3MIBA

Oxidized (cu2+) peptidylglycine alpha-hydroxylating monooxygenase (phm) with bound nitrite
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
310
structure length
308
Chain Sequence
NECLGTIGPVTPLDASDFALDIRMPGVTPKESDTYFCMSMRLPVDEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYWFCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFNHKDCSGVSVHLTRVPQPLIAGMYLMMSVDTVIPPGEKVVNADISCQYKMYPMHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQNPQLPQAFYPVEHPVDVTFGDILAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYMEAKYALSFMTCTKNVAPDMFRTIPAEANIPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Peptidyl-glycine alpha-amidating monooxygenase
publication title Differential Reactivity Between the Two Copper Sites of Peptidylglycine alpha-Hydroxylating Monooxygenase (PHM)
pubmed doi rcsb
source organism Rattus norvegicus
total genus 64
structure length 308
sequence length 310
ec nomenclature ec 1.14.17.3: Peptidylglycine monooxygenase.
pdb deposition date 2010-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01082 Cu2_monooxygen Copper type II ascorbate-dependent monooxygenase, N-terminal domain
A PF03712 Cu2_monoox_C Copper type II ascorbate-dependent monooxygenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.230 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3mibA02
2.60.120.310 Mainly Beta Sandwich Jelly Rolls Copper type II, ascorbate-dependent monooxygenase, N-terminal domain 3mibA01
3MIDA 3PMSA 3MLJA 3MIGA 1OPMA 4R4XA 3MIHA 3MIFA 1PHMA 3MLLA 4R4ZA 3KS7A 3PHMA 3MICA 1SDWA 1PGSA 4QHBA 4E4ZA 1PNFA 1YI9A 3MIEA 3MLKA 1YJLA 1YJKA 1YIPA 1PNGA 3MIBA
chains in the Genus database with same CATH superfamily
3PIGA 1JZ5A 5F3GA 5A32A 3SITA 1QJY1 3CDZB 2VTFA 4AQ2A 4N9HA 2WFF2 2VBBA 3GJAA 3ZFFA 1IS5A 3T0BA 1PO22 2ARBA 4O61A 5EJ3A 4EWDA 2GMMA 5H9QA 1Z78A 4NIDA 2V5YA 3ZXLA 1O91A 3CJXA 3H9AA 4GALA 1PM4A 4AEDC 2EXHA 3VBFC 1JYXA 4CDQA 1EAH1 4GB32 3RDIA 2QTWB 2VC9A 3VD5A 3SCGA 4LKSA 4NPMA 1QQP3 4C90A 4YZ1A 3CF6E 3OYWB 2RDNA 4GH4B 1KFUL 2QBXA 1WD3A 3GBFA 5KXEA 1YQ5A 2ZGMA 2HWB2 3WDUA 5HPOA 2YGMA 4XMAA 3ZYBA 5ACA1 4BQ4A 4OMDA 2WNOA 1KDKA 2Q5TA 3VL9A 2X5IB 3FHAA 3VBSA 3PMEA 5CFCA 4L11A 1PMJX 3Q8AA 5I0SA 1UOJA 1UMZA 1UXXX 1J1LA 1ZVFA 4Y24A 3I8TA 2L9LA 3U0ZA 1Z7S2 3OUHA 1ZRCA 4YZ5A 4Z92B 2X10A 5FBJA 3ZIXA 1VMJA 3JQXA 3DXTA 4LR4A 4XQWA 4WV8A 3VZKA 1LHVA 1TME2 2VBDA 4C8DA 5BNOA 4RSUA 3C3VA 3N9NA 4CDUB 1TMF3 2WFPA 1W9TA 3PNAA 3T0AA 2GMEA 3RSJA 4CSWA 3GGLA 5FLIA 3BOPA 1PK6A 2ZTNA 2XL7A 2EXJA 2VH9A 4MGZE 2BBVA 4AFCA 3I3QA 3N9OA 2CY6A 3ZYIB 4QM8A 3FZ3A 5C4WC 5J3UA 3H50A 3ZN6A 2RS51 3I3DA 3S5AA 1L7LA 5A33B 5F5QA 2Z42A 4CPBA 5FPVA 4Q26A 1YNAA 1X7NA 2ZX2A 1FATA 3WUDA 1SLAA 1SZBA 1S0EA 1X9PA 5FUNA 3SISA 4AEMA 3O1VA 1YYNA 3RYKA 1LOEA 4AEDA 3P3PA 3W58A 2DYCA 2WC2A 1XXNA 5JZGC 2FHRA 3EBRA 2PMWB 2WWJA 3WR0A 4JGZC 4F7ZA 3LCPA 4GXLA 5C3RA 3WNMA 1AR82 3JD71 3OPTA 4HOOA 1BKZA 5IAVA 1NY71 2D6OX 3ALQA 3O1TA 5C7GA 1E5RA 1UMIA 1XNBA 4KWUA 1ZZ8A 3ACLA 4NJ4A 2WINB 2EF6A 3UJOA 1BMV2 2W1WA 1BCXA 3RG0A 1NOVA 2BYVE 4XJUA 3FLRA 1JYNA 3UGFA 4PBOA 3H1MA 1GNYA 1G9CA 1YFYA 1BEV1 4RQPA 5EZWA 1V6IA 2TEPA 1A6CA 3ZYHA 1HB3A 3B5LB 1JHJA 3ON7A 4Q4W3 3CHXA 1OD3A 3DL3A 1RIRA 4ZPIA 2W94A 5A70A 1RUD1 3OGRA 4ASMB 2IUWA 4ZHNA 5LASA 1JODA 2VMIA 2VW1A 5KHIA 3KHCA 4P02B 1EV11 2JDMA 1ZBE3 3RYPA 2RM22 5JOWA 2ZHNA 1GOHA 4B7EA 1H8TC 2UY8A 4M4PA 2ES3A 2WNUA 4I30A 5F37A 1NQDA 4LBQA 1YIFA 2G9GA 4DEQA 5LRSA 1NCQC 1AXZA 3W59A 2W9XA 1BJQA 5LBBA 2XLAA 3RZZA 1VRH3 2JD9A 2OPKA 4OHWA 5FWJA 1G8WA 3ROUA 1W6MA 4NHLA 2GMPA 3IPVB 4QGNA 4QM9A 4GD4A 3IWZA 2I45A 3LA3A 4R9AA 5FPLA 5HV4A 2ZA9A 2W1SA 4BK4A 4NUBA 3WVJA 3ETPA 4YZ2A 1FV3A 1JOBA 3WG4A 1G9BA 1OKQA 2ILMA 5L7OA 1FMD2 5FYCA 1DGRN 3ILFA 2P2KA 1CAUA 4QPWA 1JOJA 5FAXA 5FP4A 3AVRA 3UJQA 1QJFA 3N4MA 4RFRB 4IEWA 2HWE3 5AC93 4OI4A 2VBPA 4CUGA 3K4ZA 1QY4A 2YPDA 4CEYC 3S7EA 4AK3A 5JZGA 3RZLA 1B35C 4IV3B 1AX1A 4LKFA 3W5NA 1Q5OA 3NJXA 2VGDA 4IDZA 3L9JT 1NA1B 4W4ZA 5A7WB 1H4GA 3ABZA 2VMHA 4IEYA 3RRDA 4EZHA 4PJYA 1QJY2 3ZM8A 4JQRA 1IPKA 4O9GA 3NQHA 4EN9B 3HMYA 3POWA 4I0WB 1JTZX 3NV1A 3I2KA 1JZ8A 5FZAA 5EWSA 3R4DB 1V6OA 3D5OA 5IFTA 4GWNA 2HJIA 4TLGA 5FYIA 1W2AX 2P17A 3AJZA 4LIVA 1EAH2 1CESA 1SLTA 4PLMA 4SBVA 4X8PA 5F7UA 2XLFA 4LO7A 1ULPA 2DVFA 3WHTA 4BQ5A 5SV5A 1UY2A 4WZFA 1TNRA 2XKPA 4AL9A 4CP1A 3T08A 3K3NA 2YU1A 4M4RA 5HV0A 4XJ8A 4YLZA 1K5MA 4DY5A 1JYTA 5ACA2 1MZ5A 1HQWA 1DGWA 4UFMA 4MV2A 1Y7BA 2RMU3 3ILNA 4HN0A 4Q4Y3 1H8TA 4BJ0A 4HKLA 3WCRA 3ZPOA 4CP2A 5FTTC 4ZXEA 4LE3A 3QCWA 4PLOA 1OOPB 2PHXA 1YQCA 2VW0A 4N7UA 1XYPA 1R64A 1AJKA 4RA0A 3UL2A 1Y9GA 1YCIA 4LBOA 4GMP1 5KHGA 1GZ9A 4XXAA 2XJQA 1EUTA 5FY4A 1C8M3 4EWAA 3C7GA 5GLUA 2YPJA 4K6BA 3ACGA 3TEWA 3NKGA 1VBB3 5JDBA 4FPYA 2CAVA 1W2TA 3LIGA 3M8LA 4FQ4A 5A7SA 5FO7B 1LOFA 4XPVA 4D3WA 4BCUA 3WT3A 5CFDC 2BQPA 5FFOC 4J1WA 1RUI3 3HT1A 1RUE3 4YVWB 2AENA 3MV01 4Q4X1 1W0PA 4R8HA 1W6OB 5JAXA 4QD2A 4Y1YA 1D4VB 1UU5A 1YI9A 3ZSMA 1GQPA 5K0UB 4FFHA 5FZKA 2CYFA 2EICA 1O3RA 2YZ4A 3WUCA 1B35A 4ASKA 3BU0A 1REFA 4Y26A 1REEA 4Z07A 2QDRA 2DCYA 4B29A 4ZS3A 1VBA3 4CA9A 1XJAA 3S6PA 1OLME 2DCJA 2BPA2 4QKFA 3VDDA 1ZZ9A 4DXZA 5DAXA 3GYDA 2JDNA 4BK5A 4EROA 4P08A 3ZYFA 2Y6HA 1ZBA1 3R0RA 2HLEA 4L99A 1UOGA 2EXIA 4AF9A 3KV5A 3NV3A 1BBT3 1RXGA 4KU8A 5JI7A 4DNYA 1SFNA 1ZA4A 1I3HA 4LJHA 3JD72 2IXKA 1AYM2 1PVXA 1X8EA 2XH6A 2UWBA 4NE9A 1W8FA 2DTWA 2X05A 3K48A 1NY72 4XFFA 2WNVB 4M3CE 3ZN4A 4C0BA 3KT1A 3USSA 3ZYJB 4YVSB 3B9IA 3O0WA 2WS91 2VZQA 2W2IA 5FZOB 1AR93 1MR5A 4AHWA 2A73B 2ZABA 4PIYA 3VV1A 3D6EA 3DN7A 2XKOA 4NAMA 1OXCA 1BEV2 3GM8A 1ULDA 5FZ0A 1UIJA 2R0FA 4G4FA 2R49A 1AVBA 1BK1A 1MVEA 2AREA 3OBAA 3O1PA 2J22A 1RUD2 3NV4A 3MICA 3THPA 4NPLA 1YI7A 4UWDA 3W21A 4K21A 3VBRB 2WZR1 3I4IA 1EV12 2GC2A 3EYPA 3KT4A 4S2HA 2F4PA 1CZTA 5FY9A 1YIPA 1NUKA 4D0QA 4RR3C 5CFDA 1RJ7A 3WW3A 5JCTA 2QCSB 1PIV3 4A4AA 4QAWA 5KR7A 5LK7B 2BU9A 5FV3A 2Q1FA 2V09A 1JU4A 3FJSA 3ATGA 3ZMOA 1Q43A 4CP9B 2AYHA 1BQPA 1JYWA 3JBG3 5LW9A 1S0BA 1UOBA 1SLLA 3CNAA 1N1YA 3GCWA 5FYTA 1FT9A 3RMXA 4Y22B 3RVHA 2YC2A 1W3XA 1PGSA 3MGUA 1PVC1 3UGHA 4N53A 2BRTA 1MQTA 1ODNA 3ZKYA 1C57A 2HWC3 2A6YA 2FCVA 3OD0A 5TSWA 4RD7A 3ZO0B 5A3MA 1OURA 5IUQA 4XFIA 3D0SA 4BISA 1NYWA 4UYBA 2VUJA 1W90A 2A6VA 2RS53 4CTEA 4HVOA 4QPIA 1XPWA 4OUEA 1QWRA 1W6NA 3DV8A 1PZ9A 1SACA 1VMFA 2J1RA 4NIIA 3VGIA 3OGGA 5LBFA 3T0DA 3B02A 3OEAA 2DCZA 3PUSA 3VB9A 1NX9A 3V0BA 2XHNA 2WT0A 2QQNA 3NAPC 5GKAC 1W2UA 1LEMA 4PCRA 2R1DA 1AR71 4JGYC 3NNJA 5FZEA 4E2GA 3RI8A 1I5PA 1J59A 1R1A1 1VIWB 4XIKA 1NKGA 2MEV3 1U5YA 2K9ZA 3PU3A 5IVCA 4E4ZA 1UW8A 4CCOA 1ZRDA 4DEVA 1IG0A 2AEYA 1V9U3 2B9VA 1ZREA 2D97A 3BGAA 5BNPC 5FZCA 5FWEA 1U12A 4HANA 3J8F1 2B42B 5LBCA 2ARCA 4AAPA 5FZ8A 2VMCA 5DAQA 2GH2A 3VBUA 1XNCA 1OFSA 2A6WA 4N8MA 2HWD3 4QXKA 4D6QA 4E4SA 4XURA 1O5UA 2Q30A 1JHNA 3BTZA 4RR3A 5FJKA 5JXJA 2RS11 4NVPA 3AKSA 1FX5A 1K3IA 4YZ3A 3OGSA 1UX7A 1E5IA 2GH8A 4Q27A 4RS5A 4GMP0 4YG3A 2NMOA 4BHPA 5JIUA 1RYYA 1OKOA 4PDWB 3GZEA 3OG2A 1UYZA 4UBGA 1POQA 3LIHA 4E9KA 2EIEA 3WF0A 3OGJA 4FT8A 5IVEA 1PX3A 4L97A 1LU1A 4UFKA 5FREA 2WQZC 3Q8EA 4D6SA 2VQAA 5A6QA 3UV9A 5C3OA 1QQP1 2NZ9A 3LPGA 1G6NA 3ZXGA 4Z2WA 1QHDA 1W8WA 3KCXA 2RJLA 2GP3A 3AP9A 4Q4X2 2OUHA 3WNNA 1QJZA 5KXCA 2EIDA 3AP6A 3U78A 3HN1A 3VBHB 4LBLA 1L7RA 4G9SB 3MIHA 1AL23 1WMDA 4LHLA 4AHZA 3VZJA 1XYOA 4ZU4A 4Y5SA 3S7IA 4YRDA 1DQ0A 1L7QA 3QLQA 3MIEA 4M3CB 3IDAA 2A3XA 1UPIA 3PURA 3AMMA 1VE0A 1XU2A 4NN0A 3PUIA 3H8UA 1ULFA 4UFHA 2VMEA 2QQUA 1ZBA2 4FFFA 5EHDA 4K8RB 5F2SA 4XTMA 1W0OA 3KVBA 3VBOC 1TMF1 3N7KA 4IEUA 4LULA 2YU2A 3ZXAC 2H0VA 3ZFGB 3BTYA 1GKBA 4B3NA 1CWPA 4K20A 1TEIA 1TVGA 1UY4A 3ELNA 2BVVA 3U07A 2QQVA 4W50A 3VHRA 1LAJA 1MS4A 5C9AB 1S0DA 3CJIC 3I7DA 1NXMA 2YG0A 2WS92 5ISLA 5JSOA 2F4LA 3THTA 3HR9A 3O5SA 1C5HA 4HSLA 1ZA7A 4BA6A 1LKNA 4QDSA 2BOIA 1SLIA 2ZGOA 2OZ6A 3AZXA 5I91A 1CPNA 1LCLA 2DUQA 2JDAA 3SXWA 3TEZA 3CU7A 5D8AC 1LGBA 3E6DA 4NHYA 3BYWA 4Z8BA 2BERA 2IFRA 1R082 2YDEA 3MIGA 3AXDA 4R9BA 1FI2A 4I01A 1ZRRA 1CAVB 1O4YA 2PFWA 3LKJA 1L3JA 3JU9A 2WZR2 3SCHA 1W6QB 4EN0A 4LHNA 2JB8A 3USUB 1G9DA 1OA3A 1QJX3 1S0GA 1GWMA 4MG2A 1DZRA 4B1LA 1EUUA 1V6LA 1WCDJ 2JDPA 4LK6A 4XF4A 3U10A 4UFLA 1VAMA 3NMBA 3OF1A 3VUOA 3B93A 1XE7A 4XDQA 4CDWC 1HN0A 4Y20B 4IL7A 3ZXKA 4HLTA 3ZVXA 1H2KA 4EE2A 2AGSA 4AGVA 1SPPB 3ACIA 1C28A 5F8PA 2OZJA 2WAOA 4I3GA 4NWWA 4ATFA 2VL4A 3ZDSA 1TNFA 3LSEA 4J25A 4WVMB 4UF0B 5FDBA 5F3CA 4Q4W1 1PO13 4KG8A 1O6UA 1PVC2 3L2HA 5K4LA 4E2QA 4LEJA 2P37A 2XVLA 4XJAA 3RZJA 4OULA 2YBSA 2VMFA 1CAWB 5FYHA 2XWJB 1ZBE1 1JMUB 1SMVA 2ERFA 1NE4A 1QEXA 3SEEA 5BY5A 1QDCA 3VBOA 3CEWA 3WX5A 1MEC3 2X8KA 3M3IA 3FUOA 4NROA 1QNWA 2OUJA 3T3YA 1OF3A 2W95A 2PHRA 1OUSA 1VRH1 1UY0A 4WM7A 4DIQA 1P8JA 1QH6A 2XJTA 2J1SA 5FZMA 4YPJA 1AR72 3J4UH 3EHKA 1R1A2 3MHZA 5FJHA 2WO1A 3VL8A 4CVUA 1MS3A 4COZA 4N90A 2DFBA 4JRAA 5KHJA 2RS33 3DUIA 1NCRB 4HZFA 2Z4FA 1QF3A 4AVAA 1MZ6A 1HLCA 1LHWA 2QKDA 3NV2A 4QPGC 3OTFA 1SCSA 1RMU2 2D6PA 3J8F2 2HWE1 1DQ4A 4ES8A 5EJZB 3QH6A 1YLLA 4YNIA 3SEPA 5AC91 4XUOA 2CTVA 2KM2A 4AWDA 2I74A 1IHMA 5F9TA 2JB4A 4LO4B 4V1PA 2P6CA 3FC0A 1H8VA 4SLIA 3A0KA 3IDBB 4ZKTB 2ZEYA 3S30A 1RUG3 2OPWA 2RS12 1DZQA 3KWVA 5IW0A 1W2NA 5J96B 4LOTA 2FDHA 5A6YA 4OZXA 2CWSA 2GNBA 2JDHA 3DF0A 5FZHA 4NMIA 2XDVA 4CDWA 4QDRA 3UKNA 3ZPYA 1SG3A 2WWSA 2ZGKA 3VZNA 3I2FA 1QMJA 1YFXA 4MADA 4ATEA 2YHJA 2WDBA 4MYEA 2XJSA 1GZCA 2VXJA 1QQP2 4HVRA 4D7YA 4DB5A 1RVF3 1A34A 3AP4A 4EN7B 1BYHA 3E5XA 4ZY9A 3WQ7A 5FPAA 5ABJA 3D3AA 3HAGA 1K5JA 3TN93 4ISQA 1DBNA 2RMU1 4FPFA 4Q4Y1 4QQPA 1CZVA 3EJKA 3HQRA 4IV1B 5DAPA 1CAXA 3AKQA 2ZPXA 4X6QB 2VXRA 2WT2A 4FP2A 2GALA 4HG6B 4BQ2A 4CDXB 5F1RA 5DUWA 3F95A 4IE4A 2OQ6A 2O1QA 3J7NA 3BALA 4GWIA 4L2NA 4FFIA 4CU9A 4QQHA 3LA7A 3AZVA 2XUMA 5KC5A 2XR4A 3F2ZA 3E5UA 3DXUA 1ND3A 1SFPA 1VBB1 3N35A 2G9ZA 1KFXL 1WLCA 1QXRA 1VBC3 2VM9A 5A32B 1TMF2 1AR61 1CONA 1VP6A 5I8TA 4QPGA 5KHHA 2XOMA 1HN1A 1RUI1 3HQUA 3ZFFB 1W28A 4IGPA 1RUE1 2AC1A 2E33A 1US2A 3DEMA 2VNGA 5FKCA 1F4AA 2ZAAA 4IEOA 1Q3EA 2JXAA 1DYKA 4GIQA 5BNOC 2E51A 4CDQB 4CUBA 3JQWA 3ZXFA 1QGLA 4IE5A 2ZEXA 4LKEA 1VBA1 2W08A 1I5ZA 1W05A 3HBZA 1MACA 2CDPA 3UGGA 1JZ4A 4XTPA 1ACCA 5GZFA 5A7OA 5A3LA 4YGDA 4FQZA 3GF6A 4CPBD 3I2GA 1V6KA 5BXXA 2VQUA 4INDA 3T2PA 3LGRA 4XHXA 4B4RA 3OUIA 3U37A 1VB4A 4QU1A 4Z82A 1UXZA 2Y26A 5FBZA 3N9QA 2HKXA 3VBSB 2R073 5CFCB 4KBZA 1RINA 2KA3A 4QGMA 1BBT1 3ITQA 4QX8A 3ZSKA 2VMGA 2XBO3 4C1WA 2QQJA 1OFNA 4GAZA 4IXLA 4O7XA 1H1AA 5L9RA 3IB3A 1ST8A 1LJ7A 3RZMA 2YFUA 1R091 3SKVA 3WCSA 4K8FA 4CCJA 4WBBA 1DHKB 1AR91 1MZFA 2JG9A 3PJQA 4A41A 2A71A 3KGZA 1GSLA 1QOOA 2LW8A 2VW2A 2Q8DA 3HPNA 5DABA 4AOCA 4AVBA 1GZWA 3AL6A 5CIRA 5C5UA 1UZYA 1PZ7A 2Y60A 2JICA 4AZZA 4FAGA 1PK6B 4Q4W2 3MIBA 2UWAA 1W8OA 1S4CA 2BNOA 4BM8A 5EXOA 1V6NA 1C4RA 3Q9OA 3EB7A 2ZZJA 3ZN5A 5FQ0A 2ORXA 5I0DA 4A3XA 5J48A 4XFAA 1ZBE2 1UO9A 3ILRA 3ZN6B 4RQPC 3FN9A 4QXBA 1F8VA 2D5FA 1I1EA 4CCLA 1QKQA 5BUVA 4LBQD 1PIV1 1JU3A 1WMXA 5I0UA 2FCUA 3WQ0A 1VRH2 4QQ2A 4AEDB 3VBFB 4ZZ5A 5FO8B 2E32A 2JDKA 4X8NA 1UY1A 2RR13 3JBG1 1ALYA 3MYXA 3POYA 1GOGA 5DG2A 2WNUC 4PLNA 1N3QA 2WZ8A 4KBBA 4PIXA 2RDRA 1RHI2 4Y5TA 3JXSA 5C8WA 3K51A 3TEYA 4XQDA 2LTNA 2ZKNA 3W20A 4XBNA 4XE9A 1F15A 2HWC1 2YBPA 3AMNA 4CU6A 1UAIA 1IZ3A 4KWKA 5EV7A 2IXHA 2HWE2 4Y4YA 5E6HA 1J3RA 4CCMA 5AC92 2VZRA 2WRAA 3EXUA 4D69A 4P9IA 2B4KA 2RV9A 4N43C 2Q8OA 1NE6A 5L7OC 4LLOA 2K0GA 4AAXA 5EFUA 3ZR6A 2D6NA 2XJVA 4R9DA 1KD7A 2WR9A 4AI1A 5I0RA 2RG4A 5APAA 3OYWA 2JE9A 2EAKA 3PTRB 4GH4A 4ITCA 4CCCA 3RYRA 1YO8A 3BCWA 4PQQA 4AG4A 2F17A 5D21A 4E27A 1FYUA 5FZFA 1OMIA 2HEYF 4RGGA 2MEV1 4KI5M 3AM2A 4AI9A 5IVVA 3PDQA 3ZFEC 2VNOA 4NIAA 3ACFA 2EIGA 4LBQB 2X5IA 4EN8B 1V9U1 2KD7A 2ZBJA 2BGCA 1IS3A 4OCTA 2YBKA 4RHV3 5BPXA 4COUA 2EALA 4KWLA 2GAUA 4DZGA 2J1VA 4DXRA 3OEBA 2HWD1 5C4WB 5G04L 4AI2A 2XGXA 1RUJ3 2DFCA 4QHBA 3H0OA 3TRSB 3AMQA 2XPJA 5IVBA 2RMU2 1CD3G 3LE0A 4Q4Y2 4UI9L 4Y1ZA 1PMIA 5J09A 2VOWA 4AHYA 2W3JA 4XFHA 1C1FA 5AVPA 5A7PA 2FDIA 2VNVA 1SLBA 1WCUA 3CZJA 4N7IA 2FZ2A 1K5MC 4NRQA 1B09A 3AP7A 3BODA 5JZGB 2XL9A 5EPAA 1C8M2 1GP6A 4JGZB 2WZEA 4Q2FA 4R4XA 5H9PA 3FUQA 5JOYA 4LA3A 4QB1A 2YFZA 4QB6A 3LZZA 3MUZ1 3GZTB 3O1MA 4XBQA 4GKYA 1VBB2 1UU4A 1RUF3 1T2XA 3BPSA 5FK8A 4PT6A 4YM3A 1DFQA 3C7EA 5JR7B 3SKJE 1RUI2 1LRHA 5A33A 5C3SA 3H3ZA 5T54A 4QQOA 2JKXA 4CRQA 3MLKA 1JXNA 3AC0A 4FPOB 4XILA 5CA6A 5IFPA 4EV0A 3ZMNA 1F31A 2MPFA 1V6JA 2WAAA 1OD5A 1AL21 4N43A 2ZKLA 3CIHA 1LOFC 2QQMA 1G7YA 2WT1A 5BV6A 1FNYA 1VBA2 4GZ9A 1Z7S3 4RFT0 3WP6A 1DQ6A 2C9AA 4AFMA 2GSYA 5FP7A 1RTVA 3Q8CA 1O4ZA 5GALA 5LEKA 2JIGA 4YM2A 1WBFA 4AGRA 3QH7A 4XFBA 3UESA 2GC3A 5BNQA 1XNAA 2Z69A 3H42B 5F5IA 1H8TB 3POGA 3LD8A 2DBNA 2LUWA 2QDNA 3GXUA 2P34A 3ZFEA 3AKPA 3MFAA 1ENSA 3KCYA 1KRIA 1NCQB 1BBT2 4QPYA 2CNAA 3B01A 2DTYA 1A3KA 3NJYA 3VDDC 1YJLA 5FZDA 2XUEA 4LPLA 1GOFA 1W0NA 1JBCA 1RUH3 4DS0A 2ZX3A 4D7SA 3KT7A 4H3WA 3TEXA 3HQXA 4BE3A 2RJ2A 4CXWA 1AR92 4JC1A 1ENQA 4RL7A 2JX9A 2DVGA 4V2VA 4FTEA 1M06G 4YM0A 2OXBA 2OYZA 4YGCA 3WW4A 4YGBA 3GZUC 5F3EA 4XJ9A 1SBEA 5HCBA 4LMFA 4KNCA 3C7HA 4E2SA 4QB2A 1N1VA 3QBQA 4CEYB 3IMMA 1SHWB 5C6CA 5K7PA 1JZ6A 1B35B 2DUPA 2PHWA 3EQEA 1ZRFA 4IETA 4FOQA 2VZSA 1W8HA 2IFWA 5BNNB 1BXHA 3T2OA 1SCRA 4Q1RA 1QJX1 3WP3A 5J36A 1XNTA 4YW2A 1V70A 1AF9A 1O8PA 4E4DX 1PIV2 3AKRA 4QU2A 4WZCA 1R1ZA 2GNTA 3MO4A 3R4SA 1UZZA 4PQ9A 4WM8C 2R063 5HI0A 4QT6A 2E31A 4BU2A 1COV3 1KS4A 4PBPA 2GP5A 1K12A 3OSDA 4AHXA 3N7MA 1OSGA 1AR63 3JBG2 4WVVA 4UAPA 1RITA 4FFGA 3MEPA 5L73A 2PAEA 4IV3A 3WDWA 3LDKA 3NO8A 3J7MA 1SDWA 4UXAA 5K9YA 4M01A 1PO11 1NA1A 2O0OA 2CSGA 2WWUA 3NWKA 4LUKA 4NOTA 5A7WA 4AQTA 2E6VA 4H55A 5CU1A 2R16A 1OLRA 4JKLA 1JW6A 2HWC2 3N36A 2Y38A 3HT2A 3AP5A 2B9UA 1O3TA 3BKZA 3OGVA 4BXFA 1ENXA 1MEC1 4MGIE 3GJBA 1RUC3 2A7AA 2IVIB 1C5IA 2JKBA 2RS52 2RVAA 2Y33A 5A1AA 1UY3A 2EIBA 4XFCA 3CZUA 4N53C 1MQTC 1AX0A 2P3IA 4Y1VA 3OBTA 5FYBA 1XYNA 4BPZA 2W39A 3AVSA 1AL0G 4JQTA 1GP4A 1WWYA 3WEZA 4ORFA 5C70A 2RHPA 3FX3A 1CR7A 3WDTA 4BXSV 1ZZ6A 2MEV2 4QPIC 4BLIA 5CFDB 4LO5B 4A2UA 3JB8A 2NN8A 2RS31 4ZU7A 2NPIA 4HPKB 1AYN3 4R52A 3VKLA 2FD8A 4B1MA 1V9U2 3UT0A 5JXHA 2A75A 3VLBB 3MPBA 4LLFA 1R093 4F8AA 1CJDA 3DPRA 1MZEA 2D3SA 1NG0A 4XJZA 1XQNA 3O1RA 3KM5A 4COWA 3RFRA 4CEWC 4MGQA 4GULA 5BYNA 4ZS2A 3HNMA 2HWD2 2W1QA 1E5HA 4W6WA 2J1AA 2JEMA 2D98A 1RUG1 2GN7A 4Q0QA 3VHPA 4HBNA 5A1FA 3ACHA 4OI1A 4L92A 1EPZA 2HEWF 2V4AA 2R32A 5C8CC 1IQDC 1EP0A 1GMMA 3HN3A 4K40A 4MSVA 3RPQA 2DU1A 3AB0A 3VBUC 4WM8A 2UWCA 5DMYA 1HIXA 2B45X 5JPMB 2YGLA 5K0UA 2BP6A 3KQ4B 1LOGA 1W6NB 4EWEA 4Q8KA 2G19A 3HNYM 4BYYA 3HWJA 5FMOL 3TWIA 1ULOA 2BJSA 4RS5C 1PZ8A 3V0BB 1RVF1 1H1MA 5FMBA 5IK4A 4BQ3A 4FPEA 4OUSA 1H4HA 1H9PA 4QX3A 2EXKA 3TN91 1Y9MA 5B2GB 1D0HA 5SV8A 1UWWA 5DQ0A 2Q1ZB 5JVVA 1AL22 5L9BA 5GLTA 5FYYA 4NIHA 4OMCA 2ZX1A 1WUVA 4P9GA 5GZGA 1LNSA 4YW5A 4AFBA 4CDUA 4CXXA 2BFUL 2ZGQA 2VO5A 3L2YA 2WNVA 1W9FA 3D4KA 4XBLA 4AE2A 4RR3B 1AJOA 1HV0A 3ORJA 5FZOA 4DQAA 3E6CC 1JYIA 1OA2A 3ZOIA 1WCSA 1VBC1 1YEWA 4Y4RA 4D7TA 3VD4A 4FPKA 1F4HA 1U5IA 3A7QA 3HBKA 3M3QA 4UBHA 5FZ3A 5A7NA 5LK5A 3SNMA 2FBEA 2Z5WA 4BLJA 4Q8LA 4DXTA 5ANNA 1WW5A 1UOFA 2D3RA 1GNHA 5FZ9A 4CEWA 2UURA 2WABA 2LROA 1ZYBA 2WA3A 4A6OA 3SMHA 3URFA 1NLQA 2B46X 3VBRA 1WLWA 1OH4A 3A4UA 3ETQA 1T6GC 1NZCA 3ZYRA 4DPNA 4XUNA 3AKTA 1D7PM 2CGPA 2SLIA 1DIWA 5C8CA 1JZ7A 3VZOA 1FOD3 1RUOA 3WG3A 2WYFA 2DBIA 5T5OA 1LULA 1YQ8A 2R071 4CP9A 4AVVA 2IXCA 2GC0A 3J26N 1LODA 2ZHKA 4OLLA 2XBO1 2VZOA 1SBDA 1DCSA 5LATA 2OQ7A 2QZ3A 1QJX2 3LEKA 1UIKA 3NAPB 5A3OA 4UW3A 3VKFC 3ZSJA 4JGYB 4Y22A 4DUWA 3FLTA 4B7KA 5IVYA 3HIFA 3HNBM 2J1EA 2AACA 1POV3 3ZX7A 1C3HA 4X6RB 5JOZA 3MW4A 4LA2A 2BVBA 3JB4C 5FCCA 3ZLIA 4TZDA 5FYMA 2GC1A 4QX1A 2YUEA 5JSRA 2WKKA 5FZ7A 5BNPB 3WV6A 1IG3A 5BNNA 3I59B 3AK0A 5FZ6A 1H9WA 3POJA 4PF1A 2AUYA 2V72A 5DZFA 1PO12 4OHXA 1DYOA 2VTXA 4AQSA 2VOTA 4BMBA 4MZUA 3HJRA 4HL0A 5FLHA 2OS2A 3E1F1 1QNYA 2JD4A 2WSUA 1W9YA 3NNLA 2MNGA 2R0HA 1FXZA 4FSJA 1WW4A 1IQAA 2ID4A 5D2AA 2ET7A 5FP3A 1UQXA 1MEC2 1G9FA 2BNNA 2VE1A 5FY5A 5GZDA 3ZDVA 4UW5A 5T50A 3HD8B 1X50A 2KR2A 2JJ6A 3TAYA 5FXWA 2WO7A 3VHOA 5IVFA 5JIAA 2E7AA 1LENA 4Z2AA 3OB8A 2EA7A 5LB6A 3I2IA 5C33A 2ZZQA 4Y3OA 2D6KA 3H3LA 2PAMA 3HOBA 2RR11 5FPBA 5FYVA 4LIUA 4XUPA 1UYYA 2ZX0A 2D40A 5HCHA 4MO3M 1DGWX 5CADA 4FPLA 3KSCA 2Q0AA 4XACA 2RS32 4WM7C 5HCAA 2I07B 3N9LA 2XLGA 3IIIA 3UYJA 4I2OA 1RC6A 4LO6B 4OYUA 1ND2C 2X53S 1M4WA 1RL3A 1W8NA 4L0PA 1W9WA 5IHRA 2CHHA 4MVTA 2B5HA 2W46A 1XSQA 4MGKE 5FR3A 3LWCA 1V0AA 2VZTA 5IYYA 3VDBA 4JVAA 1YXWA 1RUG2 2HH9A 1DGLA 2J7MA 1OLMA 1PX4A 1ULEA 3V0AA 1BVP1 1QJEA 2DDUA 3H1WA 1JOPA 1PGL1 2PHTA 1UD1A 4QWNA 1LB2A 4AVSA 5K8SA 1NQJA 3VBOB 2IZWA 5DG1A 2CL2A 3VD3A 3VBHA 4NAOA 3RZHA 2E7TA 4Q4V1 3WQBA 3R4UA 2W0XA 3QOPA 1W8ZA 2W87A 1J1TA 3POFA 3ZKUA 3OPWA 2HYXA 1DLLA 2QVSB 5E88A 4RHV1 3UETA 2VZ3A 2Y64A 3IKWA 1Q8OA 1GWLA 2Y34A 3CJIB 4HSJA 1F5FA 2NMNA 3MBWA 5FY1A 2ZEWA 1CIWA 2VCAA 3I49A 1V6MA 5IK8A 4IEVA 1RUJ1 3TN92 3LEGA 5JLVA 1KXGA 2VOVA 5F2WA 1Q8VA 3B7MA 2RDSA 1W06A 5JXIA 4IGQA 1CQ9A 5D8AB 2NYYA 2RDQA 3KV9A 1ULCA 4GJZA 2JG8C 3ZR5A 2Y6JA 3LDRA 1ONAA 4OZOA 4LORA 5ABJC 4YW6A 5I8YA 3M3EA 3MUY1 4EYUA 3I2OA 1SBFA 3BN6A 4JV4A 2YYOA 4LXLA 4Q0SA 2ZAHA 1NAEA 3C2UA 2FDJA 3TNQA 2QQKA 5FRAA 2BUKA 1RUF1 2F6BA 2WQ8A 4MGSA 2WL1A 2W52A 3IIAA 3LEMA 3POIA 1VBC2 3LPFA 4FPJA 4L9BA 5F5CA 4FTSA 3CQOA 2C6SA 5KBFA 5F6LB 1WA6X 3WSOA 2PLV3 5J7MA 1MS1A 4CDWB 1ND2A 4W8JA 1HRI3 1UF2C 1OPMA 5LA2A 3RQ0A 2BWCA 4GKXA 1JUHA 1ND3C 1FV2A 2V73A 2XQRA 1OF4A 2DU0A 3KZ4C 4LO8A 3RWKX 3MLLA 4Q1PA 3P3NA 5KHKA 1H6YA 3PHMA 1W6QA 1Z7S1 3WNXA 1O3SA 1S2KA 3USUA 3K46A 4HXCA 1DYPA 1VJ2A 1GICA 4P9JA 3PVNA 4XXPA 4D94A 5FYZA 1PMHX 1VMHA 3KMHA 4EQVA 4PF5A 3DYPA 2P6HA 3Q8FA 2ZGLA 1SFYA 2R072 4JAAA 1CAXB 1S0FA 3R6SA 5FPZA 3VDAA 1S1AA 2XBO2 1LOBA 1IPSA 4XF9A 3O1OA 4QHOA 4QXCA 5HXMA 1E57A 1HKDA 2JDUA 4CZSA 5FO9B 1YWKA 3K75B 4NR1A 5KC6A 2FDKA 4QHZA 1RUH1 4MXWA 2JDYA 2WIIB 4KG0A 5CNAA 5DDJ3 1JYVA 4P9WA 1VAVA 1CAWA 1S0IA 5FYUA 1HXS3 1ZM1A 4HK8A 5LY1A 4QPGB 5T5JA 3GCXA 5CISA 2VU9A 1GYKA 3NJZA 4G3YC 2YC4A 4DUXA 2JG8A 4QGLA 5FY8A 2VCMA 2TBVA 1R083 4F3JA 2HBTA 3KQRA 2QFEA 4WVZA 1AXYA 4AI3A 2AEZA 5E16A 2JG9C 1QOSA 1VBD3 3T1LA 5FOJB 3PUQA 4AW7A 1RGSA 4OQ9A 4YW3A 2P3YA 3T30A 5FOBB 3TBDA 1O4TA 5JMCA 3FFQA 1KJRA 5FUIA 2ADDA 2C0ZA 1D4M3 1W6PB 4QKNA 1ASJ3 2R061 3TYJA 5IVJA 3D82A 3OY8B 1COV1 4JDOA 1RXFA 3BTAA 4IEXA 2RR12 2VJXA 1O8SA 4KGGA 1J3PA 2R043 4BIOA 3LDBA 2P5BA 2HWF3 4TYSA 4OHVA 2VY0A 3LB9A 5A6XA 5A3PA 4QX7A 5ERLA 1ODMA 5JWPA 2DVBA 2RM21 1C8NA 5GLVA 1Z0HA 1GZWB 1GANA 2W68A 3B3QE 4XYXA 2FMDA 3M3CA 1RUC1 1Y3TA 2N7GA 3ZXJA 2DV9A 1W3VA 2IC1A 1DP0A 2A5ZA 3T2QA 2HEVF 4KU7A 4KWJA 4H7MA 4QX0A 4Y5Z0 3FE5A 1STMA 4M3CF 4FOYA 5ANQA 3ZSLA 4YFZA 1X33A 1DGRA 3PLQA 4XZPA 5FQ0B 1PGL2 1PM7A 1A8DA 1MS9A 4Y1XA 4OI0A 4XUQA 4CUCA 3T09A 3KF3A 1QJU3 4GWMA 5J98B 3CL1A 3T4VA 4ASLA 5LCWL 2DVDA 3C7OA 4IESA 2PAKA 1Q8SA 4OHYA 2PHFA 1HJFA 2K2SA 3APBA 2R30A 3B00A 1AYN1 2IVJA 1UZ0A 3UNPA 4IEZA 4XABA 2XVGA 1W39A 4LBKA 1YUDA 2ZACA 4GH4C 3WF1A 1N1SA 5A1LA 1N1TA 2J1UA 2ZS6B 3N9PA 2V4VA 4LITA 4RHV2 5BNOB 4LOSA 2Y8KA 4C1XA 3AJYA 1AZDA 1WMEA 3WXPA 1W9SA 1FPN3 2QZ2A 5KXBA 5B4NA 4B4QA 2VZ1A 5LA1A 2K46A 2EVXA 5DZGA 3WDVA 1RUJ2 2WYSA 1VBE3 2GNMA 2RJKA 2X5IC 4FBFA 2WQ4A 3WNOA 2FCTA 1LESA 4JKMA 3U14A 2QQIA 2YC0A 3VZMA 2PHDA 3BUCA 1HRV3 4XHBA 3CMGA 4CU8A 5D1IA 3WF2A 4NIGA 1ENRA 4WVWA 1VR3A 1W99A 3CLPA 3HEIA 1HQLA 3IN9A 3O7OA 4PI2A 4DOUA 1F9KA 1XSRA 4JKKA 1RUF2 5C3QA 4FP3A 3UK9A 2O8QA 3E6BA 1OPOA 3AMHA 2B8MA 5FMOS 2LM3A 3NW4A 2Q1MA 2BBAA 5J37A 2C24A 4KH9A 1OUXA 3WD5A 1C1LA 3P6BA 5A80A 4IUGA 3B9CA 2C26A 2IXLA 4AFDA 4UW4A 2VZPA 3RGBA 4YG0A 4CCKA 2NM1A 5CKMA 1UN1A 2WN2A 1W8UA 1F5JA 5LRRA 3RZKA 2XJPA 1W8TA 1WLTA 4LHSA 5A3NA 4QKBA 2DCTA 4JTNA 5LA9A 1OQEA 1BLZA 4NHKA 4D6RA 4JHTA 3DKQA 1I9RA 1E5SA 1U5XA 2BFUS 1Q8QA 4K9SA 4CCDA 1ULGA 4RQPB 4UOJA 4URAA 3KCCA 1HDKA 5FMDA 5A6ZA 2LRPA 4KQ7A 2AZ5A 5JOXA 3NRUA 2XG3A 1CZSA 5FPXA 1JS9A 3BVCA 3NKTA 3OUJA 4DMIA 3WW2A 1SLCA 2TNFA 3IDCB 2ZOEB 2BWAA 1RUH2 3FBYA 3MLJA 1VRBA 2YXSA 3OBRA 2WNUB 4P9YA 4Q4V3 4YWAA 1FNZA 2WUHA 2G4IA 2ZGSA 3A0NA 4S2GA 5E89A 3C8XA 1YRZA 3SHRA 5FPUA 1GV9A 2KXLA 1W6MB 1PHMA 4K1ZA 4XF0A 3WHUA 5CG9A 1KITA 3CO2A 3I3EA 5I0TA 3M7AA 1CPMA 1FOD1 2A6XA 5DAWA 5FXZA 3V65A 2PXJA 1FAYA 4XF1A 4HONA 3UKTA 3PJYA 4N43B 2CV6A 5FP9A 5C5TA 5DUUA 1SEFA 3VBFA 1XOYA 5L7OB 1REDA 1H0BA 3LFIA 4P5HA 2D3PA 1CAUB 5JR2A 1QOTA 1W03A 1AYM1 1Y9QA 1OVPA 3PVEA 1IKPA 2UYAA 1LGCA 2WFF3 3LAGA 5DAVA 5HBAA 1PO23 4YSFA 2PQSA 2H6BA 3AZWA 2BEOA 4S2DA 1NZIA 3POSA 3O14A 1MPXA 4LQRA 4KGQA 4YFWA 2DUOA 2FZ1A 5CKQA 4MOAA 3J7HA 1POV1 3VD9A 4IGOA 1QIQA 4GB33 1BZWA 2R062 3A22A 5M0TA 2V5DA 1WMFA 2XWBB 4W6XA 3ZFEB 1COV2 1LEDA 1YC61 5EYYA 2DURA 2OX0A 2JE7A 1AR62 3GALA 4H7LA 4AFAA 1D0GA 1RUE2 2HWB3 3JUUA 1LOAA 3GNEA 2D93A 2VZVA 4NHMA 3WP5A 4BWOA 4NO4A 1CGPA 1XRUA 2YMZA 1N3PA 3V64A 3VD7A 5KWRA 2CAUA 1GNZA 4C0HA 4Y1UA 4M0NA 2CWMA 5JMOA 2UY9A 1IPJA 1EYBA 5I93A 1IKQA 3DGTA 2CGOA 3U4SA 2VCCA 3NL1A 4IV3C 1XBFA 4AEJA 3J9SA 4IW3A 3NVCA 3KVAA 1RUC2 2VG9A 3B94A 3M2MA 1NA1C 5IK5A 3BB6A 1K5MB 1UU6A 3H1YA 2H6CA 4LBNA 2C1FA 3T2TA 3I97A 4XZUG 1TME3 2D5HA 1UKGA 3GHNA 3QD6A 1XU1A 2ZMKA 2D6MA 3G6JB 3ST7A 1JI6A 5AVAA 4A3ZA 2BOJA 4HT1T 4XW3A 3INAA 5C4WA 1GZTA 1OHFA 5L19A 1RHI3 5G05L 2VULA 4A7ZA 1AYN2 2O8OA 1MS0A 3WDXA 4RGAA 1OQ1A 5FIXA 1R092 2JIJA 1JYCA 1VALA 3TOJA 2XB6C 1OA4A 4XMIA 3IAPA 4XVHA 4JGZA 1X8MA 1VB2A 1W2OA 4UFJA 5FKBA 3GBWA 5A3WA 2NLRA 2PQQA 2SBAA 2OKXA 3RMYA 2WJSA 1OOPC 1OLQA 3EO6A 3POEA 4C91A 5FMCA 2JENA 3DPRC 5IK7A 3DCQA 1RUNA 4ONUA 4IEPA 3IPVA 3I54A 4ZZ8A 2QQWA 2VTXJ 2Y0OA 1WGPA 1AR83 1UYPA 3D0JA 4F83A 3VDDB 5LA0A 4CCEA 2BDRA 1A78A 4P5YA 5T3NA 3FHIB 3LEIA 3BTXA 4IE7A 2D6LX 2OVUA 2WNEA 1U5ZA 2JE8A 1CX4A 3MW3A 4YVWC 2X09A 1DU3D 2HYKA 2P4EA 3UKVA 2ORZA 5FP8A 5FY7A 1H6XA 3TNPB 5K0UC 2ZHLA 4XCBA 1H1IA 3T1MA 3KS7A 2EAAA 3Q8BA 4V2WA 5EYXA 2QE3A 3IZOA 3KHBA 1OBNA 5KXDA 2XJUA 1OT5A 1NCQA 2Z2SB 5LZ6A 4XAEA 3DPRB 4FTBA 1JZ3A 4BQYA 4AI8A 2ARAA 3CBNA 1GQHA 3N7LA 4PIZA 2AR6A 4CE8A 2RM23 4JDNA 1UNBA 2G9FA 3CKHA 5GJ6A 1U0AA 4B8EA 2Q8CA 3MZHA 5F39A 2DWRA 1GQGA 4HMZA 4IE0A 4BH9A 3MPPG 1KS5A 4CDUC 4QX2A 1XE0A 1S0JA 1D2QA 2WO2A 3KD4A 4WM8B 3LF7A 2WNVC 2PLV1 4NPRA 2QUOA 3EMRA 3SC7X 1HRI1 4YVSC 2ZCWA 1O59A 1J3QA 3MW2A 5H9SA 2WSVA 1ZZ7A 3DECA 5IWFA 4CEYA 3O1UA 3M4FA 2Y6KA 3ZXEA 2ETEA 2JWPA 4A7YA 3GZAA 1AX2A 1FMD3 1LR5A 5F32A 4ZU5A 3K4AA 2GN3A 2ZJCA 3AFKA 4P9LA 1OOPA 2VCBA 2H0BA 3ECQA 4I02A 1URXA 1NXD1 3DYMA 1DDLA 1WBLA 2JDZA 4M0HA 1GWKA 1FOD2 1D2SA 3HVDA 5F3IA 5T5LA 5FK7A 3W9AA 2CGNA 5IJRA 4GJYA 3VBRC 3PVBB 3NNFA 2A3WA 3D8CA 2FDGA 5I8SA 4JRLA 4N53B 1LHOA 1MQTB 1HB2A 1QJY3 3ZXDA 4GQ7A 4ISRA 1Q56A 2VMDA 3GBGA 4TN7A 4YVWA 5CEHA 1DQ1A 2O14A 3WNLA 1W6OA 4AVCA 1POV0 4HKOA 1HV1A 1ZNPA 4K1YA 3WP4A 1XB9A 1I6XA 1QU0A 4QKDA 5DDJ1 3SCFA 5JXGA 5L9VA 4QPIB 1EAH3 3H8XA 1GBGA 5CYYA 4DUVA 4GA9A 1HXS1 4XC9A 3SLIA 1UMHA 5FLJA 2ZMNA 1WCKA 3PUHA 5FY0A 2E9QA 3O0XA 4JCKA 4XFGA 5FZ4A 3R05A 1AUYA 1R081 3N3HA 4OUMA 1X9TA 4LNVA 4H14A 1IS4A 2WLPA 5ACA3 2FDFA 4CEWB 1VBD1 1F2NA 3U75A 3K3OA 4A42A 4DXSA 1QH7A 4R9CA 5T5PA 3G7DA 5AFBA 5EJ1B 3FL7A 2VVFA 3MF6A 1APNA 4K3UA 2A70A 3GDBA 4CCNA 2VOKA 5BNNC 5C8CB 4FXGB 2RE9A 4HPKA 2IWGB 2OT7A 2Y6FA 3VBUB 3TB0A 1CIYA 3LA2A 1D4M1 3AFGA 3BI3A 1US3A 1WW6A 1X82A 2AH2A 1ASJ1 2VQTA 1GP5A 3A21A 4KL1A 4YVSA 3WNPA 4YARA 4FVVA 4XIOA 4E8CA 1F35A 4MGTA 1UZVA 3AXEA 1DQ5A 4YZ4A 5LY2A 1AXKA 3P1IA 4ARXA 3FBMA 4RS5B 3A23A 4YG6A 2MHFA 2LS6A 3U11A 2ARXA 1IS6A 2R041 3MV11 3PTYA 3DYOA 3RJ2X 2A1XA 2HWF1 3KLSA 4QDQA 1X36A 1OC1A 5A7QA 1K42A 1H2LA 4QQLA 5CAZA 3WOGA 1KGYA 2BV4A 4J6GA 1GFF2 4URTA 5CB7A 3WF3A 1UCXA 4LBJA 2VZUA 2C5DA 4YYOA 4N9IA 3WG1A 4AXOA 2Z79A 2A3YA 1S2EA 1K45A 1ZZBA 2E26A 2BGPA 1GLHA 2FQPA 3N7JA 3O12A 4Y33A 2BNMA 3WINE 3I2HA 1CX1A 3AX4A 3LOBA 4Q0PA 1J84A 4UFIA 3FWEA 3AZZA 1O5LA 4QX5A 1VLNA 1J83A 1Y43B 2ATFA 4PDWC 4YW4A 4LUMA 4AQ6A 1HJGA 1WZXA 2VAUA 4NWVA 4TSVA 1QJU1 4FO9A 4XQ4A 3JD73 2UYBA 1AYM3 3PU8A 4FAHA 2ZGPA 4LBMA 1LTEA 3AYDA 1OVSA 4ES9A 2W5FA 4JTOA 2ZX4A 5DN2A 4IE6A 3P5BA 3PUAA 4FXKB 3ASIA 2QQOA 1RMU1 3J7LA 5H9RA 2WZPP 1HB1A 2YB7A 1HX6A 5JPNB 2P3JA 4Q0UA 2D7FA 2VUCA 1LGNA 4HN1A 4IERA 1QXPA 1FPN1 3BIWE 3VBHC 4U2AA 1BEV3 3E97A 4LTAA 1VBE1 4LK7A 1JH5A 1MS8A 2GNDA 1H30A 1DF0A 2WLQA 2ZMLA 3FLPA 3IAQA 3RNSA 4K7JA 1AHSA 1WD4A 3FHQA 3LSDA 5CKNA 4RN5A 3N9MA 5F6KA 3RWNA 3WG2A 1A8MA 5GLZA 1TE1B 2VECA 1RUD3 2PHUA 3IBMA 1T6BX 4AI0A 4PI0A 1XNKA 4HKWA 1HB4A 1EV13 1HRV1 3VKNA 2VD7A 3BIEA 3T4HB 5T55A 4RGKA 3WDYA 2PHLA 5DZEA 4BQXA 5CZKA 3AMPA 4XETA 4A6SA 4TLFA 4AVTA 4I0BA 3KB5A 3OBZA 4A7KA 3V0AB 2BW8A 4CU7A 4YW7A 4D8MA 2CU5A 1UYXA 3ZFGC 4IEQA 4JDMA 3WQ1A 1ZZCA 1V00A 2Q4SA 3FMGA 3IT8A 3M3OA 4O9EA 4HETA 3SH4A 2PLV2 3MF9A 5C9AC 1S0CA 5DPNA 1HRI2 4BDVB 5FZLA 3S0MA 4META 4OVEA 4BQ1A 1GU3A 1S55A 3WY6A 1XC6A 4BMEA 4TTGA 2PA7A 4BIFA 2E7QA 2OIIA 3BPZA 4OI2A 5FYSA 2DF7A 3WNKA 1SDDB 5L36A 2Y6GA 1H2MA 4TWTA 4FPGA 3SH3A 3S5QA 5A3UA 3NAPA 4XF3A 3I3MA 3RZGA 2ADEA 4PDWA 4JGYA 4CYDA 4AEKA 1YQ6A 4RYDA 1N3OA 1NLRA 1PGW1 3AL5A 2ZGNA 3H7JA 4XCAA 4XDPA 1KDMA 2XXZA 3WZ1A 5JUVA 3OOXA 2ZGRA 1TG7A 2WA4A 2TUNA 3VN4A 1DLCA 3OCPA 4NRPA 4I3PA 5IAXA 5BNPA 3JZVA 1EPWA 5E1RA 5DUXA 4QMAA 3I59A 1G9AA 3RS6A 4CUAA 4J1XA 1KJLA 2NQYA 2OW4A 1TQ5A 1TZOA 2PYTA 5DDJ2 1CVNA 3I3BA 2QJVA 2NP0A 3NJVA 1HXS2 4WM7B 4COVA 4XAAA 3AYEA 1YJKA 5FZGA 3K4DA 4QXHA 1UX6A 1RVF2 4ET7A 4M3CA 4Q29A 1ND2B 1G86A 5FUPA 2Q8EA 4COYA 1WLDA 3KGLA 3IDEA 1JUIA 4MX3A 4E4HA 4U36A 2FMYA 2BGOA 4JHZA 1VBD2 1O3QA 2GDFA 2D44A 5A3TA 1ZX5A 2BZDA 2XQXA 3THDA 2VNRA 1RJ8A 3H3UA 4JX0A 2WFF1 3I2DA 4CXYA 2XHKA 1PO21 3ZFGA 3OJBA 2J42A 4GMP3 3X29B 2VVDA 2WBKA 3MDPA 2YV8A 4LT5A 1O7FA 4H2AA 2ZXQA 2XONA 2R6QA 3RJRA 5C9AA 1D4M2 2VUDA 4XDOA 5IT6A 4GB31 1ASJ2 2E63A 4DINB 4DRRA 1VAKA 3O1SA 2PELA 4OFGA 1BK0A 4Z1VA 3ZYPA 3LQCA 3H8RA 5EP9A 2XMLA 4DRVA 3NNMA 5LWBA 1N47A 1NCRC 2G1MA 2IXJA 2HWB1 5EIYB 4Q4X3 4FI9A 4AYUA 4FCAA 3SH5A 2R042 4MXWB 3QACA 5GM0A 3C7FA 2DVAA 4NRMA 5GZEA 2HWF2 3THCA 1HW5A 5LEJA 1DG6A 1KQRA 2WN3A 3ES1A 1MS5A 1W04A 2R1BA 3E5QA 4XJWA 3V56A 1CAVA 4Q5OA 4R4ZA 2JECA 4MUVA 4ARYA 3K2OA 1UZWA 5CBLA 5JSPA 1NT0A 3PVOA 1QXJA 2WO3A 3K77A 4A45A 2JG8B 2P3KA 4XUTA 2B7YA 2YROA 5C71A 1UPSA 5ABJB 4W6YA 3NSTA 3PIJA 5FZIA 2E53A 2I2SA 4LKDA 1ZBA3 3ZIWA 1TME1 2PN5A 2CDOA 3CJIA 3OPZA 3MFCA 3OD4A 2ET1A 3SQOA 4TXWA 4OQ8A 2Y6LA 1WCQA 4Y20A 2VVEA 4Q0VA 3ZSEA 3O0VA 1BHGA 1QJU2 1SPPA 2A6ZA 5B4XA 5C3PA 4JZRA 1Q8PA 3FFZA 1RHI1 3M70A 4IQPA 4XOGA 1JN2P 4WVMA 4UF0A 5FXXA 3U4XA 4MXVA 2J1TA 3KF5A 5D8AA 3VDCA 1LHNA 4CP0A 4L8QA 1HQNA 1SQ4A 4XEZA 1GR3A 2Y0IA 3LOIA 2ZEZA 2WS93 5GZCA 1ND3B 1YHFA 2VOXA 4HVQA 5HCFA 2ZGTA 2C9KA 4EZ4A 2GU9A 3JCIA 4AR2A 1FPN2 1LU2A 4GWJA 3RI9A 1IOAA 4A44A 1S2BA 3NNGA 3VKMA 1LECA 1VBE2 4IV1C 1KEXA 2B39A 3VHNA 2BTVC 2QNKA 2UU8A 3I2JA 1CN1A 4YGEA 4CDXC 4LHKA 1EY2A 1DZTA 4MHUA 1H2NA 3GHMA 1RB8G 4BZ4A 2WZR3 1HRV2 2XJRA 3B69A 1AR81 2P1BA 4YM1A 1LOCA 1OQDA 1YFUA 3ENRA 4FPCA 3ME2A 2C4XA 4EJRA 4MLOA 1NCRA 2YY1A 1YFWA 3ZYGA 4M00A 4PHZA 3PL0A 3ZFFC 2VPVA 1PNFA 2XVKA 2ZHMA 4DY3A 1BMV1 1OH3A 3BOWA 4MGYE 4W65A 5GLWA 2R7EB 5FZBA 3VKOA 4AGGA 1GUIA 2QQLA 4DO0A 1QDOA 4EN6B 1WA4A 4BQWA 4P00B 1WW7A 5CG8A 4CDQC 3KV4A 4KMQA 2HBUA 1IGOA 2LALA 3MIDA 2GZWA 4YW1A 3PMSA 4E8DA 5JI9A 3BU7A 1Y4WA 3IMNA 1OI6A 1PVC3 3VZLA 1J58A 3KV6A 4BOWA 2QQPA 2W91A 5CVRA 4FOWA 4DFSA 2JG9B 4NHXA 4I0AA 1C8M1 4LE4A 2VR4A 5HXVA 4HFSA 4MHRA 4BB3A 1CJPA 1PGW2 3IM0A 4O65A 4FOVA 4P9XA 3VBSC 5CFCC 3POBA 1XNDA 3H8OA 5J1XA 5EQUA 2W1UA 4UT5A 1XE8A 1UL9A 4MH0E 4UW6A 4P14A 4S2FA 5T52A 5LBEA 5DXDA 1AR73 2VQ0A 2PTMA 1ZRIA 2ENRA 3H7YA 1WKYA 3DKWA 1R1A3 1BVVA 3S57A 3WW1A 5IATA 2OA2A 2W47A 4HK9A 5FXVA 3LFMA 4B4PA 4OHZA 4Q4V2 4FPHA 1FMD1 1UKRA 3M1HA 5F5AA 4IV1A 3MIFA 5AFEA 5DUVA 3MI8A 1NLSA 3WLUA 1RMU3 3AZYA 4CDXA 3U1XA 2VUAA 3J8F3 2X29A 3W5MA 2D43A 1PK6C 3ES4A 4ZONA 4ZXKA 3WF4A 1W6PA 5FZ1A 3AYAA 1JZ2A 1LHUA 4I09A 1DQ2A 1VPHA 2IXIA 3OY8A 5E8AA 1MVQA 1PNGA 2ZGUA 2DCKA 3AYCA 2RS13 2W92A 1YQ2A
chains in the Genus database with same CATH topology
5A32A 3SITA 1QJY1 4AQ2A 4N9HA 2WFF2 3ZFFA 1IS5A 1PO22 2ARBA 5EJ3A 4EWDA 2GMMA 5H9QA 1Z78A 2V5YA 3ZXLA 1O91A 3CJXA 3H9AA 4GALA 4AEDC 2EXHA 3VBFC 4CDQA 1EAH1 4GB32 3RDIA 3SCGA 1QQP3 4C90A 4YZ1A 3CF6E 3OYWB 4GH4B 1KFUL 1WD3A 3GBFA 5KXEA 2ZGMA 3WDUA 2HWB2 2YGMA 4XMAA 5ACA1 1KDKA 2Q5TA 2X5IB 3VBSA 5CFCA 3PMEA 4L11A 5I0SA 1UMZA 1J1LA 1ZVFA 4Y24A 3I8TA 3U0ZA 1Z7S2 1ZRCA 4YZ5A 4Z92B 3ZIXA 3JQXA 4LR4A 4XQWA 4WV8A 3VZKA 1LHVA 1TME2 5BNOA 4RSUA 3C3VA 1TMF3 2WFPA 3PNAA 2GMEA 3RSJA 5FLIA 3BOPA 1PK6A 2ZTNA 2XL7A 2EXJA 2VH9A 4MGZE 2BBVA 4AFCA 2CY6A 3ZYIB 4QM8A 3FZ3A 5C4WC 5J3UA 3H50A 3ZN6A 2RS51 5A33B 5F5QA 2Z42A 4Q26A 1YNAA 1X7NA 2ZX2A 1FATA 3WUDA 1SLAA 1S0EA 3SISA 4AEMA 1YYNA 3RYKA 1LOEA 4AEDA 3P3PA 3W58A 2DYCA 2WC2A 1XXNA 5JZGC 2FHRA 3EBRA 4F7ZA 3WR0A 4JGZC 3LCPA 4GXLA 1AR82 3JD71 1BKZA 1NY71 2D6OX 3ALQA 1XNBA 1ZZ8A 3ACLA 2WINB 2EF6A 3UJOA 1BMV2 1BCXA 3RG0A 1NOVA 2BYVE 4XJUA 3FLRA 4PBOA 3H1MA 1G9CA 1YFYA 1BEV1 4RQPA 5EZWA 1V6IA 2TEPA 1A6CA 3B5LB 4Q4W3 3DL3A 1RIRA 1RUD1 4ASMB 2VMIA 2VW1A 5KHIA 1EV11 1ZBE3 3RYPA 2RM22 5JOWA 2ZHNA 4B7EA 1H8TC 2UY8A 2ES3A 2WNUA 4I30A 1NQDA 4LBQA 1YIFA 2G9GA 5LRSA 1NCQC 1AXZA 3W59A 1BJQA 2XLAA 3RZZA 1VRH3 2OPKA 4OHWA 1G8WA 3ROUA 1W6MA 4NHLA 2GMPA 3IPVB 4QGNA 4QM9A 3IWZA 2I45A 3LA3A 4R9AA 2ZA9A 3WVJA 4YZ2A 1FV3A 3WG4A 1G9BA 1OKQA 2ILMA 5L7OA 1FMD2 1DGRN 3ILFA 2P2KA 1CAUA 1JOJA 5FAXA 3UJQA 3N4MA 4IEWA 2HWE3 5AC93 4OI4A 1QY4A 4CEYC 3S7EA 4AK3A 5JZGA 1B35C 4IV3B 1AX1A 1Q5OA 2VGDA 3L9JT 1NA1B 1H4GA 3RRDA 2VMHA 4IEYA 4PJYA 1QJY2 4JQRA 1IPKA 4O9GA 4EN9B 3HMYA 3POWA 4I0WB 1JTZX 3NV1A 5EWSA 3R4DB 1V6OA 3D5OA 4GWNA 2HJIA 2P17A 3AJZA 1EAH2 1CESA 1SLTA 4PLMA 4SBVA 4X8PA 2XLFA 4LO7A 3WHTA 2DVFA 5SV5A 4WZFA 4CP1A 1TNRA 2XKPA 4XJ8A 4YLZA 1K5MA 4DY5A 5ACA2 1MZ5A 1HQWA 1DGWA 4MV2A 1Y7BA 2RMU3 3ILNA 4HN0A 4Q4Y3 1H8TA 4HKLA 3WCRA 4CP2A 5FTTC 4LE3A 3QCWA 4PLOA 1OOPB 2PHXA 2VW0A 4N7UA 1XYPA 4RA0A 1AJKA 3UL2A 4LBOA 1YCIA 4GMP1 5KHGA 1GZ9A 4XXAA 2XJQA 1C8M3 4EWAA 5GLUA 2YPJA 4K6BA 3NKGA 1VBB3 5JDBA 4FPYA 2CAVA 3M8LA 4FQ4A 5FO7B 1LOFA 4XPVA 4D3WA 4BCUA 3WT3A 5CFDC 2BQPA 5FFOC 4J1WA 1RUI3 3HT1A 1RUE3 4YVWB 2AENA 4Q4X1 1W0PA 4R8HA 1W6OB 5JAXA 4QD2A 4Y1YA 1D4VB 1UU5A 1YI9A 3ZSMA 5K0UB 2CYFA 1O3RA 2YZ4A 3WUCA 1B35A 1REFA 4Y26A 1REEA 4Z07A 2QDRA 2DCYA 4B29A 1VBA3 3S6PA 2DCJA 2BPA2 3VDDA 1ZZ9A 4DXZA 3GYDA 4EROA 1ZBA1 3R0RA 4L99A 2EXIA 4AF9A 3NV3A 1BBT3 4KU8A 5JI7A 4DNYA 1SFNA 1ZA4A 1I3HA 3JD72 2IXKA 1AYM2 1PVXA 1X8EA 2XH6A 2UWBA 4CDUB 2DTWA 3K48A 1NY72 4XFFA 2WNVB 4M3CE 3ZN4A 4C0BA 3KT1A 3USSA 3ZYJB 4YVSB 3B9IA 3O0WA 2WS91 4AHWA 1AR93 1MR5A 2A73B 2ZABA 4PIYA 3VV1A 3D6EA 3DN7A 2XKOA 1BEV2 1ULDA 1UIJA 2R0FA 4G4FA 2R49A 1AVBA 1BK1A 1MVEA 2AREA 1RUD2 3NV4A 3MICA 3THPA 1YI7A 4K21A 3VBRB 2WZR1 3I4IA 1EV12 2GC2A 3KT4A 4S2HA 2F4PA 1YIPA 4RR3C 5CFDA 1RJ7A 3WW3A 5JCTA 2QCSB 1PIV3 5LK7B 2V09A 3FJSA 3ATGA 3ZMOA 1Q43A 2AYHA 1BQPA 3JBG3 1S0BA 3CNAA 1SLLA 1N1YA 1FT9A 3RMXA 4Y22B 1PGSA 3MGUA 1PVC1 4N53A 1MQTA 1C57A 2A6YA 2HWC3 3OD0A 5TSWA 4RD7A 3ZO0B 5A3MA 5IUQA 4XFIA 3D0SA 1NYWA 2VUJA 2A6VA 2RS53 4CTEA 4HVOA 4QPIA 1QWRA 1W6NA 3DV8A 1PZ9A 1SACA 3VGIA 3OGGA 3B02A 2DCZA 3V0BA 2WT0A 3NAPC 5GKAC 1W2UA 1LEMA 4PCRA 2R1DA 1AR71 4JGYC 4E2GA 3RI8A 1J59A 1R1A1 1VIWB 4XIKA 2MEV3 1U5YA 2K9ZA 4E4ZA 1UW8A 1ZRDA 1ZREA 1V9U3 2D97A 5BNPC 1U12A 4HANA 3J8F1 2B42B 2GH2A 3VBUA 1XNCA 1OFSA 2A6WA 2HWD3 4QXKA 4E4SA 1O5UA 2Q30A 1JHNA 4RR3A 2RS11 4NVPA 3AKSA 1FX5A 4YZ3A 2GH8A 4Q27A 4RS5A 4YG3A 4GMP0 2NMOA 4BHPA 5JIUA 4PDWB 4E9KA 4UBGA 3OGJA 4FT8A 4L97A 1LU1A 5FREA 2WQZC 2VQAA 3UV9A 1QQP1 2NZ9A 1G6NA 3ZXGA 4Z2WA 1QHDA 3KCXA 2RJLA 3AP9A 4Q4X2 2OUHA 5KXCA 1QJZA 3AP6A 3HN1A 3VBHB 4LBLA 4G9SB 3MIHA 1AL23 1WMDA 4LHLA 4AHZA 3VZJA 1XYOA 4ZU4A 3S7IA 4YRDA 1DQ0A 3QLQA 3MIEA 4M3CB 2A3XA 1UPIA 3AMMA 4NN0A 1XU2A 3H8UA 1ULFA 1ZBA2 4XTMA 1W0OA 3VBOC 1TMF1 3N7KA 4IEUA 4LULA 3ZXAC 2H0VA 3ZFGB 1GKBA 4B3NA 4K20A 1TEIA 3ELNA 2BVVA 3U07A 3VHRA 1MS4A 5C9AB 1S0DA 3CJIC 3I7DA 1NXMA 2WS92 5JSOA 3THTA 3HR9A 3O5SA 1C5HA 4HSLA 4BA6A 1LKNA 1SLIA 2ZGOA 2OZ6A 3AZXA 5I91A 1CPNA 1LCLA 2DUQA 3SXWA 3CU7A 5D8AC 1LGBA 3E6DA 4Z8BA 2IFRA 1R082 2YDEA 3MIGA 3AXDA 4R9BA 1FI2A 4I01A 1ZRRA 1CAVB 1O4YA 2PFWA 3LKJA 1L3JA 3JU9A 2WZR2 3SCHA 1W6QB 4EN0A 4LHNA 3USUB 1G9DA 1OA3A 1QJX3 1S0GA 1DZRA 1WCDJ 1V6LA 4XF4A 3U10A 1VAMA 3OF1A 3VUOA 3B93A 1XE7A 4XDQA 4CDWC 4Y20B 4IL7A 3ZXKA 4HLTA 3ZVXA 1H2KA 2AGSA 4AGVA 1C28A 2OZJA 4I3GA 4ATFA 4NWWA 3ZDSA 1TNFA 3LSEA 4WVMB 5FDBA 4Q4W1 1PO13 4KG8A 1PVC2 3L2HA 4E2QA 4LEJA 2P37A 2XVLA 4XJAA 4OULA 1CAWB 3VL9A 2XWJB 1ZBE1 5BY5A 1SMVA 2ERFA 1NE4A 1QDCA 3VBOA 3CEWA 3WX5A 1MEC3 2X8KA 3M3IA 3FUOA 1QNWA 2OUJA 2PHRA 4WM7A 1VRH1 1QH6A 2XJTA 1AR72 3J4UH 3EHKA 1R1A2 3VL8A 1MS3A 4COZA 4N90A 2DFBA 4JRAA 5KHJA 2RS33 3DUIA 1NCRB 4HZFA 1QF3A 4AVAA 1MZ6A 1HLCA 1LHWA 2QKDA 3NV2A 4QPGC 3OTFA 1SCSA 1RMU2 2D6PA 3J8F2 2HWE1 1DQ4A 4ES8A 5AC91 3QH6A 1YLLA 4YNIA 2CTVA 2KM2A 4AWDA 2I74A 1IHMA 5F9TA 4LO4B 4V1PA 3FC0A 1H8VA 4SLIA 3A0KA 3IDBB 4ZKTB 3S30A 1RUG3 2RS12 1DZQA 5J96B 4OZXA 2CWSA 2GNBA 3DF0A 4CDWA 3UKNA 3ZPYA 2WWSA 2ZGKA 3VZNA 1QMJA 1YFXA 4ATEA 2YHJA 4MYEA 2XJSA 1GZCA 1QQP2 4HVRA 4D7YA 4DB5A 1RVF3 3AP4A 4EN7B 1BYHA 3E5XA 3WQ7A 5ABJA 3HAGA 3TN93 4ISQA 1DBNA 2RMU1 4FPFA 4Q4Y1 4QQPA 3EJKA 4IV1B 1CAXA 3AKQA 2ZPXA 4X6QB 2VXRA 2WT2A 4FP2A 2GALA 4CDXB 5F1RA 5DUWA 2O1QA 4L2NA 3BALA 4QQHA 3LA7A 3AZVA 2XUMA 5KC5A 3E5UA 1ND3A 1VBB1 3N35A 1KFXL 1WLCA 1QXRA 1VBC3 5A32B 1TMF2 1AR61 1CONA 1VP6A 5I8TA 4QPGA 5KHHA 1RUI1 3ZFFB 1RUE1 2VNGA 2ZAAA 4IEOA 1Q3EA 2JXAA 1DYKA 4GIQA 5BNOC 2E51A 4CDQB 3JQWA 3ZXFA 1QGLA 1VBA1 2W08A 1I5ZA 3HBZA 1MACA 4XTPA 5GZFA 5A3LA 4YGDA 4FQZA 3GF6A 1V6KA 5BXXA 4INDA 3LGRA 4XHXA 4B4RA 1VB4A 4Z82A 5FBZA 2Y26A 2HKXA 3VBSB 2R073 5CFCB 1RINA 2KA3A 4QGMA 1BBT1 3ZSKA 2VMGA 2XBO3 4C1WA 1OFNA 4IXLA 1H1AA 1LJ7A 1R091 3WCSA 4K8FA 4WBBA 1DHKB 1AR91 1MZFA 2JG9A 3PJQA 2A71A 3KGZA 1GSLA 1QOOA 2VW2A 4AVBA 1GZWA 5CIRA 1UZYA 1PZ7A 4FAGA 2JICA 1PK6B 4Q4W2 3MIBA 2UWAA 4BM8A 2BNOA 5EXOA 1V6NA 1C4RA 3Q9OA 2ZZJA 3ZN5A 5FQ0A 5J48A 4A3XA 4XFAA 1ZBE2 3ILRA 3ZN6B 4RQPC 1F8VA 2D5FA 1I1EA 1QKQA 4LBQD 1PIV1 5I0UA 3WQ0A 1VRH2 4QQ2A 4AEDB 3VBFB 5FO8B 4X8NA 2RR13 3JBG1 1ALYA 3MYXA 3POYA 5DG2A 2WNUC 4PLNA 1N3QA 4KBBA 4PIXA 1RHI2 5C8WA 3K51A 4XQDA 2LTNA 2ZKNA 4XBNA 4XE9A 2HWC1 3AMNA 1UAIA 1IZ3A 4KWKA 5EV7A 2IXHA 2HWE2 4Y4YA 5AC92 1J3RA 3EXUA 4D69A 4P9IA 4N43C 2Q8OA 1NE6A 5L7OC 4LLOA 2K0GA 5EFUA 2D6NA 2XJVA 4R9DA 1KD7A 4AI1A 5I0RA 3OYWA 2JE9A 2EAKA 4GH4A 4ITCA 3RYRA 1YO8A 3BCWA 4AG4A 4E27A 1FYUA 1OMIA 2HEYF 4RGGA 2MEV1 3AM2A 3ZFEC 2VNOA 4LBQB 2EIGA 2X5IA 4EN8B 1V9U1 2ZBJA 2BGCA 1IS3A 4RHV3 5BPXA 4COUA 2EALA 4KWLA 2GAUA 4DZGA 2HWD1 5C4WB 4AI2A 2XGXA 1RUJ3 2DFCA 4QHBA 3H0OA 3TRSB 3AMQA 2XPJA 2RMU2 1CD3G 4Q4Y2 4Y1ZA 1PMIA 5J09A 2VOWA 4AHYA 4XFHA 1C1FA 5AVPA 1SLBA 4N7IA 2FZ2A 1K5MC 1B09A 3AP7A 3BODA 5JZGB 2XL9A 1C8M2 5JOYA 4JGZB 4R4XA 4Q2FA 5H9PA 3FUQA 4LA3A 3LZZA 3GZTB 4XBQA 4GKYA 1VBB2 1UU4A 1RUF3 4YM3A 1DFQA 5JR7B 1RUI2 1LRHA 5A33A 3H3ZA 5T54A 4QQOA 4CRQA 3MLKA 1JXNA 4FPOB 4XILA 5CA6A 4EV0A 3ZMNA 1F31A 2MPFA 1V6JA 1OD5A 1AL21 4N43A 2ZKLA 1LOFC 1G7YA 2WT1A 5BV6A 1FNYA 1VBA2 1Z7S3 4RFT0 3WP6A 1DQ6A 2C9AA 4AFMA 2GSYA 1RTVA 1O4ZA 5GALA 5LEKA 4YM2A 1WBFA 4AGRA 3QH7A 4XFBA 5BNQA 2GC3A 2Z69A 1H8TB 2LUWA 2QDNA 2P34A 3ZFEA 3AKPA 3MFAA 1ENSA 3KCYA 1KRIA 1NCQB 1BBT2 4QPYA 2CNAA 3B01A 2DTYA 1A3KA 3VDDC 1YJLA 1JBCA 1RUH3 4DS0A 2ZX3A 4D7SA 3KT7A 4H3WA 3HQXA 4BE3A 1AR92 4JC1A 1ENQA 4RL7A 2JX9A 2DVGA 4FTEA 1M06G 4YM0A 3WW4A 2OYZA 4YGCA 4YGBA 3GZUC 4XJ9A 1SBEA 5HCBA 4KNCA 4E2SA 5C6CA 1N1VA 3QBQA 4CEYB 5K7PA 1B35B 2DUPA 2PHWA 3EQEA 1ZRFA 4IETA 4FOQA 2IFWA 1BXHA 1SCRA 4Q1RA 1QJX1 3WP3A 5J36A 4YW2A 1V70A 1AF9A 4E4DX 1PIV2 3AKRA 4QU2A 4WZCA 1R1ZA 2GNTA 3R4SA 1UZZA 4PQ9A 4WM8C 2R063 5HI0A 4QT6A 1COV3 1KS4A 4PBPA 4AHXA 3N7MA 1OSGA 1AR63 3JBG2 4WVVA 3WDWA 1RITA 3MEPA 5L73A 2PAEA 4IV3A 3NO8A 1SDWA 4UXAA 5K9YA 4M01A 1PO11 1NA1A 2O0OA 3NWKA 4LUKA 4NOTA 4AQTA 5BUVA 2E6VA 4H55A 5CU1A 2R16A 1OLRA 1JW6A 2HWC2 3N36A 2Y38A 3HT2A 3AP5A 2B9UA 1O3TA 1ENXA 1MEC1 4MGIE 1RUC3 2A7AA 2RS52 1C5IA 2JKBA 4XFCA 4N53C 1MQTC 1AX0A 2P3IA 4Y1VA 3OBTA 1XYNA 4BPZA 2W39A 1AL0G 4ORFA 2RHPA 3FX3A 1CR7A 3WDTA 1ZZ6A 2MEV2 4QPIC 4BLIA 5CFDB 4LO5B 4A2UA 3JB8A 2NN8A 2RS31 4ZU7A 2NPIA 4HPKB 1AYN3 4R52A 3VKLA 1V9U2 2A75A 3VLBB 3MPBA 4LLFA 1R093 4F8AA 1CJDA 3DPRA 1MZEA 2D3SA 1NG0A 4XJZA 1XQNA 3KM5A 4COWA 4CEWC 4GULA 5BYNA 2HWD2 4W6WA 2JEMA 2D98A 1RUG1 2GN7A 4Q0QA 3VHPA 4HBNA 4OI1A 4L92A 1EPZA 2HEWF 2R32A 5C8CC 1EP0A 4MSVA 4K40A 3RPQA 2DU1A 3AB0A 3VBUC 4WM8A 2UWCA 1HIXA 2B45X 5JPMB 2YGLA 5K0UA 1LOGA 1W6NB 4EWEA 4Q8KA 4BYYA 3HWJA 5FMOL 3TWIA 4RS5C 1PZ8A 3V0BB 1RVF1 1H1MA 5IK4A 4FPEA 4OUSA 1H4HA 1H9PA 2EXKA 3TN91 5B2GB 1D0HA 5SV8A 2Q1ZB 5JVVA 1AL22 5GLTA 2ZX1A 1WUVA 4P9GA 5GZGA 4AFBA 4YW5A 4CDUA 2BFUL 2ZGQA 3L2YA 2WNVA 3D4KA 4XBLA 4AE2A 4RR3B 1AJOA 1HV0A 4DQAA 3E6CC 1JYIA 1OA2A 1WCSA 1VBC1 4D7TA 4FPKA 3M3QA 1U5IA 4UBHA 5LK5A 3SNMA 2FBEA 2Z5WA 4BLJA 4Q8LA 1WW5A 2D3RA 1GNHA 4CEWA 2UURA 1ZYBA 2WA3A 3SMHA 3URFA 2B46X 3VBRA 1WLWA 3A4UA 3ETQA 1T6GC 1NZCA 3ZYRA 4DPNA 3AKTA 2CGPA 2SLIA 1DIWA 5C8CA 3VZOA 1FOD3 1RUOA 3WG3A 5T5OA 1LULA 2R071 4AVVA 2IXCA 2GC0A 3J26N 1LODA 2ZHKA 4OLLA 2XBO1 1SBDA 3NAPB 2QZ3A 1QJX2 3VKFC 1UIKA 4UW3A 3ZSJA 4JGYB 4Y22A 3FLTA 4B7KA 3HIFA 3ZX7A 1POV3 5JOZA 1C3HA 4X6RB 3MW4A 4LA2A 2BVBA 3JB4C 5FCCA 4TZDA 2GC1A 2YUEA 5JSRA 2WKKA 5BNPB 3WV6A 5BNNA 3I59B 3AK0A 1H9WA 2AUYA 5DZFA 1PO12 4OHXA 4AQSA 4BMBA 4MZUA 4HL0A 5FLHA 1QNYA 2JD4A 2WSUA 2MNGA 2R0HA 1FXZA 4FSJA 1WW4A 1IQAA 2ET7A 1MEC2 1G9FA 2BNNA 5GZDA 4UW5A 5T50A 3HD8B 1X50A 2JJ6A 3TAYA 3VHOA 5JIAA 2E7AA 1LENA 2EA7A 5C33A 2ZZQA 2D6KA 2PAMA 2RR11 2ZX0A 2D40A 1DGWX 5CADA 4FPLA 3KSCA 2Q0AA 2RS32 4WM7C 5HCAA 2I07B 2XLGA 4I2OA 1RC6A 4LO6B 1ND2C 2X53S 1M4WA 1RL3A 4MVTA 2B5HA 3LWCA 4JVAA 1YXWA 1RUG2 1DGLA 1ULEA 3V0AA 1BVP1 3H1WA 1PGL1 2PHTA 1UD1A 1LB2A 4AVSA 5K8SA 1NQJA 3VBOB 2IZWA 5DG1A 2CL2A 3VBHA 2E7TA 4Q4V1 3R4UA 2W0XA 3QOPA 1J1TA 1DLLA 2QVSB 5E88A 4RHV1 3IKWA 1Q8OA 3CJIB 4HSJA 1F5FA 2NMNA 1CIWA 1V6MA 5IK8A 4IEVA 1RUJ1 3TN92 5JLVA 1KXGA 2VOVA 1Q8VA 3B7MA 1CQ9A 5D8AB 2NYYA 1ULCA 2JG8C 1ONAA 5ABJC 5I8YA 3M3EA 1SBFA 4JV4A 2YYOA 4Q0SA 2ZAHA 3C2UA 3TNQA 5FRAA 2BUKA 1RUF1 2F6BA 2WL1A 2W52A 3IIAA 4FPJA 4L9BA 1VBC2 5KBFA 5F6LB 2PLV3 5J7MA 1MS1A 4CDWB 1ND2A 1HRI3 1UF2C 1OPMA 3RQ0A 2BWCA 4GKXA 1JUHA 1ND3C 1FV2A 2V73A 2DU0A 3KZ4C 4LO8A 3MLLA 4Q1PA 3P3NA 5KHKA 3PHMA 1W6QA 1Z7S1 3WNXA 1O3SA 1S2KA 3USUA 1DYPA 1VJ2A 1GICA 4P9JA 3PVNA 4XXPA 4D94A 3KMHA 4PF5A 2ZGLA 1SFYA 2R072 4JAAA 1CAXB 1S0FA 3R6SA 5FPZA 1S1AA 2XBO2 1LOBA 4XF9A 1E57A 1HKDA 4CZSA 5KC6A 5FO9B 1YWKA 4NR1A 1RUH1 4MXWA 5DDJ3 2WIIB 4KG0A 5CNAA 4P9WA 1VAVA 1CAWA 1S0IA 1HXS3 1ZM1A 4HK8A 4QPGB 5T5JA 2VU9A 1GYKA 3NJZA 4G3YC 2JG8A 4QGLA 2TBVA 1R083 4F3JA 4WVZA 3KQRA 2QFEA 1AXYA 4AI3A 5E16A 2JG9C 1QOSA 1VBD3 3T1LA 5FOJB 4AW7A 1RGSA 4YW3A 5FOBB 3TBDA 1O4TA 5JMCA 3FFQA 1KJRA 2C0ZA 1D4M3 1W6PB 1ASJ3 2R061 3TYJA 3D82A 3OY8B 1COV1 4JDOA 3BTAA 4IEXA 2RR12 4KGGA 1J3PA 2R043 4BIOA 2HWF3 4TYSA 4OHVA 2VY0A 3LB9A 5JWPA 2DVBA 2RM21 1C8NA 5GLVA 1Z0HA 1GZWB 1GANA 2W68A 3B3QE 4XYXA 2FMDA 3M3CA 1RUC1 1Y3TA 2N7GA 3ZXJA 2DV9A 2IC1A 2A5ZA 2HEVF 4KU7A 4KWJA 4H7MA 4Y5Z0 3FE5A 4M3CF 4FOYA 3ZSLA 4YFZA 1X33A 1DGRA 3PLQA 4XZPA 5FQ0B 1PGL2 1PM7A 1A8DA 1MS9A 4Y1XA 4OI0A 1QJU3 4GWMA 5J98B 3CL1A 4ASLA 2DVDA 4IESA 2PAKA 1Q8SA 4OHYA 2PHFA 3APBA 2K2SA 2R30A 3B00A 1AYN1 4IEZA 2XVGA 1W39A 4LBKA 1YUDA 2ZACA 4GH4C 1N1SA 1N1TA 2ZS6B 4RHV2 5BNOB 4C1XA 3AJYA 1AZDA 1WMEA 3WXPA 1FPN3 2QZ2A 5KXBA 4B4QA 2EVXA 5DZGA 3WDVA 1RUJ2 1VBE3 2GNMA 2RJKA 2X5IC 4FBFA 2WQ4A 1LESA 2YC0A 3VZMA 2PHDA 1HRV3 4XHBA 5D1IA 1ENRA 4WVWA 1VR3A 3CLPA 3O7OA 4DOUA 1HQLA 3IN9A 1F9KA 1RUF2 4FP3A 3UK9A 2O8QA 3E6BA 1OPOA 3AMHA 2B8MA 5FMOS 2LM3A 3NW4A 2Q1MA 5J37A 4KH9A 3WD5A 1C1LA 3B9CA 2IXLA 4AFDA 4UW4A 4YG0A 2NM1A 1UN1A 1F5JA 5LRRA 2XJPA 1WLTA 2DCTA 4JTNA 1OQEA 4NHKA 1I9RA 2BFUS 1U5XA 1Q8QA 4K9SA 1ULGA 4RQPB 3KCCA 1HDKA 4KQ7A 2AZ5A 5JOXA 2XG3A 5FPXA 3NKTA 4DMIA 3WW2A 1SLCA 2TNFA 3IDCB 2ZOEB 2BWAA 1RUH2 3FBYA 3MLJA 2YXSA 3OBRA 2WNUB 4P9YA 4Q4V3 1FNZA 3A0NA 2G4IA 2ZGSA 4S2GA 5E89A 1YRZA 3SHRA 1GV9A 2KXLA 1W6MB 1PHMA 4K1ZA 4XF0A 3WHUA 5CG9A 1KITA 3CO2A 5I0TA 3M7AA 1CPMA 1FOD1 2A6XA 3V65A 1FAYA 4XF1A 3UKTA 3PJYA 4N43B 2CV6A 5DUUA 1SEFA 3VBFA 5L7OB 1REDA 1H0BA 4P5HA 2D3PA 1CAUB 1QOTA 1AYM1 1Y9QA 3PVEA 1IKPA 2WFF3 2UYAA 1LGCA 3LAGA 5HBAA 1PO23 4YSFA 2H6BA 3AZWA 2BEOA 4S2DA 3POSA 3O14A 4YFWA 4KGQA 2DUOA 2FZ1A 1POV1 4GB33 1BZWA 2R062 2XWBB 1WMFA 4W6XA 3ZFEB 1COV2 1LEDA 5EYYA 2DURA 2JE7A 1AR62 3GALA 4H7LA 4AFAA 1D0GA 1RUE2 2HWB3 3JUUA 1LOAA 3GNEA 2D93A 4NHMA 3WP5A 4BWOA 1CGPA 4NO4A 1XRUA 2YMZA 1N3PA 3V64A 5KWRA 2CAUA 1GNZA 4C0HA 4Y1UA 4M0NA 2CWMA 2UY9A 1IPJA 1EYBA 5I93A 1IKQA 3DGTA 2CGOA 3NL1A 4IV3C 4AEJA 3J9SA 3NVCA 1RUC2 2VG9A 3B94A 3M2MA 1NA1C 5IK5A 3BB6A 1K5MB 1UU6A 3H1YA 2H6CA 4LBNA 2C1FA 3T2TA 1TME3 2D5HA 1UKGA 3GHNA 3QD6A 1XU1A 2ZMKA 2D6MA 3G6JB 3ST7A 5AVAA 4HT1T 4XW3A 3INAA 5C4WA 1OHFA 5L19A 1RHI3 2VULA 4A7ZA 2O8OA 1AYN2 1MS0A 3WDXA 4RGAA 1OQ1A 1R092 1JYCA 1VALA 3TOJA 2XB6C 1OA4A 4XMIA 4JGZA 1X8MA 1VB2A 3GBWA 2NLRA 2PQQA 2SBAA 3RMYA 2WJSA 1OOPC 1OLQA 3EO6A 4C91A 2JENA 3DPRC 5IK7A 1RUNA 4ONUA 4IEPA 3IPVA 3I54A 2Y0OA 1WGPA 1AR83 3D0JA 4F83A 3VDDB 1A78A 5T3NA 3FHIB 2D6LX 2OVUA 2WNEA 1U5ZA 3MW3A 1CX4A 4YVWC 1DU3D 2HYKA 3UKVA 3TNPB 5K0UC 2ZHLA 1H1IA 3T1MA 3KS7A 2EAAA 5EYXA 2QE3A 5KXDA 2XJUA 1NCQA 2Z2SB 3DPRB 4FTBA 4AI8A 1GQHA 3N7LA 4PIZA 2AR6A 2RM23 4JDNA 2G9FA 5GJ6A 1U0AA 4B8EA 3MZHA 2DWRA 1GQGA 4HMZA 4BH9A 3MPPG 1KS5A 4CDUC 1S0JA