3MIBA

Oxidized (cu2+) peptidylglycine alpha-hydroxylating monooxygenase (phm) with bound nitrite
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
310
structure length
308
Chain Sequence
b'NECLGTIGPVTPLDASDFALDIRMPGVTPKESDTYFCMSMRLPVDEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYWFCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFNHKDCSGVSVHLTRVPQPLIAGMYLMMSVDTVIPPGEKVVNADISCQYKMYPMHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQNPQLPQAFYPVEHPVDVTFGDILAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYMEAKYALSFMTCTKNVAPDMFRTIPAEANIPI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-glycine alpha-amidating monooxygenase
publication title Differential Reactivity Between the Two Copper Sites of Peptidylglycine alpha-Hydroxylating Monooxygenase (PHM)
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 64
structure length 308
sequence length 310
ec nomenclature ec 1.14.17.3: Peptidylglycine monooxygenase.
pdb deposition date 2010-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01082 Cu2_monooxygen Copper type II ascorbate-dependent monooxygenase, N-terminal domain
A PF03712 Cu2_monoox_C Copper type II ascorbate-dependent monooxygenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.230 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3mibA02
2.60.120.310 Mainly Beta Sandwich Jelly Rolls Copper type II, ascorbate-dependent monooxygenase, N-terminal domain 3mibA01
3MIHA 1PNGA 3PMSA 3MIEA 1YJLA 1YI9A 1YJKA 3KS7A 1PGSA 1PHMA 3MLJA 3MIFA 1PNFA 1YIPA 4QHBA 3MICA 1SDWA 3MLKA 1OPMA 3MIDA 3MIBA 4E4ZA 3PHMA 3MIGA 4R4XA 4R4ZA 3MLLA
chains in the Genus database with same CATH superfamily
2B7YA 2XLGA 4XPVA 3I2IA 4AEJA 1UU6A 4H14A 3U78A 1VP6A 3ETQA 4KGQA 3VBOC 5FMCA 1W28A 1AR63 4WZFA 1VAMA 2CL2A 3H0OA 4L99A 2C9AA 3MBWA 1F15A 1T6GC 4Z92B 1ULPA 1UY1A 2W9XA 4YVSC 1ZBE2 4TSVA 1LOBA 1BVP1 2DCYA 3M3OA 2D6LX 1W05A 2XUMA 2FZ2A 5CA6A 2RJKA 5BNPA 3G6JB 2Z5WA 3KQRA 4CA9A 5GZEA 1NA1A 5IK4A 3J26N 2EXKA 5LBCA 2WS93 4BQ2A 1W6MB 3VKLA 3GZTB 5I8TA 1KJRA 1PO12 4OI2A 1HIXA 4KWLA 4MX3A 5FYMA 5BNNC 3ITQA 1BQPA 2YC4A 5HCAA 3IDBB 4FPKA 4WVVA 5B4NA 5T5JA 2RS11 4QX1A 1STMA 4E8CA 1O8PA 4Y1YA 4TZDA 1AR61 3JBG2 4Y1XA 4XFHA 3WDUA 1ZX5A 4M4RA 4XFBA 5A7QA 3S7EA 4K21A 5C3QA 1QJX2 5FYIA 3ASIA 5IYYA 3B5LB 1MVEA 3E1F1 5A3UA 4YFWA 3N35A 1W06A 3HD8B 2VPVA 5KHJA 5FO8B 1FATA 5JOZA 2VM9A 2BFUL 2IXLA 2GSYA 2WO1A 1YIFA 5EIYB 1OA4A 4ZU4A 4FOVA 5FYTA 4Q0PA 3T2PA 5FXVA 3HAGA 4B1MA 3WG1A 4GMP3 1NA1B 1DGRA 1SLAA 4IL7A 1UAIA 3T2QA 3WHUA 5K8SA 1ZZBA 2LALA 3J4UH 5CADA 3H8RA 5CB7A 3IIIA 2WYSA 4M0HA 2GAUA 3VHNA 1V6LA 3WP4A 1LULA 4META 4EJRA 3GCWA 3KCYA 2PLV1 1PVC3 4L97A 1LEDA 1G8WA 2OUJA 4IERA 3ZFEC 1ZRIA 5D8AC 4WM7B 4OI4A 1NT0A 2XBO2 3N36A 1ULCA 1PMIA 5HPOA 5ERLA 4FTBA 4ET7A 2DVDA 5A3WA 3KSCA 3MUZ1 5E6HA 4ZXKA 1AR62 3HJRA 2WZR3 4I30A 3OBAA 3ACLA 1LHWA 4CYDA 4DS0A 2WO7A 4B4QA 4AZZA 3LOBA 5A3NA 4GJZA 1AX2A 1CPMA 5IVEA 1XYNA 4AVSA 3ENRA 3JUUA 3AK0A 5E89A 1LHNA 1HV1A 2WA4A 4Y22A 1UZVA 2DDUA 1JOBA 1Z78A 4N43A 4Q8LA 5FZFA 1GWKA 5F2WA 4QX0A 2W0XA 4MGSA 2WDBA 4NIIA 1ZYBA 5J37A 5FPVA 3OEAA 2WS92 3WNKA 4AHXA 4NAOA 3PNAA 4CEWC 3WY6A 1CR7A 4KG0A 1ZBA3 1DZQA 1PVC1 3ZSEA 1PZ7A 1DLCA 2LROA 3GZAA 1WBLA 1YEWA 2GP5A 5A80A 2B8MA 1BBT3 3MIGA 2BZDA 5LA2A 4DXZA 5JR2A 4JGZC 4B7KA 3HVDA 4KWJA 1W0OA 1I5ZA 1OD3A 4LO5B 3B7MA 4K20A 2ZABA 3RMXA 4WVZA 4ZY9A 3AKQA 3UESA 1OUSA 1HB3A 2VE1A 1OH4A 1JZ5A 2DYCA 5EJ3A 4YM1A 3UGHA 2ZMLA 3E5XA 4N90A 5FZKA 1UMZA 4A6OA 4AL9A 4C1WA 3RZLA 1JYXA 4CU6A 1LEMA 5FMBA 4MGQA 5FPAA 5C3RA 4JHZA 1H2LA 1OOPA 2IFRA 4L8QA 3OYWA 4GH4C 4XXAA 2AACA 4JRLA 4A44A 2W91A 2PHXA 3HNBM 1GR3A 4N43B 2OX0A 2NM1A 4CU7A 1LU2A 2ADDA 1GQGA 3RYPA 3ZXLA 1O91A 2VZPA 3UETA 5FRAA 5KBFA 2EIEA 1WMDA 3E6CC 2GNBA 3BYWA 4D7TA 2DUPA 3FZ3A 4YZ2A 2VOTA 2JB4A 2YGMA 5J98B 1PVC2 4YW2A 4E8DA 3NNJA 2B45X 4KNCA 4P5YA 5EQUA 4BQ5A 1ND2A 4QPIA 3AX4A 2BU9A 2FMDA 4XW3A 1AHSA 2A3YA 4QMAA 2VNGA 1IS4A 1O8SA 3KGLA 2R043 1UYZA 3FX3A 4YPJA 1AXZA 3S30A 1JTZX 1OVPA 4HETA 2F4PA 3HNYM 2WZR2 2BP6A 1FAYA 1K5JA 2G1MA 1WCKA 3RGBA 3VGIA 4NRQA 3H7YA 5F32A 4LR4A 1WZXA 2VO5A 5FXZA 4OUMA 1CZSA 3LIGA 1OOPB 2DU0A 4BM8A 1OKQA 1V6KA 2NPIA 2ZHNA 3I3EA 3OYWB 4NWVA 2ZMNA 2DTYA 4Q4X3 4QQPA 3ZIWA 4O9GA 1YJKA 2XKPA 5ABJB 2FDGA 4H2AA 3O1PA 3LWCA 1HKDA 5FPZA 4AQTA 3ZDVA 1N3QA 2AH2A 5LBFA 3RJRA 2J1UA 3KT4A 3ZN6B 3THCA 4XF9A 1RB8G 3R0RA 4E4HA 1EPZA 3MI8A 1LOFA 1ZBA2 4XUOA 5FYBA 4KU8A 4NMIA 4HKLA 4EWAA 3R6SA 5ACA3 3BKZA 4CP0A 1BBT2 2Q8CA 4AFAA 3K3OA 4QXCA 5DZEA 3UGGA 3ME2A 3TYJA 3K75B 1OF4A 4YGCA 5FO9B 1ND2B 1NCRA 3AZYA 4TXWA 1GNZA 3W20A 4AW7A 2Z69A 4ZU5A 3JB8A 4YVSA 2MEV3 1AR71 2YU1A 4QB2A 4Y1UA 3PVOA 4OI0A 5CYYA 1QXJA 1JMUB 4TYSA 2VBPA 4MUVA 3VD5A 4LKDA 3VBRC 3IMMA 4AGVA 4Q4X1 1PMHX 4D8MA 2HEWF 3DN7A 1DHKB 1KS4A 3J9SA 3MIFA 1I1EA 4CXYA 1Q5OA 3O1UA 4DNYA 1Q8PA 3UKVA 2NYYA 5FPLA 2ZBJA 5J1XA 1X50A 4NIGA 2CY6A 2R1BA 2E7QA 4PIZA 5DPNA 3J8F1 1A3KA 4DPNA 4XABA 2BNOA 2OZ6A 2VBBA 2B39A 2FBEA 3RJ2X 4IV3C 5C70A 1D7PM 1LTEA 5B4XA 4CCNA 1K12A 3RZHA 1Z7S1 1UY3A 2Q1MA 1ZRDA 1NLQA 2VVDA 4HKOA 1NY72 3WINE 3VBFA 1Y7BA 4YVWA 3AMMA 1C28A 1PGSA 2CWSA 4QPGA 5FYSA 1JYVA 4K9SA 4A4AA 1PVXA 2A5ZA 2R042 1G7YA 5AFBA 2HYXA 4D0QA 3IB3A 4YG3A 4YW5A 3WW1A 4YVSB 5LA0A 2EALA 2A6YA 2QBXA 4WBBA 1XE0A 1AXYA 4PF5A 2QVSB 4YLZA 3GBFA 1RINA 1RUNA 3J7NA 1XU2A 1S2KA 3ON7A 2JDPA 3TEYA 1MEC1 3BTAA 4Q4X2 3I2HA 1SACA 4A7YA 5A7OA 2C6SA 1CONA 1O5UA 1W04A 3FBYA 4QKDA 4R52A 2HWE3 1EYBA 1AYN1 2BGPA 5JIAA 4EWEA 5BNNB 4RGGA 3WDVA 4K3UA 1AL0G 3M8LA 3ZPOA 4PBPA 1RXFA 5A7SA 4WZCA 3FBMA 5FCCA 3WV6A 5ACA2 4QD2A 1ZNPA 1EUTA 2WNOA 4RGAA 3ZLIA 2VUJA 3KT1A 4NN0A 2R063 5L19A 1N1SA 3VBFB 4QPYA 1YXWA 3O5SA 3GF6A 3VN4A 4IEVA 2OYZA 2MEV2 1AR91 4P9JA 4CDXA 4NROA 1J3RA 2VVFA 3MV11 4OFGA 1RUD1 4S2DA 5FZAA 3U1XA 2PXJA 5T55A 5M0TA 5FZLA 2IZWA 1KDKA 1JYCA 1OF3A 4FQZA 1UO9A 3K77A 2P3JA 3ZSKA 2A1XA 2HWE1 4HVRA 4PBOA 1UZYA 1WW4A 3CBNA 3KZ4C 1ALYA 4IGQA 4EYUA 4AHYA 1U5ZA 2BVVA 3WG4A 4O61A 3MLKA 4PIXA 2IWGB 2F6BA 2TUNA 5D8AB 5LEKA 3PIGA 4QHOA 5FMOL 3RG0A 1R1A1 2R061 3CHXA 1VIWB 1D2SA 1M4WA 4NHLA 4CXXA 2VMHA 1JHJA 1L7QA 3POEA 1BMV1 5FIXA 3AVSA 5L73A 3BCWA 5FZCA 4HN1A 4ZPIA 3IDAA 1X7NA 4LA2A 1ULDA 4XCBA 2VQ0A 5DDJ3 5CFDA 3WNPA 5JCTA 4TLGA 1NCQC 1TEIA 1WW5A 4PLMA 3RI9A 4BXSV 4V2WA 3L2HA 1W6PA 1E5SA 4GA9A 1QKQA 4UF0A 4AEMA 4GH4A 1BHGA 4NWWA 4XFIA 1NLSA 3ZSJA 2AR6A 5A3TA 5DZFA 1VAKA 4CEYC 2VJXA 2LTNA 4LA3A 4IE0A 4UW4A 3KF3A 4U2AA 4LBNA 3NVCA 3NAPC 3WR0A 5C5UA 2H0VA 4FP2A 3OD0A 1RJ8A 1IKQA 4OLLA 2IVIB 5EHDA 4WVMA 4CEWB 3ILFA 4XBNA 4DEQA 1PK6A 5JXIA 2R0FA 2HWE2 3I2FA 4LO7A 2PAKA 2ZEZA 4XAAA 3PTYA 1XC6A 4UAPA 2P3KA 4JGZB 3PVEA 3NJVA 1QXPA 2ZAHA 5LASA 3RI8A 5CFCC 5LBEA 1NX9A 4QM9A 3USUA 5JSPA 4UXAA 5A1AA 2XJPA 4D3WA 5E8AA 4FAHA 1XJAA 3OD4A 4XYXA 3GXUA 1SZBA 2R062 5DDJ1 5KXBA 1LODA 5KWRA 1IPKA 3MDPA 2KA3A 4PLNA 1WUVA 3KV5A 1NZCA 2VW0A 5AVPA 3HWJA 3DUIA 3JQWA 2LUWA 4DO0A 1FXZA 5F5QA 2WABA 5A33B 3N4MA 1QGLA 3BOPA 4NOTA 4UF0B 4GH4B 4XEZA 4E4SA 3LGRA 2Q1FA 4XJWA 2BGOA 2VZOA 4UBGA 5FJKA 5FMDA 5GLVA 1GOHA 3I3DA 4EQVA 1US2A 3KF5A 1E5RA 3TEXA 4XBQA 2VTXJ 4WVMB 1J58A 1XYOA 4D94A 3UNPA 2XXZA 2BFUS 2WN2A 2BNMA 3LF7A 4YYOA 3LZZA 3POWA 3ZFFC 3B69A 3GGLA 4OHVA 4QAWA 3MPPG 1H4HA 2XHKA 3WDWA 2RS33 1W9TA 3N7MA 5F5IA 1OLME 4LBJA 3USUB 2WT0A 2P1BA 4P5HA 3VDBA 2XG3A 3AZXA 1CX1A 2C5DA 3NSTA 2X05A 3OUIA 2E32A 3JQXA 4HSLA 3IDCB 5EZWA 2ARXA 3O0XA 4FPJA 5DDJ2 1RUC3 2W08A 4LULA 3CLPA 2UURA 3THTA 5IVBA 4OQ8A 3IM0A 3WG2A 5IVCA 1RC6A 1CJDA 3AP9A 5DN2A 3ZR5A 5FPUA 2JICA 2XPJA 2BUKA 3NJZA 5FFOC 2NMOA 3SKJE 3RZMA 1S1AA 1VB2A 4IDZA 4BOWA 1W2TA 4PI0A 2QQNA 4MXWA 2RS51 2XVKA 1G9CA 3ETPA 1MS1A 4BQXA 3IKWA 4PDWC 3R05A 1LECA 3VD3A 4D7SA 2ZX0A 2RS31 2X53S 1K5MA 5E1RA 2JIGA 1UF2C 1LCLA 2WT2A 2VCAA 5I0TA 4HN0A 2HH9A 4Q2FA 5C8CC 1UW8A 4QDQA 1FPN3 1B09A 2H6BA 5IWFA 1RUC1 1TME3 3B02A 3GJBA 3VV1A 1MS3A 2PA7A 1UPSA 4GAZA 4OUEA 2WC2A 2FD8A 2RHPA 1ULGA 4CRQA 2D97A 2WN3A 2BGCA 5T3NA 4BA6A 5E88A 3VBRB 4LKFA 3OJBA 1S2BA 3MLJA 3VBUA 1SCSA 5CG8A 4W6WA 4YZ5A 4F83A 3ORJA 1COV3 2JDZA 4KWUA 3AM2A 5T5PA 3UJOA 2XGXA 3ZXJA 2JDNA 3BPSA 4XXPA 3JCIA 4NPMA 1VR3A 1NZIA 2DVFA 5FWEA 3ZKYA 1FNZA 3V65A 3WW3A 2VUDA 2JDYA 4XETA 2ZKNA 3PUAA 1W8UA 1D4M3 1W3VA 2EICA 3C7FA 1RXGA 4MXWB 2BWAA 1AL23 2R30A 4IV3B 2V5DA 4QDRA 4XDPA 4XHXA 4DUXA 3BUCA 1SBEA 3MIHA 5FLIA 5DAWA 1MQTC 2VNRA 1FPN1 3DV8A 2CHHA 1AR83 1OD5A 2RS32 2VNOA 2CTVA 3BODA 4CDUA 2JG9C 2Y6KA 1VMHA 1D2QA 1OPOA 2J1AA 3C3VA 2BNNA 5IVVA 5FP8A 3PUSA 2NQYA 2B4KA 5C4WA 3LAGA 1A8MA 3ZMNA 2NP0A 2WNVA 1RUC2 1ENSA 3I97A 3WSOA 4AGGA 4NO4A 1DG6A 4BU2A 4XCAA 4AQ6A 2WNUC 5FO7B 1COV1 1JYWA 3VBUB 4EN9B 3WDXA 3BTXA 1MZ5A 1WMXA 1ND3C 1C5HA 1XOYA 2HWB3 4RGKA 3FE5A 1J1TA 3IAQA 4Z07A 1OMIA 1ONAA 2H6CA 2UY8A 4IXLA 4LE4A 4QQOA 5C7GA 3VL8A 4O65A 4I01A 3N9LA 1LB2A 5IFTA 3N9MA 2WAAA 1OQDA 1DGWX 3O12A 2OIIA 3LA7A 3NJYA 2PFWA 4AQSA 4BJ0A 4LUMA 2TNFA 4EZHA 1AR81 3ELNA 4FXGB 5FUIA 4FAGA 2ZGSA 1ODNA 1GFF2 4UBHA 3GNEA 2DF7A 2ET7A 5A3OA 1GMMA 2DUOA 3KCCA 3LSDA 4NPLA 1W2OA 3S7IA 1FPN2 1QJY1 2P2KA 5FZ1A 5FDBA 2ZGOA 5CIRA 2ATFA 3BTZA 1TME2 1B35A 4DRVA 2XLFA 2Q8EA 5JXGA 2VD7A 5C4WB 1SHWB 2RMU3 2KD7A 4BMBA 2WNVB 2JB8A 4CVUA 2RR13 1W2UA 2DU1A 2J7MA 1EV13 3MIEA 1PM4A 3GALA 4HG6B 4N7IA 4BQ3A 4M3CA 2HWB1 2BRTA 1HW5A 2BDRA 3GDBA 3LD8A 1VJ2A 1UZ0A 3MV01 5JLVA 4YZ3A 2AEYA 1COV2 5F6LB 3DXUA 2P3IA 2ZX2A 1VLNA 1QOOA 1XNBA 2VAUA 1IZ3A 1LR5A 4COYA 1XE7A 4RHV1 1DZRA 4GMP0 1IHMA 4RA0A 5FUNA 1D4M2 1ULOA 3LIHA 4ASKA 5CFCA 1VAVA 2D6NA 4UFKA 5KC6A 1AL22 1LHOA 1L7RA 4FBFA 3CJIC 3UT0A 3HNMA 5A3MA 5L9VA 4AF9A 1CIYA 4P00B 1AYM3 1HB1A 4ATEA 5LEJA 1AR82 3BN6A 4FQ4A 4JC1A 4FFFA 3NV1A 2Z79A 3APBA 1RVF3 2RMU1 1VRH3 2XB6C 3RZZA 1HRI3 4LBOA 2XMLA 4CCEA 4TTGA 3RVHA 3HN3A 3LFMA 3Q8FA 1JH5A 1PNFA 4CEYB 5HCHA 3IZOA 3TN91 1WD4A 1G9BA 4AI1A 2Y6GA 4L0PA 3CO2A 4M3CB 1S0BA 4UW6A 2AGSA 1XNKA 2HWB2 3LA3A 2VZRA 4AXOA 1US3A 1U5IA 1W6QB 3DL3A 2V73A 3OBRA 3JZVA 3VHOA 4CCLA 2YXSA 5FYZA 1WKYA 5I8YA 4LJHA 2EAAA 4ZS2A 3VZJA 3O1RA 4NIDA 1IS3A 3ZFFA 1I5PA 1W03A 4P9GA 5L7OA 1WA6X 4YW1A 4FFGA 2JEMA 5CFCB 3WXPA 3MYXA 3SCHA 1ENRA 3AZZA 4LIUA 1OI6A 4XF3A 1TQ5A 5A32B 4UW5A 5FZDA 5CVRA 1ZM1A 5DUVA 4DUVA 5F5CA 2JE7A 1S0EA 2BW8A 1VRH1 5FY5A 2PQQA 4QX5A 2ZX4A 3AP5A 2J1EA 1F4HA 2FCTA 2ZX3A 4PCRA 1JZ7A 2DVBA 4YG0A 2QJVA 1SLTA 1W9WA 4Z82A 1JZ8A 1DDLA 1X9TA 2RMU2 5LATA 1H8TC 3ACHA 3O7OA 4ARXA 1GZCA 3MIBA 4C90A 4C91A 2RR12 3AJYA 3LE0A 4FFHA 4GXLA 1YFUA 1EV12 4IGOA 4J1XA 4LITA 5DXDA 5EV7A 3UGFA 3OGVA 2D6KA 2Q5TA 4Q4V3 1FV3A 4XJUA 5FYCA 1S0DA 2RS13 3WHTA 4LXLA 2Y33A 3OGJA 4ORFA 2BQPA 4L2NA 3NO8A 2EAKA 1Q8VA 4PDWA 4MGTA 4R9BA 3FMGA 1I9RA 2CAUA 2A6ZA 3POFA 1JUHA 3I4IA 4R9AA 2PHDA 3ZFFB 1JZ3A 1T2XA 1VMJA 5L7OB 2QQIA 4BK4A 4P08A 4ZHNA 2J42A 3QH7A 3DKWA 1AYM2 4YW4A 3OBTA 1S0IA 1NE6A 4JGYC 5F5AA 2GMEA 1GWLA 1LGNA 4IE4A 3N3HA 1RVF2 1UCXA 1VRH2 3AMHA 4W6YA 5EXOA 4Z8BA 1HRI2 1X82A 3AKTA 4G4FA 1XYPA 5G04L 4BZ4A 3K3NA 5FMOS 2EIDA 1QHDA 1RUH1 3AZVA 3O1OA 2P6CA 4Q0UA 1QMJA 1CESA 2C1FA 4Q4V1 4WM7A 4UOJA 1GOFA 4HFSA 2PLV3 4OI1A 3VZMA 3IBMA 1POQA 3A4UA 3RPQA 2SLIA 5EYXA 3HEIA 4XTMA 4CXWA 4PDWB 5BXXA 3HMYA 5BY5A 2HKXA 1MQTA 2RDSA 3LKJA 1W8FA 3ZFGC 4FSJA 3UKNA 3N7JA 5C8CB 1NQJA 4AE2A 2WQZC 3LFIA 1HJFA 3KGZA 3T30A 3KCXA 5FPXA 4I0BA 5C9AC 2JJ6A 5HBAA 4MV2A 1TZOA 3EYPA 4XBLA 4IEQA 2P5BA 2K2SA 4KBZA 3W21A 2RDRA 4N53C 3PL0A 1YHFA 3WD5A 3WDTA 3AKSA 4BDVB 4D6SA 1REDA 3ACIA 3I49A 4Q4V2 5DG1A 1U5YA 1IG0A 2RS12 3MW2A 3RQ0A 2JKXA 1F2NA 5EWSA 5A7WB 4R4ZA 1SFNA 4MVTA 2YGLA 2VECA 1R64A 3DEMA 4Q4W1 5KHGA 3T0AA 4B29A 2FDIA 2QQWA 2YDEA 1VBE1 2UY9A 4PQ9A 1ZZ7A 1GBGA 4YGBA 1MQTB 4X8PA 4S2HA 2ZGQA 3AJZA 1GUIA 2JG9B 4JVAA 1H9PA 2O8OA 2EA7A 1DQ0A 3C7OA 4YM2A 4B7EA 5GZDA 5GM0A 1OHFA 2GH8A 2HJIA 2XJSA 4BWOA 5HV4A 2D6MA 5CZKA 5FZHA 3E6DA 1DP0A 3AVRA 2WAOA 4XE9A 5E16A 3TWIA 4I02A 3ZR6A 1JYIA 3LQCA 3MFAA 3GZEA 4JKMA 1U5XA 2WNUB 4DFSA 1W9SA 4FPFA 3FC0A 2YY1A 2JG8C 5JPNB 1UX6A 3VDCA 3ZXFA 2ES3A 3ZKUA 5A6QA 1GQPA 2C9KA 3RDIA 4HK8A 2PLV2 3WNNA 2VTFA 1N3PA 3MF6A 3URFA 4Y20A 2PMWB 1QH6A 1H2NA 2CU5A 2GP3A 4Q1PA 5JZGC 4JAAA 1V6OA 1C57A 1JODA 4OHWA 3SH4A 3D4KA 3M7AA 5KXEA 2X5IC 4QXHA 1DYOA 4NJ4A 2SBAA 2QCSB 1ZRCA 4KI5M 5FP4A 2W47A 3ES4A 2D40A 5ABJA 3HT2A 5I0RA 4NIAA 1SCRA 1VRBA 4EV0A 5T52A 3NW4A 3U37A 2YBSA 4NRPA 4BQ1A 3ZN6A 2VQAA 1M06G 4I0AA 5IJRA 5FZ8A 4COUA 5LBBA 1W90A 2QNKA 1QU0A 1SBDA 1GKBA 4UI9L 5FBZA 2CAVA 2YFZA 1N1VA 4HVQA 4LEJA 2CDOA 2K9ZA 5K9YA 1RUI1 1XB9A 3L9JT 4GWJA 1YQ8A 2E31A 4LKSA 3NV4A 1W2NA 3ZN4A 4I2OA 1CIWA 1QWRA 5I93A 3TOJA 4M00A 4Y20B 1IS6A 2VZ3A 2X8KA 4XIOA 4HSJA 2GN7A 4QU1A 1WD3A 3NWKA 4EE2A 5CG9A 1DQ1A 2VQUA 3CJIB 3ZYJB 1AR73 2CYFA 5C5TA 2C4XA 5JOYA 2J22A 5FREA 3ZO0B 1CN1A 2W1SA 2IC1A 2G19A 4SBVA 1Z0HA 2WFF1 4EN0A 3W59A 1UN1A 2D3SA 4L92A 1LENA 1QY4A 3ZXDA 1OKOA 2J1VA 1FYUA 1SFPA 2PQSA 1RHI3 4YNIA 2QFEA 5F3GA 4AI8A 4Q0QA 3RRDA 2WO2A 3GZUC 2YMZA 2WA3A 2UYBA 3UKTA 3J8F3 3IWZA 2JX9A 2PHUA 1YQCA 4FOQA 5A6ZA 4DUWA 4BQYA 2GDFA 4XVHA 5K0UC 4A7KA 3KV9A 3I7DA 4M3CF 3VBOA 5KHKA 3SC7X 1PIV3 1Z7S3 5DAXA 3ZYRA 4QT6A 3MLLA 1J3PA 4CU9A 4KBBA 2VOWA 1NYWA 5AVAA 3V0BB 5DAQA 1I6XA 3TBDA 2Q1ZB 4NHMA 1O3QA 4XUQA 1GP5A 2ZPXA 4BMEA 3RS6A 5FY7A 5TSWA 2WQ4A 4QB1A 3WZ1A 4XIKA 1TNRA 3MGUA 2Q30A 1JU4A 3Q8EA 3CF6E 2W5FA 2G4IA 4JGYA 1O3RA 3POSA 2BYVE 2WIIB 1W39A 1RHI1 2D93A 5F6KA 3RZGA 1OSGA 1MEC3 4IEUA 5JMOA 3CU7A 3OPTA 2V09A 3W5MA 3GBWA 2YG0A 3WNXA 2UYAA 1H8TB 1UQXA 2DBNA 2W1QA 3M3IA 2ARAA 5BNNA 4QQLA 3WP6A 1NG0A 5FR3A 2HBTA 3BTYA 1CAUA 2TEPA 2DCKA 1AYN3 1W8TA 3TNPB 3ZYIB 4CDWC 3PIJA 4A45A 1PIV1 1H0BA 5FPBA 1QJZA 3SISA 1UMHA 3SMHA 2JDHA 3O14A 2ARCA 1V6MA 3VBOB 1CZVA 3AYEA 5J7MA 3O1VA 1U0AA 4XUNA 2YC2A 3NQHA 2RVAA 2WINB 3VBSC 1HXS3 1HN0A 1RYYA 4H7MA 1AR72 3WG3A 1AR93 1O4TA 2JDMA 4MSVA 4NPRA 4QGLA 4MXVA 5DUWA 4JKKA 2AC1A 4C0BA 1D4VB 2BPA2 1RUD3 1N1TA 1YO8A 2WNEA 4UFLA 1N3OA 2GALA 2OUHA 4HL0A 4JGYB 5FXWA 1IKPA 1X8MA 2BVBA 3DYOA 4ISRA 1BJQA 1UKRA 3H1WA 2O8QA 3ZOIA 2FZ1A 4FPLA 1RHI2 4QKFA 4RL7A 2PYTA 1RUF1 3BOWA 1HDKA 1VBB1 1UZZA 2ZGUA 3FUOA 3HR9A 4CUAA 1OT5A 3ZFEA 3ZXEA 2DVGA 5CKMA 2TBVA 3EHKA 3J8F2 1CAUB 1XU1A 2PHLA 3J7HA 5D8AA 4GJYA 3KV6A 5F1RA 2WSUA 1PZ9A 3P3NA 1JW6A 3HQXA 2V72A 4XUPA 2LS6A 2ZS6B 4LPLA 1J83A 3V56A 1R1A3 3WOGA 2YHJA 1PIV2 1Z7S2 4CDXB 1HB4A 2QZ3A 4W6XA 1UU4A 4LBLA 5AC91 5FLJA 1OLQA 1HXS1 2EIBA 5ANNA 2DTWA 3GM8A 3ATGA 4YG6A 5GJ6A 1Y43B 4AFMA 2JDAA 3VKOA 3ZFGB 5FZOA 3W5NA 2CGNA 2V5YA 3C7HA 4LIVA 4MHRA 3DXTA 4LLFA 3ZYFA 3VBHC 1KDMA 2D5HA 3ES1A 4I3GA 4S2FA 1LESA 1EPWA 2DBIA 2XWBB 1L3JA 2A3XA 4IEXA 5L9BA 1SG3A 5C9AB 3D8CA 4UFHA 3OG2A 4TLFA 2VMDA 3FHQA 4XURA 4MG2A 1MEC2 3FJSA 4CEWA 4KU7A 4K8RB 3H42B 4N53B 2AREA 4JGZA 1J59A 1X33A 3IPVB 4XQDA 3FLPA 1AYN2 3ZFEB 1JS9A 4BK5A 1GYKA 2MPFA 5CAZA 4DOUA 3KD4A 1PZ8A 1L7LA 1T6BX 4L11A 5KHIA 1N1YA 1HX6A 4FTEA 4ISQA 3I2JA 2BWCA 3ALQA 5FZ7A 3V0AA 3WT3A 3SNMA 4E9KA 2VGDA 2YUEA 3A22A 5GKAC 1QOTA 4Z2AA 4CUCA 4M4PA 3HN1A 5A33A 3ZX7A 1HXS2 3U75A 4IESA 1QXRA 5FZOB 1CAXB 2HYKA 1AR92 1K3IA 1URXA 2RE9A 3WNLA 3H9AA 3MUY1 1YIPA 2VCBA 3FL7A 1PO21 1RUD2 3NL1A 5FY0A 4ARYA 3TEWA 1A6CA 2D7FA 2CWMA 2KXLA 2UWCA 3T4HB 1RL3A 5FKBA 1HRV3 4RS5C 5SV8A 2GMPA 1UYXA 2Q8OA 2D6PA 1Y9MA 2WWJA 3KWVA 1CQ9A 1KQRA 2XL7A 2IVJA 1CPNA 4DB5A 3AL5A 3ZM8A 1LGBA 1XE8A 2XH6A 2WR9A 1Y9GA 3B3QE 2UU8A 5I8SA 4YWAA 2Y60A 2ZXQA 2QQUA 3TAYA 3WNOA 3E5UA 3WQ7A 3E5QA 4A2UA 1QJFA 1RUJ3 1FI2A 1W6NB 2RV9A 3DPRC 4INDA 5FOBB 5JZGB 1JXNA 1R1A2 2D5FA 5IVYA 1UY0A 4GIQA 5A3PA 1UKGA 5C33A 2XJVA 3MICA 2VZ1A 2P4EA 4XTPA 5DG2A 4AVCA 3V0AB 2R0HA 1BMV2 2X5IB 5DUXA 1W8NA 4AVVA 1AVBA 1ENQA 4Y33A 3SEPA 3ABZA 1VE0A 2ZZQA 1DZTA 5J36A 1XBFA 2ENRA 1GZ9A 5FZ9A 1HRV1 3VHRA 1DQ6A 3S6PA 3UYJA 1LOAA 2JD9A 2W94A 3MW3A 2E7AA 2HWD3 4JRAA 4BQWA 2VBDA 5C3PA 1S4CA 5JWPA 5T5OA 2Y38A 4BISA 2OT7A 4AVAA 1QNYA 4ES8A 2CV6A 3FLRA 4XACA 2RS53 4LBMA 4E2QA 3CL1A 5A1FA 1GICA 1HLCA 1RUJ1 4M0NA 4TWTA 1RUOA 3EQEA 3HIFA 3U4SA 4CDQC 3HPNA 3WQ1A 2K46A 2PN5A 4P02B 4AOCA 4ZZ5A 5H9PA 3LPGA 1UOFA 4AI2A 5G05L 2WWSA 1VPHA 3H7JA 1IQDC 2EXJA 3VBRA 5I91A 1V6JA 4OULA 3SCGA 1V6NA 2JDKA 1GOGA 3CQOA 4QQHA 4V1PA 3U07A 2YFUA 3O1SA 2YBPA 4BE3A 4LKEA 4R9DA 2BOJA 1JZ6A 4UYBA 1TE1B 1REFA 2MNGA 2X29A 3MFCA 3GHNA 4MLOA 4XDOA 3A21A 3BGAA 3POIA 5KHHA 5DUUA 2HWD1 4FOYA 2JWPA 1CD3G 1JZ4A 1HRV2 1C5IA 2XR4A 3SH3A 4IV3A 4DXSA 4AAXA 4A41A 3BB6A 4WM8C 3M70A 2QDNA 4RD7A 2VL4A 1DGWA 3MHZA 3ZYBA 5K0UB 1LAJA 2JIJA 3T2TA 2X09A 4DEVA 3NNGA 2O0OA 1ZZCA 1WLDA 4MADA 3VUOA 1W6OB 1RUJ2 4PJYA 1EAH1 3POGA 4DXRA 1MS5A 4QXKA 1AX1A 2ZCWA 3ZYGA 1JZ2A 1LJ7A 4JTNA 4MH0E 3ZSLA 4FFIA 1O4YA 1KJLA 1ZZ9A 3AKPA 1OLRA 3G7DA 1Q8QA 4MGYE 3KT7A 1UYYA 2D43A 2R073 5SV5A 5J48A 2ORZA 1PGL1 1DGRN 5IT6A 2AENA 5FY4A 1OC1A 2BOIA 5T54A 5F3CA 5F9TA 1D0HA 4RR3C 1KEXA 4O7XA 3TRSB 1Q3EA 3VZOA 4CTEA 1O6UA 2HWD2 2ZGNA 3I2DA 1MPXA 2DCTA 4IE6A 3T1MA 5BNPC 2RJLA 1S0JA 2XKOA 3CIHA 1GLHA 2Y64A 3A23A 2RS52 1RJ7A 3IIAA 3PDQA 1F5FA 1JYTA 3D6EA 1HN1A 5ISLA 3I3BA 1UOGA 3PUHA 3IAPA 4Y5Z0 2DURA 3IMNA 3T0DA 5A7NA 3M4FA 4A3XA 5FP9A 2GMMA 2X10A 1KGYA 4H55A 5FKCA 2A6WA 2QE3A 2QUOA 2E53A 3Q8CA 1QJY3 2QKDA 1EAH2 1S0CA 5CEHA 2R071 1NOVA 1W99A 2VMGA 3HBKA 4Q0SA 3VBHA 3F95A 2GN3A 4X6QB 1UIKA 2IFWA 1ZRFA 4LT5A 1WBFA 4JHTA 1SPPA 2EXIA 1FNYA 2O14A 3HQUA 4UWDA 2J1RA 2VOVA 3B9IA 4UFMA 3BIEA 2GC1A 2N7GA 3ILRA 3WW2A 3K48A 4RHV3 5B2GB 2XONA 3FWEA 3RMYA 4C0HA 1W8OA 3QH6A 4YZ1A 4YFZA 3W58A 1UY4A 4HVOA 1E5HA 1VMFA 1G9DA 3WEZA 1YFYA 2VR4A 3U11A 3H1YA 1SDDB 4A6SA 4PI2A 2XJUA 3KHCA 1VB4A 3PVBB 5JOXA 4J6GA 2QTWB 3SH5A 1NCQA 2VY0A 1QEXA 1EY2A 1MZFA 2A6XA 4FCAA 3CKHA 1CAVB 4UW3A 3WUDA 1GP6A 2DFCA 1KFUL 4IETA 4CEYA 3VBHB 1UD1A 2WYFA 4KQ7A 5DABA 2DWRA 2ZGLA 5EJZB 1JYNA 2R072 1Q8OA 3NAPA 1Q56A 3GYDA 3TN93 4F3JA 1RUE3 3O1MA 1W6QA 4AI9A 1GSLA 1SPPB 2D3RA 2P3YA 4OZXA 2ORXA 2IXHA 2HWF1 1HQLA 5LY1A 2ZGPA 4DINB 3QLQA 4G9SB 4RFT0 3AP6A 2KM2A 2P17A 4HLTA 3ZYPA 3S0MA 1PM7A 1JU3A 1E57A 5FYYA 2J1SA 2XUEA 3I54A 4LOTA 1YNAA 2ZTNA 1UPIA 5A32A 4D6RA 3OGRA 1CWPA 2EVXA 4CCJA 5LA9A 2XVGA 1TNFA 1X36A 3WX5A 4AI3A 4XC9A 5F39A 4AVTA 2L9LA 2QQPA 1NCQB 4GULA 5FZ0A 1QJY2 5HV0A 2A6VA 2NN8A 5LW9A 4BQ4A 3LEMA 3LDRA 1N47A 4K1YA 3TEZA 1RUE1 2OVUA 1HQWA 2QQOA 3I2GA 4AG4A 4G3YC 5IK7A 1OPMA 1LKNA 1YUDA 3NAPB 5IAXA 1OUXA 1V0AA 4KH9A 4NVPA 1NAEA 3KHBA 4GWIA 4RS5B 3H50A 4W4ZA 2R7EB 2FHRA 4K1ZA 3LB9A 3TB0A 4CCMA 4LBQA 2W92A 3A7QA 4XJZA 2WUHA 3K46A 5JSRA 1OOPC 4JX0A 1HJGA 1WCSA 3PU3A 3R4UA 3THDA 5GZGA 1WLCA 4RHV2 4I0WB 2E9QA 3T08A 1F4AA 2RDQA 4NE9A 3ZXKA 3I2KA 4NHXA 2WSVA 4BB3A 2C24A 4GKXA 1OA2A 2GNTA 5FYVA 2IXCA 4W50A 3DPRB 3LEGA 1U12A 4S2GA 2EIGA 4QU2A 4EROA 3QBQA 2YC0A 1POV3 2Y26A 3CMGA 2KR2A 2Y8KA 3GCXA 4PT6A 1SLIA 1XSQA 5C6CA 3CZUA 4MOAA 2WRAA 3FUQA 4YARA 1UY2A 3H8XA 1F5JA 2WQ8A 4QPIC 4QX2A 3WUCA 1XNTA 2Y6LA 1YRZA 5DAVA 4ES9A 2RG4A 3ROUA 3PJQA 5IHRA 2BBAA 3WVJA 1H1IA 1RUH3 2AZ5A 2XQRA 1YQ2A 3TN92 4BHPA 1RUE2 3VL9A 1XXNA 4JTOA 1WMEA 3WQ0A 4LBQB 4B4RA 4ATFA 1JI6A 4D6QA 5A70A 4CCDA 2D3PA 4V2VA 1KITA 1F35A 3NJXA 2D98A 1O5LA 5H9SA 5C8CA 3H8OA 4CDQB 5JPMB 2LRPA 1POV1 5GLTA 2RJ2A 2DUQA 1Q43A 2BEOA 2Q4SA 4Y5SA 2GU9A 4FI9A 3WP5A 1LOFC 4LBKA 1H2MA 3F2ZA 4DXTA 3AMPA 3Q8BA 2R49A 4K7JA 1OURA 3AFGA 4MYEA 4YGEA 5EP9A 2YZ4A 3C7GA 4XQWA 1QJX1 4XAEA 5C8WA 2VMIA 1O7FA 1QNWA 1UXXX 2VUCA 4LHLA 1W9YA 2R6QA 4ITCA 5DZGA 3VD7A 1VBD3 1YI9A 1YJLA 1NCRC 4AGRA 5IW0A 3LDKA 2FCUA 4P9LA 1OLMA 4FPGA 4MGKE 3R4SA 1BYHA 3N7LA 5JSOA 4RR3A 2V4AA 4SLIA 5LA1A 4PHZA 4AR2A 1HV0A 4AHZA 5A7WA 4AWDA 1D0GA 4XMAA 5C3OA 3AFKA 4JDMA 4KG8A 4WVWA 5APAA 3NKTA 1YYNA 3Q9OA 4DY5A 1DGLA 1DYKA 1H9WA 1OBNA 4WM8B 3ZYHA 3MPBA 3PLQA 2XJTA 3OSDA 4Q4W3 1FMD3 2JG9A 2XL9A 2AEZA 1VBE3 1RUG3 1H6XA 1Y4WA 4QX7A 5L9RA 2XBO1 3AYDA 2ET1A 1JN2P 4N8MA 4LUKA 1I3HA 1W0NA 4CU8A 3BU0A 2OPKA 1VBD1 2ZEYA 2IXIA 3CJXA 3FLTA 4Q5OA 2WNUA 3WCRA 3WNMA 2P34A 4FPCA 4YVWC 3VBFC 4L9BA 4QPGC 1ND3A 3D3AA 2J1TA 1ACCA 4AAPA 4BH9A 4R9CA 2IXKA 3WF4A 2QQLA 4CP1A 3H3ZA 4BPZA 4K40A 4GZ9A 1RUH2 2W68A 3K4AA 4RR3B 2V4VA 2VVEA 3BVCA 5FZGA 3HT1A 2Z2SB 1JBCA 1W8HA 5GLWA 1BCXA 5BNPB 2A75A 2WS91 1K45A 1ULEA 3AP4A 3LA2A 1F8VA 5H9RA 1SFYA 4XF1A 1FMD1 4LOSA 4XOGA 4CPBD 1RUG1 1SLBA 1NQDA 3ZMOA 2QDRA 1UXZA 5FQ0A 4RYDA 1IG3A 1KD7A 1S2EA 4ZZ8A 1UMIA 5FY1A 1QIQA 3K2OA 3P6BA 4FT8A 2ZACA 1XQNA 2CGPA 1WA4A 2VW2A 4FO9A 2FDJA 4QKBA 3RYRA 4CPBA 5CKNA 3DGTA 4W8JA 2MHFA 2C0ZA 1WMFA 1ZZ6A 4P14A 4FPEA 3ZN5A 2RM23 5GZCA 1SQ4A 5AFEA 4DY3A 5LRSA 1VBD2 2VUAA 1QDCA 1V70A 1FT9A 4HPKA 3ZSMA 5BV6A 5C71A 4GB33 4LORA 3T1LA 1AX0A 1ND3B 3D82A 3SLIA 4CDXC 4IV1C 1ZA7A 1ENXA 1RUI3 2JE8A 2FQPA 3KQ4B 3KS7A 2W95A 2ZGRA 4H3WA 4GMP1 3K4DA 4Q26A 2VZVA 4ZONA 4E2SA 3VZNA 4OHXA 3CJIA 2ERFA 5FZ4A 3E97A 5LK5A 3ST7A 2C26A 5LCWL 3GHMA 5D1IA 4OYUA 4Q4W2 2FDFA 1FMD2 4HMZA 3PURA 5JI9A 1VBE2 1HB2A 1RUG2 2AYHA 5FQ0B 3HQRA 1A78A 4QDSA 4NHYA 2WFF3 2JE9A 4R4XA 5FZBA 2RM21 4FXKB 4ASMB 1W0PA 4JV4A 4XMIA 4ZKTB 1XPWA 5J96B 4AFCA 3LEIA 4Y4RA 5JOWA 2WZR1 2VC9A 3QOPA 3T0BA 1RITA 2LW8A 2YV8A 4GB31 1OA3A 2JD4A 3PMEA 4ONUA 5FYUA 4BLJA 1REEA 5L36A 2W1WA 2ZEWA 1GZWA 1LOCA 1V00A 2YPJA 2ZKLA 2Y0IA 1UZWA 3J7MA 4HPKB 5CFDC 4LO4B 4QHBA 2UWAA 4XFCA 2R1DA 4Y22B 1BKZA 2PHWA 1W3XA 3ZVXA 4P9XA 3V0BA 5I0UA 1RIRA 1J1LA 2YU2A 1WW6A 1ZBA1 1QJU3 3AMQA 2QQKA 3SCFA 3A0NA 1SBFA 1BBT1 1H4GA 5GLZA 5IVJA 1PK6C 1WWYA 4XJ8A 4C1XA 1S0FA 4LK6A 2DFBA 3DCQA 4J1WA 2Y6JA 4OMCA 5F8PA 3VZLA 2B9UA 1O3TA 3EMRA 3USSA 3VDDC 1H8TA 3C8XA 4EN7B 1OVSA 3JU9A 4QX3A 5HI0A 1WLTA 1AXKA 4YRDA 2RM22 1SDWA 5K4LA 3X29B 3I8TA 2XQXA 3P1IA 3NKGA 5D21A 1LHUA 3VKFC 5A1LA 4LHSA 1R083 4NRMA 1YFWA 4RQPC 4GB32 2Z42A 3JXSA 4AEDC 1GZWB 3TNQA 4HANA 3EB7A 1LOEA 5IK8A 4AFDA 2ZJCA 1RUI2 3N9NA 2QZ2A 4IEWA 3SITA 2ZAAA 1CVNA 1V9U3 4X8NA 1CZTA 2VMCA 4Q29A 3MEPA 3KVAA 3VB9A 1DFQA 1YQ5A 3KB5A 3I59A 1QJU1 3UL2A 4X6RB 4OCTA 2BERA 3RWKX 3WW4A 4GALA 2JKBA 3FFZA 1IPSA 1FV2A 5FZMA 3WF3A 1LNSA 2A73B 4MHUA 1Q8SA 5T50A 4NHKA 1ZREA 1NY71 5EYYA 3VLBB 4MZUA 1SMVA 4H7LA 5FK7A 1PX3A 2A71A 2I07B 2WFF2 1ST8A 3M1HA 4WV8A 4D69A 2R041 4XZPA 5HCBA 3OB8A 4QPIB 1S0GA 4FTSA 3OCPA 2B46X 2GNDA 1DQ2A 4N7UA 3NNMA 1R081 1C1FA 1C8M3 1VALA 2QQJA 3NV3A 4MO3M 1RUF3 1XRUA 1VBB3 2G9GA 2WLPA 2ZHMA 3ECQA 3OBZA 4JCKA 4CCOA 2ETEA 4R8HA 4COZA 4CZSA 3NV2A 1H2KA 2YPDA 5EPAA 4QQ2A 4LHNA 1OFSA 3OEBA 1V9U1 4GKYA 2EF6A 3B93A 5HCFA 2W46A 5LRRA 1JOPA 2E26A 5JXJA 4HONA 4EN8B 3ZFGA 3PUIA 4D7YA 5AC93 1JOJA 3I59B 1AJKA 2BBVA 4CP9A 1GQHA 5BNQA 2EXHA 1QJU2 2ZMKA 4URAA 4COVA 1MZEA 3I3QA 4HXCA 4Q27A 5IFPA 5ACA1 2VMEA 3NNFA 1SLLA 2AUYA 5FZEA 5C9AA 2VOXA 3H8UA 3SEEA 2HEYF 3ZXAC 1X8EA 3CDZB 1XNCA 2FCVA 3WLUA 4FPYA 1K5MC 3ACFA 1OQ1A 2ARBA 3BIWE 4IGPA 2XJQA 1BEV3 5FZ6A 2P37A 4I3PA 3S5QA 4N53A 2MEV1 1C8M1 1WLWA 1NCRB 2D6OX 5FY9A 1MACA 4CCKA 3IPVA 5FV3A 5KXDA 1UYPA 2WT1A 4K8FA 1R082 2YYOA 1TMF3 2WJSA 4OHYA 3FHIB 4J25A 5CNAA 5FOJB 2VG9A 5BNOC 5ANQA 1BK0A 2ID4A 4CCCA 2WFPA 1WGPA 5DAPA 2Y34A 2VXRA 2VZUA 4HZFA 3RSJA 3VBUC 3OOXA 1DQ4A 1V9U2 3VZKA 4CUGA 1UWWA 1BXHA 2PAMA 4GWMA 5HXVA 1FOD3 4DMIA 3MO4A 4O9EA 1ULFA 1CAXA 4URTA 4CP9B 5FZIA 1P8JA 1YCIA 2HBUA 1RTVA 4E2GA 3POJA 3DF0A 4ZU7A 4YGDA 5DMYA 1TVGA 3ZDSA 3E6BA 4Z2WA 1IS5A 3BALA 4FP3A 5IK5A 1BEV1 1PO23 2ZA9A 4JQRA 3OTFA 3NRUA 3POBA 4M3CE 2G9FA 2GH2A 3C7EA 4UFIA 3WP3A 1DQ5A 1NE4A 2I45A 2Z4FA 4YVWB 4CDUC 2E63A 1KRIA 2ADEA 3FN9A 2OA2A 2JG8A 4QPGB 4QX8A 1LU1A 1JUIA 1C8M2 2WZ8A 1TMF1 4JKLA 3THPA 1RUF2 4IV1A 1VBB2 1AF9A 5C4WC 3I2OA 1NLRA 3FHAA 2NZ9A 4Y4YA 5FK8A 1W6NA 2WNVC 2WBKA 5FAXA 2VZQA 2VZTA 3LSEA 3O0WA 5IAVA 2G9ZA 4A3ZA 5JZGA 4XILA 4RFRB 1LHVA 4QHZA 3N7KA 1PNGA 5BPXA 2WL1A 1FOD1 3VDAA 1QOSA 2X5IA 3GBGA 3J7LA 3KMHA 5AC92 2E33A 2OW4A 4FPHA 4OMDA 4M01A 4UT5A 2PELA 5CKQA 1DYPA 2OQ7A 1O3SA 4KL1A 2FDKA 1UU5A 2XDVA 4HBNA 4N9HA 3AXEA 2VXJA 3W9AA 4CP2A 1QJEA 4OVEA 3WCSA 4DIQA 2W87A 2GC3A 3B01A 4XDQA 1MVQA 3M3QA 5A6YA 3LOIA 4LO8A 1G9AA 5F3IA 5JMCA 1WCQA 3WDYA 4F8AA 1BEV2 1QF3A 2ZHLA 3T09A 4AQ2A 2E7TA 1IPJA 1MS0A 2VTXA 3KM5A 3R4DB 1DF0A 1YLLA 3RZJA 1W2AX 2JG8B 3WF2A 2FMYA 2PTMA 2B42B 3AYAA 1RGSA 1R093 1VBC3 3CZJA 3PMSA 4Q1RA 4TN7A 1B35C 3AC0A 2ZOEB 1HQNA 1ZVFA 1MZ6A 4FVVA 4IV1B 4MGIE 4QM8A 5A7PA 1TMF2 3OF1A 1EP0A 1W8WA 4W65A 1SEFA 3S5AA 1H8VA 2HWC3 4BCUA 2B9VA 3C2UA 4E4DX 1A8DA 3MF9A 1O4ZA 2XLAA 1ZA4A 2XOMA 1F9KA 5GLUA 4DZGA 3LCPA 4YM3A 1GNYA 1FOD2 4PLOA 2Y6FA 2PHFA 3ZPYA 3M2MA 4JZRA 3BU7A 3POYA 3T3YA 3D0JA 1GZTA 3ILNA 5JI7A 5LZ6A 2OS2A 4IEOA 4Q4Y3 5BYNA 5IUQA 3VDDA 3AB0A 2XWJB 3M3EA 4K6BA 1LGCA 1IQAA 1J3QA 1S55A 1PO22 2WO3A 3KV4A 4CSWA 5T5LA 5F37A 1G6NA 1XSRA 3OGGA 4Y3OA 1OQEA 4QGMA 5FTTC 2ZGKA 3M3CA 4QXBA 4YW7A 2CGOA 1R091 1VBC1 2UWBA 4RQPA 2LM3A 4MGZE 5CU1A 5GZFA 5K0UA 5FLHA 3SKVA 3UV9A 4AEDA 4LQRA 5CFDB 3O0VA 4NAMA 1W6OA 1C1LA 1W6PB 2HWC1 2OZJA 1PMJX 4AVBA 4CUBA 4NUBA 5JXHA 3AKRA 2WZPP 4Q0VA 5JAXA 1G9FA 3LDBA 2PHTA 3P3PA 3JB4C 5FZ3A 3RZKA 4N9IA 1GU3A 5FXXA 1EAH3 1E5IA 4GD4A 1C3HA 2DCZA 2O1QA 1VBA3 1GP4A 5KR7A 5JUVA 1OFNA 2VMFA 3ZXGA 3ACGA 3WF0A 1PK6B 4Q4Y1 2W2IA 1AJOA 4AFBA 1UX7A 2I2SA 3P5BA 5L7OC 1AUYA 4QWNA 5JDBA 3EXUA 4P9IA 3VDDB 2FDHA 3D5OA 4PQQA 4JDOA 4XQ4A 3MW4A 5FP3A 1NUKA 2CNAA 4RSUA 4XHBA 3WQBA 4YZ4A 4BXFA 1MR5A 4XUTA 4PF1A 2VH9A 4Y24A 4CDWA 2R32A 1Y3TA 4RQPB 1PGW1 3NMBA 1QDOA 4YW3A 4AEDB 4CE8A 1R092 1VBC2 4LNVA 2B5HA 5FY8A 1QH7A 1YC61 3CNAA 2VZSA 4AI0A 3EJKA 4KMQA 3T4VA 1H6YA 3OUHA 4B3NA 2HWC2 3VBSA 3JD73 1VBA1 5KXCA 5KC5A 4F7ZA 5A6XA 1DBNA 5F2SA 3BPZA 1WW7A 4Z1VA 4C8DA 4EWDA 2VW1A 2YB7A 4B8EA 4IQPA 2Q8DA 4IUGA 4ZS3A 2NMNA 4HT1T 1CX4A 1GANA 3UK9A 4BIFA 1ODMA 4B4PA 3K4ZA 4Q4Y2 2ZX1A 5FP7A 4ASLA 1BZWA 1H1AA 1TG7A 5EFUA 4E4ZA 1MS9A 1POV0 2HEVF 4QB6A 3AL6A 4EZ4A 5GALA 4IEZA 2VCMA 1RMU3 2YROA 5C3SA 3O1TA 3HOBA 1NA1C 4YM0A 4KGGA 1WCUA 2WKKA 1BVVA 1ASJ3 4GWNA 1UOBA 5LB6A 4CDWB 5D2AA 5I0SA 5BNOA 3ZIXA 5FUPA 1PGW2 3OPZA 2QQVA 2W52A 4FPOB 2ZHKA 2VCCA 3AXDA 3JD71 3OY8A 4LE3A 4XFFA 4U36A 4XJAA 4BLIA 3EO6A 1H30A 3H3UA 1CAVA 5J3UA 4WM7C 4A42A 5K7PA 3VBSB 3AZWA 4XFAA 4IE7A 1J84A 3U0ZA 1VBA2 1ZRRA 2BV4A 3PHMA 4LTAA 1CJPA 3RNSA 3PTRB 3MZHA 1OXCA 5BUVA 2OQ6A 2PAEA 3K51A 3QCWA 1YI7A 3B9CA 1AZDA 2DCJA 4OZOA 4OHZA 2K0GA 3OGSA 3U4XA 4OUSA 1K5MB 4QPWA 2DVAA 3IDEA 1PGL2 3H3LA 3KVBA 4GQ7A 5JVVA 2BJSA 4XF0A 3PU8A 2CDPA 1TME1 1RMU1 3EBRA 3OPWA 3SHRA 2W3JA 4A7ZA 1BLZA 1UL9A 2HWF3 3INAA 4DQAA 4LLOA 5HXMA 1ASJ1 4XF4A 1KS5A 3VD4A 2A3WA 4LHKA 3RYKA 2I74A 1DIWA 2RDNA 3PUQA 4XZUG 3N9OA 1DLLA 2WWUA 5LWBA 2CSGA 1MS8A 1JHNA 4OQ9A 3SXWA 5BNOB 2GZWA 1UNBA 1W9FA 2F17A 2F4LA 1Y9QA 1QQP3 5FJHA 5A3LA 3AYCA 1ZZ8A 3OY8B 5EJ1B 1IGOA 3H1MA 4YSFA 3CEWA 3JD72 3WF1A 1D4M1 3KLSA 4IEYA 1AL21 2ZZJA 4HKWA 2R16A 2HLEA 5LY2A 3V64A 1NXMA 3VKMA 4RS5A 4QKNA 2W1UA 4DRRA 4QGNA 3DYMA 4CDUB 5DQ0A 1DU3D 2GC2A 4N43C 3U14A 5I0DA 2VOKA 4Y1ZA 1RMU2 1R1ZA 2BTVC 1K42A 4Q8KA 3SQOA 1ASJ2 3U10A 1XNAA 2WZEA 3DPRA 5IATA 3GJAA 2H0BA 2NLRA 2QQMA 4EN6B 1FX5A 2ILMA 1QQP1 2Y0OA 4AEKA 4LMFA 2GNMA 4AYUA 4B1LA 3BI3A 2IXJA 3Q8AA 4P9WA 4I09A 4IEPA 3I3MA 4Y1VA 1PHMA 3AMNA 3VKNA 4IW3A 4JQTA 5JR7B 3AP7A 5CBLA 1A34A 4LBQD 2GC0A 3S57A 2YBKA 1SLCA 2JECA 1ZBE3 2W39A 1CAWA 1YQ6A 3PVNA 2VU9A 4KWKA 4COWA 1YFXA 2XVLA 1UOJA 4ZXEA 1O59A 4XFGA 5J09A 1CGPA 3DECA 2Q0AA 2JDUA 4P9YA 3IN9A 4Y5TA 2IUWA 2VQTA 2Y6HA 1APNA 1MS4A 3RWNA 4NR1A 5FBJA 2HWF2 2ZEXA 4E27A 5ABJC 3DKQA 1LRHA 2P6HA 2A7AA 4JDNA 2RR11 3L2YA 1B35B 3N9PA 4LK7A 4CDQA 1EV11 4RN5A 1PO13 5FYHA 4AHWA 1UIJA 1DCSA 2DV9A 3LEKA 3T2OA 2XHNA 2ZGTA 1NXD1 5H9QA 1LOGA 1PX4A 4YW6A 3HBZA 4FOWA 1QQP2 5JIUA 1NKGA 3JBG3 5F3EA 1H1MA 2OKXA 5CISA 2ZGMA 2PHRA 2WLQA 2E6VA 4BIOA 1C8NA 1ND2C 2XJRA 3FFQA 1C4RA 1QJX3 2OXBA 1ZBE1 4PIYA 4UFJA 4XJ9A 1X9PA 2D44A 3NNLA 5F7UA 2E51A 3B94A 5LK7B 2OPWA 3PJYA 1CAWB 4Y26A 1XNDA 3IT8A 3D0SA 1AYM1 1YWKA 4NIHA 3DYPA 1GV9A 1WCDJ 1GNHA 3UJQA 1RVF1 1GWMA 1KXGA 3RFRA 3QD6A 1HRI1 4HK9A 1V6IA 3VHPA 1BK1A 3N9QA 2VULA 4WM8A 4AK3A 3OUJA 1PO11 1W6MA 1EUUA 2JXAA 3LPFA 3QACA 1IOAA 2A70A 3VD9A 3A0KA 5IVFA 1W8ZA 5FWJA 1OH3A 3MIDA 1G86A 2JENA 1F31A 4HOOA 2VNVA 3B00A 3JBG1 4BYYA 1KFXL 4IE5A 4LO6B 2XBO3
chains in the Genus database with same CATH topology
2B7YA 2XLGA 4XPVA 4AEJA 1UU6A 4H14A 1VP6A 3ETQA 4KGQA 3VBOC 1AR63 4WZFA 1VAMA 2CL2A 3H0OA 4L99A 2C9AA 1T6GC 4Z92B 4YVSC 1ZBE2 4TSVA 1LOBA 1BVP1 2DCYA 3M3OA 2D6LX 2XUMA 2FZ2A 5CA6A 2RJKA 5BNPA 3G6JB 2Z5WA 3KQRA 5GZEA 1NA1A 5IK4A 3J26N 2EXKA 2WS93 1W6MB 3VKLA 3GZTB 5I8TA 1KJRA 1PO12 4OI2A 1HIXA 4KWLA 4MX3A 5BNNC 1BQPA 5HCAA 3IDBB 4FPKA 4WVVA 5T5JA 2RS11 4Y1YA 4TZDA 1AR61 3JBG2 4Y1XA 4XFHA 3WDUA 1ZX5A 4XFBA 3S7EA 4K21A 1QJX2 3ASIA 3B5LB 1MVEA 4YFWA 3N35A 3HD8B 2VPVA 5KHJA 5FO8B 1FATA 5JOZA 2BFUL 2IXLA 2GSYA 1YIFA 1OA4A 4ZU4A 4FOVA 4Q0PA 3HAGA 3WG1A 4GMP3 1NA1B 1DGRA 1SLAA 4IL7A 1UAIA 3WHUA 5K8SA 1ZZBA 2LALA 3J4UH 5CADA 5CB7A 4M0HA 2GAUA 3VHNA 1V6LA 3WP4A 1LULA 4META 4EJRA 3KCYA 2PLV1 1PVC3 4L97A 1LEDA 1G8WA 2OUJA 4IERA 3ZFEC 5D8AC 4WM7B 4OI4A 2XBO2 3N36A 1ULCA 1PMIA 4FTBA 2DVDA 3KSCA 4ZXKA 1AR62 2WZR3 4I30A 4CYDA 3ACLA 1LHWA 4DS0A 4B4QA 3LOBA 1AX2A 1CPMA 1XYNA 4AVSA 3ENRA 3JUUA 3AK0A 5E89A 1LHNA 1HV1A 2WA4A 4Y22A 1Z78A 4N43A 4Q8LA 2W0XA 1ZYBA 5J37A 2WS92 4AHXA 3PNAA 4CEWC 3WY6A 1CR7A 4KG0A 1ZBA3 1DZQA 1PVC1 3ZSEA 1PZ7A 3GZAA 1WBLA 2B8MA 1BBT3 3MIGA 4DXZA 4JGZC 4B7KA 4KWJA 1W0OA 1I5ZA 4LO5B 3RMXA 3B7MA 4K20A 2ZABA 4WVZA 3AKQA 2DYCA 5EJ3A 4YM1A 2ZMLA 3E5XA 4N90A 1UMZA 1LEMA 1H2LA 1OOPA 2IFRA 4L8QA 3OYWA 4GH4C 4XXAA 4JRLA 2PHXA 4N43B 1GR3A 2NM1A 1LU2A 1GQGA 3RYPA 3ZXLA 1O91A 5FRAA 5KBFA 1WMDA 3E6CC 2GNBA 4D7TA 2DUPA 3FZ3A 4YZ2A 2YGMA 5J98B 1PVC2 4YW2A 4KNCA 2B45X 1ND2A 4QPIA 3AX4A 4XW3A 2FMDA 1AHSA 2A3YA 4QMAA 2VNGA 1IS4A 3KGLA 2R043 3FX3A 1AXZA 3S30A 1JTZX 4HETA 2F4PA 2WZR2 1FAYA 3VGIA 1WCKA 3H7YA 4LR4A 4OUMA 1OOPB 2DU0A 4BM8A 1OKQA 1V6KA 2NPIA 2ZHNA 3OYWB 4NWVA 4Q4X3 2ZMNA 2DTYA 4QQPA 3ZIWA 5ABJB 4O9GA 1YJKA 2XKPA 3LWCA 1HKDA 5FPZA 4AQTA 1N3QA 2AH2A 3RJRA 3KT4A 3ZN6B 4XF9A 1RB8G 3R0RA 1EPZA 3MI8A 1LOFA 1ZBA2 4KU8A 4HKLA 4EWAA 3R6SA 5ACA3 4CP0A 1BBT2 4AFAA 5DZEA 3ME2A 3TYJA 4YGCA 5FO9B 1ND2B 1NCRA 3AZYA 1GNZA 4AW7A 2Z69A 4ZU5A 3JB8A 4YVSA 2MEV3 1AR71 4OI0A 4Y1UA 3PVOA 1QXJA 4TYSA 4MUVA 3VBRC 4AGVA 4Q4X1 2HEWF 3DN7A 1DHKB 1KS4A 3J9SA 3MIFA 1I1EA 1Q5OA 4DNYA 1Q8PA 3UKVA 2NYYA 2ZBJA 1X50A 2CY6A 2R1BA 2E7QA 4PIZA 3J8F1 1A3KA 4DPNA 2BNOA 2OZ6A 2B39A 2FBEA 3RJ2X 4IV3C 1LTEA 1Z7S1 2Q1MA 1ZRDA 2VVDA 4HKOA 1NY72 3WINE 3VBFA 1Y7BA 4YVWA 3AMMA 1C28A 1PGSA 2CWSA 4QPGA 4K9SA 1PVXA 2A5ZA 2R042 1G7YA 5AFBA 3WW1A 4YG3A 4YW5A 4YVSB 2EALA 2A6YA 4WBBA 1AXYA 4PF5A 2QVSB 4YLZA 3GBFA 1RINA 1RUNA 1XU2A 1S2KA 1MEC1 3BTAA 4Q4X2 1SACA 4A7YA 1CONA 1O5UA 3FBYA 4R52A 1EYBA 2HWE3 1AYN1 5JIAA 4EWEA 5BNNB 4RGGA 3WDVA 4K3UA 1AL0G 3M8LA 4PBPA 4WZCA 3FBMA 5FCCA 3WV6A 5ACA2 4QD2A 1ZNPA 4RGAA 2VUJA 3KT1A 4NN0A 2R063 5L19A 1N1SA 3VBFB 4QPYA 1YXWA 3O5SA 3GF6A 3VN4A 4IEVA 2OYZA 2MEV2 1AR91 4P9JA 4CDXA 1J3RA 2VVFA 4OFGA 1RUD1 4S2DA 5T55A 2IZWA 1KDKA 1JYCA 4FQZA 2P3JA 3ZSKA 2HWE1 4HVRA 4PBOA 1UZYA 1WW4A 3KZ4C 1ALYA 4AHYA 1U5ZA 2BVVA 3WG4A 3MLKA 4PIXA 2IWGB 2F6BA 2TUNA 5D8AB 5LEKA 5FMOL 3RG0A 1R1A1 2R061 1VIWB 1D2SA 1M4WA 4NHLA 2VMHA 1BMV1 5L73A 3BCWA 4HN1A 1X7NA 4LA2A 1ULDA 5DDJ3 2VQ0A 5CFDA 5JCTA 1NCQC 1TEIA 1WW5A 4PLMA 3RI9A 4AEMA 3L2HA 1W6PA 4GA9A 1QKQA 4GH4A 4NWWA 4XFIA 1NLSA 3ZSJA 2AR6A 5DZFA 1VAKA 4CEYC 4LA3A 2LTNA 4UW4A 4U2AA 4LBNA 3NVCA 3NAPC 3WR0A 2H0VA 4FP2A 3OD0A 1RJ8A 1IKQA 4OLLA 4WVMA 4CEWB 3ILFA 4XBNA 1PK6A 2R0FA 2HWE2 4LO7A 2PAKA 3PTYA 2P3KA 4JGZB 3PVEA 3RI8A 1QXPA 2ZAHA 5CFCC 4QM9A 3USUA 5JSPA 4UXAA 2XJPA 4D3WA 5E8AA 4FAHA 3OD4A 4XYXA 5DDJ1 5KWRA 2R062 5KXBA 1LODA 1IPKA 3MDPA 2KA3A 4PLNA 1WUVA 1NZCA 2VW0A 5AVPA 3HWJA 3DUIA 3JQWA 2LUWA 1FXZA 5F5QA 5A33B 3N4MA 1QGLA 3BOPA 4NOTA 4GH4B 4XEZA 4E4SA 3LGRA 4XJWA 4UBGA 5GLVA 4XBQA 4WVMB 1J58A 1XYOA 4D94A 2BFUS 4YYOA 2BNMA 3LZZA 3POWA 3ZFFC 3B69A 4OHVA 3MPPG 1H4HA 2XHKA 3WDWA 2RS33 3N7MA 4LBJA 3USUB 2WT0A 4P5HA 2XG3A 3AZXA 2C5DA 3NSTA 3JQXA 4HSLA 3IDCB 5EZWA 2ARXA 3O0XA 4FPJA 5DDJ2 1RUC3 2W08A 4LULA 3CLPA 2UURA 3THTA 3IM0A 3WG2A 1RC6A 1CJDA 3AP9A 2JICA 2XPJA 2BUKA 3NJZA 5FFOC 2NMOA 1S1AA 1VB2A 4BOWA 4MXWA 2RS51 2XVKA 1G9CA 1MS1A 3IKWA 4PDWC 3R05A 1LECA 4D7SA 2ZX0A 2RS31 2X53S 1K5MA 5E1RA 1UF2C 1LCLA 2WT2A 5I0TA 4HN0A 4Q2FA 5C8CC 1UW8A 1FPN3 1B09A 2H6BA 1RUC1 1TME3 3B02A 3VV1A 1MS3A 2PA7A 1UPSA 2WC2A 2RHPA 1ULGA 4CRQA 2D97A 2BGCA 5T3NA 4BA6A 5E88A 3VBRB 3OJBA 1S2BA 3MLJA 3VBUA 1SCSA 5CG8A 4W6WA 4YZ5A 4F83A 1COV3 2JDZA 3AM2A 5T5PA 3UJOA 2XGXA 3ZXJA 4XXPA 1G9DA 3JCIA 1VR3A 2DVFA 1FNZA 3V65A 3WW3A 4XETA 2ZKNA 1D4M3 4MXWB 4XHXA 2R30A 2BWAA 1AL23 4IV3B 1SBEA 3MIHA 5FLIA 1MQTC 2VNRA 1FPN1 3DV8A 4CDUA 1AR83 1OD5A 2RS32 2VNOA 2CTVA 3BODA 2JG9C 1D2QA 1OPOA 3C3VA 2BNNA 2NQYA 5C4WA 3LAGA 1A8MA 3ZMNA 2NP0A 2WNVA 1RUC2 1ENSA 4AGGA 4NO4A 1DG6A 4AQ6A 2WNUC 5FO7B 1COV1 3VBUB 4EN9B 3WDXA 1MZ5A 1ND3C 1C5HA 2HWB3 3FE5A 1J1TA 4Z07A 1OMIA 1ONAA 2H6CA 2UY8A 4IXLA 4LE4A 4QQOA 3VL8A 4I01A 1LB2A 1OQDA 1DGWX 3O12A 2OIIA 3LA7A 4AQSA 2PFWA 4LUMA 2TNFA 1AR81 3ELNA 4FXGB 4FAGA 2ZGSA 1GFF2 4UBHA 3GNEA 2DF7A 2ET7A 3KCCA 2DUOA 3LSDA 3S7IA 1FPN2 1QJY1 2P2KA 5FDBA 2ZGOA 5CIRA 2ATFA 1TME2 1B35A 4DRVA 2XLFA 5C4WB 2RMU3 4BMBA 2WNVB 2RR13 1W2UA 2DU1A 5JPNB 1EV13 3MIEA 4N7IA 3GALA 4M3CA 2HWB1 1HW5A 1VJ2A 5JLVA 4YZ3A 1COV2 5F6LB 2P3IA 2ZX2A 1VLNA 1QOOA 1XNBA 4COYA 1IZ3A 1LR5A 1XE7A 4RHV1 1DZRA 4GMP0 1IHMA 4RA0A 1D4M2 5CFCA 1VAVA 2D6NA 5KC6A 1AL22 1LHOA 4FBFA 3CJIC 5A3MA 4AF9A 1AYM3 4ATEA 5LEJA 1AR82 4FQ4A 4JC1A 3NV1A 2Z79A 3APBA 1RVF3 2RMU1 1VRH3 2XB6C 3RZZA 1HRI3 4LBOA 1JH5A 1PNFA 4CEYB 3TN91 1WD4A 1G9BA 4AI1A 3CO2A 4M3CB 1S0BA 4UW6A 2AGSA 1XNKA 2HWB2 3LA3A 4AXOA 3DL3A 1U5IA 1W6QB 3OBRA 2V73A 3JZVA 3VHOA 2YXSA 5I8YA 2EAAA 3VZJA 1IS3A 3ZFFA 4P9GA 5L7OA 4YW1A 2JEMA 5CFCB 3WXPA 3MYXA 3SCHA 1ENRA 3AZZA 1OI6A 4XF3A 1TQ5A 5A32B 4UW5A 5CVRA 1ZM1A 5DUVA 4C1WA 2JE7A 1S0EA 2BW8A 1VRH1 2PQQA 4QX5A 2ZX4A 3AP5A 4PCRA 2ZX3A 2DVBA 4YG0A 2QJVA 1SLTA 4Z82A 1DDLA 2RMU2 1H8TC 3O7OA 1GZCA 3MIBA 4C90A 4C91A 2RR12 3AJYA 4GXLA 4J1XA 1YFUA 1EV12 5DXDA 5EV7A 2D6KA 2Q5TA 4Q4V3 1FV3A 4XJUA 1S0DA 2RS13 3WHTA 3OGJA 4ORFA 2BQPA 4L2NA 3NO8A 2EAKA 1Q8VA 4PDWA 4R9BA 3FMGA 1I9RA 2CAUA 2A6ZA 1JUHA 3I4IA 4R9AA 2PHDA 3ZFFB 5L7OB 3QH7A 3DKWA 1AYM2 4YW4A 3OBTA 1S0IA 1NE6A 4JGYC 2GMEA 1LGNA 5EXOA 3N3HA 1RVF2 1UCXA 1VRH2 3AMHA 4W6YA 4Z8BA 1HRI2 1X82A 3AKTA 4G4FA 1XYPA 4BZ4A 5FMOS 1QHDA 1RUH1 3AZVA 4Q4V1 4Q0UA 1QMJA 1CESA 2C1FA 4WM7A 4HFSA 2PLV3 4OI1A 3VZMA 3IBMA 3A4UA 3RPQA 2SLIA 5EYXA 4XTMA 4PDWB 5BXXA 3HMYA 5BY5A 2HKXA 1MQTA 3LKJA 4FSJA 3ZFGC 3UKNA 3N7JA 5C8CB 1NQJA 4AE2A 2WQZC 3KGZA 3KCXA 5FPXA 4I0BA 5C9AC 2JJ6A 5HBAA 4MV2A 4XBLA 4IEQA 2K2SA 4N53C 1YHFA 3WD5A 3WDTA 3AKSA 1REDA 4Q4V2 5DG1A 1U5YA 2RS12 3MW2A 3RQ0A 1F2NA 5EWSA 4R4ZA 1SFNA 4MVTA 2YGLA 2VECA 4Q4W1 4B29A 2YDEA 1VBE1 2UY9A 4PQ9A 1ZZ7A 1GBGA 4YGBA 1MQTB 4X8PA 4S2HA 2ZGQA 3AJZA 2JG9B 4JVAA 1H9PA 2O8OA 2EA7A 1DQ0A 4YM2A 4B7EA 5GZDA 5GM0A 1OHFA 2GH8A 2HJIA 2XJSA 4BWOA 2D6MA 3E6DA 3TWIA 4XE9A 5E16A 4I02A 1JYIA 3MFAA 1U5XA 2WNUB 4DFSA 4FPFA 3FC0A 2YY1A 2JG8C 1UX6A 3ZXFA 2ES3A 3RDIA 4HK8A 2PLV2 1N3PA 3MF6A 3URFA 4Y20A 1QH6A 1H2NA 4Q1PA 5JZGC 4JAAA 1V6OA 1C57A 4OHWA 3SH4A 3D4KA 3M7AA 5KXEA 2X5IC 2SBAA 2QCSB 1ZRCA 3ES4A 2D40A 5ABJA 3HT2A 5I0RA 1SCRA 4EV0A 5T52A 3NW4A 4BQ1A 3ZN6A 2VQAA 1M06G 4I0AA 4COUA 2QNKA 1QU0A 1SBDA 1GKBA 5FBZA 2CAVA 1N1VA 4HVQA 4LEJA 2K9ZA 5K9YA 1RUI1 3L9JT 3NV4A 3ZN4A 4I2OA 1CIWA 1QWRA 5I93A 3TOJA 4M00A 4Y20B 1IS6A 2X8KA 4XIOA 4HSJA 2GN7A 1WD3A 3NWKA 5CG9A 1DQ1A 3CJIB 3ZYJB 1AR73 2CYFA 5JOYA 5FREA 3ZO0B 1CN1A 2IC1A 4SBVA 1Z0HA 2WFF1 4EN0A 3W59A 1UN1A 2D3SA 4L92A 1LENA 1QY4A 3ZXDA 1FYUA 1RHI3 4YNIA 2QFEA 4AI8A 4Q0QA 3RRDA 3GZUC 2YMZA 2WA3A 2UYBA 3UKTA 3J8F3 3IWZA 2JX9A 2PHUA 4FOQA 2GDFA 5K0UC 4A7KA 3I7DA 4M3CF 3VBOA 5KHKA 1PIV3 1Z7S3 3ZYRA 4QT6A 3MLLA 1J3PA 4KBBA 2VOWA 1NYWA 5AVAA 3V0BB 1I6XA 3TBDA 2Q1ZB 4NHMA 1O3QA 2ZPXA 4BMEA 3RS6A 5TSWA 2WQ4A 3WZ1A 4XIKA 1TNRA 3MGUA 2Q30A 3CF6E 2G4IA 4JGYA 1O3RA 3POSA 2BYVE 2WIIB 1W39A 1RHI1 2D93A 5F6KA 1OSGA 1MEC3 4IEUA 3CU7A 2V09A 3GBWA 3WNXA 2UYAA 1H8TB 3M3IA 5BNNA 4QQLA 3WP6A 1NG0A 1CAUA 2TEPA 2DCKA 1AYN3 3TNPB 3ZYIB 4CDWC 1PIV1 1H0BA 1QJZA 3SISA 3SMHA 3O14A 1V6MA 3VBOB 3AYEA 5J7MA 1U0AA 2WINB 3VBSC 1HXS3 4H7MA 1AR72 3WG3A 1AR93 1O4TA 4MSVA 4NPRA 4QGLA 5DUWA 4MXVA 4C0BA 2BPA2 1D4VB 1RUD3 1N1TA 1YO8A 2WNEA 1N3OA 2GALA 2OUHA 4HL0A 4JGYB 1IKPA 1X8MA 2BVBA 4ISRA 1BJQA 1UKRA 3H1WA 2O8QA 2FZ1A 4FPLA 1RHI2 4RL7A 2PYTA 1RUF1 3BOWA 1HDKA 1VBB1 1UZZA 2ZGUA 3FUOA 3HR9A 3ZFEA 3ZXEA 2DVGA 2TBVA 3EHKA 3J8F2 1CAUB 1XU1A 2PHLA 5D8AA 5F1RA 2WSUA 1PZ9A 3P3NA 1JW6A 3HQXA 2ZS6B 3V56A 1R1A3 3WOGA 2YHJA 1PIV2 1Z7S2 2QZ3A 4W6XA 1UU4A 4LBLA 5AC91 5FLJA 1OLQA 1HXS1 2DTWA 4YG6A 3ATGA 5GJ6A 1Y43B 4AFMA 3VKOA 3ZFGB 2CGNA 2V5YA 4LLFA 3VBHC 1KDMA 2D5HA 3ES1A 4I3GA 4S2FA 1LESA 1EPWA 2XWBB 1L3JA 2A3XA 4IEXA 5C9AB 3D8CA 4TLFA 1MEC2 3FJSA 4CEWA 4KU7A 4N53B 2AREA 4JGZA 1J59A 1X33A 3IPVB 4XQDA 3FLPA 1AYN2 3ZFEB 1GYKA 2MPFA 5CAZA 4DOUA 3KD4A 1PZ8A 4L11A 5KHIA 1N1YA 1HX6A 4FTEA 4ISQA 2BWCA 3ALQA 3V0AA 3WT3A 3SNMA 4E9KA 2VGDA 2YUEA 5GKAC 1QOTA 3HN1A 5A33A 3ZX7A 1HXS2 4IESA 1QXRA 1CAXB 2HYKA 1AR92 1URXA 2RE9A 3H9AA 1YIPA 1PO21 1RUD2 3NL1A 1A6CA 2D7FA 2CWMA 2KXLA 2UWCA 1RL3A 1HRV3 4RS5C 5SV8A 2GMPA 2Q8OA 2D6PA 1CQ9A 1KQRA 2XL7A 1CPNA 4DB5A 1LGBA 1XE8A 2XH6A 3B3QE 2UU8A 5I8SA 3TAYA 3E5UA 3WQ7A 3E5QA 4A2UA 1RUJ3 1W6NB 1FI2A 3DPRC 5FOBB 4INDA 5JZGB 1JXNA 1R1A2 2D5FA 4GIQA 1UKGA 5C33A 2XJVA 3MICA 4AVCA 4XTPA 3V0AB 5DG2A 1BMV2 2R0HA 2X5IB 5DUXA 4AVVA 1AVBA 1ENQA 2ZZQA 1DZTA 5J36A 2ENRA 1GZ9A 1HRV1 3VHRA 1DQ6A 3S6PA 1LOAA 3MW3A 2E7AA 2HWD3 4JRAA 5JWPA 5T5OA 2Y38A 4AVAA 1QNYA 4ES8A 2CV6A 3FLRA 2RS53 4LBMA 4E2QA 3CL1A 1GICA 1HLCA 1RUJ1 4M0NA 4TWTA 1RUOA 3EQEA 3HIFA 4CDQC 3WQ1A 2PN5A 5H9PA 4AI2A 2WWSA 3H7JA 2EXJA 3VBRA 5I91A 1V6JA 4OULA 3SCGA 1V6NA 4QQHA 4V1PA 3U07A 4BE3A 4R9DA 1TE1B 1REFA 2MNGA 2X29A 3MFCA 3GHNA 4MLOA 5KHHA 5DUUA 2HWD1 4FOYA 1CD3G 1HRV2 1C5IA 3SH3A 4IV3A 3BB6A 4WM8C 3M70A 2QDNA 4RD7A 5K0UB 1DGWA 3T2TA 3VUOA 2O0OA 1ZZCA 1WLDA 1W6OB 1RUJ2 4PJYA 1EAH1 1MS5A 4QXKA 1AX1A 2ZCWA 3ZYGA 1LJ7A 4JTNA 4MH0E 3ZSLA 1O4YA 1KJLA 1ZZ9A 3AKPA 1OLRA 3G7DA 1Q8QA 4MGYE 3KT7A 2D43A 2R073 5SV5A 5J48A 1PGL1 1DGRN 5IT6A 2AENA 5T54A 5F9TA 1D0HA 4RR3C 3TRSB 1Q3EA 3VZOA 4CTEA 2HWD2 2ZGNA 3I2DA 2DCTA 3T1MA 5BNPC 2RJLA 1S0JA 2XKOA 1GLHA 3IIAA 2RS52 1RJ7A 1F5FA 3D6EA 4Y5Z0 2DURA 3IMNA 3M4FA 4A3XA 2GMMA 4H55A 2A6WA 2QE3A 2QUOA 2E53A 1QJY3 2QKDA 1EAH2 1S0CA 2R071 1NOVA 2VMGA 4Q0SA 3VBHA 2GN3A 4X6QB 1UIKA 2IFWA 1ZRFA 4LT5A 1WBFA 2EXIA 1FNYA 2VOVA 3B9IA 2GC1A 2N7GA 3ILRA 3WW2A 3K48A 4RHV3 5B2GB 3FWEA 3RMYA 4C0HA 3QH6A 4YZ1A 4YFZA 3W58A 4HVOA 1YFYA 3U11A 3H1YA 2XJUA 1VB4A 3PVBB 5JOXA 4J6GA 3SH5A 1NCQA 2VY0A 4FCAA 1EY2A 1MZFA 2A6XA 4UW3A 3WUDA 1CAVB 2DFCA 1KFUL 4IETA 4CEYA 3VBHB 1UD1A 4KQ7A 2DWRA 2ZGLA 2R072 1Q8OA 3NAPA 1Q56A 3GYDA 3TN93 4F3JA 1RUE3 1W6QA 1GSLA 2D3RA 4OZXA 2IXHA 2HWF1 1HQLA 2ZGPA 4DINB 3QLQA 4G9SB 4RFT0 3AP6A 2KM2A 2P17A 4HLTA 3ZYPA 3S0MA 1PM7A 1E57A 3I54A 1YNAA 2ZTNA 1UPIA 5A32A 2EVXA 2XVGA 1TNFA 1X36A 3WX5A 4AI3A 4AVTA 2QQPA 1NCQB 4GULA 1QJY2 2A6VA 2NN8A 1N47A 4K1YA 1RUE1 2OVUA 1HQWA 4AG4A 4G3YC 5IK7A 1OPMA 1LKNA 1YUDA 3NAPB 4KH9A 4NVPA 4RS5B 3H50A 4K1ZA 2FHRA 3LB9A 3TB0A 4LBQA 4XJZA 5JSRA 1OOPC 1WCSA 3R4UA 5GZGA 1WLCA 4RHV2 4I0WB 2E9QA 3ZXKA 2WSVA 4GKXA 1OA2A 2GNTA 2IXCA 3DPRB 1U12A 4S2GA 2EIGA 4QU2A 4EROA 3QBQA 2YC0A 1POV3 2Y26A 1SLIA 5C6CA 3FUQA 4YARA 1F5JA 4QPIC 3WUCA 1YRZA 4ES9A 3ROUA 3PJQA 3WVJA 1H1IA 1RUH3 2AZ5A 3TN92 4BHPA 1RUE2 3VL9A 1XXNA 4JTOA 1WMEA 3WQ0A 4LBQB 4B4RA 4ATFA 2D3PA 1KITA 2D98A 1O5LA 5H9SA 5C8CA 4CDQB 5JPMB 1POV1 5GLTA 2DUQA 1Q43A 2BEOA 2Q4SA 2GU9A 3WP5A 1LOFC 4LBKA 1H2MA 3AMPA 4K7JA 2R49A 4YGEA 4MYEA 3AFGA 2YZ4A 4XQWA 1QJX1 5C8WA 2VMIA 1O7FA 1QNWA 4LHLA 2R6QA 4ITCA 5DZGA 1VBD3 1YI9A 1YJLA 1NCRC 4AGRA 4P9LA 4MGKE 4FPGA 3R4SA 1BYHA 3N7LA 5JSOA 4RR3A 4SLIA 1HV0A 4AHZA 4AWDA 1D0GA 4XMAA 3AFKA 4JDMA 4KG8A 4WVWA 3NKTA 1YYNA 3Q9OA 4DY5A 1DGLA 1DYKA 1H9WA 4WM8B 3MPBA 3PLQA 2XJTA 4Q4W3 1FMD3 2JG9A 2XL9A 1VBE3 1RUG3 2XBO1 3AYDA 2ET1A 1JN2P 4LUKA 1I3HA 2OPKA 1VBD1 2IXIA 3CJXA 3FLTA 2WNUA 3WCRA 2P34A 4FPCA 4YVWC 3VBFC 4L9BA 4QPGC 1ND3A 4BH9A 4R9CA 2IXKA 4CP1A 3H3ZA 4BPZA 4K40A 1RUH2 2W68A 4RR3B 2VVEA 3HT1A 2Z2SB 1JBCA 5GLWA 1BCXA 5BNPB 2A75A 2WS91 1ULEA 3AP4A 3LA2A 1F8VA 5H9RA 1SFYA 4XF1A 1FMD1 4XOGA 1RUG1 1SLBA 1NQDA 3ZMOA 2QDRA 5FQ0A 1KD7A 4FT8A 2ZACA 1XQNA 2CGPA 1WA4A 2VW2A 4FO9A 3RYRA 3DGTA 2MHFA 2C0ZA 1WMFA 1ZZ6A 4P14A 4FPEA 3ZN5A 2RM23 5GZCA 1SQ4A 5AFEA 4DY3A 5LRSA 1VBD2 2VUAA 1QDCA 1V70A 1FT9A 4HPKA 3ZSMA 5BV6A 4GB33 3T1LA 1AX0A 1ND3B 3D82A 3SLIA 4CDXC 4IV1C 1ENXA 1RUI3 2FQPA 3KS7A 4H3WA 2ZGRA 4GMP1 4Q26A 4E2SA 3VZNA 4OHXA 3CJIA 2ERFA 5LK5A 3E97A 3ST7A 3GHMA 5D1IA 4Q4W2 1FMD2 4HMZA 5JI9A 1VBE2 5FQ0B 1RUG2 2AYHA 1A78A 2WFF3 2JE9A 4R4XA 2RM21 4FXKB 4ASMB 1W0PA 4JV4A 4XMIA 4ZKTB 5J96B 4AFCA 5JOWA 2WZR1 3QOPA 1RITA 4GB31 2YV8A 4BLJA 1OA3A 2JD4A 3PMEA 4ONUA 1REEA 5L36A 1GZWA 1LOCA 1V00A 2YPJA 2ZKLA 2Y0IA 4HPKB 5CFDC 4LO4B 4QHBA 2UWAA 4XFCA 2R1DA 4Y22B 1BKZA 2PHWA 3ZVXA 4P9XA 3V0BA 5I0UA 1RIRA 1J1LA 1WW6A 1ZBA1 1QJU3 3AMQA 3SCFA 3A0NA 1SBFA 1BBT1 1H4GA 5GLZA 1PK6C 4XJ8A 4C1XA 1S0FA 2DFBA 4J1WA 3VZLA 2B9UA 1O3TA 3USSA 3VDDC 1H8TA 4EN7B 3JU9A 5HI0A 1WLTA 1AXKA 4YRDA 2RM22 1SDWA 3X29B 3I8TA 3NKGA 1LHUA 3VKFC 1R083 4RQPC 1YFWA 4GB32 2Z42A 4AEDC 1GZWB 3TNQA 4HANA 1LOEA 5IK8A 4AFDA 2ZJCA 1RUI2 4IEWA 2QZ2A 3SITA 2ZAAA 1CVNA 1V9U3 4X8NA 4Q29A 3MEPA 1DFQA 3KB5A 3I59A 1QJU1 3UL2A 4X6RB 3WW4A 4GALA 2JKBA 3FFZA 1FV2A 2A73B 1Q8SA 5T50A 4NHKA 1ZREA 1NY71 5EYYA 3VLBB 4MZUA 1SMVA 4H7LA 2A71A 2I07B 2WFF2 3M1HA 4WV8A 4D69A 2R041 4XZPA 5HCBA 4QPIB 1S0GA 4FTSA 3OCPA 2B46X 2GNDA 1DQ2A </