATFA 3THPA 4YW5A 3SCHA 4Y24A 1PZ9A 3VKMA 4FXGB 1PO22 4AYUA 3WP5A 4DOUA 3AP9A 5EYYA 1LJ7A 1ZVFA 4LUMA 4YG0A 2GC0A 2JG9B 2WT0A 5T52A 5J37A 4NWVA 3VHRA 3QACA 4GALA 3J8F1 1PHMA 4AFBA 1FV3A 2PHUA 1RUI3 4GB31 2DVBA 3OPZA 4Z07A 2BQPA 5ABJA 5IK8A 5DUVA 2KA3A 2VOVA 4XF0A 3URFA 3LAGA 1OLRA 2DVDA 2IXCA 1DZTA 2AZ5A 2D40A 3AZZA 3NJZA 4GMP1 4YVSA 4AHXA 1V70A 1D4M3 1GICA 3PTYA 4KNCA 4R4XA 2WIIB 3NV3A 1RC6A 1NA1B 3UKNA 3MYXA 1A3KA 4PBPA 4HK9A 5BNOA 4C91A 4Q26A 2PAKA 3O12A 4RA0A 3VL9A 2LTNA 3BOPA 1X82A 4IV3C 1LTEA 3AKQA 1V9U1 1DQ1A 4N9HA 4R8HA 3TNQA 4LO5B 1O3SA 1MS8A 2BGCA 1GZ9A 1C5HA 2TNFA 4LEJA 4PDWC 2HWE1 3BU7A 4HPKB 3MICA 2Q30A 3JZVA 1RUD2 4AVVA 1LHUA 3CJIA 4HSJA 5JOZA 3S7EA 5I91A 4L97A 1PGL2 1QXPA 2P3IA 4Q0UA 4N43A 2JG8A 2IZWA 1GANA 1G6NA 3AMHA 1F8VA 2WNVB 4Q1PA 1YFWA 1KXGA 3KGZA 4IEXA 1IHMA 3FLRA 2XG3A 3VHOA 2B8MA 2VNRA 4AWDA 2R49A 2UYBA 2Y26A 4I0AA 1SBEA 1DQ2A 2ET1A 5BXXA 3M4FA 4JRAA 1NY71 2GC2A 1AR93 4GA9A 4EN9B 1AR71 2E9QA 4R9CA 4IEVA 1H4HA 4IV1B 3ZXAC 1KRIA 1VRH1 2ET7A 5BV6A 1LGBA 3OJBA 2Z5WA 4XYXA 2JKBA 1Y7BA 1VAMA 4EROA 3TAYA 1MEC2 4AQ2A 3J26N 4CDWB 4FSJA 1HLCA 4MV2A 4Z2WA 1SDWA 3SH4A 3H7JA 1ALYA 2W52A 4FVVA 2ZZQA 1LGNA 1TME2 1KS5A 1ZYBA 1G9FA 5CFCB 1ULEA 3ILFA 2P3KA 5LRRA 3RJRA 3L2HA 1YJKA 2PLV2 1EY2A 4MXWB 3NSTA 4L2NA 1XE7A 3GBGA 2C0ZA 2ZGTA 1QJX3 3I2DA 2GN3A 3GBWA 2WNUA 1ND3C 3RI8A 5JWPA 1TE1B 2YXSA 1R082 3IMNA 4K1YA 2Y0OA 4IEOA 3ZXEA 2RM22 1Z78A 2YV8A 2PHLA 2A3YA 3PVOA 4IV1A 1BVVA 2VW2A 3KB5A 1H9PA 4IXLA 3H0OA 3VV1A 4UBHA 1L3JA 3ZFGC 1ZBE3 1AJOA 3WVJA 3CNAA 5BNNB 5AFBA 4YG6A 3VKFC 3IPVB 4ZU7A 2QNKA 1HV1A 1VLNA 2IXKA 5HCBA 3VKNA 2JG9C 4CEYA 5AVAA 5F6LB 1FMD2 3WDTA 4HN0A 3ZXGA 1NXD1 3FBMA 1YHFA 1SLTA 4QM8A 2EALA 2BYVE 3NWKA 4MXWA 1AXKA 1RHI2 4QU2A 1SCRA 5LEKA 3WD5A 1QJY3 4XQDA 3VBHB 2CWSA 2VXRA 3PMEA 1NXMA 2ZTNA 1LOGA 1SLLA 1EAH3 1V6IA 4QQPA 3D0JA 1YO8A 1NA1C 1WLTA 4LTAA 3MEPA 2BVBA 5JOXA 3ZYGA 4CRQA 3AYDA 2GNDA 2WFF1 4XFAA 3N4MA 4ONUA 3IPVA 4AEDC 1U5IA 4Q4X2 3CO2A 4HANA 3WW1A 1A78A 5H9RA 2FHRA 4FPGA 2KM2A 4S2GA 3B94A 4I3PA 2A73B 3N7LA 3OCPA 4MGIE 1HXS3 2MPFA 4G3YC 2DUOA 3ZSMA 4CDXB 4K21A 4L8QA 5E88A 1VBC1 1AR81 2B9UA 2FZ1A 5KXCA 1BEV1 4ASLA 3B02A 4ES8A 2K9ZA 2CAVA 3OF1A 1GQGA 1PNGA 3VBHA 4YW1A 1M4WA 1MQTB 1NLSA 3QOPA 3RYPA 1XYNA 1OI6A 2ENRA 2YGLA 4KL1A 4Y1UA 4GH4A 2VW1A 1G7YA 1GZWB 2WNVC 3GHNA 3HWJA 4I3GA 4FBFA 5BNQA 2Q8OA 3NAPC 4CP1A 4W6YA 4COWA 2VVFA 4PBOA 4FTBA 2HWF2 1KD7A 3H3ZA 4Y5Z0 1D4VB 2XVLA 1V6KA 2WKKA 5D8AA 3QH7A 3LB9A 5GZDA 4FCAA 1VBA2 4LE4A 2Q1MA 1CAWB 1PK6B 1VBD1 2BUKA 5KHHA 2NMNA 2CGOA 1POV1 4HL0A 3ZMNA 4HBNA 1MS4A 4QQHA 4RHV2 2AYHA 2E51A 2IXJA 4R9DA 2O0OA 2G9FA 5C8CA 5CAZA 5FRAA 2DVFA 3KMHA 3ZYIB 3IDEA 3KM5A 5I0TA 1XNCA 1BBT2 4LO4B 3MGUA 4LBQD 2HWB3 2E7TA 2YGMA 1MQTA 2DYCA 2Q1ZB 3W9AA 2HEWF 2VOWA 5CFCC 2GSYA 3KT4A 4HKWA 4AQ6A 2MHFA 1EV12 4AVCA 4LUKA 3ZXLA 4B4QA 3B9IA 2OZ6A 3MDPA 4JAAA 4URTA 5BNPB 4LBJA 4YGBA 3HBZA 1AL23 3ELNA 1CPMA 3X29B 3FZ3A 2G4IA 1IZ3A 3L9JT 5FMOS 1VB4A 1YI7A 5DDJ2 2I07B 1PO11 2QDNA 4Q4V2 2ZABA 1WLDA 4FOVA 4DRRA 1IOAA 1OA2A 4FOQA 3DPRC 1DZRA 2HWD2 1YRZA 1ULDA 3PHMA 5JSPA 4XF9A 2PN5A 1UU4A 4L9BA 1CX4A 1DG6A 1YFYA 2GC3A 4Q8LA 2CV6A 4XHBA 4BMBA 2NN8A 1LOFC 4HZFA 1VBB3 1QXRA 2CNAA 3WG3A 3JD73 3ZO0B 5L7OC 3VBFC 4KGGA 1ASJ3 3JBG1 1YFUA 5BUVA 3ZYJB 4YM0A 1XNKA 2VQ0A 1O3TA 5IK4A 5BNPA 3WV6A 1YI9A 4NOTA 2ARXA 1PGW1 4K9SA 3HAGA 1V6JA 3UK9A 1BVP1 3RNSA 3AZXA 4AI2A 1RB8G 4Z82A 1CQ9A 2R041 4PIXA 4HVOA 4EWAA 3R4DB 4R4ZA 1IS4A 2VMGA 3KCCA 4ORFA 4K8FA 5GKAC 1PVC2 2R073 2VGDA 2WZR3 3WDYA 1ZRDA 1AYN1 1W6PB 3M3CA 1AYM2 2WNEA 5KXDA 3B3QE 2O1QA 4I0BA 4YLZA 1LU1A 4LT5A 4GXLA 1UU6A 1UIJA 4Q2FA 3NO8A 2ZAAA 4TLFA 3WHUA 5KHGA 4Q0QA 2XJTA 4QHBA 4AQSA 1CJPA 1PVXA 3ZMOA 2BPA2 3M3EA 4CDXC 3AK0A 4JGZB 2EAAA 2GDFA 3MI8A 4CDQB 4MSVA 1UW8A 1UN1A 4V1PA 1X33A 3I4IA 1LKNA 2B5HA 1CONA 3I54A 4AEMA 1DF0A 2IC1A 4B29A 5HBAA 1Q5OA 1YJLA 1ZBA1 2IFRA 1BMV1 1CAXB 1I5ZA 4LLOA 2XJRA 3N36A 4CEWB 3VDDA 1Z7S3 3SCGA 3VLBB 3AKTA 1R1ZA 1RUOA 2ZGRA 3ASIA 4CZSA 1QHDA 2WZPP 3CLPA 1DQ5A 3OY8B 1WA4A 4RR3C 1HQNA 5C8WA 4AGVA 2WS92 1RUE1 1CPNA 1QJU3 1RUC3 2XB6C 1AHSA 1F31A 5C9AA 4YVWC 1AYN3 2RS31 1PK6C 2CGNA 1VR3A 2EA7A 2RS52 3WP6A 5T5JA 4YW4A 4F83A 2UU8A 3HIFA 2P2KA 1PIV1 1COV2 2VQAA 3I8TA 1QY4A 1ULGA 1CAVB 5BYNA 1C5IA 1RVF3 4JGZA 5FLHA 1R093 4W6WA 2VNOA 4GWNA 4HN1A 3RMXA 2RS11 4DZGA 1CD3G 3UJQA 1QXJA 3E5QA 4JTNA 1HRV2 1N3OA 1S2KA 4M00A 1ZZ7A 1OMIA 2RR13 1X8MA 4XJUA 5CFDC 1JHNA 2YDEA 4FOWA 4LO7A 3VBUB 2GNTA 3SISA 1DHKB 5T3NA 1AF9A 5AC92 1QQP2 2X29A 2FZ2A 3N7MA 4WM8B 4Y1VA 1BJQA 1YFXA 2PHTA 4Q4W2 1MVQA 5CG8A 3MIFA 4G9SB 4S2DA 3TBDA 1RUG3 4OHWA 1CGPA 3FLTA 1BYHA 5KBFA 5F9TA 2D6KA 2A3WA 3USUB 1QNYA 2CGPA 3SH5A 5DUXA 3BCWA 4MXVA 4HMZA 4YM2A 4K40A 1XNDA 2Y0IA 4NWWA 1WMEA 2D7FA 1C8M3 4XF4A 3H3UA 4WVMB 3WCSA 3MIGA 1O3RA 3EQEA 4UW3A 2A7AA 5ACA3 4BMEA 1RUH2 4IEWA 1FI2A 1FOD1 3VGIA 3N7JA 4B3NA 1UIKA 3VBOC 2XJVA 1LCLA 1TMF1 4J1WA 4N53A 5FFOC 4ATFA 1ND2C 1DFQA 1QU0A 1AUYA 5JIUA 3ZSEA 2XBO3 3RQ0A 1MZFA 2OIIA 5ACA2 2ZS6B 2TBVA 1MZ5A 3M3IA 1WCSA 3HN1A 1R1A1 3OGJA 1AR63 1NLRA 4U36A 4BA6A 4IV3A 4WVWA 1GYKA 1XU1A 3AXEA 4Q27A 3JU9A 2D6LX 1OFSA 1JYCA 1SLIA 5FO8B 1H4GA 2EXHA 4PDWA 4LR4A 4Q4Y2 3WT3A 1DBNA 1W6MA 2ZMLA 1B35B 3THTA 5K0UA 5F6KA 1ENRA 1PO21 2I45A 4P9IA 2ZGQA 1LOBA 4L99A 4XILA 5DXDA 4OZXA 1DQ6A 1JYIA 4EN6B 1VBE2 5CBLA 1LB2A 4Q8KA 4FAHA 1JOJA 1J1LA 4C1XA 3TN93 2WT2A 1SMVA 4XHXA 1JUHA 2YY1A 3KCXA 4WM7B 4AVBA 1RITA 4OI4A 4R9BA 1ZRRA 4GULA 4A7ZA 3ZN5A 4OUMA 1ND3B 2ZA9A 3V56A 3V0AB 4JDOA 2RE9A 5I0RA 4P9WA 4FPKA 2RHPA 4KU8A 4D69A 2A6XA 4CDUA 3TB0A 1REDA 4MZUA 3R0RA 4CEWC 4XFBA 1OKQA 1RMU3 3FBYA 2DF7A 4XXAA 2X53S 3E5XA 4M3CB 4O9EA 3C2UA 3ZFFC 4HSLA 2XVGA 1ZRCA 3LWCA 4LHLA 1Y3TA 4NPRA 4XIKA 3AJYA 3VKLA 1QOTA 1J3RA 3GF6A 3AB0A 2ZHNA 1XYOA 1RUD1 4YSFA 3MZHA 2HEVF 3JQXA 4AK3A 3VZMA 1XYPA 2R063 2NM1A 4QQ2A 4B4RA 1PGL1 2D97A 4AI1A 4XDQA 1H8TB 2GAUA 3WDXA 2MEV3 1C28A 2DU0A 2DTWA 2JICA 1ND3A 2SLIA 2DCZA 3NKGA 3RDIA 1C8NA 4XJ8A 1YIFA 2W08A 1RUI2 1O4TA 5CVRA 5FPZA 3VBUC 2ZMNA 1FPN3 1UKGA 1DYKA 1HRI3 2K0GA 2AGSA 2ZHLA 4YZ4A 1VAVA 2HWC3 4WM8C 2KXLA 4Y22A 3HR9A 2A70A 1CESA 3ZFGA 4C0BA 5C33A 1YWKA 2NYYA 1D4M2 4OLLA 2DV9A 4M3CA 1IS3A 3POSA 4PF5A 4AEDB 4F8AA 1UF2C 5A3MA 2JG9A 3V65A 4QX5A 3WZ1A 2I2SA 2G9GA 3Q9OA 4EWEA 1S0IA 2XGXA 1FYUA 1CJDA 4OI0A 4XMAA 1F2NA 1Q8QA 2ZGUA 3J8F3 5FMOL 1QF3A 5FTTC 5J98B 4GB33 4E2SA 2YROA 4KG0A 1OD5A 1MEC1 1G9AA 2XLGA 3VZNA 3AYCA 4N7UA 5FPXA 2D6MA 1QDCA 2QVSB 4TZDA 1TME1 4GMP3 1NG0A 4HLTA 3TRSB 4KGQA 1GNHA 1LOCA 3NAPB 1DQ0A 2PLV1 4E4ZA 1NA1A 1LULA 2B7YA 2R0FA 4H14A 4JGYC 1YYNA 1VAKA 4XMIA 3VZOA 3MIDA 1WD4A 1R081 3IT8A 2XVKA 4AEDA 1EYBA 1X36A 2RM21 5FQ0B 3WP4A 1V9U3 1H2NA 1QOOA 4M3CF 3AFKA 4HPKA 1JUIA 3V0BB 3GZAA 2HWE3 1G8WA 4AFDA 2VMIA 2BNNA 3NKTA 2HEYF 1B35C 5A33B 2ZX0A 4D7TA 1AR92 5A32B 3MW2A 4B7EA 4WVVA 2EIGA 5JI9A 2Y38A 2BEOA 1J3PA 4BWOA 1DLLA 1FMD1 2A6WA 3NV2A 1F5JA 4DXZA 2WNVA 4UW6A 1XNBA 1HW5A 4BPZA 4G4FA 1NCQC 3NAPA 3SH3A 3WG4A 5CNAA 2P37A 2EF6A 4WM7C 1RHI1 2ZHMA 3AX4A 2XKPA 3MPBA 5DUWA 3R4UA 1UKRA 1KFUL 5GZEA 4J1XA 3SNMA 1ULCA 2XLAA 4ITCA 4QPIB 1H1MA 3ZXDA 4BM8A 1SQ4A 2GU9A 1AR73 1GQHA 1LHOA 1S0CA 3ATGA 4GMP0 2GNBA 3DPRB 5ABJC 5FOBB 5JZGB 1QJX2 1VRH3 4S2HA 2XJSA 1QWRA 4YVSC 3ACLA 4HK8A 2FMYA 4CDWA 1NY72 2C5DA 1X8EA 3VKOA 4Q4X1 1TNRA 1SLBA 5GM0A 5L7OB 2ZACA 3VBFB 2OVUA 3WHTA 3E6BA 1O3QA 3M3QA 5JR7B 4Z8BA 3D8CA 4XTMA 5LK5A 4J6GA 4BIFA 2YC0A 1QH6A 2DURA 5CFCA 5K7PA 1ZBE2 2QUOA 1HQWA 2XKOA 1ZZBA 2W68A 2CWMA 2UWBA 3DL3A 3LA7A 1XE8A 1S55A 4HETA 3TNPB 5EFUA 1KFXL 4Y1YA 2O8QA 1W6NB 1DZQA 2D3PA 1H8TC 4Q29A 1XU2A 4JV4A 4RS5B 2D6NA 4BOWA 1N1SA 4ZXKA 3GHMA 1AX1A 4I02A 4M3CE 2PQQA 2BWCA 4W6XA 4E4SA 1DGLA 2IXLA 3ECQA 1WBLA 2HWF1 4YM3A 2QQPA 5K8SA 1LODA 1QJY2 1C1LA 3ST7A 2OA2A 3IN9A 4MGYE 3WOGA 2D3SA 4QXKA 1SBFA 3U11A 5JVVA 3B00A 4K20A 2XJUA 4BZ4A 5BNNA 3GBFA 1LOFA 2VVEA 1W0OA 1UZZA 1EAH2 2CAUA 2V73A 2XLFA 4JCKA 3HT1A 4KQ7A 1VBA1 3QH6A 1V6LA 3SHRA 4AG4A 2NP0A 1B09A 2NQYA 2ZGKA 3WW2A 2XPJA 3ES4A 4YW3A 4RHV1 4DY3A 4PJYA 4GKYA 4XQ4A 3VL8A 5JCTA 3AMQA 5KXEA 4E9KA 4XXPA 1W6NA 3BOWA 1BBT1 5I8SA 1ZNPA 3DN7A 3S6PA 4FOYA 4LBLA 2F4PA 4B7KA 1S0GA 2RJLA 1HXS2 1OOPB 2EVXA 3VHPA 1AX0A 1WW4A 3B7MA 4PLNA 1EV11 2YMZA 1CAUB 2GC1A 2VNGA 1MR5A 1RUJ1 3B93A 4DFSA 5GALA 2PAMA 4XBNA 3H8UA 1HKDA 1Q43A 4NVPA 4RR3B 3PVNA 2GH8A 1G86A 2WFF3 5DDJ1 4YVWB 4XIOA 4Q4V1 1ENXA 1QNWA 2WA4A 4JQRA 2HWD1 4C1WA 2OUHA 5IUQA 4COVA 5LK7B 3AZVA 4YGDA 1WD3A 2XJQA 3ZDSA 5FO7B 4CDXA 4HFSA 2DUQA 1VBC3 1AR83 1BEV3 2UY8A 2WINB 3VBRB 3H1WA 5SV8A 5CFDB 1RUF1 3NV4A 1GZWA 5CU1A 1LOEA 4NO4A 2UYAA 3QD6A 4XFFA 2DWRA 5JI7A 4DB5A 5JSOA 4IESA 3PLQA 1QH7A 4OHVA 5KC5A 2VPVA 4XFHA 2HWB2 3K51A 2A3XA 4KG8A 3M3OA 4RR3A 1GSLA 4QPIC 1W6OB 2YZ4A 3ZPYA 1CAWA 1PK6A 2DCJA 1GNZA 3H1YA 1OFNA 1VBD3 5J3UA 2E63A 1RJ7A 2LALA 5JZGC 3H1MA 1JXNA 1POV3 1AL22 2EXIA 3BIWE 1PVC1 2VOXA 1AYM1 4P9YA 4ZU4A 1N1TA 4YZ5A 2CTVA 3VBOB 1WMDA 5CFDA 4LHKA 4AHYA 1ND2B 4ISQA 2YYOA 3R6SA 1RUF3 5H9PA 4FTEA 4XBLA 4YZ3A 3D82A 3USSA 1VBB2 4C90A 3BB6A 3AFGA 3JD72 4TWTA 3RYRA 3OGGA 3WUDA 1NE6A 2B39A 1SCSA 3O0VA 1ASJ2 1S0DA 1O5LA 1PMIA 3RJ2X 1JW6A 2WJSA 4RS5C 1SACA 3ILRA 4XQWA 1W6OA 3ILNA 5GZFA 5DZFA 1PO13 3SCFA 4DMIA 4E27A 3MF6A 1UPIA 5FLJA 4H55A 2XHKA 3WINE 1WW5A 1ENQA 2WSUA 1EPWA 5BY5A 3FE5A 2BVVA 1VIWB 5I8TA 4MYEA 1LEMA 2RS51 2YPJA 4QPGB 1H9WA 2QZ3A 3H50A 4QQLA 4MX3A 3FFQA 4K6BA 3JBG3 1NE4A 5D8AC 2R072 1ZRFA 2WZR2 1COV1 2Q0AA 4OFGA 1S1AA 1MS1A 1NZCA 1POV0 2FBEA 2X5IB 1RGSA 4XBQA 3AJZA 4BIOA 2AR6A 1HRV1 1W2UA 2D6PA 5DZGA 1J3QA 2NMOA 5HI0A 4RSUA 5SV5A 3VBSB 1JTZX 1OOPC 5FREA 2CL2A 5AC91 2PTMA 4PIZA 1Y43B 2A75A 4AI8A 2R043 3R05A 1FXZA 1XRUA 4PLMA 4Q4W1 5JAXA 2E6VA 1W6QB 5T5LA 5L19A 1C4RA 3FWEA 2ZPXA 3RYKA 3ZX7A 1BZWA 2ZKLA 1WBFA 3ZSLA 1QKQA 3ZFFB 4EN7B 4YYOA 4AVAA 1YCIA 4IL7A 1W6PA 5EXOA 3ZIWA 4AFMA 4KWKA 4MGKE 3ZXJA 2PHDA 3WY6A 2ARBA 1OQEA 1Z7S2 5GLWA 1GBGA 2ETEA 1Q8VA 3A0NA 3P3PA 2JECA 1RL3A 2WQZC 4CDQA 3S0MA 1QJU2 1RUC2 5LRSA 4I2OA 3PMSA 2PHXA 1AYN2 4Y1XA 1F5FA 3VBRC 1AX2A 2JE7A 4FPLA 1H0BA 1NCRC 2QZ2A 2V5YA 3EHKA 4XFCA 1UL9A 2GNMA 2Z42A 1XQNA 1ZBA3 2D6OX 2DTYA 3AKPA 1CR7A 1CAXA 3IDBB 2PHRA 3WNXA 1BK1A 3O14A 1RVF2 3INAA 4XJAA 1R092 4CEWA 4D7YA 1WUVA 3WQ7A 4IEPA 1H1IA 4COYA 4WZCA 1V6MA 1M06G 4NR1A 1U5ZA 2PHWA 4OUSA 2RR12 1WW7A 4E2GA 2OZJA 3OY8A 3U07A 2RMU1 1LESA 1NYWA 1HIXA 4Y20B 2HKXA 4YARA 3J9SA 5CA6A 1RUE3 3WW3A 3MLLA 1KJRA 2DCYA 2ES3A 3APBA 4LA3A 3WX5A 5BPXA 4K7JA 2RS33 3EBRA 4Q4Y1 3MFAA 5FLIA 5JPMB 1MZ6A 2B45X 4R9AA 2IXIA 1RUG2 3OD0A 2ZKNA 3HT2A 1CAVA 1PIV3 3QCWA 3WLUA 4Y1ZA 5GLZA 1WLCA 2D44A 4CYDA 1UX6A 1VBE1 2RS13 5KC6A 5H9SA 4AVTA 1H8VA 1LR5A 3PJQA 2QKDA 4EV0A 1O5UA 2OUJA 1FATA 3VBUA 1C8M2 2TEPA 4LBOA 5FAXA 3BODA 4L11A 4RQPC 3ZFEB 4ES9A 4PIYA 4XJ9A 4WM8A 3VZKA 5F1RA 4JGYB 1YLLA 1C1FA 3ETQA 3E97A 2VOKA 2WQ4A 3S7IA 2ZAHA 3KD4A 2WT1A 3KZ4C 2E7QA 2XBO2 2ZGNA 3UL2A 3USUA 2JX9A 2RMU3 1NQDA 3MLKA 4LA2A 2C9AA 3NL1A 3G7DA 1ZZCA 4RFT0 2LM3A 1S0JA 4KWJA 4IEYA 1Q3EA 1Q8PA 4WVMA 3ZSJA 2GZWA 3DGTA 4NHMA 4BH9A 1AR62 1DDLA 1GLHA 4AXOA 3RZZA 4BYYA 5I93A 4CP2A 5GJ6A 4ISRA 3K48A 2ZX4A 2ZGSA 4TYSA 4D3WA 3TWIA 2H0VA 3TYJA 1FOD3 3J4UH 3HQXA 2PYTA 1JH5A 5JMCA 4QPGC 2VUAA 2YUEA 2RJKA 4EN8B 3WQ0A 2AUYA 3IIAA 1QMJA 1NCQB 1TMF3 3O0XA 2JJ6A 4AVSA 4XTPA 2OPKA 3SITA 2OYZA 5JDBA 2Q4SA 1PNFA 3OYWB 3PJYA 4UW4A 4AHZA 1IQAA 1HQLA 2X5IC 5J36A 4FPOB 4WBBA 5C9AC 3TN92 3ME2A 3I59B 1H2MA 1KDMA 1R1A3 4P9GA 1DGWA 5EWSA 1O7FA 1K5MC 1REEA 1RUI1 2OW4A 5FCCA 1UMZA 5GLUA 4MLOA 3VBSC 2P17A 5GZGA 4DRVA 4HKLA 4OVEA 1HX6A 3OBRA 2K2SA 3E5UA 3DV8A 4YFWA 4NHKA 3WDVA 5ABJB 4A7KA 5T50A 3UKTA 4YZ1A 2UY9A 1HDKA 3ZYPA 1B35A 3B9CA 3CU7A 4YVSB 4DINB 3JB4C 1D4M1 3FC0A 2NZ9A 1PO23 1N3QA 2BFUS 4EJRA 2H6CA 1KITA 3CEWA 3N3HA 2BNOA 3NVCA 2A6ZA 4DQAA 1AJKA 1RINA 1RMU2 4FPEA 3VN4A 2WA3A 3LGRA 4WM7A 2QJVA 4P5HA 3FUOA 3QLQA 4MH0E 1YNAA 3OYWA 3E6DA 4P9JA 2NLRA 2ZCWA 3S30A 1TQ5A 3LA3A 4F7ZA 4K1ZA 3V0AA 5T5PA 4B8EA 2ZX3A 3I59A 3AKRA 4A2UA 4FP3A 1NOVA 2VU9A 1MS3A 2R062 3CJIB 1PGSA 2AENA 3AMMA 4GWMA 3ZXKA 4EWDA 2MEV2 1OPOA 3EXUA 3MPPG 2PFWA 3KGLA 4QMAA 3U4XA 1MVEA 4N43B 2JG8B 3ZSKA 1IS6A 1Y9QA 1LHWA 1OA4A 1LOAA 2A5ZA 4DS0A 2Q5TA 5L73A 1FPN2 4JDNA 4D7SA 3AMNA 4N53C 5C4WC 4CP0A 1HRI2 2HWC2 3E6CC 4GKXA 1UAIA 2B42B 2PHFA 5DZEA 4ZKTB 3MF9A 3I7DA 1RUD3 1AR91 2D3RA 1ONAA 4N7IA 3PVEA 4IQPA 5E8AA 3WDWA 4F3JA 1H8TA 4AF9A 2TUNA 4Q1RA 1V6OA 1SLAA 5HXVA 3J8F2 3MIHA 2VG9A 1C3HA 1H1AA 5CADA 3JB8A 4W65A 4GB32 2W39A 3ZFEC 3KT7A 1UZYA 2C1FA 5K0UC 5EYXA 1OHFA 2EXKA 2H0BA 1U0AA 5H9QA 4FPJA 4X6QB 5I8YA 4Z1VA 4WV8A 3B01A 4P14A 2A6VA 1OLQA 1G9BA 1GV9A 3FFZA 2A71A 2CYFA 3RG0A 4MVTA 4JRLA 2MNGA 3R4SA 1QJX1 3WG1A 3SLIA 4ZU5A 4YNIA 4M0NA 3N7KA 2D5FA 4IETA 1N1YA 2WNUB 1C57A 2BW8A 1REFA 4RD7A 3UKVA 2WSVA 2BNMA 1MEC3 1WCKA 2ZZJA 1FX5A 1V9U2 3ALQA 4A3XA 2VH9A 4COZA 3JQWA 1H2LA 1ZREA 4CDUC 3KLSA 3VZJA 2GH2A 2HWE2 1TME3 2DUPA 5JPNB 3FHIB 4XFIA 1ZBE1 3MFCA 2JENA 1KS4A 2Z79A 2PLV3 1RTVA 2B46X 1RUNA 5FOJB 2IWGB 4OHXA 5GLVA 4CEYB 5JIAA 1AZDA 4QPYA 3ZXFA 3M1HA 1S0FA 4ASMB 1Z0HA 1R083 3AMPA 5FQ0A 1FV2A 1YUDA 2R6QA 2RM23 3HMYA 3LZZA 1YXWA 1QJY1 3L2YA 3V0BA 2XWJB 1SFYA 5DG2A 5J09A 4AI3A 4AGRA 5A33A 1Q56A 4QGLA 4ATEA 5A32A 1EAH1 1AVBA 1AR72 5J7MA 4LHNA 2PELA 3LOBA 5K9YA 2SBAA 1FMD3 2AREA 2WWSA 5JLVA 1VRH2 4PCRA 2UWC